2NYRA

Crystal structure of human sirtuin homolog 5 in complex with suramin
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
259
Chain Sequence
PSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTERFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase sirtuin-5
publication title Structural basis of inhibition of the human NAD+-dependent deacetylase SIRT5 by suramin.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 259
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 2nyrA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2nyrA01
4Y6QA 4QELA 4QPZA 2JI7A 5FEMA 5EJ4A 3GLUA 2QQFA 4JT9A 1OZFA 4GP9A 2NXWA 4FVTA 1PNOA 4BV2A 5IMSA 2EZ8A 1SZDA 5BWNA 4KXQA 2EZTA 2FN3A 4Y6LA 4IF6A 1Q17A 4TWJA 2VBFA 3CF4G 4JUBA 2Q28A 4Q9DA 3U3DA 1YHZA 2JI9A 2W93A 4MQ5A 2H4JA 4JU9A 4GG1A 3ZGOA 5EJ9A 1POWA 4F56A 4ZZIA 2JLCA 1Q14A 1MCZA 4UUAA 4R8MA 2IHTA 4K9MA 1YTLA 4GM1A 4K9KA 5K6RA 2FSVC 3FZNA 4KPUA 4BVHA 2H2HA 1T9AA 3FLMA 2DJIA 1M2JA 1YHYA 5BWLA 2FRDC 2OD7A 2Q27A 2OD2A 4UTZA 4JUAA 4L3OA 1PTJC 4JSRA 2WVGA 2Q29A 4J16C 2VK4A 4K9PA 4I5IA 1YNOA 4RJJA 3CLSD 4MPPA 3PDHA 1V5EA 1YC2A 3OE1A 2H2DA 2FR8C 5MFPA 4L2IA 2EZUA 4K9QA 3IAEA 1UPAA 1E3TA 3JR3A 2UZ1A 1V5GA 2PGNA 4UTRA 1OZHA 1DJLA 3D4BA 3F6BX 3HWX1 2H2IA 2Q5LA 2VK1A 3D7KA 4V1CA 5DGDA 3RIGA 1MA3A 1PVDA 1O97D 5DEIA 2H2GA 1HZZC 3CLRD 4JD5A 3ZGVA 1Y9DA 2WVHA 2VBIA 4FEGA 1D4OA 4KGDA 2EZ9A 4JUDX 1O96B 4QQ8A 2BRUC 1NM5C 1U2DC 3E9YA 2NYRA 1T9CA 4BV3A 1OZGA 2JIBA 1Z8NA 3GLSA 2H4HA 4X3PA 1S7GA 4K9OA 2C31A 4FZ3A 2H4FA 4O8ZA 2Q5JA 4JT8A 3GLRA 4UTVA 2H2FA 4C78A 2VK8A 2X7JA 2HJHA 3GLTA 2PGOA 4K9NA 4IAOA 4JUCA 2A1UA 4RMHA 1PT9A 4UU7A 1M2HA 1BFDA 1Q1AA 2UZ1B 4GPEA 5EJ6A 1Q6ZA 1M2GA 3EYAA 5EJMA 4BUZA 4UU8A 5MGNA 4IG9A 4K9LA 4BVFA 1XLTC 3EY9A 3RIYA 4BN5A 3IAFA 4V1CB 2JI6A 3LQ1A 3CLUD 4RMGA 4BVGA 3ZG6A 5BWOA 2IHVA 1UPCA 4D5GA 4RJKA 1ZPDA 3U31A 1T9BA 2JI8A 5D7NA 1SZCA 1YC5A 1PO7A 3F6EX 2EZ4A 4F4UA 4BVEA 4J1TC 3K35A 1M2KA 1U2GC 5K6TA 4JU8A 2VBGA 2IHUA 4X3OA 1PYDA 2VJYA 3EA4A 5EJAA 1EFPA 4COKA 4V1CI 1N0HA 1EFVA 5DGTA 2OD9A 4Y6OA 1U28C 2AG1A 4TWIA 2QQGA 2FWNA 1YI1A 5K2OA 5K3SA 1PNQA 4GM0A 4MPJA 4MZXA 2Q5QA 1OVMA 4FEEA 2V3WA 2OORC 4BVBA 4C7BA 1YBHA 4GM4A 3HWWA 1V5FA 2A1TR 3PKIA 4UUBA 4RMIA 2B4YA 2H59A 1UPBA 5EJ8A 1U31A 4UTXA 2PANA 2OO5C 5EJ7A 2AG0A 2Q5OA 1S5PA 3JWPA 4D5EA 3FSJX 1M2NA 1POXA 4RMJA 1T9DA 3D81A 4RJIA 2WVAA 4MPRA 4BN4A 4JUFA 5MFZA 1PI3A 1J8FA 3CLTD 4HDAA 5FYQA 4UTNA 1JSCA 4HD8A 2JLAA 5AHKA 1ICIA 4G1CA 4ZP1A 1QPBA 5EJ5A 3PKJA 1YI0A 5MF6A
chains in the Genus database with same CATH superfamily
4GXRA 4YAJA 4ZAYA 4L5JA 5DBFA 4HX5A 4RQAA 3UZUA 4ZHQB 4NYJQ 3U61B 2UAGA 4ND6A 1QHNA 2ZQYA 2VSQA 4F5EA 1NTOA 3RBAA 2Y66A 5M29A 1Q83A 1PG0A 4PLGA 3ZBPA 1YB5A 4HNGA 1XQXA 4L07A 1BDHA 4IY1A 3DVAB 5FWAA 3X1KA 2ZWOA 3E22B 1KYIA 1HDOA 1CIVA 3AQ4A 4JBHA 1W0KA 4KO8A 4LJLA 3S2GA 3T7SA 1MOSA 1PSWA 2G3YA 2HJ9A 5AXCA 4UEJA 4Q01A 3SIRA 2JGAA 1ZFNA 2REOA 1VYUA 2FQWA 5B3JC 5IT4A 1J1UA 5HG0A 3TDMA 3PHHA 4PCAA 5FI0B 4J1SA 3EGWA 4MP3A 2AFIA 3CKYA 3KR0A 5C8ZA 2G40A 4LC1A 1GYQA 1J33A 4PCUA 3K92A 3HVUA 5FI5A 3V34A 4Z49A 2DBYA 3MELA 1KVSA 2GLTA 2W8ZA 4WHMA 4EYKA 2D8MA 1L7BA 1RP1A 2GK4A 2YHUA 3IQEA 3N8IA 4CQLB 1MLDA 2ZBUA 3ORRA 3CF4G 4MVJM 1Z6XA 1P2VA 1BMQA 1QPGA 2GCEA 3CB2A 3CUEF 4RV5A 4X7BA 3F8SA 2P9HA 4KR7A 4I9FA 1NVDA 3R0ZA 1OSNA 3V4LA 1M66A 2IPXA 2P5SA 3FOWA 2OM2A 4PBSA 1D8AA 3RJMA 4DIOA 2O8CA 3KUDA 3SG0A 4UZEA 2DWUA 2EYQA 2OOKA 2ILTA 2H4JA 4I36A 4E3WA 5HPYB 1G8KA 3LCRA 2AEMA 2PH1A 3EY4A 1LUAA 1L1FA 3VGPA 1NJFA 1L8LA 3BK7A 4FILA 4D8YA 4F12A 2OE2A 2CK3A 4LVUA 1Q1NA 5JANA 2VTBA 3NORA 4N5HX 4BQPA 4L7QA 3ZX5A 3SPXA 2ODAA 2AE1A 2QL7A 2X76A 3KP1A 1ORDA 3S6JA 4F3RA 1K8QA 4OQYA 1KZHA 3T3MB 3T7CA 3QEBZ 5K6RA 2J7PD 3E3LA 3WE7A 3UK7A 4DDKA 1C30B 3ZHCA 3G0IA 1JEJA 2W2MA 1T9AA 4TQUS 2QMHA 1DARA 5J1TB 1RC8A 2O5EA 2C9CA 1PGQA 3EZ7A 1JDVA 3ON5A 3A8TA 4UNQA 4BLSA 4DCTA 2VP3A 1QVWA 4WZZA 5F7XA 1FOEB 3OLWA 2QGZA 4NDNE 4TTIA 1TA0A 2VWQA 1NATA 4MUNA 2YXNA 3ANNA 3SAJA 2PTHA 5LQKA 4Y1FA 1VHJA 2ONZA 2Q8NA 3IRVA 3EMVA 1WTAA 1ZEJA 2X0KA 3ID6C 3VH3A 4BWFB 3C7AA 2NVUB 1GLNA 3V80A 4F71A 1PWXA 4LJYA 2JGDB 4XZ3A 5HEKA 1N4AA 5IG2A 5CM8B 3OQVA 2GETA 3LKDA 4P4GA 4Y9UA 5EXDA 3HV2A 3NHLA 4AO6A 2VQEB 3IP9A 4GIBA 1FUIA 1EAMA 4J16C 2XPCA 3L0DA 4BC1A 2F43B 1T9GS 2I33A 4RESA 2I7DA 2N1BA 8ATCA 5JC1A 3E9NA 4CIAA 5AW5A 3DDCA 4RBNA 4OU5A 3PDHA 3ZTWA 4ED9A 4Q9HA 1E2KA 1VBNA 4TT3A 3B70A 3KSBC 3U7RA 3T7JA 5MFPA 3TSZA 1K0UA 5FWDA 4DMLA 4BLOA 4B9EA 2W2KA 3KEQA 2VDLB 3STYA 1A1SA 5ES4B 4C3ZA 2IRWA 5LZ7A 5LYYA 3MFYA 2HUNA 1ZNQO 5BUSA 1XCMA 3HBAA 3HNPA 1DAEA 3OHMA 5ALDA 3T3HA 2P69A 2J4DA 4NYIR 5A1TA 3TQCA 1QR2A 5C18A 4WXPA 5DCUA 3PXDA 4I08A 2Y9PB 4KRGA 4BNDB 1N6LA 1EWTA 1L9XA 4C2UA 3BTSA 2E4ZA 4IDEA 2I7VA 3LLMA 1U7XA 3FSEA 1MVOA 4X90A 2JK0A 4OFWA 1FJ2A 4E88A 1RAFA 3OZ7A 1JJFA 2OECA 5JTUA 2NZVG 5AXBA 1F1JA 3X2SA 4KWHA 3B3AA 2IFTA 3F3KA 4FGWA 3KVYA 1K7FB 1JFRA 3LECA 3WL8A 3GLIA 4TUYA 1XQ6A 3OWXA 4ACAA 1YBMA 1E92A 4WKCA 4TROA 5JZVA 3S8EA 4QASA 4CM1A 3KXIA 1RHKA 3RIGA 1KR2A 3NH9A 3ERCA 