3UXMA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
206
structure length
197
Chain Sequence
GLFVTLEGPEGTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 77
structure length 197
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uxmA00
3OHMA 3IBYA 1PVOA 3FHTA 4ZDJA 1S9DA 1Q21A 4LRWA 3CM0A 1YR8A 4IDNA 4B73A 2PZEA 3T5GA 4LBVA 5G3YA 1FP6A 1G20E 2LKCA 4AK9A 2ZUCA 2CBZA 2E9SA 2QENA 4HATA 4IFEA 4M0LA 3W90A 4QBGB 2YNMA 4ZDKA 1K5GA 4A1FA 1E2QA 1OYYA 2B21A 4TSFA 4D0GA 5TV2A 4KBGA 3IHWA 1E2LA 2BEJA 2QZ4A 1XEWY 1GAJA 4S2EA 2IF0A 1KZGB 2IT1A 4DCSA 3WMGA 2OHFA 2R6CA 4QM7A 1UKYA 4YMUA 3KJEA 3LQRA 4OK3A 2ODNA 2BKUA 1IM2A 1KK0A 1ZU5A 5F2EA 3QJYA 3ZIAA 2WICA 5H70A 3UMFA 1H8EA 5C46F 4CEHA 3C8UA 1GP2A 1E2KA 1QHIA 5DI9A 4C2TA 1XMSA 4JKIA 3GLGA 1OE0A 1KI6B 4WXRA 5AUNB 2OAQ1 3ETLA 2JIZA 4YQFA 4RZXA 4KCGA 4XIGS 2GRJA 5FPYA 1XX6A 1W5TA 4PPQA 3RVBA 3GLHB 4RFSA 2IYUA 2ZRNA 2BVNA 3JZAA 2MSCB 5C2JB 4UXJA 5FI0B 5J4VA 4JLNA 4KVAA 5KTYA 4LHYA 5DHFA 3Q72A 4URYR 4DUGA 2ZRAA 3I5XA 2QP9X 1U81A 2CMKA 2WZQA 2YV5A 1Q3TA 3WHLA 5J4KA 2VLIA 3DMNA 2QTHA 3KTAB 4LOAA 3W34A 1XRJA 3AGQA 3WHKA 1Z06A 3I61A 3KB1A 4Q18A 4ILEA 4Z51A 1G8PA 4A15A 1Q12A 2IS1A 3L0IB 2A5GA 3WRYC 3FKSD 3QE0A 3VR4A 4ZKDA 2GXQA 4JLVA 4MRVA 5AUQA 3U61B 3RS5A 1S8FA 4QC2A 2BJWA 2NZJA 3PITA 4HAYA 1ZP6A 1ZM2A 2N1BA 4WW0A 2BM0A 1SVIA 1SXJD 3RNLA 2PBRA 1B23P 5KSZA 4G5OA 4ZCIA 3QKRA 1OB5A 1VMAA 4KAXA 1V5WA 2HYDA 1L4YA 4N0DA 2ONKA 1JEEA 1PLKA 2HF8A 1N6HA 2G1JA 1T6NA 1VCNA 1DAHA 2FN4A 5JECA 3OIUA 4C2UA 2JLYA 1GFIA 1XBTA 4QBIA 4AURA 2ZR9A 2G6BA 3Q5DA 3B6EA 2V7QD 1IN8A 1EK0A 3NC1C 3ZLJA 1G3IA 5M04A 2NGRA 1QG2A 1MRNA 3MFYA 4CIDA 1W2HA 2ZR0A 5JI2E 4PQFA 2CJWB 4Q4AB 4DB4A 1XPOA 1E2IA 1E3MA 1Z0DA 4GOJA 1G3UA 2CVHA 1OT3A 1NG9A 2PZFA 3RS0A 1OH5A 4LJ6A 4A8JC 2I4IA 4HAXA 1Z0KA 4HUQB 4E5UA 1KI3A 5KPJA 3NEYA 1E1QA 2OT3B 4JSYA 3QF4B 4DT1B 1VKJA 4HZUA 5HR5A 4M1YA 1QHHA 1CJTC 1OIVA 5BN4A 1DADA 4HDCA 1E0KA 5FTKA 1MT0A 1NL3A 1IN7A 2A5FA 2WWYA 3FOZA 4WXPA 3CH5A 4D2IA 4C0BA 4I1UA 4QGAA 2XZOA 2XSZD 2QI9C 3L8YA 4RFVA 1KIMA 3BD9A 5HTKA 3IQXA 1OW3B 3GLIE 2GBLC 1LB1B 5FR1A 3X1XA 4JLKA 3HR8A 4UJ5A 3L2OB 3B78A 1MO4A 2VP2A 1U0JA 5FOSA 1G19A 2IWRA 4ABYA 4N3NA 1SXJE 2Z6VA 1GKYA 3WBJA 4LHXA 3TH5A 4G3XA 1E9DA 3KQLA 4C0SA 2FV8A 2FG5A 5K8UA 3AP1A 4JJKA 5FOWA 3RSOA 3WYFA 3N2EA 5FPKA 3P20A 3T15A 3AUYA 2AK3A 4IW3B 4TLBA 4YXWD 1IOZA 1JI0A 2O0KA 1YR9A 4B34A 3QSYA 4A0RA 4QKQA 4F7WA 4M9QA 2O8FA 4N1AA 1N3BA 2G9NA 2W2XA 3KQKA 4DCTA 2AL7A 5AJWA 4M21A 2QRZA 5A0FA 1JNYA 3MWYW 4TT3D 5E7MA 5EP3A 4C9BA 2EWVA 2FEOA 4MQBA 5IT5A 4DLRA 3A1WA 2BOVA 4Q66C 1H65A 2ORWA 2ZE6A 1ESMA 5AJZA 1Z2AA 2ATXA 2A5DA 4LCBA 4DSNA 3FMOB 4RD2A 2GNOA 2QBYA 5JEDA 4R9UC 4TLEA 1NN0A 3GLIA 5FUYA 1P3JA 1TPZA 3AF4A 2XGJA 1KZ7B 5JS8A 1Q1ZA 1GG2A 1SXJA 5CIWA 1D9ZA 2VRWA 3SZRA 2J0UA 2GCNA 5LD2C 1KTVA 4B44A 2QUZA 2RHMA 2A78A 3CNNA 1CJMA 4NZYA 2A9KA 3REFA 4EPRA 1HH4A 4LJ5A 2ZQ5A 3QBTA 1R5OA 1NP6A 3FB4A 1AGRA 1DO2A 2B8TA 2GTPA 2A3RA 5JWOA 2GF0A 1RJ9A 5B64A 4BLTA 2FEMA 2FZ4A 2YOGA 4ZIRA 4XWAA 1X8KA 1Q22A 4Q1FA 2ZRKA 1Z8FA 1KDPA 1ZD1A 4Q9JA 1OPXA 4DSTA 3PEUA 1ESNA 3DEFA 1OHHA 3TAUA 5CM8B 2Q3HA 3HR7A 4ZV4A 5JSZB 3VKGA 2AD5A 2EFHB 2OV2A 4RZ3A 2X77A 2FOLA 3EC1A 5JWHA 4AIIA 2CE2X 2NO7A 4CGZA 2ZUDA 3KZ1E 3C5CA 5IK2D 2WWWA 2HUPA 4OQLA 5J5CA 1E4YA 3KFXA 1EFHA 3ZH9B 4CEIA 2ZSFA 1UPTA 2OXCA 5TMPA 4XSHA 2O5VA 4IXMA 2IXFA 4PZZA 1KNXA 4B3CA 1E9RA 1YRAA 1ZC4A 1ZCBA 1S4QA 2IYYA 3L43A 4MYTA 2HXSA 1KSFX 5EE5B 3A1TA 2F6RA 5D3QA 4AC9A 3KUCA 1AQUA 2XSZA 3LBNA 2VO1A 4Q1EA 2ZRMA 3LY5A 3UG7A 3K0AA 2H8KA 3BBPA 3TSWA 3ZVRA 1S2MA 1E2DA 1RE0A 4BFTA 2VTKA 2CCJA 4OJQA 1IJFA 1MO3A 5EE9A 3KJGA 3A1UA 3KB2A 1WP9A 4JIMA 3KKMA 2C9CA 3W6OA 2J87A 2QT1A 4A2PA 2NO0A 2OG2A 4CZ2A 4C0LA 1U8AA 3I3SR 2NO9A 5DN6A 4B48A 1E2JA 1DAFA 3ADKA 3LX5A 3HYTA 721PA 3Q9LA 2OXRA 1R0XA 2CHVA 2ZYUX 4YXWA 5EUQB 1MRSA 3PR1A 4DCVA 3AP3A 1TTTA 4QJ4A 2PX0A 2QGZA 3Q5EA 3NHBA 3QXCA 1R0WA 3PEVA 5BN3A 2FPKA 3O8CA 4HAVA 2YZ2A 4O0MA 4Q7KA 2AHOA 3MUFA 3THOA 1Q1QA 4LJYA 1OFUX 2CLDX 2IWHA 3C16C 3VR1A 4PTLA 1NLYA 3GJ3A 4B2LA 4KODA 3QG1A 4OJKA 1G18A 3GJ0A 2FPLA 4BFXA 4ESHA 2IUSA 3CBQA 4JVLA 1O87A 4QNRA 2DWPA 4TMWA 1KOFA 4CEHB 1G41A 3K9NA 5CJ2A 2QP4A 3U7EB 2J0QA 2FSIA 2AWNA 4DSUA 4Q4JA 5DYIA 3K0SA 4DIEA 4EJSC 1OXXK 4HYYA 1TX4B 421PA 3JVVA 4PPGA 1NG1A 4X8LA 1OIXA 3TUJC 2GJ8A 1PLJA 1E9SA 2ZETA 1P2VA 4CEJA 2VP5A 4RFSB 5AUOB 2YYZA 4ZO4A 1ZYUA 3ND8A 4PHHA 3MD0A 3I8XA 1US8A 3WBKA 3MAAC 5J47A 4OKSA 1KSHA 3GQBA 4P0TA 4UQOA 3SJBA 1G7CA 1R2QA 821PA 4PC2A 2OBMA 2AN9A 1AKEA 1LNZA 4QM6A 1UM8A 3NDBB 3EARA 3BOSA 1VDZA 1ELOA 3B85A 1I2DA 4HSEA 4GMXA 2QROA 1WXQA 2WKQA 3C4JA 1ETUA 3CPHA 3R20A 1F2TA 5KNDA 3B13B 3SU8A 4WZ6A 2XAUA 5CYOA 3SFZA 2F1RA 5DO9A 2ERXA 4FMDF 4NCNA 2K5UA 3DM5A 4HLCA 5FUXA 4PC7A 5IK2A 4UXIA 5JZVA 2RAPA 1Q1EA 3N2IA 2R6FA 4DBLC 2RHDA 3B1VA 1EX7A 1I4DD 1E2FA 2IEYA 2Q3MA 3KXIA 3QKRB 4GOXA 2FU5C 4E22A 3TRFA 1NMXA 1Z63A 2HYIC 1ZM3A 2ZIAA 4LC0A 4W7SA 3T35A 4C0AC 5SZJA 4EPVA 1FPMA 5KO2A 2X2EA 5KDLA 4TTPA 4EQ6A 3CNOA 4JZKA 5IF9A 