3UXMA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
206
structure length
197
Chain Sequence
GLFVTLEGPEGTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 77
structure length 197
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uxmA00
1ZW6A 4Q4AA 1DPFA 2P6RA 4KYUA 1R10A 4DHEA 2FPLA 3EZ9A 3LLMA 3ZS9A 2WVJA 1YRBA 4AYXA 4R71A 4JLVA 4BLSA 2WKPA 1EXMA 1Q44A 3ZYCA 5L3SB 4I1OA 3DVLA 3GJ5A 2W6JA 2XOKD 3THWB 1T8TA 3Q5DA 4PHFA 4TTQA 1WE2A 1OIVA 4PPQA 3TSWA 3VR1A 1U8ZA 4LYAA 1G8FA 2A78A 4ZO4A 5IK2D 5EP2A 2G77B 1ZBDA 3THOA 1FX0B 2EVWX 3WP0A 3PEUA 4JYBA 1DE0A 3DMDA 3H1TA 4OJQA 2W0MA 4Q1AA 4LYHA 3DKPA 1OKKD 3RWMB 5B30A 3DHWC 3CRQA 2GXAA 1OYWA 3RC8A 5CYPA 1UKYA 1KKMA 1SVOA 3SFVA 4IXMA 2WSSD 3U3JA 2JGNA 2ORVA 5FTKA 5C4GB 1JXMA 1NN3A 3S1AB 1XCGB 1DAHA 1EFRD 2FPKA 4XWKA 5M04A 2ZI4A 4NCKA 4Q7LA 1PVOA 1XMIA 2FF7A 1B0UA 1R8SA 2D2EA 3K09C 4LV8B 2D62A 1KHTA 4OQMA 4Q1CA 3JVUA 5EXXA 4D4JA 4V0KA 2ONJA 4GP7A 1HT2E 3BXZA 1ZCAA 2HXSA 3HP1A 4TSFA 1KI8A 1XJCA 4UNQA 4AURA 4FMCB 2OBMA 4KCGA 2DB3A 2AHOA 4JLDA 2CBZA 3T1TA 1KK2A 2Q21A 1CR2A 1NP6A 4URUR 4XD7D 1AKYA 2KB0A 2P6UA 1ZRHA 1U0JA 4NCNA 1ZM3A 4IXNA 2G0TA 1ZUIA 3WYAA 4A36A 4L9WA 2P2LA 1MOZA 4F38A 1XDBA 3EZ2A 4GMXA 1ZNYA 1ONBA 4C0QC 4TL8A 2O8DA 2O8BB 4Q66C 2PJZA 1W48A 3OIVA 1IXZA 1NF3A 1SHZA 2PX0A 3TVTA 2FFQA 1GWNA 1KOFA 4Q4HA 1Q12A 1C4OA 1RYHA 1W36B 3CZPA 1GIAA 3CPJB 1Z0DA 2KBEA 4PX9A 1Z28A 2DYKA 5B2ZA 1P2VA 3NC1C 4GOXA 4N3NA 3EASA 4JLOA 2BWJA 2K5UA 1J7KA 4JMPA 4MRRA 2ZJOA 4IDPA 2VPPA 4EPTA 4ZIRA 5KDDA 1AZTA 2V54A 2NZ8A 1JAHA 1G64A 3BERA 1JBKA 1LY1A 4YONB 1WXQA 1SZPA 2WAYA 1E0AA 1J90A 1U8YA 4BZQA 4Q1FA 3VNUA 2P0EA 3KJHA 1ZNZA 4ZDIA 1AM4D 3KX2A 4TMXA 3FMPB 4FN5A 4EFLA 3AGQA 4EUNA 2HUPA 5EP4A 3QVVA 2IWRA 3UXMA 4BFVA 3R7WB 5J4VA 3H0KA 2QMUA 2OILA 2CCJA 2DFLA 4LI0A 2IBMA 2OFXA 4QFMA 2QM7A 4I99A 2IYZA 2YHSA 2OT3B 4L15A 1RRPA 4US1R 2OUKA 2VRWA 1IN4A 4DRZA 3ONWA 3GCGA 3SBDA 2OXRA 1OIXA 1V5WA 1YR6A 3Q85A 1T5IA 2E1RA 2QP3A 1NG9A 4PQFA 2WJJA 3FDIA 5D3MA 3V00A 2FSHA 1S96A 5TARA 1S3GA 4HDQB 2O52A 2HYIC 2F6RA 1M7GA 1JR6A 1AKEA 5DH9A 2P65A 4JSTA 3WMFA 1EWRA 1RJ9B 3LRPA 2C95A 1UAAA 5BN3A 3LO5A 2C78A 3X2SA 1GNQA 3LY5A 4Q4HB 4A0HA 2QQ0A 3K9LA 3TSOA 2DBYA 2FZ4A 4PC1A 3ADCA 1JEDA 1OJLA 1HE8B 2NO6A 4AKEA 4IOLA 2O8BA 4KO8A 2O8DB 4IOJA 5FL7D 2C8VA 2NO1A 1G3MA 1NBME 2GF0A 3EXAA 4TMKA 2CNWD 3TRFA 4R7ZA 2OV2A 2WWGA 1XU4A 2HEIA 3CNLA 3NBXX 1W0KA 2QE7D 2V1XA 5FPHA 2W2XA 3H84A 1AN0A 5CB6A 3T34A 1VPLA 2GCNA 3BBPA 1EX7A 3OE7D 4DWJA 2ZR7A 1ELOA 4P4TA 4GPTA 2JAQA 3TBKA 2O8CB 1X1RA 5J40A 4TZ0A 1Y3AA 2ERYA 2QSZA 3H4MA 4M4SA 3L0OA 3ZVMA 1QG2A 1TMKA 3EC1A 4F4CA 5GJWC 2GAOA 1N0WA 2J59A 4RFVA 4Y0VA 4RD0A 3RRYA 4BFZA 2L0XA 3WP1B 4EPWA 1KDRA 2ANBA 3EZ7A 4Q1BA 3QENA 4TLEA 3W9YA 2GXQA 1LV7A 3BJIC 2GJ8A 2JIZD 1SXJE 3WRYC 3QVUA 4O2LA 3K09A 5HCIA 2ZRIA 1NMXA 1ZC4A 4MRVA 1NLZA 1S9HA 1NVWQ 4J0QA 1RJ9A 1FX0A 4OHVA 1KNXA 1OV4A 1T3LA 2I4IA 1CBUA 3EWAA 2OCPA 2W83A 1LF5A 2ZPTX 3PFIA 1VMAA 5FPYA 3MUFA 2ODWA 3D3QA 4PC2A 3CWZA 3P4YA 2J45A 3L8YA 2XNDD 4YC7A 2AK2A 1N6IA 5L3SA 1ZUNB 1ZD1A 4KSCA 2HLDD 3P32A 3TH5A 3LV8A 4QC2A 4AC9A 2CHGA 2XAUA 4G1UC 4HAUA 5DSZA 3U3OA 3WNBA 1XCMA 3AKCA 4OHYA 1U81A 3OE7A 2QROA 3VAAA 4BLQA 2QTVB 5JCZA 1HYQA 4ZV4A 2REXB 3GFTA 2MSDB 4B44A 2CVFA 4CEHB 3R7WA 1IM2A 3RSOA 4YQFA 4NYIR 2VHUA 4LDJA 1E2DA 4PHHA 2C77A 3QXJA 4Q19A 4PQYA 3UKDA 1XXHE 2RGXA 2LWIA 4HLQB 3QSYA 3G82C 3DEFA 1G3RA 1OXXK 3HU1A 3MCAA 1E2NA 1W5TA 3MD0A 3N2EA 1G19A 1OB5A 1RRCA 3PG5A 4KLNA 4IEIA 3A4NA 3B82A 4M1WA 2KWIA 4XTCS 2F9LA 2KJQA 4BLRA 3QJYA 1XD2A 3IO5A 3BD9A 1E2JA 3GJ8A 1GG2A 3Q3JB 4KI0A 5HE9A 2RGBA 3RABA 4B71A 3EPKA 2PMKA 2YOHA 3L82B 4DCNA 3B1WA 4E22A 2I3BA 1K6MA 1E4YA 2ZS8A 4V0ME 4B2IA 5J47A 3EA0A 4U5XA 1HH4A 2GA8A 4TT3A 4TLAA 2XSZA 1E2KA 2C9YA 5KPDA 4IVQA 4BFTA 1VCNA 3U3MA 4URXR 3AP2A 2QTHA 4A92A 3CR7A 5KNCA 1OFHA 2V55B 2QPOA 5AUQA 2GJ9A 2E87A 4HSEA 1EFRA 4JIMA 4I1UA 4M1SA 4V0OA 1GNRA 2J0SA 4ASUA 4WW0A 1WBDA 1TPZA 3K0EA 4IW3B 1G9XA 1KO4A 3BIFA 1FP6A 3KQNA 3FPAA 4R9UC 1MR3F 1U90A 4QJ4A 5FBQB 3PJRA 1COWA 4Q02A 1KSGA 1GUAA 5CK4A 3BH7A 2IYLD 5LDDC 3BOSA 4ACBA 2H1LA 2LKDA 4ON9A 3VHLB 3LW8A 4HAZA 3S1AA 2GZHA 4QGFA 3K9NA 2FH5B 1KI3A 4Y0AA 2Q0HA 4LJAA 2HCJB 4TLCA 4MRNA 4Q7JB 3EG5A 3GJ6A 2OG2A 2PZFA 4M22A 5A5GA 2YOGA 2DHRA 4JZKA 2OCBA 3Q7PA 1NKSA 4C7OA 2XZPA 1SKYB 3BORA 1VG1A 3WHKA 4X8MA 3WYFA 2NO0A 1VIYA 3QPWA 4PAOA 3AV0B 3PEWA 2V7QD 2Q6TA 4A2QA 1GRRA 1JEEA 4L5BA 5BYJA 1A2BA 4PPNA 3GLHA 5JJKA 5FOTA 2PZEA 1XRJA 1U9IA 4IJMA 1VCOA 2BM1A 4PO1A 4YMSA 4Q4AB 1A82A 5G41A 5KTYA 1E96A 4K81B 3MWLA 1HE1C 2ZJ2A 4QHSA 3HJNA 2WSSA 3ZD7A 1R8QA 2O8EB 4OK3A 5JHGB 1KDPA 4DUGA 3GLGE 2RGNA 5JFGA 2ODEA 1JXOA 3K0AB 5DHAA 4EJSA 3LA6A 1N0VC 1TF7A 4PXAA 2WWYA 1ESNA 4G5RA 4D4MA 5EE0A 3GJ0A 1W4RA 3MMPA 4JLMA 4IOKA 4EFMA 1XNJA 1E4VA 1W4AA 2FSGA 2R6CA 1NRJB 5DHFA 5LBIA 2XOKA 1R5BA 3SS8A 1X3SA 1EESA 1WRBA 5G3YA 1AJEA 2A5DA 2QA5A 4RSGA 4LX0A 4DLRA 4TL7A 4BLOA 4BZPA 1BIFA 2XSZD 1DAKA 3BB4A 1E0SA 4WIAA 4AK9A 3ND9A 2EYUA 1XPRA 2XXAB 1KI4A 4GRAA 2AD1A 5CK5A 