3CR7A

Crystal structure of n-terminal truncation of aps kinase from penicillium chrysogenum: ternary structure with adp and paps
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
179
Chain Sequence
RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyl-sulfate kinase
publication title Truncated APS kinase from Pencillium chrysogenum: Insight into the function of the N-terminal helix
rcsb
source organism Penicillium chrysogenum
molecule tags Transferase
total genus 62
structure length 179
sequence length 185
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cr7A00
1Q1EA 1MR3F 2GTPA 2GAAA 1I4LD 1N6KA 5FUXA 1DAFA 3L8YA 4B76A 4LI0A 1EFHA 4EPTA 3X1XA 4A2QA 4M1KA 4BQSA 2WVJA 1DAKA 2ATXA 2IYUA 1KI8A 2WBLC 3KFXA 4DVGA 2W83A 1OXTA 3FKQA 4TYNA 1G3RA 4M1OA 5FOSA 4EPVA 4AWXA 2ECKA 2P2LA 3RS2A 2V8OA 1OF1A 3GEIA 4IOKA 1U0JA 3ADKA 4OJKA 5ELXA 1KSHA 4QC2A 1LVGA 5HTKA 1RZ3A 1EX7A 4YONB 3IEUA 4BEJA 3LA6A 3L0SA 1W2GA 3FMPB 4Q66C 4CYMA 2GDJA 3EPJA 3HDTA 4Q9KA 5AUOB 1A2KC 4PFSA 3AF0A 5EP3A 3HU2A 3HU3A 4JLVA 4OHVA 5EE5B 4BLQA 1G8PA 1W0KD 2CNWA 5EE1A 3EC1A 4Z1MA 2XXAB 5M04A 2VP2A 2CJWA 4GRAA 4EFNA 2CMKA 4YDHB 1XD8A 2PEZA 5C4MA 2PLRA 1ESMA 4JVSB 1EX6A 4BZXA 4Q4JB 2QT0A 1CJUC 3A4NA 3OESA 3QF4A 3RVBA 1MABA 3GJ0A 4LGMA 3Q72A 1DAIA 4JLNA 1N6PA 2MSCB 5SZIA 3IPYA 1FMLA 4A2PA 4BFZA 4RD6A 1G8FA 2NQ2C 2ODBA 3ADBA 3M6AA 2OCPA 4RVCA 4US1R 2WMOB 2ZANA 1T91A 2ZR0A 4OHYA 1SKYB 4H1VA 1Q3TA 2A5JA 4PO9A 4TWZA 4V0LA 4DLRA 3CX8A 2R62A 2AD5A 2O52A 5KSZA 1UPTA 4QJ5A 2G1KA 2IXGA 3LY5A 4A15A 2AFIE 1IXSB 1VCIA 1G3IA 2A7QA 4UNPA 1U99A 4QBFA 1P7CA 2OXCA 4X8MA 5KDDA 3K0AB 3OIYA 5L3QA 4ZI2A 2WWWA 4Q7KA 3SQXA 3KXKA 1PUIA 5SZKB 4Z51A 3VFDA 4QHYA 3EZ2A 1XNJA 3SR0A 4AYWA 2QE7D 1TADA 1TQ6A 4B6EA 2N42A 1CF4A 1NJFA 5FUYA 4PAOA 3VU9A 2QEQA 3A1TA 4BFYA 5J5CA 1T0JB 2XTMA 3KKPA 5JJKA 4MYTA 4MQBA 4Q4AA 2F3TA 4G5RA 3CRVA 1R5BA 1XCMA 3O47A 2FFAA 2TMKA 1DG3A 3CNNA 4GZMA 3T1TA 2GESA 4MH0R 3ZDQA 3IQWA 4RZ2A 1J99A 2CL6X 2J3EA 1G7CA 1DEKA 1VYUA 2FWRA 2IXFA 2WWXA 3DL0A 4TTQA 3ZVLA 2FFHA 1NN3A 4IDHA 5DLQC 3W6OA 1KO5A 4P4SB 5LD2C 5JI3E 5KSPA 3TBKA 3NC1C 4HEJA 1B23P 2B7CA 1J8YF 1S3SA 3GLIA 1BIFA 1KKLA 2FOLA 5GVRA 421PA 4LV5B 1ZINA 5SZJA 4KFSA 3L0IB 2OBMA 1IY2A 1KK3A 1GWNA 4GL2A 1YJ5A 2IS2A 3OZXA 3H4MA 4N0DA 5TY0A 4IVRA 4H9GA 4BASA 2KWIA 4PQRA 4BFWA 4V03A 4NTZA 4WA7A 1L4YA 1OHHA 3C16C 2VP4A 2CL7X 4OYHA 1AQYA 1E32A 2IYLD 3RRNA 4D25A 2XNSA 2Z4RA 4C0QC 1JPNA 4E22A 4ARZA 2OCAA 4PQYA 3K0SA 2V3CC 3RC3A 3NKVA 3PCRB 1ZIOA 5EE0A 3W90A 3WHKA 3P27A 1RRCA 1E1RA 4O0MA 3AVWA 2Z6VA 2CE2X 4JVMA 2DBYA 1AQUA 4D0GA 4BE7B 4AURA 1XMVA 4KO8A 4LPSA 3A58B 3AM1A 2BBSA 2IS1A 4NONA 1G3UA 4OQNA 2REXB 1L2TA 5KHOC 1D6JA 4CEJB 3O8RA 1MO5A 2ZS7A 3I4LA 1UKEA 3A4MA 1G1MA 1S1MA 3DM9B 5H8WA 2K5UA 2XJ9A 3GEEA 3KJIA 3DHWC 3REFA 4TSFA 4LJAA 1GL9B 1XCGB 3FVQA 1H65A 3Q9LA 2PJRA 1CU1A 1P2TA 4LHVA 1GKIA 3LNCA 4B2LA 4AKGA 4XH9B 4NPHA 1E4YA 2EQBA 3AUYA 3CPHA 5EXXA 1VIAA 3CH4B 1T3LA 1YQTA 1MRNA 4O25A 2J45A 4P32A 1XTSA 4QBIA 2O8FA 5CYPA 5IT5A 3AVXA 1NF3A 1UDWA 1ZRHA 4EUNA 1BKDR 3WBJA 121PA 5AWFC 1U0LA 2RAPA 1BYUA 1G4AE 1GVNB 2ZSEA 1VG8A 4B2PA 5H70A 1JNYA 2RGNA 4CT4B 4OQFA 2QN6A 3WYFA 2PMDA 3TR5A 4KYIB 4L16A 3IBGA 4TTPA 3BGWA 2DWOA 1GAJA 3D31A 1X86B 5FPSA 1XEWY 4TL8A 1E99A 1Z0DA 5A4JA 1Z8FA 3NEYA 1P9WA 2WKPA 4K46A 2ODEA 3LQQA 4RSGA 3LDAA 1JBKA 2C9OA 3QXSA 5LB2A 4YMWA 1MKYA 3GFOA 3K8YA 3QKUA 2NG1A 2Z0MA 1E79A 1ZUNB 1GL7A 2KJQA 5KTYA 4TT3A 2O5VA 4F93B 3QQ5A 1FQJA 1IY0A 4B3CA 1HV8A 1UFQA 4URWR 2BOVA 3FFAA 4PANA 3U7HB 1FZQA 3CNLA 1G8YA 2GRJA 1U9IA 2FEOA 2HUPA 3EZ7A 4JMPA 3CPJB 2IF2A 1WA5A 3QY0A 4ZCLA 1UBGA 1TF5A 1ZM9A 3GFPA 4LJ5A 1TAGA 3QG1A 3R8CA 3AKEA 1RRPA 4CIDA 3W5IA 2CL0X 4LYAA 4NCHA 3AVQA 4NYMR 1XJQA 2GHIA 2CCJA 2WOOA 3U3KA 5E95A 1S0UA 1VDZA 4MYUA 5JLJA 1DAEA 1OH6A 1GG2A 1MO4A 4PQFA 1YRBA 5FTNA 4C0BA 4CZ2A 1G8HA 2NZ8A 1W49A 1GDDA 4C0KA 4DXAA 1LB1B 2FSGA 2JGNA 2UKDA 3LO5A 3IIJA 4Q5IA 4OK5A 5CLLA 5H68A 1S2MA 1XXHB 1VECA 3SZRA 3VR2A 5EE3A 2AWNA 1E2NA 3ZQJA 4E07A 3C41J 5CJ2A 1E0KA 4A0RA 4BRUA 4EAQA 2D7CA 2AWOA 1Z06A 1DVRA 4U00A 2PCLA 5JHGB 1KI3A 4BLRA 1VG9B 4LJ7A 1N5KA 3KB1A 4Q1FA 2V6IA 3W34A 2BCJQ 3TVDA 1Z07A 2JLXA 4YMUA 1NN0A 1YR9A 4MGKR 5BYJA 4BFVA 1IJEA 1SVWA 1JECA 1S1CA 5CM8B 1E2LA 4D4LA 2IYZA 2YOGA 2KE5A 3M0EA 2QTFA 1XTRA 1FFHA 5EZ5A 2IYWA 2F43B 1JR3E 4R98A 4XVUA 1D9ZA 4EFLA 5IF9A 3EPHA 1A7JA 3CRMA 2FFBA 4DSNA 1G6HA 1U8ZA 1DOAA 2HF9A 5CK4A 5JRZA 3SQWA 5JHHB 3RRZA 3AVVA 4ACBA 3WHLA 4CEIA 3EX7C 2WJIA 1COWA 1R4AA 1X1RA 1Z6XA 2ZYWX 4M0LA 4Q9HA 3CX6A 5A5GA 1E9EA 5CM9C 3CUEF 3RWMB 3UMRA 4TMVA 4TLEA 3SEAA 5L3SB 3LX5A 3BOSA 4TZ0A 2JJ1D 4Z54A 2ZYVX 2CEAA 2ZR9A 2PH1A 4Q1AA 2ORVA 8OHMA 4WZBE 1N0UA 2CLCX 4NHOA 3UK6A 1FTSA 2J7KA 2C04A 2ZI7A 1UF9A 1US8A 2HT6A 2ZAMA 3BH0A 1DADA 1W0KA 3LLUA 3KKMA 3FPAA 2ZM5A 3DO6A 1SQ5A 3U7FB 4Q4HB 2Q3MA 3SFZA 2A5GA 3GFTA 4Q7JB 1W1WA 2C03A 3MCAA 3TLXA 5IDVA 4GSYA 4NP6A 1KSJA 5FTJA 3SNHA 4DEXA 4FCWA 4HB3A 2ODWA 1N3BA 1UDXA 2CVFA 1GNRA 1R8QA 3Q5DA 2P6RA 2ZRMA 2DFKB 2ZJ2A 3BORA 4JBXA 2FJUA 2ZSAA 5FR2A 4XWKA 5FOWA 4DBLC 1Z0IA 