1ESMA

Structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
311
Chain Sequence
QTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PANTOTHENATE KINASE
publication title Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
pubmed rcsb
source organism Escherichia coli
total genus 99
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1esmA00
3N2IA 4G5QA 1T8UA 4F4JA 3U5ZB 1W4AA 3FHCB 1AGRA 3C5CA 1TUIA 1W4CA 3BJIC 1G8YA 4C0QC 3SJZA 3VX4A 5EE3A 3M0EA 1TEXA 4TL9A 4CIDA 3T06B 1COWA 4BFXA 1XTSA 2CL0X 5K8TA 2JDID 3CH5A 4RVCA 4DT1B 6Q21A 4TLCA 1OW3B 2VA8A 1AS2A 1IBRA 2WWGA 3FPAA 5EXSA 4TYQA 1SKYB 2FFHA 3CBQA 4GOJA 1ZUIA 2CE2X 4X8OA 5KPDA 1OXUA 1JR3A 3CX7A 2F43A 4Q1BA 1RVDA 4MRNA 3OAAD 3T1VA 5FBVB 5JFGA 1NVUQ 2O8DB 4NTZA 5K8UA 1IAQA 1N6NA 3KB1A 4GOKA 5FBLB 3LVRE 4F4CA 3H2YA 4E22A 4BZXA 1OXSC 2QAGC 1EWQA 1D2NA 1ZVQA 3AF3A 4US1R 2QNRA 2FG5A 3RSOA 1JNYA 2VF8A 3MFYA 4OKSA 3I32A 3K09C 4HZUB 2L0XA 3K0EA 2ERYA 3QVUA 1I4TD 2QU8A 4OHZA 1RIFA 2NMVA 3QE0A 2IYXA 1I2MA 3UXMA 1PUIA 4Q47A 4G0NA 1UBCA 2ZITA 4FINA 3B1YA 4AURA 3W34A 4OQNA 4NDZA 1LVGA 1WP9A 4QKQA 3BGWA 4R2HA 2W2VA 3VMFA 1G18A 2FEMA 3NH6A 4BECA 3OHMA 4TSFD 3LX8A 1XJQA 2DFKB 3IPYA 5HCNA 3THXA 2AKAB 3IDQA 3VNUA 3TSWA 5FPHA 2EW1A 1GILA 2IWRA 2ZUDA 1Z83A 4JVLA 2QTHA 2FA9A 4IOKA 1DELA 2AL7A 3OIYA 2JDIA 3PFIA 1BMFD 2OM2A 3QBTA 3UWKA 1R5NA 4PC6A 5GVSA 2VPPA 4Q9KA 1SXJE 3TQCA 2ZYWX 3VR5A 4AG5A 4IEEA 4ESHA 1KTVA 4LYHA 3HPQA 1OB5A 3GLGE 1RW4A 5IRCD 1K5DA 4JLBA 4KVAA 1DG1G 2AXNA 3B13B 1Z6AA 3K53A 1A82A 3FWYA 1NVWQ 4D25A 2A9KA 2EQBA 2D4HA 3O47A 1U98A 4HAXA 4XH9B 2O0HA 4KYUA 1OYWA 1SXJD 2A5DA 3C41J 1VYVA 1XXHA 1ETUA 3VR6A 4RD0A 2ZRMA 1T3HA 4RCYA 2O8CB 2PT7A 4C7OB 4FIDA 1M74A 4FMCB 3EARA 1UADA 4XSHA 4FI3C 2A5YB 5P21A 3IUYA 4U00A 3CUEF 1CXZA 3DDCA 4OQLA 2WJJA 1V43A 2FJUA 2NIPA 5J4YA 4LHWA 3B5JA 1Q1EA 3OFND 5BN3A 3R9XA 3AUYA 5CYPA 2Q3HA 4Q4AB 2WKRA 2OLJA 3PQCA 1T6NA 3DM9B 4TSFA 3W8NA 3I61A 3I8XA 3MMPA 4EPTA 3LX5A 2E9SA 4B3CA 2CHVA 3T1TA 1EESA 3W6PA 4LBWA 2PMDA 2RGBA 1OH6A 5KSZA 5JRJA 1BH2A 1OIWA 1GVNB 1R0YA 2B92A 3RANA 2C96A 3GJ0A 3EZ7A 4RSGA 1KI3A 5FR2A 4FWTA 2JIZD 2ZI9A 3VR2A 1E9BA 4HAZA 3DMDA 4BQSA 4D81A 4DLSA 1ZD1A 2AR7A 4LYAA 4PQYA 2J46A 3WP1B 4F93B 2NO9A 4Q9IA 2O8EA 4C0JA 1A5TA 2EFCB 2XZPA 4YMVA 2X2FA 1Q3HA 1R2QA 4PSVA 5IF9A 3AVOA 2DWPA 1N0VC 2QI9C 1KJWA 4HLUA 1JECA 2OCYC 3DVLA 4MKIA 5TV2A 3QPUA 3A1UA 1QRAA 2C99A 2V8OA 2RGGA 2A2ZA 4D0LB 4IVRA 2N42A 4BLQA 3K70B 5CITA 1HH4A 2YC2C 3GQBA 1WRBA 3OEED 4UNSA 3SEAA 1OXVA 2CE7A 2D06A 4IRUB 1S1CA 3QKRA 5B64A 4IOJA 1OH5A 3GFTA 2J0UB 4RFSB 1CS4C 1KOFA 2HUPA 2QPAA 2QA5A 4PR0A 4QFMA 2QMUA 3BC1A 4LBYA 1CJTC 1P7CA 1VYTA 4FWIB 2BMEA 2J41A 3H84A 2XGJA 1T0JB 5J4VA 2F9MA 2WAYA 4Y0VA 1J99A 1LS1A 2GEDA 3OE7A 4JL5A 1YZGA 5DLQC 1OYYA 3ZS9A 1VCNA 2BMJA 3L43A 1ZJ6A 3X1DA 1XTJA 3AF0A 4TMWA 2BEJA 1F2TB 1YRAA 4G3XA 1G9XA 3RWMB 3QSYA 4HDCA 1XDBA 2ZS8A 2HCJB 1SQ5A 4LCBA 2ZJ8A 1IJFA 4I99A 4NCKA 4BASA 3WBKA 3BBPA 1RZ3A 3OESA 4JYBA 4QNMA 4N1AA 1K8RA 2JIZA 2GRJA 4NYMQ 5FOVA 1W4BA 3PG5A 2Q0HA 1P75A 4DSOA 1XMIA 2KI5A 2REBA 3W3AA 3AVVA 2NOAA 1G1MA 2GCNA 2YWEA 5AK0A 1QVRA 2ZRKA 4I81A 1G16A 4OK5A 1CEEA 3K9NA 1NLYA 5EP1A 2QTFA 2WOOA 3WYGA 1DAHA 2G0TA 4GI7A 1PJRA 5CB8A 3PUZA 4IFBA 2XTZA 3C8UA 1WBDA 2IYVA 4Q1AA 4GZLA 3LWNA 2XZOA 2CL7X 4ILEA 1D8TA 3THOA 3ADCA 4EFLA 3CPEA 4X8MA 5BW8A 5CDFE 3KJGA 1DE0A 3A1SA 1ZM9A 4D2IA 3KJHA 1MR3F 4HUTA 2TMKA 1ZBDA 1T3LA 4BLPA 4G01B 5AUOB 4KFSA 4A6XA 4PO1A 4DCTA 2EWVA 3QJYA 1GKUB 4C9BA 2GCOB 3LVQE 2Z83A 1ELOA 1OFTA 4US0R 4L16A 3U61B 4HATA 4QBFA 3CRQA 2O8DA 1YJ5A 4MYUA 4O2LA 5C4MA 3FDIA 3NHBA 4F38A 1B0UA 4YDSA 4TTRA 4A82A 5DSZA 4EIWA 3PEUA 4ZO4A 3HPRA 4G5SA 4JLKA 1RRFA 4TT3D 1IXRC 1IY0A 4I4LA 4LHVA 3IHLA 4ZKEA 3LDAA 3RVBA 2I4IA 4EAQA 1E2QA 1N6RA 3AVTA 3VKHA 3EASA 3HR7A 4G5RA 2QPTA 4WAUA 3CRRA 3LBHA 4I1UA 5FUXA 5DYGA 3ZZ0A 4AC9A 5IK2D 1WCV1 1XEWX 2V4ZA 3K0AB 4B44A 3P4XA 4PZZA 2GETA 1CJUC 1BS1A 1G8HA 2OBNA 1ZNXA 2FX3A 3RDPA 2A3RA 5HTKA 2GXUA 5EXTA 4B3FX 4GSYA 2GJAA 3ASYA 3SHWA 3EX7C 3THWA 1UAAA 4CF7A 2R8RA 5GVRA 2GXQA 3IKJA 4A0RA 3MCAA 4OHXA 4PXAA 4JYCA 1F6BA 1TQ2A 1W0KD 3K8YA 1ZNZA 3KX2A 5CYOA 4AK9A 5C46F 3ND9A 2WWYA 4M1MA 4BRUA 5GJBA 1G3RA 2YV5A 1HT1E 2NGRA 3ASZA 5CLQA 3ZIAD 5CIQA 5EE1A 3MWKA 4LX0A 4KSCA 5JI2E 1DS6A 4ARZB 2VP6A 3VR3A 4DDTA 2XTNA 1Q12A 3ADKA 3I1FA 1US8B 3QBVA 2GVDC 1OFIA 4BFWA 4TYWA 3EC1A 1DARA 1PVOA 2CHGA 2H57A 2KJQA 1UF9A 1TMKA 3U7EB 4ABYA 2UZ3A 1E79D 3JZMA 3AB3A 1IN5A 2EYQA 4H1VA 3QY0A 3RC8A 4GP7A 3PCRB 3OZXA 2REOA 4PAMA 4ZDIA 1D5CA 3I3SR 4EJSC 1YR9A 3GLHB 1KK0A 3CNOA 3TR0A 3TR5A 4UJ3A 1NJGA 5JEDA 1WB9A 2RGNC 4PAQA 2D2FA 3PV0A 4P4SB 4TT3A 3P4YA 4Q1DA 4JLAA 3TNFA 1E2HA 2IS4A 1XWIA 4A2PA 1GL9B 1Z29A 4DCVA 4YDHB 4C7OA 3RABA 1Z0JA 4DLXA 5IK2A 4HUQB 4P31A 1FL9A 1HYQA 1DAMA 3HYRA 3R8CA 3T1OA 3IIJA 1TQ4A 1VHLA 1FTSA 1KMHA 2IEYA 1VCMA 3ONWA 4Q4AA 2JLYA 1UDXA 5FUYA 3RS3A 1XP8A 4TTPA 1E4VA 4PPGA 1W0KA 3FFAA 5J47A 3KUCA 3CH4B 2VHUA 3ZIAA 1BOFA 3CR8A 3L0IB 3K0CA 4B48A 2CJWB 1XCPA 1CBUA 1SGWA 1N0WA 3QG1A 2O8BB 4LSGA 3GEIA 