2NYRA

Crystal structure of human sirtuin homolog 5 in complex with suramin
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
259
Chain Sequence
PSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTERFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-5
publication title Structural basis of inhibition of the human NAD+-dependent deacetylase SIRT5 by suramin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 91
structure length 259
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 2nyrA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2nyrA01
2WVAA 4O8ZA 1T9CA 2HJHA 2EZ8A 2H2DA 2NXWA 4FEGA 4L2IA 1M2GA 1UPAA 4X3PA 1T9DA 5MGNA 4UU7A 5MFPA 4BV2A 4BVFA 1POWA 4J1TC 1M2KA 4BN4A 1J8FA 5FEMA 1MA3A 3ZGVA 1Q17A 4JD5A 1PNOA 2V3WA 1U28C 2H4HA 2FRDC 3E9YA 1V5EA 1PT9A 5K6RA 2FR8C 3CLRD 4RMGA 4JT9A 2Q28A 1POXA 4UTRA 2FN3A 5EJ7A 3CF4G 1U2GC 3OE1A 2X7JA 1U31A 4Y6LA 1HZZC 3HWX1 1O96B 4V1CI 5EJ8A 2AG1A 4ZZIA 4GM4A 5K2OA 1Q14A 5EJ5A 2OD9A 4UTXA 2VBIA 4J16C 3U3DA 1SZDA 2QQGA 1T9BA 2JIBA 4RMJA 4KXQA 5BWOA 5BWLA 2PGNA 5EJ6A 1YNOA 4R8MA 4F4UA 3GLSA 1PYDA 3PKIA 2IHTA 2AG0A 3CLUD 3K35A 4F56A 1S5PA 1T9AA 3JWPA 2H2GA 2BRUC 3IAEA 4FEEA 4RMHA 3EA4A 4V1CB 4MPJA 2VJYA 4JUFA 2H4FA 3GLTA 1YHZA 2Q27A 2Q5LA 4RMIA 1UPBA 4I5IA 4K9LA 3PDHA 2Q5JA 3EY9A 3EYAA 4MPRA 5BWNA 4GP9A 1SZCA 2OORC 2EZ4A 4GM0A 1PVDA 4JU8A 1PI3A 2H2HA 4MPPA 4V1CA 1Y9DA 1M2HA 5EJAA 4Y6OA 1OVMA 3CLTD 1OZGA 2H59A 3IAFA 4GG1A 4K9NA 2JLAA 2QQFA 2Q5QA 1YI1A 4G1CA 4IF6A 5K6TA 4UU8A 2C31A 4UTZA 5DGTA 4K9OA 1Q1AA 1PO7A 2NYRA 2PGOA 1JSCA 1OZFA 5K3SA 4BVHA 4TWIA 5EJ4A 4KPUA 2IHUA 4RJKA 4HDAA 4JSRA 4HD8A 2EZ9A 2PANA 4IG9A 1UPCA 4UUAA 4TWJA 3JR3A 2H2FA 2DJIA 4GM1A 2JLCA 3RIGA 1YC2A 5IMSA 4Y6QA 4GPEA 1OZHA 1D4OA 2JI6A 4X3OA 2Q5OA 3D81A 3ZGOA 5FYQA 1YBHA 1YC5A 1XLTC 1V5GA 1O97D 4C78A 1Q6ZA 4UUBA 2WVGA 4JT8A 4K9KA 2VK8A 4UTVA 4D5GA 3FLMA 5AHKA 2OD2A 3FZNA 2EZUA 2OD7A 1V5FA 1YHYA 4KGDA 4BVBA 1ICIA 5DGDA 4MQ5A 3U31A 4QPZA 4BVGA 3D7KA 4RJJA 2H4JA 4BV3A 4K9PA 4BUZA 4QQ8A 2FSVC 2JI7A 2UZ1B 5DEIA 4Q9DA 1Z8NA 3HWWA 3F6EX 2H2IA 4ZP1A 4JUDX 1ZPDA 2VBFA 1NM5C 2VK1A 4K9QA 4IAOA 2FWNA 2OO5C 3F6BX 5MFZA 5EJ9A 1EFPA 4JU9A 2WVHA 4D5EA 2IHVA 2B4YA 5MF6A 1PNQA 1BFDA 3LQ1A 1MCZA 4C7BA 2JI8A 5EJMA 4FVTA 4JUAA 1YI0A 3GLRA 2Q29A 5D7NA 4BVEA 4JUCA 1M2JA 1YTLA 4MZXA 4BN5A 1QPBA 3D4BA 4K9MA 3CLSD 2UZ1A 3FSJX 3PKJA 3GLUA 4RJIA 2EZTA 2JI9A 2A1UA 2VBGA 1DJLA 2W93A 1PTJC 4FZ3A 4JUBA 1E3TA 1S7GA 3RIYA 1U2DC 1EFVA 4COKA 1M2NA 2VK4A 4L3OA 3ZG6A 4QELA 2A1TR 1N0HA 4UTNA
chains in the Genus database with same CATH superfamily
1XA0A 4FHFA 2ZRHA 3ANNA 3ZDEA 2JGEA 3KDSE 3PB3A 3I62A 5I6DA 2GNOA 2FSPA 3ORRA 1GWNA 3HVUA 3I4LA 3GRAA 1RWPA 3QIVA 1NAHA 4WACA 1KXZA 4I55F 5LD2B 1ZBDA 2GRJA 4PBRA 4RZ2A 3EXEA 1Z37A 1JKJB 2E2WA 1J8DA 3Q6IA 1MVNA 5H81A 3C3AA 3I83A 4EDFA 1XROA 2F9MA 5MGNA 3GFFA 3IP9A 2ID7A 1GVNB 3NRCA 1XYGA 5JD4A 3Q12A 3UJDA 3W7AA 5A05A 5FBKA 4C1BA 1FLNA 1PSZA 1Q22A 2D13A 1ITZA 2IHJA 2LIVA 3I53A 1X13A 3PQDA 2EIXA 7YASA 1IVSA 4TL9A 1NW4A 4BNUA 2H7VA 3VHLB 4DIEA 1LX6A 2BMWA 2YDYA 4BRSA 1IOVA 2IU4A 5LMZA 2P9ZA 3PUJA 1C30B 1X9GA 2CNLA 4ABTA 3BHMA 4YVFA 2ILVA 2VJOA 3C5EA 3Q7EA 4HAWA 5TF4A 4B2YA 4DV1B 2EV9A 3I9NA 2DHEA 4HAIA 1RACA 2C04A 2EF1A 1A5AB 2GEKA 3G2NA 3A7DA 4JVMA 4RAQA 5DBGA 3KDPA 2WU8A 5KEIA 2EL9A 4A0FA 3DB1A 1WW8A 2UXDB 1TT5A 3X1ZA 2DR2A 3E61A 3MJDA 3OQ6A 4NV1A 2XGOA 1U28C 4MB0A 1SCIA 3CNEA 3JD2A 3LFHA 3M4ZA 2HBYA 3U60B 5JAOA 3MZ0A 1EXNA 5F12A 1MEOA 3PHLA 4MUYA 1KY3A 3IUEA 3OP1A 4G89A 4LJRA 5CCDA 5C1BA 1L5YA 3I05A 2GFHA 1EWYA 2JCSA 4CRWB 2OBNA 1II8A 2AL7A 4XASA 2KYRA 1KO5A 1S3FA 1YZGA 2IEBA 1XA3A 5LQNA 1N6OA 1KYZA 1MENA 4JMLA 5CP8A 4Z5XA 1NSTA 3KPJA 4M1WA 4Y7CA 2E6KA 1ZWKA 4UCXA 5FUWA 2MSEB 4V3CA 4PONA 4XLLA 1W36B 2OFOA 4OPMA 2OHXA 1KQ3A 1EP2B 3G9UA 4EY7A 3AVXA 1OWOA 2FW6A 1CXZA 1FUUA 1UZAA 4ECAA 3PDJA 4GC5A 1CUWA 1HDCA 2BR4A 2AI2A 1KK0A 1JKJA 3KSDO 3OE4A 2R8ZA 5DNDA 1XZHA 2Y68A 2RHHA 1XRLA 2RDMA 3O9VA 2IUEA 4CV3A 4AKGA 1J0CA 2BCJQ 1CQWA 3MLEA 3OPYI 4PVDA 4Y6LA 4INZA 3FTQA 2ZPTX 4M55A 2OV6A 3C8MA 1QPZA 3KQNA 1BS1A 1IJFA 4O2BF 1YCDA 1S8NA 1Z17A 2QRKA 3R9IA 1F2TA 1C3XA 1CNFA 4TLMB 4XDZA 1V95A 4DCJA 3BREA 3QFHA 4MUHA 3WMWA 2O8EB 1IXKA 3UAXA 4BNYA 1C30A 5YASA 4A03A 3NJRA 1HDRA 2V3VA 2EQAA 2GEBA 1S3GA 3BCUA 1N92A 3CF4A 1CZKA 4JOBA 5ESWA 1TCAA 1ZM2A 3TI9A 2YC2C 1JQKA 1U7PA 4CTJA 2VNAA 3VPSA 3HY4A 4CLEA 1BKYA 2V5UA 3JQAD 1HDZA 1ADCA 1KO8A 3K9LA 1P0PA 4OJKA 4KPFC 3T9FA 2OD9A 3R3UA 2ZR9A 4ZT4A 3PRHA 4I9HA 1S8OA 1KP2A 4JJZA 2CLFB 1II0A 3QSYA 1SKYB 1RAIA 2W0SA 3QPAA 2BL4A 2QW0X 2FG6C 1FB5A 5AXCA 5JC8A 4FZRA 4NEQA 1HDIA 3K6JA 2VPIA 3BB4A 2DY0A 4PZ0A 2BHNA 5DN9A 5FNZA 5KWVA 1ZJWA 3E1KA 3QLTA 3QVOA 1JDUA 1PS9A 4KXQA 1XE3A 3SS8A 8ADHA 4CMHA 4MCAA 1ZH6A 3RKSA 4ZN6A 3O2SB 3F3YA 2CEAA 1K5GA 4R8MA 1A9RA 2AQKA 1P7VA 4O33A 4YLYA 4OMDA 5IDXA 2W90A 3EB9A 4HUQA 3RIHA 3KU4A 5AJTA 4X7RA 4FC6A 3KJIA 4J0EA 1YZVA 1MO2A 3NWOA 2KBFA 2RAFA 1K8XB 1ZO8A 3UYKA 2ZYIA 1H2FA 3G0BA 1E7SA 4DA7A 3IPCA 5AW3A 3RS5A 5EPEA 1QAQA 1Q2XA 1WMBA 2ZP1A 4MA4A 5FR2A 3UFBA 