5CTJA

Structure of a single tryptophan mutant of acetobacter aceti pure containing 5-fluorotryptophan
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
157
Chain Sequence
APVVGIIMGSQSDFETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAATRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETFRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 56
structure length 157
sequence length 158
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5ctjA00
2NSHA 2FWBA 4GRDA 2NSLA 4ZJYA 5C5DA 2FW9A 2H31A 5BOSA 1XMPA 4AY3A 4ZMBA 4YCBA 3RGGA 3KUUA 5BORA 3RG8A 2FW7A 2FWAA 2FW8A 1D7AA 4YCJA 1U11A 2ATEA 4JA0A 3LP6A 2FWJA 5CVTA 2FWIA 3ORSA 2NSJA 4YCCA 5CLJA 2FW6A 3TRHA 3OOWA 1O4VA 4B4KA 4ZK2A 4YCDA 2YWXA 1QCZA 5CTJA 2FW1A 4ZC8A 5BOSB 5CLIA 4Z7JA 5CLFA 5CLHA 5CLGA 4AY4A 3OPQA 2FWPA
chains in the Genus database with same CATH superfamily
3TL6A 1SCNE 4LZPA 4CL3A 3NYQA 5IT5A 4WQMA 4A91A 4ECAA 1AC5A 3FMOB 3MNFA 1S3SA 4NPAA 4B2IA 1H5NA 3W5AA 4JGGA 5TDHA 4EUHA 2AKYA 3SQWA 1LPBB 4LX0A 3AH8A 3UFXB 3R3JA 2P3QA 1H66A 4KO2S 2FDXA 4L15A 5F21A 3K05A 5AH0A 1CF2O 1Z9BA 4S12A 3NO4A 2AMLA 4EW3A 1AY0A 1JFSA 3ND8A 3GV0A 1LJLA 3A6LA 2K2QB 5KVSA 4D25A 1V8FA 1OT5A 4Q7LA 3ZJYA 1XMVA 2P2DA 4LJLA 4UVDA 3WLHA 2V5UA 2FB9A 1N0IA 5DLDA 4V0ME 2GK3A 5GADl 3ZZNA 2X4LA 4EG8A 3QKIA 1ZLYA 3PGKA 4QRHA 4JI7B 3GJ6A 5FEUA 4OP1A 5BMOA 3HSKA 2YV3A 1XCOA 4XQCA 1L4BA 3JZMA 1TO6A 1CUXA 1OASA 2CLDX 1JWBB 3LWNA 4YT5A 5I5EA 2EX1A 1RTKA 2YQ5A 2BBTA 2RGNA 4KXFB 1BEZA 1I51A 2VA8A 4JP2A 3VPFA 1MBZA 3WIBA 2PZMA 3L6CA 1W34A 4MR9B 2JFVA 4B7XA 5IT9A 2CXOA 2IK8A 3C74A 3KD3A 5H16A 3KX2A 5G4KB 4MZXA 4WCDA 4J7UA 3QMMA 4NE2A 1ZYUA 1PK8A 1CY0A 2HHJA 2IY9A 3C5WP 3TLGA 4N0DA 3W2TA 4E30A 5ITZB 3ONDA 2JFUA 3CX6A 1CUAA 1V2HE 1T0JB 2P6NA 4TVBA 5FI1B 2CSXA 5E4YA 5B4VA 2ANBA 5E6SA 2FEMA 2EVWX 2JKYA 1YA4A 4W82A 1NUSA 3AC0A 3GBSA 3NBZC 4EHHA 2IBSA 4EUSA 2XADA 3FGNA 1PYGA 4CHTA 4AKGA 4H6WA 4BJ1A 4KYUA 4ENPA 3F7TA 3A9RA 5F5LA 2FPLA 1L7DA 1SBQA 2PSFA 3ZWKA 1ISPA 3VV2A 4YJ2A 1VOTA 4UXHA 2I7XA 4B3RB 4MDHA 2QV7A 5T8KA 3SX0A 2PSJA 2JIRA 4B6PA 1HYEA 3P9KA 2J3EA 5K3FA 2Z2XA 2REXB 2VBIA 3EXEB 4CLXA 4HDSB 2I2CA 2A5JA 5CLLA 3ABIA 5HIKA 2DEUA 3PPYA 5BNFA 5DT2A 3W2IA 1UDRA 1UP7A 2FMIA 3EXHC 4JA2A 1OU0A 4H7DA 4W7SA 5K2OA 3HEBA 4NPHA 1GWNA 1ELOA 2HQBA 1R37A 2KS6A 1PT8A 4M1SA 4MUBA 4GGPA 3SYRA 3M1YA 4NMMA 3KRTA 1YTLA 3KKKA 1F3OA 3PKZA 1U2EA 3CLSC 4BLTA 1R6VA 3HPRA 1UJBA 3DC7A 3A9VA 1Y9EA 3IUEA 4G1EB 4OFBA 2JLZA 2IXAA 4HYEA 3PUVA 4B81A 4BN5A 5HQ3B 2AC7A 3R3VA 5B37A 1CS4C 1ULTA 4JZYA 3VPCA 4BNJA 1H3EA 5K8JB 4MJXA 3VU1A 3R9XA 1NVUQ 3KSRA 4NPCA 5J63A 1RHQA 4QXMA 3TSWA 1I4OA 1TLLA 1OT3A 1ZNWA 4ZO9A 3TN7A 2Q8QA 2JFWA 2EJUA 2N75A 3WE7A 2KQUA 1G7TA 2IXTA 4FYJA 3SBEA 1TIPA 4AC9A 1JG7A 5HIIA 3NM4A 4HZIA 1NW3A 1DCTA 1HQCA 1GR1A 4URZR 3UK0A 4BIIA 4JP8A 3L8HA 2NUTA 1H0HA 4KNVA 4B6QA 4P9NA 2ZYGA 2AMVA 3GRFA 4G0ZA 2QE6A 2IUUA 1ZUNA 4KNYA 1GP2A 4DSAA 4R3NA 4IIYA 2FE4A 1TMOA 2QNBA 1W49A 2JFXA 4JVLA 4RKFA 1NXPA 2HM7A 4GX5A 3WJ7A 3H4MA 4DDKA 5CDUA 5EERA 1CNMA 4YVFA 1VYHA 5JFGA 2NUAB 2VNIA 3BWVA 3FCXA 2ZUTA 1P0QA 1A0OA 4OUDB 1AUPA 1T2DA 2OZPA 5B1DA 4PZAA 2ZJ6A 5LXTF 1G66A 2VJYA 4YXWD 2PS3A 1UFVA 2OO7A 3P97A 4MNTA 4O2BB 1FQOA 1QHXA 4AF6A 2AFVA 1V5FA 5TQVA 3RUCA 1H2WA 1E4YA 3B51X 1BX3A 1KYYA 2WIFA 4ND8B 2Y0EA 5JSFA 1LTKA 3KKNA 4M76B 1OREA 4D02A 5B6PA 2EFYA 2HXGA 4OQEA 4EJ2A 4BV8A 5C7OO 4PYQA 3X1JA 3E22B 4CLRA 1MIOB 4BNZA 4MS4B 1TI7A 4HEJA 4MRAA 3T7JA 2PV0A 3MMZA 1TAGA 4REQA 2DQYA 3LVFO 2VPPA 1SKUA 1S9DA 2Z2ZA 1SBHA 3FCCA 4G41A 4GR4A 4MW9A 3ZDRA 1SXJB 5HKBA 2XCSB 4Z4IA 1MV5A 4HDKA 4IMIB 4OATA 3A04A 1DMRA 1UPBA 2D74A 2O7SA 2XH8A 4EG4A 4CR7A 1X1QA 3IKMB 1GRRA 1JW9B 3GLFA 2HIAA 3BX1A 1IU9A 1JPVA 4Y2JA 5KJEA 4M6WA 5CJJA 2WJPA 5A2QA 1EE1A 3FE2A 3IILA 4HUQB 2CLOB 3DMYA 3K5PA 1NGSA 2E21A 3IHWA 3OE1A 3MMNA 4UEKA 3R75A 3S5JA 2DKOA 3RANA 4FOOA 2Q3FA 2C7VA 3R40A 2AFHB 2C59A 4YJDA 1UFOA 5KI6A 1E9AA 1ZA1A 2HZ7A 3LUCA 3QKUA 1H8HA 1LDEA 1QP8A 3W7BA 4A0QA 1WCWA 5DWDA 2QGFA 4JODA 3R7SA 2GZ1A 2QP3A 4ENTA 3E9NA 4B3CA 3E27A 4I2VA 3QM1A 1JDNA 1GSAA 3KG2A 4G5OA 3E5HA 4JASB 4C2BA 1EFRD 2B83A 3LH5A 3NPMA 3NETA 3H5AA 3OEEA 3MMPA 4HFRA 4QNNA 1R16A 4E6EA 3TIIA 5HKLA 3SJBA 3UJ3X 3QY9A 3ANXA 4YRNA 3EDMA 2HUPA 2B8JA 3TR6A 3O93A 5DLPA 1R1DA 1FTNA 2I3ZA 2YVAA 3CQ9A 4QOEA 5CUQA 4BKRA 1YFLA 1PFVA 1MQ9A 1TEHA 3R3UA 3E3MA 1U5CA 1G5FA 1L4EA 2GPNA 4P4SB 3JQFC 4FEAA 4YP5A 3P9ZA 4LQLA 2JAXA 3W6UA 4C7BA 3ANSA 4EKGA 3C6ZA 2Q8NA 2XLCA 1EJ0A 1O8BA 1M34A 3DT6A 3QBDA 4G8CA 2AKEA 4RIGA 2PYDA 3LD9A 3MVEA 3RAGA 2QUHA 2C1ZA 3I76A 2GCOB 2QLBA 2HDNB 1QHGA 1TJNA 3ONFA 5DTIA 5KJ6A 2AW5A 4U3JB 1SU8A 3UHAA 1X39A 4EHFA 3G0IA 2B8WA 4GKAA 4TMYA 2J0EA 5SZHB 3VZSA 3KKMA 3W04A 1L9KA 2RFLA 2BKUA 4GXRA 4NMWA 5ICGA 3OQPA 2FEAA 5KTNA 4IJUA 1DX6A 1BDHA 1SVNA 3ABRB 5J3JA 2QJFA 5A3SA 1RFLA 1ODFA 3ROPA 3RSOA 4CNBA 4WKCA 5K0NA 1KSGA 3GPIA 2YHIA 2L17A 4EB3A 2P9EA 4N8DA 3PFWO 2HMTA 3J81A 4N03A 1ZKDA 4DQDA 2O7VA 1C9EA 2GF2A 2P62A 3CZ4A 3QOFA 3ZHCA 3G2HA 4BNUA 3OKAA 1JQ5A 5LA6F 1LEHA 2VJLA 4G5SA 1NBME 1U8TA 