3CR7A

Crystal structure of n-terminal truncation of aps kinase from penicillium chrysogenum: ternary structure with adp and paps
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
179
Chain Sequence
b'RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyl-sulfate kinase
publication title Truncated APS kinase from Pencillium chrysogenum: Insight into the function of the N-terminal helix
rcsb
source organism Penicillium chrysogenum
molecule tags Transferase
total genus 62
structure length 179
sequence length 185
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cr7A00
2JA1A 2UVQA 4HAUA 5H8WA 1JBKA 2ATVA 1IN7A 2GKSA 2PZGA 1FOEB 2J46A 3WBJA 2IXEA 2A2ZA 4HDOB 1O87A 4HUQA 4G5RA 3BOSA 1VG9B 3JVVA 4UJ5A 5AJYA 621PA 4URXR 5ANRB 3FHOA 1EG7A 5HKKD 1H65A 4V0NA 5GJVC 2PCJA 2YV5A 1FUKA 221PA 1YR7A 3RAPR 4D2IA 4QNMA 4I1OA 1JECA 4OHZA 5CITA 5TY0A 2GJ8A 3VMFA 3QOFA 3ZQJA 3TSWA 1OH7A 2J1LA 4JMPA 3PENA 5BN3A 2ATXA 2CK3A 3QIAA 1Z47A 3TNFA 4D0LB 2QE7D 1VCNA 2NGRA 3AKEA 1G41A 3B9QA 1IY0A 5EUMA 3A4LA 4B3BA 2PEZA 1E4YA 4KFSA 1KO8A 3DM9B 1XU4A 4YXWA 4ESHA 4P4UA 1OIVA 2J3EA 1LW7A 4OI2A 3SJAA 4P0TA 3T1VA 4NYIQ 4ZKDA 5J4HA 3ZD6A 5JS7A 5KYKA 1VDZA 1LF5A 4PAQA 2A5DA 5F98A 3AKDA 2WWXA 2V54A 1SHKA 2ONJA 5KTYA 3DZDA 1E9RA 5DI3B 2OEPA 2OXRA 1OH8A 1W0JD 1NMXA 4JIMA 4A92A 4TYYA 2WIBA 5BQ5A 4FMBB 1XD9A 1E9DA 4NE2A 2IYWA 2XX3A 1DAFA 1G4UR 1HT1E 1Z6XA 3IHLA 1ZIOA 4IJMA 3AVYA 5L3QA 1E2JA 1G7CA 2V7QD 4C0BA 2BBSA 1KDPA 1UJ2A 3GJ8A 3QQ5A 5AR1A 2CEAA 1E2IA 3FPAA 4GP7A 4ZPXA 2KB0A 2WMNB 3V4RA 1XD2A 3OEHD 1OJLA 2A78A 2RHDA 3B9PA 2OBNA 1E94E 4P32A 2F1IA 3RS7A 1PV4A 3T1OA 4LJ7A 1GIAA 1TEVA 5G3YA 3DM5A 1GZSA 1X8JA 4F93B 3O8CA 3THYA 3GEIA 4YONB 3VFDA 2ORVA 1R5NA 2ZRHA 4KAXA 2AKAB 4LBVA 1DEKA 3TBKA 1Z0FA 3SE0A 2JLSA 4P4SA 1X8KA 2PBRA 4URZR 2ZANA 2VLIA 3HDTA 2HDNB 4TT3A 3K70C 1YU9A 1WMSA 4JLBA 1PLLA 1S9HA 1E3MA 4A82A 2IUUA 1EFCA 4CIDA 3IBGA 5JEDA 3AUXA 4CRWB 1HUQA 1KJZA 4B6FA 2R6DA 5F3WB 2JJ1A 3MFYA 4UNSA 4UNRA 5BN5A 1BO6A 4JKYA 1AKEA 2HLDD 3B8HA 4YLGA 5CM9C 2O0KA 3B7GA 3CF6R 4EPXA 3H84A 1XB2A 3WMGA 1P2UA 5HTKA 5BW8A 1JR3E 2EWWA 1US8A 1JR3A 1Q20A 3EW9A 1W0KD 1KI2A 3M6AA 4YC7A 2XSZD 5EQTA 5FFMA 3EPLA 4MRVA 3U3KA 5EE0A 3TGPA 1E96A 4XD7A 1JR6A 5F9FA 2AL7A 2ASEA 1Q57A 4LK2A 2NQ2C 3LNCA 4K81B 3PR1A 1KOFA 1XWIA 2Z4RA 5KDLA 1XTRA 3CO5A 1YZUA 4OHVA 4GOJA 1E9AA 3CKLA 4MGZR 4FCTA 3MMPA 1R5OA 1NF3A 4JVLA 4AG5A 1XEFA 1T9HA 5DN6D 1Y63A 5L3SA 2W58A 4QGFA 1DBSA 2D2EA 5HZKA 3FMFA 4IHQA 1GOTA 3BORA 1WQ1R 2GEUA 2F43B 2ZR9A 5DI3A 3FGNA 3RS0A 5CB6A 2A3RA 1Q3HA 2EVWX 1M1YE 4Q1EA 5EZ5A 4S2EA 2HCBA 3H0KA 1KI1A 1R0WA 1G7RA 4Q9KA 3B60A 1G4AE 2ZUBA 4LJ5A 4RZUA 4D80A 1RIFA 2X19A 3TLXA 5C2JB 2GCOB 2Q9AA 2H1LA 4Q7JB 4EUNA 2R65A 3RSLA 4TMZA 2ZUDA 5AUQA 5JSZB 4X8LA 4LUCA 3ADKA 1XPOA 2DB3A 3PEVA 2WJHA 4LX0A 4E09A 3ZIAD 2XNSA 3CW2A 2ZJBA 3ZQ6A 4RSGA 1LNZA 3KKMA 1P2SA 4Q5IA 3GPLA 3D7MA 1CJTC 1TQDA 3CH5A 3TKLA 4NHOA 4YMVA 2JGNA 5J5CA 3WNBA 1XEXB 2RAPA 2W2VA 3W34A 4BE7B 3EWAA 4Q9HA 2BM0A 3U3JA 4A8JC 5K8UA 4GL2A 2FOLA 1CJVC 1E2KA 3CF2A 2ZS7A 3MG9A 1DAMA 3C4JA 5GVRA 1C4OA 3BD9A 5EXTA 1L4YA 2FFBA 2QG6A 3MUFA 4KI0A 5P21A 1XMVA 3Q9LA 4IEEA 2X2EA 1UBGA 3HR8A 3B6EA 4O3MA 1NL3A 2GTPA 4HAZA 2ERXA 4BUJA 5JI2E 4RKEA 1U2RA 1ZU4A 2FSGA 3HPRA 1TADA 3IIJA 3UWKA 2V1UA 4ZDKA 3CBQA 1TQ2A 4PSVA 1DAHA 4UKDA 1CBUA 4DVGA 2R62A 1M7GA 3FWYA 1XCGB 2N1BA 1JQLB 5CLLA 4OQXA 3MD0A 4URYR 1KGDA 2Q9BA 2FSHA 1A7JA 1Z0DA 5FTNA 1N6OA 2WOJA 1KK0A 4NCKA 2BKUA 1VMAA 1W4AA 2GDJA 4A0FA 1R7RA 2DR3A 121PA 4DLZA 3RRNA 1GRRA 1E79D 1YZTA 5EP4A 2QTVB 4US0R 3EIQA 3E1SA 4JLPA 4MGKR 5DYIA 1UAAA 2G0NA 1HE8B 2QP4A 1KMQA 1UADA 1OHHA 3T61A 1I2DA 4JYBA 1QHYA 4DWJA 1GL9B 4C0HA 1OV4A 3WYGA 3RS4A 4LJ6A 4JL6A 4KLNA 1HT2E 5CK5A 3SNHA 2ZXUA 4LYJA 1EXMA 4BLTA 2F3TA 2PJZA 3AV0B 2F43A 4GFDA 1ZC3A 3ECCA 2DFTA 1FTSA 1OKKA 3SYLA 4G5SA 3WMFA 2R6AA 4F7WA 5KDDA 5B57C 4B73A 1OYYA 2WHXA 3OFND 4BZPA 4OQMA 2JIZA 5CYOA 3FMOB 1GKUB 2WICA 4DLTA 1OFTA 4DEYA 2GCOA 4F91B 3ADCA 1ZVQA 2AXNA 5JSZA 1KI9A 3GJ6A 3BB4A 2P6UA 2ZRLA 2ZITA 3ICQB 1NVVQ 1HURA 1XTSA 4GMXA 4JKIA 1R10A 5CIQA 3NTUA 3EZ9A 1YVDA 1GILA 4QHYA 1SULA 4Q4HA 4NDZA 2R9VA 4JJKA 1TPZA 3NH6A 2NG1A 1VG0B 1XEXA 3TQCA 1R0XA 2WVJA 2GWHA 1EFTA 5FUVA 2REBA 2K5UA 3EG5A 4M22A 2WSSD 4YMUA 5EP2A 1IY1A 2ZRIA 2WWFA 2OG2A 4HAWA 3PITA 3TK1A 1LV7A 4HAXA 4WBSA 4KU4A 4HLQB 1YZNA 3UMSA 1PLKA 2DWPA 4QNRA 4BZXA 1TL7C 2ZRBA 1TF2A 1GL6A 1T91A 3NDPA 4TTPA 4CEHA 1RE0A 2VF7A 2RB4A 1KY3A 1ZJ6A 5LD2B 4V0ME 3Q7PA 3R20A 4V0MA 4URVR 3EC1A 3RC8A 2JLXA 3W5IA 2JDID 4AC9A 1GSIA 4D0NA 5GJBA 2W0SA 2YINC 1IN6A 4PO9A 4DZZA 4XWKA 1F2UB 1TQ6A 1CR4A 2G77B 3P27A 2UZIR 3AEZA 3CRMA 4IW3B 3K0CA 4LYAA 2KBEA 2PCLA 3K0FB 1DOAA 1E32A 4CEIA 3U7FB 4YQFA 5F9HA 2JCSA 1KSGA 1U9IA 6Q21A 5IRCD 1NKTA 2REOA 4Y0AA 2CHQA 4A1FA 4GSYA 2FDCA 3CZQA 3JZAA 1W4RA 4UNNA 2IWHA 1UBEA 5DO9A 3LXRA 1XBTA 4M9QA 2H57A 4YMWA 3KXIA 2C9OA 3UKDA 1KNQA 2WBLC 2LKCA 1YZKA 2O8BA 5A4JA 3C41J 2QY9A 3A1SA 5FI0B 1WA5A 5JS8A 2F55A 4PSKA 3LX5A 4DDWA 1KNXA 2VO1A 2VSOA 1T5IA 4PQRA 1VCMA 4EFNA 1ETUA 4Z1MA 3BB3A 2VRWA 3RANA 