1DAGA 2A9KA 1CR0A 4PPGA 2ERYA 2GEVA 2IBMA 2XNDD 1KSFX 2RGBA 3CWQA 2N46A 2HXSA 4DRZA 2ORIA 221PA 1A5TA 1FPMA 3GJ7A 2R65A 1OB5A 3ASYA 2P67A 3ECCA 1Q20A 3PV0A 2ZRCA 2HXYA 3BB3A 1I4TD 3E5HA 5FFMA 2ZJOA 4OK3A 1CLUA 4PAMA 2FGKA 3MAAC 3ZLJA 4OHXA 4D4JA 1SHKA 1RJ9A 2WPDD 2QE7A 1JQJC 1N5JA 3CNOA 3LW7A 1NY5A 3RRMA 1LV7A 1X3SA 4NZYA 2WKQA 4A0GA 2EFEB 3RANA 3B7GA 3BERA 4YXWD 1R5OA 2PX3A 1CR2A 2I4IA 1BO6A 4NYIR 3Q3JB 4NCJA 2RHDA 4FCVA 4WAUA 2WOJA 1KNXA 4FMCF 2GXAA 4Q7MB 1KDPA 5BN4A 2ATVA 1QHHA 2WKRA 4RD2A 3TK1A 4DCVA 4IFBA 3KXIA 1KO8A 1PVOA 1IJFA 1DPFA 3NBYC 2J0QA 4AC9A 3NVAA 2WTUA 1DBSA 1ZYUA 3GCGA 2CJWB 3BB1A 2WZQA 4Q02A 3X1ZA 4OL0A 4A8JC 4FINA 3R7WA 1CTQA 1P2VA 5TV2A 3UATA 2IWRA 2DWPA 3FMFA 4IKEA 4LOAA 5JJIA 1RVDA 1OXVA 4DC9A 3QF4B 1GRQA 2YOHA 4QOSA 3U3MA 1FNNA 2YWFA 3K09A 2CCKA 3UXMA 2JJ8A 3EIQA 2R6FA 2ZREA 3IIMA 1W2HA 4KFTA 4W5WA 2RGXA 3OEHA 3JZAA 2JJ2D 4KFRA 1Z0KA 3RRYA 1W4RA 4BFUA 4KSCA 4HAWA 4HLUA 1KI7A 4G0NA 3U6BA 1XTQA 2GBLC 2FH5B 1G6OA 4JKIA 2J0UA 4MKHA 5JEDA 5L3QB 2F3RA 4M9SA 1U2RA 1KO1A 3RHFA 3W9YA 1LY1A 1EFCA 2F1JA 2D3WA 1S4QA 3L8ZA 4JT2A 1Q1BA 3C5CA 3I61A 3P1JA 3VU9B 3QNUA 4LBWA 2VPPA 1QHGA 1NMZA 3PIRA 4HUQA 5K8TA 2IX3A 5KUTA 1W36D 3CIOA 1XCPA 2ZRPA 4Z8XA 4DT1A 2EFGA 4Q4AB 4OI2A 5E3HA 3LQRA 1TF2A 4LJYA 3L2OB 3FTQA 5JWHA 5J4VA 1E9AA 1R6BX 2W58A 3CRW1 2ZRHA 4M1WA 1X8LA 4KAXA 4HI0E 4RD1A 5JWRA 3VX3A 1EFRD 2BDTA 4JT4A 5IHPA 3LXXA 3RS5A 2R6AA 3GLFE 3AF4A 4ZDJA 1NSTA 2JDID 3ADCA 3BBPA 1R2QA 4JBWA 3P20A 2ZSFA 4PZLA 3TMKA 4IDNA 2V54A 4D82A 1NVUQ 1KY2A 2GZAA 3UG6A 2DFLA 5FOVA 3K9GA 2GWHA 4KBGA 3W3AA 3SBEA 3GLIB 3IDQA 4A9AA 2GA8A 3LVQE 4HZIA 2H7VA 3LBNA 4IDQA 2YINC 1E0JA 4C0JA 3BWDD 1JR6A 3CW2A 2JLZA 2Q0HA 1YZGA 2OILA 4QGAA 3GLGE 5C46F 3X1YA 3U7EB 1NMYA 3FE2A 5DHAA 2D7DA 3IO5A 1Z2AA 4B74A 2QAJA 3R20A 4TQUS 5JMTA 4HZUB 2H5EA 4M9QA 3T1VA 4MRNA 4LCBA 1L8QA 1OYWA 2EU8A 3IGFA 4ZKEA 3V00A 3VKWA 4DKXA 3X1DA 4M1TA 2ZE6A 1OJLA 1J2JA 3SE0A 4ARZB 1Q57A 4D4MA 5EP4A 3EPLA 5J47A 1KMQA 3RS0A 4HAUA 4MYHA 2H57A 2ORWA 3A1SA 4DCSA 3FHOA 4IOMA 1DO2A 1KI1A 2VF8A 3B60A 3SFVA 1OH7A 1LFDB 1IN6A 1YR7A 4BGDA 1CBUA 4ZIRA 3RS4A 2YWGA 3QXJA 4PPQA 2WAYA 1XZQA 1FOEB 1CXZA 2VO1A 3UWOA 3X1WA 5BXQC 3RS7A 1FW6A 1T0HB 3X2SA 3TQCA 3CR7A 1BYIA 2ZJ8A 3FKSD 2QA5A 1NLFA 4B32A 3W6NA 3OFNA 3K70B 2NMVA 1FNMA 2VHQA 2FGJA 3TJZA 3W8NA 4OBEA 2MMGA 2REOA 2GILA 1SVSA 4XTRA 3P26A 4DSTA 4Q7LA 2QSYA 4E5UA 1R0XA 3H1TA 1KK1A 4L9SA 4Q01A 2G0TA 4D0NA 2ZYUX 5FBVB 2O8FB 3TUZC 3WNCA 1ZMXA 2EW1A 1CULC 2RHMA 2VYFA 3WP0A 1Z6GA 4Q19A 3B82A 3SJAA 3ZS9A 4E09A 2X1VA 3F3YA 2ZS9A 4A82A 3WMGA 3LBHA 5BWMA 1PJRA 2IHYA 4HUTA 2F55A 2JLWA 2VP5A 4YMSA 2E9SA 1GNQA 4NCKA 5K8LA 5EZ6B 1RFLA 4C2TA 2XEXA 3Q5EA 3U6KA 1VG0B 1ZD8A 3VMFA 3AVTA 2G6BA 1KTVA 3NH9A 3KQLA 4QXAA 3KX2A 1KZGB 3H84A 3QPWA 3UANA 4EIWA 4B48A 4FMDB 2MSDB 1OLOA 2RMKA 1E1QA 2WHXA 5FPKA 5G40A 4UXIA 4MYCA 2CHVA 3QOFA 2ZI9A 4A4DA 1XU4A 1C4OA 3FB4A 2AL7A 2W2TA 1VHTA 1AN0A 2HJVA 3OAAD 1KI2A 3B1VA 4DSOA 4MA4A 1CJTC 5C18A 2QBYA 4XD7D 3P4XA 3AEZA 3PR1A 1WQ1R 1E9CA 2CHGA 1M2OB 2HLDD 2NO7A 4NMMA 4O2LA 3PJRA 3F8TA 4DJTA 1OXSC 2QMEA 5TDHA 1ZD1A 3OIUA 4MRRA 1IQPA 1JR3A 1R10A 1V43A 2LKCA 2P6UA 2VLIA 4XVQA 2JJ1A 5DHFA 3I73A 1W5SA 2ZUDA 5J40A 2ZQ5A 3O8BA 5GJWC 3VAAA 3FMIA 2VTKA 2QM7A 1IOZA 3T34A 3ZVNA 4BZQA 1YZKA 3HPRA 4MGZR 3KJHA 3TGPA 4WXRA 1JAIA 3UIEA 3V4RA 5TB5A 4X8HA 5DN6D 3NEJA 3WRXC 3T5GA 1N6NA 4LC0A 3I5YA 4HAZA 4G5OA 3QEOA 4K81B 1E9BA 2YHSA 3MG9A 1TF7A 3P32A 1XMSA 3KKQA 3U44A 1OH8A 1AA9A 1R7RA 1T3HA 4M4SA 4JLJA 1HUQA 1YZTA 2ZI4A 3DOFA 1PZNA 2OSBA 1N0VC 2XOKA 3KQNA 4KV9A 3MWYW 4JVNA 2WSSA 2ZRBA 3ZH9B 3N70A 4P0TA 3C15C 3MRSA 1QHNA 5GJBA 1SVIA 2QAGC 4POAA 5DISB 4MGYR 1EGAA 1M34E 3RC8A 3R8FA 2XNDA 4D2IA 1E2EA 1VKJA 2CLDX 2HV8A 3OHMA 2VHTA 4M21A 4BWYA 4S35A 2ZAOA 1S9HA 2RGDA 4C4PA 2QPAA 3CBQA 1NBME 4N3NA 1LS6A 4A6XA 2ZU6A 1P72A 3DM5A 5HZKA 4B35A 4FIDA 2P65A 2P3SA 1KHTA 3EIHA 2FPKA 4CEIB 2WPDA 2WAXA 2A78A 2FZLA 3QENA 4KLNA 4ZCIA 3QBVA 1E9FA 1Z28A 4JJKA 4URVR 4M1MA 1KK2A 4AD8A 4LZZA 4W5JA 4YXWA 3R9WA 1NBMD 2YVUA 4DHEA 4CDGA 4IVPA 1WRBA 4AYTA 3V4FA 1XTJA 1VYVA 4JYBA 3QXXA 4XOIA 6Q21A 3VHXA 2IYQA 5DYGA 5AR1A 1ZVQA 1XD9A 4FMDF 5L8VA 2OLJA 3OEED 4DEYA 3DPUA 4WOPA 1US8B 1WB9A 3K0FA 1T6NA 1IAQA 1GKYA 1M74A 2Z5FA 1GL6A 3PUZA 3JZMA 4HLCA 1Q1QA 2KBFA 2QL6A 3RLFA 4XTCS 4M2LA 2DFTA 4HB4A 5HCIA 5JRJA 3ZD7A 3VKHA 3A4LA 4KVGA 2ZJAA 3MWJA 4QHTA 4ZDWA 1SXJE 2BEKA 3K0CA 1Z83A 1QG2A 1GM5A 2IYSA 2O8BA 1Z5ZA 3DVLA 1UBFA 3FWYA 2JJ2A 1GTVA 1Z3IX 3KL4A 3KFVA 3A1UA 1DS6A 1FTNA 2P6NA 1DG1G 2WJJA 1OW3B 3LXRA 3PVSA 4C0AC 1KGDA 2GXQA 3A1WA 1AZSC 2DY1A 2QU8A 4MRSA 2XB4A 5AUNB 2B6HA 4CF7A 1II0A 4JYCA 2KSQA 3B85A 4IEIA 1SXJD 2ZRGA 5H1YA 4D26A 4R9UC 2ZUBA 4BLTA 1TQ2A 5TMPA 5JCPA 1G4UR 2B21A 3EA5A 3OE7D 1YRAA 3CONA 1TEXA 4AIIA 3VNVA 4I81A 4DIDA 4BFTA 3EW9A 1E69A 5FL3A 1RJ9B 4HZUA 4NE2A 3CZQA 3AVYA 1NSFA 4QRHA 1E4VA 2OZEA 2UZIR 4UNSA 1W5TA 4Q4LA 4DCUA 2XITA 3EASA 2R6CA 4WVFA 5DO9A 3U3JA 1KIMA 2OM2A 1CRPA 3QJYA 3NHAA 4G5GA 1XTKA 1M8PA 2E1RA 4ASUD 1XEFA 3THYA 1YHNA 4US0R 1II8A 2P0EA 1V5WA 3QVUA 3ZGXA 3WBKA 