2R11A 3VR4H 2JJ1A 1A97A 4AZ3B 1K6IA 3C6MA 5T3UA 2R1UA 2JGIA 1EINA 3CNQS 1V6SA 2OR3A 2WKSA 5F4ZA 1YZTA 3JU3A 2DHDA 4E6EA 4J9UE 5HQ3A 4DM3A 5IKXA 3MHTA 2JHCA 4Q4HB 3TEMA 1HT0A 2G77B 3CCFA 4B47A 3BE5A 1CK4A 2AHOA 4MX8A 5HS4A 1FY2A 1ZMTA 2MJLA 2YHIA 1JXQA 1E2GA 2HBZA 3ETGA 5D3KA 3P5BA 4MPTA 4D9FA 4XRGA 5BVGB 1G59A 2GAFA 1WZEA 1HDIA 1LWOA 2PEYA 3KYBA 1W94A 3BM5A 1BVUA 1B0PA 2I0FA 1M2OB 4KFTA 4ZRDA 4ZOLF 1TVKA 1N2SA 1D4FA 4XM2A 3VR2D 3L5OA 1SFRA 1YB4A 2PDAA 3ZHZA 4BIMA 1U2DC 4OSEA 4KRFA 5P8WA 3U3RA 3PX3A 4HWPA 2FMUA 1NVAA 1RAEA 1NI4A 3O8LA 3PYXA 4KO3S 1Z0IA 4QHSA 4KC0A 3TE7A 4XUCA 4AL4A 1NUPA 4RGBA 1ZJ6A 3QM1A 4BV3A 5D3MA 1KPGA 4OQDA 4RLFA 3MWLA 1DEHA 2Q7OE 3I9JA 1I6MA 3OP1A 4MP6A 4N54A 1C4WA 2BSAA 1K66A 4BQNA 4B40A 1Z4MA 3BRSA 3JY6A 4YRPA 3U1BA 3ICQB 1OLXB 3CZ5A 4MUMA 3P71T 5JSUA 2XA1A 3LBNA 5CVUA 1KEEA 5ITVA 1U0SY 4BAZA 1ZNZA 2CJWB 2DBRA 3TBFA 5KOJA 1ORHA 2J9XB 3EGVA 5AQ1A 1SEPA 4MR7A 1Y8RB 3RYIB 3HB0A 5HUHA 1MA0A 1Z62A 2G67A 1INLA 1ND5A 5B2FA 4ENPA 3P9YA 4IQ8A 4DTCA 9ABPA 4LBZA 4BO4A 4Y18A 4QT0A 2V6GA 2HJHA 3DAGA 4BEWA 1QIMA 5LQDA 2B92A 3G9ZA 3T1YB 3OMWA 5C34B 3W9SA 3OCVA 1NW4A 1XROA 2OC4A 1AXRA 4Y2XA 4JUCA 4L8VA 2A1UA 5DHQA 2IV2X 3WRXC 4BZWA 4CLRB 4YRBA 4DUYB 4UVHA 3U7IA 4JR1A 5AKKA 2BH9A 2HA6A 1Q1AA 1GA1A 2DKNA 2J3IA 2QHXA 3FCAA 4Y2TA 1L4KA 1NVEA 1YONA 1YL5A 3QK7A 3W7BA 5COBA 4CV3A 3IVXA 2IU4A 1RXSA 4NFHA 4HZGA 3NBFA 5J5CA 2PKQP 1EX6A 3IR7A 1JV2B 3DKKA 1DG1G 4BNVA 4ZCRA 5JJ5A 2QN8A 4J4BA 2AD5A 4KE7A 4NRDA 4NZ9A 4ZQCB 1JAHA 3ILYA 3ZIDA 1PD1A 3AVXA 2O7VA 1VZ2A 5FFMA 3I01M 1VKHA 4IGEA 5JAUA 4JJ7A 3Q3GE 1Y1QA 3FPHA 4NICA 3DWEX 2NZJA 2JFYA 4FNAA 1AKMA 4OP1A 1MQ9A 2ANCA 4W7SA 4GMDA 1O8CA 2BTQB 4NU8X 2G9RA 2YJGA 3WB2A 2XE4A 3WLNA 4XOIA 2ZWVA 1HYEA 1FQOA 3OQHA 3T4UA 4P98A 2XXBA 3PHIA 1XVIA 2RB5A 2O6LA 2IV3A 3UYKA 5FTWA 3FRJA 1WCWA 4PSVA 1NW8A 1S8FA 4C0KA 4FMDB 1NZFA 2DHRA 3LBAA 1FNCA 1GAQA 1KS9A 3MT8A 1AQLA 1X1AA 5AVQA 1Y9AA 5ETJA 4C0WA 2O2DA 2RB4A 3KTAB 1HQKA 4X1KB 2X9NA 3OFKA 3JAWB 1E9CA 2GS9A 3F7OA 4W5OA 5LMZA 2DUJA 2ZREA 1TQDA 5LNK6 1E89A 4UXIA 3PEYA 5HM6A 1FX1A 3P9NA 4DQDA 4OQNA 2GEDA 1BCSA 1Y5IA 2W6PA 4MWEA 4XASA 1GQFA 4L0DA 3LU1A 3BTUA 3ZQJA 3PZRA 2PTGA 4N3AA 3G79A 2W5UA 2D1TA 1JFFB 3ILHA 1PFYA 1J5PA 4C4OA 4U6NA 4B75A 1AV7A 1HURA 2YWHA 3SJAA 4UULA 1W6UA 4CEHB 3WAGA 3JD1A 4F4UA 3L3BA 1K4KA 5CVTA 1P4GA 5G1NA 3Q2IA 3WWCA 3ZDXB 4EG4A 5LOVF 3PXUA 5GJVC 2QTHA 4JJZA 4Z53A 1E64A 1G98A 1E2JA 2MSCB 4RDXA 2QP3A 4B83A 2JD2A 3TRIA 1F8UA 2CLFB 4L8YA 1AK2A 1XQ1A 3II6X 3V7YA 5K6TA 2R1VB 2HMYB 4DG5A 1EB8A 3L6DA 1K8RA 1JAIA 4FC7A 1V2GA 3NCTA 3VV2A 3RRJA 1QTQA 2O59A 3KQWA 5JPCA 3ESDA 3T5GA 1TMKA 3CNBA 4JP3A 1C3EA 5FUXA 1GL6A 2WF9A 1U65A 1I13A 3TZBA 2A4MA 2KMLA 4OYLA 4L5BA 4RK1A 1M54A 5AM2A 3U7JA 1EBFA 2W9XA 3N0WA 5CW2A 1FYXA 2CXXA 3IVCA 2Q49A 1Q1GA 3LGAA 4D8UA 3KTDA 4J07A 3NWOA 1E6KA 3PTZA 1GDHA 1CR6A 3K9QO 3KPJA 1LDYA 4DLYA 1DINA 1UBLS 2VXBA 3AEKB 4MVJF 1M34B 2H0AA 1Z6GA 5EERA 2CFOA 4QICA 1Z8FA 2XHZA 5TQ0A 1L8XA 2WWTA 5E4JA 2JFUA 4P34A 1S0UA 3T1QA 1QCDA 3OE7D 2OQVA 2ST1A 4ZAFA 1M8GA 3NKFA 5FOSA 1P1BA 5GZ1A 2FLKA 2PBLA 2DJ5A 5EOVA 1SQFA 1V3QE 5KJEA 4FCVA 1P4AA 3R0QA 1JE0A 4H0FA 4V0ME 1L3IA 4ER3A 3AFHA 3VYUB 1XALA 1QX3A 4I4TA 1UMCA 3NHZA 2NU7A 2OAEA 5FKJA 2HF9A 3EW9A 4X93A 3B12A 1RXUA 5CB0A 2ZP1A 3HJFA 1T4DA 4G81A 4MWOA 2RBEA 4KACA 1YBVA 3EEBA 3KAQA 1TD9A 4WH0A 3AZPA 3VC2A 2QMUA 1SQ0A 2WM8A 2IXBA 4EA6A 4D9JA 2X86A 2EKDA 2G6TA 3LPMA 2PA3A 1U7HA 1UK9A 3DYVA 1THTA 2J1LA 2NNLD 2WFMA 3TJZA 5CIYA 1QTRA 1P4JA 1SCNE 3VUEA 2NLOA 3C5EA 3WG9A 2P77A 2WZDA 2FZLA 5E2IA 1K75A 3U48A 5M3BA 2H5IA 3DHNA 1GPLA 3PXGA 1HFKA 4FEAA 2A59A 3ZI4A 4Q4JA 1TIPA 4UDYX 1HNWB 1DKUA 5T4BA 2YUTA 3UFXB 4R7ZA 5CA1F 3TF5A 1JSZA 2AZXA 4IMJB 3DZCA 1J7KA 3H9CA 3RW9A 3SY8A 4QZVA 1JB9A 1PSDA 5CLHA 2PS9A 2HI0A 2J0EA 5FJIA 3VPAA 9ATCA 4HMQA 3V7FA 2ZITA 4B6PA 1KTIA 2AUNA 4UM9D 1LFDB 4KQIA 2OEPA 2EJWA 3W4JA 4HVTA 3ZWXA 5EUQB 3BVPA 2YR0A 3D1LA 2J9ZB 3W8EA 4UOEA 4Q6WA 1O6CA 4LZOA 5CBPA 5EGSA 2WWIA 4ZXFA 1QTNA 1QC5B 5BV0A 4RHXA 4ZRNA 5C37A 3R76A 3W7AA 2PL9A 5KJCA 4KWIA 3N2KB 5F9FA 4KLNA 2HDHA 1XMVA 4IDDA 2Z9DA 3IALA 5JY6A 5KYUB 3KYJB 4D8TA 1B6TA 2PPVA 3U49A 1QF7A 3OZVA 4CLXA 1T4MA 3K30A 3QOYA 4F5ZA 4KPYA 4W1QA 4MRPA 5AXAA 3K6KA 3TXXA 5AW4A 1TVMA 3V2UA 2PZEA 3G3EA 4ZT7A 3L43A 1MIHA 2WVAA 1NXQA 4LOIA 4HDKB 4MPRA 4MROA 4MXDA 4BN4A 3UNXA 2XKJE 3ZWBA 4C2TA 1IRIA 1JXMA 1UJ2A 2UZAA 3C14C 4B79A 2JCBA 4FFSA 4GOXA 1KR5A 5F1PA 2ZAIA 5KB3A 2QN7A 3Q98A 2B20A 2YWEA 2CJYA 4BCCA 1KARA 3CT4A 2ZJBA 2V7UA 1F3OA 4U3JA 4DXAA 1PI3A 3D2CA 2IXFA 2VNAA 3JAKB 3LGXA 1ZKMA 3B2NA 3EW7A 3QELB 1J8FA 4KBFA 4HDAA 1GCOA 3U80A 1G3RA 3SDZA 1E9VA 4EHIA 5GVSA 5T6MA 2ZRAA 4RZIA 2Z2IA 4KIJA 1YL6A 4G37A 1O8BA 3Q5EA 2Z5FA 4ZVOA 1C0KA 2AD1A 3FPAA 3N1UA 4E3ZA 3RLIA 1TPZA 2HBRA 3NJ8A 5BT8A 3MB5A 4PGFA 5ALMA 5E9JA 5JPDA 4IFTA 1YI0A 3RREA 2HO4A 1L5FA 5J1SB 4JXKA 3IVRA 2AG8A 3EZYA 4E4YA 7REQB 1W48A 5DIFA 3OU6A 2Q0SA 1GKKA 1ZJ5A 5IJAA 1PEKE 4HPXB 5LYJF 4Y6SA 4I55B 4DV1B 1URPA 2IW3A 4Q05A 2RE8A 3HSSA 4W63A 3A04A 2ZIXB 3MVEA 1L5LA 3Q7SA 4MUXA 1KEVA 