5CTJA

Structure of a single tryptophan mutant of acetobacter aceti pure containing 5-fluorotryptophan
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
157
Chain Sequence
APVVGIIMGSQSDFETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAATRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETFRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 56
structure length 157
sequence length 158
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5ctjA00
4B4KA 5CLHA 2FW9A 2FW6A 3ORSA 3RGGA 2NSJA 4Z7JA 3LP6A 4YCBA 2ATEA 5BORA 2NSHA 2FW1A 4ZJYA 2FWBA 4ZK2A 5CTJA 2H31A 2FWIA 4AY3A 5CLGA 3KUUA 3OOWA 2NSLA 3RG8A 2FW7A 2FWAA 5C5DA 5CLFA 2YWXA 5BOSA 4GRDA 4ZMBA 4YCJA 2FWPA 1QCZA 4YCDA 4ZC8A 5CLJA 1D7AA 2FW8A 2FWJA 5CLIA 5BOSB 1XMPA 3TRHA 1O4VA 1U11A 4AY4A 4YCCA 5CVTA 3OPQA 4JA0A
chains in the Genus database with same CATH superfamily
4P4SA 4ZOLA 2ZJBA 1RW4A 5C3UA 3A9TA 1U9ZA 4IUDS 2FMTA 2CK3A 1CC1S 1T9KA 2C2XA 4EYEA 1PD1A 2IXAA 3A4LA 3NBAA 4BCCA 4DF3A 3D2BA 2CE7A 3GJ0A 3M6WA 4POOA 4BATA 2ZRKA 2HF8A 3F7TA 4GSYA 4WNIA 3TM4A 1YUNA 2VPQA 2V6GA 1QK4A 4ATNA 1AKUA 3C5VA 4BFYA 2WJGA 5HKAA 4Y98A 1R9JA 4URZR 2WOOA 3E9CA 2NG1A 1BMQA 4IIHA 5HJ2A 3T1OA 5JNSA 3HEMA 3WWZA 5LQMA 1WUHS 3DTVA 4ZAGA 1J25A 2CZCA 2JAOA 2ZUVA 3R6GA 5FI5A 4EITA 4F45A 5FWAA 1GKUB 1MTZA 1Z4JA 1CY0A 3C39A 4HVAA 3WIOA 2HXSA 3DE1X 3WIVA 4G0VA 2BFBB 4C21A 4X71A 5BN4A 3CTPA 1S2MA 2XB2A 1UK8A 2F7SA 4NV0A 2VYQA 5EAIA 4YAKA 4EG8A 4GVXA 2A1TR 1G18A 4TUYA 1P0MA 1KOLA 4P7FA 4EY8A 2BBSA 5AKKA 2JLWA 1KY5A 3CLHA 1G21A 3UV3A 1DHTA 1ADFA 3PQEA 1XNJA 1YDEA 3QLVC 4NFSA 5B5SA 2FLVA 1OILA 3LFHA 1L4HA 1Y3FE 1I2BA 2DR0A 4TL7A 4A0GA 4HY3A 4UU7A 5DM70 4WUVA 3K70B 1TU4A 1VL2A 4HQ6A 1L4EA 5DLYA 4MR8A 4EAAA 1AXRA 3GLFE 4YRCA 3QIAA 4JJFA 2O8BA 3AUJB 4S05A 4NS4A 1VRCA 3DJFA 3TIIA 2V3CC 2A9RA 2QRPA 2BFOA 2Z08A 1O6ZA 3OOHA 3B6IA 2AMLA 1XTRA 2I6XA 4MKZA 3C6XA 2CDAA 2NU8B 4GRIA 1D2EA 4EKNB 4UD6A 1AQYA 1Q83A 2IQIA 4ZYTA 8LDHA 2G9ZA 5E1BA 4FFPA 4BJ3A 2KW5A 1H3EA 2ZITA 3CONA 1W0CA 1FXWF 1X19A 1YB7A 5KWVA 1M0WA 3LP5A 4YCMA 4LZZA 5AK3A 4A2PA 5FWYA 1DKUA 2GFIA 2JCYA 3OM9A 5F78A 1I2CA 2CUZA 4NMXB 1XMOB 1ZN8A 1FTYA 1YTLA 1IB6A 3QF4A 4LHWA 4J0FA 3P2EA 2Q3CA 3L4BA 4UBLA 5H4HA 4OP2A 1ZLYA 5KSZA 2WWTA 2JJYA 2AXPA 1L7NA 1W1IA 2RD2A 4R9UC 1ECBA 3Q7RA 4FOTA 4LF7B 2ZAOA 2JLAA 4EJSC 3LKZA 1PFQA 5CDHA 2OHHA 3IOEA 3THYB 1THTA 3U44B 3R6TA 1MN6A 1XZKA 1P7CA 4LHSA 3HFRA 3Q4GA 1A2QA 5CCEA 4RLQA 4ZRNA 2DCUA 4TL9A 2VJYA 1I3MA 1ID1A 1FSFA 5AW1A 3MC1A 4MLDA 2ZUFA 4MRVA 4MI9A 3VC2A 3WWOA 2I3AA 3W3ZB 3KKPA 2L2QA 4O08A 3ORYA 1ODSA 2C84A 2ZYGA 3EZ7A 3VX3A 1Z2AA 3FYHA 3H18A 5ICMA 2Y0PA 3W7VA 5K4AA 1EB8A 5U4QA 3UGTA 1RXVA 1NPYA 3NYQA 1YASA 1VJ1A 3I12A 2BFNA 1JLMA 2Z58A 2BP7B 4P6VF 3UM9A 2DEUA 2I55A 2VDNB 2PZGA 1E4YA 2CVOA 2QLNA 1FVFA 5FI1B 3WBFA 3W79A 1I6MA 4WZAE 4REMA 3NHKA 1EDZA 3LZDA 3B52X 2W2NA 4GBED 5KOYA 2O8CB 4HO1X 2X19A 3JSAA 3K5HA 1H5QA 3O4FA 3DM9B 3SF8A 3ZWBA 1DUIA 1GCUA 4M38A 4PRZA 5LP6A 5CIYA 3C97A 4XD2A 3E3LA 1FQJA 3BQ9A 4OKNA 1PNTA 3RSHA 1RADA 1O6GA 2AJTA 4BECA 1OH5A 5DV9A 4AS2A 4BLSA 4V38A 3WL4A 4YLYA 2QNBA 3C70A 1KS9A 5EL0A 3VKHA 4AMZA 3G6KA 3Q72A 3ZBUA 3K8OE 1E6UA 1NQOA 1IVYA 1QBKC 1BIFA 2M32A 3B8HA 3IURA 4IEIA 3VVCA 2ZM6B 4S04A 3OJLA 4B7ZA 3UVEA 4US1R 3HCDA 5IYZF 4EHIA 4G0OA 5BQFA 4JGIA 4QFMA 2YWGA 5DOZA 4QFDA 2VK4A 1A4IA 1KYZA 5AXCA 1SVNA 4HJXA 2QJFA 4QDKA 4CKBA 3ZW7A 2RK6A 2HEGA 3NBMA 3URMA 5IVPA 1UQRA 4XUEA 1THGA 1W76A 2AGVA 4KX3A 1BZYA 1TYBE 2MSNA 2Z1NA 3CZMA 1GQSA 1E2HA 3PVSA 4O2BA 3TF5A 3EWNA 1HDCA 4QQKA 1LB1B 1IAVA 1Z0SA 4WBSA 1ZCAA 1HX7A 2Q28A 4AJ2A 1WO8A 3E3NA 5AI9A 1P8AA 1IG3A 4L1KA 2GUGA 4JYBA 4KQIA 2W6IA 1KVTA 4YRIA 1DNPA 1US8B 3P52A 2G70A 3RYCB 2FW9A 3D2LA 3B6JA 4PG8A 4O2AB 1C9JA 1T6ZA 1VE7A 1UC8A 2CEAA 3D4BA 4IGFA 3T34A 3IXLA 3IHKA 4FINA 4BLRA 3W7BA 4DSAA 3IO5A 3QV1A 4R1PA 4CKEA 1V5FA 4F8EA 4YRSA 1D4AA 1R0BA 3KQTA 1N2GA 3BIXA 1ZD5A 4RJLA 1E8DA 1DWPA 4DAEA 4DZZA 1N1MA 3AERA 4AK9A 4YP5A 4E46A 1YGPA 2DTEA 1CUZA 3LPAA 3F90A 3O1IC 3RWMB 1L4KA 4CNBA 4E21A 1GEGA 1GR0A 5EJEA 3ADBA 2PKQO 3OLYA 1FSPA 2XKAA 4L5BA 1G4UR 4IW3B 4PIPA 3TL2A 1ST2A 6CHYA 1F2TB 5CK5A 1GU0A 3QTBA 3Q5DA 4IG9A 4UM9B 2WFZA 1YC2A 1PX0A 3THRA 1HDGO 1BU5A 4OAPA 1LV7A 1E2IA 4KPGA 4E2FA 3UICA 4RKWA 1XJ5A 3GFBA 1ODCA 1G66A 3PRYA 3IOBA 3DDCA 3DDOA 3AV0B 2HU5A 1QGOA 3BB1A 1JQ5A 2RK4A 1P9NA 3DAHA 3HGQA 2YOHA 3HXLA 4OBWA 1SQSA 4KAAA 5ECDA 4QTUB 2QT0A 2V5VA 5AH0A 4BGUA 4FKBA 1N7HA 4HN2A 2C4VA 4LWOA 4B80A 1J7KA 3WIBA 5TE9A 2BEWA 2EGGA 3EDMA 3IILA 3LKBA 5AT1A 1AS0A 2EZUA 1OAOA 5H5JA 4J8PA 3EH1A 2YJ6A 2MR6A 4J2TA 5E1OA 4AAYA 3QOXA 4OIFA 3KYBA 3RTGA 4TRNA 3UH1A 4B7XA 1XVTA 2JJ1A 5B7GA 1UKCA 3K5WA 4GDFA 1KAHA 5J4HA 4P58A 1PS0A 1BJTA 1ENOA 3JQCA 3NIGB 3OPNA 5FA5A 4OQEA 4EAQA 5C80A 1ZOSA 4F3YA 1KEEB 2PBFA 2OHXA 3LF2A 3ECAA 3HN7A 4JBLA 4RK4A 4GMFA 4IBOA 2X1MA 4KACA 2O8VA 5DGIA 3PXXA 3TKLA 3TOCA 1CLUA 1ORHA 2YJZA 2YZNA 3AIIA 3EW7A 3KPWA 3C48A 2D5CA 2DWCA 2WBLC 3VO1A 4HTFB 2XCTB 3G8BA 3HA2A 3HZZA 4FZJA 4ETIA 1DCTA 2UVQA 5GV8A 1Q7BA 4Q4HA 4UQLA 1OX5A 2Z2IA 