3UXMA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
206
structure length
197
Chain Sequence
GLFVTLEGPEGTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 197
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uxmA00
3HYTA 3UK6A 1NMYA 1CKEA 4ON9A 4LJAA 3ONWA 4PXAA 1KO1A 4KFRA 1SXJA 4WXPA 2BBWA 4OHXA 4PPNA 2CHGA 4TMKA 3WMEA 1E2MA 1N5IA 3U7FB 5FL7A 2F43A 2XSZD 3MWYW 1F60A 2A78A 1T6NA 4HB0A 2DFKB 5KO2A 1E96A 4BE7B 2ZE8A 2VPPA 4D4JA 2HDNB 3CRQA 4A82A 1CR2A 2ZAMA 4URWR 5BQ5A 1OFIA 3W3AA 4KCGA 3R8CA 1OB5A 2PJZA 621PA 2P5TB 1HT2E 1XD9A 1IN8A 2PZEA 3VHXA 2B21A 5B58C 5FPSA 4NDZA 2BWJA 5KOYA 1CRPA 4JLAA 1TX4B 1CJUC 4B71A 4ITRC 1GUAA 3QNUA 2QAGB 2QL6A 1OLOA 4IHQA 4L4UA 1SGWA 4XTCS 1MH1A 4Q9JA 3RS2A 2WPDA 4LHZA 3X1YA 3AVOA 1SHKA 1FMLA 2R6GA 2I1QA 1YHNA 1ODFA 4LYHA 4Q9HA 2CK3A 4I1VA 1GKYA 3B1VA 5J4YA 3R9WA 3W9YA 3MJHA 1OT3A 3IDQA 2DB3A 1I4DD 1D2EA 1QHYA 3GLHE 1W0JA 1UBCA 4UNNA 5KNCA 5CK5A 3TUJC 1YRAA 3RAPR 1SULA 1UKZA 4A9AA 2W58A 4B2IA 3BS4A 2ZSFA 3VKWA 3CRVA 3VR6A 4NYJQ 2PX0A 1Z0FA 1OXVA 1O3YA 1PUIA 2RKOA 3A1SA 4XWKA 3QBVA 4BFXA 1KMHA 4MUBA 1FP7A 4LPSA 3VNVA 5B2ZA 2JIZD 3U44B 1AKEA 4DKXA 4Q4AA 1KI1A 2QAJA 1IN5A 2VP0A 3QXSA 1SXJE 1PV4A 3VFDA 2D7CA 3VR5A 3LA6A 4A2QA 4LUCA 3O8DA 3FMPB 3T61A 2CXXA 2ODNA 4O25A 1V5WA 1HYQA 3TR5A 4D4LA 3REGA 4F38A 2JDIA 3KZ1E 5AJVB 4A2PA 1NY6A 4XD7D 1Q22A 4IDOA 5JI3E 3RS3A 1KI6A 4BFTA 4DLXA 2BKUA 2JLUA 2Q3HA 2QE7A 2V6JA 2AXNA 2Q6TA 3A1WA 4Q48A 1SKYE 4IDNA 4O3MA 5SZHB 3C5HA 3AUXA 1P72A 2WM9B 2F1RA 1WB9A 3CONA 4PPQA 1JNYA 1ZNXA 4TYNA 2VHQA 1SVMA 1IQPA 4IJMA 4XOIA 1F2TB 4W5WA 4HAWA 1G1MA 2BDTA 3K0FB 2NO1A 4MITA 3EIHA 1S9HA 2ORIA 2HXYA 2KI5A 3CH5A 4WZAE 3I5YA 5HE8A 1XD8A 2JLQA 1OIVA 4DWJA 1P2SA 3I5XA 2GCOA 4FIDA 2CEAA 1MO6A 4DHEA 4Z54A 1IN4A 3L0PA 2BC9A 1W5TA 4OQMA 4B34A 2ASEA 2JJ1D 2MMGA 4DDWA 4F91B 1ZUNB 3KQNA 3L82B 4LGMA 2TMKA 2DWPA 1RKBA 4RD4A 4YDHB 2QMHA 4PZLA 2OZEA 3DM5A 5DLQC 5EQTA 4TMTA 2G0NA 2XZLA 1UKVY 4WA7A 4AK9A 4C0LA 3GFPA 1NVVQ 4G5QA 4TLBA 3W90A 4N0EA 1G21E 3X1ZA 4XWOA 3W34A 1T3SA 4PZZA 4CEJA 4LHVA 1K5DA 3REFA 1OXUA 5CIWA 4CEIA 4DDUA 1M7HA 2H5EA 2IYVA 4B3BA 4PANA 2BMFA 1L8QA 3SHFA 2GXAA 4Q7JB 1ZM3A 3R8FA 2FOLA 3T1VA 4WVFA 3NWJA 2EQBA 1OFTA 4Z51A 4OKSA 1YU9A 3NC1C 2GETA 2W6JD 3PITA 4JZKA 4DLRA 2OLKA 2A5DA 1J90A 3TSOA 2FH5B 4G5SA 1J99A 1J2JA 3C16C 4RZUA 4PO1A 1NSTA 3IUYA 3AF1A 3IPYA 2OILA 4TT3D 2WJJA 1DAMA 1EWQA 3BGWA 3TR0A 1WXQA 1ZCBA 1KDTA 2WSMA 2ZAOA 4TQUS 5CIQA 4IKEA 3BH7A 1Z0AA 1KIMA 2CL7X 2N46A 1ZUIA 1KSHA 3EAQA 4R2HA 3TJZA 3W5IA 2F9LA 2P67A 3KKQA 5L3SA 2RHMA 4C0BA 5LBIA 5FR1A 3OFND 2IL1A 2X2EA 3BD9A 1Q1BA 3V00A 4PSKA 3PUYA 5JEEA 3Q5EA 3BRWD 1S4QA 4DT1B 1W48A 2JJ2D 3AH8A 5TARA 5G41A 1CIPA 3R7WB 2JLZA 3PQCA 3SQWA 1KGDA 1LY1A 2V55B 4TTQA 2G0TA 4JT2A 1NVXQ 3RYTC 4P4SA 3CIOA 3O47A 4XTRA 1IY0A 4PZYA 1TEVA 4UQOA 2QRNA 2MMCA 2GEDA 2NZ8A 3OE7A 2XXAA 2HCBA 3B2EA 1LFDB 2RGAA 5DISB 2HJVA 2Y8EA 3CRMA 1RE0A 4IXMA 1AS0A 1OKKA 5DE3A 4DLWA 5JRZA 4QHYA 2PT5A 2AKYA 2B7BA 1KI3A 3PEWA 2G9NA 4A1FA 4P31A 1GM5A 5AUNB 4QJ4A 2V54A 1AA9A 1L7VC 2IYYA 1QVRA 3B7GA 3M0EA 3KKPA 1G5TA 2ZE6A 2VSXA 3DMDA 3CB4A 4NPHA 3W5JA 2QGNA 4A92A 5JLJA 2C98A 3FFAA 4TTPA 4PC1A 4JYBA 3WHKA 1Z5ZA 4PO8A 3PUVA 3G5UA 4BLPA 2J5XA 2YOHA 3EW9A 3TKLA 1GL9B 4D6PA 5D3MB 4AI6A 2F7SA 1CJMA 1KZ7B 2IYLD 1S0UA 2P2LA 4HZUA 1ZCAA 2IYZA 1D9XA 1CJKC 4V0NA 4B2PA 2O8FB 1KNQA 3CF6R 2ZJZA 3CZQA 4KFSA 2CL6X 1OIWA 1FZQA 4BFYA 4DCTA 4DDTA 2RGEA 4EPTA 1XWIA 1Z3IX 4M53A 4RD2A 1T3HA 1VG8A 4TLDA 2WTUA 2C99A 5HKKD 3AV0B 3AVWA 3QKUA 5K8IA 2ANBA 2D7DA 1BOFA 1IHUA 1HUQA 1T5LA 3S1AA 3UATA 1YZNA 1JR3A 4RZ3A 1NIJA 1GKUB 4NL4H 2AK2A 3ZYCA 4HAVA 2IWHA 2OCAA 1NP6A 2VP2A 2IS2A 1Z2CA 4KI0A 3SDZA 4NCNA 4B33A 4PAMA 4OJQA 4PQRA 1NNEA 5JS8A 3K0SA 3CZPA 2P6NA 3U6KA 1MO3A 4PAQA 1XTKA 2WOJA 3PFIA 4KLNA 4Q18A 3EPJA 1AQUA 2FFAA 1G3MA 3THXA 3F5FA 3NG1A 2IF2A 3Q8XB 2FFBA 2ODWA 3AQ4A 4FMDF 3TH5A 1HE1C 2WMNB 2VYFA 3LXXA 4FW9A 5GVSA 3CF0A 3HR8A 4ZI2A 2CHVA 2P3SA 2QM7A 1AJEA 4DXAA 1OSNA 3I32A 2CCGA 5SZJA 2F1JA 1H8HA 1COWD 1G7TA 4QL3A 4TL9A 3VHLB 1E0AA 1LW7A 3UPUA 4EJSA 1T91A 1CS4C 3SS8A 2VA8A 2ZRMA 4C0KA 5UKDA 1E2EA 1SXJD 4UJ3A 3LY5A 3QPWA 2XB4A 4K81B 4IXNA 4JS0A 4HB3A 1XMSA 4NYMQ 3GJ5A 1E0JA 5FL7D 4A0RA 2FN4A 1LVGA 2Q9CA 1U90A 2IEZA 2I1VB 2WSSD 2NOAA 1ESMA 4M21A 4US1R 3TGPA 4JLNA 5TVKA 3KJGA 1BH2A 2V7QA 3NH9A 1F6BA 1E2KA 2GXUA 3ZVRA 1JR3E 4KSBA 1VECA 1HE8B 3U4QA 3KTAA 1RRGA 2GJ9A 2IHBA 4DSUA 4IOLA 3BB3A 5C4GB 4AKHA 3FMOB 5DGXA 5J4VA 5EP1A 4MGIR 1N6PA 4CRWB 5L3VA 4QBHA 4RD0A 1XEXA 4MKGA 5FTMA 3F8TA 3U3OA 3NXSA 1YZTA 5C4MA 3K9NA 3EIEA 2O8EB 2WPDD 2HT6A 3FYHA 1E79A 1VTKA 5F9FA 1SVKA 2E87A 5SZIA 4NCJA 2JAQA 4OK3A 1PLJA 4TSFA 2NQ2C 1X8KA 3EARA 4I81A 4Q1CA 4GBMA 2CK3D 1WQ1R 4KFUA 4PC7A 3SN6A 4QRHA 1E9FA 4D0GA 4D81A 4CIDA 4EPVA 3PVSA 1OYWA 2FWRA 4V0OA 5J47A 2ZXUA 1W0JD 3RVBA 1WE2A 3L2OB 3KXLA 1EFHA 2FFHA 4YONB 2DR3A 4MYTA 4RJLA 1A5TA 2O8BA 3VNUA 1R6BX 5FL3A 1NIPA 4Q9IA 5AJWA 4JLJA 2VTKA 3FKQA 2F6RA 1ZUHA 1II9A 4MRVA 4B43A 5KDDA 1IXSB 4F4IA 4M1SA 2WOOA 3SJAA 