3UXMA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
206
structure length
197
Chain Sequence
b'GLFVTLEGPEGTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 197
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uxmA00
1KY3A 4DCVA 2P65A 2V4ZA 2YVUA 1PJRA 4DKXA 4N3NA 2AK2A 1G6HA 5LDDC 3LXXA 3ADCA 1RPZA 4LC1A 4IW3B 4OK6A 3P4YA 1OB5A 2C99A 4O3MA 3CR7A 4UNNA 1TQ2A 1ZVQA 2BOVA 3L0SA 2BMJA 3ZYCA 4P4SB 2ZU6A 4KI0A 3PEWA 1T0JB 4PO1A 5IHPA 1EWRA 1F2UA 2PX0A 2XNDD 2ZYWX 4RD6A 3PUVA 4JLNA 1NMXA 1FZQA 2DHRA 2KBFA 1KI9A 1T3SA 3RVBA 5FH9A 2GXAA 1OB2A 1P72A 1JQLB 1BKDR 2ZRGA 4A6PA 3I72A 3DZ8A 4LHZA 2D06A 2Q21A 2QG6A 4IKEA 1P2SA 4P4UA 3VTKA 1R2QA 2XOKA 3MAAC 3NHAA 3SJBA 1FUUA 2PCLA 3RS2A 1U0LA 5TY0A 3PR1A 2EFHB 2GWHA 4GBMA 4C4PA 1EFUA 2BKEA 5BN4A 1U0HC 4V02A 4D0GA 2AWNA 3QNUA 1S1CA 4TYNA 5ELXA 3A36A 5JECA 4HZIA 1XB2A 3BRWD 2WHXA 4FINA 3RWOA 3KQNA 4G1UC 2R6DA 3DOEA 1HV8A 5CDFA 3K0CA 1AM4D 3CF0A 2XTNA 1II8B 1TF7A 5EP4A 2IHBA 2VHCA 5FOTA 3QY0A 2X77A 2W83A 2ZAOA 5C1BA 3GLIE 5AUQA 4NYMR 4TYPA 1XD8A 2OESA 3B9QA 1EFCA 3W6OA 3CIOA 4MGKR 3LNCA 5DI3B 2O8FA 1E32A 1SXJE 3BB1A 4BZXA 1XZQA 2OAQ1 3RS7A 1UKYA 4OI0A 1ZNWA 1KTVA 2VP0A 4QBFA 2W6IA 4RY2A 2Y8EA 2IS1A 4FMCB 2WWGA 5DNYB 1XMSA 3FHCB 3K0AB 1M1YE 1UBEA 3R7WA 5B57C 2NMVA 2BHRA 3R20A 4LI0A 5GJCA 4EAQA 4QGAA 2XJ4A 4PHTA 1HE1C 1P2VA 1A7JA 3MCAA 4WAUA 1FNMA 4CZ2A 2PLFA 2FPMA 4H9GA 3WYFA 3X1DA 1F2TA 2CLDX 2PJZA 4OHXA 3B9PA 1ELOA 5HPYB 4HLDA 1RKBA 3U6BA 2IW3A 4ZCLA 1LF0A 1HT2E 1HURA 1FTSA 1ZRHA 4BLSA 3F5FA 1U99A 1WRBA 2WMOB 1EX7A 3E1SA 1D8TA 1CTQA 1HUQA 5IK2D 1J8YF 1N6RA 5DH9A 4Q03A 1T91A 4BZQA 2ORWA 1OE0A 4Q18A 1CIPA 2OCPA 1QHXA 2FU5C 1R5NA 2VHUA 3BFVA 4FCVA 4OK5A 4QBGB 4QXAA 4HB0A 2IWHA 3C7KA 1ZUHA 2DFLA 3ZZTA 3VX4A 2ATVA 3I92A 5EE5B 3TH5A 3LWNA 3W9YA 1ZM2A 4MYCA 1G291 1GKIA 4A6XA 3U7FB 2PZFA 4NYJQ 2HF9A 2GTPA 1YJ5A 2H8KA 3AVVA 1XFAA 2J41A 3L0IB 1N6LA 4M9XA 4LHVA 4S2EA 2G0NA 2W6JD 3CWQA 4Q1DA 3RLFA 3DVLA 3AVOA 1OHHD 4FWIB 4MYUA 2H5EA 4C0HA 3U4QA 4C0KA 1QF9A 1Q3TA 2ZJ2A 3AVWA 3AF1A 2WSSA 3TR0A 1OLOA 2BV3A 5HKKD 4QBHA 5FTMA 2O8DB 4L9WA 4DLYA 1TF2A 1W4RA 5J5CA 5BYJA 1XTRA 1MKYA 4HAZA 6Q21A 3ADDA 2VSFA 4PANA 3ZD6A 4HYYA 4K46A 3W3ZB 3CPEA 2HYDA 4E07A 2PEZA 8OHMA 2WAYA 4YMWA 2D62A 5DHFA 5LPNA 4IDOA 4DLWA 3VKHA 1R0YA 4XWAA 1KMQA 1E2KA 4L15A 4DSOA 5TMPA 4RCZA 3GLHB 2AXNA 1Z0JA 2AFIE 2YJTD 4RFSA 5EZ6B 1R0ZA 2XNSA 2D7DA 4LBWA 2QT1A 1Z8FA 1KMHB 5G41A 1H8EA 4DLZA 4AURA 3WP1B 4ZIRB 2QMEA 4HEJA 1VKJA 3N70A 4BLTA 4Q1CA 5IRCD 3ZH9B 5SZIA 5KU1A 1J90A 5CM9C 2ZYVX 3O47A 5H68A 3TBKA 3L2OB 4E22A 1W49A 1JB1A 2ZTSA 3K0AA 4IXMA 1W46A 1HY3A 2A5FA 4LJ5A 1OIVA 2QM8A 4JMPA 3AF2A 1JECA 2NZ8A 3U44B 4LDJA 3WBKA 3SFZA 3UKDA 2ORIA 5J4LA 1IN4A 1P9WA 3Q5DA 4B3BA 1R5OA 4LBYA 3OEHA 1Z6XA 4QBIA 3VU9B 3ASZA 1E1RD 4QL3A 5KNBA 1TEXA 4DLRA 1RE0A 4B3FX 2DY1A 4GP6A 3KB1A 1NY6A 2YZ2A 1W0JD 2O8BA 4FMBB 1XXHE 3KFXA 3ZVNA 1E3MA 4RCYA 4A9AA 4MUAA 1LNZA 4CEJB 2J7PA 2WJGA 2FFBA 1NBMD 3CPHA 4XSGA 2XTZA 3P26A 4M53A 2F3TA 3FMOB 4TLDA 1OFUX 1GL7A 1ZCAA 4Q66C 4CIDA 3EPJA 1HE8B 4Q4LA 3CZQA 1OFIA 5FTNA 3W90A 2MMGA 2VHJA 5F98A 2VSXA 2IYUA 3IKJA 3K09C 5UKDA 2IWRA 3I1FA 4ARZB 2Z4RA 2J9RA 4JVMA 2OT3B 2FPKA 2ZYUX 2BJVA 2AD5A 3PJRA 4ZO4A 4L8GA 3OE7D 2OHFA 2GXSA 4ACAA 3GJ0A 1ZIOA 3QBTA 1X3SA 2XJ9A 5D3MB 3CBQA 3NWJA 4EFNA 3SBEA 3UPUA 2AFHE 3VHLB 4HAXA 1UPTA 1V5WA 2KWIA 3BIFA 4G5GA 4KVGA 1LVGA 2WZQA 5EP3A 4B76A 2FH5B 2IYVA 1GRNA 2BM0A 1FP7A 1PLJA 2XNDA 1MRSA 3B1XA 1GL9B 1N5JA 4ZCMA 2DR3A 4HUQB 1G21E 3ADKA 1VYTA 2BJWA 2WKQA 3ZS8A 4ACBA 2CE2X 1WBBA 3I32A 1C9KA 3LRPA 1HH4A 1JR3E 1X8KA 1E0SA 2C78A 3GLHA 3T35A 2NGRA 4TL7A 2OV2A 3BK7A 4HB2A 4QNRA 4Q9IA 1KMHA 3GLGB 1E6CA 1IN7A 2FJUA 4C30A 3RS3A 2VP9A 1YR7A 3B13B 4B2IA 2R6CA 5JJIA 3BS4A 3OZXA 1KI3A 3GJ7A 3LVQE 3WHKA 4DCSA 4DCTA 2FV8A 5L3RA 4CW7A 4ZDKA 4BFUA 5K8IA 1QHNA 3CRMA 2GRJA 4P32A 1FMLA 1XEXB 1XBTA 2PLRA 2W2VA 3C15C 4PHGA 4B43A 3K70B 3AVYA 1I4DD 2ODNA 3FHTA 1DOAA 1QG2A 2O0KA 3FKQA 3MWLA 4BFWA 1N5IA 4YC7A 4Z54A 4GI7A 2JIZD 3HU2A 3U44A 4MGIR 5JWRA 1B0UA 4HB3A 4F7WA 5A4JA 1YZQA 3SI7A 1KIMA 4M21A 3NEJA 4B44A 2VQSA 1XMVA 2XXAB 2CBZA 4DLTA 1WQ1R 2J5XA 3QF4B 2WJJA 2A78A 2HT6A 2AK3A 2AL7A 3Q72A 3RC3A 4XVUA 3THWA 2AN9A 4Q21A 2VSOA 5EZ5A 2OE2A 2I1VB 1P9NA 4CEJA 1D9ZA 1TUIA 4HLQB 4C2TA 1SHKA 4JLPA 3VHXA 3IHWA 3CKLA 1FQKA 1G64A 1EG7A 1NMYA 2FSHA 3AVTA 5C2JB 2F43B 2ZSEA 1QHSA 2GBLA 3T61A 1P73A 3T15A 4OI1A 3Q8XB 5LD2B 2FFAA 3TK1A 4QHYA 3CRRA 5B2ZA 3IPXA 5JEEA 5KSOA 1AQYA 1VYUA 4KJZA 4ARZA 5L3SB 4DCUA 4F93B 3ZQ6A 4DHEA 2CCJA 1NI3A 2QTVB 1T5LA 2G1JA 4TMKA 1DPFA 3QPUA 5AR1A 2EWWA 5IK2A 4G5SA 4WXPA 1SKYB 1XPOA 4IOLA 2ECKA 3N2EA 1R0WA 2NQ2C 2ODEA 4KSBA 1AS3A 1Z06A 1O87A 3LH5A 1R8SA 2CEAA 4Q9HA 2CNWD 1LY1A 1T8UA 2C2HA 2QP4A 2YINC 5CJPA 5EE1A 3VQTA 4Z51A 4H1UA 3MJRA 3U3JA 1T6NA 1RZ3A 2OUKA 3I5XA 5GJBA 1TQ6A 4TQ9A 4IEEA 2AHOA 3QKSB 1NJGA 2W6JA 3ADBA 2Q3HA 3OIYA 4L16A 3MGCA 1OHHA 3NH6A 3K0FB 4XTRA 4AYWA 1OXSC 2EVWX 4WA7A 1K5DA 3CX6A 3NDBB 5HE9A 1N6OA 3QKRB 3EC2A 3N2IA 2RGAA 2WJHA 4NYIQ 1RRGA 4URYR 