3FBWA 4KV7A 4F38A 1N2SA 4EGSA 2ZVDA 3B3GA 3K9HA 3PUJA 3U48A 4FN5A 4UMEA 1RQLA 1DQYA 1WMFA 1NT2A 1PJCA 3JQRA 3QKSB 4E2ZA 3N6VA 4JLNA 1RQPA 3TXYA 1YZNA 4DNOA 3A7DA 1CZHA 4BLQA 5JANA 2QTNA 3U26A 3X1DA 3L1HA 3D3KA 2I8AA 3GYBA 3M2TA 4IFIA 4INOA 3FR7A 2Q07A 1F0NA 1V47A 1D7OA 2VBGA 4J0DA 4NAUA 2CL0X 4IYRA 2G5CA 3VTKA 3WWYA 1CNEA 2JI6A 4XQEA 3R7AA 3N53A 3UAXA 4DLKA 5G53C 1AMNA 4LDRA 3EEBA 2B0JA 4KH0A 1DG3A 1WXEA 1GNSA 3KUDA 3QFRA 4KFTA 1WCIB 3ND7A 2R8OA 3MTDA 4PAOA 1E0KA 5CLJA 1M1UA 1YRBA 2GEKA 3NUZA 4H27A 3AK4A 2O1XA 1KGSA 1VJGA 4J75A 4YV1A 3V42A 2ZYWX 3FJYA 4FFRA 4YDQA 5J2UF 2D2EA 2IYWA 1O94C 4JOSA 3TYXA 4D4JA 2DCMA 3PXDA 4HQRA 4YJ3A 5FCDA 2DQSA 2W6MA 1Z3IX 4FB5A 1RE0A 2DWOA 4D4GA 4TKVB 4RPCA 1ZA1A 4RMGA 3TL3A 2QL7A 1FDVA 1BRMA 2YN0A 4B6JA 4DLNA 4BUZA 4OKIA 3N8IA 1U7OA 3F6CA 4AI6A 2I03A 4DCSA 2C3YA 3Q2IA 4JQCA 2PZJA 2V5AA 2NQ2C 2ZJ7A 2Q6OA 2D7DA 2BEVB 3SXJA 1BHJA 3COJA 3EBPA 3OOSA 3PGMA 4IS2A 5LZ2A 2AHOA 2C99A 4NHEA 3HTXA 3HY6A 3PCRB 2QN9A 1I7SB 2P27A 1VHJA 4MAFA 1VIMA 4G6ZA 4WH0A 4EJMA 5IW8A 2QSUA 1FVHA 1Z4NA 3O8CA 4RD6A 3G2MA 1NMXA 1FXSA 3RTDA 4EA8A 5CVTA 2GJKA 4K9NA 1FSZA 1BWSA 3ZH2A 3JW8A 1ZCFA 2DQ4A 4X24A 1QYDA 1XZMA 1XHLA 3GFSA 4XOIA 3W2EA 1O8CA 3WLLA 2D0IA 5KYTA 3LNCA 4YDHB 2IITA 2ZDHA 1LI7A 1VGQA 4JIMA 3EG9B 2FDCA 5HIMA 3PGA1 3UANA 3HADA 4QULA 1SAYA 1MNAA 4FYYA 4IZOA 1A98A 4L28A 4GX0A 4QVIA 2G06A 3AF1A 4G67A 3BD9A 2AW5A 3PVZA 3ESBA 4DV7B 1O0SA 4QJIA 1CRPA 4Y2UA 4DWOA 5CX1B 5G3YA 2YFKA 2F3UA 5EZYA 1J2RA 4B2YA 2N9UA 4D3SA 5JAIA 3GZJA 3KCQA 3I34X 1GQ2A 4BLPA 3U1TA 4DOMA 5KC8A 1DAGA 4BO6A 2XTJA 1YONA 5F77A 1M2KA 2O3JA 1COWD 4XPZA 2E1RA 2HWYA 3I0MA 5J63A 3WV4A 2UXCB 4AECA 1H6BA 1KYXA 2HRDA 3CWZA 3ZWQA 5BWBA 2JI9A 4AZTA 1RYFA 1L1FA 1V1RB 2JLYA 1MKYA 1SUFA 1EVZA 1GAWA 1YO6A 2OFOA 3ZZNA 3R5KA 3VYRB 5A7FA 1M75A 2MR5A 4RL6A 3RBVA 2JGAA 3A06A 4DM4A 1A7KA 2HA7A 3CZ9A 3NCTA 3G1TA 3ZZTA 2BGWA 1M7GA 3KWFA 3IKTA 2AMFA 4NARA 1TJ4A 1ZH8A 4E07A 4HCJA 1J2JA 3U16A 3JVVA 3I5XA 1P3DA 2MYPA 4B2PA 1M5UA 1WZUA 2V7VA 3GRFA 4LOLA 5TS3A 2O05A 3L8FA 3B20A 3IULA 4D9JA 1IBRA 2A3NA 4QXPA 3VH2A 1EK6A 2FMKA 4IDDA 1KARA 4ZEXA 4RD0A 3FA2A 1P18A 2HWWA 3V1TC 4BP1A 4DT1B 2F8TA 4XLLA 4TSRA 1FEZA 4RHTA 2OV8A 4IIUA 3HFSA 4FR0A 3RSOA 1DMSA 3DWFA 3KU1A 1M9NA 2CMKA 3SZRA 1S3FA 4JLVA 1U3UA 3D81A 3TTUA 3VYUB 3TBFA 4O59O 3RW9A 5T57A 1H0SA 3IAUA 3LY5A 3Q11A 1ACJA 1NOJA 4RLHA 2FG7C 4MVJP 1JFFB 1WHSA 1U1DA 2O7NA 4O4JA 4S1PA 3TQSA 1K6XA 1N5KA 1TA9A 1V48A 2P62A 2R47A 3FOCA 2FH5B 2H4ZA 1YA8A 2INGX 3HMKA 3HN6A 3MCVA 4PYIA 4ENQA 3QPUA 3WLTA 3F3SA 3PUZA 4RKEA 1D2GA 1EZZA 1LDBA 3JAKB 4PPNA 4IDAA 1VBKA 3L6DA 3MWGA 3RT7A 2ATXA 4ER7A 4HZUB 2I6SA 1EJ6A 3P0IA 3TIFA 1P7PA 1DKOA 4GBGA 4OAOA 1ZUD1 4KWTA 3R0IA 3S1LA 3X1JA 4DEXA 1UC4B 2FCAA 4O5OA 4ZO9A 3RRYA 5GMOA 5CBPA 5J2TF 4ZI7B 3UJHA 2GD0A 4Y2RA 4EGAA 1PEAA 1QDEA 3JZIA 4IINA 4MQEA 4UE3S 3CHYA 2ZRHA 1P4AA 3EGOA 4CFZA 4MKFA 5DCWA 2QJRA 3D6NB 4CQMD 3OZAA 1PV2A 4OYHA 1AKTA 4RZQA 3NXSA 1XF1A 4CIBA 2PT5A 2V0NA 3FI0A 2FPPB 4Q82A 3CU5A 5HXAA 1CCWA 1PJLA 4PFJA 4UU0A 1NMEA 2GETA 3D6FA 2QRLA 2Q6TA 1JVBA 4ZDIA 2PJRA 2ZJ5A 1XVVA 5EIXA 3MEQA 1VJ5A 2ZETA 3DFMA 3NPMA 5D1NA 1E1LA 1BXGB 3RROA 2VYVA 1VG1A 3I2IA 3HKBB 5G40A 1E3DA 3CEHA 4FBLA 4C2TA 1LTKA 2E87A 4DCCA 3MERA 4P0QB 3M6AA 1OGYA 3OQHA 1MO3A 2I2XB 2ZP1A 1QO0A 1M3SA 1NX6A 5DGDA 4PXYA 3SI7A 1HFEL 1NASA 2JLQA 3KQPA 4QU9A 2VZEA 4UNPA 1V16B 1YV9A 4QATA 3RAPR 1NBEA 1ZK3A 2I6FA 2EJCA 3TR5A 2O3TA 4BAZA 3GNLA 1V6CA 1WD7A 1O89A 4KO1S 5CCXA 3RVNA 2IDZA 1MH1A 4B71A 4OUKX 5JZVA 1AGYA 1RAEA 3RAGA 2AJCA 9ABPA 4OVKA 2HA6A 2IBMA 3N39C 2F1HA 1EVLA 1RM0A 1V6SA 2CXRA 1GNPA 3T1YB 5AHRA 4YCLA 4JELA 1J8FA 5E1MA 3SZUA 3TSAA 1QF6A 4DMUB 1ZD8A 4XWAA 4RULA 2W58A 5JD3A 2W2XA 2P2ZA 1N2CA 2QUBA 3FVQA 4I4TF 1VKHA 1YF3A 2CHFA 4PFQA 5LVAA 4OYYA 5ALXA 5BV0A 2C88A 4Z3OA 3F73A 3NR2A 2P3QA 2XCIA 4ZD6A 4EHAA 5KJ1A 1NTRA 2BFDB 3L0CA 1KH3A 1OY1A 3LW7A 3OPMA 1L7RA 3J80A 1LDNA 1ZR4A 1VLQA 2I3BA 1Y7PA 3SVLA 2ZRQA 2O2IA 4KLZA 4MPJA 4Q9IA 1T8UA 3L77A 1P7YA 3I8OA 1AJEA 1G8JA 4KMMA 5J43A 3DL2A 1JHDA 3PFCA 3EWSA 2H2IA 1WTAA 1XAIA 2QAGB 2XE8A 3EQ6A 5J4LA 2F1IA 1E5QA 5KJEA 3ELYA 4MYCA 1NVDA 4XRGA 2KLHA 4IS3A 4QBGB 2W6QA 1A4UA 3BWCA 3R77A 1EJBA 3DXFA 3E58A 4PLCA 4WZZA 4RZIA 2R4QA 2ZDQA 1JSZA 3E48A 4BWFB 1GRQA 4OTZA 1RQXA 4EFKA 1F4LA 1IK6A 1OV6A 3JALB 4P36A 4E7OA 2GBGA 2FB9A 3U4MA 4DA4A 5AFSA 3WB2A 3IAM1 4EH1A 1L4LA 4K9KA 4K6CA 1T9GS 4NNOA 2RH5A 5GONB 5TPZA 2LZ0A 2QE6A 2G80A 3KPUA 5IC5A 5JLAA 3KHSA 1LFDB 1TYAE 4XASA 5ENDA 3FOEC 4BO7A 3MUNA 3CPJB 1K86A 2V59A 3HLKA 1Z25A 3M1IA 3PWKA 1C0PA 1NW6A 1JIIA 5AJVB 3U9LA 1VJ0A 3L4BC 3WRYC 1RWWA 2HWUA 1Y8AA 1F14A 2NGRA 3K20A 5GOTA 3WLQA 1X3SA 4A6EA 1UKVY 3FWYA 4IY1A 2YICA 3T6KA 1UP4A 5T3YA 5IDQA 1GQFA 3TOVA 1DXQA 2VHYA 4QAQA 2ID8A 3FLAA 4NYMQ 5B36A 3HS3A 1T9CA 3GGDA 1J8YF 1C1XB 1LUAA 1E60A 2PGOA 3JQEA 3BJRA 2VK2A 3DBRB 3QFCA 1ISRA 1OKKA 3W7AA 1N1GA 4YTEA 4IVNA 3EZ6A 3R7FA 2QJWA 3E35A 4M76B 2IDMA 1W6RA 3ZHUA 3K4HA 2Z4TA 3MGAA 3QVKA 1NBHA 2D0DA 2IOHA 2JFUA 2R85A 2JDID 3NBXX 3FKSA 4YDRA 5DX8A 2ORED 4WVFA 