1XWFA 1C3VA 3GZJA 3KU4A 4LJ4A 1ZI6A 4RQBA 3V2GA 4DCUA 2IS4A 1PR0A 3BGOS 2Q41A 2WQZA 721PA 3JYOA 4FC7A 4YI5A 1WKBA 1NTRA 1G6OA 2B1IA 1Y7IA 3C8MA 3LWZA 5COBA 5LZ2A 1ZVKA 1RZRD 1UM9B 1HSZA 3UFBA 2AQ8A 2JBWA 3BN3A 3EGOA 3L41A 2E82A 2GM5A 1O5TA 1Q14A 3AF2A 3T9EA 3WWYA 4WJLA 4RJIA 2VG8A 1M6NA 3GW8A 3JQ9C 3TJRA 4OMCA 1U2QA 3GDWA 3DDHA 4WBNF 1F8YA 5TQ2A 3Q10A 1ZHOA 2DETA 5DGDA 3DXFA 4KUGA 1NP3A 1K97A 1VCIA 2V1XA 1KDVA 4PG8A 3O3MB 5KJFA 3U1BA 4ZTZB 1YRAA 2M6RA 5HJ7A 2IPMA 3QX7A 4GL2A 1QC5A 2FK7A 1LRKA 4F72A 1H3FA 1Q2UA 1RRMA 1SC4A 2FUKA 4JWKA 3N2YA 4GG1A 3AFOA 3FBTA 5BOSB 5HRUA 2O0LA 1KK3A 3D7NA 4DDHA 5BV8A 4FIDA 4QELA 4RF2A 4CCYB 3QLVA 4V2IA 1XEFA 4MI9A 1XU7A 4QRDA 4I6EA 4Z54A 1XZNA 2CEKA 2PSHA 2C5FA 4OGFA 3GLTA 1EZZA 3ZCSA 2XNSA 4YAUA 1AB6A 1H2FA 3W2EA 3B6KA 4RFSB 1SY7A 3OA2A 1RHJA 4P6VF 3HABA 3PFBA 2DWPA 1RJFA 4ZGGA 5AUNB 4CKCB 2JLAA 3WYAA 1NRXA 3BD7A 5FUXA 4LTNA 3M7IA 1KP9A 4BX3A 3BK7A 4MTLA 5C4GB 5AKXA 1YKGA 1DDIA 2OZVA 1XNJA 1FJXA 1IULA 2DG2A 2ZQZA 3ADCA 2CJWA 4DMHA 2WJHA 3SCZA 4BEJA 1HGXA 2V7TA 3H6GA 1F12A 4JYPA 1Z18A 3LCJA 2O2SA 1RM4A 4KN8A 5DYWA 2B4AA 3SSMA 3VC1A 4AJ9A 1D0IA 4IXDA 5BR4A 2Q3HA 1EDZA 5J4HA 2FRDC 1RBZA 2ANCA 2HA0A 1JHOA 3GNSA 4FFSA 4FOPA 5ISMA 1REQA 1R8XA 4URXR 5EZQA 2UYHA 2X5OA 4PANA 4PICA 3C7KA 3Q8MA 3TKAA 1XRLA 3U16A 1DC8A 1A2OA 5JPDA 1ZJWA 1H9BA 2GCPA 4L51A 3WV5A 2PEYA 3BWDD 4MCIA 3PE4A 1SC1A 1I2ZA 4H6XA 4ZDJA 2X6TA 1Q84A 2D5CA 5DYGA 4RK6A 1W85B 4M0DA 4C04A 2H1HA 5K0CA 4D42A 2IYQA 3I23A 4BE7B 4PLCA 1PV4A 4P8RA 1UBOS 1U5BB 2QZJA 2XEDA 3R0IA 3IL2A 4KZKA 4JUDX 2B99A 5C8VA 3VPXA 2LVBA 4MLDA 3FTPA 4GGOA 1I9CA 4OYYA 1ZRNA 2JZCA 2HNAA 1QHEA 2XOKA 2ZTHA 1G2IA 4QT0A 1BOFA 1O58A 4Y6QA 2O20A 2FPUA 3DCJA 2N3ZA 3AETB 1J8DA 2QQEA 1P8JA 2DBRA 4ZO6A 2ZTLA 4CIXA 5KTMA 4EW1A 1PS8A 4GM4A 5KTKA 4INPA 3U7EB 4JVOA 3ASYA 1QYIA 1JR4A 1QH9A 2ENWA 4X3PA 3LKBA 5CTJA 4RYDA 4BLPA 5LMZA 1V4NA 2JLWA 3S1LA 1JF8A 1A97A 2EBFX 3LIIA 5ADVA 4A1FA 5D5QA 3AWIA 1KETA 3LRPA 1FNMA 5AM3A 4X6UA 3TB6A 3Q41A 4UJ3A 2DU8A 1RWVA 2ZYIA 5HDQA 1VJTA 3UENA 3I58A 1CC1S 2I1QA 4IKPA 1PNVA 1NVDA 1L7QA 1CRQA 2ZVJA 3ZWOA 2X86A 1RBMA 2GTIA 3SZUA 1PV1A 3SP1A 1LK0A 4INJA 5TY0A 4J9VA 3TRJA 4D0GA 4IV5A 5G02A 1RWMA 4R1MA 1YS4A 2I0FA 2ZATA 5DHQA 1IOVA 2R6DA 3E9EA 3SU8A 4DM3A 4EG1A 3VJRA 4XX0B 3CURA 3HY6A 1FF9A 4DCSA 3FOEC 5K0FA 1HG0A 1TEXA 2QF7A 4M1WA 4C3VA 4Q0MA 3KKPA 4H1WA 2CMGA 3FVTA 4JB0A 4I2NA 4RF5A 2O2GA 2X7HA 4G1MB 4UHBA 2W70A 5IZ4A 3T1QA 1OILA 1ADCA 1R7RA 1TXGA 2WHRA 2GBPA 4YB8A 4F4FA 3NONA 2BH2A 4AI6A 1ZGHA 1ZDMA 3KR1A 1N1GA 4H35A 3G8YA 3IV7A 3E9CA 4NY1A 3DMFA 5DBOA 1YBVA 2EFHB 2IEDA 2ODNA 3EEYA 4ONEA 4QJBA 3AFMA 3WDSA 4CMIA 2IHZA 4XOUA 2Z8YA 4MW6A 3WX0A 2ECOA 1QGZA 1H2BA 4I3FA 3VJKA 2XQVA 3H2KA 3X1ZA 2QUKA 1M6HA 4L76A 3IE0A 4HGZA 1T5IA 3EIHA 3NTLA 1K66A 4WIAA 3U80A 2DBQA 4ARBA 5L3VA 2LNDA 3OY2A 2VCEA 5L3ZA 5KWSA 1SHLA 3KELA 3C8UA 4RUKA 3KUXA 5MGBA 5ECGC 3SEAA 5C5EA 1FFAA 5AUPB 5JS6A 4FXOA 5C8YA 5LZ4A 2O8BB 3ZWQA 1QCDA 4A16A 5CA1A 4L4XA 1JIVA 1H1LB 1V11B 4U0KA 4C9BA 2Q3LA 3Q6IA 4WA7A 5G41A 2ODEA 1VPLA 1JYFA 2YRXA 1AZSC 1U31A 2RGCA 3H9GA 2FFJA 4LXYA 1WIWA 4A6PA 2OCPA 1BCSA 4EKIA 5KYXB 5I9TA 1QG0A 2HWXA 4H3VA 4WLFA 5FUVA 2GPJA 4W1RA 2JI7A 4KQKA 3QFTA 4PPGA 3WMFA 4ZI7A 3ZLJA 4WZBE 5HSGA 2JGDB 4KQJA 5KQPA 3HVKA 1PU2A 2BFFB 4YJHB 1RP1A 1GGJA 2CYBA 3PFCA 2W0MA 3F74A 4RC9A 3JARA 3QLUC 2QRMA 1FP7A 1NG9A 1RP7A 2X4DA 2BZGA 1G98A 2QN6A 1CKEA 3ND7A 4G5HA 3ZDDA 2ZITA 3GEHA 2YYAA 2QVLA 1B8PA 5GINE 3HHPA 1P5FA 3F2VA 2WWXA 4G5RA 1XTZA 4JQCA 1HLPA 2I34A 2C7PA 1N34B 4LOAA 1AKYA 2ZYAA 3T5DA 3ZDZB 4DMGA 5F2KA 4NYJR 5BW8A 3DHVA 4IJVA 1VLJA 4ZYVA 1JFVA 4G07A 1OE0A 3AR8A 3GA5A 1XXLA 4JJEA 2WP0A 3BJZA 4DGQA 3IRVA 1IEVA 4TKLA 4DJAA 5LP6A 3U31A 2W8BB 3IUQA 3E15A 3QKSB 5TPWA 1PNTA 4YTEA 4ON9A 1PGJA 1J0XO 1C1HA 1QRSA 2GAJA 3QI7A 5CA0B 2VVTA 3DUFB 3S6JA 4DV4B 5AQEA 1E2MA 2C3MA 4GM1A 2EERA 1Z35A 4ZQEA 2QRLA 3NB0A 4LYAA 2CDAA 3M5WA 2WEKA 4I1YA 3TMYA 3K5WA 5DF1A 4XPZA 3PA8A 2B61A 3G1WA 1FNCA 1CZRA 2PA0A 1I0ZA 3L7KA 5BNWA 2HC9A 2BGJA 2K87A 1DCFA 1JYSA 3UPTA 1LFDB 1MP0A 4V02A 3FUWA 3W9YA 3LP8A 3HFJA 2ACEA 3GNTA 3HNOA 3ZD9A 1ECPA 3LC1O 5EKDA 4MYSA 1Q44A 2MDTA 5GY7A 4BDSA 2LDBA 1IHPA 1ZK1A 1V35A 2VH5R 3FH0A 5H3HA 5T4HA 3GRAA 2QNRA 3L7DA 1NJGA 3PDIA 5MHTA 2ZJ5A 5A3QA 3UV6A 3SHQA 1EXDA 1P7ZA 3DFKA 5FUMA 5LQJA 3BHNA 1FBNA 1TA4A 4DNPA 3PJGA 3V8PA 2O59A 3AZOA 3AVYA 1NF8A 4HVLA 4JEMA 3R5SA 1MO4A 4YV1A 5JMOA 2IHJA 2AXPA 4OIMA 4OEHA 3ZVLA 2G7MC 2JIQA 4BIMA 4CR8A 3G8DA 3AUFA 4M8LA 4Z0PA 3WLOA 2CCJA 1QWOA 4MMXB 1E8NA 3KB1A 1ZD2P 4QOIA 1Z7EA 4W5OA 3CH5A 3LY8A 1DRWA 1QQ5A 2Q5FA 2VQ6A 1N7IA 4IRMA 1XZ8A 1Y6ZA 2NTYC 4PFSA 3NKFA 5F76A 3O8QB 3BE6A 1EWVA 5T64A 1II8A 2HFJA 2H5IA 3PG5A 4R01A 3TB4A 1AQNA 1PZGA 1YRWA 3B3AA 1L1EA 4GIBA 5SYMA 3UWOA 4KREA 4QREA 4KH0A 5LWQA 4I19A 3ESAA 4FR5A 3W5CA 4UAGA 4EB8A 4Q01A 2BDEA 2XA2A 3EFHA 3SLRA 2VL7A 1T0HB 2YIJA 4BFTA 2JCVA 4QU0A 2WG0A 1LW7A 1VSVA 2CMHA 2Z9DA 5CIQA 2AOWA 1XQ6A 6NULA 4TL7A 4F7WA 3S3TA 1KI9A 2VJKA 1QZXA 4L57A 4PCVA 5IC4A 1MFPA 4IVQA 1U2GC 1F1JA 5I45A 1HQKA 