1ESMA

Structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
311
Chain Sequence
b'QTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PANTOTHENATE KINASE
publication title Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 99
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1esmA00
1VKJA 4BEBA 2Z5FA 3ZIAD 1KSJA 3CRW1 2O8BA 3PEWA 3SJAA 2JEOA 2YVUA 5FTKA 3L82B 2BBTA 3VR5A 2JA1A 2PZEA 1TF2A 1ZIPA 3AM1A 4IDPA 2AFIE 5GJWC 4B47A 4DCSA 4M2LA 1X8KA 2ONJA 5ELXA 1KDOA 4GP7A 1RC8A 2QAGC 4XTCS 4HAXA 1TAGA 4JSYA 3KQNA 1SQ5A 3ADBA 1RIFA 2NPFA 1G6OA 1P5ZB 4MKHA 2CK3A 4EPVA 3HPRA 1P9NA 2W00A 4I1SA 1G3UA 3C15C 2X1VA 2AHOA 1D9ZA 4M1SA 2QAGB 1EX6A 2OILA 4Q4AB 1AGPA 4RD6A 3DZDA 3CBQA 1E69A 2VEDA 4NHOA 4Q03A 4D6PA 2WV9A 3SQXA 5KU1A 1SVLA 2IYUA 5SZJA 1PJRA 1CBUA 1GL6A 3JZMA 1R10A 2GVDC 1B0UA 5E7MA 5JS8A 1W5SA 2QL6A 3B82A 2HCJB 1KYIA 1SXJD 2WMOB 4RJLA 4C0HA 2Q3FA 1GVNB 3T15A 1AZTA 2UZIR 2OXRA 3BIFA 3NEJA 3AP1A 5J40A 4TLAA 2QTFA 3AV0B 5FOVA 4DT1B 1WBBA 3K0EA 2IUUA 1HE1C 4U02A 1E2EA 4C9BA 2XB2A 4AG5A 1OE0A 1OH6A 2OG2A 4FMDB 4LV8B 4PQYA 3VKHA 1US8B 2GXUA 5G41A 1IONA 2IS4A 5AR1A 5IK2D 1EFHA 1MABA 1NVVR 4L5BA 1KAGA 4EPRA 3B13B 1W4RA 2AX4A 2EYQA 1U9IC 2C9CA 1ZD8A 4IDNA 4IVPA 1OIVA 1R4AA 4M9ZA 2FU5C 1Z06A 1HE8B 4ZDIA 2ZE5A 4OI0A 2E9SA 2IYRA 4B3XA 1N0UA 1Z6GA 3SI7A 1FX0B 1YKSA 4A82A 1DARA 2F9MA 4RVCA 3EIEA 2J45A 821PA 1FL9A 1K5GA 5L8VA 4JT4A 1KO5A 5TARA 2BV3A 2FV8A 1GFIA 2OCYC 1IN5A 3EZ7A 3VFDA 5KYKA 1MV5A 3FGNA 2WOOA 3DMDA 4JLVA 3GJXC 3G0HA 3AVQA 1RE0A 4TMKA 1CJUC 4Q4JB 2V9PA 2B6HA 1G7CA 1W49A 2VBCA 2HT6A 2YWHA 2CCGA 3CR8A 3TQFA 4DLRA 4OI2A 1L4UA 2OAQ1 5F9HA 2GBLC 2F43B 2FSFA 4JLNA 2CE7A 2ZETA 1COWD 3KTAB 2GHIA 2C9YA 3FHOA 4ARZB 5TV2A 1OKKD 1MOZA 2E1RA 2QROA 4I81A 2ZI4A 4CRWB 3IO3A 4AI6A 1DO2A 1SHKA 5DI3A 4DXAA 2IYWA 3CH5A 3GJ0A 2REXB 3BH6A 2IYXA 4GOKA 4BZPA 2GF9A 2NO6A 2MMGA 4KAXA 3D6TB 4RZXA 2A2ZA 5FTNA 1M2OB 2ZQ5A 4TLEA 4Q18A 2DWQA 4L15A 5HKKD 1G7TA 2DR3A 4JYCA 5H68A 3ADCA 3R9WA 5KNDA 2ZJBA 3BOSA 4B3FX 1UEIA 2NPIA 5KDDA 4W9MC 1XCPA 5EE0A 1EWQA 3O8RA 2CJWB 2QP4A 1Y3AA 5EZ6B 3TKLA 3VX3A 4JS0A 2QN6A 1KI8A 2F6RA 1CR4A 3C16C 4QGAA 2WSMA 4XVUA 2WAYA 1AQYA 3G5UA 3E2IA 2ZXUA 2ASEA 4CW7A 4RD2A 4E03A 5GADl 1NMZA 4BFYA 3GEEA 3X2SA 3DHWC 2Z0MA 1E0AA 3GJ8A 2EFGA 2A5JA 3BD9A 4ZCLA 1OXXK 3EX7C 2BM1A 1QHHB 1F6BA 4QJ5A 3ZQ6A 1EK0A 5FUYA 2REOA 1N6KA 1XMIA 3Q7QA 1OFIA 5L3SA 2QGNA 2CCKA 2ONKA 4GZMA 2QMEA 5KNCA 4PXAA 2ZJOA 2A5DA 4JVLA 4C7OA 2R44A 1KJWA 1TEXA 2EFHB 3CF2A 1NY5A 2G9NA 4YC7A 3AVOA 4URUR 4UKDA 4BLQA 1J90A 3KKNA 2VP2A 1CP2A 3N5CA 5DYIA 2QSYA 4L16A 3ECCA 1E9SA 1XPRA 5SZHB 3FMOB 2R9VA 2BVNA 4WBSA 1AN0A 1IBRA 4FCTA 2CLDX 1JALA 4BUJA 4BLPA 4A4DA 2ZRMA 3QVVA 3B5JA 4NYJQ 1UBFA 4BECA 4DRZA 4GP6A 2O8FA 3NKVA 2FSIA 2R6CA 4C2TA 1AM4D 3K0FA 2ZJAA 1YVDA 1XWIA 2P5SA 3OZXA 1DAGA 5CB8A 1SXJE 4IVQA 1J8MF 2PJZA 3Q9LA 1U8ZA 2FF7A 1NI3A 2BOVA 4PC2A 2E87A 1JEDA 1FOEB 4DJTA 2DFNA 3L0PA 1P61B 1EGAA 1JR3D 1TQ4A 1WB9A 3A6PC 4Q9IA 1ZVQA 4PPNA 3ICEA 3AB3A 1G21E 3GLIB 3GLFB 1TL7C 2A30A 1Z28A 2ZS7A 4G5SA 1U94A 4CEJA 1I4DD 5HZHA 1KNXA 4XSGA 1IY1A 1Z3IX 3U3KA 1OXVA 1E9FA 2WAXA 1YZKA 3BFXA 1MO6A 2ZTSA 2DPXA 4UNPA 5AJZA 1AS0A 2QMUA 3TSWA 1DAMA 2YV5A 1XP8A 3AQ4A 1ZC4A 3R7WB 1GM5A 2GJ9A 4P4SB 1E9AA 2YOGA 5HCIA 4ZDWA 4GBMA 5EP1A 5CDFE 3QF4A 3KXLA 3LV8A 4JYBA 2D62A 5B57C 2BEJA 3QXCA 2IYQA 4EFNA 3I8SA 3P26A 1G4AE 1LS6A 3W8RA 2PZGA 3Q72A 1OHHD 2O8CA 4B35A 1VDZA 1FQJA 2ZSFA 4MYCA 2V1XA 1G8GA 1GNQA 1Z47A 4M9XA 3TR5A 4IFBA 1XEXA 5EE1A 4TYNA 4JBXA 2VSFA 3A8TA 1G8HA 3IEUA 2ERYA 1XEWX 3KKQA 1IM2A 4TYQA 2EFCB 2KE5A 5KO2A 3W5JA 4JSTA 4LYFA 3TVTA 5JRZA 4NP6A 2R6AA 1G17A 1M6NA 3B9PA 4Q1BA 4EPXA 5EQTA 2OM2A 2UKDA 1CULC 1GRQA 3SJZA 5A5GA 2DWOA 3AF4A 1LF5A 1Z83A 2FPKA 4DDTA 2IHYA 1G16A 1S3GA 4OI1A 4AIIA 1VG1A 3ZVLA 1Z07A 4OHXA 3K0AB 2ZIAA 4W5HA 3VR1A 3LW8A 3ONWA 4IHQA 1BIFA 3KKOA 3W6NA 3ZVNA 2MSEB 4M1TA 3ZVRA 3I5XA 3P20A 2HJGA 3S1AA 3U6BA 1TTTA 5JJLA 2YHSA 4Q9LA 5HZKA 1VCNA 5KTYA 2JLXA 1ZP6A 1XU4A 1YHNA 2OAP1 2C2HA 2XNDA 5HCNA 3WRYC 5DIFA 3ZQJA 4TL6A 5G40A 4ZDJA 2FZLA 1LVGA 1OIWA 3NC0C 1QVRA 1W7AA 3DDCA 1X3SA 3PVSA 3QSYA 4NZYA 1EXMA 2UZ3A 1CXZA 5J4HA 1G7RA 1E79A 2BHRA 2IF0A 2QZ4A 1A7JA 4DC9A 3Q5EA 4R7ZA 4PSKA 2C8VA 2CBZA 3PITA 3TW8B 3U3OA 4US2R 1Z8FA 3IO5A 1XXHA 1VHLA 1OH5A 2C9OA 2UVQA 1KKMA 4A2PA 2C95A 2FFAA 3VR6A 3I72A 3WXMA 4F4JA 4I99A 4J0QA 1JXOA 3AVWA 3QXJA 5GVRA 1NBMD 4WIAA 1XD2B 1U9IA 3GMTA 2V55B 4ZKDA 4TZ6A 1HTWA 3SFVA 4BQSA 4NONA 2Q3HA 2GTPA 2FPMA 1ZNYA 1GOTA 4V0ME 5FBQB 3EZ6A 1QHGA 4CGZA 4M9QA 1YJ5A 4GMXA 1G18A 4TL9A 3QPWA 3B60A 2FE4A 3CW2A 5BQ5A 1FW6A 1OFUX 2VLIA 3UG7A 2D7DA 2QG6A 4Y0VA 1RW4A 2O8BB 2CLCX 3VQTA 2BEKA 1TEVA 2CL6X 1EFCA 3R9XA 1WBDA 1XNJA 2QPOA 1JR3E 1KO8A 2H18A 4TL7A 5AUPB 1QZXA 2QBYA 2FSGA 1BMFD 2MSDB 3GLGE 2D3WA 3WP1B 4FW9A 2C5LA 1U8YA 3C41J 3CF6R 2GBLA 2PCJA 1A4RA 4PANA 3B1XA 3Q8XB 3EC2A 1OB2A 3NHAA 5BWMA 4O3MA 1A82A 2JJ2A 1TPZA 4A0HA 4DCVA 3RRNA 1CS4C 4LJ6A 4PHTA 1KMHA 1ZUNB 2GJSA 1RFLA 3L8ZA 5AJYA 3RABA 3RSOA 4D4LA 3FOZA 4CEIB 1IY2A 4PC1A 