1W2HA 4URVR 2IYZA 1E2LA 4QFMA 3W8NA 5HKKA 3M0EA 1JJ7A 4Q9KA 2DWQA 2NO7A 4RZ3A 3K9LA 4TN1A 4NH0A 3GLGA 1QBKC 2ZS8A 1LS1A 4KFRA 3LW7A 4D4KA 3ETLA 3NBFA 3ND8A 5EXXA 4YMTA 2GEDA 3CNOA 4F4JA 2YWEA 2VIIA 4UXJA 1N6KA 1NSTA 2FFHA 2QSZA 4DDTA 1WB9A 2D3WA 3WNCA 3WRYC 1J2JA 2Q0HA 4TTQA 1K5GA 1XEXA 3T5GA 1GL6A 3DEFA 5JI2E 3FTQA 4L5BA 4Q9LA 2R2AA 1X8LA 2NPFA 4A2WA 4CRWB 2F1JA 3I8XA 4B2LA 1Q22A 4LBZA 4V0MA 5P21A 4NCKA 2C5LA 2W6ID 1O3YA 1EXMA 1ZNXA 5JRJA 3R8CA 3P27A 3UWKA 3QUSA 1R7RA 1XCPA 2O8EB 1CF4A 1QDEA 1SQ5A 2R6GA 2ZVPX 2ZXUA 2ZJBA 1L4UA 3B82A 1DEKA 4BFSA 4R7ZA 2PH1A 2VLIA 1QRAA 1N25A 3U7GA 2IEZA 5CLQA 4OHWA 2FSGA 2EFGA 4KCGA 5EUMA 3QXHA 3RRYA 2OCYC 1G5PA 2GETA 4OBEA 3U6KA 1JR6A 4LJ7A 2CCKA 2RGXA 4P3YA 2Z0MA 1E1RA 3A8TA 1P7CA 1FL9A 4G5RA 1G3QA 2ZRKA 5L3VA 2ZPTX 1W0JA 2KE5A 1NRJB 5DI9A 4W7SA 4CVNA 4WZAE 5L3SA 3PEUA 3IIMA 3NEYA 3AP1A 3LLMA 2RHMA 5KNDA 3THYB 3OEED 1S3GA 1E9FA 4ILEA 2GVZC 1OSNA 2ZRAA 2C8VA 3B78A 2FE4A 4NMMA 2DBYA 4Q47A 3K53A 1KSGA 4DRZA 5KDOA 3T1TA 4URXR 2E1RA 4JZKA 4U7DA 4RKFA 5DSZA 3IBYA 4BLRA 1NLZA 1XD2B 4BPBA 2O5VA 2SHKA 3FB4A 3A58B 4JL6A 3OFND 4D0LB 1E0KA 1KI6B 1XEWY 4BLPA 2HXSA 4FMDF 5AJYA 1CJKC 1L2TA 3REFA 3GLIB 4EPWA 1ZCBA 3FOZA 4I1VA 1T0HB 2FWRA 3FMPB 1W1WA 3CF6R 2ZSFA 2OZEA 2WWFA 2XTMA 5CYOA 3SN6A 1IN5A 1SXJB 1OV4A 1YVDA 3OE7A 3CH4B 3H84A 3THXB 2R8RA 1Z28A 3K9HA 4PPNA 3K0FA 2NO1A 1Z0KA 1CBUA 5GVRA 3KL4A 2EWVA 2MMCA 2JGNA 2F7SA 1FX0A 3FFBA 3GFTA 1QHHB 1DTSA 1M34E 2D2FA 2ZUBA 4LRWA 3VR2A 4W5JA 5GVSA 3QG1A 4M9QA 4NL4H 1NMZA 4HDQB 1YR8A 4GP7A 4Q4AA 3VNUA 3F8TA 1M7HA 4U5XA 5KSPA 2FN4A 1HT1E 2QEQA 3UATA 4KVAA 1PVOA 2IYYA 3W34A 1Z47A 2ZI3A 2IYWA 1TU3A 4IOMA 2IF2A 4U00A 1GNQA 1RRFA 2GDJA 2WWXA 5JWHA 4JVLA 1AGPA 1E2QA 3C14C 1H8ED 1VCOA 1KKLA 3SHWA 5CK4A 1ZJ6A 2QPAA 3GFOA 1SVMA 2IX3A 5DGXA 4D81A 2YNMA 4R9UC 4F92B 4BZPA 2RGNA 2JJ2D 1KK2A 3KXLA 4HAUA 1TPZA 3BE4A 4FN5A 5J4KA 1BS1A 4HI0E 3V4RA 2O8EA 5FI1B 4GPTA 2ZIAA 2ODBA 3RC8A 2CJWB 2GVDC 5HR5A 1U8YA 4S35A 2R62A 4MKGA 5TB5A 2HCBA 3BERA 5L8VA 1XEWX 4DJTA 1M2OB 1G17A 4MA4A 2JIZA 2GF9A 4GOJA 3LY5A 5KDDA 1OIXA 4LOAA 1T3LA 2YWHA 3AEZA 3JZAA 2F9LA 4JS0A 1IJFA 3RRZA 4JJZA 3KKMA 5G53C 3KJIA 1JR3D 3KZ1E 4MRPA 5FPTA 2ZETA 3DM5A 1FMJA 4W5WA 5C4MA 2Z43A 4X8LA 1PZNA 4LHWA 1E2PA 4KLZA 1IY0A 1OH7A 4PSVA 3AP3A 3LV8A 1N6HA 3NBZC 2OFXA 1Z6TA 1LS6A 5FOXA 1UKZA 3RS0A 2A30A 2FG5A 3GLFB 1GAJA 4TMXA 1J70A 3R9WA 5FPHA 4YLGA 4PZZA 2YOHA 1DG3A 5SZJA 2GBLC 4JKYA 4ZV4A 1T3HA 1XD2A 4Q48A 3RDPA 4NCJA 1UF9A 2J7KA 2FSFA 2ZQ5A 1FW6A 1G3UA 4CGZA 4LV5B 2PL3A 4P0TA 3GLIA 4TZ6A 1IY1A 1AGRA 2W58A 2HUPA 2H16A 4DB2A 2DWOA 3CF2A 2BCJQ 4FCWA 4OI4A 2QENA 4LY6A 5KPJA 4WIAA 2B7CA 2ZJZA 4PO8A 2KI5A 1EGAA 1UBGA 2A7QA 2CNWA 1ZNYA 2TMKA 3BH0A 1YU9A 3I73A 3WYAA 3BC1A 4IEIA 3PEVA 1WMSA 1WCV1 2WKRA 1GKUB 2QE7D 3U3OA 4IDQA 4V0NA 3GPLA 4TT3D 2RKOA 3SYKA 2DFKB 4TMZA 1Z5ZA 1MO3A 1Z83A 2RGDA 5DN6D 1J8MF 1U0JA 4B3GA 3ZLJA 1GTVA 1TTTA 1CKEA 4OK3A 1XXHB 3ZDQA 4A8JA 1Z2CA 3B1YA 3E5HA 4A0GA 1G20E 1XTQA 2RB4A 4RZ2A 4TSFD 3SBDA 4XD7D 3JZMA 2JATA 2X2EA 3GQBA 4GOKA 2WIBA 4L9SA 1KI2A 3HPRA 1Q1EA 1JPJA 4ZI3A 1P6XA 1CJUC 4JLOA 1XJCA 4HAYA 2R44A 1U90A 4BEJA 1KHTA 3GFPA 4PC1A 1UAAA 2AX4A 4YXWD 2ZVQX 1ANKA 4IJMA 1KDOA 3Q7PA 1G8FA 2RGCA 4NP6A 1AJEA 2J59A 3TNFA 4IRUB 2ZI7A 2ZJYA 3S1AA 1Q0UA 1WA5A 5KO2A 3PIRA 4ZKEA 3QF7A 2D2EA 4V0LA 4QJ5A 5KPDA 5LB4A 1S9DA 3K0EA 4RKEA 2F1RA 4DSNA 4DZZA 4OI2A 4D0NA 4AYTA 1S3SA 1M7BA 2NO0A 1VIAA 2WWIA 1BYUA 4DLUA 4V0OA 4Q1EA 3LX5A 1NIJA 3LBIA 4A15A 2GJ8A 4QC2A 4IDHA 1E2IA 3ND9A 3C8UA 4EKDA 2BBWA 3Q85A 2YV5A 4DVGA 1XJ0A 2WVJA 4BFXA 2W00A 4MH0R 4NU0A 4BE7B 4JLJA 1VG9B 2GCOB 2GCPA 2HCJB 2HXYA 1W4CA 1XTKA 1A2KC 3TQFA 4ZDWA 1NLYA 4BLOA 1UDWA 1DVRA 4DWJA 3U5ZB 2ZI6A 1ZD8A 2PMKA 4DC9A 2BIFA 4NYJR 3V00A 4D26A 2DWPA 1YZKA 1Z29A 2REBA 4NYMQ 3K1JA 4LC0A 2O0JA 2BEKA 3TSWA 3OEEA 1GFIA 5HZKA 2V6IA 3TRFA 1NN3A 4JJKA 4UJ3A 4B2PA 3HR7A 4TYYA 3K9GA 3IEVA 4I1UA 1E9EA 4OQLA 3A4MA 3EIEA 4JIMA 4POAA 2YWGA 4JSTA 4WVFA 1OF1A 3ICEA 2MSDB 5E7MA 4HDCA 1IY2A 2OFOA 4IOJA 2C04A 4P4SA 2J46A 4QRHA 4QOSA 1SKQA 4R2IA 4GDFA 3OFNA 2NIPA 1P9RA 1W7AA 2QL6A 4CT4B 4M22A 2PCJA 3IDQA 4PPQA 2VPPA 5A0FA 1KO4A 3WP0A 1YHNA 1XPRA 3W6PA 1Q21A 5JEDA 4LJ8A 1KDRA 4Q7MB 3KKQA 3EW9A 3PUWA 2CLCX 1AS0A 3SC3A 2QT0A 4LJYA 1QHGA 5FBRB 5ANRB 1G5TA 2BMEA 2VTKA 1F6BA 1NF3A 4QHSA 3AM1A 2I3BA 4HZUB 3SEAA 2JLYA 4Y0VA 1H8HD 3EA0A 3EZ2A 3L8YA 2OFWA 3KKNA 1EK0A 1S96A 4I81A 2FX3A 4Q9JA 1XCGB 2JA1A 2JLVA 3FKSD 1G8PA 1MO4A 3GJXC 2VF8A 2IYXA 2ZS9A 3KTAB 4A92A 3GLFE 2QROA 4KAXA 4V0KA 5JBQA 1IN6A 3B8HA 2CLSA 3B6EA 1NL3A 4LPSA 4LZZA 5H8WA 1TUEA 3QSYA 3ZJYA 3VR5A 3AF4A 4EJSB 3K70D 4LCBA 2NOAA 1II8A 3SS8A 3QQ5A 5E4FA 4ESVA 5BWMA 1G16A 2YKGA 2IS6A 3D7MA 1YRBA 4IXNA 4BFVA 3U3KA 3SHFA 2WM9B 1CEEA 1E2DA 1XNJA 5GADl 2OBLA 2J0UB 2JJ2A 1HYQA 5FOVA 2RGNC 3B85A 5DI3A 4IVRA 1SVLA 3H0KA 5KUTA 2O8CB 3RRNA 5JS7A 2GZHA 4Q4JB 1Z6YA 1DAMA 1FOEB 3OESA 2YOGA 2GEVA 3MSXA 1Z63A 4MDEA 2P5SA 1KZ7B 4DDVA 5JSZB 4AIIA 2DFNA 1G41A 4M1OA 2IT1A 1XJQA 4C0LA 3AUXA 4TL8A 4C0JA 3UMFA 