2AG5A 2D62A 3FDZB 3HSSA 3WLAA 1JAXA 4DMCA 3OG9A 1P1KA 1QRRA 3IVCA 4JI8B 3CC8A 2FMHA 5FWNA 3NWOA 4X7BA 1IH8A 4ZQGA 2CUKA 2I7VA 1CDDA 2J45A 3CO0S 3GA7A 3KR9A 2OSBA 3P9IA 5CMLA 4B3SB 3EOAI 1IZ9A 4HX2A 1J8MF 1YMUA 2HUNA 4NQZA 4UDNA 1MB0A 5DZSA 3NOVA 2OBXA 3CLUD 3FHJA 3UYKA 4MWOA 5IK2D 1TJYA 4GGMX 2XLBA 4DHEA 3FRJA 3EXFA 3VR2D 5IAOA 1KZ1A 2I8CA 2IIVA 2G4CA 1ZMBA 1YONA 2OCDA 3NBKA 3ZHSA 5FBQB 5CDGA 1PQWA 3NH9A 3SHTA 4C6TA 2ZS8A 3L79A 4PSCA 3ZKWA 1U8XX 5JISA 5ILOA 1O0CA 4R0MA 1M8GA 3UCXA 3ACBA 1G16A 4JLPA 4LQCA 2CFCA 3UTDA 3DR5A 4OF4A 3V9PA 3FWNA 5DTMA 5ICEA 4U7PB 2VHWA 1EP3B 1I10A 2VPXA 3GF4A 1M7GA 2WHPA 1ZXXA 5IXSA 1YA6A 5DHRA 1XD2A 1XDUA 4XKJA 2FRVA 1KAEA 2ZE7A 3RADC 4X20B 2AMJA 1NVBA 2WB2A 2BOVA 1Y9AA 3Q6NA 1GCIA 4MVYA 5GV8A 2I6TA 2C4MA 4RETA 1X77A 4GSLA 5AW4A 2ONZA 1GKLA 2J5KA 3B7GA 4BNYA 5TGTA 3OF5A 4UM9B 1JDVA 2JVJA 1Z8DA 2HWYA 5DMHA 3UN1A 1I7NA 1H9AA 3BTOA 3B60A 4UEQA 1DC4A 3VMMA 3ZI0A 4OQPA 1PWXA 2BW0A 1JQJC 2HA5A 5HZHA 4A92A 2J87A 1GAQA 3NX4A 1AHPA 3KWFA 2J30A 2PMDA 3CNEA 1QQ6A 2QP4A 2FPRA 4N47A 1PHRA 2WFLB 3VSAA 3ONVA 1YS1X 1CQWA 2B4KA 2AWOA 2FWNA 3LYHA 3FGZA 4CDMA 5C31A 2R4UA 2YZNA 5H4GA 4BXOA 3L8YA 4WFJA 2AZXA 3QHQA 3QWBA 4YXWA 7YASA 3UGJA 1JKIA 4ISBA 4W5NA 1CRZA 2HRZA 2WD9A 3AHEA 3IVGA 3V2IA 2VRCA 4FOSA 3GC6A 2G0NA 2HSDA 4D57A 1SCQA 1E58A 3GDGA 1L5GB 3O03A 4BBJA 3B2EA 1HKUA 4IOMA 3COWA 4LNAA 5DIFA 1KPIA 4HDMB 4FTWA 3FOFC 4AO6A 2HRDA 4EB6A 1GG9A 1U8YA 4II2A 3EWAA 4B4VA 3M1IA 1RQNA 1YK1A 2YZGA 5CLJA 1VSTA 4Q16A 2IU4A 4YA6A 1BGXT 1Z8HA 3FX2A 4X8MA 1BS2A 1KKMA 1S7CA 1QK4A 3OPYA 4OJQA 2B36A 4UNIA 3GFPA 3PQ4A 4D5EA 4H7EA 2F8SA 4KHPB 4IHKA 3W0LB 2NTNA 4GOLD 1U1EA 4BNNA 5LN1A 4M0UA 1FDSA 3VFDA 1JRLA 1A9PA 2XDWA 5EIFA 2FNAA 1YRYE 1GA1A 1G5PA 4KTTE 1XDDA 2XVZA 3A3KA 1FVFA 1E9BA 1H94A 1TRKA 2V8BA 3KWJA 3PE6A 4MUXA 3QMWA 3QBJA 3DBIA 5EVJA 4L22A 5F5NA 3RB8A 3MYYA 1K08A 2FPWA 4E51A 2PH1A 3WOVA 1SC3A 2AYZA 2M9MA 4JI2B 5MN5A 2WU1A 1W6UA 3D4OA 2YY5A 3OICA 1EVQA 5EGNA 5REQA 3DMTC 2ZIUB 4FD2A 3U7FB 1SUCA 4OBWA 1KYVA 3ZS9A 2ZI5A 2A3NA 4FFBB 2GD2A 4MQUA 2QAGB 4N6NA 3OM9A 1I1OA 3LI2A 4RPJA 5KYUA 1HNWB 2JHAA 1EFRA 2O14A 4AD8A 1EFAA 3RYFA 3TZLA 2VQEB 4CTJA 4V0SA 5C81A 3BDVA 3FNEA 2FK8A 4Y2RA 5ALJA 2EX4A 4KXYA 3KSUA 4NBRA 3SY8A 1QV6A 4NJMB 4BEWA 2EQAA 3D3WB 1RNLA 3A0RB 3F5QA 3HVJA 5COQA 4RSGA 1FDUA 4EJMA 3IIIA 4Z7NB 1VCNA 2WIDA 3Q7QA 1A2QA 4R0NA 1PBNA 1KOJA 3T0FA 4OHXA 1L3CA 3GGOA 3NAQA 1O6CA 5TJHA 3ZQJA 1Q0PA 1K8XB 3GH3A 2B2XA 4ZYZA 1PJAA 2HHAA 2CKDA 3TZ6A 1TZKA 3ND5A 3GFOA 2QBYA 3D81A 2BC9A 3AHIA 3RBAA 3WYBA 3CU5A 5BXYA 4JLJA 4Z8YA 4J0JA 2XT9A 1SM4A 2XB2A 2ZZKA 3AGPA 4MV0A 1WZEA 2HHLA 2DFLA 4GZ6A 5DM1A 4IMJB 2BFNA 1QMPA 2NIPA 3HMQA 2EEZA 1NFQA 3IULA 3PQ8A 4FC6A 4TKUA 5CM2Z 2EYUA 4DRZA 1DRKA 4C4XA 1ULZA 4Q1VA 2UUPA 1TU3A 1J22A 1YE3A 5DHSA 3KV3O 3K6RA 4LHZA 5H1YA 3TXAA 4MLCA 3BMNA 4WLVA 4OLAA 2FPIA 1VZ3A 4D3YA 4GQIA 4KSBA 5IKXA 1W6RA 2BEJA 4WJKB 2HB6A 4KRGA 4A8JA 3FUCA 3PYLA 1S4MA 4A2QA 4KQIA 4JL8A 1WEKA 4MLZA 1DIAA 3UUEA 5DM0A 1KP3A 3CVYA 2MOKA 1K4KA 1W76A 4EVRA 5CPBA 1JHPA 1N0UA 3RS9A 1J97A 4QBTA 2C5EA 1RZRA 1C0EA 3KYBA 3SD7A 3M9LA 5CW2A 4B6GA 1YI8A 2HMUA 1ISMA 2O50A 2FPXA 2QX8A 3DQQA 3GFTA 4G0UA 4JV5B 1IZYA 1Q7TA 2QKYA 3BWEA 1GRVA 3K9WA 2XCTB 3B85A 4IIDA 1RXWA 1M3SA 1MH1A 4RTLA 1WD7A 4JJIA 2A33A 2Z2YA 4G85A 3VH4A 4EF6A 3TTXA 4DB4A 5E6RA 2BH9A 1TYBE 2QA5A 1RYEA 5CT8A 5J9FA 2IBTA 1VL0A 2VAMA 1H0RA 2XJ9A 1E3QA 1HT2E 3HS3A 1SUAA 3AZPA 4I1VA 1X1EA 3PD7A 1W7AA 3DM5A 1UH5A 3REQB 2HR1A 3S1AB 2B1JA 4Q82A 3T7CA 1RYNA 4KFTA 1DB3A 4GH5A 5DGTA 1W52X 2VF4X 4H0CA 4BO1A 4DCMA 3TD6A 1A4RA 1U7WA 4JJZA 1OJ7A 3CLVA 3LPLA 5EXSA 1ISRA 3JSXA 3S2FA 4F5EA 3IHLA 4S2UA 4PPYA 1MJGA 2O5EA 5JSUA 3FAKA 5KINB 4D4KA 3V4LA 5KNDD 1OI4A 2YDXA 3QFSA 3IQFA 3GG9A 4KWEA 3INGA 1E0DA 1DEHA 3O0TA 5KHOC 4XQEA 5IZCA 4QPDA 1U0BB 2I4TA 4BNMA 3RLIA 3UOGA 2TMYA 4ZVRA 4R84A 1WMEA 3T1VA 2R00C 3H2JA 1WB4A 5J2TB 1JBKA 5T4FA 1VGQA 4RA6A 3V1NA 1E3WA 4CI0B 1EX6A 3K72B 2WSYB 5LIRA 2GZDA 4Y1RB 1NUAA 4X54A 2Y99A 1J33A 3W6NA 1OI3A 2IY8A 2UZAA 4N1AA 4PSKA 4M0EA 2XOEA 3U4DA 3R7AA 2ATCA 3O7MA 1P2BA 1T2CA 2QVGA 4A0SA 2QVXX 4MDEA 1G20B 3DDZX 4LY6A 3BPSA 1NA5A 2H4XA 2PKYX 1XHFA 2BRUC 1AK9A 2BMFA 3QXXA 4D80A 2C92A 4IFBA 3GQBB 3PQ3A 4C1BA 1AMNA 2GN4A 2RHHA 3EUWA 3I0NA 3BCUA 3WYEA 1RWPA 4BV3A 3NRCA 2F3RA 4IGFA 3VX4A 3WL7A 2GN0A 1ZKMA 2ZQ5A 4QYIA 1TT5A 4IILA 4P4LA 5HFNA 2VT7A 3RASA 1TQ6A 3IAAA 3RVQA 3UKDA 2WNIA 1UEXC 1D2NA 1HDXA 3UJHA 1E2GA 2G71A 3EGWA 1J90A 3LHSA 1KC3A 1UBMS 3CX4A 1TCUA 2QENA 4XAQA 5AIAA 1OY1A 2OCIA 1QFYA 4NWIA 3GEDA 4EG0A 5A03A 4CL0A 1EJBA 1C3OB 4WCFB 2PR7A 3H65A 3U7GA 1T3LA 2QG6A 2W6ID 2J3IA 1HPLA 1RRCA 1NP7A 5ERGB 1SIOA 2WTEA 1NR7A 1H9CA 4AB1A 1EVJA 3I39X 4RVSA 4R8LA 2DFTA 3JY6A 2QN3A 5E4FA 4HH0A 3U7QB 5K3BA 2WB4A 4JUFA 2NP7A 4IS2A 2E37A 3C4JA 4QWMA 5D6OA 3RM3A 4LYFA 4NECA 3H97A 4IAOA 4F5WA 3HB5X 4RCZA 5GOZA 4AKSA 4ND2A 2FY8A 1CNEA 3F71A 2N9UA 4CKWA 2NZWA 3PFHA 5I7WA 4NBTA 4BNFA 3H1TA 3ZV4A 5I8PA 1RQRA 1VJDA 4QU5A 5AK4A 5JAUA 4F6RB 1QLHA 4LZWA 3RT1A 2SKDA 1ECGA 4OHVA 4AY5A 5DSXA 5KNCA 