1FX0A 1NLFA 5FBQB 4ESVA 3WNBA 2XTZA 2OFXA 3B8HA 4QXAA 3K0CC 4YMVA 1N6KA 2XZLA 2VF7A 2WBLC 1DPFA 2HXYA 1QVAA 2RGNA 2YKGA 1F2UB 5H1YA 5DYGA 3TUZC 4L8GA 4JLDA 2BCGY 4FN5A 4IDOA 4BZQA 1CU1A 4GP6A 5J4HA 2IK8A 3P26A 1Z83A 2GVZC 3ADDA 5B57C 3R8FA 2XXAA 1WBBA 3DZDA 4KHZA 1S1MA 3Q85A 4OHWA 1VCIA 3QKTA 5FTMA 5HPYB 4HZUB 2JLRA 3RLFA 4ZDIA 2ZREA 4YMTA 1QHHB 4KJZA 1AKYA 1VTKA 3KKOA 1VPLA 4QHYA 4O25A 2CK3D 4PPNA 4DLVA 1KKMA 1NMZA 4W9MC 4NYMR 2RGGA 4G5QA 2H16A 1G8HA 3LD9A 5JJLA 1E94E 1RYFA 4G5SA 3RWOA 3ZS9A 3ND9A 4UKDA 5JFGA 2ZS7A 2FSHA 1KHTA 5JBQA 2XNDD 1K6MA 1T3SA 2P6NA 3K09C 1YZKA 1DO0A 1CR2A 3EX7C 3HWSA 4P32A 1BIFA 2YJTD 3TR0A 3ZJYA 4RKFA 5LDDC 4P4TA 1AZSC 1G3QA 1WMSA 4I4LA 3VAAA 4DKXA 4KFTA 5JMTA 2O8FB 1GRRA 2FPMA 2RCNA 1F6BA 2P5TB 4LV8B 4Q03A 2F3TA 1KJZA 2PLFA 3QENA 4QGFA 3CPEA 4C0KA 4URVR 1WQ1R 4GFDA 4LJ4A 1OFIA 1NKSA 4CRWB 3VQTA 3PCRB 5FOUA 1GL7A 3BAFA 2ORIA 1VECA 4MGIR 4D80A 2WM9B 2PH1A 1TUEA 4YLGA 3EZ9A 2P5SA 3J81k 1CR1A 2QBYB 4BQSA 4LJAA 4TL9A 2BCJQ 2GK7A 1P72A 3UWOA 3GLIB 3U60B 3I72A 4B3FX 2OO7A 3GJ7A 2P67A 2XZPA 4B74A 3A37A 3HU2A 1SXJB 3LVQE 5KPDA 4O2LA 1M7HA 1E2NA 4YONB 1GM5A 2QPAA 4Q9IA 2J0UB 4DHEA 4E03A 5FPTA 1G9XA 5HCIA 1NN5A 1ANKA 1C1YA 4JLOA 2ZJ8A 3DO6A 4KI0A 4E09A 3W3ZB 1G1MA 1T4GA 4M1WA 4A9AA 4RSGA 1FP7A 1KDOA 2OM2A 4X8HA 1HT1E 2R6GA 3A4LA 3FTQA 4F4JA 2OESA 2WIAA 3EG5A 5CK4A 1T9HA 1NVVQ 3AVPA 4TL8A 5JWRA 2H5EA 1QHSA 2D3WA 4OHYA 3WNCA 2ZVPX 3BB3A 3G5UA 2WKRA 2AWOA 2QQ0A 2JASA 2P6RA 2FFQA 1HQCA 2J46A 2WJGA 3AKYA 4WOPA 1F3OA 2ORVA 3NBFA 4C3ZA 2C9YA 1E9FA 1D9XA 5B58C 3EZ2A 1N5IA 2NIPA 2JATA 5JI3E 1CJUC 4TMTA 3FHOA 4BRWA 1VG1A 4CVNA 3SQXA 1XMVA 1OXTA 4UNQA 5LPNA 2VSXA 4C4PA 3KQHA 3HPQA 3KQNA 2O8CA 1W46A 1YZQA 4MKFA 4PHTA 2WTUA 1YZNA 1NJGA 3EPJA 1OH7A 2Y8EA 1P9RA 4M8NE 4EPWA 4NHOA 3OEED 3RS2A 3WRXC 2EQBA 3T5DA 4Z54A 2EFCB 4R2IA 1AA9A 2CK3A 2F1HA 1TL7C 4OYHA 5EE3A 4DXAA 4Q1BA 2VH5R 1HUQA 3TQFA 4DUGD 5A5GA 1HV8A 5EXPA 5IRCD 4DLYA 1DAIA 4ZDWA 4BLRA 4HB2A 4LHVA 3AVYA 2AXNA 4OK5A 2PEYA 2ZS9A 4OI1A 2ZJBA 4G0NA 2Z4SA 2FJUA 4GI7A 3THYB 3QF7A 4BEBA 3LBIA 1E0AA 1DEKA 1S0UA 4HDOB 5DIFA 3MCAA 3SJZA 2OUKA 4LYJA 1E2GA 2QPOA 1GUAA 2FFBA 4IDHA 3ONWA 1W2GA 4I99A 4KFUA 1TUIA 2CL0X 5EZ6B 4B47A 1KK2A 2EU8A 4AYWA 4WZAE 3K53A 2C77A 2ZSBA 1G64A 4KSCA 4NU0A 3EZFA 5LB4A 3T06B 1TEXA 3ZGXA 2O8BA 3AQ4A 5CJPA 4DJTA 2XITA 4GT1A 3SOPA 1CKEA 3LO5A 3QKSA 4URZR 5BYKA 5D3MA 4DLSA 3PENA 5TDHA 1L2TA 1U0LA 3T34A 1Z0AA 4F93B 2RB4A 3U3JA 2AR7A 5KSPA 3WYAA 5GJCA 2PT5A 3MWKA 1KKLA 1ZNYA 3ZQJA 4C0HA 4BECA 4FINA 4XOIA 2B6HA 4JLMA 4M9XA 2QQEA 3CNLA 1SVKA 4EPXA 3H86A 4JYCA 4URUR 4Q4JB 4DVGA 3FMFA 3BC1A 4IOJA 2Z0MA 5SZKB 4MA4A 1IQPA 1TADA 2C96A 4NYMQ 3PFIA 3LX8A 4GRAA 2FSGA 1LF5A 4US2R 1P9WA 3VMFA 1D5CA 2WOJA 2C9OA 3AH8A 2ZI3A 3UKDA 1E2MA 2KBFA 1US8B 5B30A 1KSJA 1E1QD 2ZAMA 4NCKA 4NCHA 1E4VA 1SULA 3B82A 4DLZA 1ZD9A 4OQMA 2CEAA 1M7GA 1UBCA 2BKEA 2P3SA 1ZU4A 1CR0A 3QQ5A 2DB3A 2ZRBA 2YHSA 2P65A 3IKJA 2R62A 4DDVA 3WXMA 3IPXA 1PZNA 4AY2A 4UNNA 3P1JA 3THWA 4JL8A 3AVWA 1TF2A 1Z6GA 2O0HA 2QN6A 2DFNA 1KJYA 2GXUA 2HCBA 2IYLD 2XNSA 3I92A 4PO8A 3QNUA 4IOKA 2YOFA 2ZITA 4LY6A 4PAOA 4WIAA 1VHTA 5EP4A 1UDWA 3AF1A 3ICEA 1IY0A 2YC2C 2DWQA 5AWFC 2QL6A 2REOA 1R6BX 1XP8A 3LXRA 4KFRA 3BH7A 2AX4A 2W6JD 5KDOA 2DY1A 4LYHA 3RC3A 3OEEA 3FPAA 1VIYA 4MKGA 4H1UA 5CIQA 5FUWA 2FH5B 4M4SA 4IXNA 5KHOC 1YQTA 1GRQA 2Q3FA 3TE6A 4A8JA 2P6UA 4KV9A 4XVQA 4BASA 4EQ6B 1XJCA 521PA 3K70C 3CRQA 1AZTA 1FX0B 2F9MA 5H68A 1MR3F 3GPLA 4Q4LA 4TMVA 3TJZA 1TEVA 2ZI5A 5FI1B 3VKWA 5GADl 1XWIA 2NTYC 2GCOA 4E07A 5L3RA 2VP0A 2IC5A 2W2VA 3L82B 4LI0A 5IHPA 2HLDD 2ZI4A 3ECCA 1TF5A 2ANBA 1G7RA 3SYNA 4QG7A 2C5LA 5DGXA 2ODEA 2G3YA 2QMUA 2GBLA 1IBRA 2XXAB 5KU1A 3BB4A 3CB4A 5EXXA 2D2EA 4D4MA 4Q02A 1D2EA 2VF8A 2WAXA 3A4MA 4OHXA 3AVUA 2OCAA 3R9WA 3UXMA 4FWIB 1Z6YA 1I4TD 1SKYB 1FL9A 2C03A 1EFCA 3CUEF 3FVQA 4TN1A 4U5XA 2GWHA 4MKHA 2EFDB 4PO9A 4Q00A 3WY9A 2O8DB 2F1IA 1XXHE 2WWXA 4JKYA 2Q9AA 2Q9CA 3OIWA 2BBWA 1JB1A 1UKVY 1OKKD 4CYMA 1RFLA 2OE2A 3TSZA 3M1IA 5L3QB 3C7KA 1OXSC 1G8GA 3TQCA 3WMEA 2FMXA 3AVOA 1S3SA 4Q9LA 4JVMA 3OAAA 4Y0AA 1DAMA 3LBHA 1L7VC 4XVUA 1DELA 2WWHA 3CF6R 1E0JA 1PJRA 3U2QA 1FW6A 4Q4HB 3GEEA 4PXAA 1OHHD 1TQ6A 5SZIA 2OZEA 1CJKC 4RZUA 3LQQA 3NH6A 4O2RA 4KU4A 4HLDA 1DE0A 2WSSA 1TF7A 5JS7A 4HZIA 2ODBA 2VHJA 1P9NA 2CLSA 1XDBA 1XD8A 3IPYA 3HDTA 2G83A 2XB2A 1KSGA 2JA1A 3PXGA 2EFEB 5BWMA 2XB4A 1VYVA 5FBVB 1BOFA 3WYGA 2IBMA 1KAGA 4BLQA 4Q7MB 3LVRE 2ZUBA 4D82A 4I1SA 1A2BA 3TGPA 3O8RA 1U98A 1ZW6A 3U44A 4JLJA 1XXHA 1IY1A 2J0VA 3BH6A 2IS4A 3LV8A 3QKUA 4DIDA 2QY9A 1QHXA 3LXXA 2FX3A 4IVPA 1LY1A 5EQTA 2D62A 2C8VA 2WJVA 5DN6D 3LWNA 3UWKA 5BYJA 4D0NA 2CCKA 3KXKA 2UZ3A 3CIOA 2F9LA 2W6JA 3ADCA 4GNKA 3GLFE 1FZQA 1KO4A 3HPRA 4QL3A 3SYKA 4TYYA 3OESA 2PL3A 1TQ2A 1XNJA 3EWAA 3IHLA 2QMEA 1J8YF 3C15C 4PQRA 4BGDA 5FTLA 1Q3HA 3MRSA 3K9GA 2YWHA 1FUUA 1UADA 1KI1A 5EXSA 1OXUA 1LS6A 5CB6A 4U02A 4HAWA 5FOXA 1NVXQ 1XZQA 3SJAA 2PJRA 1CR4A 2ZI6A 4PX9A 4TYNA 4RD4A 3GD7A 4G5GA 4HUTA 4Z1MD 2HLDA 4HAZA 3AKCA 4HB4A 3LDAA 2QSYA 