4EPRA 5KPJA 1OXVA 3TUJC 3LXXA 3M4YA 4LZZA 2C03A 4ZKEA 4V0LA 3KJGA 1BMFD 3REFA 4D26A 3MGCA 3ZZ0A 3IKJA 1UBFA 4TZ0A 3QKSB 3GJ3A 2F3RA 2ZI3A 4MGIR 4HAVA 1KI6A 4IDHA 3EC2A 4A15A 1U81A 1J70A 1UM8A 3OIVA 3DZ8A 2GZAA 5AUNB 1X1RA 3DKPA 4EJSA 2B92A 2D3WA 2WJGA 5EE9A 5SZHB 1ZUHA 5CDFE 4B75A 2QEQA 5CDFA 3P4YA 2ZS9A 3AVPA 3LLMA 1W2GA 2ZSFA 3TAHA 2Q6TA 5J47A 4C2UA 4G5QA 1NN3A 4TMWA 3A4NA 4TLCA 1E0JA 2ZI6A 4TLAA 4N0DA 1XTIA 3FMIA 5SZIA 1H8ED 4D4KA 2VP4A 1QHHB 2IYSA 3PEUA 4OK6A 2JLYA 3A1UA 3TR0A 3NVAA 3ZZTA 1OXSC 4R9UC 2IA5A 2QAGC 3OE7D 1XPRA 2DBYA 1UKZA 1PZNA 1E2FA 2ZU6A 3EA0A 1SKQA 3U7HB 2IXFA 1JXOA 3GFTA 3QPVA 4A6PA 3VKHA 3RRZA 3WRXC 1DAIA 2IF2A 3AVUA 3VR2A 1E1QD 4JBXA 1ZNZA 3IHWA 2HF9A 3K0CC 4AD8A 4ASUD 1KSHA 4DSTA 3F3YA 2BCGY 1CR1A 4IVPA 2AD5A 4NYMQ 1IBRA 4IDOA 1TU3A 5JMTA 1ZM2A 2OFXA 4LSGA 2YHSA 2P0EA 3AVTA 1Q1EA 2CVFA 1Z83A 3LBIA 1DAGA 4M1KA 5EJEA 2J0UB 1AZTA 3BERA 2EYQA 4LHWA 2IWRA 4KBGA 2GF9A 2ORWA 3CRRA 3FKSD 3OZXA 4I1UA 1AM4D 2FE4A 4ILEA 4RKFA 1F2UA 3DHWC 4DLSA 1NY6A 3I62A 2EFHB 4OBEA 4EPVA 5HCNA 2ZI4A 4EPYA 3BIFA 3K0FA 3NEJA 4LJ9A 1Z6TA 1A2BA 3TUZC 3UANA 1FP7A 1XXHB 2YNMA 4DCSA 1XFAA 3R7WA 1Z6GA 3KKNA 4JLKA 2F9MA 1UF9A 1HE1C 3GD7A 5KSZA 5L8VA 4LPKA 3D3QA 2OAQ1 3BGWA 4IOMA 2J7PD 4FINA 1G3RA 3ASZA 4DLYA 1NVXQ 4NP6A 1W46A 1PJRA 2OCPA 1T0HB 3KFVA 3LAWA 3QXJA 3THOA 1WCV1 5C1BA 1D2NA 1W5SA 4EJSC 2KSQA 3OAAA 4GT1A 1VYTA 1Z0KA 4GBMA 4LCBA 2IL1A 4I1VA 2GVDC 4B33A 2VBCA 3OF5A 1X1SA 3TSZA 4NYIR 1S1CA 2QA5A 4NYJQ 2V9PA 2ZSBA 3T5DA 1AS2A 3EWSA 2ZE8A 1WB9A 1U94A 2CHVA 5FOSA 1N5KA 2CL7X 2L0XA 1XJCA 3TR5A 4EDHA 3I1FA 4R2IA 4Q19A 3I5YA 2GJ9A 4BEJA 3W6PA 2CE2X 5KHOC 1QDEA 3BH7A 5FUWA 3QPWA 5KNCA 3P1JA 4M1WA 2FWRA 1COWD 3ASYA 1Z5ZA 2QNRA 3O47A 4IVQA 1W36D 2TMKA 3ETLA 3KTAB 1G3IA 1HEIA 3DDCA 1YE8A 3OEEA 4XVQA 3T06B 4M4SA 4Q03A 1VG1A 4FW9A 4CVNA 3IQXA 5EXXA 3SN6A 4TQ9A 1WBBA 5BYKA 1NMYA 1K8RA 4Q9JA 1GAJA 2YC4C 2GXQA 1FQKA 1G291 2FJUA 4QHTA 1FNMA 4C9BA 1DAKA 3LX8A 1FP6A 2GILA 2J45A 1OE0A 3GLGE 2YWGA 2IEYA 2VP9A 4HLCA 3ZGXA 2O8DB 3GLGA 1W0KA 3F8TA 1JPNA 1E1RD 3ADBA 4RZXA 4HAYA 3DMDA 4QOSA 1XMJA 3T15A 5KU1A 3PJRA 2V6JA 4FI3C 5JRJA 4C0SA 1D2EA 3KJHA 2CNWD 5FBRB 5CIWA 2O8EB 1AGPA 1BKDR 3R8CA 1QRAA 1TUIA 2IS1A 4RCYA 1Q44A 4DCUA 3QY0A 1NKSA 1T3LA 2C2HA 4H9GA 4RFSB 1D8TA 4ZI3A 5DYGA 5KSOA 3Q85A 2IF0A 4RVCA 4QBHA 1P73A 5DI9A 4B3GA 1E2NA 1Q1QA 1N6NA 4OQNA 4U00A 2F1JA 4DLUA 1E2PA 2X8AA 3B78A 3QSYA 1Z3IX 1P75A 1XMSA 2JJ8A 3ZZUA 2GCPA 2C9CA 3T35A 1XXHE 3ZJYA 3VTKA 2FGKA 4A0RA 3ZVNA 1OW3B 1CULC 1XXHA 2B6HA 3VNVA 4KHZA 4HATA 2MMCA 4HYYA 4DRZA 2G0TA 4JLMA 3VR5A 2WAYA 1KO1A 5TB5A 3CWZA 1RZ3A 3SEAA 1YRAA 2ERYA 3J81k 1CEEA 5FOVA 4ZCLA 1G19A 3UMFA 4PQYA 4BPBA 1FMLA 4JZKA 1TAGA 2IYQA 3UATA 5AUPB 4MYUA 4LOAA 3RABA 1SVKA 1H8HD 1IXZA 1QHIA 2WWYA 1XPUA 1HQYE 3T5GA 2XEXA 3HPQA 1S8FA 1W44A 4RD6A 5FPHA 1XTKA 2HV8A 2O8CB 2KE5A 3K9LA 2Z5FA 2YYZA 3ICEA 3LDAA 3TMKA 1YJ5A 1ANKA 2HJVA 1OXXK 4LWZA 5JWRA 1MOZA 1KI8A 1OFHA 3ND9A 1ZU5A 2ZAMA 4JYCA 4OJQA 3THWB 4BFSA 2RH5A 3A36A 5JJKA 4DSUA 3QPUA 3PFIA 2WZQA 4W5HA 1DVRA 3TVTA 1RRGA 3U3RA 2VTKA 2FPMA 2ZSAA 3GEEA 2OLJA 2O0JA 2IYLD 4YDHB 4B32A 5AK0A 1OIWA 1CJMA 3BFKA 2ZI9A 3KTAA 2HT1A 3AF3A 4NZYA 4ZDWA 2GETA 2WJJA 1TU4A 1RJ9B 4FMDF 2WKRA 3BFVA 5DIFA 1KDTA 1MH1A 2CLSA 1T0JB 5FPYA 1Z2CA 4WZ6A 3SJCA 4PHTA 1KK3A 3B1YA 3SFZA 4TZ6A 3DO6A 2D06A 2MMGA 1DO2A 3EARA 4Q00A 4KFUA 1J8YF 3K0SA 5JJIA 1MRSA 4PAOA 1M6NA 1GRNA 2H16A 4MRNA 4Q4LA 1W4BA 3PG5A 4BFWA 1G8FA 4QBIA 3CB4A 4OHWA 5EXSA 4GMDA 1UDXA 3HU2A 3X1DA 1SVWA 4B3XA 3VX4A 2H8KA 1E79A 4HSEA 3WYFA 4BQSA 5E95A 1IXRC 1JJVA 4LYHA 5AWFC 1F3OA 4JVNA 4YMTA 4O0MA 3N2EA 3LV8A 4E5UA 4RFSA 5EP3A 3I72A 1UPTA 4RJLA 5TXGA 2JJ2D 1EFRA 2OZEA 4A9AA 2ODEA 4TLDA 1QG4A 4B44A 3OHMA 1SXJD 5LBIA 4PC6A 2EU8A 2VL7A 1UBCA 4AIIA 5JCZA 1CS4C 4BFZA 1M2OB 4Q47A 3WYAA 5IHPA 3NHBA 5FOWA 1GKYA 4DXAA 3SOPA 2QGNA 3AVWA 4NONA 1E99A 2QRZA 2OCYC 3AP2A 2PL3A 4OK5A 3AQ4A 3U61B 2CHGA 2CCJA 2BBWA 4BFUA 4P3YA 1L2TA 4QKQA 3VU9B 4B34A 2RGXA 1NSFA 2ORIA 4HZIA 1Z63A 1RVDA 1Z2AA 2HXYA 721PA 1JEEA 2JLUA 3RWMB 1ZIPA 2EYUA 4C30A 2AWNA 4GDFA 4M1TA 2NO7A 2O8CA 2O52A 4DJTA 1U8AA 2G88A 2CCGA 4NBSA 3CNLA 4L15A 4O25A 1RFLA 3MWKA 4CEJB 1KI7A 3LO5A 2WJYA 1D9XA 5E7IA 5JECA 2FPKA 4FMCB 1U0LA 2P5SA 3VQTA 3GFOA 2WJIA 1P60A 2NZJA 2WPDA 4HUTA 4A0HA 3C8UA 4N1AA 1WRBA 2GZDA 4BFTA 3OIWA 2HXSA 3M0EA 2VIIA 3CR7A 4ZDIA 1GM5A 4Q4JB 3SU8A 4DBLC 3D6TB 1WF3A 2AXPA 3IPYA 4RD0A 2FFHA 4C2TA 3U3MA 3A1TA 1L8QA 2AK2A 4PPNA 1NJGA 1KJWA 4CF7A 1NVVR 4BRUA 2QENA 2Z0MA 2QI9C 1KO7A 1U8YA 3FFAA 2Q0HA 4IOLA 2RGAA 5FUYA 1ZM7A 5TV2A 2XB2A 2WWWA 4D81A 3IUYA 2RGGA 3U7EB 4KCGA 1KSJA 4D25A 5KDOA 5FR2A 3PQCA 1N5IA 3B1VA 3CWQA 2D2FA 1RYHA 4KODA 4IXNA 4PO8A 5IK2A 4CZ2A 1SZPA 2ANCA 1S1MA 3P32A 2I1VB 5TMPA 1JI0A 2ZETA 5BN4A 1NLFA 2YWFA 1D2MA 2Q9CA 1MO6A 4GI7A 3IIKA 1E6CA 2WAXA 2D7DA 3U60B 1FQJA 4UXIA 4B43A 3AVVA 3PVSA 3U6KA 3BFXA 4PQFA 1G9XA 2FZ4A 3VR6A 1B0UA 2W0MA 4DIDA 3QBTA 2V6IA 4PHGA 4WZAE 5HE8A 1OT3A 2BV3A 3AP1A 3ONWA 1SHZA 1P62B 4Q1AA 1NN1A 4AKEA 4C4PA 2CVHA 4TYQA 2HCJB 2IBMA 1Z6YA 4Q1CA 3NC1C 3ND8A 