1GDDA 2P8JA 2PZEA 1J49A 2ZU6A 4RH1A 5LYJA 4RKRA 3HGMA 1M8FA 4DSNA 2VT2A 2BFEB 4QL3A 3HCBA 1SKAA 5LDHA 3PT5A 2H4WA 3M9WA 1NMEA 1NBMA 5JFOA 5C1PA 5LIPA 3MCVA 4JVMA 1P77A 2NZXA 3LECA 1HZZA 2VUIB 5BWMA 4YMVA 4HDOB 3ZCQA 4RELA 3DB2A 4RGQA 4D4GA 1IY1A 3OHSX 5IYZB 4TOIA 1W36C 1E64A 1WUJS 2DC1A 3PE3A 3TZEA 9GPBA 1OPRA 3T7DA 2IV7A 3P9QA 1TPYA 1TE2A 3GEPA 3EFOB 1DRUA 3C6XA 3I3SR 5K3AA 4DT1B 2NU6A 5G3ZA 2NVWA 5G0UA 5MF6A 2Q2VA 2ZPAA 4YMSA 1FQJA 5SZKB 5T6MA 4N12A 4AF7A 1HRDA 1YZ3A 1DFGA 4M1TA 1WXDA 4DLNA 1LW6E 5ALOA 2X8JA 3EA5A 3EXG2 1Y3CE 3OLWA 3NUZA 4IDNA 4DCPA 4OFWA 1B1CA 1E6LA 2JAOA 1T4CB 3KU1A 5IBPA 2H07A 2EKLA 2OXEA 5FBHA 4NARA 1L7VC 2R751 3HA2A 5K8IA 5KTYA 4BL5A 4QEDA 4LTMA 1RHKA 5FNVF 3W5IA 2HADA 4EA7A 5KPJA 4NV0A 2CV0A 5EIHA 2R8ZA 4ZVMA 4ZVUA 3EMKA 6GPBA 2QM0A 1GFIA 4MGHA 4ZDIA 2P5SA 3GK3A 4KLZA 4TQAA 4EM6A 3WKBA 4Q03A 1YS9A 1QS0B 3T06B 1M1ZA 1PBTA 2QTNA 1D0VA 1IXSB 1E1CA 3UA4A 3CGGA 4QGGA 5EXXA 2PGOA 2HOQA 4XPIB 4A36A 2G77B 3TMKA 4HB0A 3Q8XB 1OPXA 3A1DA 1ZMRA 3ZBPA 1L7BA 2DWUA 4MAMA 2Q1UA 2C5GA 2WF5A 3OKPA 3V3TA 3MGBA 4V0LA 5G0TA 5D3MA 2II6A 3UJ8A 3G8CA 3C8ZA 1F2UB 5FAKA 4RTJA 1GLVA 1E18A 3L7LA 1BW9B 4UUMA 2Y0CA 2P35A 4DR3B 4FFNA 2BKEA 4Q66C 1W75A 1WUHS 3VA7A 4V3BA 1ZO8A 1D2EA 4JT9A 4CG1A 3JWHA 3AR9A 1JUDA 1HOXA 2R44A 1SKQA 1Z8NA 2WICA 3IOEA 3KYCB 4J0DA 4RM2A 3RS5A 4NAVA 4FJ1A 5KAMA 1TK2A 3HH8A 4M86A 4NJEA 4R41A 1OLSA 3E48A 1W88B 5F4ZA 4MR7A 3X44A 4YAGA 4W9MC 1R6DA 1DTWB 4O4JF 1MR3F 2Q6VA 3FW1A 3QG5A 3QE2A 3CX8A 4L07A 1PK7A 4BRZA 2FCRA 2P40A 3LUKA 1AQYA 2XF2A 2OGTA 5FWXB 3BE4A 2L0XA 5CCBA 4JBIA 4UEOA 2MSLA 4DLWA 1P2UA 3GGDA 2DCUA 3RUIA 3DS8A 1KMIY 2DGDA 4BLVA 3QBTA 2DFPA 5LUBA 1J0EA 1U4NA 3SXUB 4II3A 4DTIA 5DKFA 3HYNA 1ZGZA 2ZSHA 1U7DA 2PGAA 1ORHA 3VI3B 2ZUEA 4R0VA 4Q5IA 4PHFA 1YZGA 5CH3A 5U1PA 1C5KA 1ZIXA 1C7RA 2D8MA 4X1KA 1CUJA 4I5DA 3UK1A 3TTVA 1SBNE 1IM5A 2ZR8A 4NAHA 2RE8A 3TQQA 4M55A 2Z1NA 2DHDA 3L7BA 2EHDA 2W2KA 5JFTA 3U0VA 3WL8A 3DZGA 3FWKA 4MRVA 1SVMA 3EF0A 4EHDA 2MINB 3CUUA 2C9OA 5K0SA 1QQ7A 4BFZA 2Q0HA 4JCCA 1W46A 2P9CA 4LHVA 4B3BA 2X0KA 1DXHA 2QSZA 4KODA 3U9LA 4XVHA 1NXQA 1XYYA 3FBWA 3QENA 1MJFA 3OZFA 1YT5A 3SHWA 4R40A 1W47A 1FNSA 3LP5A 4ZYUA 3C2QA 5JAMA 4MRMB 2ZE6A 5JI2E 2C31A 4JKOA 2O3SA 1ZCZA 2EKBA 4ZVLA 1EBBA 4A9AA 4AJPA 4C4RA 3O8BA 3VKFA 3CPEA 4DQUA 3FZGA 4R1QA 5KOHA 3JX9A 1SC6A 3E9RA 4LQDA 3WOHA 5A1JA 2CK3D 2I6UA 2YIMA 3QRWA 4QKQA 1X7WA 3SIRA 4WZAE 3RR2A 4ZMRA 5DNDA 3SZLA 3N7UA 4JYBA 1QU3A 1P7VA 5CBPA 2MYUA 1JFTA 3QF4A 2J4FA 1EAMA 3MELA 4KCGA 4YJGA 2I3BA 1WHSB 3EDOA 1Z5NA 1FU8A 4LK3A 3SDZA 1V7PC 1M2EA 1JG3A 1INLA 1SKMA 4RCVA 1RWXA 3V8MA 2VKTA 1BE8A 1V1JA 4II7A 4UU7A 1G6HA 4Q12A 4S1OA 2ZCJA 1K6JA 3Q7SA 1NBWB 5HOEA 4BVGA 1W4CA 2R1UA 3I73A 4NK5A 1MD9A 3QJYA 2GD1O 2BWJA 5DTJA 1FMJA 5JD3A 2GEDA 2XBLA 2YR0A 2JJ8A 4FLMA 1HWYA 4WKPA 2ZBGA 5K3CA 4IP0A 4MVJH 1FA9A 5EQJB 4D56A 3HTXA 3KT8A 3TZQA 3EMDA 1U9IC 1U8ZA 4I6GA 4UNQA 2ZSBA 3C3XA 5NLLA 5K6AA 3IVAA 4FKZA 1DDGA 4HLNA 1C30A 1EFUA 1KH3A 3BWBA 1FBTA 3HLKA 4J4BA 1QSGA 1VDMA 1LU9A 4NENA 5KKNB 1O6GA 1KU0A 3W2HA 3R41A 2HA7A 2R8RA 2IP4A 5JIBA 1FXWA 1WPXA 1WB9A 1S89A 4NF2A 2VAPA 2C4WA 4G37A 3U3ZA 1DIOB 1UKCA 2WUEA 4RU1A 1CUUA 3KZVA 5B7NA 5CG1A 3HYTA 2JHPA 5C52B 2QEQA 4OJYA 1Y3DE 3LDAA 4RPCA 5IK2A 1POWA 1YDMA 3D6HA 3WISA 3VR2A 4KRFA 3ZKAA 2IA5A 4HN4B 3TLEA 1F7VA 5FP0A 3VU9A 4YCNA 2JKVA 3LG2A 3CR7A 4KFRA 1E1RD 2HJHA 3RD5A 4RZQA 4Q3NA 2P2ZA 4W9RA 3UMBA 3OE7D 1UFKA 4BNVA 4TSRA 1OC2A 3WMGA 1A2KC 1TU4A 1GDHA 3BWYA 3TLGB 2VXYA 4HQFA 2GT1A 2DX7A 4NVRA 3IODA 3OQHA 4E2XA 2FW0A 2FXVA 3K4QA 2QZPA 4H7IA 5G1OA 4Q9HA 2TMDA 3ZCPA 2SCUA 3AFNA 4J3NA 1DI0A 4H7KA 5AVKA 5JW6A 2OL4A 4DXDA 4W7HA 4CMHA 1M2GA 2G5GX 2WT9A 3HN6A 4O4IF 2VOEA 5HRCA 1NSFA 1TFRA 2WJ3A 1E79D 4NI5A 5AM4A 4ARCA 1CQIA 2BUCA 4YJ2B 4B44A 3EAGA 3M5PA 3I04A 2WVAA 5AW1A 3WK8A 1GPLA 3HJCA 2B94A 1LSSA 5ADHA 4D4LA 5IM4A 3LZCA 5K3FB 5EIBC 4DILA 4BO3A 1PFYA 5SZJA 4WNCA 3RJ5A 4MK4A 1HSOA 2ESRA 2RGDA 2ZBFA 2R7AA 2YXBA 3KR0A 1MAWA 1JDPA 1PEYA 3PVCA 4L75A 1BJTA 3VYRB 4AICA 3SSNA 1R0SA 4QDXA 3W9SA 4FNGA 5LSAA 1BE0A 2ETVA 4XB6B 5ARDA 1Y8CA 1RTTA 3FVWA 4JC4A 3OE4A 5KYYB 4OLBA 5GZ1A 3CR3C 3WB2A 2AUMA 2MSNA 3AM3A 5CLQA 1UANA 1HDOA 1ODCA 1QTIA 2ZVDA 5DI3A 3Q40A 3SN6A 1WPQA 5DM60 2VLIA 1ZN7A 1YQGA 2PGDA 2FDCA 4Z9FA 3KXLA 3R9XB 3GRCA 2JH8A 2EJWA 3GLRA 3IJRA 3TNDA 2P6OA 2H11A 3KOMA 4EO9A 3OHPA 3C3AA 1U8EA 4TMWA 4JXZA 2ZTSA 4J1NA 3ST7A 3UW3A 1QPZA 2ODTX 1KZ4A 5HKOA 5K0TA 2I1WA 1M2NA 2ZJ2A 3NV9A 4Y2QA 1XALA 3Q8LA 4I1SA 4TRJA 5B2FA 1C7JA 2VAVA 3S8EA 3U7RA 3TTYA 1SO8A 4XDYA 4B8ZA 4F85A 3ZQ4A 1UK6A 1RPTA 2A5FA 2XB8A 4BKOA 2NT3A 4CF7A 5J23A 3SGLA 2QRQA 1Q7BA 4HY3A 4KXWA 4MS1A 5EHGA 1ZUNB 4W1QA 3L06A 1NUHA 1HEIA 5B7QA 1WX1A 1YJAA 2YXNA 1Q1AA 2FVYA 2QY6A 3CA8A 3N28A 1RXYA 4ME6A 1VL8A 2ARKA 4OL9A 2BE9A 2G36A 3VHRA 2B5VA 3G6WA 2PUBA 4E7PA 2QR2A 3MCUA 1OXMA 5LUAA 4JA0A 4QUKA 4R5HA 1PDOA 3OZEA 1MNQA 4N5MA 3WMWA 3FWPA 2D2EA 1PZXA 3AERA 4PBSA 1GTMA 1J2EA 2FW6A 1CVRA 2Y9MB 3C6YA 3L1IA 3VR4D 5JI3E 4JJAA 2X9GA 1TMYA 4EG5A 1GT6A 1NC1A 1HDIA 1DBWA 1PSZA 1XL0A 