4BNXA 4REOA 3FOCA 5AI8A 2GHIA 1CFZA 4UBKA 4QREA 3O26A 1B8UA 1SN7A 3HEMA 4BX0A 1Z5OA 1XRNA 3P9CA 4FGJA 1I2ZA 3WSVA 3ZWCA 1TTQB 2WAMA 5KOYA 3FFTA 1KRWA 3EW9A 2AFIE 1R9MA 1OI2A 2O8EA 2VSFA 1N5KA 5DYWA 3DHVA 4KHZA 5K2MA 2HRBA 1FJHA 1AB6A 2JB9A 5ICMA 3V4ZA 4POOA 2XOXA 5IYZB 1O4WA 2YWDA 4R2IA 2C7OA 3KQLA 4U7FA 1KZHA 1YRQA 4JBHA 3QJ5A 1R0LA 2PRSA 4I4NA 1D1TA 2VC2B 4CN8A 4BMSA 2ZRPA 4RO0A 1H5NA 1ABFA 3SF0A 3B9RA 2HRCA 5CH8A 5KJCA 4ZCLA 1AVTA 4ZARA 1M6WA 2P6RA 5EPOA 3S1AB 3I9OA 3WLAA 4GOKA 2QVZX 4DPLA 4OHYA 1HE4A 3ZVMA 1NWCA 3WL3A 1R0XA 1YQEA 1N2GA 3FHCB 3H6KA 1FYVA 4JL5A 3U7JA 1TE2A 3Q15C 1SMKA 3SYTA 1GZUA 5C18A 2QTWB 3CY6A 3UJHA 5JS7A 4L4YA 1GCOA 3C1AA 3A2MA 1EVZA 4KDRA 1G8JA 4IJKA 2ZI9A 3I01A 2XUFA 4RLHA 2H1VA 3FYDA 2NOAA 1DP4A 3EGDB 4E2WA 3PC4A 3WZ2A 2P6MA 4BFVA 4UD2A 2ONZA 4M7OA 1PJAA 4F8JA 4MQMA 2ZG6A 1GG5A 5K51A 4BASA 1DC4A 4PLPA 3PU6A 5DMXA 3IMKA 2OGZA 4UPEA 2JLVA 1PWXA 1I1NA 4LF5B 3PQFA 4MQ6A 5LL6P 2X2EA 3QYPA 5A3QA 4BVAA 4XYBA 4RYLA 4ZVQA 1XMJA 2JKZA 2PGIA 4ZT5A 1SUCA 1RLUA 1XXHE 4LRQA 2B4RO 4ZYWA 1XMVA 3TDNA 1NTOA 3R7AA 1TEZA 1U9CA 3ZZNA 1LSSA 2H31A 2MSDB 2YY6A 1YCHA 2EWMA 3PUWA 4L73A 5K6AC 3B3AA 2XCUA 3UGKA 1QFMA 4YR7A 1J1UA 1WXGA 3GA7A 5LQAA 2PWYA 1PBNA 4KSCA 4UVGA 3QKRB 5ILGA 5SYMA 2P9QA 1V3UA 3SVZA 3SSNA 5IYZA 1J07A 3W5SA 3WL5A 4TKLA 1GZDA 1NC1A 3U4GA 2J5BA 3NC0C 5FOSA 4CV2A 5JPIA 1S2OA 2RH5A 2C9YA 1J33A 3N7TA 5DFAA 3OE5A 2QOEA 2VUHB 3K30A 5BNFA 1OZGA 2QIPA 4H7DA 2GK4A 3DKRA 3S1AA 3RT9A 2W2TA 4I9UA 3UJ3X 3R6GA 5DHTA 4JSTA 1YZYA 4UTPA 4FKMA 1ZIYA 3VGJA 4D57A 1JALA 1CU1A 1FNCA 1O5IA 3WWEA 4PNEA 3LA6A 2Y8EA 1SCDA 4AL4A 1SVKA 2CHFA 2R00C 4K9OA 3KS9A 4NYIR 4PZEA 1HOTA 4XCQA 1WDLA 1EDZA 2DECA 1PL8A 1TJNA 5DX8A 3EGDA 1PDVA 2PZLA 3A9SA 4Q3CA 1D2CA 4C20A 1HFWA 2WWIA 2GMWA 4GD3Q 3O7MA 1XKXA 3PJEA 3VR6A 1SUIA 4F9TA 3HH8A 4YRIA 5H9WA 4ZTZB 3D8NA 2GZAA 2V03A 1S0UA 1Q0UA 3LDHA 3UMRA 1KEZA 2DQ4A 4K1XA 3WICA 1AUQA 5F7XA 5HG0A 3AIMA 4B0OA 2I91A 3LFUA 4QICA 5C31A 3TQOA 1RAEA 4PNZA 3LOUA 1RBYA 3H5RA 2WPNA 2Y67A 4GMGA 4V39A 5P8WA 3ZBUA 1V9SA 4CTNA 1N6RA 1XJ0A 4OU4A 4U2BA 5CVVA 2HDNB 2WFLA 5IKXA 1JHOA 2G70A 4JI6B 2C54A 4RJKA 4B43A 1KGSA 1IUOA 4RTNA 1L5NA 3TSYA 2P4UA 4OHPA 1ZSVA 5H5JA 3B5IA 2OGSA 1RFGE 3ZS8A 4Z4CA 1KKUA 2QRQA 5EGSA 3EGIA 2FSFA 2HHAA 5IDWA 3STHA 3HJHA 5D01A 4Q7QA 2DJIA 1PIWA 1V1JA 3V4FA 2RGCA 4QQFA 2NIPA 4DWWA 5K8IA 4CEIB 4K5QA 1Z88A 3K5HA 1YC2A 1XG5A 1J8VA 1G2IA 3QBDA 4XH9B 1M72A 1X7WB 4J49A 1E9EA 1JH8A 1GV1A 1X39A 1ZAYA 5LA6B 3UHJA 4YYZA 4R1OA 5JAMA 4BNMA 3KKLA 4W5TA 1AKNA 3G3EA 3JVEA 3S29A 4R3NA 3ZGOA 3KBOA 1FFXB 2CDAA 2Z30A 2BFWA 3FJOA 4GMFA 4HNHA 3ZBPA 4ENSA 1O95A 5HA5A 3WGGA 1G5FA 2Z09A 1UP7A 3KUDA 3QWHA 3TLKA 3V42A 5FWXB 1O97D 1J25A 3BAFA 3C41J 3K96A 3KSZO 1TU4A 4P4TA 2PL9A 1P3DA 4JL8A 4JLJA 1PV2A 1ENZA 3KQYA 3ZCUA 2OCDA 3D1VA 3HP1A 3JSXA 4G1MB 3DAPA 2JCBA 2MMCA 3L8DA 3ODPA 3RWMB 4HT3B 5K4HA 2XVMA 2BBTA 2OC4A 4E5KA 3MTJA 3ZHXA 1X1EA 2CNWA 3N75A 7AT1A 2W6ID 3SS7X 2QTMA 3VVBA 1W49A 2J0UB 4GOMD 4HAXA 2YRWA 2GPWA 3OQJA 3QEAZ 1T8SA 2NNLD 1NM5A 5GONF 1ADYA 3SHOA 3WA6A 1F1JA 2XYRA 5KYXB 3QF4B 1RBMA 3ENVA 2X7XA 3QE0A 2VDJA 3DV2A 3FSRA 3HYTA 3WJ2A 3S2YA 1XL0A 5EA2A 2Y1KA 1VGRA 3GT4A 2D1RA 2ZUUA 4AB1A 1UUFA 3EVTA 2OZLB 1RYFA 1TJYA 3NHUA 2XEXA 2G1UA 2FJUA 3DEHA 3L0CA 3KZ1E 3L43A 4HB3A 4TGLA 5HZGA 3U09A 4JXXA 1Y98A 3C2QA 2W70A 3G2IA 5BWMA 2H4JA 4XWYA 3C1TA 1SEVA 1X7WA 3OJXA 4K9PA 3TD9A 3NAMA 2QD5A 4ISCA 4QU0A 3WSWA 4CF3A 5LA6A 3S7ZA 1P73A 2V1XA 1OBFO 2WKRA 3U0BA 4Q3DA 1W5EA 1M0WA 2JZCA 1CUVA 2KHZA 1FFXA 3EUWA 3PGJA 3OZVA 4W7HA 4I1IA 3VHRA 1ZD1A 1R6VA 1IXSB 1Z7YA 4HADA 4QWMA 5FWXA 1L5RA 1QV6A 1TPZA 4N54A 4N5HX 1CUEA 4Q02A 1KAMA 3T3NA 4OI0A 1AXRA 4AUNA 3AR7A 1YHNA 3W2HA 4YP5A 2AXNA 5EJFA 2JI4A 2C82A 4C5AA 4D6PA 3VFDA 4KGXA 4TMTA 3E3LA 4X3CA 3OZBA 1KMNA 1HNNA 1SWWA 1C0LA 4HJRA 5A71A 2A3RA 4CMIB 4F7DA 2J0UA 3NVDA 2VNJA 4QGBA 1MAVA 4LY0A 4JU9A 2RG1A 2WTXA 4EW6A 2WU3A 5LLDA 2ZI3A 3FUCA 4MUNA 3U1VA 2GKSA 4D3SA 1Q0LA 4MUKA 5KYXA 3QF4A 4DLYA 2CMHA 2R1ZA 4YMWA 3VC7A 3T1YB 3S3TA 3WMFA 4BLWA 2CW5A 1KGDA 4XGQA 5A1TA 1Z68A 2BKLA 2B0CA 3IAAA 3LH5A 3FBWA 5LP6F 4OGFA 4GOOD 3VR4H 3ZCSA 2X0NA 2OZLA 3KOWA 1I1QB 2EHDA 1BD3A 3LNCA 5KHAA 5M29A 3HRHA 2WFMA 2O8CB 1SIOA 3B48A 6Q21A 1IBSA 5DNCA 3GRKA 1G291 3CW9A 1B8OA 4P0PB 1RPZA 1JHQA 4FFWA 1VJ5A 1GCUA 1YJAA 2AUMA 3EC1A 6PFKA 4E07A 2VYVA 3NMUF 1CJCA 3ILSA 2ZAMA 3BSSA 3LP6A 3KUKA 1YK1A 4F4HA 3MNFA 5CLQA 5THQA 3ZW8A 3S4YA 1X7HA 5HFNA 3FSEA 3ITNA 1BNCA 1E3JA 1N7GA 2CBXA 3KKZA 5I4KA 4E15A 3ZEAA 4FSDA 5CLIA 1YQTA 4IIEA 4M6WB 3GARA 4HJXA 3ZK7A 3QVTA 4W1RA 3H1FA 2ZE6A 1N77A 1ORHA 1NUAA 2AX4A 1A50B 5EHIA 1RIIA 2GN8A 2JCVA 2X15A 2V6GA 3OEWA 3ZCQA 1BIFA 3BMNB 1RAAA 4YN3A 3UUWA 2BI8A 4AMUA 4AJLA 4MVJI 1U2DC 4WNCA 4C14A 3NTOA 1E9VA 3OIGA 3GH3A 1GZ5A 3P2JA 4A8JB 3B78A 1R16A 3FOWA 2IEIA 1NMXA 2AE1A 1TM7E 1E9FA 2JASA 3PNBA 2VFAA 4I4TB 4CMIA 4FIDA 3OCZA 3PQCA 4JYPA 4BE4A 2B34A 4L3OA 1NE7A 2HO5A 3AWIA 1T1GA 1A9QA 4I9GA 3FGPA 1NLMA 3VX4A 3PPIA 3FFBA 2XKBA 3IE2A 3BWXA 3RSQA 1N3IA 3WK4A 4Z4HA 2HNBA 4W9MC 2C95A 2XE8A 2P9EA 3AW8A 