2C77A 2N1BA 1XTSA 1Z07A 1F3OA 1AK2A 4AY2A 2DFTA 3HPQA 5B58C 1JR3A 2QM7A 3HDTA 5K8UA 4TMTA 1ZM4A 2CHVA 1NSFA 4M1WA 1KO7A 1HA3A 1OYWA 1IN8A 2A5YB 2WBLC 2ZUCA 3T12A 1AZSC 2C96A 4LPKA 1FP6A 1NKSA 1W2GA 5J4VA 2CXXA 4KO8A 3EPLA 4TMVA 2JLXA 2FZLA 3TQCA 4DDWA 1I2MA 5EJEA 1S0UA 4I99A 4NONA 1LTQA 3RNLA 4BQSA 2ZI4A 4FD2A 4UNPA 5B30A 4O2LA 4OQXA 4DXAA 1UADA 4JBWA 2BBOA 1M8PA 2RGEA 2GF0A 1NVUQ 1BMFD 2ERYA 2VYFA 1CJTC 3F0TA 4A0FA 4DEXA 1VG0B 2JCSA 5CB6A 3V4FA 1N0UA 4X8OA 1XPUA 1LFDB 1SVOA 1OXTA 1E2EA 1LF5A 1Y3AA 2ZRHA 4XOIA 1TQDA 3W5IA 1E98A 1XTIA 4KU4A 5JJLA 3BXZA 1OJLA 1XDBA 1HQYE 3IPYA 3B7GA 3TAHA 3AF3A 5F3WB 4PQYA 3DKPA 1S2MA 4EFMA 4DLVA 1D5CA 2W0SA 1FTNA 3ONWA 4IDPA 3T1VA 1G6OA 2ZITA 5C4GB 1KAGA 4HZUA 1JI0A 5AJXA 2QE7A 2IEYA 4D2IA 1YZLA 1ZAKA 3GEEA 3ECCA 1DAIA 3NC0C 4TT3A 2K5UA 4II7A 5FR2A 3R8FA 4AD8A 3R9IA 2BMDA 1G3IA 2ZRIA 2PZGA 1WF3A 4NPHA 5DN6A 3NIBA 1ZU5A 2ANCA 1FNNA 2WJVA 1G7RA 3CRW1 5CITA 3U60B 4QGFA 2IS2A 1KOFA 1RRPA 3FFAA 4US2R 1GDDA 1KO5A 5FBLB 4A8JC 1NVVQ 4EJSA 3DMDA 2HEIA 1PUIA 1N6PA 2OXCA 2JLUA 2XB2A 4TSFA 1JQJC 4M8NE 4XD7A 4ZIRA 3AKEA 2GNOA 1VMAA 1I4LD 3DOFA 2J0UA 3ZGXA 1C4OA 2DYKA 3EG5A 1M6NA 3X2SA 1AIPA 3FVQA 3WHLA 4TWZA 4M2LA 1QHYA 1KJYA 1PV4A 2WJIA 2O8CA 3PITA 3I61A 4Q4JA 4C0AC 2G83A 3KDSE 1US8B 1J7KA 4YXWA 2HDNB 3M1IA 4QKQA 3EX7C 3ZVMA 2FOLA 1YR6A 2IYTA 2JDID 4IFEA 1G4AE 1JPNA 3PCRB 2HYIC 1KJZA 1G7CA 4UNSA 2WAXA 2ZRCA 3BFXA 3SQWA 1MV5A 2ZRDA 4JLBA 5FTJA 4E03A 1OKKD 1OW3B 1NN0A 1ESNA 3RSLA 4JLDA 2IS4A 3SE0A 1EFRD 3VU9A 2XZOA 2QUZA 3VKWA 4BECA 1N0VC 4BLQA 1DAFA 1RYHA 2D7CA 3BBPA 4XSHA 1XZPA 3A6PC 3H1TA 3QVVA 1AA9A 4KBFA 1S1MA 1VPLA 3MLEA 4KITB 2G6BA 4NDZA 4JLMA 3I5YA 4PXAA 3LBNA 5KNCA 2ZS7A 1WXQA 4M1SA 1IQPA 4PZLA 1N0WA 3LD9A 2GESA 3SJCA 5JZVA 1E9RA 1F5NA 1TF5A 2FNAA 4XVRA 3MFYA 1CJVC 2QPOA 1JAIA 1L7VC 3GJ4A 2EYQA 3EWAA 4XTCS 2ZRNA 4E5UA 3CZPA 2X19A 2P5TB 1RJ9B 3EIHA 3CRVA 4QM7A 5KOYA 1E94E 4JL5A 4LUCA 3QIAA 3TVDA 3X1YA 1E4VA 1GP2A 1SXJD 4JLVA 2GJ9A 1EX6A 2NZJA 5CM8B 2P2LA 4HLUA 2QAGB 2XX3A 3HWSA 2ZJ8A 4Y0AA 3JVVA 3ZD7A 3T34A 2DCUA 5D3MA 1DE0A 4IVQA 1OXXK 3A4LA 1MABB 1RFLA 1VCIA 5AJWA 2EW1A 4C0QC 4YDSA 4B47A 4CEIB 1E1QD 3EPHA 4AG5A 3BB4A 4ZDIA 1TEVA 4RSGA 4Z1MD 2CL6X 1OYYA 2ZR0A 3HU1A 1DS6A 1HTWA 2I4IA 3QXSA 4M9ZA 2O8DA 4EFLA 2BWJA 4HUQA 3BWDD 4GFDA 4OHVA 1GIAA 3HJNA 1E9CA 4KHZA 4OHYA 4QM6A 5EXPA 4LBVA 1OIWA 1UEIA 3QI2A 3CUEF 1GOTA 1II0A 3KB2A 2BVNA 1YRAA 1TL7C 4OQMA 5TDHA 1NJFA 4PC7A 3SYLA 4BRWA 1YR9A 1H8HA 4W9MC 3A1UA 3WXMA 1KK0A 3R9XA 3H2YA 5KDLA 3I3SR 2GK6A 1E9AA 3GEIA 4M0LA 3FKSA 3ZS9A 5B64A 2QN6A 1N6NA 4MITA 1CU1A 1W5SA 1EFHA 2QZ4A 2VL7A 4I1SA 4UNQA 3GJ6A 2VP5A 2WOJA 3NHBA 1MRNA 2AD1A 3RSOA 1U8ZA 2WKPA 4PO9A 1ONBA 1Z0AA 4JL8A 1JEDA 2AKYA 1VG8A 2E9SA 4AYXA 4DCNA 2X1VA 3W5JA 1BYIA 3RS5A 3QXXA 1NVXQ 3L43A 1P62B 3AQ4A 3A4NA 1N5KA 1VG1A 5L3QB 4PR0A 3CWZA 3CPJB 3FDIA 5E95A 1H65A 1W36D 1DAEA 3AV0B 3FHOA 2DB3A 1ZM7A 4PC3A 3SJAA 4YMVA 4B73A 1N6IA 2XXAA 3BD9A 1SVIA 5HCNA 4F38A 2L0XA 3QF4A 1XF9A 3GEHA 4F91B 2VH5R 3X1ZA 1ESMA 1WDTA 3GCGA 3MG9A 1L8QA 3ZZUA 4ZDJA 2UZ3A 1DADA 2VHTA 1A82A 2PX3A 3A1TA 2ZJ5A 2Q9BA 1UBCA 1KZGB 4BFZA 1AZTA 3I4LA 2G0TA 4HATA 4MDFA 4DLSA 3B60A 1CRQA 3Q9LA 2OLKA 2O52A 2F43A 2YC2C 2CHGA 1S4QA 4PAMA 5HE8A 4DT1B 3T06B 4KFSA 2PJRA 1KJWA 3NBYC 5JS8A 1JALA 2IYQA 1ZMXA 2OAP1 3HR8A 2ZANA 3LDAA 5HZHA 2GAAA 4BFTA 3LQQA 1CRPA 1TQ4A 3F3YA 1GWNA 4GOXA 2XZLA 2JEOA 2CL0X 2F3RA 2C03A 5J4HA 2V8OA 5DE3A 4JVNA 2NO9A 4XIGS 2QAGA 4EPYA 3PUXA 3B1ZA 4FXPA 3UG6A 2B6HA 4RZUA 1BMFA 3EAQA 2P67A 1U98A 5FOUA 3WNBA 3OF5A 5LB2A 1IXRC 1SULA 3EZFA 1COWA 4B6EA 3QKUA 5K8TA 3V9PA 4B3CA 1CS4C 1G7TA 2QBYB 3QKSA 5HTKA 4Q4HB 3EZ7A 5F2EA 1P60A 1E9SA 2IA5A 5AUPB 2WWHA 2E87A 3QKRA 2VHQA 4OJQA 4YQFA 4K81B 5CB8A 4QGGA 2PBRA 3BB3A 2QORA 3LXRA 1NG9A 1BOFA 5A5GA 4ZCIA 3IO5A 4TL9A 1F48A 4B75A 4YMUA 5HCIA 3TJZA 4KFUA 4Q7JB 2QY9A 1N5LA 2IC5A 2WWWA 4RD3A 1CR0A 3A1WA 4UJ5A 2C95A 3DHWC 1JJVA 3PUZA 1OFTA 1C1YA 1JBKA 3ZVLA 5AUOB 4ERNA 2FZ4A 2X2FA 2LCFA 1UDXA 3ZZ0A 1LB1B 221PA 2WTUA 4EJSC 3TSOA 1VHTA 1AN0A 1F2UB 1KI1A 5DIFA 2ZEJA 4OHZA 5BYKA 4FMDB 2Q6TA 3CR8A 5JHHB 5D3QA 2CCGA 4HSEA 4B6FA 2ONKA 1T9HA 4FCTA 3U3MA 5FPYA 2GXUA 4OKSA 3EARA 4A82A 4B48A 1VYVA 1D9XA 1RYFA 3KUDA 1G19A 4OQFA 2VF7A 3NXSA 4MGZR 3A37A 4LJAA 4MYTA 2ZM5A 4MGYR 5AJZA 3TUZC 3O8RA 1KDPA 3MWYW 1YQTA 1IOZA 2YC4C 2JDIA 1JEEA 1NVWQ 4KFTA 4A2PA 1NBME 4WW0A 5AK0A 4PQFA 1YE8A 2ZSBA 3C5CA 2J0VA 1OKKA 2FGJA 4O25A 4ZI2A 1W36B 5JLJA 2FA9A 1N2CE 2F9MA 4RD0A 1GSIA 5FUYA 1EFRA 2XB4A 1W44A 4URWR 2OO7A 4N0DA 4DT1A 1P2UA 1E99A 3CH5A 3E2IA 4LYFA 3PXGA 3K9NA 4Q5IA 3CO5A 4QGHA 1ZBDA 4OQNA 3OHMA 2IXGA 3KXKA 521PA 3RRMA 5FBVB 2OG2A 121PA 3THYA 1KSFX 1AKYA 4UQOA 4LJ6A 4MKIA 2YYZA 1Q12A 1I2DA 3PENA 3QPWA 2VP2A 2B8TA 3CB4A 1VDZA 3FGNA 2CVHA 2IYSA 2ZRMA 4BASA 2QA5A 2QMHA 2OSBA 3R7WB 4CYMA 4LJ4A 5EXTA 2R6FA 4J0QA 2NTYC 1KI6A 2N46A 4G3XA 4WZBE 621PA 1SVWA 3GJ5A 1M7GA 1DAKA 1P61B 3LX8A 2LWIA 1XU4A 4MYHA 1SXJA 5JCPA 4M9SA 2PT5A 3MWKA 3T5DA 3B2EA 3OIVA 3THXA 3NTUA 4M4SA 1G1MA 1MOZA 