3CR7A

Crystal structure of n-terminal truncation of aps kinase from penicillium chrysogenum: ternary structure with adp and paps
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
179
Chain Sequence
RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenylyl-sulfate kinase
publication title Truncated APS kinase from Pencillium chrysogenum: Insight into the function of the N-terminal helix
rcsb
source organism Penicillium chrysogenum
total genus 62
structure length 179
sequence length 185
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cr7A00
5SZKB 1KI8A 3IILA 4B3DA 2ZRNA 3AF0A 4XTRA 3QXXA 1XDBA 2G83A 1MRNA 4LUCA 2VHCA 5DSZA 4P4SB 4O3MA 1HA3A 1QHIA 1FZQA 4JLVA 2O8CB 2OCYC 3HU2A 3AGQA 3RABA 4NONA 5FTLA 1M2OB 1M7HA 4BEBA 2IF0A 5J4YA 1L8QA 2LCFA 3SHFA 2R2AA 2WJJA 4M0LA 4BGDA 1NN0A 5B64A 1KK2A 1M34E 3VKHA 2DHRA 2QBYA 3OIWA 4Q1BA 2ZIAA 4QXAA 2PBRA 4LJ9A 3OFNA 3OIVA 2C9CA 4TYPA 4E09A 3HU3A 2IW3A 2UKDA 3F8TA 3B5JA 5FPKA 1ZW6A 5FTJA 4KODA 3LO5A 4FIDA 3VHXA 2WAXA 3GEHA 4BFXA 4LV6A 2ATXA 4US1R 3CRVA 5DE3A 1RZ3A 2HEIA 1G17A 3TVTA 1FX0A 1H65A 4FN5A 2R65A 3OZXA 2FGJA 2W0SA 3QPUA 4LX0A 5TARA 4BLOA 1OKKD 2A5FA 5AUPB 5G40A 4B35A 1ZD9A 3RSLA 3W6NA 1WB9A 5JSZA 1XRJA 1IY0A 3AVPA 4I81A 5DI3A 3QQ5A 1CP2A 3Q5DA 621PA 4JYBA 1GWNA 1JBKA 1R0WA 1F2UB 3KZ1E 5CB6A 1EFHA 2R6AA 2AFIE 4PQFA 3T5GA 2GCPA 2H18A 3CF2A 3T5DA 4JYCA 1N5IA 4JLOA 2KJQA 1TU4A 1MH1A 1CJUC 1RFLA 4MUBA 1LV7A 4CEHB 3BFVA 4JLJA 4DSOA 3K70C 3Q85A 4DHEA 2FFHA 3OIUA 3REGA 4BE7B 4DSTA 1TADA 2GF9A 3B8HA 5C1BA 4UNSA 3A58B 1JB1A 2DFKB 2QORA 3NXSA 1ETUA 1KI6B 2C96A 1KI1A 1FFHA 1W4CA 3KKNA 5FH9A 5KO2A 2LKDA 4Q1CA 4DLZA 1XWIA 5E4FA 1I2DA 1NL3A 2Q3HA 3AF2A 3FOZA 4POAA 1G8YA 2ODWA 4GOKA 3IIMA 2ZPTX 3O8DA 4RZ3A 3U60B 2XJ9A 4WBSA 4BLPA 2G6BA 1VCMA 4DUGA 3QIAA 2IHYA 1UADA 1OXXK 3NHBA 1KKLA 3KQLA 2BCGY 3VU9B 1II8A 1ZBDA 3PEUA 4HB4A 4DSNA 3E70C 2G77B 4PAMA 2VA8A 1GZSA 1RE0A 1J90A 2GHIA 5B57C 1P60A 2HDNB 1S3SA 2REOA 4DDVA 4HAXA 3UIEA 1DAMA 2EWVA 3PQCA 2RCNA 4ZI2A 2IS4A 3F0TA 1XD9A 4CEIA 5C18A 2XZPA 4TQ9A 2QSYA 1BH2A 4D26A 3HYRA 3ZVRA 3ZDQA 1W0KA 4II7A 4KVAA 5FR2A 4PX9A 5DI9A 5ELXA 4JMPA 4ZKDA 4OHXA 3THWB 1ZU5A 4GMXA 4HSEA 1NMXA 3TW8B 4CT5A 3TQCA 1G3IA 1YR6A 2ZJ8A 3W3AA 1Z2CA 1X8JA 1Z0JA 5FUVA 4H1UA 4EQ6A 2BVNA 2PX0A 1CU1A 4Q00A 4A2PA 1BOFA 2C98A 2ZI5A 2HJGA 4AURA 3UANA 1KDOA 2J41A 4IDHA 2ODNA 4LHXA 4RFVA 4QM6A 4TZ0A 5F3WB 1ZD8A 1Z0IA 3BB4A 1VTKA 3P27A 4A82A 1P62B 1D2MA 2DWOA 1IY1A 2XTZA 1CJVC 1G8PA 1L7VC 1CLUA 2VP0A 2DY1A 2C04A 3EASA 4TLBA 4G3XA 5KNDA 4TL9A 3QOFA 1GL6A 4AK9A 1XEXB 5F2EA 3CB4A 2WMNB 4NYIQ 1E1RA 3DEFA 2D7DA 3KB2A 3KTAA 1OFUX 3FKSA 2PMDA 1HEIA 3BK7A 2BWJA 2V7QD 4PAOA 1ZJ6A 3LLUA 2D2FA 4PAQA 4URVR 1OYYA 4J0QA 1FPMA 4OK5A 1NKSA 4DEYA 4LZZA 2WSSA 5IT5A 2H92A 1KKMA 4NYMR 2RHDA 2J7PD 3OAAD 2QZ4A 4JLKA 4DCNA 1FP6A 2B8TA 2ZE5A 3CX6A 3MG9A 5CM8B 2O8DB 3IPXA 3BXZA 3D8BA 3A4LA 1OH6A 2OFOA 4B2PA 4A8JC 2EQBA 1GNQA 1NVVQ 1A2BA 4KLNA 2FSHA 3PXGA 1OHHD 1G7SA 2XGJA 5FI0B 1XEWX 3BB1A 4TMTA 3ZH9B 4LBZA 1E9DA 5HE9A 3RRYA 1TX4B 1Z6XA 2RGDA 3DZDA 3QXHA 3TW4A 4ABYA 4CZ2A 2PZGA 1Q1QA 2GBLA 1N2CE 3M4YA 4XD7A 4LDJA 3U7FB 4ACBA 4GNKA 2DYKA 3CH4B 4M2LA 1AZSC 4GDFA 2GJKA 3PUXA 3TH5A 5DLQC 4X8OA 4IVQA 3V9PA 4DLYA 1E69A 4XOIA 2IS6A 3K0FB 1KY3A 1H8EA 1JPNA 1E2IA 2J0SA 3CBQA 2ZSAA 1XFAA 3F5FA 2XSZA 1OW3B 3Q7QA 2ODEA 4HAWA 3SOPA 4B3CA 5B58C 1O87A 4M4SA 2OCPA 2Z6VA 4B3FX 3D31A 2W6JA 1UPTA 4I1UA 1MOZA 4XWKA 1S4QA 3QKSA 1A7JA 2FJUA 2V6JA 2O5VA 5A5GA 1E9RA 1ZINA 2RMKA 1AS3A 1ZM7A 3VR1A 3PG5A 4EIWA 3QNUA 2V9PA 3FMIA 2EW1A 4WXPA 1NBME 3BS4A 3CF0A 1FP7A 3Q72A 3QY0A 1XF9A 1XCPA 4ZDJA 3GLFA 1GVNB 2ZU6A 1G7RA 2A5GA 3ZVNA 3GLIA 5CYPA 5FBWB 3PCRB 1G7CA 3AQ4A 3WBKA 2ZRGA 3L8YA 4OI1A 3VR5A 3MRSA 1ZM4A 3EXAA 3GPLA 4F92B 1C9KA 4MRVA 3H1TA 2Q21A 5KOYA 1IJEA 1T91A 2P3SA 3CPJB 4JLBA 2GVDC 5DN6A 2DBYA 2EU8A 4YLGA 3AP1A 5HR5A 1FX0B 1FMLA 3CW2A 1W0JA 1GIAA 1IY2A 3V00A 3VHLB 5HZHA 3V4FA 1VHLA 1LFDB 3CWZA 3QEOA 2BOVA 3AF1A 3WY9A 2QM7A 4DB2A 2ZXUA 4AIIA 3K9LA 4OJQA 4EJSB 4L8GA 5F9HA 3KKMA 2WWIA 3FHOA 3PUYA 4OHVA 3SE0A 1KO4A 4Q02A 1D2EA 3PENA 2J59A 4PSVA 4K81B 3TIFA 1NIPA 5GADl 3IQXA 1ZM9A 1G3RA 2QMOA 1Z83A 4UJ3A 2E1RA 1CR2A 1G16A 4IFBA 1SXJB 1NLYA 1P6XA 4WZ6A 2BMEA 2QQ0A 4DCVA 1YZKA 1GM5A 4A6PA 4D4MA 2KBFA 2XX3A 1NBMD 3SFZA 4M21A 1TQ6A 4A8JA 1E2KA 2PL3A 3UXMA 2JLSA 2N46A 3NKVA 1EWRA 4DXAA 3EIQA 3K0CC 3B1WA 1QG2A 4NMMA 3TMKA 3THXA 2V1XA 4FW9A 4JT2A 3T1TA 4AG6A 3LX5A 4AKEA 1T4GA 1HUQA 4PHTA 4PXAA 1U8ZA 2EFEB 5JECA 1E2HA 3CRMA 4E07A 5AK0A 2RHMA 3FPAA 3C14C 4GOXA 4JL6A 4B33A 1KJWA 2R6GA 1II8B 1W4RA 2GCOB 4URZR 2XNDA 3MAAC 5KSPA 3SI7A 1WP9A 3K0SA 1SXJE 3MCAA 1N6IA 2I3BA 4DIEA 4A0FA 4A0RA 3VNUA 1CIPA 5KNBA 1DADA 3P32A 4OQXA 1XTJA 3OEHA 3KJIA 1E79A 1JXOA 2IK8A 1YRBA 4WIAA 1BO6A 4DEXA 1XPOA 2EWWA 1RYFA 2GAOA 4PHFA 2GA8A 2CEAA 4RY2A 1T6NA 1OH5A 5EP1A 1D9ZA 5TDHA 1VYUA 2RGBA 3OE7D 1QVRA 3TUZC 3DMDA 2W6ID 4Q9KA 1CJTC 3B1ZA 3EARA 2FEOA 1GAJA 3Q9LA 4A92A 1SZPA 4A0GA 3IO5A 4JS0A 1E9SA 1KAGA 1T9HA 3LBIA 3TUJC 4EQ6B 2R6FA 1HT2E 5ANRB 3FGNA 3SBEA 1R8SA 3NDBB 