4G3XA 2IUTA 5JCPA 3GLHB 1M8PA 4C0AC 3VR4A 1II0A 5HPYB 4OI4A 2CJWA 1FNMA 3SFVA 4C0SA 2IYUA 2P65A 3PXGA 2JDID 2QT0A 3CRRA 3ND8A 4KHZA 4XSGA 4AURA 4EPWA 4DBLC 1OH6A 5JCZA 3DKVA 2FU5C 1TQ6A 2QRZA 1GILA 3F3YA 3D31A 3AGQA 3ND9A 2ZRAA 4KV9A 5E95A 3T1OA 2IT1A 4C0HA 2QE7D 1SXJB 2PZFA 1FPMA 4FMBB 1T3LA 4C9BA 2VLIA 2PMDA 1Q0UA 2AFHE 2F43B 1NF3A 4OL0A 5EE9A 3LVQE 4Z8YA 3PIRA 2NO9A 3IILA 3TSWA 4DLYA 4W5JA 1CBUA 2FF7A 2GAOA 2XJ9A 4RVCA 3RS7A 4Q1BA 2FNAA 1Z63A 3T12A 2F1HA 4MDEA 1KMQA 2AN9A 3K9LA 1K5GA 1SKYB 1OJLA 2WWYA 1DADA 4AD8A 5FI1B 4LX0A 2PX3A 1DOAA 1U8ZA 2O0HA 5HE9A 4UXJA 4NU0A 4BUJA 3UMRA 4CYMA 4K46A 3SI7A 2JLRA 2WWXA 1EG7A 1K6MA 2KWIA 1CRQA 2ERXA 3WBKA 1S1CA 5B64A 1UEJA 1GIAA 1M1YE 1OPXA 2V6IA 4HLCA 4PFSA 1E2LA 3AVXA 4NE2A 4MGKR 1KKMA 3SR0A 1JEEA 2V1XA 4FXPA 3JZAA 4O2LA 5C46F 4LHXA 3RNLA 4LZZA 4JL5A 2G77B 2F55A 3SJBA 2C04A 4M4SA 2GTPA 1KYIA 5CB8A 1II8A 3CF2A 4TL8A 2IYWA 3RDPA 3GMTA 2GCPA 3M1IA 1EXMA 1R2QA 2Q9BA 2UZ3A 1KMHB 3I1FA 3EZ6A 1W4RA 5GJWC 4Q4AB 4BZPA 2OG2A 3SYLA 4ZCLA 4M9SA 1GDDA 1U0HC 4OI1A 2DHRA 2IYXA 4TYYA 2IUUA 5CM8B 4EFMA 3TQFA 2VIIA 3N2IA 4PTLA 4X8OA 1R8QA 2IX3A 2GZHA 1IN7A 1KI6B 5KU1A 3GQBA 4J0QA 1ZIPA 4U5XA 4OQXA 2GKSA 1DG1G 1YR8A 3SU8A 2V3CC 1EX7A 3N70A 3ICQB 3EZ2A 2ZI3A 5BN4A 3J81k 1XMJA 2Z83A 2I3BA 4QBFA 2F3RA 4MRSA 2OFXA 5AUQA 1OH5A 3TAHA 4HLUC 5DIFA 3WBJA 1Z0KA 3JVUA 1W1WA 3AF4A 3LXRA 3NHBA 1TU3A 4OJKA 1GZSA 2O8CA 3SYKA 5FOWA 1UEIA 2R6DA 4DRZA 2CL0X 1Z08A 4WXRA 2ZRHA 5F2EA 5L3RA 4Z1MD 3OIVA 2OAP1 3M6AA 1Q1QA 4HAZA 2O0JA 1WDTA 5E3HA 1QF9A 2GCOB 2X1VA 5A5GA 5J4HA 1N6LA 1KJYA 1JAHA 2DCUA 2ZJ5A 1AZTA 5AWFC 2ZRLA 3SEAA 1PVOA 4ZDIA 4BPBA 1CJVC 1OIXA 3AUYA 3TW4A 2IYTA 5HCIA 2ZETA 3QXJA 4Q7KA 2JATA 4ARZA 2EWVA 5K8UA 4QHTA 1E1QA 1AKYA 2RAPA 5KNDA 1MR3F 3DO6A 1RIFA 2C8VA 3R20A 3BJIC 1XD2A 1K8RA 1TUIA 3TIFA 4B74A 1Z6XA 3I92A 4KLZA 2AD1A 1OKKD 4CEHA 4YDSA 4TYPA 3R9XA 1CP2A 3MG9A 4JLBA 4RY2A 4QBIA 2BHRA 2W2XA 1HTWA 4AKGA 4OHYA 5AK0A 3HDTA 1S96A 1YZLA 4KU4A 5IT5A 3I4LA 1RJ9A 2J1LA 2W2TA 4I99A 4CEJB 1ZM4A 2QORA 3P32A 1KK2A 1N0VC 1YQTA 4L8GA 4LV6A 4CEIB 4PR0A 1JBKA 1GITA 3TW8B 3SYNA 2FPLA 3WP0A 1EFRA 1FL9A 5KSOA 2CVFA 1UDWA 4WOPA 2FX3A 4DSTA 3WHLA 4QGAA 5BN3A 2CE7A 1VIYA 1CULC 2OCYC 4A6XA 2JLYA 2C5LA 2ZJ8A 3KB1A 2OHFA 1XX6A 1NG9A 2ZTSA 4QNMA 3E2IA 2XB2A 1E2QA 1QVAA 1W2HA 2ERYA 2CHQA 1SVIA 3P4YA 4GOJA 221PA 2YINC 2JLWA 3KL4A 3X1WA 4Q4HA 2HCJB 1E6CA 1XEFA 2R6CA 1G8GA 2PJRA 3JZMA 2FZ4A 4NHOA 3U2QA 5L3SB 4LJ4A 4GL2A 1XB2A 1CLUA 2GESA 3FTQA 2ZS8A 1QHNA 4HATA 3SFZA 4F7WA 1EESA 2F3TA 4G01B 4DJTA 3B78A 2ZR9A 2FSFA 2YZ2A 1XTSA 2ECKA 2W6IA 2BMJA 2QPTA 1ZD9A 3LLUA 2Z4SA 2XNSA 5AJZA 4DIDA 4ERNA 3K9GA 4JBXA 3PEYA 1E32A 2WJIA 2FSHA 3TK1A 4P4SB 1KI8A 3CPHA 1P60A 4A0HA 1W4AA 3NBZC 1TQ4A 1XBTA 2E1RA 3PJRA 3Q9LA 1VCOA 2XTMA 4JJKA 2XXAB 2H17A 1E9SA 1UF9A 4IDQA 4GP6A 4Q7LA 3SZRA 1YZKA 1XCMA 3B1YA 3K09A 3QUSA 4F4CA 4IOKA 3KXKA 3FHCB 3RSOA 4D4MA 4Q00A 2B7CA 1NN1A 4CVNA 1W2GA 1YE8A 3BWDD 3FB4A 3PUWA 1D6JA 4LCBA 2ZPTX 4R9UC 3TAUA 4R2IA 3AF3A 2BM0A 1LF5A 1ZW6A 2P6RA 1D5CA 4EUNA 5KSZA 3FOZA 3EG5A 1H8HD 1TTTA 4I1OA 4MKFA 1FX0A 4RCZA 4AIIA 1SHZA 2HUPA 5FOUA 1KI9A 4DCVA 1Z28A 2NTYC 2ZJBA 1FUUA 1S3GA 2QTVB 3EZ7A 3QE0A 3K53A 2YKGA 4URYR 4LOAA 4EIWA 3WNBA 3FPAA 3VX3A 3B82A 3OAAA 4NCIA 3WY9A 1P2TA 3QBTA 1QRAA 2XAUA 2IA5A 1G17A 4HZUB 1YZGA 3O8RA 5SZKB 3RS5A 4TYWA 4ESHA 3AKDA 4E07A 1YJ5A 2D2EA 4B6EA 4XH9B 2QY9A 3TLXA 3FKSA 1U2RA 5M04A 2V7QD 5ELXA 4U02A 2RH5A 2C03A 2ZI5A 2AD5A 2DFTA 3DHWC 2IXFA 3DL0A 4IDHA 2FA9A 1RRPA 5IDVA 4FMCF 1E4YA 2IK8A 1MT0A 2ZI4A 4DLUA 1US8A 1N3BA 2GXSA 4PC6A 3S1AB 2OBNA 2YV5A 5EUMA 2OCPA 1ZM9A 3BFVA 1G64A 1E79D 4PQFA 5HZKA 2HXSA 4HLUA 1XCPA 2ZJAA 4IRUB 4TSFD 1DELA 3MD0A 2OSBA 4ZCIA 1TNDA 3T5DA 1C1YA 1XU4A 3LNCA 1F2UA 2AK3A 2G83A 1GAJA 2KBFA 2C9YA 1GG2A 1VYUA 2QT1A 4JVNA 2KBEA 3UWOA 1WBBA 4XWAA 4TLCA 2GJKA 4LC0A 3FHTA 2FV8A 3QIAA 4LJYA 4AYWA 1R5NA 1PLLA 3H1TA 3DPUA 4WIAA 5H70A 1PLKA 3U7EB 3THXB 1U8YA 1U94A 5TV2A 4D25A 2YC4C 1VIAA 2V4ZA 1CEEA 4W5HA 5EZ5A 1FTSA 3T34A 4N1AA 2FEOA 2I4IA 3EA5A 4TQ9A 2J9RA 3RS0A 3GLIE 3RRZA 4R71A 3P27A 3Q3JB 3KDSE 3NDBB 2ANCA 4LDJA 1E9CA 1G19A 1S8FA 2XZOA 2G6BA 3H0KA 4EJSB 4M1WA 4EJSC 2R6FA 1E3MA 1G4AE 3EX7C 2EFEB 5TDHA 1E99A 2QG6A 2XTZA 4ZDKA 4EDHA 4Y0VA 3RABA 1ZD1A 3ADKA 1OXXK 4JVSB 1H8EA 2KSQA 1RVDA 4LYJA 4EPYA 1WA5A 2OBLA 1YZQA 1FQKA 3QPUA 3RS4A 5K8LA 3T15A 2H8KA 3IHLA 2FFQA 4GSYA 4JL8A 5DN6A 2BBOA 1KK0A 3U4QB 3KTAB 1P2UA 3W6PA 5LB2A 2QROA 1Z6GA 1TADA 4HDCA 1XEXB 3IKJA 3TNFA 2ZU6A 1QG4A 5LPNA 1NMXA 2D4HA 4HAUA 2OAQ1 1KSJA 5FFMA 1SKQA 4FCTA 1TU4A 2A5JA 4OK6A 4JJZA 5KDOA 5FPTA 1UM8A 3ZLJA 1W44A 4E22A 1D2MA 2D06A 3MWJA 1SVSA 4CGZA 4M9QA 2R6AA 1KDPA 2C78A 1GNRA 5DI9A 3NBFA 2CCJA 4CF7A 2GRJA 2Z5FA 2O0KA 3IO5A 3ZIAA 2EWWA 2YOGA 3OEEA 3A4MA 4BEJA 2P5SA 4PQYA 5H68A 2O8BB 1OFUX 1G3IA 4BRUA 4MKHA 1R7RA 1OHHA 4DLVA 1G9XA 4MRRA 4NP6A 3UG7A 3KQLA 4WAUA 2GVDC 1RZ3A 4LK2A 5FBWB 1NMZA 3A8TA 4DB4A 4BWYA 2CJWB 1VCIA 2P6UA 4XIGS 5JJLA 4BFVA 2H92A 1HURA 4UKDA 4BLOA 3VQTA 1NRJB 4XJXA 4V02A 