5EE5B 3WNCA 1NF3A 4DB2A 1I4LD 2GCPA 4LJ9A 4NPHA 2J7PD 4CW7A 1L8QA 4OI0A 2WV9A 4DEXA 4JVNA 2OBLA 1KGDA 4D26A 3NEJA 2GKSA 1VCIA 2QE7D 4MRSA 2VO1A 4LHXA 2BVNA 3Q72A 1GTVA 3WY9A 1OE0A 2B6HA 4Z54A 5JZVA 4NZYA 3ZS8A 1XPRA 3B9PA 3DZDA 1E69A 1C1YA 1ZW6A 3WRYC 1JQJC 1KMQA 1XD9A 4BUJA 2ODEA 2IT1A 2E1RA 2WJIA 1XEWY 2IYUA 1LF5A 3AVUA 4M9ZA 1N2CE 3QPVA 1NSFA 2C9YA 4IOLA 1IN6A 4LJ7A 2J0UA 4RFSA 1FX0A 4TN1A 3K0SA 2BM0A 2OG2A 2YKGA 2PBRA 1VMAA 2IXEA 1G6OA 1UBFA 1S4QA 2J1LA 1E2DA 3K9HA 4PSKA 3L2OB 2IUSA 5KNDA 1H8EA 4K46A 4QBHA 1OJLA 5C1BA 421PA 2CHQA 2ZANA 1RYFA 2DY1A 4YLGA 1F2TA 4DXAA 3C4JA 1E9EA 3JZAA 4IFEA 1RFLA 5G3ZA 1FNNA 1Z07A 5HE8A 3SE0A 5HKKD 5BXQC 1OKKD 3U3KA 5AUQA 1PLLA 4LHZA 4PSAA 1MO4A 4BLRA 3D7MA 5EUQB 1VPLA 1GG2A 5EZ6B 1E1RD 2X1VA 1HA3A 5JHGB 4XIGS 4EPVA 2EFDB 3SYLA 4D80A 3CWQA 2DCUA 5DI3B 2ONKA 4LJAA 4PQFA 3B6EA 3P26A 4QHYA 1Q1BA 4HAVA 5FFMA 5E95A 1SHZA 2XEXA 4GOXA 4RZXA 3KQHA 3SBEA 4TL7A 1JPJA 4FCVA 4GFDA 2BIFA 2IYTA 4U02A 1Z06A 2D3WA 3HJNA 2ZTSA 1E9FA 2ODBA 3PJRA 2VP9A 1NIPA 4UXHA 4XVUA 1XZQA 3GLIE 1MRSA 1RKBA 1OB2A 1TPZA 2PCLA 1XCGB 2QY9A 1OH8A 1BYUA 1MABB 1N5LA 4C2TA 2YC4C 3RS4A 2OHFA 2GJKA 1H8HD 4JBWA 2ZJAA 2NPIA 4P4UA 1RE0A 1AN0A 3BB4A 3L8YA 1QZXA 4TMXA 2QT0A 3LRPA 4IVQA 3MLEA 3NG1A 2MMCA 3PIRA 3TBKA 5FUVA 1JJVA 1HV8A 5LB2A 4PC7A 4OQMA 1KI7A 3IGFA 1UBGA 5AJXA 3AGQA 2OO7A 2NO0A 2IYYA 2GCOA 3EWSA 3MWYW 4FXPA 2ZE6A 4BFTA 4URXR 4C0KA 2XAUA 2XXAB 2BV3A 1Q21A 1W47A 2FE4A 3CR7A 3ZQJA 3EXAA 1KKLA 2OEPA 5E7JA 1KDPA 1N5KA 1N5JA 2WMNB 4II7A 1XEXA 3RRNA 5HKKA 4D82A 2OFOA 2BBTA 1D9ZA 1NLFA 2XNDA 2QRZA 1FQJA 3BS4A 4A8JB 1Z0FA 3IO3A 2WWXA 3ZDQA 1W36C 3NWJA 5FPYA 2P6RA 5J4KA 3IIMA 3GFOA 4EKDA 2LWIA 4IKEA 1A2BA 3P32A 4NBSA 1FOEB 1GOTA 3SJCA 4G5GA 4DCUA 3TVTA 2W2XA 1ZRHA 4M8NE 3K0AA 1JALA 5TB5A 4ZIRB 2BJWA 2I1VB 3EPJA 3AKDA 2G6BA 1DTSA 4CVNA 2AKYA 1DAEA 3A37A 2GZAA 4JSYA 2NPFA 1SXJB 2J0VA 2P67A 3WXMA 3TVDA 3EA5A 2IYRA 3CRVA 4JVSB 3GLGB 2BOVA 3LBNA 4R2IA 3EG5A 4MKGA 4F4IA 2N1BA 5FBWB 1P5ZB 3IBYA 3GEHA 5H68A 2BM1A 3KKNA 5EP2A 4JKYA 1R5BA 2GTPA 4RJLA 1CKEA 4MRRA 1G5RA 2FH5B 2AWNA 3AVYA 2FSIA 2O52A 2VSOA 1XRJA 1US8A 2H92A 2ZU6A 3KJEA 1T8TA 1G4AE 3GJXC 3VKWA 4A36A 3BXZA 1OFHA 3EA0A 2C04A 4EFMA 2F1IA 4XVRA 1SVWA 3BB3A 4HLDA 2ZRHA 3AQ4A 1ZMXA 3UK6A 1UEIA 1Y3AA 4WZAE 1FMLA 1CP2A 1XTQA 2HT6A 3GLHA 4TLDA 5EXPA 2G0NA 4AWXA 2IXGA 1E0KA 5LD2B 2J7KA 1XBTA 3X1WA 4JJKA 5E4FA 1Z0IA 4QGHA 2YWFA 3KJIA 1NJFA 5JHHB 1M8PA 3GPLA 3E5HA 4DLWA 3CZPA 2MSCB 1YVDA 4Z8XA 4EQ6A 4LOAA 1VG8A 1JXMA 2HJGA 2IHYA 2PLRA 4URVR 3W5IA 4DZZA 2GJ9A 2JLWA 4FD2A 1E9AA 2XJ4A 1U94A 2VRWA 3BRWD 4HUQA 3TUIC 3X1YA 4YMSA 3V00A 4D4MA 3T61A 2BMDA 3M4YA 2QGNA 5FI0B 2B7BA 5FOSA 1N6LA 5CB6A 2C77A 3WNBA 3QEOA 4W5WA 1IY2A 3A4LA 1KNXA 2D74A 2GVZC 1HE8B 4Q02A 1EX6A 4Q48A 3FKSD 2J3EA 1FZQA 4NH0A 4Q66C 2RGCA 2C9OA 4BLSA 2QBYB 4JBYA 3K0FB 5C2JB 2JCSA 2JATA 2G9NA 1ZM3A 2CJWA 2C2HA 4YQFA 1ESNA 3GLFE 3HU2A 3WNDA 2IX3A 2O8BA 4GP6A 1KJZA 4NYIR 3T5GA 5SZJA 2D2EA 3OF5A 3KZ1E 5TY0A 3WRXC 1G21E 2W0SA 2ZE5A 4CYMA 1CRQA 1NN0A 1KK1A 2IL1A 3AF4A 4LRWA 4EPRA 4LK2A 1WA5A 1G3QA 1TAGA 3SHFA 3UWOA 1PV4A 5FI1B 4KXFB 3WHLA 1RRPA 5K8LA 4POAA 3QNUA 1KO8A 3REGA 1DAGA 1T91A 2F9LA 3D8BA 1P2TA 4IDPA 1NI3A 3NC1C 2R6DA 3MD0A 4PTLA 2XX3A 2QP3A 3X2SA 1A2KC 2KE5A 2OV2A 3THWB 4LWZA 1RC8A 3AEZA 2GF0A 1FPMA 1Q22A 1QHNA 2A30A 2A5GA 2NZ8A 1N25A 2PEYA 2ZI3A 3K1JA 3SFVA 3TAUA 4BEBA 1TUEA 1E6CA 2FWRA 2PJZA 4MGIR 4OYHA 4QGAA 4KU4A 4M4SA 4C4PA 3J81k 2ZRNA 3FKSA 4I1VA 4AI6A 3RS2A 4AKIA 2IS6A 2WWIA 1DVRA 3P1JA 4RZ2A 1CU1A 2HLDD 1TADA 1O3YA 4GT1A 3ZQ6A 3AV0B 5DI3A 1P2SA 2FSGA 5DISB 3QF7A 1KKMA 5FOWA 3UG7A 5EP3A 4C2UA 1ZC4A 2N46A 5IDVA 4LY6A 1W44A 2FZ4A 4IDHA 4HEJA 5DH9A 1P9RA 3OAAA 4UNPA 3NDPA 1D2MA 1TU3A 4HLUC 2JLQA 3EPLA 3U60B 1KNQA 4GZMA 1ODFA 2FF7A 3R9IA 4DSNA 5AJYA 4B32A 3RAPR 1FNMA 1ANKA 3AVQA 3H86A 2Z43A 4M53A 3GJ7A 1MABA 1V5WA 2OCAA 1IJEA 5JMTA 3ICQB 1M7BA 2ZETA 4KLNA 4NL4H 4XVQA 5KPJA 3MRSA 2C5LA 3WYAA 4DLZA 2DR3A 4NP6A 1GKIA 5CJ2A 3VTKA 1N0UA 2WWFA 2FSFA 4KFUA 1E0JA 1E32A 4HB0A 2QZ4A 3U3JA 3A1TA 1FQKA 4RD4A 5B58C 2VH5R 4RD1A 1KMHB 3C15C 4W7SA 2ZUBA 5AUPB 2XXAA 1S3GA 1W2HA 1Z0KA 3P20A 5JWOA 1U8ZA 4E03A 2YJTD 1CLUA 3RYTC 4DLRA 1WBBA 2PT5A 4OI4A 4QGFA 4Q1EA 5M04A 3I4LA 2X2EA 1ZUNB 3ZD7A 2R6CA 2NO1A 1BMFA 2RGXA 4M1OA 4Q1CA 2HLDA 4HLQB 4LV5B 1KK3A 4A8JA 1Z6TA 1X8LA 5JS7A 1N3BA 3CIOA 1DO0A 3QEJA 1YZTA 5ANRB 4LBZA 3ETLA 3NDBB 1YZNA 4NCNA 1B23P 1R4AA 2NO6A 5G41A 2LKCA 1IN8A 4ZIRA 4A15A 4FCWA 3GMTA 2R44A 5E7IA 1AGPA 2KSQA 2GDJA 3C16C 4GRAA 3O8CA 4WBSA 4PO9A 1TQDA 1ZNYA 1SXJA 4PHHA 4L9WA 2VHCA 3SI7A 2JLZA 4RKEA 2WICA 1KHTA 2WSMA 2RAPA 1KI4A 1E9SA 3C14C 3GLGA 5L3QB 1E2IA 3DKPA 3LNCA 4PANA 3Q5DA 4C30A 1SHKA 1WQ1R 1FX0B 2QG6A 2IUUA 1KDTA 2VP0A 3GJ6A 5BN4A 2ZYVX 3SJAA 5FH9A 3IHWA 1CULC 1EWRA 5L8VA 1LW7A 4CDGA 3OFNA 1HTWA 2ZE8A 2FDCA 5DYIA 3UATA 2OESA 3W5JA 4ASUD 4TL8A 1Z6GA 1Z6XA 4OBEA 3LFUA 1ZNWA 4TYYA 2HCBA 1NY5A 5CM9C 3FB4A 4PZLA 4V0NA 2QROA 1U2RA 1G17A 3KL4A 1Z22A 5HCIA 2ZAOA 3GJ4A 5J4HA 4LUCA 1GL6A 2ATXA 4ZDWA 1Z0AA 2BWJA 