2VSXA 5LB4A 3X1YA 4BQSA 1OXVA 2F7SA 1G8GA 2QGZA 2V55B 4LYAA 3LV8A 2OV2A 3VR2A 1KHTA 1E32A 3UK6A 4WVFA 1JXMA 3QVUA 4L5BA 4C9BA 1LF0A 2VPPA 3Q5EA 4JJZA 2ZYWX 4MGYR 1DAFA 3IEUA 4UXHA 5JLJA 4LC0A 2VP4A 1ZAKA 1DVRA 2WHXA 4V0KA 4Q4AB 1E4VA 1P61B 1EK0A 3A4MA 1KJYA 2ZI4A 1JPJA 1F2UA 4X8MA 2ZSFA 5EP4A 2OO7A 1E96A 4JLAA 4B48A 1YJ5A 3MSXA 1YHNA 2EFDB 2QENA 3DM5A 4M22A 4XWAA 3TKLA 2QSZA 2BJWA 4C0KA 3TLXA 2GVZC 3SJAA 2FMXA 2ZE7A 4QGHA 1Z07A 4WA7A 5FPTA 2HV8A 5LDDC 3NEYA 3ECCA 2CL6X 4QHTA 2F43A 5E3HA 5BYJA 1J99A 3AF3A 1R5BA 4RD1A 2VP2A 3AKDA 4R98A 4KITB 4YMWA 3LWNA 2NGRA 4IVPA 3GJ3A 1UKZA 1B23P 4NYMQ 4V03A 1Z5ZA 4N1AA 5FOXA 4JSYA 2B92A 1I4DD 2IEYA 3FVQA 2P67A 3OAAA 4IHQA 3H86A 4HLCA 2QMUA 4V0NA 2O0HA 4HZIA 1P9WA 4RCYA 4NH0A 3SEAA 3A37A 3QUSA 5KDOA 2QP9X 1ZU4A 1VIYA 2JJ1D 2A5JA 2PMKA 2ZYVX 4YDSA 5KDLA 1OHHA 3TSWA 2VF8A 2VHQA 3VU9A 1RC8A 2IS1A 1EX7A 3LDAA 4Y0VA 3W6OA 4NCNA 1J70A 1XZPA 1G3QA 4GI7A 1EX6A 1EFCA 4A4DA 3WP0A 4AI6A 1G5TA 2PCLA 4TTPA 2IX3A 1V5WA 2G1JA 3P20A 4XSHA 4D82A 2OSBA 2JLRA 2VRWA 3W8NA 3WP1B 4FCWA 4RD0A 3AVUA 2X1VA 5FBRB 4GPTA 1R0XA 3KKOA 4A0HA 1ZCBA 2WSMA 1DPFA 2VO1A 4MKHA 5KSZA 2CHGA 1ZM3A 3THWA 1GKYA 2NPIA 4QFMA 4D4LA 2J1LA 5EXPA 5L3RA 5LPNA 1P2TA 1E4YA 4TSFD 4MYHA 1E0SA 1YZGA 3BH0A 2VIIA 1N6RA 2GF0A 3TK1A 4LSGA 1PVOA 1KTVA 5BW8A 3IGFA 1NMYA 1G291 2IT1A 1SVSA 3GLFB 4DLWA 4G01B 2ATVA 2O0JA 2OBNA 4Q5IA 1T0JB 3TNFA 3GLIB 2J9RA 4KI0A 1S96A 2IEZA 1X8LA 2IUUA 4KO8A 2QROA 2V3CC 5B2ZA 4NYIR 1DS6A 2EYUA 3L8ZA 3SJBA 2FN4A 4KXFB 2WTUA 3GJ8A 3X1ZA 2ZS7A 4QKQA 4M1KA 4BFUA 3IDQA 1OXSC 4KJZA 4PHHA 1XEXA 4B76A 2ZRDA 3I5XA 3ZIAD 1MABA 2F9MA 3PR1A 1E0KA 1HY3A 1LY1A 1KSHA 3CONA 5KDDA 2JIZD 2YINC 4LHZA 4JVNA 5L3SB 2GJ8A 2NO1A 4EJSC 2AWNA 2JDIA 1DAEA 4KBFA 3EPHA 3A1TA 4GFDA 1BYUA 3BD9A 2CLSA 3GJ7A 2IA5A 1KDPA 3GLIE 1DAKA 1CS4C 2AKAB 1XTQA 3DVLA 5BYKA 1P7CA 5CJ2A 3T06B 1HURA 2O52A 4BLQA 1EESA 1E9BA 1Y63A 1A4RA 3CLVA 1OV4A 2QGNA 2O8DA 2QAGA 4IXNA 2Z0MA 4TYYA 2OT3B 3TGPA 4QBGB 5FBQB 1J8YF 1AM4D 5LBIA 1IN4A 1VPLA 1HE8B 3RS0A 3FHTA 4I1VA 1CEEA 1NY6A 1E94E 4PANA 3BERA 721PA 3WYAA 2RAPA 3GQBA 1A5TA 1RYHA 2HT1A 5JJIA 2OXRA 3I92A 3U7GA 2JAQA 4X8HA 3KQHA 2BBWA 4NKRA 2JJ8A 4U00A 3QENA 1PV4A 3MMPA 2IL1A 1EFRD 1W5SA 4QNMA 3GJ5A 4EKDA 1E9AA 1AS0A 1NBMA 1G18A 2ZI3A 1S1CA 4KV9A 4KSBA 2KI5A 2ZS8A 2LWIA 4A2WA 3W9YA 5FUXA 4C30A 2PT7A 3R7WA 3A1VA 2QPTA 4BUJA 3SR0A 4IVRA 3QJYA 4JVSB 1COWD 4U5XA 4A9AA 2ODBA 4IDNA 4DLRA 1IN8A 2WV9A 1Z22A 3KJEA 5SZHB 4XWOA 3CX7A 1UEIA 1A2KC 1XD2B 4LHWA 2N1BA 4DB4A 2BC9A 3CWQA 2BHRA 2XNSA 3QG1A 1GKIA 1R4AA 3QF7A 2J5XA 4F91B 1YZQA 1OB2A 2ZRIA 5TV2A 3VNVA 3CKLA 2UZ3A 4KYIB 3QBTA 1U0JA 3GMTA 4CT4B 5JEEA 3ZLJA 3RRNA 5F9FA 3DM9B 3NTUA 1E9CA 4MDFA 2QEQA 1G8FA 3U7EB 4G5QA 1G9XA 2B7BA 3VMFA 4FMBB 1WXQA 4MKFA 2IF2A 2F1IA 4LJ5A 3RWMB 5TMPA 3RVBA 1H8HD 5J40A 5AJZA 2W6IA 3QXJA 3SFVA 3BAFA 1FTNA 1E99A 1KK0A 4D0NA 3OESA 1Z6TA 2FA9A 3EWAA 4MQBA 4WXRA 1IBRA 1SKYB 2H17A 2QPOA 1D5CA 2YZ2A 3ZGXA 4ZDWA 2QMHA 4UQOA 1R7RA 3FDIA 4PPFA 4R7ZA 1ELOA 2FE4A 1NRJB 3BC1A 4NE2A 5HKKD 1E6CA 4XH9B 2QT1A 2BMJA 2AD5A 2XTMA 1Q22A 1QRAA 4MH0R 3ZS9A 4DLVA 4UNRA 1KMQA 4PPQA 4C0QC 2QT0A 1OF1A 4NCIA 1KK3A 2J0UB 4EJSA 1M1YE 2Z5FA 4M9ZA 2C8VA 1OIVA 5TVKA 1XP8A 3UMFA 4TYWA 3IQWA 2WIBA 2QTVB 2YC4C 2TMKA 1JAIA 3X2SA 3IHLA 4EPVA 3SN6A 4XJXA 4NU0A 4AWXA 4NDZA 2F43B 3HR7A 1SGWA 5FBLB 3MWYW 1ZUNB 3I62A 1SKYE 1SXJA 4LPSA 5FL7D 2V1UA 1AA9A 4O25A 4GP7A 4XVQA 2OE2A 2CCKA 2OM2A 5CM9C 1F6BA 3ZVMA 1VG9B 1RVDA 3FB4A 1S8FA 4FMCB 4D0LB 4OQNA 5BXQC 1UJ2A 3VKGA 1O3YA 4IDQA 1KMHB 2CHQA 2KWIA 3EC2A 5UKDA 1WDTA 2GZHA 3RS4A 3UMRA 2GBLC 2WOOA 4Z51A 2XITA 4HLDA 1FTSA 1VMAA 3C7KA 1U8AA 2QE7D 2GETA 3AV0B 4Q4JB 4D25A 4G5OA 4RD3A 2OAP1 1P2VA 4QRHA 1QHSA 1G4UR 3AVTA 1Q1ZA 3IEVA 4HUQA 3W6PA 3T61A 2MSEB 1P3JA 5BN3A 1UKVY 2GCOA 2JLUA 1LVGA 4D81A 5JZVA 3IHWA 3QE0A 4DWJA 2OHFA 3ZZTA 4QBFA 3PJRA 3SYNA 4CDGA 2XXAA 1XTSA 1KIMA 2GZDA 1E2DA 5DYIA 4MYUA 2G0NA 2XB4A 5KU1A 2JJ1A 4PQRA 1R8QA 3FTQA 4F7WA 1G4AE 3C15C 4BRWA 1MO6A 2HYIC 1E9FA 1HTWA 3W3ZB 4BFVA 2NO0A 1NJFA 4OQFA 4URWR 3ZZ0A 3C41J 4W9MC 3C16C 2GESA 1Q20A 3EAQA 4LBWA 4PC6A 3I8SA 2JLXA 3SYLA 2BKEA 1HQCA 1PLJA 1NKTA 2CVFA 3H84A 2O8EA 4B73A 1ZC3A 3AEZA 5JFGA 5IHPA 2P5SA 4PHGA 5IK2D 3GJXC 1U9IA 3LLMA 2W58A 4PO1A 4DT1B 4GMDA 3CRQA 1ONBA 2P0EA 1NMZA 2ANCA 1IONA 3QKRA 2X2FA 5EP2A 2VHJA 5EUMA 2VH5R 4ARZB 4DCUA 3MWKA 1E98A 1K8RA 2GEVA 3UG6A 5FTKA 1QHNA 2XAUA 4AY2A 3QBVA 3ASYA 3W5IA 3G82C 2G3YA 4LJ4A 4Q7MB 2ZE8A 1NF3A 2P65A 4Q4AA 1MABB 3IO3A 4H9GA 5KHOC 4Q7JB 2D4HA 3MFYA 3SHWA 1OYWA 2BMFA 3GFOA 521PA 4BECA 5K8TA 1ZMXA 1YZNA 3NBFA 5B30A 2XB2A 3T35A 2C95A 4UXIA 3ND9A 3U44B 1S9DA 5KPJA 4HYYA 5FUYA 2FNAA 2H1LA 1TEXA 3B9PA 3AKYA 3QF4A 4Q03A 4TT3D 1F5NA 3DMNA 2GTPA 2YWGA 1P2UA 3ND8A 2C9OA 3GLGB 2XZOA 2RGEA 1VCOA 3ONWA 4WZBE 3ASZA 1ZIOA 3B1VA 3KXKA 4LJ8A 2IYTA 2Z4RA 2JCSA 1VIAA 3DOFA 3ADDA 2JIZA 3X1DA 1IHUA 2QQEA 2JLZA 3ICEA 1D2NA 2ZAOA 221PA 4EAQA 2QAGB 2WKQA 4YONB 4JZKA 5KUTA 1W2GA 2R6CA 1Z6AA 2R62A 2HLDA 1E9EA 4M9XA 3S1AA 3E5HA 1ZNYA 1UKYA 4C2TA 2CCJA 3WXMA 1YR7A 4Q4HB 5HTKA 2FSFA 