4NDZA 5TARA 3U4QA 3CX6A 4QGGA 1JR6A 4B2IA 4YMSA 2HDNB 3B1ZA 4V0ME 3CX7A 3CZPA 2DCUA 2J45A 1E6CA 2O8CB 3RC8A 4TZ6A 2ZYWX 1X6VA 5J4LA 1YZUA 3P27A 3U3OA 1XJ0A 3SQWA 1XEXA 2WWFA 1CULC 4JVSB 3AF0A 3V4FA 8OHMA 1G5TA 2GZAA 1G6HA 1CXZA 3VU9A 2HJVA 2H18A 3GLFA 1KMHA 5EJEA 1W4BA 4S35A 2X8AA 2N42A 2KBEA 3T61A 1OKKA 1VCMA 1IAQA 1IN5A 4GDFA 3D6TB 4WVFA 1J70A 2QG6A 2QAGB 1UKZA 1EG7A 2PJZA 2J5XA 1XB2A 2Q9BA 4WZBE 4MYHA 2IYQA 1WE2A 2KSQA 2PT7A 1E69A 1P2SA 4KO8A 3UANA 2GILA 2G77B 3B9QA 2VP4A 5FL7A 2WHXA 1JQLB 2ASEA 1PUIA 3L0SA 3FE2A 1HURA 2Q6TA 5KNBA 3A8TA 3QVVA 4HB0A 1W0JD 4L5BA 3RS3A 3NBXX 3LAWA 1GKIA 2VL7A 4I1OA 4OHZA 5AR1A 1J2JA 1HE8B 1KDTA 4OQFA 2IX3A 2ZXUA 3TMKA 4EJSA 4C7OA 3A4NA 4HLQB 1R5NA 1XPRA 2DHRA 2CHQA 1P60A 2RGDA 3QKSB 5D3MB 1W36C 1Q57A 4LUCA 2BDTA 3ZQ6A 3UMRA 4B76A 3AGPA 2D06A 4GZLA 4P3YA 3FMPB 5E95A 2ATVA 3DVLA 2VEDA 4OBEA 4BFYA 5HCNA 2FGJA 3TVDA 2JAQA 2ZM5A 1ZM9A 1N25A 4DLWA 2YWGA 2VPPA 2F43A 3KXLA 4B75A 4JSTA 5DHAA 5B2ZA 3S1AA 4HI0E 3X1WA 2GJKA 3KKNA 1E79A 3F8TA 2FA9A 4FXPA 3CWQA 4Q5IA 2IYXA 4A0HA 1M34E 5AJVB 1N2CE 4KYUA 1XCGB 3LNCA 5KDDA 2MMCA 3CF2A 5AJYA 2R6AA 1KJWA 3KQUA 2ZRJA 4RD3A 2IF2A 2RKOA 2I1VB 2GEVA 5DI3A 1DVRA 3SBEA 1W4CA 2R9VA 4DDWA 2TMKA 4EPYA 3BE4A 2VIIA 4URXR 4FMBB 3Q8XB 1QZXA 3VX3A 1DG3A 1UEJA 1FTSA 1FMJA 3L0OA 1Q44A 3F3YA 4GPTA 1IXSB 2ZRGA 1W7AA 2ZRLA 3THWB 4GP7A 1G8YA 3QXHA 3FYHA 4CDGA 2R65A 3P32A 2Q21A 4Z1MA 3Q7PA 1XCPA 1N0VC 5FTJA 2J3EA 3GLGB 1BH2A 2A5JA 2CCGA 3K0CA 3VHXA 3ZZTA 3KL4A 3V00A 3K1JA 3B1YA 2ZSDA 4D26A 4D25A 1UAAA 1S96A 4IOMA 1KI8A 4MDFA 4FIDA 3E70C 3TLXA 1ZNXA 5DLQC 4X8MA 1D8TA 3ZVNA 2QMOA 2RGEA 2JLVA 2NQ2C 3GEHA 2IHBA 4HB3A 4LPSA 1IN6A 1SGWA 2PCLA 1KMQA 4Q21A 2HT1A 2DWOA 1OSNA 4POAA 2IUUA 4BFVA 1P62B 3DZ8A 1Z22A 2NPIA 1J99A 3GLHE 4F38A 1KI4A 4NYJR 1W47A 2GCOB 4B2PA 1SZPA 2QTVB 4PSKA 4K46A 3GJ8A 3DM9B 3NDPA 2F7SA 1GKUB 1N0UA 2V54A 2IUTA 3EIEA 1L4UA 1W0JA 4IDPA 2WOOA 1P2TA 4BFSA 1QF9A 1XMJA 1DAKA 1UEIA 1BYIA 1CBUA 1M8PA 3BXZA 1XEFA 2ZE7A 5F3WB 1N5KA 1T3HA 2JCSA 5FBWB 1LS1A 4Q7JB 3W9YA 3PEYA 1YVDA 5BQ5A 2RMKA 4JJZA 1FNMA 3K09A 1XJQA 4PFSA 2ZAOA 3B5JA 1XD9A 2GETA 3A36A 1OF1A 3VR3A 4C0QC 1HA3A 1TU3A 3I32A 4DLUA 1G5PA 1KNQA 1LF0A 4LK2A 4Q47A 5EUMA 5E3HA 1KI6A 2C99A 3UMSA 5ANRB 4KITB 1KI7A 4A82A 2OBNA 1A5TA 1FFHA 5EZ5A 4IRUB 4XWKA 1WBDA 1W44A 2V9PA 4AD8A 1OV4A 3I62A 3GLHA 121PA 3VTKA 1IONA 1TNDA 5JCZA 1UF9A 1Z47A 2P2LA 3U3RA 2CL6X 3QXSA 3QPVA 1E9BA 1G7TA 1T3LA 2UVQA 1BO6A 1NN3A 3HJNA 2JJ8A 1HYQA 2D2FA 2RGAA 3KTAA 2YWFA 2DR3A 5HZKA 1NY5A 1GL6A 3MG9A 2JLZA 1OIWA 1YZTA 4RCYA 2ZSEA 2PLRA 3UIEA 1GNPA 1YZGA 1IXRC 2YWEA 3CRW1 2GA8A 1PV4A 5LD2B 2G88A 4JLBA 5FPHA 1BMFA 2OCBA 4GOKA 2B7CA 3NH9A 3Q7QA 4W5HA 4HDQB 5KOYA 1HQYE 2O52A 2IYRA 3PVSA 3QPUA 4GL2A 2AKYA 3CRMA 2F55A 1AQYA 1DOAA 3AVQA 2EYUA 3BGWA 3SDZA 4A6XA 4LYAA 3VX4A 1E9EA 2BIFA 2HV8A 1G4AE 4JBYA 4EFMA 2QE7D 4AG6A 2CVFA 2ZE5A 1OXVA 1Z0FA 2H57A 3D3QA 3EA0A 4NONA 4MGKR 3UG6A 3RS7A 1R0YA 1U90A 3U5ZB 2PMDA 1XF9A 3PG5A 1A82A 2C2HA 4HEJA 5JHGB 1VHLA 2ERYA 3ASYA 4LV5B 4D4LA 1R0ZA 1JXMA 1KGDA 1R7RA 3QPWA 4V02A 4Z8XA 1Z3IX 3M4YA 4Q4AA 1ZC3A 2VHCA 2F3RA 1AS0A 1OH8A 5CLQA 1UJ2A 1VCOA 1FQKA 5FOTA 1VG0B 5DNYB 2C98A 1U9IC 2DFTA 1NVUQ 1W0KD 5DH9A 3K70D 3FMIA 3U4QB 4D4JA 4EPTA 1HTWA 3IIMA 1CF4A 4DT1A 3A6PC 2W6IA 1UFQA 2ZTSA 3VNUA 3GCGA 2BMJA 2PCJA 3DKPA 4K81B 4GZMA 2WPDD 4B6EA 1J90A 3U7FB 1XTQA 4RY2A 1XEXB 3ZS8A 2BM1A 4QNMA 4TTRA 4F91B 1G16A 3QVUA 3RRNA 3VU9B 3BFKA 2J1LA 1Q1BA 4B71A 3GLFB 4NPHA 3THXA 3EA5A 1C4OA 5CM9C 1G17A 2ZJ2A 3NHAA 4MUBA 2BWJA 4Q1AA 1XPUA 4TL6A 4M1TA 4RJLA 1Z08A 2CNWD 1U2RA 2FFAA 1GTVA 3WNDA 1RJ9B 4UNSA 2FFHA 3DMDA 3QOFA 1R5BA 4ZIRB 3W5JA 2VHQA 1UDXA 1EFRD 2QSZA 1ZJ6A 3U6KA 5FL3A 1LW7A 4V0NA 3RRZA 3Q3JB 4PSVA 4NCIA 1E1RD 3IGFA 2YVUA 3EASA 1U0HC 2PEZA 4R7ZA 1Y3AA 2W0SA 1KO7A 4GMDA 4AYXA 4A36A 3KX2A 3NTUA 4II7A 5EE0A 3VFDA 3MGCA 4Z8YA 5C1BA 3SR0A 4Q1CA 5UKDA 3FWYA 2J0SA 1KO5A 4JBXA 1NBMD 2OSBA 4NYJQ 2XJ9A 2ZVQX 1RYHA 4CEIB 1L8QA 1WA5A 3I8SA 2D74A 3QEOA 2IYVA 3CRRA 3WP0A 4EJSB 2IS6A 1XTRA 5L3SA 2C78A 2ZS8A 4U00A 3AVXA 1CS4C 1AIPA 2DFLA 1WCV1 4RD1A 1R4AA 4TLAA 4EFLA 3L0PA 3IO3A 4FW9A 3QBVA 4EFNA 3IEUA 5E7IA 4MGZR 4ACAA 2GAOA 3K0AB 2D7DA 3IIKA 4QJ3A 1ZVQA 4LHWA 5GJWC 4YDHB 1S3GA 3GJXC 1P61B 1RIFA 1P2UA 1EFUA 4N0EA 4ON9A 2OLKA 1AK2A 2WSMA 3HP1A 1OH6A 4LJ8A 4FWTA 2A5YB 1YJ5A 3FDIA 3OE7D 4QBHA 1DAGA 2NPFA 4EAQA 4UXHA 1JXOA 3MMPA 4KXFB 2G1KA 1YZLA 2XTMA 2QE7A 5EE1A 1JAHA 1X3SA 2B8WA 2IXGA 3IIJA 3W8NA 3AVTA 1GRNA 1KK3A 4M1SA 2HCJB 4NL4H 2QNRA 4DEXA 2BMDA 2OBLA 2WIBA 2YINC 2AXPA 3EIQA 3GFOA 3B2EA 3MJRA 3RDPA 1ZCAA 3WP1B 5CDFE 1RRPA 2MMGA 3B1WA 5HZHA 3LRPA 5HE9A 1YE8A 3TBKA 1RPZA 1T0JB 4DB2A 2ZR7A 2W00A 2VP6A 4K8OA 2BMEA 4NE2A 1NI3A 4NBSA 4A4DA 3RANA 3BH0A 1EXMA 3X1YA 4XTCS 2WAYA 3IO5A 4JL5A 2QM7A 2B7BA 1CRQA 1XEWX 4EUNA 1J8MF 1Q0UA 3BB1A 2J7PA 3LH5A 2NG1A 3A58B 1ZUIA 3JVUA 1W0KA 3C5HA 3R8CA 3NBYC 1NBME 2V6IA 1M6NA 1QHGA 2V4ZA 4EIWA 2PZGA 1T0HB 3GJ6A 4Q48A 4V0LA 3RS4A 2P0EA 4B32A 5TVKA 3OAAD 1XD2A 2A7QA 2H7VA 3NKVA 4U7DA 1FMLA 