4PZPA 5J58A 2R8RA 3AKEA 4R8LA 3HP4A 2AI1A 2PJUA 3C2QA 1LWNA 4QDTA 1THMA 4G1UC 4M7OA 5A5VA 1MJHA 1N5LA 4Q9AA 2DUNA 2HQBA 1ZJWA 3K96A 3TBKA 4WD3A 1UINA 3UMRA 3B1ZA 1QR6A 2PXXA 1UMDA 2HO4A 3HHEA 4IZ6A 2DECA 4MV0A 2QV0A 1W5TA 5F5LA 3D0OA 1TD9A 1FC0A 2B4QA 3W0LB 2ZPTX 1DSSG 1TVKB 5LP6C 1WDTA 2REQB 3TLAA 1Z83A 4PVCA 2Q3FA 4V3CA 4G1MB 3GGPA 3O3NB 3O1LA 2IY7A 3G68A 1JG2A 2HY7A 1QO7A 3DMDA 1AX9A 4URFA 3C5CA 2DPGA 1U2ZA 2D2XA 1WBDA 2PH5A 5I9MA 2VWPA 5G0VA 1I1OA 3EVZA 2Y8EA 5FTLA 4C5BA 1V37A 4N7RA 1N4AA 5IEBA 2EKQA 3FMPB 3LQFA 2QM3A 1A8SA 2WZBA 1ORTA 2NVUA 4WKOA 3I5YA 1BG6A 1XL0A 2GN0A 1W4RA 2DBRA 4FYPA 4UHCA 3C8HA 4ALJA 1M2OA 5EJ5A 3E2MA 3I2HA 3HZOA 4UBOA 1E1RA 1P9WA 2OLJA 1B0UA 4K87A 1X8XA 3JY6A 1LLDA 1NVGA 4RV4A 5DDIP 1LS1A 3I2GA 2AZMA 2DQZA 3KOZA 3QXCA 3S55A 2RHTA 2P5SA 5JBNA 2IZOA 1UQTA 1L4YA 2CMGA 5CYFA 3ZK8A 1DJNA 1VJTA 3SDZA 1PU2A 3W3AA 3K0CC 2F67A 3R3ZA 3WLKX 3ZCRA 2PKRA 1EK2A 2EQ5A 3MA0A 4YROA 3DLHA 1P1BA 1DL5A 3IO3A 1G8SA 1IWBB 5EP3A 1G8KA 4Z54A 5K6AC 3K71B 2J07A 2N1MA 4D26A 2VHJA 1P5HA 3VR3D 2W7TA 3DEAA 3V7WA 1XC7A 4OREX 3ZDEA 1W9MA 1OXBB 5SZJA 4WGGA 4G5XA 4D45A 1GDHA 4GLJA 2VKTA 1GAXA 1XCPA 5H59A 5ECYA 1QE0A 4HQLA 1E6LA 1QVAA 2PD4A 3CSUA 5EIEA 3O8NA 4GZLA 4YPFA 4YRRA 4MA0A 3VPCA 5LWHA 4TWAA 1Z75A 5E9QA 1E1DA 3RAEC 2ANBA 2J59A 2G6BA 2EJVA 1T6BY 4EB8A 4QGAA 3I2FA 2B83A 1V26A 4WNCA 4HUTA 4XGQA 1SBTA 3VR4H 5CAEA 2GD6A 1N2IA 2R6FA 2QU8A 4R9VA 4BTEA 4S0XA 3S81A 2RHOA 3KHTA 2IXEA 1Y1LA 3ZGXA 1JA0A 2BM0A 2P0YA 3V8NA 3MTBA 1JIVA 3V8RA 4NHOA 4BNIA 1GUZA 3PDUA 3AR8A 1JA9A 3QWAA 2ODQA 4XJVA 2XLCA 3R9IA 3F9IA 4Q05A 5FYQA 4WLOA 4LFCB 4C0SA 2F1KA 1YB1A 3RM3A 4IQ4A 3G2HA 3S7ZA 4BIIA 1DV1A 1IUNA 3ITKA 3PTZA 1B0ZA 4ESOA 1U6JA 1AGPA 2FSSA 2EDAA 2H4JA 3U17A 4DNQA 4BMNA 2ZE7A 2GEFA 4R5MA 3F6BX 3QKRA 4DIMA 3HI4A 5DBFA 1PL7A 3U31A 2X4GA 3P2JA 2JFVA 5DYNA 2ZT7A 3HKEB 1X8KA 2OO3A 1KDPA 5JRZA 2WMNB 5C51B 1PFGA 2X4DA 1OAOC 1LRKA 4M7PA 1A95A 4PYLA 5C37A 4YMWA 3ENZA 4R40A 1R0RE 1URPA 3JYOA 2WM3A 5TMEA 1F9AA 1BXKA 4J0JA 1XL1A 2VSNA 4NNJA 1KQGA 1KJYA 1FDOA 1EG2A 2X4LA 3EEOA 1CJMA 2PBRA 2VHTA 2VT6A 2ZWAA 4XZ3A 3K94A 1FPMA 3KKQA 5D6OA 5AKJA 1KC1A 2WT8A 4Q3KA 5FHQA 4E33A 1E3LA 2AFIB 2I3DA 3IT1A 2CLFB 4MKGA 5D3MA 4DPMA 1AQNA 3E82A 5B7NA 1B8VA 1CK4A 2A2ZA 3N6RA 3SIPA 4AS3A 3DUFB 5ITVA 2XDQA 2DETA 3OT1B 1U7TA 3B5EA 4UVEA 1EZ4A 4OFWA 1V3QE 4K6OA 5D84A 1A5SB 2XXAA 2Q4RA 2Y71A 3VYSB 2XUKA 1V25A 2C94A 1X7YB 4P83A 2UVPA 3WGZA 3ZVNA 3HE3A 4GO1A 5U4XA 4JB8A 2VPYA 2HK9A 3DWIA 1WQ4A 2J87A 2GR9A 2GO7A 4H7KA 3PWTA 4PQEA 4V0SA 2HJWA 2HUNA 1XLTA 4LJ7A 4M53A 3TZBA 1P45A 3OQBA 5JD4A 3SNHA 5AKGA 5CVJA 5A4IS 1M5TA 3TRKA 3DKKA 3D8TA 3PEEA 2QUHA 5EE3A 3LIPA 3VZCA 1RLJA 3G0CA 4NCHA 3C7DB 3DPIA 3PYLA 3SOPA 5LQDA 5ICSA 4OQQA 1V9LA 3F74A 4ZEWA 1KMHA 2FSFA 2GNAA 3DVAB 3LT0A 2AMYA 3WBKA 3FPKA 4MZXA 1KEPA 3G59A 4X7BA 3IAXA 3W4JA 3ETGA 4UTNA 3JQQA 1D0IA 1KY2A 4L50A 2P65A 4OX9B 2F62A 4JBNA 1CDOA 1JKXA 5KYKA 5DP2A 4U0JA 5T4EA 3LY8A 1LQTA 4W5WA 1WZNA 1JLSA 5HF8A 2ZT5A 3AI2A 3CSSA 5IAGA 3NYWA 1LQ2A 3JCZA 5H81A 2J85A 2UV8A 1QG0A 2DHRA 3U4HA 1O95A 2QLBA 4UDNA 4KFRA 5AK0A 2JVIA 3DFFA 4UJ5A 4AP6A 3V4VB 2XUGA 1DBVO 1V71A 4CWAA 4CE6A 2IELA 1P62B 2VPZA 2X9VA 5IT4A 2Z4SA 1D2MA 3UPTA 1G20B 3CWQA 4Q4AB 4TYQA 1SIOA 2QE7A 3OM8A 1RCTE 2LUOA 2CVFA 4CM6A 5CFOA 2IW3A 4QBFA 2M6SA 4O0LA 4B47A 2H3HA 3RJ5A 3BIFA 3WNDA 2B8WA 1O2DA 2XV1A 4GC9A 1N1DA 4OJNA 1A5BB 4BXOA 3M4NA 3RFUA 4AY3A 1D9XA 3PF8A 2JFNA 5B64A 1W19A 1JHQA 2CXOA 3SQWA 2VPTA 2PUCA 2FPKA 2GRAA 3RRZA 2P11A 4WXPA 1M72A 1PKEA 5JSQA 5IH3A 3KUCA 2LRHA 1VBMA 2A7QA 4ZOCA 3CTMA 3Q88A 3HZHA 4BMSA 5HRUA 2VJQA 3IOMA 2ZWVA 1H2RS 2W98A 5KCMA 4ADSG 3DOFA 3ROGA 1IJBA 1GFWA 1ZNXA 1KXZA 1PLKA 2CC2A 1CP2A 1P5RA 2P9QA 3QVXA 2HADA 2VCHA 3VBEA 4EGFA 4LZAA 1RM5A 2V6IA 2FKNA 2O8EA 3AF2A 2PQMA 4BMVA 5JEDA 1SPBS 1TFRA 4OQMA 2AG6A 1G6OA 2OG2A 3GVXA 1E1CB 3HJRA 3IE1A 1DQRA 3COYA 1ZXXA 3UV7A 5BWOA 5KCZA 1ESNA 1T4BA 3TKAA 2O7SA 2Q2NA 4NZ9A 3ZW8A 3KB6A 3R76A 3KQMA 2GK3A 4MLCA 3OX2A 4GC5A 1L4GA 1RVDA 3DZJA 2CLDX 2HC9A 1JH8A 4IDPA 1QQ7A 1ZINA 5DYTA 3LHKA 2UZ4A 1PR1A 4BAUA 3ZKWA 1YVUA 2ZYSA 4HGRA 2XYGA 2Q21A 1N3LA 4IEEA 1BDJA 2Q5EA 3SIXA 5CA0F 2GZDA 5JMWA 2WV9A 4FDMA 5ECGC 4I9GA 5JJKA 4EFDA 2FFJA 4R1UA 1ZRHA 2GM5A 4GPBA 4OP1A 3LDUA 2ORYA 2QYOA 4J1SA 4QYIB 5EJAA 2P79A 1GRNA 1DT5A 3ED5A 3F96A 4QPNA 3I92A 4F21A 3REQA 2YMMA 4YQFA 1K3UB 3CLUD 4H7PA 4J0HA 4OFBA 3KT8A 3E3AA 3LC1O 3LY9A 1FDIA 1QG2A 3FRHA 4IMPA 3C15C 4LW8A 1Z0IA 4D8WA 4M89A 1YOBA 4CW7A 3WICA 3CRRA 1EDOA 4ZEMA 1KZ7B 4N9QA 1MO5A 1QIKA 3BF7A 4A8JB 4ZRDA 2KB0A 1VIVA 4I1RA 4CKYA 4DLXA 2AS0A 2IP2A 1QKKA 1SU4A 1ZGJA 4AN1A 2AT1A 2WTNA 3H3JA 2WFLA 3OESA 1R16A 4FGJA 4LFAB 2ACWA 2CCKA 3IP9A 5JZMA 1P6QA 3V9AA 1DPFA 5BP7A 3OF2A 3BHJA 2X5JO 2VF5X 1CJTC 2Q0HA 4N1AA 3G1WA 3CVYA 3I9MA 2COUA 3EAGA 4NU6A 4UHFA 1D2CA 1I94B 1VSUA 1IXZA 4G0UA 3GARA 1TJNA 1TNDA 1ZVJA 3RJMA 4PLZA 5DT2A 1ZVKA 2B61A 3IAAA 4QGFA 2VAWA 4B48A 4F8JA 4KPFC 5AMXA 3Q6NA 4DA8A 3OFKA 3ZWXA 4WBNB 4TTTS 2WPDD 4S24A 5AOCA 2GARA 4D82A 4F2HA 1M2FA 2PRKA 4DEYA 1PYGA 3L8MA 5GINE 