1Z36A 1LX7A 3TN7A 4PZLA 2VIIA 1YKGA 4OHZA 3RS7A 4D6XA 5AI5A 3AVPA 1EB8A 4AC9A 4M9XA 3ETGA 3KNZA 3W5DA 2HV9A 2Z3WA 3K0KA 3GT7A 3H2IA 2G5CA 3GT3A 2H5JA 1KO1A 4IX9A 4P4LA 1RYNA 3JQGB 3T34A 3NHSA 4ASUA 2ZATA 1TF7A 3AR4A 3NV9A 4HHEA 4MWTA 4PIPA 4AYXA 2H1OA 3OCVA 3MBKA 5KSZA 3TLBA 1DHRA 3GGJA 2VDKB 3M2PA 3UK0A 3LYAA 1ID1A 1E1MA 3A6GA 3UHAA 5DJ5A 4BUCA 2QRHA 3LBFA 1I2CA 3OFND 1PDWA 4OMCA 5KJEA 1EWRA 2R9VA 6CHYA 1OA1A 2UV8A 5DX0A 1E79A 3B89A 1RXVA 2OAEA 4M6WA 4MJLA 5FEMA 5I5GA 4DKXA 3A32A 3HCNA 4MMZB 2W2QA 4TLCA 4QGSA 1FZTA 2MT9A 2O19A 5C32A 1OC2A 5EP4A 5FIUA 2I4TA 1RRCA 4TXJA 4TSRA 3BMNA 5IULC 3EVGA 1NNEA 2VHCA 4D43A 4DJTA 2M32A 2VF8A 1ULSA 5EXDA 4DF3A 5C8YF 3IMGA 1U1CA 7REQA 2VPXA 3UAVA 1XLVA 4A8JA 2UZ4A 1FEZA 2YX1A 2V97A 4I4TA 2JLZA 2JAPA 2Q21A 4L15A 3VJKA 3DDOA 3A2LA 5F77A 2O7QA 4GPD1 2GM5A 4HWSA 1QYWA 4DZRA 1VA5A 2DUWA 4WN9B 5G02A 2O1XA 1RE0A 5M5BA 5FBZA 3FUVA 1K3TA 4NMXB 1JI3A 1U7ZA 3KJQA 1CERA 4RHEA 1VE9A 2WA1A 3GJRA 1ZUWA 1MPTA 3KYCB 1E99A 4KYVA 1D8AA 4H7EA 2IGBA 3JQ9A 3JZAA 1Y3BE 2OM2A 2RHBA 3QM1A 4YAKA 1MJFA 4TMYA 1CJTC 5J5VA 4HN4B 1JBEA 1QTIA 1E18A 2BFOA 3LUFA 4KQKA 3PGVA 3A4TA 4L02A 3VMFA 5AP9A 4PN3A 5B7PA 3C8ZA 3EH2A 2AB0A 2H9AA 3JQGA 4Q01A 4YUWA 3F3MA 1T25A 3BWBA 2XHEA 1X1SA 4PYJA 1L6RA 1U0RA 3L8CA 1A1VA 3SZOA 1ZIXA 4A23A 1JILA 3VKFA 2J3DA 1X8XA 1QHXA 1LU9A 1I1HA 2YXDA 3SJCA 2G5TA 3DHEA 3W5UA 5JYCA 3EQ6A 4IVRA 2IYZA 1RXUA 4EW3A 1M67A 3NJ8A 1GEEA 1NWHA 4NV0A 3W1VA 1E1DA 1P2VA 2H9IA 3AI7A 3ME5A 3H65A 4NYIQ 3SMVA 4AXBA 2DPMA 1L4BA 5K2OA 1EJ6A 1U1FA 3FR7A 3R5FA 1Q50A 3KVYA 4X93A 2JFPA 2WYOA 4MO9A 1EVLA 3IB6A 1UAAA 1GILA 1E5LA 1OAOC 2VR1A 3OZEA 3QV2A 1X70A 3ZTWA 4U7JA 4DCUA 4BRZA 2YASA 4RVNA 2VDVE 5IUKC 2GM9A 3PNVA 3KQSA 3KP1A 3GGCA 1SCBA 4G86A 1YDWA 3VU3A 3K9CA 1ZNWA 1OWMA 4MOWA 1E32A 4RQTA 3NYIA 2SHKA 4HVTA 3O31A 1ADJA 2X0RA 1T9BA 2JIBA 1EPUA 3CH5A 4ZQBA 1DI0A 4RTLA 5J4LA 2HMSA 2NSDA 1SHJA 1N5LA 2PGNA 5EJ6A 4KQJA 5ITVA 5ELMA 2Y2VA 1BSVA 1FVHA 2N47A 1E2DA 3AU8A 4AJ9A 3DKIA 2EF0A 4HQKA 1G8YA 1M75A 1IZ0A 2W8BB 4RA6B 3TIIA 1LBTA 1QCDA 1U11A 2QUAA 3EIOA 4GWKA 4P7JA 2BZGA 2IUTA 2VPZA 3CNBA 1V4BA 4D02A 4G0WA 3TBHA 4MDFA 3LWNA 4ND5A 3RHFA 3PKIA 1N75A 3IOEA 1TZJA 4RHCA 1GPMA 1TVEA 3MWKA 4YDSA 3LBAA 3KQOA 2CK3D 4AF6A 3F46A 2IOYA 1RZRD 1RIFA 2I6GA 2VH5R 5JTTA 3NGXA 4DAOA 4KBYA 3HCCA 3PVSA 5DU2A 4E4TA 2F64A 2PKYX 5CW1A 4HPWA 3SC4A 4N48A 2Q4OA 1UJ4A 5KYYA 1MBZA 3FFXA 1EKXA 1F14A 1L5HB 2PMCA 2XNCA 5E2IA 5AW0A 1T9AA 1V7QA 1QYXA 2VPTA 2ZUFA 1DXQA 2HF2A 2XPCA 3AR3A 3D4NA 3VYWA 3ZXYA 1U8FO 5BQFA 1C8VB 1QQ5A 1ZI8A 3QJGA 3HADA 2PZAA 1UC9A 5GOTA 4YMTA 8ATCA 2I8LA 1XDWA 3LBYA 3ORHA 4IQ0A 1MB3A 1EAYA 1K6MA 2VYND 1P5JA 4OGLA 4FYXA 2ZROA 4OLFA 4CKCB 1XZLA 1A4IA 3UT0A 1EEXB 2A58A 2A8YA 2RHRA 3OIDA 4JUFA 1NNUA 1QPGA 2GBLA 2TMKA 1Y34E 3R20A 1WCYA 1R7RA 3HYLA 4II7A 4QTUB 1GCAA 1BCRB 4JI0B 2ZJ1A 5DVZA 1ZJJA 1SBTA 4EUNA 4HZGA 1ZCJA 4ZYLA 1P18A 3FAKA 4B4KA 3MN1A 3RYTC 2XUKA 3V6LA 4XX1A 4ENWA 1XJWA 2JVJA 4TMXA 1QVVA 5GIPE 4R7GA 5DCWA 3TLYA 4DLNA 1H65A 4MR7B 1FQWA 2JIDA 3TVTA 3HJTA 2JHAA 3WGOA 4JI1B 1A8PA 3FWPA 3JAKB 4JASB 1P77A 1UOEA 3TQCA 2QTVB 2W8BA 4RA6A 4FZJA 4HV4A 2GZDA 2P2YA 2Q5JA 4EHBA 3RC2A 3AXSA 3BERA 2OBYA 3PD0A 1WDTA 2FPPB 1MTOA 3DOFA 3B2QA 3MWLA 3T0GA 3PNQA 1MAUA 4OVKA 4KXLA 1RXWA 1U0LA 1UJMA 2FJPA 3I1YA 3WGLA 5KYNA 2V98A 5G0WA 3RJ9A 1IWOA 2JEZA 5EXPA 1UP6A 1WP9A 3CMCO 3FVQA 2FMKA 1H23A 5ITSA 2JFXA 1RNLA 3H9EO 4RIHA 1Y4SA 2QX6A 3ZJYA 4F1KA 4EKYA 2HH9A 4RFSB 1ZH2A 1L5HA 2JL1A 3F8WA 3VO1A 2WOJA 5JEEA 3KZOA 1Z45A 1TEVA 2B8TA 1TZMA 1NNLA 2PX0A 3Q87B 4QUHA 1PVDA 2C83A 5T8KA 5TPWB 4UEWA 3W2GA 4EEXA 4KMMA 4HEJA 1DS6A 1QRAA 3H04A 3JYLA 3M9LA 3OEYA 5KVQA 1HXHA 3TLJA 3L7CA 3UH0A 4OOFA 3DTVB 4NQRA 3QEBZ 1AHIA 2J3IA 3N6XA 1DELA 4KG7A 4MZDA 5DT9A 3ZCVA 1CTQA 3NORA 2FK7A 2CN1A 3RSZA 1Y9DA 4YP9A 2I2CA 3UMSA 1RC0A 2GUWA 3TINA 3PFHA 3QW2A 3T4EA 1QG6A 2EGUA 1XRQA 1YS4A 5IBRA 2QLNA 2ZPAA 4UD6A 3NIDB 5JADA 2I6FA 3AOGA 3DVRX 4OL9A 5BSWA 3L0BA 5BMVB 1AZWA 3S70A 2HZBA 3EC2A 3ZBTA 3UC5A 1YXMA 3ZZMA 2MSLA 2P2CA 2P1ZA 3RO7A 2GTHA 1Y4DE 1ZK1A 1TXGA 4MR7A 3NHZA 1GG2A 4RFVA 121PA 2AX3A 3HJUA 2WT4A 4QUGA 3GLHE 3O93A 3TECE 4YRSA 3ZJUA 1VHTA 1H2XA 2Q6LA 2QTVA 1EB9A 3KQVA 4RF4A 5CD9A 5JXIA 2HRDA 4YYEA 3ZHRA 2H1CA 2QORA 3D2LA 4Y2TA 5F2OA 2FPPA 3OD1A 1GRRA 1OA0A 3WNVA 4CVNA 4MQLA 1B7GO 2P4HX 1OZFA 4RNDB 3MMXA 2C2ZA 2BGKA 2WKSA 1PL0A 4RGYA 1OHHD 3UWMA 1K6JA 3ZH9B 5B1EA 4ZCSA 4GH5A 1IQUA 2G9NA 4B74A 2AVNA 4XFJA 1FA9A 1ST2A 2WIFA 4GSYA 4OB6A 3GGSA 3WLMA 3ZS9A 4ZV7A 2CB9A 2VLIA 2AR7A 2WFAA 4JUIA 1VJTA 3FMGA 4KLAA 2Q2WA 2BHLA 5CJPA 5J5AA 3SBDA 4RFSA 3J81A 3THWB 3TQFA 2GZ1A 4G1EB 4WINA 4FLMA 4OBWA 4D4HA 5TPWA 3CF6R 5H4GA 2P0AA 4N82A 5A3JA 2ZOSA 4GYWA 2HXSA 4NENB 1UPCA 2RC5A 4OMUA 3BMXA 3FR8A 4N8DA 2AJCA 4UUAA 1FSGA 8LDHA 5ESRA 3HO8A 5IH7A 4NBUA 3AETB 4G4GA 3RIGA 1QX3A 1P2UA 1Y3FE 2C0PA 3HDVA 4NS4A 2C9OA 3W1WA 5K99A 1EJBA 3TGWA 1VYUA 2R5WA 4TYYA 3GELA 3IGFA 1FYXA 1T9KA 2PPVA 1ZC4A 2ZS7A 2ZWOA 4GR9A 4EBFA 2HDHA 4JBGA 4BQSA 4QYSA 1A7JA 1L5QA 1JKFA 3CH7A 4WHMA 3VH4A 3ZGYA 2HFKA 1A98A 4OXYA 