4ND5A 5EJ4A 3EDQA 2FFJA 4BOYA 1P3DA 4TQAA 2FPIB 1EE2A 1XZLA 4JKYA 4ZMSA 3A1DA 1WXDA 3KJXA 4KFUA 1GZ7A 4G1VA 4EJSB 1B2LA 2WILA 1RXIA 4AG6A 4GUAA 4Z7NB 1SHTX 1CT9A 4X1YA 1JT2A 5E3HA 1Y5LA 2AT1A 1HNZB 2VTVA 4M6WB 4A4DA 4W8GA 4QJBA 4A6DA 3HVRA 2IXAA 5T4FA 5GINE 1A8UA 2FX3A 3KVRA 3T35A 2GYWA 3WGOA 5J2TA 1E6EA 3WK8A 3T99A 1HUQA 3UMVA 4YMLA 2BF4A 4GS5A 2ZTVA 5DMHA 1KI7A 2I65A 4KFRA 4PRLA 1YE5A 3AOGA 2BMAA 3SOPA 4A5SA 3GT0A 4CMEC 5LQRA 3ZHTA 3D6MA 3GLGA 4A8JB 1B1CA 3PFKA 5FX2A 1EYZA 4GT1A 1K2VN 3SSMA 3MYRA 4D3DA 3H4VA 2CMFA 3HDHA 1GKYA 4PTLA 3K6JA 2ZPUA 3IP8A 5L7TA 2VBFA 4GMKA 5BXYA 3Q2KA 4FMDF 4K0KB 2OB2A 3ZK8A 3LQKA 5IYZF 2J41A 3PUXA 1UXJA 3W06A 1DKLA 3TO5A 3OA2A 4MRMB 1USVA 1A77A 2YIMA 4OHZA 4PR0A 2WTEA 2VRCD 1FLDA 2FPKA 3WHKA 1VBMA 3OHPA 3GFTA 1GQ2A 2JHPA 3GCWA 2IOFK 2BFWA 4R98A 5BRAA 2ZGVA 1U90A 4OX9Y 3VPDA 4DQKA 2RGYA 3GIWA 3O2JA 3ZDRA 1CUSA 1Z0FA 2UUCB 2UUOA 4ZCLA 2O0LA 3PDJA 2V45A 1U8UA 2VJOA 1EK1A 1NW6A 3INTA 1ZU5A 4FGUA 3QFRA 5K8CA 4YAKA 2EKQA 2JBWA 3BORA 2NXEA 4URZR 4TT8A 1Q1QA 1UH5A 2GHQA 1TM4E 3UATA 3RF7A 1GUYA 3FOBA 2OKCA 1I6LA 4KPUA 1RDFA 3PFCA 1U7UA 4KW7A 4NY1A 4O4HA 3WYNA 4DGSA 1DEOA 1XNHA 3PFFA 3EA5A 3FHJA 3KO8A 3QFTA 4DMCA 3UV6A 3KQHA 1WKCA 3LKZA 5B4TA 1W7AA 1PQ4A 1GCIA 1VBKA 2QNIA 4G07A 4K88A 2ZSBA 4Q34A 5H0IA 1L7PA 1QHHB 1PKXA 4K5QA 3Q3EA 4GX5A 1P4SA 3OHSX 1PN3A 2XA2A 3F6CA 1WDWB 3S2FA 5CT9A 4FCTA 3X3HA 3EFEA 4NDAA 4R2IA 2ZE8A 4PV7A 3WIBA 1MB4A 1CRQA 4QJ3A 1FQJA 1VKRA 2HLDD 1E1RA 1ESCA 2XB4A 3DMHA 5C8XA 3AX6A 2ZVPX 4H7IA 4IDAA 4TN1A 3NBQA 2XCRB 3W3ZB 1XCGB 4V2UA 1XP5A 3CN7A 3V1NA 1PIWA 2BE9A 2XMBA 2VK4A 3H6GA 3Q7TA 5FO1A 3PPIA 1WB4A 1GGEA 2YIVX 3ED5A 3ENKA 2CNBA 2IE8A 1W75A 2FSIA 2PZGA 3QNMA 3JQ7B 4MPPA 1YS7A 2JIPA 2HIHA 2OT3B 4M37A 2FE1A 5GPBA 3K09A 3DF7A 3HSKA 3L8HA 4BP1A 2R87A 3FXAA 4I2NA 2H2DA 1MEOA 2I66A 2OCPA 1YASA 2BIFA 2C5GA 3DMRA 4TMKA 4G2TA 3WLQA 5JWRA 4BMNA 3UK1A 1O95D 3KT0A 5C7IO 2HJSA 1UPAA 3KR1A 2PUGA 3MCZA 1ZCJA 2EL9A 1ICEA 2EW2A 1RJ9B 4BV9A 4DR3B 1TMYA 4YMUA 1YA4A 3E15A 1NW5A 3NW9A 3IPXA 3OIWA 4TYYA 3DZDA 4MQEA 1H9BA 1PL7A 4HH3C 1GTZA 3IV9A 4RVDA 5GONB 4G0UA 2JATA 3AM3A 5KYYB 1UFOA 1FZTA 2IPLA 3JRWA 3T34A 1JL3A 4EMBA 5JOQA 5ALJA 3DMTA 1KS2A 2HQ1A 3BYZA 1EIZA 2H1WA 4MPDA 1N6OA 3VX4A 4C0QC 1LV8A 4UHBA 3IUPA 1DLJA 2GB4A 1FMCA 1J97A 2XNDD 1Q21A 2ZDGA 3BQ9A 3CX6A 5AHWA 4LJ4A 3UC5A 2KBEA 4PNEA 2ZRJA 3T7RA 2YXLA 2NP6A 4YC7A 3OFSA 3B9PA 4A2QA 3YASA 1M75A 5G1PA 4X66B 3ZZ1A 1Y1RA 3R41A 4JQSA 3CSSA 1VQ1A 5JNWA 4M0KA 4TWAA 5ALIA 5U1PA 3RAJA 1VLQA 4DWWA 3ENZA 3QUBA 4QDOA 3F5MA 3IEIA 2WJ6A 4P5EA 5ADHA 4H4CA 4EI7A 2H11A 2PFKA 4RF3A 5DEIA 3R5TA 3D3EA 1CZOA 2ZYSA 4ZVQA 5A4FS 2H2GA 1T2FA 4QOSA 4AQYB 1YTUA 1HZZC 3QUAA 2O8VA 1IN1A 1QS0A 4ROSA 5J4LA 1U11A 4OK5A 2JIRA 1NZDA 1SB8A 3L7NA 4EZEA 2RI1A 3KZOA 2ZB4A 3QF4A 4LF6B 1A50B 1D9ZA 2QTCA 2QP9X 5BPHA 4QATA 2HGSA 2GCOA 2J9YB 3FPKA 4D6YA 4NK4A 4QARA 3EIUA 4UAGA 3OTOB 4Z2AA 2FFRA 2O0MA 1ZLXA 1Y9EA 1M1XB 2FLVA 2V4UA 3GARA 3IP3A 3ZIAD 2QEQA 3LF2A 3A7EA 3NATA 5KX5F 3DE4X 3BMCA 4LK3A 4XEHA 3WX0A 1GCUA 4RSGA 3HY3A 3LUGA 4ZTUB 1SB9A 1E5VA 1P61B 3DJYA 3ENNA 1L8OA 3HDQA 1YR7A 4HN4B 2I2BA 3DC7A 2QW1A 3BA6A 3OTGA 5CITA 4D0LB 3JYLA 3QE9Y 1UJ5A 1TPYA 1JIJA 1RXCA 4G67A 4AN1A 3SWWA 3RYFA 2CD9A 3PNSA 3O4RA 3KLMX 3S1AA 4KXYA 5HP4A 2GN8A 1U6IA 4Q3KA 4IH1A 2H92A 3PHGA 4OI0A 2AI2A 4Q18A 5CRIA 3PNLA 2I9KA 2HLHA 1P0IA 4R1TA 2CLKB 1RLOA 2HREA 2CNNA 1Z2EA 2LD4A 3PDIB 3VMMA 1TF2A 1ZUNB 3O38A 4OP3A 3OO1A 4ZICA 3BZUA 3FA2A 4B84A 3NDBB 1XO1A 3CE9A 4A23A 4UVDA 3U4CA 1PZFA 2QUBA 2O8EA 1PZGA 4FMCB 2W37A 3TPFA 5CT4A 1GZVA 1TCUA 3CUUA 3NEJA 3O3OB 4U39A 3T1NA 2QTRA 1MJGA 1ZY2A 3S27A 1WQ1R 3BB1A 4O5OA 2CCJA 2HADA 2I34A 2IYXA 3W9BA 3P4XA 4AYXA 3CF2A 4GOJA 3CG0A 5CXSA 4HAOA 5FLEX 4KQEA 1NN3A 3VVCA 5TEWA 4KVGA 4ARZA 1R16A 4BQSA 2HIAA 1TVEA 2QDKA 4PO3X 1ARZA 1WPRA 1A88A 1MORA 2QAGB 1Q84A 1QG6A 4QXRA 3W0LB 4F1KA 2ONYA 3KZXA 4O2LA 2QRHA 1A72A 3W77A 1XMOB 1M2HA 1IPEA 3MIZA 1GRCA 4P83A 1T5LA 2X0EA 1TJPB 3D5QA 3ZKWA 2A5FA 1IBCA 1NBAA 3C1UA 3LX5A 2IELA 4U9IS 4B2PA 5HQJA 5CAEB 5FV4A 3AOEC 5M34A 2L69A 5E9QA 3WIDA 1Y9JA 3GXBA 2AKEA 3R3SA 2QT9A 1Y8AA 4PFKA 3C1AA 2WHXA 2C4VA 3DVQX 3PL1A 4PLPA 1SVNA 1JHXA 3DPIA 1W1UA 4Q5IA 1KJNA 1W49A 2BFDA 3RIEA 1XNRB 1JECA 1ZVMA 1MP0A 1R3UA 1USWA 3BG5A 4L0MA 1XRQA 4CMEA 5BYJA 3F7TA 4F9TA 1YZVA 4G85A 4R01A 3ILVA 3LV8A 1BXZA 4CG2A 3F3MA 4BVFA 1P77A 3WJAA 2GAOA 2ZR0A 3P5SA 1VFNA 5D2CA 4DCOA 2QM0A 3E53A 3NQ41 4JYMA 2CV0A 1GZ3A 1C8LA 4RU1A 4TTJA 2GD1O 2YCLA 5FULA 3PNMA 2F59A 2W2LA 5FAXA 2P9CA 2OILA 1ZONA 1AZLA 4O5AA 1QJCA 1UBRS 4N6GA 5TF0A 5KWJA 3F0TA 5LQAA 1VIDA 1YDGA 3ISTA 1I2AA 1NNI1 4CIYA 1XAGA 2C2OA 3K16A 4JROA 4MIEA 1HDEA 1E2IA 3TXYA 2FPUA 4HO1X 4D5GA 7AT1A 5JAHA 3VNUA 5HJ5A 2FX2A 3GEPA 2WQZA 1XZKA 2XCSB 2GWHA 2HRZA 3MCTA 3V8NA 2C7PA 1LBIA 2W2QA 1QIHA 1HRDA 2X77A 2XADA 3C16C 4PZ0A 4LE0A 4IZ6A 1MO3A 3PTAA 3ZHYA 1ADFA 4Y6RA 5JD3A 2J4FA 1PYOA 2P9BA 3SZMA 2B8WA 3CNLA 4EBBA 3I9V6 5DWVA 5ITZB 1GAJA 1UM8A 1M6YA 2DU8A 2YVUA 3TNDA 3ESYA 3V5NA 3GZNA 2ZIEA 4BMPB 4IRMA 1U5AA 3JX9A 1VGRA 5JASA 