3KXLA 1EFRA 1Q22A 1QHHB 1S96A 4P31A 4RD4A 1PV4A 2GJ9A 3PUYA 4Q03A 2C8VA 2JDIA 3CWZA 5EQTA 5FPHA 3T61A 4PHFA 2HF8A 1AS2A 1K8RA 1U94A 4RCYA 3HR7A 1G5RA 3R7WB 2O8CA 3WY9A 1ZUIA 1N6HA 3GLFA 2V1XA 4I99A 4TLCA 3T35A 1RC8A 4V02A 1S9DA 2ZRNA 3OIWA 3BFVA 4NKRA 1UJ2A 4LHWA 5L3RA 2OLKA 2ZYTX 4G1UC 4Q1CA 2QTHA 4BFXA 1CR1A 1H8ED 3T1OA 5F2EA 4V0ME 5D3MA 2QP3A 4FN5A 3TW4A 1QVRA 2BBTA 4QG7A 4AKEA 3K1JA 5JS8A 4DLYA 1WE2A 1ZNXA 1G5TA 2J0UB 4B2IA 1ZNWA 2UZ3A 3IIKA 1ZM4A 2YC4C 2ZUCA 5DNYB 4GOKA 3GLGA 1N0WA 2BV3A 3PEUA 2V9PA 2CBZA 5SZHB 1MT0A 1P2SA 2E87A 3PUWA 2G88A 4ON9A 1YZLA 2EWVA 3PXGA 3LFUA 3SI7A 3KQUA 2ZJBA 1IN4A 4HAYA 3U7GA 5LDDC 4KU4A 4HUQB 5EXPA 2QMOA 3AV0B 1EXMA 4DT1B 3KZ1E 3H0KA 4I4LA 4W9MC 2PMKA 1A1VA 3QF7A 4PZYA 5BYKA 2RGEA 1NG1A 2WJYA 4PC3A 4QGHA 2GXSA 2OAP1 4NDZA 2GZDA 1E9RA 4IDPA 5EXTA 4XVRA 2EFCB 1XEWX 4KFUA 1W48A 4FI3C 4DUGA 1W4BA 3LX8A 3N2IA 1C1YA 1K6MA 2R6DA 3FKSA 4GPTA 4M9XA 4RY2A 5AJXA 3ZS8A 1NNEA 2OHFA 2RGCA 5B64A 1T3SA 2X8AA 5ANRB 1M6NA 4DLXA 2NGRA 2Z43A 5JEEA 2F1RA 2PT7A 1G20E 3TE6A 1G9XA 3CM0A 3NH6A 1CIPA 2WV9A 4DCNA 4FWTA 1A82A 2BMJA 2OAQ1 1GSIA 1YR6A 4XWAA 1DTSA 4IDOA 3LWNA 2RB4A 2HCBA 1XPUA 1RPZA 5B57C 4A8JA 4TQ9A 2PBRA 2WSMA 3CF2A 2ZI3A 3AGPA 2H16A 4K8OA 1XMIA 5CK5A 4F7WA 4AKHA 4KSBA 3D8BA 4CVNA 1OKKD 1RIFA 4TMTA 2ZI5A 4B34A 2W2XA 2W6ID 5EP1A 1H8HD 1W7AA 1NIJA 1ONBA 3FMOB 2L0XA 4PC1A 2GF0A 1QHYA 2W2VA 1G18A 2OFWA 4TLBA 3R9XA 3ZJYA 2WWIA 2DFNA 4RD0A 2GBLA 1JEEA 1WBDA 4C7OB 1LF5A 1P75A 3OAAA 4L4UA 4EJSA 1XZPA 2HDNB 4ZIRB 4WBSA 2NO6A 2PX0A 4XD7A 3TW8B 2GVDC 4QKQA 1Z6TA 1DO0A 4TL9A 5EXSA 4D4KA 5C1BA 3MWKA 3PITA 4RJLA 3EIEA 3CF0A 4M1SA 1HA3A 2OESA 3KQKA 1XRJA 1AKYA 2F1HA 3ZVMA 1F2TA 3B5JA 5HE8A 1U0HC 3CRRA 2WMNB 1KK0A 1PLLA 4HB2A 5E7MA 4AI6A 1WDTA 2V4ZA 2GEDA 4JLKA 3ICEA 4MRVA 1QVAA 4UXHA 4WIAA 1VMAA 4QBGB 3HWSA 3KTAA 4Q00A 5DN6A 5FH9A 2ZJ5A 4EKDA 1TPZA 5JJLA 4B6FA 3RSLA 4D6PA 1ZM3A 3RNLA 4F91B 3UPUA 4DDVA 4R7ZA 1RKBA 3THOA 5JSZA 3GEHA 3AUXA 4PSKA 2QMUA 3GD7A 1P6XA 4V0NA 4PHGA 1IHUA 3SJBA 1XPRA 4MITA 1VYTA 1F6BA 2ZRAA 3AF2A 4I1UA 2BEJA 4IRUB 4DDWA 1NKTA 5G3ZA 2FA9A 2BBOA 3B9PA 3C5HA 3E70C 2ZE8A 3ZVRA 5FOTA 2GCOA 2JLUA 2G1JA 2VBCA 3QI2A 4KBFA 1UM8A 4M1YA 1NG9A 5KPDA 1T5IA 2QP9X 4Q48A 2XJ4A 2XZPA 1Q12A 1EWQA 1AZTA 1IN8A 1HQYE 4NH0A 4TN1A 2VF7A 4WXPA 5IRCD 1KZ7B 4NYMQ 2FE4A 2J87A 4XSHA 3BD9A 1RW4A 2ZRIA 1WBBA 2Q21A 2QBYB 5JFGA 2XSZD 3WNBA 5AJZA 3SYNA 3SJCA 3WP1B 3DOEA 4TQAA 5FBWB 1UBEA 2ZITA 2V1UA 2JCSA 2JLVA 2RGNC 2ZRKA 4PR0A 4LHXA 2IW3A 1NBMA 1N6IA 1FP6A 4DLSA 1EFUA 1TU3A 3EPKA 1XDBA 3KDSE 2BKUA 1CRQA 4N0EA 4PC2A 2OBLA 3QKSB 3C8UA 4KXFB 2O0JA 3G82C 4US2R 3U5ZB 2R6GA 2DPXA 2CE7A 3OEEA 4URUR 2FNAA 821PA 1YR8A 4JLOA 2NZJA 1JALA 2ZI6A 4B75A 4JL5A 3WYAA 1Z47A 3R9IA 1E2QA 4BRWA 4LRWA 4Q1EA 5HE9A 1FL9A 4F92B 3SU8A 2PCJA 1E2DA 1YKSA 1SVLA 1U9IC 5FTLA 3U44B 4LBYA 3D7MA 4TTRA 1NRJB 1PLJA 4I1VA 4L9WA 4NU0A 2Z4SA 2ZRJA 1RYFA 1U81A 3I92A 3K9HA 3A6PC 5HPYB 4IJMA 5HCNA 1TNDA 5FTKA 1Q44A 4W5HA 2RCNA 5FOUA 3U61B 2IEYA 4ZPXA 2YWEA 2JLSA 3NC0C 4PO1A 1SXJA 5KU1A 4LC1A 4EPXA 2ASEA 2ZVPX 2A5YB 3CB4A 1X6VA 3OE7A 1KAOA 1U90A 2QQEA 4IFEA 4LBZA 1EFTA 1XEXA 3HR8A 4NYJR 2HEIA 2VHCA 4MRPA 1U8AA 3CR8A 2GF9A 3T5DA 2NO9A 3I3SR 4Q1DA 1M7GA 2ZJYA 2OO7A 4ASUA 1MH1A 2ODNA 2OFXA 4I1SA 1E9SA 3SN6A 2ZROA 1EG7A 1W0JD 1SZPA 3Q7PA 3AF1A 2CVHA 3F0TA 1LS1A 3I1FA 4FWIB 4JSTA 3SDZA 3U2QA 1U98A 4KHZA 2FDCA 1TUEA 1X1SA 4LJ8A 4TLAA 3DKVA 3K0FB 2OE2A 1F3OA 2IXEA 2QPOA 2WWFA 1E2JA 3QEJA 3IHWA 4GP7A 3IO3A 2I1QA 2OCBA 2IYXA 4V0OA 4GBMA 4AK9A 4OKSA 3LW8A 5DI9A 3MUFA 3B1YA 1XWIA 2IS4A 1WXQA 2FFQA 4F4CA 4A0FA 2IUTA 1KJYA 5GJCA 2DCUA 1UKYA 3IEVA 2O8BB 3TR0A 5CDFE 1SULA 2F1IA 3UMSA 1UKZA 5L3VA 3GLHE 2X2FA 2FU5C 1H8EA 5JCZA 5DE3A 3C14C 3J81k 2QP4A 2B8TA 2A5DA 3VQTA 4RZXA 3BB4A 3TAHA 3KUDA 1DE0A 2VEDA 3A36A 3ND8A 2PZEA 4DLWA 1FUUA 3UG7A 1W4AA 3EXAA 2O8EA 3B8HA 4TSFD 4NYIQ 2FX3A 4GFDA 4A36A 2JATA 3AKYA 1KDRA 4V0MA 4B73A 3EWAA 3BRWD 4MDFA 5F9HA 3LBIA 1G3MA 1W36B 3QXHA 4UNQA 4XWOA 2QQ0A 1FX0A 1OIXA 1OE0A 1UEIA 4L8GA 2IEZA 2QSZA 3TUIC 5KSOA 1CJKC 1ETUA 1HE8B 1Z08A 2NPFA 4UJ5A 2WJVA 3THYB 4ERNA 1II8B 3GJ4A 3KKOA 4TMWA 1XBTA 1N5LA 2GJ8A 4F4IA 4DCTA 1J8MF 2PZGA 4C7OA 3LAWA 4DDUA 5LBIA 2W6JD 4UNNA 5KYKA 1VHLA 2CXXA 2AKYA 3THWA 4A2WA 4LDJA 4PZZA 5KNDA 3N5CA 3H2YA 3CO5A 4D81A 1G291 4DLZA 5BN5A 3I62A 3B1XA 4R2IA 2IYVA 4WW0A 1FP7A 2O8CB 3S1AB 5DIFA 4YMTA 4FXPA 2WICA 3GLFB 4ZI3A 1FMJA 2OUKA 2W0MA 3I8SA 4C30A 2I1VB 2V6JA 2ZRDA 2EYQA 1XB2A 2A5FA 5FL7D 3EC2A 3I5XA 4J0QA 3W6PA 3ZIAD 2QRNA 5JS7A 3M1IA 1VPLA 1SGWA 3KQHA 3BH7A 1AM4D 2H18A 1OFTA 3U4QA 2CK3D 5JBQA 3ZZ0A 3G0HA 5D3MB 4YLGA 4LV6A 3OF5A 5G53C 3NHBA 1YZUA 2QUZA 5FBQB 1XD2A 2Q9CA 1ZAKA 4URYR 5FR1A 2C77A 1KJZA 3L43A 1OKKA 3SBDA 2AK3A 2BKEA 3PENA 1Z0AA 2W6IA 1G7SA 4ZO4A 3U3OA 1A4RA 3W8RA 3GLGB 1H8HA 2FV8A 1F2UA 3WMEA 4A92A 2GEUA 3QE0A 1CS4C 1M1YE 1D2NA 2ZSBA 1AGPA 3EAQA 2QZ4A 3PUXA 4G5SA 4XSGA 3BXZA 4RD3A 3ONWA 2N1BA 2B7BA 1WF3A 2LKDA 1O3YA 3K09C 3DEFA 2GJAA 2VSOA 2QM8A 3MWLA 2BVNA 1JJVA 3NTUA 1OIVA 5C2JB 2F9LA 1L7VC 4EPWA 2IYTA 4TYQA 2H17A 1P61B 1GITA 