3UXMA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
206
structure length
197
Chain Sequence
b'GLFVTLEGPEGTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
molecule tags Transferase/transferase inhibitor
source organism Pseudomonas aeruginosa
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
total genus 77
structure length 197
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uxmA00
4BFUA 1JJ7A 3A58B 1XJ0A 2Z83A 4IVPA 1E9RA 2ZRAA 4P4TA 1E4YA 3IILA 2ZI3A 3C8UA 1VCOA 4IOMA 1Z83A 2F43B 5LD2B 2P6RA 1A2KC 1HE8B 1UKVY 2DBYA 4K8OA 2QAGC 1I4LD 3BFXA 1RE0A 3U4QA 4O0MA 1B23P 1OFHA 4PZLA 3WNDA 3QXHA 4B3DA 4HLQB 1U9IA 3ZVLA 5G40A 3GJ4A 5E7MA 3OAAD 5EP1A 4B35A 2RGDA 4PFSA 3AVYA 3CWQA 4B76A 1ZCBA 4D4JA 2RGCA 3CNNA 4NCHA 3EIEA 2H92A 1B0UA 4DLRA 5EXPA 5AJWA 1XEXB 2W2TA 1MKYA 1IN5A 1QHIA 1V5WA 4L4UA 2ZU6A 2JLXA 2O8CA 5AJVB 2ZSAA 1BOFA 2P0EA 3TK1A 2PCJA 4LK2A 4LX0A 1ELOA 5LDDC 1H8HA 1BO6A 2NTYC 4HEJA 1PVOA 4IDNA 4MRVA 1HQCA 1ZW6A 1G16A 1P72A 5JSZA 4B33A 1CIPA 4X8LA 1E9FA 5DIFA 2FSIA 1S4QA 2GXUA 4QG7A 2CL7X 2R44A 3X1WA 2R6AA 2ZRMA 5CM8B 2KSQA 2ZSBA 3BWDD 2GJ8A 1KAGA 1OLOA 4D0GA 4US1R 3PXGA 4PX9A 2O0KA 4YMTA 2D2EA 2GK6A 3A36A 1G8FA 3B7GA 4G5QA 3NBXX 5C4MA 1E98A 2X2EA 4LDJA 3THWA 1OXXK 2DFNA 1WCV1 5JLJA 3ICQB 2ZJOA 2LCFA 4IKEA 4PZYA 4UXHA 3P4XA 2YOHA 3TBKA 3LRPA 1I4DD 2W00A 2CHGA 4DB2A 4JKYA 1IXRC 3SI7A 3TW4A 4RZ3A 2I1QA 2EFEB 3N5CA 2VPPA 621PA 5GJCA 2QN6A 2ONKA 2R6CA 2PT7A 1NBMA 5HE8A 1UKZA 1SHZA 1W49A 4Z51A 3HP1A 5L8VA 3I62A 4B32A 2GEVA 1UEIA 4M22A 1W36C 1S9DA 2JLQA 4JT4A 4TYPA 3TSOA 1OYYA 2ZI5A 1IN8A 2OSBA 5D3QA 2QUZA 2Z5FA 2X19A 1DAGA 2JDID 1LS1A 3TIFA 1ZAKA 2SHKA 3VQTA 4B6EA 3Q8XB 4QGAA 3GLIB 2DWOA 4UNQA 5FL7D 2AN9A 2VSOA 1M34E 4NMMA 4ASUD 3O47A 1KO4A 3GLGE 2FJUA 3K0CA 4GNKA 4JL8A 1OXVA 1KKLA 2OT3B 2QRNA 4LBWA 2FZ4A 5J4KA 2QENA 4DCVA 3GJ0A 3ZVNA 5FBLB 5FBVB 3PEWA 1KI9A 1ESNA 4Q01A 4B34A 1TF2A 4R7ZA 4DKXA 3RAPR 3BB4A 3ZD6A 2N46A 3CR7A 4F93B 5FR2A 1XD9A 2OG2A 2ONJA 4DC9A 3AH8A 3PENA 2VO1A 4L9WA 4LSGA 1FUKA 5C4GB 4W5HA 1UKEA 1CULC 1E2LA 1X8JA 2ZJ2A 3OFNA 3KUCA 3UMSA 2OBNA 3HR8A 3ZIAA 1E2PA 1ZM4A 4KVAA 4ILEA 5CB6A 4NYMQ 3U60B 3QKSA 1OIXA 4OKSA 4XSHA 4DT1A 2R62A 1KOFA 2CMKA 5CLQA 1ZNXA 4UJ3A 4TYNA 4A0FA 4V0KA 3PG5A 5EJEA 1G7TA 2CLSA 1Q20A 3SNHA 3OHMA 5P21A 3QKSB 3UIEA 4B3CA 4URYR 5FTNA 2AD5A 2GK7A 3QOFA 3GJ7A 3PEUA 4V0LA 1YE8A 3ZS8A 5JRJA 4C0AC 3BERA 3R9IA 2RHDA 4QJ5A 3RC3A 2PEYA 4Y0AA 4C0KA 4I1SA 3V00A 4BFXA 4EQ6A 1GKIA 3A1SA 5JEEA 3RRNA 1PV4A 4C0SA 4JLMA 2B8TA 5DI3A 1EX6A 4FMDF 3C41J 4IOJA 4QHSA 4D2IA 4ZIRA 3EARA 4TTQA 4EPYA 2IYSA 3B78A 2EYQA 2YZ2A 2BEKA 5AJXA 5M04A 1G8GA 2WHXA 3IBYA 4KLZA 4OJKA 5KPDA 5GJBA 2NOAA 3K9GA 1M7HA 3AVVA 4P4SA 4FINA 2VP0A 4B3BA 2ERYA 1EFRD 3CX7A 3GLFA 5JEDA 3M6AA 2O8BA 1QVAA 3PV0A 5IK2A 1DAIA 4G5RA 4C0HA 1TF7A 3MWYW 5FI0B 2J7PD 1XXHB 1AN0A 4EPWA 2HXSA 3GLGB 5FUYA 4LJ7A 4ZDIA 1K6MA 4XWAA 2QTVB 4RJLA 3L8YA 4WBSA 2ZAOA 2C98A 4LJ8A 2DR3A 2HT6A 1Z2CA 3SYKA 2QQEA 1SVSA 1E2GA 1VTKA 1ZUHA 2C78A 1T9HA 2NG1A 3DO6A 4JL5A 4F92B 3KQUA 4OBEA 4C0QC 4IW3B 4RCYA 2ZR0A 4BRWA 3B9PA 3L0OA 3NEYA 3ZZUA 2C5LA 1XEWY 2XJ9A 3KTAB 2V6JA 3VHLB 3VHXA 5EP4A 2V9PA 2BKEA 2OV2A 2WMOB 4KFSA 4PAOA 3SHWA 3WMEA 4JMPA 1WBDA 1XU4A 4D82A 2RHMA 4LJ4A 4V02A 2BEJA 2F9MA 3KDSE 4TZ0A 2GJAA 3AP3A 3OESA 2GRJA 2ZETA 5FUVA 2R9VA 3QEJA 1GM5A 1W48A 2VQSA 3RS5A 3EC2A 2JLRA 4BRUA 3I73A 4GI7A 5FOSA 4R9UC 1E1RA 4Q18A 4N0DA 1ZC3A 4LHZA 4JLAA 3CLVA 4NYIR 1YZTA 4WZBE 3VMFA 4DUGD 2O0JA 5FUXA 2GZDA 3BH7A 4URXR 3SJAA 5JBQA 2VSXA 4G1UC 4PZZA 5KNDA 1XTRA 2IUTA 1PLLA 2ZYUX 4WIAA 5CIWA 1SHKA 3GFOA 3ZS9A 4ACAA 3RDPA 1II0A 4DLTA 2QMHA 4NE2A 3BRWD 4WZAE 2ZYWX 4DJTA 2XNDA 2O8FA 5FOXA 4B71A 1AGRA 4DCUA 1EFRA 2EU8A 2VL7A 3AF4A 2NO0A 3LLMA 4P3YA 3W6NA 4DEYA 1M7GA 4MYUA 2AXPA 1O87A 2GXQA 2O8CB 4GBMA 3Q5DA 3KXIA 2AWOA 1XWIA 4P31A 1N25A 3BB1A 2FDCA 3OEED 3HR7A 4A8JC 421PA 3SC3A 3B1XA 1II8A 1F6BA 4JLPA 1AGPA 1CJVC 1E99A 4MRSA 4DVGA 1OIVA 4TL9A 1X6VA 3QY0A 3PCRB 1GVNB 1XTJA 3PEVA 2JCSA 2WWIA 2J0UB 3IPYA 1JR6A 4CT4B 4CT5A 4NDZA 3ADCA 1P6XA 3AVUA 2WWHA 2IT1A 1OPXA 2GCOB 1E2EA 1F2UA 1G4UR 4HUQB 1MOZA 5LBIA 5TXGA 4ABYA 3FFBA 3I8SA 4ZCLA 1R5OA 4HAVA 4RD6A 4M9QA 4NYJR 3AKCA 2Q9BA 4CRWB 1JBKA 3X2SA 4BFTA 1Q1QA 3AVPA 2D7CA 4IDPA 2NPFA 4O2RA 5EUMA 3X1XA 1JECA 1YU9A 2IYVA 1JPNA 3Q5EA 4B74A 1WE2A 2G83A 4RD1A 3HDTA 2CDNA 3JZAA 1HT2E 2XTMA 4YMVA 4R71A 1X8KA 2PLRA 1D9XA 3HYRA 3CB4A 4UJ5A 1XCPA 2BV3A 3DPUA 3WYAA 4LCBA 1YZUA 5L3SB 1XX6A 3LFUA 4HB4A 3WBKA 2HDNB 2ZJ5A 4D4LA 1CRQA 4A9AA 3A4LA 3FTQA 1OJLA 1W5SA 4CEIB 3SBEA 3BBPA 5DHAA 5IHPA 3K0EA 4MKFA 4LWZA 2KJQA 3EZ7A 3GLIA 4JJZA 2C99A 4LHWA 4NCKA 1ZNYA 4KJZA 3ADDA 1IXZA 1RRCA 1KMHA 3SU8A 3NTUA 2ZRNA 2J87A 2ORVA 1DAHA 2FG5A 1P9RA 4Q1CA 5IT5A 5A4JA 2P67A 2GESA 3EZFA 4Q4JA 3GMTA 1AS0A 5DE3A 2Q3HA 1Z0AA 2GDJA 2VHTA 3IIMA 1EG7A 5HZHA 3DMNA 3IBGA 4M1MA 1R7RA 2QM7A 2WBLC 1D2EA 5K8LA 4KBFA 4QNMA 721PA 4A15A 4ITRC 4LYHA 2QQ0A 5DGXA 1W36D 2W2VA 2OBMA 3LAWA 2DHRA 4I99A 3EPHA 4WAUA 2ZRHA 2ZRPA 3E5HA 3FKSA 1AS3A 4XD7D 1TU4A 5TV2A 1HURA 