4HLUC 2FFQA 2WICA 3AVXA 4IVPA 5G40A 3U3RA 1QHHA 4JLKA 4UNRA 1DG1G 4TLEA 1R6BX 1NIPA 1E1QA 3X1WA 3KQHA 3EWSA 4IHQA 2KB0A 4Z1MA 4GL2A 4PAOA 4JKIA 4LHXA 3LAWA 4UXIA 4AI6A 5JJKA 4TQUS 5EQTA 2C9OA 2QTHA 3QVUA 3VR1A 2GJSA 3LLUA 1S9HA 3EASA 1E96A 1U9IA 5JRZA 1P5ZB 4TQAA 5FL3A 1T5IA 4C0SA 4ABYA 1QVRA 1Z0DA 3SJZA 3AF0A 3FMFA 4MQBA 1UEJA 4RVCA 4MRVA 1LV7A 1YKSA 3T1QA 2WSMA 2ZAMA 1K6MA 1J99A 2H57A 3AGQA 4ON9A 4N0EA 1E69A 2F55A 2Q9CA 3U4QB 1Q57A 2CK3D 4FMCF 1ZUNB 1ZC3A 4B34A 2EYUA 1IONA 1W5TA 1GNPA 4P4TA 2ASEA 4TYQA 4NTZA 2H17A 1WE2A 1TMKA 2CJWA 2V1XA 3SNHA 1G9XA 1VHLA 2KJQA 3K70C 3I62A 4TTPA 2AXPA 2IYLD 1MT0A 1ZM3A 3GJ3A 4TTRA 1E79D 1N3BA 3MMPA 3CONA 3TKLA 4O2RA 1UKVY 4F4CA 1UJ2A 5C46F 2QU8A 2WPDD 4EDHA 1Q3HA 4AKHA 3U7HB 2CL7X 3UXMA 3THOA 3UWOA 4RD4A 3SDZA 4US1R 3VX3A 3HYTA 4URZR 4RFSB 2P0EA 1FQJA 1WP9A 3B1VA 4G0NA 4M1MA 4YONB 5JMTA 5IT5A 1XMIA 2V54A 2A3RA 1R4AA 3KXIA 5F9HA 3IQWA 3D3QA 3DM9B 4WBSA 5FTLA 1HQCA 1Z08A 1X8JA 1XRJA 4Q00A 5FUXA 3VR6A 3GLFA 3EIQA 1V43A 3FE2A 2J0QA 2HV8A 5EXSA 1KSHA 5DISB 5EUQB 1DELA 4X8HA 2G9NA 2WIAA 1G5RA 2REOA 4NKRA 4DUGA 1A2BA 4C7OB 4TLBA 4FI3C 2UVQA 1Z3IX 3BH7A 4NZYA 1NN5A 2UZIR 3LQRA 1GZSA 1P75A 5LD2C 5CLLA 1X6VA 2CHQA 3UANA 4AC9A 4PZYA 3CX7A 4JYCA 1ZD9A 2YWFA 4NHOA 1G8YA 2OILA 2ZRFA 3CX8A 2Z6VA 2N42A 2QMUA 3DO6A 4D4JA 5SZKB 2ZI9A 3FMIA 5H70A 4MRSA 3U2QA 2IXEA 4WXRA 4AG6A 5FUWA 1P2TA 1TX4B 5FOWA 2CMKA 4OL0A 3VR3A 3IILA 2QAGC 4KODA 4XH9B 4B3DA 1P4SA 1G4UR 3L82B 2O8BB 2GILA 4IFBA 5EP2A 5KHOC 5JCZA 3WMGA 2G1KA 4C0BA 4ZKDA 3GJ8A 2IUTA 4PQRA 4U02A 1DO2A 3C16C 3B5JA 3VR4A 4PX9A 4M1YA 3TUIC 1IHUA 3KJEA 4JYBA 3W8RA 3TAUA 1KO1A 2JASA 4Q7KA 3SZRA 3CW2A 2R6AA 1JXMA 2IUUA 2BBTA 1RRCA 2FSIA 5F9FA 1XXHA 5DYIA 4KBGA 4HB4A 3QENA 5CDFE 3REGA 5TARA 1Y63A 2C9YA 1E4YA 2ZJAA 1ZC4A 5CIQA 1GVNB 2A2ZA 2FPLA 3K0SA 1QVAA 2EFCB 3RHFA 1CP2A 1IAQA 3CRQA 3EPKA 4D25A 2H92A 2HF8A 3N5CA 2GA8A 4EUNA 5EE9A 3KJGA 3TR5A 4LK2A 4PAQA 2HJVA 4MRNA 2IF0A 3RYTC 3VNVA 4PHHA 4AKEA 2EU8A 2R65A 1KKMA 2BDTA 3DMNA 2FEMA 3TGPA 1OH8A 3TW8B 1NLFA 1A5TA 1ZU4A 3M6AA 1U94A 4A2QA 4XWKA 2GHIA 2ZE5A 2LKCA 4G01B 1IXZA 4JBYA 3AKYA 3PV0A 1ZINA 1GITA 2XITA 2ZSDA 1FUKA 1YZNA 3DZDA 3UK6A 2KSQA 2QQEA 5FBQB 3AVQA 3QE0A 1NNEA 5TXGA 4TZ0A 2A9KA 2ZROA 2V9PA 1OXVA 2ZU0C 1T4GA 5FL7D 2LKDA 1Z22A 2REXB 5SZHB 3WNDA 1XWIA 5JHGB 3SQXA 1G8GA 2HLDD 5EE0A 4C9BA 4CT5A 4MKHA 2HJGA 3W6NA 2UKDA 2V55B 1SHZA 2ZE8A 2B7BA 1W0KD 2ZREA 1WBDA 4N1AA 1KAOA 2GCOA 4C7OA 3LW8A 2OEPA 3PUYA 1LW7A 3BORA 3IIKA 3KKPA 5G3YA 2WJYA 2PT7A 2VP6A 5BQ5A 3RAPR 4A36A 1KK1A 5M04A 5FPSA 3GMTA 4K8OA 5CYPA 2PMDA 3AVPA 1TADA 3A1SA 3DPUA 3K8YA 3ZIAD 1PLKA 3THWB 4GMXA 2QP3A 5FOSA 3WMFA 2C98A 3EA5A 1ODFA 1COWD 3QPVA 1KY2A 1Q44A 1E2FA 4JT4A 4LV8B 3GP8A 2QRZA 3IHLA 2XGJA 4MKFA 1ZYUA 1ZUIA 4QG7A 1B23P 2MSCB 4D4MA 3LFUA 3D31A 3H4MA 4M1KA 2OCBA 2YOFA 1SXJC 1RIFA 4HLCA 5EP1A 4BUJA 4BEBA 2J87A 4B71A 1S8FA 1MO5A 1DAHA 1XTJA 1KI8A 2EQBA 2BKUA 2OCAA 2W0MA 1IXSB 2QP9X 2Z83A 2V7QD 4GZMA 4WZ6A 4DB4A 1E9BA 4R98A 3ZVRA 4C2UA 2VA8A 1NVVR 2W2TA 4EQ6B 5E7JA 3KQLA 3D8BA 1ZD1A 3UG7A 4XVQA 4QNMA 1UBFA 3DL0A 2QGZA 2GZDA 2XAUA 3PFIA 1OFHA 1A1VA 4Z8YA 1PLLA 2FMXA 3X1XA 3KTAA 4HAVA 2A5GA 3CNLA 1CJMA 4ASUD 2B21A 1CXZA 4HUTA 4XWOA 4MRRA 2R9VA 3MRSA 3FPAA 1U9IC 2QPTA 1CULC 2PZEA 4TLCA 421PA 4DBLC 1PUJA 3C41J 4PC2A 1X1RA 3P1JA 4LJ9A 3G82C 1Z0FA 3RABA 1G3MA 1F60A 2G77B 1JAHA 2CK3A 1GILA 1KGDA 3IEUA 4B32A 1E2GA 3NBXX 2JLZA 4KYUA 2QI9C 4NE2A 5BN5A 2ZI5A 4JLAA 5DYGA 1D6JA 4TYWA 2BCGY 3BJIC 3QG5A 4CDGA 5DO9A 4HDOB 2ONJA 2ZJOA 3UIEA 4XJXA 4C3ZA 1E79A 5JSZA 3TSZA 5IDVA 1EWQA 3KKOA 2ATXA 3VMFA 2WMNB 2RMKA 4Q1AA 2WPDA 2CDNA 4PHFA 4D80A 2JJ1D 3RANA 2J0SA 1DO0A 1YZGA 3AKCA 3EZ9A 4A0RA 3PVSA 4EPRA 1W36C 3NDPA 2F6RA 2MSEB 3G0HA 2A5DA 4RJLA 1W4BA 3WRXC 4BWYA 4AWXA 1OXUA 3KQUA 3K0CC 2OBMA 2ANBA 2O0HA 1KDTA 3A1VA 1Q1ZA 4CEHB 1DAGA 3ICQB 2QMOA 3B1WA 1AS2A 4ZPXA 1QG4A 4PSAA 1TU4A 1UKEA 2ZR7A 2H7VA 3WBJA 3CNNA 1MR3F 1II9A 3OIUA 3UMSA 5FUVA 5J47A 2RAPA 1ZNZA 4BFYA 2D4HA 3DDCA 1G7SA 1D2MA 1MH1A 5FFMA 2G3YA 3LBHA 1E2HA 1MO6A 2IHYA 1BIFA 2ZYTX 3BFKA 3GD7A 5FI0B 2QAJA 3M4YA 2XSZD 1GKYA 2F1IA 3FWYA 1AQUA 3NC1C 1SZPA 2VRWA 3TW4A 3Q7QA 2EFDB 4PSKA 4LWZA 2QNRA 2RHDA 3WY9A 5J4YA 2WV9A 1D2EA 5H1YA 5FBWB 3TLXA 3KUCA 4GNKA 4P31A 4O0MA 2OBNA 2IXFA 4GZLA 3NVAA 2AR7A 1NG1A 4NYIR 1IBRA 3HU3A 3GLHE 3OAAD 3O8DA 4A1FA 2VEDA 2P3SA 4AKIA 3QEOA 3MWJA 2QSYA 5BN3A 4ITRC 3AB3A 2C9CA 4EQ6A 2GZAA 3IBGA 3MUFA 4H1VA 2RH5A 3I8SA 1Z6GA 2F1HA 5K8LA 4B33A 1NN1A 3SR0A 1YZTA 1KI4A 4AK9A 1Z2AA 4ESHA 5FR1A 4BRUA 3NKVA 3MD0A 4FW9A 1NP6A 4EIWA 1GRRA 2Q9AA 4BGDA 1XD9A 4PC6A 1XMJA 2JLQA 3EC1A 1KK3A 1M74A 2FF7A 2GJKA 2NPIA 2JJ8A 1FFHA 2ZRBA 2VBCA 3P20A 1GUAA 1R8QA 2H18A 2J3EA 4FIDA 3RS4A 3ZQJA 1KNQA 3FYHA 2J1LA 2BBSA 3Q3JB 1G18A 4UKDA 4GRAA 1ZW6A 1FX0B 2GAOA 2XOKD 3BGWA 5AUNB 3VFDA 1Q20A 3IGFA 1OH5A 3O8BA 4KYIB 4PPGA 2V3CC 1T8TA 1US8A 3QBVA 2ZSAA 2D74A 3QKTA 2ZUDA 1JXOA 1OH6A 2XEXA 4Q4AB 4LYHA 4TLAA 1KI7A 2DPXA 1ZP6A 3BAFA 4FWTA 2P6UA 1P3JA 2GXQA 5IF9A 1Z6AA 3TIFA 2IK8A 