5D3MB 3QVVA 5JRZA 4RD4A 1BMFA 2GNOA 1XRJA 1ZNXA 1KMHB 4GOXA 4XH9B 4KITB 4TL7A 4LV5B 2ZI5A 1EX7A 5SZJA 5J4YA 1CJUC 1II8B 3QXXA 3LQRA 4HDQB 2BDTA 4TMVA 4V0KA 3TVDA 2R6GA 2KWIA 3AGQA 2ZJZA 1VG8A 4HB2A 1NIPA 3VU9A 2P5TB 1BS1A 1DELA 1XD8A 3TH5A 4MRPA 1OPXA 1Z0JA 2QL6A 5DSZA 5L3RA 3RRYA 3FMPB 4B3DA 3K70D 1X86B 3IGFA 1W36B 3D31A 1LS1A 2Q21A 4OJKA 4EQ6B 5BXQC 1AA9A 1XX6A 3CUEF 5FL7D 2IUTA 4B3CA 4TYWA 3QI2A 1NBMD 4RZ2A 4CEJA 3KQUA 1CRPA 2GJAA 4EFMA 4TLBA 4MKFA 1HTWA 3PUWA 3A37A 4J0QA 4W5JA 2EWVA 3FVQA 2CK3D 4NCIA 4HB0A 4DSOA 4L9WA 2FGJA 4MITA 3AVOA 4P31A 4YMSA 3QENA 1R0ZA 3IDQA 1M7BA 4E03A 5AJVB 1VPLA 3U44B 1E1QA 1N6LA 3HU3A 4DSNA 2W2XA 5FTKA 4ASUA 1ELOA 4OQLA 4PC2A 3ZDQA 4IFEA 1F6BA 3H1TA 4LY6A 3R9WA 1M8PA 1ZM9A 4F4CA 2XNDA 2RGCA 2W83A 4U7DA 2GJSA 3DVLA 1KYIA 3GLHB 3LVQE 4PAMA 2ZE5A 4NL4H 3AGPA 3CLVA 1OF1A 2E87A 1RW4A 1TNDA 2ODWA 4DLXA 4AKHA 2QPTA 4LBZA 3FKSA 1G7SA 2MSCB 4WXRA 1E9CA 1GNQA 3RNLA 2G9NA 4JL8A 2LWIA 4WW0A 1T6NA 3KXKA 4NCJA 3U3OA 4LV6A 4PXAA 3UMRA 1UEJA 1GNRA 2F7SA 4KSCA 2QBYB 2ODBA 1AJEA 4PHHA 3TAUA 3BH6A 1KAGA 2PJRA 4L8GA 2DCUA 1E9BA 3EZ2A 3T12A 1P9RA 4ZDJA 3LD9A 2XJ4A 1XEWX 2OAP1 3UG6A 1YR9A 4NYMR 1OXTA 1ZMXA 2GESA 1J7KA 1O3YA 1NG1A 1TF5A 2J7PA 2WTUA 2RGBA 4ZO4A 1TEXA 4P4TA 3THXB 2OESA 4LJ4A 4X8MA 4NCHA 3AKYA 4TMXA 3R8FA 2WKQA 1M74A 2ZYTX 1IN8A 2XTMA 4PZLA 5SZKB 2XZOA 1EWQA 2IW3A 2WJVA 1W49A 1YZLA 4FCVA 3Q72A 1JAHA 1CR0A 2P6RA 1JAIA 4DLWA 2QU8A 2X77A 4TT3D 1SVLA 2D4HA 4LHYA 1S4QA 2YZ2A 3NH9A 5H68A 3KZ1E 5D3MA 4BFYA 1RYFA 1VCIA 4QG7A 2ECKA 3LRPA 4W7SA 1KMHA 2QUZA 3WNCA 2AHOA 3K53A 4I99A 3NBZC 4EAQA 2CDNA 4G5GA 3FDIA 2YOHA 2J9RA 1IY2A 1SVMA 1XJQA 2V1XA 2ZQ5A 1I2MA 3G5UA 5C4MA 2BIFA 4D82A 3O8DA 1X8LA 4TMKA 5DHFA 4Q48A 1XCPA 4C7OB 4KSBA 1YZQA 3EA5A 1P9WA 3ZH9B 3MAAC 1AK2A 1FUUA 4BLSA 4B47A 3FOZA 3NC0C 1C1YA 1G5PA 2ZRPA 3C5CA 3BH0A 5FPTA 5CB8A 3EZ7A 2VQSA 3EIHA 4XD7D 3AF2A 1E2LA 1G3UA 3K0AB 3KB1A 5B2ZA 4DUGA 5IDVA 2A7QA 2CJWB 3GLIB 1GVNB 4UQOA 4TTQA 3BJIC 2FF7A 2RKOA 4PTLA 4URWR 1LF0A 3BS4A 5J4VA 5GADl 3X1XA 3QG1A 4GOKA 1JEDA 1D9ZA 2YWHA 5FI1B 1EFHA 2WWHA 4M8NE 4JT2A 1CP2A 2IYTA 4X8OA 2C96A 2Q3FA 4KYIB 3GLHE 1VYVA 2BMDA 3L0OA 5FOXA 2IUSA 2YWEA 1E9EA 3GLHA 5FBVB 5FL3A 1F60A 5GJCA 3EX7C 2XOKD 2W6JA 5KUTA 3P20A 3GFPA 1N6IA 3X1ZA 1CKEA 3EASA 4QXAA 4PO1A 4Q7LA 4TMTA 3KUDA 2QM8A 4AKGA 1TUEA 1G16A 1YR8A 1E2QA 2BC9A 1W48A 3N5CA 1ZUNB 3GMTA 4FWTA 3LFUA 5JI3E 2J5XA 1W2HA 1Z07A 4CT5A 1SXJB 2VH5R 1NN0A 2QBYA 1C9KA 4JLJA 4QJ4A 2YOFA 1F2TB 5FTMA 1OFUX 2A30A 4ACBA 2VP0A 4US1R 1DG3A 1ESNA 1Z8FA 2GA8A 3SZRA 2ZJYA 1GUAA 4LRWA 4WIAA 2OXCA 3DKVA 3NXSA 1XDBA 5IF9A 4XVRA 3VR4A 3WY9A 4DHEA 3THXA 5JBQA 1J90A 3KQNA 2PEYA 2NZ8A 2YOGA 2QZ4A 1G8HA 1TTTA 4Q02A 2VPPA 4ZCMA 2QQEA 3BK7A 4AYWA 1G3QA 2NIPA 2OM2A 4LBYA 4M1MA 3AVQA 1FTNA 2QPOA 4Q1FA 4E07A 5LDDC 2FX3A 3A8TA 1XTJA 2A5YB 2DPXA 3N2IA 1B23P 3MSXA 4Q7KA 4ACAA 3T1QA 3KQKA 5HKKA 1G8GA 2A9KA 2QMUA 4DDVA 2QMEA 5CJPA 4LBWA 3SI7A 1Z0IA 4QGHA 1F48A 1K5DA 2G1KA 5TDHA 4R71A 3CX8A 3MRSA 1G21E 2CBZA 3D8BA 1YKSA 4TL8A 4Q4AB 3UPUA 1GFIA 3WHLA 3B1ZA 2WM9B 2ZJAA 4WAUA 3DL0A 3CH4B 3L2OB 4V0OA 1U9IC 4CT4B 4FN5A 4US2R 1OFIA 4H1VA 1T4GA 2QE7A 3Q5EA 3QKUA 2BEJA 2RGNA 2RMKA 3P26A 1Z6AA 3GLIE 3I32A 3K0AA 4JLNA 4ZI2A 3CF0A 3GLIA 2EQBA 2VHCA 2PMKA 5CJ2A 4AG6A 1UDWA 2ZTSA 2QAJA 1JJ7A 1WXQA 3PUZA 3BB1A 4Q9IA 4F4IA 4M53A 2V8OA 1NP6A 2PLFA 2J59A 5J40A 2ANBA 2FSFA 1JXMA 4L16A 1OH5A 1OHHD 1SVOA 4JL5A 3RDPA 1A1VA 3CX7A 1W0JA 2I4IA 1EWRA 4M1YA 4PFSA 2AX4A 2EFEB 4DCVA 2FH5B 2FFAA 1QBKC 4M9ZA 4MGYR 1LFDB 2ZUCA 1I4LD 3IO3A 3SQWA 3K9GA 4U02A 3CPEA 3UWOA 1K6MA 2V7QA 3L8YA 2QMHA 5UKDA 5KO2A 2ZEJA 1R0YA 1KY2A 3B82A 3S1AB 1TX4B 3BXZA 1NLZA 4C0AC 4DEXA 3EPHA 2JIZD 2IK8A 2ZRNA 1DAEA 2VYFA 3RLFA 1T8UA 3MWYW 2DY1A 1UKYA 4RZ3A 2J41A 3OEHA 3AB3A 1SXJE 2AK3A 1JB1A 2FEOA 4MYCA 2RCNA 1SXJA 3WXMA 1P4SA 1RRPA 3U4QB 2QP9X 2VF8A 1N6RA 4TWZA 4EKDA 3QKSA 2IS4A 1RKBA 2OLKA 1GWNA 1F2TA 1FX0B 4TTRA 3RS5A 4QGAA 3I92A 4KO8A 1GL7A 5CK4A 4LJ8A 3V4FA 3NDBB 3SBEA 4XJXA 4PC3A 1QHGA 5ELXA 1XF9A 4HUQB 2WWGA 1XNJA 3LLUA 1Z0AA 1CIPA 1ZC4A 4MA4A 1WBDA 1LTQA 3AUYA 2ZE7A 1M34E 4KXFB 1N25A 1KO4A 1CXZA 1PLJA 2BBTA 2QQ0A 3CM0A 3K0EA 2OCBA 3QKRB 4A2PA 4POAA 3GCGA 1II0A 4PANA 2IYYA 4IDQA 3VR3A 3K70B 5LD2C 4I81A 1QHHA 2ONKA 4QFMA 2VP5A 2EFCB 3NBXX 4WA7A 4B76A 2CL6X 2CLDX 1KO5A 1HV8A 1T5LA 2HLDA 2RGNC 3PV0A 5DISB 3KKQA 4A6XA 3VNUA 4ZV4A 3SJBA 2WSMA 2QTFA 4IEIA 3U2QA 1D5CA 4TL9A 2V3CC 4Q4AA 2F1RA 1A5TA 2XSZA 3SJZA 4DT1B 4AKIA 3SS8A 1MR3F 4B3FX 1E69A 2XJ9A 4EFLA 4LHXA 1KZ7B 3CRVA 4DLRA 3CNNA 5FR1A 1NNEA 2QT1A 3GJ0A 2ZRKA 5FBWB 2VEDA 1XTQA 2ZSDA 2J0UA 1CR2A 3QVUA 3IBYA 1KDRA 4Q1BA 4A4DA 2VP2A 2P65A 2OFOA 1KDOA 2Z4SA 1JQJC 4PR0A 2C95A 5DN6A 3GJXC 4JVSB 3WP0A 2JLZA 1LY1A 1QF9A 2G1JA 3LW8A 3SC3A 2BMFA 3W8NA 3FHTA 4DDTA 4TYNA 1SVIA 1VIAA 5B58C 4PPQA 5L3QB 4BLOA 2KBFA 1IHUA 4K46A 4GP6A 4AY2A 1NRJB 3WMEA 4QL3A 3TJZA 1XCMA 2FNAA 2ZI7A 1E9FA 1T8TA 3EPJA 1MV5A 1QHSA 3MWJA 4B35A 2FEMA 1XD2B 2BKEA 2O8FB 3HWSA 1FW6A 4EIWA 4HZUB 1DARA 3WHKA 2QMOA 3I8XA 1S9DA 2E1RA 1LS6A 3KKOA 4JSYA 4R7ZA 1GDDA 