1P4SA 2C5LA 4GL2A 5TY0A 4YMVA 4TZ6A 4FCVA 2YWEA 2OEPA 5D3MA 5K8UA 3CPEA 3EZ6A 1P5ZB 1P9NA 1T0HB 1Z08A 3SBDA 2PZFA 2ORIA 1RIFA 3WBJA 1JEDA 4WW0A 3LFUA 3SQWA 3GLGE 3NBYC 3DO6A 1BKDR 2FPLA 2RH5A 4CGZA 3AVVA 5FI1B 5CIWA 4MKGA 4IDPA 5H68A 3R7WB 4U7DA 4ASUD 1OH8A 4ZCIA 4C7OA 3PITA 1VG1A 3BIFA 1KSGA 2HYDA 3BWDD 3L2OB 4FXPA 1UKEA 1JQLB 4OK6A 1M7BA 2IYRA 3GD7A 1EFRA 3I8XA 1WQ1R 4JBXA 1GITA 4Q9IA 4UNQA 3WNDA 4HB0A 4LJYA 1LTQA 2OFXA 2XJ4A 3EZFA 1TNDA 4ZCMA 2BCJQ 5EE1A 3VTKA 4A36A 1GILA 2AN9A 4QHSA 1U8YA 5HCNA 1BMFD 4EPXA 2WKRA 3R8CA 2WWWA 4LPKA 4ON9A 4IOMA 2WVJA 1KO1A 4Q4LA 5AR1A 2D7CA 3CR8A 1R5OA 4LRWA 3I73A 2WPDA 3EIHA 2WAYA 1Z3IX 4S2EA 3RNLA 4PZZA 3CX8A 4BFZA 3U4QA 1W36D 1FL9A 1VDZA 1K5DA 1XX6A 2ZU0C 3B1YA 4K46A 4WOPA 4DKXA 2ZJZA 3LD9A 1TPZA 4MRSA 4DIDA 2WWYA 2WICA 1OFHA 5EP3A 2A3RA 1HE1C 2FFQA 1PLLA 1QF9A 3ETLA 5CIQA 1Z8FA 1KZGB 1Z6GA 4BLTA 4JT4A 1JECA 1OFTA 1W44A 3P4YA 5D3QA 1JNYA 1Q21A 1ANKA 1KZ7B 2ZRBA 3EW9A 1SHKA 1VECA 3HPQA 4KU4A 4MKIA 4QJ4A 4KVGA 1H8HA 3MWLA 2XZLA 3REFA 4BRUA 4BZQA 4JJKA 4NZYA 5KTYA 2R9VA 1AGRA 2AR7A 4B71A 5L3SA 2Q9CA 1U98A 3E2IA 1YU9A 2ZI7A 3WRXC 4ZPXA 4LBVA 3TR0A 2PJZA 4Q19A 5BN5A 4L9SA 2I1QA 3NHAA 5M04A 1EG7A 1OKKA 2QRNA 1P75A 3T12A 3J81k 2GWHA 2YOHA 1W4AA 1TUEA 2GXSA 4OI2A 3CRW1 3QKTA 2NIPA 4MGZR 2RGXA 2ZREA 4NHOA 1BYIA 2JEOA 1AK2A 4O2LA 3BRWD 1DBSA 2I4IA 5EE9A 2QL6A 1W47A 2FZ4A 4PZLA 2HXSA 2JGNA 2PLFA 2CCGA 2BIFA 3B60A 1N6KA 5DHFA 3SJZA 2CDNA 1P73A 4US2R 4QL3A 1U94A 3FMOB 4DCTA 1JQJC 3MLEA 2D06A 4TQUS 5DGXA 5H8WA 5FL7A 1CF4A 4NCJA 3RRZA 4BFSA 2R44A 2PCJA 3ZQ6A 3BH7A 4F4JA 5GJBA 1WE2A 4RJLA 4B6EA 4A15A 4A6XA 5JEDA 2BKUA 2WM9B 4IFEA 1GL7A 3BB3A 1AZTA 4HUQB 1GFIA 1RW4A 1NVWQ 1VYVA 2AX4A 2OBLA 3P4XA 421PA 2ANBA 4QGFA 2VHUA 3CNNA 5FR1A 2DB3A 4IRUB 1XD2A 4DCSA 1VKJA 4BZXA 2XXAB 2ZAMA 4JSTA 2QE7A 4JLMA 5CITA 3KB1A 1DOAA 2CVHA 4JL8A 2A2ZA 1SKQA 2AXNA 4BWYA 3R9WA 2QI9C 2BEJA 5CLQA 3P1JA 2Q9AA 4B34A 2O8FA 2VEDA 2GEUA 4TLAA 3WHKA 3JVVA 4YXWD 3R9XA 4QBHA 3KKPA 4Q1EA 4ZI3A 1UAAA 3EG5A 2ZYTX 2QM8A 1XXHB 4ZO4A 4P31A 3TQFA 5JWRA 2H7VA 4YDHB 1KAOA 2X19A 5TXGA 3ZYCA 2QUZA 3UWKA 2O8EB 2EFCB 3LQQA 1R0YA 2RGNA 4I99A 1UBFA 4QHYA 2ZRCA 2FGKA 2ZQ5A 3PIRA 1Z63A 3BOSA 1XZQA 2BBOA 2ERXA 4P3YA 1LNZA 3UWOA 3OFND 3QKRB 4KAXA 3LX8A 2NO7A 1OXUA 2X2EA 2GDJA 5E7MA 4XVRA 3DKPA 1KI2A 3M1IA 4D0GA 4PO8A 1HV8A 5E7JA 2G9NA 5EXTA 3L0IB 3VFDA 2NPFA 4Z8YA 1DTSA 1B0UA 3FE2A 3A36A 4ESVA 5GJWC 5IK2A 2MMCA 3CRRA 5LD2B 3LQRA 2GJSA 2HT6A 2N42A 4D2IA 4ERNA 1EFUA 2ERYA 1RRPA 1XXHE 1U90A 3DL0A 1YKSA 3ICQB 2G1KA 5KNCA 2CL7X 3K9NA 2J0UA 4R2HA 1DE0A 1G6HA 1Z28A 3IPYA 5J4HA 3QF4B 3AVXA 4AKIA 1IQPA 1DELA 4Q7LA 4C0AC 3NVAA 5DH9A 3TJZA 4CF7A 4HAUA 2NZ8A 4B44A 3LVRE 4GP6A 2FOLA 5CK5A 1G8HA 2QN6A 3MJRA 4ZIRB 4CW7A 2QAGC 1FNNA 4KHZA 2V7QA 2EYQA 3I1FA 4B6FA 2RGGA 4RSGA 5SZJA 2Y8EA 3BH6A 3H0KA 4M8NE 3GLHB 2NOAA 4KFRA 2W2TA 2VP6A 2PEZA 2QA5A 4JVMA 2EVWX 4PC7A 2KBEA 3NH9A 3PUVA 5FFMA 3ZJYA 1E2LA 4ACAA 3K9HA 3S1AB 2QTHA 4LJ6A 3OHMA 3SS8A 2A9KA 1DO2A 1FUKA 4R9UC 2OLJA 5H1YA 4DJTA 3DOEA 1LB1B 1NN1A 2J7PA 1KMHA 4Q47A 1U0LA 5F98A 1N5JA 3RC3A 3U2QA 1E2EA 1SVLA 2ZANA 2ZEJA 4QNRA 5A0FA 4PSAA 5D3MB 2D62A 1N6NA 4Q4JA 2OUKA 3O47A 2Z4SA 4P33A 4CIDA 1VG0B 3BBPA 3EPKA 4AYTA 5J4VA 2IBMA 1JJ7A 1CKEA 1XMJA 2IYLD 3TBKA 4DUGD 4JLPA 2GXAA 5AJXA 1SULA 4TLCA 4C7OB 3N2EA 4OHYA 1AIPA 1OJLA 4FMDB 4TWZA 2B6HA 3GLHE 2IUSA 1G5PA 1Z0FA 1KK1A 4PZYA 3LBNA 4P32A 2QMEA 4E5UA 1J7KA 2ZS9A 3U6BA 1TQDA 4RZ2A 3LW8A 2CK3D 5JHGB 2ZTSA 1DARA 3AB3A 3I3SR 5FOWA 4ESHA 2J0VA 1GRNA 5C4MA 4IOLA 3PVSA 4ASUA 2WJIA 4GT1A 1OXTA 4RZXA 2P5TB 4LYJA 5JI2E 3VR3A 2IYQA 3LVQE 2LKCA 1G3UA 2E9SA 1W0KD 2JA1A 2V54A 4G5SA 2WOJA 4ITRC 4M9QA 1GDDA 1HQYE 3U3KA 1QHXA 2FG5A 4MA4A 3U7HB 4LCBA 1OH7A 4M1YA 3THYB 3UPUA 1FW6A 3RC8A 4C0LA 4IOKA 3GJ6A 4D4KA 5GVSA 4G0NA 4Q01A 1D6JA 4AKHA 3ADKA 1Z2AA 3U4QB 1N25A 4TLDA 4DT1A 1BMFA 1VYTA 3K8YA 4MGKR 1YZLA 1M6NA 4ARZA 4YMUA 1AKEA 2ONJA 3AVQA 3EZ2A 3Q8XB 5J47A 3TSOA 3SU8A 5JCZA 1E3MA 2NG1A 4KBGA 1G64A 3AVWA 1WCV1 1I2MA 4HDQB 4N0DA 2K5UA 1N6HA 4QJ3A 3MD0A 2DCUA 3RHFA 5HE8A 4OKSA 4V0OA 3TSZA 2PJRA 4OI0A 3T1VA 1II9A 4L9WA 4G5RA 2IUTA 3DDCA 2FV8A 4DDUA 5BWMA 4UNNA 5CJPA 2ZJBA 3RWOA 5JS7A 2PLRA 5L3QB 5J5CA 4IW3B 1WF3A 1Z0KA 3K09A 3UATA 1LS6A 2X8AA 4Z8XA 3U44A 3NC1C 2IYSA 1D8TA 2EFHB 1SVOA 1GNPA 5G41A 1L4UA 1ZYUA 3QI2A 3KQUA 2ZM5A 1E0JA 5CDFA 2ZR7A 1A1VA 1CR0A 3GLGA 1IM2A 1JALA 1OB5A 1RRFA 2FWRA 3N5CA 3LH5A 2QP4A 5IDVA 4OHZA 1E2FA 3GEEA 3U61B 1CBUA 2X77A 3KXLA 3EA0A 3ZS8A 1SXJC 2WSSD 2PEYA 4GOJA 1ZUHA 5GJVC 1R6BX 2FPMA 3K70D 4HZUA 1JR6A 3RANA 2YWFA 1ZCAA 1NG1A 2I1VB 2PH1A 4LYFA 5EUQB 1XB2A 3W90A 2VP9A 1KSFX 4Q4HA 4TYNA 2WJHA 3JZMA 4DDWA 1CR4A 4EDHA 1W7AA 2YC2C 4N0EA 2YJTD 3M6AA 2QRZA 1YQTA 4X8LA 2DWQA 3WYFA 2CE7A 2YYZA 2F1RA 2ZJ5A 1Z06A 5FTNA 2YVUA 4Q48A 3C5HA 5K8LA 3SQXA 4B2LA 3WRYC 4DLSA 3NBZC 1CRPA 4B74A 1KI4A 3HDTA 3JZAA 1KNQA 1PUIA 3VX4A 4UJ5A 1T5IA 4HLUA 2V8OA 2OESA 3AKCA 1DEKA 2GJAA 1NG9A 4DSUA 1SVWA 4MYTA 4US0R 3LXRA 5JS8A 3I5YA 5CK4A 2ZR0A 3JVUA 4YMSA 2WWXA 2F6RA 4TQAA 4TMVA 4PSKA 4HAYA 3MJHA 3SC3A 