4E70A 1I7PA 3LT5A 3DDOA 3MUOA 2FUEA 2ACWA 1GXSA 1E9FA 2QIPA 3IHLA 1IB0A 3I2HA 4HNQA 3WP0A 4D74A 2PAFA 3B1ZA 5IW8A 2NTVA 4RZ3A 4NEQA 3I5UA 3DEFA 4YCAA 3NM6B 3ZI0A 1NDHA 2P79A 3HH8A 1Q6YA 2GTHA 1GOTA 3JYHA 5AJYA 1PHRA 4EPYA 1ESZA 2B4KA 4GP6A 1TRKA 3CNHA 5C46F 2V7EA 1AQUA 5JNSA 3K32A 2QTZA 3SZUA 2C5HA 1LX7A 4H16A 4WLEA 3MD9A 4WZBE 2IF0A 3E8MA 2R44A 2IYLD 3QBEA 3E9EA 4KWEA 5HKKA 2YYAA 3A37A 1GR0A 3GDHA 1NKVA 1X7YA 4JFRA 4S1NA 4F6LA 2VC2B 3ZZ0A 4TYNA 2JLZA 3VU8A 1G9XA 2N75A 2VEDA 4AX4A 4EJ0A 3OC0A 2V0CA 2W58A 3DBHB 1X8KA 5CLFA 3AF6A 4Y2UA 4OQPA 3WGKA 1K9SA 2EIXA 3J7TA 3NC4A 5CB8A 5JNRA 3EF1A 2WKPA 2D7DA 1HSZA 1E9SA 3A7DA 4UCXA 3RRFA 1YQ9A 4L51A 1G19A 3PUWA 1NBEA 2IZ6A 1H4VB 2OV6A 1EM8A 2BBSA 1NJ8A 2GN2A 1CE8B 1HDCA 4X92A 4FQ7A 2P75A 2Y1CA 4I4CA 5GONF 2ERXA 2J3JA 2FG6C 4U2DA 5LP6C 2FCAA 4DV6B 1GU1A 1JXOA 2N9UA 3I8XA 4WDQA 4B3CA 1UXOA 4CM4B 5DXFA 4K8RB 1Z25A 1QOPB 4P3OA 3VPBA 4HGOA 2FDRA 5ICEA 1VCMA 4C89A 2I6TA 4EYSA 4EVQA 1NULA 1CSEE 2R8YA 2FUKA 1UKCA 2IIVA 2X14A 3F8WA 3CSUA 1Z13A 4W8HA 4YJ2B 5K3FB 4AW9A 3EJWA 3M6IA 5DT2A 3HLYA 3FVQA 5BOVA 1XK6A 1AGNA 1DTWB 2GCGA 3AU9A 1UODA 4B4DA 1CB7A 3K0AA 3VO2A 5EHXA 4E07A 2XV1A 4Y2VA 1XHLA 2XWBF 3HKEA 2A9QA 5EIEA 5E9WA 1NFQA 3UA4A 1XTTA 4D8XA 3T5DA 1VIVA 4YXWA 4RHFA 2BM0A 3DCYA 3GWGA 5ABPA 3K6SB 1PLJA 2I6GA 1KGDA 2EWWA 2C3OA 3EGDA 1F12A 3KYIB 2H9IA 3UMFA 1H2AS 4F72A 4LXUA 1IPFA 5C35A 1VSQA 2C54A 4NX2A 1UPBA 4BYMA 4FNOA 3VNSA 3HGMA 5JEDA 4GPTA 4J1TA 3R3UA 5KTTA 1J0DA 4BDSA 4ECEA 2GERA 4IOJA 1JU4A 1DXYA 1JQ3A 4IZOA 2IJGX 1EUDB 3GVCA 4JEHA 4LISA 3QVMA 4TL6A 4MNTA 1T2DA 4H15A 4BFCA 1VG9B 2H52A 1TQ6A 2ZIGA 1H1LB 3F97A 4PU0A 3UAOA 3R8FA 4AJNA 4REQA 4CFSA 3EF3A 3R6LA 4RM2A 4D5EA 1JHUA 1ZHFA 2QWXA 3GJ7A 2VZ9A 1M2NA 4MI3A 4G5XA 3ZLBA 1SVKA 1RQXA 2QF7A 3VZCA 1N77A 2QJRA 3PDWA 1CR0A 2CEKA 5IBPA 1RBZA 3UKDA 2DWQA 4JYBA 4PHFA 1ZK2A 3BT7A 1MH1A 4KN9S 1G7RA 3LCMA 2GMWA 1Y6ZA 3UPUA 4OMDA 4ESOA 1XN1A 2DH6A 1T5BA 2NQ8A 4A0GA 4RJIA 3DAFA 3VH2A 2VHXA 3KJIA 3R6DA 2RHLA 2WAOA 5KNLA 3CE6A 2CYAA 1ZZGA 1NUHA 2B2NA 1DAOA 1R8SA 4NZNA 1Z3IX 4DDWA 5B3LA 1EUCA 1SKBA 2HMSA 4B4KA 1VSBA 4D4LA 5C8YB 1A98A 1G21B 3AY6A 1LBHA 5GZ3A 5KTOA 2V59A 2HUPA 3JTEA 2H5LA 1USIA 4KIGA 1ATIA 3H1EA 4EG3A 4B3TB 2HJWA 4FE3A 2D0PB 4UTNA 2OQRA 2Z4SA 4DEYA 3IKTA 2P9ZA 1OD6A 3E0QA 4D9EA 1A82A 2OLEA 3GRZA 4UHJA 3DFIA 2XNJA 1AY0A 2A9PA 1TA4A 3UJDA 3FDZB 1KQPA 1RWMA 2XEXA 3TJMA 5CDSA 4DDMA 4R8KA 3KKPA 1R6XA 3LNCA 2OHOA 4DQUA 2IHJA 2KJQA 4KI7A 1TX4B 3ZDFA 4N48A 1P31A 3ISVA 2G4LA 4MCHA 3QKSA 5IVPA 1B93A 4XYEA 5IAEA 3E3NA 3OX2A 1JDJA 5BXQC 5JDIC 4F5DA 2HJVA 2IKSA 4ZARA 4IGFA 1DX4A 3JARB 3P9KA 4O25A 4P5PA 4L4SA 4XD2A 5J4YA 3IXQA 3PGXA 4ZDWA 3TCXB 3BH6A 4RD6A 4JQYA 2OORA 3D2BA 1U7WA 3IV6A 4H18A 4D82A 3U0BA 4MYSA 5C7LO 2DUNA 1O6GA 2X22A 2G5CA 4DBVO 4DLBA 1WULS 3LP8A 2H16A 3SHQA 4PYRA 3R09A 4BB6A 3KT8A 1CQXA 2BLLA 3G2NA 3L8GA 4ND7A 4MA0A 3CVJA 1YF3A 2QR5A 4J7XA 1DKPA 4BV2A 4NAVA 4HAIA 2BF7A 1YRLA 2YXBA 4J8PA 5KSPA 4B2IA 5F2OA 3L6UA 5A4AA 5CG2A 1Y42X 4Y1RA 5I4CA 4NMXB 4G5HA 2J48A 2YXDA 4DRXB 3HFSA 4KXQA 3OFVA 4CLOA 2VF7A 3NUGA 3EXEB 5A2GA 1AKUA 1FFSA 2A3NA 1YV9A 2JIDA 2WAAA 3B51X 3G2OA 1FFYA 4CQJA 3EC7A 2E4AA 4U2EA 3BCSA 3NUZA 4B3IA 3OY7A 4YYEA 4NAUA 4RGVA 1AGYA 2PLWA 3IJPA 2I2WA 3BB3A 4IJQA 3DFZA 4RGQA 5FQNA 3ZIUA 1D04A 2QVBA 2VDKB 3SVLA 1AHPA 3FB1A 3K0CA 3KHKA 4E15A 2WHYA 2FW1A 2HPVA 2X7HA 1N2CE 4HFMA 3EYWA 3GAFA 5D1NA 4EW6A 1PLKA 1WUJS 2VATA 4KUHA 5JSKA 5JADA 3INRA 4E51A 1AMOA 4ZJZA 3RWBA 1M33A 1CUGA 4MIYA 4YRDA 4DR2B 1QDUA 3IUYA 1JBKA 3C41J 3D6UA 1GVNB 2VPPA 3TINA 3TAUA 1CNFA 3DXZA 4MTCA 3HCDA 5K4GA 1LNQA 4F56A 1AUPA 1FTQA 2C1ZA 5CJJA 1JEYA 4WKBA 1E1QD 3GYBA 3STHA 2VXCA 1NOKA 1UMBA 8OHMA 1FEZA 2Z8YA 4ZAZA 4EW1A 5BMOA 1X7ZB 2FSVC 5B55A 1R18A 3T3PB 1NZJA 4S05A 1DRKA 1J49A 3PQ8A 3GP8A 5HDBB 1YWGO 1DELA 1WWKA 2M1ZA 3TL2A 1G2OA 3I6YA 5AKZA 3L1UA 4L8FA 1RABA 4RPHA 3CRW1 2ZRPA 1YJQA 2CF5A 3CS3A 3KOYA 4U2KA 2VHJA 4J2OA 3HEBA 4RPIA 4FLEA 2R751 1PJ3A 1N36B 2F00A 4C88A 4FYMA 4B80A 3PR3A 1P5FA 4OV6B 1XBTA 4UBMA 4EA8A 1P6QA 5IDQA 1ID8A 3CUTA 4HLUC 5ALFA 4UPEA 2HL6A 3COPA 1BW9A 2WPDA 4M8KA 1E9RA 1YVRA 3FUUA 2CXQA 1JWBB 2Q6KA 3DO6A 4GLFA 4BL5A 2QD3A 2G9NA 3Q72A 4JDPA 2O8BB 1J0CA 1LX6A 2I9PA 4JUAA 5F2EA 1WUHS 1GNQA 4HQKA 4M9CA 4YJDA 4ZOAA 5FH9A 2Z2YA 3HHPA 1FFWA 4QYXA 3OZFA 2AL7A 1UDWA 3NIGB 4LXGA 2WIAA 1A5ZA 1UMDB 2D3WA 3R7SA 3QI2A 4G36A 4R4JA 3UKOA 4DLLA 1DS6A 3H7AA 2WG1A 4KSYA 4DHWA 4KAFA 5FNVF 2QMYA 2HZ7A 3CPSA 2IW1A 1BJRE 1XRSB 3FPBA 5C8DA 1OREA 5FCDA 3PUIA 3Q88A 3DOOA 1JQEA 3S2EA 4AY4A 4TLLB 1TEZA 1M72A 2JKYA 4PM4A 5FOQA 4M76B 1T6NA 5SICE 3BC1A 3Q41A 2HK6A 1G63A 1X38A 3OCYA 4AULA 4EBFA 2FSFA 4DSUA 2FVYA 2RK3A 4NFSA 1EXVA 4DN6A 2CVFA 3HCOA 2G36A 1P6UA 3R9XA 2N3ZA 4JUIA 4HNVA 1E3MA 2BFEA 3KKQA 5LPNA 3U4QA 4P4TA 4C29A 3B7GA 4UNPA 5BV8A 1CJKC 2GEBA 3EC1A 3IERA 1WY5A 1FIUA 3DLPX 2ODNA 2NAFA 4D4GA 2R25B 4QVIA 1XDBA 2HPAA 1TZCA 2UZ1A 2PL1A 3U7EB 4MVJP 1L7QA 5LWQA 4II3A 2XZOA 2PGNA 4J49A 1RZRD 1QVAA 2OB1A 3FKSD 4E4RA 1FJXA 4AY6A 4ARIA 3LOPA 1AQ6A 2IZOA 2JFZA 4MVJD 1Z4QA 4HGYA 