4JBYA 3K9LA 4P4UA 3CLVA 4HLUC 4HAVA 3T1QA 4JLBA 5HKKD 3D3QA 2P5TB 3G5UA 3SYLA 4PSVA 1BH2A 1A2BA 5J4KA 2OV2A 2D06A 2IF0A 1SKYE 1R0ZA 4C2UA 1PUJA 4RKFA 5E7IA 4LJ9A 3SHFA 1Z0FA 4RZ3A 3QKSA 4B3DA 4OI4A 1KDTA 1LTQA 3GJ5A 4TMKA 5FTMA 3T06B 2CCGA 1IXZA 1ZC3A 3AB3A 4E03A 4LBVA 4KITB 5EE9A 1F48A 1I2MA 1SVOA 3OIVA 3RAPR 4B43A 4D0LB 4EPRA 2KI5A 3WRYC 2NOAA 1ZD9A 4FMBB 3TIFA 4RFSA 1E98A 2J41A 2CDNA 4LUCA 2XGJA 4YDSA 4IHQA 4B71A 3TSZA 4A8JB 3BFXA 2EFHB 4MGIR 1NVVQ 2ZS8A 2V55B 1COWD 1P62B 1G19A 1UBCA 2XTNA 1AS0A 1L4UA 5F98A 1MOZA 1DAHA 1FUKA 1N25A 2BJWA 5EP2A 1NP6A 2EFDB 3CKLA 1S3GA 2D2EA 2GJKA 5J4LA 1KO7A 4JL6A 1GOTA 1II9A 1WP9A 1XPOA 2BBWA 4CEHA 1G7RA 4N1AA 3MMPA 4JZKA 4AG6A 4HYYA 3CZPA 4EJSB 2O8DA 2QGNA 2XSZA 1P9NA 2BM0A 4OK6A 1HH4A 4R2HA 2QTVB 3DZDA 5FUVA 2GAOA 1SKQA 1NVXQ 1SHZA 5E4FA 5EUQB 1JEDA 2ZXUA 1CEEA 2X19A 3T12A 4F4JA 1B0UA 1VIYA 2BWJA 2C5LA 4L5BA 2HT1A 5KO2A 1OT3A 3KJEA 2DR3A 2IHBA 1NVWQ 3ND9A 1GZSA 1F2TB 3ASZA 3LLMA 3HP1A 3PG5A 1BOFA 3DZ8A 5G3YA 1E6CA 3PEWA 4BFSA 2RH5A 2YNMA 2GK7A 3ZYCA 2PL3A 3MLEA 1GUAA 1E2HA 3MFYA 4M9ZA 5EUMA 2VL7A 2C2HA 3KTAB 4LWZA 2FN4A 5TVKA 1CP2A 1TX4B 4Y0VA 2XB2A 4ITRC 3A8TA 1NL3A 4LYFA 1P9RA 2REBA 2VP9A 1JJ7A 5UKDA 721PA 1YE8A 2GNOA 5CIWA 2JEOA 2OG2A 3LV8A 3GJXC 4JLPA 3IKJA 4FCTA 2VSFA 5E7JA 3E1SA 5JSZB 1UADA 2NPIA 2VQSA 4P33A 4IXNA 4RKEA 1OB2A 4URZR 2FMXA 3NBFA 1D9XA 2R2AA 1T8UA 3QPUA 5IK2D 3EG5A 2Z83A 3L0OA 1E0AA 1XX6A 1OFUX 5K8UA 2GCOB 2SHKA 3AP1A 3M4YA 4EQ6A 2EYUA 3JVUA 1VCNA 2YJTD 3BJIC 5G41A 3TRFA 3EZFA 3HYTA 4TYPA 2KBEA 5CJPA 4OQMA 4LK2A 1NJGA 2GETA 1R0YA 1Z6AA 1P5ZB 2Q9AA 1QBKC 3O8CA 2W0SA 1GNPA 4DB2A 4PHTA 5KNBA 4UQOA 1IN7A 4Y0AA 4MKFA 3AF3A 4GMXA 2YWHA 3PFIA 2G77B 5KDLA 4M8NE 2BM1A 3VR6A 5HR5A 1XJCA 3GJ3A 2GCNA 4LYJA 3CRQA 4IXMA 3O8DA 4B3GA 4Q1BA 2ZETA 3BS4A 4LHZA 4RZUA 4KVAA 1J70A 1ZCBA 2J9RA 1HQCA 2ZJZA 1Q1ZA 2ZSDA 2P5SA 1CKEA 1W0JA 2D62A 4JLDA 3OEHD 5TARA 2J7PD 1ZUHA 2C95A 1J90A 4GZLA 2FSFA 2YOFA 2A2ZA 1JXOA 2ZPTX 3DMDA 3GJ6A 5B58C 2J0SA 1YVDA 3GQBA 5AUQA 2FG5A 4G3XA 4DLTA 1KMHA 621PA 2JAQA 4G5QA 1F60A 521PA 3ZQ6A 3QG5A 5CB6A 4QJ4A 1ZU4A 3BH6A 3MGCA 3ZZUA 3ZZTA 1XP8A 4TL7A 4MKGA 1XFAA 2JIZD 1ODFA 1ZJ6A 3EZ9A 3IHLA 3RDPA 4C0LA 4WZ6A 5FI1B 4EFMA 2WJGA 3S1AA 1IXRC 1HY3A 3TSOA 3TSWA 5CITA 1E2PA 1ZNYA 2ANBA 2FF7A 2ZRLA 3NBXX 4CW7A 4TZ6A 4NBSA 1G21E 2BCGY 4TYWA 2KB0A 3Q85A 1SXJB 3DDCA 2G83A 1AKEA 1DARA 2VIIA 2C96A 5FBLB 1Z2CA 4B3BA 5CDFA 4URXR 4IOLA 1AK2A 2H92A 3FHCB 3WNDA 1TEVA 3GLHA 3Q7QA 2IUUA 3P4YA 3Q8XB 1BMFD 4GI7A 1XEXB 2BHRA 3IBYA 3NBZC 4GDFA 4II7A 1CJVC 1P3JA 1WCV1 2NO1A 1D8TA 5CLQA 4ZDIA 3AQ4A 4JL8A 2C98A 1TUIA 3TH5A 2QG6A 2ONKA 4PC6A 1VCMA 4V0KA 4LX0A 2F7SA 2RGAA 2R9VA 3AKDA 1XXHE 1RRFA 2IC5A 3K53A 4U7DA 1HURA 4PXAA 1VTKA 2C99A 1QRAA 2ZU0C 2QI9C 3B1ZA 4KYUA 2AX4A 1OXXK 4M22A 3FHTA 2Y8EA 3TVTA 3T15A 4AKIA 4C3ZA 1D2MA 2W6JA 4PPNA 1ELOA 3BAFA 3TUJC 5J4YA 1OSNA 4XIGS 1KNQA 5A0FA 3VR1A 4M53A 4ESHA 2Q3FA 1Z29A 2ERXA 2LWIA 3TQFA 1E2KA 2EVWX 5DI3A 3DKPA 3TKLA 1E0SA 1AIPA 4PO8A 2DHRA 4HLDA 1KO4A 2QT1A 3FDIA 4LPKA 4B44A 2VH5R 3EZ6A 2AN9A 3E2IA 1XF9A 1OXUA 5FL7A 2FSHA 1G41A 3ZIAA 3QUSA 3QKTA 2ZEJA 3VR4A 5JI2E 4DLUA 2FZ4A 2JLRA 3CX7A 5HZHA 1JB1A 3THXA 2CK3A 3BC1A 1G64A 1SVKA 3AGQA 3CPEA 2J5XA 5B2ZA 2WWGA 2IWHA 2RGGA 2XTZA 1P60A 3UKDA 4OJQA 3V9PA 1IN5A 1TQDA 1CJMA 2R8RA 4ABYA 2WWHA 4B47A 3U60B 5BN3A 4KI0A 3I8XA 1IY1A 1UEJA 2BMFA 2Q9BA 3REGA 2O8EB 2AD1A 2QAGB 1RE0A 4PSAA 4QFMA 3WMFA 4ZCMA 3GPLA 4FD2A 4QJ3A 1IBRA 1GRNA 2YYZA 1NN5A 2IYRA 1KOFA 5C4GB 1Q0UA 3OFND 1M7BA 2FEMA 5CYOA 5K8IA 3B2EA 5JECA 1ZM2A 1G5PA 2PZFA 4HATA 4L15A 1FX0B 4LJ4A 4LV8B 5BW8A 1EK0A 3AKCA 3GMTA 1M7HA 3K0CC 2VSXA 4Q47A 3VTKA 1K5DA 1Z63A 5F3WB 2V7QD 4B3XA 5TXGA 4B33A 3K9NA 4QM7A 2VA8A 1E2MA 2DYKA 3MD0A 5AUPB 2Q3HA 3BK7A 1GIAA 1R5NA 4AY2A 3H86A 1OH5A 1E2GA 4Q9LA 2FSIA 3NXSA 2CHQA 2HLDA 2PJZA 4Q9JA 5HKKA 3THWB 1O87A 1MRSA 3A37A 4OQXA 1MO6A 1KSGA 2XXAA 3I72A 2NIPA 1NN1A 2IK8A 2OEPA 2IS6A 2ZR7A 2QNRA 1KI6B 4QNRA 4O3MA 3K0EA 4GOJA 5GJVC 1KI9A 2J59A 2ZIAA 4JLMA 4Q4JA 1Y3AA 3QXCA 5CB8A 1BS1A 2JLQA 1YZQA 4FMCB 2X77A 4DB4A 3KKNA 3VR5A 3W3ZB 2A30A 1E1QD 4PC7A 1W36C 1ZBDA 3QPVA 3LRPA 3MJRA 4JKYA 4WZAE 4JJZA 1EWRA 2OBNA 2X2EA 3GJ8A 1QDEA 4BUJA 3U4QB 4QM6A 2AXNA 4A0HA 3QKRB 1IM2A 3K0AA 1XD2B 1TTTA 5LD2B 1AGRA 1MV5A 3HU1A 3MJHA 1VCOA 4LJ6A 1J7KA 1JR3D 1CR4A 4OI0A 1G7TA 3L0PA 2EWWA 1F2UB 4MUBA 2GZHA 2UVQA 1G3QA 4JSYA 4I1OA 1FQKA 5JZVA 3LVRE 4X8LA 1OFHA 2ZE5A 4ESVA 4BLSA 3ICQB 5KSYA 1E3MA 4KODA 4B3FX 3EA0A 3K70C 2YV5A 1Z6YA 4Q21A 2DB3A 3QVVA 1KI4A 1ZC4A 4PX9A 3AP3A 3PEVA 2YC2C 5EJEA 4LYHA 4H1UA 2BMEA 1JXMA 4NCNA 4GMDA 4GT1A 2NO0A 1OFIA 4TL6A 4IEEA 5KDOA 2CNWD 2IL1A 2MMCA 4DSUA 2J0VA 3PQCA 3QBTA 4PHHA 1R8SA 5J4HA 5DGXA 2XOKD 4Z1MD 3N2EA 4P4SA 2QMHA 2WSSD 2BIFA 3A1VA 1X8KA 4C9BA 2HYIC 1Q21A 4F38A 3NIBA 1D2EA 1VG1A 3QIAA 1T8TA 3DMNA 3CH5A 1OPXA 3QSYA 4AYXA 4P3YA 1NLZA 1GRRA 3FOZA 3AVOA 2BMDA 2G0NA 2XAUA 3BE4A 3AVPA 4QNMA 4HDOB 2GK6A 3GP8A 2NTYC 4RFSB 1G16A 3IILA 4TYYA 3WXMA 4ILEA 1JQLB 1HYQA 2LCFA 2GXUA 2AXPA 2QRZA 1N6RA 4CRWB 5DYIA 2VHUA 1TL7C 4A1FA 