5LPNA 1ZW6A 3CPJB 3ZIAA 3TW4A 4TSFD 2OT3B 1ODFA 3Q3JB 4A36A 1TF7A 1X6VA 3A1WA 1RRFA 1S3GA 3FFBA 2C8VA 4TLEA 4LYFA 3THYB 3W90A 5HR5A 2QRNA 2XITA 2LCFA 3KQHA 5E7JA 4QBFA 2BMJA 3PCRB 2GCNA 2B7CA 1FL9A 2DHRA 4P4SB 2O5VA 1NLYA 4Z8XA 2FMXA 3U4QA 2Q3HA 1MO5A 3B1XA 3GJ4A 1FX0A 2R6CA 2IEZA 4KVAA 2IYZA 3LQQA 2NOAA 3KJEA 1EGAA 4UNPA 3SYNA 2HYIC 3IILA 1BH2A 4OI4A 2BM1A 3H86A 4LC1A 4MUAA 3RRMA 1G8YA 3BWDD 4IKEA 4OL0A 4A8JB 4ARZB 4A2QA 1FPMA 4NPHA 4AYTA 3K9NA 4LI0A 2ZYVX 2IYRA 3QKRA 2FPLA 5LB4A 1JNYA 1ZUIA 4L9SA 4EPTA 5DH9A 4D0GA 5G40A 2ZJ2A 1XZPA 1MO4A 4GZLA 4M1OA 1QVRA 1I4TD 2WV9A 1US8B 5FL7A 2WWIA 3RWOA 1GKIA 1MRNA 1NBME 2Z6VA 4G1UC 5JEEA 1NBMA 1R5BA 5AJZA 4O2RA 2B21A 2NTYC 2C99A 4Z51A 3WNDA 2GVZC 3X1YA 4AI6A 2OBLA 1E0KA 2O8DA 3IIMA 3AM1A 2VA8A 2PZEA 4QGGA 4MKHA 4N0EA 2H7VA 4DT1A 2W6ID 3FE2A 2AR7A 1HA3A 3NBYC 4M9XA 2VHUA 2O8EA 1ZAKA 2Z43A 2Y8EA 2HEIA 3KJIA 5H1YA 1WDTA 4JBWA 2HYDA 4DKXA 5L3SB 1W4CA 1ZBDA 3A1VA 4Q9LA 1G6HA 2FZLA 1ZCAA 3KQLA 2PX0A 3B1WA 4XTRA 2OHFA 2GZHA 2REXB 3K1JA 1AN0A 2QSYA 2J87A 1P3JA 2J0QA 1L7VC 1N0WA 2EFGA 3SYKA 4C0KA 3CNOA 4V02A 2IX3A 4N3NA 3NG1A 1ZINA 2WKPA 1HY3A 3OFNA 4TYPA 1R8QA 2DWQA 3SBDA 3B5JA 1ZM3A 1G5RA 1ZD8A 3OAAD 3IQWA 1KJYA 2P3SA 3C14C 1U0HC 1X3SA 3QEJA 2AD1A 3EIEA 2UKDA 4IOJA 4UXJA 2O8FA 1S96A 4JS0A 2PT5A 1VKJA 4HZUA 3MWLA 5HZHA 2FN4A 4C3ZA 4D4MA 1KK2A 1DTSA 4JBYA 1LB1B 1U8ZA 2E9SA 4RFVA 4OI0A 2FU5C 2VHTA 5F2EA 2Q3MA 3QG5A 3UIEA 4NKRA 1II9A 2ODNA 4MYHA 4RD1A 3UK6A 4MDFA 1G6OA 5BWMA 5JJLA 3I3SR 1AQUA 1AIPA 1AZSC 5DHAA 2SHKA 2WSSA 3THWA 1Q3TA 2ZR7A 3VHXA 3W9YA 2AKYA 2AN9A 3IPXA 3QEOA 2CL0X 1GRQA 1ONBA 3OEED 4BLQA 1MO3A 2IT1A 1CRQA 1OIXA 2CE7A 3R9IA 4A8JA 2R2AA 4ARZA 3L8ZA 4NH0A 4C0JA 3QXSA 2QORA 4JLDA 1AS0A 3G82C 1RJ9A 3C15C 1J2JA 4P33A 4JLAA 4URUR 1N6HA 3NEYA 5JFGA 1P5ZB 2GBLA 4Q01A 1OB2A 1D6JA 3AH8A 1P9NA 2B8TA 2OFWA 3CRQA 4UNQA 2JDIA 1EFUA 3TE6A 3WP1B 1U90A 2QSZA 3K9HA 1V43A 3BC1A 4ABYA 3SR0A 4Z8YA 1KKLA 3HYTA 4BECA 1VHTA 4BFXA 1E9SA 1IN4A 2IS6A 1N0VC 1ZRHA 2F1HA 3EXAA 3PUXA 2X1VA 1YZGA 4JVMA 1S3SA 2F6RA 4LJAA 4UJ3A 2VSFA 1HQCA 4OYHA 5JHGB 3B85A 1Z28A 3V00A 4XSGA 5J4LA 1WP9A 2BHRA 1EESA 1XJ0A 4R98A 4AYXA 2DYKA 1ZCBA 521PA 2BCJQ 4BRWA 5GVSA 3U7GA 4DB2A 4KFRA 1NSTA 1VTKA 1DPFA 4D6PA 2QTHA 3K09A 4OK3A 2P2LA 3L43A 3ZVLA 4XVUA 4FMCF 1XZQA 4BLRA 1XEWY 4GZMA 1GNPA 2JLRA 1G7TA 2BWJA 3LH5A 3HYRA 5A5GA 2XOKA 3N70A 3H2YA 5AUOB 5CYPA 2EFDB 5A0FA 2ZSEA 3QF7A 1VCOA 4D4LA 1E2EA 1TQ4A 4KV9A 2VHQA 1FFHA 4LHVA 1GITA 2J0VA 4G01B 4QM6A 3ZVRA 4TN1A 3GJ5A 3C16C 2I1QA 1JPJA 2GF0A 4TQAA 4DIEA 4F4JA 3L0IB 1ZP6A 4II7A 1BYIA 4Q4HB 2R8RA 1J99A 2H92A 3GJ7A 3NWJA 4PHFA 3TQFA 2NO6A 2BVNA 3BRWD 3MJRA 2GJKA 4L4UA 4Q66C 4XWAA 5CLQA 5FPSA 4F92B 1NN5A 5EE1A 3JVUA 2PT7A 1A2KC 4QC2A 3ZD7A 4LPSA 1KI3A 4MRRA 4OQFA 2J0SA 1OXUA 1CTQA 3DPUA 3FHCB 1VHLA 4HEJA 4ERNA 2RGEA 1SGWA 3AVXA 1JALA 4V03A 1WE2A 2W00A 1ZNWA 3VKWA 2V4ZA 5G41A 1E0SA 1H8EA 2IHYA 5EP1A 4LC0A 3NIBA 2PH1A 5KNDA 2JLVA 2GBLC 2P6NA 3OIUA 4IOKA 3OE7A 2EW1A 1KAOA 2BJVA 4KLZA 1R4AA 1QHNA 1I4DD 5HPYB 4QJ5A 2ZM5A 1HYQA 1G5TA 3GEHA 1G8PA 4CEHB 2NPFA 5FBQB 2ZU0C 1VECA 3KKPA 3I5XA 2H5EA 4PPFA 4YXWD 3NKVA 1MT0A 4Q4JA 1UKVY 1W47A 2QAGB 3DOFA 1BIFA 3JZMA 1Z29A 2IYVA 3NHAA 4M0LA 5DE3A 2D7CA 4ESVA 5K8LA 1GTVA 5TARA 5KSPA 3OESA 4MYTA 3TW8B 1NJFA 1IAQA 5FPKA 4RD2A 3GLFB 1G17A 2XXAB 4CEIB 3CIOA 4PZYA 3K09C 3Q7QA 1G1MA 1ESMA 3LBNA 3OIYA 1U0JA 3QNUA 1NMZA 4B2LA 1F5NA 3ZYCA 2A5GA 5JWOA 3KL4A 3I8SA 3VAAA 5DLQC 3K8YA 2VP6A 2YJTD 1YQTA 5K8TA 1DS6A 3MLEA 4D4JA 3NBFA 3SHWA 1IN5A 1U98A 3F0TA 2O8BB 4HLUA 4TQUS 3Q8XB 1EFRD 2VSXA 2NO1A 3AF4A 5KSYA 5H70A 4XWOA 5JCPA 1R8SA 2XGJA 3A6PC 2NO9A 1IJFA 3C5HA 2P67A 1R2QA 1BOFA 1DE0A 2F9LA 3HR7A 4FCWA 4I4LA 2BBOA 2JLWA 5KNBA 2ZPTX 4FXPA 1OSNA 3KB2A 1FNNA 4XSHA 5C18A 2GXAA 1P2VA 4WZBE 4E22A 4ZIRB 3PEWA 1MABB 5FBLB 3I61A 4LV8B 2FA9A 1N6KA 3SFVA 1G3MA 1NVWQ 1Z08A 2NPIA 1Q12A 4Q21A 1Q22A 2IYXA 4MUBA 1KI6B 1NVUQ 3HJNA 2WMOB 3BE4A 3QBVA 1RPZA 3RSOA 4EJSB 4NU0A 4MDEA 3P4XA 4I1SA 1XMIA 4M21A 4B71A 3IO5A 3GP8A 2NMVA 4GNKA 1UKEA 2JJ1D 2IS2A 1II8A 2PLRA 2G6BA 3RC3A 2CLCX 4B2IA 2AFIE 3C7KA 3FKQA 3I73A 1T3SA 1COWA 2B8WA 3ZVMA 5EE3A 4MKGA 3ADDA 1A4RA 2OO7A 4CGZA 4LHZA 1E2MA 1P2TA 1AS3A 3EPKA 2OCAA 3FTQA 5EZ6B 4LDJA 4MH0R 4PC1A 4EQ6A 1OH6A 1JR3D 2WPDD 3UG7A 4BASA 1IQPA 2D74A 2C04A 1NY5A 1FZQA 2OILA 2ZRMA 2ZRAA 3LY5A 4MQBA 2NO0A 3ZLJA 2MSDB 4KVGA 2PZFA 4NYJR 4BFVA 1IJEA 2BJWA 1G20E 3EZ6A 1U99A 4S35A 4F38A 3VX3A 4OHXA 4TL6A 3V9PA 1AQYA 821PA 3U44A 2GXUA 1TMKA 4BZQA 1BYUA 2N42A 1N5JA 2QAGA 1E1RA 4PC7A 5C4GB 3X1WA 4DB4A 4RD3A 3L82B 2ZIAA 2ZJ8A 4HB4A 4KBFA 2CNWA 5KOYA 1G64A 2QN6A 3O8RA 3M1IA 1G18A 3LWNA 4K8OA 8OHMA 4HLUC 4OHYA 5J4KA 5C46F 3GLFE 1XP8A 2OV2A 2GEVA 2QPAA 3GLFA 4QJ3A 2XXAA 4JSTA 4WXPA 2QROA 2ZS8A 2BMEA 1W7AA 2UZ3A 2RGDA 3KUCA 2CCKA 5IK2D 3QF4B 2BEKA 2ZRCA 4G3XA 2DFLA 1P7CA 1IOZA 2O0HA 3R7WB 4OKSA 1T3HA 3DOEA 1DADA 4BGDA 1HH4A 1OYWA 2JASA 1AKYA 3L0SA 2QP3A 4GPTA 5FOUA 1S2MA 3SHFA 3W5JA 1J8MF 3LA6A 3ZS9A 1Z06A 3E2IA 5AJXA 3EAQA 1PUIA 3IEVA 1E2DA 3KDSE 2GAOA 5K8IA 2ZREA 2JATA 1SVSA 1NG9A 