2C03A 2XSZD 2ZRFA 3M6AA 4K8OA 4Q7LA 1IONA 3BWDD 3CF0A 5KOYA 3HDTA 3SDZA 2KB0A 3RWOA 2Z4RA 2J0QA 4JSTA 5EE0A 2OAQ1 4KHZA 4XOIA 3RC3A 2ZRBA 2OZEA 2ZREA 2RB4A 4ZPXA 1W5TA 3FKQA 4UNQA 4FMBB 4BZPA 1IXZA 4UNRA 2IF0A 3MJRA 5IHPA 3PENA 4YMTA 1U9IA 1IY1A 2C8VA 4V0KA 4HLCA 4N0EA 3B85A 4WVFA 3OEEA 4RD6A 3QUSA 4HDOB 3ZVMA 1W48A 1ZCBA 4ACAA 5DGXA 1NNEA 3FGNA 3LO5A 1Z08A 2QBYA 2XITA 2J87A 4Q4JB 3K0FA 2ZUCA 3AF2A 4R9UC 5E7MA 1G7SA 1KY2A 2ZRJA 1FFHA 5EP4A 4JZKA 4QGGA 1KDOA 1U90A 5KDDA 1AKYA 3KUDA 2ZRIA 5FBQB 1E4YA 1UPTA 2OCPA 4TZ0A 1MH1A 2OSBA 4LYFA 4ASUA 4KITB 1OFUX 3OEHD 4KYIB 4DUGD 3SFZA 2V1UA 1LFDB 1XEXB 4M2LA 2ORIA 2LCFA 5J40A 1QVAA 1RJ9A 3DMNA 4QJ5A 2BC9A 3KTAA 5AWFC 2WTUA 2IK8A 2PX0A 4MYCA 4OI2A 3TSOA 3TGPA 4B3GA 3RSLA 1UFQA 3HR8A 1Q44A 4W9MC 4B6FA 1AZSC 2ANCA 2BBOA 4D0GA 1KO4A 5FL7D 3PITA 3UMSA 4PPNA 1Q1ZA 4GNKA 4EPXA 4UQOA 1BYIA 5KU1A 2VBCA 2ZJ5A 4IEIA 2CCJA 5KHOC 5FOTA 4JL8A 5FR1A 2QQ0A 2OCBA 2R62A 3BAFA 1NVVR 3W8RA 4TYNA 2WOJA 1XTRA 2PZEA 2ZJBA 2ZSEA 3B7GA 3PUYA 4TMKA 4HAWA 4Q00A 5FPKA 4KSBA 1XMVA 2F1RA 4NCJA 4ESVA 3NBFA 2ZSBA 3EW9A 3EZ9A 2G3YA 3G5UA 4EDHA 5HE9A 2CEAA 4RZ3A 3B78A 4B74A 3K0CC 1F60A 2OBMA 3L8ZA 1P4SA 3KKMA 4HB2A 4UNNA 1FTNA 4US2R 4JJZA 1P72A 4XSGA 3GLIB 3TUZC 1DG3A 2OAP1 2YHSA 3ECCA 4C0LA 4FCTA 1DAKA 1D2EA 1P62B 2OT3B 2W6ID 2OXCA 3U44B 1YE8A 1U0JA 2J45A 5DNYB 1NBME 3OIWA 1E9RA 4ZCLA 4D0NA 4IW3B 3L82B 3QENA 4IXMA 5CDFA 4DUGA 5A0FA 3THYA 2FV8A 1NKSA 4B3DA 4F91B 2QRNA 4C0AC 4QM7A 3RRYA 4ACBA 1AIPA 3K70C 1TTTA 2B7CA 2IBMA 1EFHA 4MQBA 2ZVQX 1ZD8A 3Q85A 3B8HA 4TQUS 2CCKA 4NHOA 2GBLA 2RGEA 1JEDA 1NBMD 3TMKA 5FL7A 1HY3A 4EQ6B 4ZCIA 2FGJA 3RRZA 3BIFA 1G41A 3ADBA 2PMKA 2OFWA 2ZRLA 1Z6YA 521PA 1QHSA 1T5LA 3SYKA 4JT4A 5FL3A 3SOPA 1KDRA 2FNAA 2MMGA 3U3MA 4NONA 4MYHA 3KQLA 3UIEA 3MWLA 4JLVA 5E3HA 4R71A 1P6XA 3PEYA 4PQRA 2JLXA 2RCNA 3V4FA 1KI6B 5KSYA 3LW8A 1VG9B 2O0JA 1IN7A 2REXB 3AVXA 1SVMA 2GJSA 1UM8A 4LPSA 5EQTA 5FTMA 3OIVA 2RGDA 3VHLB 1IQPA 2HV8A 4MGKR 1L2TA 1F3OA 5SZIA 3SU8A 2UVQA 2P0EA 1N6HA 4M9XA 2QN6A 1N6PA 1AA9A 1HEIA 1XD8A 4V0LA 3DPUA 4DB4A 2YVUA 1KO7A 2Q3MA 3DO6A 1Q57A 1IXSB 1E79A 1GFIA 1NVXQ 4RD3A 2ZR7A 2QM8A 1OSNA 3ZVRA 3TKLA 1XU4A 2IW3A 1XPUA 3K9LA 4B43A 1P2VA 3T1QA 3I5XA 4KVGA 4QM6A 2HEIA 2VLIA 1JAHA 1UJ2A 2WIBA 1Y63A 3BH7A 3TW4A 1Z47A 4B2IA 3SBDA 1OT3A 3P27A 4TMVA 4M21A 2ZXUA 1SVSA 3MSXA 1JXOA 5AUNB 3B2EA 4TL6A 2I3BA 3A1WA 4QHTA 3KXIA 1NIJA 4L9SA 4LJYA 4RCZA 5L3QA 5FPTA 3CLVA 3T5DA 1CJKC 2FSHA 1NP6A 5A5GA 3EZ2A 3FYHA 1OIXA 4DCNA 4F7WA 2ZYUX 4YMWA 3WYFA 3NBZC 2VP5A 4L4UA 4BFVA 1E0AA 1WE2A 2F3RA 2X19A 4B33A 1NMXA 4YC7A 1ZIPA 1Z2CA 4M1TA 4XWOA 3PR1A 3ZYCA 4WIAA 2ZRDA 4CEHB 4DSTA 3SN6A 1JJ7A 5KNCA 1HE1C 1LS6A 4Z51A 2JJ2D 2Q9BA 2I1QA 5SZHB 2GZDA 1T3SA 4AD8A 1VYUA 3IQXA 3DOEA 2P5TB 1FUUA 5L3SB 1NN5A 5FOUA 2CLDX 2WJHA 4HSEA 4LHYA 3U7HB 2ORWA 1YKSA 3NVAA 4Q4HB 4BWYA 3MJHA 3QXSA 2O8FB 1CR2A 2WBLC 3PEVA 3W6NA 5J4LA 2J7PA 1CR0A 1N6KA 1X8KA 3S1AA 5KSOA 3GCGA 4EPYA 3W9YA 3QF4B 1U99A 3Q7PA 2FFBA 4TLAA 2GNOA 1E2JA 1HT2E 2QE7A 3RS0A 1E98A 4XD7D 2ZROA 2WJGA 2WIAA 4LDJA 2QMHA 2FOLA 2VTKA 1X3SA 3I8SA 1GWNA 1R5OA 4DDVA 1KIMA 2ZJYA 3NHAA 4MDFA 1E2LA 5SZKB 3ZLJA 4DLTA 4N3NA 2B8WA 2J59A 1ZC3A 2ECKA 3W6OA 2VP4A 5JWRA 4XWAA 2V55B 1G64A 1W49A 1MRNA 2H5EA 1GRRA 1M6NA 4LV6A 3DZ8A 2Z4SA 1Z8FA 3BOSA 4AYTA 1G291 2QENA 4Q4JA 2DBYA 1J8YF 2F6RA 4JVMA 1IM2A 2A78A 4PHFA 2RMKA 1E2MA 1E2PA 1NG1A 2ZJZA 1J70A 1NN1A 2OILA 4B3BA 2JJ1D 4X8LA 2QAGB 2AK3A 5CLLA 2QQEA 2HF9A 3NTUA 3U7FB 2ZQ5A 4JLOA 2RH5A 3DM5A 4ZV4A 4EPWA 4RY2A 4FMDF 1OKKA 3LXRA 2ODWA 1M1YE 1E1RA 1G20E 4HAUA 4NYIQ 2W58A 1GRQA 1VIYA 2FZLA 5EJEA 3IO5A 3EWAA 3Q7QA 1E96A 1CTQA 1DAFA 1I4DD 1KI9A 1KSHA 2ZIAA 4URYR 4A6PA 1ZM2A 2JAQA 1I2DA 4LBVA 4BZQA 3ZVLA 5JECA 4MUBA 1QG4A 4A1FA 2WVJA 2YZ2A 2QAJA 4KLZA 4WZ6A 1JEEA 3AUXA 4XD7A 3F3YA 4MITA 4PC2A 1OXTA 2ZI6A 1VDZA 4RFVA 2FGKA 5CK5A 2ZS9A 3HU3A 4A4DA 3HU1A 2GJ8A 4HYYA 4B35A 2WSSD 4YXWD 4Q01A 3Q5EA 4LJ8A 1H8HA 2ZYTX 5LBIA 3EAQA 1W36D 1SVKA 4FW9A 2PEZA 3CM0A 2HXSA 4KBGA 4M22A 3SYNA 4IOMA 3ZD6A 2NTYC 8OHMA 2D7DA 1XF9A 1L7VC 3CF2A 4OI1A 4OQXA 4NYJQ 2ORVA 1EFTA 3AKYA 2AD5A 3GLIA 1ZCAA 2JGNA 4OJQA 2QMOA 2HYIC 2VL7A 3CPHA 3BD9A 3A1VA 2JLSA 2GF9A 2YOHA 4B75A 3U44A 3QG5A 3HP1A 1JR3E 1G5PA 4BFUA 4BE7B 3PVSA 1JI0A 3R9WA 4JLPA 1NMZA 1COWD 2QEQA 1HQCA 1HUQA 1K6MA 3KKPA 3TSZA 4DCSA 1A1VA 4AYWA 3L0OA 4P33A 3ZH9B 4EFNA 2B8TA 1GITA 1LB1B 1IN4A 3K9GA 2P2LA 1RYHA 2GK6A 2HDNB 3CZQA 1WMSA 2IEZA 1E94E 3L0SA 4BLTA 4X8HA 5BQ5A 4MRPA 3AP2A 3FMOB 5L3RA 2DHRA 2ONJA 1K5GA 4HAYA 1XTIA 1Q1QA 4Q19A 1CR1A 3E70C 3O8RA 4JKIA 1ZU5A 4B76A 2ZJOA 2VSFA 1KI1A 2J5XA 3I73A 4B47A 1PLJA 4L5BA 1NRJB 2WSSA 4JLDA 1C4OA 1KO5A 1CJVC 3RHFA 3NC0C 1KI6A 2HXYA 4P3YA 3E2IA 1Z2AA 821PA 2BBSA 1R8QA 3I5YA 2HT1A 2NO7A 3IPXA 1FUKA 3KB2A 3BH0A 3VU9A 5AJWA 4QL3A 1E1QD 1RRGA 3UPUA 3KQKA 1JBKA 1RRCA 4OQFA 3T12A 2VIIA 1GKYA 3AP3A 4F92B 1GNRA 4QC2A 1XTKA 5JJIA 1QHYA 4LC1A 4AKEA 1S96A 1M34E 1A7JA 4CZ2A 721PA 4LPKA 3IIKA 1AS0A 4PC1A 4M1KA 4XTRA 2XOKD 4QBGB 4A92A 4D6PA 1ZM4A 4YMUA 2WKQA 1XD2B 