2QENA 2OT3B 2RKOA 5IK2A 2XZLA 2A3RA 1T4GA 4MUAA 1KDOA 2JLYA 2MSEB 3BIFA 2I3BA 4X8OA 3B1WA 4W7SA 4LY6A 1QF9A 2OFOA 3VHLB 1KJWA 2BC9A 2C78A 4CEHB 1AJEA 1Z22A 2QY9A 3AH8A 4EDHA 1T9HA 2H1LA 4D80A 2O8DB 4CEJA 4U5XA 1QHSA 2QPTA 3FYHA 4UJ3A 3FGNA 1N6LA 2O0HA 2IUSA 1EESA 4PPFA 3NDPA 3GLIE 4OHWA 5DH9A 3UWKA 2WM9B 4C0HA 4NCIA 1GILA 3MSXA 1R0WA 2B92A 4YC7A 1JAHA 3JVVA 3RWOA 1I2DA 1MABB 1E9DA 2ANCA 2ZVQX 2GKSA 1GKUB 2CLSA 2PT5A 3U3RA 1K5GA 4CGZA 2F6RA 4ZDKA 1P73A 2J7PA 3EWSA 1LW7A 5AK0A 2D74A 1W47A 2DWQA 4O2RA 1HE1C 2YKGA 1LNZA 1NKSA 3FFBA 3ADDA 1Z0JA 4GOXA 1DAMA 1RRGA 2PLFA 4HDQB 2D4HA 2JASA 4EJSC 1G17A 1HT1E 3EARA 5FOXA 2JIZA 2ONJA 3UMFA 5KOYA 1KKMA 1OHHD 4BPBA 1QHXA 1TU4A 3SHWA 4HAXA 2XX3A 2FPLA 4MDEA 3RYTC 4EQ6B 3B9QA 1JPJA 2G3YA 2OXRA 4JS0A 2Q6TA 4IOJA 4PAQA 4U02A 4Q9IA 5GADl 1TMKA 3C4JA 4IVQA 1E1RD 4FW9A 3SJZA 1UAAA 1IONA 2ZTSA 3VKGA 1E2IA 3PEYA 4AG5A 2QORA 3C7KA 1ESNA 1SVMA 1ZP6A 1ZNZA 3HJNA 3HYRA 4Q18A 1N6OA 5LPNA 4CT5A 1YZNA 4DDTA 5GVSA 2OCYC 4HSEA 4QGGA 2D2FA 1BMFA 4ACAA 3KB2A 1WMSA 2J1LA 1D5CA 1E94E 1PLKA 3KJGA 1ZU5A 2QAGA 2AK2A 1NLYA 4XJXA 3VX4A 4ZKDA 1ZW6A 3RABA 2H8KA 2YZ2A 3NDBB 4LHYA 2WJHA 2IYYA 4GP6A 3K70D 2QROA 1KAGA 2BJVA 4JIMA 3SOPA 2GVZC 4UNRA 1QHIA 1XJ0A 3RS3A 4A6PA 3ETLA 2GJSA 3WYGA 4NL4H 1KYIA 1XXHA 2VHJA 1HEIA 3I32A 1MO3A 5B30A 1KMHB 2VP6A 4IW3B 2O0KA 5KPJA 3D6TB 1N2CE 3SC3A 4OQLA 1I4DD 2ZE7A 2XZOA 1UKVY 3B78A 4RCZA 1F5NA 2WIAA 2HYDA 1C9KA 2QGZA 5FPYA 2F9MA 1KI6A 1W46A 4S2EA 1OV4A 2IA5A 5LB4A 2AR7A 1RYHA 1NVVR 3B13B 2J46A 3LD9A 1AS3A 3SS8A 5KNCA 4G01B 4HDCA 1KY3A 3KUCA 1E79D 4TLDA 1QG4A 2B8WA 4BLOA 4TT3D 4NYJQ 5BQ5A 1ZM7A 3VNUA 2F43A 3AP2A 1YU9A 4ZV4A 2JA1A 3NG1A 3HPQA 4P4TA 5F9FA 2AHOA 3ZD6A 3GLHB 2WWYA 2VP0A 3QKRA 4DUGD 3B6EA 1GP2A 1NIPA 4YQFA 4LSGA 4QGFA 4RFVA 4YMVA 2PEYA 2AFHE 1OIWA 2VRWA 3W5JA 1ZCAA 5L3SA 2AKAB 4PTLA 2ZRFA 5DSZA 5CIQA 2FPMA 1NI3A 2GCPA 5D3QA 1XTIA 2R44A 2W00A 1XMJA 2V7QA 4GNKA 5AJVB 5P21A 2WIBA 4Z8YA 3PUVA 1JI0A 1G8GA 3F5FA 1Y63A 3TAUA 1HT2E 4EPYA 4KLZA 1GFIA 4BEBA 1ANKA 4KCGA 5FPTA 1Q3HA 1S8FA 4HB0A 1QZXA 4UXJA 1U8YA 4MKIA 1SXJC 1P4SA 1DELA 4Q4HA 3SYKA 1OYYA 4TMZA 4JVLA 5DI3B 4DIEA 5FI0B 4OHZA 5JWOA 4DWJA 1ZIPA 1LF0A 3VR3A 5AJYA 1NMXA 3IUYA 4QBHA 1W4CA 3IQXA 4DZZA 1T5LA 3CF6R 1E2FA 1E96A 3BFKA 5FUWA 4KJZA 2G9NA 3RSOA 3NWJA 4BLPA 4HLQB 1P2UA 2HJGA 1N5IA 3L82B 4QL3A 4UKDA 4OI1A 5AJWA 4BECA 4DLVA 3LH5A 1HTWA 4QHSA 4TMXA 1TQ4A 3THXB 1X8JA 5FBRB 2HCJB 2C9YA 2C9CA 4BZPA 4C0SA 3IPXA 3AVUA 4R71A 2IT1A 1W44A 3TNFA 4JLAA 1NY6A
chains in the Genus database with same CATH superfamily
1CG6A 5BOSA 2GTPA 2GAAA 2CEKA 1I4LD 4GQBA 4OYLA 3JALB 3L8YA 3NVDA 4ROTA 4WZAA 5FUXA 1M10A 1NHWA 2IE0A 2W71A 3HCRA 4P3PA 2ZM6B 4P81A 5HX7A 4G0PA 2AGVA 3V3KA 2O7QA 3FSJX 2W83A 1OXTA 5IT4A 2PS1A 5CB0A 2E4UA 2H2FA 5U4QA 5A3RA 3EUFA 3BREA 1SQ0A 1P1IA 4JOSA 4WY2A 4XKJA 3IR6A 1KC3A 1U0JA 5ELXA 1NASA 4OJKA 3FYTA 3ORYA 2B34A 2AUNA 1QX4A 3QA9A 1RZ3A 2I99A 2G28A 3L0SA 1EIWA 1PKXA 1W6RA 2B98A 2GDJA 4RENA 4C1NA 2DR0A 2WU3A 4Q9KA 1A2KC 5EUCA 3AF0A 4OH1A 1AHNA 1NW3A 2CWDA 2V0CA 1VBNA 4IHAA 4LVNA 3D3JA 4L5YA 4UPEA 4BNTA 1RCUA 2B5OA 4BMSA 1PQUA 1F38A 2V7XA 4DR5B 2CJWA 3GGGA 2YFKA 3E03A 5BSEA 1WOMA 2JK0A 4P22A 2PEZA 5ALGA 5FV7A 1XCLA 3K6JA 4DLAA 3RVBA 1MABA 3F8WA 5DGHA 1Y5NA 3ANSA 1KR2A 4PZEA 2XCLA 3LU1A 2J6HA 5SZIA 2B69A 3WGLA 1VLVA 2VJPA 2WINI 3C24A 3L8CA 4BFZA 2ODBA 1NZJA 3ADBA 3M6AA 2OCPA 1FY2A 1WHTA 1T91A 3V8MA 2WU4A 1JG3A 2A5JA 4PO9A 4DLRA 5I7FA 1IBKB 1UPTA 2OKCA 3R3SA 1PBTA 4JSRA 5AOBA 5ES3A 3GNTA 1SCDA 1IXSB 1KAMA 3B7PA 5AVOA 3H4TA 1P7CA 2OXCA 4E6EA 4Z4CA 3K0AB 3T5MA 1NJ2A 3B6ZA 3OIYA 5ULLA 5L3QA 4WPGA 1ZW1A 3QVWA 3KXKA 3UFXA 2YMPA 4JX9A 4Z51A 4QHYA 1XNJA 3SR0A 3DHYA 2QX8A 3FPFA 2QE7D 5EUBA 5CH5A 1UPFA 3DW1X 4B6EA 1CF4A 1NJFA 2GO7A 2O2DA 2YXEA 5GIPE 1BMTA 3A1TA 4DJFC 4LXXA 1A9PA 4JR2A 3TYXA 4DMGA 2ADFA 4MYTA 3T7JA 2WLSA 5B1YA 1DTEA 2ODQA 3VISA 4JC0A 4CV3A 4Y1RA 3A9CA 4YWJA 4KE8A 3O47A 2XUGA 1IIRA 5JIBA 4GZMA 3PGKA 4B8YA 4ZK6A 1NUPA 5EHNA 4BC1A 2BHSA 3IQWA 1ZJJA 3P2OA 1I3KA 2WD7B 3NWPA 1TYEB 1J99A 4ADSG 3QEBZ 4FKZA 4F2PA 1L3CA 4FKMA 5KVSA 3DL0A 1ZGAA 1UK9A 1K92A 1ND5A 1QFSA 4WWHA 1KO5A 5DLQC 3W6OA 2C5EA 2X0JA 2AQKA 2P77A 1O1YA 5JMOA 1KMNA 2Z5LA 3IUJA 4ROSA 2G1PA 4ER0A 4RTQA 5JAHA 4MS1B 1CZKA 3UT5B 2BEWA 1U5CA 4HQ6A 3N1UA 1JWBB 3PKZA 3PIDA 3GLIA 4BQFA 1BIFA 4G37A 4R1UA 2IYOA 4KGZA 1DO8A 4PLYA 1F06A 4YRGA 1TMYA 1WXEA 2P78A 2Z2KA 3GQVA 3MC1A 2CMFA 1Z4PX 3CTPA 2ZP1A 4NIMA 4LSWA 1GWNA 4FFBB 1YJ5A 4K26A 1A9RA 2RK3A 4MUGA 3H4MA 3Q8MA 4NSNA 4GVLA 5F2OA 2TRSB 4EARA 3ZYZA 4BASA 3C43A 3ILHA 1SFRA 2ZDHA 4FHDA 2GR9A 5HUHA 1X7WA 2IIQA 1EIZA 3PE4A 3DE0X 1JR4A 2PGXA 4YCCA 4IZOA 3NT2A 3QX9A 5DM60 2B4RO 2F67A 1I6LA 1ORWA 4DBVO 4D25A 3DCNA 2HTFA 5K6TA 2H9AA 3LK7A 2E37A 1KZ4A 2Q3CA 3A0UA 3M4ZA 4B6QA 4K6MA 1Z2OX 4RTMA 2OHVA 1RRCA 1E1RA 4O0MA 4PNHA 3SBXA 2CJFA 3U16A 3AVWA 4EGCB 3RI3A 1EUQA 1PR2A 3ED1A 4AURA 1XMVA 4WDQA 1SKAA 2FSPA 1WUJS 4F04A 5IANA 3G5LA 4OQNA 2REXB 5LDHA 1VLMA 1SZDA 4TZKA 2N75A 1R9MA 3OTQA 1MO5A 2ZS7A 3I4LA 3A4MA 3WKDA 1NVMB 4BAZA 4HVLA 1R8JA 1QQ5A 