5EUQB 1Q1ZA 1P61B 1KIMA 3FB4A 2R44A 4B48A 3TSOA 2C5LA 1P72A 1KZGB 1H8HA 4HI0E 5DNYB 2GK6A 2XZPA 3FYHA 4ZIRA 1L4UA 2ZYUX 1MABA 4PX9A 3DEFA 4XOIA 3LVRE 3RYTC 1R6BX 4BEBA 4TSFA 5LB2A 1A82A 4IXMA 4Q18A 5E3HA 3REGA 1W36C 3PUYA 4XTCS 3HP1A 5B30A 1W5TA 5B64A 1E0AA 1SKYB 3E5HA 3ZS8A 3VKGA 3WRYC 2R6FA 3IEUA 2G83A 2C77A 4B6EA 2C78A 2OBMA 2AWOA 3PIRA 3UXMA 2BOVA 4HLDA 4YDSA 4L5BA 4WVFA 3W3ZB 4DDUA 1E4VA 3LBHA 3MCAA 5EE5B 3QE0A 4W5WA 2KJQA 3W6NA 4C7OA 2G3YA 2X2FA 4ON9A 3A58B 1N5LA 5TVKA 1CF4A 1N6PA 1E2GA 2VHJA 2I3BA 4A0GA 4ZCIA 2ZROA 4CYMA 1QHXA 2CJWA 2XB4A 2IHBA 4PZZA 4QM7A 5AJWA 2GHIA 3GLGB 2HJGA 1AGRA 4FD2A 2ZRJA 4A2WA 1KSFX 2ZRDA 3L0PA 1E2HA 5FTJA 3CONA 4MKIA 1Q0UA 2XNDD 5CM8B 5JZVA 3TUIC 4CW7A 4BWYA 4DC9A 3EZFA 3RS2A 4NCNA 3KX2A 4H1UA 5G3ZA 2RHMA 3VR1A 2W6IA 2QGZA 1ZYUA 1FMJA 4EPWA 2JLQA 3RVBA 3LW7A 2ZE6A 4BLPA 1CU1A 5M04A 1VYUA 2XTZA 2CXXA 1OKKD 1N3BA 2H17A 2H18A 4RCZA 5DGXA 5JWHA 3SQXA 1IM2A 1ZNYA 3QF4A 2JJ2A 1OLOA 2PX3A 3PXGA 1EX6A 1QVAA 1ZD9A 2GXSA 1KKMA 3BBPA 4Q1DA 2IC5A 3CX6A 4LGMA 1UEIA 3TIFA 1V5WA 2IYUA 3W8RA 1KK1A 2N46A 4MRSA 2AFHE 4IVRA 5EXPA 3T34A 4XIGS 2C98A 5BYJA 2YC2C 2FFQA 5JHHB 2CMKA 4JJZA 3VHLB 4LJYA 1IONA 5HE9A 1KI4A 3R9XA 3G0HA 4R2HA 1N2CE 1Q21A 3QKTA 3RHFA 2HF8A 3F5FA 4U5XA 3W3AA 5KPDA 3BAFA 1SQ5A 4NMMA 5HCIA 3RS3A 2KI5A 3TRFA 3AP3A 1ZM4A 1LVGA 1QZXA 2WOOA 4FIDA 4NTZA 1RRCA 4C0QC 3KXLA 3U5ZB 1VIYA 3CRW1 2J7KA 1EK0A 3U6BA 1W1WA 3Q5DA 2GK7A 1YR6A 5G53C 1UFQA 1SKYE 4M2LA 2ZRGA 3QJYA 2YKGA 3CPHA 4Q7MB 2A5JA 1GG2A 2D62A 2DFNA 2Z83A 4IDPA 4JLOA 421PA 1QG2A 1MKYA 1RC8A 3SDZA 2W2TA 1P6XA 4QRHA 3QXHA 4M9SA 4X8HA 3X2SA 4QHSA 2FG5A 1KHTA 2DWOA 4OI1A 4AWXA 2YVUA 4G0NA 4UXHA 5E4FA 4O2LA 3PEYA 4FWIB 2MSEB 5FTLA 4DUGD 1K5GA 2C9YA 3PUVA 4KYUA 1Z22A 5GJWC 4IRUB 5FUXA 4C0LA 4KJZA 1YRBA 3CR8A 3A4MA 4Y0VA 2V55B 1IXSB 1S0UA 1CLUA 4GRAA 2ZVPX 4AURA 3MJHA 4IDNA 5D3QA 3WBKA 2QT0A 3T1TA 5E7MA 3QXCA 2ZR0A 4HB3A 1YHNA 3QUSA 3I4LA 4QBGB 2QM7A 4Z54A 2GEDA 4W9MC 1OB5A 1DO0A 3KFXA 2OE2A 2XAUA 3AF1A 1E98A 1CJKC 2LKDA 2PMDA 1M7HA 2W6JD 2ZJ5A 1GP2A 1NIJA 1SXJC 5L3VA 1PUJA 3H4MA 2A5FA 5FOTA 2ZJOA 4KFTA 3GQBA 1Y3AA 1NI3A 4PSAA 2GAAA 4DCNA 4RY2A 4Z1MD 2FV8A 3HU1A 3W6OA 1N0UA 4M1SA 4IFBA 3S1AA 4DCTA 2JEOA 4AK9A 2ZYWX 3DMNA 1PVOA 4G5OA 2HT6A 2DFKB 2FSIA 2ZAOA 3B13B 1KTVA 3CZPA 3B2EA 2GRJA 4B2PA 2IXGA 2ZRFA 4JLVA 1Q1BA 2ZVQX 4PPGA 4FMDB 4B74A 4HDCA 1ZD1A 3AKCA 4DLVA 2OUKA 5JLJA 2B7BA 5FH9A 4WOPA 5IT5A 3E70C 4JT4A 2XZLA 4CDGA 3AF0A 2XTNA 3O8BA 1DG1G 2OSBA 2JAQA 2HUPA 2WIAA 4ITRC
chains in the Genus database with same CATH superfamily
3E1GA 2UVQA 5TF4A 4HAUA 3RFTA 5H8WA 1JBKA 3PUKA 4PF1A 3OZSA 3BXFA 2PZGA 2IKSA 4D9FA 1KQOA 5IAEA 5U4XA 1GAEO 2I67A 3WBJA 1ZH8A 5HJEA 1P44A 1JFTA 1Y7IA 3WYDA 1X74A 5KSWB 2I1WA 4G5RA 3ZNOA 5BN5B 5K3OA 1JFVA 1HLDA 1Y7PA 1LLUA 1VG9B 1ZIYA 621PA 4PXSA 4UVIA 1F06A 3ZV4A 4HNVA 3CSDA 3ROMA 4A8PA 5IAAA 1NWHA 1YFZA 2C7PA 1I7QB 1ST2A 1U2DA 3GELA 3OMLA 2BTQA 1GLNA 2JFVA 1GV1A 1K5PA 3QA3E 4QASA 4QU9A 4YRFA 5IP5A 4IZ6A 2ZWOA 1K3TA 1PGQA 2GMWA 1NULA 1DT5A 1PNVA 2AT1A 1BZYA 1K3FA 1W85A 3BTOA 3E3NA 4I1OA 1A9XA 4M88A 2IGTA 4R69A 1M0EA 2GJ8A 3ZQJA 4CM8A 2VDWB 4UTRA 1U0TA 3TSWA 3NHMA 1OH7A 1TKAA 2J1LA 4IZIA 1H5UA 2KLBA 3WLOA 3N2ZB 4HADA 2VT7A 5I4IA 3JD1A 4JCCA 1NUPA 4YQZA 1M6VB 1RTTA 2QE7D 3X2FA 1SCJA 4MV9A 1G41A 2DPLA 3HKDB 3K94A 4AJIA 4TKLA 1BFKA 2CLMB 2PEZA 1E4YA 3G02A 3RUHA 3LHDA 1Y6ZA 3O90A 3PX3A 2WFAA 2FLWA 2ZG6A 2G1PA 4P4UA 2J3EA 1LW7A 3SJAA 2AMFA 2J07A 4IQFA 4H31A 3LLSA 2X86A 1JDUA 3FZEA 5JS7A 4WXEA 1JX6A 3KO8A 1TJ3A 2A5DA 3KQMA 2V54A 2ONJA 2D1YA 1E9RA 1Y1KE 5EA2A 2OEPA 2OXRA 4K2AA 1LJUA 5AW8A 1YL6A 4O29A 3PGMA 1T1JA 4A92A 2WIBA 5CJJA 3NDJA 4JI3B 3TQOA 2OBXA 3EWIA 3MXOA 1BVYF 1CNFA 5IJAA 3QJ5A 4BKQA 1KVRA 1L5ZA 1GEEA 2IYWA 1NJ8A 2J9FA 2X41A 3GEPA 1K88A 1DJPA 1XHFA 2XX3A 4ALKA 3IHLA 4H7JA 5F1OA 3RTDA 5L3QA 5BN4B 4IDAA 4MS3A 2GUGA 3MUNA 3OC6A 4C0BA 4UOEA 1QIEA 4K6OA 1KDPA 4RDIA 3GJ8A 2Y2VA 1R8XA 5IUKC 5K2MA 1R6DA 5KKCA 3F7OA 4U63A 1YU6A 2CEAA 1SR8A 3RC2A 3FTPA 1E2IA 5EOVA 4GP7A 3DV9A 3ABRB 4DIBA 3BYZA 4S1NA 3K0HA 3RFXA 2GPYA 5TMEA 5IJ9B 2XE6A 3U4MA 2IRWA 4P32A 1KH2A 3AJEA 2BSAA 1K86A 3VVBA 3ZEAA 1Y81A 3KBBA 4YJFA 4NBWA 4F1WA 3HN7A 4DJJA 3CEJA 5BSKA 2WD7B 1TLTA 1KP3A 3VFDA 1GZ3A 1E77A 1WL8A 2X6RA 4LBVA 1F0YA 5LP6C 4B6QA 2P11A 1Z0FA 3YASA 3ZE7A 2JLSA 1IRXA 2P9YA 2P3OA 5KNCD 1GGVA 1X1EA 3LKBA 4URZR 1KJ9A 3HDTA 1E3WA 3AC0A 3OH8A 3K70C 4L51A 4CI0B 4JLBA 1WMSA 2YH2A 1S9HA 1ACLA 1T9KA 2FW8A 4L0MA 4NBRA 2YV3A 4RF3A 1E3MA 1DUIA 4A82A 2IUUA 4MHTA 4DV1B 2BHTA 4ZK2A 5FJJA 1BMQA 1K9VF 3ZHQA 5JEDA 5TVGA 3NPMA 2R6DA 3O3MB 5F3WB 2JJ1A 2BGWA 3MFYA 1I9CA 1QTIA 4D9NA 3EVEA 5BN5A 5KYWB 2VJMA 1BO6A 4UHJA 3HJHA 1PFYA 3CF6R 2YCLA 4HYEA 4EPXA 1CEYA 3H84A 3PDWA 4H77A 1Y3FE 2Q4DA 2CL5A 4CCWA 5BW8A 1JR3E 3W2HA 2XQVA 5CR9A 3M6MD 1I1QB 3Q1LA 1US8A 2EG9A 2R1UA 3MERA 3M6AA 4G1BA 1BKYA 1ONPA 1G98A 1YNOA 1NKVA 3OUUA 5EQTA 5FFMA 5HFNA 4W5TA 3U3KA 2VDWA 1E96A 4XD7A 3U7IA 5F9FA 3K5IA 1JL3A 3KQQA 2HLNA 4L22A 1NVEA 1MP0A 3NIDB 1M67A 4G81A 2JH8A 4Z4HA 5L4SA 2P4QA 2NQ2C 3KELA 3UAWA 1LDNA 