1H85A 5EMKA 3UFBA 4YRMA 4RLQA 4RH1A 1S2IA 3D4BA 4LJ5A 5ENZA 4H60A 2Z58A 3GNQA 3RT1A 1WXWA 1RI5A 1TUBA 3JD0A 3GNLA 1JEQB 2J45A 1REQB 3OF5A 3E9MA 2P1ZA 2P0EA 2WWWA 3F6BX 2MHCA 3HWX1 3B7PA 3T7AA 4BIIA 3RC1A 4W9NC 5BN3B 3R3VA 3QWHA 1UC5B 4LNUB 4AF7A 1OLUA 4A92A 5T41A 3BDIA 3HMKA 2XRMA 2PN1A 3DMNA 5B57C 2HX1A 1VE9A 2VNKA 1S1CA 5BORA 3F1LA 2Z30A 3P9XA 2XZTA 3KE9A 4NMLA 1Y3HA 1E9EA 2AQHA 3B2QA 2AJTA 4JD5A 3AL2A 4KE6A 4AU1A 2OCXA 10MHA 4KHZA 1E96A 3DNPA 3GJ6A 3AV3A 3LDFA 5EIWA 3ZLTA 3BH7A 1DAGA 5SY6A 2J9FA 1SCUA 2AC4A 3K9WA 4JI1B 3TKLA 521PA 4BGUA 4QO8A 3BRCA 1VECA 4ARSA 1HTTA 4UNNA 2C0PA 5I01A 1I3MA 3BD6A 3KOZA 3MLAA 4V2IA 3FPGA 4LX8A 3AR4A 2YRFA 3ND5A 2G6BA 3CTMA 4G0NA 2A6PA 5LP1A 4XR4A 3I2JA 1E8MA 3VR3D 4KOAA 4EHHA 5DGCA 3ND6A 1D2NA 4AKGA 3M83A 2OBXA 2ZYRA 4G5SA 2YS6A 2JCGA 3B5IA 4FR2A 2VF4X 3E5HA 1DCKA 2CBXA 1QFXA 3LK7A 3U5ZB 4I99A 3L7JA 1AKQA 2ZJAA 2H3HA 5KTMA 1GNTA 4HR7A 2UV8A 4IF4A 5C8YF 4NPHA 1D6JA 1Z7WA 3COZA 4QGHA 4TKMA 3GYGA 1ZUIA 4B71A 2PX4A 2IZZA 1LK0A 2O07A 4MW1A 3AUXA 1UC4B 2R1TB 1IWPB 3N8NA 3GEGA 3QU4A 4PRKA 4J7AA 5E3IA 2OA0A 5A9SA 1I2DA 4JC4A 2BFAA 5AJWA 1W96A 1S7GA 4JJIA 4EP1A 3OQIB 2XE8A 1G9SA 4J0EA 5CLGA 1VE6A 4A91A 4M54A 1A4XA 1U2SA 1M2VA 3KOUA 4NV0A 3E5RA 5K6AA 1IVSA 1AE1A 3A14A 3I30X 1NQVA 1TJ5A 1YUNA 2F1KA 3BD7A 4F84A 5GJCA 4P82A 5ALLA 5SYMA 4X6UA 4QDKA 3ZPXA 4AIRA 3HCEA 5CA1A 2NQTA 2OVFA 2ZI6A 1VBFA 1GAWA 3EZ9A 2V3CC 4ARBA 2DQKA 2J4CA 2IX3A 2JARA 3EGIA 1F8XA 4MW2A 2P2GA 3G0GA 4H1UA 4LSZA 3L6BA 1AKWA 2C42A 4ONEA 1PR6A 1F9EA 2CXRA 3L0BA 3E27A 4FC6A 4V03A 3R7BA 3ECCA 1Q12A 2GPTA 4R1SA 2YRWA 1Z4PX 3VVLA 1RQ2A 3JWEA 5EP3A 4IAOA 5CIWA 1Q95A 3MWEB 4R0VA 4O3FA 4YUYA 3H75A 4QUDA 2V6JA 1NBMA 1Z7BA 3IAAA 6YASA 1XJCA 4XYLA 2QTLA 2H4WA 4UFPA 5M04A 1VCIA 2QTTA 4GPIB 4GPAA 2OFXA 4BP8A 1RAAA 1ZESA 4NG5A 3ONDA 3O8RA 1OJ7A 1FDOA 2HA4A 3GEHA 4Z4QA 1KYTA 2SKDA 4MRVA 1KAHA 1NMEA 3PD1A 4FONA 5ENVA 1VMEA 2GLXA 2KLBA 4TMWA 2G1KA 1VP3A 2HNKA 5LSAA 3ND9A 1GCAA 1MXHA 4K0RA 2JAXA 2O4UX 1Y7LA 3BL8A 2VNJA 3CJQA 3PQDA 4IMRA 4Q16A 3WV5A 3KPVA 1A0OA 4A8PA 1EXDA 2XT6A 3A2KA 4LMAA 5F12A 1GPUA 3H8SA 3MINB 4YP7A 2HGZA 3AP1A 3A3YA 1AZTA 4AXBA 5ADVA 4QUBA 4HG2A 3O92A 2YVAA 1B7GO 2REXB 3GAZA 5JVDF 1Y4DE 3TK1A 1EWRA 2O0JA 4YV2A 3CIOA 4I2VA 5DN9A 3IDQA 4E31A 2AXPA 3TX2A 4K7JA 5IKMA 2XVXA 5FL7D 1T3TA 5ER9A 1SUPA 4MGIR 5K0GA 3LUJA 3K2IA 4BBAA 5JIBA 4NQZA 1BCRA 5G0TA 5CT8A 1FLNA 2J6IA 4JLNA 3ELDA 4WOBA 1NVGA 3L05A 2OCIA 4YV1A 1C7QA 1AMUA 2UXBB 1MAUA 4J0KA 4O02B 5AHXA 2BZ1A 3FAKA 1Z0UA 2V96A 2JCYA 1U4NA 4HNSA 1DV1A 1ZJZA 4FHCA 4B8YA 2XI4A 2NUPB 1DWQA 2WTAA 4ND8A 5LYJA 3RWMB 1AB5A 1A1VA 1GA4A 2O48X 5ITWA 1EK5A 2QJTA 5AYVA 1MRSA 3AMVA 5A7HA 5NLLA 2HFJA 3FI0A 5HUQA 3NDIA 3CZ4A 2X13A 1Y6RA 3QVVA 4KLZA 5C0OE 2Y92A 5JQGB 4R1LA 1U0TA 4X24A 4B6QA 4G5OA 2VFAA 3F9IA 4RK4A 1WPXA 2HMUA 3DMYA 3HDTA 3KEFA 2XCLA 5FHQA 3DLHA 1L5VA 4R2XA 3QLEA 3UUFA 3L0SA 4WESA 2FTKE 3ZXUB 3V1KA 2EGUA 3NB0A 5ICFA 4KAJA 3RDPA 3L4KA 1M9NA 3DV9A 2XCQA 3CU5A 3FKQA 3DB2A 3GFQA 3QVWA 3REFA 4DQLA 1NUSA 4MUYA 3G9TA 3HY4A 1MO6A 1E5XA 1EX7A 1PZNA 1RBMA 4LRXA 3DMGA 4BJ5A 3HRHA 2CDRA 1LS6A 5E6UB 1YKFA 3MJTA 2X6QA 1NT2A 1J2YA 3PDCA 4LOJA 5EZYA 1T6XA 2HZBA 4Q3NA 4QD3A 1N6RA 2VBGA 4F2PA 4XLTA 4XPIB 1HH4A 5KS2A 4DV3B 1QB8A 1EP1B 4A0SA 1Z7GA 3A6DA 2QRMA 5KU7A 5CLLA 4TRJA 5AVZA 2RC6A 2HV9A 1BROA 4HTFB 1K7CA 4RWEA 2P6RA 4M9XA 1CQIB 2GKOA 2ZDHA 4TTQA 3RSHA 3MMSA 1WDLA 3RFVA 3VUFA 3O3NB 5DLDA 2GZHA 2PZFA 1WV0A 2FN8A 2ZRGA 4L4RA 4C0SA 3N0XA 4R2JA 4EKIA 1OI7A 4HT3B 1KMIY 1MHPA 4X64B 3HNRA 5DCYA 2CDNA 4LY0A 5ECYA 3CZAA 4TKLA 1TM1E 5AK4A 4YT2A 1U6JA 1N0UA 1UOQA 2SBTA 4RZHA 3TUIC 5B6JA 1IONA 1E7YA 5FUBA 3WWPA 1NAIA 3A2MA 4TMFA 3I2KA 1MV5A 4JJ6A 2AN9A 4WFQA 2FOXA 2GZDA 3V1TC 5K05A 1NUAA 2XQKA 4Q12A 3BE6A 5IAAA 1O54A 3DE2X 4Q1VA 2R79A 4Y98A 4YPVA 1FTWA 2FWAA 1ZH6A 3LS2A 2DUUA 1G8MA 1UBEA 3QUQA 1IEXA 1UWCA 2Q5QA 3C43A 3MIIA 3U7QA 5G40A 4DJ5X 1JI3A 1HA3A 2RGAA 2WVJA 3TXAA 1GGVA 1NUUA 5TS3A 2VJMB 2HXGA 2W00A 3ECSA 3NEAA 3NNSA 1P7VA 4G86A 4M88A 3RYCB 2WYHA 2BGWA 1MW8X 2BGNA 3AJ9A 3JALA 3GGSA 3MWFA 3WNDA 4DCJA 4TZ0A 3JWHA 3QA3E 2PJUA 1L4NA 4MS1A 4RC9A 1G8AA 2A9FA 1WZNA 2FW7A 4PVDA 4U7PB 2FKNA 1GLGA 2HNBA 2ZYWX 3QENA 3RUIA 2WFLA 2ZB8A 4WBXC 3ZW7A 2CNLA 2HH9A 3S1LA 4CEIB 1TZMA 1VPTA 1RM4A 3QKRA 1E4YA 1JLKA 2P5YA 1DXQA 2O2YA 2QK4A 4RMIA 3IB6A 2HHCA 3SQWA 4YACA 2QTBA 2RGWA 3GDFA 5EKXA 4BX9A 4KTTE 1EHCA 2CXUA 2QUZA 1WW3A 4LRSB 3DZGA 3N59A 3BDAA 4H3VA 4OQEA 2QA5A 2AJCA 1BWPA 5F77A 3EG9A 1I9GA 2VH1A 4ALIA 2PD3A 3FJYA 3O75A 5TVGA 4BWGA 4V39A 5GIOE 2QNBA 2VP6A 4O33A 3ER9A 2B1QA 3ABIA 3AR6A 2C2WA 2GF0A 3CRZA 3IBSA 3IO3A 3DBIA 3DSRA 1NF9A 2ZRLA 2O1SA 2B4AA 4I5EA 5THKA 4POOA 4H1TA 3O8QA 3RT9A 2OGUA 5J5AA 1PJRA 4M83A 1VLLA 3OCWA 4Q3BA 2OYCA 1IE3A 2OGZA 2CFTA 1RZVA 4PBRA 3T1OA 1KKLA 4RVHA 1MX1A 3EVTA 1EFAA 3DEHA 3A4VA 4FD2A 3UGTA 3W5HA 3WKBA 3FPJA 1LF5A 3B9BA 5FL3A 5K51A 3IMFA 4FE4A 4IZHA 1HOTA 1UDXA 1ZCBA 1T9DA 4UBLA 2IU0A 1YZGA 3FTPA 3VU9A 1AM4D 1UXGA 2JFXA 3ZHRA 2FWIA 1I3KA 2CDCA 3V8EA 4WUTA 4MKGA 1P6XA 1MZVA 1I14A 1YJCA 3OKAA 