2WKQA 1HTWA 3WYFA 2WPDD 3BIFA 4DB4A 4OHYA 2AK2A 3C4JA 2XNDD 1E4VA 1KK1A 5KHOC 2R6FA 1MH1A 4A0HA 4S2EA 3K53A 1UBGA 5HKKA 2NO6A 3WMFA 3K0FB 4QFMA 5FTLA 4Q48A 2XX3A 4LHVA 4C0LA 2J9RA 2RGBA 3KQHA 4OL0A 2O8BB 4TQ9A 4PQFA 1UEJA 3H86A 1OFUX 3W3ZB 2A5JA 3IO5A 3O8RA 2GXAA 2AR7A 1JPJA 2A5DA 2QAGA 4Q7LA 1U0LA 4TMZA 4DLUA 3ND9A 3EASA 3U7FB 3RANA 4BLQA 4M1SA 1CEEA 1WMSA 4Q1EA 1E94E 1MO3A 1FMJA 2CNWA 3KKOA 4DCNA 4K81B 4JIMA 1VYUA 2CLDX 5IF9A 2IW3A 3TVTA 4TMWA 1G3MA 5AUOB 4D4KA 4HSEA 3QE0A 3K70B 1M8PA 4URZR 2ZRCA 1ZM2A 2I3BA 1FNNA 1CP2A 1E2IA 2DFLA 4IDQA 1L2TA 4A2PA 4EAQA 5E7IA 1FX0A 1GP2A 1KJZA 4RD3A 5FOWA 2IYWA 4KODA 4MUAA 5DHFA 4MUBA 1M1YE 1IAQA 1ZJ6A 2IYZA 4NL4H 3WMGA 3BD9A 4BFZA 3PEYA 2YWEA 1JJVA 2VHQA 2HCBA 3BJIC 3C16C 2IS6A 2ZE8A 3MSXA 2WJVA 4LJAA 3K9LA 3TRFA 4HDQB 3VKGA 1QHHA 2KB0A 5BN4A 1SKYB 3IKJA 3R9WA 4A36A 4DSNA 1G6OA 3LXXA 1Q44A 2GCOA 5AUNB 1XPRA 3HU1A 3FMFA 1P61B 4D80A 4AD8A 5FUWA 3MG9A 3PJRA 4M8NE 4ZCIA 5SZIA 5FBRB 1DS6A 1ZM9A 3EZ2A 1ZU4A 2Z43A 3LO5A 2A30A 4B2LA 2IYYA 3ZH9B 1XNJA 1QBKC 1GFIA 4U5XA 1EFUA 3P20A 4RD0A 3KQKA 4MGIR 5FPKA 1TX4B 2WJIA 3RABA 1Z0JA 1GITA 4OQLA 1IHUA 4LHYA 1IY1A 2EWWA 3HPQA 3ZJYA 3H1TA 2CVFA 2GHIA 4RZUA 1GNPA 2IF2A 2MMCA 2PH1A 2QPTA 4KFTA 1VCIA 2CE2X 3AVQA 2DB3A 2PT5A 1ZU5A 5EXSA 2ZSDA 3TAUA 1CBUA 1OW3B 2FGKA 3EG5A 2CJWA 4KO8A 2QMEA 1SXJC 2QPOA 1R0WA 3QNUA 4GDFA 1TQDA 4X8HA 1Z0KA 4MKGA 4Q00A 4POAA 1YZKA 1FP7A 5AJYA 1YKSA 5FTJA 4KI0A 2RMKA 1D8TA 4QNRA 1KHTA 2V8OA 1P5ZB 3KJHA 5CJPA 4ACBA 4E09A 5KDDA 1OH8A 1GAJA 3Q85A 1U81A 4Q4HA 2IEZA 2JJ2D 4OI2A 3AQ4A 1O3YA 4Q9KA 2V55B 1KI8A 3IDQA 1KO8A 2B21A 4F4CA 5HKKD 2F7SA 3SYLA 3PQCA 4B3XA 1GNQA 3AV0B 3WBJA 1G3RA 2CLCX 3IHWA 2BHRA 3GJXC 2EWVA 4AKIA 1JXOA 1A2BA 1S9HA 3UG6A 3REFA 5DN6D 2ZPTX 1ZP6A 3QKUA 3TJZA 2G9NA 1KI6B 4CVNA 1Z07A 2HYDA 4XD7A 4DDVA 1EFHA 1CRPA 2BMFA 2EYUA 3L43A 1T5LA 2OILA 4GMDA 3U3RA 4BFVA 1N6RA 3W90A 2QAGB 3LD9A 3FMPB 2HT1A 4HLCA 1G18A 1AQYA 3CRQA 3EIHA 3SE0A 2OCPA 2IF0A 1SVOA 2FMXA 1RW4A 4NKRA 1E6CA 1IN7A 2XEXA 4PPGA 2L0XA 1JB1A 4JLDA 4FCTA 3IQXA 5JWRA 2BJVA 1Q57A 3WNBA 2FV8A 3SQWA 3AF0A 1KI3A 1I4TD 4IOKA 5KSZA 3CUEF 1OH7A 4HB3A 3V4RA 4HZUA 2ZANA 5JMTA 3BH6A 4GP6A 1J7KA 1E2KA 3FMOB 4EFMA 3M1IA 5KU1A 2KE5A 4Q9HA 2WSSA 4PTLA 1JEEA 1U2RA 4HAYA 4JVSB 4JLVA 3DVLA 4NP6A 1Z63A 1MRNA 1MT0A 1Z06A 4YMWA 1NVXQ 2ZR7A 4Q4JB 2W2XA 4ZDWA 1NRJB 2PX3A 3LH5A 4FMCB 4EJSA 1X8LA 4LHXA 3ASZA 4HDCA 3OZXA 3R8CA 1S1CA 4XH9B 1KSJA 4LPKA 4M1YA 3PUXA 4TTPA 1DPFA 4Z1MA 2OFOA 4DLXA 2ZM5A 1OKKA 1NLZA 4QJ4A 1E2NA 1RRPA 2GJKA 3NDPA 3QXSA 3QXJA 4OK3A 1VCNA 5EUQB 3OEHD 3U2QA 2JLVA 3MUFA 3HU2A 3T34A 1KYIA 1BYUA 1HEIA 3KL4A 1MO4A 1HE1C 2OCAA 3IQWA 4TWZA 1NJGA 1DELA 2C9CA 2JLZA 3IIKA 2MSCB 1LW7A 3ZIAD 2OFWA 4Q1FA 3DZDA 5C18A 3FHTA 2KBFA 5K8TA 1EFCA 3MWJA 2OZEA 1F60A 2HJVA 1KSFX 3L8ZA 3GJ6A 2FPLA 1GL7A 2ZRJA 2OCYC 2QGNA 4URWR 3AKYA 1XEFA 1Z5ZA 1CR1A 2OLJA 4PXAA 1E0AA 3UG7A 4YQFA 4OHXA 4A2QA 3B1YA 3RSLA 1GDDA 4OHZA 1EXMA 3VKWA 1T8TA 2ECKA 2CK3D 1UM8A 2I4IA 4FCWA 1VCMA 4CEHB 2BBSA 2N1BA 2AL7A 3PUVA 4HB2A 4Q7MB 2ZRDA 4MYCA 1WQ1R 4RD4A 4TLDA 3Q9LA 1Z3IX 4EJSB 4PPFA 1S3SA 3THOA 2F3RA 3DDCA 2A7QA 2ZR9A 3N2IA 1JR3A 2CCGA 3Q72A 1NMXA 1GL9B 3CIOA 4YLGA 2W83A 4NYMR 3CM0A 5DN6A 1T3HA 2WSMA 1Z29A 5GVRA 4Q19A 2C9YA 1NBME 1T0JB 4ZDJA 4Q9JA 4CEJA 1XF9A 1NMYA 2YWGA 3A1WA 2WVJA 4QHTA 1N5JA 1GZSA 3QKTA 3RRMA 1XJCA 2JLYA 1E2QA 4PPQA 3OIWA 4HUTA 1EFTA 1NY6A 3HPRA 4BGDA 1ANKA 3G0HA 1ZCAA 2QY9A 5EE1A 1XP8A 2RGNC 4Q5IA 1XTQA 2CK3A 1VECA 5EXXA 1UF9A 3U3KA 3B82A 4QGFA 5E4FA 4W9MC 1R8QA 4ZDKA 3GPLA 4BFYA 2C03A 4FMDB 6Q21A 2DFKB 3QPVA 4M1TA 4GRAA 4RVCA 1YZNA 4GFDA 3VFDA 2QL6A 2ODBA 4ESVA 2W6JD 5EXTA 1TPZA 2B6HA 1XZPA 4F4JA 5E3HA 2GCNA 3EW9A 3R8FA 1VYVA 3SBDA 3X1DA 2RH5A 1IJFA 4PC1A 2BCJQ 4EPXA 4Q9LA 1NSFA 2GCPA 2PZGA 2REBA 5LD2C 3EIQA 1J2JA 1NN0A 1ZIOA 2VP4A 3BB3A 3CNOA 3A6PC 1ZVQA 2JATA 4LBVA 1M6NA 1XDBA 4A0RA 4QBIA 521PA 1GNRA 3TE6A 3WHLA 5L3QB 1NNEA 1YZQA 3IHLA 1TF5A 2ZTSA 2UZIR 1KO5A 2YC4C 2KWIA 3JVUA 4LBYA 4CEIA 1XXHE 2W58A 1FTSA 1KZGB 1X86B 4I4LA 4D81A 5JI2E 2X8AA 1CU1A 1ZIPA 2EFHB 3KTAA 4M21A 4MYTA 4DLVA 4M1WA 1DEKA 1KMQA 1G17A 4WZ6A 3L0SA 3T61A 1S1MA 1JALA 4Q7JB 4R2IA 2QZ4A 5IRCD 2R65A 4V03A 1QHSA 3M0EA 1E9AA 1U98A 4RZXA 2H17A 4KXFB 1JAIA 1DAMA 3KXLA 1AZSC 2ERXA 3OIYA 1ZMXA 5LPNA 1KO7A 2WIBA 4AKEA 3N70A 4QM7A 5DI3B 1CR0A 1QHNA 1W0KA 5SZKB 2ZUCA 1F2UB 4C2UA 4HATA 4KCGA 1J99A 5H68A 4KFRA 2GZHA 2OE2A 3GEHA 4DEXA 4U00A 4BEBA 2IEYA 1J8YF 2G0NA 2VF8A 2C96A 3ZVRA 1P4SA 5FTMA 5DSZA 4AYTA 2FPKA 5B64A 3LVQE 3I92A 2GVZC 3GLHA 5FL3A 4B2PA 2EFGA 4B75A 4G5SA 1RIFA 2AD1A 1II8B 3V9PA 5HPYB 1A4RA 2P6UA 2Z0MA 2BVNA 3VR2A 3L2OB 4W5WA 1OSNA 4GOJA 2H16A 4UNSA 1AIPA 2P2LA 2QPAA 3UMFA 5EP2A 4ZCMA 5B57C 3IPXA 2PJZA 1Q3HA 4PSAA 4FXPA 3CPEA 3KKPA 3GLFE 4FWIB 1IN4A 3FB4A 3T15A 4TLCA 3B13B 5CYPA 4JL6A 3UMRA 2ZRKA 2D2FA 2FEMA 3HWSA 2ZE7A 3BGWA 3KKMA 5JECA 2F1IA 2F3TA 1KDOA 1RRGA 2BBWA 1US8B 3OE7A 3X1ZA 1NJFA 4PPNA 3UWOA 2WJYA 5KSYA 1OHHD 4KYIB 4Q02A 1WA5A 4NCNA 4PQYA 3TH5A 4KHZA 1TUEA 2IWRA 1FZQA 3RNLA 3W9YA 4F91B 