3PR1A 3PKJA 1LWNA 1XWIA 4U7WA 3SHVA 4ZHQF 2Q5QA 1UMDA 2DQ4A 3CO5A 3HKDA 1TTHA 3WK7A 2C5AA 4WE3A 2OHIA 4HFRA 4GOJA 2PD4A 3K32A 4MGZR 2BZ0A 1GA1A 4FCTA 4J7AA 5FUBA 1YOVB 5IZCA 1VMDA 1PW5A 2NUAB 1T9HA 1M66A 1Y63A 5K3BA 2YUIA 3P19A 4Y6QA 2XMBA 1DBSA 2D2EA 5I9BA 2G36A 1QR2A 1T0IA 1CZRA 3BORA 3Q7SA 2FUG1 3R3SA 2F43B 4NJMA 3LWDA 2X0NA 4ZD6A 4D5GA 3QMVA 2A3RA 5DGDA 4Q1EA 1M1YE 5EZ5A 4H6PA 4K26A 3TXYA 5HIKA 1C9EA 1U5AA 1XZHA 2HCBA 3H0KA 3IERA 5AKHA 3ZQKA 5BWOA 1SEVA 1W9MA 1XOIA 4NHEA 3VYVA 3QYPA 5K0NA 1JLLB 3TQSA 4LJ5A 1C3XA 4OBXA 5FDFA 1WMAA 3V46A 3TLXA 4QDUA 3J80A 1QIKA 5CVUA 1X1CA 2QVGA 3PGKA 4KR0A 2R65A 3IRVA 4X8LA 5IU6A 3O9MA 4CFYA 4PE5B 2WJHA 4BKRA 1V1MB 4E09A 4X24A 3CW2A 5F73A 3A28A 1TO2E 2PV7A 4JQZA 1P91A 4FNMA 3ZQ6A 3KKMA 4AN0A 2A9QA 4EITA 5JQGF 1OTYA 2AZDA 1B16A 3D0KA 1NU8A 1K7FB 1TQDA 3TKLA 1TO1E 4NHOA 4F0JA 1YQQA 2FWBA 1H3FA 4D9HA 4WJLA 1JHRA 3HYNA 2HREA 2OQ2A 4RVSA 3UJNA 2NWQA 3EWAA 4KSYA 4Q9HA 4C6RA 1SOUA 2BM0A 2LPMA 5M5BA 1IE3A 2BONA 3KE8A 3U3JA 3QE9Y 4PZEA 5K8UA 2EKDA 2FOLA 1CJVC 2Y0CA 4KWCA 2QG6A 3WLPA 3O73A 2Z30A 3MUFA 2CLEB 2L2QA 4ND5A 3TMYA 4AO7A 1XMVA 3GH3A 1EUCB 2O2EA 2R6HA 3HR8A 4IR7A 4OJNA 1KQGA 4M0EA 4PIMA 3MCTA 3VNSA 5D3KA 3FMGA 3QVTA 1X19A 3EVNA 4HAZA 3R2JA 5THQA 2ZVJA 2P8JA 3S40A 1DXOA 1ZU4A 3TL2A 3QHQA 4PLPA 1TADA 4U7FA 3F8SA 5ERXA 1PO7A 3UZUA 4RF2A 4ZXPA 4FJ0A 2HJWA 3D3EA 4WCFB 1RPNA 1BQ3A 4ID3A 5KHAA 4XARA 1EP3B 4O4HF 5L7TA 5KYWA 4C2AA 4JP8A 3H7IA 1LK5A 2YDXA 3H99A 3JVDA 3Q8KA 3RVRA 3MZ0A 5FTNA 1OC2A 3QPBA 3SX0A 4JI0B 1AXGA 3D5EA 2AG5A 3DKKA 3VKVA 5IZCC 2JKYA 4EUHA 4M1ZA 1T29A 1W4AA 4WXMA 1RXSA 3AFHA 2EATA 2XWQA 1C5KA 2JFZA 2B9EA 1TYCA 3H13A 5FKJA 4JC8A 3RRNA 3R0QA 4FWBA 4HGYA 3H1BA 4JLPA 2EIXA 4LDNA 3AETB 4MAFA 4MGKR 3UW3A 5JNTA 4I08A 3VPHA 4IIJF 4BFCA 3EA4A 1DTEA 1DKPA 1L7PA 1EVKA 1JDVA 3C6BA 4KL8S 4UHBA 5TMDA 4JYBA 4GBJA 1PNTA 4C0HA 4F5YA 6ABPA 3LT5A 3RS4A 4LJ6A 3UWPA 4AZSA 1GL3A 3HKBB 1CG6A 1ZA2A 4CU5A 3VH2A 3WOVA 3P2YA 4CKZA 3AB8A 1LU9A 5AW4A 3RCBA 3ZHUA 4NZMA 5I5EA 3URMA 3EBOA 3HCFA 4RO0A 2ZUTA 2PGOA 2F43A 4FYYA 3HU5A 3VH4A 1MXHA 1ZC3A 4OATA 4Q0MA 2E6UX 4B4KA 1UXGA 2DFTA 4D3YA 2AN3A 1U11A 5IARA 4LZWA 1ISPA 3Q3EA 4RKYA 4FX2A 1OYYA 4PNHA 1EGHA 4LF7B 1X1TA 2V4MA 1JLLA 3BVPA 3DC2A 3EXG1 4C5BA 1GKUB 3TZBA 1JA1A 3BEOA 2BT4A 3AONB 4YO8A 3BCHA 5A2GA 1Z39A 1JDSA 1QCYA 1U4SA 3IP9A 4F4FA 1P2BA 1RWWA 1F0NA 4MB6A 4CM4B 4RQUA 4DGQA 1DZ3A 1P1HA 2B8JA 3PGJA 5EMKA 1Y9JA 1P0QA 5K0BA 3ICQB 2K7ZA 3OQPA 4UTZA 1R10A 3RT7A 1GILA 3HDGA 1GSHA 1SULA 5KAMA 2R9VA 3B8EA 2C59A 4JJKA 4QYSA 5CPBA 4EABA 2ONCA 3NH6A 1MCZA 3N6XA 4IIEA 4FFNA 1ADFA 3W4IA 5IX8A 4YASA 2HJRA 3OX2A 4C4SA 3OZIA 4FDAA 3ZN2A 2X3FA 1EK5A 4JCOA 4QVKA 4XRRA 3ESQA 1NBHA 3Q2KA 1B43A 5KYYB 1OMOA 2HK7A 1YBVA 2V0CA 3FSGA 3Q12A 4EHAA 1AT1A 2H9AA 3IC5A 1CVLA 5HILA 4GM1A 1K4KA 1K5HA 5B1SA 4KU4A 1EUCA 1IB6A 1YZNA 1EDEA 1MJHA 4EL0A 3DHVA 3NV9A 5JNSA 4UDXX 4P0QB 2DWPA 3E8XA 4X6YA 4Y7CA 4QNRA 4YALA 3FJ1A 1S8NA 3AFIA 5HOQA 4TTPA 1TT7A 4CEHA 5HDQA 1RE0A 1MTZA 2RB4A 2ZR8A 5F12A 1Z36A 3LZ6A 4V0ME 5ALFA 2FMTA 3Q7PA 5F1YA 3T5AA 4XJVA 1USKA 4ZVKA 4NI5A 4ENWA 1A9RA 4DPKA 5K0ZA 2IY8A 4RTOA 1DX6A 2B20A 3EVZA 4AC9A 2OKCA 3K0KA 3UUGA 3IT2A 4FNOA 2J32A 4D3FA 1IN6A 4DZZA 5GJBA 1NQWA 2IXBA 2YVKA 1ZICA 2XZTA 1NV8A 4DEVA 3WRXA 4XWKA 2E5LB 5H7XA 2UZIR 1RJGA 1NT2A 1MVNA 2JKVA 4IW3B 1FRVA 4LQLA 1MX1A 4KLCA 4M8IA 4PLWA 4CMCA 4D43A 7REQA 3ICVA 4CLRB 4RZHA 5BRJA 1E32A 3U7FB 1IC6A 2C4MA 2F9FA 3O5AA 2JCSA 2L69A 2UUOA 1XYVA 4PGFA 2X0DA 3RD5A 4AMUA 4I2NA 5HNKA 2AE1A 3PFCA 1HM5A 2PIAA 1WU7A 4GM4A 1A4IA 2R68A 1CY2A 4LXUA 1NFQA 4OHBA 2FDCA 4PRLA 3NKLA 4UNNA 2IWHA 1SIOA 1UBEA 1M2EA 3HCPA 1L9XA 1UXIA 2H57A 2Z09A 4YMWA 5T8KA 2C9OA 4QFBA 4R5HA 2NSJA 3T9EA 3ZBPA 2O1XA 4ND7A 3L0CA 5CBPA 3SVLA 3TTYA 4KTVE 5A4JA 1BD3A 5EGSA 2QY9A 5K8LA 2VNKA 1WA5A 4FC7A 3U3DA 1PS0A 4N8DA 1K97A 1OPRA 4M3NA 2VYCA 3HKBA 4BCCA 3WDSA 5EJ5A 5LNK1 1RACA 1QDLB 4IWXA 4AZTA 4DDWA 1RTKA 1UWLA 2D2XA 3KB6A 3PNKA 4BVEA 2P7HA 1YKGA 2PBZA 1ISRA 1ETUA 1RXUA 3E9MA 4L78A 4Y2XA 3RIGA 3UUFA 3RANA 4W5NA 4I14A 1XMQB 3HG7A 1U5CA 3HZHA 3LXXA 1A04A 2GEBA 1TRHA 2C03A 3M4YA 4YJ3F 3WWEA 4D44A 2AFVA 3SKYA 4D26A 3IKLA 3AEQA 5EINA 4N12A 1UBFA 1DQZA 2QM0A 3KLMX 5CNKA 4TZ0A 1XEAA 1V48A 3QKSB 3JD3A 4KMOA 4RAOA 3SVTA 4UCXA 2F3RA 4MGIR 4HAVA 1NUAA 3EC2A 4OMFG 4XWWA 1UAYA 5T6MA 2YDYA 4P5PA 3NUZA 5BVGA 1UM8A 1YGYA 4CM4A 4AS2A 4AWBA 3EDRA 4P36A 3BSFA 3TNDA 2WJGA 5EE9A 3UTCA 3GN1A 5SZHB 3TOZA 4S24A 2WG2A 1FS5A 1A9QA 4C06A 5DXAA 4FI3F 1EM6A 2LCQA 5CDFA 3TXAA 2PBFA 4MDYA 5DM60 3R8XA 2OGSA 2C4KA 2ZSFA 3PQ6A 3WQSB 4G5QA 5I48A 4TLCA 2F8LA 1H4TA 1DPGA 2ZI6A 1NJ1A 3IVCA 1TM4E 3PUJA 4HNSA 2ZYAA 4UMDA 5TT0A 5LVAA 2HK9A 2WUVA 1D1QA 2P3LA 2YRFA 3PEUA 4IJ5A 4M38A 3ZDDA 3NVAA 2O06A 2IA5A 2QAGC 1UODA 3OE7D 3FPFA 1EE9A 2Q28A 2DKOA 1QQ7A 1UH5A 2AE2A 1T4MA 3JY6A 5IJXA 4ABTA 5CG1A 1IBLB 3IAS1 1BWQA 2YZGA 1SKQA 4EW6A 3QPVA 3PQ5A 1HTBA 1HZJA 3ND5A 1IHXA 2DTDA 3WRXC 3GR6A 5KQLA 2FEXA 4QUHA 3WKBA 2BHLA 4A6EA 2C00A 2HF9A 2PRJA 5T5QA 5KVQA 5CLHA 4DSTA 2O4CA 5HK9A 1CR1A 4IDOA 1C8KA 2GK3A 3BJRA 4UBKA 