1ESMA

Structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
311
Chain Sequence
QTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PANTOTHENATE KINASE
publication title Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 99
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1esmA00
1AKEA 1T8UA 3TAUA 4LPKA 5FPYA 4EJSC 3EZFA 2HT6A 5EE0A 1DARA 1GUAA 4PSKA 4EIWA 4DUGA 4ACBA 1Z6YA 1E99A 1G7TA 1KO4A 1RYHA 2XAUA 2ZYWX 3CWZA 4JT4A 1DBSA 6Q21A 2G9NA 3U6BA 3GLGE 3E70C 3F3YA 2QAJA 2W0MA 5D3MA 3ZVNA 4Q1BA 4B6EA 4M1OA 1XU4A 3U61B 3UKDA 4A1FA 4JT2A 2JCSA 2VP0A 2J7KA 3LBHA 2TMKA 3W9YA 1YR9A 2VPPA 3TR0A 1NLFA 1E2NA 3GEIA 2G6BA 2ASEA 3VKHA 3LFUA 5B30A 4NCJA 3Q72A 2L0XA 5IK2D 4E09A 2PJRA 4Q1CA 1XNJA 3ADDA 1JJVA 1DAIA 4TMXA 3NDPA 2OAQ1 1X1SA 1IONA 3BB3A 1VCIA 1QHHA 5H70A 4HLCA 3QSYA 2HF8A 2W6ID 2ZJYA 1P62B 1DEKA 4Q1FA 1U8AA 3QOFA 1U9IC 2E87A 4QOSA 4C0JA 3OEHA 3FKQA 4LK2A 5DSZA 1CU1A 1TAGA 3ZS9A 2B7CA 1Z5ZA 3AVVA 1UM8A 1NKTA 2J0VA 1Y3AA 1AS3A 4US0R 4BRUA 3OFNA 3OAAD 2IYUA 2O0HA 5BN5A 2ZANA 2XZPA 2B7BA 3HU1A 4TLAA 4MDFA 1SXJE 4PFSA 1XCGB 5JRJA 4A15A 4K46A 2BJWA 1KGDA 1Q20A 3C16C 1VG1A 2JJ1D 3A1WA 1R10A 1CJKC 1QG2A 3X1XA 5HE8A 5HE9A 3LX5A 1SHZA 2PZFA 3NG1A 1TEVA 1COWA 1H8ED 4L16A 1S2MA 5HCNA 1EWRA 1E9DA 2GDJA 2RCNA 1JR3E 1U99A 3IPXA 4JLPA 4UJ5A 1UBEA 3KXKA 3W8NA 4KVGA 1IOZA 1NSTA 2B21A 2R65A 2IBMA 3FE2A 1QHYA 4QNMA 4TQUS 4UKDA 4UNPA 4X8OA 3TVDA 3WBKA 4WW0A 2WWIA 3LQRA 3C5CA 4Q4JB 3KJEA 2OM2A 1FW6A 1TUEA 4MGZR 1U98A 3LVQE 5FBQB 5KNBA 4L8GA 3MLEA 3MMPA 1Z63A 2W58A 1QRAA 2EVWX 4BFWA 1VYUA 3UANA 2BOVA 3B1XA 1XD9A 3BFVA 3KKQA 4XWOA 1FOEB 1C1YA 3UWKA 4ZIRA 1HT1E 2RGBA 1ZC4A 4TTPA 2FPLA 4KFUA 2ZITA 4C30A 4JKIA 3KB2A 3S1AA 3UXMA 2GJAA 1ZUNB 1QHIA 5DISB 1E9BA 