3BZWA 3KTDA 4RVHA 5TY0A 4DLZA 3IEXA 1YZHA 4QTTB 5F1PA 4FKZA 1HA3A 2AIRA 4UZFA 5JJCA 2JHGA 1BXRB 2GYYA 2I29A 1ULBA 2YDXA 3I3OA 3QBTA 4YACA 5D87A 5B55A 1Y8CA 2ZCUA 5A3SA 3EUEA 3RG2A 5I7VA 3K0AB 5CNJA 1RAHA 3U3RA 3UAYA 1B93A 1JYFA 5DN9A 3I8SA 3MIZA 5A9TA 2VNHA 1I4WA 3WMRA 4L16A 1D4OA 3DO6A 5JNWA 2HCFA 1CJUC 4FYHA 1L7OA 5M34A 1GKLA 3W6ZA 2O2HA 3DB1A 1GV1A 3EMKA 2H57A 1J5PA 4EB6B 2EZ8A 4QVGA 2AC7A 1UOEA 4D3ZA 2VPWA 3VBCA 1P80A 3BC1A 3U4QA 5FULA 2XDYA 5JQGB 1UOPA 2OV3A 3AC0A 1ZC3A 3O9ZA 3ELUA 1PF7E 2O23A 3FB1A 4A6DA 4JBWA 4DM3A 5JHGB 4COOA 3VZRA 1VMDA 2I6QA 1CT9A 2AOXA 1SCUA 2DH6A 2BVNA 3NB0A 1SXGA 1XLVA 2YWRA 1PJTA 3GJTA 4BFXA 4F4UA 2AEMA 4Z7QB 3VDQA 2W90A 2PZMA 2D00A 1N2CE 1ULTA 4GPEA 1Q0PA 3DDWA 2Q9UA 4ZVSA 1Q0UA 5KHAA 4RQAA 1PNQA 3IMFA 3ETHA 1XTUA 5CXXA 3WLMA 3TL6A 1QORA 3O2JA 3S68A 1Z33A 1GNVA 2Z0MA 3I58A 3ORQA 3ZD7A 1BH2A 3QU7A 4PHFA 3T7CA 4RIFA 4KK4A 1IY1A 3JR3A 2R11A 3NU1A 3UBTA 3TXXA 5FWDA 4A7PA 1HNZB 5GM1A 2WB2A 4G5GA 1YU6A 4UZSA 1Y6FA 2PJZA 3RSZA 1E2MA 3QEBZ 4NENB 5LZ8A 3V6LA 2X5KO 1K6EA 3KZXA 4JT2A 5B1DA 2QBYB 5ERXA 3ZDXB 1ZR2A 2UXBB 3TNLA 4IVRA 1BTOA 5BN3B 1XYGA 4MW5A 3ZHCA 3E5HA 3H5LA 1PO7A 2D1FA 3ZWNA 4BX0A 5A03A 3CUVA 1P81A 3FTPA 1K68A 1UBGA 3H8SA 4JVLA 3W1VA 5FPPA 5IG2A 3IUYA 1P73A 4ISBA 1EFRA 3GEPA 2BKLA 4KXQA 5DSTA 1BW9A 1VA5A 2JFHA 4MV3A 2R79A 1TCAA 4P80A 4RM3A 3EPPA 4JUAA 3H3XA 3BMNA 1YDHA 2XEXA 3MQ4A 1TADA 4KQHA 5J4VA 3GNQA 1NDUA 2ZKLA 1HG1A 5EXPA 2XYQA 1QK3A 2BHLA 4KMOA 3WADA 3ICVA 4CU5A 3IR7A 2GPSA 5TVGA 2WK1A 5CLFA 1GUAA 4P31A 1KSGA 1G5TA 2R6JA 3ADPA 2MHCA 3ODGA 4M46A 4UM5A 3H2GA 3KLOA 5KSPA 2E9SA 3T61A 4CPDA 5K0BA 1JSRA 5EQDA 2PGJA 4LECA 3EZNA 4Q4DA 4M1OA 4UTOA 2YV4A 1ADCA 1XYYA 1YA4A 2EJBA 2N0SA 1DRKA 3F1LA 4CNQA 5LOVF 2JGMA 1P0QA 2YS7A 4UPVA 4AULA 4C3ZA 5B7QA 2C83A 3QMVA 1XA3A 4TUYF 4BNJA 4AY4A 1EJ2A 1WZEA 4QPZA 4ZV7A 1JTEA 1IWOA 1JR3D 2OZLB 3BWXA 3SYNA 3ZHVA 5M2QA 2HSJA 3GN1A 3WIEA 4RKYA 4MVJI 4HDMB 1CW2B 2Q3BA 3I61A 4HNUA 5JASA 4QBKA 3AP2A 4DR3B 4KDRA 4MH0R 5CJPA 1R3DA 5T5QA 5BOSA 4KDFA 1OROA 4B4OA 4QQRA 5ESRA 1Y6RA 1IONA 3IBCA 16PKA 1E79A 4OH1A 4LXGA 3WYGA 3LK7A 4J2OA 3VOSA 3IXMA 1FCJA 1JQEA 1K98A 5EQFA 3THOA 2EZ9A 2R1TA 2CLKB 5TXGA 5LLDA 1DC7A 4I5FA 3C3KA 4R0VA 3PC2A 3L8DA 2KS6A 1R10A 1TT5A 4KZKA 4O2RA 1KU6A 4IWNA 2QTBA 3EX7C 1Q17A 5FT9A 1JKFA 1Z07A 4J3NA 2REXB 5HKKA 3ZWMA 3ZXIA 4Q7QA 5IXYA 3MCZA 2H1HA 2I4RA 4MIYA 4R1NA 4B31A 2OFWA 3OZIA 4ZHQA 5GZ1A 4C08A 1G5RA 1J33A 2Q6IA 2PWZA 3MLBA 4OXRA 3B9QA 4DY4A 1C2YA 2ODTX 2WIAA 1JI3A 5DGCA 3URKA 1CIPA 4Q7JB 2XJ9A 2HQ1A 3ZNQA 1PIWA 2P9JA 3IH5A 1C41A 3EC7A 2ERYA 2HQRA 4NIMA 2XOKA 1PG0A 2IW1A 4KQ2A 3L40A 5FOVA 1TCBA 3CMCO 2IDJA 4BBAA 5H3CA 3C6MA 2FOIA 4BKUA 1BOOA 1NQTA 1NUSA 3CM0A 5DNEA 4PBSA 3FNHA 2I7VA 1L1RA 2XECA 3MGCA 2Y0DA 5CH8A 3EXG1 3DCIA 2BEUB 3KZKA 3O73A 1QQ6A 4Z7NB 3D4IA 3WP1B 1WE2A 2X8AA 4MUHA 5KVSA 2GZ3A 3MRTA 1I0LA 2I7DA 2FEOA 1JJAA 4YJHA 4IUCS 3ONEA 1ILEA 2CHEA 3BICA 1HK7A 2JFBA 3DG9A 5IH7A 2CD9A 3EK2A 2CFOA 4OB8A 1KWKA 1NF9A 3D6UA 2I67A 3NTXA 5BVHA 1TCVA 5T67A 1AKWA 1M1XB 2Q46A 2ZIWB 2ZSDA 5C81A 2MYNA 4W5JA 3M1LA 4EPRA 1U0EA 2PSDA 5B2ZA 3C3AA 5F1KA 4Q34A 5E6SB 3EXIA 3RQIA 3VYVA 1WA5A 1YJ5A 3WE7A 1ZNYA 2G09A 2YH2A 2J9FA 3KR9A 2YWCA 5LP6F 2R44A 1N5IA 1PGPA 3ESCA 1N2BA 1UXOA 3ORSA 1MG5A 3R7NA 4C3VA 3Q8XB 3HR8A 3K7EA 1R6TA 2DPYA 3EXEB 3LWBA 2QS9A 2JAXA 2DKOA 721PA 1WW8A 5K7SA 1W4CA 4LJSA 1E1QD 2AI2A 2BUBA 2H59A 1EWVA 2PGXA 3EIHA 3ORRA 4ND3A 5DE3A 3BRSA 4PRYA 3AR9A 3Q7IA 2IXGA 5C52B 2P6PA 2EL7A 1FNCA 1P1KA 3LFUA 3WDSA 4K1XA 3PNOA 3WQHA 2XSZA 3ESQA 4MUIA 3L0PA 1CZKA 1I2MA 5A0VA 4OXNA 3QSGA 4EY7A 3ILYA 2KE5A 4LXQA 2ZDGA 1HDYA 1AUXA 1JQLB 3FSGD 2FZ5A 3F8SA 3MD0A 1W4LA 3SK0A 4BQQA 1RZRA 4G0WA 4PHCA 1JZQA 3DEJA 1EWTA 1JF8A 3IV9A 5H1YA 2C7BA 1VE9A 1QZTA 4PSKA 1OFVA 2L42A 3TN7A 3WLPA 2XYPA 4BBJA 4OFXA 5BW4A 3NH9A 1M8GA 4F9EA 1EXNA 2AKEA 5ALJA 2OMEA 4E5DA 2GLTA 3QVGB 2Y4NA 1JRLA 3I6QA 2I66A 5K20A 4HDRA 5MFZA 1N6LA 3SM9A 1LPBB 3J7TA 5AR1A 4H35A 2JCGA 1WF6A 1KJZA 1I4LD 3C14C 4TMWA 3VNVA 2H1LA 4ZOQI 3K9GA 1UC5B 1DC6A 3L9WA 1ZW1A 3BRWA 1G8YA 3QA9A 3RSLA 4YMVA 3HCPA 2ZBRA 5FJIA 3E2PA 4FWIB 2PUAA 3L82B 1KJIA 3ZWDA 2JIPA 2AA3A 2XCSB 3DDSA 1I6WA 3MELA 4DDHA 4QGHA 4F3NA 4P33A 3ORFA 4XIGS 4HDCA 4BUCA 3WGUA 2O52A 1G2OA 5IAEA 3AL0C 3AHDA 2RFLA 4BN0A 2ACKA 4Q4CA 1CZRA 5IUKC 5FJJA 1ONPA 1S3IA 3CPHA 1QTQA 1WZ2A 4FMDB 4K0KB 1NUHA 3HCWA 2XODA 3ONVA 1UWKA 1UKEA 2R7LA 5FEMA 4FQ7A 1D4ZA 1T13A 4N82A 5AUOB 4YJKA 1XLTC 4ZICA 2PGIA 5JATA 1FU4A 3FE2A 3O2NA 1JFLA 1SU7A 4I55A 1NUUA 4CEJA 2O5EA 3D6VA 3A36A 4CMJA 4H3VA 3UA3A 1ZJYA 4H3SA 4NYJQ 1R4MA 3DZHA 1ZX1A 4N0PA 1DG9A 1NPTO 1WMDA 4D43A 3DXZA 4EKEA 4BKQA 1F7UA 3N70A 3NANA 4Y9DA 4ZA2A 3FZYA 2O2SA 2A5GA 4ACBA 4M9UA 4XB6B 3ZV3A 5DHFA 2VI5A 3GMSA 1HYHA 4DBLC 3NM5A 2IY8A 4ND2A 2FUKA 1D5WA 2HM7A 2WABA 4M87A 4MS3A 4RK7A 4F6CA 5KDOA 1EPUA 1O5OA 1W0JD 4GMDA 3EH2A 4A27A 4FI3C 1A8QA 1JS1X 2HIGA 1CE8B 1QFYA 3IQGX 3C41J 1E9AA 4B6OA 5KOHB 4YLEA 3M4YA 4FK8A 1VSTA 1O95C 2ZCVA 2JGIA 4EG3A 1IJFA 4JYMA 3NJ4A 1K2VN 3GCXA 2J5BA 5ADWA 1PZEA 2JZNA 