2YINC 3Q3JB 2DWOA 4LGMA 1X86B 1ZUHA 4Q7JB 1RJ9B 3FE2A 3QXJA 2AXPA 3VR4A 4DLUA 4B34A 3KTAB 3TLXA 2BHRA 4UXIA 3QOFA 2ASEA 2QMEA 3SC3A 4DKXA 1M7GA 1XXHE 3QQ5A 3ZJYA 1E0SA 2Z6VA 2PH1A 2H7VA 3DHWC 3KKQA 2ZI5A 4A0HA 3PUVA 4P4TA 1J90A 1YZKA 3NKVA 4S2EA 5HPYB 3SZRA 4C3ZA 3LQRA 5KDLA 4KO8A 4KODA 1A4RA 4UXJA 4JLMA 1CF4A 4V02A 3W3ZB 1GZSA 3PXGA 5FBRB 4CEHA 1G3MA 1E99A 3NBXX 2QTVB 1W5SA 2PLFA 4I1SA 1AQYA 2DYKA 3N70A 4LJ4A 5DE3A 4W5JA 2ZVPX 1E1QA 3Q8XB 3FMIA 1QHGA 2W0MA 1ZAKA 4A8JC 4EUNA 5L3SA 1ZP6A 4QRHA 5AR1A 4LJ6A 2UZIR 4O0MA 4Q4HA 4DC9A 4DDWA 1DEKA 2O8FA 2ZI7A 3GJ3A 1O87A 1F48A 2R6AA 4OHYA 2ZR0A 3LLMA 3LXXA 1TNDA 1EX7A 5CK4A 1OF1A 3QXHA 2IWHA 3IEUA 4BFZA 2XOKA 1VECA 1CIPA 3VKGA 1YR6A 1AZTA 3QF4A 4S35A 3TH5A 3THYB 2PJRA 3B82A 1D9XA 3TK1A 3BH6A 3BE4A 5FTKA 2GEVA 2Q21A 5B2ZA 1SXJC 2PCJA 5EZ5A 1OXXK 1XZPA 3PUWA 2XB4A 3GLFA 1GDDA 1KZGB 4BFYA 4WXRA 1UKVY 5D3MB 2B21A 4UJ5A 3BK7A 1LTQA 2SHKA 4HB4A 3SS8A 4KFRA 4J0QA 4M1YA 4GMXA 2Y8EA 3CF6R 4M0LA 3UKDA 2JA1A 1MV5A 2VF7A 1QG2A 1W46A 2FMXA 2R6GA 4C0HA 1M7HA 2WPDD 1Q3TA 4ZCMA 2ZPTX 3GEEA 1KYIA 1MO3A 2FFQA 3CPJB 3KFVA 4PAOA 2GXAA 1JR6A 2DWQA 1MKYA 4XTCS 3F5FA 3QI2A 3TQFA 1NMYA 1GL7A 3X1XA 1HURA 2CCGA 5TDHA 1Z5ZA 5DO9A 3SQXA 2QAGA 4HI0E 3B1XA 4IVPA 4MRVA 3TJZA 1GIAA 5C4GB 2AFHE 3M1IA 1Z63A 2JLVA 2OLKA 5TXGA 1FP7A 4P32A 4GL2A 4FMDB 1G5TA 1KO1A 3U6BA 3SQWA 2EVWX 2QUZA 3AP1A 4KI0A 1T5IA 3EC2A 1S3SA 2YYZA 3K09A 3KXLA 3NH9A 1TF7A 2GILA 3BFVA 4TYPA 2FEOA 4TQ9A 1OH7A 5LD2C 3VAAA 1W4RA 2KBEA 3B60A 1L4UA 3C5HA 1UKYA 3KQUA 1F2UB 2EYUA 4NYJR 2P65A 1LNZA 3OE7D 1SVOA 1YZQA 1XB2A 1KY3A 3A4NA 3U4QB 3D3QA 3AM1A 1KJYA 2EFEB 1EFRD 2V6JA 2VQSA 4IDQA 4QJ3A 2AK2A 3F8TA 1NLZA 2JLUA 3VR1A 1W7AA 3BFXA 3KFXA 1II9A 1U9IC 4N0DA 2F3TA 2G88A 4UKDA 2NZJA 4NU0A 4DLVA 2YWHA 2MSEB 3GFPA 4OK3A 4PZYA 4WZBE 4O25A 2V54A 3TW8B 1R8SA 1AK2A 2HF8A 4JS0A 5CM8B 4JT2A 3V4RA 4QBIA 2XTMA 5KO2A 4IXNA 2MSDB 1GNQA 2H16A 4PHTA 3WP0A 4DDUA 1P73A 4PPQA 2KWIA 3CO5A 4U5XA 4CEJB 2K5UA 2WPDA 2H18A 5UKDA 5DI9A 4WW0A 1NVVQ 2W2TA 2V6IA 5KDOA 2GK7A 3MGCA 1S0UA 1SKYE 4DWJA 4EJSB 2V9PA 1H65A 1EFUA 4A0FA 2E87A 4FN5A 4B71A 2GZHA 3N5CA 1EG7A 4JMPA 5GJWC 1WDTA 4ZI3A 1GUAA 2YNMA 3A58B 4B73A 2ATVA 1R0XA 4WXPA 5LDDC 2FFAA 1S8FA 2ZI4A 3BB1A 3UG6A 2VHTA 2Z5FA 1U0LA 2NG1A 1II8B 4PHGA 2D7CA 4CEIA 4LV8B 2G83A 1UKZA 1X8JA 4GPTA 1UDWA 1XPOA 2YWGA 2BDTA 4DHEA 1EFRA 1DO2A 3S1AB 3EZ6A 5JI3E 1YR7A 4K81B 1EK0A 1X1SA 2PZFA 3R7WB 3SJBA 4Z1MD 5JS8A 1CRPA 1QHHB 5H1YA 2J9RA 5FPSA 2EFHB 2KBFA 2W83A 2ZE7A 3EIHA 4CT5A 4HB3A 1SULA 4B2PA 3ZVNA 2WMOB 1G8GA 1FW6A 3VX3A 5K8IA 1XJ0A 3UMFA 4LC0A 1TEVA 1KI2A 2R2AA 3QXXA 1KZ7B 5G40A 4BGDA 1IHUA 4C0BA 4ZDKA 5DHFA 2QSZA 3RS7A 1S9HA 2CVHA 2GEUA 2WAXA 2H17A 2P6NA 3NIBA 3PUXA 4JLNA 4LI0A 5B57C 1S2MA 2C95A 3DKVA 4CT4B 1E2GA 2OUKA 5JJKA 1P9NA 2IYWA 1U8YA 1P2UA 3I62A 2QL6A 4IDNA 1OHHD 2AWOA 1KSJA 4LZZA 1U0HC 3CWZA 4GMDA 4KFTA 4QXAA 3B1WA 1TF2A 5FTLA 2D62A 4IHQA 1XEFA 2W6JD 1E2EA 2GAOA 4DBLC 4MH0R 2ZR9A 3REFA 3TE6A 4R7ZA 5JSZB 3LA6A 3CX8A 1GRNA 1WF3A 2C98A 2ODNA 5AJVB 2IA5A 2IS1A 4JL6A 5JJLA 1AS3A 4B2LA 5ELXA 1XD2A 1SVIA 4ERNA 1GP2A 1PUJA 4Q1FA 5GJVC 2OE2A 1DBSA 3MUFA 4Y0AA 3I92A 1KSGA 5EUMA 4DIDA 2ZAMA 2WWHA 1ZD9A 5JWHA 1UKEA 4DT1A 2VYFA 5FTJA 1G8PA 2XSZA 2GBLC 3FHOA 3WBJA 3MG9A 3OIUA 4BPBA 4M1WA 4QNRA 5F9HA 1NN3A 1Q20A 2RKOA 4KCGA 1TF5A 2JEOA 2RHMA 3VFDA 3UMRA 3I72A 3U2QA 3EIQA 1J8MF 1Q0UA 4MA4A 2A5JA 4Z1MA 4AG6A 5BN5A 3QKSB 3ZZTA 2JLRA 3H1TA 3D6TB 1G7CA 5KTYA 3ICEA 1ESMA 1TU4A 1J2JA 1G8FA 1TL7C 3AVWA 3TIFA 2ANBA 4LJ5A 5FTNA 2ZU0C 4RZUA 5TMPA 5IT5A 2UKDA 2IC5A 1YRBA 2QP9X 1JAIA 1OV4A 3VHXA 4HZUA 1YZLA 4DLYA 4CRWB 4TQAA 4M9SA 3CW2A 1MO6A 2GA8A 5HR5A 5HZHA 1G6HA 4A2WA 1MOZA 3WMFA 1S1MA 4WA7A 1OHHA 2G1JA 1XCMA 1QBKC 4D4JA 3N2EA 2QSYA 2R65A 2VHJA 4AIIA 4DVGA 1T0HB 3U3RA 2ZJ2A 1JPNA 1BKDR 1DAIA 3R20A 3T15A 3V9PA 2W6JA 2Q9CA 4PPFA 4TZ6A 4JLJA 4MKHA 4V03A 2CBZA 4MDEA 2C78A 3U7GA 2FPKA 1EXMA 4E07A 4WOPA 1YR8A 1AM4D 1KSFX 2DFLA 1G7TA 3OEHA 3ZGXA 4LYJA 3AKEA 2H8KA 1P61B 2CNWD 2P6UA 3H0KA 4ZKDA 2BMFA 3R8FA 1XMSA 1FMJA 2EFGA 5KYKA 3A4MA 4TMZA 5JLJA 4MUAA 5D3MA 1KK2A 1BIFA 1RPZA 2BJVA 3CNNA 2C9CA 3MWJA 1E2NA 4I1OA 1Z28A 4NKRA 4NYMR 4Q9JA 2XJ9A 4URUR 5JBQA 4QOSA 2CK3D 4V0ME 2JASA 1ZU4A 1ONBA 1W2GA 2XZLA 3G0HA 3GJ5A 4QG7A 1QHXA 1R7RA 5L3VA 4MKFA 3WHKA 2FU5C 4KAXA 2AFIE 3O8DA 4YONB 4W5HA 2F1JA 2ZRCA 2AN9A 3TUJC 3ZZUA 3K70D 1YHNA 4Q9LA 1HQYE 1KAGA 3BORA 4Q03A 1E3MA 2O8CA 5CJPA 3VU9B 3JVVA 1W36B 3QXCA 4Q7KA 1UBEA 2ZM5A 4TLBA 1BO6A 2A5FA 5LB4A 5KNBA 3DEFA 2X8AA 1S9DA 3D31A 1MT0A 3UANA 1R0WA 1NKTA 2BEKA 5KUTA 2P5SA 5HZKA 1KAOA 1M2OB 3U3OA 2BCJQ 4TWZA 1F2UA 3AVPA 2W6IA 3U4QA 4HDQB 2QORA 2BBWA 5FUWA 1H8ED 3TRFA 1XFAA 2IYSA 4G5OA 3IBGA 3RNLA 5F3WB 1NSTA 3IEVA 3HYTA 5H70A 3FFBA 5JRZA 3GP8A 3NBYC 2VHQA 1N6IA 1GM5A 3Q9LA 1N6OA 2O0KA 1P9WA 2WHXA 2CNWA 3FOZA 3KXKA 4OJKA 1UEJA 4L15A 4PX9A 5BYKA 1R6BX 4IJMA 4D4LA 5D3QA 3TAHA 4URWR 1F5NA 2ERXA 3IILA 5J5CA 4BFSA 1XNJA 5AJZA 1KI8A 1Z3IX 2R6FA 2F43B 1NBMA 4NCHA 4RD2A 3CONA 4GDFA 1C9KA 4CEJA 2CK3A 3LW7A 2Z0MA 4DIEA 