3T1VA 3OEHD 2WPDA 4FCTA 2CDNA 3HYRA 4G5RA 1W4AA 4JLAA 2WJHA 2JLWA 1O3YA 3OFND 3SHWA 4WA7A 5FPSA 2ONJA 1IJEA 3QEJA 2W58A 5FBRB 4CEJB 1RZ3A 4PZYA 2JLSA 2WSSD 1YR7A 3VHLB 3RAPR 3ZDQA 2ZANA 3BS4A 2ZRCA 4PZLA 3REGA 4Q9HA 2JLQA 2O8EA 5E7JA 3VR2A 4GSYA 2BBOA 2CNWA 1YKSA 3DL0A 5CDFA 3RRMA 4AWXA 3DDCA 1NVWQ 5EP2A 4TYWA 1A7JA 3SEAA 1W5SA 4XSGA 1EFRA 2GVDC 2C95A 1DG1G 3I5YA 1ZUNB 1GVNB 1UBEA 5C4GB 3PQCA 1E1RA 1LV7A 4PO1A 5HE8A 4TYQA 1NY6A 1F2TB 3OZXA 1G3MA 4HLUC 2GJAA 2QRNA 2ZJOA 2QMHA 2GEDA 3AEZA 1OFHA 2QAGC 2ZYVX 1NBMA 4YDSA 3IQWA 5AJXA 3TSOA 1Z6XA 4OQXA 3W5IA 1GSIA 2C04A 4M1MA 1AN0A 3KKQA 1ZUHA 4Y0VA 1SVSA 1LTQA 2ZROA 1CEEA 3R9IA 2A30A 3TKLA 1JECA 4OHVA 1RW4A 2ZRPA 2PMKA 2VSFA 3IUYA 3H4MA 4B3GA 1XTJA 221PA 4TMKA 2JLXA 2RGBA 3SS8A 3AV0B 4B3DA 2JJ2D 3CF0A 4QGHA 1EX6A 2HF9A 2BBTA 1FOEB 4Q19A 1NN1A 1K8RA 1SVWA 4IEIA 4BPBA 4LYFA 2IYWA 4M1KA 4BEJA 2BJVA 1PLLA 3PUYA 2WMNB 1OLOA 3U3MA 3CR8A 3OE7A 1W36D 3BWDD 3CR7A 4RD0A 1N6IA 1NF3A 3KFVA 4AKHA 3D31A 3EWSA 2YOHA 3T12A 5FR2A 4A92A 1E9AA 1RRFA 1X1SA 4AG5A 5LBIA 3AF3A 2Z43A 5CITA 3SBDA 5FFMA 1GZSA 4B35A 4TQ9A 1JPJA 5K8LA 1JBKA 4PR0A 4IJMA 3I1FA 3I4LA 2GXSA 3OIVA 3U7GA 2NZ8A 4A0GA 1A2KC 3IILA 4C0JA 1E2EA 2W2TA 4IVQA 1M7BA 3CWZA 4URWR 1JPNA 1W1WA 3SNHA 4ITRC 4OI4A 3DHWC 4IHQA 2AK2A 1Q20A 1X1RA 2ZJZA 5K8TA 5JJIA 2E87A 4KBFA 1COWD 2WJJA 2ODWA 5ELXA 4NKRA 2ANCA 5BW8A 2LCFA 2E1RA 1M2OB 3LLUA 3RRYA 1Z6AA 1ZM4A 1F60A 2DFKB 4TL7A 1UBGA 3OIYA 3OEHA 4QRHA 4JVNA 4DCUA 3VKHA 1G7SA 4LJ7A 3OFNA 1UBFA 4PHFA 5FL7D 1AM4D 4FCVA 5DISB 5EXTA 1D6JA 5H8WA 5SZHB 2FGKA 3ZZ0A 2UKDA 1DTSA 3BORA 1N6NA 1CP2A 2R6DA 5FTNA 1I4LD 3MSXA 3QG5A 4CF7A 4IFBA 3PUWA 3TUIC 3JZMA 4KVGA 1KAOA 4PHGA 2ZJ5A 1AGPA 1E32A 3A1VA 4FMCB 4QOSA 4US0R 3TR5A 1N5JA 2IXEA 4RZ2A 1JAIA 4FMDB 1F2UA 3F5FA 4X8OA 4PPFA 2PX3A 1A4RA 1R10A 2GZDA 4EDHA 3TAHA 5GVSA 3W3AA 4PSAA 3NBZC 1ZMXA 2VBCA 2X1VA 2IYZA 3GMTA 3VR6A 1SVLA 4DDUA 4RD6A 5JEEA 1IHUA 1QHYA 2ZU6A 1Z0JA 2GXAA 5G3ZA 2L0XA 4NP6A 2Z4RA 4DRZA 1E79D 3U3KA 4LBWA 1P7CA 1II0A 3HU3A 2V1UA 2VHUA 4B6FA 1VIAA 1OYWA 2JGNA 2QA5A 3UPUA 4B33A 1UKEA 5JCPA 3CW2A 2NOAA 1LVGA 1RRCA 3EZ7A 3GFPA 4PC6A 2ZPTX 4NCJA 3X1ZA 4M22A 4UNPA 3THXB 2IYTA 1NSFA 2BBSA 4IKEA 4LBZA 1GL9B 4D81A 621PA 2RGXA 4L9WA 5CYPA 1GILA 2A2ZA 4L16A 3B7GA 1SQ5A 3AF2A 1PUJA 3VNVA 4XTRA 1Y63A 2JJ2A 2BV3A 4UNRA 3T1TA 3B9PA 4IOLA 3AM1A 3AKEA 4OK6A 3A1SA 3AUXA 2JEOA 2GHIA 3KJIA 4DZZA 1XU4A 1Z29A 1I2MA 4RKEA 4MGYR 3IEVA 1P73A 4KYIB 2UZIR 3H1TA 1XFAA 3TW8B 4WAUA 4V0KA 1S1CA 1KY3A 4P4SA 2GJ9A 5F9HA 2HT6A 2I1QA 4JS0A 1G21E 1KY2A 1FUKA 4J0QA 4BRUA 2QPTA 4XJXA 1ZNZA 1T5LA 1NSTA 4JMPA 5JRZA 2GCPA 1G4UR 4ACBA 4R2HA 3PIRA 4AKEA 1Z07A 4F4IA 2FDCA 4D0LB 5L3SB 1RVDA 5AK0A 4JT2A 4A0FA 2KE5A 1KO1A 1Z5ZA 1Z6TA 1NIPA 3FKSA 2GF9A 4C30A 5CB8A 5HKKD 1Z2CA 4PC3A 3V9PA 3AP2A 2OCYC 1XTSA 1COWA 2EW1A 4LSGA 4ZCLA 4XD7D 1N6LA 4BWYA 2Z83A 3TVTA 2W0MA 4ARZA 1E0SA 4A2QA 4LWZA 3G0HA 4P4UA 4Q9KA 3SHFA 4YMWA 2HEIA 2R44A 2EWWA 1B0UA 5CLLA 4W5JA 2EVWX 1II8A 3E5HA 5JLJA 1T91A 1X8LA 3KJHA 4M1OA 1TMKA 2D7CA 2H92A 4Q1DA 3R7WA 5JRJA 1P6XA 1W49A 3EPHA 1F48A 5BN5A 2QAJA 1ZBDA 2JLUA 2CE7A 2V7QA 4V03A 1T5IA 3D8BA 4I1VA 1P4SA 4M53A 1IY2A 4V0MA 4WBSA 2V8OA 2WWIA 2O8BB 3SYLA 3U6BA 2V1XA 2QM8A 3FFAA 1KO8A 2JJ1D 1BKDR 1RC8A 1NLZA 2WWGA 1E98A 3ZVLA 5C18A 4JT4A 3H0KA 4DLTA 1HE1C 2XTNA 1GOTA 1MH1A 5L8VA 4G1UC 4DDTA 2Z5FA 1N0WA 4TQUS 3NEJA 3QUSA 4R98A 1ZD8A 2ZI7A 2I3BA 4LGMA 4LHZA 2X2FA 3K70B 3H84A 1VYUA 1V43A 1T8UA 2OILA 2GZHA 5LB2A 3TW4A 1H8HD 1CLUA 4MRSA 1XD2B 1CJVC 2QEQA 2XEXA 2FSFA 3CZQA 3SI7A 3VR5A 4AI6A 4TYPA 1VYTA 2REXB 3GJ4A 1X8JA 2KB0A 2KJQA 5G40A 3CO5A 4JL6A 1JALA 1M74A 1WDTA 3FGNA 4TWZA 3K9LA 2ZRFA 2O8EB 1SXJC 4XH9B 1YU9A 1JJ7A 1OFTA 2GEUA 4V0OA 3EPLA 1E9CA 3THYA 1DAEA 2QP3A 4TQAA 5BXQC 1D2NA 2JDID 2DPXA 1HT2E 3G82C 3PJRA 1II9A 1BMFD 1G8FA 1KK1A 3ZD6A 1ONBA 3D7MA 4FCWA 4KLNA 4TZ0A 4LJ9A 4M9SA 4L15A 1OJLA 5E4FA 3W6NA 4OL0A 3NG1A 2OLJA 4MRRA 3L8ZA 2ZJYA 3T1OA 4H1VA 4JBWA 4TT3A 4B43A 2OEPA 1IN4A 1YR6A 4DWJA 3BIFA 1NIJA 1ZIPA 2BMFA 4KSBA 1XZPA 1ZNWA 4OI0A 3BJIC 4LPKA 4FD2A 1MABA 1F5NA 3UATA 1NRJB 5HKKA 3K0FA 3QXJA 4A8JB 5C4MA 1DARA 3MWLA 2H1LA 5FH9A 1XCMA 3O8DA 3W6PA 3FHCB 1RKBA 5KUTA 2NMVA 4XD7A 2ZEJA 3DOFA 3FFBA 4H9GA 5DSZA 1GIAA 4P31A 4G01B 1EESA 3TK1A 4AKGA 3EXAA 2FNAA 2QGNA 2V55B 3E2IA 4M2LA 3CPJB 5EP1A 1XTIA 2AD1A 1NVVR 1QRAA 5GJBA 2VA8A 2R8RA 4D6PA 1GDDA 2FWRA 1YRBA 4UJ3A 2V6JA 3CONA 2LKDA 4BZPA 3KKPA 4A6PA 5GVRA 2W6ID 4MYUA 5CK5A 5KSOA 4YC7A 3TNFA 3KUDA 1JJVA 5J40A 5L3VA 3RHFA 4JLPA 1E96A 3EIHA 1AS2A 3BFXA 1E99A 1SHKA 1R8QA 2JJ1A 3BK7A 3P4XA 4D4KA 2HJGA 5K8IA 4F92B 2V3CC 1TQ4A 2FF7A 1NJFA 4RVCA 3MLEA 4LZZA 2OFWA 2NO6A 2GDJA 3FKQA 1ZRHA 4BFZA 3EPKA 4FMCF 4NYIR 1E2HA 3NXSA 5J4YA 3IDQA 1JQJC 3WMFA 4MRPA 2ZI9A 1X86B 3W8RA 3CRVA 3CKLA 3PUVA 3LFUA 2CHGA 3CH4B 3RWMB 1H8HA 1SKYE 3PUZA 1S9HA 2ZSAA 5KSYA 1A1VA 1U8ZA 2G0NA 3QXXA 4CT4B 1N6PA 6Q21A 1MO5A 1QDEA 4A2WA 4BLPA 5FOVA 3IBGA 1U9IA 2OAP1 4TTQA 2WKPA 3NC0C 2OFOA 2WMOB 1EWQA 3LW8A 5KYKA 3N70A 3AB3A 3OF5A 4MH0R 