2JVKA 4G1VA 4U39A 1ODLA 1SKYE 4K0RA 4NLLA 4ZRNA 3FPKA 4GPAA 4BN0A 4DG9A 1YB6A 3ANMA 4RTNA 1X74A 3TX2A 1KJJA 3MHPA 3VPAA 3NVKI 1SC9A 2GYYA 5DNWA 1N33B 3B3QA 3VPBA 4KDEA 2OHVA 2CBZA 3KQYA 4I8DA 1QR2A 1R3UA 5HCUA 3B3FA 3HPQA 3SHVA 3UTCA 4J1TA 4Q7JB 1II0A 3WGUA 1MIHA 3ZY5A 4MVJE 1AURA 4DA6A 3KQUA 4B3MB 3MXTA 4CLRB 3BIWA 1ZVQA 2YN2A 3R9IA 4DLRA 2JB9A 3G0CA 2IT1A 3PS9A 4HH1A 1FFXB 1I3NA 2Y77A 4YRKA 2VQ3A 3FPFA 5AW9A 2Y2UA 3O0DA 1DAMA 1FUEA 5C1BA 4REQB 2ON6A 2XW6A 4TMTA 2H57A 3KQHA 2A59A 1QIFA 3IT3A 3FTCA 3I2YX 5HILA 4NE7A 3SNHA 3ESRA 3IIKA 2B1QA 2GSWA 3O26A 4HDKB 3C5EA 2J0UB 2ZT7A 3PU6A 1E2IA 1MB4A 4XYBA 5EZYF 4AG5A 1A8UA 1K6XA 4H77A 2H7CA 1XGKA 6Q21A 3ZE6A 1IONA 4URHA 2ECFA 2OTCA 3DZDA 1TKCA 4P2BA 4M6WB 4LJKA 3WL6A 3TEJA 1Y6RA 5F2OA 1VKZA 3G17A 1E5VA 3QVGA 1DAOA 2G28A 3H2IA 5KNBH 4HR7A 2CNDA 4IBOA 2DPGA 1FTGA 1KIAA 2XWPA 3CY6A 3OZBA 3PPWA 4I55A 2PHZA 3FSEA 4YCJA 2H7YA 5JJIA 2I99A 1GPBA 5I9BA 3DFUA 3VBEA 2VUHB 4NYIR 1L5YA 5TB5A 3PUJA 3U26A 5HKKD 2P2GA 1S8AA 4BRSA 2YWCA 3EWIA 3LUJA 3JTEA 4OD0A 1Z36A 3V4FA 3O90A 2I29A 3N5KA 3RVDA 1YZQA 1GIAA 4UHDA 4BQEA 4EF4A 2X7JA 3H0CA 2NPFA 3K9FC 1AOXA 1EFHA 1G6KA 2EQBA 4BTVA 3EQ7A 2WHQA 1XQXA 4W7IA 4E13A 3R3HA 3EPHA 4JDUA 1DARA 2LV8A 3JASB 2OV3A 3OIGA 4K5QA 4DCJA 1P4RA 4QZVA 1GKKA 2VP6A 1L1QA 4UTZA 2VHJA 3ZDXB 1M34B 3H8SA 3X1DA 4WDRA 2Z5FA 4FLEA 2OC4A 1GNTA 1JR6A 2Q27A 1Z6YA 3OCWA 5AVXA 3OLQA 4YJ3A 1GTG1 3R6GA 1XF1A 4R2WA 2W98A 2PXCA 4QDTA 4LGYA 4QWWA 4XWWA 5A0VA 1QFMA 5EPUA 4QG7A 2J59A 3ZIUA 3GXBA 4PCLA 1NLMA 3S2UA 3ITDA 3U62A 5I7RA 4BU0A 1D5CA 3IERA 1VJGA 1ZK3A 4YRZA 1RRVA 2YHIB 4A6XA 4CDGA 2HFKA 3AM1A 6REQB 4QOSA 4FYXA 1RZUA 1Q12A 2Z5GA 5KYNA 4M9CA 1T5DX 2BT4A 4YLYA 3N8IA 5KNDA 2HK8A 2WSBA 5T7BA 3KVRA 1YJQA 1EGQA 5IJXA 5K45A 3I09A 1DQYA 1GCUA 4HEA1 4QOHA 4XGKA 3JS5A 4RD1A 3MAJA 4UU8A 1TGYA 3GCZA 4B43A 1PLJA 3CLRD 2R65A 1EZ4A 4QM7A 5M2QA 2WI8A 1I3LA 3R8XA 4EGSA 2H5JA 4E0BA 1Y5MA 4I14A 3HJRA 4J7CA 1FRFS 1R0KA 2P27A 1L5HA 3C3PA 4PZ0A 3AJ9A 1UKBA 3PZBA 1PNOA 2ODQA 3GY0A 4LRQA 1WUKS 4B84A 4F5DA 1EGMB 4J0FA 1FFBA 2PKQP 2RAVA 2QTBA 3O95A 1U3CA 4GRIA 4TKMA 4IZIA 4UAVA 4BZXA 3A6HA 1MOZA 2GWHA 2WWWA 4BMCA 1NXXA 5BSHA 1FU4A 4RVFA 5C37A 4G0WA 2VSYA 2AG1A 2K4MA 3R6DA 3CUKA 2VF2A 3W8NA 4I50F 1L5SA 1FU7A 2FSSA 1JV2B 1SEPA 1KBOA 1ADYA 1JHAA 1SHKA 4O8CA 2VZ0A 1G1AA 1SHZA 1E2HA 1TMGE 3C3WA 3RVRA 5CLHA 1AGXA 1LBHA 4Z3KA 2AI3A 2C9MA 2VNHA 4V24A 5KQSA 2BMDA 4G25A 4GI2A 4LF5B 1JU9A 2VK2A 1IHDA 1XEXA 1H42A 2FKNA 3AUYA 5GAJA 1KSHA 4YRPA 1D8AA 1XZFA 4LV8B 2W6IA 3RK1A 1B73A 5JCZA 1SZCA 2VSNA 4IMPA 4G67A 3TOVA 3U19A 2I2BA 4CF5A 3QSYA 1W0KD 2FWAA 5AYVA 5DK6A 4DKJA 1ORRA 4KFCA 3KD2A 4NG4A 5DGHA 5E0OA 3RC9A 1DNPA 1DEXA 3H9JA 1KEEA 4J3JA 1WO8A 2GRJA 1UT6A 3LJKA 4LHEA 4PO9A 1AD2A 4DQXA 3GHHA 4IOKA 1EFVA 2RH4A 2PPVA 4BWYA 5BNTA 2ZUCA 1EBUA 1H2ZA 2LUOA 2VPTA 3LKVA 4W8GA 1QCCA 1ZICA 3UXEA 1NI4A 4C4ZA 3ROXA 1DE0A 3TOCA 2WWYA 2XMQA 1GYQA 3BSFA 5ECDA 5BSKA 4KBYA 5IUKC 4YI3A 2X6QA 3UMFA 1A71A 3E7PA 4AJNA 4PBTA 4XA8A 1Q0HA 4PNPA 4R8SA 2H0RA 3OZSA 4ALKA 3E3AA 3VZQA 1SQSA 3ZG6A 1L2TA 2FX5A 4Q02A 2HEIA 3QNMA 4Y67A 4OJNA 1VYVA 4PGHA 1QGOA 3Q87B 2AJCA 2GPYA 3W1EA 1VBNA 2PRJA 2WRZA 1YQXA 3WO0A 1KTVA 1P5ZB 4NH0A 3D1JA 3PNKA 1B6GA 3UKJA 4EY8A 1P72A 2BKXA 5I51A 3QA3E 1E92A 4OUKX 3KL2A 1Y8RA 4X1YA 2IYZA 3AB3A 4O0LA 1BS9A 4LX8A 1RM3A 4ID3A 1CVLA 2V7PA 3DDWA 1YZHA 3BD9A 4UVGA 2ZJZA 4OH7A 4F2WA 2HO5A 4MW0A 4OO3A 5HXAA 4TSFD 5K2MA 4QQNA 1DAEA 2BEWA 4WE3A 1M6WA 3VZRA 5E4TA 5K0EA 1NVMB 1FP2A 4RVUA 4BGVA 4UQOA 4DLBA 1FRQA 5ALXA 3H2SA 3K8YA 4HSGA 1MUUA 3C3MA 3IT1A 3ZHRA 3NEAA 1L4YA 2HJVA 1F60A 1P1BA 4A0HA 4H18A 3F96A 3GDOA 3OPVA 4O08A 2OXCA 2FZLA 3ZLUA 1RYBA 3L05A 3X2EA 1UR5A 3I42A 1E59A 4V0NA 1C1DA 1U6IA 1W94A 1RLTA 1Z2AA 2CVQA 1TW2A 4HXEB 4BP8A 5I7SA 3T9AA 5JVDF 5FLXA 2H4JA 5M5BA 4Y98A 3GUYA 3FFBA 3IDSA 1GVHA 5ALTA 2BFDA 4HCJA 3RSLA 3UOWA 5BW4A 1GPJA 1QRDA 5I7UA 1J20A 1P6QA 3Q2KA 1P60A 5HBRA 3X2SA 4RA9A 3WYDA 1XTQA 4GHWA 1V16A 2R79A 3KB8A 3BHIA 4L8YA 4P81A 1EVLA 4WN9A 1NU8A 4CETA 4I1PA 4U63A 2ZAGA 5EFZA 3EIEA 2UDPA 2QLFA 3COZA 3EQ9A 2D1RA 5JXIA 1N2EA 1QIIA 2GO1A 3ZXYA 5H3LA 1GZ5A 4K9LA 3K5HA 1YQWA 1LWOA 4KZPA 1MORA 4G5FA 2XUQA 1AA6A 1QGAA 3WB9A 3QBVA 2O4UX 4UJ5A 3FMFA 1DUVG 1RKQA 2IC5A 3Q2IA 4AKTA 2ABWA 2GB4A 3BL8A 1JE0A 2IUTA 3F1KA 4YWJA 3I2KA 3B8EA 5KDDA 1KHHA 2AOUB 3T3IA 1NATA 3BSWA 2YVQA 4BMNA 3LBHA 1QG6A 3F3KA 1K5DA 4TLAA 4AVYA 1J5EB 4IWXA 5JJLA 2ZJOA 2EHJA 4E5YA 3P71T 1SH7A 2A14A 4Q4CA 2IYWA 2Z04A 4GOKA 5HE9A 3Q0EA 4CMIB 2O1EA 2H3EA 1DP4A 2VC2B 1Y4UA 5HBGA 3PNBA 4JBLA 3NWEA 3LOPA 3OURA 3U44B 1X86B 1AN9A 5KQMA 1Q0QA 1XMIA 4X71A 5EIAA 3NTXA 4CEHB 1Y1QA 3F97A 3OBBA 3II6X 3H5LA 4CKBB 1FFEA 5C8YB 3T9CA 2XNHA 3IURA 3T54A 3IBFA 2HL6A 2XE8A 2E89A 2V4UA 3UBMA 1ODJA 2Q3EA 2H17A 4UCWA 1EG2A 1UDCA 4YMWA 4FWBA 5L8VA 4IW3B 1X42A 5FORA 3PHJA 2OOSA 5JDCA 5KWIA 1BCSB 3HZOA 4ACAA 1PR6A 2YXEA 4ZQHA 3F3YA 4LPKA 1AB5A 3STTA 3HADA 4UVHA 4ZI7B 2PLWA 4E88A 5TF0A 2RKOA 5A62A 2XSZD 3Q8KA 1DJMA 1Z74A 2VXBA 1URPA 4EIWA 5F4BA 1D09A 3PEFA 4H17A 4J0GA 5LXTA 4KIFA 