4FCVA 1HRDA 4CG1A 2P35A 2Y1WA 1UM9A 3QELA 5IAKA 1TZ2A 3FVWA 1JLRA 2NTNA 2JGDA 3AP1A 4M1YA 5LA6B 3WNQA 3LGSA 4I81A 3Q3VA 4IG4A 1FP1D 4OUDA 4GM0A 3VR1A 5EOVA 3VMMA 3FZNA 3K9WA 4CKXA 3S27A 3H5WA 3WK6A 5EESA 2JHCA 5HTOA 3D7LA 3V00A 1W85B 3RUFA 3ZIAD 1S2NA 3X2EA 2P9BA 4ON9A 1QRTA 1H5UA 1ZIDA 2BFEA 5G1PA 1EB9A 3JQ9A 3OQNA 2NAPA 3PGJA 3DHWC 2F00A 1KYYA 2GAOA 3PUIA 4G5QA 1S3SA 6AT1A 5LQKA 5E9JA 1HMYA 1R5JA 2JS7A 1JHVA 1ECLA 3LMKA 1MB0A 2BRUC 2AOTB 3MGGA 4FS3A 1OPRA 4P4TA 2J7PA 1RPAA 2JGJA 3WLJA 4C22A 4D3YA 5IUJC 4ARUA 1RHQA 1KJWA 3M49A 4M8NE 4DMLA 2GAJA 1T6YA 4CLDA 4ES6A 4GG1A 1IXKA 1J07A 2ZUSA 4HB4A 2FFHA 2FWIA 1SZDA 4PLHA 5A1JA 4Q21A 4A73A 5CITA 4LF5B 4QEKA 3SEZA 5FD8A 1YBFA 1L8QA 2QK4A 1E2UA 1TKBA 1Y8QB 1F0YA 1CY6A 1HDZA 2FETA 4EHKA 1LX7A 4TTRA 3N8KA 2OPBA 4B3TB 2R62A 4YJ3F 4RWZA 4HH3C 5EFZA 3DQZA 2BGMA 1QNLA 2AQIA 2VT3A 3LJKA 3TLCA 3KQQA 1R0ZA 4ECEA 1IFXA 1QAQA 1WVGA 1GGVA 2YZ2A 3GDOA 1RXUA 3HB0A 3L7LA 3WI7A 3DDNA 1T0UA 4OJQA 1HFJA 5JSYA 2UXDB 2HRBA 3LT4A 1NIPA 2A9PA 1E4EA 1PUJA 2WU8A 1BH6A 3E9EA 4L2IA 3RIXA 3T7IA 1EGMB 2W42A 2NU9A 3LPCA 3JQDA 1BX0A 1BFKA 4OMDA 5CDTA 4YFYA 4MR9A 1N2JA 3UY4A 3B89A 3F0TA 2PWYA 4I6JA 3W3AH 4D0GA 5IVHA 4JWTA 4IAOA 4F2PA 3G2NA 1V9SA 5E0KB 1EP3B 2WWFA 3S2FA 1X39A 3ETLA 2QT9A 4GQIA 3L0DA 3B12A 4XYMA 3TRIA 4CQMB 1J4AA 1PVVA 1QHFA 1YOVB 4YMSA 1CHDA 1NR5A 1CYDA 4HUQB 2P5TB 2QJTA 3F5MA 3ASUA 3VOBA 4PX3A 4DJDC 4RK1A 3FCOA 3LYLA 4REQA 5JG7A 1V4BA 5BSVA 1GG8A 1ISGA 4Q5IA 1DAEA 2F4VB 2CVQA 3A2LA 3GF4A 2OCDA 3ZDZB 2ZVJA 2RGRA 4NBUA 5IT5A 1Q84A 2ATEA 1MQ9A 2P4SA 3OT4A 2KLBA 1V11B 4HUJA 3RSQA 3UWMA 1KMNA 1Z6XA 2OB2A 2OZVA 4YRAA 3JVIA 1GA4A 1R6BX 3ZV4A 5BUZA 2FGJA 1JFSA 4CKCA 1G7RA 1MP0A 4OHRA 1F12A 1BN7A 1GZ4A 4D4KA 4MARA 4C7XA 5CA1A 3OEED 3GJRA 2VR1A 1Q3TA 1U5BA 1LK5A 2Z2JA 4J16A 5E7IA 3DXXA 1FNSA 2VWGA 5CXSA 3C1AA 2YRFA 3ILHA 1A4RA 3H5RA 3AR7A 4X7RA 4IL5A 4CV1A 4FGWA 4KKVA 3FYUB 2VNSA 3O4RA 2ZRGA 4ID9A 4Z7OB 3PNBA 4JLAA 4U6NA 1NJSA 2NUPB 3BJEA 3G9XA 4OGFA 4UMDA 1JPNA 1W0KA 2BFCA 4WESB 3ASVA 2BGTA 4WMLA 5JVDB 3D5TA 3DF9A 4P7BA 1TUBB 2IA5A 3ZH9B 4L8YA 4TTAA 4XFDA 4KP7A 3O3OB 3Q7EA 3K2EA 4CI9A 4RTMA 3T95A 3D4LA 2A6PA 3SEAA 2A59A 3DAYA 2VP5A 4V0RA 4CTMA 1U0RA 4CEHB 2V7TA 1XJQA 2PLFA 2VQDA 1X7WB 5F51A 3WKBA 5C5IA 1YT5A 3OLZA 1E3WA 3C7KA 4HGNA 4K9LA 4ZDWA 5ERYA 3KOUA 2VDOB 3ZD9A 5KIAA 1HLFA 2GBLA 3P0JA 4ZDKA 5EUQB 1CS0A 2XNKA 1E32A 3PIIA 1DTWB 4EPXA 4RF4A 4MS4A 4DRZA 1S01A 1CPYA 1CUGA 1EVIA 4LMBA 4IHJB 2R5NA 3KJFA 2QMYA 4QPDA 1VMAA 1JU3A 1PD0A 2YY5A 3OCJA 2ZRLA 1Q16A 4ZKDA 3RG8A 3WNCA 3DP7A 2EGHA 4B3IA 4L5CA 4X85A 1AC5A 2QRNA 3HMQA 4D9GA 1EWQA 2HCRA 1QR2A 2JEZA 3TIGA 5EHQA 4AS1A 4MVJF 4E14A 2ZYIA 3IBFA 2RHMA 2C9YA 4XQ0A 5AO9A 2Y0EA 3JZDA 1DS6A 2ZBPA 1FFGA 1YWGO 5KNCD 2B30A 1WY5A 1ZK2A 2V4ZA 1V35A 1BKSB 1OGIA 2W6JA 1W5FA 3HCNA 4BPRA 1JHPA 2KX7A 2P9GA 2X0JA 3V32A 1XROA 2A33A 4P93A 2CV1A 2VK8A 3LRPA 5TT0A 4DADA 3FWHA 3QOFA 2I80A 3ONNA 3UG6A 4MWEA 2EL9A 4LK2A 1LZKA 3QKWA 2PVSA 2J48A 1K7XB 4XRRA 4CN8A 5A4MS 1UZNA 3RYIB 3Q2KA 1ZS9A 1Q3HA 2I6UA 4YEDA 5DT9A 1I9CA 3B82A 2XT0A 1H6AA 4N41A 5GM2A 4RCZA 2XRZA 2A8YA 2CCJA 2CL6X 1O96B 1UXIA 2GX6A 4Z8XA 1XCGB 1RQ2A 3N2KA 3I9V1 4AIRA 5C8VA 5L53A 2YZMA 3WGYA 1KRWA 4JJAA 4J43A 3HJNA 3OUUA 1KKMA 1ZQ9A 4BV9A 3KZNA 1V4VA 1VYHA 3TWOA 4LRXA 5FKJA 3TRHA 3NHFA 1MO6A 1ZQ1A 2C2YA 1KVUA 2VPIA 2XWPA 4MVYA 4OHMA 3NGXA 5EJ2A 3L5OA 3NIBA 5F64A 2IU0A 4N6OA 3SDBA 1A04A 3JYNA 3BILA 4WERA 2CLEB 5JJLA 2V96A 1EFPA 3NHPA 5BSFA 5AVSA 3V8MA 3WLOA 2GF9A 5FI3A 4AUMA 1GLGA 4MROA 1MC4A 1USKA 3AF5A 3RF6A 4FWTA 5GIOE 1W5BA 2QRUA 1Z5UA 4UEQA 4X1IA 4ZMSA 2H1RA 4P4GA 2ZUCA 5ER6A 3NEPX 1M74A 5ABPA 1U2TA 1OSNA 4DMMA 1IY9A 3UK7A 1YJBA 4H17A 1XAHA 2ZIXA 2P9YA 3I9OA 1NBIA 2G1JA 2YBEA 1NBWB 4P34A 3WB1A 4XA8A 5AUPB 2G4LA 1PT9A 3B9RA 4V02A 1L5GB 4RA6A 4D8YA 2PLAA 5DLQC 1X15A 1E94E 2Q0QA 2DUWA 3MS2A 1NSYA 3MT7A 2OZEA 2IC5A 2ZB7A 4FLEA 3QMMA 1VQ1A 3NJRA 2CFRA 4N3AA 4EPWA 1FVXA 2OCAA 5LUBA 5BSEA 4DDVA 1BDMA 1BNCA 1DIOB 2HAEA 1JQ3A 4HMPA 4DV4B 3RFXA 4YHHB 3UYKA 1AHHA 2RGEA 2WP0A 4FN4A 4I1IA 1MVLA 1X94A 2IUFA 2OLEA 3A31A 3M0EA 4UAJA 3GLGA 5TPWB 1RMQA 3JQ7A 1OFGA 4MGIR 4JLMA 3WLNA 3A1FA 1OZ0A 2V6JA 4E5YA 4Z4QA 3WMFA 4D5EA 2BMDA 3SZLA 2L69A 2QN7A 3R5HA 4L4YA 3UV6A 3NDRA 2BHTA 2GOYA 2JIBA 2XOXA 2HNKA 3Q9NA 1NSTA 1XKXA 2EW8A 2FPGA 5AESA 4C03A 2GB4A 2PH3A 3EDCA 1RBQA 4FSXA 3LBHA 4FE7A 3OZDA 3MRVA 2Y99A 2IZ0A 1FDRA 1U0JA 1DJOA 2ZXEA 1PR3A 2XT9A 5BWLA 1C3OA 3ABQB 3R8FA 2RGUA 3C6KA 2Z5VA 4YP9A 3VTZA 1QRAA 2LV8A 2XVAA 5KPJA 4Y2PA 2TECE 4AZ3B 2WTMA 5KNDA 3BD7A 5EXTA 2FK7A 4HAWA 4IOLA 4MQBA 1V43A 3G2JA 3EEYA 1NW5A 1FBNA 1KEVA 4BFCA 5IASA 3RF7A 3M33A 4LYYA 4LX0A 1JUDA 4OKSA 4GECA 2SCUB 4II7A 1UZUA 3VR4D 5JALA 5BMVA 4BMZA 3PQFA 3L41A 1JMKC 1ZM3A 4EFNA 4CLOA 4K03A 4XVQA 4MLPA 4BZWA 4K28A 2CZQA 2I2CA 1DV2A 1EWYA 5CMLA 3GRKA 4XEUA 1HQDA 4BQNA 1XQXA 5KYYA 4RGBA 1JAYA 2FX3A 1SURA 2A4KA 3DTNA 4LTDA 4OQZA 2H6EA 1H2FA 3U7EB 4CMEA 4F92B 2IS2A 5DYIA 2VAPA 2DFTA 3UK0A 4WLVA 1B7GO 3ELBA 2GYUA 3RVJA 3QNWA 4Q93A 1F8FA 1L5KA 4CMGA 5CT9A 1M7BA 1ZUNB 