2XJ9A 4KE6A 3VVBA 4MUKA 3G8AA 4DV0B 3BT7A 2QVZX 3PWZA 2IHVA 3MMSA 1HT0A 1IZYA 1FFXB 2I3AA 3FVQA 1ZJYA 2ZWVA 3OZEA 1FFBA 4E5MA 1TK2A 3W2GA 1CU1A 1SVUA 1O6CA 5EPOA 2QXTA 3O1LA 2XE6A 2EKLA 3GPIA 4FXOA 4JQSA 1N9KA 2BM9A 2IOYA 4NPHA 2AQIA 3M2TA 3CPHA 3TTYA 4JEUA 4ZEMA 1B8OA 2HK8A 1FRFS 2XRZA 4ZO7A 1T3LA 2R79A 3RVPA 4O25A 4P32A 3RK0A 4QBIA 4F6CA 5CYPA 5IT5A 2F4VB 1NF3A 1THTA 4EHHA 3R7LA 4C4TA 4HNRA 4U7HA 3HN6A 3E8SA 2DSNA 3KQQA 3SLRA 3WBJA 4NOJA 3N0TA 1LSSA 1GY8A 1G4AE 1GVNB 1C3OB 2CBGA 1SUBA 4KW7A 4CTNA 4DSAA 1HNXB 1H1LB 3W7AA 3JQFA 1MDFA 1OD6A 4KNWA 4QYSA 4TVKA 4L16A 1UBOS 5FPSA 3FDFA 3HL0A 1GGFA 1NV8A 1E99A 4TL8A 3VYVA 4BFCA 5E2IA 1Z39A 1A5SB 1P7YA 2ODEA 1T0UA 2WKPA 2ZSHA 3HBFA 5EVJA 3LDAA 5DM2A 4MDYA 1OILA 4ZAWA 4ER6A 3BHMA 2VSNA 3PF9A 1T0PA 1YAHA 1S2OA 4LRTB 3QKUA 1T1RA 3COSA 1QYWA 1SXGA 1RS0A 2VUUA 3IUMA 2IVFA 3H2SA 4L27A 3HBLA 5AVYA 5KTYA 1NVFA 3PGVA 4NV3A 1FCJA 2UYOA 3B52X 1RPAA 2YNMC 3LYAA 1DMRA 1JIXA 4KI7A 1O5TA 1XOIA 2F17A 3CUTA 3FBWA 3FFAA 2Q2NA 4PANA 4MWZA 1FZQA 3U7HB 1G8YA 4KR0A 3A9VA 4G1EB 2OGWA 1O0CA 2HUPA 2DPLA 3EZ7A 1I0LA 5DM4A 2IF2A 1WA5A 3QY0A 1TCUA 2YFHA 4HWRA 3C8MA 3H6KA 5CVUA 4ZCLA 1UBGA 2YZMA 1ZI6A 3PTAA 1E5LA 1XRNA 2JFZA 1VI5A 2WHRA 3AKEA 3LVFO 3O73A 2JIRA 5J5VA 5C8YB 4CIDA 6CHYA 3OLVA 4I6GA 1WABA 2EJWA 3ESDA 1Y4AE 3F5SA 3OLQA 4LYAA 3RUIA 4B76A 1XRRA 1Z37A 1V7ZA 2PRJA 4NYMR 4YRIA 5ALOA 3RW9A 4EHLA 2IZ7A 2QUKA 3DMYA 4BB5A 1FBTA 4GPAA 1PNTA 3SLKA 1PWXA 1DAEA 1GFWA 1V3VA 3S7ZA 1MO4A 1VPTA 5FTNA 4CZ2A 1ZSNA 3ITNA 2PZMA 4IUYA 3G9TA 2NZ8A 3H65A 4MVJP 1AE1A 5K45A 2ROQA 1O9GA 1LB1B 2GYVA 2JGNA 3LO5A 1DC6A 1ZKDA 5AMXA 4MWEA 1FLAA 5H68A 1JTFA 3PWKA 3TG8A 1GG8A 2J31A 1I2AA 1XXHB 1PI3A 1PJCA 1E7WA 1UWLA 3A4TA 3NJRA 3SZRA 5E1OA 1E2NA 2FOXA 1BRMA 3GK3A 2CL5A 2WAAA 1XQVA 3VR6H 3YASA 4QTUB 1S89A 2AWOA 3O75A 3MHPA 1JDBC 5T6MA 3LLVA 2PNJA 4CIVA 1ENZA 4NJOA 3ABSB 4KH0A 2C54A 4WERA 3AO0B 4QFCA 3ZWWA 4BLRA 1J5EB 3I1YA 1GEEA 2BR4A 3DF7A 1HDXA 2UU9B 4X6XA 1WNFA 3VKUA 2BRUA 1E4EB 2FQ1A 2JLXA 2XB6A 2PZKA 2C5SA 1YR9A 3CG0A 3PD1A 4NVRA 4ZANA 4Z3DA 1Y6GA 4OMUA 4TV8F 5JQWA 2ZYSA 3K2IA 4OKNA 4YAWA 4PYMA 5BV8A 5E6SB 1E2LA 1GAQA 3ZC3A 3ITDA 4AMVA 3D81A 2HWKA 1ULHA 2FPGB 1XTRA 2I6TA 1WV0A 1PQWA 1QYRA 2F43B 2IYWA 5JCJA 2C3YA 1SOUA 1TZJA 1EWVA 4MR8A 1A7JA 4RGBA 4XVUA 1IWOA 1BQ4A 3BULA 1VOTA 2I66A 1KERA 3AXTA 4D3SA 1PX2A 2HF9A 1RMQA 5JRZA 2J3MA 1YTUA 3WHLA 1BXRA 2VXYA 3EX7C 2WJIA 4QODA 3T3HA 5K3AA 1HFEL 1JBQA 2LE0A 2RI1A 1F0PA 4M0LA 4Q9HA 1JIIA 1KY5A 1JHRA 2GM9A 1QJCA 5CM9C 1QLHA 4YO7A 3RYHB 5A5GA 1QFYA 4FCCA 1JA1A 1LQ2A 5L3SB 1T4DA 2VRBA 1PTJC 3VR0A 1ZJZA 3IOMA 1BX3A 1DBIA 3IMEA 4I3FA 4L4YA 4DANA 3WLLA 1Z62A 2ZYVX 5T8KA 2IQ5A 2I22A 3ZDBA 1K2VN 3LBYA 4Y7CA 5ALEA 3IAFA 3PZBA 4N7MA 4F84A 5GV8A 5NLLA 4XAQA 3TB4A 1KYZA 3U31A 4F5EA 4GPEA 1VPEA 4UC0A 4NHOA 3UK6A 1ZISA 2JANA 3B20A 3EVEA 1US8A 1T8PA 3D6UA 2J9FA 3K96A 1W0KA 3EULA 1M9NA 1TYZA 4UREA 4CR6A 2ZM5A 4FGLA 3UMBA 4X1KB 5JO9A 3CX4A 5KIAA 2UZ4A 3G85A 2PXCA 5GP1A 4CMCA 1U31A 3NVKI 1I0ZA 3ZWNA 5JG7A 5CH8A 1KSJA 4YCMA 1DXHA 1DJLA 2INGX 2W8BB 3SNHA 3G2PA 1BQ3A 3K4PA 2Y6VA 4FCWA 4I1IA 4DNFA 4ZHQF 2CVFA 4HYEA 4AJHA 3NNSA 3KEGA 1WL8A 4ZWNA 5LZ2A 1DJMA 5JATA 1T9KA 4BU1A 2DFKB 4IIJF 2JHFA 2NXWA 2FJUA 1V9LA 1NP7A 3DAYA 2JGRA 3ETGA 3IHKA 3ZDEA 3QEAZ 4F4FA 1GZ5A 1WU8A 2XT0A 3KU1A 1N3LA 1CR0A 3QELA 4ZD6A 2GARA 2OVBA 3OKCA 3OO0A 3SMQA 4TVSA 8ADHA 4QGBA 4B45A 3AR5A 1T29A 2BFBB 3ZPXA 2HXSA 4UUAA 3ZHVA 1M0EA 4EG8A 4X95A 2AFRA 5G0SA 4HRXA 1M0TA 1RLJA 3DG9A 3A9RA 3EWNA 2P67A 3ZIUA 1X77A 1VE1A 3COVA 2OPBA 2HXYA 3BB3A 1Y98A 1JKFA 1SCNE 3CLTD 3JQ8A 3R6WA 5FFMA 1YO6A 2ONZA 1QP0A 1OWPA 1J0AA 3ODPA 3SHTA 4B7UA 3VNRA 1IB0A 1UBHS 2RHOA 3WO1A 4D4JA 1TJ3A 2WPDD 3F8SA 1NM5A 3KPYA 3HU5A 5COQA 3FJYA 1PL0A 1C3LA 1HOXA 4BVGA 1S8OA 3VPCA 5CXQA 2X1LA 5DF1A 4YQYA 2ZT6A 2AFIA 5LA6F 2VF2A 4HGRA 3GA5A 3RANA 2GFQA 2Y0CA 1ZO8A 3BERA 2PSSA 1R5OA 2ATIA 2JHPA 4YH1A 4YBRA 1CB7A 1BO6A 3IVCA 5DGCA 2WSLA 3RU7A 2MSKA 1GG9A 3EVTA 2WOJA 5D85A 1KNXA 1AHIA 2C4NA 2GXAA 4Q7MB 1KDPA 5BN4A 4O1MA 1QHHA 2PU7A 4PTZA 2WKRA 4HMPA 1Z8DA 4YRTA 4IFBA 1FBNA 1KO8A 3TK1A 2XDQA 4GWGA 4KEAA 3AIIA 3NBYC 1A8QA 4AJIA 1LBQA 3KOZA 1YS9A 3R9KA 2RE8A 2I5PO 3NVAA 3V4PB 3QE9Y 4JUFA 5F76A 1HSOA 4EEZA 1ZXLA 2R4QA 2P27A 4IEFB 3MINB 4ZAFA 1UDAA 5K0TA 1ODSA 5DBHX 4Q02A 1VLJA 4A8JC 2EP7A 7YASA 1NE7A 1CTQA 4HFJA 3UATA 3UMMA 2B4KA 2O06A 4LOAA 1OXVA 2A1IA 1ZJWA 4G86A 5JD4A 2UXCB 2YOHA 2VRCD 3PPVA 2GGSA 1Q2XA 2IDMA 2JJ8A 3EIQA 2R6FA 1SELA 1W2HA 2D5IA 1G6Q1 2RGXA 4KFTA 1MV8A 3KYJB 4QQKA 4W5WA 5AP9A 2WMDA 4YCSA 3W7BA 3PJGA 2O48X 3SM3A 3ZHTA 1QQBA 2HRZA 4OAOA 3THYB 2W6OA 3KFLA 4FPXA 1Y9ZA 1W4RA 3FPBA 2GBFA 2ZWOA 4H6VA 4HLUA 3TEMA 1ETHA 2Y1DA 2FHSA 1XTQA 2GBLC 2FH5B 3CJRA 4V0QA 4AMZA 3QPBA 4PPYA 2F3RA 2LUOA 2WY2D 2NVUB 3P7MA 4HS9A 4M9SA 4IDEA 4N48A 3RHFA 5L7WA 4GLLA 4E1VA 2XIQA 3ICWA 4YFVA 4A3SA 1Q1BA 3DFUA 3Q10A 4Q3OA 1DBVO 5IBPA 1J07A 4UVIA 1BW9A 3LC1O 2VPPA 1NMZA 1VRWA 2H63A 4JC4A 4BP3A 4BJ5A 3AHIA 3U1BA 1B00A 1M1UA 3V8QA 1X7XB 3QPDA 4Q4AB 4B5LA 3LQRA 4AP5A 4JBHA 4LJYA 1O95A 3L2OB 2EXXA 