4MDEA 3TLXA 1PUIA 1KO5A 1MO5A 1NSTA 1Z6GA 4JS0A 2FMXA 1NVVQ 1O3YA 2Q9AA 2VSOA 3F3YA 5KO2A 5HR5A 2BM0A 2WM9B 1II9A 2HCBA 1IBRA 3RNLA 3GMTA 4GSYA 2CHQA 3U7GA 2GAAA 3DDCA 1JAIA 1DS6A 1ZIPA 2WZQA 3BE4A 2HXYA 4HB3A 2QBYB 4DBLC 4D26A 3KZ1E 4GI7A 4DJTA 1S1CA 1ZNXA 2IYVA 4JYCA 4YDSA 3B2EA 1B23P 5JS8A 3B9QA 2EFEB 3BH6A 4OI1A 1T9HA 4EQ6A 2VTKA 2JLVA 4LJYA 3VKGA 2A2ZA 2EW1A 4M53A 5JWHA 3CF6R 4DXAA 1XTQA 2XNSA 1XXHB 4D2IA 4AYWA 2REBA 3GPLA 4LOAA 2HJGA 3K0FA 1G41A 1Z8FA 2A3RA 3DZDA 1GILA 1Q3HA 3CX7A 1KY3A 2Q3HA 4H1VA 5G53C 2QRZA 2PX3A 3CBQA 4IVRA 3EZFA 3PXGA 4LPSA 5DO9A 5FOUA 5FH9A 1JI0A 4TMZA 1KJZA 2QMOA 2ZUBA 3LBIA 4I1VA 3GLIA 1DO2A 1QG4A 2ODNA 4B6FA 1P2UA 1F2UB 3ZDQA 3SYLA 1CP2A 1HV8A 2GHIA 2OBNA 2BBSA 1AIPA 2IL1A 4A82A 2P5TB 2ZS7A 3K9HA 4BFWA 1M1YE 2ERXA 3UG6A 3TKLA 4HZIA 4DIEA 3LWNA 2N42A 4GP6A 1Z83A 3C7KA 4DT1A 1I4LD 3UANA 1P2SA 2GWHA 2B6HA 3B78A 2F7SA 4HAXA 1MRNA 4Z1MD 1TU4A 1Z0FA 3U6BA 3ZZ0A 4N1AA 3SEAA 3OIUA 1II8A 2IXEA 4ILEA 1Z0IA 2PMDA 4PC6A 5F3WB 5J4HA 4KLZA 2ORIA 4XJXA 2QTFA 2VH5R 3BS4A 3CONA 4Q1DA 3TK1A 3F8TA 1R0ZA 1YHNA 4M9XA 3KB2A 1TUEA 2ORWA 2FE4A 3CKLA 4Q48A 5EQTA 5FI1B 3T06B 4L9SA 3PEVA 1US8A 3SJZA 1FOEB 2LCFA 3ZIAA 1LNZA 4QJ3A 3EIHA 4PQRA 4XVRA 5IHPA 3GJ3A 4OBEA 2X2EA 721PA 3GEIA 4YDHB 4TLDA 4TWZA 1SVWA 4KU4A 1P9WA 2G6BA 3PR1A 4F93B 1GFIA 521PA 4TLBA 4FI3C 4B47A 1MRSA 1U0LA 3N2IA 4BFUA 5SZKB 4B3CA 2I1VB 3SYNA 3NC0C 2PH1A 4ERNA 4O25A 3I32A 3IBYA 1GRQA 1JJVA 2AN9A 4FCVA 3L8ZA 1ZMXA 3LFUA 5SZJA 3HYTA 5HPYB 3MWJA 3RAPR 1SVSA 1R6BX 3CRVA 2MMCA 4XTRA 1NLYA 1XP8A 3K0CA 5ELXA 2NOAA 5CJPA 2EFGA 3ZQ6A 4LBYA 2D74A 2GK6A 2VQSA 3IPXA 1EFUA 1G4UR 3MG9A 2WJYA 3OEED 4EDHA 1UBFA 3D6TB 3VNVA 2XITA 4GL2A 5TMPA 4M1YA 5JZVA 4HEJA 2YINC 3K53A 2BV3A 3C41J 2EFHB 4B6EA 3P20A 4AIIA 2FSIA 2VP5A 2ZI3A 1WF3A 4YXWA 2QPTA 3WMEA 4ARZB 2F43B 3FWYA 4FCWA 3VFDA 3EX7C 4KBGA 3NEJA 4OQNA 2IK8A 3WNDA 1OXTA 4LYFA 1LS6A 4OQFA 4PTLA 1SGWA 1HY3A 1SQ5A 2OAP1 3RLFA 4AKGA 2GZAA 5FOVA 2G83A 1N5KA 2ZRHA 3I8SA 5L3VA 1OSNA 1NL3A 1T8UA 3PEYA 3WBJA 1ZCBA 1CEEA 3TUZC 3TMKA 4B74A 2I1QA 1KAGA 1OKKA 1W1WA 2VF8A 5AK0A 3VKWA 2ZI5A 5C2JB 3REFA 4V03A 5E7JA 5L8VA 1XEXB 2QEQA 3NH6A 2GESA 3WRXC 1UPTA 2IC5A 3FKQA 5KDOA 2P67A 1GKYA 1AK2A 1ZNWA 2FN4A 1KI6A 2QE7A 4DLXA 1PLKA 4D25A 1T0JB 5IF9A 2BJWA 2QP4A 3KQHA 4RJLA 4OKSA 3PUVA 3A1VA 4YMUA 2FJUA 4Q9LA 2QAJA 5K8TA 4L8GA 4NP6A 3QE0A 4A4DA 1IN6A 1HURA 1LW7A 1R0WA 1QHXA 2YC2C 4WA7A 2GEDA 1JB1A 2AFHE 1JQLB 4MRPA 3THXA 4NU0A 1GSIA 1GRNA 3Q9LA 4KAXA 1KKLA 1BS1A 1L4YA 1FQJA 5BQ5A 4GOKA 3ADDA 3A4LA 4ZCMA 1F2TB 3DMNA 1XTSA 3KFVA 3M6AA 4URZR 2H17A 2DWOA 3TVDA 5B64A 1RFLA 2JIZA 4C9BA 3PUXA 1VIAA 2OLJA 3FHCB 1A1VA 3PUZA 2YV5A 2KSQA 4POAA 4KXFB 1NMYA 3W3AA 1D5CA 1CJTC 1SKQA 1X8KA 2EU8A 2QL6A 4RFSA 4JT2A 1D2MA 4W5WA 1OH8A 1RE0A 3O8CA 4PSVA 2BIFA 1KI7A 2CE7A 4LV6A 5H68A 3DPUA 2ZJ8A 3QF4A 4OHWA 3D7MA 1G8HA 4CEJA 5EP3A 4A6PA 5JI3E 2YNMA 4IHQA 2ZRBA 1G18A 1SXJD 4GDFA 3GD7A 3K1JA 2QBYA 2R2AA 3AH8A 2ZI7A 5EXPA 2WWIA 2VEDA 5KOYA 4UNRA 4V0LA 2JLYA 4JVSB 5BN5A 3ASZA 5IDVA 4IEEA 4NH0A 1T6NA 1U94A 1OB2A 2FGJA 4U00A 1N5LA 2H18A 3KKOA 5L3QB 2JJ2D 1KI1A 3AGPA 2OHFA 2ZANA 1KGDA 3W5JA 1E9EA 4XVQA 1IXSB 1NBMA 5JSZA 4Q7MB 4TTRA 2XXAA 4I1SA 4G5SA 3G5UA 2OZEA 2NGRA 4MKHA 4KYIB 3W34A 4PC3A 2IUUA 1T4GA 2GZDA 1QHGA 3IQWA 4LJ5A 2QQEA 1KYIA 3EPJA 3T1VA 2A30A 2V7QA 1VKJA 4JT4A 4UXHA 1IAQA 2VHQA 3U6KA 5E7IA 3LAWA 1NNEA 4EJSB 3KQUA 1XEFA 4A2PA 4JLNA 1JR3E 2PJRA 2IS2A 4OI2A 3PUYA 4JLPA 4Q00A 4QGHA 4XWOA 1BYUA 3A4MA 1GNPA 3FMFA 2P3SA 4RCYA 1E9RA 4RZUA 4B35A 1FW6A 2ZE8A 2V8OA 2NIPA 2ZI6A 3LQRA 1Q57A 1T91A 4B75A 3ZD6A 1Z0JA 4U02A 2VBCA 2WV9A 4CZ2A 2RHMA 1W4BA 1G17A 4OK6A 5A0FA 5FOXA 1KK3A 2WWXA 3TQFA 2CMKA 1G5RA 4TL6A 1CRPA 1MO6A 1E2MA 2TMKA 3LD9A 1OH5A 2IHYA 1E9SA 3JZAA 4PZYA 2GDJA 2RMKA 4ABYA 2J0QA 3FMOB 1QZXA 4RZ3A 1F3OA 4DLSA 1CR1A 2FX3A 1OF1A 3AVXA 1XF9A 2B7CA 1Q1ZA 3U2QA 2EFDB 2O8FA 1AQUA 4R2IA 2C98A 3FMIA 3OF5A 2RGEA 4IFBA 4DSNA 2PEYA 1L8QA 1HEIA 4JBXA 1FP7A 3I62A 5AWFC 3CNOA 2ZIAA 3HYRA 1G6HA 4JL8A 4D0NA 3IQXA 4DSTA 2W2TA 4LJ7A 2BBWA 1AZSC 1S0UA 1YKSA 5HKKA 1M34E 1ANKA 2BBOA 3EC2A 4IKEA 1OIWA 3CIOA 1F2TA 4LZZA 4TQUS 4FMDF 2AXNA 3W6PA 2NQ2C 4QBIA 4XVUA 2BKUA 2Q3MA 2ZRJA 1XX6A 3FKSD 2BMJA 1D8TA 2OLKA 4B2PA 3CLVA 3QKTA 4US2R 4QBHA 1RW4A 1GL6A 4QNMA 3CNNA 2AD5A 2HYDA 4JVLA 1S8FA 2F1RA 1XZPA 4DLWA 2DWPA 3IIKA 3O8RA 1S4QA 5EUMA 1P75A 5P21A 1UBCA 4RZXA 3SQXA 3RWOA 1T3HA 2Z43A 1ZD9A 3REGA 3MWKA 3L0SA 1BMFA 1KO1A 5HE8A 3TUIC 4TYQA 2CJWB 2HJVA 5TV2A 8OHMA 1KI6B 1OFIA 5FTJA 2W58A 1TEVA 2R6GA 1L4UA 4LHYA 1GP2A 2WICA 3SBEA 4ZKDA 3CPHA 1CF4A 1KMHB 2QM8A 3HPRA 3C8UA 3AVVA 1F6BA 2X8AA 2WKRA 4NCJA 2OBLA 1K5GA 2XZOA 2O0KA 2XX3A 4LJ4A 4NYIQ 3THYB 4MRSA 1DBSA 1G3QA 1PZNA 1EG7A 3KKMA 4DLVA 1S3SA 5EXSA 3EZ6A 5JJIA 1XCPA 2F1IA 3AKYA 4B3GA 4PAMA 4CF7A 3T12A 5JEEA 4UXIA 3FGNA 3I5YA 3DL0A 3N5CA 3GLGB 2BOVA 2ZJ5A 3RDPA 5LB2A 4NYMR 4C0JA 3IPYA 4DDWA 4GZLA 3B7GA 1FUKA 1P7CA 2OCAA 3LLUA 3FVQA 5H8WA 3BB3A 3CRRA 3DKVA 1RRGA 4OK5A 2ZJBA 4QGAA 1UDXA 1IN7A 1W0KD 2YJTD 