4PR3A 4W4TA 5BMVA 2FWJA 1NW5A 4IIYA 3NCHA 3V1LA 3U16A 3IIJA 5KNBA 3FN4A 1BE8A 4C0JA 3V8MA 5L6LB 4ARSA 1WD5A 1HDYA 4UNRA 2GX6A 4YAGA 3T7TA 2ZSIA 4TTIA 3V1MA 1E3EA 5TJ9A 3A3KA 3EEOA 4IQ4A 1IXYA 4OP1A 1VI5A 1CHDA 1FIUA 3DPUA 1VLVA 3LLCA 1G6KA 2P6UA 4DR5B 3R3SA 1MW9X 2QLLA 3K53A 4US2R 1HL7A 2ZJ7A 4FJ1A 4IIXA 1ONSA 3NB0A 3GR6A 1DAMA 1RHKA 3LM8A 3MGBA 1EQAA 3ICOA 5FLKA 2PVSA 3NOOA 1PQUA 3OU7A 4IQ8A 1CBUA 3IILA 1T0PA 5ERGB 5C7OO 2DOKA 4XQCA 2FF7A 2QMQA 1NLUA 3H97A 3THWA 2IV2X 4B8WA 4KGDA 4OJTA 5KWJA 2I7XA 4Y2XA 2Y1GA 4C7XA 1UF9A 4NENA 3RS3A 1RLTA 3QXHA 1EIZA 3CRZA 4HLUA 2D5CA 4R68A 3IPRA 4NWIA 4S1PA 1T3HA 5ERYA 3ZJ4A 4AJNA 2QU7A 3IBGA 1OKKD 4J2HA 3AETA 5DK4A 4E0BA 5L8VA 2CLEB 2I2BA 4ND3A 3A1CA 4RGQA 4WOKA 3P52A 1BRMA 1GUDA 2GXAA 2VUTA 2YZ2A 4KFUA 1W8IA 3OF2A 4YQZA 1K89A 1Q57A 1WDMA 1KJJA 3EVAA 3EQ8A 3HB1A 5EJEA 2C59A 2B7BA 1IBMB 3HNPA 5JOQA 2WINI 4N5DA 4QQ8A 5TQ0B 4F4IA 4ZTUB 4XIJA 5BR1A 5FOXA 1E9RA 2CJWB 1KAOA 2A9JA 4NF2A 2CHUA 5UKDA 3F4KA 2NU6B 4KXWA 4E5UA 4YAEA 2WF8A 3IDZA 4MUEA 1ZGJA 1G5IA 3HU5A 4FK8A 1RHQA 3HV2A 3L2OB 5TIIA 4DLAA 4DCTA 3F96A 3M5PA 2Q7DA 4GZLA 5JFGA 4LDAA 4E13A 3WBFA 5CG2A 2WQ7A 3AF5A 5IM4A 1Z6YA 3ONVA 1G7SA 4DQDA 1IUKA 2CCKA 2GA9A 1SELA 1ZKDA 3HK2A 3F7NA 2OK8A 2XTJA 3ZCTA 2ATCA 3TOVA 1WXWA 2C42A 2BFBB 1LRKA 2XW6A 3GK3A 3PC8C 3E05A 4W7IA 2RE8A 2RH8A 1JE0A 5L3VA 2UYHA 4M0KA 2OO5C 3H4TA 2H1HA 1WG8A 1XQXA 2C4WA 3PFBA 4UHCA 1ZITA 2CZCA 3UKJA 4CIVA 2JFGA 2WVHA 4AT1A 4D5EA 5EQFA 1HRDA 1YB2A 3RSFA 1ZEMA 1SK8A 5EQTA 4FMCB 1Z5GA 1ZYUA 3EC7A 4NMWA 4W8HA 5M7EA 1MZPA 3H17A 1ZXXA 2AF3C 2J9FB 3DFZA 4JJKA 2C5LA 3WWYA 2WE8A 3EG5A 4JDPA 4MKZA 2FE4A 3IAS1 2YMPA 4ZEXA 3O91A 3U17A 1UJCA 2A0KA 1ZD9A 3D6UA 3PSHA 3WIVA 3GN2A 3FPBA 1H3NA 3PUYA 4DBVO 1J0BA 5F9HA 4HQLA 1YI0A 5C8ZA 3VOAA 3IQZA 4LFCB 2AN3A 3AKDA 3GDFA 3GUZA 2HJGA 1X94A 4JB3A 2V6BA 1P0FA 4ZVMA 3OBIA 3WL4A 4EG4A 2F8LA 3MTEA 3HXMA 1BEZA 1DAEA 2X3FA 1QGUB 2CJXA 2H1IA 1XLUA 1ZJ5A 2NUPB 4NESA 4WY5A 2JVIA 3O7WA 5TQ0A 4DMLA 4AF8A 4Q9NA 4BGVA 3PNLA 1SXHA 2CJWA 4G07A 3PEEA 4OXQA 2HO4A 4YT8A 2FW0A 2NLOA 2NU6A 1MO4A 2QM0A 2ATXA 4M89A 2NP6A 3HDJA 3TAXA 4UHJA 3V33A 1NVAA 2J9GA 1K7YA 2LGJA 1FVOA 2D2EA 2XNDA 2PTGA 3INNA 1R6BX 5AVKA 3WLTA 4OIMA 3QFRA 1MZVA 3QGMA 1E2EA 1L7MA 3A27A 2JI9A 4FT4A 2NW6A 4E46A 3LKVA 2L82A 4BKMA 4FZVA 5ED4A 4ATNA 3MYYA 4QGFA 1ZD2P 2P2GA 3PX2A 1Y1KE 2BFBA 4Y7DA 1GKUB 4KAAA 3T7IA 3ZWVA 1JFSA 1FPMA 2BEKA 4XYGA 2OHGA 1WUJS 3P0JA 4OSPA 1E9AA 4FR0A 1S2LA 1MB4A 1AS3A 4E2FA 4DR6B 1C9YA 1VMKA 4V0QA 4O2AB 3MUOA 3R0XA 3VBCA 2F3PA 2HCTA 4WFJA 3JATB 3TUJC 4OI4A 2YZMA 3UXHA 4DA0A 3K09A 2E4ZA 2VUIB 5KQRA 5HUHA 3FNIA 3SWWA 1VLZA 2O2SA 3U0VA 2YTZA 4HDMB 3TMAA 2J9FA 1F2UB 3T15A 4DM3A 5IT9A 4M8IA 3N2ZB 5IYZF 1SG6A 1QVZA 1Z2AA 3BH0A 1I6LA 3GRRA 4TXNA 4YNBA 2J5QA 1Y6JA 2JHFA 1Y3HA 3CJRA 4DSTA 1TM3E 1QRSA 1K06A 4AN0A 3QUTA 1OI7A 1QDLB 1MEEA 1T9DA 2EHJA 4BDTA 1DKUA 2IODA 3GLQA 4FYVA 1HYBA 1QGUA 2NUPA 3NONA 1UJ5A 4JT4A 4BFYA 4FOLA 2GOYA 2BR5A 1U9IC 1NT4A 4NE7A 4ALIA 1UOOA 1WW3A 4B4UA 4ER3A 1JHZA 1GSHA 1JECA 3N58A 5IEJA 1L9XA 1VL1A 2AW5A 2CLSA 3ZXIA 1FW8A 1M8KA 1VOTA 1XK6A 2IYLD 3KFVA 4P31A 3T4PA 3E53A 4XOIA 4GXQA 3RFFA 1HFEL 5KJ1A 1DXYA 1FFEA 3WX0A 4DBLC 3RU7A 4P9NA 1ZU5A 4F7WA 2R97A 3RYHB 1RQ2A 3E4DA 3U61B 1GSOA 2ODWA 3WY9A 3ZUPA 4JN6B 1VIYA 5AKYA 1SKBA 3RSGA 3OZWA 1R5OA 2OG2A 2ZAOA 4RHYA 1ZM3A 3RQIA 4QXAA 3D43A 4GQIA 1PKXA 1NUUA 4O2AA 1R9JA 4LK2A 3HKEB 1GO2A 5JD3A 2EX1A 3JATA 3OF5A 4JR0A 3RRXA 2QLBA 3G79A 5IVIA 2MIIA 4ABYA 5KNDA 3JQ8B 2BGGA 3I23A 1B23P 5F1OA 4UJ3A 2A5LA 1LVUA 5DCUA 4G85A 2Q28A 2VYCA 4NYMR 1V9LA 2WIDA 4KR2A 2HPVA 2W2MA 4HDMA 2NO0A 5GP1A 1RWXA 1SY7A 4J9VA 2WMDA 4MAMA 3CFYA 4MV5A 2P9FA 3HI6A 3QPDA 4KJZA 3QIAA 3EZ9A 4LVUA 5EUBA 4AJEA 1DE0A 5EJ7A 2B9EA 2PMKA 4EAQA 2QMYA 2ZAGA 1BVHA 1I0LA 1W2HA 1YRWA 2NGRA 2OXCA 4GGPA 3CTPA 3G02A 1JHMA 2GEJA 4OQNA 4D82A 1YZFA 1YE3A 1EX1A 1MC5A 4HO1X 5EWJB 4J1NA 4P34A 2PTHA 5FQNA 3UK2A 4EFDA 6ADHA 3OLWA 3MA0A 4Q3KA 3UJNA 1Q0PA 4W7SA 1YZHA 5EIWA 4IDPA 2AJ8A 3DBIA 1DIGA 5C8XA 1F17A 4RY9A 2FSGA 2R47A 1JLRA 4TSFA 3TR6A 3ONWA 4L07A 1T91A 1SIWA 4OBBA 2C00A 3E8SA 2UUPA 4IUYA 1J2JA 5DTEA 3RWBA 1JJ7A 2YXBA 3LRXA 3OQVA 4UVEA 4YMVA 2I67A 5A4DA 2CHGA 3GA5A 1GL3A 5AI0A 4KMRA 3VH2A 4F5DA 1ZN8A 2EIHA 2X0FA 3R40A 1PL7A 1DMRA 2C9MA 2RI1A 4AN1A 4PGAA 1P9WA 1RTTA 4S1VA 1OXUA 5AKEA 2II6A 2VBIA 4FYYA 4AJIA 2LDXA 4HSGA 2ZR8A 1EGVB 4D56A 1OIVA 4MVXA 4IJMA 4KUGA 2HMYB 4PR0A 4X8MA 2BBOA 3H84A 4N3GA 2E82A 4HVAA 3HKEA 4RCVA 4Z1OA 1DCFA 2IUUA 1EUQA 2FFAA 4AZ3B 3O2QB 3UW3A 4A92A 3JQ8A 5BWLA 1H2RS 2Y76A 1K5HA 3PVZA 1YE8A 4MI3A 3A2KA 3CF0A 2QRGA 1RHRA 1ZU4A 1SVSA 1XXHA 3LVFO 5I3ZA 2OHOA 4KLRA 2UU9B 5ICCA 1NMQA 3COYA 3VAYA 4EI9A 2WTAA 4LGCA 1S89A 3QZUA 2Q2NA 1RBQA 2PLRA 4TL7A 3Q8MA 4FILA 4L50A 4B3IA 4DIOA 1U8TA 2F6RA 3DO8A 1G1MA 3PZRA 3F2VA 2J7PA 4EITA 3ISJA 5IAJA 4QPJC 2YUTA 2H4YA 5AK3A 5LA6F 1AHNA 2REBA 3JYOA 3T3GA 2QAGB 3WTBA 2BY4A 2PG3A 3DOJA 3P0RA 1DX9A 4J7AA 3CLUD 3I0NA 4LEIA 1D2MA 4TTRA 1KDOA 3B53X 1N0WA 1ZJZA 3WL7A 2Z8YM 3A0UA 2OCYC 4ITVA 4DLLA 1U3GA 3VMMA 2FPIB 