4BUJA 2GAAA 1HEIA 3RABA 2ZU0C 5DE3A 2IL1A 4DEYA 1NNEA 2JDIA 3E1SA 4US1R 4LBYA 3U44B 1JEDA 3X2SA 1KI9A 1XXHB 3K8YA 4QBFA 4QFMA 2ZRDA 1KDRA 4I81A 1QBKC 4PQYA 5FBLB 1DBSA 4IVRA 4ASUD 4HAUA 4KFSA 4MKIA 1J7KA 3SN6A 1NKTA 4TMZA 4BFWA 2EFGA 2EYQA 4B3BA 4DC9A 2NO1A 2O8DA 2J7KA 1G5RA 1TU4A 1T8TA 3O8BA 4AKIA 3M6AA 4BFUA 1G291 2LWIA 2ZRHA 3ADBA 3O47A 5L3QA 5TB5A 1CTQA 2ZJAA 4KLZA 2BEKA 4DLXA 4LDJA 1D2MA 1MOZA 2F1JA 1N6RA 3PEWA 3SJCA 2CLCX 4ZI3A 4L9SA 2CJWA 4MYCA 2KI5A 1JR3D 5G53C 1EFTA 4AYTA 1ODFA 4Q4HA 4QHTA 2RGCA 3ASZA 1CIPA 1WB9A 2XOKD 4JYBA 1KYIA 1YHNA 5FUVA 1W36B 5F9FA 2R2AA 2J7PD 4HUQA 5TXGA 1FNNA 3ZYCA 4RCZA 4OQNA 1R8SA 2FZLA 2J59A 3LA6A 3SC3A 4P4SB 4LC1A 1WF3A 2IEZA 3QF4A 1Z28A 4LV6A 2GJSA 4OI2A 4GBMA 1TQDA 1EGAA 4L4UA 2RGNC 1SKQA 2IS2A 3U7HB 2QORA 4EKDA 1C9KA 2WJIA 5TY0A 3GEIA 3UK6A 2QTFA 3HU1A 4NMMA 2YC4C 3LLMA 2VQSA 1P75A 4QJ5A 2CXXA 2G0TA 2GESA 2IA5A 1KMHB 2D4HA 2J41A 3AVVA 1GITA 4ERNA 1SVMA 3NWJA 1BYUA 4PANA 4ZPXA 4PAQA 2OCPA 4MITA 3NVAA 4PC1A 4CT5A 2SHKA 4R71A 4ARZB 4FI3C 4MRNA 4Q7LA 3QY0A 4XVRA 4LX0A 3F0TA 5P21A 4PAMA 1W48A 2AFHE 1N6OA 4MDEA 4W5WA 2QT0A 2FE4A 3AKDA 2BC9A 4IDQA 1BS1A 1QHNA 1II8B 1CRPA 2XX3A 4TSFD 2WJYA 3LW7A 2O0JA 3R7WB 3M0EA 1SVOA 2J9RA 4QHSA 3T1QA 1ZM7A 1E2PA 3GP8A 4O3MA 3C41J 1OB2A 2REBA 3PUXA 4BZXA 5JJKA 3SFVA 1G6OA 1JR3E 5KNCA 3ICQB 1EWRA 4C7OB 3DKVA 1FTNA 3MWJA 4F4CA 1TAGA 1DS6A 3BFVA 1MV5A 2CL7X 3ZIAD 1P5ZB 2H17A 3I73A 5IDVA 1H8ED 3EZ6A 3GFTA 4ZKEA 2IYSA 4DSOA 3K9HA 3DOEA 1ZINA 1U8YA 1GNRA 1SHZA 1FQJA 2BHRA 2N46A 3V4RA 2F43B 2MSEB 1N5LA 1MO6A 3RYTC 4BLOA 3S1AB 3BRWD 2JIZD 2WV9A 3GJ5A 3EAQA 5GJVC 4ASUA 2IHYA 4Q01A 5AUPB 2IW3A 1RRGA 1QVRA 1Z0IA 3R9XA 5G41A 3KDSE 3ZVMA 4NYIQ 2VHTA 1K5DA 3QI2A 3SE0A 1KI2A 2VP9A 1GWNA 5A4JA 1G3RA 1XTKA 2VYFA 2ZRIA 2AFIE 1LFDB 4HLUA 5DI3B 3EW9A 4ZI2A 3TIFA 1QG4A 2QAGA 4DCNA 1NMYA 2MSDB 2X19A 3P4YA 4CW7A 3BERA 2ZYTX 2XJ4A 4M9ZA 4NTZA 1VG9B 5JHHB 3B60A 1JR3A 1U99A 2DYKA 2GKSA 3N5CA 1AJEA 3EC2A 2QU8A 4BLSA 2Q0HA 4BE7B 4TLDA 4B3XA 2XNDA 2KWIA 5JSZA 2XOKA 2GK6A 1ZAKA 1XMIA 1M1YE 3ZZUA 1VG8A 1GNQA 2VSOA 2WVJA 4TMXA 2W83A 3CX8A 5F98A 3B1XA 3RSLA 4XWOA 1ZIOA 1AS3A 3DPUA 4P33A 3NIBA 3ZD7A 4NH0A 3H2YA 3QIAA 1WRBA 2DBYA 4MUAA 4IEEA 3MJHA 4TLCA 2ZE8A 2AKAB 1W4RA 4ZCMA 3CLVA 1HY3A 3C14C 2B92A 1MABB 3PV0A 2RH5A 3K0EA 1MKYA 3X1DA 3K0FB 2ECKA 1IXZA 1U94A 3GLGE
chains in the Genus database with same CATH superfamily
4LOJA 4BKUA 3N0VA 1I0IA 1O54A 1UZAA 1PVOA 3DYBA 4XD2A 3AHEA 3KXPA 4LGVA 4J0DA 1C1XA 1Y3FE 1ZONA 3SOZA 2PIDA 3B7PA 3T5GA 4LBVA 1Z5GA 4KXUA 1MIOA 4QATA 1KRXA 1G20E 3EOBI 4CHTA 2O1SA 4RPIA 4GWLA 4UMVA 3IUJA 4KC0A 4QBGB 3W90A 1SIUA 4GI2A 3EOZA 4BJHB 4AJ4A 4TSFA 4Z4EA 4D0GA 1EXNA 5IJAA 1WPGA 4KBGA 2P5UA 3CCBA 3IHWA 5EIHA 1WBJB 3DDNA 1ZGBA 1PQPA 1RRKA 2W70A 2G28A 4U9UA 1LZLA 3HCCA 1O7JA 4HX2A 5D7NA 4S2EA 8ATCA 5J2UB 3ELWA 2GN2A 3LQ2A 1KZGB 3O5AA 2A0FA 2VTBB 3L4SO 4W1QA 1CE8B 4MICA 4YAOA 3WMGA 2R6CA 2VJNA 3C8HA 3VZBA 2YV4A 3IEKA 4MV6A 1NNI1 1UKAA 2UVPA 1VRWA 1OI3A 3L4BC 5L4LA 4X7PA 5F3RA 2PUFA 1HSOA 4RPJA 4XGKA 4O4LA 5TRTA 1JA1A 5SV2A 1ZU5A 3FHJA 2BDEA 3NHYA 2O2CA 2XIJA 3GGCA 5C46F 3HDVA 3C8UA 5KIAA 1QHIA 1E2KA 3W9BA 4C2TA 1XMSA 2QNBA 1YUBA 2RJNA 3B9RA 3J81A 1XK7A 4EA6A 2Q4BA 3GLGA 1OE0A 1KI6B 2JFXA 4EHIA 2DRIA 3IJRA 4DQ0A 2NTJA 1JF8A 1FDUA 4HH1A 4Q6BA 1TT5A 5I51A 3QMWA 4KGZA 3KSZO 5FPYA 5DX0A 1XX6A 4IYJA 4PPQA 4QQRA 3W8DA 4EG6A 3G0HA 2ZWOA 2V9ZA 1FRFS 1YJXA 1BJKA 2IU0A 3WWEA 3RU7A 3FOAA 4FXOA 1CWUA 5DX1A 3D02A 1SCUB 4P92A 2Y1FA 2C8JA 3EB9A 3GUZA 4LHYA 5DHFA 2FK7A 1UBJS 1VC2A 2ZRAA 1T13A 4K1XA 2V74B 2HBRA 5THKA 1I80A 2DECA 4MWGA 3VO8A 5EIXA 1PEYA 5D86A 4NDNE 3W34A 3WHKA 2W6OA 2XGSA 5IDQA 1Z06A 2WU3A 3KB1A 1BWRA 2ZSKA 2HWWA 4OOEA 4A15A 1D09A 2IS1A 2ONYA 4BMZA 2GJ4A 3L0IB 3E18A 1RJFA 3WRYC 3FKSD 4EB0A 4ZKDA 1Y1LA 1XF1A 2GARA 4JLVA 2JCXA 4MRVA 4Y9TA 4GBED 5AUQA 5TMBA 4CCYA 1OFGA 1K7FB 3DAFA 4WA8A 3BX1A 2YVKA 4PONA 3W5CA 2ISQA 2X76A 3WI7A 5D3ZA 5G2OA 1SXJD 5J63A 4I36A 4IDGA 3RNLA 2VDUE 2PBRA 1EFKA 4G5OA 4PLYA 3QKRA 1VMAA 1V5WA 2HYDA 1L4YA 2OG1A 4LNAA 2BONA 4HDMA 4N0DA 5FYDA 2ECPA 3TBHA 2R8XA 1PLKA 3VNVA 1SCDA 1N6HA 4X24A 1AO3A 1DAHA 2FN4A 2OUIA 3L6BA 3QU4A 2HU7A 2POCA 1X1TA 1GFIA 4G85A 4HFRA 4G0MA 3QVWA 4IR7A 4CCAA 4AURA 2ZBFA 3EEQA 5JASA 3Q5DA 1WIWA 4RVUA 1LPAB 1JEQA 1N8TA 3B6EA 1JWLA 3NC1C 2FQXA 3I2IA 6AT1A 3ZLJA 2RGYA 5IARA 4AS1A 3IQDB 4LDRA 3VZSA 1MRNA 5IKPA 5GTDA 1AHIA 3DFIA 5JE8A 3J80A 5JI2E 1G2OA 1XMPA 1ZZGA 2KS6A 5K6AA 2HADA 4I3FA 4LSWA 1KZ6A 4RM2A 3V33A 2ZT8A 1LJ8A 4ETIA 1YS7A 4REQB 1ZJWA 4B3RB 1U2EA 4P35A 2PZFA 1OMOA 3GR6A 5AM4A 3TTTA 1QFZA 1V3TA 2W98A 3VUEA 1XEAA 1NMQA 4LJ6A 3RAFC 1DKRA 1NHWA 4K8RB 1Z0KA 4LZNA 2PH5A 2PS3A 3CY6A 5B1IA 3DE3X 4U7HA 5F7ZA 3ZXXA 3VOAA 2HCTA 5KPJA 4H0NA 1T3TA 2O54A 1QVWA 3CUSA 2PRYA 3TR6A 4DT1B 2BFWA 1TM1E 4HZUA 2F8SA 3PQ8A 3EUAA 5EZSA 1SUFA 2WIJA 5JVDB 1CJTC 1MMFB 1DZIA 4LNUA 4DPLA 5BN4A 1SCIA 3PF8A 3VR5D 1MB2A 2A9RA 3PC7A 4UULA 1VKNA 4QYIB 4C0BA 1WW8A 1Y5NA 1ZO8A 2XMRA 3WL6A 1TAUA 1D6SA 2AEEA 3MWEB 5HTKA 1OI7A 