3NEYA 1EWRA 2KB0A 3D3QA 1U90A 5LD2C 1T6NA 3AVUA 5UKDA 2N46A 3WMFA 4PQFA 2OBNA 2HUPA 3FKQA 1DAKA 1HQCA 1U98A 3WNBA 4OI4A 4QBHA 1N5KA 2R65A 2OBMA 3BJIC 4GT1A 1G3MA 1TU3A 2AKAB 3SBDA 3AF3A 3MMPA 2WJGA 2ATVA 4PPFA 1K8RA 1KO4A 1RRPA 2G6BA 4ON9A 2FEMA 5CIWA 4A2WA 2Q3MA 3U3JA 4TSFD 4BE7B 4OHVA 2OSBA 4FCWA 3K53A 3QKSA 1S2MA 4L9WA 3R8CA 4HZUA 2PEYA 4IEIA 5CYOA 1FUKA 3I62A 2YZ2A 2RHDA 4PHGA 2GZDA 4TQAA 2ZYWX 4QJ4A 4WZAE 4NU0A 5FBRB 2GCOA 4NCNA 5JWHA 2GNOA 1MABB 1CJMA 3GFOA 1VIAA 4GI7A 4Q00A 2X19A 3P27A 4DLSA 3GEHA 3PCRB 1QDEA 2REBA 2ZVPX 2IF2A 2WWHA 1Z29A 5KSPA 1T4GA 4AYWA 4ZO4A 1A2KC 2DYKA 2HV8A 1ZM4A 5H70A 4YXWD 4YXWA 1XF9A 4Q1EA 4B2LA 2J46A 3FVQA 5B64A 1YRBA 4LC1A 3T35A 1MO5A 2IXEA 2W0SA 2O0KA 3IIJA 1UAAA 1ZM2A 2J0VA 3D31A 4PX9A 4UNRA 1FZQA 3HDTA 5JI2E 3THXA 2QENA 3A1UA 5FOUA 5DH9A 2FSHA 1HH4A 5H1YA 2W2TA 4GNKA 2SHKA 3C8UA 4MRVA 1GRRA 1M74A 3TRFA 5BN4A 2ZI3A 2P0EA 5E7JA 1OFHA 3H1TA 5BN3A 2FH5B 2BMDA 1I2MA 3WYFA 4D81A 2ZR7A 2MMCA 2B8TA 4TYPA 2VH5R 3OESA 1XMVA 2ZVQX 1IN8A 1JB1A 2JDID 3CNLA 5DI3B 4YDHB 4G5OA 1DVRA 1U99A 4KFTA 1VG9B 3U4QA 4MYUA 1NLZA 4HAVA 3VU9A 3ZD6A 2G0NA 1NBME 4R98A 2GXAA 4LHXA 5AK0A 4D80A 4A92A 2J9RA 3PUXA 4JL8A 4BFXA 3A37A 4OHWA 2PCLA 1I4TD 3CNOA 1Z0DA 2ZRGA 2BCGY 1DAEA 2VHCA 2B92A 4JL6A 1JJVA 1DELA 3C14C 3M6AA 4KI0A 3CZQA 4PPGA 4EPWA 3U3MA 2VPPA 2IYTA 4XJXA 3E5HA 3Q7PA 4PSAA 2A9KA 2PX0A 2CNWD 3KJGA 3DEFA 2OLJA 3B1ZA 3QXXA 4K46A 5HR5A 4G5GA 3F3YA 5DE3A 5L3SB 2P5TB 4D4JA 2OFXA 4Z1MD 3WP0A 2C77A 4C0SA 4BZQA 4C7OB 4LYHA 4LWZA 1R5NA 4KXFB 4ITRC 3AEZA 1KI4A 3QQ5A 1WF3A 5CYPA 3TBKA 3PV0A 2BBSA 3KQKA 1CEEA 2R8RA 4B71A 3TW4A 2NG1A 2PX3A 2PH1A 2G88A 3OF5A 4BGDA 1FFHA 2WM9B 3IBGA 1WQ1R 1C9KA 5CLQA 3A4LA 4L4UA 2XX3A 1K5DA 1DE0A 2YOHA 3QKUA 3QIAA 3MWJA 2ZROA 3L2OB 3X1DA 3FFAA 4C0JA 4IOKA 2BBOA 4MUBA 4KITB 5F9FA 5FPHA 1E2MA 1Y63A 1T3HA 3SC3A 2O8FB 3IGFA 4Q47A 4TWZA 3K0FB 3P32A 4RZ2A 4DLWA 4A8JA 2J7PD 3FMFA 4C0KA 1IJEA 4E07A 3CPJB 1E96A 4OK5A 5HE8A 4KO8A 1KOFA 4K81B 2J87A 4M1WA 4QBIA 1Q20A 5A4JA 1E9RA 2VP9A 3ICQB 1AA9A 3PENA 4N1AA 121PA 1VHTA 1Q21A 4NMMA 1UKYA 3RSLA 5EJEA 1E2PA 3B78A 4Q01A 4RFSA 4PHHA 2IXGA 4RKEA 1P2UA 3QOFA 3RS7A 4XH9B 3G82C 1UBCA 1HA3A 2DFTA 4XWKA 2Z4RA 4CEJB 4Z8YA 5FTMA 1PLKA 3JVVA 3LO5A 2VP6A 2H16A 3AKYA 4ACBA 4V0NA 3NXSA 1BS1A 1N5JA 3LX8A 2P6RA 1W44A 2XOKA 3VR2A 3NBXX 1P72A 4TMVA 1N0WA 5M04A 1E2LA 5FI0B 3CUEF 4ZI2A 4WVFA 4PZYA 3NBZC 1WRBA 2HEIA 3ZDQA 2WWIA 4V0KA 3LBIA 3HWSA 4D0GA 4FXPA 3UWKA 4XTRA 1OF1A 1P73A 3QF4B 4UXJA 5FUVA 1FTSA 3L8YA 3UMSA 1GNRA 1SKYB 4H9GA 4YQFA 2RGAA 4DSUA 3IIKA 4I1OA 1UDWA 1KJZA 2W83A 2YYZA 4NCIA 1J99A 1YZGA 2MSCB 2ODBA 2W2VA 2H5EA 1WP9A 1IN7A 2IS1A 1KZ7B 1ETUA 5F3WB 2YJTD 1KY2A 3GLIE 3GLFE 2O8CB 4KVGA 2EU8A 3T5GA 1OXSC 3LVRE 1NN1A 4TMZA 3BH7A 3RYTC 4Q1DA 3KKMA 2Z4SA 4YLGA 1XEXB 5DSZA 1R0XA 3GJ3A 4HUQA 1N6HA 4W7SA 1PVOA 2CK3D 2JLYA 3AVYA 5EE5B 1QHYA 3U44A 2FJUA 2WICA 3UPUA 4DB4A 3SYLA 3WNDA 3LAWA 1KHTA 4JJZA 4KBGA 2QM7A 1XTIA 2J5XA 2GJKA 4R71A 5TVKA 4KBFA 1CTQA 4JLPA 3W5IA 3KQLA 4E09A 1OXUA 5TDHA 4QGHA 3CONA 5E3HA 3SU8A 1VG0B 4AKGA 2RGDA 4NYMR 1GSIA 2HXSA 2CMKA 3PG5A 4HDCA 5FBVB 3T5DA 4MDFA 1R8QA 1XEFA 3ASZA 3AUYA 3GLHA 4LY6A 2FX3A 1RRFA 2ZYTX 4LJAA 5DN6A 4AKHA 5ANRB 1XCMA 3FKSA 1E2KA 4X8HA 2ZJ8A 1JAIA 1E0SA 3EC1A 2A78A 3SN6A 2WJHA 3PXGA 3S1AB 3OEHA 4QOSA 3REGA 1YRAA 2ZPTX 3GFPA 4LYJA 4Q1AA 1YE8A 3M0EA 2VO1A 1YZLA 5F98A 3NDPA 5FBLB 4OBEA 2AWOA 2RAPA 3MWLA 2AXPA 2VRWA 1N6OA 3OFNA 5E4FA 1C4OA 5TB5A 1SVKA 1WXQA 2CVFA 4EQ6A 1YR9A 5BW8A 2O5VA 3KXIA 4FINA 1UBGA 3EIHA 3EWAA 3SR0A 1M1YE 1UKVY 3BB3A 1I4LD 4A0FA 2R62A 4QHTA 5LPNA 2VHTA 1AKEA 4A9AA 2J59A 5C46F 3I1FA 2H17A 1XXHB 2A5FA 3C7KA 3UIEA 2QP3A 1I2DA 3DMNA 1LNZA 3EG5A 4BFWA 5JEEA 3EA5A 2EWWA 4TT3A 1TQ2A 2RMKA 3TVDA 1E3MA 1V5WA 2VSXA 4FMCF 5LB2A 3DL0A 1UDXA 3KB1A 1NLFA 4TL8A 5C1BA 4FIDA 1NG1A 3X1WA 4M21A 2ZI5A 2QSZA 4M8NE 3PR1A 4CT4B 4XWOA 2YOFA 1VYTA 4QM7A 1Q3HA 4KFRA 3I3SR 3EARA 5JI3E 4OJKA 4LHWA 3Q85A 2B8WA 4NH0A 4LBVA 2QI9C 1XTJA 2X8AA 3LW7A 1D2NA 1HV8A 4DCUA 5FH9A 4DIEA 1ZC3A 1OLOA 1XJQA 1VIYA 2AK2A 5KSYA 2HF9A 2PEZA 4KVAA 1H8HA 4B6EA 2QBYB 4R2IA 3MRSA 5K8UA 1JR6A 1G5PA 4LJ9A 1T0JB 4OYHA 2Q9AA 5FTLA 5J4KA 4ZKEA 1FP7A 3QF7A 4CVNA 2RGXA 1R8SA 3D7MA 1SHZA 4IJMA 4EAQA 4M22A 2XXAA 5JMTA 1CF4A 2QQ0A 1Z0IA 2GXQA 4Q7LA 2GF0A 1SVWA 1W2HA 4MRNA 1Z6TA 3QKRA 1KMHB 4LSGA 1TX4B 4MRRA 4NPHA 3RANA 2JLRA 2GILA 1O87A 3PIRA 1XPUA 3QPVA 1G9XA 3QXSA 5JSZA 1U8AA 3HYRA 2JLVA 1XEWY 1VYVA 4IRUB 3ZZ0A 4F93B 2GDJA 5HPYB 1G3IA 2EW1A 3IPXA 3LLMA 4P4TA 5GJVC 5JZVA 5EZ5A 3ZYCA 3TNFA 2ANBA 1FMLA 2DB3A 4Z54A 3WYAA 1ZMXA 2ZUCA 1UJ2A 4Q4LA 3TJZA 2TMKA 2ZE8A 4B76A 1J7KA 1RVDA 2WPDA 3BAFA 1MO3A 4GMDA 2QUZA 1TNDA 4V0LA 2IS6A 2WBLC 4GOJA 5KHOC 1OH7A 2ZRDA 1XJ0A 5EP2A 1AQUA 4BFUA 2WMNB 3CNNA 1ZINA 4B43A 1W47A 3QKSB 1WCV1 4EUNA 1OH8A 4HZUB 3W9YA 2DCUA 3BB1A 4TQUS 1KZGB 2AR7A 4OQLA 1KMQA 3TAHA 1NN0A 2ZRHA 4TMTA 2ZEJA 2JIZA 3B6EA 4FN5A 3HYTA 2WWYA 1TU4A 3NH9A 3TLXA 2GCOB 4CIDA 4IEEA 3BGWA 4MGKR 1E0KA 5CM8B 1NVWQ 1R7RA 1L8QA 4M53A 1XZPA 2JJ8A 1ZW6A 