2G6BA 2JJ1A 1G3IA 1OXUA 1E2MA 4LV6A 3VR6A 2OBLA 5KSPA 1E3MA 3N2EA 1WDTA 3R20A 4JKIA 1N6PA 3TQFA 1TL7C 3Q3JB 1RC8A 4MDFA 4DSOA 3E1SA 2X2FA 3OIUA 221PA 1MABB 4XVRA 2I1VB 2KBEA 2WM9B 1NSTA 5KYKA 5HZKA 4D6PA 4M9ZA 2CL6X 3NKVA 5TMPA 3LBNA 5J4YA 2AKAB 4AKGA 3LWNA 4I81A 2VF7A 1Z6YA 3SJCA 3O8BA 3K09C 5AUQA 1KDTA 1LF0A 2BMJA 2HCJB 1KK3A 3HJNA 3K9NA 1G19A 1G5RA 1XRJA 2BC9A 2J45A 3BXZA 5J4VA 1G21E 4DDTA 4BZXA 5A0FA 2EW1A 1W0KD 3RS2A 4A2WA 4JLKA 4E22A 2XXAA 4LYAA 1D9ZA 1HH4A 4GMXA 4TTRA 3W5IA 3QG5A 3K70C 2D4HA 2LWIA 1KJYA 1E79A 2QROA 2WV9A 2IYLD 3NHAA 5JJIA 5EE5B 4BFSA 2XGJA 4TSFA 5JWOA 1ODFA 4FMCF 4MRNA 1SKYE 2YC2C 4A8JA 3D3QA 4KAXA 4JJKA 1JI0A 2ZI4A 5FPYA 3IO3A 5TARA 3ECCA 1KAOA 1R0XA 2HUPA 4TQAA 3AVOA 4C4PA 2J7PA 1WF3A 3JVVA 1W2HA 4CF7A 1IY2A 2YOFA 4L15A 5C1BA 5SZHB 4TQUS 1OFIA 2QG6A 2VLIA 4AIIA 1VKJA 1ZBDA 3MD0A 4U7DA 2QBYB 2YNMA 2J3EA 4HUQA 2BBOA 1HQYE 4JZKA 5FI1B 3R9XA 3QEOA 2ZJBA 1T91A 4MGYR 1II9A 1L7VC 2H5EA 4GL2A 4GOXA 2GEDA 1X3SA 4LJ5A 3THYB 2RGEA 1YR7A 4EFLA 1Z6TA 2GZAA 5EE9A 2ZROA 4IFBA 2GF0A 3AF3A 5BN5A 2C04A 3PITA 3F5FA 5CITA 2XB2A 1SVMA 2CL0X 1SQ5A 2VSFA 4LV8B 4ZPXA 3BFKA 2ZUBA 4Q03A 2WOOA 1U99A 1J90A 1KK2A 1VMAA 3QF4B 4IRUB 2ZI6A 1F5NA 2ODEA 4OQFA 3RC8A 3WRXC 1NY5A 2O8DA 3Q7PA 1OH6A 1R0YA 3AGQA 2VHUA 1RPZA 1NVUQ 2VP5A 1AQUA 2AWNA 3FGNA 2HYIC 1LV7A 4XWKA 3CF6R 3H0KA 4G0NA 1E2HA 4H9GA 1N0WA 1D5CA 4II7A 3LX8A 5CYOA 4ZKDA 2IA5A 1Z22A 2N42A 3A1UA 5D3MB 2F1JA 4BZPA 3GEIA 5AUPB 4RCZA 1SXJE 1XFAA 2G0TA 3WHKA 3CWZA 3QXXA 1XZQA 4W5JA 2AFIE 5K8IA 3ADBA 2PMKA 3THXB 3W34A 1N6LA 3NH6A 4EDHA 4JT2A 4JBWA 2FFAA 2BOVA 3MWLA 4EIWA 4JSTA 4TMVA 4A8JB 4F7WA 2ZI7A 4EPVA 4US2R 2JAQA 3NEJA 4UNPA 1DE0A 4OQMA 5ELXA 1TQ2A 3SJBA 1E9SA 2PZFA 2PL3A 5FPHA 3ZZTA 3NHBA 3CR8A 2QRZA 3CW2A 3RWOA 2V7QA 4M0LA 2ZVQX 3MGCA 4Z8XA 2JDIA 3T5DA 1Q12A 3KJIA 2AHOA 4Q4AB 2QAJA 3BE4A 3FOZA 3AGPA 4TLEA 5JWHA 3K0SA 5L3QA 4W7SA 3THWB 3AP1A 1AM4D 4CGZA 1P2TA 4ASUA 4QBGB 2TMKA 2ZJZA 2Q21A 1WRBA 4HAWA 1Z6GA 2FN4A 3NBYC 5HR5A 1TU3A 1OB5A 4AYWA 1AA9A 3TAHA 1E1QD 1IOZA 1UPTA 1NN1A 1U94A 2MMGA 2WZQA 3ZDQA 1P7CA 2QMOA 1CJUC 2FSHA 1VHTA 2H7VA 4PAQA 3KJGA 4P32A 4Q47A 3P26A 2LKCA 4Q9IA 1LY1A 4QL3A 4HLUC 1KI2A 4PO8A 5JJKA 1KJWA 3SYNA 3CRVA 1LS6A 2PX0A 3CRMA 4DBLC 1FTNA 5UKDA 5F2EA 3LW7A 1XMVA 1ZM7A 1NN3A 2O8EA 2BIFA 1Z8FA 3ND8A 5F9HA 3MAAC 4EPTA 5BQ5A 4OI0A 2ZRGA 2WWXA 2GAAA 2NO9A 2Z6VA 1SKQA 3P1JA 2NIPA 3KB1A 3T06B 2NQ2C 1JQJC 2Q3MA 2FPMA 2FH5B 4MRPA 4RZ2A 5FPTA 4V0OA 2IL1A 3CH5A 2NPIA 1AJEA 3LW8A 1CS4C 3OF5A 4M9SA 3HYTA 2ZYTX 3CRRA 1NKTA 1XBTA 2GEUA 3EWSA 3PUWA 1QG2A 2A5YB 4P4UA 3EZ9A 2VIIA 1MR3F 3FKQA 3AP2A 4M1OA 1G3QA 3S1AB 4DZZA 2DYKA 2FEOA 3AUYA 4IDOA 4D0NA 1WBBA 4WXRA 2HLDD 3LBHA 4NYJQ 5A5GA 4XJXA 2RGNA 1L4UA 5JS7A 1W4RA 3QJYA 3F8TA 4C30A 3U3MA 4C7OA 4IVQA 4OI4A 4TL7A 2IWHA 5JRZA 4S35A 1P9NA 1KSHA 1W46A 1QRAA 1E1QA 1NVVQ 1R5NA 5F9FA 3QKRA 3LDAA 1D2MA 3WY9A 4L8GA 2ZJ8A 5EQTA 3FHOA 2ZI9A 5F3WB 2FA9A 1TEXA 1DG1G 1F2TA 4IHQA 3REGA 5FFMA 1CJMA 3TUJC 3U3OA 1U8YA 4LOAA 4AI6A 2BJWA 3QUSA 2QBYA 2WPDA 4FN5A 4HI0E 3QBVA 4QKQA 1DVRA 2Z4RA 1OHHA 4UNRA 2AXNA 1COWD 3NBFA 4TN1A 2J7KA 2NZJA 2F6RA 1H65A 2AKYA 4PHFA 3I61A 3ZLJA 1GSIA 3BFVA 3R7WB 2BCGY 4LJ9A 2P6NA 3A1VA 1N3BA 1OKKD 4XSGA 1UFQA 4OYHA 5GJVC 3H84A 4LV5B 4A0GA 4MQBA 3W8NA 5J4LA 2NMVA 3KB2A 2BKUA 2YWHA 2RKOA 2R2AA 5FH9A 2F1RA 1GIAA 2QEQA 4DIDA 4NU0A 5FBWB 3QVUA 5G3ZA 1IXSB 3K70D 4QC2A 3W6PA 4DDWA 2IBMA 2G3YA 2QNRA 1T6NA 2XSZD 3GP8A 4EFNA 2GKSA 5CM9C 1KDRA 1G8YA 4ARZA 4YMSA 3U6KA 1G7SA 2WWWA 4QXAA 3B60A 1E0KA 2J59A 2VP6A 1M7BA 1GTVA 1GRQA 1PZNA 4IJMA 1W0JD 4ON9A 1LF5A 2RCNA 4HLDA 2WICA 2VHCA 4EJSC 3AB3A 4Q21A 1Y3AA 1QF9A 1RFLA 1HA3A 1Z0IA 2Q9AA 2ZS9A 2GVDC 4TMKA 3K0AA 5BW8A 1ZD8A 4I1VA 4LRWA 3PFIA 2QP9X 3TQCA 3WRYC 3T1QA 4CZ2A 3UKDA 3KXKA 4BWYA 5C2JB 5KTYA 3DKPA 4TZ6A 1G3UA 4LYJA 1I2MA 2ZRIA 3R7WA 1E2JA 3IUYA 1TQ6A 1BH2A 4AK9A 3ONWA 3NBZC 2IYQA 3MWKA 2VTKA 2W6ID 4YC7A 2VEDA 4Z54A 1TUIA 4B48A 1XEXA 2IXFA 1KIMA 1U8ZA 3I72A 1Z28A 1PLJA 3JZMA 5BWMA 821PA 3F3YA 2Q9CA 4Q4LA 3ETLA 3LBIA 1YJ5A 2ANCA 3W8RA 2PEZA 3AUXA 2GA8A 4CEJB 3CZPA 1ZYUA 1NIPA 3AEZA 3PUYA 4GP7A 1WXQA 4E03A 2WAYA 4P4SB 3RS4A 1RKBA 1YRBA 1BYIA 1US8A 5G53C 3B9QA 3EA5A 4JBYA 1IY0A 3Q7QA 5FTKA 1CXZA 1G5PA 2NGRA 1ZNZA 4C2TA 1LB1B 3QF4A 2JLSA 4LYFA 3VR4A 4DWJA 2V54A 2IS2A 4R2HA 1FUUA 4B3FX 3DM9B 2ZE6A 4H1VA 2J0SA 2VA8A 1TQ4A 2D62A 2Q0HA 1S2MA 5EZ5A 3MJRA 4JSYA 3THYA 1G20E 2ZU0C 2FZLA 3EPLA 1Z0DA 2BM0A 5BN3A 1HT1E 1OT3A 3LLUA 3V4FA 3WP0A 2A9KA 3P27A 4PHTA 2A78A 3B2EA 5JHGB 4NCJA 3QSYA 4X8MA 1XD2A 5AK0A 1T4GA 2B92A 2PLFA 2D7DA 1I2DA 4WOPA 3NVAA 4DIEA 4LGMA 1RJ9B 4OHVA 4BE7B 3LX5A 3B1ZA 4DLSA 1NF3A 1WB9A 5TDHA 4C0BA 1A82A 3EZ6A 4BUJA 1S8FA 2WWYA 5JZVA 1P3JA 1NP6A 2OCBA 2EFDB 4PO1A 4URVR 1NLFA 1N0VC 3C5CA 2E1RA 3BORA 3UXMA 4ERNA 1K5GA 1N0UA 2QP3A 4MITA 4O3MA 5DLQC 2EQBA 3VU9A 2O0HA 3DKVA 3FWYA 2IYRA 3CO5A 4QOSA 1QZXA 3I5XA 2YINC 4Z8YA 1P75A 4EKDA 1XEWX 3RS3A 1C9KA 1TMKA 1Z0FA 4K46A 1AZTA 1JQLB 5TB5A 4BLOA 2JIZD 2JLWA 3OAAA 2WIAA 5SZJA 3ZZ0A 2ZAMA 4AWXA 1G8PA 2O8FB 2WMNB 