1ZHOA 3PFBA 1OW3B 2GBLC 2FETA 4GQAA 3PQ4A 1VA4A 3EHEA 2RHOA 2AFRA 4X7MA 1Z26A 3HCWA 3PNPA 1U0JA 5FOSA 2IPAB 2IWRA 5I7EA 2Z1MA 4TXMA 3T4EA 4YIHA 1KL7A 2GZRA 3HRHA 3USES 4AJEA 5EZQA 5CXQA 1EJ2A 1HMYA 4KPEC 3KQLA 3UB2A 1KA9H 3OKFA 4UBIA 2FQ1A 3AP1A 4WJKB 4YP5A 3VPHA 4K40A 4CF3A 1JW9B 2L17A 5FPKA 4QXMA 3N2KB 2J32A 3D4OA 5CPBA 3D7LA 4FEYA 4YCDA 3UAZA 4YXWD 2HWKA 4H4EA 3FZQA 1RBYA 1M2NA 2O0KA 4L28A 4RMIA 1HTTA 3BD6A 1JEOA 1U8UA 2X4DA 3OG9A 1LBTA 3LPLA 5JANA 1AQJA 5AHXA 4JI5B 5TT1A 1V9LA 2W2XA 2B4KA 5B7QA 5KYWA 5AJWA 1P9OA 3NRCA 4E4RA 1BWQA 1JNYA 2E1PA 3AUUA 3SYRA 5EP3A 2C2GA 5F73A 4MS3A 4F97A 1N7IA 3UWDA 1OLXB 4AMUA 3MCVA 1LCIA 1QG6A 1NJ1A 1ZJZA 3P52A 3IERA 5IM5A 4EG0A 3A1WA 1W35A 2ZE6A 3K31A 4MA0A 4RHEA 2A5DA 3HP4A 4DSNA 4RD2A 3WWPA 5C80A 5JEDA 4F8EA 3GLIA 3PRJA 2HRQA 3PDWA 2AT1A 4Z4QA 2XGJA 1H94A 1AKWA 2K87A 3HVKA 1FMTA 5H81A 1RC0A 4RA9A 4BX8A 4W63A 5CIWA 5FEUA 1VGVA 5BYAA 3C74A 2GCNA 3CW8X 4EI8A 4G24A 4U0KA 3REFA 3HU5A 3LDUA 4P81A 2GAFA 3FLEA 1HLPA 2B1IA 1HH4A 3L7LA 4U7PB 2ZQ5A 1H0HA 1E5XA 1JHQA 1KZYC 2R87A 2FEKA 2JHFA 4HSGA 4TUYA 2A1UA 1M2KA 3EMVA 4UASA 3TL6A 4QUAA 5LLDA 4C4XA 2B8TA 3GARA 2A3RA 1ISFA 4KTTE 4YJ2A 3VVLA 1R8XA 2JZOA 4FUQA 2FZ4A 3MOGA 2GEFA 4P84A 4Q1FA 2EBHX 3HK2A 1NA5A 4F6RB 1Z5PA 4LQDA 3CEAA 3NMUF 1KDPA 1RI5A 1U3VA 4Q9JA 1TLLA 1UCFA 2VDKB 3DEFA 4R6WA 2Q3HA 2VRCD 1DP4A 1FFSA 2AD5A 2EFHB 2YYYA 3N0TA 4MVJE 1UXGA 2FOLA 2X77A 4EGAA 3KQWA 4H2DA 4PM4A 4KTVE 3KWMA 3GBSA 4I66A 2Y2UA 5E7QA 2EX4A 3KZ1E 3G2MA 1C1HA 4HPJB 2WWWA 1I5OA 1OU4A 5ALJA 1H1LB 4OQLA 1QQBA 4HS9A 3KFXA 1PGQA 2P3QA 3AEUB 2B35A 4UCQA 4X97A 2OXCA 4CJXA 4GXNA 3MGAA 4XSHA 4EDFA 2O5VA 5TMPA 2ZB4A 3EBOA 3C8ZA 5AW7A 1WMAA 4EA9A 3WIBA 1VA5A 1YRAA 3HSYA 4YALA 4MYTA 4BAGA 1KSFX 2PX8A 3OHPA 3A1TA 5IH3A 2XSZA 2VO1A 5I9NA 3LY5A 3PQ6A 2YTZA 3UG7A 3TSWA 2H8KA 4JQZA 4BBPA 4UBLA 2H6EA 1RE0A 1T4MA 3I42A 3DCIA 2ZIWB 1T2AA 1ZEMA 3TOXA 1CRLA 1LBEA 2B94A 1QYRA 1SAYA 2IOQA 2WKWA 4H1WA 1R16A 1Z5WA 4WPGA 2YMQA 3NWBA 2IW1A 1MP0A 1GPH1 2Q4EA 3LCMA 2ZJ6A 1LPOA 2QT1A 3W6OA 1PFUA 2H7YA 1C1XB 1U8AA 3L3BA 1QYXA 1V8PA 4MWBA 3V2HA 2CZGA 3I3SR 2NO9A 1L7RA 5FWDA 5A4KA 1E2JA 4RKRA 5BWLA 3HYCA 5TSDA 1VIDA 4QARA 721PA 4M46A 2OXRA 1R0XA 4LZAA 1MENA 5IC4A 4GM0A 1W6UA 1MB0A 3CZRA 1JDVA 1MRSA 3MUEA 4OSPA 1NI5A 4YJ3F 5EUQB 3PHHA 2PX0A 1WNTA 3IOYA 3OZEA 2C2XA 4GPZA 5CBKA 1WP4A 3M6MD 3Q5EA 5DWQA 3QXCA 3JWPA 2OMEA 1KEUA 5BN3A 1H6CA 4HAVA 2BR5A 3FPSA 4Q7KA 4I50F 2DUWA 4PZPA 4URHA 1QAOA 1ADJA 3NHLA 4K05A 3VBCA 2B9EA 4RORA 3WL3A 1NLYA 1IXYA 3B51X 2YDXA 3Q6NA 3QG1A 4OJKA 4QQFA 1G18A 4ESHA 2CBGA 2IUSA 3CBQA 2JIOA 1O87A 4HN9A 1MC8A 4QOJA 1B3RA 1QK5A 2ZR8A 3QTBA 3FCAA 1KOFA 4QUDA 5KQLA 3Q1LA 4XPIB 3K9NA 5CJ2A 3TQTA 3U7EB 4TKVA 5JAPA 2FSIA 4YGXB 3RYIB 3ONVA 3NYIA 4M7RA 2A1TS 3VU3A 1CV2A 1GZUA 4JROA 1NG1A 1L1QA 2IIVA 1FNDA 1OIXA 4X8LA 4EOGA 8LDHA 4JEHA 2ZETA 1RBMA 3C97A 2JFPA 2VP5A 4PRKA 4BNDA 4MV9A 3OTWA 3DKIA 1Q0HA 2LXNA 4GM1A 3WK7A 4AZVA 1ZYUA 3MD0A 4R1TA 5AIBA 2QN1A 2XNCA 2GYWA 3BIWA 3DGFC 2YRXA 3MM4A 1TVCA 1J8FA 2ZDQA 1TA9A 5J47A 4J90A 1J0DA 2DQ4A 4DPKA 5J59A 3GN1A 3VR0A 3SJBA 4PIVA 2HBYA 4K9QA 1LLCA 1R18A 1TRKA 1XDDA 2EEPA 5DB4A 1THGA 1QV7A 4CLXA 4QM6A 1UM8A 5J58A 2OO3A 4G5YA 1PZEA 1EPUA 1VDZA 5CCEA 4RMJA 4JXKA 1U1IA 3S7ZA 1ODSA 2M6LA 1XQ9A 1RQGA 3A4VA 3C4JA 1ETUA 3R20A 3L05A 4CCYB 2K4MA 1BROA 4ISBA 5DO9A 4KEAA 2DJ5A 1TAHA 4FMDF 4NCNA 4UC0A 2D5IA 5IK2A 2JIRA 3D0KA 3V8BA 1ZY2A 1RQLA 2RAPA 1Q1EA 3NJ8A 4FYXA 5DHQA 3N2IA 1R4MB 1RWOA 3A0RB 3GFRA 1KE1A 2G8LA 3B1VA 1FRZA 1EX7A 4GOXA 1E2FA 2XZDA 3LMKA 3QKRB 3NHFA 3TKAA 5DW3A 2FU5C 5EJ7A 2O06A 1YWGO 3N53A 1T2DA 3H3XA 1KEZA 4TXHA 2J6HA 3IT3A 4G36A 5EERA 4W7SA 1Q7BA 1J56A 3WLJA 1YR1A 2MWMA 4ENTA 3OZBA 3MRXA 4IQ8A 2O2DA 2I7DA 4ESVA 4O02B 1GTJ1 1P19A 1PIWA 1Z68A 1BXGA 3B8HA 3I3OA 4IGKA 4EA7A 3RUDA 2XZLA 4ENWA 5EJ8A 3FRJA 4AF7A 3IDFA 3BMOA 3L0ZA 3TEFA 3VC2A 2HW8A 2MSLA 3W06A 3TUZC 3SLGA 3HXQA 1YK0A 2QW1A 5EXEA 2BH9A 5EJ4A 1XV5A 3OZ7A 3QQPA 1JQDA 4MO2A 4U3JB 2IPXA 2OORC 4YQZA 1CU1A 3QKWA 3M34A 4U1RA 5TC4A 2GVZC 3ZHZA 3OZAA 3SM9A 4BTEA 1RLOA 5A5FA 2XXAA 3PEFA 5T57A 4AX8A 2LZ0A 3B1FA 3DZDA 4L0MA 1SIOA 4GKAA 4LX8A 4ZAWA 5TQ0A 1UFKA 4ITVA 1MNQA 4HZUB 2H07A 1A3CA 3UBMA 4PIPA 5E1OA 4YMTA 1AKYA 5BN4B 5EESA 2HA2A 3M5PA 5IT4A 3G8DA 3KKOA 4MJXA 3BCUA 5J2UF 2FWJA 4L4YA 1WUIS 3WGHA 3RUHA 4FD3A 5C51B 4DLVA 3QYJA 1KKMA 1NMZA 1JQ5A 4W9MC 1VHJA 2WU0A 2RGGA 4NXMB 1KY5A 4QELA 3ZDEA 1AUPA 1J97A 1E94E 1RYFA 3HCDA 4ZK6A 3STVA 4WE3A 3P9SA 4OSOA 3JQFC 5JFGA 3CEMA 2Z08A 1LQUA 3B6ZA 3AK4A 2EFJA 4M8SA 5A3QA 3L8MA 2R8EA 1KHTA 5JBQA 3TSAA 1EIWA 2XNDD 1MFPA 2RHCA 1YZKA 1TPYA 3BWBA 1DO0A 3AC0A 2HA0A 3H1PA 1Z8DA 2UDPA 1V6SA 3N05A 3EX7C 3FOFC 1F06A 1BIFA 2H08A 2EKPA 1M5TA 2TECE 1FFAA 3F98A 2JANA 4RKFA 5DWDA 3WLMA 3ZJYA 4C08A 5LDDC 3QJGA 2BFAA 4JELA 1AZSC 1G3QA 4I4LA 4DKXA 3DBRB 1M1XB 4P9NA 5KYWB 2RCNA 3A0UA 2E4ZA 2P5TB 3CZ5A 4BZZA 1X70A 3L7CA 4J3FA 4MPPA 4C0KA 4ZWNA 3JQAD 4URVR 1ZK3A 3KVVA 5IULC 4ALIA 1F1JA 2IGBA 4JQSA 4W82A 3U48A 4F9GA 4FOPA 1XMXA 1E5DA 2QMQA 3HDGA 