1J7KA 1R10A 2ZRGA 2HJVA 3BFKA 3NEYA 2IYQA 1DPFA 4QJ4A 2A7QA 121PA 1FP6A 1W1WA 1X1RA 2JJ8A 2OFXA 2QT1A 3CB4A 5F9FA 3CRMA 1WXQA 4EJSA 3WMGA 2P3SA 4Q5IA 5F2EA 3B1VA 1NG9A 5G3YA 2RGNA 3BERA 3SR0A 1P3JA 4JIMA 3KKOA 2DB3A 4AY2A 3JVUA 3AKCA 5LPNA 4BLOA 1QDEA 3LH5A 2ZSFA 4M1SA 4V0MA 1CR4A 2X77A 4Q4LA 2FN4A 1SKQA 1II8A 2DFNA 1OIVA 3CRW1 4PFSA 4ON9A 4IDOA 3U6KA 1L4YA 2DPXA 2FPLA 5DN6D 1P60A 3RS5A 4O3MA 4V0OA 2GESA 1ZM7A 3THXB 4M9QA 1N5IA 3ND8A 3GJ8A 2VSXA 4OHVA 4URZR 3R7WA 3T35A 3FHTA 1QHHA 4DRZA 4QHSA 4L8GA 1T4GA 5TARA 3CNLA 2ZRAA 3MAAC 3W90A 4OL0A 3FVQA 3H4MA 1G3IA 1U8AA 2XNDD 3C7KA 1G7RA 3GLFB 2V1XA 2CL6X 4Q18A 2F55A 3KDSE 2OXRA 2Q6TA 4A2QA 4ZI2A 2IHBA 1PLKA 1G4UR 2O5VA 2G77B 2F1HA 3A36A 4NCIA 5TVKA 4PO8A 4Z8YA 4DEYA 1DOAA 2WKPA 5KSPA 2RHDA 3RRMA 2AHOA 4E09A 4XWKA 5DIFA 2AX4A 1IOZA 1W0JD 3VNVA 4PC3A 2LKDA 2BKEA 4DJTA 5JSZA 4MGYR 1XXHB 2CVFA 1NL3A 3LD9A 4ZDJA 2WJVA 1Z0DA 5F98A 4OK6A 3L0PA 2GWHA 4HZIA 4CGZA 2JJ2A 5GADl 2G1KA 1VG1A 4BEJA 1QHIA 4FMCF 5H8WA 3O8BA 2CLCX 2FPMA 3A6PC 3ADDA 4AKGA 3EPHA 3GLHE 3NXSA 1VCOA 1VHTA 4G1UC 3FMFA 1DADA 3T34A 1LY1A 1JB1A 2YOFA 3FMPB 2Q3FA 2EU8A 1II0A 2QPOA 1VIAA 1SZPA 2ZEJA 1XX6A 3F0TA 4H9GA 4TLEA 2AD1A 5DN6A 1MO5A 2WZQA 1AQUA 3DOFA 3E1SA 4O2RA 4TTQA 5B30A 3DL0A 3FTQA 1R0ZA 3QKSA 4A0GA 1CJMA 1QF9A 2IS2A 2J0SA 3PEWA 3SNHA 1VTKA 1EFCA 1YU9A 5DHAA 3EIEA 4P0TA 4B6EA 1JQLB 2CLSA 1ZYUA 1GAJA 4OHWA 2V7QD 1ZIOA 4C0SA 1GSIA 2O8EB 1D6JA 2IXFA 1E2KA 5A4JA 2HYDA 1PZNA 3AF1A 3EPKA 3HWSA 2XB2A 2H1LA 2CDNA 5C18A 2CXXA 4RKFA 4B3XA 2QP4A 5CIWA 1XMJA 1OLOA 1AJEA 1W0JA 4KJZA 1AKEA 3A8TA 3LY5A 2QGZA 4XJXA 5JEEA 1LF0A 2IF2A 1U81A 2IYZA 2JJ1A 3B9QA 3CKLA 3AH8A 2WWWA 1NY6A 3GD7A 1X6VA 2WM9B 2NQ2C 3EZFA 3QKUA 4Q7MB 3LQQA 4JBXA 1ZINA 3LV8A 2PX3A 3QKRB 2ZS7A 3B1ZA 2IUTA 1G19A 1E9DA 3QVVA 221PA 5EE9A 4Q21A 2BKUA 2DFTA 5FOXA 4ITRC 2F7SA 4CEIB 1TX4B 2VEDA 4ARZA 4AYXA 4A9AA 2RGAA 2XNSA 1TQ6A 4GBMA 2ZRPA 1VG0B 2VP2A 4NE2A 2R9VA 2GXSA 2PZGA 1SVLA 1YQTA 3QPWA 4TMTA 5JCPA 4Q9HA 1JR3D 4D4KA 5G53C 2YOGA 1LV7A 5JCZA 1G3UA 1OPXA 3RLFA 1EGAA 2ZSDA 4MYTA 3KQNA 3VQTA 3LLUA 2Q9AA 4KBFA 1YZUA 3QIAA 3LAWA 2GHIA 4MGZR 4YXWA 5BYJA 3X1ZA 3AGPA 4P4SA 4KV9A 2V3CC 3LBIA 2GAAA 2V7QA 3QKTA 5BWMA 5GJCA 2ZSAA 4U7DA 4AKHA 2BCGY 4NMMA 4DSUA 4H1UA 1T9HA 2QM7A 4BRWA 2EWWA 2IYLD 3WMEA 621PA 3CX6A 1XJCA 5EXXA 2CMKA 1GNPA 1VKJA 4E5UA 3IQWA 2PL3A 2W00A 3G82C 4R98A 2WJYA 1E2FA 1E9CA
chains in the Genus database with same CATH superfamily
4E46A 3N2IA 3O2NA 4G5QA 4OPMA 1Y5RA 4YT4A 3OLQA 4N54A 3LKBA 1TUIA 5IUKC 3W77A 1G8YA 1XL0A 2HDHA 2X9NA 3EEQA 3GNQA 3SJZA 3U81A 3N8NA 3TLYA 1TEXA 2PMWB 4ZTBA 4C07A 1X74A 3OZTA 3T06B 4B84A 1YRLA 4IGKA 1XTSA 2PO5A 3SLKA 4BB9A 3OURA 4DIMA 3HI6A 3CH5A 4DT1B 2VA8A 1IBRA 1TIBA 1V3UA 3J80A 1UZUA 5KWIA 2YTZA 2RFLA 3BGSA 4OA5A 4O2BF 5KIAA 1X1AA 4X3OA 4XOUA 5DM4A 2D1YA 4LNUA 1JUDA 1VZ2A 1ZUIA 4XX0A 4FILA 3UJDA 2I4OA 1YCFA 5KPDA 3NKFA 3V55A 1NUHA 5COAA 5D8DA 3CX7A 1QV6A 3U13A 4B3JA 4EI2A 1RVDA 4MRNA 3T1VA 3JASA 1IC6A 3UAGA 5H0IA 1SBYA 3IOCA 4NTZA 3Q41A 3Q3EA 5K8UA 3I45A 3IT0A 3KB1A 1N2HA 4GOKA 2QR2A 3FWKA 4GBGA 4LY0A 4RSMA 2II6A 5KX5A 1OXSC 3GDWA 4HRVA 1EWQA 5WRFA 1O9HA 5SY4A 3AF3A 4K6HA 2QN8A 3GRKA 2QNRA 2XMSA 2PNFA 3RJTA 4WDQA 1HYBA 3MFYA 5C0OE 2ZAYA 1ULUA 3QFRA 2Q2WA 2L0XA 3HNPA 3K1TA 3MFQA 4HZUB 4AIRA 1I4TD 2QU8A 4OHZA 1D6NA 5K2MA 3AB8A 2P41A 1S5PA 3FUCA 2BGNA 3K73O 3PCXA 5B4TA 4CKCB 4I2VA 3KEOA 5DOZA 2Y0PA 3VR6H 3O2JA 3FUUA 4G0NA 2NQTA 2OHIA 3BHMA 3BMOB 4OSEA 2XOEA 3GCXA 4YJFB 3EXG2 1Z7EA 4YPVA 2EX0A 1Z35A 4YROA 3L1IA 1DQYA 1H3NA 4C43A 1A8UA 1L8LA 4GWLA 4R83A 3UM9A 4QKQA 1ISPA 1Q16A 3OX1A 4BECA 3AUFA 3NH6A 1QMGA 4JBHA 3TECE 3LX8A 1XJQA 2X41A 5HCNA 4NCXA 5BNFA 4BJ5A 3THXA 1Y5MA 3IDQA 3VVCA 3VNUA 4LSZA 3TSWA 1A5BB 4Z4GA 3T3MB 2GNAA 1FFXB 2ZUDA 4CKWA 1EE2A 2PTHA 1FP4B 4UTXA 3E3MA 3QMMA 3OD1A 4DQDA 2AL7A 3OIYA 2JDIA 3PFIA 1TYZA 2I8CA 3LO8A 4NZNA 5CVDA 1EE9A 3E9MA 3QBTA 4JJEA 4XW2A 1R6XA 4CJXA 1I3NA 2VPPA 2VXBA 3UA3A 5LP6F 1LQUA 4ATNA 2DERA 2ZYWX 4FYIA 1V3TA 3ZC3A 1KTVA 2J6BA 3I9MA 1QFZA 3OA0A 2JFOA 1RW4A 3ZQUA 3KCQA 5E6RA 1DBVO 4JLBA 1PL0A 4ZGGA 1TVEA 2RI0A 1DG1G 1ODJA 2P7IA 1REQA 4H59A 1A82A 4IWNA 1L5YA 5FEMA 3E9DA 5KHAA 4RHEA 2XYRA 4D25A 2YWJA 2A9KA 3BGOS 1WETA 4P3NA 2AIRA 1RLMA 4NE7A 2AV6A 3EBLA 3O47A 1EQ2A 3RFFA 2O0HA 4KYUA 4D9BA 3UJHA 1JF8A 1KH3A 3LFTA 3C41J 3K2BA 3KOWA 1ETUA 3UAVA 1NTRA 3AWIA 2ILVA 3JQBC 4RCYA 2BTQB 3F96A 1RI4A 4FIDA 1WP4A 4LJKA 1U3UA 2BEUA 4ESEA 2A5YB 2J8ZA 3SHVA 2QSUA 3D2LA 4GC5A 4KMMA 1JILA 1G8MA 3G79A 3WGQA 3X43A 5ABPA 5AW8A 1CY1A 4U00A 3CUEF 1EXWA 1P1FA 3KYIB 1B8NA 5FA8A 4OQLA 5B3JC 3G8AA 3T3EA 3QBDA 4NAHA 2GRUA 2D5AA 3COYA 2BUBA 1LRJA 3GUZA 3B5JA 2W98A 3LM8A 3L6CA 2WUGA 4MJLA 3CZMA 4Z2YA 4Q4AB 4M49A 1T6NA 1ES9A 1WNFA 2ENWA 1KZ9A 3LX5A 1MORA 3DUWA 3TG2A 2GYVA 2REQB 4HWPA 3SF0A 4YECA 3W6PA 5LQRA 4KFCA 4LBWA 4WGGA 2GVNA 5K0SA 4I3HA 3MMNA 1GPH1 1Z4KA 4MXDA 4D97A 2RJNA 4G4SP 1BH2A 3I6MA 2XGSA 2XW6A 4OOFA 3EZ7A 3KYBA 4C88A 4RSGA 5COBA 3TLJA 1QGYA 2HPVA 5KVAA 2ZI9A 2R4TA 3GN1A 5BP7A 4JHXA 1ICIA 2ESRA 