3I1FA 4LUCA 2XZLA 1SVLA 1ZNWA 1F3OA 5E95A 2W0MA 2FU5C 1WP9A 2WSSD 3GJ8A 2V1UA 1EX7A 2FFHA 2X77A 4JVMA 4PC2A 3SHFA 3B5JA 1UDXA 3SJZA 2IUSA 3K1JA 4QBFA 3EA0A 1UBCA 2BMEA 1IONA 4DSUA 3U7EB 1LFDB 1N6NA 5BYJA 1NKSA 1RZ3A 3TKLA 2QGZA 3NXSA 4DXAA 3PR1A 1MO5A 3T1OA 1UBFA 2NZ8A 3DHWC 3UANA 5J5CA 3G82C 4B73A 2B7BA 2J0QA 3BK7A 3RRYA 2XOKD 5EE3A 4Z1MD 3I32A 5BXQC 3U44B 2QT0A 1KSGA 1XTIA 2ZRFA 5CIQA 2F9LA 1KY2A 1T8UA 3C5HA 1KNQA 4FW9A 2G1JA 3PVSA 4LZZA 2IS4A 1NVVR 2VBCA 1G7RA 2FGJA 2ZYVX 4AC9A 2HEIA 2W6JA 1M74A 2ZQ5A 1GL6A 1KTVA 2BWJA 5JCPA 1VIAA 1K8RA 3I5YA 4O25A 3FPAA 1NMZA 4Q4HB 3DL0A 1Z47A 2ORIA 1A7JA 5AJZA 2ODWA 2G77B 2AX4A 2VH5R 2ASEA 4KLNA 1W1WA 4N1AA 3MMPA 5CB8A 1LNZA 1W36B 4TLAA 3RS7A 4CIDA 3KKQA 1QHGA 5D3MA 1YR8A 4OHWA 3VTKA 1KI7A 3VAAA 5JSZB 1VG0B 2QI9C 4TYYA 4PAMA 3TSZA 1ZD1A 4IOLA 1IJEA 1F48A 2JEOA 4TL6A 2P5SA 1ZD9A 4C9BA 1W47A 1R5BA 1R10A 2X1VA 4JLBA 4I1OA 2O8DB 3QKRB 3EWAA 3FMIA 5FL7A 4LY6A 1ETUA 3KX2A 1PJRA 4B44A 3GD7A 4HAUA 4FD2A 1N6KA 4EQ6B 2BM1A 1N2CE 3WYGA 3KFVA 1E9EA 3VR5A 4AYXA 4RSGA 1FPMA 4G01B 4NTZA 4OK5A 3SR0A 3ZD7A 4B43A 5DYIA 2D3WA 4MYHA 4BZQA 3P4YA 1FL9A 4V0ME 1EWQA 2JJ2A 1E2FA 2PJRA 2VP9A 1GG2A 4BLTA 2OXCA 2F1HA 2IHYA 1RYHA 4KYUA 1E9BA 3TUZC 3D8BA 2DPXA 1P73A 2V4ZA 3GFTA 3A4NA 5AWFC 3H4MA 2OM2A 3SFZA 2C2HA 4NBSA 3ZVMA 3QPUA 4UXJA 4TSFD 2W0SA 3CKLA 5CK4A 2R8RA 1U9IC 1HV8A 4LJ6A 5KDOA 1G6HA 2GBLC 3M4YA 2H18A 1W4AA 4YXWA 1G7CA 4XTCS 121PA 4JVNA 4PANA 4A92A 1BMFD 3KUDA 2GNOA 4MH0R 4CDGA 3K0AB 1Q1EA 4QHYA 3GLIE 2CVHA 2VHJA 3NWJA 4KBGA 1ONBA 1NL3A 2ZS8A 5LB2A 4Q1DA 3FDIA 2CEAA 5TY0A 4NCIA 2HXYA 1H8ED 2CHVA 2QTFA 4YONB 2O8EB 2JIZA 3EPKA 3EXAA 2GWHA 3K09A 2RGXA 1VG8A 1NN5A 4F4IA 3DEFA 2WJJA 2GJSA 1PUIA 1GWNA 2FX3A 1RVDA 1FOEB 4LPSA 1D2NA 4QRHA 4C3ZA 4D4MA 8OHMA 4BFWA 4Q1AA 1XMJA 1N5KA 3L0IB 4NZYA 1T3LA 1YR6A 4HB0A 5GJWC 1YRAA 3L82B 2XXAB 1N6OA 1YVDA 3OFND 1VDZA 2NO1A 2HF9A 3K0FA 4OQXA 4TT3D 1GOTA 1RRFA 2ORWA 1JNYA 2IYUA 4PQRA 4XWOA 2DWPA 1G5TA 3EAQA 2VYFA 1EWRA 3E2IA 3CONA 1E9DA 2G1KA 2E87A 4L9SA 4F38A 3GJ3A 4HZIA 1QHXA 2IK8A 3VR3A 4Q4AA 5DO9A 4X8OA 3BOSA 2ZSFA 2P65A 2REXB 3TMKA 1ZM3A 1UJ2A 5E7JA 1SZPA 1KKMA 4BLSA 2ZE5A 2C77A 3WP1B 4GSYA 5FOTA 2GTPA 3GLGA 5B2ZA 3CF0A 1N5LA 4TMXA 4HAXA 4CYMA 2CHQA 4JVLA 2OESA 2PMDA 3B85A 1OH5A 2FFQA 4KVGA 5IK2D 3RS0A 2J5XA 4IFEA 1P2VA 4BQSA 2BDTA 1E96A 3U6BA 1GILA 3O8CA 5H8WA 2ATXA 5TVKA 5L3SA 3HU3A 5J40A 1V43A 2QP4A 5DYGA 4OQNA 3VX3A 3TW8B 1UKYA 5DI9A 4QGGA 3VNUA 1NVWQ 4PR0A 3RYTC 4YDHB 2G88A 1UDWA 1KZ7B 5J47A 2IYTA 5LB4A 1J8MF 2UZ3A 3DM5A 4LJYA 4RFVA 5CK5A 5KNBA 3U5ZB 1E69A 2WJHA 3NC1C 2O5VA 1IQPA 5GVSA 4ZO4A 4RKEA 4A6XA 1L8QA 1BIFA 1OV4A 1DAEA 2CNWD 5C46F 1OFTA 3QG1A 1VYTA 2DY1A 3CH4B 5L3RA 1U8AA 3GQBA 1TADA 4M9XA 2EVWX 4LBZA 2QE7A 4URUR 2OEPA 4BPBA 3GLHB 3FYHA 1S3GA 1BMFA 1OB2A 1CF4A 4DT1B 5DISB 2CCKA 2XB4A 2ZVPX 4UQOA 3U3JA 2J0UA 4U02A 4J0QA 1XTKA 4N0EA 3U4QB 1HUQA 1MRSA 4ZI2A 3PUZA 1K5DA 4DUGA 3U7HB 1FFHA 2C9OA 4RY2A 2CXXA 5KPJA 3KKNA 4IEIA 1XB2A 5KSOA 1CR2A 4DHEA 2ZRBA 2ZRLA 2P5TB 1FX0B 2J46A 1KK0A 3ADKA 1CKEA 4M4SA 3KZ1E 1Z2AA 2WKRA 3SDZA 3DOFA 4GPTA 2QE7D 3BC1A 2A5GA 4MGZR 1A1VA 2XTNA 4HZUB 1VG9B 1R0ZA 1JEDA 3A4MA 5EP3A 4B2IA 4QJ3A 4YMUA 3TR0A 1NG9A 2JJ8A 4DRZA 2HF8A 3LVRE 4M2LA 4ZV4A 4JS0A 1KY3A 3QBTA 5CDFE 2WKPA 1XPOA 1FQKA 1CLUA 1RYFA 1VIYA 4JYBA 3VR1A 1IN6A 3RVBA 1OE0A 1TEVA 4G3XA 1OIWA 2IX3A 5JI3E 3GCGA 3LV8A 3CZQA 2Z4SA 4V0MA 1DARA 2RB4A 3W6OA 4D0LB 4HLUA 3LXRA 5HCIA 4WA7A 4KITB 2JLUA 2FF7A 3E70C 1BKDR 3U44A 4DSTA 1E2DA 1N5IA 2YVUA 4I1UA 1DTSA 5HCNA 4MRRA 3CBQA 4HYYA 3B8HA 4NPHA 1UAAA 3MCAA 1QHYA 5HTKA 2IUUA 1S96A 1ZINA 1DO2A 1N6IA 2VRWA 2ZEJA 3TNFA 2CCJA 1IBRA 2EFCB 3F0TA 3W3AA 2QSYA 3CPJB 3SEAA 1U0JA 1BS1A 3VU9B 1P9WA 3X1YA 3ASYA 3A8TA 2CE7A 5K8UA 1XXHA 1SGWA 4RD2A 3FFAA 4LC1A 1X1SA 5IDVA 4WXPA 2W6IA 1COWA 5JJLA 1FP6A 2OXRA 2AK3A 2DCUA 2FSFA 5EZ6B 1GKUB 2J0VA 2JGNA 2Q6TA 2R6DA 2Q3FA 1TNDA 3CNLA 4KU4A 4A4DA 4DDUA 3BS4A 1F2TB 1EK0A 1Q22A 2DFTA 2J41A 3CX6A 3GEEA 5JCZA 2ZREA 3IEVA 2BMDA 1OYWA 2F43A 4MKIA 3KQLA 1W44A 2V7QD 4NHOA 2QTHA 3QVVA 4PC6A 4GZLA 1KI1A 5KUTA 1N6HA 2A3RA 2IS1A 4Q7KA 2XNSA 3MJHA 2JA1A 2XTZA 2QA5A 3U61B 3OE7D 4TYQA 2D74A 4RFSB 2HV8A 2UVQA 2FE4A 1JAHA 2GF9A 4JLJA 4ZI3A 1DAKA 4FIDA 2LKDA 5J4HA 3RHFA 4FMBB 3S1AA 4BLPA 2ZSEA 3KFXA 1QHHB 4AY2A 2QSZA 4PO9A 2JASA 5JHHB 5GADl 2MSEB 3O8DA 3UPUA 4A82A 2RAPA 2DWQA 2REOA 1KO1A 4LC0A 1CTQA 3K8YA 4XTRA 2FWRA 3K0CC 5H1YA 4DCSA 3P32A 3B1VA 3T1VA 1CJKC 1TTTA 3B6EA 2QT1A 1EGAA 2HLDA 2RGGA 4B47A 3NG1A 2IYXA 3EC1A 1FMLA 1S0UA 2Y8EA 1OXSC 1CJTC 3SQXA 5DH9A 5G3YA 4IEEA 4DLYA 4FCVA 3GJ5A 4D26A 4IXMA 1DADA 4AG6A 2H1LA 2JJ1D 1GRNA 2V6IA 3MLEA 4OJQA 4XIGS 4KSCA 2ODNA 5KNCA 3T1TA 1U0HC 4O2LA 3LNCA 1KGDA 3CRW1 4JLNA 3AM1A 4PC3A 4V0NA 4YDSA 3U7GA 1R4AA 1SVKA 4E5UA 1R8SA 4TLBA 1YZGA 4BLRA 4DLZA 5FR1A 2WWFA 1OF1A 4KSBA 3SZRA 3PIRA 1W7AA 2CBZA 2VP2A 3QIAA 5F98A 4N3NA 2FSGA 2C8VA 1W4CA 1Q21A 1Z6AA 4ARZB 3QQ5A 3FVQA 1AKEA 2GXSA 4RKFA 5L3VA 3J81k 1XTSA 1HYQA 4GOKA 2ZXUA 1OXTA 2KI5A 2WTUA 2A2ZA 1Z08A 3SN6A 4QM6A 5H70A 