4Y9TA 2P69A 3HCOA 1KE1A 3RLIA 2HFJA 3DYVA 4D9IA 1IM5A 3CJTA 4MGYR 3IAEA 1N3LA 4WDRA 4ADSG 4KK4A 1QZTA 1KQFA 4KRFA 3Q9SA 1PJZA 3QU5A 2WABA 1RRKA 4OA8A 3CNHA 2CFTA 3NU1A 4H6VA 3HTXA 4RXTA 3TSOA 2HR1A 4Q82A 2DCUA 1NXVA 1ZUIA 3OIVA 1SVWA 4MP3A 1E1CB 2D00A 1ZHHA 4I36A 3MGAA 3KJEA 5HQ3B 8OHMA 1JIVA 1HT3A 3K73O 1G7TA 5ALTA 1MF7A 2WU1A 4LRXA 3G68A 3PA8A 1DEAA 4NFHA 4AZ3A 3DBOB 1P7ZA 5DZSA 3F1KA 1UPBA 2VRWA 4DREA 4KE8A 3UJ8A 4DCSA 1PZEA 3B6JA 4WXRA 4EKDA 2IEGA 3GEBA 1JMYA 4YCDA 4ENTA 1ABBA 3KETA 3M9WA 3N87A 3SYLA 1C8LA 2FUKA 2QJRA 1CJMA 4JLSA 1AQJA 1M73E 4DHEA 4IEEA 3VR4D 1RAGA 2I1LA 4HDKB 4FINA 2VDWB 1H2ZA 2GYUA 1UQTA 4J0FA 2P2NA 2VRNA 4GBGA 2GGSA 3SX2A 1OZAA 3B8EA 4FGLA 3U7GA 1K6EA 2LD4A 4B87A 1DRJA 1AO0A 2VYFA 3HVIA 1SZCA 2B5WA 4AZ0B 4ZRNA 1AK1A 2QAGA 2ZB3A 1W5FA 3HSYA 5CGZA 2Z2YA 5DGXA 5J2TA 2V6IA 2XB4A 1SG9A 3IMFA 1T26A 4P54A 4DV0B 3UC9A 3CVVA 3MRXA 3IALA 1TYBE 3S40A 3ZGLA 5A4FS 2FPIA 3LX5A 4OG2A 2ERXA 1W75A 4R8SA 2G6TA 3QBJA 1NBMD 2AFHE 3KUUA 3W5HA 3ETJA 2BTOA 2WHRA 5CLFA 3JASB 1DEXA 4AX4A 2REXB 1JQ5A 2DM6A 3ITKA 5TT0A 1RLMA 1F8UA 4MPPA 4RE5A 3II6X 1D3AA 3HM9A 4F9GA 3T7SA 1EE2A 4GPBA 5FADA 3V7UA 1E1CA 5CDSA 3GUCA 4KE9A 4DN6A 3JY6A 3SI7A 1U9ZA 5HQ3A 3N8HA 4QDUA 1EDBA 2WWFA 1VSQA 3MFYA 5D84A 3K0FB 5H3CA 3PUZA 1VE6A 2GSWA 2OLJA 2VUUA 4WT7A 4XYEA 1EVQA 1I2BA 1J0XO 2HQ1A 3EULA 2WHEA 5KQSA 3ONFA 4MIKA 3RAGA 6YASA 5AI4A 4UTZA 1FY2A 1VHLA 3EVFA 5DGTA 5M2QA 4R1MA 4U7HA 3ZLUA 4C06A 3N53A 3L7MA 3LF1A 3D6TB 3E9EA 3GJ0A 3K6KA 2VDWA 1ZOOA 1T3ZA 2Z6UA 3DLTA 1U1IA 2RFLA 4DT1B 4RLFA 5DISB 5CDYA 1DWUA 1JSCA 2IYEA 5ECWA 2GD1O 2WZBA 2CXOA 1E5TA 2Q5EA 4YO7A 3UPDA 5IUJC 4GW3A 2JBHA 1NC3A 1WABA 4RZXA 3SX0A 5F4BA 2TMGA 1MJ5A 2WV9A 1Z15A 2ZB4A 2ZYWX 3M3PA 3THYB 3AVVA 4E5VA 2W6NA 2C8JA 4DRXB 2ZIFA 3KL4A 3ABIA 1QRTA 5HRAA 4HDAA 4JSRA 1DXOA 2GK3A 4XLZA 2DEUA 2J3EA 1NBAA 4X66B 2BMVA 2QRMA 5BPHA 4J0KA 2FZWA 3BKWA 3A37A 4QYIB 3PSAA 4NSNA 5A1JA 2RI0A 4G97A 2O54A 4TKVB 3RHTA 3JASA 3OLYA 2HBRA 4NBVA 1ZVKA 5KPDA 5TC4A 2QTLA 1QYVA 2XB6A 3GAAA 4E51A 4QUDA 1XTPA 4H16A 4K46A 3WJ7A 2PJUA 3L41A 1I7SB 5JCOC 1YTUA 3IA7A 1N33B 2UYOA 2ERYA 5LCXA 4HN9A 4I4TF 2OCBA 4QECA 2IV3A 3DFKA 5CG1A 2JEOA 3J7AC 3VUFA 4M8LA 1B93A 3EJWA 4KVZA 3W6NA 5A04A 1CRZA 3BMCB 3F73A 1KH3A 2AV6A 2Y92A 4IDGA 3K0FA 3KKMA 4IXDA 2NQ8A 5K0NA 3ZHQA 3LYUA 3F49S 4MTCA 5E95A 1T2UA 3I28A 2PJDA 5SYNA 4CCYA 1T6NA 3V3KA 3KPWA 3LT1A 3QKUA 2BKUA 1Y81A 4BNFA 5F23A 2ZBPA 1EVJA 4RUKA 5ALXA 3JS5A 3OHPA 3UIEA 3A2NA 1HF3A 1KJYA 5IBCA 2Q6TA 3F2IA 4LBZA 2FQ1A 2WG1A 4BO3A 2CXQA 2P9BA 4G5GA 5EUCA 4B4VA 3K31A 4DT1A 4UUBA 1UBGA 4GS5A 4RPHA 3WK9A 5F78A 4Q3BA 2PWPA 1IZYA 4PPYA 2Z58A 4I99A 4MWOA 1I13A 3HDYA 4W82A 3THYA 2R1VA 1E63A 3TW0A 4E14A 1XCOA 3DOCA 5I47A 3DMRA 5ICSA 4BMOB 3DO6A 3W3AH 1J0DA 2OD7A 4UE3S 3EVZA 2N9UA 7ADHA 4LHWA 1FRQA 1P1FA 5JNWA 3TLXA 4RVHA 4QYIA 2H5IA 3QPWA 2EJWA 5TGZA 1BGVA 1SVOA 3RDPA 2D7DA 3HABA 4TKVA 4QOFA 4AP5A 3VHXB 1GIAA 4OJNA 2XBMA 2DFVA 2YHIB 3NM5A 4BVGA 4WNIA 1M9NA 1SKAA 4OHCA 4TKUB 1J00A 1GG9A 2GLTA 5AXAA 4MRAA 3HBJA 3ABOB 1OBCA 4WZAB 4COOA 2WSSA 3HVRA 1J2RA 3IEKA 5DHRA 3SIPA 2OG1A 3RODA 4JP1A 3SQOA 2C7GA 3O1IC 4YCAA 2ZIWB 3IKJA 1D1PA 2PSHA 3QMWA 5BYBA 1ISGA 3BMCA 4H27A 1G2OA 2JI7A 4EMUA 4J9UE 1ES9A 3K8OE 2MWMA 1N5MA 1DJNA 1JXQA 2OAQ1 2AN4A 4IIBA 2R8OA 5DASA 3ZY2A 3GLIB 3WQSB 4J2TA 3FCUB 2QVYX 3UH1A 2RGDA 1YVEI 3HRKA 3P5SA 3PRJA 1C9DB 1O94A 5FFFA 3STYA 3GDGA 4B3HA 5M34A 1Z82A 3QKWA 1OOEA 4Q4LA 4FNAA 3M3DA 3B1YA 1KJQA 4QGHA 3PA6A 1OASA 4LYGA 3L05A 3PE4A 2B5VA 1K0FA 2PMDA 3V7NA 1JPVA 2XUIA 2Y1LA 4F3RA 3TFOA 5LZ7A 2OXFA 3JW8A 1W36D 1MDBA 4ZODA 2JFZA 4ES6A 3UMYA 3U5ZB 3DC2A 3TW4A 2B4TO 4S05A 1NXXA 5LMNB 4LF6B 4DEXA 3RRBA 4K0KB 1NLFA 3CTMA 1KIFA 4ME6A 2Z98A 3MT8A 1C8KA 1D1QA 1GTMA 1TTHA 4KVGA 4O1HA 1QC5B 1DJQA 1Q92A 4CFSA 1NF3A 1UFOA 5LWQA 4GOND 1I1OA 4CQJA 1VDZA 1Z12A 1TF2A 1NRWA 3CXRA 4X95A 3VZQA 1OXSC 2OLKA 4G0UA 3CUYA 4JA2A 1CNMA 2KI5A 4QUAA 3SZUA 4JH0A 4JGGA 3IVGA 4MLDA 1ECGA 1XNHA 2G72A 2VJKA 1Z6QA 3IEUA 3R4CA 4U6QA 5I7AA 3REQA 3W3ZB 1KJZA 2FWAA 1U81A 3M5CA 3QHPA 2FOXA 4RTKA 2WIKA 4XRGA 2JLWA 2G1JA 1FC0A 3LQ1A 4DQ0A 2X1MA 4WL0A 5SYAA 3KYDB 5BR7A 5AJZA 3C4JA 5U4QA 1NL3A 1CX9B 1N5DA 3VHXA 1UBSB 1A27A 3K20A 5CR9A 1S2NA 2JAWA 1T3GA 4TKUA 2IIQA 4QOEA 5F1KA 4AWXA 2I33A 5G3ZA 1YASA 1GEGA 4BE7B 1GKKA 2O5RA 2AR0A 1JJAA 3TRJA 1JZTA 5JJCA 2E4VA 3KQTA 3NZEA 4RL4A 3EVCA 2ODAA 4RIEA 3T3DA 4CNQA 5AJYA 3N2NA 1YJ8A 1T5DX 3DKVA 2V7BA 3GH1A 1G8HA 1KZ7B 3GLIA 1M1NA 5BV1A 1H4VB 4PC6A 1Z16A 2KMLA 4A0SA 2ZDHA 3FBTA 4OH7A 2H7CA 1WE2A 2FPKA 3KPUA 2P40A 1KZ9A 3IPXA 4UAJA 5E7JA 2VPYA 3FTDA 3A6JA 3MTDA 4J1TA 5MN5A 4O6VA 2XKKA 5C4MA 1KNXA 2JNWA 1P1RA 4HDCA 2BAGA 2W93A 1Z06A 5E7IA 4RSRA 1LPBB 2VP5A 4WCVA 2OFXA 1VG0B 1QIDA 1U0SY 3KKNA 5E1DA 4D9GA 2Q0QA 3NEAA 5DDIP 5JSHA 5DYGA 4A0QA 1S7GA 3JQEA 4F3YA 4D9JA 4CKZA 5B1IA 1N2SA 4MCIA 5T67A 4R98A 1XDSA 3CGGA 3M3HA 4MCHA 1RWBA 1Q7EA 1ZXBA 5GJVC 1QC5A 3MCAA 5K4GA 2F3QA 3EA0A 3E8MA 4R2MA 2E5FA 2Z5GA 1OYVA 2XUQA 1YZNA 2H6EA 3RH0A 3JWIA 4IH9A 1N0HA 2N3ZA 1KQNA 1YL7A 2FRDA 4B1FA 1C1DB 4YRCA 