3PR1A 1TQ2A 4JLPA 2GJ8A 4KSCA 3Q85A 2IYSA 2R9VA 4NYIQ 3ZVLA 3BERA 2A5GA 1ZBDA 4C4PA 1I2MA 1FP6A 3AVPA 4MYUA 3X1DA 1M7GA 2A5FA 1KSGA 2OM2A 3ZJYA 1QHHA 1A7JA 1R0YA 4Q03A 3VX4A 2IYRA 3EA0A 2ZROA 2CLSA 1EK0A 1XP8A 3D3QA 2VHCA 3NBXX 3V4FA 4C0JA 1RC8A 4FCWA 2J7PA 2R62A 3N5CA 2LKCA 1P9RA 2QQ0A 2ZJ2A 1S2MA 2DWOA 1G291 2NO6A 4AG5A 4IEIA 2ZE5A 4BLSA 1KJZA 3VR2A 4B35A 4IDPA 1MV5A 3WRYC 5CB6A 2YWEA 3AB3A 1X86B 2FJUA 5TB5A 4B44A 6Q21A 4L5BA 4EAQA 1N5LA 2GZAA 4TMVA 3AEZA 4PPFA 2NIPA 1NY5A 2WWFA 2YHSA 1ZNZA 5CJ2A 1KI7A 1E1QD 2FGJA 4BFZA 4LYAA 3IQXA 4N0DA 4OHWA 5TY0A 4DZZA 2NO0A 2BJWA 2EFCB 5EXTA 2J46A 4TLEA 3EWAA 4Z8XA 4JLKA 2VEDA 521PA 5JHHB 2ZM5A 5F9HA 1T0JB 3VR3A 1AGPA 1YR6A 2BCGY 2IWRA 3UIEA 1KO5A 1HV8A 1G6OA 3QKSA 4BASA 2CLCX 2R65A 1II8B 3TSZA 2Z0MA 1E1RA 4POAA 4JLVA 4YC7A 4E09A 2B92A 1KHTA 5K8TA 1VYTA 4M22A 1C4OA 2QQEA 4RD1A 3IQWA 1UKEA 1EFRD 1L4UA 5CLLA 1UKYA 4JMPA 1F5NA 5JHGB 1X8LA 3GEIA 1BMFA 4A8JC 4MH0R 3BBPA 3B9PA 3HJNA 3IHWA 5G40A 5FOVA 2NPFA 1OXTA 1E2HA 2ONKA 4LBVA 2WHXA 3E1SA 3GEHA 4Q21A 1FUKA 1XFAA 2GBLC 2CMKA 3VKGA 2FSIA 1ZD8A 2GF9A 3FE2A 3RHFA 4URXR 4DUGA 3KB2A 1NI3A 2JASA 2ZYWX 1G3RA 3MRSA 1Y3AA 3NEJA 4HUQA 1Q1ZA 3MJRA 3PG5A 1AIPA 1NVWQ 2CLDX 3OESA 4M1MA 4DEXA 4LWZA 3WNDA 1QDEA 3OIYA 1OF1A 1P75A 2AXPA 3FVQA 4BEBA 2XTNA 5JEDA 4O2RA 2O8CB 4GZLA 1HY3A 1Z29A 1QHSA 4Q1FA 3GJ8A 1YR7A 1D8TA 3C7KA 4V03A 1TQDA 4EKDA 4AY2A 1DS6A 1XXHA 4IFBA 4B73A 5DI3A 1D9ZA 3SC3A 2WJVA 2W6ID 4IVQA 4HLQB 2AX4A 1OXSC 1KO8A 1PUJA 1P2VA 1QHGA 3GEEA 4H9GA 5KPJA 4UNRA 3QXHA 5JWOA 1CXZA 2QI9C 3WYAA 2IW3A 4Q1DA 1EX6A 1AN0A 4BFWA 2IBMA 2PH1A 1P62B 5BXQC 5FOXA 4ARZB 1XTIA 2QSZA 1G8HA 1JI0A 3D7MA 2CNWA 3WMGA 3UMFA 2VP9A 1G6HA 1XD2B 1KO7A 1DO0A 2IYQA 1OW3B 2C77A 4OQLA 4CEHB 3GJ7A 4MGYR 3ICEA 2ZVQX 4NBSA 5G3ZA 4P33A 2E9SA 4PX9A 4QGHA 1RJ9B 3LBIA 1Z83A 4HUTA 4OI0A 4M8NE 4HAYA 4Y0AA 2ZSDA 2GK6A 1KSFX 4EPRA 5A4JA 1B0UA 4QGGA 5HZHA 5JS7A 3U3JA 1AGRA 3DZDA 4NCHA 4Q1EA 3ZZUA 2J41A 3MWKA 1VCMA 1GNPA 1IN6A 1WP9A 5JMTA 4KODA 1KK3A 3NEYA 3K70C 1NN3A 3VU9A 2C96A 3OAAD 4RZ2A 2PMKA 2ZQ5A 3B85A 3RWOA 3GJ0A 4JKIA 2VSOA 3HU3A 1SVLA 2RGBA 1ZU4A 3LV8A 1AS2A 1VG1A 1XJ0A 3TUIC 3A4NA 4EFNA 4ZV4A 1N6KA 1ANKA 2ZI6A 2GAAA 2GWHA 3FKSD 1XZPA 4LJ7A 4CT5A 8OHMA 3U6BA 1A2KC 1XXHE 4NONA 4D0NA 2JGNA 3BH6A 2G1KA 3CLVA 4Q4HB 3K0CA 2QMUA 5JSZA 1E0KA 1U99A 1T9HA 4LV5B 1YR9A 3B9QA 1CR0A 1TMKA 3CX7A 2PL3A 4HLDA 3GJ4A 1SZPA 4DCSA 1S9DA 2C9CA 3RC3A 2GEVA 1OH8A 2V1UA 1OB2A 3BOSA 1RRFA 4MRPA 5FTJA 5GJVC 3R7WA 2ZRCA 2AWNA 2JJ1A 2GHIA 1T0HB 3B13B 2G3YA 3AP1A 3NH6A 4D0LB 4M9XA 5J5CA 4B3DA 3U7HB 3KQKA 4C2TA 1CR1A 5CJPA 1KY2A 1E9AA 2H57A 1BIFA 2FMXA 2QSYA 3R9IA 3ADCA 4UNQA 5L3QA 3P20A 3MFYA 4DLZA 1J7KA 4IEEA 1T5IA 4M0LA 2UKDA 4D82A 3AKEA 3GCGA 4MYHA 2QP4A 3LD9A 1GFIA 1E2NA 1ELOA 1EFTA 3DZ8A 4A0FA 2JLVA 3EZ9A 3EC2A 3K09C 3IIKA 2VHJA 4RD6A 4RFSA 3EASA 1MABA 3P1JA 3HPQA 3VKHA 2MSEB 1LV7A 4QFMA 2A30A 1DAHA 2ODBA 2WMOB 4UNPA 5KSPA 3RLFA 5EZ6B 3V9PA 4LI0A 3WYFA 4D2IA 4V0MA 2OV2A 1TEXA 3EWSA 3QJYA 4LSGA 1FX0B 3ZZTA 4MDFA 4NYJR 5EXXA 3SOPA 5AUPB 4QC2A 2V9PA 2H16A 4MQBA 1EWRA 3PV0A 2Z43A 1N2CE 1H8ED 1TL7C 1U9IA 1XTQA 4MKIA 2HLDA 2W2VA 3PEUA 4HYYA 1JQJC 1U98A 4GRAA 4L9SA 5DSZA 3OZXA 3CW2A 1R0WA 1XZQA 4A0GA 5C18A 5DN6D 4V0LA 5EJEA 5KNBA 2JCSA 3O8BA 1BYUA 5JJKA 4WZ6A 4A8JA 4AC9A 4ABYA 1UPTA 1JALA 2AFIE 3SHWA 4ACBA 5FPKA 2GZDA 4Q02A 2ZS9A 3GLFA 5EE0A 1NLFA 1VG9B 1M7BA 5EP4A 2GJSA 1X3SA 3LBHA 1US8B 1E98A 4ZKDA 2GBLA 4C30A 4QOSA 1HQCA 3TUZC 2DYKA 1KZGB 1Z22A 2REOA 1XDBA 3Q7PA 4B6FA 3VAAA 2GNOA 2Q21A 1WF3A 4MGZR 3HPRA 1GL6A 1MKYA 1GNQA 4Q4JA 1HT1E 5IHPA 3QKRA 4G0NA 1G5RA 4M9ZA 1F2UB 3AF2A 4WW0A 4Q47A 4LBWA 2YYZA 3THWA 1JPJA 2D3WA 2GVZC 1YRBA 3ZIAD 3OEED 3NKVA 4BLQA 5CYOA 1FTNA 5G3YA 1OV4A 1QG2A 5HCNA 3H4MA 3AVVA 1W49A 4V0ME 2FPMA 3W6OA 2PLFA 5KUTA 4GNKA 2WJYA 2YVUA 4PC2A 1S3SA 1ZIOA 4P0TA 1GKIA 4GOXA 3SQXA 1ZNYA 4PC3A 1LS6A 5CITA 2VRWA 4DSNA 4D80A 2C95A 1G5PA 1NVVR 2VH5R 4F93B 1P5ZB 3OE7D 1NN0A 3KKMA 3QXXA 2PBRA 1KO4A 1X6VA 3NC0C 2Z6VA 4XVUA 3QF4A 5LD2B 5CLQA 5LD2C 5FUVA 3THYA 2ZRGA 2VP4A 1X8JA 1YVDA 4JLOA 1N6NA 1F3OA 4KAXA 4TL6A 2YWHA 5JWRA 3SJCA 3GLFE 4EQ6A 3MLEA 5EE5B 3U3RA 5P21A 1GRQA 3AVUA 3RSLA 4DDVA 2J7PD 2QENA 3QKTA 5KTYA 2CVHA 2QBYA 3KQUA 1UAAA 3H86A 2EFGA 4M2LA 3AP2A 3QENA 1G8PA 3PUXA 4Q5IA 2KB0A 5HKKA 1MO4A 1DAKA 2ZI9A 2ZSBA 4JL6A 5KSYA 3ETLA 2ATXA 2D2FA 1P4SA 1NN5A 3CX6A 4YMWA 1WCV1 1ESNA 1X1SA 1Z6AA 2X19A 1U81A 2ZRIA 2WWIA 2XZPA 2RGDA 2ZSAA 5JI2E 4KYIB 4TMWA 5EXPA 1ZVQA 2EW1A 4PHGA 3T1QA 2IS6A 1KNXA 1ZNWA 4IFEA 2WKQA 1ETUA 4BRWA 2QA5A 2BV3A 1NBMA 3AGPA 3C8UA 3CWZA 3I72A 4ZI3A 1IBRA 1KDOA 3T06B 1HQYE 4NCKA 2ZRNA 4QXAA 2NZJA 4A15A 4AYXA 2FE4A 4JT4A 1N6IA 4LBYA 3LX5A 5FH9A 4ASUA 3CWQA 1JR3D 4PO9A 4R7ZA 3BE4A 4RCYA 1N0WA 1E1RD 1JECA 2BBSA 2JLXA 1SQ5A 1RYHA 4JVMA 2NGRA 4JKYA 4AYTA 4ZIRA 1IY1A 1IXZA 1IM2A 1NJGA 5DYGA 3BK7A 1KTVA 1COWA 3PENA 4U00A 4URUR 4A4DA 4QKQA 3RC8A 2BM1A 1BMFD 1OFHA 3U3KA 3I8XA 2ZU0C 3OF5A 4GP7A 4Q1AA 5EP2A 1W36D 4FD2A 1CU1A 4KBGA 4MYCA 1LTQA 1WMSA 2WIBA 