4FI3C 1QDEA 1C4OA 4ESHA 4GZMA 1MABA 2GETA 1Q0UA 3WNCA 1DAFA 2K5UA 4L16A 4OK6A 1KNXA 3W5JA 2V3CC 3A1TA 4TL8A 1KI6A 3D31A 1LTQA 2XAUA 3OEEA 4HAZA 3WXMA 1P60A 1X1RA 5B58C 1Q3TA 2D06A 4WVFA 3ZQ6A 3SOPA 2OO7A 3IIJA 4D25A 2UKDA 3ZQJA 1Z6XA 1G64A 2BBTA 3T35A 4LI0A 1FQJA 1W4BA 2FOLA 2ZIAA 2FNAA 3VNVA 4G5GA 5BYKA 3DOEA 3THXA 2WOJA 4HDOB 2GJ9A 1DG3A 4KV9A 1P2SA 1AK2A 1D6JA 1W2GA 1XD2B 5KOYA 3H2YA 3NH9A 2XZOA 1Q1ZA 1QG4A 4M53A 3AF1A 1FNMA 4TYWA 1DBSA 3RRZA 3TLXA 2YYZA 4QGHA 2QMUA 1P62B 3IEUA 3D7MA 3VKHA 2WJGA 1G1MA 3K9HA 3DMDA 1GUAA 4JYCA 3TUIC 4G5OA 3TGPA 4NYIQ 5JFGA 3QPWA 4BASA 2GBLA 1G4AE 3AKDA 4C0JA 2H8KA 2XOKA 3QENA 4Q66C 5CLLA 3KJEA 5FBQB 1MO6A 4MGKR 4JLOA 3C14C 3LQQA 4TMTA 4XOIA 2A5FA 3AVTA 2ATVA 2YV5A 3I3SR 1XCGB 1NI3A 4PHGA 5KO2A 4GT1A 5ANRB 4CEHA 3ZGXA 2B8WA 2IHBA 4EPRA 2YWFA 4AG5A 1NLYA 2XSZA 4IDHA 4NH0A 1G9XA 4FWTA 3L0PA 1XMIA 4IVRA 4AURA 4DLWA 1KI4A 1ESMA 1YR9A 5G41A 1Q1BA 3RLFA 3ICEA 4US0R 4B3GA 1ZRHA 1VHLA 1VPLA 1E9CA 1E0JA 4L5BA 5JS8A 1ZUNB 4Q1BA 5CJ2A 4EUNA 4XVQA 1C1YA 3CPHA 3QI2A 3OIVA 5B30A 2P3SA 1ZC4A 3TR5A 3CF2A 2XITA 3AVXA 4Y0VA 3TSWA 2NO7A 2OLKA 1W5TA 4E07A 4IXNA 4AKHA 1T5IA 1P2UA 4C7OB 2MSDB 4BECA 2H57A 1JXMA 3EX7C 1MV5A 2PBRA 3EPJA 1UADA 5AR1A 1SULA 2GILA 2YOGA 3T5GA 3CX8A 1G291 5KDLA 2QM8A 1LVGA 1AKYA 3BH0A 2WWGA 2PZEA 3A37A 1JR3E 3IGFA 3SS8A 2R6GA 1DO0A 1ZUIA 4P0TA 3ZYCA 1NIJA 1R6BX 2O52A 1XJQA 4MDEA 3OEHA 2YJTD 3LQRA 1E32A 1SXJA 3NIBA 1HY3A 1W0JA 4MA4A 1XPUA 2ANBA 3FE2A 4CW7A 2IC5A 3C7KA 3DZ8A 3UATA 1T0HB 1PUJA 1UBEA 1U90A 2OAP1 2J1LA 3MFYA 1VG1A 1GRRA 5CDFA 4A6PA 3QF7A 3G5UA 3T12A 2RGAA 3I8XA 3FKSD 2F55A 1IM2A 4BEJA 5FOUA 1YQTA 3FHCB 4TT3A 3VX4A 4ZKEA 1H8HD 4XVUA 4A1FA 3MRSA 1E0SA 5HE9A 2QORA 3AKEA 4H1UA 5FPSA 4PSKA 4UNNA 2OFXA 1J70A 2IXGA 1A5TA 1YHNA 4PSVA 4PC7A 1H8EA 1TAGA 2OUKA 1NBMD 4MKHA 2XJ4A 4OI1A 1QVRA 1R2QA 2ZUDA 1XCMA 2IXEA 1YZLA 2PCLA 4UKDA 1Y63A 1E1RD 1L4YA 4KFUA 3KQNA 1KMHB 1CR4A 4UXIA 1SVWA 2ZITA 1DOAA 3AVWA 4PHHA 4R98A 4B6FA 3LY5A 1PLKA 2OAQ1 3C15C 1GKYA 4WW0A 3GLFB 1JR3D 1G8HA 1NG1A 1SXJB 3NC0C 2HJGA 4YXWD 3RWMB 2YHSA 2GAOA 3TVDA 2B7CA 3D6TB 2V1XA 3UWKA 1RJ9A 2AFHE 3BAFA 3UK6A 1XD8A 2ZJYA 2OHFA 3QXCA 5EE0A 4DCTA 4ZIRB 4M1KA 5FOVA 4P33A 2C95A 3NDBB 3I4LA 1KDPA 2ZS7A 2YKGA 2WAXA 1T3SA 3B1WA 3GLHE 2CJWB 1M2OB 1XMSA 3AF2A 3LA6A 4NONA 3RSOA 1SXJD 4QBHA 3SFVA 1G41A 2E9SA 4JBXA 1E79D 4RFSA 5DNYB 1EESA 2ZJAA 1AS2A 2XZPA 1FW6A 3GFPA 2QU8A 2FFBA 1SVIA
chains in the Genus database with same CATH superfamily
4UTXA 1QSGA 4KIWA 2Z83A 3UH0A 1NW6A 4RGQA 2AA3A 3IILA 1NDQA 2ZT8A 3C5VA 2RI1A 2RJ3A 3D4IA 3PFFA 4GVXA 4R51A 3UWSA 2BHLA 3R5SA 3I01A 3WA7A 2PG3A 4GXNA 2I3GA 4PLFA 4HGQA 1F1BA 1Z83A 3MOSA 1TZCA 4ZRMA 1UDCA 1A2KC 1YQUA 4ZJYA 5JDIC 2P6RA 4K8OA 1QO9A 3G9ZA 1I4LD 3U4QA 3MERA 1DHTA 3FPKA 2QRVB 1B23P 2FMHA 3I1JA 4H16A 4WKPA 3WNDA 3QXHA 2VDVE 3BCSA 2BEVA 3UZUA 4DA6A 1SUIA 4I1PA 2PUBA 4XGQA 3VHRA 3JWEA 4FEAA 3ZD6A 2C58A 1UXGA 2IP4A 3LKZA 3NHJA 4JSRA 4D4JA 2VPZA 4DIBA 3CNNA 2H31A 1B0UA 5ETJA 5EXPA 3KLMX 5T4EA 1XEXB 4HQKA 1I5RA 4ND8B 1TTHA 2RHBA 3QQPA 4FR0A 1YMVA 1IN5A 3WL5A 3KVYA 4L4UA 3KT0A 4G2TA 4EEKA 4ER7A 2ZBDA 1BOFA 2P0EA 3FBTA 3PWKA 4J2TA 4UBMA 2A1UB 2PCJA 5EG5A 2O1WA 3M2PA 3ZGLA 1H8HA 3QELB 3IP5A 1LLCA 1VGRA 1I24A 2EJVA 4G0XA 4MRVA 2AT1A 1PVOA 1MPXA 1T1EA 1ZW6A 1G16A 2G5TA 3NW9A 4FONA 3UH1A 4BQRA 1XVAA 3EE6A 3EQ7A 1WNTA 1Z5WA 3GJRA 4Z3DA 4CIVA 1PQUA 1S4QA 4QG7A 3ROMA 4ZVSA 4Q37A 4BMZA 2HAEA 4QOIA 3LUFA 1EP2B 3KR9A 3CZMA 5CM8B 3RKUA 2I2DA 4PRYA 2GJ8A 4GOND 1L4MA 3LVFO 1FDWA 2IKSA 3LK6A 4PX9A 5ECDA 4A3SA 1U0FA 3A6HA 2WIFA 3D7KA 1UKBA 3OLWA 3GEGA 4FBMA 1E98A 5C4MA 2X2EA 5FLXA 4Q9DA 3SC4A 3TXAA 1N4AA 2HK8A 3EDOA 1VL6A 2IE0A 3DDOA 4D8UA 5C1OA 4OEHA 4M7PA 3TBKA 1UXHA 4F3CA 5LOVF 3T38A 4MJLA 5D7NA 3ZPXA 4Y30A 3ZWCA 1ZL0A 1EVLA 1J49A 2QRKA 2PFKA 3SQOA 2PUEA 1GHTA 4UAGA 3G0IA 4Z7OB 1T1RA 1CUVA 5AOAA 2OHJA 4IJVA 2J3KA 4PG8A 1IXRC 3TW4A 3WZLA 5AW3A 3M6FA 2R8OA 4JWTA 4XUDA 5FBKA 2FPXA 5IEJA 2YV4A 2ONKA 2R6CA 3SCZA 5HCUA 2X4DA 2UUAB 1NBMA 5HE8A 1I7LA 3WV5A 5A4IS 2RKWA 4G1EB 1E3WA 3OIFA 3DMRA 2X6QA 4M22A 4MCJA 3TBFA 4K40A 1XROA 2AG8A 2NU6A 1ISMA 2AX3A 1VDMA 4QT4A 1XQVA 3ESYA 3FPBA 1RPJA 2IHKA 1OMOA 3FOAA 3FR8A 2IZ1A 2Z5FA 3INNA 3MJDA 1PL6A 4G4SP 2QJWA 4B79A 3BDVA 3DTNA 2PL5A 1W5AA 4XJVA 2XCQA 5BUSA 3LYAA 4XQGA 3V34A 3VQTA 5CTAA 1CPYA 2XQGA 3PD0A 4BTLA 1SIOA 3PA6A 4X63A 2AN9A 3QU9A 1FUIA 3RH0A 4ASUD 3GLGE 2FJUA 3N2GA 3EIFA 4FLFA 4U9IS 2MYUA 2WKWA 3PHBE 4TTIA 2QRNA 4LBWA 1IZ0A 4WOBA 1OREA 2FQYA 1IH8A 2QENA 4DCVA 3ESCA 1YUNA 3O2JA 1DCKA 1ESNA 1VI2A 2NU7A 3FW1A 1EFAA 4R7ZA 4YAGA 1UEXC 2IPOA 3F78A 3BB4A 3MWEA 2N46A 3H7IA 4IR7A 1R4MA 1H0SA 2XQKA 4OQYA 5AVYA 4G0VA 2QN3A 5P8WA 1YBHA 1GKLA 1ZVKA 4J9UE 3SEFA 1ESCA 5TQ0A 3OT1A 4L9WA 4LSGA 5B3AA 5KVCA 2HIAA 2BFFB 3DXZA 4JC5A 1NI4A 1ZIDA 3NORA 4W5HA 4ZVQA 1UK7A 3JQFA 4U2CA 2WILA 4LN1A 5IUJC 2H1OA 2JEYA 4V0QA 4YO7A 3VPAA 4AZTA 5LZ9A 1OWPA 3QKSA 4URFA 4F12A 2R62A 4BLVA 2FKNA 1YBFA 4C3VA 1KOFA 1O6FA 1YB1A 2W5UA 6PFKA 4UJ3A 5TVGA 2NVOA 1WTCA 1ORVA 1C14A 3PG5A 4V0KA 2F00A 