4MGZR 4Q5IA 5FPTA 4B34A 1OJLA 1Q57A 1FNMA 2VHUA 2QGZA 4LJ4A 4JLMA 3VKWA 2RKOA 1W0KA 3V9PA 3B1VA 3SYKA 3K70C 4K8OA 3MWYW 1KI6A 4DWJA 4E5UA 4V0OA 1Z6YA 5P21A 2IWHA 4DKXA 4LDJA 3THXB 4MRSA 2VTKA 1MRSA 1XMJA 3LH5A 4TZ0A 1DAIA 1ELOA 4N3NA 5DHFA 2G1JA 1SGWA 1X8LA 3X1YA 3K9GA 5C18A 1JQJC 1M8PA 4NYIR 1OW3B 1OYWA 3K70B 2GEVA 3MLEA 2XZLA 3NG1A 4BWYA 3A1TA 1DS6A 2ORVA 1X1RA 1H8EA 1E4YA 3GFTA 2ATXA 3R20A 1HT2E 3CH4B 3K9NA 3U7EB 1CRPA 3B85A 3EZFA 2FWRA 1NN3A 1YR6A 2FMXA 2R6GA 4Q4HA 2JLUA 3AH8A 4JIMA 1MR3F 3QBVA 4AKIA 2N1BA 1P2TA 1QG2A 1CR0A 1P6XA 1F5NA 3M1IA 2LKCA 3KKPA 1PUIA 5FI1B 3RS3A 1TQ6A 3U4QB 1XPOA 1OIXA 5JWOA 1U0HC 3AGQA 3RDPA 3VU9B 3HJNA 3WHLA 1Q44A 4JVMA 4EPYA 1P4SA 3AKEA 1ZYUA 2F55A 4HDOB 2HLDA 2ZE7A 5FL7A 3BFVA 1PLLA 3JVUA 3PEVA 3IQXA 1NKTA 3HU2A 1L7VC 5TMPA 3BB4A 4A0RA 3H0KA 3IUYA 4DSTA 1R6BX 2XB4A 2XGJA 2VYFA 4OQNA 4URZR 5JHHB 1JXMA 3MJHA 3IDQA 5CK4A 4L9SA 3W3ZB 1W4AA 2NO7A 2J7KA 3BK7A 3K09A 3ZZUA 2PJRA 1YZQA 2P6NA 4Q21A 1G19A 3W34A 1FMJA 4MGIR 3H2YA 5G3YA 1A5TA 2ZUDA 4JT2A 3W3AA 4PC3A 3A1VA 3MFYA 4IOMA 1R2QA 3MG9A 4C30A 3RS4A 1M7BA 3QEJA 3N2EA 6Q21A 3PUVA 1KI1A 2GCPA 4CDGA 4F38A 3RC8A 1JPNA 4JBYA 3P4YA 1T5LA 1G20E 1HURA 2VIIA 3GPLA 3KJIA 1HT1E 4PZLA 4A8JC 4JBWA 2ZJ2A 1KY3A 2ZYUX 3LD9A 4ASUA 2NIPA 4ZIRA 4QC2A 4JZKA 5C4MA 2ZAMA 3T12A 1XZQA 4PO1A 1U0LA 3FE2A 3ADDA 1X6VA 2IA5A 2FGKA 3CPHA 1E9EA 2BC9A 2KWIA 3D8BA 3E70C 2PMKA 4DDVA 5GJBA 2OFWA 1N2CE 1ZM3A 1E2HA 1E0JA 4A8JB 4P0TA 4QXAA 4CZ2A 1T0HB 2ZAOA 3OE7A 2XNDD 1DAHA 2VHJA 4TTRA 2ZRKA 5FR1A 3NVAA 5B58C 4AK9A 1MO4A 4MA4A 2PZFA 4M9SA 2IYLD 2Y8EA 4M1KA 3LNCA 1ESNA 1DPFA 1E79D 4JKYA 5E7IA 1II8A 1PUJA 1GDDA 3SBEA 5KDLA 4RFSB 1K6MA 5DISB 4XSHA 1GL9B 4O0MA 2HDNB 4C0BA 4ERNA 1RJ9A 4HZIA 3IHWA 2ZANA 2AWNA 5G53C 4HLQB 4DEXA 3DKPA 2ZRPA 3UK6A 2I1QA 1Q1QA 4UQOA 2ZSBA 2R6DA 1QHNA 4R9UC 4HI0E 4HB4A 5IT5A 2WTUA 1Z22A 1R0ZA 2AK3A 2GEUA 2VQSA 3KJEA 3RRYA 4JVNA 1YZNA 2IXFA 4C0LA 1EFTA 2AXNA 1NL3A 2GVZC 5IF9A 3OAAA 2GRJA 4DLXA 1ZBDA 5FOWA 4QM6A 3TUZC 1KO1A 3F5FA 4JJKA 1Z0AA 3TMKA 2G3YA 1E2DA 3MSXA 5FOSA 4C4PA 1S8FA 3U61B 1XTQA 2WWWA 4MUAA 2FFQA 4PAQA 2NO9A 1ZM7A 4OHYA 1G291 2WIBA 4NL4H 4POAA 1II0A 5JJIA 4MRPA 1G1MA 1XRJA 2QAJA 3NTUA 4WA7A 3VNUA 4F92B 3N70A 4EIWA 3QXHA 2F7SA 3A36A 1NY6A 3DOEA 1O3YA 1RRGA 3L0SA 2JJ2D 1T91A 4HUQB 3CWQA 4B48A 3SEAA 2ZRLA 1CJTC 2DWPA 1F60A 3U44B 5JCZA 2XZOA 521PA 2D06A 2KI5A 5BYJA 2CL0X 1FQKA 1X1SA 2OCBA 4HAYA 1UKZA 3TUIC 1GRNA 4KLZA 4NCKA 5TY0A 2V7QA 2F1IA 4DUGA 2IX3A 4UJ5A 4C3ZA 1IXSB 4B6FA 4A15A 1SKYE 2WJVA 2CVHA 4S2EA 2QNRA 3GLHB 1HYQA 3GQBA 3LWNA 4BRWA 3THYA 1R5OA 1E9CA 3UWOA 2KBFA 2OT3B 3REFA 5LD2B 3LX5A 1KK3A 4EDHA 1UEJA 3I4LA 3EPJA 1CIPA 1XD8A 1NKSA 1NVXQ 1RRCA 4BLRA 4ILEA 4A0GA 1GWNA 2WWXA 1DO0A 1N6IA 4PZZA 1AZSC 3K9HA 2VP4A 2GZAA 4OK6A 2JCSA 1NVVQ 5JLJA 2BMJA 3ZS9A 1YQTA 1AJEA 2JATA 4D2IA 2PLFA 4EQ6B 2H7VA 2VA8A 3AVXA 1XCGB 1ZNWA 3L43A 3V4FA 4HUTA 2QORA 4IDHA 1JI0A 3NBYC 4IVRA 3WHKA 4B44A 5HE9A 5B2ZA 3RHFA 1KO7A 1Z0KA 2Q9CA 3O8CA 5FOXA 3ASYA 4B73A 4D4MA 2F1RA 3AF0A 5KPDA 2ZI9A 4ZI3A 4GRAA 5JEDA 2IS2A 5KOYA 4EPTA 2XJ4A 3AP2A 3FDIA 2EFDB 5KSZA 1KI9A 4MKFA 1TF5A 2WKRA 2P6UA 3ADKA 2ZUBA 1RKBA 3QNUA 4JLJA 4Q7MB 1E1QA 3K70D 4Q1FA 5FOTA 1IY0A 2ZRBA 3IHLA 3OIVA 3BBPA 2BJWA 3MCAA 3O8DA 3NC1C 4ZCIA 1GIAA 3CRVA 1NNEA 2ODEA 2V6IA 1QG4A 2ORIA 2IT1A 5FUWA 1UPTA 4HLUC 4N0EA 4B3DA 5EE3A 1JNYA 3THOA 5BXQC 5LDDC 3OEEA 1E2QA 1HQYE 4S35A 4Q9KA 1VTKA 2A3RA 3CRRA 1KSFX 4MQBA 4XD7A 4JLBA 2Q6TA 1KI3A 2FNAA 4US1R 1KDRA 4QRHA 3CF0A 1YZTA 1W4BA 2QP9X 3DM5A 4QNMA 1GKUB 2QPTA 2A5GA 4Q9JA 2VSOA 1NLYA 4WXRA 2XXAB 3SHWA 4B3CA 1F2TA 5JFGA 1E99A 3SJBA 4QL3A 1N6PA 2ZJ5A 3QKRB 2ZU6A 3Q5DA 2C03A 4CEHA 3RWMB 1VPLA 2W6IA 4F4CA 4C0QC 5K8IA 3W90A 2BKUA 2ECKA 2F1JA 2QQEA 4ACAA 3KFXA 2Z43A 3LVQE 4X8LA 2A5YB 5FUXA 2I4IA 5JSZB 1NVUQ 5K8LA 3VX4A 1VCOA 2O52A 1ZUHA 4RZUA 3HP1A 1G8PA 1ONBA 5CK5A 4Q19A 1IN6A 1QBKC 4M4SA 2PBRA 1CJVC 1E1RA 1RZ3A 2ZYVX 3LRPA 1XTKA 2W58A 2YWGA 1C1YA 2V6JA 3PUZA 3AUXA 4D0NA 2F3TA 4MH0R 3ZLJA 2RGNC 3LQQA 4RKFA 1XD9A 1NIJA 4RD3A 3VKGA 1S9DA 1N6LA 3BS4A 4PAOA 3B1YA 4F7WA 1ZRHA 4LOAA 4PC7A 3ZVMA 3JZAA 5JJKA 2GAOA 2G1KA 3LDAA 4EJSC 2ZE6A 2J0UA 1LF0A 1OYYA 4YDSA 1NJFA 2W6JA 3RNLA 2QTVB 2GK6A 2YKGA 3GJ6A 4JKIA 3DOFA 1RPZA 1E2GA 1T3SA 5DGXA 4EFLA 4QG7A 5AWFC 4UNNA 2D2EA 1M7HA 1S1CA 4DZZA 1PZNA 4B2IA 3AVTA 3GJ5A 1CR2A 4URWR 4OJQA 4MYHA 3A4MA 8OHMA 1EFRA 1KI6B 4YMSA 3AKCA 3LBHA 4NYIQ 2ZRNA 2OXCA 4G01B 4GFDA 3U7FB 2FDCA 4ABYA 3PEYA 3LBNA 4DEYA 1XBTA 4LJYA 2C78A 4D25A 1F48A 4AYXA 1XB2A 4I4LA 3UG6A 2CEAA 3W6OA 4F91B 4LUCA 1E9DA 2XEXA 3ND8A 4PPQA 4LJ7A 2QA5A 4DSOA 1T5IA 1VG8A 1W4CA 4KFSA 2YWFA 4Q4HB 4EFMA 3VR3A 2QE7A 4N0DA 2XOKD 1VCIA 3FTQA 1G64A 3BXZA 2ZI7A 3AF2A 3M4YA 3EPLA 2DHRA 2V54A 1ANKA 1W0JA 2J41A 5AJWA 5HTKA 1GKIA 2F1HA 3MGCA 1R0YA 3IIMA 4GSYA 3VTKA 2GA8A 1Z2AA 4B75A 1SZPA 1U0JA 1Q0UA 1UF9A 3CRMA 2WSSA 2IYSA 4GPTA 1G8FA 1QHIA 1P2VA 5JWRA 3UATA 1E9BA 3K09C 1UBEA 1A2BA 1Q1EA 4RCZA 4UXIA 4A36A 3LXXA 1ZD9A 3A58B 1P2SA 3IQWA 4XIGS 1N0VC 3EPHA 2AFHE 4KODA 