2IVZA 4U7WA 4XUEA 4YDRA 1AHNA 3ST7A 1FFAA 3DMDA 4BQSA 5CXUA 4DLSA 3W3AD 4LYAA 3ZGVA 4PEVA 5AVYA 3JPYA 2PUDA 1R00A 3MINA 2NO9A 3BQNB 1N2BA 1USWA 1XZGA 5I7AA 3OFKA 1A5TA 4TRMA 4YMVA 1LSSA 1B3RA 2W11A 2Y71A 5DGTA 5FOQA 2VNSA 5DNUA 2ZUEA 3AVOA 1GD1O 4UMVA 3KAJA 5FQOA 4GX2A 2C9DA 3OPXA 2ZIUB 4MVJM 4HLUA 2OCYC 2WYVA 3DVLA 2C5HA 3DYIA 2CBXA 4O2AA 4YRKA 3A1UA 3I4CA 4EGFA 1P0IA 3K4HA 5TQJA 4LRQA 4QZVA 5EEHA 3ZJ5A 4DV1B 1Y1KE 4MUEA 4R8MA 3SZMA 1HLGA 4IVRA 4BLQA 1R18A 5K0EA 5CITA 1PNTA 5E1DA 4UNSA 4EKNB 3RNOA 3VNAA 4HRYA 9LDTA 3FZEA 5TJ9A 1AG9A 1SWWA 3EGXB 2I9PA 5GWXA 2YYSA 5BYBA 1VE5A 1OH6A 4KKXB 1WB5A 1KOFA 4PR0A 1ONOA 4RFSB 5L6LB 1ZR2A 1QRDA 1ZVJA 3BC1A 1P7CA 2Q6VA 1CIJA 4FWIB 4E88A 3H84A 4JX9A 3P9RA 3KQYA 2W4MA 1G98A 3WB0A 3FUTA 1J99A 1LS1A 3BXGA 4OVKA 4D9KA 4J0EA 4F5YA 2PR7A 2VDOB 4HPXB 1MQ8B 5DYWA 1VCNA 1EM6A 3AL2A 5HUHA 3EODA 4TTJA 4N3BA 3BL6A 2AFHA 2XMBA 3UWPA 4HL6A 1AQJA 1YRAA 4G3XA 1B6TA 4DLLA 2RHRA 4HDCA 1YL7A 2ZS8A 4ZEXA 3IJPA 2ZIVB 3U7RA 2OHVA 4EO4A 5KINB 3R6GA 1IJFA 1KBZA 1THGA 2A9OA 2XB9A 1H5NA 2JIBA 4NCKA 2Y99A 3BBPA 3I5AA 4NBRA 3OESA 4JYBA 3TRKA 3IAM1 4H7HA 4QNMA 4EX7A 4N1AA 1K8RA 2JIZA 4XKJA 3KQOA 1WG8A 2FE1A 3TOSA 1KY5A 5GQSA 4DSOA 2H4HA 4G37A 2JGEA 2REBA 4HYQA 4RKYA 5G0VA 4BX2A 4NOJA 2B4TO 5FNVB 4B6JA 1EJ6A 1TQ8A 3L1KA 3P9YA 3GFRA 5AK0A 4DVJA 3RCBA 1H0KA 1UMDA 5TQ0A 3UJBA 1G16A 3ZJTA 3T3OA 2O50A 4E94A 1NLYA 1RPJA 3CUTA 5AVOA 4ZV7A 3LQ1A 4F71A 4AF8A 1DAHA 4Q9DA 2G0TA 1WABA 2IUEA 3WS7A 1JIUA 5C81A 3HO1A 1J5EB 2JFUA 4NU5A 1UPFA 3BGIA 4ZHQA 4Y6RA 2YWXA 1I6MA 4GZLA 1Y1RA 2NVUA 4KDRA 3DDWA 4Y2QA 3MJDA 5A4MS 2UZ0A 2AE1A 3TX6A 4LRSB 3N6XA 1J07A 1SZDA 1XWWA 4DBLE 3NORA 2BKVA 3C3XA 4EFLA 4MVWA 4X8MA 1NFRA 3RPEA 4TWJA 1LK7A 1JSCA 4NLLA 2H54A 1VLLA 2C2BA 1KC1A 4G8JA 3V1KA 5BW8A 1ZM9A 4AAYA 1BFDA 1LBHA 1R50A 1MR3F 3QU4A 3ZG6A 2TMKA 4AMVA 5BSKA 3QW4B 3C4QA 4BLPA 3L4KA 4G01B 2Y1WA 4B9AA 4LKRA 5KMGA 4O2BB 3ZCUA 4GWGA 4PO1A 2RB5A 2VKTA 2VQ3A 4Z0HO 3VR3D 4DCTA 3S8EA 3QJYA 4MR8B 3PNKA 1BTOA 5AOVA 5FF9A 1UFKA 5JFOA 4YMLA 4L16A 2Z8YM 3LC1O 1A77A 1O6CA 2P8JA 2QW1A 3IQGX 3TD2A 1O58A 1EDBA 2IPOA 3AFNA 4HATA 4GX0A 4E70A 2QLLA 4QBFA 1T1SA 5JMWA 3ZV5A 3SYTA 3VAZA 4IDEA 3NOOA 5C4MA 2XWSA 1R0SA 2OK8A 2PRJA 5CVJA 3AM5A 5K6TA 3L6DA 3KB6A 4ZO4A 5AW2A 1N34B 1KYYA 3RVDA 1ADFA 4TT3D 4KR2A 4UU7A 3ETJA 4ZKEA 3TSAA 1DQRA 2D2IA 3GT4A 3RVBA 7ABPA 4WKNA 3O95A 1H22A 2IXTA 4H15A 4A8JA 2AW5A 3BJRA 5B4VA 2I4LA 2ZTUA 3PA8A 4QU0A 1KPGA 1E8MA 1KVSA 4WFQA 2MINB 1Z39A 4O4JB 3K0AB 5ELLA 3P4XA 3H6KA 1FXUA 3G2HA 2BP7A 1CJUC 1FRNA 2AOVA 4WJLA 2H0QA 3IJEB 4C76A 2FX3A 3JYNA 3ZEIA 1EFPB 2EX1A 1E3QA 4B3FX 2ODPA 3M6MD 2IW1A 2ZJ0A 3QLTA 3ASYA 3QFHA 3RK0A 3THWA 4BJ6A 1MZVA 2BR4A 3M1AA 1VOTA 2Q27A 1J56A 3GNTA 2BE7A 2VPWA 4J07A 2V5VA 1YQ9A 3S5JA 4A0RA 3MCAA 3WC4A 4CN8A 2Z5LA 4E13A 1OZFA 4PXAA 2FP3A 3T5BA 1XK7A 5C46F 3ZNPA 5CYOA 4CG0A 3KX2A 4AK9A 3DG9A 2PLAA 4GVLA 1H85A 1Y1QA 2AXEA 2HCFA 2YHIB 3JRXA 3KNZA 1G3RA 3MK31 4K28A 4BRUA 1HT1E 3PF9A 4OKNA 5TR9A 1SUFA 1CY2A 4X20A 5CEFA 7REQA 1XQ6A 4ARZB 2ZZNA 2L19A 1ODCA 3NDIA 3FSJX 5AM2A 2ZQZA 4DDTA 3FTNA 4QEDA 8GPBA 4HAIA 3PQ4A 1Q12A 2HMWA 3ADKA 2J5BA 3KXDA 2GVDC 3QBVA 1VSUA 3OMWA 3EC1A 1SCKA 4RBNA 2CDBA 2HLNA 1UF9A 2FG6C 5KYYB 4WXYB 5TPZD 3T4XA 3JZMA 3AB3A 3QUQA 3N86A 1XCBA 2XCIA 2YV2A 3MTGA 1NXOA 3ZE8A 4BDSA 4CG1A 3V5NA 3ITEA 2REOA 2Y0EA 4ZO8A 1EK1A 4K86A 1YR9A 5CX1A 2CNKA 3GGCA 3TR0A 4DPMA 1DBQA 2J9XB 3VPBA 2RGNC 2DECA 1LPNA 4PAQA 4IL5A 4C06A 4R8LA 4R1UA 4WKGA 4J1NA 4M87A 5K3FB 3ZHQA 4S0ZA 4LF5B 5H83A 1RAAA 2GBPA 1GFWA 2R7NA 4YDHB 4P98A 5E0OA 3ZTWA 2PKCA 3WZMA 1C7QA 3ANTA 3N2ZB 1Z0JA 2ZYDA 3OH8A 4MTLA 5GV8A 4DLXA 2P3QA 1Q2UA 1HEYA 3PHIA 2AEJA 2DPHA 4G4GA 1OR8A 1VL6A 1YUNA 1A8PA 2VZ8A 5JADA 4HUQB 4JROA 4G09A 1YTLA 5B1HA 2H4JA 3NS7A 3IIJA 1VHLA 4E2YA 4NV1A 4ZAYA 2IEYA 2QPLA 1VCMA 3I01A 3VI4B 5EJ8A 2BFBB 3GELA 2UYYA 1JAYA 5TF4A 4K3UA 1THZA 2CNOA 1CRWG 3N59A 4OEHA 4PPGA 4X9XA 3RR2A 4C3ZA 4H1HA 1J25A 1E20A 2PMFA 2QOEA 4LOLA 4PLCA 2RHTA 4C5BA 4F1WA 4MR7A 4O8ZA 5EHXA 3KUCA 1OI4A 4K3VA 3TZKA 2DSTA 2YVKA 3L0IB 1FYWA 4B48A 2CJWB 4X71A 4TM8A 2YJGA 1CBUA 1T43A 1M8GA 3N8IA 4LOKA 2O8BB 5IJ0B 3GEIA 2B5WA 1I4LD 2GCPA 4NPHA 2H6EA 1E1KA 2ZDGA 4CW7A 2WV9A 1J33A 3S28A 2C8JA 3EGDB 3QM1A 1W0CA 4JVNA 4R8SA 4Y2XA 1J5XA 2CMHA 3VPCA 4D26A 1RLTA 1C3XA 4MRSA 1I2AA 2Q1XA 2VO1A 4PCVA 4F3TA 4KXQA 3TTYA 1GTVA 1CNFA 3LHKA 2V6GA 4F4HA 5IAAA 4W7HA 1NU6A 3RIGA 4Z54A 1NJ1A 3Q0TA 1A7AA 1CF9A 4XGIA 4YJ2B 5FWYB 1O7JA 3A9VA 3LPNA 4I7EA 3V8PA 1MMFB 3B9PA 1KZ6A 1VKHA 4F9TA 1C0KA 1C1YA 3WRYC 1T5TA 1XD9A 4G0ZA 4ZK6A 4ZYVA 3U39A 1Y48E 4M0KA 1W1IA 1LF5A 2IYUA 4LF4B 4M9ZA 3D0KA 3JQAD 3Q3GE 3QPVA 1NSFA 4LJ7A 1L8AA 3ZW7A 2J0UA 3DB2A 2JLAA 3GG2A 4FEAA 3C97A 2JHCA 2O5CA 1G6OA 1NXSA 1S4QA 1SHLA 3JCZA 1T2EA 1N2ZA 3U16A 2VJKA 3AZOA 2AFIA 4PY2A 4JQSA 3PT9A 2DOKA 1H8EA 1L5HB 3IA7A 4LQ4A 1OJLA 2FP4B 2J48A 1RYFA 2CXNA 2YMMA 1F2TA 3AOEA 2PJDA 3C4JA 3JZAA 4GKVA 1RFLA 3TTVA 4MRMB 3IVRA 4JR0A 1PLLA 1ICEA 1MAHA 3D7MA 4WERA 1RZRA 4PLYA 4R01A 1GLVA 5CFOA 3ZGZA 1N2OA 4EPVA 