5EJEA 2CLSA 2IVFA 5P21A 2Z4TA 1U0RA 3GRKA 3QKSB 5A9TA 2QQ5A 3STXA 2BDUA 3TW6A 2D1QA 5IARA 4GPEA 5DVZA 3QOFA 1VE9A 1YS6A 3HCEA 4TV9F 4AJ4A 3LQKA 4DNPA 1KYWA 1FQOA 3I09A 3ZS8A 5JXJA 3COVA 5TJ9A 1I2BA 2VHXA 4MW5A 2OXIA 2PKQP 3GNQA 5H7XA 4EG8A 4QJ5A 2CB9A 4FSHA 2PEYA 4MWTA 3MJTA 4I1SA 1ID1A 1AURA 2GEJA 2CUNA 3TOCA 2J09A 2X7JA 1JSCA 3C6QA 1RWKA 3JQ8B 4U9UA 3I1IA 1UDAA 4JLMA 2B8TA 4FOSA 4KIJA 2XVMA 2J6CA 4BOYA 4QHSA 4CL0A 4D2IA 1LK7A 1SC6A 1ZO8A 3RREA 5BT8A 2X40A 2CLKB 4K9SA 3K2QA 2BEKA 2WHXA 3IBYA 4LMRA 4OJKA 4R8MA 1CQIB 1GNVA 5LUBA 3TIXB 3II6X 3H0CA 4QULA 5IFKA 1JE1A 3K9GA 4EGAA 5LIRA 3R44A 3JWPA 3VYTB 2AIRA 3FWKA 4XM0A 1P3Y1 2ERYA 5EFOA 4R1QA 2FXIA 1PJ4A 1W1IA 4E5VA 1O0CA 2VDPB 4H7DA 3IFSA 4U7FA 2BLLA 5FI0B 4C0HA 1AN0A 2FCAA 1DUSA 4WCVA 5JFTA 1NVMB 3C4QA 2QDKA 1AKVA 1GD1O 3IP9A 4LJ7A 1K6MA 3WJAA 4AF7A 1J8VA 3BGIA 3SYRA 2C98A 4BNUA 1LBTA 1MQ8B 2HT6A 3SYKA 3TQIA 2K4MA 1R66A 3N75A 5DCLA 3EZGA 1GA1A 2C4UA 2O2DA 2XGOA 4AZVA 4IQFA 2NG1A 1T2NA 2V5AA 3KQUA 4DOMA 2R4UA 1NV9A 1I5OA 2HR1A 1MB3A 2ZR0A 3NXKA 4YFVA 4Y67A 3VOTA 2BTOA 3E0XA 5BT9A 3L0OA 2WTXA 2JLCA 1DV2A 1T2AA 3DE6X 3LBYA 1NAIA 2X58A 4PNZA 1TAHA 3UJ8A 3RSGA 3H6KA 2MYTA 4MTLA 3E8MA 4NEHB 3VHXA 4EH1A 2OV2A 3R7FA 4GE3A 3WMEA 4JMPA 3E8SA 4HK4A 1XA0A 1XU4A 3JV7A 4LJ4A 1OAAA 1HKHA 1QZ3A 4MCIA 3ESAA 4TZ0A 5FUVA 4EECA 2GRJA 3MNFA 4HNAA 3U56A 3VYSB 5EZSA 2B2CA 3RS5A 1GM5A 3DVQX 3IUQA 5CA0A 3GFSA 4BRUA 1VLQA 3DMGA 1UT8A 5FOSA 4R9UC 2OYCA 1E1RA 2V5UA 4RA6A 3I5AA 1S3FA 4W9NC 3ZQ4A 5FLEX 4D92A 4JLAA 2ZUEA 1UZAA 4QSMA 1A88A 3KCNA 3E58A 4BP8A 1TK2A 1B1AA 5FUXA 2H9AA 2GZDA 3PX7A 4K2HA 5DWQA 1FJGB 5CA0F 3EUWA 5BQXA 3W05A 3LF2A 2GKGA 2KS6A 1XTRA 4GICA 4HXYA 5CIWA 2ZIUB 4WIAA 3ZS9A 5KEIA 3FMGA 4OQDA 1II0A 2ZQYA 4ACAA 4Q4CA 2LTAA 5ADWA 1AKUA 4NE2A 4DLTA 3BRWD 4NR0A 3TQHA 2XNDA 2O8FA 1SXIA 1CUJA 4EQZA 1AGRA 2EU8A 3LLMA 2NO0A 1THMA 1ULBA 4L0CA 1XT6A 3UCEA 2YJZA 4J0IA 4BAGA 3NP7A 4EHLA 2R6ZA 1ZAYA 3S5JA 2YZMA 2ZSUA 2VJPA 4MYUA 4FGZA 4GBMA 2EFJA 2Q2WA 2AWOA 3C43A 1HF3A 1XWIA 3ZU3A 3ZX5A 1YFLA 4LTDA 2IXDA 3D0OA 2OAEA 3L5KA 4OSPA 4D9EA 421PA 1BH6A 3O84A 3SC3A 2IOYA 5AM0A 4TVSA 2VZLA 3AESA 4GIBA 1I2ZA 4KXMA 2IUFA 1CZOA 2YXLA 1OIVA 3DQPA 2GASA 3QY0A 5MHTA 4P93A 4BS9A 3LP6A 3PEVA 3JQGA 2HA4A 2EBFX 3DV9A 4ADSG 2RH4A 3LFTA 4J49A 2BT4A 4MVJG 1E8MA 2ZDHA 1HI9A 2GM5A 4CT4B 3R0XA 1Q91A 5EN4A 5MGBA 3ADCA 1JQDA 1P6XA 4U0JA 1OPXA 3UJNA 1JHMA 3QBEA 1E2EA 5LBIA 4HUQB 2HBYA 4OXQA 4CM7A 3OCWA 3TSYA 2MIIA 1ZK0A 3FFBA 1TC2A 3P2JA 4R1MA 3F5SA 5C53B 1R5OA 4HAVA 3VDMA 2W2MA 2VRNA 1OBFO 4ZDJA 4D44A 4DMUB 3ZNQA 1HE3A 4WESB 1YTUA 3ER8A 3X2SA 5EUBA 2H51A 4IDPA 1FP1D 3QSGA 2NPFA 3HI4A 4O2RA 3S7TA 3LLCA 4CM9D 1JECA 1YU9A 2QVCA 3MPOA 3QU4A 4WZBB 1DXYA 3L7BA 3N8IA 2AB0A 4YJGA 1WE2A 5EJ6A 1BFDA 2G83A 4MAMA 4P5EA 4LTNA 1R0RE 4IZHA 1HT2E 1WB4A 1H69A 3UJPA 4YMVA 1VBFA 1X8KA 1NUPA 3Q15C 1JEYA 1ZZGA 5JD6A 3TBHA 3GH3A 4BJHB 1PNTA 3AZOA 3DPUA 5FQNA 3WYAA 4LCBA 2XECA 1YZUA 3FMVA 4IIBA 1XX6A 1LDGA 3A25A 1NBEA 1U7PA 4A9AA 3A4LA 4RV5A 5DFAA 4YJ2B 4CEIB 2H4XA 5DHAA 3ECAA 4I9HA 3SBEA 2O9JA 3FF4A 1XNQB 1OZGA 1CT9A 2LV8A 3GIDA 5ALUA 1DJQA 4MJ3A 1QGYA 1TQHA 3HL4A 4JJZA 2O2IA 4NCKA 1LC3A 4JU9A 3KQSA 4U7TB 1KMHA 1Q1AA 3IPLA 3P0FA 3ANMA 1P7YA 1DAHA 5E3IA 5JVDF 5A4JA 1I3KA 4U7PB 2GESA 4BO2A 4GNRA 1XZIA 3GMTA 4Q4JA 4XJSA 5DE3A 5HZHA 2VHTA 4TYNA 3IT1A 1IVSA 3BF7A 3ZUGA 2QM7A 1JB9A 5TPWA 1D2EA 4B80A 3CVJA 1W5FA 3KHSA 4PICA 4ITRC 4A15A 5JANA 3TE7A 3AETB 4XASA 2W2VA 2OBMA 3GDWA 3LAWA 2DHRA 1BEEA 2HJHA 2ZRHA 1XE3A 3DO8A 2YVKA 3FKSA 4POOA 2GM4A 1K3FA 3W5DA 1MQAA 2I66A 4R16A 3G5TA 3LF1A 3QVWA 3HCCA 2F8LA 2ENWA 4DB4A 1KXZA 2IHUA 3F6PA 3OBBA 2X0DA 1E4VA 4A0HA 3OMXA 1JKMA 5IDXA 1WJGA 2NO6A 3PL5A 4JBHA 4Q16A 3FUUA 3K0FB 4OREX 3WMFA 4AS2A 3MWDA 3HXQA 4LHVA 4C0LA 1F0PA 1LWNA 1UQUA 5ALYA 4UC0A 1QGZA 4OL0A 4IV8A 1PW7A 4XX0A 3T4PA 4NK5A 1Y6FA 4Z53A 2AR7A 3WGYA 3GRUA 3HU5A 4XIIA 3PRKE 5D01A 2A5DA 1V4VA 1BDJA 4DLUA 5NLLA 1V47A 3D8RA 4KR9A 1T24A 2JKYA 2X0RA 2X5JO 2XZDA 1E6WA 1WMSA 4LMAA 4Q1EA 2RGRA 2ZB8A 1MO3A 2CDAA 2Q5JA 1X87A 7MDHA 1BHSA 2PHZA 4OHBA 3S3TA 4EY5A 1VP9A 4ZU3A 4AUKA 3KQQA 3WIEA 4DCNA 6REQA 4K81B 2ID8A 2AJCA 1QV7A 1VYUA 2B94A 4L3OA 4GMKA 3D6HA 1G3MA 4D4KA 4HSEA 1P1BA 3EPRA 4DV5B 3NOQA 1U8FO 2YHBA 4Y2HA 1FNNA 3THRA 4ARSA 1T25A 1E1CB 2FW8A 2OQIA 4IWNA 4JLUA 4A2PA 2PZAA 4MCHA 4EAQA 1WU8A 4CE6A 1GP2A 2IQ5A 1KJZA 3QX3A 5IZ4A 4Q7QA 4C5CA 2H0QA 1KA9H 4EG6A 2IYZA 3WMGA 4F5ZA 3BD9A 2D1SA 1SR8A 2YWEA 1JJVA 4N0PA 2HCBA 3QW4B 1P4HA 1SFRA 2B69A 3MSXA 1K0FA 3CGWA 3K9LA 4LJAA 3UGKA 3W2TA 1QHHA 2E5WA 2KB0A 3L4BC 5BN4A 1NX9A 1SKYB 2XCOA 2B82A 3DWFA 1BDBA 3IVGA 3IVCA 3GG2A 4MUGA 2O7SA 1PT6A 4XPIA 5CGQB 1GUBA 1A76A 2ZJ4A 1CWUA 4QXRA 3DZIA 3HCNA 2DE0X 5KCMA 4B82A 4D80A 4F1KA 3ES9A 3PJRA 3CE6A 5SZIA 2JJMA 3OP4A 4UMVA 4XCQA 2P7IA 1DS6A 4EG4A 4NRDA 1P91A 5C8YA 2NZXA 2HXGA 4BBAA 3T7KA 4EHHA 4DC0A 1TI7A 1RXVA 1DG9A 3PD7A 1XNJA 3DULA 5IXSA 2BKAA 1A9XB 2AOUB 2PUAA 2YZ7A 1OZFA 1YOBA 3I5MA 1MAVA 4RD0A 3SZOA 1TX4B 3N39C 3RTCA 1N7GA 1ST2A 3CG0A 3GL9A 5CH8A 5BR7A 1RQXA 