2C9YA 2XSZD 1GOTA 1QDEA 1IXZA 4URXR 2CLDX 1K5GA 3FMFA 4M1SA 3QPWA 5CLLA 4DC9A 2O8FB 4LJAA 4JVLA 3ZQJA 2W6JD 1I4TD 3QEJA 3H2YA 3THOA 3G5UA 4OL0A 1FOEB 2IXFA 2ZR9A 5JRZA 2ZRLA 3TRFA 4IEIA 1RKBA 4AYWA 1F2TA 1U9IC 2BM0A 2OZEA 1BIFA 1W5TA 3AF4A 5HCIA 1NSTA 3M0EA 1T3HA 2O0KA 3LW7A 4ZV4A 3HP1A 2VSOA 3OE7A 2VSFA 4YXWA 1P2SA 2ONKA 3EPJA 2DFTA 2V4ZA 1T5LA 1X1SA 2BEKA 1Z0AA 1TMKA 3CR7A 2H8KA 2ZETA 1KJZA 3BFKA 2AK3A 2A30A 5JHHB 4U02A 1U81A 1S3GA 2WWHA 1E2JA 3RS2A 5LD2C 4LK2A 5DISB 5DN6D 2OG2A 5LB2A 2CLCX 3C4JA 8OHMA 1W0JD 1I4LD 6Q21A 1RPZA 3K9GA 2FX3A 4UNPA 1ZIPA 1JI0A 1CTQA 3GFTA 1JR3E 4P4UA 3D6TB 1QHHA 4HAVA 3RSOA 4FI3C 1ZNXA 2YHSA 4FWIB 4C3ZA 3QXSA 2BMDA 1PUJA 1ESMA 5SZIA 4FINA 1AKYA 4PQYA 3H4MA 3KJHA 3EZ7A 2E87A 5FTMA 2ZUCA 2JJ2D 2ZUDA 3DZ8A 4HUTA 1X8KA 2G88A 2DFNA 2ZI9A 3CH5A 3KL4A 3EWSA 1HH4A 3K0EA 4MGIR 3I32A 4B3BA 1ZP6A 1Q57A 3GP8A 2G0TA 5FOTA 2FU5C 3SJCA 1G41A 2ZUBA 4Q9JA 2AWOA 2OBMA 3B85A 4RVCA 3BGWA 1KO8A 4QGAA 1W4BA 2GEDA 2GNOA 2PX3A 3LNCA 4EFMA 4C0HA 3LBHA 3LA6A 5DHAA 4ZKEA 4LY6A 4HB2A 4EFLA 1YRAA 1S1MA 4FD2A 2ZRMA 1EFTA 1MO5A 2VQSA 2P6NA 2YOGA 4IKEA 1KYIA 2BDTA 2EFGA 4NCHA 4EUNA 3AM1A 5DIFA 1RJ9A 2R6DA 1UBGA 1E2NA 4QOSA 3AP2A 3VAAA 4MRRA 4URUR 4CEJB 2IXEA 3NBXX 3MUFA 2GKSA 1CJMA 1TF7A 1U0HC 1G5RA 5AJWA 3PFIA 3WNCA 2XNDD 5EZ6B 1E1QD 1G7TA 1XPUA 3AUXA 4OQLA 1JAHA 1NSFA 2QAJA 1E2QA 1HT1E 3QG5A 4LI0A 5G3ZA 3TE6A 1Q3HA 2F3TA 2JASA 2NTYC 1JR3D 4D4JA 3VKWA 1U99A 3OEHD 1E79D 1QHYA 1T8TA 2OILA 2P6RA 1M7GA 2ZSEA 1FMJA 1S2MA 4Q7KA 3MGCA 4JL5A 1GG2A 4BLRA 5L3VA 5G3YA 4LV5B 2WWFA 3CO5A 4C0SA 2JLYA 4LV8B 3R8FA 2BBSA 4LC1A 3VX3A 1NN5A 1CRQA 1XXHA 4TTRA 4B75A 4Q1FA 3NC0C 4TMZA 2CK3A 3IUYA 1R2QA 2ORWA 3KFVA 4YMTA 1WA5A 4B3GA 1XCMA 2VTKA 3OIYA 4CVNA 4HI0E 3KQNA 3NH6A 3Q7PA 2BJVA 4O2RA 3KUCA 1S0UA 5FPYA 1LS1A 4TSFA 3PEYA 4AG5A 4I1SA 1IN7A 3AVYA 2NQ2C 1KGDA 3B9QA 4W5WA 2XTNA 2J87A 1G1MA 4QGGA 2WJVA 3O8CA 4GBMA 1LW7A 4M9SA 4HB3A 4KFSA 1W36B 1YR9A 1GSIA 1SVIA 1Z0DA 4QBIA 1XTKA 2IYXA 5C2JB 4Q1DA 1SVMA 2H16A 4H1VA 2DFLA 4OYHA 4S35A 2GAAA 2CJWB 2JLQA 4M53A 2D3WA 1MR3F 4Q18A 2H57A 1DG3A 4IJMA 4BFTA 1QZXA 2HF8A 4ZCLA 4PC2A 3ZIAA 3RLFA 1SVKA 2WWGA 1II0A 4V0MA 3EPLA 2JLWA 1DG1G 3CM0A 1N6PA 2VLIA 4DBLC 5DYGA 3FWYA 3W34A 1R5NA 4ZIRA 2CNWD 3CZQA 4M1WA 2VF7A 5FOUA 5G53C 3WMEA 2KB0A 3GLHA 1UEJA 1US8B 5GVRA 3TAHA 3WMFA 2ZITA 4HDCA 4M1OA 2A5DA 2WIAA 4HZUB 4YC7A 4HATA 4ZDKA 5CYOA 3HPRA 1UF9A 3DPUA 3A6PC 1SHZA 821PA 4DZZA 3QKUA 3ADCA 4PC1A 2RGAA 2DPXA 2QPAA 4HDOB 3TAUA 5J4LA 3NDPA 2Q3FA 2C03A 2NO9A 3A1UA 2PT5A 4NYJR 3B82A 3LAWA 4Q21A 3PUZA 5HPYB 4GZMA 4DLUA 2ZYUX 2V6IA 1QHGA 1NLFA 5CDFE 1Z47A 2WZQA 1TL7C 4AKGA 2HCJB 2REBA 4JLDA 2AKYA 1XMVA 4ILEA 2AHOA 3L0PA 4JKYA 3W8RA 3RS5A 1TAGA 4F4IA 3PUWA 4DLXA 4EPWA 1IXSB 4LHYA 4UKDA 4OK3A 1CJKC 4XSGA 1XMSA 5FOSA 3NG1A 1RRCA 1OE0A 1LF5A 2GK7A 2AFHE 2RB4A 4TLEA 2GJ9A 4IDOA 3KX2A 2ZJAA 3EA5A 4KCGA 5AJYA 2HJVA 3CNLA 3HWSA 1NVXQ 2KSQA 1COWA 3D3QA 2J0QA 2NMVA 1NIJA 1XEFA 1AN0A 3WNBA 3RS3A 4Z54A 1J8MF 1TEVA 2GK6A 1NJGA 1L2TA 3BJIC 2F1JA 2VP5A 4GZLA 3CNOA 2GCNA 1TF5A 3THYA 1N3BA 4IEEA 4RFSA 1UDXA 3EIEA 2RGNC 1W48A 2B7CA 3UG7A 4A1FA 5JWHA 1F2TB 4HAZA 3L43A 2D2EA 1EXMA 1G6OA 2XOKD 1G3MA 1XTIA 3B6EA 1E2MA 1UFQA 3PEVA 4Q1AA 3ZD6A 1IAQA 4OHWA 2QNRA 3NEJA 2ORVA 3VR4A 1NNEA 4TYQA 1ZD1A 4KYUA 1T3LA 4EPRA 1Q44A 2L0XA 2ZRHA 3AGPA 3K0AA 4L4UA 1GRRA 3ZVLA 4IOJA 4XVUA 3I61A 3T1OA 1QBKC 3D7MA 5AUNB 5L3QA 4DVGA 3FHCB 1E0AA 2Z83A 2QBYB 2C2HA 3A8TA 4YQFA 2W2VA 3BE4A 3L0OA 4NPHA 3LY5A 1QG4A 4LWZA 3T34A 1R0ZA 3C8UA 4RD6A 2MMGA 4W5JA 3MWJA 4JBYA 1L4YA 5E7IA 1QHHB 3LXXA 4CYMA 4TL6A 2HCBA 1FQJA 5P21A 5CB8A 1GL9B 2JDID 2W0MA 1N0UA 5EE3A 3R9IA 1S9HA 1XMIA 4LYHA 1NI3A 4NP6A 1KI3A 4TL8A 4NTZA 3O8BA 3A1SA 1JJVA 5FPHA 2OFWA 2DWPA 5HKKA 1X1RA 1FQKA 2ZVQX 1AJEA 5JSZB 2ZE6A 3B1XA 4NL4H 4MRPA 2OLKA 5DI3B 4B47A 1C1YA 3EX7C 3U5ZB 3EZ9A 1W2HA 2W83A 3TVDA 4B2IA 1XPRA 1MO3A 4WAUA 2FFBA 4XIGS 2ZROA 4LGMA 1IN6A 4W5HA 1J2JA 2F3RA 2ZRAA 1GUAA 3HU1A 4Z1MD 2JJ2A 5E95A 2W00A 1X86B 1M8PA 1AGPA 1D9XA 1HYQA 3T1QA 1R10A 4FMDF 4MDEA 1CXZA 4A2QA 1X3SA 2IYWA 4M1TA 3X1XA 4TTQA 4KFUA 2JLVA 2O8BA 3OEED 4URYR 4G1UC 1PLKA 3U3RA 3FFBA 4JLNA 1RJ9B 1NP6A 4NBSA 1Y3AA 2GILA 1WBDA 1ESNA 1GP2A 3KJGA 1TUIA 2CE2X 4XTCS 2P6UA 4V02A 4HEJA 2FSIA 3W5JA 3FKQA 3HYTA 1TF2A 2WMOB 2XEXA 1OIWA 1VCIA 3GEIA 3QXCA 4AYXA 3ZD7A 4FCTA 5KSYA 2Q9BA 4D6PA 4E03A 4NCKA 4UXJA 3IIKA 3NIBA 5AUOB 2WJGA 1YVDA 4Q9LA 1CR1A 5DO9A 1XD8A 2A78A 1OSNA 4BEJA 4KLZA 1G19A 1N6OA 4EPYA 2CXXA 2ZRPA 2YWHA 2IHBA 1E1QA 2WBLC 3WHLA 1EGAA 3CUEF 1XNJA 3KDSE 4RD4A 3V4RA 3ZZUA 1JR3A 1TQ2A 1XJQA 2AXPA 3T15A 1Z29A 1EWQA 3BORA 2MSCB 3E1SA 1Q12A 1KOFA 1XCGB 2GRJA 4CEIB 2NO6A 1YR8A 5AWFC 3KFXA 3B78A 1KO7A 4DDTA 5JBQA 2BBTA 3KKQA 4P4SA 4EPTA 3UMSA 1KI7A 1ZRHA 2CMKA 2OCAA 3KQKA 2O8CA 1WMSA 3VR6A 1W36C 1Q1EA 4LBYA 3U3JA 2UVQA 2HF9A 2RKOA 3EC1A 4RKFA 4RZUA 3DHWC 3Q3JB 5TB5A 2BV3A 2FH5B 1IJFA 1AQYA 5EQTA 3RDPA 4RD2A 3K09C 1GNRA 5EJEA 5JWOA 5EXSA 1G21E 4PPNA 4GRAA 1KNXA 1CULC 3RAPR 3KXIA 1E2GA 2KE5A 2AL7A 3AH8A 5HZKA 5GJCA 5FL3A 5JRJA 2NZJA 3U3OA 4FWTA 