5F78A 1TU3A 4M76B 1PQUA 1P5RA 2FSVC 2YHSA 1EEHA 4WNYA 1PJ8A 2HTFA 2PAAA 1YV9A 4BN5A 1Z83A 3OOSA 4Y1EA 3CUWA 2J0UB 1AZTA 5CMLA 1JDNA 4LHWA 2IWRA 3DNFA 3ZE1B 2GF9A 1OVGA 3DQQA 3FKSD 2FE4A 2OUIA 4LAFA 3FYTA 5KI6A 1ABEA 1NY6A 2EFHB 4OBEA 4OGFA 3PWZA 2WZDA 4TV9B 4HWSA 4D57A 4LNAA 2GZ1A 1LX7A 4MK4A 1H9CA 4BV8A 1DUSA 4CLRA 3A9VA 3I6QA 1NW7A 1Z6TA 2H65A 1Z18A 5BNWA 3TUZC 3INYA 3UANA 3DEYX 4TQGA 2PUBA 4GX2A 3A32A 4MV5A 2DHDA 3N6RA 1XFAA 3R7WA 3OT5A 4JLKA 3FI9A 3GHYA 1UF9A 3K16A 3CG4A 3HCWA 3GD7A 3PXAA 4RVOA 5KSZA 1GGHA 3D3QA 3QU9A 4CR8A 4FM9A 3BZBA 4KQIA 1PZEA 2EIHA 4QYWA 1M0SA 1BJKA 1P0FA 3DT9A 5G4LA 3INGA 2B2XA 4UTOA 1NVXQ 2A8YA 3JATB 3WLSA 3KFVA 1X2BA 5EJ6A 3C8MA 1OBHA 1WCV1 2VHZA 3C3YA 5C1BA 2M32A 5A2QA 1CQJB 1D2NA 1YDWA 1LKZA 3LDFA 4GT1A 1VYTA 4GBMA 5ARBA 4G97A 1DC6A 2RAVA 1U0GA 1J0CA 1N2CA 2ZTLA 1JU4A 3H5OA 3IOEA 1K7EB 1U7UA 4V3BA 4Y2QA 4D3ZA 4F7DA 5LZ9A 4OXXA 2IE0A 2K2QB 1VXOA 1QJ4A 1AS2A 1WHSA 5AW2A 5FORA 1AKQA 4AKGA 2PXHA 2DUWA 3DP7A 3L1HA 4J9VA 5DGTA 1A3CA 3TR5A 2DXIA 4F2WA 4R2IA 3OC0A 4BEJA 1Q7RA 2CE2X 1QGAA 2PUTA 3I5UA 1QDEA 3BH7A 3HY3A 2QTLA 3FOAA 4M9CA 2FWRA 3N8KA 3GRUA 4RNCA 4PLCA 4G0QA 2QNRA 5KQGA 2OCKA 3GRVA 2HBZA 4MB0A 5E4JA 3OQOA 3DDZX 4GOLD 4EHLA 3OPQA 1G3IA 2RIRA 2WYVA 3OEEA 2DPMA 3PNBA 3T06B 4M4SA 4NQZA 4DMHA 2PSJA 2Q27A 3WWCA 2OV6A 5EXXA 3SN6A 4K28A 2YV2A 1WG8A 3MJCA 4I5EA 2RHBA 4RUKA 1GT91 4TQ9A 4ZU3A 2ID8A 4RKQA 1CVRA 4ZVRA 1UC5B 3WLTA 3STTA 4KR7A 1ORHA 1YBAA 2GXQA 2YBEA 1G291 2H2IA 5D86A 4FOOA 4BYGA 3FSEA 4EOGA 4YRDA 2O50A 1FYEA 1JA0A 2QK4A 3FBWA 1OE0A 3TE7A 3ITNA 1ZGJA 1XCBA 1YRLA 3ZGXA 2O8DB 4XPZA 3STUA 1SUEA 1DBPA 2JIRA 1NQVA 2XA9A 4HAYA 4BNHA 1MEJA 3TW6A 1DZIA 1UIRA 5KU1A 5T7BA 4FI3C 4GF5A 4C0SA 3L07A 3ENVA 1G55A 1L7DA 2QNBA 2Z3VA 4OA5A 4POOA 4B3MB 4U2EA 3LS2A 1M1UA 3SD7A 5I7UA 1RC1A 5K0LA 2OHGA 2OP1A 2CYCA 2XCUA 3EXHB 5MN6A 4TTJA 3N3AC 5IHXA 1T3LA 3SIPA 2D5CA 2F00A 4NCXA 3V34A 5B7PA 3SNHA 1H3NA 2VSQA 4B9EA 5GM2A 3TD9A 4RVCA 3TIIA 1N57A 4TV9A 4B3GA 5BR8B 4AZ0B 4OQNA 1YI8A 3KYIB 2F1JA 4U00A 7AT1A 1E2PA 2PVSA 3B78A 1P75A 3DOOA 3LK7A 4KMRA 4LVOA 1X1QA 5E0OA 3ER8A 3VTKA 5J3JA 2DHEA 3ZVNA 1OW3B 2HWUA 2FUG6 1IDN1 2EJBA 1XQ9A 5JXIA 1O5IA 1C1XA 1KO1A 2WAYA 2PLWA 2QRPA 2WHRA 3L0ZA 5G1OA 4CDMA 2WD8A 1RZ3A 2W6NA 1RLMA 2ZJ1A 4U9HS 3WHPA 4CV1A 5A5EA 4PQYA 1TAGA 2IYQA 4EY8A 1VJTA 5AUPB 2FPGB 1GR1A 3HJUA 2Y0EA 4XQ9A 3W4KA 4B0OA 4XJTA 3TLCA 5NLLA 3ZIUA 2WWYA 1XPUA 1EWTA 1GNTA 1ORWA 4XYEA 4N8SA 3T7DA 2SECE 2LBPA 3HPQA 1R88A 1X7ZB 1S8FA 2PX4A 3BZWA 3NHSA 4BOYA 4DIKA 5EIBD 4R83A 4ENSA 2KE5A 3K9LA 1MC4A 1S2IA 2YYZA 2YASA 3JALB 5H02A 3ICEA 4F3NA 3TMKA 3M2PA 3OQBA 1OXXK 4Q9AA 4LWZA 5JWRA 5GZ1A 1OFHA 4UDNA 1ZU5A 3MMSA 4QTUB 2DBVO 2G9QA 5B58T 4BFSA 2GT1A 3PNQA 2RH5A 4O63O 1J2UA 1N2ZA 1MQSA 4NABA 5EMJA 3HA3A 3OQJA 3PFIA 2XI4A 2J4CA 1RRGA 4AFNA 4YP1A 1Z56C 1VJRA 3U3RA 5K0EA 2FPMA 2PL1A 2NUPB 2OLJA 3AU8A 2HA3A 1KKUA 3BPSA 5IUNC 1OZAA 1QCCA 4B32A 1UPCA 2VF2A 2RAUA 4N3BA 2VCEA 3GH1A 3J7AC 4OM8A 1N2OA 3IAAA 3AF3A 3DAGA 1KP2A 3UUEA 2I6XA 3TZEA 5KZMB 1KYYA 1RJ9B 1MRZA 4KGVA 1RM0A 1QNLA 2AHRA 2CLSA 2BFPA 3OM1A 3Q3CA 4OHPA 5KJ6A 1Z2CA 3U3XA 4U2CA 1W52X 2J31A 3C8DA 1D3AA 4NENA 1AHIA 4BO1A 1T3ZA 1ZXXA 2C29D 3N75A 5JSQA 1IYZA 1CY4A 1P5HA 1WQ4A 2CWDA 3DO6A 2YXPX 3WGHA 4I55F 2IVZA 1RQ2A 4KFUA 2F4NA 2ZWPA 3K0SA 1C0IA 1Y1TA 4WKPA 1M6NA 1GRNA 3Q0EA 5FNVB 4UE6A 3TLJA 4YHHB 4BXOB 2I5PO 1W4BA 1ILEA 4DS3A 3THSA 1NBOA 4BX9A 1SVWA 2H8KA 4HSEA 1NP7A 1GLVA 1G42A 4X45A 2WQZA 4BQSA 3RJMA 5E95A 3EF3A 4K86A 3HHEA 3L04A 1JKJA 1CJSA 1XG5A 2QB5A 2YW2A 3EXHA 3HEMA 3NTVA 2PGDA 4NULA 5TLSA 1CNMA 1S3IA 1AQIA 1Q95A 3KXDA 4MWDA 4GPBA 1PBTA 4F56A 4DM7A 2OZEA 2CLIB 2OYSA 3WLKX 4AZ0A 2FR1A 4LJRA 3GX1A 4LXTA 2JD0A 2I34A 4PC6A 3R0IA 2EU8A 5CNMA 1UBCA 1BEUB 1OX4B 2CDAA 2BRUA 2QJWA 3QOXA 4GMHA 4QPCA 2CZQA 2GPJA 5JCZA 5HKLA 1PG0A 2WSYB 3B20A 1T2UA 3CEMA 3QFFA 4RMJA 3CLUC 1ONSA 3VR4H 1GKYA 2QGNA 3A31A 4W8HA 5BT8A 3HYSA 1ETHA 1E3SA 3I9LA 3JQ8A 2OCYC 1FYXA 1XQXA 2PL3A 3KKKA 2FPGA 2ZYHA 4UUQA 5JYEA 1YVEI 4NF2A 1EWYA 2BBWA 3WGOA 2QMQA 2O7QA 1ISGA 1Z4LA 4JQYA 3VU9B 3DFZA 4FC6A 3CLTD 3MSCA 1NSFA 2BW0A 3A3PA 2Z98A 3LKZA 2HXYA 3HCCA 4HZIA 4HEA6 5BOSA 2JLUA 2AF3C 1AX9A 1X7ZA 2BMVA 2EYUA 3FNEA 4K9SA 4RHTA 2JAXA 2P77A 5M2QA 4M1TA 3IUQA 1BDBA 1ABBA 4D92A 3AHJA 3JALA 1THTA 1M6EX 2IHJA 3M4XA 4MWTA 4DJTA 4ZYLA 5L4LA 3FZQA 2ZAYA 5LZ7A 3MWKA 1FDRA 4CEJB 3LLCA 1NLMA 1TU0A 3IDZA 1M2FA 3INNA 3LO5A 1QTRA 3R0JA 4GLOA 2J6CA 1EXWA 2FPKA 1VJ1A 4J7CA 4FMCB 2WHPA 3KZXA 2WPDA 2NVWA 2NZJA 4AMVA 3MAJA 5DW0A 3C8UA 5AVVA 2GZDA 5BNFA 4DDHA 1RXIA 2XPCA 1GM5A 4Q4JB 3SU8A 4XB6B 3H4VA 2RHTA 4RSHA 4BNNA 2VPZA 4RDHA 4CM3A 4RANA 4AMGA 4XUDA 1KEUA 3A1TA 1K66A 1ZSYA 4PPNA 1Z5UA 1LI7A 4MUGA 4RIHA 1KJWA 5LLTA 2PWPA 4CF7A 2I8AA 1O9GA 4IDFA 3PXBA 5F7JA 1OAAA 3HRIA 2BFFA 2Z0MA 3OF2A 3QH4A 4NY1A 4QFCA 4RQBA 3FFAA 2V3WA 3EXHC 4L7QA 3WDLA 1OROA 4ZYZA 1JDBC 1USWA 2VC2B 4J94A 4FFWA 4QYXA 1MU0A 4IOLA 4WY2A 1R12A 2RGAA 1SBCA 3O2SB 4MS1A 5FUYA 2H2AA 3N2KB 1DL5A 1YACA 2WWWA 2XB2A 2BCEA 1TVEA 2N47A 2Q6VA 1U02A 1JQ5A 3IUYA 7YASA 4JYAB 