3RFCA 1MZVA 3MUEA 5GGXA 3W2GA 1SAYA 1TYZA 3LDUA 3FPSA 4ALNA 4IHAA 4KFTA 1EINA 4ARVA 5AVQA 2CE2X 1LJUA 1ZGBA 6ADHA 1SUSA 3R7SA 3VYUB 1GGHA 4J94A 4OIFA 1TT5A 2UV8A 4KMRA 4X6XA 3DBVO 2PT5A 4BB9A 1W88B 4D3SA 5EXSA 1B0ZA 1JP7A 1MG5A 2O1SA 3E9ZA 3I28A 3EG5A 4PV7A 4A5OA 3FVRA 1GPKA 2CJWA 4Q4DA 2XKKA 1O97C 4JDUA 3LY8A 1XCBA 4E5YA 1AK9A 2Y67A 4X8HA 2FW7A 2AFRA 5LQKA 3Q0EA 4RTQA 4POAA 3HCAA 4FDVA 5CYGA 1R9JA 3TEMA 2ZSKA 3TW8A 2JAHA 1GPBA 1LCIA 3GDOA 1NVFA 5L6LB 1T8RA 3SGLA 1D8TA 1P33A 1KHTA 2R7NA 1ZGCA 3FHLA 3T4EA 4MB6A 2OK8A 4OHPA 5CJPA 4E09A 5KDDA 3QLUA 2Z3WA 3OD1A 1OFUA 1GAJA 3LGSA 2O23A 1U81A 4Q4HA 4R69A 4DG5A 1H85A 1TUBB 5ADVA 1Q95A 1AQ6A 2V55B 2QTBA 1ZX1A 1KO8A 3D1LA 4GPBA 5HKKD 2F7SA 1SVNA 3PPWA 4B3XA 1GNQA 3AV0B 3WBJA 1G3RA 2CLCX 2BHRA 3GJXC 2EWVA 5F33A 2OXFA 2FK8A 3RUFA 1JYFA 3RSZA 5EKUA 1S9HA 5DN6D 3REFA 4EY4A 3QI7A 3VSAA 3K8OE 3TJZA 2VXBA 5CXQA 1QIMA 3SQLA 4XD7A 2X15A 5EJ2A 3TQQA 2Z1NA 4LHEA 3ZJYA 5LQAA 3NYQA 3ILSA 3LSYA 3VH3A 1SCQA 3HXOA 1XP5A 3W90A 1ZJWA 1FTWA 3DFMA 3LD9A 3PBKA 2OBBA 2Y4NA 4HLCA 4MV1A 5DOZA 4B0OA 4QUIA 1O5IA 3OIDA 1B4DA 3EIHA 4FJ0A 3AEYA 4LVNA 4UM9D 4PX2A 1MJHA 1Y89A 3SVZA 2BGKA 4K9KA 1SVOA 5K9ZA 1NVEA 3JQEA 1LPNA 5IBRA 1T4DA 1E6CA 1IN7A 2B3DA 2QX4A 2WKSA 5ILOA 4W5RA 1MP0A 3V7FA 1SO8A 3QUAA 1EX1A 2ADOA 4UBIA 2IXAA 3IQXA 5JWRA 2ZVJA 4KX5A 2GARA 2R5FA 1G8SA 3RFVA 3P9CA 4O02B 3CUEF 1OH7A 4MDYA 4LJRA 3IT3A 3BGVA 3Q3VA 3BH6A 3JASA 1ATIA 1J7KA 3ZIUA 3DAPA 3HZZA 3OTHA 1P4JA 2KE5A 3I9MA 4GKVA 4HPXB 2GTIA 4PTLA 1LDEA 3AXTA 3QA9A 5CIYA 4NBTA 5I7SA 2SBTA 4LZAA 3JCZA 1J22A 5C8DA 1MT0A 5TPZA 3LHIA 4YMWA 2BI4A 4Q4JB 3KYBA 5LL6P 2PX3A 3P9PA 4JZYA 5H4HA 5GZ3A 1CZHA 1DJLA 4LHXA 2G9ZA 3F9IA 1Q2UA 3G68A 3HL0A 3OZXA 4JB3A 3TRDA 3A4VA 4DGQA 4LPKA 1Y3HA 5K0SA 5E4TA 4R3UC 4PN3A 3PUJA 2JNWA 2QR5A 2BN4A 1DEHA 3C3MA 2GJKA 3FSRA 4YJ3B 3A70A 3TZCA 5C8YB 1CRPA 1YE5A 2ORYA 3FAKA 1C0PA 1MJNA 1YASA 3HRKA 4JP2A 4S1VA 5FPPA 3KL4A 5CFNA 4YJ2A 5IC5A 1U04A 4QXQA 4FFPA 4AG3A 1C7JA 2C9CA 3OC0A 2ID9A 2JLZA 4Y6LA 1K5PA 2JGLA 2OFWA 4Q1FA 1L7MA 1EJ0A 2EIHA 4G4SO 4Y6OA 5C18A 3L8ZA 2HJVA 4JUCA 1KSFX 3BRQA 1NBAA 4GC5A 5FWAA 3IP3A 3EXG1 2OCYC 2QGNA 3C3WA 2PSDA 4HQRA 4RVFA 1JG4A 1XEFA 2W4IA 3D0KA 3MUOA 1I36A 5CMLA 1LPPA 4YP7A 2OLJA 2WG2A 2ZPAA 3P0IA 2FOXA 4A2QA 3RUPA 3HEAA 5BYBA 5JIBA 4F4FA 1EXMA 3VKWA 2PKEA 1G6Q1 1T5TA 4HNSA 2CK3D 1K68A 4FCWA 3H75A 3BGSA 1AKNA 2MHCA 4HB2A 4RA9B 1WLSA 1V39A 2ZRDA 2QTRA 1WQ1R 4MYCA 4RD4A 3LECA 4FLMA 3EEOA 4FZVA 1MVNA 4EJSB 2FSVC 3FROA 2EBWA 2O20A 3NANA 1D1QA 2F3RA 2O06A 3GJZA 5ICGA 5IAEA 1RYBA 3N2IA 1JR3A 1GNLA 4BQEA 1YKGA 3OTGA 3BRSA 3JALB 2W83A 4NYMR 3CM0A 1QPBA 4AJJA 4DGSA 2OOSA 3DV2A 2C9YA 4ILKA 4Q19A 3P9RA 1PK8A 4XUGB 1MHPA 1XF9A 4FGSA 3ZWPA 4CEJA 2O54A 3Q4GA 3L79A 1MOQA 4WGFA 3K5WA 3QY9A 2ZIEA 3IQEA 3W5UA 3UJ6A 1U31A 3EVBA 5ERYA 1WSAA 4DV7B 4L08A 4C2AA 4ISBA 1CK4A 1G55A 3AWIA 3OIWA 3WBBA 4BGDA 4BVJA 1QH1A 2JBWA 3GEPA 2XRZA 2FZVA 1XP8A 1W581 2Q1SA 2RGNC 4PU0A 2EZ9A 2NUTA 3K6RA 2QD1A 4D02A 1FFCA 4DLKA 5E4FA 2BHTA 4ER5A 4TV8A 3TMAA 4MV5A 4MARA 3DEAA 3JAMA 2EX4A 4FMDB 1WW3A 5CH5A 4D8WA 4TWRA 4GFDA 3SQDA 4GI5A 2J07A 1WUJS 2ODBA 3VHQA 2NP7A 1EQUA 3H5RA 1KEEA 5EXTA 3EH1A 5E1BA 2LE0A 1OWMA 4PFJA 2XNKA 3EQ8A 3SBDA 1RHJA 3CEHA 1UBNA 4PC1A 4RENA 3WO1A 4UCQA 1RM0A 1ZICA 3PJEA 4N40A 4Q9LA 5FHRA 3UNXA 3WK6A 4EPXA 1M1UA 3DKIA 5EIFA 1NN0A 2J4DA 3BB3A 1ZVQA 1M6NA 1JHVA 3JQAD 3PQFA 521PA 3WHLA 1NNEA 2Q4BA 3ED5A 3OCYA 4K0RA 3IHLA 3TWOA 2XCTB 2F8TA 2YC4C 3ZDCA 2BR4A 2OAGA 2H06A 2XMQA 4Z0NA 4CEIA 1A96A 1Q0LA 5BRNA 5B3LA 5IWCA 3BWXA 1DT3A 2R4QA 4ZTUB 4BV8A 3NOOA 5AW2A 1AE1A 1ZIPA 1K6IA 2QRMA 3AG5A 3N8KA 4XIJA 4DLVA 4CL2A 1PJCA 5DTMA 5BV7A 2P41A 5FT9A 2N3ZA 1KMQA 1G17A 4M98A 4BKOA 3C5WP 1JALA 3ITEA 2Q7DA 5FEUA 5K0BA 4LNAA 2P3LA 1BHJA 1QC5A 4KUEA 3SEZA 5KWVA 2ZJ6A 1GGEA 2NTJA 1XXLA 3EHEA 3L01A 4M0DA 3WICA 4WZBA 2X3UA 3ZCRA 3M0EA 1S02A 2JK0A 1U98A 4RZXA 3HFGA 4RVSA 2H17A 3LUPA 2X5OA 4WCDA 3FCSB 4HAOA 1HG1A 3SYTA 3R0QA 3FPHA 1RWNA 2G67A 4LSZA 4RMNA 4P3KA 4HTAA 1JZQA 3GGGA 5CFPA 5LPNA 3PB3A 4QLOA 3B8EA 4JYMA 4CKEB 5DI3B 3BZWA 3DBOB 4QELA 4DCGA 2PGDA 3GP5A 3OTWA 2I2AA 1Z5NA 1UC4B 1Y8QA 1QB7A 4C2UA 3C1TA 1Y9EA 5ALKA 3WGHA 3E9DA 3LCUA 1RXYA 1SHJA 1MX5A 2AC4A 2I78A 2Z8XA 4OYRA 4UQPA 5H68A 3AJDA 3IOBA 1TFRA 2UUPA 2V8BA 1BRTA 4O4IA 3H4TA 4TROA 4C5BA 1R6TA 1EDZA 2QD3A 3T3GA 3UF0A 2VKTA 3L84A 3QVJA 2NAPA 3DFUA 3HP4A 4WFQA 5FTMA 4R3NA 4N4AA 4FFSA 3I92A 4B2PA 3T3OA 3ZHBA 4F2DA 5KS2A 1UC9A 2ICAA 3IB3A 4PYIA 3ZHVA 3TCXB 4EJ2A 5HPYB 3FRIA 1A4RA 2Z0MA 3REOA 4AECA 1TM5E 2BVNA 1XRLA 4QSHA 4W5WA 3QE9Y 3NWOA 1NT4A 4ZCTA 5HKAA 5U1PA 1ONPA 4P8RA 2HQBA 3EXEB 4UNSA 1L8OA 3DMPA 2DUMA 2IODA 3UMFA 1MU0A 3CZ5A 5EP2A 4DXHA 5B57C 3K94A 1JDPA 2PJZA 3CIFA 2XUKA 4MVJF 1Q3HA 2H4WA 4FXPA 2X13A 3CPEA 1C1XB 3NIWA 1TIPA 3ZBPA 4C21A 3PUKA 3KKPA 4UCXA 4FEYA 2QUJA 4JP8A 3L49A 1Y9ZA 1LPOA 5DXJA 4DDKA 1GQOA 1S5PA 1M72A 3QK7A 3ULKA 1FNSA 5EYPB 4F6CA 4WLNA 1S2NA 1SUFA 3ZWVA 2ZRKA 4AJ1A 1WXEA 1R8YA 2P35A 4WNCA 1MIHA 1P1RA 1XVLA 3BGWA 3NEPX 4WSOA 3KKMA 3WGVA 8ATCA 3H7AA 