2ECKA 4G5GA 1F60A 1T3SA 4L16A 2FDCA 4Q66C 1M74A 4N3NA 1DAGA 1F3OA 1FUUA 2J7KA 3NWJA 3RS7A 2SHKA 4JKIA 4TL7A 4P0TA 3K1JA 3SDZA 3KTAB 1UBCA 5J4KA 4C2UA 4TT3A 1N0VC 1UBEA 3ADBA 1SXJD 3CZPA 4DLTA 5H70A 3SYKA 1GKUB 1GRQA 1PJRA 2AK2A 3R20A 4D80A 2VL7A 4LJ7A 1N6LA 1K6MA 4MUAA 1VG8A 1ZM2A 3HR8A 4P4TA 2CNWA 2IYZA 1TU3A 4CEHA 2ZRJA 3UKDA 5JCPA 3GJ4A 4C4PA 3DKVA 1N0WA 3BFXA 4K8OA 5C4GB 1KO5A 1F48A 2F9LA 1YZUA 3B7GA 4M1MA 3K70B 2QTFA 3SNHA 1AQUA 4BLSA 2Q0HA 1KI6A 2CL0X 4V0ME 3RRMA 1ZUIA 4RKEA 4HLUC 5AJVB 5JMTA 2P2LA 2QU8A 4CEJA 1VHTA 3FFAA 4NYJQ 4LOAA 5FBVB 1MV5A 1P72A 4I1OA 3L0SA 3B13B 2IYUA 5EXXA 3GCGA 2OAQ1 3I72A 5KSOA 2YNMA 1KI9A 4F93B 4KFTA 3K0CA 3C5CA 1UM8A 2IWHA 3U3MA 4CRWB 4ZDIA 1A82A 3CIOA 1NVUQ 1OPXA 2IXGA 1YE8A 3IKJA 4GSYA 2F55A 3GJ0A 1NY5A 2HUPA 4MRNA 4C0BA 3PEWA 2B21A 1ZNZA 4BFWA 1VCNA 1KY2A 5KPDA 3LRPA 2FFAA 5AUQA 3QPVA 1W1WA 1U2RA 4BZPA 3O8RA 2FF7A 3RYTC 2A5YB 1MT0A 2W2XA 1AS2A 2JATA 2C99A 1V43A 1ZVQA 2ZSDA 1IN5A 2IS2A 1OT3A 1X6VA 4MITA 4RFSB 2IWRA 2J46A 4QJ5A 1WBBA 4W7SA 2ZI6A 5FUWA 4E22A 3AP3A 4B32A 3N2IA 1MO4A 4QM7A 4QG7A 2Z43A 3QKSB 2YV5A 3AUYA 3OF5A 2D74A 2OXCA 3AVOA 1P9RA 3IBGA 1ODFA 4OQMA 2ZJYA 2ZVPX 3P26A 3U6KA 3K0AB 1JEEA 3L82B 1ZC4A 2XOKA 3B2EA 3QSYA 2OCBA 1G20E 2WKPA 2YOFA 4L15A 2ZJ2A 4B3XA 5JJLA 4Q9HA 1QVAA 4TMXA 4OI4A 2Q3MA 2VYFA 1E1RD 3QVVA 4R2IA 1Q1BA 2CJWA 3CF6R 1T8UA 2IC5A 3FKSD 1W49A 3AKEA 5BN4A 5JJKA 1XJ0A 2J45A 3K53A 3FYHA 4B43A 1XBTA 3FMPB 1DO0A 4PFSA 5FOVA 5L8VA 1N5LA 3N70A 4JIMA 4AC9A 1OIXA 2Q6TA 5EE5B 2FZLA 4KSCA 4PTLA 1TQ4A 1ZNWA 2CBZA 4FMCF 4PR0A 2QG6A 2FPKA 2RGCA 4LHVA 1US8A 2GXQA 3IBYA 1N5KA 1Q3TA 4HLQB 3X1WA 3GLFE 1TTTA 1MKYA 2ZRKA 4O0MA 2HLDD 1KDTA 5K8IA 2IYYA 1UDWA 2C77A 1YZTA 1IXRC 1NVVR 3TR5A 1GTVA 1DAIA 4JBWA 1FNMA 2QY9A 4AD8A 1XJCA 3WYGA 3HJNA 1NN3A 2O8BB 1RRGA 1Z6YA 2UZIR 1E2PA 2ZRFA 3CPHA 1C4OA 4V0LA 4I4LA 2DR3A 5IF9A 1SQ5A 3I4LA 4OJKA 4TN1A 5DNYB 2REXB 2VHTA 4PC3A 4XD7D 4BPBA 2ZJOA 4Z1MA 2C78A 4IXMA 1NLZA 1OFIA 4WZAE 1KSJA 4Y0AA 5EE0A 4PPGA 4A8JB 4F38A 5IRCD 2HXYA 3A1WA 2F1HA 3GFPA 1XTRA 2GZAA 3KUDA 3TUIC 2VBCA 5C46F 3G0HA 3A4NA 1H8ED 4EFNA 5BQ5A 2ZSBA 2FEMA 3OEEA 4MYCA 3IIJA 1Q0UA 1W46A 3THXB 3PV0A 5EZ5A 5A4JA 2YKGA 2WJYA 3SZRA 4C0JA 1WRBA 1BS1A 4R71A 3F3YA 2ASEA 1XEWY 2J3EA 5FPSA 2CHVA 2QP3A 2R8RA 4PO9A 2IYVA 5KYKA 3VQTA 2MSDB 1IOZA 1PZNA 3K0FA 4BASA 4BFYA 2AD1A 1OLOA 3WMGA 4DRZA 1XU4A 1KDRA 1MRSA 4QC2A 2PZEA 4OBEA 1DAHA 2BM1A 2GXUA 4TMWA 2FSGA 5JI3E 2A7QA 2H5EA 4RCZA 4TMKA 4F4CA 121PA 2B8WA 2WPDD
chains in the Genus database with same CATH superfamily
3GU3A 5D01A 4FDMA 3DMHA 2G67A 4NWIA 2ZRNA 4NX2A 1WZEA 1A8IA 4MCIA 3DBRA 3KPWA 3QXXA 1SQFA 1XDBA 1MRNA 3FPHA 1K6IA 1IVYA 1J0XO 2G40A 2VHCA 3JQAA 3NAGA 1JAYA 2FMIA 2V3VA 4HYEA 4DVJA 3UB4A 3KZXA 1HA3A 2Y2VA 1QHIA 3ZHRA 4R16A 4JLVA 4O3MA 2QR2A 5ERYA 4DY6A 3HU2A 5FTLA 4BMOB 1C0PA 1RMTA 1B1AA 3DEJA 5JY1A 5T4BA 4G0VA 1UXGA 2NLOA 2BP7B 1ZCZA 1XCOA 3I04A 3NBQA 4M0LA 4X84A 5EYPA 2A1IA 1BDIA 2G0AA 1XK7A 1RJEA 2DHRA 3L9WA 2ZIAA 2AZ4A 4FDTA 4J0IA 1R0LA 4I50B 1TKCA 1M0EA 1MVOA 2WP0A 3O73A 1BXZA 3OIVA 1EJ6A 4TYPA 2VQ6A 3S44A 3HU3A 2ZKLA 1AO3A 3PHCA 1ZSNA 3B5JA 1SOAA 3NR2A 4GO1A 3ORFA 4KODA 4KPEC 1GNTA 1Y3DE 2LE0A 3DR3A 3LO5A 1ZMTA 4FIDA 4WGGA 5IJAA 4AMYA 5SICE 2PSSA 4M88A 2XQVA 1M2EA 4I6GA 4ZT2A 1E77A 1RYZA 1PGJA 3F4KA 4EI2A 5DE3A 1P33A 2HEIA 3QK7A 3VPSA 1FX0A 4AMUA 1LJLA 4CKBB 4ENVA 4LX0A 4PONA 1PNQA 3U26A 5AUPB 1H2ZA 3NNNA 5D6OA 1PIWA 4ZEOA 1C3VA 1WW8A 3RSLA 2AEMA 2XMPA 1MJGM 2VDQB 4I81A 3EGXA 4DQVA 5JSZA 5DI3A 5KTNA 1U4SA 1PG5A 1Y6QA 4MK4A 3RHTA 3S27A 4EX6A 3HKBA 1GUZA 4EA6A 4NJMB 4JYBA 1JBKA 4I6JA 2P8JA 4YJ3F 5ARDA 1CQJB 1RR6A 5T6BA 5FUMA 2R6AA 4KE6A 1O4WA 2GCPA 3RTGA 4GC9A 1ADFA 2R85A 3PQ8A 3CF2A 4D79A 2FUG1 4JYCA 4ZD6A 3L1KA 2XLCA 4YP9A 3HYLA 4CIYA 1TT7A 4GSLA 4AJ4A 2QZJA 3OOSA 3ZY4A 1E6LA 3VR5H 1W85B 1YB4A 3AJDA 3VYRB 4IGFA 4MWZA 4HMOA 4JI4B 1C3XA 1LV7A 2DBRA 1SA0B 4DSOA 4BKMA 2ZGVA 4M6WA 5FNZA 5E6SB 3REGA 4MLCA 1TADA 3F7OA 3R6TA 2PWZA 4IIHA 1R15A 2O7QA 3QMVA 3QMMA 3H17A 3WRVA 1QK4A 1QSGA 1KAQA 5D7NA 5EHNA 1KE1A 3LY7A 2FAXA 5KO2A 1IVNA 1GPMA 3KKNA 1KZYC 2LKDA 1EJBA 2PZJA 1NPDA 1H2AS 1Z3CA 1DFGA 1HETA 1XWIA 2Q2QA 4Q1CA 5E4FA 3L7YA 4ZEWA 1I2DA 3NAQA 4MHSA 1YNSA 3KT3A 1G8SA 2QTBA 4QO8A 4POAA 5EKXA 3NIWA 3V7WA 2R7MA 3MWFA 3PFHA 1PDVA 1U7TA 4GOKA 4KSYA 4OJMX 4GUDA 5TQ2B 3TF5A 4XRRA 4RZ3A 3U60B 4Q9AA 4UZSA 4PCLA 3RK0A 2ISSD 2EX1A 2G6BA 1NA5A 2VG8A 1VCMA 1LUAA 3PGJA 1X1TA 2EARA 5KQSA 3BCSA 2XQJA 3QIAA 4GX0A 2IHYA 2B20A 2XMZA 2BCGY 2ROQA 1U02A 2XB8A 1R4NB 3PEUA 4Q39A 4XUCA 3E70C 4LSMA 3KJZA 3NWPA 1RE0A 1Y3BE 2RIRA 2H2DA 4IO1A 4BTEA 4N12A 1SB9A 2GHIA 1U1GA 3MRTA 3Q2IA 5B57C 2MCFA 3U56A 5A03A 3L18A 2X0EA 3C70A 1FSGA 1MJ5A 1XTZA 3UIEA 4ZI2A 3SZ3A 2QUJA 4YAGA 1XD9A 4CEIA 3ZHUA 1J2RA 5C18A 4WKBA 3T7AA 5DCUA 1M5TA 4GMGA 5I9TA 3V2UA 3NNSA 3V8PA 4B7UA 1C9NA 2WWRA 3FM9A 5KOHA 1AQNA 1VRWA 4UM7A 4YDQA 2FW7A 1AK9A 2JJQA 3Q1KA 1TZKA 4KQJA 4PRLA 5DI9A 3ZBTA 1VHWA 4HSEA 4CT5A 1EQ2A 2FZCA 2Z8ZA 5I7VA 2BYTA 2DERA 2A4KA 1MQAA 3WIDA 3HCBA 4TQGA 2BVNA 3R41A 3FPCA 4ZVRA 1CU1A 