4FB4A 5PGMA 1PJBA 2FI1A 3JARB 3DWFA 1SXJC 7MHTA 3OQ1A 4LOLA 2G7ZA 2GN8A 4Z2YA 3DG9A 3UK6A 1T3ZA 5EMKA 3KDSE 3PJDA 1ZM7A 1UKYA 1WTAA 2B37A 2ZK7A 4HAOA 2F3UA 1HETA 1F0PA 2CDNA 1MU0A 1AHNA 4MUGA 3MERA 3T4EA 4OQ4A 4EGAA 3LGSA 4MPRA 4OJMX 4WLNA 4WLOA 3D8HA 3UIEA 4HB3A 4B3HA 3EVDA 1GAXA 3GYGA 1D6NA 2IRWA 1BFUA 3TTUA 4ZEWA 2CK3A 2JVIA 3TW8B 1FYXA 1GN9A 1CYEA 2QTLA 5G0VA 2YJ5A 5LP6B 2QM3A 2JIMA 1MXFA 4CTNA 5TPWB 4DOMA 1SRQA 3IBSA 3VH2A 4KHZA 1QP4A 4E2ZA 3KXPA 4Y6OA 1Z68A 3ZHUA 5LCXA 2JCGA 3OHMA 4I6JA 1HQDA 2C99A 1CDZA 3SICE 2H2WA 5AQ1A 1IXYA 1ZC3A 1HLDA 3M1AA 5LDGA 3WXBA 4UBNA 5MDHA 5AW8A 4MHTA 1MN6A 1XVVA 4KXVA 1A1VA 3DEJA 3JQQA 3RIMA 1KKUA 4IVPA 3FPCA 3W6PA 1MJHA 3H9BA 3NCTA 5KSWB 1Z5VA 3GWZA 2O6HA 4K2AA 4MWGA 3WGZA 3GLIB 2IPNA 2RHRA 1JQ3A 3EA0A 1RC0A 4V38A 4HT3B 1OGIA 3SC6A 1FVHA 3HXLA 4BO7A 5BP7A 3DE6X 2GEFA 5IKEA 4OKNA 1VE1A 4L9RA 4OB8A 1UJ4A 3TS1A 1TRHA 1PGPA 2A3RA 2J7KA 2CL0X 3DV0A 1A9RA 4G5QA 4M99A 1DKPA 1B4DA 2IXFA 3QA9A 4A5OA 2JFOA 1M1YE 1KDOA 1T4GA 3CLSD 5IHPA 2R5FA 4B7UA 3N2GA 1M83A 2GLUA 5LL6P 3FYCA 3HJAA 3L04A 4LHWA 4UU0A 2F00A 1TTTA 2FZ4A 2DFKB 2Q5IA 1A4IA 3BTVA 1JHXA 1YR2A 3C8HA 3CVXA 2J1LA 3A37A 3PJRA 3BF7A 4G8BA 4DJFC 3T99A 4XDGA 4AU1A 3ZE9A 3D6VA 2IUEA 1QVZA 2VYVD 3OE7A 2I2DA 2BEVA 2NN3C 2G0TA 5D1HA 1ENYA 4RMHA 5E9WA 5G1NA 3NFYA 1VL2A 2F1RA 2F3QA 2X5JO 3OJCA 1V4BA 1P45A 2A9QA 2FWIA 2GQ0A 1K98A 3L0BA 4ND7A 1IWOA 4C78A 4WOJA 4DDMA 1WPGA 3WGOA 3DP9A 1K5HA 1BU5A 5J2UF 1DBVO 2OQ2A 2JFNA 2KW5A 3HU1A 2R8EA 3CJQA 4IO1A 1NVTA 3ZI7A 4DEXA 5B12A 3D59A 3OOYA 1KQ3A 1UWKA 2V7GA 4HD8A 4PBRA 4DXHA 4QXPA 4AF8A 1M2VA 4XYMA 1E79A 1JJIA 2F17A 4MQEA 1OA0A 2J3LA 4P7FA 1NF3A 5FJIA 5LA6A 2QJOA 1DWOA 2FR8A 2DWCA 4GUDA 4UULA 3NRJA 3LNTA 2YWHA 4IH1A 4DKXA 4ZJUA 1C1YA 1JHZA 3IPAA 4AG3A 4B7AA 5KJCA 2FEWB 2O2HA 2XTAA 3ANNA 1TQ4A 1E69A 2C95A 3NLLA 3GJQA 1UIMA 4ZCPA 3I9FA 2AB0A 4IICA 3R0XA 5IMBA 4P0QB 4BVHA 3Q6MA 2KX7A 3FKQA 4BTLA 1O5IA 3P8ZA 3AVXA 1NW8A 2I3DA 5EWJA 5JZMA 2Q4EA 3TGLA 2VEOA 3GROA 4ZJPA 2ZRJA 4HXFB 3FMIA 4A8TA 5LWHA 1KORA 4C6TB 2V9CA 2Q7OE 4WBNA 1D4AA 2EAUA 3ZKWB 2G88A 3BCRA 1KFBB 5BNZA 3GJ8A 2JH3A 2VBGA 3RK4A 2XKAA 4Q9JA 1KO1A 2FZ5A 2DTDA 3E9YA 1O97C 4OXIA 4PR0A 2ZR0A 1PDVA 3WLIA 4XQGA 4P3PA 1CUVA 5CCEA 4P98A 2O8FB 4BVBA 3GPLA 1XD2B 4GXTA 4TZ0A 1PG5A 2UXDB 1BVYF 1CUWA 1EMDA 1XDWA 1NE7A 3MT0A 3NV7A 1TLFA 1D1SA 3F47A 3GBPA 5G4LA 3TTSA 1L6RA 1P4HA 2Z1DA 5HFAA 2PY6A 1VMIA 1NI5A 1IXRC 4ZAGA 5CNMA 2HMAA 3KZCA 1PZHA 1Z13A 1MRZA 4NDNE 3EUFA 2P2SA 2PU5A 2UKDA 2C42A 1F2DA 1XP5A 4QYXA 3A9UA 3FSGD 1XTPA 5GJCA 2B82A 2NO1A 2OD2A 4FP9A 4JMLA 1T15A 3FWHA 1Y6QA 1AZLA 3PTLA 4QNMA 2HBZA 1I1NA 2B0CA 2FG6C 4PC1A 3FPEA 4PZCA 4WWHA 1DV1A 3NZEA 2G25A 1M73E 3ZU6A 8LDHA 2UV8A 3BYZA 1MB2A 3F8WA 3IQXA 5EPEA 3T7EA 1NYQA 4HWTA 2ZCVA 3RREA 3ZCXA 2X4GA 1HTTA 4KWIA 1K7EB 4U7TB 1N32B 1ENZA 3C0KA 3FKJA 1IUOA 2IZ5A 1L4FA 4GMXA 4V0RA 2D1YA 2WHEA 3KZKA 4LMAA 5GMOA 2O8VA 5CIYA 1E2UA 1L5FA 4V03A 2C1XA 5HF8A 1ZM9A 5KKCA 4XEUA 4DPLA 4R71A 4LHSA 4ENSA 2NO5A 4G1BA 4PTYA 4QTUB 2XY4A 4P08A 4PN7A 1E20A 2V58A 4JT4A 3I6BA 1Z0IA 1P44A 1OBFO 3OX3A 1CY6A 1BIFA 2XAAA 4HGRA 4NR0A 5JCJD 1EIWA 4TMXA 2XZOA 4EB6B 3OJFA 4ZT5A 3HXPA 3A4TA 3I5XA 4D6YA 3VC7A 3W2GA 3OMWA 5A5EA 3L6RA 3CX3A 5L40A 3JYNA 1E1QD 3CZPA 5LC1A 1CP2A 4A1OA 2IOFK 3VYTB 2O7NA 4H7JA 2FV8A 1JA9A 3FYDA 1UOQA 4AECA 1EJ2A 3RU3A 1GPNA 2NXCA 3HXKA 1QIDA 2VJPA 3KAKA 2WSIA 4XJVA 3UANA 1H6DA 1FIUA 2AC2A 5HWSA 3FY4A 2AHOA 4UBLA 5DYNA 2YWJA 5KWJA 2WU0A 4B9AA 3Q5GA 2RHMA 2WTMA 4JBHA 4TV9F 4PC2A 4YS6A 1N92A 2V98A 3K96A 4GWGA 1SRRA 2CVOA 3N3AC 4HH4A 2Z6QA 2EZTA 3RF6A 2X58A 1RYFA 3PTZA 2IZOA 1BCRA 1P91A 5CYOA 3H75A 4DQLA 4UHKA 4M7PA 2Q4OA 2HMVA 4UVIA 4XWKA 5JWOA 3M8KA 3WIOA 1V1MA 2FZWA 2J9XB 2R97A 3MQ4A 3NDIA 1TKRA 4YDSA 3AF4A 3LV8A 1QPGA 3GOHA 1JFRA 1PQPA 1T2NA 4C0XA 2A9RA 4NOKA 2ZWPA 3TCKA 9ATCA 2I6XA 2X8WA 3RYFB 2H2HA 3GCWA 4DMKA 4EY3A 2ZWAA 1T4BA 2PZ8A 4FNOA 5TMEA 2VBFA 2KB0A 1G3QA 1XTIA 4GNRA 1C9NA 1FP4A 4HNSA 2E3JA 4Y0VA 3MGKA 2GR9A 1JU4A 2ZUUA 3O74A 4BYGA 3MAGA 1WXXA 4O29A 3T5GA 5I9NA 4D0LB 4M38A 5AJTA 3KT0A 3KLPX 1U98A 2G63A 4A26A 1NN1A 3LA8A 1DADA 3C3KA 3NRBA 4XWYA 4BEBA 4BCDA 4EO4A 2NV2B 2WJ6A 3DEIA 6AT1A 3N05A 1HQYE 4HK4A 3FZEA 1N7JA 3ABZA 4M89A 2H2FA 4WINA 2PUWA 3UAYA 5J4VA 3NNDA 2NXJA 4FN5A 4ZXPA 2QBYB 2BCEA 2MTBA 1NMQA 1MB3A 2GGSA 2Q7DA 3PRJA 3OQMA 4G24A 3V1KA 4GF5A 1A9SA 2V0NA 2WU8A 1U1IA 3RFCA 2QVCA 4CM9D 5LQMA 3VPSA 4TYQA 4QAQA 1GOTA 8ABPA 3KYDA 4ETMA 1PT5A 1JDBB 2JDID 3FI9A 3RJMA 4BE4A 1NQXA 1WD5A 3FROA 3MTBA 1PP4A 1KTIA 5EJIA 3BMNB 5EZ6B 3UOAB 2FPIB 3VO8A 4EQ6A 4ZYXA 1KJZA 4GP6A 1ONOA 5UKDA 3DPUA 3HSYA 3N7AA 1AZWA 2C3OA 3TLMA 1HL3A 3G2LA 4CM4A 4A8JB 5CFOA 3UZUA 3WFJA 4G5GA 3PQDA 3U2QA 3WTCA 1JI0A 3C43A 3QV1A 2ZBVA 5DEIA 1HEUA 2FQQA 3DTTA 1GLGA 4QQRA 5FUQA 1HM5A 3H42B 2O5CA 2FUNB 4GPIB 5DM2A 2FP4B 1GTL1 3OU7A 5EJMA 4CRWB 1N6RA 2QQ0A 3SWWA 4KPEC 3FI0A 2BFMA 4ND4A 1SJ9A 5K09A 5IAKA 2OHJA 1LI7A 3N8KA 1O6BA 3PUZA 4LI0A 4UVEA 4K28A 3RK0A 1C9KA 1KAGA 4OGLA 4EYGA 5IN5A 4EJSC 3ER8A 1B76A 1YBAA 4JUCA 3I83A 2RDMA 5FUWA 2NADA 