3SKYA 1N2XA 3W2HA 1NWCA 1GL7A 2X3YA 4N5DA 3RRBA 1ZJ5A 1QH1A 4L74A 3WRVA 1GPYA 1VE7A 4UM5A 2OV1A 1T2CA 4DNXA 3J81k 4MPDA 5MHTA 4AN0A 1TD1A 3U7RA 1TIBA 2B69A 4B8YA 3N75A 1NYTA 3QTLA 1P72A 3GLIB 4ENQA 4QUJA 3EXFB 4B3FX 3MIIA 4LZOA 3OCJA 2XUIA 3H9EO 1SBHA 4DV5B 3O4RA 2XZPA 4Y2JA 5IBRA 3HU2A 3MGGA 3GH1A 4HBGA 3LVQE 4RA9B 1UJMA 1JRLA 4HQ6A 4DHEA 4U2KA 3N8NA 3H99A 2X9QA 3G2KA 3OZUA 1AF7A 1NN5A 2I3ZA 1W25A 1ANKA 5HCIA 4V1CA 5IUJC 1UZMA 4YO8A 3FYCA 3DF9A 4F3NA 3A6KA 1P6QA 1TFRA 2Q4RA 4E09A 2IPLA 1ODTC 3Q87B 4M1WA 4A9AA 1JEYA 4LF9B 1QTNA 1FLDA 5GIPE 4TUYB 2EW8A 2A1UB 1HT1E 3O38A 4JKOA 3A4LA 3FTQA 3L8FA 4YRRA 2OESA 3QYPA 3VGPA 1LXCA 1WZEA 2VBGA 5JWRA 2ZDHA 3NW9A 2BGLA 3H4TA 1NVDA 2ZVPX 3BB3A 4IUYA 2N9UA 4DUYB 4FC6A 1HDZA 2FFQA 2PSJA 4OTZA 2WJGA 3HZRA 5CIYA 3HABA 2P6RA 1Z38A 3NBFA 3NM5A 3GN2A 4L22A 5I7RA 1E9FA 5KTTA 1KXJA 2VEOA 3Q6IA 1IBKB 4M3NA 4TMTA 5G4KA 3FHOA 5GPBA 2FKAA 4CLEA 3OA2A 3K96A 1OXTA 4HUJA 4UNQA 4EY7A 1A8UA 1IDN1 3ZU3A 4QDZA 1CY0A 1DBRA 1YZQA 1CVLA 1X7WA 2JFHA 2KHZA 4PHTA 1NJGA 2OV8A 4V2IA 3CYFA 2VC2B 1OH7A 2X13A 4G4SP 1PDOA 2VT2A 1GQ2A 3OEED 4LK3A 4EHJA 3DDHA 1BHQ1 4C4SA 3FB1A 3OZIA 5C5DA 5IJ9A 1RMTA 1UOPA 1H2XA 4CIBA 1Y3CE 1GHTA 3SHQA 1TL7C 4HNSA 4Q1BA 1ZA2A 1NOKA 4YCCA 3L0BA 1HV8A 5EXPA 4EY5A 5IRCD 2BI8A 1OAOC 2Q5EA 2BEUA 1DAIA 4KWCA 1MIHA 2GLXA 4HB2A 4WK0B 1T15A 4Z4FA 1PYDA 3BD8A 2PEYA 3ACBA 1RZVA 2FR8A 2ZS9A 4OI1A 3LY9A 4NBNA 2Z4SA 3O3NB 4B4WA 2XKJE 2FJUA 5AMXA 4U9IS 1HYBA 3V7FA 4BEBA 2XCSB 2Q3EA 3HUDA 4ZXPA 4E4TA 3DDUA 2G5TA 5DYNA 3KZMA 4Z3DA 3SJZA 2JFYA 2OUKA 4LYJA 3QMPA 4E13A 4BJ6A 2SECE 4LVUA 2OXFA 4RVHA 2I7CA 2FFBA 1ULZA 2WIKA 2XVMA 4IDHA 3ONWA 4I99A 4UPEA 3OKPA 3FJYA 4KXVA 2JGMA 3HZZA 4B47A 1SO8A 3MJVA 3C3MA 3IA2A 1XRPA 3GJZA 2O8BA 1G64A 3AX6A 3EZFA 3ZJ4A 3ZK7A 3R77A 4MQEB 5CJPA 3A3PA 3MT7A 2I6SA 3B8EA 1AKVA 4BNZA 2PAAA 1BN6A 2OENG 4G1EB 3V55A 3CZMA 3R7SA 1O5IA 1ZI8A 4AO7A 1EP3B 3A14A 5JZBA 3G8CA 3T34A 3M6LA 4BE4A 2C57A 3EWIA 1Z0AA 1BVYF 5LP1A 2Y1EA 2RB4A 3FMGA 3U3JA 3G85A 3KUXA 2GD2A 2X41A 2IHZA 2PT5A 3DHNA 3ZQJA 1ZNYA 1H6DA 3E1KA 3F6RA 1GCUA 1GGEA 4TKVB 3DHYA 3G17A 1EE2A 5B3AA 3S70A 3N8IA 4M9XA 3OOSA 5HKOA 4LKRA 3QHPA 3ZZMA 2WILA 5CHEA 2VP3A 1U7DA 2Q07A 4UTZA 2VNIA 2FPSA 1UOOA 3WL4A 1IQPA 4NYMQ 3D3EA 3PFIA 3LX8A 1C9MA 4DR1B 3C85A 3LQ4A 4BDTA 3O90A 4TWJA 4XGIA 3K8OE 4ICIA 4BC1A 4BNDB 1J9GA 3GHHA 1U8CB 1E2MA 3CZCA 5JCOA 4LJLA 4RKYA 5IUKC 4NOLA 1SKMA 2ALJA 3S3TA 4NCHA 3KDPA 5F5NA 4CFYA 1E4VA 3WADA 3WX0A 3AHHA 3O3OB 1ZD9A 1QM5A 2CEAA 2BKEA 3BM5A 2P3SA 1WVMA 1EAYA 1ZU4A 5EIFA 3SHOA 2G70A 3HVJA 1I01A 1U7TA 2P65A 5ADWA 3IKJA 1VLQA 2R62A 4DDVA 1C0EA 3IPXA 1PZNA 4BVJA 4MPRA 2R7AA 2R8ZA 5EKTA 3I2FA 3OOYA 1TF2A 1BRTA 2Q6IA 2FTKE 3NGLA 2XNSA 4PO8A 2IYLD 3SGLA 4P4GA 4N5LA 2SICE 3JQBA 3PI6A 2YOFA 1PN3A 1IEQA 2VPIA 5AW6A 4MR7B 5EP4A 1VHTA 5TVGA 5K3OA 4QUBA 3IAFA 4RSHA 1EZ4A 1UDWA 1CQJA 1UMBB 2ROQA 5F52A 4BXOA 1VJGA 2DWQA 1EX9A 2ID9A 2QL6A 5AKHA 4C0XA 3LXRA 3BH7A 2AX4A 3UKOA 2DY1A 3TPZA 3ZCVA 1TFUA 2D5BA 2GDZA 2JGEA 4FLFA 1AB6A 5CIQA 4JI1B 4ETNA 4WK6A 4UDYX 4XYEA 3X3HA 4C29A 3H9GA 2RHHA 2NU9B 3VO1A 5CA0B 4HNRA 1Q77A 3MSCA 5BOVA 4A8JA 3TQOA 4BASA 4XVQA 1WXWA 4CIWA 3K70C 3IVRA 5HNKA 1X13A 1CT9A 3E8SA 3GPLA 1BXGB 2GBIA 4Q4LA 1Q7TA 4OH1A 3BMOB 4W9NA 3TZEA 2QTLA 4JA0A 3TD6A 5GADl 3DZIA 3OQJA 1RD4A 1XWIA 3OU2A 4FGWA 5L3RA 2VP0A 2A58A 4H4CA 4NZZA 4LI0A 4LF6B 2EKDA 2B61A 3ECCA 5IVKA 3IVAA 1G7RA 5CFNA 3GBVA 2C5LA 5DGXA 4I2VA 1FS5A 4PV7A 1UK6A 2QMUA 2XRFA 3M2PA 4MVXA 4OUKX 5CA1A 3N7AA 2CVOA 2XXAB 3FCUB 2PL9A 2FW0A 3QEKA 1BX0A 5KI6A 3NYQA 3QOWA 1E3JA 1FJ2A 1G2IA 1OA1A 4Q02A 2VF8A 3IQGX 3P19A 5TQ0B 3AL0C 3H11A 3LF1A 4JBGA 3R9WA 2PMBA 1Z37A 4HQ0A 1ATIA 1XZIA 4IRMA 5ESWA 1RIIA 1I4TD 1JKMA 1POXA 2IITA 2QQ5A 2B98A 2R79A 3B7WA 3FVQA 4TN5A 4TN1A 4LDQA 2EFDB 4IDFA 4MKHA 4R5HA 1YB6A 2NU8A 3WY9A 2F1IA 2Q1YA 4IXTA 3IHTA 4EEXA 2BBWA 1DWUA 1XVVA 1ZWLA 4YT8A 2OE2A 3TSZA 3KVNA 3DSRA 4C7MA 1I2CA 1P1RA 1YGPA 4NENB 1G8GA 4P34A 1C8LA 1ZAYA 3TKYA 3TQCA 4FZJA 1GUBA 1S3SA 3F9RA 4B1FA 2Z6UA 3JD2A 4NDAA 5DTQA 2BEWA 2EHJA 3CF6R 2VQ3A 3GCXA 1J0EA 1OPRA 1TQ6A 3KD2A 3FUVA 2KX7A 5SZIA 1CJKC 2XNKA 3KEGA 4RZUA 9ABPA 3NH6A 3VZPA 2QJOA 2YHUA 3A31A 1LH0A 5BT9A 3PUKA 4RH1A 2AE1A 3DQQA 1JIQA 2WSSA 4FEAA 4IIDA 5CDGA 4DV6B 3PLNA 4CKYA 3E27A 1TQ8A 4KAJA 4KXLA 1P9NA 3R6LA 1V2HE 3AR7A 3FN4A 1C9DB 1BQEA 1ORVA 2XQKA 3FZNA 3GJTA 3IX7A 4UU0A 1I3KA 3NETA 4H6WA 4E4YA 3NYWA 2JA1A 3PXGA 3QLTA 1T8PA 2BJHA 4RTRA 2CXTA 4Q3NA 1LDBA 1WVGA 5LDHA 5F21A 1KAGA 3VXKA 2WTEA 3LVRE 4D82A 5HIAA 3TGPA 1WLYA 2O20A 1F0YA 1VKRA 1U98A 1ZW6A 3JYNA 4XWYA 2X5JO 3FIUA 1QH1B 4XX0A 2QVLA 3ULKA 1VI2A 5DKFA 4ZAZA 3TQQA 4ARSA 2FW6A 3AIMA 4G1BA 3BH6A 1TJNA 2NVUB 2IQIA 1YB4A 3LV8A 1C0PA 1ST2A 3PC8A 4DIDA 2Q29A 1QHXA 3LXXA 1T4BA 4QEKA 2FX3A 4OHUA 4YCNA 3NPMA 1DX6A 4B5LA 3KLNA 5CD1A 4TROA 1K4MA 2P2CA 2J5KA 3GAFA 2D62A 1S3FA 3DAHA 3LSTA 2WJVA 3R3WA 3WLOA 5E1DA 5BYJA 5KHLB 1RTTA 2CCKA 4ZC8A 4F0JA 2W6JA 3KB6A 3O1JC 4CMEA 2VZLA 1DQZA 4TTTS 1Y3IA 5FQOA 2I6QA 1Q91A 4MLZA 4IIJF 4TWRA 