3OZTA 4Q00A 2UVDA 3Q40A 3UBMA 1TECE 5EWMA 3ZU2A 3BA1A 4X90A 4B9EA 4IL5A 4ZANA 1TYZA 1UANA 1GD1O 2ODNA 1HFEL 3BJEA 4RFVA 4QM6A 3A6EA 2O3TA 3WC4A 1ZD8A 2F4NA 3BB4A 1VTKA 3P27A 2VBIA 4OAOA 3WGOA 4Y0NA 2F8MA 1LC3A 1L5GB 4RPHA 1V37A 1IH8A 1D2MA 5LLDA 4H7EA 3UPDA 2XTZA 3E9YA 4EZIA 1CJVC 1REQA 1ZRSA 2YRFA 4R5MA 2AXQA 3LL4A 4LGYA 2BMVA 5KNDA 1EXDA 3I6MA 5BYBA 2NW6A 3V6MA 4TL9A 3QOFA 5IAJA 3BWYA 1XEXB 4DKJA 4TUYF 3CB4A 1P29A 1GZVA 3V6LA 4CI9A 3OMWA 3GEDA 4P5EA 3RC8A 3YASA 5I9IA 4MVJA 2IBSA 1J4AA 4LVOA 2DQZA 3M5WA 4FZ3A 1U80A 3FTPA 1PGPA 1ZJ6A 5LP6B 3M1AA 5LMCA 4I4IA 4URVR 3BGVA 2NAPA 1RS0A 3OOHA 3JR3A 4MWTA 3CLTD 4GKJB 4UCXA 1N2CB 3SK0A 1EA7A 4HRVA 4LZZA 3VU8A 4F2GA 1UQRA 1IHYA 3IRVA 1RQXA 2WSSA 4ENQA 1CY0A 2H92A 5H80A 1X2BA 5AW0A 4NYMR 3JARA 1JDZA 2ADMA 3KQMA 3LGXA 4IXWA 2ZWIA 4C4YA 1FP6A 3CX6A 1EGHA 2C3PA 3LK6A 3T5BA 3ZE7A 4B31A 4EAAA 4RKYA 5CXQA 5AW7A 2Q1WA 2O2IA 3MINB 2HSEA 3ZC3A 3A4LA 3VDXA 1OH6A 5CLGA 1B7GO 4GU5A 3IJPA 4TVBA 4A8JC 3O3MB 4W5QA 4L0QA 4ZN6A 3JQ7A 4KLNA 2JH8A 1BDBA 1NONA 4RMGA 4HR7A 2B4KA 3ZH9B 1TAHA 1ZK4A 4TMTA 3NV7A 1FP4B 2PS9A 4W1PA 5ADHA 4MAMA 1O9HA 3ILHA 3DAYA 3CG0A 3C98A 3R0VA 2Q4RA 3L7AA 3OC0A 3TW4A 2XVXA 2I67A 3PNKA 3QWAA 2IPLA 1N2CE 5I4CA 4BKRA 1ZFNA 2X3UA 3M4YA 4LDJA 3U7FB 4ACBA 1E92A 2ODQA 4KKXB 5CTJA 4GDFA 4AJPA 2NXJA 3LP8A 2I55A 1M8FA 4LQ4A 2OQ2A 3QITA 5DLQC 4UEJA 5D86A 4G8DA 1NF2A 1BHO1 5ADVA 1DWQA 1G5QA 1DEAA 1H8EA 2MINA 1JPNA 2PXHA 1VJ1A 3S2FA 2ZSAA 1PEKE 1L6IA 4D9HA 3F5FA 2X9LA 3JYOA 1UWVA 4NCAA 2Q41A 3QU4A 3IURA 4RU1A 3G3EA 5JTUA 4OHBA 1OBCA 3B1JA 1CRLA 1JG6A 3FOAA 3PQFA 1N9GB 4JBHA 5B58C 5JDCA 4WI1A 3D31A 1RDFA 3U48A 4HGOA 2BFOA 3FYUB 1QGOA 3GJQA 3NHLA 3QKSA 2O5VA 4FHZA 2V74B 1E9RA 2JGLA 3HHPA 5GOZA 2C83A 1QIMA 1DQRA 2AKEA 3D8NA 4LQCA 2NUBA 3MPUA 4PLWA 4PYOA 5GONB 3WGLA 4B0PA 2EW1A 4WXPA 1VI6A 3ZV6A 3LTNC 1NBME 3CF0A 2WDPA 3S5UA 2PUGA 1MB3A 4R41A 4BZZA 2EEZA 3QY0A 3GLFA 5J9FA 3AHEA 4O0LA 2NU6B 4Q9NA 2FFRA 4DYVA 4YUWA 3ZBQA 3VTFA 4TTPA 4U7FA 1BN7A 4E31A 4C14A 1SR8A 4REQA 3WBKA 4HX2A 3QUAA 4JUBA 3VR5A 5DHTA 4JA2A 1F17A 1DX6A 4BLUA 3EXAA 2H2IA 1C9KA 3VHXB 1E2UA 1CF9A 2PA3A 4RS3A 4MW9A 4Y98A 4DQUA 4KUHA 4GP9A 2P3SA 4ZMBA 1EUQA 1VMKA 3PGA1 1JDUA 3DDOA 1L4EA 3PDIA 1RWBA 4EZEA 4QX6A 4JD5A 1B14A 4JI0B 2VT2A 3FNIA 3IQGX 2Z09A 4X85A 3VPAA 1GIAA 1QKKA 2ARKA 1UJ4A 3VHLB 4RQAA 1X39A 1Y5NA 2GRAA 2Y1KA 1D0SA 2EKPA 5ESWA 1A98A 1U8TA 1H4SA 1S01A 4YV2A 3AF1A 2JFZA 2YHIB 1ZO8A 3T3HA 2QM7A 4CLEA 1JEYA 3OCYA 5CVDA 2WA1A 4NOLA 4BNGA 1E7QA 4XFJA 2YFHA 2D2IA 4Z0TA 4YQEA 2NU8A 5JAMA 4E5SA 1I1OA 2Q3CA 3FHOA 3GAFA 3CF4A 2HU5A 3N86A 4Q02A 2J59A 5DYTA 2HNKA 1T2AA 5C5EA 5F5LA 1NIPA 5JT1A 2JPDA 2WAOA 1S02A 3WYCA 1A7KA 1V7QA 1ZM9A 4PLYA 4CXMA 2EDAA 3B6IA 2GYVA 2XZDA 2JAXA 3KXDA 2XLBA 4FHGA 1P6XA 1VL1A 3V8EA 5L4NA 2B7LA 3DFUA 3NHWA 5CMLA 4PY2A 4DCVA 3RSQA 3DFKA 2KBFA 3FRIA 4E14A 1QNLA 1HE5A 3FFTA 2WU8A 4MQFA 3U16A 2UXDB 1IIRA 1YR1A 2IEAA 4LKRA 4MYDA 4IWYA 3N2YA 2R6HA 4G0YA 2DJ5A 2QUKA 5FYQA 3KNZA 2QUAA 2VQEB 5EESA 1TFUA 5SYNA 2V1XA 4FW9A 3BL6A 3JAKA 1BA2A 1GQSA 2LRHA 3LX5A 1U1DA 3NGLA 5TNXA 4I4TA 2ZB7A 4QDTA 4XI9A 1CNMA 4PHTA 5CNMA 4X00A 3ZHYA 3MTBA 2EFEB 3ZXXA 5LA6A 4Q93A 1K6XA 1K2VN 4GOXA 1LRLA 5F2NA 4B33A 3N76A 4K5QA 2G1UA 3DNMA 5BN3B 4URZR 5KSPA 1RCUA 3ET4A 1WP9A 5HIAA 4KH0A 1EUZA 1QYRA 1N6IA 1V8FA 3MCAA 4RDHA 5E0KB 3VNUA 4QYIA 4A0FA 4A0RA 3P9KA 1BAPA 1CIPA 1V3QE 3GVCA 4QDOA 4UDYX 1THZA 1JXOA 1MXHA 2JS7A 4PX2A 4MR8B 4RA9B 1IBLB 3N6XA 1S6YA 5HVNA 2AOUB 2AZXA 1RYFA 1WXEA 2ZB2A 2D6FA 2VKTA 1QLJA 3M2PA 5E9WA 1PDOA 5B1DA 3VSBA 1V9CA 2C8KA 4E13A 2BN4A 4M8SA 4P7FA 4DYDA 4Q3EA 3HCWA 3DBHB 2ZB4A 2W6ID 1K0FA 2X0NA 4A92A 1GAJA 1PHRA 2IKSA 2F3QA 4U2KA 1X19A 1E9SA 4YI5A 3OU2A 3TIIA 2M1XA 4YCBA 1Y7PA 1I7QB 2I80A 3RUDA 3R7FA 3STYA 1R8SA 1A7UA 3X1YA 2PMEA 5FV4A 2V55B 4BV3A 3S81A 1QGED 3PD0A 4FPXA 1BROA 4IHJA 2JRLA 3VYWA 4ONEA 4AJHA 4BB9A 3SVTA 2AMYA 2PKWA 2C0PA 4WVFA 1SXPA 4NCXA 4BMYA 1YQUA 3P2MA 4LWPA 3IA2A 3CVXA 4MGYR 3IEUA 5JV5A 4KXLA 4HPJB 1UBSB 5TRTA 1YS7A 3G6WA 4LC0A 4UM9D 3RV4A 5T7BA 1T2VA 1FDTA 5B58T 4BKOA 1DVRA 3IB6A 1ZWLA 3KYCB 4V0KA 4MB0A 1YUBA 2JIPA 3A31A 3DCIA 3H5TA 3WIUA 1J7JA 1E4VA 2OORA 3P0IA 4DIKA 4KQIA 4NJMA 1XHEA 1UAGA 2Z6AA 1VSQA 1QNFA 4G63A 4HDKB 2NP6A 2EL9A 4U3JA 5I7EA 4ENTA 4Z4IA 4B48A 2QNBA 3TKLA 1YHNA 3WRXA 4M22A 3NHFA 4H7PA 2VWPA 2ID7A 1WZNA 1X1EA 1AOXA 1VJ0A 2FMXA 3SJAA 3T3GA 3TLAA 2V0GA 1L5QA 2FR0A 4C4TA 5IYZA 4F56A 1Z07A 1GPYA 5FPTA 2HV8A 3BJRA 3C3PA 3EQ7A 3NTXA 1DOHA 1SN7A 3ECCA 4L0DA 4NNPA 1OU4A 2YVKA 5ESDA 3ROQA 1ZUNA 1MAAA 1J99A 1OILA 1R5BA 4O4LF 1DZ3A 1ZMOA 2VP2A 1RXUA 2G07A 3ANMA 3R5XA 4CL0A 4KITB 4NI5A 3GJ3A 4JH0A 4GOMD 4HFJA 3ZUPA 3I42A 1VP9A 2BZSA 2C1EA 3H9BA 2GWRA 5ALGA 4G97A 3VJMA 1IEQA 4U1RA 1Z0UA 3K8OE 4NXMB 4RTSA 5JNWA 1I4DD 4IGEA 2PVSA 4KGVA 4GX5A 1PX0A 4HNQA 5KJ6A 2O19A 4B4UA 2P67A 5H4HA 3QLJA 4IHQA 4IDEA 1CQWA 4HY3A 3LDHA 3NWOA 2QMUA 4JI5B 4V0NA 2Q1SA 5EIFA 3STWA 2WJ3A 1E1NA 2AOXA 4NH0A 3HZHA 1Y6ZA 1DFIA 4EKYA 3V1NA 2JJ1D 4HTAA 4INAA 2PMKA 2ZYVX 1L7EA 3SIPA 3TSWA 1TW2A 3P9ZA 2TMGA 2VHQA 1H5NA 1OV6A 