1P62B 1UKZA 4JLBA 1CJMA 1EWQA 1DTSA 4ZI3A 4MYUA 4QOSA 5FOSA 1MT0A 2ZRGA 3RS2A 2BCJQ 1XTKA 4JJZA 2AKYA 4B34A 3W3ZB 4IFEA 5FTMA 4CEHA 4RD3A 4B32A 5KSZA 2WMOB 2Q9BA 4C0SA 2JLRA 4AY2A 2B8WA 3ZIAD 4ZPXA 3RRZA 5FBVB 2YKGA 4DLTA 3UMRA 3C14C 3U44A 2GVDC 1VYUA 2C03A 3BK7A 3P27A 4NPHA 3NTUA 1LFDB 2DY1A 1O87A 2YZ2A 4TTPA 4AYTA 2ZITA 4AG6A 1P4SA 3M0EA 1E1QD 3PV0A 5JHHB 2ONKA 2PLRA 3CRW1 5J4KA 1GZSA 1G5PA 1G6OA 2JLQA 2OE2A 2PBRA 2RGDA 4YMWA 1VG0B 2AWNA 2IS1A 3VU9A 4EAQA 5CIQA 1TUIA 2BVNA 2JA1A 1Z63A 4QGGA 2G9NA 3TR0A 2QPAA 3K0CC 1MABA 4DDUA 2VHCA 3CR8A 4F7WA 4US0R 2Q3FA 4E5UA 3U3KA 3AVQA 4HDCA 4DEXA 4PPFA 3D31A 2BEKA 4UXJA 1KY2A 1XPUA 1UEJA 4RKEA 4X8LA 1NIPA 1J70A 3NBYC 4RVCA 1H8EA 2XGJA 5HZHA 2X1VA 3IILA 3CRMA 2QRNA 3RYTC 4DT1B 1KZ7B 1WQ1R 3EA5A 2ZXUA 3EARA 4HUQA 4DLUA 1E32A 1P5ZB 4NKRA 1GVNB 2GXSA 1XMJA 4FMCF 1HQCA 5JLJA 3CW2A 1Q21A 1IONA 2H8KA 3A1UA 3OIWA 5JMTA 3O8DA 3B8HA 2IF0A 1DG3A 2FZLA 1XJQA 1F2UA 4XWAA 4NYJR 2X2FA 1NN1A 1Q1QA 1KI2A 3FTQA 4RKFA 5DN6A 4C0AC 4IDQA 3DOEA 3SHFA 1E9BA 2FU5C 4V0MA 5E7MA 4LHWA 1RVDA 3NHBA 1PV4A 2QUZA 3GEHA 3R9XA 4GOJA 4OHZA 5DE3A 2QT1A 1F48A 2N1BA 2A9KA 2NO9A 5GVSA 5F98A 1UM8A 2D7CA 4P4UA 421PA 4XD7A 2GILA 3BFXA 2KI5A 1MV5A 3QQ5A 4KFRA 5DN6D 4BUJA 1GTVA 2R44A 1I4TD 2GXUA 2SHKA 4O3MA 1IN8A 1PLLA 2ZETA 4PZZA 2RGCA 3DM9B 4DCTA 3K0SA 3T1OA 4CW7A 2IXGA 1TNDA 1KI9A 2W00A 4NTZA 1W0JA 1DO0A 3UG7A 2DPXA 2RGGA 1I2MA 2PCLA 1ZM4A 3NDPA 1I2DA 2KBFA 1RRFA 4UJ3A 1VHLA 3ND8A 4GBMA 2ZSBA 2WMNB 1CJKC 4NMMA 2X19A 1OXUA 2A5YB 4AI6A 4FWIB 1E1RD 2JJ8A 1YZQA 3RRNA 1R0XA 4KITB 2GEUA 1NKTA 1TU3A 2YVUA 1XZQA 4TN1A 1TQ4A 4NCIA 3QKUA 3G0HA 1P2TA 4M2LA 3EW9A 2VHJA 4ZIRB 4Z8YA 1FMJA 4Q9JA 2FWRA 4KV9A 1KAOA 3K70D 1Q1BA 3KJIA 4NHOA 3RSLA 3MSXA 4LY6A 4GNKA 4BPBA 1WMSA 4A2WA 5DI3A 3A58B 2B92A 1KDTA 2LKCA 4JKIA 5KSPA 3K0AA 2ZE7A 1DOAA 4UJ5A 1IXRC 1SULA 4FXPA 1E9CA 1FTNA 4PSKA 4TMWA 4DDVA 4BRUA 3GLFA 2ZYTX 3VTKA 2O8EA 3B85A 3RS4A 1H8HA 4JSYA 4LHVA 3NBFA 4WVFA 3FE2A 4KFTA 5JWRA 4FIDA 2WTUA 4M1MA 2IYQA 3OEHA 5F9FA 1YZTA 1FL9A 1ZM9A 2G0NA 2QORA 2VP9A 4LJ8A 4PAQA 4DLYA 2ZR9A 1WBBA 3WMGA 3KUCA 1W49A 3I61A 2A5FA 3ASYA 4FMDB 3O8BA 4BGDA 1ZC3A 3IHLA 3GLHB 4JL6A 1WB9A 4LGMA 3W6NA 4WAUA 2WSMA 3CM0A 2YOFA 4D4KA 5IRCD 3TW4A 3NG1A 4MQBA 4WZ6A 2JJ1D 3LXRA 1YR7A 4HB4A 3SR0A 1VCIA 2VLIA 1E9DA 1E2EA 4Q4JB 3LVRE 1G7TA 1NN0A 3SJAA 5DI9A 1DEKA 4A0RA 1CXZA 2P5SA 1DVRA 1BOFA 4G5OA 3B5JA 2JLSA 4FCTA 2V1UA 1VDZA 2ZAOA 4D81A 2IHBA 2FDCA 2ZREA 5KHOC 1SXJC 3T5GA 1YZKA 1YZLA 3AUYA 4AKIA 2HF8A 2ZRKA 3F5FA 5EE5B 4A0GA 1ZU5A 4M1OA 3B6EA 1IN5A 2IW3A 1YE8A 2J3EA 4Z54A 3OESA 2FSFA 1KSJA 2CE2X 3A37A 5EZ6B 2CL0X 1GITA 2JCSA 4XSHA 5GJVC 2ZRFA 4HATA 3MJHA 1VTKA 3HDTA 4URVR 3QNUA 1M6NA 3GP8A 5AJWA 5EE3A 1G16A 1N2CE 2RKOA 1E2LA 1OLOA 2CL6X 5FPSA 4A9AA 2J7KA 4RD1A 2IS6A 4HZUB 1E2FA 1P73A 1HA3A 1EFTA 4HI0E 2YYZA 3LDAA 4A8JC 4CYMA 1OPXA 1MKYA 1ZD8A 3BFKA 3DO6A 4LHZA 1IJEA 4UQOA 3MJRA 3GLFB 2BDTA 2FG5A 2AK3A 1TF2A 2ZE6A 1CIPA 3EIQA 3U7EB 4LV5B 5DI3B 3AM1A 1MO3A 4W5JA 1WCV1 4FW9A 4LBVA 5K8LA 4XSGA 3CX6A 2BMFA 2XB4A 4Q5IA 4V02A 3QXHA 1JPNA 1TAGA 4L16A 1JPJA 1Z07A 2QMHA 4M9ZA 4TSFD 1Z08A 5FUYA 3B13B 2UKDA 3JVVA 2ZJAA 2PZGA 3QG5A 1U99A 3ZVRA 1PJRA 3QKRA 4URYR 2ASEA 3X1YA 3AKDA 2QY9A 2ATVA 2WPDD 1KMQA 4OHXA 2NMVA 4ESVA 2V6IA 5AJXA 1U0HC 2XTNA 3QY0A 1NJFA 3OAAA 1DAMA 1E79D 4H1UA 3RHFA 4BE7B 2PL3A 4G3XA 4P0TA 1W44A 1NJGA 2PLFA 3BFVA 4CT5A 1ZINA 3WYGA 1XMSA 5FBWB 3V4RA 1SKYE 1VYTA 3RC3A 1Q3TA 3GJ4A 2ANCA 3ZGXA 2OCYC 3MRSA 4G0NA 4NONA 5DYIA 1KK0A 3GFPA 2J9RA 2WIBA 5CLLA 4BLTA 1TX4B 3NXSA 5JRJA 2ODBA 1X8JA 3PUWA 4ASUD 2J87A 3SHWA 1E94E 3QEJA 1LVGA 3QKSB 4BEBA 3TNFA 4JBYA 5FR1A 1KTVA 3VKHA 3CZQA 4BFSA 5HCNA 2J46A 4B33A 1W36C 1DAIA 3KJEA 4L4UA 4TYPA 3SDZA 1KSFX 1TEXA 4ZDKA 3V9PA 2CDNA 3IEUA 1IHUA 5EUQB 2OFWA 3U5ZB 4I81A 4P4SB 1DELA 3H2YA 2RHDA 2W6ID 4QHTA 4PHTA 4DSUA 2OFOA 4U7DA 1W5SA 4R2HA 5EP1A 1CR4A 2BHRA 2CXXA 5DLQC 4C2UA 1P9NA 4D80A 1HTWA 4Q47A 1NBMD 2D06A 4HAYA 4XH9B 3WY9A 4TL9A 2IYTA 4Q4JA 5EE9A 4BQSA 3QG1A 1M2OB 1E1QA 3IHWA 3HU3A 4Q4LA 5G3ZA 4CVNA 1JECA 1DAEA 1ZM7A 2ZEJA 1N6LA 2JDID 1U2RA 2YWHA 1S9DA 1ZUHA 1W4CA 1M7HA 2JLUA 4F4JA 1BH2A 3SU8A 1W46A 4CT4B 1D2EA 4HUQB 2O8CA 2FNAA 1T3SA 2VP2A 2J5XA 3C15C 5IT5A 4I4LA 4NE2A 2C96A 3ZH9B 1YRAA 1AGRA 1E98A 4Q03A 1TQ6A 3UWKA 4JBWA 4H9GA 3AF4A 3I1FA 3K9GA 4Q1EA 1P61B 4Q9IA 1G1MA 1PUJA 2WPDA 3SI7A 4E03A 3AVTA 4MUBA 4Q21A 5C18A 3W5IA 2JASA 1N6NA 1KDOA 1VG9B 2ZRLA 4GFDA 1X1SA 3RS5A 4B3BA 2XJ9A 2WWWA 3R9IA 4DIDA 1RZ3A 5AUNB 5K8UA 2CHVA 1W47A 2ZYVX 3Q5EA 5AUOB 3LH5A 2IYXA 2X77A 4BRWA 5KDLA 2QN6A 5E95A 1MABB 3AEZA 5KSOA 2YWGA 3PIRA 3AVUA 3SYKA 4FD2A 5GADl 5A4JA 3LBNA 3P1JA 2P6NA 3VU9B 2AFIE 2ECKA 3KKNA 5LB4A 3KJGA 3LBHA 1XPOA 3AVYA 1FUUA 2IWHA 4S2EA 2QGZA 4Z8XA 2Z4SA 4UNSA 3C5CA 5C1BA 3QBVA 5JRZA 3GLHE 3BB1A 5D3MB 1GKUB 3SJCA 2DFTA 5DYGA 4QM6A 1SVIA 2J0VA 3SOPA 3U44B 121PA 1DAGA 2B21A 5SZIA 3J81k 1G4AE 4OQLA 4MITA 4RCZA 4XOIA 3IO3A 3ZJYA 4O2RA 3B60A 5FUVA 5HZKA 2IYUA 4URWR 4X8HA 1H8HD 2NZJA 4NCHA 2PT7A 1XTJA 2GF9A 2QI9C 