4NCBA 3WZMA 1EGAA 1T34A 1Q0RA 1LGYA 2DT8A 1T2NA 4FYHA 4ZZ0A 3ABSB 2HJVA 4CL3A 2Z04A 2H2DA 3HMKA 1PZFA 2KJQA 2WICA 3KYDA 3L9XA 1JQEA 1WLSA 3QWAA 4A27A 3A6KA 3X2EA 5JNSA 2YJTD 3I09A 4AKTA 4AULA 1FP6A 4LBVA 4Q3AA 5COQA 1U8UA 4AZVA 4QOHA 3ZWDA 1KDVA 5HKBA 5AK5A 4TYPA 4ZJZA 4BJ5A 1BJKA 4QVGA 4WLFA 2GPBA 2PT9A 1NBWB 1FSPA 2QDKA 3LK6A 1TCBA 1ODSA 5A4JA 3OBBA 4UXJA 8GPBA 4ZV4A 4BV2A 2CFCA 3B36A 2VZ9A 2C07A 3A6ZA 1H2WA 1MQ8B 3I42A 3QK7A 2V5AA 3SHQA 3O21A 4AJJA 4B6OA 1Y6RA 4Z7JA 1LZKA 4N40A 4BN4A 1QRDA 1KAGA 4CLHA 4DMHA 2OFPA 5FTMA 1P8AA 2YMQA 4L5JA 2JK1A 4NY1A 5TPZD 2PUJA 3NOQA 3OPVA 4ALKA 1U2QA 1MA3A 5HJ7A 2PS1A 1BEUB 3VPFA 3P9XA 2NTJA 3ZLVA 3CEJA 1JDVA 3I92A 4J4HA 1B2LA 1VLHA 5DNAA 4HAVA 3ROMA 1DPGA 5MDHA 5EIXA 1LBSA 3VR6D 2V3WA 2VI5A 2X4IA 2W7TA 3Q6MA 5FRDA 3HUFA 3R0ZA 1O8CA 3PEUA 4YCCA 4YRRA 3OIWA 2FPSA 1B0AA 1DFHA 3D8BA 3ELWA 2R96A 5ALPA 1FX1A 1HV8A 1GL9B 1JSRA 1AS0A 2ECQA 2GVNA 1V7CA 3FHLA 3HP4A 3WE7A 2D5IA 2PCLA 5DIFA 3FA2A 4B82A 3T12A 5BN1A 3AJ9A 1PGNA 4NEHB 4BAZA 4XCXA 5FAKA 5CA0B 3ZE2B 1C1DA 1IPFA 5FA5A 3G7UA 2X58A 2HOQA 1NZJA 1QKJA 2QUJA 3EA5A 4K40A 3GNTA 3T1OA 1NOKA 1DO2A 1YRBA 3TIFA 4UZSA 5TSDA 2BT4A 4TMFA 3IXLA 1UJ6A 4BE9A 4LJ6A 1YIOA 4HFNA 3W4JA 5D86A 4CU2A 1J23A 3TKAA 3CF4G 1BKSB 2DG2A 2Z2XA 2Q8NA 1EDEA 1BEEA 4I81A 2QEQA 3TZKA 4GOLD 1QP4A 3W4IA 5DYNA 4AS3A 2I1QA 4CODB 1XQ1A 3L6DA 3A6DA 3RAPR 5BMVF 3NBAA 4ILEA 2GDJA 1JQBA 2GRAA 4WK6A 1G8PA 3UQZA 3U3KA 1SD1A 3KJZA 2BCEA 4P6VF 3C3DA 1NBEA 6REQB 2VXYA 5L9AA 1GZSA 1A95A 2O57A 4AZWA 5LUAA 1W76A 1ZMXA 1QB8A 3KLNA 1O95D 2C2YA 2PYIA 3FROA 1G2PA 3EGWA 5DE3A 2C2HA 2IFTA 3B1FA 1UT8A 4IXNA 2D1SA 5DLYA 4RTPA 4HGPA 4N39A 4HYYA 3PT5A 1ZDMA 3UA3A 4F8EA 1VHJA 1C7ZA 2GHRA 2ECPA 4JIMA 4MDHA 4MRRA 3DDCA 4OYRA 5AVJA 3TL6A 4EA8A 1XZFA 1V48A 1S1CA 4B0PA 1YVDA 5D5QA 5JW6A 5CFQA 2P78A 5BN5B 3FXAA 4DY4A 1TCCA 4J0DA 1PHRA 1PFWA 4TVBA 1VIVA 2CNWD 1SRRA 2Z5FA 3I58A 4YJDA 1OMOA 1N1DA 1YDEA 3JARB 5D5PA 2DETA 1ECBA 3D2AA 4EGJA 2ZB8A 3X1YA 2X4DA 1TAGA 3WFZA 2IUFA 5BV8A 5JSZA 1X1AA 1KH1A 4DC0A 3NVKI 1HETA 1FYDA 1P2TA 3HXLA 3MCVA 5CA0A 2D5LA 2WIAA 3F47A 5JXJA 1R6DA 4YRZA 5LD2C 5LZ8A 4P92A 2GESA 4BO4A 4DNQA 4ARIA 3BE5A 2OCLA 3L1HA 4RF5A 1O2DA 3DEIA 1PYDA 2ZRAA 3K9FC 3H8SA 3TH5A 3ZLBA 2FW8A 4BO2A 2AC2A 2OCGA 3CUVA 4XPIB 2ACEA 3MF4A 2OGTA 4I50B 3F78A 4DLWA 2O2DA 3KDAA 2BBSA 3MAAC 1I94B 3EBOA 2Q3DA 4CLRB 3AF1A 1NIJA 1P9LA 1XTZA 3AHGA 1OX5A 3C4VA 4MJ7A 5SZKB 5AKHA 1XZ8A 4A6EA 4F56A 1B4DA 2R6GA 4NL4H 4L78A 2QRUA 2PUVA 4GXTA 4M54A 3X1MA 4DANA 3WL8A 6REQA 5TLSA 2DWQA 2H2WA 3D6JA 3OPYB 1BGWA 3C8HA 3R1IA 2K2QB 5IM4F 1E60A 1I3MA 4BLRA 1V6SA 5B1DA 5LQKA 1XKTA 2GAOA 1LBHA 4FFPA 4MK4A 3WL6A 5JAQA 5L7TA 3HV0A 3IIMA 1EZ4A 5KAPA 2FDXA 4UZFA 4NABA 2C0CA 3BIXA 4WTOA 2ONCA 3UHFA 3OOEA 3NHLA 4AUEA 5BN5A 1JN0A 5JAIA 5CT4A 2CCJA 5CB6A 3JARA 3CZ4A 1E7MA 2HIMA 1GRVA 4KQ2A 1M1YE 2Q27A 3FNFA 3HA2A 4FUQA 4P3KA 3GJYA 4ZALA 4X44A 4IEIA 5JZBA 1W36C 4IZOA 2CFOA 4YHHB 4UDNA 3TNJA 1MVOA 1YR3A 4ZVTA 1OVGA 3WBBA 4BIIA 3FLAA 4BTLA 1PEAA 1LVHA 3I1FA 3ECCA 1QDUA 1W0KA 4BHTA 3EY9A 2IYOA 1OZ0A 4KWHA 4EJSC 4Q1VA 1M6VB 3OT4A 2G09A 4PZCA 2IHZA 3HVJA 2HSJA 2GPYA 3WGHA 1JG3A 3MIZA 2FWIA 4BCBA 3R09A 4XPIA 4W5WA 4I50A 5BN4A 3N2YA 2G71A 1NR7A 2Q1SA 2Y93A 3RU9A 4KPUB 3LWZA 1QO9A 3JD3A 3KHKA 4BQOA 2OT3B 1WNFA 4TS9A 3GGDA 1A7AA 2XYQA 3IHWA 3QSGA 1MV5A 2CL7X 3GB9A 3A1TA 2VYVD 4JQCA 4NCKA 1DAKA 2C3UA 2FEAA 4D0NA 1XVIA 2CXHA 4WW0A 5IXJA 1WSWA 3IESA 4BKQA 2JLQA 3WC4A 3U1BA 3Q2KA 5CBKA 3TEMA 3OPYA 3F3SA 3URKA 5FBQB 4XFKA 1NN1A 2ZJ6A 5CTJA 2IYTA 4X97A 1X87A 2VHEA 4B44A 1KYTA 4M1SA 2ID9A 4C6TB 4K9SA 1UC5B 3OCXA 1OFTA 4JXKA 4MS3B 2J0EA 4LA4A 1LA2A 3JYNA 4GWGA 4HB2A 3TM4A 4C21A 2H4WA 3ETLA 1D6MA 2PS9A 3IQFA 4MICA 5EJAA 4C3OB 1UBNA 4DZZA 1XRJA 4EZEA 4NCAA 5FBRB 5KTKA 1DTWB 1NJ8A 3N59A 2ACKA 3QFSA 1SBIA 4WAUA 5E1OA 4A36A 1RKXA 1LPOA 3PK0A 3UM9A 2O7SA 1AURA 2PSFA 3WOVA 4BO0A 4UBLA 2O7RA 1L5WA 2W43A 2ZIZA 3QE2A 4IIFA 4PPNA 5C7YA 2O06A 3N0WA 4LWQA 3RIEA 4FMCF 4H59A 3RTDA 2CF6A 3M6XA 1I5OA 2W00A 4DG8A 1TCUA 2E87A 3R8CA 4AYWA 1ZGAA 5K3EA 3TB4A 4I8XA 3BFPA 4WKOA 5CIYA 1FRFS 1V2GA 3ZDQA 1RRGA 1OI4A 2M98A 1AUVA 2G17A 3BFVA 5B4TA 1KY2A 1U04A 2QTFA 3H3XA 3M6IA 1MO6A 4UQLA 5KOJB 2FX2A 4PGHA 2ZM5A 1M6VA 1Y89A 3ZV6A 2HXGA 2NZYA 1DJPA 4IYRA 3ZDAA 4QTZA 2HKIA 1PJ3A 2BGNA 1Z8HA 2IEDA 2OY0A 4CXMA 2HBQA 2VHYA 4KPUA 1NBHA 1FVFA 3PWTA 4FKBA 4ASUD 2QNBA 5K1ZA 2CFRA 2ILTA 1FTSA 3TTWA 3IBTA 3LPDA 1UBMS 2P9GA 3ER8A 4QUIA 1P4RA 1XNJA 4J91A 2H7XA 5JSKA 1Q1NA 3ZE9A 1G18A 2G4LA 4W9NA 1EWVA 1ZRSA 2FKAA 3M4XA 3DE6X 2FX5A 3H87A 4CIYA 1NR5A 3K9WA 3Q10A 2PUBA 1E79D 1L7AA 1ULZA 4KTVE 3WGTA 4E5MA 2ZU0C 4C6TA 3HXTA 1Y8CA 4W5HA 3RYIA 1GADO 2B7CA 3F7MA 2FQWA 4MS3A 3VYTB 3WFJA 2IYNA 3OT5A 3K16A 1OBHA 3CGWA 4JSYA 5DLPA 5LBTA 1EXMA 4R1UA 3IBSA 3IUMA 2JZOA 4N7RA 3F97A 1DTWA 5JZVA 1XD2B 4O2AF 3DEKA 4G0NA 3CONA 4PHCA 4UVDA 1E8NA 1JG2A 3UAWA 2UYGA 1RM3A 4P4GA 3WIUA 3K0HA 3HCDA 4ZO7A 5B6PA 5HKOA 1ADBA 1EHCA 1GTJ1 4D8YA 5KQPA 2OECA 2BYTA 1ENYA 2X40A 4RC9A 2X9VA 4P53A 2UVDA 4TZKA 4EHIA 1XTVA 3ONDA 3T7JA 2RG7A 1Z4OA 