2ZI7A 2ZYVX 3ZQJA 2A9KA 1KDRA 1E9DA 1T4GA 4DUGD 2WSSA 3CH4B 2VP6A 3U60B 3BORA 3GFTA 2DY1A 1LNZA 1B23P 1NSFA 2W00A 1QHHB 4BZQA 1KJWA 2R44A 2ZRBA 3GLGA 2OCBA 5HTKA 5ANRB 2YOFA 2ZANA 1S1MA 1SVOA 2JEOA 4PAOA 4QGFA 2PT7A 1N6HA 3W8NA 3CNOA 1NVUQ 3HYRA 2FG5A 2VP5A 3SBEA 3UKDA 3CX8A 2QMEA 2QU8A 1QBKC 3K0AA 3QPVA 1L2TA 5FPYA 1W4CA 2Q0HA 3GLIA 4ZDWA 2QAGC 1NBME 3U7GA 3FHOA 3QVVA 2EYQA 4JSTA 2QUZA 4Q19A 3E5HA 3T5GA 1UADA 4PHTA 1P9WA 4FCVA 3BAFA 2X77A 3BFXA 2REBA 3RRMA 4BECA 4TZ0A 3DMNA 1CR4A 4UXIA 2GCNA 4G5GA 2FDCA 2NMVA 1AM4D 1IY2A 1OH7A 2Z4RA 3PUZA 1E2FA 1RW4A 2ZJOA 3CR7A 4HB4A 4RZXA 5JWHA 1J8MF 4X8HA 4KITB 5E7JA 2CNWD 5J40A 3AVTA 2GILA 4IOMA 1JXOA 2DBYA 3L0OA 3KX2A 1HEIA 2QGZA 1BO6A 3OEHA 4LJ8A 4P32A 1BYIA 3KUCA 3A4LA 5JZVA 5FBLB 2J0QA 3QKSB 1I2DA 2C2HA 1E9RA 5KPDA 3LBNA 2CBZA 4B2LA 2LWIA 4QBGB 3UG6A 1M6NA 2PCLA 2ORVA 3HR7A 1T8UA 4Q7MB 4HZIA 1VHTA 2AKAB 2IUSA 4UXHA 5FTKA 121PA 2DFLA 1ZMXA 5LB4A 4EFLA 3UWKA 1G8YA 2DFNA 3GJ3A 2AHOA 3KQHA 1DAIA 4JSYA 3GLGE 2LKDA 1W36B 1Z07A 1ZP6A 2YWGA 5CYPA 4Q01A 4B32A 1W36C 5JJIA 1N5JA 3ASYA 3IPXA 1L4YA 1Z6YA 1JJ7A 5C1BA 4QHSA 2QP3A 4HEJA 3C15C 5FOTA 4WZBE 5BN5A 1MRNA 4HUQB 5E7MA 5FBQB 5DO9A 3BB1A 2XOKA 4BLRA 4NYMR 1VKJA 1JEDA 2RGNC 3LO5A 4M1KA 4GMXA 2QEQA 1Q44A 2R8RA 4YLGA 3B60A 2H1LA 4V0KA 3LAWA 4B3XA 5J4KA 3CUEF 5AJXA 2GK7A 1XXHB 1NG1A 5DI3B 4CDGA 2Q9AA 5CM9C 2BEKA 2ODEA 2C9OA 4DCNA 3CRW1 5FPHA 4BFSA 3TE6A 2QN6A 2WJGA 3QF7A 1HH4A 2WWWA 2XX3A 2HJGA 2GF0A 4US0R 3BFKA 2W83A 4C7OA 2YWFA 721PA 1Z8FA 2QM8A 4B3FX 2WKPA 4OQNA 2VO1A 3NVAA 1NKTA 1VG0B 1XEWY 1P73A 2ZR0A 4W7SA 5JECA 3IGFA 1E0SA 1ZJ6A 1VCNA 1W0KA 5E4FA 5FUXA 1U8AA 1ZINA 3VMFA 2BJVA 4LC1A 3I8SA 4JLMA 3W3ZB 2GXQA 2J59A 3CPEA 3KJHA 2FZLA 1RRCA 4YXWA 1NKSA 3AKCA 3PEVA 5AJYA 2ZSEA 4LBZA 4QNRA 3V4RA 3FFBA 2OBMA 2IF0A 1NJFA 2AWOA 4IVRA 3ZGXA 3G82C 3NIBA 1XF9A 3N2EA 2D62A 3LX8A 2O52A 3DM9B 3NDPA 1CF4A 1GRNA 4DSOA 3CNLA 1TUEA 4W9MC 1YKSA 3ZQ6A 2RB4A 3B1WA 1MO5A 3B6EA 1XJCA 1KI2A 5EP3A 5AUOB 5HR5A 4H1VA 1NLZA 2XITA 3VU9B 1N0UA 3GJ6A 2J0UA 1E9BA 5IRCD 3RRYA 2HLDD 1FFHA 4YQFA 2O8DA 2DPXA 1KKLA 2BCJQ 3WXMA 1VPLA 1Q21A 4ACAA 1WBDA 4OQFA 2ZYTX 2KJQA 3AM1A 4PHFA 5JSZB 3T1TA 1DARA 2N1BA 3K0CC 1KOFA 1O87A 2ZJYA 3CM0A 1U0LA 2RGXA 3AF0A 3JVVA 3QG5A 4IW3B 4JBYA 1P6XA 3CNNA 1RFLA 4PHHA 3CKLA 3UANA 3MUFA 4Z1MA 4A2WA 1I4LD 4LRWA 4H1UA 1J8YF 5DH9A 3LVRE 4NH0A 5CDFA 3IBGA 4P3YA 4WBSA 1JPNA 1D2NA 2VHTA 2EFDB 2EYUA 1TPZA 3QXCA 4BLTA 1U0JA 3IBYA 1R5BA 5J4LA 1EFCA 2NPIA 2WICA 1TF7A 2ZYUX 3QY0A 4AWXA 3HU2A 1LF0A 1EFUA 3BC1A 4Q9LA 3OIWA 5G53C 5L3QB 3HWSA 4DCUA 2J0VA 5FOSA 3TMKA 4FINA 4A36A 2BMEA 2A2ZA 3Q72A 4I4LA 3I62A 1ZM2A 3I73A 2QAGA 2B8WA 2WVJA 2NG1A 3EXAA 4CZ2A 1UFQA 4BZXA 2ZS7A 3LW7A 3WNCA 2MSCB 4FWTA 4Q9KA 4QJ3A 2QTFA 4HDOB 4RFSB 2VL7A 3WYGA 1XPRA 1GP2A 4YMUA 1MABB 3DVLA 4G5OA 2F9MA 2REXB 4B3CA 2FPKA 2XNDA 2WIAA 2F1IA 3A6PC 2KE5A 4M1OA 3KXIA 4Q4LA 5IK2A 1Z0DA 3BB4A 4B48A 4RD3A 1IJEA 4TMZA 4ZKEA 4N3NA 1E94E 3PCRB 4KYUA 1NLYA 3LQRA 1GVNB 1ZC3A 5KHOC 1V43A 3ZD6A 4OBEA 4RKFA 2PEYA 1DAFA 3P4XA 2VHUA 1A1VA 3A37A 5FUWA 1R5OA 3U44A 1U9IC 4LV8B 2ZRDA 3L0IB 4HB2A 3ZS8A 2ZRKA 3Q5DA 5BW8A 2QZ4A 1DG3A 4B3GA 2FGKA 5LDDC 1E2GA 2WAXA 5FBRB 2FSGA 5CDFE 5DHFA 1LB1B 1Q1EA 1DEKA 3CBQA 4URZR 4A8JB 4DEYA 3K70D 1M34E 1XJQA 3B5JA 1AK2A 5FI0B 4B75A 3GLFB 3OHMA 2AL7A 1Z06A 2BBTA 2PCJA 4KVAA 3LH5A 4BGDA 4URVR 2H18A 2BMDA 2ZE7A 3W6NA 3C4JA 4TZ6A 2OUKA 2XSZA 5KDLA 3QI2A 2HYIC 3KKNA 2A5YB 2OXCA 1JJVA 1F2TA 1X1RA 3A58B 821PA 2XJ4A 1NBMD 3A36A 3K0FA 4I1SA 1Q3HA 4Q4JB 5GADl 3QKRB 5B30A 2RGNA 5TMPA 4HDQB 2IXEA 3CR8A 4JBWA 4LHWA 2JJ8A 1DAEA 4UNSA 1W4BA 2V8OA 3THWB 4XSHA 1XRJA 4M1YA 3ZVMA 4ASUD 1C9KA 1ZM7A 2ZIAA 3EPHA 1G7SA 4QM6A 2J87A 4PSAA 4FMCB 4IOJA 4AKEA 3BH0A 2ZR7A 3A1UA 4GPTA 5GJCA 2W0SA 1W46A 3U5ZB 4K8OA 3EPLA 2ZEJA 1IAQA 2IC5A 2G1JA 1PZNA 3FMFA 3EPKA 1QHXA 1UBEA 1UDXA 1XPOA 2OFOA 2RGCA 1NL3A 4FI3C 1A2BA 2B8TA 2HV8A 2ONJA 3O8CA 3ADDA 3TVDA 4NKRA 4CW7A 4AKIA 5IF9A 1PJRA 2A7QA 5F98A 2AR7A 3IIMA 5BYJA 3L8ZA 1OE0A 2BEJA 3U61B 2MSDB 3OIUA 4ZPXA 3QF4B 1GWNA 4DLTA 1XEWX 3SE0A 3THYB 4TMXA 2WZQA 3I61A 3I3SR 3QSYA 2WWHA 1SVWA 5BWMA 2CE2X 2HT1A 3E70C 1G41A 1G3QA 3LFUA 2LCFA 4BQSA 4EQ6B 1G18A 2JIZA 1FNNA 3DKPA 2GA8A 1G3UA 2YNMA 3QEJA 4QJ5A 3B1ZA 3ZVNA 2HF8A 3FMIA 4NMMA 4F4JA 4PPGA 4TYQA 2J7KA 2A3RA 4TLAA 2HF9A 4KFTA 2QBYB 3GPLA 3WP1B 4X8LA 4QM7A 4XD7A 4C3ZA 1RYFA 4TL7A 3K70B 1KAOA 1Q20A 1JR6A 3VTKA 3NHAA 5A0FA 4OHZA 1DE0A 2J0SA 4NTZA 2BVNA 3AP3A 3NBYC 4LYFA 3X1XA 2QTHA 4GT1A 2J3EA 1W5SA 4C0QC 4HI0E 1E2PA 5EUQB 3QG1A 2ZVPX 3DDCA 1E2JA 1XTRA 2OE2A 2VBCA 3IEUA 1P7CA 1N6OA 3CPJB 1Z6TA 2GJAA 1N25A 3KJIA 1LS1A 4YMSA 1XPUA 3ECCA 4TTRA 1JB1A 2D74A 4L9WA 4MRNA 2G88A 5GVRA 2ZREA 2QMOA 3OEHD 2ZUDA 2JA1A 2NO7A 3SNHA 1QHIA 2EU8A 1IXRC 4R98A 1F48A 2UVQA 4DT1A 1Q12A 4YMVA 2ZRJA 4MA4A 1E2IA 2L0XA 4TN1A 3QEOA 3H84A 3DOEA 4LPKA 4DVGA 4ZIRB 1AQYA 2XEXA 2YJTD 1XNJA 4G5RA 4KBFA 1RPZA 3IEVA 3W8RA 4O0MA 4EPXA 2VSFA 4I1UA 1W47A 1GSIA 5EE1A 4D26A 5DNYB 5AR1A 2X2FA 4E03A 2WJHA 3ADBA 2PLRA 3TRFA 