3QE0A 2OO7A 1D8TA 1NG9A 2G77B 4C0AC 1LFDB 3C5CA 4TLDA 2FPLA 4KU4A 4WZ6A 3I32A 3RS2A 3ZIAA 4DCTA 3UMRA 4H1VA 3FPAA 4LI0A 4JL5A 4X8OA 2GK7A 3CKLA 1KSHA 5C2JB 2L0XA 3BC1A 4HLDA 2R6FA 1NRJB 4BLOA 5CB6A 1D2MA 5KPJA 3HR7A 4QFMA 2C96A 3WRXC 3NHBA 4CF7A 3C4JA 1SVIA 5J4VA 3SQWA 3QVUA 2IC5A 2XZPA 4FMCB 1UFQA 5FPKA 2B7CA 1Q12A 3AVPA 1T3LA 2P3SA 2QT0A 3R8FA 5DN6D 4BZXA 1CRQA 4MDEA 1PV4A 1KDPA 1V43A 2ZRJA 3TK1A 4RD1A 5L3VA 1ESMA 3FKSD 3KB2A 3Q3JB 1GG2A 3EA0A 4YMTA 1J8YF 4ZIRB 3THWA 4CEIA 3UKDA 2J1LA 1PLJA 1U81A 1GP2A 4TQ9A 3OEHD 5DLQC 2H92A 3GP8A 3K0SA 2NGRA 1OPXA 3R9IA 4DBLC 1IAQA 1D9XA 3PQCA 2IYVA 4FCVA 1M7GA 1KIMA 4URVR 1NMYA 2B21A 3I73A 3OFND 5BYKA 2WHXA 3H4MA 2ORWA 1SXJA 2X2EA 2P67A 1Z6XA 2IHBA 2F3RA 4OQXA 2V8OA 4TTPA 3KFVA 1KI2A 1RYFA 1II8B 4IOLA 3TSZA 5J5CA 4PO9A 3LXRA 4QHSA 1P9RA 2D4HA 1ODFA 2C04A 5EXSA 2P2LA 1BH2A 3L0IB 1RJ9B 5FTJA 2NZ8A 3AF1A 4NCHA 4PAMA 4XWAA 4TT3D 5EXPA 2QMOA 2C99A 2B7BA 3MAAC 4IDQA 2OFOA 4G5QA 3VR4A 2NTYC 3KQHA 4QGGA 1NSFA 4LBYA 4DVGA 2FEOA 1UKEA 3H86A 5IK2A 2ODNA 3FYHA 2NO1A 1N25A 4G0NA 2HYIC 5C4GB 4ZCMA 4UNSA 4QJ3A 4B33A 1R5BA 4OL0A 2HCBA 4PO8A 4JLKA 1XDBA 2D7CA 1VMAA 1P60A 5CDFA 1CR1A 1H8HD 1LY1A 4PC6A 1U2RA 2P65A 5FL3A 1G6HA 4B3GA 4I1UA 1KTVA 3KL4A 2ZSAA 2HJVA 3TR0A 2FG5A 4DLZA 2NMVA 1MKYA 4FWTA 1DG1G 1KNQA 4LJ5A 4HB3A 2LKDA 1E32A 5AUQA 3CX7A 2CE2X 5L3RA 2ERXA 4HLUA 1LTQA 3WBJA 4MGYR 4RFVA 2JLZA 2W0MA 3V4RA 2QM8A 1P3JA 3OIUA 1DADA 4URYR 4JVSB 2ZSEA 5G3ZA 1M34E 2FZ4A 4G3XA 1COWA 2LCFA 1L2TA 3VHLB 3BFKA 3PJRA 1OKKA 1KGDA 4AD8A 721PA 4FMDF 1W5TA 4QBFA 4HATA 4B74A 4LK2A 5EP3A 1EFUA 1J2JA 1BKDR 3SNHA 1ZJ6A 2R2AA 3EAQA 2O8DA 1F2UA 2G83A 3K1JA 3DO6A 2DFKB 2ZRIA 2N42A 3QKTA 3VHXA 4DLVA 1DEKA 2BMEA 2YNMA 5HKKA 3VAAA 3THYB 1NSTA 221PA 4DHEA 2V4ZA 4Q7KA 4XVQA 2YWEA 4Q7JB 4HAUA 3HPQA 2WWFA 3CIOA 1KSGA 3RRZA 3I5YA 2O8EA 4IKEA 2XTNA 3BE4A 1JEEA 4YONB 3TIFA 5L3QA 2WPDD 4QNRA 1BYIA 2Q21A 1S0UA 2ZR0A 2NO0A 4FD2A 3UMFA 1Z63A 1NIPA 2OHFA 4BEJA 3ZS8A 4IFEA 1KDTA 2GWHA 1SVSA 1YZUA 3NH6A 5TXGA 3IBYA 3QG1A 3VMFA 4OHZA 1S3SA 2NOAA 4FMBB 4G5RA 2IEYA 2GXSA 4NCJA 2WKQA 2EWVA 2JIZD 1IJFA 1EESA 1TF7A 1WDTA 2RGNA 3LY5A 4C2UA 4AYTA 4PHFA 1NF3A 1ZM9A 4Z8XA 2DY1A 4WOPA 1B23P 2BCJQ 1VYUA 2BM0A 2VHQA 1AS3A 1JAHA 3GCGA 4KFUA 1QHXA 3CLVA 1EX7A 2RGEA 3CO5A 4UXHA 5SZIA 4ESHA 2RHMA 5J47A 3GLHE 4TMWA 4EJSA 2J0SA 1NP6A 1W0KD 2J3EA 3RS0A 1H65A 4PTLA 3K9LA 5LB4A 4JMPA 4W5WA 1G8YA 3HR8A 2ZS8A 1ZIOA 2H8KA 3K0CA 4KYUA 5KDOA 3EXAA 2AD1A 5FR2A 3SHFA 3SE0A 3BRWD 3GJ4A 4HYYA 4ZV4A 3OHMA 1NJGA 2K5UA 2F9LA 4H1UA 4V0MA 2XTMA 2NZJA 1H8ED 3KJHA 3MD0A 5JBQA 421PA 3I61A 1FP6A 1DAFA 1GAJA 1E4VA 4KHZA 5AUNB 4O2LA 2ZRCA 3I92A 1E2NA 3QI2A 3FMPB 2FFBA 1XTSA 1W1WA 2O0HA 1N3BA 5EP4A 1JR3A 4LCBA 3V00A 3RS5A 2GCNA 2FFHA 3GLGA 1G5TA 4LZZA 4D4KA 1QRAA 3FB4A 3F8TA 3LLUA 1Q3TA 3A1SA 1F2TB 1KI7A 4HLCA 4DDUA 3VNVA 2HF8A 3HU1A 3CB4A 4D82A 4CEHB 2FOLA 1N6RA 4M1YA 3DZ8A 3MJRA 2HLDD 5FL7D 5D3MA 3NWJA 4XVRA 2VP5A 4HB2A 1N5LA 2ZU0C 3WY9A 4NTZA 4QHYA 2QU8A 2D2FA 1SVOA 2KJQA 2VP0A 1Z0FA 1KJYA 3EASA 4P3YA 3RLFA 1AS2A 2PT7A 3T1OA 1BYUA 4BLTA 1LB1B 2WWGA 2JJ1D 2JJ1A 2XITA 3FMIA 4LGMA 5FPYA 5CJ2A 2O0JA 3OIWA 1KK1A 4TLBA 4YMVA 2WKPA 3KXKA 3SFZA 3ZJYA 3CWZA 1OHHA 3U7GA 1Q22A 3L0OA 4LRWA 2Q0HA 5K8TA 2I1VB 4LC0A 1W48A 2XSZD 2XSZA 3QY0A 4M1OA 1G3QA 2ZRAA 1AGRA 1AK2A 1JJ7A 3K8YA 3DM9B 1L4YA 2J0UB 3H84A 4M0LA 5CIQA 4BPBA 4B32A 4IOJA 4ASUD 2QRNA 2QAGA 1IN4A 4GOXA 4Q4AA 1Z2CA 3FHTA 4OQMA 1OXTA 4DB2A 5EUMA 2ZJZA 3IKJA 1ZCAA 3C5HA 4DLYA 1IOZA 1QHSA 2G0TA 3AVVA 1DG3A 2C98A 2DBYA 4ZPXA 1W36C 1GZSA 1MH1A 1ZCBA 3OE7D 3EZ9A 1NN5A 2OESA 4TLCA 3TGPA 3PUWA 1ZNZA 3EWSA 2H57A 5JCPA 3PEUA 1OV4A 2ZITA 4V02A 1LS1A 2ANCA 2IYYA 4IXNA 4PFSA 1KK0A 2WJJA 3T1VA 1P75A 3DPUA 1Z08A 1XFAA 4DT1A 1TUIA 1W36B 2WJIA 2ODWA 5H8WA 2HXYA 4IW3B 4RY2A 4AWXA 3MUFA 2BBWA 3KX2A 4HB0A 4U00A 4BFTA 4RCYA 2YINC 3U7HB 2J0QA 2JLSA 2IEZA 3GD7A 1US8A 1WMSA 2YC2C 4URXR 2IW3A 1JQLB 2Z83A 3SJCA 1CLUA 2ZI6A 4A2QA 1P9WA 1TUEA 3WYGA 4P31A 4JLOA 2QT1A 3PUYA 2VF8A 1G3RA 1MRNA 5GVSA 2ZRFA 1DOAA 3U2QA 2WOJA 2GZHA 4HAZA 1G7SA 2IUSA 3OAAD 1OSNA 1GKYA 1TQDA 3LQRA 1OB5A 1FX0A 4TYWA 1XX6A 4D26A 1YR8A 1DTSA 1NBMA 1GNPA 2BJVA 3GEIA 1ZD1A 4OQFA 3T34A 2HYDA 3O47A 1GL7A 2DFLA 2X2FA 1IQPA 3B2EA 5CJPA 3U3RA 5SZKB 2WZQA 5AUOB 4W5JA 2CDNA 3IILA 2XNSA 4Q4JA 3ZGXA 5AJXA 2CHVA 2CXXA 3EZ2A 4L8GA 5D3QA 4TYYA 4JLDA 4AY2A 4IDOA 3ZZTA 5F2EA 2GEDA 3ETLA 3W8NA 2F43A 4U5XA 4V03A 2AD5A 3KTAA 1P7CA 2LWIA 4ARZA 4KYIB 5CM9C 1TMKA 2CHGA 2RH5A 4NYMQ 2V7QD 4FWIB 5B30A 2I3BA 1E6CA 2OLKA 2RB4A 3CRQA 1BMFA 3KZ1E 4DUGD 4X8MA 4TTQA 1GUAA 4BFVA 2CCJA 1S4QA 4KCGA 5IRCD 2JLQA 4E22A 2KBEA 2IK8A 4LPKA 1UM8A 4LHYA 3TQCA 4GZLA 2IBMA 3B8HA 4Q48A 1FUUA 3QG5A 1F3OA 4P33A 1T8UA 5LBIA 2CJWA 2RGGA 1VECA 3SOPA 3FWYA 3RVBA 4HSEA 4KJZA 4CT5A 5IHPA 3THWB 3RWOA 3DVLA 4NDZA 1SXJC 2IUTA 3W6PA 3CM0A 4LHZA 1QVAA 4ZDKA 1HUQA 5JECA 1SVMA 2OEPA 1A1VA 1S1MA 3BORA 4KV9A 2PLRA 4U7DA 1XMSA 4GDFA 2Q9BA 4DIDA 4DCNA 1QHHA 1Q1BA 2AN9A 1SXJB 4YMUA 3SS8A 1BO6A 5EXXA 4QGFA 2V3CC 1SULA 4TSFA 3IEVA 