4F92B 1J8YF 3IIJA 3U4QB 3KTAB 5AJYA 3VR2A 2ZSDA 1AGPA 3CUEF 4JVNA 1E9AA 2WJIA 2DFNA 2F1HA 2IEYA 5CIWA 3SQWA 1BMFD 2W6JD 2ZROA 1D2NA 3IUYA 3B9PA 4HDOB 1G5TA 1E2HA 2ZE5A 4P32A 2CK3D 5H1YA 1W2GA 3I92A 1YZNA 4FWTA 1KJYA 1OHHD 4LUCA 1GDDA 1N5IA 1EGAA 2ZTSA 1PLJA 3ZZTA 1NVUQ 1P72A 1LF0A 2DR3A 1N6HA 1UEIA 2VSFA 4MH0R 1ZIOA 3UATA 1V43A 3T61A 2AL7A 1ESMA 2NTYC 4LJ9A 1FNNA 3OHMA 4EJSC 1D9XA 4RD6A 4KVGA 2O0JA 3SNHA 3THYA 3KFXA 1FFHA 4Q01A 2A5JA 2CLCX 1KZGB 2VP0A 4K8OA 5L3RA 3TAHA 2GJAA 3TJZA 4A1FA 5E3HA 2IYWA 5HKKD 1Y63A 1SVLA 4JL5A 1YQTA 2ZJYA 5TB5A 3LW7A 1OT3A 4OI0A 1R7RA 4TQ9A 1W0JD 4LK2A 3ZVLA 3U61B 3ADKA 4OL0A 4WZAE 4HLCA 4IDHA 5FFMA 3TQCA 1NLFA 1G3UA 1MO4A 1E3MA 5KSYA 2BMEA 2CJWA 2GRJA 4BWYA 1VHTA 4MYCA 2RAPA 5FUXA 3NH9A 3BRWD 5CM8B 2WJVA 1GAJA 2ZRPA 4UNPA 4DUGD 4TYNA 1NVVR 3CH4B 3MAAC 1N25A 3O47A 2WJGA 3AQ4A 3A1WA 2RGNC 2IS4A 2J0UA 4QBGB 2O0HA 1E79A 3OZXA 4F4IA 1Z2AA 2GJKA 1M7BA 1IQPA 1QF9A 2FA9A 1J99A 1IJFA 1W36D 3AP3A 4YMTA 4LYJA 3TIFA 2ZAMA 4PR0A 2DCUA 1SVMA 3QUSA 4FINA 1OHHA 1XD8A 2VP4A 3ZZUA 4DB4A 3SZRA 4K46A 3TUJC 2QSYA 1GL9B 5JECA 2GK7A 4OI4A 2VHTA 2XEXA 3I5XA 3ICEA 1XBTA 2Z5FA 3TR5A 1YU9A 4BFYA 2IXFA 1G8GA 1RKBA 3LVQE 4Z51A 1OFUX 1VCMA 2ZU0C 4CEIB 2HT6A 4BECA 4YXWD 2O8FB 2IT1A 4C0BA 2QAGB 1YR9A 3R9WA 4M9QA 3GLIE 3THWA 1Z3IX 3SN6A 5TVKA 4PHGA 3FHOA 3LQQA 2WWHA 5BXQC 2EWVA 5AR1A 2F1JA 3AF1A 2Z83A 3GQBA 5BYKA 3PITA 1TQ2A 4HLUA 2JLXA 4WXRA 1L7VC 5FTLA 4V0NA 1NVXQ 3EAQA 3PCRB 4CIDA 4EPRA 2JJ2A 4KSBA 2WJHA 1IY2A 3NVAA 1WP9A 2HF9A 1SVKA 3CH5A 5F9HA 2O5VA 2QENA 1UDWA 3I4LA 1D6JA 1Q22A 1P9RA 3PVSA 4KFSA 1CS4C 1NY5A 1QDEA 1DARA 3W8NA 621PA 2R6AA 1E0KA 4MKGA 2ZI9A 1OE0A 4TYYA 1P6XA 2OM2A 1Z6AA 4CDGA 1XEWY 2ZUDA 1C1YA 4KJZA 3P4XA 4ZKEA 3C16C 3GLGA 4OYHA 4KBFA 1NSFA 4DB2A 3KB1A 4DZZA 4DDTA 1XTIA 4CGZA 2ZYUX 3A1TA 4RY2A 1ZU4A 1K8RA 1FMLA 5CM9C 5JEDA 4WBSA 2R6DA 4MGIR 4UNNA 5J4YA 1Z2CA 5F2EA 3ZQJA 2G1KA 4QKQA 1Q20A 1IY1A 4TZ6A 2A7QA 2D3WA 3RANA 5J4LA 1X6VA 5FBLB 3QXXA 2OESA 4QRHA 1E2QA 4HAWA 3VR3A 2D4HA 5JSZB 5KYKA 2GCOA 3QBTA 5JS7A 1U98A 1P3JA 1KMHA 3KQLA 1J8MF 3T15A 1IY0A 3CX8A 2Z6VA 2QP9X 1TF5A 3IKJA 1R2QA 4OQXA 4PO8A 4EFNA 1N6OA 3C4JA 5L3QA 2CLSA 2BCGY 2D2FA 1R0YA 4G5GA 5KUTA 3AB3A 4KHZA 4ITRC 3UK6A 2H57A 3C5HA 1YZUA 3FKSA 4W9MC 2C04A 2W6IA 1A2KC 3BH0A 1EX6A 1QHIA 2ATXA 2FPMA 1YJ5A 4G5QA 2CEAA 3RS3A 3R8CA 5FUWA 4E09A 2IEZA 4DCUA 4QHYA 1Q1EA 3T1QA 3TAUA 1CRQA 4MYTA 1R5OA 4CEJB 4Q9KA 2QAGC 1OFTA 1VG8A 4PFSA 2IX3A 2FEOA 1QHSA 1UKVY 1G7SA 2DWQA 3CB4A 1QVAA 1H65A 2OSBA 2ZYWX 4PSAA 4WXPA 1JJ7A 3SJBA 5FL3A 2ZRCA 2Q9CA 4AWXA 5D3QA 3IIMA 2VO1A 2WOJA 2OEPA 3OFND 2HDNB 5K8IA 3ECCA 5EXTA 3TW8B 3R20A 2QG6A 3I72A 4LPKA 4S35A 3CO5A 3D8BA 4IOMA 4N0DA 3OAAD 4TMTA 1EFCA 1YR8A 4WOPA 4QM7A 2G3YA 2GJSA 1GL7A 4HYYA 4BZXA 3ETLA 1XMVA 3U7HB 3H86A 1FTSA 2VP6A 2GETA 2UVQA 1N5JA 3RVBA 4JJKA 1R4AA 5UKDA 1D9ZA 2ZRDA 2W2VA 2XJ4A 4IDOA 2ZSEA 3AVOA 1KNQA 1QVRA 1KSHA 1QHHA 4LBWA 1E1RA 1G7CA 1S1MA 2C2HA 4M8NE 1NY6A 2WKQA 3DOFA 3P26A 4IVPA 2H7VA 4X8OA 3V4FA 3A1SA 1AS2A 1AS3A 3NWJA 4O0MA 5BW8A 4HLUC 4RZ2A 4B76A 4DCVA 2OAQ1 3ZVNA 2XB2A 1J2JA 3NDBB 3W6OA 1CLUA 2BMDA 2J7PA 1DADA 4P3YA 3AKEA 3K8YA 1XD9A 2PT5A 3HU2A 1XTRA 3OEEA 3K70C 4ZCLA 2REOA 4MA4A 3B1VA 3TGPA 4YLGA 2CCKA 3AF3A 2AR7A 3VX4A 3Q7QA 2XZLA 2CL7X 4MKFA 4QBFA 3QF7A 1JNYA 1QBKC 2MSCB 3GJ7A 1W2HA 5DGXA 4HLDA 2WOOA 1NI3A 2IYRA 2UZ3A 1UJ2A 221PA 1ZYUA 1FNMA 2VA8A 4AD8A 3AP1A 3QEOA 4M1TA 2FFBA 4JLJA 2MMGA 3X1ZA 4D6PA 3KXKA 4ZCIA 1AS0A 4AKHA 4BEJA 2H5EA 3BGWA 4MDFA 4A8JA 3OEHD 2R9VA 2GBLC 4PZLA 3HR8A 2KE5A 2EQBA 2RH5A 4R98A 4Q9HA 5TY0A 2F43A 5CB8A 1E0JA 3KKPA 5DISB 5AJVB 5FOWA 4N0EA 2JLZA 4LJ6A 5CYOA 3QI2A 2B7BA 4E07A 1XJ0A 1Z5ZA 4PO9A 4P33A 4BFXA 1CJVC 2ZSFA 3B1ZA 3KUDA 4XIGS 3UWOA 1E69A 1UKEA 3QXSA 4W5HA 1UF9A 3KKQA 1E9FA 3VQTA 1QHNA 4ESHA 3IGFA 2JDIA 3L2OB 1SXJB 3ICQB 1I4DD 2FOLA 3ADBA 1LB1B 2QGNA 4DCSA 4D4LA 5CJ2A 4UKDA 1CR0A 1FPMA 2IUSA 2IYSA 3ZLJA 4KODA 1K5DA 4LRWA 2C5LA 3MFYA 4RD2A 2G88A 1AA9A 3SE0A 5LD2C 3IEVA 4JLAA 3L0IB 4D0LB 1ZP6A 3E70C 1OXVA 5FBRB 1TQDA 2ZR0A 2QAGA 3QF4B 2BC9A 1XWIA 2RB4A 4CEIA 1YVDA 2ZRMA 2QU8A 4G01B 3B1YA 4GZMA 1L2TA 5JWOA 4RFSB 3K70B 5FPKA 2ZVQX 3E2IA 4C3ZA 1X86B 3TSZA 1Z47A 4LC1A 2PEZA 3FB4A 1U9IC 2JJ1A 2N46A 2OO7A 2ZJZA 2FEMA 1XEWX 4HB2A 1CJUC 3VHXA 2Z4RA 4NYMQ 3DZ8A 3KXLA 5LD2B 1II0A 2G1JA 4QNRA 1RPZA 3UMSA 2RCNA 1G8YA 3T35A 1GM5A 3WHLA 5DIFA 2HT1A 3N70A 1HQYE 1JR3A 1NMZA 4HAVA 1A4RA 4OJKA 1ZVQA 5JCPA 4B43A 1IOZA 4TMVA 1ZAKA 4NBSA 3THXB 3CPEA 2EYQA 4MKIA 3TE6A 2V6JA 1OXSC 5BWMA 2J0UB 1M74A 5IK2A 1MH1A 2AX4A 2CVHA 4ZDWA 5KU1A 1R5NA 1QRAA 3HPQA 4MGYR 3NHAA 4B3DA 4IDNA 3EPLA 4NDZA 2EFCB 1GKIA 2CK3A 2VSXA 3CF0A 3R8FA 5AJZA 4RD4A 1Z0AA 1CU1A 2C9CA 4AG5A 1S2MA 4EPXA 2V9PA 4C30A 3X1XA 4HUTA 5B58C 2FV8A 2H92A 5AUPB 2ZRAA 5G40A 3W8RA 1BO6A 4JKYA 5ANRB 1LTQA 4NZYA 3WBKA 1XEXA 3AF0A 3I73A 4QXAA 2F55A 4PC7A 1T5LA 2GKSA 3EWSA 4EPVA 4NYJQ 1X8LA 3F0TA 1E99A 1U8AA 3I8XA 4Q7KA 5FTNA 5J5CA 5TDHA 5C4MA 4JVMA 3FOZA 4TYWA 4D0GA 2BKEA 3AF2A 1TTTA 4PPGA 4C0KA 2WWFA 