3QVUA 5FBVB 4BFUA 1DTSA 4E5UA 1QZXA 1Y63A 1TAGA 4GZMA 3QOFA 1SXJC 4OYHA 2VF7A 1VYVA 5JBQA 1KI4A 1VMAA 3HU1A 2OLJA 1JAIA 4JVLA 1XMIA 5DYIA 2W0MA 1UJ2A 2RGGA 4HAXA 1IONA 2N42A 2ATVA 4CT4B 2XOKD 2VQSA 3GLGB 1P61B 1E2DA 2OT3B 3D8BA 4LJ6A 3GFOA 1MOZA 3EIQA 5FTNA 3VR1A 4ZDJA 3A1TA 3MMPA 1Z2AA 4M1TA 3C41J 5B57C 3K0AB 2W6JA 2B6HA 1R10A 5D3MA 3EZFA 4DIEA 3TBKA 3KFXA 1G8FA 3GLIB 4XVRA 1M2OB 2IXGA 3MCAA 4L15A 1FQJA 1G20E 3QQ5A 4DB2A 3K9HA 1W7AA 4NZYA 1VHLA 3THOA 2O8FA 3CO5A 2ZITA 4PSVA 4OHVA 4P4UA 1G7RA 1Z47A 4KO8A 4TT3A 4X8MA 5FTLA 1FW6A 1HA3A 4JYCA 5CK4A 3ZS9A 1G16A 1P3JA 4ZCMA 3A1VA 1Z0IA 1CJTC 4LHYA 1P9NA 4B76A 3F0TA 1E9EA 3BIFA 3KUDA 3ZH9B 421PA 1Q57A 3KKOA 4RSGA 2BKEA 2OXRA 1WRBA 3C5CA 1W0KD 4GI7A 5GJBA 3M4YA 1AZSC 2JLSA 3UXMA 3LWNA 1DVRA 3OFNA 4FN5A 3ZDQA 1FMJA 1G7CA 1DPFA 4YXWD 1XTJA 2WV9A 3HP1A 3KJEA 5BYKA 1ZRHA 1DAGA 3H2YA 2ZRFA 4FWIB 1JQLB 1G4UR 1IOZA 2JJ2A 3TVTA 1VDZA 3L43A 3X2SA 3AVYA 1KK1A 4B47A 1XMVA 3SBDA 4DLSA 4IVPA 4U7DA 3B1XA 5D3QA 2QPOA 1FOEB 2DWQA 4Q66C 4OK5A 4F92B 2OFWA 1M74A 3UMSA 1YZUA 3BXZA 1GL7A 3DEFA 4S2EA 4XVQA 3GP8A 2H7VA 1OHHD 2QNRA 3AKYA 4KVGA 2R2AA 4UJ5A 5F3WB 2O5VA 3ZD7A 2WKRA 1A82A 1OYYA 4TWZA 3T35A 1XCGB 2HEIA 5JFGA 3FDIA 3NTUA 3AVQA 3D6TB 1JXMA 4OI2A 1GOTA 1AS3A 1T8TA 1H65A 2CCKA 1IJFA 4C2UA 5DHAA 2WAYA 2ORWA 1BS1A 1KY3A 2RCNA 1R8SA 4S35A 5C2JB 3LQQA 2CDNA 3WRXC 4DC9A 3Q7QA 4ILEA 1R0ZA 1TF2A 3MWLA 1CTQA 5FUYA 1R0XA 1GTVA 2XGJA 4LY6A 3WMFA 1DBSA 3GJXC 3LDAA 2EVWX 1N6RA 4II7A 5KYKA 5EXSA 4A6PA 2Q3MA 2ZRPA 4ZO4A 4LJ5A 3EC1A 3K1JA 3ASZA 1ZAKA 2GEUA 1Z0JA 5FR2A 1UBGA 2OESA 2PZGA 3MGCA 1A4RA 4AG6A 4FMDB 3RANA 1ZYUA 5JRJA 4KXFB 1ZU5A 1GRRA 4C7OB 3L0SA 4LJ9A 3C14C 1I4TD 5H1YA 3GD7A 2BOVA 1TF5A 1N5KA 3KFVA 5L8VA 2IEYA 4RKEA 2UZIR 4GFDA 2ZUBA 2IHYA 1EGAA 2Q3FA 4QG7A 3B8HA 2RHDA 2O8EA 2FEMA 4TQAA 3RWMB 4KJZA 2VF8A 4ESVA 3U3MA 3SJZA 3FWYA 3K8YA 4HSEA 3FGNA 4GMDA 1ZC4A 4GDFA 1Q3TA 3MAAC 5EE3A 4US2R 5E7IA 4RFVA 2XNDD 2WWGA 2J45A 3LRPA 4JLDA 4D4KA 3P26A 5IK2D 4P4TA 1E69A 3RRNA 3IIJA 1E4VA 3MSXA 2IS1A 2P0EA 2WBLC 4GOKA 1KAGA 1UBFA 2GDJA 5TXGA 2EFHB 2QP9X 2IS4A 3LW8A 3ZZ0A 3K0EA 2RMKA 3DOFA 2J0UB 1R4AA 3IO3A 4L16A 3TQCA 3G0HA 2OO7A 1DO2A 2HYDA 2QPAA 4JIMA 3GLHA 1J70A 4G1UC 2O8DB 2X8AA 4YMTA 4NYIR 1ONBA 2SHKA 2YC2C 2BIFA 3LLMA 5H8WA 2ZUCA 4MUAA 1BKDR 2PEZA 3L8YA 1MRSA 2K5UA 2OEPA
chains in the Genus database with same CATH superfamily
3UK6A 1JVSA 4G5XA 4MA5A 2ZYDA 3AETB 5C32A 4LJAA 2G80A 3ONWA 2D0PB 2EJWA 4KFRA 4WXPA 1O54A 4PPNA 4TTJA 2RH8A 5EIWA 1N5IA 1QCZA 2D1SA 2HMTA 3LDHA 5FL7A 2F43A 2R79A 3HVIA 1DIBA 1VL6A 5CB0A 3EMKA 3WIOA 1UANA 2ZE8A 5CA1A 5ITVA 2Q29A 3CRQA 1CR2A 4QU9A 1LCIA 2I7DA 1OFIA 1V6CA 1AT1A 1WMAA 2A8YA 2FRDA 2PZAA 3W3AA 2PJZA 4WGFA 4IUDS 2C57A 3C7TA 1KJNA 5JV5A 1NVGA 1KEEA 4IF4A 5F77A 1XD9A 2P2ZA 1IN8A 2QV7A 1GT91 2H2GA 4LNAA 3VHXA 4ZI7A 5B58C 3OZVA 4NDZA 1K7CA 4E2YA 5HQTA 1IUOA 4JLAA 2JKYA 1CJUC 1KE2A 1GUAA 3FLAA 1IHXA 1LSSA 4KBYA 4KXMA 4O4JA 3MAJA 4UTOA 1D3AA 3TNYA 3WYBA 5LQDA 5JS6A 2J3LA 1JT2A 1V11A 2H59A 3M82A 2OCXA 3O8QB 2I80A 4L4UA 1MH1A 4XTCS 1TKAA 5REQB 4QEDA 3TOCA 2IPOA 2CDBA 3R41A 1SHKA 4C0WA 5JBIA 2XUFA 4CMBA 5JADA 3KT6A 2BFMA 3DULA 4FS3A 4Y7DA 3E6AA 2NUPB 3ZW7A 3KZVA 3H75A 4L08A 3NORA 3R9WA 4FBMA 3W9YA 3FWPA 2DB3A 4D96A 3A1EA 3TLCA 1P0CA 1QHYA 1BJRE 5EMNA 1KQFA 4G4GA 2C3OA 3EJ6A 1I9GA 4K9DA 4L57A 1QTQA 1TLFA 5AQEA 3WA6A 3P9ZA 4WOCA 2WU1A 4OF4A 2X14A 2UVPA 4CJXA 4H27A 3VR6A 1T2CA 1Z0FA 1PV2A 2PX0A 1OILA 3F5DA 2FLKA 3K8OE 4IQ8A 4B7XA 2VYND 2HLNA 5AKGA 4XFJA 3KT3A 4MOWA 4E5YA 2AZXA 3CB2A 4RY0A 5BUQA 3VFDA 4EI9A 1A69A 3LA6A 5DK6A 3DEAA 4CCAA 3FMPB 4NBUA 3KR0A 4WY2A 1NJ8A 3LC1O 3LPDA 2BKXA 2JDIA 3AYXB 4IHJA 1WSWA 2JCGA 3GAFA 5D7BA 4BVAA 4F06A 2Y4OA 2I2XB 4PN3A 3RS3A 1OD6A 1KI6A 1A8HA 4JT8A 1ZWLA 1LPPA 2MSLA 1VJDA 2BKUA 1B76A 4OHUA 2JLUA 2Q3HA 4MV9A 2FXVA 1RQRA 3I4CA 4OQPA 1OAKA 2NQTA 1ODCA 5CNMA 1T5BA 2PUDA 1MJ5A 4F97A 1P72A 2P9BA 2BE7A 1ISMA 2ORYA 1QQAA 3G89A 1WB9A 4J94A 1ZNXA 4TYNA 1GPYA 1N0HA 1IQPA 2VHQA 3OPYB 2UYOA 3KOUA 4IV8A 3ZLUA 1EEHA 1G1MA 3BREA 3H0EA 4J1TA 4MITA 1S9HA 2QYHA 2HXYA 3C5VA 3JXEA 4V0SA 3PUIA 3OU2A 4U7GA 5CMLA 3WWZA 1GPAA 3QWAA 2X22A 2NYAA 1OIVA 4PVCA 3W06A 2E4YA 5D1HA 5L6MB 1O9GA 1O08A 5I7RA 2VNAA 3I5XA 4NFLA 3S2YA 5CP8A 4YT2A 3HZRA 4UARA 2CEAA 2C5SA 1IN4A 3L0PA 4C22A 1IY9A 2JFOA 3L7DA 2Q6VA 1LVUA 1P44A 2H54A 4B34A 1DCTA 1XTZA 2JJ1D 1O94A 3ABRB 3LTEA 4CLOB 4LQ4A 4CMEC 2XQFA 5F52A 4DDWA 1CZRA 3TZKA 2YN0A 4F91B 2ZIEA 1OC4A 1AE1A 4XDZA 5DX1A 2V03A 1NBAA 2TMKA 2H4HA 3L82B 4MIYA 5CX1A 3WIUA 1GQOA 1RKBA 4RD4A 4BRZA 4JB0A 1BD4A 1UOEA 2K7ZA 4PZLA 5IYZB 1BGVA 3WGNA 3CH6A 1SJ9A 1KZ4A 3DM5A 2Z30A 5CW1A 4TMTA 4F3CA 2OBXA 3BF7A 5DW0A 2RIRA 3BJZA 4JDUA 4BX3A 4GM1A 1PYDA 1EZ1A 4QPZA 4WV3A 2DT5A 2WU3A 1C2YA 1UKVY 2VNKA 4CKCB 1I7NA 1XRNA 5FI3A 5AXBA 4C0LA 1JFVA 1NVVQ 1I36A 4G5QA 4MJ3A 5DM60 1VIVA 4FFBB 4X1YA 1G21E 3PNYA 3X1ZA 3N2KB 4WXHA 2CLFB 5ICEA 2AEFA 4DLAA 1DOHA 1H23A 1OXUA 4BXOB 1NNLA 1PGNA 1SMKA 3ANXA 1GN8A 1PP4A 2C2MA 3HADA 3WBBA 3ME5A 2BGNA 1CUVA 