1KOJA 2BY4A 2OORA 3PCTA 5EYPA 3VI4B 3CRW1 2AEJA 5D3KA 5ALNA 1WAMA 4M1WA 3G5MA 1M8FA 3TLAA 3WVNA 2HPVA 4FHGA 4HBZA 2GN4A 3LXXA 3UQZA 4MW1A 5I9TA 4DC1A 1R9NA 1XSEA 4U2DA 1A98A 3BBPA 1R2QA 3UMYA 4CTJA 3HVKA 4AN1A 4EX6A 4IDNA 1FS6A 1IZ0A 2G82A 4MGEA 4X44A 4ZO8A 3GRKA 4BAUA 3OTGA 2W2PA 3NWEA 5AHWA 1X8XA 3QNWA 2GZAA 3IE0A 1IQ0A 1WMEA 1HXHA 1NU8A 1HK7A 2GWHA 2MOKA 4ZT2A 3SBEA 4F6RB 4DV1B 2DETA 5B1DA 1TA9A 2YICA 2W4MA 5ITZB 1H5UA 1SCJA 4UFPA 1YULA 4HZIA 4QT4A 1Q14A 3PX7A 2CDAA 1RXYA 3V80A 5ENZA 2H29A 1GPUA 1UXKA 2N47A 1ZZGA 1U3CA 3NJ8A 4GLFA 3TSYA 3CW2A 1JR6A 2QUAA 3LOQA 1YZGA 1BJTA 1T1SA 4MQEB 4NRDA 1C0IA 3FY4A 2ZAIA 1NPYA 5DLPA 1MQ9A 2B1RA 1DIBA 1QR6A 2G6TA 2JGAA 2X0IA 4IMIB 1JGTA 4BMDA 2HPHA 4B74A 1K7XB 2B2XA 4HZUB 4MQMA 3HLTA 4J03A 3T1VA 3LUJA 2GBIA 2HSJA 1G2QA 4IXDA 3V00A 2UXBB 4PEVA 2ZE6A 3E2PA 3SE0A 4Z4EA 4C2AA 2PZJA 2CDBA 3FZQA 4K9PA 1JHYA 1QYXA 2C1ZA 2EHDA 3BDIA 3WI7A 4BTLA 3ZCXA 3E3OA 4RMIA 4MYHA 5HMMA 3DEAA 5KVVA 2ORWA 3A1SA 3ANTA 3E5MA 4I14A 4OP2A 3WK6A 5KREA 3FHOA 4IOMA 1DO2A 1VBFA 2VF8A 2NTJA 3SFVA 3UB4A 1C3VA 3ZXIA 1ICIA 2R6ZA 2Q4BA 2AEFA 3IR7A 1QH9A 1M0SA 3QXJA 4GECA 2ZUSA 1UMBA 2ILTA 16PKA 1ORDA 4UM8B 5JC8A 2ACKA 5KMGA 2D5LA 2Z9BA 2NQTA 2Q2OA 4KAJA 1Q0QA 1YUBA 2VO1A 3PKIA 3A3YA 3RS7A 1U8XX 4CF3A 4CM1A 3ZV4A 4PV7A 3X2SA 3FOAA 3RUPA 2IBTA 2C57A 3CJQA 3FKSD 2WLTA 4D8UA 4ZI7A 4DV4B 4ZHSA 1GVHA 3OFNA 4XJVA 4DA4A 3EXHA 2NMVA 3Q0IA 3W8NA 2HQSA 2HD4A 3O94A 2JFNA 2PJDA 4XTRA 4C05A 2CZGA 3N0WA 4ZK2A 5CLIA 1VE6A 2YV4A 1PAUA 1GTL1 1TU0A 3LWBA 4UAJA 3UUEA 3Q2IA 1KK1A 2G0TA 1NUQA 3TUZC 3WNCA 4KR2A 2VYFA 2WP0A 2BMVA 4Q19A 1FA9A 2PIDA 4QE3A 4S0XA 3STVA 4XD2A 4Z9AA 3RE1A 4Q05A 1EM6A 2CNDA 4R54A 2HLNA 3WSWA 4A82A 3OZGA 3WMGA 2EBUA 1J9EA 1PJRA 1DIGA 2GJ4A 2IHYA 3ROTA 2YS6A 3IPRA 4UZFA 4HUTA 2CF6A 3HKBA 5IM4F 2JLWA 4X61A 3FLEA 2GYUA 1R4NA 2Q5EA 3I9V1 4MV7A 4RA9B 1XDZA 5EZ6B 3UH1A 5K8LA 5KVAA 2FR8A 5EJ2A 1AA6A 3VV3A 1CFJA 3U6KA 1VG0B 4YGXB 1KZHA 2CNKA 3KK0A 2G6BA 3IL2A 2QZ9A 1UEXC 3H84A 3F6EX 3KX2A 3QPWA 1N2CB 3LQFA 3NV9A 4EIWA 1UZLA 2GN1A 1Y5RA 3L1KA 4ZQIA 4ZVKA 4AMBA 5I7OA 5G40A 3T3IA 5F33A 5CLJA 3OTIA 2FSSA 4A4DA 5EMKA 5IJ0B 1C4OA 1ZL2A 3RVMA 5FO0A 3D2AA 1Z5NA 2DFDA 2W2TA 5F77A 5LZ4A 3L6EA 3HYSA 2TYSB 4BEVA 1KGSA 5FUQA 2W4QA 4ILKA 1JYEA 4MA4A 5IAEA 2NZYA 2QBYA 4XD7D 3AEZA 1VL1A 3AEUA 1E9CA 2CHGA 3PR1A 4NMMA 4U7JA 5CFMA 3PJRA 3HFJA 4XRGA 3MELA 3RFFA 4L28A 4KWEA 2GTHA 1F9EA 3U9LA 2QMEA 4EY4A 1ZD1A 3OIUA 4YB8A 4BKOA 2NXEA 1JR3A 1V43A 1WDWB 2P6UA 4C4RA 3AKZA 5DHFA 4MVJD 3SMVA 4FFRA 2ZQ5A 3OHSX 2Y77A 1IOZA 3GFQA 6REQA 4J29A 3FNRA 1IVSA 4R0NA 3OECA 5H5JA 4OOFA 4RTNA 2DM6A 4DV2B 3KVYA 1KS9A 1NJ8A 3WYBA 2PUTA 4KQCA 3WGUA 6PFKA 3I2GA 1LDEA 5TB5A 1FNBA 1DU4A 4X8HA 1CVIA 5EEGA 3CUSA 2VT2A 1E3TA 1FJHA 2NUTB 3IJRA 4O4LF 3T5GA 5KTKA 3I5YA 3HJRA 1FDRA 2XMRA 5LQJA 4KAAA 5T4BA 1J8FA 1ZOIA 4QRDA 5EKTA 3P32A 4AS2A 2EATA 4NAUA 3TCXB 5U9CA 4Q9AA 3IALA 3I9MA 5L6MB 1TW2A 2BEVB 2VJCA 2XE7A 3DOFA 1EVLA 2NT3A 3DMGA 2OSBA 2XOKA 1A2QA 2QRGA 4JVNA 4G97A 3DEYX 2C7BA 2Z8XA 1KYVA 3C15C 2VYCA 4LXGA 3MFQA 2H07A 2P1ZA 5KVQA 5A7HA 3RK4A 5DISB 5LWHA 4ESEA 5LNK1 3ZJ4A 4MGYR 4QDOA 5B12A 5LBTA 2O2SA 3JQ6A 3SS7X 1E2EA 2ZBUA 4FQ5A 1VKJA 3AIKA 2D1FA 3DUWA 2QMQA 3RLIA 2R8BA 4Z4IA 4S35A 2ZAOA 1S9HA 2RGDA 1GUBA 1LX6A 3KAJA 3Q4GA 4KQIA 4ECAA 1CIVA 5BUZA 3GF4A 5JQGB 5GINE 1NBOA 2ZU6A 3MMNA 2XMZA 4Y9UA 1WWKA 4D6XA 4WXEA 2V7TA 2PZ8A 3DM5A 4ID3A 4LZOA 1PF7E 1Y1QA 2KHZA 2P65A 2VDKB 3BDAA 3S55A 2HF2A 4ALMA 2WM3A 4XDYA 2B78A 3V8RA 3E3MA 3EXG1 1WETA 2GAJA 3E7WA 1E9FA 3PQEA 4CQLA 4D5EA 2QRKA 3Q40A 3QFFA 4M1MA 1CPYA 2AOVA 1KK2A 1YXMA 2JGKA 2RHRA 3D4LA 4N5IX 4JYAB 2X7XA 4W5JA 4NENB 4OCZA 4YXWA 4F8JA 1U28A 1EJ2A 4RZIA 1WRBA 3NIDB 1NUAA 4L3WA 3SF8B 1VYVA 4JYBA 3QXXA 5I7UA 2AVDA 4TXLA 5DYGA 4DCCA 2JVIA 2ZIXB 5L8VA 3CVWA 1GTSA 4TM7A 4O5AA 2ZZKA 2GX6A 1M0WA 3K30A 3B38A 3PEFA 1YK0A 1YCGA 1W6UA 3IXQA 2XA1A 5TJHA 3VA7A 2XE8A 3KELA 3REOA 1WXHA 4YNBA 2ORYA 1SCAA 2EBWA 2Q3BA 1O8CA 3DE7X 1GCUA 1T6NA 2WFLA 3ET5A 1AZLA 3PNKA 5LOVA 1KF0A 4C21A 4R01A 5ESXA 2FPIA 4KN8A 3ZCTA 2DLNA 3X1MA 2QL6A 3PC4A 3HEMA 4H0FA 5U4XA 4M2LA 2DFTA 4E11A 3IAUA 1EX9A 3UJNA 1LBSA 4HTFA 1P18A 2QN2A 3KT8A 4L6IA 5F4ZA 4AY5A 1O94C 2ZJAA 3MWJA 4P4LA 2NU8A 1OY1A 1YB2A 2H2AA 1T25A 1BWSA 3KHSA 3Q3EA 1N1GA 3L06A 4GGPA 5ICGA 1R0KA 1GM5A 5TPZA 1KE1A 2IYSA 4MI9A 3DVLA 3WHIA 2O8BA 3FWYA 2BH9A 3SYTA 2GA9A 1DS6A 3EW7A 1QAOA 4N5MA 1OW3B 3DFFA 3HN7A 4C0AC 4E33A 2KYRA 3IUQA 2Y66A 1X1BA 4QLBA 4ZVOA 1CDDA 1GRCA 3P9NA 5AUNB 1NBEA 4UTNA 2IRWA 4MP8A 1SXJD 3IJPA 4GYKA 1FFGA 4MCJA 4V1CA 1Z18A 3LCCA 4R9UC 2P9HA 1EGHA 4C4YA 1G4UR 5LXTB 3EA5A 5BURA 4M89A 1QG6A 1U9CA 4DIDA 4L5AA 3IP8A 1E69A 2PSEA 3RIXA 1C41A 1RJ9B 1VJDA 2Q1SA 1Y1SA 2WD9A 3CZQA 4WCFC 1S8AA 4QRHA 1E4VA 2VYQA 3OF2A 2YQ5A 1U1GA 4J7CA 4IJUA 4JQOA 4UNSA 4DFDA 4V0RA 1FU8A 3WGGA 4EHJA 1MB9A 4XWYA 5KWSA 2HMYB 2X9LA 3MOGA 3WGHA 5DO9A 3PQ4A 1D5WA 1KIMA 3EVAA 5K20A 2YWBA 5B1IA 4UTRA 1FUEA 5JJBA 3P97A 1XTKA 1M8PA 2E1RA 4QTXA 1XEFA 2BKXA 4Y2TA 4GOMD 5GWXA 3ZGXA 4TN5A 4NLLA 4UDNA 4Q16A 5I3CA 3P19A 1S96A 3T9BA 3ZY6A 