2XUDA 3IKTA 4N41A 3K70B 1CZKA 1LFAA 1N6IA 5BVHA 3NIDB 4CIBA 1GAEO 5E6RB 4YACA 3HV0A 3PC6A 2XNCA 3D5TA 1GTZA 4DCOA 4X6XA 1FPQA 4KMRA 3VQTA 4CEHA 1JLMA 2ZS7A 2JI9A 3T34A 4F3RA 3QQ5A 4R9RA 5K9ZA 1EA7A 2FN4A 3Q8WA 1ATIA 4U6SA 5AVSA 2OV1A 2LIVA 2XB6A 3FYUC 1NM5A 2ZJBA 3ZDYB 4EZBA 5IWAB 4TXJA 2AYYA 3CUSA 2PUEA 1FLAA 2XE6A 3CZ5A 3NATA 4HUTA 4FSHA 1BKDR 2K5UA 2YFHA 4DJTA 2M1XA 4LJSA 2C58A 1JL3A 1YR1A 1I80A 2BGLA 4FIZA 2VYQA 4NV3A 1QYXA 1VLMA 3GCGA 3QITA 4UU1A 2ZROA 2FUG1 2RC5A 3LW8A 1WG8A 3WNBA 3PITA 3UAGA 5FO0A 1O95D 1DBIA 3AM4A 3N39C 4PZEA 2XYVA 4B8YA 4W5QA 1CUZA 3DB1A 2N1MA 3LP6A 1ORTA 1E3WB 1M2HA 4RA6B 1I14A 1T36A 2Q8PA 2QRPA 4XD2A 3G2NA 3PD0A 2LTAA 3TZKA 4R81A 1ABBA 4BY9E 1JHRA 3GLHA 3FHCB 1C7FA 3G5TA 3ZWWA 3OJWA 4H4DA 3U61B 2E87A 2H2AA 2ZSUA 3I6IA 2YWXA 3IAM6 1XZLA 3CVJA 2EKZA 1T2UA 1TLTA 2POCA 2PX0A 1SD2A 2IPLA 3G82C 1T29A 2W2LD 3M6FA 4ZVTA 3I8OA 5FWDA 5A6SA 4C4YA 1V7CA 2V74B 1GA4A 3Q7EA 3EG9A 1EAYA 1VXRA 1T9CA 2PXHA 3VBCA 1F8FA 4RQUA 1SCBA 4R7ZA 5IC6A 5AVJA 1HE1C 1J1IA 4YRFA 1T8RA 2WWHA 4QYIB 3L5KA 1GRQA 4E22A 3ROFA 3F7MA 2JK1A 2VSQA 1GZ3A 1P7PA 2J6CA 1QNLA 3P5SA 1KAQA 3ENZA 2IEIA 3DEFA 3PWZA 2GEJA 4OB7A 3PHHA 1W4RA 5K4HA 1T0UA 3EQZA 3LDUA 3P94A 3IEKA 4NZZA 4DQ0A 1VKRA 3DF7A 3H19A 2OGUA 3VNBA 3PFFA 4TV8F 4CV3A 5EP1A 4UTRA 1JDZA 4QD3A 3A1SA 5BW5A 4KL8S 1TYEB 3WGJA 3DL7A 4CTOA 4M7RA 4MP3A 2WNHA 2RCYA 3HNRA 7REQB 3N2NA 2D1QA 2BZSA 1EWRA 2W42A 4K0KB 4MWZA 2F9MA 2WLTA 1NDUA 3ORYA 4W4TA 4E32A 1T9BA 2XDYA 2ZREA 3LGAA 3LUPA 3Q72A 5M34A 2O19A 1I32A 2EDCA 1SR8A 3UAOA 5KWEA 4OHCA 4AJ4A 3TOZA 4O63O 4EF5A 5B6JA 1RJWA 2QJRA 4YX9A 1XLVA 1L8OA 5KAPA 2OQVA 4M0MA 1QQAA 1OWOA 2P2YA 5KIAA 4RJTA 4DREA 5IM5A 5TS3A 1WLYA 3U09A 1FDIA 4DUYB 3C85A 2Q4RA 2WWFA 4NICA 4PRLA 1QXSA 1Z28A 3CNOA 4H0NA 3TIGA 2VHYA 4EHKA 2DTEA 1DS6A 3P2MA 5FDFA 2H51A 5EE9A 3DLIA 4RLHA 3DWGA 2Y1GA 1ZMTA 3HA5A 3FETA 4PWYA 4DG8A 5HCNA 1Q6ZA 2PA3A 4OFXA 1U6JA 4Q6BA 3UJCA 5EJ9A 4UMFA 5HVNA 3NVDA 2D59A 1L4HA 1RU3A 3FOAA 3D2AA 3R77A 5AO9A 3ZHBA 3S2EA 1D4FA 1NX6A 1F8GA 3ZUPA 3HB1A 4ALMA 3WGNA 1DPFA 3KFLA 4JJGA 3SDSA 2BJHA 5F2EA 3T3GA 2A4KA 2ECKA 1RI1A 5M3BA 2QTWB 5GOTA 1VCHA 3UGTA 4LJ5A 2IEBA 1CJKC 1O87A 1YB4A 4F93B 3BQ9A 2NU6B 3EUAA 4MKXA 1NBIA 3EH1A 3ZVKA 1YZLA 3OZTA 1UC5B 1ZHHA 3WLKX 4MS3A 1VZ2A 1U63A 2B2NA 4B2PA 3JD1A 1Z7BA 2XBUA 3OJLA 4CG3A 3KQPA 2XRYA 5JLAA 2DHQA 1P0PA 1GNVA 1YZNA 1GRCA 2VZ9A 1SOUA 4X6LA 3FNFA 4WFQA 4L7VA 3GPCA 1QOQB 1XO1A 1QH8B 5JECA 1KYWA 5D51S 1TD1A 5I9SA 1Q2XA 2KBEA 5K8VA 3RTDA 2YHAA 5ALMA 4I99A 1X8JA 3DKKA 2XNDD 2VP2A 3UK2A 4OXNA 1F6BA 1JNYA 2O2ZA 4PHHA 4KE6A 4RX1A 2OCLA 4J29A 4X93A 5L4LA 1DIHA 3PC8A 2OLKA 2XQIA 3OJOA 3QMVA 4P4NA 1HZJA 2ZRLA 5FIUA 4AYXA 4BX8A 4KPYA 4G0NA 4B2LA 3RAEC 1GTJ1 3OQIA 4Q7KA 2XSZA 4F21A 5I7EA 2QDKA 2NZYA 3HCNA 3STYA 4DM4A 2H1CA 3GJ7A 3OPXA 1QH1A 3N86A 1DQNA 3GFSA 4IG4A 3RDPA 1IJEA 1EXNA 3THSA 5CVTA 3MJVA 4UXIA 5D3MB 3DGFC 5E3IA 3KB2A 5FBRB 3G0GA 1XRPA 1YIOA 2A1UB 2QRNA 3MN1A 4OHBA 3GCXA 4YRLA 2QPLA 3JZFA 5DYTA 4C30A 3WGKA 1X1TA 2PGNA 1EK5A 5DBEX 5JAHA 2OUIA 2GXUA 1HDRA 3BH7A 4ML3A 1U7PA 1NXWA 2Z2KA 1TUGA 4J8PA 1BDIA 2XGJA 1LQUA 4ZJYA 1S01A 3DNFA 5CRIA 1HXHA 3PSHA 3ORFA 1SIUA 4B4DA 4PLYA 1MAUA 4LG1A 1JGTA 3HDHA 3PICA 4QHSA 5AXBA 5L3RA 1OLSB 4CU2A 4CW7A 4MR7B 2ATXA 4B3FX 2DPHA 5JJ5A 1PJ2A 1RBQA 4OHOA 1G4HA 3WXMA 4GMDA 1EK6A 2ALJA 4HBZA 1HURA 2QAGC 3LAWA 4UKDA 1WM1A 1SUBA 4ZCLA 5K05A 3CNLA 2Q46A 2VWHA 3R6TA 3HYRA 4XX1A 3C8DA 3PSAA 5JSQA 3D54D 3LCCA 4OSPA 2J5BA 2AX4A 2OYRA 5LU8A 3IELA 1OFUA 4RIIA 4C2AA 2FMUA 2PPLA 2OGZA 2XQJA 4FOTA 4KRYA 1DBRA 4Y6SA 2FUCA 3AILA 3IALA 4X1KB 3OO0A 4LYJA 3K0KA 1C0IA 3KUKA 3ZW9A 4B5LA 4BNHA 1C3XA 1N9GA 4HQKA 5JNVA 1QM5A 1L4UA 2GRAA 3ZV5A 4RIHA 5ITVA 1D07A 2W2KB 4RL6A 3CUTA 3SEQA 5CT5A 4B48A 3TCXB 1GUZA 4X7RA 5DBFA 5IXJA 5KSZA 2YC2C 1LCIA 2X3UA 2W2PA 3GFFA 4PSDA 2PJRA 2H63A 2P69A 1FFGA 2QVZX 3A06A 3DAOA 4UBJA 4LWQA 1N8KA 3MRSA 1MX5A 4RENA 3WIEA 2NTVA 2ERCA 1PG0A 1U3DA 2MYTA 2PKEA 2YHUA 1Y3FE 1NURA 3B1FA 3CWZA 3L5OA 4H31A 1DINA 4QDUA 3ZZ0A 4EZEA 4RV5A 4R1UA 4R1LA 3TLBA 4BC0A 5AHXA 2Q07A 4Q24A 1KY5A 3F67A 1EFCA 5TGDA 2CLCX 4DFDA 2H1VA 4Y7CA 5KOHB 5I4IA 4HP8A 1G3MA 2PH7A 2C97A 4RK5A 2DT5A 2NO9A 2RAPA 1X7WB 3DNMA 1KXZA 1YI0A 1JJ7A 3RYHA 4CUJA 3IPLA 3L8CA 5CBPB 2QVBA 1V8OA 3QF4B 5CHYA 1U2PA 4FW8A 3E2MA 3BQNB 4LY0A 4MQ5A 4YJGB 4PRKA 1VMEA 2FEKA 3KJEA 4L6CA 2UZIR 2I3GA 4O2BF 2YWBA 1KY4A 4L5IA 1OVGA 3A25A 3BICA 1JIJA 3KOUA 1EUZA 4KSCA 2QN2A 2DMRA 3G2PA 3N8HA 1LPNA 4JHLA 4RK1A 1KE2A 4BU1A 4F2HA 1TUEA 2C2ZA 1I8TA 1US8A 1AKRA 2P9QA 1S2GA 3C98A 1FRNA 4AN0A 2XNKA 3T9BA 3WQSB 2QN7A 4GRDA 3IAEA 1U2DA 1JHUA 1P9WA 4HWSA 3WZMA 5K6RA 3AG5A 1CXZA 4J0EA 4YRGA 1VGVA 1CDOA 1S3IA 1DAFA 3EEOA 1GQFA 5C18A 5TIIA 2FLKA 1ZXLA 3O3NB 1KVRA 4JNKA 3PNOA 4KXXA 2ID8A 3ANYB 4AJHA 5JS1A 4NENB 4NULA 2IYNA 2GF9A 2X76A 3AHHA 3NM5A 4MRSA 4WGGA 4AJEA 4PNEA 1ST2A 1OA1A 2XTNA 4IEIA 4GT1A 5HTOA 3ZLBA 3ZDAA 3N8DA 2QE7A 4F11A 1K8ZB 2UUCB 3T1TA 4ZKDA 2DB3A 1AGYA 1M74A 3CJTA 1IUKA 4J2OA 1C7ZA 4LTDA 3UMMA 1L5RA 4MVJI 3VU9B 3STXA 2I4OA 4L95C 4ZVKA 