4OXRA 5BQXA 2F62A 3EY9A 1ZM3A 1UDAA 4Q7JB 3RTGA 3R8FA 2FOLA 3NWEA 3RYHA 4Z51A 3DPSA 3CZ9A 4C89A 4XWWA 5CLJA 3G9ZA 1PQWA 1YU9A 1ZQ1A 3QMMA 2W6JD 3PITA 4QUGA 7REQB 2VWQA 4JZKA 3IP8A 2AEMA 4EGCB 3HUEA 4TS4A 5K4AA 4JB2A 1CUCA 4OL9A 2P5UA 2HRBA 3MT7A 3UT6A 1B74A 1J2JA 3C16C 4RZUA 1G38A 1PR9A 3STVA 5IC4A 5FUBA 2AOUB 3RV3A 2EP5A 2W11A 5FORA 2WKSA 4DWWA 4IKEA 3AUSA 2G0AA 3BH7A 3PL5A 2R6JA 1GCAA 3IESA 5EG5A 2EERA 1ZUIA 3EAQA 5AJHA 1AH2A 1BD3A 3O84A 1K92A 2CB0A 2PMEA 2P67A 3KKQA 3OZAA 5AOAA 4YAOA 5CUQA 5JJCA 2I6UA 2VRNA 2DBVO 2RHMA 4FYWA 2QZPA 3SC4A 3AVWA 3EH2A 1XLVA 3SVTA 3OFND 1QKJA 1F06A 3IR6A 2UYHA 4PSKA 1RJWA 4NBTA 3BRWD 1I2AA 2IP4A 3HG7A 2NU8B 3FX2A 2JLZA 1X7GA 2VA9A 3ZCXA 3NI2A 3PQCA 4ZD6A 1XV5A 2TYSB 3CEPB 1RBQA 4FFMA 4YQZA 2ZPUA 1DMSA 4H1TA 2H1VA 1CLEA 1FNBA 2WE8A 5M34A 1TEVA 4KIUA 2V7GA 4UQOA 1Z37A 4PVDA 4R41A 1YIDA 3OE7A 4OMDA 1A9ZA 3Q7EA 3B2EA 2B99A 3DWIA 3RSSA 2FW6A 4ENRA 5HS6A 1RE0A 1WKVA 3JWIA 3EVDA 5A06A 3QMWA 2JK1A 1G2IA 1YDFA 4DLWA 2GX6A 5JRZA 5BWLA 1KI3A 1GM5A 4HS4A 2WF8A 2G9NA 3IAS1 2PGOA 9MHTA 3LGAA 4ZZ3A 1AA9A 3VU8A 4E0BA 2IYYA 5CVDA 4DR2B 1UZAA 4DS3A 3M0EA 4MWGA 1M54A 1X9GA 3RUIA 2OK7A 3W5JA 5AQ1A 1NXWA 3EMDA 5JLJA 2C98A 3AHDA 4J91A 4G5YA 4JC8A 3U4HA 4BCBA 2FQYA 2EQAA 2FUNB 1SHUX 1QGZA 3B2QA 2R6ZA 4WKNA 4PC1A 2O3RA 3R0IA 5BMVA 1GUDA 4WKGA 1R12A 1IK6A 3G5UA 3DOIA 2J5XA 1Z6ZA 4HDRB 2X0NA 3HCRA 4E46A 2TRSB 1HBJA 1KZ7B 3E7PA 3PFWO 5HGXA 1R18A 5E2AA 3M6IA 3HBNA 4P22A 2O8FB 4V0NA 1CUGA 4KFSA 2AUTA 2PO5A 1QF6A 2FPUA 1DT5A 2P2SA 3GN2A 2R8BA 4B6RA 1CC1S 1NF2A 3PNVA 1I9CA 2J08A 4JU9A 4NNOA 1TAQA 5BOVA 4W1PA 3GU3A 4TLDA 3HP7A 4OJMX 4QUAA 1URPA 2FPIA 5DF1A 1HRKA 3L79A 2Y9PB 2D7DA 1T5LA 5EL0A 2C59A 4TMYA 4NXMB 1L0BA 4C4TA 1DIHA 4RZ3A 3I1IA 3QVGA 4MICA 1AUVA 2HK9A 1CNFA 1GKUB 1NVMB 3A4TA 4BKMA 4KQ6A 3ZYCA 5MHTA 1BCRB 2VP2A 3F7NA 4KQGA 3NHSA 2WNHA 1LDNA 2IEIA 2OO3A 3KTDA 3QWIA 1EEXB 1E1KA 1YAHA 2IEAA 5KEIA 1RFGE 4NV1A 1BX1A 2GKGA 5JQGF 5JS8A 1ZH6A 3AC0A 5CURA 1SCJA 2C1ZA 1TTQB 1M2VB 5AKKA 1CY7A 1MO3A 2VPXA 1XTKA 2WOJA 5J4VA 3G79A 4DNPA 3H9EO 3F6RA 1AKMA 4IXTA 4D74A 4HGPA 1FFXA 2PNJA 5DM4A 3UKOA 3THXA 1AKUA 2I2CA 3KQVA 2O2ZA 1C9EA 3NG1A 4IQGA 4UVHA 3FZEA 2EW8A 1XZAA 1YNOA 2HN9A 2UZ1B 3Q8XB 4QICA 5AKLA 4Q7QA 4KREA 4EI7A 2YBDA 2YR0A 1KDVA 2WMNB 3P0EA 1JEYB 5GP1A 1KYQA 4YFYA 3S5JA 3V2UA 4FGJA 4ZI2A 4KQKA 4MI9A 3W2FA 1NUPA 2QM7A 3FKJA 3C43A 3TQIA 3W5HA 5CPFA 3ZGYA 1COWD 4QL3A 4ZYWA 3AT1A 2A59A 1T91A 5JZOA 4UASA 1YI1A 3D4PA 1VL5A 2ZDHA 1ST2A 5BV1A 1WS6A 1MW9X 3LPCA 2VAPA 3TFQA 4ARCA 2Z5GA 3AJDA 4UJ3A 5F21A 5AVKA 2XB4A 1SU6A 4IXNA 3VNSA 2GS9A 4CKYA 4HB3A 4L02A 1KERA 5AM2A 3HCEA 2J32A 4B3RB 3QVSA 1BXGA 2Q9CA 4OSEA 2R1VA 4BMPB 1RP7A 2FP4A 2IEZA 2QMQA 2NAFA 3HKBA 3JWJA 3U39A 4JP5A 4TRMA 2OCIA 3UOWA 5IZ4A 2ZRQA 2L42A 4JLNA 3SBOA 2PFKA 4GWKA 1Y4SA 3P9IA 1AC5A 5AK6A 2V7QA 1F6BA 5IW8A 2GXUA 3I2FA 4P86A 4CKZA 4CLEA 1HE8B 1VJ1A 4R2MA 4FZ3A 4U7HA 4S24A 3I2IA 2GJ9A 3B6ZA 4DSUA 1WW2A 3BB3A 5C4GB 3FMOB 3W4JA 1Y37A 4MROA 5J9FA 2XCIA 2VF2A 4RJJA 3SWWA 1YFJA 3G2HA 2JLAA 1VSBA 5GZ6A 4HJRA 2UV8A 3U3OA 2PSDA 4RXTA 2XDAA 1U1FA 2OL4A 3AILA 3K9NA 3OT4A 3HM9A 2WPDD 5EMMA 4MVWA 3T4XA 4XPIA 5I4CA 4JHLA 2PKRA 1T8PA 1Z5WA 4OK3A 2Q1YA 5T4HA 3UK2A 2C2WA 2N47A 4CGYA 4OMFG 3EBPA 3PGVA 1E6LA 1TCCA 2QM0A 3N0VA 2OPBA 3WWOA 1OI2A 3M6FA 4OBWA 1K6IA 4HN4B 3PVSA 3V97A 4V0OA 4A0QA 5B37A 2OHGA 1RXUA 3TG8A 2ZXUA 1M1YA 5A5EA 4RJLA 1A5TA 3L1KA 3VNUA 1I32A 3W3AH 1R6BX 4ZRMA 5FL3A 1NIPA 5AJWA 2GUWA 1M1ZA 3HWWA 4DVJA 5KX5B 3IVAA 2QIPA 3IQFA 2PR2A 2DH5A 3H87A 4MRVA 5IM5A 3Q5GA 3CN7A 1KAEA 1OTHA 4B43A 2WOOA 2GARA 4YLYA 4G3XA 1YH3A 4KQFA 1C1XB 1J5EB 3DTVA 2JFZA 1ADBA 1E20A 2P2DA 1A9QA 5A3SA 3GPDG 4NBLA 4DJEC 2K4MA 4R69A 2FX5A 4RCVA 1SBNE 3V1YA 4E30A 4C0SA 1CDDA 1UDRA 4M8IA 4MR7B 4P83A 4REMA 4AURA 4IYRA 3HR4A 4MRMB 1OH6A 1MGPA 1PBNA 1ZD4A 3KOWA 2FU5C 1TQ6A 2ROQA 1GILA 3ND9A 4OAQA 3MVEA 4EHIA 1A7AA 1M67A 4CL2A 3T1OA 1ZD2P 3K71B 4QXPA 4N48A 3EDYA 3U17A 3KSBC 1HDCA 1SXJB 4RK7A 5H02A 2PZFA 4D4HA 1V25A 5I9MA 2GZSA 2JL1A 3ISJA 1YGYA 1Q0UA 2AFHE 4OL0A 1XVTA 5H4GA 3LVQE 3CEHA 1BMQA 3NUQA 3QMPA 1M2KA 3QBEA 3TSWA 3WKAA 4FGKA 4BNJA 1GD1O 3E2PA 4PZCA 4W5JA 4DLYA 2XJ9A 3RS7A 4Y1FA 2OCGA 5CAEA 3F7MA 3T12A 1QLJA 2F1HA 1TUBA 1XIVA 2A6PA 2H51A 3O3NB 3E27A 1BOOA 4YCJA 1K5GA 3VR6H 3HA5A 2LP4Y 4AD8A 1IATA 1CUHA 4LX0A 3WGGA 4ZT6A 4RVNA 4KXNA 1T6YA 3AF6A 4O2AF 4UXJA 1LA2A 3OD1A 1XCLA 4BUJA 4CYMA 1EXWA 3ZHQA 2JIMA 3M3PA 4K46A 3PJDA 4MHSA 3SI7A 2C7OA 4TKMA 4PGGA 3R76A 2YMPA 1XZKA 1GXSA 1K6MA 1MFPA 1QGOA 1XYGA 4P53A 4Q82A 3O8OB 2C2XA 2C2BA 1GIAA 2AG6A 1A5SB 4AZVA 4PFSA 2MINB 2RHLA 4HEA1 3ZHCA 2X0IA 1X1BA 3ZE8A 1L8OA 4LVNA 1J9GA 1U3GA 1DBPA 4H6PA 2DXIA 5ER9A 2V1XA 4FXPA 4HJXA 4ND8A 4O2LA 2X7JA 1YD7A 4CNBA 3H65A 1YA8A 4H59A 1NXVA 1SUSA 3PGXA 5EHXA 3VSCA 4J0GA 2F55A 2V3VA 3SJBA 1YS1X 4G0WA 3S68A 5EGSA 2A9RA 4DCJA 5HKBA 5K99A 3FUCA 4M4SA 1E4OA 4BFLA 1KYIA 3HCFA 4UQLA 3PXEA 1YOVB 5ALXA 4QEKA 3PFHA 4AVYA 3HACA 3TFWA 1KETA 4E12A 5A3JA 3JATB 3QOWA 1R2QA 3OOHA 1S01A 2OG2A 3OPMA 