5FPSA 5KNBA 3ND9A 4O25A 3WBKA 4ESVA 2ZSDA 3F0TA 2QY9A 3KUCA 3QJYA 1LV7A 3SDZA 2PMDA 4DLTA 3CR7A 4PQRA 3LFUA 3CX8A 3KQUA 1Z0JA 2OUKA 1CJKC 4FI3C 2GAAA 1E2IA 1X8JA 5JRJA 1KK2A 1RYHA 4PSVA 2RCNA 3KUDA 2IWRA 2X77A 4Y0AA 1ZNXA 3X1XA 2BDTA 2AKYA 2GKSA 4JLAA 4NBSA 1E1QD 5GJCA 3FHCB 4NKRA 5J4YA 3AGPA 1G4UR 1G5RA 3X1ZA 5DNYB 1DBSA 4NYJR 2A7QA 1HEIA 1IXZA 2HT1A 1JPJA 1S96A 3QBTA 1IXRC 5E95A 1E2FA 3MWKA 1VCMA 4RZ3A 3RC3A 2NQ2C 4AC9A 3NBFA 1E94E 2AL7A 3OEED 1ZU5A 4DDWA 2KSQA 1II9A 4WAUA 4XD7D 5EXTA 4B3BA 4AG6A 1XXHE 1WA5A 3B9QA 3U6KA 4Q66C 4WXPA 2OCAA 3TSOA 3GLFA 3GLIA 1G41A 1T9HA 1FPMA 2W2XA 4TN1A 3SYNA 3OIYA 2GETA 5DYGA 5KUTA 4OKSA 1FNNA 2ZS9A 4D0LB 1GTVA 2VF7A 3TE6A 1S9HA 4MKGA 1LW7A 2BIFA 2W6ID 4LV6A 5DO9A 4CYMA 3O8BA 2ZM5A 621PA 1YU9A 3P1JA 3U5ZB 2WJYA 1HY3A 5A0FA 2JDIA 4II7A 2IL1A 3R7WA 4AURA 2EQBA 4EKDA 2QMHA 2O8DB 4DLUA 1F2UB 4P4SA 2QRZA 3P4XA 4R2HA 5EUQB 4Q02A 2CL7X 2ZREA 4A1FA 2PT5A 3B7GA 2RGBA 1E1RD 2XJ9A 4GL2A 2FA9A 1JBKA 2VL7A 2OBLA 3IPYA 5CLLA 1IHUA 2OV2A 4KSBA 2RGCA 2O8EB 1TADA 4LHVA 2GESA 3WNCA 3BWDD 4BFSA 4HEJA 1D6JA 3BERA 5L3QB 1NMXA 3NIBA 2QEQA 3GJ7A 4UJ3A 4QKQA 3AKDA 4KSCA 4HDQB 2FGJA 3A1WA 4LJ8A 1YR7A 4RSGA 2GJ8A 2JAQA 4A6PA 3EIQA 3QENA 1E2JA 2JLWA 2WVJA 2CLSA 3TAUA 5JHGB 3PFIA 4IXMA 4LBWA 1XTRA 4BFZA 1P62B 2CNWA 4Q9HA 2W6JD 1CU1A 3NDBB 1UADA 2FN4A 3UXMA 4BLSA 5CITA 3QPUA 3U60B 1ZUIA 4Z1MA 1T8TA 1OT3A 4WW0A 3CPEA 1SKQA 4LYAA 2ZJYA 3TUJC 3I8XA 1X86B 2EVWX 3K0CC 4US0R 4KLNA 4BASA 3KDSE 4EJSB 1ZAKA 4M1MA 5J4LA 3DKVA 1J70A 3LA6A 4WZBE 1MT0A 4O2RA 1GITA 2WIAA 4MYTA 3T1QA 3EPKA 4TMXA 1EFRD 3WMEA 5JS7A 4A6XA 4DSNA 3SZRA 2OE2A 1D2EA 4LPSA 3K0AA 2YC4C 4QBGB 3FFBA 5BN5A 1W2GA 2ZR9A 4YMWA 5KSOA 2GJAA 2QPAA 4Z51A 4NE2A 2BWJA 2OCPA 2BMFA 2BKEA 4LBZA 4LX0A 3BH0A 1W36D 4BRUA 4RD4A 1GILA 2XTZA 3HU3A 1JECA 1CKEA 1KAOA 2Z6VA 3EW9A 2J7PA 2D74A 3N2IA 2QTHA 4RD0A 1N6NA 3B1WA 5DHAA 5IDVA 4HAWA 2CHQA 4XOIA 5FFMA 1Z6AA 3QEOA 3J81k 2QE7D 1Q1ZA 2IYZA 3QUSA 4OK3A 1D5CA 3CZPA 4PR0A 3ZH9B 5AJVB 4P32A 3A4NA 1ZU4A 1BOFA 1W0JD 3T06B 1FTNA 2PL3A 4G1UC 1XJCA 3GLGB 3RRMA 4AKEA 1EG7A 3UANA 3AP3A 1KKLA 1E98A 1WE2A 2EFEB 2XAUA 1QF9A 3T61A 1AIPA 2JASA 1AKYA 4I1VA 2JGNA 5FBWB 1Z5ZA 2EYUA 4Q1CA 2WSSD 3ZD7A 3T1TA 1OFTA 1XD2A 4P4UA 5D3MB 3RAPR 4UNQA 2H1LA 4LV5B 4F4IA 1R0WA 4B2PA 2OZEA 4MITA 3CX6A 1W46A 5EE9A 4MKIA 2V1UA 1N5IA 3E1SA 5DI9A 3TH5A 3WMGA
chains in the Genus database with same CATH superfamily
3IAXA 1FSZA 3ZIAD 3LYAA 1QVZA 1X1QA 4ALJA 5DT9A 3SJAA 1Q11A 2MR6A 4U39A 4EO7A 2O07A 1UXGA 2JA1A 5JARA 1XTVA 1JF8A 5LMZA 2PZEA 1I1QB 1SQGA 1F8YA 1EUDB 3AHDA 1FS5A 2D8AA 3EB9A 3M1YA 4B47A 1GT6A 3F5MA 2BONA 1X8KA 3V34A 2QZPA 3ILHA 1RC8A 1QTIA 1N7IA 3I6BA 2QX8A 3EWNA 4HAXA 3ADBA 3EEQA 3VVLA 2Y76A 2NPFA 1KXZA 4QTTB 2CK3A 1PNTA 3HPRA 4G41A 1QRTA 5FA5A 2W00A 1EXWA 2FHSA 4YS6A 3M6IA 4ETWA 4KIFA 3C15C 2OD2A 4G2TA 1PJ2A 4XUEA 2FVXA 1D9ZA 2V5AA 3PDIA 5EUCA 4WZAB 2XBMA 1EX6A 2HV9A 2G8LA 4UAGA 3DMTC 4RD6A 1LBTA 2PD3A 2RARA 4QO8A 4D6PA 1SVLA 2AJTA 1RQNA 2IYUA 3L4JA 3U19A 2R87A 3OPXA 1QCCA 3L6BA 4TXJA 1MW8X 1VYHA 4QUGA 1R10A 4HQOA 3NOQA 2EERA 4DMHA 3SLGA 1JDNA 5JS8A 2QL6A 5BWCA 5TT1A 3DOUA 1LDEA 1EFDN 1KYIA 2WMOB 4X7BA 4C0HA 5C7OO 3A3OA 3DLCA 3BIFA 1Q19A 2UZIR 2QNIA 1J9GA 2YWBA 3AP1A 3O82A 5J40A 1QYVA 4H35A 3RG2A 2G7ZA 1RM4A 3JQAD 1U4OA 2PRIA 2X22A 2ZBQA 4D9BA 1QIEA 2C4HA 1U2GC 4WCFB 5E4JA 2PUEA 4X62B 2EX4A 4KUHA 3VH3A 3K0EA 1E2EA 2DG2A 3AFMA 4Z1OA 1JHUA 1NP7A 2FW0A 4AG5A 1X9HA 4GBGA 4PGHA 2OG2A 3N2YA 2ZAYA 3K92A 1VM6A 2VYVA 1PR5A 1NATA 4PQYA 2R60A 2BFAA 3ND6A 1Y5RA 4BGEA 1DPGA 2E55A 3VR4D 5EWMA 1IONA 2IS4A 1R6UA 3N7AA 3JCZA 3B1JA 3OE1A 3ZHYA 4YIHA 4JOCA 4J0JA 1I94B 1NVVR 3HVIA 1KAGA 4EPRA 3B13B 1XZAA 4WXEA 4Y6LA 2CXOA 1WL8A 2C8JA 2BDUA 4IVPA 2JBHA 2EV9A 4MI3A 4RAOA 3IA2A 3QX7A 1ICIA 1QPZA 3PKIA 2ZE5A 4EMSA 3OD5A 2E9SA 3GUCA 4G8CA 4FFNA 5BSUA 1JJAA 2QWXA 4WGGA 2J45A 1FL9A 1K5GA 4UU0A 3B7WA 4UBJA 4X20A 2P4UA 4HTAA 3P9RA 3AJ8A 4TKUA 5TARA 3RU9A 3W6ZA 4JJ8A 2BEUB 1GFIA 4FT4A 2Y0PA 4BO0A 3VFDA 3QE3A 3F7OA 4KSYA 3GNQA 2D7JA 3L1JA 2WOOA 1WPQA 3MT7A 2D1RA 4ZAVA 1DAPA 2V6MA 5JASA 3FJYA 2YWHA 2B6HA 1G7CA 2UZ1A 3EIUA 1SU6A 4D3FA 3UF0A 4EHAA 3UAXA 3JAKB 2O19A 3LZDA 4ZVKA 4M7OA 1EFVB 4OI2A 1L4UA 1PWXA 2OAQ1 4EW2A 4TWIA 4LZAA 3ZDYB 2F43B 4EW3A 2PKCA 4JLNA 4E1BA 2X0RA 4R6XA 2QNBA 4JP2A 4K0KB 4ARZB 2VNIA 2VRCA 3GU3A 1OKKD 5TV2A 2E1RA 2QROA 3N2KA 4AI6A 4N8DA 2ONYA 2ACKA 1EVQA 1ZEMA 2IYWA 3GJ0A 2PU7A 2REXB 2OD9A 1PJAA 2IYXA 4GOKA 2NO6A 2PYIA 3KOXA 5A9RA 1VL6A 3JWGA 5K4AA 3W78A 4RZXA 4ZC8A 2A2ZA 3PJEA 1GZHB 1M2OB 2AEJA 2D2IA 2W8ZA 3GLQA 4HN9A 2DR0A 3GWZA 4L08A 4LRYA 2B1GA 4JYCA 1UQRA 4MA5A 3T5MA 4GECA 3R9WA 4JI2B 2ZJBA 4M0FA 4ZVRA 2RJOA 3CN7A 4IVNA 1PX2A 4OHBA 4UBLA 3S6JA 4B3FX 5KDDA 1EWQA 1O6CA 1XCPA 5EE0A 2WYHA 2QP4A 1ABEA 1ENOA 1T9GR 1Y3AA 4I55A 3TPZA 2J0SA 3DZIA 3PFGA 4UZFA 3SKVA 2WJ4A 4Y8VA 2Q1TA 4KYVA 4DXDA 2W6ZA 3C16C 4XVUA 3NTVA 3LT5A 1AQYA 1JIUA 1UK7A 3G5UA 3AV3A 3E2IA 4B4DA 4C22A 4CW7A 1RJWA 4FLEA 4RD2A 1WR8A 4E03A 3L6UA 3RH0A 3X2SA 5BVHA 5DN9A 4G0PA 