5DH9A 4IH4A 3LT2A 4M0MA 3ZQUA 3M4XA 5BQXA 1SXQA 4RUKA 4H3KB 2YWXA 2PMEA 2EJUA 2CK3D 1SKMA 2OP0A 4XIYA 1OT5A 3RYHB 4AMVA 1R66A 2FP4A 5EQTA 4B6QA 2CV0A 1D0VA 1TE2A 2VQSA 3H2JA 2QI9C 4ILKA 3A10A 4XAQA 3T5MA 3WVNA 4Y9SA 4HOYA 7YASA 4Y6RA 4LZJA 2LNDA 1P5JA 2XNCA 3G9UA 1W88B 3ZCSA 2QR5A 3HBNA 4AZSA 3A7EA 4IIXA 4XIFA 1BOFA 2Z8XA 3P2YA 3KKZA 4G01B 5EJFA 1GZSA 3FI9A 3HYNA 3RVRA 1WPXA 5MN4A 1IQPA 3RUAA 2PSHA 3KTFA 3VFDA 2QYHA 1NXOA 2B7BA 3OQIB 2B20A 4Q7LA 5DW3A 2WP8J 2ZTMA 2FUEA 4DR2B 1Z26A 3SXUA 4WX2B 1M2VB 4KQ1A 1ND6A 2BSQA 2ZTSA 5FR2A 4GUDA 4H31A 1MW9X 2CW5A 1F8UA 3AM5A 5HX7A 3BFVA 2H52A 3LOQA 3E0XA 1MABB 2J67A 3R3HA 3PJGA 4IO0A 4V2IA 3RWOA 1HDRA 5CCBA 3V7NA 3CH5A 3TQIA 1CDZA 4GZ6A 1VGVA 1CQWA 3RVSA 1QGZA 1PCXA 3TW4A 3R3WA 4HLNA 2AOUB 3IP7A 4TV8B 2WI8A 4WADA 4X3CA 3W77A 1BQ3A 1RVV1 4OI0A 1PV1A 1IHUA 2FN4A 4GPTA 4M1MA 3DBLB 1P75A 4U63A 4JXZA 3GB9A 3BGVA 4ND6A 3AEXA 2FZVA 3ZCQA 1M6YA 4BNKA 1QYRA 4BVLA 1VPVA 1IHPA 2IYUA 3OMWA 1I80A 1N6IA 1CP3A 1PNVA 2YJGA 5BWNA 5ARDA 1WDWB 3GMIA 2PQ6A 7AT1A 3RHTA 3EUWA 1TJ5A 3A6HA 1C7ZA 1NBME 5LMCA 1N3IA 2VO1A 3EDOA 2IFTA 4B5KA 3I30X 2VHXA 1K89A 3V33A 1ICEA 2FDXA 4Z0TA 3BM5A 4X1KA 4YI3A 4WZBB 3X2FA 5C7OO 5L4SA 4NCJA 1YZLA 4X91A 3NBFA 1VE3A 4U8GA 5LD2B 4ZU1X 4KXNA 5C0OE 3WGNA 2WM8A 3O94A 1A97A 1U4NA 4LK3A 1SBCA 3UC5A 4P3OA 2H1CA 3E18A 4D9IA 2DH5A 2F2TA 5AM3A 2HU8A 4ZJPA 2GZ1A 2A9VA 1RI5A 3BTSA 3CZQA 3E3OA 4F7WA 4WK6A 4K88A 1VDZA 2ZATA 1JXOA 2RG7A 2WYVA 4CJXA 4EI9A 2D5IA 2H2DA 2HMTA 4B76A 4HNRA 1HSOA 4L4SA 5KU1A 2D3WA 3HDGA 1OI2A 2D5BA 3OFJA 4YRNA 4Y2QA 3DMFA 3HLTA 2XQGA 1UJ5A 4FD2A 3ITNA 5KSWB 2IUSA 1NJGA 4U2GA 3L0SA 1O6FA 2DHCA 4Q3EA 3RNLA 2JPDA 4HFJA 5LUAA 1QH9A 4OSEA 4TS3A 3T5CA 5CB4A 1Y6ZA 4Y6GB 4D0RA 1JHXA 5M3BA 4LDPA 4CQLB 2ONYA 4DXAA 1FTNA 3V6MA 1XDWA 1MH9A 3GFOA 4YIKA 2Q1WA 1WXXA 2WIJA 4PY2A 3E53A 3H8VA 5KTSA 1CQIA 1XKTA 4IKEA 4RNDB 3AEQB 5K0JA 1CYEA 4BO1A 3UGQA 4X61A 2P6OA 1CERA 2RGNA 3B1KA 5FTNA 2HDNB 2HIMA 3UG7A 5C7IO 4KGZA 4PX5A 2WQ7A 1E9BA 1S0UA 3I42A 1C8VB 3NHBA 3OFVA 1BWQA 3PGXA 2EZTA 3K2IA 4AJ9A 1XD2B 1NX9A 1U8UA 4A5OA 3WLEA 2JAUA 1HL7A 3ODPA 1H94A 3CRZA 3TGWA 4RGYA 3N0WA 2OGSA 1RLOA 2N1BA 5LOVA 4DQ0A 2DZDA 3IP1A 3WK4A 5KTRA 2VJBA 2W2KB 5COAA 2BFPA 1ZK0A 2QN6A 1QUFA 2BKUA 1LPOA 1LV8A 2I7CA 1K3TA 2VP3A 4CIXA 4DBZA 2ZI6A 2O2JA 1JDZA 2IODA 2E5FA 1Z18A 2V58A 3X1YA 1RD4A 3GEBA 5K3FB 4H77A 2YJNA 3DL7A 2VPPA 4IIVA 4MCJA 4RZUA 5LYYA 3JQGA 5CYOA 3RJZA 1IOVA 1KP3A 2FOXA 1HG0A 2P40A 3KXPA 1S02A 2Y1XA 1R8QA 1MV8A 4UHHA 2D0PB 1FLDA 5GTDA 5AP9A 4MW6A 1CEYA 3ZXUB 5JXWA 1QP4A 2YCBA 1W44A 1E9SA 1G38A 2Z6QA 4DCUA 2ZYVX 1TAUA 3O26A 1JA1A 2HKIA 1X9IA 4CG3A 3G2OA 1NW4A 3LDAA 1U1CA 3MFQA 2NWQA 2QZPA 4MW1A 3IMKA 2A9KA 5C4GB 2QVLA 2OCIA 1ZDMA 3MWJA 3CX3A 3Q10A 4CIAA 3PRHA 1PZGA 3PB3A 5DGXA 2W6ID 3DBVO 1UANA 2W2LA 3B1XA 4AVYA 3RARA 4HTAA 5J1TB 5J40A 2WLTA 2NSLA 4D8TA 2F48A 4G4IA 2VVTA 1DBIA 4W5OA 3WKCA 4RCVA 1Z28A 2X9LA 1JXMA 1M34B 2GTHA 3C6ZA 1P3JA 2AX4A 1RXWA 2C00A 1PW5A 5CM2Z 3HWRA 1QCCA 4D25A 4FI3F 1YQTA 1LPSA 3OKFA 4EX7A 1TW3A 1GA6A 1HLDA 3WQQA 421PA 3HPRA 4U00A 5L3QA 1IVNA 2WYUA 5AW5A 2DXIA 1BQ4A 3IFSA 3SGLA 4HT3B 1BO6A 3ECCA 3KS9A 4KQWA 4MW0A 3ICEA 1I01A 4KTTE 3P19A 1R9GA 4PN7A 1JW9B 1K4KA 3QFHA 3G5TA 2WIKA 1FQKA 2FMHA 1PSDA 1R0YA 3FM9A 4QGGA 3GO4A 2FEWB 3JASA 1NT4A 4TT3A 2R8PA 4G1CA 4UU8A 3Q2OA 2IX9A 3ZU6A 2ASEA 3QK7A 3HN2A 1LLUA 2Y77A 4G5FA 1REQB 3ZGVA 1J99A 4YP1A 4ER6A 2H2HA 4NPCA 1CUAA 1ZY2A 2RAFA 3TCNA 1L4BA 2BBOA 2C82A 3W2HA 2O0MA 4OA5A 4JQSA 2R8YA 1QTNA 2HA3A 3SYRA 4C6TB 1IDN1 4F97A 1FRFS 2NUBA 3RSCA 1FTWA 1IYZA 1I14A 2TYSB 3ETDA 1YRAA 3LUPA 1RCUA 2QX6A 1II9A 2WJZB 2FEAA 3B1YA 3TSYA 2JJ1D 4BRSA 1WVIA 2OR3A 2QT1A 1BEZA 2D4HA 4ZCRA 4GL2A 1NF3A 2EKDA 3K6JA 5I7SA 4LQCA 2XWSA 3N2LA 2OAQ1 5DMXA 4ZCSA 1RKQA 2GHRA 2OQRA 4M55A 4YO7A 1L5YA 5ALUA 4JEUA 4BNWA 2XCRB 2O3SA 5HJ5A 3TGLA 4NOKA 2FPOA 3AIMA 1E1MA 3DE5X 2PK3A 2VA9A 1W2WB 3EXHB 3JWEA 4Y6PA 1BD4A 2ZSEA 5FOUA 1X14A 2H4WA 1FFWA 1FDUA 3HV2A 1QS0A 4QUJA 3U3KA 3T7EA 4NOJA 1UBTS 3E4CA 1M1NA 3E61A 2XZPA 1T2VA 4KQKA 2P4EA 5FLKA 2CUNA 1N33B 2IPXA 4FHGA 1X13A 1JR4A 3AHEA 4ML3A 1IJEA 1T2EA 1UJNA 1YHZA 3V4LA 4B4UA 5K8UA 5K45A 1JEAA 2H4FA 3T0FA 4JDUA 4H4EA 1O9GA 4GI5A 3VR2D 2QYSA 4LF6B 1SXHA 1C1DA 1QYCA 4CMHA 5C1BA 1ZMOA 4C4PA 1KOGA 5REQB 3OZ7A 1XLUA 3VDXA 3P71T 3UHJA 4K9QA 4TV9A 2EBUA 3R5SA 1AU9A 4G4SP 3KEMA 3OZGA 1D3AA 1RJ9A 2UUAB 1GU7A 1ZRMA 1DCMA 2QM0A 1IMOA 1JL3A 2RIRA 5TGTA 2IHBA 4Q4JA 5FNVA 1PLLA 4DL9A 4X54A 3KV3O 4G86A 1T1RA 1HURA 3CNBA 1L5HB 3A9RA 3AW8A 1XPOA 1U3CA 1RXCA 1GJRA 2NNLD 1XNQB 4QYMA 5I8WA 3TVYA 5E0OA 1YQGA 4XJSA 3RFCA 2Q4BA 3HWX1 5GOZA 1KNXA 2DF8A 4GX2A 4UQPA 5HCUA 2V9CA 5C1DA 2KPOA 4QU5A 3H4TA 4K05A 4LSZA 4FU0A 4C3UA 3ZCTA 2QTFA 3SJAA 2CLIB 4OMUA 4NDZA 5DHRA 5DSXA 2G88A 4BNYA 2DSNA 5E7JA 4DSUA 3RU2A 2HCBA 3VX4A 1NQAO 3EPLA 2HLDA 4WOBA 3RVDA 4D1YA 3AWDA 2I8LA 1NMZA 1JDTA 2BDUA 3IQEA 5IJ9A 3AU8A 5HKBA 1YA6A 4H4CA 3VNRA 4HXGA 1C30A 2B69A 5JW6A 2ZS8A 1SXJC 1RRKA 3LDHA 3SBOA 4Z4FA 1ODJA 4XX0A 1VPDA 4JVNA 3EJWA 1SWWA 1MO2A 4EABA 5LJLA 2NO0A 2Q3MA 