4FKBA 3NIWA 4S1NA 2DCUA 2WSLA 3KYDA 5AI0A 4KK3A 2HR1A 3EISA 1Y7TA 4K7JA 2AG8A 1H3FA 2E4XA 3UV7A 5E95A 4ENTA 4GOXA 2NXWA 2XEXA 1GCIA 1X80B 1CRLA 1RHQA 2Q0QA 3FTDA 4RZXA 1MQAA 1S7GA 5T3YA 1H2HA 4FCVA 3SBEA 1XMQB 3DBIA 3ZW9A 4XM2A 2IYTA 2RHGB 5I8ZA 2WJAA 4D0SA 4XIIA 1SG6A 1NPYA 2ZTSA 3MT7A 1KARA 2ODBA 2PZJA 3P94A 4K03A 3ZV3A 2FW6A 4M6WA 1E6WA 1XZQA 2OM6A 4UAVA 4AZ0B 1MRSA 3G9XA 4CTNA 2Q99A 5MF6A 3R9KA 3L4JA 4N47A 2PCLA 1FTWA 3OIGA 3EOAI 5LA6F 1CUZA 1RQGA 3WQQA 4I5EA 2YC4C 3Q8KA 2KQUA 2GFIA 4LSMA 1H8HD 1VRWA 2CV1A 1HDIA 1D07A 2OV8A 3BMQA 1RE1A 1H6BA 3VV2A 2RK3A 1U3TA 4TMXA 3ZU6A 1PW7A 2Y2UA 3NG1A 4WNAB 2DXIA 5CP8A 2A1UA 4LOJA 4QDZA 3S55A 5MGBA 2EBFX 4FJ0A 1IUNA 4ZANA 3VMMA 1OZ0A 3ETEA 4QUJA 3AGQA 3ONDA 2IYYA 1TMYA 1CY8A 4EG0A 4OX9Y 1M8KA 3K2IA 3MUNA 2QTLA 3WWZA 2GAJA 4MKRA 2XXAB 3AM4A 2APJA 4FFNA 5IJ9B 2WYHA 3EXAA 4Q16A 3B89A 1CDEA 4D9FA 4EGAA 2JGLA 1TVMA 2X9VA 2LDBA 1NUQA 4II7A 3OCWA 5HKKA 3QHPA 3UY4A 1M1UA 1I94B 1HYGA 5H3CA 1MQ9A 3OX4A 1MRZA 1NLFA 2ZBRA 2WG2A 3M33A 3OEWA 5CYFA 5AW6A 1NATA 2R8ZA 3HO8A 2XDYA 3NWJA 5FPYA 3B2QA 3GGSA 1WS6A 5C4IA 3IIMA 5J4KA 3HU5A 4EKDA 1T6YA 3I9V1 2LWIA 1A2BA 3KT0A 2DTDA 3JALB 3VI3B 1ULZA 1VLZA 4DCUA 2NZUG 2W2XA 3TVTA 1Q0SA 3U62A 1HBJA 4HEA6 3L3BA 4ZIRB 4PQGA 5JD6A 4J1TC 3LGAA 3PD0A 1CCWA 3AKDA 2R6HA 4ZGWA 2W37A 1HDRA 2HHLA 5F21A 1AQNA 4CIBA 3H5NA 2J67A 1MNAA 4RKQA 2J0VA 4OMFG 4QPCA 3F6BX 5A0VA 3LXUX 3WXMA 5IAEA 1AKUA 5BUCA 1GUZA 3CRVA 1KDYA 1BWRA 3H3JA 3GLGB 2IYEA 3ENKA 4KNWA 5F7ZA 5BWOA 3DDSA 4EFKA 3ZXSA 1QNLA 1E5DA 1V1RB 2ID9A 3GEHA 3PYXA 4GKBA 1KE1A 4Q15A 4X66B 2JGDA 3IP1A 1JAXA 3QX9A 2YH2A 5ICGA 4TTAA 3RASA 2ZAIA 2AWNA 5LZ9A 5DJ5A 5DHPA 2FR1A 5CT8A 3B6ZA 1X39A 2GK3A 2QN3A 4HXGA 3KJEA 4IZOA 4Z0TA 1WMBA 2NU8A 4L1KA 3ILHA 4Q39A 3BXZA 4QVGA 4XPZA 2E49A 3HI4A 3RAFC 4NV3A 2ZBPA 3IUPA 1SFRA 3AUUA 3UHFA 3IAS1 3HB1A 1KXJA 1SVWA 3FYUA 4MP8A 1IU9A 1C9MA 4YJGA 2WI8A 3T7AA 4EGJA 3GWGA 4X62B 1LX7A 5AH0A 4WZAE 1CP2A 2EL9A 3GI1A 2XVZA 4CDRA 4AWXA 1OC4A 5A03A 3QNWA 1WW3A 3EB9A 2HM7A 2J7KA 5IC6A 2Y9PB 4A10A 1ZR4A 1SIWA 3KJIA 3O3NB 3F6YA 3Q9SA 4RA9B 5FO1A 3E5HA 3VR4H 1F06A 2F17A 3GPLA 2YZNA 2MSCB 3CZPA 4WDRA 2FPIB 4Z8XA 4G5HA 1JQBA 4LGYA 1USUA 3R3ZA 3N0TA 2WB4A 2PLRA 4RPGA 3QVGB 3VM6A 4YT2A 3W5IA 4DZZA 3O7MA 3LBFA 5JISA 4MW4A 4FD2A 3KWLA 3TL2A 1DC6A 1LPPA 2JCVA 1LRKA 4Z1OA 1D09A 3BWEA 5EUBA 4R2WA 2X42A 2E55A 3MBIA 2ZSKA 3W2TA 5CB6A 6REQB 4CNBA 3ENNA 3PKIA 3D3EA 3GGJA 3HKEB 2GVZC 2ACKA 4NZMA 1BX1A 1W25A 3BD7A 3FW1A 5EWLB 3O4GA 3TOZA 1FTQA 3FKSD 2VDKB 3JYOA 4CKEA 1A7UA 3WFIA 3KWJA 1ABEA 1OC2A 1V2HE 1SXGA 4RK6A 1F8GA 4JBYA 2JCSA 1VLQA 2JATA 1ZM3A 2R5NA 4YQFA 1ESNA 3GLFE 3HU2A 4HDNA 1ZHOA 2G63A 2G67A 4GP6A 4HGNA 5I8PA 3ELWA 4GXNA 3OCCA 2PWYA 1PKEA 5J1TB 1Z8DA 3TKYA 3ZCXA 4DBZA 4UTRA 4HGZA 2ZE5A 1RBYA 1H4TA 1CRQA 1O5OA 2P27A 4HFNA 4W1PA 4X5OA 4ZT4A 1MOPA 5EQJB 2GO7A 3K05A 3HBMA 4LRWA 3U4MA 4LK2A 5IHPA 2JIRA 3VO1A 4MV6A 3UWOA 1Q7BA 3H3FA 5FI1B 3CVYA 1VE3A 4KXFB 2WF5A 3TGLA 1ZCJA 4RIGA 4EATA 3R0JA 5K8LA 3PXDA 4C4OA 2CLHB 3OFVA 1U0BB 5K3CA 3QNUA 1YZHA 4ANFA 1A9XA 4NCBA 4FVTA 3KBBA 2H65A 5F4BA 4DF3A 3V8RA 1U0TA 1LV8A 4TRJA 1EDDA 1P2TA 1GG8A 1PEDA 4FYJA 1NI3A 4IDPA 4L9AA 3UAOA 1JHYA 4HFRA 1KVTA 1ISRA 5AQ1A 1ZN9A 4EJSC 2R6DA 3MD0A 1UDCA 2C0QA 3R5JA 5JQGA 5ARBA 1A2KC 2I4TA 1TTQB 1ACLA 2OV2A 4D56A 1Q15A 2L17A 1OJ7A 2ZDHA 3H87A 3LYLA 4GYJA 5LXTA 3AEZA 1E5QA 2A30A 2PEYA 2VJCA 3ORHA 1GZ7A 2R25B 1KERA 3AEUB 3RD5A 3T38A 3K20A 4DNQA 3E8SA 2BAGA 2Y1OA 5CVVA 2FWRA 4OYHA 4CIAA 3L6OO 3C8ZA 1BXRA 2I34A 2QRVB 3A1FA 4NFLA 3CX4A 1R0LA 4AKIA 3F7MA 3PYLA 1TCBA 2IS6A 1ZSVA 4EHBA 4LJSA 5IC4A 1DBRA 1RTTA 4DCPA 1LBEA 3UMYA 3OA2A 2Y6UA 1O3YA 4RFLA 2EIXA 4GT1A 1BXGB 2EZUA 4G24A 1PFQA 3AV0B 3UJCA 4P3OA 5DISB 3NP9A 2P91A 3QF7A 2C4VA 1KKMA 5FOWA 4C2UA 1VE1A 2N46A 3D5QA 3F5MA 2PLNA 3I6YA 2FRXA 1KAQA 4G26A 4AFNA 5JU6A 5DH9A 3RUHA 3KFLA 4UNPA 3NDPA 4HLUC 3DT6A 2FMKA 2DU8A 1AA6A 1KNQA 3K6JA 4FDLA 2H7XA 3U60B 4DMCA 2V45A 2FF7A 4J03A 1TXGA 1X92A 4ALIA 3IIIA 3GAFA 3HCAA 4GQBA 1NMSA 5LA6B 3S7TA 1HDEA 1X7XA 2G06A 3IR6A 5HILA 5BR8B 3ICQB 4CQMA 4KLNA 4XVQA 3KTOA 4RM2A 3SBXA 3MRSA 4MIEA 3WYAA 4DLZA 3W5UA 2DR3A 4DCOA 4NP6A 4DABA 2Y4OA 1HE3A 2F3SA 1YUMA 2FSFA 2J30A 4ZVMA 3FD8A 3L6EA 1GZ6A 3KR2A 4KFUA 5EERA 5NLLA 1XU9A 1ZKMA 4R0VA 4PG7A 3UBTA 1FYEA 2C5AA 1WNTA 5B58C 1GR0A 1U7XA 2H5IA 3R5SA 1JKFA 4RD1A 4XGQA 4FM9A 1KMHB 1VPWA 4DLNA 3OLWA 1RADA 5AUPB 3H8SA 5HQ3A 4OIMA 1I36A 1S3GA 1Z0KA 3P20A 3ZKWA 3G1TA 2Y05A 2VZ9A 5T6MA 1EKXA 1TCCA 1EDOA 5FWXB 5TQ2B 3RYTC 4LWQA 3SF8B 2PT5A 4LXTA 1NYLA 4N4AA 3I4LA 1RIIA 5C51B 2Q6KA 2E5WA 3DDUA 3T4EA 1XQYA 4YP1A 4AMYA 1OLUB 1VMIA 1T10A 3L9XA 5DM60 1TC1A 2GPSA 2KMLA 3KPYA 4HLQB 5FX2A 1VGRA 2V65A 5AJHA 1EM8B 1SD2A 3CIOA 3VR0A 3K9QO 5CXSA 9LDBA 4WHMA 1J9GA 1YZTA 1NQVA 4U4AA 4DQKA 4GI3A 4XRGA 3JRNA 3NDBB 4I1IA 4NCNA 1Y5NA 2QK4A 1UBMS 1RXSA 1ZOIA 2NO6A 4Z4FA 2W2LD 3OD5A 4NOLA 2BE9A 1Z62A 3I6IA 3I2YX 4BDTA 3MJTA 3KK0A 3CURA 3UHOA 2OV6A 3KVOA 4ZAXA 2ZBDA 1KEKA 3B7WA 4XIFA 2ODAA 3SDBA 3F3SA 4YRPA 5E7IA 2Y1GA 2WP8J 3S3TA 