1R4NA 1V11A 3MJSA 3AW9A 4B3SB 2XT6A 4Y0VA 3N1UA 3RG2A 3W6OA 3ZNQA 2UVPA 4NCNA 5IM5A 3CSDA 3R9KA 3QOYA 5F1KA 4A4DA 4AI6A 5K0FA 2VYVD 2JIQA 1V5WA 2G1JA 4R3UC 4RZIA 4D0RA 1CB7A 2OQRA 2VAVA 3CW8X 1RYDA 3QIVA 4GXTA 4C20A 2JLRA 2VRWA 2FCRA 2P9TA 1I4WA 3V8NA 3WP1B 4PZDA 3RC2A 2PL9A 1RM3A 2RHTA 4GPTA 1THMA 3HYCA 4A0HA 4YVFA 4BP3A 3ECAA 4IICA 1Z6PA 1IWPB 1PFWA 5KSZA 2EP7A 1UZAA 4EYKA 4MIOA 5JYEA 4KXUA 5LPNA 4ZJUA 5HQ3B 3MMZA 3KE9A 4S1PA 1K0UA 2E48A 2VIIA 3Q3HA 1N6RA 1I3OA 1A9QA 1E18A 1EU1A 1GNSA 4J03A 4ZAZA 2G06A 4UDNA 3VPHA 4WZZA 4A26A 3OM9A 2O0JA 2Z9CA 3DULA 4N5MA 2X58A 4G65A 1I6WA 2J9RA 4ZVLA 2IUUA 4Y9RA 1PBTA 1J42A 2A5LA 2IUEA 4NYIR 4RVOA 2M1ZA 5C9ZA 2FN4A 3JRNA 4P92A 3IEMA 4N3BA 3ZLVA 3LO8A 2QTZA 3GHHA 1XSEA 3HI4A 4M1KA 3DF9A 2DRIA 4DM4A 1FRVA 1OWMA 1OXSC 1HT3A 2E21A 1IBKB 2QF7A 5JCOA 1YWGO 5KYWA 1G5IA 1XEXA 3UTDA 2XE4A 4IF4A 4U2FA 3GIDA 4E3ZA 2ZRDA 5KQLA 3I5XA 1KOGA 3IAM1 4OXQA 1KE2A 2F9MA 4UUNA 5TF0A 1E0KA 2PXXA 3NQ41 1N5DA 3A2MA 1HYBA 3T1YB 1CQPA 2R87A 5KDDA 1E6EA 2I1LA 3A6KA 3GEMA 4JVNA 3TPFA 2GJ8A 2NO1A 5LP6A 1ZN9A 1DAEA 2D00A 2UZAA 4KBFA 3IT0A 1QTQA 3EPHA 1CD5A 3GARA 2CLSA 1CUJA 3TOZA 2AJLI 4KVFA 3V5NA 1Q91A 4CHTA 2E55A 2AKAB 1CS4C 1LZLA 3DVLA 4GNRA 2PX5A 2P79A 4JP5A 1ACLA 5AT1A 2H07A 3DL7A 2ZSHA 3ESXA 2ADFA 2O52A 2VFAA 4K9KA 3UHOA 2FRDC 4W9RA 5ULLA 1A4RA 2FQXA 2PXCA 2HIAA 5KYVA 3WGGA 3TI9A 2NYVA 2QAGA 1K7SN 4U39A 2OT3B 3MINA 2ZJ1A 4QBGB 4DW8A 3TGPA 2PY6A 1HE8B 3RS0A 2ZDQA 4JR1A 4F3RA 4I1VA 2TMYA 2XCIA 1E7YA 1CEEA 1B0AA 4EJMA 5KEIA 3BERA 721PA 3OLYA 2BMAA 1DZIA 4PIPA 1TYBE 1H9AA 4S2UA 2VF4X 3F46A 1A5TA 1RYHA 3VOBA 4DDKA 1U4OA 4HV4A 5JJIA 1CY7A 3D6NB 1XDUA 2AXEA 2GI4A 5JJCA 5A4FS 4B3MB 2JJ8A 3IAHA 3MMPA 4FSHA 4I6EA 3TEJA 4BMVA 4OHKA 5BVHA 3PHBE 1EFRD 2C2OA 1K8ZB 4QNMA 1GTJ1 3NHUA 1VL0A 2J9FA 1UBUS 4ALJA 4L27A 1AS0A 1NBMA 2XRYA 3JVEA 3VSAA 2LWIA 3B38A 1RZRD 3CE6A 3SWWA 4X66B 2PT7A 2GK3A 2Q46A 5DFAA 2GZSA 1M34B 1U3CA 4ODIA 1HX7A 1RABA 4YMIA 1I3NA 4U5XA 4A9AA 2JFFA 1YRLA 3NTLA 4FEEA 1IN8A 2WV9A 1Z22A 3T9FA 4HDNB 1XK6A 2IHVA 2CV0A 3R0QA 1BW9A 1OMOA 1X9IA 2IZZA 3RASA 3VI3B 4CQJA 3BMOA 4OB8A 2YZKA 2DT8A 1LCIA 2PNJA 5KSWB 4BFLA 4DB4A 1N9GA 2O1WA 1XCBA 4QGSA 1ZPDA 5DSXA 3VJKA 2P69A 4OMFG 3D9QX 2C9BA 3FVTA 3HGMA 3ZK8A 1GKIA 3D59A 2TYSB 1P4AA 4KN8A 1YACA 1EFKA 4EQZA 4M0FA 1YZQA 1I01A 1YK0A 2YR0A 1RZVA 1FVHA 1G1AA 1YH3A 4UM8B 3RH0A 5GONA 1YQXA 3BL8A 1P9OA 3NOOA 2OOKA 5FWYB 3OZGA 2Z8XA 3O83A 3K4HA 1HYGA 3DM9B 2R5WA 3NTUA 4WK4B 3V4SA 1A50B 2G7ZA 4ND3A 1USWA 1G8FA 2Q0QA 4MUHA 3U7EB 3NHRA 2PSJA 2HRBA 5C32A 1WXQA 3V33A 1ECLA 4AS1A 2X7JA 1MA0A 1G60A 2IF2A 4JP3A 1CUSA 3IXMA 4UUPA 1D2HA 4H27A 3WTCA 2NT4A 5FKJA 1E3IA 1H8HD 3IAAA 2NUTA 5AJZA 1A7AA 1WPQA 3S40A 3TKAA 3BAFA 1RSZA 1G38A 3GT7A 4DLNA 1Y4SA 3GH1A 3B52X 4H0FA 1SUFA 3MD9A 4X91A 4KR0A 1Z6TA 2FA9A 3EWAA 1O6GA 2MYNA 2NXNA 3CTMA 4IJ5A 3SHVA 5LOVF 1V6CA 3HS3A 1AV7A 1PG0A 4ZDWA 2O2SA 2CLLB 3PNBA 2QMHA 3LIPA 1SRQA 3FDIA 4PBRA 2CL5A 4LI3X 4R7ZA 2ZWAA 1KTIA 3ANTA 5C5DA 2C4WA 4E2WA 1E6CA 3VHQA 2FN7A 3VVMA 3TQTA 2XTMA 3AHIA 1QRAA 5DBGA 4EG8A 4C6TA 1NYLA 1IEVA 1TK3A 4PPQA 1O6FA 5K03A 4WKCA 2WZBA 3H13A 3KDAA 3PRJA 5LQMA 3JATB 1KPGA 4EATA 1OF1A 4NCIA 4MWOA 5I8ZA 1IUNA 1OIVA 2IYNA 2F2TA 3T9CA 4V38A 4X6YA 1Z5PA 4YBZA 5DM60 1P7ZA 3M4XA 3WQQA 3TRJA 3B53X 5JXHA 3H1EA 2C4KA 1RE1A 4GMHA 4KQEA 1ZA1A 4TS1A 3X2SA 3JWGA 4NARA 4AWXA 1RI2A 3I01M 5IP5A 3TLZA 2QIOA 1SGWA 1VPEA 4KXWA 5FBLB 3D4PA 4LJKA 4ZZ0A 4AF7A 1P2FA 5FL7D 3VPCA 3KSZO 2I4TA 1CS0A 5ADUS 5GINE 5IZCC 5CM9C 4YMLA 3TZLA 1F6BA 2A88A 4N6NA 4TUYA 4H2DA 3FR7A 3HZOA 5L4LA 2H65A 1XTBA 2O2HA 3QEKA 2B9VA 1O3YA 1NBOA 2CUZA 2AB0A 1A9SA 1NRXA 1SZJG 2GBLC 3ZTWA 2J5RA 2XITA 4I08A 4TMYA 4C88A 1FTSA 2P9BA 2GT1A 1U8AA 3GUVA 2GETA 3D43A 1FXWA 1M3SA 3K0BA 3N8DA 4Q4JB 1EQAA 3RHZA 2BGWA 5TQ0A 2MDTA 2OAP1 1AC5A 3I12A 3ADOA 2PH5A 1I0IA 3AVTA 4XR4A 3GDOA 3PJFA 3WRYA 3EF3A 2MSEB 1P3JA 1H6CA 1CNFA 3PPVA 1M8JA 3VDRA 5BN3A 4L76A 4D81A 5JZVA 3LKVA 3QE0A 2ZWOA 2QYSA 3LT0A 3RBAA 4DNXA 4P22A 3PJRA 3G6KA 1NBHA 1WKVA 4FX2A 4CDGA 4KXMA 1IUKA 3D7RA 4I3GA 3RW9A 2RK6A 3P0RA 4FYMA 1XTSA 5GP1A 4MR8A 3QVWA 1EAYA 1E2DA 1QFJA 1K86A 2NWQA 3B70A 1X14A 4MYUA 2AOUA 2BH9A 2G0NA 4PQRA 2VNKA 1R8QA 2NZWA 3E3MA 1G4AE 4JB3A 5AW9A 5LC1A 4BRWA 2HYIC 4GWLA 3GRAA 4IRMA 1HTWA 3TNDA 1ZDMA 2RHHA 1J9EA 1NJFA 3CSSA 3DBHA 4FZ5A 3EZLA 1Q7RA 3EAQA 3QYJA 3BSWA 4PC6A 3EH2A 5B55A 1JRLA 2VCYA 2JLXA 3SYLA 3GRUA 4X6UA 3CNEA 2ZLBA 1EYZA 1N1DA 4D5GA 2H1SA 4MWCA 1Q7TA 4B73A 5ECDA 5JFGA 1V71A 1ZQ1A 2P5SA 3SCZA 1VL2A 4B7AA 3WV4A 1U9IA 4XXHA 3AFGA 2J3HA 2W58A 3ROZA 2VOEA 4PS1A 3CRQA 2FEKA 2O1XA 2P0EA 3HBNA 4XDHA 5KVSA 2X2FA 5EUMA 2VH5R 3MIZA 4JOSA 5CPFA 4DCUA 3MWKA 3RGWS 1E98A 2FW9A 4HDAA 3SC2B 3KZOA 1R9GA 5T3YA 3TDKA 4BRZA 4NK5A 2GHQA 3TXYA 5FTKA 5KNCD 5L7TA 3EVBA 4PYMA 3LSYA 2IDMA 4HWTA 1RPNA 3QBVA 4MS3B 4AY2A 1NZDA 4KMSA 3KSBC 1E3SA 3B2NA 2ZE8A 3SYRA 1NYRA 1V1RB 2ZPUA 1HOTA 3BVPA 2GFIA 5F12A 4ZGGA 4ZQIA 4Q7JB 1J0AA 3PA6A 4MVXA 4JN6B 2GK4A 2PKXA 2FK8A 3M1LA 4X1KB 3SHWA 4RC9A 3R6DA 1ZMXA 4BECA 3SDBA 2XB2A 3T35A 1SCDA 4HDKA 3V4VB 3AJEA 