4JSYA 4Z8XA 1OPXA 2ZE6A 4Q1FA 1Z0IA 2P6NA 2GJAA 4G5QA 5FPKA 1Q1BA 4EPTA 1DARA 1ZM9A 3L0OA 3LVRE 5JFGA 1IM2A 4L4UA 2ZE7A 3PQCA 4I4LA 5TV2A 1X86B 2RCNA 2G88A 3WMEA 3U61B 5KTYA 1E2NA 3LA6A 4QHTA 5FL7A 1SVKA 4B74A 4KSCA 1E2JA 1EFTA 5DHAA 4CEHA 5AJVB 2V1UA 2HLDA 3JVUA 2OXRA 4JBXA 1TNDA 1ETUA 3SU8A 1W47A 1GM5A 1CR2A 2CVFA 2YHSA 4DUGD 3TUJC 1AKEA 1W0KA 1BO6A 4MUBA 4AKGA 1TAGA 3Q5EA 2GEUA 2Q3MA 4WOPA 3H86A 1KNXA 1G3RA 3KFVA 4PPFA 1VECA 2RGBA 4DIDA 4B35A 2ZR9A 1RJ9A 5CJ2A 1KO8A 1QHIA 2NG1A 5GJVC 3P32A 3G5UA 4LV6A 3PEYA 4GSYA 4Q02A 2B92A 4NCHA 3SYNA 3RWMB 1GG2A 2JLSA 2WOOA 3TMKA 4EPXA 2V6JA 2NO6A 2HT1A 3P4XA 3E70C 3ZIAA 1XP8A 3O8CA 3WYGA 3IQXA 4LGMA 4M1TA 4Q7LA 1MABA 1BH2A 4URUR 1U2RA 3OIWA 4NCNA 4CEIA 2ODWA 1NBMA 3MJHA 3PG5A 3SOPA 1NKTA 3GLGE 2GKSA 1Q1QA 5CK5A 3NG1A 4GMDA 3DKVA 4NCIA 3CM0A 5G3ZA 5CIWA 3TVTA 2FGKA 2JAQA 2Z5FA 2IL1A 3AKDA 1E0JA 1ZIPA 2I1QA 3VKGA 1L4YA 3SFVA 3IO3A 4KXFB 2ZRJA 2V7QA 3LO5A 1GNRA 3IUYA 2JLWA 1W4AA 2A5JA 4DSTA 4DSUA 3AVUA 2B8WA 2JLRA 1W48A 1G8HA 4NBSA 4D82A 2GCNA 1R0XA 2AWOA 2QTFA 4V0ME 5BW8A 2BMFA 3L0PA 2WSSD 1R10A 4Q01A 4ASUA 2W2XA 2VP4A 4OYHA 3L8ZA 5KYKA 1XX6A 5LBIA 3U7EB 5J40A 3QOFA 5EE3A 2IUSA 1SVSA 4JT2A 1CLUA 1CR1A 1VIYA 3D6TB 3QJYA 1RVDA 3TE6A 1D2NA 4RFVA 3CLVA 1OT3A 4DEYA 4TMWA 1JNYA 5L3QA 2PEYA 3AP2A 3QXJA 2OLJA 1CR4A 4LSGA 4A4DA 1XCMA 5JWOA 3ASYA 2Z4SA 2WWYA 5KSZA 3W3AA 2J45A 4E09A 1RW4A 2ERXA 4IDNA 4V03A 1HEIA 4A8JB 1E0AA 1VTKA 3KJHA 5E7IA 4RZXA 2FDCA 1QZXA 2IYRA 2X8AA 3C5HA 1UFQA 3UMRA 2QGNA 4D6PA 4PFSA 1KYIA 3BH6A 5C18A 2EFEB 1I4TD 1GRQA 1SKYE 2QQ0A 1E9DA 2JJ1A 4B3XA 821PA 5JI3E 5KSYA 1DBSA 5BXQC 4P33A 2BC9A 4Q19A 4D4LA 4R71A 4A0HA 1R5BA 1E2MA 4KV9A 2ZRLA 4LYJA 4QJ3A 1RC8A 2KBEA 4HAWA 1U8AA 4OJKA 4UXHA 4W5HA 1EESA 4F4IA 2QRNA 5E3HA 4RD2A 3EXAA 4LYAA 5TVKA 2XZPA 4GT1A 1A4RA 3S1AB 4YMSA 2AKAB 3AGPA 3KX2A 2O8FB 3QEJA 4QJ4A 3HYRA 4US0R 4CF7A 3OEHD 3AUYA 2CE7A 1FPMA 3NH9A 4G5OA 4PTLA 2GK7A 5FTKA 721PA 3IIJA 2Q3FA 4R2HA 3J81k 1X1SA 1KSJA 4I1OA 4TL6A 2RGGA 4IOKA 4RD1A 2J7PD 2XSZA 1NY5A 3BOSA 3HP1A 1K8RA 5DLQC 4DIEA 3T1OA 4EPVA 3KQKA 1U81A 4YDHB 1SGWA 2BEJA 3C4JA 2H1LA 1F2TB 4X8MA 2QBYA 2P6RA 4Q4HA 4DLXA 2BM1A 2VO1A 1XEFA 2IBMA 1UM8A 1VCMA 2ORVA 1IJEA 4LX0A 2OM2A 3EZ6A 4Q1BA 2FEOA 3AH8A 2ZRPA 3K09A 4JVSB 4LHYA 1VCNA 5GJWC 3OAAA 3QXCA 3VAAA 1YZUA 4DDUA 4KLNA 5AWFC
chains in the Genus database with same CATH superfamily
4FZJA 4WGGA 1B76A 2XCQA 1M66A 1KQFA 3P9CA 4UMDA 4D97A 4DKXA 4F6RB 1JG4A 1ZHHA 2G25A 2GS9A 3D0OA 3JYHA 3LXXA 4ZTBA 3WGJA 1ZD3A 1KZHA 3F90A 2JGMA 1DUSA 5I8WA 3PNKA 4G07A 4AO6A 1HDEA 2C99A 2XF2A 4X60A 1GXSA 1V8FA 2W8BA 3IPRA 5KYUA 3L0SA 2AN4A 2BOVA 3AUFA 1L4LA 1YK1A 1I13A 4P4SB 2VDJA 1GSAA 1K7CA 4M8SA 2JAHA 1Q74A 1E6KA 4JR0A 1RKQA 4FEEA 4HFMA 3QVTA 4RU1A 3E81A 4PYIA 3UMBA 1VB3A 1I1OA 1F2UA 1X9HA 2YJ3A 4IILA 4RD6A 4ZEWA 4AS1A 3PUVA 1NURA 4LKRA 1NMXA 2DHRA 1JBQA 1HZJA 1T3SA 4X20B 1DHTA 2CLMB 1L5HA 4H6WA 1M3SA 4RMGA 2GXAA 4B8WA 2FEAA 3FJ1A 3H5TA 5AOBA 2X8LA 2ZRGA 4A6PA 1NVMB 5I51A 5JZMA 5JY6A 2Q21A 2QG6A 1GZDA 4P4UA 1GQRA 2I8AA 2XOKA 3M1LA 3MAAC 4OHKA 1KQGA 1ISFA 1MW8X 4NBUA 1A7AA 2ZSKA 1LI7A 1PTJA 3DBRA 1FSFA 4QRDA 3RS2A 1PW7A 3D8NA 4OAOA 1BDJA 3V8RA 2ZFUA 5CB4B 3PR1A 2GWHA 4H15A 1EFUA 3KK0A 2FPIB 5C7IO 2OBBA 1U0HC 2XUGA 4D0GA 3AG6A 5TQ0A 1J0EA 1TT5A 4OHBA 4CTJA 1T15A 4WFQA 3JQAA 2Z30A 2HJSA 3BRWD 4FINA 3KQNA 5T4EA 1R0RE 2WJAA 1CQIA 4MICA 2EV9A 3B36A 5AVQA 1JHAA 4BC1A 2ILTA 1DEXA 2XTNA 2AUMA 2WIDA 3GGPA 4GHWA 5BOVA 4LF7B 4FDLA 4CHGA 5I7OA 4H6XA 3B1KA 2WHPA 4QYWA 4Z4EA 1Y89A 1U9YA 4YRRA 4J3JA 3VV2A 4DC1A 2P7HA 3ASUA 1JSZA 3SHQA 3UWDA 3QU4A 3TL3A 2XCRB 4NYMR 2MYNA 4UEOA 1EFCA 5D1HA 5EUCA 3LNCA 1U65A 2G67A 5E6UA 4OI0A 1D2CA 3RS7A 1UKYA 4OPMA 1ZNWA 4HC4A 1F2VA 5J58A 4XLLA 3SF8B 1HEUA 3ID6C 2CUKA 2Y8EA 2YY6A 2F00A 3IFSA 2HZ7A 1CEYA 1CLEA 3NCTA 1PQWA 1XMSA 3K0AB 5TC4A 4DYDA 1N2JA 2QD1A 2FI1A 1U7ZA 4D9HA 1USVA 4X1YA 3ZGZA 2NMVA 3ZWBA 3R20A 4LI0A 4LE0A 4GECA 4PICA 5AXDA 3USCS 3D6NB 1WZ2A 2DOKA 1KPHA 3HTXA 2QVYX 2IDKA 4I50F 2OPHA 5BUQA 3FXAA 3X0DA 4CZ2A 3EG9A 2FPMA 3ZTTA 3I2JA 4RAOA 3WYFA 1KPGA 2PJZA 1K8ZB 2PVPA 3AEQA 5I9MA 4KZPA 5HPYB 2JZOA 5JCJD 3OQMA 4YHBA 1DMRA 4ROSA 3ZV4A 4HLDA 2MWMA 4UHEA 2H2FA 1GV0A 1DQZA 3IPCA 1LLQA 2IW3A 2QZJA 4A5SA 1PQYA 1LF0A 1JHQA 2GPTA 2QS9A 4H1HA 1DBPA 2J5RA 3EH2A 3LHFA 4KXMA 1LBQA 4HNUA 3F2IA 4NENB 1SRRA 1J06A 2PR7A 5DGCA 2G76A 1J1IA 2YYSA 1D8TA 4IIDA 5A5FA 2IY9A 3RVJA 2XCTB 4EELA 2QJFA 1Q92A 1J8YF 1ZRSA 3A7DA 3EFOA 1VPTA 2POQX 1L4EA 4BZQA 4BGVA 1PFWA 5KJFA 2XCIA 3A1NA 4OK5A 1HE5A 5AM4A 3R3XA 3CLRC 4HB0A 2JFHA 4RELA 1DT5A 4TV8B 3ZZTA 3E82A 1LLFA 1QIKA 2QGFA 2VJQA 3AFGA 5AXAA 2DHCA 2XMSA 2BGWA 1JDNA 1YZYA 4A6XA 3DT9A 3AJRA 4Z6KA 3T4UA 2GTPA 1YJ5A 2AOVA 2H8KA 1QC5B 3PNMA 4MUIA 4BATA 1ZG3A 3N6VA 4UM9D 4EVQA 1SBCA 3OLZA 2H51A 2QR5A 2ZT7A 4LHVA 3KT8A 4M9XA 4MUNA 1O5OA 2HA4A 4UCQA 5U1PA 5C5CA 2G0NA 3RV3A 1Z37A 1RBMA 4Q1DA 4TX1A 5J5VA 3DVLA 4WXEA 1WD5A 3AVOA 1L0BA 4C0HA 3DNMA 2EKPA 4C0KA 5KTSA 4I4NA 2WSBA 3HXKA 5IKPA 3H8WA 3AVWA 5DTMA 2QRQA 