3GEEA 1G21E 1N6RA 2R62A 3K0FB 2VIIA 5CDFA 2V3CC 2ZM5A 1XXHA 1DG1G 2DFKB 1G291 3MWYW 3LXXA 5LPNA 4M1KA 4EQ6B 3MLEA 4QL3A 4ARZA 1COWD 3NBZC 1KO8A 1OW3B 1E2PA 2ZQ5A 1VYVA 3HR7A 3VX3A 3OIYA 3KQKA 3KTAA 3U4QA 1G7RA 2JEOA 5B57C 1SXJA 5KPJA 5CLQA 1F5NA 2J41A 1KO7A 1Z6TA 4GT1A 2ZRNA 4KFUA 2YWEA 1HT1E 1GOTA 4LHXA 3IBGA 2FGKA 1UBEA 2AKAB 3QXCA 2F3TA 1JQJC 2PCJA 3MGCA 2BBTA 2E9SA 3A36A 1RC8A 4EPYA 3U60B 1E2IA 2GNOA 1Z6YA 5GVRA 3ZS8A 4DSOA 1M8PA 2A5GA 2W0SA 2ZU6A 3E1SA 3X1DA 2ZS9A 2VYFA 2J7PD 1WA5A 2GBLA 2WIAA 4A8JB 2ZVPX 5EE1A 4BASA 2YC4C 4MUAA 1VECA 5JI2E 3LNCA 1UFQA 3DM5A 1N6KA 4W7SA 5E4FA 1N0UA 3VR5A 4QG7A 1P60A 2IUTA 3I3SR 3IDQA 2UZIR 1FZQA 2NG1A 2WAXA 2FFHA 3CF2A 1QHYA 4B3FX 4MGKR 1JR3D 1DAFA 2HV8A 4F91B 3KXIA 1US8B 3QPUA 3LX8A 2YWFA 1ETUA 1W7AA 2H16A 3A6PC 2JLWA 3QPVA 3UPUA 6Q21A 5C46F 5CITA 1OH7A 4GMDA 1ZJ6A 1F60A 4DC9A 1EFHA 3U7FB 3NIBA 3EPHA 1G3IA 4LBZA 4D82A 1BKDR 1Z6XA 5FPTA 1II8B 2GVZC 3Q72A 1ODFA 2IYYA 4CRWB 2ZSAA 2AWOA 2RGAA 4LC0A 2NPFA 2WHXA 3FFBA 4B73A 5BN4A 4FMBB 1QHHB 3FYHA 1YZGA 4MYHA 5FR2A 1N3BA 1JALA 2C9OA 3KL4A 5EZ5A 2CCGA 2R8RA 4C0HA 5EJEA 1KIMA 4DLZA 4HB0A 4WZBE 1Z0KA 2ZUCA 2XNDA 1SHKA 4DKXA 1XB2A 3E5HA 4EKDA 2F9MA 1T0HB 1FQKA 4C7OB 1KK1A 2HLDA 3GLIB 2WBLC 3BAFA 5SZHB 2GTPA 3SFZA 1LS1A 3JZMA 1TADA 4YMVA 3AVPA 4B2LA 4TT3D 2AXPA 2BJVA 5CDFE 4P4SA 4B3XA 2MSEB 1CTQA 2R65A 5H70A 1Z29A 3KDSE 3VMFA 4ACAA 2FFAA 1G8PA 2Y8EA 4C0LA 4PANA 4NL4H 5TXGA 3WXMA 2VF7A 3NKVA 4ZI2A 3RRMA 2GEVA 3QKSA 4KVAA 1TL7C 4M21A 4DVGA 5DNYB 4BLPA 4C4PA 3NEYA 3GLFE 4A15A 3X1WA 2IA5A 4LWZA 3GJXC 1E6CA 2XTMA 1E2GA 1C9KA 1UADA 3L0PA 4LCBA 4ZDJA 3A8TA 3VR4A 2NO7A 5FI0B 2VL7A 1OH6A 3SC3A 3UIEA 1BYIA 4II7A 1Z06A 1H8ED 4DEYA 5JJLA 2Z0MA 4B48A 5JBQA 2JATA 2OXCA 3B1XA 3PENA 1WDTA 1NIJA 5GJBA 3L43A 3HWSA 3PQCA 1XFAA 2GCPA 4QJ5A 3EIEA 3OFNA 2B8TA 1Z22A 3VR6A 2R6FA 2D7DA 2XTZA 3AUXA 3FFAA 3T5DA 2GCOB 2QZ4A 1Q0UA 4TQAA 3WNCA 4IRUB 3QKRB 4C2TA 3M1IA 4A0FA 1G20E 2J1LA 3CWQA 821PA 3M4YA 1A5TA 2BEJA 3QOFA 1EK0A 2CNWA 2QT0A 1XD2B 3LX5A 1ZM2A 4MGZR 5FL7A 4LSGA 1RYFA 1UBGA 3GFOA 4M0LA 5HTKA 5KNDA 3RS0A 1AQYA 1A7JA 1CKEA 1CULC 1RIFA 4P31A 3U3RA 3FHTA 3RS7A 2NPIA 4EIWA 3AVWA 2V4ZA 5KNBA 1NN5A 1OYYA 3Q8XB 4Q18A 1NG1A 2IF2A 2CLDX 1KJWA 4JLKA 2EWWA 3QIAA 1HUQA 4M9SA 3UMFA 3W90A 2QMEA 2C99A 2F3RA 2QNRA 4A6XA 3BC1A 3BWDD 5GJCA 4HZUA 1N6PA 4Z1MA
chains in the Genus database with same CATH superfamily
5DNCA 3TRHA 5K20A 5C5CA 3P2MA 1B0PA 2QVGA 2P6RA 2V9ZA 1OVGA 2VNIA 1R10A 4E7OA 1FFCA 4L0MA 4PE5B 1H9BA 1OGJA 5K3FB 3ZS9A 2G80A 1DX6A 1U11A 4RE6A 3WSWA 1XNGA 3DXZA 1E8NA 4QVGA 5I9NA 2BFBB 1WVIA 4TVOA 1LC0A 3RROA 3ZYCA 2PJUA 3GJ5A 1NJ8A 3LGSA 3AQIA 2RGYA 1CUFA 3Q5DA 3FIJA 3KDPA 1WE2A 4GXRA 1OIVA 2HPVA 4PPQA 5TC4A 3TKAA 3AUSA 1U8ZA 3VAYA 4C76A 3FLMA 2F8LA 3RVSA 5IK2D 1BN7A 2B3DA 2H4JA 3L01A 1ENOA 4ZN6A 2RG1A 4W5QA 1KRWA 5F33A 1UP6A 4B82A 2WG1A 3V46A 1YC2A 3Q8LA 2NUPB 4TRRA 3SXUA 2VTBB 3PEUA 1BJKA 3ZWYA 2LVBA 1C7IA 3FLBA 2BFFB 3FSEA 4EK9A 3LMKA 1W0CA 3CO0S 1XQ6A 3O6VA 2O23A 3OOEA 1QQ5A 2IOHA 3CRQA 3FFWA 4L4XA 3RC8A 2NXJA 1UKYA 1A7KA 2JFXA 1SVOA 2OC9A 3KRTA 4WH0A 3SFVA 1JWBB 3WK9A 5J2TB 1F2DA 4WY5A 3S1AB 5T4FA 1ZH8A 4FJ1A 1DAHA 3DDOA 2OCDA 1SXPA 4BXOA 2V7VA 2O14A 2AT1A 2CW5A 1MW9X 4YUYA 3BM5A 1V37A 5EN4A 4NCKA 3T9DA 4ZTUB 2FF7A 5CNIA 4TXHA 3IS3A 2X5XA 4LV8B 4Q1CA 4OQMA 4D45A 4PG8A 2M6RA 1GAEO 1J0DA 1DCMA 1C9JA 4LSZA 2C7GA 4MZXA 1L4MA 3TOVA 1SU4A 2C4UA 5B3KA 4GO1A 1N2CA 4L5AA 1NDUA 4OXXA 4TSFA 1M54A 1KI8A 1XJCA 3JSXA 4TMYA 4AURA 1A9SA 1JV2B 4WLFA 3KXPA 1I9CA 2OBMA 4FMCB 5FBZA 1TYEB 4JLDA 4EEKA 3T1TA 4G9EA 4CM7A 1KK2A 1CR2A 4URUR 4F1WA 1YJQA 2QN3A 2Y1LA 3SPXA 3A28A 2P6UA 4HGNA 3C87A 5JAOA 4RDHA 2G0TA 3M5WA 4JXZA 3BD6A 4QBKA 1HYEA 4XB6B 4AUKA 4CQMB 1O77A 3DBIA 1DQNA 2D0PB 1EGMB 3A26A 3GGOA 5DHRA 3RARA 3SC2A 4AFNA 4ARIA 1ZNYA 3MTGA 1UXIA 4CV0A 1ONBA 3DMGA 3B6IA 1AKRA 4F2HA 2O8BB 4BV8A 1NTRA 3ZW9A 4Q3DA 1SUBA 1W48A 3VDMA 3K9BA 3VPGA 1JZSA 1IXZA 1XDGA 4EI9A 3SKXA 3FBTA 5DLPA 3RREA 3T99A 3WB1A 4MUFA 4RSHA 4ZQCB 5LMUB 4LZJA 1UZLA 3T9CA 5G0VA 5EIBD 2YMPA 5G4KB 1ZAYA 4PX9A 3TTXA 2Y3IA 1P2VA 3KBOA 5B2ZA 4KQKA 1JP7A 2ZCVA 2ZIEA 1EVEA 2BWJA 1J7KA 4Q24A 1DBIA 4MRRA 4ZMBA 5KDDA 2V54A 5AKZA 3TXYA 1QFXA 4KEAA 1LY1A 3ILYA 1UFRA 1WXQA 1SZPA 4G6ZA 1Y42X 4CQMD 4EMTA 2R4TA 2QX8A 4Q1FA 1E0AA 1ZNZA 1IB6A 3FXAA 3G89A 1AM4D 3HVJA 4CF5A 3PTLA 5DSTA 4DLNA 4Z3DA 3FMPB 1P9LA 1LI7A 3AGQA 2P1RA 3KQOA 5DP1A 2HUPA 3TLGB 5F1KA 4NHEA 1TW3A 4BFVA 4K8RB 3R7NA 4JNCA 2DPGA 2PSFA 4ISCA 4ZI7B 5FUMA 3QFSA 5J4VA 4FX2A 5EJAA 5IUKC 3I4FA 2CCJA 3NCHA 1XLTC 3BSSA 1G8KA 4WGGA 3HBLA 4EELA 3LQ1A 2ETXA 1AT1A 1XDDA 2IYZA 4I99A 5IC5A 2OT3B 1VL1A 4OHRA 1J0AA 2GFIA 5HM6A 3TEFA 4US1R 3PHIA 5B4VA 4MUYA 4MWEA 3GCGA 5K8VA 1JMYA 3LQFA 2CD9A 3NWOA 2WMDA 1J21A 5F7JA 1DL5A 4WACA 4E13A 1KPIA 2O6HA 2DX7A 1VKRA 4M38A 2O52A 1L5GB 2OVFA 5AKGA 2ZM6B 3JQ7B 3INGA 5DM0A 3ZDCA 4HEA1 1RJ9B 3LRPA 2C95A 1PZEA 2P9JA 2ID9A 1SN7A 3KXDA 3X2SA 3QV2A 1GKKA 1GNQA 1TA4A 3LY5A 1GXSB 3LC2O 5G0TA 4EX7A 3LQ4A 1E1CB 4M6WB 4NZZA 1NWCA 5BPFA 