5K4AA 2G5PA 3F6PA 3TZBA 5KPJA 1Q15A 2YXEA 1WNFA 2FNAA 1IBSA 3GUZA 3AKYA 4MP8A 4R0NA 4MHOA 1VA5A 1AQJA 3DLTA 5DW0A 3EGDA 1P2UA 3H7IA 4BE9A 3NOXA 2M6LA 4C4XA 1JXQA 1KPIA 1VCOA 1SCKA 3KQWA 3ONWA 1ZIOA 2CNLA 3B1VA 4MULA 4RAOA 3E5RA 5A9SB 5KTMA 3DOFA 3N59A 2JIZA 4Z4EA 3PFCA 2QQEA 3WQBA 4CIVA 3ICEA 1IATA 1ZY2A 2ACWA 221PA 3ZDRA 1FJXA 4JT8A 4YY3B 3FSGD 4JZKA 2I2XB 2EKBA 2R6CA 1J07A 2HLDA 4UUQA 3SQDA 5KWEA 4L74A 3L7JA 4QPJC 3QWHA 3QKIA 2DCMA 4C2TA 5FBQB 2VHEA 3OQBA 1OBOA 3MPOA 4Q4HB 5BWLA 2ZYRA 4DQLA 1B73A 1OJ7A 3IRUA 1P4SA 2C5LA 2FEPA 2WYWA 4RVFA 1KQFA 1FK8A 2RHGB 4FCVA 4OGFA 5F5NA 3Q3VA 4YMVA 4DLAA 5AI5A 1P9NA 3SBDA 1SCIA 1Z08A 2XNCA 2OPHA 5AESA 1O89A 2VDKB 3WBJA 1LW6E 1JEDA 3OQJA 4H6WA 4WMLA 1HE4A 3NBYC 1EM8B 3WDLA 2CFCA 4CGZA 3DLBA 4XYMA 1J23A 4ZYXA 4F5ZA 3MTQA 4C4OA 2FPPA 2H59A 4LW8A 4NU8X 1VG1A 3L7KA 4OP2A 4Z4GA 1Z56C 3S4YA 3MJDA 3T9EA 2HYDA 3URMA 4X1YA 3CU5A 1M7BA 3GD7A 1WUJS 5EVJA 4UHJA 1C3OB 4H1WA 3PU6A 4GPAA 1GITA 4GL4A 1G2QA 3G02A 3WNDA 3PC8A 1OI2A 2FN8A 2OFXA 4R31A 3WQRA 1YDEA 2O7VA 1NNUA 4XYEA 1TA0A 1TNDA 3ETHA 3TPCA 1R37A 2V0CA 3INYA 1C81A 5DHQA 4R01A 2V6BA 3N53A 4ZRNA 4A36A 3E1KA 2EAUA 4U6NA 3L4SO 3N0VA 5HCNA 1DKMA 2Z9BA 3R8CA 2YN4A 4I1YA 1KDYA 2WWWA 4OFWA 5KTOA 4ON9A 2EJTA 1E7WA 1QFSA 3EZGA 4IOMA 4RM3A 1CERA 1N1GA 1QIFA 4UW9A 2WVJA 5DLYA 4CLRB 2DPYA 4REOA 5L53A 1CUBA 4RK7A 4ZVTA 5LYJF 7REQA 2OD2A 1YC5A 4MRAA 4LRWA 4Q4CA 3EIHA 3KV1A 1BRMA 3PHLA 2C2GA 4S2EA 4F2HA 1D7AA 5JS6A 5ESRA 2QNIA 4BFZA 1JPUA 4PCVA 4NY1A 2EERA 4YCMA 3AILA 2BE7A 3PXBA 1I1HA 1ISSA 5LKAA 1F14A 2XMBA 4K46A 4XGQA 4DIDA 1P19A 3QX7A 2FYTA 4M1QA 3NCHA 4P2GA 5ENDA 3WTBA 2A3RA 4O5OA 2AC2A 2G17A 4XR9A 4FT2A 3PVCA 3FVWA 2FFQA 4IIJF 1QF9A 3UJ3X 2DECA 1ECCA 1NGSA 2H8GA 5EHXA 2CV2A 3DTVB 4NEHB 2VTBA 2A4MA 4JT4A 1OFTA 1W44A 3P4YA 3GT0A 2APJA 4ZARA 1Q21A 1ANKA 2D4AA 2ZRBA 4NK4A 4KU4A 3WS7A 2Q6KA 2Q5OA 3EQ9A 4JJ8A 1SIUA 1EDBA 2XDYA 4X20B 3W5VA 1GPBA 1WJGA 1YSCA 3MWLA 4DCMA 1GV1A 2XYQA 4JJKA 4BNWA 4NC9A 5HWSA 1Y8RB 1JHRA 1LDMA 1CETA 1RBZA 1ADBA 2AR7A 3QE3A 4N3AA 3V7UA 3VZRA 4CODB 2OAEA 3X2FA 4DXHA 5CT5A 4ZPXA 2ZIZA 3L02A 2ZIGA 2X14A 2IEGA 2XGGA 3DA8A 3HB0A 1H69A 2P5YA 1YIAA 2VPZA 2H48A 1MAUA 3O4GA 3UJ7A 3NHAA 3OECA 2HA4A 3KQYA 2XUHA 3HUTA 3RRJA 4PQGA 2YOHA 1JG3A 1XQ6A 2D59A 4NZMA 4OI2A 3OJXA 1I8TA 3DUWA 3ISJA 4UMVA 2AZDA 1FLAA 4N0QA 2A1UA 3EPRA 1J49A 1PKEA 3O93A 1NQAO 3BD7A 4QWMA 2ZT6A 4X97A 3LHDA 2AG6A 4IZHA 1KVUA 1BC5A 2VT3A 2HXSA 2JGNA 3BQNB 5DHFA 4RORA 2E89A 3GFQA 4YK7A 4US2R 3MHPA 5H81A 5HDBB 1RKVA 1KEEA 4Y1RA 1U94A 3RSGA 4BP8A 2H2FA 4IUYA 3MLEA 1ZJYA 3LT5A 2D06A 4S12A 1ISGA 2HM7A 3DP7A 4L95C 3T54A 3VDMA 4JP1A 4QOJA 2E4WA 3KZNA 5H8WA 1CF4A 3MXOA 2RGUA 3RRZA 4AP9A 3EBPA 5MHTA 2C7VA 2CLOB 5I4KA 1ZQ9A 3BH7A 1I14A 4Z4FA 5GJBA 1WE2A 4A15A 1ADYA 2BKUA 3H8WA 4W9NA 4HUQB 2Z04A 4YGXB 2C00A 2B9EA 1NJ2A 2DKNA 3ZZ1A 3S8MA 1T8YA 1VYVA 3KPYA 5U1PA 421PA 2CV1A 2ANBA 3TZQA 4JI7B 2OYSA 2VHUA 1YK1A 1I3LA 4WINA 4YWJA 5EN4A 3AC0A 3L8MA 3VPDA 4BZXA 2B82A 1K4MA 1M0TA 3DBLB 3MTGA 2QRGA 1D04A 2VZLA 2A2ZA 3L0ZA 2AXNA 3AX6A 1JS1X 2FSVC 4G1CA 2QI9C 5CURA 5CLQA 1JKIA 2JANA 4CQLB 5CP8A 4KK3A 2OCLA 3ENQA 1SHJA 4KNVA 3C0KA 1CHNA 1IG3A 2YIMA 2JHGA 4XQ0A 5J3JA 3R9XA 3HHEA 5AKGA 3JQAD 4MV0A 5KI6A 1XPJA 2FK7A 2EG9A 3KFLA 1ZRNA 4Q1EA 4D3YA 1CUZA 1T5OA 1Z8DA 1Q11A 3OICA 1J5XA 2QM8A 4J4BA 3I45A 4OTZA 3H16A 3R7SA 3GZJA 4YDHB 4TVSA 2Y0PA 5TXGA 2DMRA 2QUZA 4WKPA 2O8EB 3LQQA 1GDTA 1A76A 3DL4A 5KBYA 1UBFA 1A4IA 2XXJA 4O2BF 1Z63A 3U4GA 4EWLA 1AA6A 1Y4ZA 3BOSA 5JOQA 1N78A 1K5HA 4IO0A 5JTTA 1LNZA 1GCUA 1IOLA 2M6RA 4DUPA 1KP3A 1PU2A 1OXUA 2WKSA 3QBJA 2F4VB 4Y6LA 1MNQA 2B2CA 4AMZA 3RVKA 4RA6B 4TZTA 5EXTA 4OXXA 4Z8YA 3FE2A 1B0UA 4RPLA 4ESVA 1NDUA 3COZA 2PUDA 3OFVA 2BSQA 5GJWC 2LDBA 5LUAA 4FFDA 4WGFA 1BHSA 4DYHA 1N34B 1L5YA 1QYIA 5G1NA 5B6JA 2JRCA 1J8VA 3L77A 4Y6SA 3J7AC 2N42A 4FHCA 4ERNA 2YV1A 1EFUA 4KFCA 1U90A 4JQCA 2I78A 1U2ZA 1H85A 4FZVA 1H1DA 7ABPA 1WV0A 1IMOA 1YR2A 1LC0A 3K9NA 3ZEAA 4EB8A 4ZXFA 1DE0A 2XCTB 2WA2A 4AKIA 2KMLA 2FF5A 1A9XB 3DWIA 2DLCX 2OO3A 1TM3E 4F84A 4Q7LA 5E0OA 2QRKA 1INLA 4OHCA 3GRKA 4JU9A 1PJ4A 4CF7A 4HAUA 2NZ8A 5FA6A 3LVRE 4KQ9A 1RKQA 2FOLA 5CK5A 5F77A 5AVRA 1M6YA 1ES9A 3MJRA 4XCVA 2INGX 3K0KA 3AEQB 2G4CA 1IY8A 5IF3A 3FYDA 2RGGA 4RSGA 4TTSA 4F04A 4F3TA 2Y8EA 3SZLA 1PZHA 3CVVA 2HI0A 3GLHB 4RNDB 1KAMA 2QA5A 2EBWA 1L5HA 2OQVA 4GGPA 3NBUA 4LSZA 1ITZA 4P86A 1ZUWA 4HFNA 2HB6A 2KQUA 4ZGBA 3RUIA 3PUVA 1NRWA 1XYGA 4BQFA 2GD0A 3H4VA 5JAIA 2X9QA 3HKDB 3ANSA 2AI2A 3OHMA 3S2ZA 1F8UA 4AJ9A 4R9UC 5HZGA 5H1YA 3D5TA 4Y7CA 1NN1A 4D96A 3U31A 1GGFA 2R1TB 1YJXA 3NIDB 3NPMA 3OY7A 1T0IA 2AQIA 4QNRA 5D3MB 3TI7A 3F9CA 3T9DA 1JG1A 3UQZA 4RJTA 2FPGA 4Q4JA 3VTAA 3VBEA 1LEHA 1VG0B 2I4RA 2H1VA 2YWDA 4H3SA 4R8LA 4AYTA 5J4VA 1CKEA 3FI9A 3KIPA 4MWDA 3A9CA 1N2HA 3TBKA 3ZI7A 1CQZA 5FIUA 3RVLA 4MJXA 1SULA 3IEIA 3LPLA 1JSXA 1WMBA 1ZESA 2ZWPA 4FMDB 2AUTA 2W6PA 2G9UA 1YS2X 3GLHE 1JL3A 1SC4A 2IUSA 5EGNA 2BKLA 4BVHA 1M75A 3V8VA 1Y9ZA 2FUG6 3U7QB 3MK31 1V1MB 5EHQA 2H4FA 1TQDA 3KQVA 3M70A 1DARA 3BCUA 3I3SR 3L8GA 4ESHA 4H7JA 2J0VA