5DULA 4CMKA 2ZWOA 1N2ZA 4INZA 4OI1A 4D3FA 1Z45A 5EYPB 4CM7A 1FJHA 1NW3A 4LDRA 3EXG2 1QO0A 4QQNA 2IUUA 3MS2A 3TZEA 3TQFA 4GZ6A 3U1TA 4XX0B 4X8OA 1NI4A 4K2AA 2B1IA 4LOLA 1PFGA 4K9KA 4J1NA 3NTRA 4LY0A 1ZIPA 4S1NA 4OQXA 1I7DA 1PEDA 4GWGA 3PCXA 3C7DB 1QC5A 2DHQA 2NLOA 3N70A 5JIBA 1Y1RA 3CVUA 3VNRA 2F48A 1XMJA 2XKAA 3G6KA 4G8DA 5AICA 3KEFA 2OFXA 5LIPA 3ZXUB 2UUCB 2OZKA 5DIFA 4FGZA 2E4AA 1RQ2A 1BROA 5TPWA 1OBCA 4P5PA 4EG8A 5H9WA 1EUYA 5K0GA 3AF4A 3EXIA 3JWHA 3LXRA 4EAAA 4QOIA 3ITNA 1EHYA 1U9JA 2AJDA 4M37A 4OB8A 4J1TC 4GI5A 5TQ2A 1Y5MA 5FOWA 1OC2A 4KHPB 3I4FA 2XYPA 3EEOA 2C42A 4GPD1 3H17A 3GRPA 3JX9A 3OIVA 1BVHA 1BTOA 2E4XA 5DMXA 5A5GA 2X1VA 4LCEA 1B00A 3WGMA 4E1BA 5TQ0A 2ZCUA 2DCUA 3SEAA 5FAKA 5FCDA 1PVOA 1JR4A 1BXRA 5JZBA 1CJVC 3FZNA 3GJQA 4GYYA 4II2A 2IYTA 4MJXA 3RJ5A 2Z04A 4OXNA 5KWEA 3TSAA 4S1PA 5EHQA 3CBGA 3QXJA 1COZA 4Q7KA 2CNOA 4CTOA 4TPKA 3PFGA 4IGAA 4AP5A 2C82A 5KNDA 1MMFB 1JLKA 2VUUA 4RZSA 5EKDA 3IUJA 5JPCA 4HYTA 1K8RA 2IDJA 2JZOA 1F4LA 4AX4A 4KLZA 1W0CA 2AD1A 1OKKD 1M2JA 4J7AA 3TIIA 4YDSA 4UMEA 1NXQA 2GLUA 3R9XA 4JLBA 3AHGA 4RY2A 4E14A 3EQ7A 1EQAA 1HE4A 2AG5A 2BHRA 2R4QA 2PPLA 4WCFA 5ESWA 3C6KA 2PT9A 3HDTA 3OTQA 4KU4A 1OBHA 5AK0A 1C0EA 5K0ZA 1E2UA 2P75A 5DM2A 3ZCVA 3EZGA 3V1UA 4D79A 2W2TA 1ZM4A 1WHTA 1KK2A 2G9VA 2FPOA 2R96A 1I5OA 3UHAA 3ND6A 5ALSA 2FPLA 1NXXA 2GZMA 3OQOA 1I4EB 2CVFA 4D9HA 2WDZA 3ZWQA 1FLVA 5K03A 3T7KA 1BVUA 1PYGA 3HLKA 3PGA1 4DCMA 4N5LA 1DQZA 4Y6QA 2WFLA 4CQMB 2JLYA 1MEEA 3PXBA 2ZJ8A 2DQKA 3IQDB 3SYMA 4F3KA 2R8ZA 1ZXBA 3JWPA 1MXFA 1ZH2A 1RPJA 3ADPA 3KB1A 2HQ1A 3AMVA 1XX6A 3VTAA 5CFPA 3BILA 1P5RA 2CWWA 2I65A 2IGTA 4RHUA 3E2IA 1FYEA 1X14A 4ZEVA 2GYUA 1QVAA 5AI4A 4Z99A 4OP3A 5AI5A 4BVLA 1WO8A 1XVVA 5JYCA 3VPDA 2YINC 4UUQA 3ONEA 4C0XA 3KL4A 1J6UA 3FOWA 3PFNA 3X1WA 1SC9A 2Q6LA 4GOOD 1O77A 3D1JA 1WZUA 1JBQA 4IS3A 3G2NA 3RBVA 2ZBQA 4KR0A 3HGMA 1EP2B 3DDWA 2FZ4A 2R1ZA 2CF5A 4H0FA 4UEWA 3WGKA 1H22A 2P35A 1JE0A 3E9MA 4GL2A 3WIEA 4F7WA 3OJWA 4H18A 3SFZA 2O2EA 4KG7A 2F3TA 3LU1A 3BBLA 1F4VA 1W34A 1Z34A 2PMFA 2ECKA 2W6IA 4JUFA 1ND5A 3OIDA 2O48X 2OYRA 2YUIA 1Z39A 3VI3B 3M5CA 4JI3B 5AJZA 2Z4SA 2XNSA 2NO4A 3CLSC 4UBOA 4NEGA 4F8YA 3ZI4A 3M3HA 1MZVA 1E32A 1P74A 1TTPB 3MEQA 4ME6A 2VJNA 4LTDA 4P4SB 1KI8A 2D5BA 1P60A 4HNAA 5DK4A 1W4AA 1BG6A 3H8SA 4CUZA 5K3OA 3IOMA 3NMUF 3S5UA 1XBTA 5LWQA 4ZVTA 1JL3A 1VCOA 4M83A 4X1IB 3ES9A 2P90A 4EVQA 1Y5RA 4X93A 4CG0A 2BM8A 1JG7A 1TA4A 3B1KA 3V2GA 2BW0A 3W5UA 3QUSA 3VZCA 1F14A 1QK5A 1C50A 4F4CA 1E64A 5JH7B 3KXKA 3FHCB 4HY3A 3H5LA 4H4DA 3ULKA 3EEYA 1YE8A 3V6MA 2PSEA 2TSYB 1XA3A 4BV2A 5KINB 3NHZA 3INNA 1THTA 2HTEA 4R9UC 4J90A 1WCWA 1ZW6A 4LX8A 3T7RA 1D5CA 5JJBA 3M1AA 3SIXA 1X38A 4WSOA 4ZQBA 3OFVA 2GPTA 4QXQA 3BL5A 3IJRA 4QOGA 4MKFA 1JDBB 3BIXA 4RCZA 5EHGA 4QYTA 2JGKA 3AEKB 3ANNA 3AUFA 4MUXA 4NAUA 4PSUA 4DCVA 1P5JA 5IHXA 2QTVB 5K6TA 5CXSA 1QZZA 3EPRA 4ARSA 4URYR 5LZ9A 1J0EA 1YIAA 2YKGA 3T5BA 3LF1A 1SCDA 1P8JA 1VFPA 3B82A 1JTFA 1XRRA 4OX9Y 1NR7A 1QRAA 5EKUA 1WX1A 1TZJA 2XAUA 5FNZA 4QBTA 3AR2A 3IEKA 3PFKA 3X1KA 2BFEB 2XOXA 1KAQA 1DC7A 1QDUA 3KWLA 3DGFC 2X4LA 4K3VA 4DA7A 2QY9A 2PY6A 1JRLA 1TQHA 1FJGB 1DXQA 2BP7B 1HXHA 2VZ8A 4FYIA 1NZFA 5BN1A 1MU0A 1L4LA 1WVIA 2PNFA 4OJNA 2ZI5A 3KM0A 2DFTA 3TOSA 3DL0A 2O5EA 5KKNB 4E3WA 2PKYX 4OGWA 1UPUA 1E4YA 3I0ZA 2VP3A 3IJEB 4OUDA 4PTZA 2OXFA 4YJHA 2VHWA 5DNVA 1H6AA 1US8A 3CLRC 4IHAA 3EVAA 3GNLA 2QJOA 3S1AB 4I36A 3U31A 3FNBA 5EFZA 3ZBQA 1ULBA 2YV5A 5L4NA 2CLKB 3OCXA 5LKAA 4PQFA 1E79D 1LJLA 3F4KA 1BVYF 4FI3F 1QS0B 5FNVF 2HXSA 5HZKA 2GB4A 4HLUA 4X91A 2YXDA 4LYDA 2IZ0A 2YJGA 1K8ZB 2JBAA 3FVVA 3O1LA 5COQA 5F1YA 1TYDE 3M5PA 4ZO9A 3BGOS 4ZCIA 1TNDA 4NICA 3UWSA 2AK3A 2YY5A 1AMNA 5LM3A 1IUNA 1RLUA 2C9YA 4E5SA 2EKLA 1GG2A 2QT1A 1QCCA 2Y71A 1KVUA 1R74A 1WBBA 4XWAA 3GCXA 4EI8A 4LC0A 4DR5B 3C8HA 3QE3A 2PGDA 3F5QA 4BMDA 1CIJA 3WQBA 2ETVA 2AI3A 1ZLXA 1PLLA 3CLTD 2Z8XA 2C97A 2GK4A 3DPUA 3ENKA 2JFPA 3DT6A 2A58A 3H1TA 1U8YA 1U94A 2DFPA 3I42A 4Y6GB 4D25A 4L27A 1CEEA 5JDIA 1GU1A 2J30A 3UKJA 3CUKA 4N1AA 3VR4D 1V2GA 2YHIA 3C8MA 4RAQA 2HD4A 3INYA 1D8AA 1TA9A 3LMKA 1NNI1 3Q3JB 3KDSE 1IU9A 3NDBB 2FK8A 2YN2A 4ERXA 2X0RA 2VDMB 2ZK7A 2AA3A 4PAWA 1ODTC 1IG3A 3HWRA 4M1WA 5JQGA 1XT6A 5KZMB 3D3WB 2P1RA 3EF1A 3AF5A 1E99A 4JAVC 1G98A 3V7UA 1JI3A 4ZDKA 4EVIA 3LKDA 3RABA 3U3ZA 1DO8A 1H8EA 4LYJA 2OVBA 1FBNA 4K5QA 5K0FA 3BA6A 3DL2A 4LI3X 3QPUA 2VXBA 2VDKB 5BP7A 1SHLA 1PX2A 1QPGA 4UCWA 5DNEA 4Q34A 1GTJ1 2HV9A 1L5KA 1C0KA 3IVMA 5FFNA 3KTAB 4IO0A 5LP6B 3X2EA 3WRVA 1E3JA 1P2UA 4EQ6B 3SEFA 3R0JA 2PK3A 3R23A 1FBTA 4HDCA 3IKJA 3PQ3A 2Z08A 1QGAA 2ZU6A 2DPLA 4G0YA 5LPNA 2CMGA 1C9NA 3NGMA 2X0DA 4OH1A 1JSZA 3ISTA 3STXA 3U26A 5DP2A 4OK6A 2K2QB 4OREX 2XMDA 3RLIA 1W44A 1XUOA 1D2MA 2GBPA 4TV9F 1C14A 3DOJA 4IP0A 4TV8F 3MWJA 4Y9UA 4ALIA 3HXQA 2PN1A 1J42A 4LZJA 1J1IA 1MIHA 4MUJA 4OHCA 4JI6B 4C08A 1D2CA 3GJSA 2ZUTA 1U8XX 1B6GA 4ECAA 1GNRA 5DI9A 4KC0A 2ZWPA 3FJYA 1JDJA 1WZIA 4C7BA 4CQNA 2GRJA 1HTBA 3DW1X 2SNIE 4MVCA 4TS9A 3GZTB 2GZRA 2WZDA 3ZIAA 2R8YA 3OEEA 2WMDA 3A4MA 2P5SA 3ILYA 