3FZGA 5P8WA 1X9GA 1RWKA 1ZLXA 1ACJA 3AIIA 1JEDA 1Z36A 3IX7A 3A3OA 3PUIA 2PL5A 3WDLA 2GM4A 2BEWB 4HF7A 5ERXA 1B1CA 2NO1A 4UE3S 3K8ZA 3FVRA 3RODA 3LDGA 1N9GA 2FE1A 2NV2B 3TRFA 2JL1A 1K7SN 4KWIA 4WK4B 5KVVA 3A4YA 3IAXA 5BVHA 1TK3A 4KIFA 1W0KA 4NDAA 2QE7D 2V1XA 2WJPA 3U4IA 4I4IA 5EIBC 5CB6A 3R3JA 3ZDBA 2NYRA 1VPLA 4RV5A 5ALPA 5IDWA 4NJMB 1G21A 1RZUA 2JAXA 3OE7D 5JT1A 5KCZA 2DERA 3MTJA 2QTBA 3UJ6A 3TBKA 2O8CB 5HCUA 1M8FA 3HJCA 2Y1EA 4JP2A 4MPDA 4BQQA 2XUHA 4U6NA 1TMKA 3ZVMA 5BW5A 2J09A 1KDVA 4BVKA 5LP1A 3HABA 1Z8NA 1M2OA 2L0XA 3M89A 2IYOA 3A10A 4EZEA 3JARB 5BVHB 4CL0A 2ANBA 1L7RA 4KIWA 2MCFA 4BEVA 3UKJA 1E3WB 3QENA 1H0HA 2DLCX 3DQZA 4ENUA 4IHJA 3LYAA 4K9DA 3FF1A 2GXQA 1Q7RA 3NI2A 4N4AA 4NZPA 2FW8A 1GSAA 4X65B 1N92A 2R1ZA 2X9GA 2NP6A 4M83A 4I6EA 4QPNA 1P1JA 3V7WA 5HCIA 4DREA 1G59A 1E1CA 2O5CA 1K7YA 1ZC4A 2WWVD 1SKMA 1CIVA 3D4LA 3VVMA 3X1KA 4E30A 4D6YA 2GARA 4Q9AA 3UGKA 5BN3B 1QVVA 4XWGA 1LUAA 4OHVA 2QYOA 1BG6A 3U4HA 1VRWA 1T3LA 2PPVA 5CG1A 4WD3A 3HL4A 4AMYA 3PNPA 1BEEA 4PGHA 3PFIA 3VRHA 1VMAA 3QLUC 1PGJA 2ODWA 3D3QA 3NZEA 5LR6A 2AFHA 5EQFA 2C07A 3P9RA 2WU4A 2J45A 2XNDD 2AK2A 5L3SA 4RNDB 1ZUNB 2BFAA 2N0SA 4KSCA 3K2QA 4BO9A 4G1UC 2XAUA 2C1ZA 3UJ8A 1QORA 3CKMA 1XCMA 4HR7A 4QU0A 1QPZA 1W87A 2CDCA 2WFZA 2D4AA 2FUG1 4JODA 3CEJA 4MJ7A 5JAPA 4CEHB 4COKA 2MSDB 2XKKA 3T5CA 3L8CA 1CDDA 3V8MA 5DHSA 4YP5A 1IM2A 1CUJA 3OSZA 2V96A 2ZJ0A 1QIHA 3GNLA 2AE1A 3WOHA 2HTEA 2HBZA 2O2XA 3R5XA 4PYKA 5EZYA 4GICA 4MHOA 3MCTA 2VUUA 4DR4B 1CQIB 3OZDA 1B7GO 3DCNA 2Q3DA 1Y4DE 2WF6A 3G82C 2IX9A 4O2BB 3Q3IA 2Q2WA 1KEPA 4ONEA 4R8LA 1CUBA 3PQ5A 4FFLA 5DXJA 3W4JA 3SC6A 5K8JB 1O8BA 1UEXC 2JC3A 2WFLA 3PG5A 1AD2A 3QOWA 4PLWA 3JYNA 3LKVA 2GYWA 3EBPA 5BMVA 5JYBA 4CN8A 2Y2VA 4P6VF 5LA6A 1G6Q1 3H9JA 2F9LA 2KJQA 3EE6A 2Q50A 4GGMX 3WQRA 2A9RA 4GM4A 1RBMA 3ZWBA 3RGGA 3G9TA 4IQ0A 3PKJA 3QJYA 1XD2A 4X3CA 3OQ1A 1QFYA 3SKYA 5CCEA 5ICMA 4UD6A 1IEVA 3GJ8A 3TQIA 2C0PA 2HU5A 1B8VA 1GG2A 3G8CA 2GPNA 4CM8B 1W35A 2PR2A 3UYKA 4HRAA 2WUFA 3L82B 5IFKA 1H3EA 3AL3A 3B1WA 5JAMA 2W9XA 4PTYA 4XLZA 1E4YA 2PKXA 4V0ME 4YP9A 4J6FA 5JROA 4OGFA 2FW0A 5EFOA 3QEBZ 3QBJA 3IAS1 5KX5F 9GPBA 2RONA 1RWVA 1COZA 2NXWA 1PNQA 5EIOA 2DLDA 3IDOA 3KZKA 1EWTA 4NFLA 5BV1A 2Q4OA 3P2IA 1O6ZA 2QTHA 4A92A 3CN7A 3HKDB 4N7MA 4EKIA 5DM4A 5AUQA 2DECA 5C5IA 4HSEA 1EFRA 3I58A 1KQPA 4M1SA 4PYNA 1CWUA 3HCOA 1MEOA 2J0SA 5B3AA 1HQKA 1YA6A 4F56A 3A6FA 5J2TF 1UQTA 3ANXA 3P2OA 4BNYA 4EHBA 3OD5A 1KO4A 3DHYA 1FP6A 1AF4A 2ZKLA 3OU2A 2CGEA 4BC1A 4KO4S 5FBQB 1U90A 1A27A 2X7XA 4QJ4A 4A2CA 4C1BA 3KKEA 4WGFA 2Q5IA 4XGQA 3K8QA 4HH1A 5CK4A 5GONA 1KSGA 3PFCA 5HHTA 5L4LA 1LSUA 5LDDC 1FDWA 2C7VA 2LKDA 4FFVA 2SECE 1VSUA 4BXOB 1I0ZA 2OBFA 1C1DA 4HAZA 4J76A 4S1TA 5GQSA 1RXIA 3S1AA 3AEKB 1UPXA 1JMVA 5LQSA 1UAGA 3K9NA 5DX0A 4CBVA 3DAFA 1KI3A 4JWKA 4ZC1A 2XB9A 5DWQA 1FS4A 3BRCA 3KVNA 3QPAA 4MRNA 4Q7JB 3D1JA 4LW8A 1TUBB 3EG5A 1CY2A 4YFYA 2PZFA 1PD1A 2D0OB 1EBFA 1P17A 1FRFS 3ACDA 4N76A 2DHRA 1D6NA 2OCBA 1M6YA 3NFRA 2M1ZA 1HYBA 3N0WA 4W5NA 2DFPA 4O2BF 4DOMA 3ZXIA 1TQ8A 3QPWA 2EIHA 1VIMA 1XTZA 2G7ZA 1R6VA 3QWFA 4D8YA 3GDOA 8LDHA 1DC7A 2Q6TA 4RPKA 3VM6A 4EI2A 5ICSA 3AHHA 4OXQA 1Z15A 4MEBA 4Z4EA 1U04A 3QVLA 3CTPA 1U2GA 5JJKA 2BHTA 4ISBA 2BISA 4WE3A 3OQOA 3MTEA 4FYWA 1U9IA 1BRTA 2C83A 3FI9A 3O73A 5HQJA 2FF5A 3OQBA 5DNVA 5K3FA 2BM1A 4JR2A 1Z35A 3M83A 3LP8A 2HM7A 3A3KA 3IXMA 1HM5A 2BFDA 4Q4AB 4YMSA 1A82A 3VUEA 1Y9JA 2WA1A 1S7CA 1E96A 5LUBA 2DMRA 2ZIXA 1Y9AA 2FP4A 1HE1C 2ZJ2A 2N75A 4KUEA 3D2BA 5G02A 5E2BA 4BP1A 5LQNA 4HWPA 1R8QA 3LDFA 1ULTA 4JEUA 1YF3A 1SHJA 1YBMA 3GLGE 3MGAA 3ZDZB 3D0KA 5DHAA 2A3NA 1ORHA 5ARBA 4ZREA 4EJSA 2VA9A 1N0VC 1TF7A 3EVZA 4PXAA 5KNCH 3KSRA 1ESNA 1K7EB 1QK4A 3MMPA 1YJXA 2B4AA 3IUQA 3T1YB 1E4VA 1W4AA 2FSGA 2XUIA 3LGXA 4LVCA 1IOLA 4RTKA 2YZMA 4ZOBA 1V4VA 4M0MA 1JKFA 3RSCA 3JVDA 5G3YA 2AEEA 1ZEJA 3HFJA 4LX0A 2ZWOA 4NULA 2AB0A 4OHBA 2J9FB 5K0TA 4EJFA 3KLPX 4BVEA 2A86A 3RUIA 1BIFA 2XSZD 1DAKA 3V1UA 3BB4A 4ER6A 1AKNA 2F8SA 2YN4A 1NT4A 3VYTB 1L0BA 1E7MA 5CK5A 2AD1A 4MDEA 1U3WA 3DFKA 3W0LB 4MS3A 5D2CA 2XUKA 3WG9A 2WRZA 3D3NA 2IPNA 4WN9A 1AE1A 4MWZA 2VSOA 4LDQA 1FSSA 2IJGX 5KO2A 5HR5A 1LEHA 2I34A 3IKVA 4PRKA 4B7UA 4EENA 2Q46A 1II9A 2HCBA 1X2BA 4B8YA 4CI9A 4FXOA 1E5XA 4B6SA 1MB0A 2WB4A 1AHHA 3AI2A 3U7GA 1U7XA 2CSXA 2GKGA 2Y9PB 3CVVA 4PRZA 1X9HA 2HXYA 2HY7A 3IEKA 4CCWA 5JBIA 3IR7A 3LLVA 1WQ4A 4BB9A 3NIFB 1WZUA 1HWYA 2NX2A 5JS8A 2C3UA 1MD9A 3NYQA 3EIWA 3RIMA 3WS7A 3FAZA 1RKXA 2VTKA 2D1TA 2JLVA 4LJYA 4UVHA 4ND8B 2A2ZA 1P8AA 3EQ7A 3L77A 4M53A 3INTA 4BKPA 5DNEA 1OXMA 1I33A 1XXHB 1YKFA 5K6AC 4LOAA 3E22A 4ZV9A 3K0FA 4MYSA 3OC0A 1T2FA 1G41A 2BFEB 2IDKA 4V39A 2ZRQA 4MV6A 5ALOA 5TVGA 3ZE9A 2YBDA 4LZPA 1EGQA 2Q3HA 3NOOA 4GMGA 1U4NA 1NVAA 1VIDA 3PE4A 5THKA 3N2YA 5U4XA 1I24A 1SUCA 1KAEA 1PT6A 1SIWA 2GPAA 2PMBA 3WYCA 3BKXA 3RIGA 4AS3A 5IMSA 2QMOA 3A1FA 3LBIA 3SQLA 3FSGD 4I1VA 4I5EA 3GLIA 1X19A 1ABBA 3F9IA 3ZKWB 1SOAA 1XYGA 1F2UB 4EW6A 4UM5A 2W2LA 3FYDA 1DEXA 1M2HA 4QUEA 4ECEA 1KAQA 4IICA 1N2BA 3H19A 1AIPA 4GPAA 3FVWA 1PS8A 