1RNLA 3GJ8A 1BH6A 1AD2A 1IVSA 2V6GA 3MYRA 3AZQA 1LI5A 1F6BA 1KZ6A 1TCUA 2Z1MA 3HNOA 4EKIA 3AHIA 3FIJA 1N6KA 4RVUA 4GMFA 5L3SA 4MI9A 2DETA 4OMDA 2ONKA 3PJGA 1EXNA 2E6KA 2AG8A 4BP1A 1N36B 1KPHA 2A5DA 2IZZA 4JVLA 3TOVA 2B4AA 1KJWA 2EFHB 3W7VA 5JAQA 4S0XA 1EGHA 3ES9A 1U7TA 1YJXA 1Y8AA 2BSXA 4BLQA 1S89A 1YQEA 2WMYA 2UV8A 4WD3A 1WW3A 3HVKA 1GQYA 3INYA 4DR6B 4Y9SA 2R9VA 3VVCA 1RAGA 5BNTA 3B3QA 1ZONA 2FLKA 5JVDA 1FFDA 1JMVA 2OVFA 1CUJA 4FOLA 2AH5A 3DD5A 2HDWA 1O6FA 3QVVA 2Q7DA 2IEIA 1UBFA 3GRKA 5H9VA 4OHMA 4R0MA 1IRIA 5MF6A 3FF4A 3D3NA 4U0JA 2FZGA 6AT1A 2O8FA 4NF2A 3W1WA 1F8GA 4QD3A 1VJGA 4UTNA 3ZCQA 3HTXA 2LTAA 3B2QA 1USKA 1YVDA 1PG5A 1Z5GA 2DP4E 1CZLA 2HBRA 4HFNA 4WV3A 5HFJA 3OZXA 3TLBA 4JITA 4WY2A 4CKEA 1Q50A 3Q9LA 3ESYA 2FF7A 1XAJA 4YJFB 1PK7A 5DNVA 4E7OA 2BOVA 4RXMA 2ZT7A 1U8XX 3ZR4B 3WWZA 2Z08A 4Q9IA 3C7DB 2BM8A 4FVTA 1VIDA 3AB3A 1BXKA 3TLMA 1IYZA 4PYMA 4RSHA 1J2YA 1TL7C 3LHIA 4H60A 3K1ZA 4KQJA 4G5SA 2ZS7A 4NC9A 5BQXA 3NEAA 4DG9A 2AXQA 2FX5A 1YMVA 5DASA 3EBPA 2PWPA 2XE8A 5AVYA 3ITDA 1E4EB 2DECA 3A1EA 3V1NA 4AUMA 2NO5A 2XOEA 2ZTSA 4HRXA 4UNPA 3U4DA 1AS0A 2NV6A 4DMKA 1HNXB 1J4AA 1FLVA 2HSZA 5AVUA 1V71A 1XP8A 1TO2E 2Q99A 4ISCA 1ZL2A 2FKAA 4BNUA 5JD6A 1B14A 1DHRA 4ZDWA 4HMPA 2QLBA 3RD5A 3RK0A 3FTNA 5AXDA 3V6LA 2VAPA 1YU6A 5EP1A 5GM1A 2NU8B 5EXDA 4B8YA 1E77A 4IIDA 3R0JA 4F7DA 5JPIA 2RHWA 3DLAA 2BEJA 3QXCA 3HXLA 3OD1A 4H1WA 2ETXA 3GR6A 4GLJA 1CY1A 1PP4A 1XTPA 5JO0A 4ZJYA 2YXDA 1C0KA 1COZA 5AOBA 2HIGA 3JQGB 3Q72A 4Z9BA 5KC9A 1M2EA 1GADO 1BFUA 3OJXA 4PAWA 4X24A 1GLGA 1VDZA 3NFRA 4MVJH 5JXWA 1SN7A 3I9KA 3EXIB 4JJEA 2HMAA 4FGSA 1H6AA 4CMEC 2C42A 3OPYI 5EE1A 3BWXA 3H18A 2W22A 4L5YA 2D2VA 3IEUA 1QZTA 3ZI0A 2JGFA 3IBSA 1A8UA 1UUFA 5EJMA 4NCAA 2ZP1A 2AMYA 1XEWX 1XA3A 2B69A 3KTDA 4EKEA 3TINA 5KX5A 3I4FA 4YY3B 1KEZA 1VPTA 1VE9A 4JSTA 3JQ7A 3Q7IA 3VV2A 4RHUA 1TQHA 2VDKB 2DWCA 4TTSA 3BDVA 1ULBA 3ZQ4A 4F3YA 3GPIA 1AHHA 1M6NA 3BMXA 1JHAA 1R3UA 1BEZA 1USVA 2QTWB 4INAA 1JA0A 3GHYA 3GW8A 4EY6A 3ZV5A 2UKDA 2HBQA 2PKXA 3NUZA 5HA5A 1GRQA 2DZDA 2QMYA 1N1DA 2A0WA 4S1NA 2C20A 2GRUA 3H3JA 2GNPA 4BVKA 3TGWA 1X1AA 1S3GA 4FYPA 4KK4A 2VQEB 2RJ3A 3HE3A 3OOYA 1NONA 3PQ5A 5A3QA 5MFPA 1Z07A 4MW4A 1M66A 4OHXA 3SWWA 2BFOA 1GZVA 1ECCA 1UC8A 3E18A 2WI8A 3MTEA 1LQTA 2XI4A 3GLSA 1XHFA 1NYLA 1SB8A 4II2A 5KB3A 5C53B 1I3KA 2N9UA 3Q0IA 1SBZA 3KKOA 1P4JA 7AT1A 4M1TA 4TXHA 3C3CA 4NAVA 5E9QA 2Q45A 2HJGA 3S1AA 2YHSA 4HVAA 3TQHA 2YJNA 2WSBA 4GEKA 1VCNA 2JLXA 5CT4A 5F5XA 1ZESA 1ZP6A 1XU4A 3H2BA 4AP9A 4CNQA 3DFKA 3FAKA 5DIFA 5CXUA 5BPHA 1PS8A 1P0PA 3A1NA 2G4LA 1LVGA 4ZOLB 1X7HA 1W7AA 2OOSA 1SBYA 2WIKA 1DJPA 3FUWA 3BD7A 3PVSA 1M2VB 3F2VA 4RHTA 5CRIA 3QSYA 4U7PB 1CXZA 1UXIA 1TYAE 1WDKA 1EFKA 1Y37A 1Z4IA 1YE3A 2IF0A 2QZ4A 3DDWA 3FA2A 4EY4A 1QO0A 1Z45A 5U4XA 5GZ1A 3AEQB 3R5SA 1R50A 1TO6A 1VHLA 2OZKA 3FBTA 1HDXA 2EZUA 3PNBA 4U2FA 1OH5A 3PNYA 3BZUA 4EUEA 3L7OA 2RK6A 2C95A 2O2ZA 4PZPA 4J0QA 3HCEA 2XAAA 1JXOA 4EO9A 5GINE 1FVFA 2GBCA 3N8DA 4KL8S 3TW6A 1MDFA 3WWOA 4E21A 2AGVA 2Z9BA 3MA0A 1VHDA 5KVQA 2OGWA 1HTWA 4O2AF 4L74A 5A1JA 4NULA 4KLAA 3ZU6A 2FR0A 3WSWA 1AT1A 5FBQB 3KOYA 3FDFA 5DX1A 1C3XA 5IMBA 1AUQA 2R7NA 3QPWA 1VXRA 1XRLA 3EFEA 5F77A 2CSUA 2RSLA 1AY0A 2PKYX 2CLCX 1TZCA 2XYQA 3TXYA 1TEVA 2CL6X 2FR8A 1CZNA 2MIIA 3AW8A 1WBDA 1XNJA 5B6IA 2FOXA 1JR3E 5AUPB 1NF8A 1KKUA 3DEKA 3QMVA 4WASA 4FM9A 3I5MA 3VV3A 2HA3A 1SBNE 1NVFA 4QVGA 4FW9A 1GPH1 2AHRA 5IZCC 1LWNA 1LH0A 1WO8A 3ZTWA 1DMSA 4P34A 1G2OA 4K6HA 3KXPA 4PANA 2CXQA 4F1KA 1OB2A 4O3MA 2OBBA 5BWMA 2Z5LA 3FPLA 1N2IA 4P3OA 1Y7HA 4J3NA 4F1JA 2J9XB 3CUYA 4JT8A 1XSEA 2BFDB 3O6VA 4FR2A 1GLNA 4CEIB 3UFXA 3NEYA 3F6SA 3P0HA 1EWRA 5A4AA 2KB0A 4OQDA 5AI5A 3N0TA 4HEA6 4N01A 4OJYA 4D92A 2Q5CA 2I54A 1ZZEA 2WWVD 3WMFA 2R6R1 4X85A 2CFTA 3CFYA 2HUPA 3NHKA 2ZPAA 3NAZA 2B98A 3QU7A 1BE0A 2C58A 2NXJA 4LGYA 1WETA 1N5KA 1TA4A 3DS8A 3KQSA 3M6XA 1DT5A 2B3DA 2NVBA 2IQIA 2QXTA 4F5EA 1DC8A 3PIIA 4KGXA 1Z0UA 4WZBA 5D5QA 4HTFA 3SBDA 2R8PA 4B6PA 4BDTA 2QVZX 5F2NA 3MMPA 1KFEB 1PK9A 2DFPA 3O8QB 2GM3A 2VH2A 3EIWA 4U2BA 3U09A 3ZOZA 1PJBA 4KYTA 1YB5A 2XVYA 1M0TA 2QN9A 2IW1A 4BE7B 2VHEA 3GGPA 2B25A 2XNJA 2OSBA 5E1DA 4WOCA 2R6JA 3SIPA 1P0QA 2F48A 1ZHFA 3QKSA 3CVXA 2FZCA 2P78A 4PLPA 5CYOA 1P0CA 2M1XA 4U9UA 3UGTA 4DN6A 1PQPA 2OZVA 3GFQA 4NEQA 4EKGA 1KR2A 2G5GX 3N86A 4WZAE 1J9EA 2VI5A 4RHFA 4ZRDA 4F4HA 2AEEA 2GCOA 3QPBA 5LLTA 1H3FA 2C00A 3I01M 2VPXA 3CJRA 4Y1RA 2WA2A 1XZHA 2QT9A 1OZGA 2QM0A 5EZYF 4C4YA 1JG6A 5CVDA 3COSA 3GFOA 1XTBA 5ETJA 5CGQB 1QDEA 4BO6A 1DHTA 2I71A 2IF2A 2RKWA 4MI6A 3SNKA 2TMYA 3KPYA 3DL7A 4JJGA 1GYRA 1PNOA 1UDAA 1Z29A 2QIOA 1T4GA 4NVRA 1N4AA 1NNLA 1NUTA 2HV8A 4DR4B 1NVAA 4YXWA 3JAWB 3FVQA 1WCIA 4CM8B 4LC1A 2NQ8A 4H6VA 5CLHA 1IE3A 5KWSA 2IXEA 1PJSA 2W0SA 1HR0B 1LWOA 5A4KA 1IL0A 4FFDA 1ZM2A 3THXA 2FUG1 2AC2A 3Q1LA 1FZQA 1XNHA 4BMZA 5JNRA 2P35A 3A1UA 3JQEA 5LQKA 5FOUA 3UWDA 5DH9A 3VR5H 5JYBA 4RO0A 3TFOA 4C06A 3M49A 4ADSG 2W2TA 3IQIX 3I6MA 3V97A 2SHKA 1PNVA 2B1RA 2H48A 3E5RA 3HWX1 4K9KA 4ETIA 4GI1A 3FSRA 1NYRA 3B3GA 4JQCA 7ADHA 3TRFA 2OGSA 