4P5PA 3KZNA 3TR0A 2I2BA 3VBEA 1G9TA 1SU6A 4NZOA 5HKKD 3AY3A 5EPEA 1QFZA 4ENSA 3J7TA 1P0IA 1LBTA 2OECA 4RDHA 3GJSA 5BYJA 1EE2A 2NU7B 2Y1CA 4C08A 3R3ZA 5A0TA 3DH0A 1DXHA 1Z16A 3VU1A 1R9GA 4PANA 3ZD6A 4FX5A 3FCEA 1OGJA 4HEA1 5LQRA 1A9TA 4NH4A 3G7UA 4B7ZA 4E07A 8OHMA 5HIMA 2WAYA 5LA6F 3ZWOA 1RI2A 4MS4A 1GGNA 4BO6A 1YK0A 4IDOA 5C7YA 4XWAA 5LPNA 4ZOCA 3MUEA 4DSZA 2NNLD 3JQ7A 5FYDA 1NKVA 3O3OB 2AFIE 2XVMA 1R0ZA 2Q6IA 1H5UA 1NQUA 3CNBA 1Z8FA 3KD3A 1CUIA 1XU9A 3D0KA 3BG5A 1JKJB 2VRCA 3HGQA 4AURA 4DLZA 3C5WP 1CRWG 1ZXBA 5JE8A 4BLTA 4PX3A 4Q1CA 1H2FA 1Y81A 2OFFA 2W22A 1NBIA 3Q0IA 4JGBA 4EMUA 4YMGA 1KXZA 1BU5A 4K1LA 1C3JA 4DR4B 3U4GA 1JB1A 5JT1A 4TTVA 1KRWA 2P9HA 2DUMA 2JEZA 1TD1A 3E1GA 1T8SA 1OIVA 3CG4A 1NWCA 2QM8A 4RENA 1JH8A 5HIKA 2PSFA 3AF2A 1CYDA 1AKTA 1MIHA 1U3VA 2QRVA 3OY2A 3QRWA 4LDJA 1P2BA 5KWEA 2AJLI 2D0OB 1A9RA 2QQ5A 2VF2A 2JVKA 4WJLA 2I66A 1IN4A 1NV9A 3D8SA 4JENA 1WPXA 1EZ4A 4F8JA 4DMMA 1FUIA 1Z6XA 4L76A 1MENA 3ASZA 3VU9B 5KTMA 2G70A 3FPLA 2XWJI 4BQQA 2FP3A 1Q1NA 2DY1A 5CW1A 5HVNA 1G2IA 2P4EA 1T5TA 1W0JD 5K09A 2FMHA 3ANSA 3P2KA 4RCYA 2DZDA 1JL3A 1LNZA 2P9YA 2PUHA 3DEYX 3P5BA 3QI7A 2ZSUA 4TXNA 2FFBA 4UNIA 1KAEA 5EVCA 1X7YB 5K01A 4QYXA 5KNDD 2XTZA 4BB0A 3FMOB 4KIFA 4H4EA 3IR5A 5CJJA 1OFUX 1VL0A 4KKVA 4Z7QB 2JCVA 4CIDA 2DJ5A 2XGMA 2JAXA 3QV2A 4QXPA 4BO4A 3V5NA 3IVAA 5IJWA 3HYNA 1VJGA 3EVEA 2GDZA 3CZQA 1SELA 1C7ZA 1OFIA 3K9QO 4I4TA 5MN5A 4WINA 3PTZA 3TMYA 4HMOA 5FTNA 5K3FA 2AC7A 2FWMX 3ZDCA 5F98A 2IWRA 2BF7A 4O1MA 4FEYA 3K2BA 2JAPA 1Z25A 2P9EA 2ZCUA 3IQHX 3KR0A 3UTDA 2D2IA 1OXMA 2AD5A 4ND6A 3V7NA 3OECA 3ZK9A 4F2HA 4ZO4A 3PJRA 3VU8A 1GT91 2FR8C 4F04A 4G85A 4Y6SA 1DUIA 4YRMA 1QIGA 1AKWA 3LS2A 3GJ0A 2RBGA 3OFKA 3W5UA 3QBTA 5JU6A 4UDYX 3RLIA 3TXYA 1XQWA 3FLAA 3CBQA 1IJKA 4ZO6A 3E9CA 3NBAA 3VR2D 1ZOSA 3LGAA 1QCCA 5E9JA 4EFNA 1G59A 1Z4IA 3H04A 4GSKA 4DPMA 2WFMA 3CBGA 4HAXA 1CPYA 1M33A 1QPBA 2KWIA 3OQIA 5DPMA 7REQA 5IKEA 3IEKA 2P27A 2FH5B 4FIZA 2IYVA 2BM0A 1JHUA 3OCWA 3MMSA 1YQUA 4LJRA 2VK4A 3B1XA 1N4AA 2BFDA 3L4SO 2P8SA 4UVIA 3HB7A 4PGGA 1WUIS 3WDSA 4BPRA 2IOFK 3KOYA 1FFXA 4YY3B 3PPIA 2BJWA 3KOMA 3ZS8A 1IK4A 4QUIA 1B1AA 1H9CA 4YX9A 1R74A 2OKGA 2I2FA 3I32A 3NGLA 1C9KA 1IVYA 3PD0A 1HH4A 1X8KA 3EQ2A 3L7AA 4JLSA 4KV7A 3T35A 3WL6A 3HI4A 5K6RA 3ZDXB 1DKUA 1O57A 2B2XA 3JU3A 4S0XA 1EMDA 3VI4B 4Q9IA 4EO9A 4U39A 3PDJA 1KMHA 4BDSA 1IUPA 2HWUA 1E6CA 1IN7A 1OFGA 2DP4E 4C30A 3GLGB 4B2IA 2GHTA 1QK5A 4U1RA 3U3ZA 3FUTA 2J3HA 1CNFA 3GJ7A 3OZXA 4NCXA 5BRNA 3WHKA 3ZXXA 4DCSA 4FGLA 3D6FA 1Z5OA 3EW7A 2PUDA 1LD3A 4YRQA 2WM8A 4ZDKA 5EJ8A 4LXYA 5K8IA 5ELMA 3JAWA 2I9KA 3CRMA 1HDGO 3DLTA 3X1KA 4B43A 4MRMB 1I4DD 1QG2A 2O0KA 3EGVA 4FOTA 4F1WA 3GPBA 3ISVA 5FJIA 2LPMA 1A72A 2P11A 4LIPD 3U44A 3HQ4O 3QMVA 1B0UA 1RYDA 1SC6A 4M1ZA 4F7WA 4BVGA 5BNZA 2FMFA 4AMVA 4NAVA 2A9RA 3SI7A 2PR2A 4Y7CA 4B44A 4CMGA 1N34B 1T10A 4TUYF 2A6PA 4Z53A 4MYRA 4DLTA 4G89A 2J5XA 5F64A 2VK2A 2WJJA 3HP4A 4I1IA 4TGLA 5GZ6A 1USWA 2WF5A 5K3OA 2HBYA 3KV3O 4ND2A 3CX3A 3WK9A 3HCEA 2AN9A 3BZWA 2GKGA 4F72A 3U56A 5F2OA 4J7CA 1EG2A 1D9ZA 2XE7A 3TINA 4HEQA 3WLTA 4HLQB 3D4BA 1SHKA 2DPMA 3DFIA 3NVMB 3RS9A 5JXGA 3DYIA 2P9QA 4P2BA 3C98A 5B7GA 4JBIA 2JIPA 3G9QA 2YBEA 4WXMA 3UHJA 1K4KA 4FFBA 1FJ2A 4YO7A 5IT9A 2WPNA 5IJ0B 4KQ1A 1CRZA 2H0RA 4EX7A 2XMCA 3AUUA 4PBSA 4ZVRA 3GOHA 3T7SA 3DQQA 5REQA 4A73A 3Q8XB 2P6OA 4R5HA 5LD2B 2EIHA 2FFAA 3IVGA 4FGSA 5B2ZA 5JSQA 4ARZA 1DWUA 3O8LA 4F93B 2PIDA 1F6DA 3ZQ6A 4DHEA 1QIEA 5C1IA 4QEKA 5AR1A 1CZLA 1KERA 4NRDA 5IK2A 4J2HA 1XPOA 5BWLA 2ECKA 5EKSA 3N2EA 5LP6C 4QPCA 1R0WA 1TK9A 3B9BA 2ODEA 2GTIA 3GLTA 4O2BA 4OU5A 3W77A 4F4HA 4UOEA 1ZUD1 3LH5A 3WS7A 2P4QA 3QWFA 4BMVA 5HIAA 1AMNA 2HOQA 3V4PB 1PL6A 1OYVA 2H31A 5EE1A 3MEQA 5GOTA 3VQTA 3WMXA 4AN0A 4F3RA 2NLOA 4J29A 3CC8A 1RZ3A 3I5XA 2XA9A 3GNLA 4TQ9A 3DMFA 1WSBA 5T57A 3SXUA 3OM0A 3L04A 3LCRA 2X6QA 1YRWA 3DZHA 3Q3IA 5DT9A 4PONA 1IIBA 2AHOA 3QKSB 2QR2A 2XDWA 3I12A 2XUFA 1TM4E 2NSHA 4CL8A 4F5YA 4RIHA 4Q93A 2Q8NA 3OIYA 4XTRA 1OHHA 2V7EA 4TQGA 1OXSC 3LTNC 3CJRA 4WA7A 2OXTA 3SSAA 5HE9A 1F4LA 4NYIQ 3EC2A 4DM3A 2RGAA 2WJHA 4RPIA 1RRGA 3AHFA 1W2HA 4B31A 5BSEA 1JWAB 3RJZA 1UKBA 2IYZA 3BK1A 5EJ6A 1XZKA 1OA1A 2HK6A 3M0EA 5AK4A 2RAVA 3RTEA 2AXQA 2NO7A 3Q8WA 3K9LA 5I4KA 1EVJA 4TN1A 3DVSX 1E64A 3P2YA 1QBKC 3WK5A 4KP7A 2G82A 1RQGA 1PTKA 5CA0F 4KLCA 3AU8A 3LCUA 3DB2A 1T9BA 3JQAD 5DLYA 3QK7A 2NSYA 1Q6ZA 4ME6A 3CNOA 1E7QA 1THMA 2UZ1B 4ITVA 1KU0A 4DPKA 4CETA 3N2ZB 3R7DA 4C21A 9ATCA 4UXJA 4WNAA 3KVVA 2QSZA 1OVGA 4MUJA 4F9EA 2ISSD 4MQFA 2D3WA 3WNCA 4FBMA 2FZ5A 4TTQA 1JPUA 4R1NA 3WRYC 3FOEC 1SU7A 3ISJA 3NHJA 3OBBA 1GL6A 3Q87B 1HBJA 4J49A 1K0FA 4L5BA 2V3VA 2GK3A 2P2ZA 1TKCA 1BE0A 2J3IA 3E7FA 3ZNNA 4AMYA 3T3GA 2PL9A 5IEJA 4H7PA 2YZGA 1I10A 4CIWA 5JRJA 3ICPA 3K6KA 3P27A 5CBKA 4ZYLA 2O8EB 4X92A 4F06A 5LU9A 3RUAA 2R6GA 3BSSA 4F60A 3FH0A 2ZXUA 2V7WA 1J39A 3U7QB 4YRKA 1YRYE 7AT1A 2FWNA 2X14A 2C4TA 2OY0A 2PH1A 2ATCA 2JHCA 1QRAA 1GZ6A 2QG4A 1N25A 2VFAA 3EOZA 4LX8A 4UW9A 4BNHA 3U7GA 3SBXA 5AKLA 1RYZA 1FP2A 3TPFA 3V4OA 2FSGA 2EFGA 