2E6UX 1G3RA 2DR3A 3OIUA 4JJ4A 3SKVA 2NO0A 2I54A 2I03A 2LXNA 4I3HA 3SJCA 3BT7A 2O2EA 1OAOC 1AXGA 3LYAA 2R7MA 1VG1A 1WZUA 1YKFA 1RKXA 1X80A 3ZI4A 4F8YA 3PNQA 4R4JA 3I9V6 3KBBA 4KX3A 4C4SA 2PRKA 2SCUB 1OBCA 2B3TA 3M81A 5FULA 2F43A 4FK8A 1CIJA 2OZLA 5AMXA 1ZUHA 1AT1A 2YUTA 4XCXA 1QIEA 3L9WA 2BSQA 1CQIB 2V65A 3AWDA 3FSGA 2PZGA 1P0IA 2E5LB 3H5WA 4ZAZA 1D4ZA 1L7PA 1BFDA 1BWRA 2AF3C 2Q6LA 2Y0DA 4QAJA 2CV2A 5A7HA 3UBTA 1XFDA 1UBUS 2YICA 1O77A 3LL4A 4OLFA 3X43A 1NW4A 4FE7A 4C0QC 3BRSA 4QICA 4AUEA 1LD3A 1P2DA 1WQ3A 2D1SA 1UDAA 16PKA 1QONA 3LHFA 2BJVA 1X7YA 3SI7A 4EDHA 2R6JA 4CEIB 3OOEA 1I94B 3FGPA 3MBOA 2PYZA 1ORIA 4YEDA 5GM1A 1CJTC 2YBDA 5BR7A 1JKJA 4NZPA 2AUNA 2I6FA 3VR5D 4IDGA 5DI3B 3VSCA 2H1IA 1NQUA 1BO6A 1Y0BA 2YHBA 4WCFC 3JQAD 3VR6D 5EG5A 1LNSA 2D1FA 3I62A 5DLEA 2DRIA 2B34A 2X9QA 3FKSD 1M75A 3KJNA 4KPGA 1WXFA 3HI4A 4RK7A 2BDTA 5G2OA 5JCJA 2PX8A 4GI7A 3SMQA 2R6CA 1YBHA 2ROQA 4QOJA 2ZB7A 1EE9A 4FWIB 2WUGA 2YW9A 3AG6A 3U17A 3FUVA 3OQJA 2GCIA 1U65A 3ADDA 5JCOC 4XJXA 1E1QA 3GGGA 2CE2X 3FZNA 2P0YA 4JOQA 4RWZA 3VZPA 3PX2A 3BGDA 2PNFA 1RYMA 4LBVA 2IELA 3IBYA 4CQMD 4RZSA 1RCTE 4GICA 4EMSA 5A5FA 4EO7A 4KLAA 5JO0A 2G8LA 4GX0A 1R5NA 2J3JA 3M4XA 4D1YA 1Y7HA 2CJFA 1WZNA 2GN1A 4N6OA 1KZGB 4MHOA 5BQ3A 2XKKA 4Z2AA 1GG5A 3E2IA 4ZU1X 1BH6A 2L18A 3DVAA 4QX6A 3MJFA 1QDUA 3QNUA 2ICAA 5ALDA 2Z6AA 2PCLA 3I8SA 3H9EO 1T5OA 2FEXA 2FOIA 3D43A 2HIMA 2NZUG 3A1EA 1GQQA 4WASA 5FA6A 3P9SA 3L4BA 1GKYA 3KSDO 5AXDA 4D8XA 1MX1A 1ULSA 1MT3A 3IQGX 2DHCA 3AERB 3AJRA 3KVOA 4O33A 5CNJA 4UUBA 4R2XA 4BGIA 3M6IA 1E3SA 1G64A 3LS2A 1BXGA 3WQRA 5GONB 3WKEA 3K1ZA 5T57A 7ADHA 2CY0A 2XITA 4K81B 3HA3A 4PY2A 5CDFE 1YZKA 3B9BA 5DLYA 1MAAA 5BT9A 5KTOA 1BKSB 3SYTA 2HSZA 2X42A 5KVCA 4ZOAA 3WL3A 1QGYA 3RVKA 1BU8A 5DJ5A 1FTQA 2ZWIA 5HGXA 3EVBA 3GR6A 2WMOB 2ERYA 2Z8YM 1X7XA 3MIZA 1ZD5A 3VV3A 5AIBA 5C4MA 1FXSA 3EIXA 4DJJA 2AJBA 2NXNA 2P9GA 3NHZA 4Z51A 3L6EA 4H2DA 2WZQA 3CVWA 1DIGA 1PJ3A 4KIGA 1UKEA 2EF1A 4F5ZA 5DULA 2AZ4A 4JI3B 4QTYA 5KYGA 1E1MA 2CF6A 2O2IA 1Y48E 4S0ZA 4CM9A 1E63A 4OHYA 1C0KA 4HATA 2JAUA 1ZQ9A 3Q85A 2VTEA 3R4VA 4RZUA 1HYBA 3BRCA 3IPXA 3E84A 4BB9A 4D0NA 2JDIA 1MABA 3I2JA 2W5UA 1JNXX 1TQHA 2COUA 3BXHA 3QVGB 3K5IA 4PM4A 4JJ7A 2BEUB 3KOYA 4AFNA 4F71A 2C29D 1LDNA 2AN5A 2OBYA 4KYVA 1KSFX 3F8TA 3FM9A 1XRNA 3Q0IA 4LISA 4WK0B 1AF7A 1L7MA 1OHHA 1SUWA 1W48A 1KIFA 3HZRA 4I55B 4MJ7A 3UM9A 1JDUA 1Y5RA 3UNXA 1EWKA 4Q7QA 2QMOA 3HJUA 3W5UA 1PUJA 1EDBA 1K1EA 4K9PA 4DR6B 2XMGA 4RHCA 3D8SA 3EXAA 4PHCA 1YACA 4BVAA 1YRLA 1D7AA 1X8KA 2KYRA 2B98A 4XM1A 1TZBA 3CTMA 3BRWD 3RUDA 4DLZA 1II9A 4HDNB 2P75A 2EBUA 4K9QA 2PIAA 3DC2A 1J25A 1Q77A 2IUSA 5FNVA 3UHJA 1KR5A 2NYUA 1KMQA 4WVFA 2AEMA 3ZV3A 3RRFA 3MJ4A 2WMYA 1CY4A 4CIDA 2E4XA 3MBIA 2YV1A 4IDCA 4RJLA 3TWOA 1G3UA 2XJ4A 4WOPA 4HYTA 3PQCA 1P1RA 4Z99A 5LMCA 2AI1A 4BJHB 2Q9CA 2C96A 1RWNA 2G9ZA 5DH9A 1Z07A 2DECA 4BO2A 1L5VA 1ZP6A 3TUZC 4CEJA 5JMPA 2WUDA 4JI1B 1B8UA 1NUTA 3RRBA 2BM0A 5B2ZA 1YR9A 3S4YA 2R6HA 1YRHA 5FPYA 3CINA 3KTOA 1SOWA 4UFNA 3FJ1A 1UPCA 3MTDA 3R5XA 3CWQA 3E82A 4YP9A 4Q9AA 2HDWA 4DNFA 1OUMA 4BNTA 2ATVA 4NXNB 5IN4A 2AUTA 1ISSA 1JP7A 2R6AA 1XIVA 1FS5A 5IEBA 3OWHA 3I1YA 2VH1A 4TL8A 5BWNA 4BV2A 2ZAMA 1XAIA 1IATA 1MQ8B 2JGLA 3R76A 3ZY3A 4HVAA 1EWYA 1Y8AA 2H3HA 4L73A 4D44A 3VGJA 3R8FA 4PR3A 1EUCA 1ZL2A 3ASVA 2V59A 3NDJA 5ER9A 4XLLA 3V1UA 3W1VA 1GZ4A 2OCAA 1P81A 2QT9A 3HBNA 4V1CA 1O95A 1PR3A 2A88A 2DH5A 3PI7A 3I6ZA 2DLCX 2C07A 1TCBA 1UC9A 4RSMA 1IN6A 4R7GA 4OQXA 1UBGA 4UFOA 1TT7A 4ARUA 1I7QB 1B0AA 3A1VA 4HF7A 2HW8A 3KALA 3SS8A 1ITZA 2PYIA 1A5ZA 1EK1A 2BSAA 2I8AA 4U9HS 5B4TA 1ECJA 3LPNA 1K5GA 4P0TA 1I30A 2DHRA 2PZKA 3M49A 1R4NB 3PFIA 4FFOA 3TRDA 2F62A 2YJNA 1KDPA 3P96A 4FCVA 3G23A 4MA5A 4TTVA 3MRVA 2NO7A 1IQRA 3IO5A 1FDVA 2W2LA 4MPTA 2HXYA 1B6RA 3HJBA 2CDRA 3VDMA 4RDIA 5CVCA 3SYKA 5C7YA 2XQKA 5E3JA 4TWAA 5MFPA 1Y89A 3HK2A 1AO3A 4PYOA 3ICOA 1UZNA 4NV1A 1PJCA 3AP1A 1QHNA 1S2NA 3C1UA 2H9AA 3PT9A 4XTRA 4ZVSA 5AJXA 4CMAA 1DHTA 4CV2A 5JLJA 4DUPA 4K1LA 3QU4A 1ZVVA 3QI2A 5KDOA 3I5UA 4EB0A 1OX6A 1HEYA 5JZVA 3LX8A 3QE4A 4MW2A 4MRPA 2VUSA 4FYKA 2ZUDA 4LE2A 2HMWA 1IRXA 1UK8A 2YXDA 3P9CA 5HK9A 1XEXB 1VJCA 2I3AA 1QAMA 2WTBA 2XUZA 1CQJA 3EDYA 2OGSA 3HUDA 3KZXA 3DJFA 4WKNA 3LK6A 5ED0A 4EX7A 1RPZA 2UUAB 1F6DA 2CHFA 3JWGA 5BWBA 1BWQA 1K06A 1FC0A 3EUEA 3G1UA 3HB0A 4P93A 3T15A 4CT0A 2CD9A 4O02B 5CB4A 5CFLA 4WBXC 1NV8A 3K09A 1TF5A 4JLUA 3GIDA 4MYUA 4X1IA 3TNJA 1KEEB 1MTOA 3AR2A 5MN4A 2Q2QA 5JCPA 1EFVB 1PYDA 2FWJA 4DIKA 4CKXA 2P6UA 3IBCA 3EGCA 4JU9A 5HNKA 4G3XA 1C1XA 5EJEA 1YZTA 2R96A 4MQ4A 1NI4B 1P8AA 1T1SA 1XDBA 3UF0A 4Z4HA 1B41A 1KAMA 5TF4A 4WNAA 3TZBA 4KAAA 4K3UA 2RGNC 3ZLTA 3G6KA 4I5FA 5DYYA 5EJ2A 3IB6A 1PW5A 4U8HA 1FPMA 2K2WA 3FMVA 2O7RA 1NBHA 3P9NA 4GM0A 4BBPA 1FVOA 4DPMA 4ER6A 3INRA 1L8XA 1LI5A 2EP8A 5EJFA 1CY1A 1C8LA 1CHNA 2KLHA 4LJRA 4XR4A 4D3XA 2AK2A 1PTJA 1GPAA 4BMYA 2FPGA 3PLAE 1RJ9B 2GHTA 3DPSA 4IJQA 2YVLA 4WDQA 2JG3A 1RQPA 4I9HA 2X9VA 5CA0F 3ILXA 4YRSA 3K0FA 3NT5A 4H6PA 4GW3A 2BFOA 5CT9A 4EHIA 3RSCA 4M0LA 1Y8RB 1DQZA 3ISJA 4EARA 3GFRA 1C4WA 1DIRA 4G9GA