1HDOA 3ESQA 5FNVF 1ZNQO 3SFTA 1R66A 4AICA 3CLSC 3HDYA 5E7JA 4INOA 4EHKA 5BN3A 2WE7A 1MX3A 1I2MA 2Y1CA 3SLKA 4D81A 2ZR7A 2A9OA 4YRKA 2EJVA 2Q1SA 2MMCA 2B8TA 3IV9A 4JCCA 4XB6B 4CL2A 1XMVA 5KQMA 4HY3A 4W1RA 1IN8A 4YRBA 3KZXA 4P5EA 2AI2A 4G07A 4ALNA 1A7AA 5MN5A 1DVRA 2FMIA 1XQWA 3L0YA 4TXLA 1ISHA 1XXLA 5CA0F 3QM1A 2G5CA 4JY7A 2A9FA 4LF4B 1ZDMA 4EF4A 4R98A 4LJSA 5E8RA 1FBNA 2AZTA 2XEDA 4LHXA 4N5LA 5AK0A 3PUXA 4JL8A 1ZJ4A 3FTCA 4A92A 4OHWA 1C9NA 2PCLA 3PP8A 4EDFA 4LF7B 3CNOA 2X76A 3DZKA 4FXOA 4OX9B 3T3DA 4PW0A 5C5IA 1Y9DA 3E9CA 1JJVA 3P0IA 1DELA 5E2IA 3EOAI 1RLTA 3C14C 1HBJA 3M6AA 4KI0A 1K63A 1WB4A 1MOPA 4GXTA 4EPWA 3ZY2A 1PVDA 1EK5A 3LUDA 1V8OA 4YTEA 3U3MA 1RPAA 4ES6A 1YQWA 4G0ZA 4G0MA 4PNEA 5JXHA 2PMCA 3JQ8A 1QR2A 5ELMA 4NZOA 2A9KA 3T5TA 4JQOA 3KJGA 3OQPA 4K46A 3B1ZA 2AG6A 3QXXA 4NENB 4RDIA 4UEKA 5EIBC 4RTOA 3V2UA 3F3YA 4HF7A 3TQOA 1YR3A 3MGBA 4P82A 2B1JA 2A1TR 3W1EA 1XZEA 1WMDA 2I22A 3PI7A 3AL3A 4LYHA 4XLTA 1R5NA 4BZQA 4C7OB 3CNEA 2P9GA 1L5RA 5TX7A 4PGFA 1T6BY 1CEEA 1D1QA 4UVDA 5T3YA 4O2AA 1H4QA 1I3LA 4YH1A 4KKXB 4E32A 4JLSA 3TW4A 4MJLA 4RUKA 4BRZA 4QDTA 3OF5A 2PH1A 2WFLB 2XCIA 3FWPA 3DO5A 3IBGA 3RF6A 4RK7A 2FXIA 5CLQA 4L4UA 4LC9A 2XX3A 2YOHA 1DE0A 3GOHA 2VT6A 3QKUA 3SKYA 3ZDEA 5F9FA 3X1DA 4IOKA 4EVSA 4QLAA 3MCWA 3RIMA 5FPHA 3S2EA 3C1UA 1Y63A 3O3CA 2C5SA 3JQFA 2POQX 3DF9A 3I76A 4BC1A 5JPDA 4H7JA 3FZNA 1KZ4A 3MTDA 4UCFA 4DLLA 4TWZA 1Z5PA 3P32A 3G0DA 1V7CA 1SBTA 4DLWA 5KWEA 4A8JA 2J7PD 1DC5A 1YWGO 4OGFA 3CPJB 1MGPA 1E96A 1Y4DE 3H42B 2DBZA 4PF1A 4OKIA 3VZCA 3VPSA 4C87A 3TJRA 2PLNA 4G36A 2H3EA 4FX2A 4P08A 3GPBA 1H23A 4M1WA 4RLHA 1FP2A 2HZBA 3LUCA 4MB0A 4Q3CA 6REQA 1IHYA 4BX2A 2X0EA 3ICQB 1NJ6A 3CCBA 3PENA 3QXGA 4NMMA 1VHTA 5BSTA 3L79A 2WNSA 2QJOA 3L49A 4V24A 3SGLA 4MUJA 1E2PA 5CT6A 3B36A 2PX5A 3B78A 3BHJA 4J91A 1P5RA 4RFSA 4RYDA 3RGGA 3EDMA 1NPDA 2OMEA 3RS7A 4OY3A 4CI0B 1UBCA 3JV7A 4IWYA 4N5DA 4IUYA 4OMCA 4C1BA 5FTMA 3C45A 1ATIA 2XYGA 4K0RA 3NXSA 1BS1A 3ONVA 3GZTB 5ALYA 1Z5UA 3RFCA 2P6RA 2C4VA 1WZIA 5KNDH 4PRZA 1YZHA 3DSRA 4TMVA 4ZO8A 5KJCA 1IM8A 1T3GA 3D3KA 3NHFA 3CUEF 3NO4A 1E6WA 3IDAA 4WVFA 4E5SA 4RSRA 3F90A 4ED9A 3KSBC 2HIAA 2QRKA 3G2OA 1MBZA 1DRKA 1O8BA 3LBIA 4V0KA 1YB4A 5CLIA 5C51B 2QB5A 4IDDA 3DC7A 4JHXA 4QXMA 4R8KA 3D2BA 4XM1A 3GAAA 2VT2A 1AOXA 1GNRA 3QQPA 1UPXA 3CBGA 1WY7A 4YBRA 1UDWA 3KV3O 2HTEA 2H1IA 2YYZA 3L7AA 2QW1A 4MULA 4NCIA 4U6SA 1V4NA 2W2VA 4QPCA 2H5EA 4EYKA 4YR9A 1ISIA 1KZ7B 2C31A 3FUTA 1U0GA 1W9MA 1A8HA 5TNXA 4EA8A 5F3WB 2WFMA 2JS7A 1K98A 3ZNQA 2O8CB 2EU8A 4HWOA 1RM3A 2WSLA 4I2VA 4DR3B 1V1JA 4TMZA 3RYTC 2QVCA 3O7MA 5IBRA 5K8VA 2Z4SA 5KNCH 5M7EA 1XEXB 4JZYA 3GJ3A 3RVPA 2CK3D 2JLYA 2CHUA 3NI2A 3AETA 3U44A 4X60A 5REQA 4TN5A 4TPKA 2G9QA 3B70A 4DB4A 1K6IA 1K97A 4DAEA 2OV4A 3DZFA 4KBGA 1XTIA 2UUBB 1Q2XA 3C7TA 3TD9A 2GJKA 4B82A 4M37A 3V3TA 1CTQA 1YUBA 2C3YA 3AY0A 4J29A 3W5IA 4KGDA 3R7DA 3JQBA 4IQ8A 3QEMB 1GSIA 2HXSA 2Y9MB 4HDCA 4BV8A 2GYVA 3O8NA 3TDMA 3U80A 1KBZA 3LUPA 1PZMA 4WN3A 3T5DA 2QR5A 3OJLA 4MDFA 3GLHA 4YRAA 1GTZA 3AL2A 2ZYTX 1ICEA 2QM3A 4AW9A 4KXLA 3RASA 2V59A 2Z1DA 4Z9XA 4AKHA 2HDHA 3VPXA 3RFUA 3SZGA 4J4TA 4TV8A 1HQKA 1A7KA 2IV7A 2IOFA 3AOEC 5FNVA 2B94A 2BGJA 1NQ5A 2EL7A 4H1TA 5D86A 2YFYA 2YIJA 1XWFA 3QX9A 4QOSA 1YRAA 4UCWA 3REGA 3ZCTA 5I45A 3FTDA 4Q1AA 5B7QA 1OTXA 3CH7A 1NHGA 2VYVD 3I52A 4YGXB 3M0EA 5I3CA 2A9JA 4OUDB 2VKQA 3NDPA 3H17A 2CYAA 2RAPA 3G0IA 4I9HA 3JPWA 3MWLA 1U1EA 3COJA 3PGXA 4FJ1A 4O4IF 1C4OA 1JKJA 4N03A 5E4FA 1RBMA 2YJ3A 3F46A 3D8UA 4HDKB 5CA0A 3WO0A 4UREA 3TB4A 2EQ5A 3IDFA 3COPA 3KVVA 1V7QA 3EIHA 4NNPA 4PX3A 1ONPA 1TZMA 1W4ZA 1ZK1A 4LXTA 1WXXA 4BCBA 4MMYB 3DUFA 3KWMA 1L3CA 4H0FA 2VHTA 1WV0A 2ZBGA 4LOJA 3JS5A 4WESB 1CC1S 1R4MA 2RJNA 2C83A 4ZQIA 4TKLA 5GONF 1AHNA 3UT5A 2GEJA 4AMYA 1EJ6A 1V4BA 3V2HA 1BROA 1LNZA 4HRYA 4Z53A 5JEEA 2EWWA 1R16A 3G8AA 1EKXA 1PDOA 3ZU3A 2BGWA 1IZ0A 4N18A 1XMOB 3QLTA 4YJHA 3KB1A 4TL8A 2DMRA 2FWAA 2FR8C 2IHVA 3FX2A 3X1WA 2COUA 2ZI5A 3QV1A 3FRJA 4B3MB 2CUNA 2N0SA 4CT4B 3OU7A 2BMWA 1XLWA 2ZYIA 3NANA 3C48A 4RF5A 5DHPA 3S7TA 5BURA 1Q3HA 3PRKE 3I3SR 4KFRA 2AI3A 5CB4F 5JI3E 1GNVA 3E0XA 3T4XA 5B6JA 7REQA 4O4JF 1XCJA 2B8WA 1ZOPA 1LLCA 3EZYA 1RSZA 2QI9C 1RMYA 3HDHA 1D2NA 3KEFA 3QBJA 5JNLA 3N7TA 2RHTA 4AO7A 1ZC3A 1A9XB 2NUBA 4AQ7A 4EYOA 1OAAA 3GUHA 2C3OA 1A8IA 1MB9A 2VRCD 2O9JA 3DXYA 4KQEA 3QELA 2XVAA 4CLHA 4R5MA 2C4MA 4MLPA 2KMLA 3DR3A 2G9UA 3CEMA 4R2IA 5EJ2A 3HJHA 4LJ9A 1LI4A 2Q9AA 2ILTA 4ZKEA 2RGXA 1EWYA 1VJDA 2BKAA 4AZ3A 5ITWA 3CLSD 4WH0A 4OU4A 1RT9A 4F0JA 1PW5A 4M22A 1Z12A 4RVNA 4WT7A 5ALQA 4JXZA 3FIUA 2CB9A 1UBLS 4Z4CA 3HRHA 3FB1A 1B6GA 4C2BA 1U5BA 1EP9A 5IWAB 5CH3A 2PGOA 1TT5B 3JVDA 5CFNA 2WWRA 4NV0A 1YFJA 3EDCA 2YUIA 3DGFC 1JWBB 2GILA 5L40A 1OTYA 4QYWA 1XPUA 2XA9A 1G9XA 1O94A 3QXSA 1QKKA 1U8AA 4GR5A 5JSZA 3ZZ0A 2JLVA 2IGBA 1E64A 2XD4A 1YBFA 2G70A 3DE7X 3A2MA 3GJZA 2NYRA 1U1CA 3RJTA 3UHFA 2WMDA 4MB2A 1RCUA 5EWLA 3KELA 4QUIA 5TS3A 1JDPA 2BGMA 3D7LA 5CVCA 2WYIA 3TNFA 2XCRB 8MHTA 1KYWA 1FMLA 5D2CA 5GIOE 1UJ2A 3HKDA 2P8SA 4M6WB 4Q4LA 3TJZA 5TEWA 