5CNMA 2CLLB 4UKDA 5ADVA 1G8FA 1SVUA 2OENG 3L8MA 3OWHA 2QMZA 3AUUA 3HU3A 4DB4A 3EZXA 3C39A 1TIKA 1JSZA 2YY5A 2C5FA 2RCYA 2Y71A 4RHFA 1JVNA 5KOJA 1LLQA 3WG9A 5IZ4A 2TMDA 1HEUA 1L7BA 2R5FA 4EL0A 4ZQHA 2J33A 3TZ6A 5IG2A 1NPYA 1VPLA 2NSHA 4HRVA 1VLQA 4YH1A 4YRJA 2J85A 4FFLA 4IR7A 3G5AA 1XAJA 1SVIA 3MMZA 1VG8A 4AZTA 2D1QA 4Q7KA 4BBJA 4EVQA 1DWOA 2PO7A 1Z0AA 3X1DA 1XZJA 1DG1G 1EXVA 2QX8A 4WLEA 1L4MA 1DARA 2ZUDA 3AHFA 3FPLA 5C2JB 2FXIA 4G8JA 1VLLA 4N6NA 4ANFA 3HN6A 1G7RA 1NW3A 1PEDA 1T4MA 4Q9IA 2EG9A 3FWHA 5KSWB 4RD3A 1SULA 1IY9A 1IG3A 2PM8A 2GN0A 3R8XA 4HX2A 3NT4A 4EHLA 3H7AA 3F8TA 3E48A 1M8JA 1TJ5A 4R01A 3UY4A 3C5WP 3NQ41 3Q7TA 3E5HA 4PZDA 2Q5CA 1C3EA 2BJHA 1TLLA 3K92A 4B09A 1KO7A 2FI1A 2ZEJA 3CH6A 4LRUA 3EDOA 1FRVA 2BM9A 1RHMA 1OFIA 3H2BA 3SFTA 3ZNNA 3DZJA 3ZWQA 1XD2A 2GAIA 1Q21A 3L18A 2F1HA 3RVSA 2HYDA 3UENA 3OTIA 1UBCA 1SXQA 1J2TA 4EKNB 3OFJA 1EQ2A 1SQFA 3PXDA 3R3WA 3TD2A 5FP0A 3TLAA 2QXTA 1L4KA 1QV7A 2XITA 3DUWA 4H1UA 4NR0A 3T5CA 3L5KA 3DEAA 3PFWO 2DYKA 4EY4A 1SOVA 3AONB 4ILKA 1YBVA 2IYVA 2H2IA 2C0QA 2YVAA 3PX3A 2A1UB 4GF5A 1AXGA 4DTIA 5LQJA 3M5DA 4XGIA 2XWQA 2O1EA 1UJ2A 3IV7A 2I6SA 4UMFA 3AEQB 4F46A 5BV7A 3ECSA 1EDOA 5AOAA 5FI5A 2FEXA 2HMAA 2XLBA 4QT4A 3PQ2A 1NM5C 3L8FA 4ZVVA 4QG7A 3OZSA 4DV7B 1SNYA 4HAYA 1JDSA 1IAQA 2Z9BA 4NG4A 4UXHA 5DIZA 3T95A 3NBFA 5CCBA 2VS1A 2G28A 2VOEA 1X6VA 1K2VN 4RBNA 3RJZA 3T3MB 2XTZA 3ORQA 5L3SB 4NE2A 1TW2A 1AMNA 4HWTA 3I45A 4MARA 1RQPA 1S01A 3F0TA 4Q37A 3PHGA 4Q4JB 5CXXA 3SQLA 2ZBUA 2PXAA 4CFZA 3NHBA 3FDJA 3GFGA 2ZE7A 5DLQC 4CIDA 1VRVA 2C5SA 1B26A 3LC0A 1C8BA 2QG6A 4LWZA 4Y1FA 3ZZUA 1WCIB 3CKLA 1PJRA 2W11A 2Y9MB 3BUSA 3JQ7B 3QYJA 1ODIA 2GN9A 1D6JA 5BN3B 1Z4KA 3OWXA 5BOSB 2W48A 5CITA 5GJBA 3GLRA 1H2YA 1U94A 3PDIB 5JCZA 4DKJA 1O6CA 2Q29A 2O07A 3DMYA 2VKQA 1CB7A 1QS0B 3OAAA 4B4DA 3H86A 3IURA 1M34B 5B30A 4ARZB 3DT6A 3EGEA 5EP2A 3AP3A 2WJWA 1B8PA 2GVZC 3D4BA 2PBRA 3G49A 3MJCA 5JO9A 1TRKA 1OW3B 5F64A 4YY3B 1PV4A 1ULUA 2XMQA 1OX6A 2ECFA 2YICA 3JXEA 4K28A 3THXB 5DGCA 4ZGBA 1B43A 4FQ5A 3PR3A 3SE7A 4EHFA 5HWSA 2EW1A 3FKJA 5A5DA 3WIDA 1I01A 1PU2A 2IYRA 4JLMA 1T0JB 2A1UA 2VH2A 4HF7A 4ZDJA 3KXDA 2G9VA 4UHEA 4JELA 4CQLB 4ZU3A 2FY8A 3AEQA 2WJPA 4FOPA 5KQGA 1LK0A 4CE6A 1R0SA 2IPLA 4R1NA 5AYVA 2GZSA 2ZYUX 1XELA 3M9XA 1EUZA 4LYAA 1M2NA 1VL8A 5AW7A 2IZOA 3G9TA 4F93B 4YIHA 5J2TF 3ETHA 3FRIA 3IB3A 3VX3A 3BB3A 3CE6A 2YV3A 3E6AA 3H0KA 2F8SA 1RHUA 5L3SA 4DGSA 2DWUA 2W4MA 2WUVA 4Q4JA 4L8VA 1G64A 4OHUA 2C2OA 4RK6A 2SKDA 2G9RA 2QENA 4LPKA 5KVCA 4AAYA 2OSVA 3MWDB 2FQXA 4EI7A 1TJ3A 2LCIA 2YWRA 2VSXA 1E1KA 1BKDR 1WCIA 3JQ7A 5KWSA 5DSTA 1CF4A 1XTBA 2P5YA 3L3BA 3MTAA 3VDXA 3OZIA 5BOSA 2PT7A 3EFEA 1GPNA 2E37A 5BO5A 2QTCA 2YYAA 3PDIA 2ARKA 4URVR 5JBIA 4Z7OB 1PR3A 2GYVA 1GN8A 3KB1A 4Y2UA 1QS0A 4Q1AA 4U0KA 5AVZA 1M34A 1UDAA 4LQ4A 1N32B 2W37A 4ZU1X 1T8WA 4ARZA 1R4MB 4M7RA 3DNMA 3O73A 4MYUA 2CDRA 1J99A 5IANA 4ER0A 1POWA 5CFLA 4JLVA 4RL6A 1SU7A 1JHXA 2CXXA 3ZZ1A 2DTXA 2JCGA 3MQFA 4DQVA 1U6KA 1Z74A 1U5CA 2P2LA 4PAOA 1EFKA 3M81A 4D8VA 1L5KA 1BYIA 4X63A 3VZCA 2WSBA 4WASA 1E7WA 2OHFA 2XUZA 3N8DA 3QXGA 4P7KA 3NM4A 4MI6A 3NC1C 1UMKA 4EKGA 1E6UA 4RDCA 4CQLA 3B1WA 2HMTA 4JJIA 2GFIA 2G9QA 2X42A 3ESZA 2BZSA 1ZM4A 3HB0A 2R8RA 3RV4A 3LV8A 4JKYA 2BGUA 3QFFA 2H4HA 1AM4D 1R66A 5DM60 4EPWA 3SEAA 3BZWA 2ZLBA 1QQ6A 4IRUB 4PF1A 4ZYUA 1CQJA 5IAGA 3QPBA 2GEVA 4RKYA 3M6MD 2SKCA 1SPXA 4MROA 3PQEA 3EUAA 1IN5A 2Y1CA 5JVDB 4MXDA 3FYTA 4X62B 1XVVA 5B55A 1CEEA 1O5OA 3DZHA 2C5GA 3A1SA 4IFTA 1QSGA 4CUZA 3WLNA 4HNUA 4K88A 2IYXA 1E1YA 1JV2B 1WUIS 2JAQA 3BMQB 1NPDA 1KKMA 1MABB 3AW9A 3MWDA 5AVTA 2NO1A 3SICE 8ABPA 2IYPA 1SQSA 5JPCA 3A06A 1GTZA 2I7DA 1YQ9A 1JFRA 3A8TA 3ZD8A 2GD2A 2XNJA 4QFDA 3O0TA 1AA6A 2J3LA 1AQ6A 3GVXA 3OE1A 4YLGA 3K94A 1E2FA 5ICEA 5F7JA 2R2AA 2X86A 4BNTA 4AMBA 1KEKA 1UDBA 1R4MA 3RC8A 4I1PA 3CVJA 4M49A 2I2DA 4LMPA 2QU8A 2VPQA 4CG2A 2X0JA 3RVQA 3QVLA 3ZTYA 3LKBA 1P80A 2Z3ZA 3TR0A 5KNBD 4AQYB 4FGUA 3B8HA 4I4IA 1WNTA 4DSNA 1YZUA 3MLBA 1JEAA 3ZX4A 4UOQA 4YS6A 2ORVA 1WZUA 2CNDA 2VTKA 4HLCA 4ZZ3A 3Q8KA 4MGIR 3USES 5CD1A 4A8JC 2OQ2A 2GBIA 3PCRB 2C7QA 2I62A 4MWBA 1KS2A 1QVRA 3G8BA 4QUJA 3R3XA 1MHTA 5GIOE 3FVRA 1JR4A 2XB8A 3KB2A 4XVQA 5EJ5A 1L4NA 2N1MA 3BH6A 4DMUB 1EA7A 2W6MA 4PRLA 3M70A 1GOTA 4HVCA 3G8YA 3QOXA 1N0IA 4JBLA 4QPPA 1PWZA 2AHRA 1JU4A 1KR2A 2Q3MA 4WNAB 4IL5A 4MHOA 2ZRMA 4YMHA 5JVDA 1Q15A 2AW3A 1AGPA 3AK4A 1DJOA 3JQ9C 3WISA 2VATA 2OB2A 4PC3A 5AKLA 2I4MA 3ELUA 1BJRE 2EEZA 2V59A 2ZRJA 4BLSA 3CR7A 3DDWA 3PPWA 1XMSA 3CT4A 2ZM6B 1O6GA 4RZHA 1MABA 5DYIA 4DLXA 2A9FA 2C2BA 3AR9A 3RHSA 4TLBA 4BX3A 3B13B 5AICA 1VLJA 5K0TA 1QH9A 1ZI9A 1MJNA 4G1VA 2PAFA 2IE8A 1ATZA 4TT3A 5JANA 1O3YA 1NVUQ 1WHSA 4YJHB 3WP1B 5B5SA 3UANA 5C1DA 3VNUA 5IT0A 1BH6A 1CB0A 1THGA 3IP8A 5J58A 3G0HA 3R5KA 3GRPA 1X80B 1XZQA 2QUBA 3FFAA 1GUYA 3KJHA 1QOQB 4TM7A 2BFFB 2VXBA 5DPMA 3T61A 3V80A 4DMMA 4B2LA 1L6IA 3LUCA 4JJFA 4YBRA 3WYGA 4AECA 1L5FA 2NAPA 5JNVA 4L74A 2SNIE 1XCPA 1BWQA 2IYUA 2W6PA 3COWA 5B53A 4B3XA 4DFDA 1NI3A 5JWOA 5KC9A 1E61A 3PNMA 4G0YA 3WLQA 3ZZTA 3TVYA 4AKHA 5IM5A 2VL7A 4C4OA 2AOTB 