4PQYA 1FFAA 1OFUX 3WKBA 4FEAA 3OQMA 1J0XO 1YS9A 1CEQA 4PYLA 4DJ5X 4DLVA 5DN9A 2O19A 3UG7A 4WAUA 3LLCA 1HE3A 2A94A 4HMQA 1Q17A 3SHOA 1RZ3A 2NT3A 2OHIA 3A8TA 5AYVA 4DB4A 2QR3A 3ZWAA 2WU0A 3OTWA 2P6UA 1NGSA 1VA4A 4IWNA 5F35A 3V8MA 4BFVA 1U7WA 1HURA 3MCZA 2QXYA 3CVWA 2Q1TA 1QMGA 1I51A 3MYYA 4RLHA 4BLOA 1R66A 3F6SA 3W4KA 3N8NA 4KGVA 4XJXA 3EEQA 3GCDA 1TQ2A 4JUDX 2GJ8A 2YFKA 4KSCA 4DJDC 1C3OB 1U02A 5BNIA 5IKOA 4U2FA 3PPYA 3WZ2A 1JN0A 1KOGA 2A5LA 1RBYA 3CVXA 3BERA 2AMFA 2NNLD 3D6HA 2PS1A 2YW2A 4Z0HO 1WPGA 3UGJA 2I7VA 1EDDA 1M7GA 2A5FA 1KBQA 1EUQA 4QECA 3ZJYA 2O2HA 1G4HA 3G8CA 3PWTA 3FTDA 4Q03A 3VX4A 4NJEB 2IYRA 1T1IA 4O6VA 1EK0A 3QYPA 4HC4A 1XP8A 4X62B 1T8WA 3K9CA 1RC8A 4N9WA 3Q3GE 3PWSA 2F90A 4P2BA 1H94A 2QQ0A 2VN8A 2OQ2A 2ZJ2A 4CMAA 4YRSA 4UU1A 2VT2A 4PLWA 4JP8A 4HTFB 3VHRA 4AG5A 4IEIA 2ZE5A 4AP9A 5FV4A 1GPNA 4TWAA 1JX6A 1F51E 3EDQA 1KJZA 5B3KA 1ODKA 2FZWA 3WKDA 4B35A 1EXDA 4G81A 2GSDA 3RYCA 2FMUA 4IZIA 3UVEA 1WKCA 2YWEA 1X86B 2OGWA 3G9TA 3WKCA 3VYVA 4AT1A 1BXZA 1P9LA 2IVFA 4C6TB 4EAQA 1N5LA 3AEZA 4PPFA 4CNQA 2H2WA 3VU0A 4MPPA 7GPBA 4ZFNA 1ZIDA 5CJ2A 4EA6A 4TZKA 2FGJA 2C4WA 2WU4A 3QPAA 1RVV1 1MCZA 4QAJA 5G0TA 2BJWA 1AKTA 1T9DA 2J46A 4TLEA 1V8PA 5L7TA 1GZDA 1YUNA 3DHNA 3SZGA 4Z8XA 1JFFB 5JY6A 2EZ9A 4MIOA 2YY6A 2XCOA 1NNSA 2H2DA 5CLGA 3T99A 1AO3A 5TEWA 3VR3A 1AGPA 3ZHYA 1YR6A 3ET4A 2ZCJA 3OLWA 4RIFA 3T9DA 4PFKA 4O2AA 3QKSA 1G6OA 4OBBA 2RHHA 4BASA 5KOHB 1II8B 1DAOA 2II6A 2HX1A 4JLVA 5G2OA 3LUBA 3H5NA 2P4HX 1SKBA 2P30A 5HGJA 3UMJA 4D5GA 5C7IO 3AZOA 3FWZA 5MFZA 2EZUA 2FAXA 3IJ5A 3DXFA 1T4CA 4JMPA 5TC4A 1A7UA 1M6YA 5I7SA 3GGPA 1AY0A 2QRLA 3UUFA 2HCRA 4FYVA 2FRVA 3DBHA 2E5LB 4MH0R 2PKEA 1PZEA 2JI9A 3IHWA 5K3EA 1X77A 2FFRA 4E5VA 3KPUA 2HA3A 4PSCA 1NFFA 3PVCA 2ONKA 4D92A 1PU2A 4LBVA 3T41A 3ROXA 4CV0A 1XFAA 2GBLC 3FUXA 5K5EA 3VKGA 4W1RA 2HIHA 4Z3DA 2I2AA 4QGSA 1TAUA 1KRWA 2FWBA 4URXR 2MJLA 3MGBA 1NNUA 3KB2A 4J7CA 3SVZA 2JASA 3LHKA 2XVZA 3K1AA 4HUQA 3RTEA 5FUMA 2D1TA 3MWDA 3B12A 1PJ2A 4PLTA 2UU9B 3KDPA 1V6SA 1Q1NA 5HA5A 4M1MA 1HOXA 3BSWA 5K0EA 4MULA 4EY4A 3DMTC 4UFOA 2QTCA 2HF2A 3JWEA 1DLJA 3EIXA 3HHEA 4AZTA 5AW5A 4O2RA 3SLGA 3D64A 3OZ7A 4WXEA 1QHSA 1R0BA 1WEHA 3I58A 4V03A 1MHPA 5L45A 1QE0A 1I3KA 4GL4A 3AJEA 4IDDA 1U0GA 3PE4A 1J2TA 1D9ZA 2PS9A 1GSAA 2HXGA 2IHJA 2IOFA 4PPYA 4O4IB 5GONB 4BP9A 2OYCA 2ZOSA 2YVQA 3G13A 2AX4A 3CU5A 1PUJA 4H9GA 1P2VA 1JEQB 2H2FA 3AY0A 4JBNA 2CNNA 3NATA 4KQXA 4S1WA 1QYVA 3HVJA 4UNRA 2WQ6A 1HK7A 4CFYA 1P1HA 3UF0A 4Z49A 3NS7A 1MTOA 4FNMA 4YRIA 2FFJA 1QKKA 4LFCB 3HTXA 4LHSA 1NC1A 3H0CA 5BXQC 5FOXA 3UK7A 1WW3A 4ARZB 1LEHA 2QSZA 4X45A 1PI3A 3NT4A 4W1SA 2R8OA 3HLTA 2AFHA 2DUMA 3WMGA 2VP9A 3IAFA 1GU0A 2YWXA 1XD2B 4DYDA 1KO7A 3R7AA 3N7AA 1ZHOA 2P0YA 1BEEA 3IXLA 2VJMA 3MGKA 4LRXA 4PBSA 4X61A 1E89A 7ADHA 3E5NA 2P2CA 4MGYR 1RWBA 3PZBA 4AO6A 2YS6A 3IPRA 2CNBA 2ZVQX 1C5KA 1E58A 1TJ3A 4WCFC 1IQUA 2Q4EA 1P7ZA 4P33A 4PX9A 3A6DA 3KT8A 4RACA 5A71A 1EK2A 2R47A 1H0KA 1M1XB 3BUSA 3RUEA 3R77A 2PSHA 1UODA 3IURA 4RXMA 1IULA 1KSFX 1U2EA 3N2NA 3DZDA 2ZJ4A 4BNGA 1ECJA 5A5FA 2M1ZA 2VFAA 3CTPA 4RV9A 4NJMA 4Y2QA 1WP9A 2KPOA 1Y80A 5KNCD 1EM8A 1U3UA 1T2VA 1Z12A 3GXBA 3JD0A 3K94A 4XQCA 1NN3A 3TAXA 3EWNA 3VU9A 2ZQ5A 1Q14A 3IP5A 2VSQA 3LBFA 3NANA 3B85A 4G1EB 4P3OA 3GJ0A 1YFLA 4JKIA 1Z2PX 2VSOA 3AFIA 3HU3A 2DR0A 4L5AA 5CHYA 3REQA 3HC7A 1ZU4A 3LV8A 3Q1KA 1AS2A 3SKVA 2WUWE 1U0BB 3IYLW 1H66A 1XJ0A 1O0SA 2D4AA 1FPQA 3A4NA 3L7OA 3O8NA 3O0DA 4L0MA 4Q24A 4EFNA 1LD3A 1XZPA 4CT5A 2VAXA 1PAUA 8OHMA 3WNZA 2FVYA 4ZV9A 4A8PA 4D0NA 2D8MA 2JGNA 3IBTA 3IUQA 2NU9B 4CV1A 4EG4A 1E0KA 1X2EA 3NEPX 4J6FA 1N2CA 1T9HA 2AVDA 4YVFA 4AP6A 2AN1A 4RTPA 2XCRB 3CUWA 3GPCA 4UHKA 4WNAA 2XE6A 1YSCA 3CX7A 3KPYA 5J59A 4CTMA 5A0VA 1JAZA 1Z3CA 3GJ4A 2XNKA 3QELB 5J58A 3ZX5A 4ALKA 2B6NA 4FCCA 3OE4A 3ZDDA 1B26A 1I5EA 1DQRA 2P62A 4JJEA 3LXUX 3BOSA 4D45A 1RRFA 3DXXA 4MRPA 1QGUB 1M2HA 4JCCA 3N2ZB 4K6FA 3R7WA 3V7FA 3KTFA 4YRAA 1SZCA 3OFKA 1X39A 2AFIA 1WUJS 2JJ1A 2GHIA 5DGCA 2PA3A 5I4IA 5JXGA 3MTAA 3Q7SA 4EM6A 4ER5A 1ZUD1 4C2TA 2I4LA 5CJPA 1KY2A 2HDWA 3KXDA 4N76A 2Y77A 3R9IA 1RRKA 3DBLB 5MN4A 1UPCA 5L3QA 1N2EA 1O7JA 3CCCA 3P20A 3V7NA 3ESYA 3ZGLA 2Z6QA 2FN8A 1U2SA 3IUNA 5CPBA 1AOXA 1OLUA 4ZO7A 2FXIA 3DKIA 4D82A 2QP4A 1MO2A 1QX3A 4AG3A 3FGZA 4MMZB 3L6BA 4RTNA 1EFTA 3DZ8A 2JLVA 1Y42X 3EZ9A 4ZC8A 1WDKA 3IIKA 3R09A 3RU7A 1BZYA 1YWGO 3JQ9A 4X63A 2D13A 1CQIA 2LNDA 3EASA 3K2BA 3P1JA 1RADA 1XDSA 1YR3A 1A50B 2WF7A 5DNWA 3U7QA 4F2DA 3W5BA 4ZYLA 4B3SB 2WLTA 1U7ZA 2XXJA 3NHYA 1LV7A 1M0TA 1DAHA 2ODBA 2WMOB 3K35A 5T41A 5EZ6B 3V9PA 1XCJA 1LWNA 2FUCA 1OWMA 1NHGA 2V58A 2OV2A 1TEXA 1UOOA 4RHXA 5FJIA 3R7SA 3QJYA 4UDOA 1JZTA 1VBNA 2AJ8A 4LSGA 5DCUA 3V2IA 3WO1A 5JAIA 2I3AA 2C3UA 2HGSA 1KXJA 3SY8A 4MDFA 3SOPA 2J3HA 1GR0A 3NUZA 3R4CA 5ALQA 1ORVA 5KCMA 1J09A 4HDNB 3LCCA 3AR7A 1U0NA 5E8RA 2Q6IA 4G2TA 1EWRA 3PC7A 4GGPA 3P9YA 4HWTA 3DAYA 1OLSB 2WHQA 4V1CB 4QLBA 1JJFA 5ITZA 1JQJC 1U98A 3F67A 3NIGB 4L9SA 5C81A 2W2QA 3P9PA 4P92A 4W9NC 3O8LA 5CVEA 4OXQA 1SVNA 2KYRA 2EKZA 4U3JB 5DN6D 1K89A