4BXOA 5FNVA 3HNOA 4YBRA 5KDOA 1SN7A 3PQCA 4QXOA 1FJ2A 3P94A 3PRYA 4WY8A 2OAEA 1P2GA 4DWOA 3QWAA 4JMLA 3AEXA 3EDCA 2ANCA 1KP9A 2VTBB 3MF4A 1NLFA 2E4WA 1MO6A 1J49A 1C9NA 1QSGA 4C03A 4LF6B 4M9UA 3HKEB 3AFMA 3EYAA 2GFHA 3ROQA 3HVIA 1UBUS 4Z0TA 4B43A 3PVSA 2PSDA 3BFXA 3P8ZA 1G9XA 2FZ4A 4PQFA 1B0UA 3M2TA 2C84A 2VNAA 4LRUA 3VR6A 5LMZA 1WOMA 1NUUA 2HIGA 3OPYI 4WZAE 5DGCA 4JI1B 5A5VA 2V0NA 3ONWA 2JI6A 2NU7A 4C4PA 3GPDG 5GOZA 3HDJA 4R8KA 4ETNA 3KG2A 1XKTA 3W0LB 3IEKA 2HCJB 3F2IA 5CP8A 2I4LA 1T36B 1O5TA 9LDTA 5D3MB 2P68A 3D7KA 3KZKA 5ADHA 1G5IA 2OA0A 2D2VA 4FYIA 5GV8A 1B3RA 4DMKA 1X94A 3CW8X 1WUHS 3PU6A 2R4QA 2EOAA 3DMGA 3EVAA 5KINB 2C7RA 3EEQA 4S3MA 4FE7A 1CJUC 4AIIA 2BDTA 4TMVA 5JJBA 3F96A 4HB2A 3IXMA 4P08A 2C5SA 2H11A 4LY0A 3VU9A 1BS1A 1DKRA 4XAQA 4FYXA 4AICA 3B1KA 1YT5A 1BCSB 1UDAA 1Z0JA 5KVSA 2ZIVB 4KQ6A 3HCBA 5DSZA 2JW5A 3L1UA 4X7PA 5L3RA 2OOKA 3RRYA 1Z4NA 1GGJA 1O96B 2BP7B 3D31A 4HRAA 4EQ6B 1XTZA 1AA9A 5FL7D 1JNXX 4B3CA 2IUTA 2GKOA 1O6BA 4RZ2A 3DF9A 2YQZA 5DEOA 4DOMA 4CEJA 2GJAA 1W5BA 4OHCA 1X87A 4ECEA 5ALVA 4ROTA 4J0QA 1Q14A 3ENKA 2EWVA 3FVQA 2CK3D 2HMAA 3ZE6A 3FNQA 4YAEA 4P31A 1J0AA 4V1CI 2C2OA 2EKLA 2R7MA 3QENA 4KNVA 1R0ZA 4IXWA 4KR2A 3KHSA 3BZUA 3DZCA 4CL2A 4GPEA 3EFHA 1FDWA 3O7MA 4ENUA 1GO2A 3ZHBA 1C1HA 5FTKA 3A7EA 2XGOA 3QU7A 3TFQA 2NTEA 3ZDQA 4HHEA 4D5EA 4MWGA 3R9WA 3NI2A 1ZNQO 3TDKA 3Q7TA 3MN1A 1VHWA 4YEDA 2AEJA 4KG7A 2W83A 4PAWA 3U56A 2GJSA 4KQKA 3DBRB 4AQYB 1YFLA 1KYIA 3LVQE 4J0JA 2PKRA 2QE6A 3PHLA 2WINI 4B7UA 4D8WA 4E70A 3SIXA 5CLFA 2O4UX 4KFCA 1PJCA 3CN7A 2AOWA 4X6UA 1TK2A 4MKRA 4RK5A 5JH7B 1LBIA 1YRYE 1RU3A 1Z2EA 1M54A 1FUIA 2ZT8A 3L7BA 4LBZA 1YB6A 1XZFA 3N2KA 3UJ6A 3RNLA 2G9NA 2FZWA 2LWIA 1NOKA 4WW0A 3RRXA 4LQDA 4CG3A 3KXKA 1LPBB 4R05A 2X4GA 3U4IA 4PXAA 2AMYA 4OMUA 4PG5A 5CG2A 2QBYB 1AJEA 5B1HA 3TAUA 2NX2A 3NP9A 4NECA 2PO7A 1KAGA 2PJRA 2F1OA 1TUGA 2C57A 2DCUA 3UK0A 1IVNA 2VTBA 3GGOA 2CFCA 1P3Y1 3C4QA 3GWZA 2P40A 4UD6A 1A9TA 4F5DA 1OXTA 2GESA 1NVKA 3GJQA 1XZCA 1TF5A 2J7PA 2WTUA 3SNKA 4IUBS 1TEXA 5ELLA 4AECA 4NX2A 4P4TA 4IGIA 4REQB 3LBAA 4LJ4A 4X8MA 3UA3A 4A91A 4TMXA 3M5PA 1M74A 4PZLA 1EWQA 2XTMA 3VU8A 1C4KA 3PFNA 3QVXA 5SYMA 1H2XA 4BBJA 2GJ4A 1HFWA 4MVJM 1W49A 2QNIA 2DGDA 3EOZA 4KHPB 1JAHA 1CR0A 3ILYA 4MPPA 1BRTA 1ZD2P 4WK2B 3F5QA 3C6KA 4A10A 4HDKB 4UAJA 2FLVA 1N2IA 2EP8A 3AU9A 3CUVA 4FW8A 1M33A 2JD2A 2ASVA 3NH9A 5H68A 1YQEA 3KZ1E 5D3MA 3T8YA 3EAFA 4QA9A 4BFYA 1RYFA 1VCIA 2YY7A 3ROPA 1QP0A 2ZUUA 3GCWA 1E3EA 3P0IA 1EXDA 1VBNA 3WNCA 3O38A 4I99A 3KVVA 4F2PA 2CDNA 5DYTA 5DNVA 3WJAA 1T5SA 2YOHA 4MP8A 4LY3A 3P9KA 4JEMA 1XJQA 2ZQ5A 3BD8A 3G5UA 3SK0A 3DT6A 1IB0A 2BIFA 3F9RA 1X8LA 4EMUA 4YUZA 2FW1A 2YMPA 5EHNA 3TQQA 3VJRA 4WESB 3D2BA 3EA5A 2Q5EA 1G9SA 5CVCA 1Y3DE 3RSFA 4KWTA 1AK2A 4Z4IA 5BQXA 3FOZA 1C1YA 3EVGA 3I0ZA 1MA0A 3B9BA 3OLCX 1XYGA 4ZZ2A 3EZ7A 3IEMA 3MCZA 4FYJA 3BK2A 3NBUA 1ATZA 2O07A 2DG2A 2RH4A 3H0EA 2A7QA 2CJWB 3KB1A 3MGKA 2BFEB 5FUMA 4IVNA 1SU4A 3GNLA 1CP3A 1XN4A 1JEQB 3ETGA 5D7BA 1LF0A 1XRLA 4ZICA 2VPTA 3LFTA 2W2LD 2EP5A 2JHFA 2YVLA 3VC2A 4AJHA 4PU0A 2VYVD 3QWBA 1HGXA 5CB4A 1D9ZA 1XLWA 4R0NA 2YWHA 1A5SB 3GP5A 5CH5A 5CEFA 1G59A 4M8NE 2UXDB 1SCAA 2Y1KA 2YJ3A 1CP2A 5KQPA 5HF5A 5LMUB 3RVNA 4A23A 3OU2A 4KXUA 3L0OA 1EFDN 3DBRA 4HNGA 5FBVB 4GI5A 4TUYB 2CDRA 4Z9YA 5FL3A 4E51A 2BFWA 2NM0A 2ZYSA 1N6IA 3D6JA 4J0KA 3UEOA 1CKEA 3GCDA 3AHIA 3N0TA 4Q7LA 5JH7A 2Z2YA 2O6HA 1RXEA 1JTEA 5L9AA 1ZUNB 2HRQA 1K89A 3FWKA 3PT5A 4D0RA 2XGSA 1ZQ9A 2VG8A 2J5XA 2WAMA 2FB9A 4TVSA 5JTTA 2OWEA 4PGMA 1LVUA 1SXJB 1R3UA 2UUBB 2QBYA 1C9KA 2XDYA 1VJCA 4J0HA 4JLJA 5JXJA 1FLNA 3PWTA 4MINA 4EX6A 2J6IA 2UYGA 3A05A 1CY8A 2C8KA 2A30A 2Q50A 5EIFA 1V7QA 1MDBA 1H2EA 2R2GA 4Y2GA 5BRAA 3PD7A 4EFDA 3TIVA 2GA8A 2ZIZA 4TKUB 3SZRA 2ZJYA 3GA5A 1GUAA 4LRWA 2VDNB 1V5EA 1LRLA 2ILTA 2PUHA 5AI8A 4F46A 1DDGA 4U7PB 4DHEA 4REQA 1Y6JA 1EA5A 4RE6A 2CBXA 2W2PA 1ODIA 2PEYA 2Y9MB 4RLHA 1LLFA 5DK6A 1M34B 3KD3A 4MR8B 2Q62A 1GNSA 1C80A 1U7XA 4ZCMA 2P4HX 2WR8A 4AYWA 1NQ5A 3JQCA 2OFFA 5AHXA 1G3QA 1GQRA 2NIPA 2OM2A 3I9JA 4LBYA 4INAA 4DNOA 1Q7TA 1DV1A 4QRDA 4E07A 5HKOA 2FX3A 4ATNA 1QG0A 1F17A 4Y9SA 3KQKA 3HUEA 1EWVA 1TZJA 2QTAA 2BGLA 2X0RA 4HDMB 2O3UA 3HBLA 2QMEA 3SI7A 2HRDA 3GXBA 2JHGA 4P84A 4R71A 3MRSA 4D4GA 1U7ZA 3IUJA 2A9PA 3UPUA 3H65A 5EJIA 4Q4AB 2POCA 3WHLA 2QTMA 1N9KA 3B1ZA 2ZJAA 2EZTA 3Q98A 1YQUA 4HDSB 1CPYA 4R0VA 3SHTA 2Z6QA 5DB4A 1UT8A 3OE4A 1SUBA 4GQIA 5A4MS 3S8YA 1CETA 1XZBA 4KQ9A 2I4OA 2FW6A 3JQFA 5T4BA 5EIWA 4BAUA 4FN5A 3PPIA 3VO9A 1X1AA 4EP1A 4QGSA 1LQTA 4H1VA 2DPGA 2QE7A 3QKUA 1E58A 2ZTVA 4X1OA 3H2SA 1XF1A 3LQ4A 4J4HA 3ZOKA 3OZGA 4YB8A 3GLIE 1WKCA 4LE1A 1T10A 4WUTA 2PMEA 5FLKA 2EQBA 5I47A 2VHCA 1YVUA 5CJ2A 2BFEA 3ZX5A 3F47A 1QP8A 2MT9A 3L6OO 2FKAA 3PUZA 3RUDA 1PGPA 1PJZA 2V8OA 2O3RA 1JEQA 2J59A 2PV0A 2ANBA 3E4DA 4HGNA 1OH5A 4G9GA 4NSNA 1P77A 3EPRA 4PRKA 5C7LO 3E7WA 3E9EA 2QYHA 2FW0A 3OUZA 3CX7A 4JUAA 3AEYA 3BGSA 1NVTA 2C9ZA 1U4NA 3GRFA 3K92A 2OBYA 4HWGA 4M1YA 1VL2A 4MLCA 5GWXA 3ZDBA 4TKVB 4FT4A 1NUSA 5DLEA 1H23A 1NR7A 4L4RA 1LFDB 5EIAA 5IXYA 3L1JA 5JO0A 2XDAA 5CDTA 1QYCA 1FYFA <