5EIEA 2P5TB 4WHMA 4BFWA 2ERXA 3O3NB 4MLZA 1LQTA 2O2SA 4MUMA 2FMKA 2G8LA 3M6LA 3DLHA 3WIUA 1SG0A 5CGQB 2DUWA 2GM5A 5F64A 1R64A 3MC1A 3OPYA 4GP6A 3IT2A 4J90A 5F9MA 5KYVA 4FT2A 3SQOA 5AW2A 1LDEA 3C7KA 5D87A 3E7DA 1G4HA 4ITVA 4X5OA 1P2SA 5TQ0A 3E9RA 2JFWA 3B78A 2CD7A 2F7SA 2GFHA 3FVTA 1VHQA 3HUEA 1FFXB 4HAXA 4RQBA 3SEAA 4BGIA 3OIUA 4NOJA 4LN1A 2IXEA 1UKCA 5ER9A 4DV5B 3IEPA 2IV7A 1JB9A 2NSHA 2ORIA 3JQ9A 3PICA 1AVTA 4H0NA 3DEYX 4KLZA 5SY9A 1WP4A 2WMYA 2VF5X 4B6OA 1SQFA 2AN3A 3Q10A 4PBSA 2VH5R 4Q1DA 2PLAA 1OLUB 3CRNA 1LZLA 3PVCA 4R41A 4DABA 2DHEA 3WWOA 4Q48A 3CKLA 1JQ5A 2D8MA 2FE4A 2ORWA 5EQTA 3X3HA 5JCPA 2YFHA 5KKCA 1US8A 4QJ3A 1LNZA 3VZQA 5C8YB 2JFYA 2VHYA 4R8VA 4XVRA 2I2WA 3OJCA 1XE3A 3LUKA 3NUZA 4TUYF 1VMKA 1ZXLA 3GEIA 5CT8A 3JWPA 4RAOA 1SVWA 4ZC8A 1U0RA 4KU4A 3V8EA 1P9WA 1YS2X 1FVOA 5LYJB 2G6BA 3PR1A 1ODSA 2RGWA 4TUYA 1NX6A 4TLBA 4LCJA 4YA6A 1U0LA 3I6IA 3N2IA 3OVMA 5FFNA 1ZX1A 3ZU6A 4B3CA 1LLQA 4BFUA 1N8KA 1U2GC 4QU8A 4NV3A 3HWRA 1WW3A 2EJWA 1MJ5A 3BK2A 1T8YA 5BSEA 4CTJA 2P2NA 3P9SA 2Z6AA 1JWAB 3TYXA 2J48A 1VFPA 2Q3EA 4BJ5A 5SZJA 1P0QA 1V3UA 1W5FA 3OTIA 4W8OA 1L9XA 4JY7A 5DBOA 2B3TA 2HDWA 1XP8A 2OMEA 2VDMB 5AW3A 5BSTA 2EFGA 3C6ZA 2D74A 2C8KA 2GK6A 4RADA 1GRCA 1JDZA 1GCGA 1KJNA 3USZA 4CUJA 1T3TA 1G4UR 4EA7A 5JZBA 3ZGVA 1GV1A 3F8SA 2OPBA 1ZMBA 3KQQA 2Z6QA 5EIXA 1UKBA 5KOIA 1R3UA 2BTEA 4QECA 1K63A 4DGSA 2QN7A 3NHYA 4RA9B 5AHKA 3VC3A 4DBZA 5BSGA 3I6BA 4RVUA 4I55A 1Q0LA 3DNPA 3EZYA 4M1YA 2HA7A 2CF5A 3TEMA 4MA5A 3TSAA 2HPAA 3K53A 2ZGVA 5KTRA 4J2HA 1TO1E 4ETWA 1C80A 1G42A 2FWJA 2XWJI 3MBOA 3P20A 2FSIA 1GZHB 2VP5A 3IAM1 1OWMA 2UXCB 1AF7A 2HF2A 2D00A 3ND7A 4HJRA 4GPBA 1D1QA 4RSRA 2W4IA 4YXWA 2F43B 3R6DA 3VR3D 5LVAA 4WCFB 2PNJA 5CLJA 2X40A 5GMOA 3LUDA 2IOFA 1Z6ZA 1OA0A 3IP5A 2F64A 3SICE 1SQ5A 5EXEA 4UM9B 2GZAA 1O2DA 3KUKA 3U9TA 2G83A 1GQSA 1RR6A 4RTMA 1Q74A 2H8GA 3BPSA 3PE3A 4MVJD 4Y1RA 3WBJA 4BBZA 1XK7A 2QN9A 3NHPA 3RJTA 3TUZC 4FZ5A 2NXEA 4G07A 4J4BA 4B80A 5BURA 1W1WA 2VF8A 2BGKA 5CFPA 4B4OA 1ZOPA 2CLHB 2ZI5A 3C6BA 4W4TA 3REFA 5IN5A 1H1LB 3QSGA 5DMHA 4KZPA 5E7JA 5FA8A 1V9SA 3CLTD 5HRUA 4TWBA 5C7LO 1ZEMA 5FQNA 1MJFA 3FKQA 3SCZA 5KDOA 2P67A 3M4JA 4XR9A 5HP4A 2AYXA 5C52B 1GKYA 1ZNWA 2B8JA 3FWHA 1FRQA 5HIIA 3FRIA 2KMLA 3MPOA 1U7UA 3OQMA 3TXXA 1Z6QA 4QBTA 5IF9A 5KX5B 4D0SA 3KETA 1LPPA 4OKSA 1MUUA 1R16A 5JV5A 2FJUA 4Q9LA 1BFUA 4FSXA 1XNQB 3QLVA 4LIPD 5K8TA 4NP6A 3K94A 4EECA 1UMKA 3OZWA 4NBLA 4Y9DA 1YC5A 3RUHA 4JC8A 1R0WA 5BRJA 4NNPA 4DV4B 1RI2A 2W22A 2GEDA 1U8UA 4HWOA 1V5IA 1PYGA 2AFHE 1JQLB 4ZFNA 4MRPA 3E82A 5D8DA 5KTPA 2NACA 4HWTA 2I7CA 3E9ZA 5AESA 1YOBA 2JJMA 1GSIA 4UQPA 1RBYA 3BIJA 4EMBA 3KAJA 3SVTA 1FU4A 3KVYA 3H7AA 1BS1A 1L4YA 4KAXA 3VU8A 5K45A 4A6EA 4B87A 3MOSA 1NHGA 1QMGA 4MR9A 3DMNA 1XTSA 2C2MA 4OHMA 6YASA 2H17A 3HO6A 4MA0A 3CZCA 2DWOA 1YZ3A 5B64A 1RPAA 1ISSA 2JIZA 4GZ6A 1P5RA 5G0UA 4JEHA 1MNAA 2OLJA 2R7AA 4OH1A 9ATCA 5LOVA 3VPBA 2KLHA 2QE6A 2YV5A 3F6EX 3EXG2 3EXEA 3TZHA 1SU6A 4AY3A 3PF9A 3IERA 3W3AA 1CJTC 1RHUA 1SKQA 4GRDA 2QL6A 3IQDB 4G1CA 4XUEA 1JMKC 1ISJA 2QUBA 5CW1A 4XXHA 1D2MA 1E6MA 4ZT6A 3USCS 4ECAA 2JIMA 2FYTA 1CS0A 1OH8A 1RE0A 1Y33E 2BIFA 4DPMA 1POWA 3CFYA 1GPLA 3MWDB 3PGKA 2YWBA 3JV7A 5PGMA 1RQGA 2ZJ8A 3QF4A 3D7MA 5JR3A 2DT5A 4IXTA 2FDXA 5AW6A 3QX7A 2ERCA 4YRCA 1PFVA 4IHQA 4DRXB 3DR5A 2M32A 3TPZA 1IZYA 3GD7A 3SQNA 2P8JA 2O1EA 3K1JA 5FORA 2QBYA 3C39A 1Y6QA 2ZI7A 5EKUA 4XQGA 2VEDA 1QRRA 1CY8A 2JLYA 3BG5A 5IDVA 3NPAA 3ZEAA 1ML3A 4NH0A 1SKUA 3HDYA 2X0EA 1H5NA 1U94A 2AG5A 2B8EA 2BFNA 1N5LA 3ZOKA 3MGKA 1QH8A 1KI1A 1VPEA 3AGPA 3O93A 3GLQA 4R2WA 4YMGA 1NW3A 1P1KA 4EEXA 2BI7A 3W5JA 1ORWA 4OIMA 6REQB 1YFJA 2UU9B 1WIWA 3C5VA 4WLOA 1G20A 4TTRA 4UFNA 2QTZA 4UTPA 2AI2A 3WQBA 5J2UB 4I1SA 3PXCX 3M6VA 4M60A 4BFCA 3G5UA 4MKHA 2NGRA 1PUXA 2ABWA 2PAAA 3HZZA 3ORHA 3R3WA 4KYIB 4YAOA 2H3HA 2QTGA 2PH7A 4EX6A 3E2MA 3RVDA 4GVXA 1FJ2A 2GZDA 4EHIA 1NYTA 3AHCA 1KYIA 1PJCA 2PO5A 1ONNA 3LHDA 5JH7B 1C7JA 4XVHA 1IAQA 4I66A 3VR0A 2VHQA 3M6WA 4K9SA 5BVGA 5KWVA 3DHEA 4J4TA 4LRUA 1NNEA 1U3UA 4OHUA 1QFJA 3E0QA 4U2FA 1YKGA 3Q9SA 3KHKA 3NNDA 3ZY3A 4BV2A 1C81A 3PUYA 1MXHA 4HDSA 4JLPA 3WTBA 5JASA 2O7RA 1M1NA 1TJ4A 2XYVA 1GNPA 3ETCA 3JRXA 2P3SA 1RSZA 3CRZA 4HG2A 4K9MA 4RCYA 4RJIA 1FW6A 2V8OA 4MHTA 4D9NA 3C4VA 2C7OA 3O3MB 1TAQA 3NM5A 1ESDA 2DH5A 1SK9A 4OFBA 2FUEA 1U2PA 4B75A 3ZD6A 2VSNA 3IAUA 2IRWA 2VBCA 1YJBA 4IH1A 5D84A 2HLPA 5A71A 4CZ2A 5H7XA 3DJYA 1QH9A 3LBFA 4J4HA 5E4TA 4D4HA 2G5TA 2WWXA 1NVDA 4B5KA 5EEHA 3ZK8A 5IJAA 4ESOA 3LD9A 5A3RA 1FDSA 1RLJA 3ZQKA 1W1IA 3JZAA 4MW0A 1JG1A 1I32A 2H5JA 3I9V1 2RMKA 4PZYA 3T7CA 2PX4A 5BR7A 1N5DA 1QZXA 1PL7A 1TQHA 1SCKA 2CDRA 1X92A 1CR1A 2FX3A 3CUUA 3L92A 3NXKA 3AVXA 1Q7GA 1U8TA 2R5FA 2XLBA 3OIGA 4H4CA 1N8SA 1Q1ZA 2VDKB 3NHUA 3U2QA 3SOZA 1IWOA 2BZ0A 2M1XA 1ZD5A 4TRNA 3DWGA 4JUIA 1A97A 1AQUA 4INPA 3LZ6A 2C98A 2Y0PA 3OF5A 5EFZA 4IFBA 3UEOA 4DSNA 1BW9B 1L8QA 1HEIA 3NU1A 4M8IA 4BNZA 4M0PA 1PX0A 5DV9A 5AWFC 4PAWA 3QLJA 2OGZA 5DOZA 4IF6A 1NFQA 2ZIAA 3KCQA 3D8RA 3EEYA 3HYRA 1FYFA 1EVQA 3D9QX 4FLEA 4KXXA 