5EUMA 3PKIA 1VIVA 2IRWA 1E3SA 1U8CB 4ZVQA 1QFJA 2VCEA 1Y8QA 2Z0MA 1E6WA 2JB9A 3GJYA 3IKMB 4XA8A 4O63O 2IV2X 3ONDA 2Q5CA 5L3VA 3FAKA 2C88A 4QBKA 2IYPA 1V16A 5DNEA 3Q9SA 3C3CA 4L4SA 5HZMA 2PQMA 5DI9A 2AG8A 2O1EA 4CVNA 1GNLA 2YVKA 3CB2A 3PEUA 1DFGA 3KHSA 3PF9A 5T8KC 1ZFNA 2IOYA 4RE5A 3UHAA 2QTVA 4RGQA 2G5TA 1JT9A 1C41A 1FC0A 4N3AA 3B78A 2FE4A 5JC1A 5TJHA 5KDOA 1GPDG 4JNKA 1GLVA 3R6LA 2UYOA 4URXR 2E1RA 4DS3A 1A50B 4YRCA 1TD9A 1FZTA 4BLRA 5EQFA 1XD2B 2O5VA 4PS0A 3OFND 1XEWY 1P6QA 3HE3A 4BWVA 4D99A 2HXSA 5HIIA 1ZCBA 3HKDB 4I1VA 1N32B 3LHSA 5E0KB 4P0QB 4I5GA 1N5DA 3CF6R 2ZSFA 2WWFA 4ZO8A 4OX9Y 2WNHA 2H54A 1A27A 2Q0QA 3H84A 4N6NA 5GAJA 1Y6GA 3RVQA 3WJ2A 3K32A 2JPDA 4OXIA 3NAZA 2Q41A 1FX0A 3EGXA 3FFBA 1XHFA 4XGRA 1PT5A 5IJAA 3H5NA 3RIEA 4O08A 1YJQA 3HVJA 2QN8A 2VDLB 1E1NA 4FYXA 3CRNA 5F1OA 3HN2A 1LPOA 1BZYA 5MHTA 1MN6A 1OOEA 3A27A 3GUHA 2J07A 4ALNA 1M7HA 2YX1A 1B2LA 2JD1A 1C1DA 1XMXA 1K4YA 4IIJB 5AIAA 5A4IS 4KVAA 4RQAA 1X13A 5FNVA 2GYYA 3W1EA 3W34A 2QY6A 2BFEB 3DL7A 3NI2A 3OO1A 1T2EA 1EWTA 3K0HA 4IKPA 3TSAA 3ZHOA 1X7WA 1A76A 2OORA 4U00A 2C3YA 2WWXA 3PFGA 4CMIB 2WZCA 3V4ZA 5IXJA 5MGNA 3AESA 1QYVA 3QW2A 2VCHA 4OVKA 4ZJPA 1DCTA 1QKKA 1VCOA 1DC8A 1P74A 4U7PB 4MS3B 1NVEA 1RWXA 1UT6A 3GFOA 3ZE8A 2ZUVA 1D07A 4D81A 4R9UC 4BZPA 1ZD4A 4JY7A 3VYVA 3FNGA 4ZI7A 1P18A 4INPA 4P58A 4YT2A 2QK4A 3G2LA 4Y6QA 3BE4A 5J4KA 2PQ6A 2AH5A 1KMNA 1HFKA 1I2BA 4RQUA 5THKA 2QIOA 3VR0A 4LF8B 3CZAA 5HZGA 4DCGA 2ODBA 3JASA 4B0OA 3VPBA 3ZK7A 3KVRA 5HR5A 3IQGX 4AB1A 3OFSA 4S35A 2R62A 2D8AA 4MKGA 4ARUA 2BE9A 4RVUA 3T8YA 4I5DA 1M2OB 3LUHA 3MQ4A 3ZXSA 2GF9A 4F3YA 1GTL1 3Q15C 2CXOA 3W3AH 3JVDA 4JS0A 1QKIA 3BTUA 1L4NA 2D1RA 4JJZA 3ISTA 3L8HA 5G53C 3KZ1E 1UDRA 3KU4A 4ND5A 4MI9A 3T4PA 3PWKA 3N2NA 3W8DA 2HNAA 1DWOA 3LHDA 2Q5OA 3E23A 1PZNA 4LHWA 5FFFA 2CDRA 2RH8A 1HPLA 3CN7A 1L1EA 4KLZA 3KEMA 1YIDA 5JW6A 3AP3A 3LV8A 5LQNA 1JA1A 1J8VA 1Z6TA 1LS6A 4Y9DA 5FOXA 2J6IA 3JD1A 3CVYA 1EFDN 3KCNA 3QBJA 4MV3A 2FG5A 3DR3A 4OGWA 4BO5A 1QOZA 4ARCA 3R9WA 4HN2A 3IPAA 3VA7A 4QXOA 1XQ9A 3HVHA 4BL5A 2WF8A 4YLGA 1QRRA 5ALLA 2WTNA 5SZJA 1MJNA 2Z2ZA 3HFRA 1F0KA 3EFHA 1Z2PX 4Q48A 2VJDA 3AC0A 3VNBA 5JNTA 2E4UA 2RKBA 1G3UA 4CGZA 2LV8A 4DARA 4PSDA 1IY1A 3MCTA 4N0PA 3RCBA 3HK2A 1MXFA 3K9FC 3RAEC 2IFTA 4ZOLF 1UDBA 4OMFG 2DWOA 4DB2A 2O48X 3WWZA 1U7PA 2HBZA 3EIXA 4P7JA 1VXOA 2W98A 4LY6A 1BDHA 3DMTC 2Y67A 1A2QA 2B7CA 3H6HA 1OR8A 3TIGA 3SLRA 1KRXA 4HWSA 2CNWA 2WUVA 1J23A 2AS0A 3GP5A 4EUHA 4XWTA 4DIFA 2R8YA 2G9ZA 2VPXA 4K5QA 4KQ2A 1WMSA 1G5QA 1WCV1 3U7RA 1V7PC 2HSZA 1GKUB 2QE7D 4JN6B 3SIWA 3N8DA 3U3OA 3ZBTA 4N5MA 4YMLA 3BMCB 2DFPA 4P3NA 4DA7A 3KWLA 2RC6A 4PZAA 3TTWA 2WQZA 3IKVA 4UREA 1Z5ZA 1Z83A 2RGDA 3V1KA 4DJAA 3KAQA 4NFYA 3TTVA 2XXBA 4OU4A 4ZEXA 4LSWA 4S24A 5D5HA 1XXHB 1RHKA 3OMXA 1GHTA 1CUBA 1C3EA 3K6JA 3MC1A 3QLUC 3OTOB 4D8UA 3F6BX 5JZOA 3CMCO 1XTQA 4N3CA 3G85A 3ZHVA 4YRTA 5C7LO 4XD7D 3JZMA 1ITZA 1DOHA 1M0TA 4E6PA 2X2EA 4L2IB 1EHIA 2K2WA 4J7AA 3NRBA 1H2ZA 2DSNA 2H4YA 4I1YA 3HPRA 4H77A 4KR2A 2WYVA 1MX3A 3IIIA 4MAFA 1V6SA 1EB9A 1Z35A 2ZJ3A 1FEZA 4O02B 3KSBC 4CQLA 4S0ZA 1A69A 4HH1A 1U90A 4BEJA 4PC1A 2OENG 3A6GA 3ONFA 1F9EA 2ZVQX 1AXRA 4RVOA 1IHYA 4X61A 4FGWA 3Q7PA 1YV9A 5TF4A 3GMIA 4BU1A 1ZSVA 1VYHA 2HMYB 3E9RA 3S29A 4DLPA 1AC5A 8LDHA 2MYTA 1T9AA 3JQ9A 2RK3A 4CMEC 4D5GA 5IF3A 2W2NA 4LGCA 4D45A 4BO1A 3S1AA 1KWKA 2UYCA 5KO2A 3IR7A 1QKJA 2NZVG 2R8PA 3BM5A 4HBZA 4HPJB 3ESQA 3IAFA 5F4ZA 5A9SA 4TVOA 4DV4B 3OTGA 3HRKA 1NXOA 4V0LA 4DM4A 2AFHB 1PWHA 1KAMA 3KLMX 5CFOA 4WKNA 3L7JA 4P0PB 2ZDGA 4RKEA 2H63A 4DSNA 4XIFA 2O2CA 1NA5A 2XV1A 1S3SA 3MHTA 2GSWA 2V5UA 3H2HA 3QUAA 3L05A 1DB3A 3LOUA 4KQHA 5BSGA 2IU6A 4RK1A 1NIJA 3ZQKA 1QAOA 1ZKMA 3IE2A 4ZMRA 3EXHA 1ND6A 1QB8A 1QIMA 1UQUA 5CFQA 5KSWB 1YS6A 2BFBB 3Q85A 3KSZO 1AUOA 1U8EA 3LPLA 2UZ4A 1XJ0A 1H2HA 3GAMA 4BFXA 1F4PA 2Q2WA 4MH0R 4F9TA 1PGOA 1VG9B 5KWVA 2GCPA 4DCCA 1FRVA 5IG2A 2HCJB 2HXYA 2DLCX 1DKOA 1RAHA 4DBLE 1RWOA 4QLAA 2CL5A 2ZAGA 3MJCA 4H1TA 5LL6P 1UDWA 1Q1AA 4G4GA 4EVIA 1JR2A 2ZZKA 1OI7A 1W4LA 3V00A 1GU7A 2C0PA 2DWPA 3HUEA 3QEBZ 2A67A 2O0JA 2R66A 2XOEA 3AB7A 3DE2X 3VAZA 5JSUA 3PUKA 4PVDA 2V6IA 4WWHA 4B2PA 2BTEA 2JLAA 3HR7A 1DRUA 5JR3A 3K9GA 1E9EA 1TI7A 4OQLA 4Y2RA 3EIEA 1JU4A 2YV1A 3ORRA 2YWGA 4MS1B 5EFZA 5EJ4A 5C53B 2YMMA 1IY2A 4GVPA 1U5BA 4IOJA 2C04A 3HJBA 3UJAA 1P4GA 3GFSA 4QOSA 1SKQA 2BFCA 2FK7A 4M7WA 4L74A 4PLYA 4YJGB 3UFBA 2DBZA 1ZESA 2Q4DA 1I7PA 3H9JA 4Q16A 1P9RA 5JMPA 3H8VA 4J1TA 3VSAA 1VC2A 5DNVA 4B6QA 1FDUA 1TAHA 1X7ZA 3CX4A 1K9VF 1PEDA 1RQXA 1KO4A 2NXNA 3F9CA 5FF9A 5CMLA 5A0FA 3WWOA 3HY3A 5ALHA 5BPHA 2Y0CA 3EQ7A 3D0QA 4LJ8A 5KAMA 3Q40A 4XX0B 2ZUFA 4HDRB 1PKEA 4GYJA 3EW9A 3IT3A 3WKBA 4RTJA 4M8LA 2XB8A 4HO1X 1AN9A 1QHGA 4L51A 4BTEA 3UJNA 1OUMA 1G5TA 2VTKA 1F6BA 2J9GA 2FKNA 2I3BA 4QT0A 2JLYA 1ONNA 1X14A 1O58A 3W5BA 2Z2IA 2INGX 3RHTA 5LXTB 1UMDB 1KS9A 3FWZA 4QUAA 1D1QA 5JSHA 4I81A 2WILA 3SXJA 2FX3A 4R01A 3A4TA 1EVQA 4CTNA 1C9EA 3FKSD 4PIVA 4EHIA 2G72A 2VNJA 3KTAB 3O4JA 3VSEA 5CFMA 3AOGA 5B6JA 1IN6A 2E4VA 4QXQA 5C34B 1XZGA 