3C74A 4HDNB 2OK7A 4U2EA 2YMLA 4RY2A 3P0HA 1GPYA 3GRVA 2EX0A 4CR7A 4MAFA 1T9ZA 1G3IA 1JT2A 4MPJA 2SKEA 2XIQA 1UBOS 3PWKA 1YA4A 2DUMA 3BRQA 3GQBB 1NG9A 5IFLA 4EH1A 1S96A 1FXUA 2MYTA 4TTPA 3TTVA 3LBNA 4OUDB 5CVEA 2MINB 2HGSA 4X8OA 2B6NA 3HL0A 1VYHA 4WNAA 4GKJB 1FSFA 1N1EA 3G23A 4KXUA 1X19A 3EGXB 1GDHA 4HGYA 2Q5LA 2ZI7A 4XGRA 5ELLA 1T8YA 2BR3A 3ILHA 5F33A 3P26A 2NADA 2J41A 4AIRA 1NNSA 1QQAA 1TPYA 2XA2A 2FUNB 3IEPA 2ACVA 3OJFA 4K9LA 1J21A 2JGMA 3NDRA 4MUMA 1DL5A 3OT1B 1OB2A 4C9BA 2ZYAA 3K70B 1CSEE 3O8CA 4NMHA 4W1PA 1W9HA 4I8IA 2NSLA 2O5CA 1ZRHA 2SICE 3D7RA 4X41A 4AY5A 4YJHA 2Z4SA 2V6JA 3C43A 5BWNA 1QFYA 9GPBA 1CKEA 4M8KA 1Y4AE 1YQDA 1TO1E 2BLLA 2PGDA 2NO4A 3MJEA 1X80A 3UWOA 3O75A 2DCMA 1PFVA 3JD0A 5F7OA 4DQXA 4XVCA 4ETIA 1OBVA 5K8LA 5KTNA 4GM0A 1KYXA 2KSQA 3OZCA 3OWOA 1TCVA 3P9ZA 3LLMA 7ABPA 2GZ2A 2C58A 4Y6RA 1UC8A 1CUAA 1VCNA 4JJ8A 4M0MA 4PZZA 3ELBA 1KVSA 4JI3B 2QRVB 2XNDD 4FGZA 2BTQB 3OZ7A 2XCQA 2TRSB 2AOTA 4B85A 2C8VA 3DO5A 5JSFA 4HDNA 1TYEB 3TZQA 3W2FA 1QFSA 1EP9A 2ZJBA 3L46A 4YT5A 3EIWA 3E7FA 3WKEA 4F21A 3FPFA 4R4JA 3UMCA 2C4HA 1HK7A 1VP9A 1GPKA 3ZE0B 4D9HA 1YVPA 5I9BA 3GQBA 5CYPA 5A02A 5IN4A 1U1GA 4UBJA 1T43A 2VP9A 2WWXA 4OUDA 3DJYA 4ZIRA 2WJGA 5A0VA 4V3BA 2LCQA 2V3CC 1OUMA 2X2PA 3KAQA 1WV1A 3EGXA 1OTXA 4WK4B 1Z83A 3TRFA 1IQ0A 1BTOA 3AF0A 3ASUA 3HPRA 3JVVA 2QJOA 1IBRA 1QO0A 2O1WA 2DKOA 1U7TA 1UKCA 2I8CA 5EXTA 5C5EA 1HLFA 2PRZA 1WQ3A 3I30X 1GVHA 3O95A 1J56A 3PG5A 4YHBA 5DRTA 3GFPA 1M7BA 3DLAA 3SN6A 1O9HA 2ZWPA 5K3CA 4OKNA 3QX7A 5LJLA 3MUNA 2R44A 2IPNA 4BVKA 1TGVA 3ISTA 2WJ4A 4I19A 2QN1A 1H1DA 2PLWA 4CKEB 1DIOB 4GMKA 2A0WA 5T8KC 4DLTA 4CQMD 5L53A 1W6UA 3C3EA 2VDPB 3KZXA 2J45A 4GXNA 3B1VA 1S7CA 2GZ3A 3LX6A 5ESXA 1USWA 1VQ1A 5E0KB 1A3CA 2QSJA 2ZKIA 4OH1A 4OIFA 2DJ5A 3D7LA 3KD2A 3UF0A 3VR3A 3I61A 1DFGA 1L8LA 4MNTA 4MLPA 2JCXA 1RMQA 3MWEB 5J43A 4MW2A 1R5JA 3B7GA 2QRVA 3AB8A 1GTSA 2BTQA 1VE5A 3R7SA 1TUGA 4EECA 4ICIA 1IOWA 1TMYA 1Y82A 2H2FA 2J4DA 3IFSA 3IPLA 4IHJB 5F7ZA 4D97A 1M0TA 4IIHA 3TQSA 5CX1B 1WP4A 2VEDA 2V7TA 3PEVA 1XD9A 1G4AE 1V25A 1NR1A 1Q1EA 1KFBB 2FHSA 1FF9A 1K7FB 4WGGA 2BFNA 4L28A 1Z0SA 1BWPA 3AESB 4NV3A 2BGMA 1M5TA 4X3OA 5IKEA 4KXVA 3D81A 4BFTA 1PAUA 3ZD7A 1DLIA 5KNDD 1IBCA 4TLEA 2VJMB 3CR3C 1H9CA 4Y3UA 3KEMA 3BFKA 1UBKS 2FZKA 3PDCA 3O84A 1ZZGA 4GX1A 4IDHA 4N8EA 2P41A 1X0XA 4KYTA 3RU2A 1QH1A 3OOYA 1J09A 2FUG1 2HU5A 3C3MA 2XD4A 3KKEA 1KAQA 1W25A 1Y1LA 2JFHA 1UDCA 2CYCA 3NEYA 1FLAA 3N2EA 4IF4A 2DLCX 3S68A 2JATA 5F4ZA 5DTRA 3QKTA 3BWCA 3G9ZA 1Y80A 3QP9A 3H9QA 3OTHA 4BWYA 1IJBA 1UXHA 3SC2B 1QCCA 2ENWA 4CF4A 2G36A 3B6KA 3LZDA 1LSOA 4FI3F 4OHXA 1XUOA 4P7BA 3FZNA 1LJLA 3N1UA 1GY8A 1NJ2A 2J3HA 4A1OA 2B94A 2TS1A 3VSEA 2PJZA 2EYUA 3SVTA 5EIBD 4FBGA 4TSFD 3K9QO 3ZOZA 2X8WA 3SKVA 1UIRA 4D2IA 3OLZA 3E27A 1F0PA 4F91B 3MWEA 4IUBS 1VB5A 4X8LA 3RT1A 4RE6A 4LX0A 4YJ3A 3CRRA 2ZPUA 5CEFA 1JLLB 4QODA 2CMFA 2OZEA 3D0QA 3GLKA 4UEJA 4PICA 1XZAA 4D3ZA 4BIMA 5IVHA 4KO1S 1UM8A 2BDUA 1I24A 4IHJA 1LTQA 1ODKA 1Y7PA 1WV0A 3L7AA 4I5GA 5K0SA 5CX1A 2YVKA 1SG0A 3W05A 3ZV7A 1ZUNB 2AJLI 3W0LB 1QHEA 5TDHA 1WW2A 3BHNA 4V0MA 4ZPJA 2WB2A 3GIWA 5FWNA 5KWIA 2HHJA 1OLUB 3EZNA 2D2IA 3EZYA 2ZSAA 4HPJB 3AESA 4DCOA 4ZI5A 3ZHCA 4KE6A 2R6HA 2RH4A 2X3UA 1PJTA 2X6RA 3EAFA 5ALDA 2HCBA 2FN4A 3SYKA 3ND5A 5H82A 5CA0F 3RPEA 1XKLA 2VJMA 2Y0BA 1H0HA 1NBME 1QQ7A 2NZ8A 2O0MA 4NBWA 4IO1A 3KM0A 3I04M 4M22A 4N0MA 4BNKA 4JBYA 1Y3IA 4EA7A 3REQB 4BNGA 2I03A 3KSAC 2O6HA 3GZTB 2HUPA 2Y05A 1C3OA 2G82A 2XUGA 1ZFNA 3FCXA 3GO4A 3TE7A 4C4YA 5HF8A 3GZNB 4HAUA 4YJFB 4LMRA 1BX3A 1NV9A 1PN3A 2ZRQA 3MD0A 5IF9A 2PUAA 3P5BA 4K9QA 1D6NA 1WXEA 3DF7A 4NCJA 4RWZA 3ZXXA 4FGSA 2J7PD 1D07A 2IF2A 3SC2A 3GCWA 1PTJA 4DNFA 4M1EA 2FG7C 2G06A 4KHPB 3KZNA 3LLVA 2YWCA 5KNCA 2IXDA 3LY9A 1UKVY 1UPFA 3H11B 4MR9A 1Y48E 5LBUA 2IHVA 1VM6A 2Q5FA 4AG3A 1RJFA 5AJVB 4HLUC 4S1NA 5ALYA 2OEPA 1J90A 5ALJA 1JDJA 5GADl 3HKDB 2JIZA 2DWOA 2LE0A 1YH3A 2IX3A 3IVCA 1YGPA 1PSWA 3G13A 3IUYA 1SAYA 4Z3OA 4OSOA 2GK6A 4TXHA 3T5GA 4B9EA 4OJYA 5HK9A 2M6SA 6ABPA 4FVTA 1F6DA 1U2PA 2G0AA 4AJPA 1CQIB 3ESAA 3IAXA 4Q48A 4MV1A 1XXLA 2HMUA 1FDTA 2FH5B 4L95C 4D0SA 1ZUNA 4BVEA 3BC1A 4QO8A 3TR5A 2XCRB 2G6BA 1XZEA 5FB3A 4FHDA 2C4TA 1C0KA 1OLUA 2LDBA 1QPBA 3B5JA 4M76B 4PLFA 1ZA1A 4EHJA 2QD2A 4MDYA 3UTDA 2WPDA 1H0SA 1K75A 1ZVJA 4QJ3A 5JR3A 3UFXB 2CVFA 2HZ7A 2DXIA 4Q9KA 1S8FA 3CW2A 4OLHA 3HCWA 4HCJA 3WK7A 4U2DA 2HRRA 3GUYA 1MNQA 4KX5A 2IU0A 4RTSA 4GDFA 1ETUA 1AXEA 1W1UA 2EW8A 1VCHA 2DFLA 2EZTA 2L18A 2R85A 4FGWA 1P5RA 4FR2A 4IEFB 3ZY5A 2HY7A 3OY2A 1Z9BA 2A30A 4L8YA 3DFFA 3CSSA 2Y1FA 2B1RA 5F2KA 3BTSA 3VRHA 2JD1A 1MDFA 3GZNA 3FOEC 1ZZEA 4R9RA 4I50F 2ABWA 3D3QA 4YMIA 5ELXA 2FB9A 2R6AA 2OR3A 5AM5A 1JMVA 3EN0A 1QYCA 2AK2A 1T2CA 2CXUA 5AIBA 3ZXSA 3U7HB 2ZRKA 3I6BA 1DDGA 1WR8A 4Y18A 5A7FA 5FPPA 4O0LA 5F52A 4NJMB 5PGMA 1QCZA 4FCCA 2R751 3H11A 2EP5A 2XXAB 4Q4CA 1E6EA 3KOZA 1SB8A 2RHGB 1RI2A 5CCXA 3DHYA 4PY2A 3HKDA 4NCNA 2WVAA 1JHVA 4RX1A 3SBOA 3BPSA 4DUZB 4GI3A 1P5FA 2MYUA 2R87A 3IBFA 3H3FA 1LDBA 2HJHA 1YZLA 1YBFA 3GRFA 1BHSA 2G3YA 3K8ZA 5BUCA 1VBNA 3JRWA 4D80A 2A86