1PQUA 1XFDA 3Q8KA 2FW9A 1SD5A 3ITDA 4J3FA 2EXXA 5AOCA 1QRDA 2WSSA 4UTPA 3MSXA 4DNFA 2J3DA 1ODTC 3FTFA 5E7MA 4KDEA 2JA2A 1PWYE 2V9PA 3E35A 2KYRA 3EXFA 3WO1A 1IB6A 2Z6QA 5JJIA 4I1RA 4LRTB 3OPYI 4CMBA 4O4HB 2AMFA 1D6MA 2J46A 2QSZA 4NE7A 5TGZA 3RG8A 2WB2A 2BH2A 4LHVA 1BNCA 2JANA 5E8JA 1RWXA 4CFZA 1QLHA 3KQYA 1P9LA 5D5PA 4FE7A 5C4GB 3OOJA 3L1IA 1CETA 4A0FA 3IQDB 1JGTA 1ZM9A 1GM5A 4O3MA 3OAAD 2NVWA 5FP0A 1DOHA 4CG0A 2CV1A 1PWEA 2PJZA 5KQGA 3QWAA 4OYRA 1BFUA 1A2OA 2QN1A 4E2FA 4OOFA 4BGEA 1ZMRA 2DWPA 1JQLB 4HMOA 3HFGA 3U44B 3UT0A 1PDOA 2JEZA 1HKHA 3I53A 4HRAA 1UKAA 1BE6A 2H8KA 4N6NA 1A7AA 4MQUA 5J63A 4QDUA 3VNVA 4U63A 1Q5PA 2WNHA 2GI4A 2WWXA 3LVQE 1NUQA 2BFPA 4LGVA 4XB6B 2J0UA 4BZZA 1OXUA 3QVLA 1B8OA 2NXWA 4F4IA 4F3NA 1MABB 5D6OA 1W4BA 3IIEA 1EGVB 1FFCA 1DT5A 1GRNA 1VCOA 3ZDEA 1QYDA 4DVJA 3C4QA 3P4UA 1V3UA 2F3QA 3E48A 3PQ6A 4N5LA 2RH8A 5K3BA 2C3PA 3V8RA 1UQTA 4Q1FA 4XUEA 1ONNA 3OZXA 5KTNA 3L7LA 1P3JA 1WE2A 1RMTA 2YFQA 2XTNA 4GU5A 4BFWA 4EJ6A 1NQ5A 1RXEA 4KVFA 1X8JA 4Q7LA 1SD2A 4FHGA 4K2AA 5EP1A 5ALPA 2NTJA 2BBTA 3UMCA 2AFHB 1UEIA 5G4KB 1GUAA 3KLPX 3G02A 4QOGA 2VZ0A 4BAUA 4YMVA 1F48A 1XXHB 1C1YA 4XQ9A 5IHPA 4BO7A 3SHTA 3L6CA 2XBMA 1DRUA 3JS5A 1AUQA 1I5OA 3HABA 4U4AA 1SUDA 4KYVA 1KC1A 3BCRA 4GR4A 1C8BA 4EHBA 4TS4A 2VUHB 4NYIQ 1B0UA 2OM6A 2XGSA 3THWB 1COWD 2NUTB 1ORIA 3GA5A 5AVYA 1OE0A 4O2RA 2WIKA 3AF2A 1JJ7A 5FORA 3UAXA 3ZE6A 5A6SA 2R8BA 2Z8ZA 4O4IF 1JR3D 3EDMA 1HNNA 3GRYA 1Q14A 4WK0B 3V1YA 4EJ2A 5JISA 1E1LA 1H65A 1I2BA 2AV6A 2P4UA 2R6DA 2WD9A 4I8IA 4C03A 3MTAA 1KBQA 3G2JA 4PZYA 1GCGA 1X7XB 2XODA 5KI6A 2WJAA 1NXTA 2CMDA 3Q0IA 5F98A 2D1QA 2NZ2A 5JBNA 1XDWA 4Q7MB 3ZS8A 1KRHA 1JYFA 3ZVRA 2GUGA 1VLHA 4M86A 4MH0R 4YAFA 2DFVA 3QJ5A 1T9GR 2K4MA 3P2KA 4EEZA 5JCOA 2JDID 1AO3A 3OQNA 3LBIA 3GZ4A 1JMKC 1Q3TA 2FP3A 4RANA 2J0SA 1TEXA 1T0IA 3AI2A 1SXIA 4MVWA 4UUQA 3ELWA 4Q4DA 1MB2A 1PDWA 1U0EA 3R7WB 2QQ0A 4MQFB 2HCRA 4E94A 2OD2A 1K5DA 2WE8A 3H2JA 2FEKA 1GL3A 3FCEA 3NBKA 3NONA 1H8ED 3I5AA 4L3OA 3I73A 1EHYA 5AWFC 3FF4A 1S89A 4RKQA 5E6SB 2ORWA 4NR0A 5D3QA 2PUEA 1UIMA 3I2FA 2RGUA 3N5CA 3QVKA 4J0CA 4XYGA 2ZUBA 3U39A 1ZVQA 4LOHA 4AMVA 3FPLA 4BLVA 4CLDA 1VMDA 3LHSA 3ORSA 4F4HA 4N0EA 1YZYA 1UBGA 4BFYA 3PYMA 2A92A 5GMOA 4RW0A 4TMVA 1R9MA 3TRFA 4MW4A 3A1CA 4YQZA 3SN6A 1WXEA 2XMSA 3DZBA 4KQ1A 5EI5A 3EFHA 5DOVA 3WHIA 4ZDIA 5JS6A 3O4VA 1J90A 3WRVA 3P27A 3IAEA 5FUVA 1Y6GA 4R1NA 1KY3A 4WN9A 4G4SO 3B13B 3OJFA 4X1OA 1AURA 5JV5A 3ESBA 3DOIA 3HUTA 1WU7A 4OQXA 5A04A 3R75A 4ZCPA 3L40A 1AHNA 1IM8A 3G0CA 1T0BA 1JHRA 2ZUSA 3ETEA 3JQCA 1X13A 2YUIA 3KJZA 4YTEA 4ASUA 4XOUA 3G9QA 4CQMB 4DYVA 3W2HA 5J4KA 2XSZD 5FI1B 3DOEA 5CPFA 4G0VA 1XNGA 3E2MA 3V4ZA 1HDGO 1W93A 3RJZA 1G2PA 3K1YA 5HK8A 4PG7A 1CULC 5EJFA 2YZ7A 3UIEA 2AK3A 2ECKA 1ECFA 1KP9A 3Q2OA 3ZKAA 1EUQA 3RFTA 2ENUA 3D8SA 3IV7A 4JIGA 4N7RA 3B6JA 1YZUA 2IEDA 5B12A 4DPLA 1VHDA 3KQVA 1C7FA 3LUAA 4XQ0A 2IUTA 1PGPA 3A1UA 3QWBA 3QY0A 3KTOA 4RZUA 3KXDA 2UYOA 2XY4A 2I62A 3EVCA 5B7PA 2Q5LA 3OO0A 3GFOA 2E9SA 4OQZA 4KGZA 2F2TA 3OEEA 1KSGA 1B2RA 5AI9A 3QLUC 1U63A 2C94A 3KAPA 1E1CB 2VDWA 4D3ZA 1VLMA 2JLYA 1Z5OA 4XIIA 1J2EA 3NV7A 4Z1MD 1VYTA 5DPMA 3IUMA 3C24A 3RIHA 1NAHA 1R0SA 1XRJA 3DL4A 3JATB 4X6LA 4MCAA 4D99A 1TYEB 4URFA 1IUKA 3WRYA 4DCVA 2ALJA 4KQGA 3NEYA 1I4TD 1MOQA 3W3AA 3HA2A 1SPXA 2GBLC 5TC4A 4TWRA 4B6JA 4CGYA 4FEGA 1UBTS 4F06A 2HB6A 4IUCS 4QHTA 3DDWA 1A5SB 3G49A 3ELBA 4M49A 2B5VA 3CWQA 2CKDA 1TZJA 2HCTA 2QLLA 5EJ8A 1PR9A 5J4VA 4Z1OA 3TOVA 1O5OA 2JJQA 4QQ8A 4UFOA 2BRUC 1TYZA 4EELA 1SCIA 5BMVB 5D86A 3ITNA 3TZ6A 3LDAA 1AMNA 1OLOA 1SURA 4UD6A 3EIQA 1V25A 4KR9A 1KOJA 3NR2A 1RM5A 3GLVA 3FZQA 3SE7A 5JAIA 3MLBA 2FN9A 4DG8A 4O4JB 1YU9A 1Z2DA 4M8NE 1HE2A 2VPTA 1FP7A 1DO8A 2M32A 5HBRA 1QAOA 2NW6A 2O50A 5DLYA 6Q21A 5CDUA 4WECA 4YCDA 1YAHA 1DX9A 4MUIA 3F2VA 4NOMA 1TW2A 3OD5A 3UJBA 1RWNA 5KYNA 1PGJA 1IK6A 1N7GA 1Z36A 3DEIA 3KQOA 4HBZA 4PZZA 1G0NA 3JQ8A 2BUCA 4DV0B 2GBFA 2PVPA 5JAQA 3R3ZA 3DTNA 4DILA 1CUHA 1XNJA 1O95C 4YAWA 3GLFB 4ZK6A 3JZAA 3D7MA 4YJKA 4AB1A 2EBFX 4TTTS 3R3YA 4F6RB 4CXMA 1WXIA 3DV0A 3RNLA 2CBGA 1AUVA 2GT1A 3BAZA 4RZXA 2IUEA 2GA9A 3LWDA 4QDZA 4RIEA 3LQYA 4H1HA 4M1WA 3KSAC 1T29A 1E0KA 1Z2NX 4HDRB 2X7JA 4JITA 5LA6F 2PH3A 5FTLA 1KMHA 3SYRA 1DZIA 4GXQA 3DUFB 4DIDA 2AC7A 2EW8A 2SCUB 3PUVA 1Q19A 3IPAA 3SEFA 2JBHA 5BSTA 4BVLA 4JVMA 1N5KA 3F90A 2O7SA 3DWFA 4V0QA 3ABSB 3IJEB 4JAVC 1KFEB 3W6UA 3WWYA 3NRCA 4CI9A 2ZSAA 3P9QA 1RYMA 2A5LA 1MF7A 3H1GA 1T36A 2AVDA 4W5HA 1ENOA 3DFMA 4N0MA 4WNAB 1BVHA 1VHQA 2D1FA 3DEJA 3NKVA 2I4RA 3P32A 1SXHA 4US1R 2GFQA 1HMPA 3F4KA 1M2GA 4FYWA 3NVDA 1YFJA 5DCLA 3OPYA 5L6LB 1FA9A 1E1KA 3KOMA 3R6WA 1JHYA 3K0SA 3ZW8A 4EEXA 2RD2A 1X1DA 2XMRA 3AHFA 4MDHA 2NPFA 4DDVA 5AESA 4ZMRA 4EJMA 4FM9A 4Q9NA 1FU7A 1ODFA 3ITEA 5I48A 3D1VA 4L9WA 1PR5A 3RIYA 1AQNA 1NL3A 3OMLA 4V1CB 2C2YA 4AI6A 5U4XA 1FF9A 1MTZA 4P84A 2CW5A 5AI0A 2BFOA 3SU8A 4ZYVA 4JB3A 4UASA 4QPJC 3EZNA 4PGMA 3EZ6A 3BQMB 4Q15A 3EODA 5IN5A 2DQSA 2PX6A 4JOBA 3TBKA 3OICA 1BRMA 3K4HA 2Q9CA 3DTTA 3L04A 3TLGA 3ZU2A 3QVXA 1FUKA 4ER7A 2OHIA 3UV7A 1UXIA 3AHGA 5I3ZA 3NVAA 4JYZA 