1KR5A 2FF5A 1VKOA 2PL3A 5ER9A 3VYUB 4F46A 5FWYA 2BGTA 3A06A 5JAQA 2HHAA 3DEIA 1JTEA 2IU6A 1L1EA 3VC3A 1BX1A 1J7JA 3OZSA 4EGQA 1JEYB 5FTLA 1Q3HA 3MRSA 4BJ3A 1RKVA 1FUUA 2YBEA 2YWHA 2PIAA 5AKJA 3LKDA 5IDWA 3I9V1 3P0HA 4XDZA 1DCMA 1PGOA 4QYTA 4YEDA 5EGNA 3ITNA 2J3JA 5FOXA 1IG0A 2HK9A 2YXLA 4F2GA 1FA9A 3HUFA 1MA3A 5K0ZA 1JG6A 3GRYA 4RADA 4QNNA 1BWSA 3UA3A 4QTYA 3NO4A 5C34B 2ZI6A 4PX9A 2G07A 4RD4A 2QRQA 3GD7A 4HUTA 3TRKA 1UT6A 3LTEA 2LTAA 1NUPA 3LDAA 2DH5A 2QSYA 3IAS1 3IEIA 3R24A 5JH7A 2JAUA 3CX6A 1EH5A 5G4KB 4F5EA 1JR6A 4UVIA 1Y81A 2HDNB 3UEOA 4K87A 3CX7A 4DV0B 3VZDA 1KYXA 2J45A 3X1JA 1BZYA 1ISMA 1E6CA 3C43A 3FZYA 3RC8A 4TZ6A 1X7WB 8AT1A 4CCWA 1Y6FA 1X6VA 1Z5OA 1XJ0A 2WI8A 5LQDA 1CULC 4WDRA 3V4FA 2DCMA 1G5TA 4IUCS 5AI4A 1G6HA 3JY6A 5JDCC 4YLEA 3VU9A 2AFHB 5J43A 4HGZA 5HQJA 5CTAA 5IJ9B 16PKA 2GEKA 5BY2A 4GMHA 4R8VA 1ZSVA 3QUTA 3EDYA 4KUEA 4WWHA 5EJEA 1W4BA 4S35A 3ZXIA 3C7CB 4ZT2A 4ENUA 2KBEA 3RSCA 3KOYA 1RYNA 4Y2HA 1VCMA 2SBTA 2VNSA 2AQHA 1IN5A 2BEUB 2X7HA 4QO8A 2IJGX 4OGLA 3F9IA 3JXEA 2HY7A 2XE8A 3MILA 1CNFA 1VI6A 2XGMA 4O4HA 1EG7A 4JBLA 4KLCA 2C0QA 3FFXA 4KIFA 2J5XA 3CNHA 4W9RA 4J9VA 4UHDA 1YJBA 4ZZ3A 1TVKB 5BQ3A 1P2SA 1SK8A 3OBIA 3EVCA 2WYVA 2J08A 2H4WA 3HSKA 3LOUA 3L7AA 3MXOA 2VP4A 4UHHA 1VLLA 5FL7A 2XHEA 5CVDA 2WHXA 5FA5A 1MHTA 4EELA 3L0SA 3OF2A 3FE2A 1HURA 4FILA 3K6SA 3P9QA 2DQKA 1OREA 2C4UA 2VL7A 2RSLA 1G98A 2ZSHA 5BW5A 1O89A 5AR1A 3OLXA 3A1EA 3F9CA 1SKUA 1XAJA 1QRRA 1KDTA 1BFKA 3QWHA 3DFZA 1G59A 3KEOA 3OZDA 2GEJA 3TMKA 4IMRA 2QDKA 3NHPA 4YRTA 4N48A 3TZCA 1EM8A 1R5NA 3R6GA 1Y9EA 2CHQA 1I30A 1W36C 3NAZA 3ZQ6A 1B00A 3UMRA 4Y6RA 5HMMA 4B84A 4Z2AA 3ZCSA 1LA2A 2O6LA 4BFYA 3FG9A 5CXSA 2Q3JA 2FGJA 5T67A 1A98A 1ZM9A 4OIMA 3L77A 3KXLA 4EUSA 3R5XA 5HUHA 4ROSA 4LVCA 5DHAA 1YB2A 4LIPD 1I9CA 2GJKA 1QGYA 1E79A 3QPDA 4H59A 3D4LA 5AKGA 2CW5A 2YIDA 1GL3A 4MPTA 4KXQA 4Q5IA 4A0HA 1M34E 5AJVB 1SU8A 1CUAA 3DLPX 2JFQA 4DQXA 5B7NA 2ZWMA 5T64A 4OLAA 3Q3EA 3KQUA 4RD3A 1ZHFA 1F1BA 4C0WA 1FQOA 1R15A 1VI5A 2NUTA 2GEVA 3C1OA 4G26A 3QE9Y 1NQTA 2DHCA 3RARA 2H06A 4FPXA 3B5EA 3SBEA 1XN4A 2R9VA 2XNJA 2ZP1A 2FSUA 1J8VA 4EPYA 4F6RA 5DRYA 5BRAA 3AHCA 2VIIA 1XE3A 4J2HA 2JCBA 2CZCA 1PJSA 2UZ0A 3P2OA 4L5IA 1E63A 3H9UA 4IIUA 1KH3A 1GO2A 1KQPA 1DG3A 1UEJA 1FTSA 1U3CA 1FMJA 4NF2A 1TZBA 4KPFC 4GPTA 1IXSB 2I2WA 3TDNA 4Q3DA 4Z7QB 2ZZMA 4IUDS 1HORA 4PSCA 1XVUA 2ENUA 1LDNA 3FYHA 1JU9A 2Q21A 4Z1MA 5AVKA 4BQPA 4D42A 1ZS9A 3K6JA 2VBIA 1EJ6A 2WHQA 4EH1A 4F3KA 1AKQA 3GAAA 3W5AA 2FMKA 2PZMA 2J3EA 1K63A 1RP7A 1YUMA 3AZOA 1TCAA 3TTYA 1CZOA 4RF3A 2A5JA 2O2HA 1CQJB 1NTOA 2CCGA 4AP9A 4XDGA 3QFTA 4WMLA 1XRMA 1URPA 1O94D 2QTBA 4TS9A 4UPDA 2WNIA 4BXOB 1JVBA 5IAOA 3PRHA 1JAYA 3BE8A 1DV2A 1N2CA 2P9CA 1R12A 3ETEA 3OMXA 3KYDA 4IOMA 4PG6A 4ODIA 3DD5A 1X9IA 1E3DA 1HFWA 1RI2A 3GRZA 3KQQA 5JSYA 1QRDA 5DLQC 1NBWB 1P3Y1 4YRNA 4DYDA 2FN7A 2FN9A 2RGEA 3G0BA 5L6LB 4F4DA 1VJ1A 2F8TA 2IHBA 4HB3A 4DAEA 2PJUA 1DX4A 2PCLA 4EYEA 4Q21A 5K3SA 4POAA 2QL7A 3R7FA 2VCHA 3NTRA 3Q41A 3R7BA 1Z22A 3AEKA 3W2TA 3NJRA 1K66A 2NPIA 2W4MA 3H2ZA 4LVNA 4G0QA 4UBJA 4NYJR 1W47A 3GXOA 2HJWA 4M0PA 4OXIA 1SZPA 2XWPA 2PUJA 1F4VA 3IOMA 1RYDA 2QX8A 5M5BA 5K0JA 3GJ8A 4MP3A 3DM9B 3EVZA 2BFPA 4B85A 2B1JA 4FFWA 2YVLA 4XCVA 5CA1B 3MGKA 1D2AA 1K3TA 2WOOA 1P2TA 4BATA 2GRUA 4BFSA 1XMJA 1V7PC 1CBUA 2A35A 1M8PA 3BXZA 4RABA 4Q9AA 4Y2RA 2YIVX 4BNIA 2RDMA 4LWOA 5FBWB 2XMSA 3D8TA 1LS1A 2E6KA 6NULA 5DTMA 3W9YA 1DIBA 2W2PA 1HPLA 1YA4A 5AW3A 4JUFA 4JJZA 2NU8B 1IM8A 1FNMA 3K09A 2JJYA 4I4TA 5BNWA 2ADFA 3WWCA 2QYHA 3C3PA 3B5JA 3GGSA 2IZ7A 4GYJA 4PRZA 1OF1A 3VR3A 1AMNA 1C30A 2DTDA 3I32A 5EUMA 1BS2A 1XYGA 3O83A 3ZWWA 1C4XA 3V8MA 4UVHA 1XPJA 3GZJA 3PU6A 4LDAA 3UMSA 4KLRA 4TV9A 5ITZB 3AY6A 4GLJA 1W29A 3G3EA 4HFNA 4KQ1A 4BBZA 4EHBA 5IFLA 4F86A 1FFHA 3IYLW 1Y34E 1PDVA 4F7DA 1DUIA 4IWYA 4GUAA 1VBMA 3GLHA 2R1ZA 2XQVA 4Y67A 4ZT6A 1UM9B 4MUFA 5CEEA 1Q6ZA 1GCGA 5M2QA 3K6RA 1KS9A 3WDLA 1FCJA 1JXQA 4KBYA 3IL2A 1NAHA 1UF9A 1Z47A 3KHUA 1RCTE 4REOA 4B82A 2GTIA 1FRQA 3HA2A 4XYLA 3DJYA 2VDNB 1KETA 3HJNA 5H7XA 1C3VA 1XQVA 1BSVA 1IB6A 2JJ8A 2QXUA 2RK3A 2VWPA 2DR3A 2YWFA 3FPGA 3KTAA 3MG9A 3JWEA 4N0MA 1MOPA 1IUKA 1NP3A 1OIWA 2DT5A 2O1XA 3R44A 4KH1A 5E6UA 4BGUA 1UT8A 3TLBA 1PR6A 1GNPA 1XA0A 1IXRC 1OLUA 1LPSA 2ZPUA 5DLPA 4E15A 1AZLA 1B8UA 3BIOA 5ALVA 2GA8A 4JLBA 3DWGA 4GOKA 4XX0B 1ETHA 1V35A 1X39A 4HDQB 4L85A 1M2OA 1SHLA 2PRJA 3L01A 4LFAB 3TMYA 4KP7A 2IYRA 1VL6A 2JLCA 3M7IA 5B58T 2RONA 1NF9A 4IX1A 1AQYA 1DOAA 1PW7A 3AVQA 2Q5FA 4LRUA 3E9CA 2FX2A 4L08A 3SDZA 4FQ7A 4R9RA 4EFKA 3JATA 3KB8A 2HV8A 4KR2A 1ATZA 5CM2Z 4BX2A 2ZQYA 4JBYA 2QE7D 3WL8A 4EFMA 1JKFA 4FFPA 4Z9XA 4HNUA 1AK9A 1ABBA 1Z0FA 4NONA 3EA0A 4XR9A 2IUFA 1XQYA 5FWYB 2QRKA 1SUAA 3FDFA 2ZBQA 4J2TA 1UMDA 1KORA 5DYTA 2ERYA 2ISCA 5HHTA 1M54A 1PKEA 2DJIA 1F2DA 2EC5A 2PSHA 3I9JA 5FA8A 2RJOA 1ZMBA 2DQSA 1W8IA 1Z3IX 3QPWA 2C5AA 2B1GA 2VHCA 3Q15C 4E2WA 1H93A 1NT2A 3KJFA 2CT8A 3O8OA 1UJ2A 3WRXA 3SF0A 4XJTA 1JLLA 1GA1A 3JPYA 3KRTA 4BMDA 4EKEA 1VB3A 2GNAA 1EDDA 1E7SA 3WGZA 5SY4A 1NLUA 1TVMA 3ZE7A