4W5QA 3W8FA 1RZVA 4LZOA 3OPYA 3HVUA 2GCOA 5EY5B 1CQXA 4A6PA 4EL5A 4G56A 5SZHB 2JI4A 2WVAA 4LRQA 1P9OA 3PE6A 1X87A 3JS5A 4BB6A 3RK0A 4MKXA 3NTRA 2ZE8A 4ECAA 4EVIA 1Q0SA 1WMBA 1QIMA 1M6VB 3IC5A 3WA6A 3S8EA 1T8PA 5KX5B 5KYXB 5CLQA 1GT6A 4M1QA 1ITZA 3N76A 5BQ3A 4G26A 2GLUA 4RFSA 2I33A 4G8JA 3DEYX 3MGKA 5A6SB 3PFFA 1V96A 1AQUA 1YNOA 4PE5B 4XVRA 1UAAA 1H5NA 2NU7A 2C8LA 1IHDA 2P1DA 1DJLA 1Z2DA 1O5TA 2CHUA 2GQ0A 2VUUA 1P1FA 3H1GA 3LA6A 3ZDAA 1ELOA 1H1TA 2PH1A 4KVFA 3S8YA 5AUQA 2VBFA 4BVFA 4OBBA 2WV7A 3NM6B 2RBEA 3D6MA 4Y1FA 5BQ5A 4CGYA 2NO7A 1OXVA 1NKTA 3CUYA 5ALGA 1PTJA 3HUUA 5LU9A 2BAGA 4R7TA 4XGKA 2X8JB 4M9ZA 2YQ4A 3G5UA 4R68A 4DTIA 3PYMA 1WUJS 1Z7YA 2A7XA 3E5NA 4QNNA 3MJCA 3NIDB 3W9UA 3M8KA 1CLEA 3PG5A 5BSUA 5JSKA 621PA 6YASA 1MOPA 2XTZA 3BIJA 4BNNA 2QTVB 2PD3A 1KGDA 3RKRA 4EUFA 2LXNA 1GXSB 2GN2A 5IBPA 3RSGA 1XAGA 1H66A 4BBPA 2PV7A 4R3WA 3T1NA 1KI3A 3WLHA 1ZIYA 3QH4A 3HRKA 3H4VA 5KQSA 4EA6A 3RR2A 3TINA 3ZHQA 2QNRA 3KSBC 3PQ4A 4TKUA 4NEHB 1I2DA 1Z34A 4AN0A 3OZRA 3DMTA 3P9QA 3WRYA 3ER8A 3NWJA 3H8WA 2Y1OA 4KSCA 3UQYS 4YJGB 4DCVA 1XRSB 4N49A 4KR9A 1SUPA 2WHPB 1TZKA 3LVBA 1QGUA 2ZULA 4HQKA 4IIBA 4Q37A 2PEYA 4RMIA 4XD7A 2XW6A 2CB0A 2A14A 1A9YA 4BKOA 3GLIA 1ONSA 1HE2A 3TD2A 5JPIA 2RH8A 4OV6B 1UR5A 2FUG6 5DTRA 4Z4GA 5MGBA 2EIHA 2XZOA 1U1EA 1EU1A 1I33A 2XWQA 3N9IA 3VISA 5JAUA 3OG9A 4LJAA 4PFSA 5BRNA 1UBUS 4ZZ2A 3EGDA 2V3VA 2EU8A 4XIIA 3V8VA 5C8ZA 2EFCB 4MV8A 2D2FA 3WWPA 3KWJA 4KIUA 1Q77A 2HMUA 4FNMA 4RQUA 1NVXQ 1WQ3A 4LNUB 1OX4A 4UNSA 4XQ9A 4OIMA 1IBLB 4R16A 2SBTA 3IXQA 1P2FA 1ZL2A 4HPWA 2WZQA 5E6UB 2PMFA 2X2EA 1YTUA 4RSGA 2GSWA 4G0MA 2ATVA 1KVSA 3AONB 4HS4A 2NT4A 2CYAA 1NXSA 3KEOA 5LBUA 3F3KA 3UGJA 2XZLA 3AUAA 3BORA 3DBIA 1L4NA 3D4PA 1XZBA 4A36A 2GAIA 2QIPA 1Q7RA 2EF1A 3FY4A 2J46A 5BYBA 5LPNA 3GLRA 2LD4A 4PYKA 4L0CA 3SHFA 1J8DA 4LGCA 4Q3CA 2ZTVA 3TAUA 1BGXT 1JG7A 1P2UA 4G63A 1YHNA 4MUNA 4IGIA 4TZKA 1QFXA 1SUDA 2X7XA 1JEYB 1Z8HA 4HLUA 3AVPA 4GR9A 3PC8A 4CMCA 1ABBA 1CB7A 4IFEA 5C5EA 1H9BA 1NF2A 5E4TA 1QO0D 3KLBA 4QQFA 1TXGA 1OF1A 4RORA 4ZC1A 3WXBA 5JADA 2PKYX 3GZNB 3MWEA 5K09A 1ONBA 1G8GA 3SQNA 2BR4A 1N5DA 1QVRA 4EK9A 1LBTA 1RM3A 4WCVA 1YRQA 5JE8A 4JL8A 1A5TA 2X2PA 1RZ3A 3UHPA 3GAFA 3PIDA 4F4IA 1Z9BA 3CNLA 4D6YA 4YGYA 3PPIA 1JZTA 2JFQA 4R3NA 5SZKB 4FDLA 1SPXA 1SOUA 2VYND 3U60B 5AICA 4LHVA 1UMCA 2WHQA 1AF4A 1KDRA 2BOVA 2R25B 2MSWA 2XUZA 4OHPA 1G20E 4QIHA 221PA 1M2GA 1QPBA 2EQBA 2CJWB 4TS4A 4ZOBA 2QX9A 3RFFA 1LY1A 1QF7A 2R6ZA 3I4LA 1R6AA 4KWHA 1H6CA 2ID4A 5CM8B 1TAHA 1KQPA 1SFRA 2J9YB 2R68A 1Q0LA 4N9WA 3V46A 1KE1A 4JT9A 2CN1A 5ALOA 4B5LA 2EIXA 2P78A 2Y1DA 3I1JA 3L02A 4HDSA 3AB8A 4KLCA 1Y7TA 2EC5A 3BERA 5G1NA 1KYIA 1QVZA 2JATA 1HNWB 3R3UA 1KI4A 3LHSA 4FEGA 2O06A 3WFIA 5IANA 2OK8A 1FP6A 1USUA 4X1YA 1KYTA 4QJBA 2FXIA 2OQIA 3U7QA 1PBTA 2PWPA 4L9RA 1EVJA 3ZUPA 2C9MA 3VKFA 5HUHA 1AKNA 2A0WA 3DOUA 3HJTA 2P2NA 1JTFA 5DM60 3FHCB 3C6QA 4NZOA 1S6YA 1ETHA 4JX8A 1IIRA 1NVKA 1UBEA 2BW0A 4KQXA 3V80A 5I7OA 1OH7A 2I5PO 4QNRA 5MF6A 1RXYA 2FJUA 1NNUA 3LSYA 3GT0A 1E3SA 2QI9F 2PT6A 4JA0A 4DKXA 3UJ6A 3O7WA 1A4XA 1C8BA 4HNSA 2J41A 3JQFA 4XDZA 8AT1A 1YDMA 3SIRA 1S8NA 3ULKA 2G0AA 1W5AA 2ZBFA 1CV2A 1II8A 1MX5A 1BEUB 1TGYA 2EW2A 4HQNA 5KTPA 1QZZA 1T26A 1P6UA 3QBEA 3IT0A 4D9HA 2RHCA 2VT7A 4YMHA 4DUGA 4LPKA 3TGPA 2JGRA 2O07A 4DV6B 1XEXA 4PAGA 2GTIA 3DNFA 4JENA 5FFNA 3FGOA 3S29A 2R7AA 3VU1A 4BFLA 3A1WA 1AKRA 3PHGA 2IHVA 1G9XA 3FNRA 3QX9A 3EG5A 2VTKA 3P97A 1OKKD 4HDOB 5HK8A 1FS5A 3BTUA 1RAIA 4I46A 2O57A 5A2GA 1YZKA 2J31A 1RYBA 2GRUA 3GLVA 2WF8A 4KODA 1B8PA 2ORIA 3F3MA 3RODA 3AJAA 4B85A 3EIOA 1Y1KE 5L3RA 5AKZA 4RENA 1E1KA 3H0EA 2XTNA 2RGNC 1CJKC 4NJEA 3JWJA 4AF7A 4DHEA 4F71A 4ZQBA 4RVUA 3CF4A 2GJ4A 3N0RA 2W8BA 2JLBA 4IQFA 3DLPX 2ZSFA 4W1RA 1PFKA 1PT7A 1ZEMA 3BXXA 4FNAA 4MS1B 4NBTA 2BKAA 5BR7A 3R40A 2PX5A 1KAOA 1EQUA 1XTQA 3A6LA 5ESWA 1N7IA 2FZKA 4XYEA 1PK9A 3G5LA 4MUFA 2YHAA 2IWRA 5HQTA 1U8EA 1JHRA 2HHHB 1ZGGA 4UXHA 1E92A 3A3PA 2BKVA 4QZVA 4JI5B 2CMHA 2JEYA 1TT7A 3ACCA 3IHTA 3O31A 5K3DA 2XGGA 3VJMA 4DM7A 3MQ2A 3H16A 1DRJA 3KDPA 1XP8A 5CTAA 2H5IA 5JSZA 4PNPA 1J8QA 5LYJF 3U7GA 2GNPA 1TMOA 3QE2A 4KE6A 1PGQA 2JJ8A 4MYHA 1E69A 5DN6A 4KHZA 1UKBA 3R7LA 3SLGA 4DYVA 1CUUA 2ZAMA 2F3TA 1EGAA 1MRNA 2FF5A 2ZSJA 1B76A 4F3TA 3AX6A 5F5NA 4OEHA 5JLJA 3JWGA 1J5XA 3QUQA 6ADHA 2OCPA 3EAQA 1LVGA 2B8EA 1AQJA 3FUTA 2VWHA 3P5BA 4HR7A 3ZOKA 3W3AD 1AS2A 3AI3A 1HT3A 2XWBF 4JYCA 2WJIA 3QJ5A 4QUEA 4BLUA 1UFRA 2A4MA 3G6WA 2IPNA 3O1JC 1M2WA 4DCPA 1S89A 3WGLA 3KRTA 2XZTA 4WBXC 2F1RA 4L8VA 2WSMA 4TWZA 4MYUA 3KAKA 4P4NA 2V0CA 2R8BA 5FUBA 4K6KA 5BV7A 4RDXA 1LDEA 1Y8RA 1XXLA 4NMLA 3SKXA 3CG4A 4B17A 1CRZA 3NYIA 5KAMA 4Z4IA 5HVNA 2ETXA 5BURA 2C42A 3OIFA 4YJ2F 4AT1A 4JI0B 1MIOB 1R27A 4KYUA 4UDOA 1JKIA 4YRZA 1L5OA 5THKA 4F8YA 2WE7A 2SKDA 5F3WB 1V6AA 5DWDA 3TW0A 2G0TA 3AYZB 3GY0A 5KNDH 2GLXA 2G28A 4MSUA 1S8OA 4PPFA 3RU9A 5LM3A 3R9WA 1D6SA 1DT3A 1ISSA 1AD2A 3GJQA 1DKMA 2A9JA 3OOJA 5JY1A 1QRDA 2KYRA 3RAFC 1G7CA 2W6CX 2ZYRA 1A71A 4OL0A 4HFRA 4W7SA 4RPKA 3WV5A 4GKJB 4BN4A 2H5EA 2R7KA 4YAJA 3IQZA 4UFNA 1C0LA 