4E15A 3IV7A 1E89A 3LFTA 1MUUA 5E4TA 4C07A 2UYHA 4KNYA 3QLUA 1Y4DE 4AZWA 2ZIUB 2GPTA 2JFQA 4ETMA 5L45A 1JX6A 1TKCA 2DXIA 4FJ1A 2JW5A 4D9BA 3Q7RA 1RKXA 3TSAA 3EFHA 1K8RA 3OLCX 4EENA 3KLMX 2JVJA 2JB9A 5CDUA 1V8DA 5CT5A 2O8CA 3PL1A 1OAKA 1N6HA 1NNI1 2IPMA 1G8MA 2V1XA 5ILQA 3OQVA 1ZR4A 4LJSA 4I99A 2EC5A 4C6HA 3ASVA 1S9DA 2ZRNA 1NMQA 4JI3B 2PFGA 3BFVA 4G36A 1JQEA 1WUTA 5L3RA 1JKXA 2ZYTX 4G1UC 4HJXA 4Q1CA 1CR1A 1H8ED 2AEMA 5DGTA 2I2CA 1RWMA 2WAMA 1DL5A 4I4IA 3G2KA 4GD3Q 4RQBA 2ZUEA 3CE6A 4GR9A 3NOVA 1JAXA 2D2XA 1YJXA 2V65A 5AXAA 3OETA 4DQLA 2W2QA 1U3GA 4DLYA 5LMNB 3MQFA 1NX6A 1N2HA 3BK2A 3GAZA 1SC6A 2YL2A 4HWTA 1T9DA 4B4WA 2QF7A 3QU7A 4N9WA 1CDOA 1T2NA 4E6PA 2OAEA 3DBVO 1TA4A 4AULA 5WRFA 4TUYA 1NXVA 3HHEA 1N0WA 1U0RA 3ILXA 3NT5A 2CBZA 5F7JA 1KVTA 5GPBA 1P2SA 3PP8A 3PUWA 2G88A 1NR1A 4ON9A 5TEVA 4MS3B 2HRBA 1RKVA 3U3DA 3HXTA 3NM5A 3KQUA 2CV2A 4HAYA 2WIFA 3U7GA 1PYDA 1I3MA 2QN8A 1SU6A 2GZSA 4HUQB 2R6HA 3KZOA 5FWXA 2IXBA 5EA2A 3S2GA 4DT1B 1D6SA 1MW8X 4J3NA 1VL5A 3A04A 2BFCA 1CUGA 5CFNA 4GRIA 3LO8A 3C4QA 4JDPA 1X70A 2Q5HA 4KKVA 4PU0A 1NPDA 3VYRB 2RGEA 2WJYA 3EMDA 1OZFA 1DSSG 3EUAA 3NUZA 4P3NA 4PC3A 4NDZA 1NOJA 3II6X 4QGHA 2OQRA 4X90A 5FNVF 1OVGA 4C4XA 4BNNA 4IDPA 1I36A 1FMCA 4N41A 3HNRA 3PJDA 4HDSA 4ZAXA 3BWBA 3DL4A 4HLNA 1W4BA 1CNEA 2R6DA 3L77A 2Y1KA 1XZJA 2OHFA 3DVQX 2FF5A 2I7VA 1Q6YA 3DUFA 2H0AA 4RVGA 3NHKA 5HVNA 1BDMA 2F1RA 1G20E 2ZVDA 1U7WA 1C4XA 5JJ5A 3CM0A 1R6DA 3KYIB 4TXMA 2WV9A 4DCNA 5A4AA 3HN2A 4RDXA 5TC4A 1DAPA 1JDVA 4MVYA 4HNAB 5BNTA 1LJUA 3WGYA 1MNQA 2ZWAA 1UKBA 1Q15A 1GSIA 3AR7A 3L1VA 1R8XA 4U3JB 4A91A 2PR2A 4P5EA 4XWAA 4X24A 2P8SA 1LKZA 1AUVA 3R7BA 4BBJA 2WSMA 3CF2A 2BF4A 3M4JA 1RBZA 4KQ9A 4AKHA 1P0QA 1U9JA 1Z6ZA 4CVNA 5AVZA 5EJ9A 4UE2A 3I0ZA 5B36A 4CKZA 3SLGA 3FYUA 4QUAA 3A6DA 2O1SA 4MB6A 2D1QA 4S1VA 2A9OA 1TZKA 1EFKA 1NIJA 1W7AA 3FMOB 1G9SA 2R8ZA 3QOXA 1D4AA 1VBMA 4R84A 3PNOA 2C2YA 1KZ6A 2OFWA 3RYFA 3WQBA 3ZJYA 5DZSA 3GYGA 3O95A 5HIKA 4RD0A 1EK6A 3GW8A 1M67A 3R0XA 4MV9A 1P75A 3E7PA 2XT6A 3L92A 4WBSA 3CH6A 2GVDC 1G2IA 4B4DA 4AQ7A 3FOEC 1X42A 1YONA 3MS4A 1E1YA 3CRNA 3G2LA 3OJCA 5AXDA 5C1BA 3MWKA 3PITA 3ZQUA 1QK4A 4BX3A 3X3HA 1NVEA 4ZOLF 1Y8RA 2E48A 3G9XA 1APBA 4HXGA 4KDEA 2F3SA 4X1IA 1J0XO 2AF3C 4GM4A 3B5JA 1VGVA 2J5RA 4M0DA 2ZUUA 4R2KA 5DULA 5HE8A 3ZQ4A 1XZCA 3CV3A 3HCEA 2O2JA 1VGQA 2V4ZA 2VHZA 2GEDA 2XD4A 3L05A 4JLKA 4CM4A 3LT4A 2Y2UA 1JN0A 3HR4A 3QXGA 1Y80A 4ND6A 4R6XA 4UXHA 5TQVA 5AW6A 4QBGB 2P2DA 1CB0A 1KH3A 2F8MA 1DC5A 4LDPA 4NV1A 1U9YA 3NIFB 3FMVA 1WU7A 4CQJA 5CX1B 1Y1LA 3F7OA 3CIFA 1XT6A 2HMWA 3IURA 3RNLA 2GEKA 4TSKA 4KIFA 1HKHA 2VDNB 4AIRA 4YUWA 1QGDA 4PSKA 1P1KA 4HYTA 3WLOA 1OBCA 1K0UA 2HZ7A 4GGMX 5EESA 2OK7A 3Q12A 4V0NA 1IHUA 4XX1A 4C04A 3L5KA 3TAXA 2UAGA 2ZRAA 3J80A 4I1UA 3E22B 2XNJA 3L8GA 1D2HA 2PVCA 4KOAA 1JLSA 2M98A 1FX1A 2QTGA 3AY7A 3BN3A 4PLFA 4XPIB 3TNLA 5IJWA 1NG9A 2NXCA 4LFAB 1MAAA 1BHQ1 2VNKA 3FPKA 4N03A 2ZWPA 1W1UA 3IVMA 4PSDA 1T2DA 2VEOA 3IT1A 1EWQA 4BNDB 1O58A 4AW9A 1AQLA 4XARA 3AEQB 1SUIA 2XCIA 1QGOA 3DLPX 4LCJA 1GZ7A 1XAHA 2AIRA 3AIMA 1FXUA 2C94A 4TVBA 4PX3A 1RI3A 1ZI9A 2FE4A 2X22A 3C7AA 1UWKA 4XSHA 1GLGA 1Y7TA 1GKKA 2ZRIA 4RAQA 3URMA 5REQB 4NCBA 1M34A 5JFGA 3WR5A 3S29A 2NVWA 4CTKA 5L4LA 1GTJ1 2C59A 1DPGA 2ZITA 2JCSA 3PR3A 5D87A 5HK8A 2HWXA 3T1HB 4Q15A 2ZRKA 3JD1A 2SKCA 4LHXA 2F1KA 1KE2A 2DF8A 4EHDA 1MIHA 3HJUA 4JP3A 3OSZA 1OLSB 1WV1A 3KDSE 3UJCA 4RF4A 3UT6A 5JTTA 5JVDF 3QKSB 3C8UA 4KXFB 2I4LA 1UMKA 1EXDA 1NJSA 2Z56A 3G82C 2APJA 3RFXA 5KX5B 1Z2PX 2A7XA 3F49S 4LAFA 2VPQA 3SXUA 2VN8A 3JQDA 2DPXA 3JXEA 3OT1B 3UKJA 4URUR 2FNAA 2PUWA 3MBKA 2EF0A 3T9EA 3O2SB 1RZUA 1JALA 1QK3A 1FU7A 1MAVA 1RHMA 1Z47A 3R9IA 1GA6A 4BRWA 1P4HA 5DYYA 5HE9A 2GLXA 2VK4A 1MRZA 1U2EA 1V2HE 4OGFA 1NNLA 2M6KA 5JC1A 2PCJA 3RJ9A 3DEIA 3I6QA 3LC0A 3WJ2A 5BVHB 7GPBA 4R0VA 5DNEA 2DHQA 5FB3A 3TRHA 2XUJA 1NRJB 5DHTA 3W9BA 4WBNF 2Z4SA 5JAPA 4D9GA 5HRUA 1Q0ZA 1CUAA 3KM0A 4LQ4A 4M76B 3PRYA 3CC8A 1GQRA 4RVDA 3ZZMA 4QQRA 5HCNA 3MTAA 4CQMB 5FTKA 3EEQA 3PC8C 1JHMA 3FGOA 3U17A 1I24A 1SBIA 2RCNA 5FOUA 1Z4NA 1CRZA 4PO1A 3DE5X 2XVZA 2C9MA 2Y68A 2P9YA 4NEGA 3E9NA 1XZKA 3LUPA 3WTBA 1FNSA 1AHHA 1PT6A 2ZVPX 3C6KA 3WFZA 2I0FA 2A5YB 1PVDA 4Y6SA 4QJIA 2O7VA 4RQAA 2QQEA 1U90A 5IBQA 4CDNA 3EDCA 2J3QA 2I7TA 3OZTA 4EF5A 5FWYA 1T1JA 3A9UA 1EFTA 1XEXA 1ZXBA 3HR8A 1JKIA 4WK0B 1XNRB 4IJ6A 4NYJR 1GAWA 3V3TA 1U8AA 1R9GA 1ULUA 5JROA 1TJ4A 2PKYX 3FI0A 3T5DA 2W2OA 3IUNA 2RB5A 3HO8A 4TKVB 1M7GA 1QKKA 2C88A 3PD7A 1W4ZA 4RK5A 1Q91A 2FZKA 2OO7A 1DKRA 4ASUA 3GPLA 4YMIA 4EUSA 2OFXA 4FKBA 4X7MA 5LQRA 1E9SA 2O1XA 2H1FA 1JFRA 1TE2A 3Q7PA 3I1FA 3F0TA 1U98A 1L8AA 3U81A 1P4AA 1MX1A 5EZQA 1JEQB 4YQEA 1F3OA 4BO1A 1QORA 2P8JA 2WTAA 3W2HA 2FEAA 5JUWA 3PHCA 1Z36A 4LECA 1QP8A 2I1QA 5CFPA 4FM9A 3F9CA 2KMLA 1P5JA 5EIEA 3QU5A 4GBMA 5AJUA 3JVIA 4AK9A 3LW8A 2P9BA 3PX3A 5F5XA 3MUFA 4ZC1A 3S7TA 4CN8A 4D79A 4PYQA 3D3KA 4JB2A 1XWIA 5CT9A 5JFTA 3R7DA 4BYMA 5BN1A 2FFQA 4QBTA 2IUTA 1XI2A 2I76A 3L84A 2IU0A 1E6KA 1MX5A 1UKYA 1PTKA 5KTPA 1UBLS 5EIBC 1AT1A 3FM9A 3GPBA 3B6MA 4DRYA 4EJ0A 4YAIA 2PYIA 5SY6A 2Y92A