1D0SA 5LFAA 2MT9A 3AESA 2W2TA 3HH8A 4BJ1A 3QVJA 2BGWA 1OTHA 1X7ZA 1AZSC 2BBWA 2FOIA 1WDMA 1S0UA 1YKSA 3DR3A 3FCUB 3GD5A 1HDCA 4M7OA 3TCXB 1T4BA 2JAHA 2M2IA 2DJ5A 2WYIA 4U3JA 1D2AA 1BXGA 3HZRA 4LF4B 4FMDF 3Q3EA 1Z0UA 4OA8A 2AXNA 2ZSUA 2NZUG 2XYRA 4PFQA 1XKQA 2A9VA 2BKUA 1PEYA 4OVKA 4FS3A 2BMJA 1D8TA 2JK1A 2OLKA 4L7VA 1K0UA 1NJ6A 4R84A 2E55A 3ZX5A 3ZTTA 2HCFA 4FNAA 1XTPA 3CNNA 4QNMA 3L6RA 2AD5A 3CINA 2AXEA 5G1OA 5F51A 4MUGA 1RWNA 1ETHA 1S8FA 4P80A 5B58T 2R751 1QOQB 1S4QA 3IAHA 4N0PA 5EUMA 3ZU4A 4MB6A 4G0VA 2AW5A 1WZEA 1DKUA 1ZSVA 3AUFA 4IZIA 2O3QA 1FLAA 1V1JA 3MWKA 5A5DA 3C3CA 3D3KA 4TTTS 1OI7A 4TYQA 2O50A 1CRLA 3H83A 3RG8A 1E6WA 3M3PA 5DF1A 5TV2A 1FLDA 3KR1A 4CLHA 2R6GA 2VJMB 3HJBA 4LZWA 4YRBA 1Z2EA 3SR3A 3RAJA 4NE7A 3ECSA 4IO1A 2WKRA 1RWOA 4QUAA 4XGNA 1ONSA 2O0KA 5HOQA 4N01A 4L72A 3ZHYA 2RI1A 4C7JA 3U80A 1JVBA 1DIRA 1PGPA 2Z1DA 4MRSA 3ZCRA 2ISCA 4CKEB 3I6YA 1G3QA 1EG7A 2BY4A 5BR1A 3EFBA 4RQAA 2VZ9A 1YE5A 5M3BA 3PFGA 4RA6B 1O7JA 1CX9B 2AG0A 1E6UA 2RIRA 5JEEA 4PSUA 3H5OA 3FGNA 4OHOA 1NLUA 1UPAA 1GGJA 1PJ4A 3GDGA 1Y1TA 1JHQA 2XAAA 2R8BA 3OQVA 4QWMA 5LB2A 1K06A 4C0JA 5LYJF 3PSAA 3MN1A 4E3WA 2XF8A 2Y1GA 1Y6ZA 2QZZA 1FUKA 4CMIB 1L7DA 3LLUA 3ST7A 5JS6A 2AIRA 3BB3A 1Y1KE 4OK5A 3IE1A 4V0RA 1JDNA 2WHQA 2W2KB 3WWEA 5JMWA 1PV2A 4HZGA 4JLBA 5GPBA 4M0FA 1JHVA 5JSYA 3TOCA 4XCXA 3CLRC 2ZRGA 1BQ4A 1XTKA 5JNRA 4OLBA 1JE1A 1OVMA 1U6KA 3KYBA 2YXLA 1NI4B 2EJCA 5TGTA 5EPUA 4IFEA 5FTMA 4RPCA 4R31A 2Q9BA 3TD9A 1GLNA 3A1EA 2TSYB 3RD5A 4EG4A 2WP0A 1JS1X 1Y8RA 4DLTA 4NPAA 5CFQA 1EUZA 1A9XB 5BOSB 2ILVA 3H9UA 3BK7A 1T3ZA 1JLRA 2DY1A 2RHBA 5IKMA 3L9XA 4L6AA 1EHIA 2ZSKA 3E6AA 3L9WA 2RHLA 3Q1LA 1FPQA 2A0FA 5CB4B 3PV0A 5ED0A 3EEBA 4YASA 5E6RB 4L07A 2VT6A 3M82A 3CRW1 2V4MA 2PS1A 5EKDA 2C20A 2Y6UA 1HT0A 3ETJA 3IALA 2RGDA 4IXDA 4LJLA 4YMWA 4JENA 3K0HA 4EAQA 2ZUFA 2ZWAA 2G36A 4LYGA 4UAVA 2R87A 4R7GA 2YUIA 4QGGA 1Z63A 1V5FA 2BZ1A 2ID4A 4L3WA 4WMLA 1C7FA 3AG6A 3CR8A 4AF8A 2QKYA 1X1CA 4GHWA 4US0R 2GLTA 3DFFA 1N5RA 4HKTA 3W1VA 4CFZA 4IWNA 1YB5A 2BAGA 4X0EA 3U3KA 4DEXA 3JALB 1A3CA 2VJKA 3HDGA 3DZFA 3N86A 2PZMA 2ZATA 5EVJA 2TMGA 4PPFA 5IEJA 4B3SB 4KOEC 5AKJA 3GGCA 1OZGA 1UEJA 1ZL0A 4RKEA 3WGZA 3WK5A 4D42A 4X7RA 3AK4A 1P8JA 4IYRA 2V98A 1AHIA 1VJTA 4LCEA 2LGJA 4YCJA 2B4QA 3L5OA 1C2YA 1PZHA 2QRNA 3G2QA 1PYDA 1GR0A 4NBKA 4ZVNA 3RYTC 1TCAA 5BT8A 2A0UA 4MS4A 1WQ1R 5AVRA 2JGEA 3AWDA 1KOLA 2ZUTA 1VKOA 3WO0A 4JASB 5KYWA 2XOEA 4JI0B 1E32A 1P5ZB 2NU7A 3WYNA 2GXSA 3GIWA 1RXVA 1PQUA 1UMBB 3CA8A 4CQLB 4LRYA 5JLJA 3JQ8B 2VEOA 1Q2XA 4CL3A 1IONA 4H31A 2I9PA 2H8KA 3EPPA 3G17A 4OBXA 8MHTA 3ZWNA 5JMTA 4KN9S 1A88A 3B8HA 3D7LA 4KMSA 2IF0A 2PKRA 1Q7CA 1XJQA 2X2FA 1NN1A 1ZITA 1KI2A 4RKFA 5L7WA 2RKWA 3WWDA 3K1AB 2R3SA 2HMWA 2WF7A 4OYRA 4I5IA 4LHWA 3EGXB 4AZ3A 1PV4A 3GEHA 1KQOA 1IOWA 4QNNA 3BGSA 1X0XA 5NLLA 3C7TA 4EHDA 2YIDA 5GVSA 3JYHA 3WVNA 1WUJS 4YAIA 4X61A 4KDFA 4YWJA 4L4YA 1AUXA 3HKEB 4EGJA 4RANA 1J2TA 4MQMA 2Y67A 4O4JB 4X1KB 1EVYA 2BSAA 2CHFA 1HEYA 2IKQA 1MU0A 2L17A 4XEHA 3W2EA 2KI5A 5JC1A 1C0IA 2BFCB 3VU1A 1MV5A 2VHVA 3CGGA 3QQ5A 4KFRA 4V2UA 5DN6D 2I7DA 4BU1A 1GTVA 1NBEA 1I4TD 3FUWA 2SHKA 4EKNB 4NWIA 2A1UB 3IV6A 1IN8A 3VTAA 4BV9A 3F9CA 4GKVA 2AMJA 1K6XA 1PHRA 5A3VA 1FMCA 3QYPA 3OJWA 5ALWA 5GOTA 4ZV7A 5IAKA 4BX2A 4HNRA 4N3CA 2QV0A 1NXSA 1Y3DE 1REQB 1XZEA 3MIZA 2W00A 4NTZA 3U81A 1U3FA 3U1BA 3VOTA 1KZ1A 1OREA 1I2MA 1XQWA 3CNHA 1ZM4A 3G9XA 3HY6A 2P2CA 3PPIA 2JBAB 1FDIA 4BNMA 5KC9A 3NDPA 3FOFC 4V2IA 2GNPA 4LZLA 3ND6A 4GXTA 3I9V6 3ESBA 4NMMA 1QAMA 1G38A 3ADOA 3B2QA 1ES9A 1OXUA 3DUFA 3GEMA 4NFYA 1VA4A 4ZQEA 2OLEA 4FWIB 3UN1A 5KTSA 2C2GA 3GR6A 1JFFA 2RG7A 3UPTA 3AHJA 3I76A 1MJGA 1Z34A 2TYSB 3N76A 3U4CA 5IXJA 3NBAA 1BX3A 4OQ4A 5SY4A 4NCIA 3QKUA 3Q6IA 1E66A 4M2LA 3IUPA 1PO7A 3S7ZA 3HXMA 2E37A 4Z8YA 1AUQA 3DE4X 3KJIA 1VIVA 3MSXA 4LY6A 1GUZA 4LRSB 2D5BA 1K4MA 1TZBA 2Q8PA 3DE6X 2IEBA 2QZJA 4Q7QA 5CH3A 2LKCA 2EKQA 1BA2A 2AYZA 5KSPA 3UF0A 2GFQA 3TTSA 4GSKA 5K0JA 3K30A 5CLFA 1FTNA 2ONCA 4MWGA 4RMJA 5KTOA 4BRUA 5CCXA 2WVGA 4W5RA 1VRVA 1XDSA 2HQOA 3JQAD 4K9RA 4NENA 4LHVA 1H2BA 1K7XB 4O4JF 5JG7A 4AWBA 4WVFA 4CR8A 5JWRA 1PSWA 4KO1S 1HSZA 5K05A 2CZQA 1FYDA 5KVQA 3ESRA 2OECA 3H4VA 4DLYA 1WBBA 3PC8A 1W49A 3I61A 2J3MA 2Q5HA 1CHNA 2R00C 1RVV1 3OMLA 4RHTA 3QEKA 3GLHB 3RVOA 4BGDA 2DR2A 4BNTA 2ONZA 1THTA 4M36A 3W6NA 4UULA 1UBOS 5D00A 2YOFA 4GXNA 4OAOA 4D4KA 5I7VA 3TW4A 4K3UA 3TM5A 3FWNA 3Q4GA 5JATA 3N2LA 2PUHA 4MRMB 4HB4A 2V9CA 4W8GA 1XLTA 4KSYA 4FZ3A 1MJHA 1YONA 2PL9A 1G7TA 2H6EA 3MWEB 5G4LA 2Q3JA 4LXUA 4ENTA 3AINA 5B2FA 1N33B 1BOFA 1ADGA 4G5OA 3RUEA 1KS9A 2HSZA 1FDOA 5CBPA 5F23A 2C7PA 1EUYA 4WECA 2V1UA 1E1KA 4QT4A 4D81A 3ZGZA 4XJTA 5THQA 5AXDA 4GYWA 1YHYA 1X9IA 4GE3A 4ZEXA 2FDCA 3BRQA 3F90A 3LOPA 4FSHA 1LLUA 1MAUA 2JAUA 4L27A 3FPKA 4GD3Q 3RG2A 1WNTA 1AK1A 3EUFA 1TJYA 4EUHA 1HFKA 2VG8A 1SZCA 1Y4UA 3C3DA 4G67A 2HF8A 3UCXA 3QVKA 1GCUA 1GNTA 2HBYA 2B6NA 2YMQA 3CB2A 3F5FA 2R85A 3MWEA 4M1EA 3JTEA 4FLMA 4WFKA 4Q39A 3ZY2A 1ZU5A 3P96A 1Q0SA 5DBIA 4CLEA 4BMOB 1TCBA 1K3UB 1OD6A 1FXUA <