2C83A 4KBYA 2X0NA 4OHYA 4MO2A 1WM1A 1ZW1A 2C7BA 3BD9A 2OZEA 3DV2A 1NLMA 5D7NA 4OQMA 4KSBA 3DDSA 4URWR 5AI4A 1ABEA 1O6FA 5T57A 1DRWA 1OIWA 1E8DA 2NZXA 2X6TA 1NYTA 1P5ZB 2HU7A 3ESZA 4RQTA 4A3SA 3MGKA 3CISA 2XKAA 5KEIA 1YS9A 3KKMA 1JJBA 3H97A 3FBTA 4UFNA 4E2WA 1ST3A 2HW8A 2VYNA 3ROZA 4FS8A 2G07A 4LXIA 3VGJA 2NZWA 4NFLA 3NOOA 4TL9A 5A4JA 3GHYA 2WSBA 1G5TA 2Y05A 2NU6A 5BN5A 5LKAA 3G1WA 2DT5A 2X0IA 4HAXA 1HWYA 3F2IA 3RBVA 2ZIZA 2ZRCA 1QXSA 2JJYA 4Z9YA 1FNDA 4BJHB 5L4NA 1L3BA 4IO1A 3IP5A 3ESAA 4B3SB 3D6AA 3BBLA 2OFFA 3EIHA 4N6OA 4HQOA 1SJ9A 3ASYA 1NP7A 1QVVA 5CVJA 3BTOA 5TGTA 1MEEA 5DHAA 1L5OA 4KXVA 2PH7A 4C0JA 3DMFA 3H5NA 3EA4A 4OMUA 4XX0A 5BSWA 1NXPA 5HZKA 4GRAA 4X6YA 4YT8A 3LRPA 4MI9A 1OPXA 5J2UB 3D8TA 4PCVA 4ZWNA 5FIUA 3T0FA 1K7XB 4B85A 1CJUC 3B60A 1SEVA 4B7AA 2ZROA 3BGVA 3H1PA 3N2YA 3REQA 3RU9A 2R6GA 5IAGA 1OI3A 2J08A 2Q1UA 4K9SA 3ZLVA 2C57A 3Q0TA 1GG9A 4Q1AA 2AK2A 3CTPA 2ZVJA 4INPA 4PLZA 1OT5A 2IU6A 3OLVA 1V8ZA 3Q9LA 4M0PA 5D85A 5I9TA 4DM4A 1Q77A 4II7A 5FBWB 5KNCH 3ESQA 3LXMA 4O4LA 1M5TA 1NVKA 3PE6A 3NIWA 2V9CA 3EQ8A 5I8WA 1ILEA 4Z86A 2IA5A 2O7NA 1GHTA 3OKCA 4RFLA 4R1UA 4CQNA 1IEQA 4R51A 3ND7A 4FYKA 1DRVA 1L4LA 2Q3LA 1RMQA 2J59A 4IGKA 3M4YA 3R6GA 4NCIA 2I80A 4DMMA 2WTBA 3A9VA 3DDHA 3DONA 3BRQA 3H9BA 3L82B 3N0RA 3N58A 2IYOA 4DIFA 3JPYA 3A6PC 1JDTA 1U5BB 2AOUA 5G0UA 4CM9A 3A6KA 3L6OO 5JXWA 1T24A 2DE0X 4BO8A 3Q1LA 1Z06A 3V8MA 5JBQA 4AX8A 2D62A 3WGLA 4W1SA 3HU5A 4B09A 1G3UA 4NMMA 3C7TA 4UHCA 1TZ2A 2P3SA 2B8EA 4FMBB 1NN1A 2JIQA 3SKVA 4HYQA 3RC2A 2IUFA 3JYQA 2C4UA 1M0EA 3BMQB 3D43A 3E3MA 2ZJ4A 3DDUA 1YBHA 3QIVA 1EVLA 4BMDA 4YIKA 4F91B 3QLUA 2WWYA 4KIUA 4NC9A 5HZHA 4P93A 3C3AA 1XDSA 3F6RA 3S5JA 3MRXA 4PG4A 2QRJA 1SBYA 5CTJA 1JTEA 4ZAGA 4QYIA 1XQYA 2DFTA 5FNVA 5KBYA 2WWRA 4TV8B 2EBUA 3D0KA 2UVDA 5FTKA 4DUPA 5L3QA 1QGYA 3AEXA 5IT0A 4AS2A 4ZQHA 2NU9B 3C3XA 1JAZA 4LW8A 2WNIA 1X7WB 4PRYA 2ENWA 2TMYA 4RULA 4IRUB 3TZEA 1TK2A 2X40A 3I62A 2DFPA 1HR0B 1UP4A 4E5DA 4FSDA 2RGDA 2O2ZA 1V6CA 2JNWA 3JWPA 1H3FA 2SECE 1SD1A 3FSJX 3K9LA 4FINA 3EEFA 4ZI7F 2J87A 3IBCA 4BFLA 3IHTA 4JGGA 2FWMX 5IH7A 3RAFC 1F2VA 3V8BA 2OP1A 2CE7A 1Z2OX 4RWZA 4B76A 3MUEA 4R0NA 4IHJF 2JFPA 5FWXA 2R7KA 4IIDA 2RI0A 3IQXA 3L8MA 3NHWA 3KWFA 2GRAA 3FROA 4IIGA 3PJRA 1GAXA 3HYNA 3JQAB 2A5YB 4O8CA 5JJCA 3DCJA 4HNRA 2P0YA 5HK9A 3EOBI 3A1VA 1BO6A 4WZBA 2DSTA 4N5IX 2NV6A 1TK9A 3KL4A 4JUFA 4OLJA 3SP1A 3VNRA 1YU6A 2KLHA 4NBWA 2EJCA 3N8KA 3SC3A 3MJRA 4ZVSA 1JSCA 1W29A 2ZCVA 3WMWA 4K6CA 4IUBS 4NJMB 4TSFA 5EG5A 5AHKA 4DW8A 1WPGA 2VJNA 1ZK0A 4PW0A 1I7NA 3EXG2 4WJKB 3TG2A 2XUKA 4Y7DA 2R00C 2BT4A 1OXXK 3IIKA 5K0EA 3C7CB 1KETA 1N5RA 2FOLA 3OIYA 4RTNA 3DUWA 3PU6A 3PUKA 1PUXA 1J2UA 1XT6A 4KTVE 1GFIA 1XYGA 1YJBA 2ZRFA 2EJTA 3P9SA 1TJ3A 4ESEA 4YPOA 2QZZA 4DV7B 2ET6A 5L53A 4D92A 4OVKA 3VO9A 2J6HA 5FWNA 1JILA 3BWXA 2XMDA 3H1TA 4BHTA 3THYA 2JFGA 3GCZA 2WJ3A 3H5TA 1UL1X 1V71A 5KMGA 4MW9A 1E7MA 1KU6A 5TR9A 2EVWX 3V4OA 4JLOA 1J5EB 2X7XA 1V7PC 2AN5A 1G6HA 1GGKA 2DTXA 2E37A 3JYNA 4RD4A 3T0IA 4R8LA 3GWZA 3LFUA 1HDXA 1NIPA 2XDQB 2XRZA 2P5TB 4S1OA 1DX6A 1DIHA 3DLTA 3DTVA 1JSLA 3MS2A 1XZNA 2BZSA 3DNFA 5AK6A 4NBVA 5IVIA 1V8OA 4GVLA 2PYIA 5EZ6B 2Q46A 3OURA 4RA6B 2E4WA 3RVJA 5BWNA 4X62B 1ZI9A 1MB3A 2I6SA 4JB2A 4OHWA 3G5MA 2R6HA 1SPBS 1YR8A 3W90A 4M1SA 2Z98A 4UW9A 1ECJA 4ASUD 4BVJA 1XEFA 5IEJA 2VTDA 2BR4A 4FW8A 1ULHA 1UQRA 2I8LA 1WCIA 5IN4A 3W6PA 1PW7A 2Q28A 2XUZA 3LCUA 4GI3A 1X9HA 5ALZA 3V8QA 3ZXSA 1RAIA 1X0VA 4XCQA 4LHSA 1LNZA 2EKZA 4G4GA 5DHSA 1KFBB 2IHYA 4BAGA 1BU8A 4FD3A 4P7JA 2Y77A 4ZC8A 3D6FA 3VR5A 1ZH8A 4QREA 5CLJA 2XYHA 1GZUA 3EGXB 3KZ1E 2IOQA 2JLBA 4S2UA 4C5BA 1J07A 3I42A 3H4MA 3O73A 1MOZA 3VYWA 4YJGB 2RSLA 2WLSA 4H7KA 5LQNA 4U9HS 2LDBA 3AKDA 5KOHA 4NCNA 3H04A 5CA0F 4L4YA 3HB9A 4TL7A 1YFLA 4TMYA 1Q1BA 2P62A 4FSXA 1IMOA 4PAQA 4YFVA 4M7RA 3WGGA 2Y1XA 4Z99A 1BZYA 1T10A 1YRQA 3WLSA 3ZE9A 1XDDA 2ASEA 4M22A 5BOSB 3IDFA 1D1TA 3GZJA 3KM0A 4DSNA 4PXAA 5F76A 5E1DA 1H8HD 3FZNA 1I7QB 2EFDB 4BVHA 1Y8QA 2FP4B 3RK0A 1EWVA 2D5LA 2HXSA 4I50A 1OBOA 1ZCAA 3CR8A 5DI9A 3JASB 2Q2VA 3SJ7A 3UN1A 4ARCA 3MZ0A 3RVLA 3GD7A 1SBNE 1OU4A 2A3RA 3QBDA 1EPUA 1BH6A 1IZ0A 2O06A 4U2GA 4BLRA 4KPEC 2CXOA 4Q03A 2ZM6B 3STXA 3DE0X 2V3VA 1N8TA 2FFQA 2OGTA 4UMEA 3PGLA 1BXRA 3C45A 4C2AA 4GKJB 3TGLA 1UOOA 3EZGA 1T3ZA 5TPZD 2IOHA 4GH5A 4R6XA 3KLNA 1WTCA 3RUDA 1MVNA 1W2GA 1A9RA 2QR3A 2RGNC 1DFIA 4XUDA 4XLLA 2OAP1 2JIZD 2KPOA 2Q50A 4RDHA 3H9UA 5HKLA 1KDZA 4KNYA 2FSHA 5LP6B 1LSSA 1XUOA 2WZQA 5E9AA 2GXUA 3VDQA 2C2HA 2XB8A 1ISGA 3DR3A 2Z6AA 5F9HA 4F9EA 2LGJA 4PSDA 2XD4A 3N2GA 4K6KA 3TD6A 4BP9A 3RYTC 4FFNA 5CVDA 4H9GA 4TKUB 3L06A 1WMEA 2ZZMA 1P1KA 4Q3LA 1MRZA 2ZZKA 1BSVA 1L4UA 1NUTA 1GV0A 1XELA 2MMCA 3B6KA 1GFSA 3K9BA 3LNTA 3QF7A 1W5TA 2GCNA 4X84A 4ALLA 3H5WA 1CY7A 5JI3E 1U4OA 4I14A 3GU3A 3UT5B 4F4FA 2JBAA 3S29A 3E6AA 1SUWA 2ZUEA 2XDYA 4BX0A 4LRWA 1GZ6A 3KJHA 3ZWMA 1QQBA 3JZIA 4GLBA 2LKDA 3NH6A 1XD2B 2JI4A 4I3GA 4ZANA 5JDCC 2OBFA 1TMOA 3WDSA 2W2OA 3IDZA 3ZVMA 1E3SA 3H86A 4MR8A 1KOLA 2FW8A 5I4KA 2G28A 3ZNQA 2PUCA 3ELUA 3N6RA 3SXJA 4TKVA 2OCLA 3QVGB 4OY3A 