2O6HA 3H99A 2IUYA 1RQLA 2Z58A 4RH1A 3ZJYA 3VR5A 1E61A 2GBCA 1C50A 16PKA 3AF4A 5GQSA 3TQHA 4EGQA 1X2EA 5G0UA 1DKNA 2GZRA 3QVMA 4YIKA 1MOSA 1II8A 1UC8A 2C1EA 5TR9A 1CCWA 1T2VA 2G9RA 3HYCA 3H1EA 2P68A 3CURA 4FE3A 1YRBA 4FX2A 4IXNA 2A0KA 4YAGA 2IS6A 4K26A 1CEEA 1U2SA 2HA7A 1E2DA 4IIFA 4O5OA 3R75A 3RWBA 4P9NA 5GADl 3WKCA 3IE1A 4WCFB 2JJ2A 5AESA 4MWEA 5FOVA 4OFWA 3B85A 2IIVA 4ZCQA 5A1JA 5K3EA 2F4VB 3D5EA 1XQYA 3EXEB 5EHGA 2VAVA 3IURA 5TPWB 1Z6YA 2EARA 3QE4A 5BN5B 4G8DA 1IDN1 2GEVA 2ZB8A 4C88A 4ZZ3A 2CLHB 3M5WA 1HDCA 1TCCA 2ADOA 2K7ZA 3BHMA 3L1IA 2X8WA 4RACA 1KZ7B 3S8MA 4GF5A 3SQOA 2YJ5A 4F5DA 2IU4A 2C82A 1JNXX 2O2HA 3AUXA 2ZXEA 4LFBB 3D59A 4G0VA 1X0VA 5L9AA 1YRHA 1NXWA 5EEGA 2XCLA 4KIJA 5B58C 3VR5H 1JR3A 1F8XA 2WIKA 4NBRA 1MC1A 2C7OA 1Y8RA 2QR3A 5EIBD 1T5DX 1KO7A 2BHLA 3O5AA 3BRCA 4QUBA 1AZSC 3LYLA 4BVFA 1OREA 2C96A 4LPKA 1ORWA 1Y5MA 4MEAA 1MO2A 1RMTA 1W2GA 3V3KA 4KO8A 2FZLA 1BW9A 1WO8A 3TQCA 4LVNA 4EX6A 5ADHA 3CVVA 3ESXA 4AJHA 4I99A 2QZSA 1LTQA 3RNLA 4BQSA 2ZI4A 3N8GA 3O92A 4W6QA 4LJSA 3QPCA 2D5AA 1EFPA 4JEUA 1M8PA 1WJGA 4BX0A 2O2JA 2RGEA 1NVUQ 4D3DA 2VTEA 2VYFA 4AUEA 1CJTC 2DAPA 2YZKA 3D4OA 4ISCA 2ID4A 2WIJA 2B8JA 2JCSA 1MIOB 3U4MA 3FETA 1CDEA 5CB6A 1PZEA 1XPUA 3ETDA 4RL6A 4A8HA 2RG1A 3CT6A 4I3HA 1OXTA 4DNXA 4U9IS 3WQQA 1E2EA 2YV4A 2W70A 1AKUA 1VE5A 1I0LA 1DKRA 5JAHA 3M8KA 5IT4A 4MIEA 1D2HA 1GTJ1 1TQDA 3G2JA 3JATB 3W5IA 1QPZA 5KNBH 4KU4A 4EHDA 1NASA 3G0DA 5EKDA 5JS2A 5JJLA 1QH1A 4UEKA 1VSUA 1NI4B 3HXMA 4YWHA 2WY2D 4I1RA 3AJEA 4K28A 5CH3A 2X22A 1AXGA 1S2MA 4Y3UA 1D5CA 3T1VA 1FTNA 2VNKA 4QUJA 5C8VA 4ZAYA 1RXIA 1U4SA 1IXYA 4HZUA 2AEJA 1KIFA 3WYCA 1BHJA 3NC0C 5FR2A 4HD8A 4TT3A 3HWRA 3R8FA 3OJWA 3R9IA 2VT3A 1G3IA 2ZRIA 4R2XA 4JR2A 5DWVA 4PFKA 3VM6A 3ANTA 1YOVB 3IMEA 1QPGA 2MTBA 4Q3DA 3SC2A 3U60B 4HSGA 4RSMA 2IS2A 5CR9A 4FFWA 1RRPA 2Y9MB 1PG0A 3HBFA 4LSMA 2IU0A 4EW2A 1KO5A 4FU0A 4A8JC 4DXHA 3KZCA 4EJSA 4OXYA 2OHVA 3I5UA 5B2EA 1D6MA 1PUIA 3H11A 5H7XA 2JLUA 3A05A 2ODQA 2XB2A 2VR1A 2ZDQA 2Q7DA 2HIHA 1OASA 4RPCA 4XQ9A 2PUFA 1B42A 2ID7A 3EGWA 3JARB 1QRTA 1R00A 2QM0A 1I4LD 4L8YA 3DOFA 3IB6A 5A6SA 4OXKA 3FMGA 1C4OA 1EPUA 2CVPA 5LOVB 3H75A 4BNMA 3RQSA 1KY5A 1YR1A 1JFVA 4NMXB 4Q6BA 2WJIA 2QRHA 1PV4A 3GLVA 1V4NA 3EWIA 4KNVA 2G83A 4Q4JA 1MDFA 3SKXA 3HUFA 1VSQA 3V2IA 5ICFA 2GI4A 5J3JA 2HDNB 2X0DA 5CFLA 2FOLA 2V59A 3FYUC 3Q7TA 2IYTA 3CF4A 4XM1A 4FS3A 1G4AE 3PCRB 2AKEA 1P2GA 1G7CA 3AHJA 4KH1A 1BG6A 4TTAA 2ZRDA 3R23A 4B5KA 3CUSA 1IBLB 2X3FA 5FTJA 2GPBA 4FOSA 4Q7EA 3PA6A 3UYLA 1H4QA 2XGOA 2Y71A 4E2ZA 1NYLA 3CCFA 4OLBA 4R1SA 4CUZA 3LBFA 2I4NA 2WUWE 4XSHA 3W4IA 2GWRA 1WV1A 3OPQA 4Z49A 4POOA 2SECE 3H2BA 4KXVA 4KITB 1TDJA 1QS0B 5ALDA 1HSZA 2QD5A 5D1NA 1L4GA 1MEJA 4KOEC 3LPNA 1B00A 4E1BA 2C07A 4EATA 3LBNA 1GZ7A 4ENQA 5KNCA 3AO0B 3I5YA 3LF2A 2F8MA 3N07A 1ZLYA 1IQPA 1H4TA 3IJRA 4LVCA 4QLOA 4EAAA 2DQKA 5D3KA 1FNSA 3LD9A 4EENA 3SJCA 2B6NA 3L40A 4ENWA 5JZVA 3PFKA 2SKDA 4M46A 5IJZA 1E9RA 2FNAA 1FDOA 3MFYA 5DIZA 2BW0A 4XTCS 3ABIA 4AJ4A 2VK1A 5GONB 3GV0A 4EO7A 4CMAA 5MF6A 2X19A 4UFOA 2B20A 4ZOBA 5JXIA 4JLWA 3RJTA 3QSGA 2PSHA 2PV7A 4LXQA 1DEAA 1SXJD 4OHCA 1YZHA 3G0CA 3I8OA 1G8KA 1L1QA 4E1AA 4ZZ0A 1FTGA 3HWSA 2GO7A 3LBYA 2ZJ8A 3JVVA 3ZD7A 4BB5A 2COUA 4Z99A 4RPGA 3EZGA 3BN3A 1IATA 1GADO 3PP8A 1EGQA 5JFOA 3V1LA 2HW8A 1I1HA 1MABB 1RFLA 4RF4A 4TXHA 1ZSNA 1E7WA 3OZFA 4X6YA 4N0QA 4I4CA 1REQB 3ZHYA 4X3OA 4YDSA 4XXHA 3SICE 3R5FA 4AG5A 2NT4A 4ZDIA 5A3JA 5GPBA 5KNCH 1H9AA 5ADVA 4Q1VA 1U0RA 1Z8DA 2G04A 1OYYA 4RSGA 4CQMA 4F8YA 1HTWA 4M9ZA 4UHKA 4A7PA 1Y7LA 2BWJA 3WLSA 4OHVA 4R2LA 3QA3E 3VPXA 1GIAA 4P2GA 5ESWA 1H2XA 3N0RA 3ZKWB 1NATA 4LBVA 4ZCSA 4ND8A 5DEIA 2C29D 2H4ZA 4KNWA 3LLVA 4EG0A 1X9GA 5FRDA 1II0A 4N54A 4WZAA 2C9MA 3ONNA 3RJMA 3WAKA 2MDTA 1TL7C 3ZE9A 2YYAA 4I0WB 3SYLA 4PC7A 1ORHA 1S01A 4YECA 3VNAA 4UDNA 1L5SA 4ZPJA 2BMWA 3VRHA 4W9MC 1EYZA 4FE7A 3R9XA 3GPDG 1Z34A 3F46A 4DXDA 3H2YA 1G98A 4JU9A 2GK6A 2B7LA 1K6JA 2XUDA 2HO4A 2YV2A 3FTCA 1UBSB 2PRYA 2R8XA 5MFPA 4RMNA 1NPYA 3TCKA 3QHQA 1YQWA 2HEGA 4JMLA 1IEQA 3VH2A 3B9RA 3UGQA 1GTSA 2Q5QA 1PJ4A 2AD1A 1HI9A 4AUMA 1Y1PA 5K2MA 1Z0AA 3LUGA 5DM4A 4S05A 3FF4A 5C8YF 2ZKIA 1NR5A 1NE7A 5IKOA 4DCNA 3V4VB 2X1VA 4D98A 4IH4A 2Z04A 4WLUA 1MFPA 3RS5A 1IM5A 1OXBB 1NM5A 1P62B 4WK4B 2FRDC 1JE1A 5HM8A 5FO1A 3OQHA 4EMBA 1O77A 2AQHA 3FDIA 1H65A 3I9FA 5E95A 3RVOA 3FHOA 4ZCTA 4ZD6A 3HXQA 4YMVA 2FEKA 4UC0A 1SNYA 5LP1A 4B73A 3RU9A 1N6IA 3MOIA 4NBNA 3BD9A 2XXAA 2L0XA 2W2QA 1M34A 1M10A 1XK6A 4G2TA 3N39C 1NULA 3U9LA 3G2MA 2ACKA 1QZTA 2HDHA 5BVGB 1RJFA 3S2UA 5DW3A 1DQNA 2Q2OA 2FSVA 1N3YA 2SICE 2J4DA 1W9HA 4YS6A 3T54A 1V47A 3BTOA 3I4LA 3NHLA 5BRJA 5HOEA 3ZWDA 3DZBA 5DT2A 3HB0A 3L6CA 2QUHA 4D9IA 4MUHA 1E89A 4G37A 1L7AA 4I2VA 1DBIA 3HKEB 5L7YA 5HE8A 4CFSA 3SK0A 1T4BA 1PS8A 1KJWA 3LYAA 3NBYC 2IYQA 2GCEA 3O4RA 5JAIA 3WBFA 2OAP1 3I6QA 2V97A 3F49S 1SCBA 1YB1A 3LDAA 2YIDA 2ZPAA 3EXFA 5DHSA 4JJ8A 4BFTA 1QMGA 1JX6A 1QGYA 2AMJA 3F3YA 3GF4A 4KRXA 3I9MA 4LNHA 4ARSA 5MDHA 4G0MA 4UHHA 1YAJA 4M36A 5DX8A 4YPVA 6ABPA 4PRKA 2VWPA 3E7WA