1MB4A 2WD8A 3HNPA 1T0JB 1ZW6A 3Q9LA 1T5SA 5MDHA 2COEA 4NH0A 4JLJA 4L6AA 3H9UA 3WL5A 4MKHA 1JBKA 1XRRA 4OQYA 4RD3A 3BJMA 3UW1A 4JLOA 4G1BA 5K51A 5HOEA 3WGKA 4ZK6A 2P0EA 4FFWA 2F59A 4IIJA 2PUEA 1NI5A 4CIYA 4NTZA 1ADJA 4WNAB 5T41A 5FEUA 3OZSA 2WA2A 5LB2A 4MV5A 5EHXA 1C0IA 4HGOA 3ZI7A 1IRXA 4U3JA 2CLMB 3RSSA 3W9YA 3I0ZA 4ESHA 2BTOA 4RFLA 5TT1A 5EUBA 2EFHB 4BV3A 3P7MA 5A62A 3BK7A 3DEZA 2H1OA 1DXYA 4L02A 2QSYA 5F7XA 1XXHB 3H13A 1ICIA 3KJQA 4XYLA 1Y7HA 2GJ8A 4R1LA 4RSMA 4OJKA 1DE0A 2V7EA 4X8HA 1JTVA 2WINI 3C3XA 2ARKA 3NBYC 4CZ2A 5I7FA 4KREA 4BX8A 3U7RA 1MRSA 1P61B 1QVWA 5AVUA 3WLFA 2J30A 5THXA 3EFOA 4GZ5A 1UWVA 3NHZA 1Y82A 4R2JA 1D03A 1M1YB 1UK7A 2PUJA 3AI7A 4IMJB 1L5NA 3H42B 1RWOA 2DBZA 1JILA 2A58A 3DMHA 1DPGA 2WTBA 3RUEA 2P69A 3AZQA 4RD2A 1CUJA 3TLZA 1PX2A 1YRHA 3BQNB 3OE7A 1T9BA 5JYDA 1YZYA 3UXHA 4RD1A 1RBYA 3X1KA 1QU3A 1NM5A 2B5WA 3FLBA 4Y30A 3F5FA 5B1IA 3VC3A 3B2EA 3HHPA 1EFUA 3MM4A 3QLUC 3VDRA 4EEKA 3NKLA 4K0RA 3NZEA 1JG4A 2Z2KA 3HQ4O 3UFXB 1KK0A 2Z8YM 3IA2A 1AZLA 4JWKA 4H6XA 1GTRA 3FUWA 4UHJA 3THSA 1NAIA 4OU4A 3SC4A 5CA0B 2R8XA 1TAGA 2HRCA 3GIDA 1P0CA 4J1TC 4PTLA 4LA4A 1YFZA 2ZBQA 1U3TA 1NN5A 5JSHA 1YIAA 2DJ5A 2H7YA 1NVWQ 1SIUA 3GDHA 4BFVA 2P2YA 3R6WA 2DTXA 4YAIA 1PT8A 4NULA 4YHBA 1HZJA 2MOKA 1VE5A 5BYAA 2YUIA 4AZ0B 1G98A 1QTRA 2H0QA 2RMKA 2Q5QA 3FD8A 3L6OO 4M88A 3MB8A 5CYPA 4I9UA 4JB0A 5G3ZA 3RIGA 1AK9A 4TL6A 1I36A 5DB4A 1N1EA 1PAUA 4FNGA 5GP1A 821PA 1XDBA 1KFJB 1VE6A 5ES4B 4WVLA 5G2OA 4YI5A 4X90A 4BFSA 3STWA 2JFGA 3DKIA 2EARA 1Z0UA 2E82A 1QIGA 1RP7A 1D1PA 4IDBA 4RZXA 5GAJA 4M6WB 4CF3A 3QV2A 1IQRA 4Q3DA 1FXWA 2YW9A 4GNRA 1GWNA 3JX9A 5FA6A 5KVVA 2PL5A 1RKVA 3NHJA 3DBHB 1UM8A 4LV8B 5ALMA 2HU7A 4W5HA 2W83A 4B0PA 5LXTA 4AJOA 2RC6A 1ZVVA 2QE7D 1K0FA 5FL7A 1H1LB 3LRTA 4URVR 2IIPA 1K75A 4PHTA 5EE1A 4U7WA 1B74A 1QZUA 2HJHA 3EVTA 2D3TA 3MBIA 3NDJA 4PG7A 1SXPA 2VSFA 4I50F 2C04A 4EHLA 3DZFA 4NS1A 3AEKA 1J97A 3LYAA 3A6GA 2F9LA 2VDUE 4EO9A 2W6PA 4CL3A 2CXNA 4FYVA 4XSHA 1W29A 1DKNA 2V1XA 2IYPA 1GL6A 3FOBA 4PLGA 2IH4A 3M6LA 2FJ0A 5BN5B 5F9FA 3BRQA 3ZEAA 1F3LA 2FMIA 3HB5X 3Q1KA 3QJGA 1TIBA 2XCQA 3F71A 1KZYC 2XE7A 2X0KA 5HIJA 4QOSA 4LYDA 3KXDA 5C7YA 1TCUA 1NBAA 1USIA 4C4OA 5JOQA 4BL5A 1BROA 4GX1A 3ST7A 2YWEA 2OOSA 5HJ7A 3KOOA 3KAPA 3MWKA 3TEFA 3ZZUA 2OD7A 2OCKA 3ZDQA 3TQOA 4RANA 5E7MA 2P3SA 3TM5A 2C9BA 3ZYZA 4YYZA 5HOQA 4IF6A 2PVCA 5BYJA 4MUGA 4DVGA 3TVTA 4FS8A 2ENWA 4MMXB 3FPJA 2IDKA 4UTVA 4I1PA 1YNSA 4UARA 2XR1A 2H4YA 3H4MA 4M1ZA 3WAKA 2BJHA 4HH0A 1K8YB 1NMYA 1OYOA 2RONA 1EUCB 3FCXA 1E5XA 2PS0A 1JLHA 3G2IA 3R41A 3OKCA 2ZR9A 3R5JA 3U9TA 3UT6A 1XDGA 3EOBI 1ULAA 3O21A 4PBRA 4BE9A 1Q95A 1PTJC 1S9HA 3C3YA 1QFSA 4L3VA 5TDHA 1AY0A 4AP5A 1PR9A 3IQFA 1Y1SA 3K0KA 2QL5A 5B4TA 3GLQA 4Q3AA 3HR4A 1KZGB 2Q7XA 3I04M 3O47A 4ZAFA 2V97A 3RT1A 1KK3A 3NOVA 1Y3BE 2I2DA 2QXYA 4IDEA 2C78A 2XQJA 3RUHA 4D98A 5IYZA 3K92A 2WIDA 4V0QA 1CY1A 2AEFA 1GTVA 4BOYA 5JS1A 4J6EA 5FBWB 1CJBA 3DZCA 4NYIR 3PL5A 4CT4B 2QMZA 5IEJA 5I7RA 1AUOA 4J6FA 1H2EA 1YB5A 2Y27A 2A5JA 2DT8A 1YL7A 4B87A 3K0SA 3FDFA 4RELA 3V7YA 4D9NA 3E8XA 1TYEB 4GZMA 4ZXPA 3SOZA 2HW8A 4L15A 2VHQA 3RK4A 4S2UA 3U5ZB 5F98A 4NV1A 1U8TA 4CTOA 3T1QA 4N3CA 2Q0SA 4LXTA 4QJ4A 4OK5A 3DE2X 4R1SA 1DMRA 2V7WA 3H9CA 1QC5A 2VA8A 4EHJA 4OQNA 2C8VA 3RFVA 3CH4B 3IALA 1ZN7A 5JD6A 3CUEF 1H23A 4GPIB 3VDNB 1FP2A 1JDUA 4V1CA 4P4SB 2D1TA 4ZOLB 1IBSA 2Y76A 4ZAVA 4OF4A 4WINA 4DFDA 4JI4B 3CLVA 4FONA 5JPCA 1GPKA 1GTSA 1HPLA 3S2IA 1DFHA 5LDDC 5F9HA 2C2HA 4DMRA 1T5LA 4JIGA 4JYPA 1XZJA 4BQEA 3LPNA 3VVBA 4U4AA 3DOEA 2WYOA 4D3DA 3F67A 4LNAA 3HACA 4KQGA 3CNQS 3E05A 4ENWA 4JJKA 3ZJ5A 5IMSA 1SIWA 3JZAA 3CLSD 1NWHA 3DTVB 3TSCA 1RRCA 2UDPA 1P0FA 4ENTA 3B6EA 3RBXA 1BGWA 4ED9A 3I52A 3V8QA 1TQHA 1UJMA 3IL2A 3ROXA 3CG0A 5HMLA 5BN4B 3STVA 4JOBA 1NVVQ 3MMSA 3DHVA 3Q41A 2GCPA 4HP8A 3PXGA 2ODAA 4H6WA 1QIDA 2PWAA 2QTZA 2CNDA 4HYTA 4XUDA 4BVEA 4TUYB 2JARA 4E0BA 2JI7A 3CJQA 4LVNA 5D00A 4DSTA 3AGPA 4OGKA 3PC8C 3GCZA 4LG1A 3KUKA 4BC0A 2ZRPA 3AVTA 3DV0A 4I14A 1KEKA 1F4PA 4JCOA 4K9SA 1G21B 4LGVA 4MDHA 4ARZA 1HOXA 2H65A 3H05A 4OXKA 2H17A 3BDAA 1YVDA 2UZ1A 2IEDA 1CQJA 2DM6A 4JUCA 1HNXB 3N05A 3D2CA 4FFDA 4TSKA 3T4PA 1G17A 4ID3A 3M6MD 1UPUA 5C8YA 5T3UA 2FE1A 2ZJ0A 4MR8B 4MUAA 3K35A 1I10A 1OYVA 2Y3IA 4KE8A 3CZ5A 5FOTA 4ASUD 2O8BB 4MRMA 2ZEJA 4DDTA 3BWVA 4KR6A 1SHUX 1QSGA 3LW8A 4OCZA 1SC3A 5EXXA 2C4TA 1O4WA 1TVEA 5FAXA 2D6FA 4PLTA 2X0NA 2LBPA 1DX4A 4WJLA 2QV7A 1PDOA 4RU1A 3D8BA 3DYBA 4H4DA 1E98A 4D4MA 2PE5A 2NYVA 5FWYB 1NXXA 4ZQIA 2HH9A 1CFJA 1APBA 3GXBA 4DIKA 4QGSA 1HE5A 2Q9BA 3ABOB 1V5IA 3Q9UA 3L1KA 2DWPA 3T3GA 2EP8A 3FOWA 1KO7A 3QF4B 5BMVF 2I87A 2BPOA 3G8AA 1DB3A 1OI4A 2XMBA 4MOWA 3TTVA 1OBOA 4DKJA 3CURA 2W11A 2B1GA 4TX1A 1UQUA 1E7MA 1JHYA 3CEAA 2HMVA 2GPWA 3IA7A 3EGIA 1H85A 1Z74A 1GZVA 2X5XA 2X5NA 4GEKA 3V4PB 5A2QA 3G17A 5HYVA 4KBGA 3F2IA 1Q2XA 1TMYA 2QSJA 3QG1A 2D2IA 4KEAA 2G1PA 2NUAA 3A32A 3N28A 2Q5LA 1KDZA 5E9AA 2FV8A 5FPYA 4CFSA 5I47A 4XEHA 1C7EA 2A9FA 5BRJA 1I7NA 3MS4A 1JNYA 1KEUA 1ADYA 4IX9A 1IPHA 2QGNA 3JYPA 4WLFA 3PPWA 2Q5CA 4I2NA 1L3BA 4QYTA 3VHLB 1NJ2A