3HUUA 4F8JA 4EAAA 2X4LA 2XX3A 3L1HA 4DV5B 3G2KA 4XIYA 4F5WA 4JLAA 1D8TA 1K5HA 1Q3KA 1S01A 4UEKA 5IULC 1K89A 3QVSA 4BMZA 4OXRA 3GPIA 5ER6A 4E14A 4CW7A 1NI5A 2Q4BA 4MK4A 4R1MA 5E4TA 5LQSA 1E58A 1XEAA 4A2WA 3PNKA 4NABA 1VZ3A 5ALOA 5BYBA 2EFEB 2Z04A 2GYYA 2OHHA 3LH5A 3SJUA 3ZZMA 2WMYA 1WHTA 2X19A 4IEFB 2O14A 2SICE 3PPXA 1MX5A 1QLJA 1SRQA 2A0KA 1PWHA 2AJ8A 4YJ3A 3NT5A 4V02A 5H82A 4DC0A 3N2ZB 3I2YX 2IXGA 4BFZA 2F90A 4MITA 1UCFA 1EH5A 1T2EA 3FRIA 4QJ5A 4KH1A 3EIFA 4F1JA 2EG9A 4NG4A 2WOJA 3R7AA 1VB3A 2IF2A 3GUCA 2C96A 1GSIA 1GQYA 1YS6A 4TGLA 2IYYA 1KMCA 1Z08A 2B25A 1L5HB 1Z75A 2Q2OA 3QPVA 3W5UA 4CUZA 3HACA 4A7PA 1EM6A 3GLHB 4GI5A 1NBIA 3KDAA 4JR0A 4DXHA 5B2ZA 2E5FA 4EO9A 4EKNB 1ZICA 4HEJA 5JAZA 4GMFA 1NM5C 4NE2A 3G82C 3L4BA 4PS1A 5LB4A 3V3KA 5C5CA 1LPBB 2YDYA 1SH7A 1C9MA 5H4GA 1U1GA 3ETLA 3I6QA 2C59A 5F2KA 3HM9A 4H7JA 3H16A 2AXNA 1C9DB 1KAQA 2QJWA 4R68A 4D9GA 4DMFA 1T9CA 4KB5A 2QVLA 1AHHA 3IVMA 1CDDA 1Q7EA 2VDUE 5KTYA 1TYDE 3W2TA 1SWVA 2RC5A 1P44A 1E61A 1TTPB 3LRTA 3SQDA 2IHNA 3TB4A 3GLSA 3AF1A 4C7JA 5DGIA 2IEGA 5DNEA 3DTYA 1X8XA 4POAA 3BS4A 3V4RA 3R8XA 3R0XA 2GPYA 3N74A 3IBFA 4WCFC 1MENA 3MBOA 1NBHA 4DDHA 3RWOA 1UINA 2I2FA 3FGOA 1O5TA 2PG3A 2ZBRA 1BJTA 2WDZA 3HLTA 1RMYA 4X97A 2ICAA 1CUJA 1KI9A 3FUVA 1LEHA 1BQ4A 4AJ9A 7MHTA 4FKZA 4YS6A 2X9LA 3V4VB 4IIJF 4YFYA 2UYQA 3DBOB 3FUWA 3UKJA 1V0JA 3GCDA 3JD2A 3R20A 2FPPA 4IOLA 4LSMA 1GTMA 4MJ7A 4MOWA 4KGVA 3GLTA 2RJOA 2QE7A 3AVUA 4F4CA 4KR3A 2YNMD 4QECA 4A6PA 2AFIE 3DT8A 4V0SA 4NJEB 3S81A 4RMHA 1USKA 3HVHA 1Q1ZA 2VHTA 2I3DA 1BMDA 2XYRA 3G89A 2QT1A 2PRJA 3HJGA 2WU8A 3RTEA 4R3WA 3ZLUA 1NIJA 2Q9UA 2QOEA 4JLWA 2IV7A 2C8JA 1WNTA 1CJCA 2VRWA 4LZAA 2H9YA 4L6IA 5GM2A 3U5TA 3EXAA 5C1BA 5JS2A 1TTTA 1BXGA 3ZDYB 1MGOA 4FBMA 2OL4A 2ISSD 1ZVJA 3QNWA 1ETUA 1G20B 1RYEA 3G1TA 3QEMB 2C9ZA 4WXYB 1ZGHA 1BDIA 4PYOA 4ZIRA 2IS2A 3EBLA 4LBYA 4DM7A 4ZJPA 3V9PA 4QYWA 3L7YA 3RSZA 1B43A 1SO8A 2BONA 2CGEA 5CX1A 4EUHA 1Y34E 2A7QA 2OAGA 4LF8B 3OUTA 1E6UA 3RHFA 1CP3A 4B2LA 5ED4A 1OY1A 4E21A 1EBBA 1VE7A 1VPDA 2W98A 4OP2A 4BN5A 4LMPA 4W6ZA 1DSSG 1II8A 1NY5A 1ZAKA 2BN4A 2IC5A 4GFDA 2YWRA 1SKYB 5FR1A 3V7UA 4JQCA 1SUFA 1KXZA 1FDWA 4XSHA 2F3TA 3ZY5A 1THZA 3BWEA 3VR4A 3WK7A 3A2NA 3GT3A 3Q9UA 1E4EB 1P7ZA 3BCHA 4RXTA 5KWVA 2P67A 3AM5A 5K0LA 3RUFA 5A0FA 4G23A 1AKVA 1QGUA 3S4YA 3NMUF 1XCBA 4DY6A 1YR2A 4FYVA 3VHRA 4LYYA 1VE3A 3D3WA 3LHKA 3AH8A 1VL6A 3DZIA 1RAGA 1W5BA 2V5UA 1Z22A 3EULA 2PRYA 2VF5X 5GOZA 1US8B 2AXQA 2NWQA 4YUWA 4F92B 2NP7A 1SCDA 4LV8B 4DLSA 4YRFA 3DBRB 4G41A 3VVBA 2H7XA 5EKDA 1KH3A 1JDBB 1H0HA 4U1RA 2GJKA 5FBZA 4ZC1A 4XARA 2D6FA 1ISRA 1FRQA 4Q47A 1P7YA 4XD7D 5EMHA 4RFSA 1N78A 1OU0A 5ALRA 4IQ0A 3WY9A 4OM7A 3LX8A 1DG3A 5AW3A 4MB6A 1E32A 1MIOA 3LOUA 1FNBA 2G1PA 2GZ1A 2PFGA 2H18A 4L4XA 3K4QA 3UH0A 3VZRA 4NV3A 2WJVA 3ODPA 2ORED 1F51E 3QPDA 4J03A 4LJ8A 4YDSA 3SYMA 1ZD4A 4MW0A 4HOYA 2R8RA 4UUPA 4I1OA 3AFIA 3O8NA 1PAUA 3L8EA 4CM8B 1RQ7A 1NGSA 4YCSA 3UAVA 5A3JA 2I4LA 3MCAA 4U00A 4DCCA 1PDVA 4YWJA 2LE0A 4NIMA 1A8IA 1R6AA 3OQ1A 3V97A 3I6ZA 4F3KA 3EPPA 4LX0A 3IOBA 4L1KA 4O2AA 3ULKA 4FWTA 2VDJA 1PG2A 3SYTA 1J2TA 2NG1A 2GA8A 2Y3IA 1SWWA 2BFCA 4X3OA 2RBGA 5HA5A 4S3MA 1ZOSA 3OA0A 1LSUA 1FP6A 1SXJE 2EP8A 2M9MA 4OU4A 2GSWA 5DYIA 3V55A 2VT7A 3LFTA 4LF9B 3IXMA 3UH1A 2WT9A 4HPWA 2F1OA 3A1FA 2IBMA 3O9VA 1IRXA 4E5NA 4C0HA 4DAEA 1ZN7A 1KK3A 5BNIA 4COKA 3TQTA 4YQFA 1I1QB 1L5MA 1HYHA 3NAZA 3PNYA 2BISA 4KN6A 4ZHQA 2IZ5A 4N9WA 3VRHA 2G4VA 2JJ2D 1EFLA 1O9BA 1X1RA 3CIFA 2JLSA 3H19A 3WVNA 4D8WA 1KL7A 1KU0A 1LKZA 3R1IA 2ANBA 3R3WA 1KH2A 4HNUA 4HVCA 3DVAA 2YN4A 1BHSA 4N5NA 3VQTA 5C4MA 1ZN2A 2DWCA 1BD4A 2O2SA 5EKUA 2GZSA 2G72A 5FPPA 3M6AA 1DMRA 3TIGA 5K3EA 3FSRA 3ZBQA 4LF4B 1U3CA 3DYBA 2BBOA 1GNRA 4UEOA 5K3SA 3IULA 5C4IA 1ULBA 2QZPA 3IHWA 4EW2A 4DCPA 5JJLA 3CF4A 2FZWA 2NVBA 3SS7X 2QP4A 1ADGA 2B4RO 4QRDA 3EARA 3ZZUA 3TI9A 4F86A 4LHXA 4G5YA 1YA8A 3FOFC 2ZAOA 3SHOA 2WW8A 2YQ5A 4IQ4A 3T3EA 2ATVA 3A3PA 3ROGA 1YQEA 1UADA 2FMXA 2H07A 4FIZA 4CQLA 2VP2A 4NECA 5LXTF 5TX7A 3T4XA 3TR0A 4L50A 1T26A 2PVCA 3L5KA 3AVYA 2EX0A 1NMYA 3ROKA 1HYBA 2EFCB 3HSYA 5B53A 1IJBA 2J5RA 4JXZA 2DR3A 4UUBA 3ZE7A 4MEJA 5ED0A 1N57A 2YBEA 3JVIA 4YAOA 5ESDA 2Y0PA 1A3CA 3ZV4A 2VYVD 3A9WA 3WQBA 4URYR 1L7RA 5DN6D 1DP4A 1S8AA 1W2WB 3QJGA 2I3ZA 4CPDA 2PANA 4X7PA 5JMTA 2PD6A 4Y1GA 5JHGB 4F3CA 3OKPA 4LYFA 4HNAB 2PT6A 3I1JA 3KJFA 3TVDA 4ERNA 3PXBA 3ZHBA 1ZUHA 3LPAA 4L7VA 4E2YA 3FPFA 1L5YA 3GLIB 1XEXB 2WRZA 1RRCA 2G88A 3N2LA 4OHFA 2VUUA 3F6YA 5DOZA 1C30A 4MUKA 4CDGA 1HEYA 2C8VA 3PCXA 1Y3IA 1ZH2A 3FI9A 1TVCA 4X44A 1RLMA 2ZRMA 4GEKA 4TKZA 4UBOA 4OUDB 2I8CA 4PYJA 1WMFA 3KZCA 3KZNA 4QTXA 1MXFA 1XOIA 3PC8C 2WIGA 1X7DA 2QORA 4N8SA 1GD1O 1X1CA 5KTSA 4FFBB 4GZ5A 3SKYA 3V4PB 3AEYA 2BEJA 4H6WA 2NVUA 2XAUA 1RD4A 3AFOA 3NPAA 3QYAA 2FK7A 2JGDA 3BKXA 2GTIA 3M6WA 4C1NA 2XWJI 3MTIA 4FOSA 1USGA 1PF7E 4MQLA 4RTRA 4H6VA 4JGIA 3QFHA 1ECBA 1WXGA 4ZU3A 4DREA 5DFAA 4QEKA 4BTEA 1DADA 2XZDA 1OASA 4UBNA 2OCKA 2ZB2A 3WQSB 4C21A 5K8UA 1H6DA 4IG4A 4BTLA 2IXTA 1NF3A 3B9QA 2Q6LA 5F3RA 3NNDA 5DH9A 3I52A 1IZ9A 4QBKA 3U9SA 5FPKA 1AKYA