2B8EA 3HXPA 4I55F 1KDOA 1NW7A 2OGWA 5CT8A 4NCBA 3DL7A 3I0ZA 3OE7A 4IDEA 2VK8A 4HRXA 5EJ5A 3E48A 3BHJA 1MB2A 1PEAA 1W4ZA 5BUZA 3MEQA 1WA5A 1E4OA 3TH5A 3RJZA 4JJGA 3CNEA 3LZCA 4KHZA 1TUEA 3DBRA 3OJFA 4KAFA 4RPHA 3W9YA 4EUEA 4F91B 3AVXA 1G3IA 2AYXA 1E2MA 1J00A 5I6DA 2VWGA 3VR6A 1VA4A 2Y9PB 3OD5A 3N7AA 5KSPA 2I67A 3R20A 2XW6A 4JKIA 1N6PA 3MBKA 2OCDA 4A03A 3AXSA 3VHXB 1AC5A 1HQKA 4E5KA 3U16A 3E35A 5ES3A 1WPRA 2YW2A 2F8SA 4NZPA 5JR3A 4BNZA 2VWHA 1N2BA 1MABB 1HNWB 4EG5A 2JKVA 3WB0A 4JC8A 2M9MA 2FWMX 3WVNA 1DCMA 3NT2A 1QO7A 2P2YA 4G0ZA 4RW0A 4D0SA 1P7PA 3L8FA 3NJRA 2FQQA 4XVHA 2AKAB 5J4YA 4HH4A 1T1SA 3QLEA 1ODIA 2BTQA 2VF7A 3M2TA 1Z6YA 4MB0A 1P5FA 3O8BA 4QJIA 4R5MA 4RPKA 3SJCA 1ICEA 2Y77A 5E6RA 1N3IA 1KDTA 1XCOA 2XOXA 2HCJB 2VQDA 1G19A 4ZQFA 2ZBEA 1YA6A 2ZTHA 4LOLA 5JC8A 3IV9A 3BVPA 5A0FA 4J90A 4MV3A 1JIXA 1W0KD 1HXHA 1BTOA 1CRWG 2BGNA 5E6RB 5EPUA 3R3WA 3RS2A 5LYJB 2BTQB 4LYAA 1LWOA 1JG7A 1KQPA 1HH4A 2XR1A 1WXIA 2FW0A 4HGRA 3THSA 1GGVA 3PQEA 4LK3A 2Q4EA 1E79A 1N2HA 1ZQ9A 3PDWA 1XRNA 2DLNA 2M6RA 3AC0A 3VUFA 2M32A 2PKYX 5AKGA 2ACEA 5JJIA 5CX1B 3ZVKA 2ZJ3A 2WV7A 3N3BC 3FGZA 3LPDA 4OOEA 4FSXA 4RIIA 2WUFA 2EDAA 3M1YA 5KYUA 4CCAA 4E33A 5BV8A 5CA0B 4W8GA 1YHZA 1H9BA 1SKYE 4GDMA 4HQFA 4A8JA 2D5LA 3CF4A 3D3QA 4ZAGA 2GZ3A 2WD8A 4QYTA 4ZTBA 1JI0A 4RLQA 5B4TA 2DFVA 4Q3BA 1PFYA 2E0IA 3ECCA 5HUJA 2HUPA 3HRHA 2V58A 2PYZA 5SYNA 4C22A 4CCWA 3QPAA 4M0MA 5C0OE 2PVPA 2VZ8A 3LFHA 4BO6A 3FFXA 4C4PA 1S2IA 1WF3A 2HHCA 3JVVA 3STWA 4D99A 5J2UF 2YOFA 2BEUA 2QE6A 3G88A 1XELA 4PLTA 3V1NA 4TQUS 1OFIA 1I8TA 2AOWA 3P9IA 3ZOZA 3H19A 3DPIA 2SKDA 2XUJA 4I3GA 4K0KB 2QG6A 3D0QA 4M36A 4U7DA 4MIEA 3H2SA 4WGGA 5BSVA 2BZGA 2CY0A 2JIPA 3RO7A 1X9HA 2EP8A 2L19A 5FI1B 2LVBA 5A9SA 3GCZA 1PHPA 4D3FA 1EVIA 3PYXA 1II9A 2H5EA 4Q12A 4NFSA 2O6LA 4YVFA 3QLUC 4TTSA 5K51A 1SD1A 2DH5A 4OMUA 4Z2YA 1Y4AE 2R66A 1SC4A 3LZ6A 2EG5A 3KSZO 5CITA 3DFFA 2ZKIA 2VSFA 1Z12A 4W63A 3UW1A 2VWQA 1UMCB 1HZZC 2W11A 1LLUA 3FNBA 3HABA 4FYKA 1J90A 4MHTA 4XDGA 3GCDA 3MIIA 4H7EA 2R751 3F7NA 1ZPDA 3GFRA 4UDYX 2NU9B 3Q7PA 5AOVA 4GPD1 3A32A 3GK3A 4C6SA 2PPLA 2I9KA 3KB6A 1R1DA 2VHUA 3Q7EA 3A05A 1HL7A 4XWKA 3CF6R 3KT8A 4G0NA 1E2HA 2EZTA 1N0WA 1XQYA 1SCBA 4II7A 1BGXT 1I51A 4G26A 3NCTA 3WL3A 1QK5A 4CQLB 3UBTA 2JJYA 4JNKA 2BMWA 4AY4A 4HFRA 1D2CA 2IEBA 1Z22A 2WSIA 3A1UA 2F1JA 3NDRA 1EVZA 1TAQA 2V7TA 2ZWAA 3PGA1 1FSFA 4WN9A 2BFBB 4RCZA 1O0SA 1SXJE 2EAUA 3GGSA 1X1TA 2J5QA 4ATNA 4GZ3A 5BRJA 1EVKA 2AFIE 4DIFA 2PLWA 1HYHA 2ZYGA 3THXB 2Q2QA 4N01A 3PVZA 5TMEA 4QDXA 2RHLA 1FYXA 2Y0PA 4P9NA 4CHTA 4WN3A 2BOVA 1LXCA 3IP6A 1KARA 3QYJA 4EIWA 3WSVA 1UOPA 4YMIA 1D1TA 3DT8A 3LNTA 2F1KA 4FGKA 4UVDA 4WKNA 4BKUA 1X7GA 3AERB 3UTCA 4IF6A 2LW7A 1ABFA 1N57A 3EBLA 4YRIA 3B6JA 4C88A 2B1JA 1OLXB 3CR8A 3RWOA 2IY9A 2V7QA 3ZE7A 4ZV9A 4BP3A 4M0LA 1XDGA 4Z8XA 5D5PA 4B2YA 4MI9A 4Q4AB 3RS9A 2QAJA 4ZICA 1GNSA 3FOZA 4X71A 3K0SA 2IBSA 1UANA 5LFAA 4P7JA 4G65A 3SS7X 3A9SA 3KPVA 1C1HA 1WRBA 5EQJB 3LGXA 4XLZA 1Z6GA 3MFQA 2GAFA 4M6WB 1LK5A 1VJ0A 1OB5A 1FFXA 3A1FA 1E8NA 3V7UA 2C2BA 3NTRA 4X7MA 1OCEA 1IOZA 2WZQA 4JHLA 4NBVA 1MQ9A 1SZDA 2HFJA 5E1DA 1CJUC 2XDQB 3C48A 5AI6A 4P32A 4KIFA 4B7XA 4BMXA 5C8VA 3AIOA 1FIUA 2H4ZA 1ZN2A 4Q9IA 3H5IA 5FORA 1MGPA 4U2DA 3S6JA 3HM9A 4Q9AA 4ENPA 3K9QO 1RZRA 2VJQA 3Q9SA 4FZ5A 3OJXA 4I9GA 2PX0A 3CRMA 2Q2NA 3NTVA 3T5CA 3D4LA 1XMVA 2W8BA 3VTAA 1JQEA 4YV1A 1W93A 4Q3DA 1IC6A 4E5MA 2H1HA 1ECFA 4J8PA 4YUYA 1UK9A 3G7UA 4GOMD 4P6VF 1XAHA 3MAAC 1V4NA 5B6PA 5JBIA 1AQIA 1U4OA 5F4ZA 3OTOB 3MRVA 2ZRGA 1AHPA 2WWXA 4X5OA 1CDZA 1M1YA 5EZQA 1AN9A 4UFOA 3D3JA 1SKQA 3P1JA 2SNIE 3EYWA 1GPJA 5LU9A 4PG7A 3DWGA 4UVEA 1IU9A 5CURA 2DU8A 3ILVA 3ASUA 1Y48E 2WM8A 3OECA 2QUAA 3LU1A 2UU9B 3PL1A 4JEUA 4NARA 1CS4C 1Z73A 3OU6A 5AKEA 3VSEA 3OHSX 3EWSA 2UYCA 1NM5C 2JVKA 3PUWA 3TVYA 4P4UA 5CB4F 3EZ9A 1B7GO 2PD4A 3OLCX 4P22A 1OLUB 1MTZA 3AP2A 1F9AA 1WW8A 4M1OA 4RA9A 2FEOA 2WF5A 4IDOA 4DZZA 3A6KA 1WBBA 2ZIWB 2HLDD 4F56A 3HYCA 4I1YA 2B5WA 3ZDFA 3RR2A 3FZNA 3EG9A 1K6EA 1X9IA 2BR5A 2FP4A 1W4RA 2XGMA 3NNDA 3SPXA 4C1BA 3U3MA 1T2CA 3T94A 4YMLA 4O4LB 1RCUA 2DGDA 1B41A 1P0FA 3DDNA 3Q7TA 4OB8A 4S35A 5JRZA 1P9NA 1UBJS 4FR2A 1W46A 2W6PA 1ZXXA 4LJKA 3REQB 1TZJA 4MR9A 1T3GA 2VZEA 3GMDA 2R1ZA 3E61A 4QWWA 1MJFA 1WS6A 2C2ZA 2F62A 2FK7A 3FYUC 3GY0A 1D2MA 3U39A 2PUFA 4EG7A 1HETA 4CIAA 3FUXA 3K9BA 2ZJ8A 1OI3A 3H5LA 1C3VA 1C9MA 3KOMA 3JSAA 3LC0A 4G8DA 3ZGOA 1ZXBA 3VPDA 3NHRA 2D1FA 4RQUA 2CNNA 5C3UA 5C81A 3KETA 2R8EA 5KNBD 3REGA 1BE0A 3BMOB 4KAJA 1IPEA 1MA3A 3QZUA 3TUJC 2XQFA 3NKLA 4UFNA 1BX0A 3U3OA 4OU5A 1U8YA 2VNSA 1N5RA 1I1HA 4G0YA 4OHMA 4C14A 1XGKA 4HEHA 5CDGA 3CVVA 2D7JA 4UMDA 2QBYA 2WTMA 4UVHA 5AQEA 3TQRA 3VJLA 1OHHA 4E88A 1CZNA 3GD5A 3M3DA 3QTBA 4F4HA 2BFNA 1JA1A 2GYWA 4B7UA 2PWZA 2NZJA 4Q93A 4Z7QB 2F6RA 2OQRA 2X7XA 2Y1XA 3HQ4O 4PHFA 1YK1A 3R7WB 3CLUD 2AFIA 1B15A 2R8ZA 1PJ8A 2WTNA 3AM5A 3WHIA 3LUJA 4UUPA 2GN0A 3PGJA 1J0CA 1YBVA 5IXYA 4IL5A 1K9SA 4OYHA 4ZT3A 1K7EB 2AG0A 4B8YA 3ANNA 3DCJA 5J4LA 2FETA 3KB2A 2NMVA 3BD7A 5CRIA 1EFVB 1ZN9A 2VCEA 3EWNA 4ZAXA 5K3AA 3W9SA 4AZ0B