3FCAA 1KFEB 4KAJA 1A9ZA 1LJUA 4WBSA 3P9CA 2CVPA 3CT6A 3CGWA 4LTMA 2VHCA 3SI7A 4C7XA 3MCUA 3ZWNA 1M6VB 1LXCA 1RI2A 5LJIA 2UYQA 4RNDB 2OXTA 2DR0A 4GE0A 4ND5A 4LVOA 4EF5A 1P8JA 4XLTA 4BVGA 3I4FA 2PKRA 3IDFA 2JHGA 3R74A 1M54A 3KR1A 3FYSA 5EJ2A 4IQ0A 4OA8A 1KFKB 2VP0A 1PIWA 2IUUA 3UJ8A 2WNHA 4UMEA 4ZV9A 3VYWA 5BN4A 2OMEA 5FH9A 4XEHA 3RYIA 1W88B 4H3KB 1HTWA 3ZLTA 2FDCA 5M2QA 3RVJA 3IOMA 5DYIA 3RB8A 3P2IA 2JKVA 4ASUD 2HN9A 3U40A 4TL8A 1Z6GA 2JFVA 2XUDA 3FB4A 4RF3A 3IMKA 1AZWA 4R5MA 2JI6A 3O1IC 4W5TA 2PNJA 2FQXA 3W06A 5HCIA 2JJQA 4KOAA 3WQRA 4N6NA 5AKLA 4LUCA 1QH1A 4G67A 1IWOA 2C03A 5KOYA 2K4MA 4OGKA 3LE8A 4KN6A 3O2SB 1HE2A 1FA9A 3F90A 3RWOA 4CM4B 4DV3B 4YBRA 1DKNA 3I9FA 4XOIA 2DBRA 1JB9A 2OLEA 3RYHB 1SOWA 1I7NA 1RZUA 1JDTA 1VB5A 1Y6ZA 3EDQA 5DXFA 2RB4A 5I9BA 4G0WA 1P0MA 3HBJA 4DWVA 3S2EA 3Q2KA 2OY0A 1W5TA 5AXAA 2OA0A 5DASA 3FKQA 5DYNA 5GTDA 2XPCA 4FMBB 3UYLA 1IXZA 4PM4A 1YWGO 5DXJA 1FW8A 3PENA 4DJFC 1WXFA 3G2LA 1FDUA 2GM3A 1X7ZA 1KQFA 1BSVA 4FQ7A 4EAAA 2J4FA 4R2LA 2YXPX 4NMLA 5FULA 1TK2A 4MMZB 4BLWA 1G6KA 1JBEA 1NR5A 3B85A 3V7NA 2M6KA 4EZBA 4F72A 4XDHA 4B45A 2O8NA 4W8GA 2SCUB 4JP8A 3U4HA 3P9QA 4L73A 3KJQA 1PW5A 3EXHA 5CA1A 2YS7A 5BURA 3QRWA 2QN1A 1JJAA 1NUSA 2XITA 3K0FA 1PQPA 2A86A 3W8DA 4R9UC 7GPBA 1KY2A 1NDHA 2ZRJA 3HYSA 4RGQA 3WAKA 5KOHB 2WJWA 3TYXA 5I3ZA 2IEDA 1GA6A 5F76A 1BE1A 1KDOA 4PFKA 4CTJA 3DP7A 4OYYA 3KUDA 1J00A 1P7YA 3D6AA 1UPTA 2WM2A 2OP1A 2VJBA 1NVAA 2YMLA 4GNRA 3B5EA 3SS7X 2VAXA 4CCYB 1OFUX 3W8FA 5FNZA 4DUGD 5E3IA 4XYMA 1XEXB 3QKIA 2AS0A 4H3VA 5J40A 5JY6A 1QVAA 2R84A 5DYYA 2RHLA 3K92A 4KYVA 4NSNA 4XCVA 1ST3A 2VJDA 4Q9NA 1EA5A 4JA2A 3TBHA 2IK8A 4MQEB 4ZAZA 1XZKA 5I9TA 3X3HA 4B3GA 1UFQA 4EYKA 1Q44A 1KVUA 4PCUA 4B6FA 5ADUS 2G9VA 4D0GA 1MBZA 1ODIA 1KO4A 1M2HA 3FWPA 4YUYA 5JNSA 3T3GA 3ZV6A 1X70A 3F7TA 5DBGA 3ZWYA 1UXKA 5FBZA 4EPXA 2ZIFA 3VC1A 1BYIA 5KU1A 4E0BA 3MXTA 4R51A 5IZ4A 1RBMA 2CCJA 1K06A 4EABA 1T15A 1LQTA 3BXXA 3N2KA 4JL8A 5FR1A 3TPFA 2A4MA 2AH5A 4NAVA 3OJEA 2V7EA 1SVNA 3LDHA 1UH5A 1TAQA 1C1DA 5C7IO 2ISCA 4HAWA 1UWLA 1Y8RB 2FSUA 2NZWA 4ZEWA 3D6NB 3NBFA 2ZSBA 3P2KA 2XNKA 2LCQA 3ZWDA 5T41A 3LNTA 1E59A 4E5KA 2G4CA 3DW3X 3H2SA 4AJ2A 1F60A 3MQ2A 4ZARA 3L8ZA 5B3LA 4OHMA 5FHQA 3HDVA 2JIQA 4OQQA 3WGKA 2K6GA 4PGAA 4BVHA 5M3BA 3JD0A 1R6VA 3GLIB 3PRYA 4X41A 1PAUA 5A02A 3L40A 1JW9B 2P9BA 2W6ID 4BATA 4NC9A 4IDAA 4KQIA 5AXDA 5FKJA 3U44B 1WV1A 2C20A 3E81A 2J45A 3DWFA 4UBMA 4YRTA 5C8ZA 2E18A 1X87A 1BEEA 1GGVA 2ZYIA 4IW3B 1V9CA 3HM9A 3QENA 3EC7A 1KBOA 5AIAA 5A0FA 1EFVA 3T95A 1NKSA 4EX6A 2QSJA 3LG2A 1FFEA 4M7PA 3ROZA 1RI5A 1E5TA 1Z5VA 4UULA 3JD2A 4QM7A 1UKCA 3K70C 2B7CA 5DM0A 5CB4F 4MQBA 2ZVQX 3QI7A 2ZZKA 1NYTA 5IYZF 3R3UA 3B8HA 2H7CA 3H17A 1Z9BA 1ZXLA 4LKOA 3RODA 4IUDS 3FR8A 5BNTA 1ST2A 1U3DA 2GBLA 1JEDA 4R7TA 5IEJA 4L6IA 5ICCA 3DMFA 4R41A 5FL7A 2P9JA 4BGVA 4ZCIA 3F1KA 1XKXA 3BIFA 3RRZA 4EA6A 1G41A 5LYJA 2Z30A 4ZQEA 2ZRLA 4H0FA 5CW2A 1IHYA 4JT4A 5FL3A 3N6VA 3P2YA 4JUBA 2C2YA 3U3MA 2QWXA 4NONA 3UIEA 4JLVA 1P6XA 4WECA 4PQRA 2CJPA 5EKUA 4G2TA 2RCNA 3AOEC 4EHFA 4TVKA 1P2FA 4K9SA 5F64A 1CSEE 2NXJA 3GJYA 5IWAB 2GJSA 4X93A 5EHNA 1E1YA 5HDBB 3VGJA 1C7RA 1JLKA 3VHLB 2O2DA 4EARA 2YIDA 4GLOA 1L2TA 1F3OA 3NJ8A 3SU8A 5HFAA 1ITZA 4AMGA 4JQCA 2XRFA 3WAGA 4M9XA 5D5PA 1USGA 1B2RA 3ZZMA 2QI9F 3D81A 4DNFA 2OXFA 2B4KA 4P3PA 2Y1DA 1U8FO 2YVUA 5EQDA 2G0AA 4MQFA 5KC9A 4WCFB 5TPZA 1IXSB 4RD3A 3IBTA 3T3HA 1Q83A 1U5BB 2I3AA 3QV2A 1JI3A 4WLNA 2ZCJA 1TW2A 1XU4A 2IW3A 2ORYA 3ZDEA 1DEHA 1P2VA 1XUOA 2HEIA 4IQ8A 1U2QA 3FNEA 3SZGA 1UJ2A 3BH7A 1Y63A 3COVA 2OHOA 3NHSA 4WLEA 4ZQHA 1YNSA 3SBDA 3KU4A 2Q1SA 4HRAA 1BROA 3BD6A 2X3UA 5A04A 3IHTA 5E1OA 4O4LA 2IY7A 4YRFA 2VPQA 2HQ1A 1EZ1A 4G4JA 5L3QA 1NIJA 3GDFA 1JFRA 2FSHA 5A5GA 1VHQA 3FN4A 1TIPA 4WKCA 4I4CA 4Y2HA 2PPLA 3Q0IA 1B0ZA 1QQ7A 3PLRA 4CLOA 1I3OA 1O6FA 2UYHA 1E0AA 3AZQA 2O3JA 3VTFA 1CZUA 4MI3A 4YC7A 2QN7A 1ZIPA 3PI7A 4CIXA 1ACMA 2C57A 1NJ2A 1EFDN 4WIAA 1DQNA 5A5DA 3ZUGA 3MMZA 4DSTA 3SN6A 1IK4A 4ZYUA 4HDRB 1Z18A 3HDGA 1HE1C 1P1KA 3TS1A 1E1CA 3M1LA 3VTZA 4BU0A 3GLUA 4RVNA 2JJ2D 1AKTA 2FZVA 5F73A 1T3SA 1PBNA 4AD8A 4IIEA 2OQRA 1P4JA 3DB1A 1FFGA 3DOEA 2AZXA 1FUUA 4NJMB 3PJDA 1EXVA 4HQ0A 3CLUC 1UK6A 5FOUA 4E5NA 2CLDX 4D9NA 4W8HA 1KU6A 5BRJA 2QL5A 5ALGA 2ORWA 1YKSA 3S81A 3U7HB 5CH8A 3GMDA 3QXSA 5AVKA 2O8FB 1CR2A 2GN8A 2ZJ6A 2WBLC 3QVLA 5C5IA 3O9VA 3T3DA 5EC8A 2M6SA 2QM3A 4N0QA 3AETB 1N6KA 4CKBA 3O8OA 1NC3A 1X8KA 2A6PA 4EPYA 3C5VA 4TKUA 4JGBA 4X1IB 5K99A 1U99A 4TLAA 4WY5A 1NDQA 1RPAA 2WWTA 4RADA 3I9V6 4GVPA 1U7OA 4K9OA 2JCBA 3STVA 2HADA 5BT9A 2VDJA 3SC2A 2X6TA 3F2VA 3HBFA 5B6IA 4OHOA 2LBPA 4NR0A 1HL3A 4BN4A 4KUHA 1AY0A 4R1OA 3NHAA 3NWPA 1L7NA 3E0QA 5SZKB 2G5CA 2P79A 1EK2A 1XQXA 4N3NA 3E2MA 4WXMA 3WK5A 4JYAB 2EG9A 3FF4A 5DEOA 1DKQA 2ECKA 2YBEA 1K86A 2Q5IA 4UHBA 5F35A 1W49A 1RI1A 1UK7A 4HEQA 3H1AA 1T9DA 3DZ8A 1N1MA 2Z4SA 4KQ6A 1Z8FA 2FPOA 4IO0A 3DQZA 3PDJA 3A3PA 4MUYA 1YS6A 3A3NA 2QENA 1NOJA 2GDZA 3ZIUA 1W5BA 4Q4JA 4PZDA 1J8YF 2VYVD 4OF4A 1O96A 2A78A 4RHUA 2RMKA 1E2PA 1NG1A 3LUHA 2ZJZA 4REQB 1X1BA 3OTHA