1J7KA 2Q5LA 3LPCA 1QYIA 2R5FA 3JYQA 4DAOA 3BAFA 4GMDA 3MCVA 2HI0A 5DTIA 4NG5A 1USUA 1MZPA 5EP2A 4BFUA 2JI9A 2ZIFA 5J3JA 4B43A 3LTNC 1WCV1 1Z6ZA 2I4RA 3HU5A 1C2TA 5EIBD 1D6SA 3TAHA 3WYBA 1KP9A 1QS0A 2UVPB 3KOZA 4MRAA 4PLZA 3CNHA 2ZRHA 4RXTA 4O1MA 5DFAA 2ZEJA 2JIZA 3BCSA 3FHJA 2Y3IA 3HYTA 1Z15A 1GEGA 4N7MA 2WWYA 1HETA 2Q0XA 3NH9A 2IYEA 2QE6A 2ONCA 4R2LA 1SUIA 1E0KA 2Q8QA 2PVPA 1QQ7A 2XXJA 2IHUA 3QWBA 4IKOA 4LRQA 4YRDA 3WK5A 3ML1A 1XZPA 2OTCA 5E3IA 5HWSA 4CV1A 4Q5IA 2BMAA 4HDNA 1YIAA 4LRSB 5FPTA 3N2NA 1OJLA 1WXEA 4GQIA 2QGZA 3VKWA 1OBFO 3LPNA 3V9PA 1HKUA 3B1VA 1QCYA 2HY7A 4HRAA 4RF2A 4K8OA 1PNQA 1DBIA 4V0OA 1CHDA 4ZZIA 4DKXA 2VF5X 4K9OA 3IUPA 1Y5IA 2NUAA 1JVBA 5CVEA 2C2KA 1E1MA 3PE3A 2Z4TA 3R6GA 4OG2A 3TQTA 4GG1A 4P5PA 4E5DA 2OCXA 4F11A 2AOTA 2GEVA 3MLEA 4KNVA 3EGVA 5EGNA 2XZLA 5DPMA 1DS6A 2ORVA 3EIFA 3ASVA 3CCFA 3GFTA 3HLKA 4CG0A 4DLAA 1H69A 3RHSA 5TE9A 3TQQA 3U7EB 1CRPA 2VWQA 3B85A 1CVRA 5AVOA 4NOJA 1WLSA 1YR6A 2R6GA 2Y2UA 2HU5A 3C43A 3PEFA 2V7WA 4NV3A 1L6RA 4ZQBA 3VDXA 3MQ2A 3K32A 1SCDA 3QBVA 3NCTA 4MW0A 1RWKA 1P6QA 4I6GA 4CCYA 5JSHA 3QVLA 4MQUA 1H6DA 1PUIA 4RZSA 2Q4DA 1Y3FE 4MJ3A 3U4QB 1A8PA 1OIXA 3LS2A 1XEAA 4L8LA 1VCHA 3RDPA 3UJCA 3VU9B 5LWHA 3ROMA 3UV6A 1JHYA 1UBKS 3ABZA 1L5MA 3G8YA 3AKEA 1E66A 3PXDA 1N0HA 5LXTB 4KZPA 5J23A 1F2DA 4QOGA 3FR8A 4PVDA 1EK1A 2Q5HA 1FQWA 3Q10A 1VL2A 2GT1A 2HLDA 2M2IA 3KSRA 3KZOA 3BFVA 1PLLA 2C82A 4UZEA 3T9DA 1QE5A 3PEVA 1NKTA 3H16A 1L7VC 1JKXA 5IX8A 4DSTA 4BVGA 1L1EA 2D1TA 4O4IA 2VYFA 2XGJA 3HWRA 3BF7A 4OQNA 3L8DA 4IAOA 3LF1A 4M7PA 4WJLA 3IDSA 5CK4A 1MB0A 4K6MA 3UGQA 3C3AA 3K5HA 1C3OA 1M8FA 1L7OA 2XDWA 3FI9A 4K87A 3RYIA 3A11A 4U8HA 1GFSA 3ZU2A 3ZZUA 4BQFA 4EL5A 2P6NA 1B7GO 3RU7A 1KC3A 4FNGA 3N8HA 3CSDA 1IY9A 1KPIA 1LPSA 1WCXA 3AR9A 3GOQA 5GONA 4C5AA 5BUCA 1Y6QA 4J49A 4KW7A 1FSGA 4GPD1 2FPPB 2O0MA 2YBDA 2YHBA 4RL6A 2IH2A 1VLLA 1J5EB 4GX5A 3REOA 4XJVA 2X5OA 2AXEA 1M7BA 2P41A 2BI8A 3N2EA 1T9DA 2WT9A 4DILA 4FDMA 1R0SA 4K40A 1JPNA 4IKPA 4KQHA 4E4TA 3PQDA 3RU2A 1BS9A 1HT1E 3DXXA 4A8JC 4J2HA 1F38A 2YW2A 4GEGA 3FH0A 4JBWA 4ZT4A 3OSZA 1E5TA 3W7AA 4F4FA 3R40A 1Z74A 5LOVB 3BGIA 4ZIRA 4JZKA 2W93A 3FUCA 4O4JA 5EMKA 4QUAA 10MHA 1A88A 4D97A 4COKA 1U0LA 1N1GA 1OC4A 1X6VA 2IA5A 3AHGA 3LI2A 4WKNA 2HCTA 3TDKA 3WK7A 4BY9E 3O1HB 1MV8A 3D8BA 4TUYB 1YAJA 2PMKA 3UKJA 4DDVA 1HDYA 1OOEA 2A9VA 2GMWA 2PLWA 1MFZA 3HA2A 4P0TA 4CZ2A 3E9DA 1NZDA 2VJNA 3NGXA 1DAHA 2VHJA 2G9ZA 2XQKA 4IMRA 5ULLA 2WY2D 3F6BX 5B58C 4RS4A 1N8SA 1JDTA 4JX9A 1DXYA 3ONEA 3Q6MA 1HRKA 1RWWA 1X39A 4M1KA 1RXSA 5E7IA 1SO8A 1CT9A 1D0VA 1DKMA 1TIKA 1QO0D 2Y4OA 3SBEA 2BGKA 3MUOA 2YIVX 4FGUA 5EKSA 4ZVMA 2JCGA 5K03A 1RU3A 4D0SA 1I7DA 3Q88A 2O06A 2J3MA 2GUWA 4C0BA 3F6EX 1ESDA 5E4TA 1T36A 3ZHSA 4XPIA 4BAGA 3E22A 1ZN9A 4HLQB 1QFJA 3AJEA 3D3JA 5H9WA 5AKYA 2OBYA 2C2WA 1RZVA 2AE1A 2ZSBA 3KUKA 1QHNA 4LWQA 1YQUA 2PWZA 3DAHA 3IXQA 1H2RS 3ITEA 4HB4A 4JWTA 4MW9A 1Z22A 4MV4A 1R0ZA 2H0AA 2W8BB 3GYGA 3HKCA 1MW9X 4GM0A 3H7IA 4C0LA 1VI5A 2ZJ0A 1SOMA 2XYVA 1EFTA 2QRQA 2WU3A 1U5AA 2AXNA 1B73A 3PHLA 2P8JA 4M0DA 5EC8A 3OAAA 5JH7F 2GRJA 2RHCA 1DKNA 1LPBB 4AS1A 3I2IA 4GUDA 4QPJC 1KO1A 5B58T 3PNVA 1NI4B 2OSVA 5MDHA 5ERYA 3D7RA 4CG2A 3SC6A 2G3YA 3HQ4O 3MSXA 3CZ5A 4C4PA 6ADHA 5JFOA 1O96B 1XTQA 2QXUA 3N5KA 2FFQA 4Q3OA 1OI3A 2BUBA 1Z4LA 3OURA 3HSSA 1BAPA 3V2GA 5JIBA 1Z13A 1XKLA 5C1OA 4NL4H 1II0A 3FNFA 4M7RA 5FWXB 1TJNA 2RG1A 4UUQA 1UWLA 5LMNB 2ZPUA 1K7FB 5IH3A 4EIWA 2CB0A 2F7SA 3L0SA 1K4YA 3ANTA 1T91A 2W2KA 1FSPA 2GSWA 3JQBC 4ZMSA 4ZYXA 1TEHA 3WL7A 5JCZA 2XZOA 2J33A 5FEUA 3D6UA 2C4NA 3GAFA 1OLXA 2ECQA 5BYJA 1X1SA 3MTJA 4UASA 1GRNA 1N5RA 3DE0X 4NCKA 3NAMA 5ESXA 1S2NA 2GFQA 2F1IA 3UTDA 3VYRB 3TFWA 1CPYA 1BE8A 4DUGA 3IUMA 4HOYA 1U8TA 1KDZA 3RTAA 2Q3CA 2I2FA 3A9WA 1BFDA 4B6FA 2NXNA 2E2WA 2WJVA 4HDSB 2V0NA 4S2EA 2ON6A 3P52A 1HYQA 1GTSA 2C8KA 3LWNA 1EVLA 3A28A 3E3OA 3DV0B 3PNQA 4PYQA 4CM9A 4OGKA 4R69A 1UEJA 3I4LA 3LLCA 4U3JA 3VPHA 5LYJB 3A6LA 1OJ7A 3KJFA 4PGAA 1CIPA 3H1BA 4TROA 1NKSA 3M1LA 4IV0A 3C6ZA 3ETGA 1TRHA 3ZQUA 4YJ3B 1NUQA 4QUBA 1RRCA 4WCVA 4YR7A 2HFJA 4A0GA 4I3GA 2I2AA 5ALIA 3WZ2A 2C9MA 4R1LA 1JG2A 4ZVLA 1HL7A 3FOFC 4P1ZA 1XTZA 1B41A 1PW7A 2EGHA 2VAWA 2GZ2A 3TSAA 4QUKA 4DQXA 3R3WA 4F4DA 4UMVA 1FP1D 3U4MA 4R1OA 3ZKAA 2R1ZA 2O3RA 4FDUA 3TRKA 2J9FB 5CH5A 1KEEA 4QU8A 1JTVA 2O0LA 1TTHA 3ZCSA 2PA0A 2N3ZA 3L43A 3MINB 2X0DA 2CYCA 3LDUA 2OQVA 1GXSA 3VZSA 3TRIA 3RHFA 2YN4A 1Z0KA 3FFXA 5E9AA 3VGPA 5K99A 5K4GA 2HU7A 3KUUA 4QIHA 2F1RA 5KPDA 2B78A 2HXGA 3D81A 4LZNA 1KWGA 4CF6A 4R9VA 4DXHA 1ZH8A 1FC0A 1YZFA 3FPHA 1Y3CE 4ND2A 4WLFA 1H5UA 2XJ4A 1GQRA 3AP2A 4F2PA 1VMDA 4P86A 1PEYA 3PF9A 1CQZA 4XQGA 4V2IA 1Y4ZA 3HXPA 1EVIA 4XDYA 2N75A 1RKBA 3QNUA 3ZDRA 3GEDA 1I13A 5DM0A 2YUTA 2FLWA 4Q1FA 1IY0A 5TQJA 1H4SA 3OIVA 3V8QA 4QICA 3EVEA 2RHHA 4WINA 3SLRA 3O8DA 1FFYA 5ER6A 2PQ0A 3AZOA 3FROA 4FEAA 3KTFA 2VNKA 1C8BA 4M86A 2DHQA 3OX1A 3GH3A 3HO6A 2DHDA 3UV7A 4AULA 1C0IA 1OGYA 2VYNA 3BJMA 1KERA 4K2HA 3D6AA 2Z2JA 2FRXA 2YW9A 2F1OA 3KPUA 3QOWA 4KTTE 3RSHA 3VPDA 3WISA 4B3DA 4BVHA 5K6RA 5EE3A