1KDPA 4EFMA 5F2EA 3QBVA 3NC1C 1VTKA 4TT3D 3QQ5A 5KOYA 4Q7KA 3NH9A 4HB2A 2O0JA 3Q7QA 4ZKDA 1OB2A 2GVZC 1NLZA 1G7RA 3JZMA 5AUPB 5BW8A 1YJ5A 5EE5B 4BLRA 4LYFA 3RC8A 3KKNA 2KJQA 2CVHA 1TMKA 3BOSA 2Z4RA 4YONB 4HLUA 1OH6A 3AVUA 1OXSC 2FV8A 1HV8A 3FHOA 1TF7A 2RB4A 2VBCA 1S1MA 1G7SA 2F3RA 3KQLA 4B47A 1QG4A 1QHSA 3B9QA 3O8CA 3EWAA 3QKSA 3ND8A 1P75A 4RFSB 2VP4A 1WQ1R 3ASYA 1VG9B 2IYRA 1WXQA 3AVWA 2JDID 1VMAA 1ZVQA 5CB6A 3EZ9A 4PC6A 4YMVA 4LJ8A 2CJWA 1MABA 2VHQA 2REBA 1J7KA 4JLAA 4KO8A 4PPNA 3GLFB 4JBXA 2P67A 3WXMA 3P26A 2NO6A 1OXVA 2W6JD 5DH9A 3LNCA 4TMWA 1CXZA 3K0AA 4J0QA 3GLGA 4M1TA 1G4AE 2WKQA 3HJNA 3VR6A 4YMSA 1YHNA 2FFQA 4O25A 5L3VA 4NONA 4XOIA 1TF2A 1VECA 1YZQA 3JVUA 2QT1A 1MH1A 1TU3A 1XCMA 2C9YA 4M0LA 5DN6A 4AD8A 4A82A 4FIDA 2GXSA 1BMFD 1RRCA 2QP9X 5AR1A 4N1AA 3SJZA 3GFTA 1E9EA 1Z28A 4QRHA 2HUPA 1W5SA 3C41J 4IDQA 1AGRA 1XFAA 2QROA 5K8LA 4LYAA 1HYQA 2H92A 5DO9A 5FTLA 5HKKD 4GSYA 4CEIA 2ECKA 2B92A 2P6RA 4QGFA 2V7QA 4R71A 1HQYE 2ZRHA 4R9UC 2QAGB 1CTQA 2P6NA 4HZIA 2CLDX 1T5IA 2FU5C 4LHZA 4LJAA 4BE7B 1GP2A 3JZAA 1GL7A 3WNBA 1AZTA 4QGAA 5D3MB 1SXJA 1CP2A 4TL7A 3R8CA 2ZI9A 4C2UA 2ZJ5A 2F9MA 2AR7A 1YZTA 2GK7A 4CEJA 5F9FA 1Y63A 4B2LA 2WJYA 4PAOA 3IKJA 2WSSD 2IS1A 4V0NA 4G0NA 2NZJA 1K5DA 3SDZA 4K8OA 4KJZA 3HPQA 1JR3A 1TQ2A 2VQSA 2O8DA 3RS2A 3IBYA 4ERNA 1W2GA 3EPKA 3SHFA 4PPGA 2ZRJA 4GP6A 4LBVA 2FG5A 1SQ5A 1KY3A 4EFNA 1JPJA 2FPMA 3E2IA 2GESA 2MSEB 5FBRB 4D25A 1KJWA 3ZZUA 3K0CC 4PTLA 4C0HA 1LTQA 1H8HA 2AKYA 4XH9B 5BYJA 2FSIA 4HZUB 4QFMA 5FL3A 3EA0A 1MO5A 5EP2A 2AL7A 1GIAA 2C9CA 2VO1A 5DNYB 2ZM5A 5IT5A 4DBLC 1W4RA 2VHTA 1X8LA 3AF4A 4IKEA 4NU0A 4AIIA 2J0QA 2YWEA 4JBWA 2PCJA 4RVCA 1GRRA 2BDTA 4TMVA 2QEQA 3X1WA 5C46F 1OPXA 1XCPA 1RVDA 2RGGA 1G41A 2ZAMA 5FPHA 2IT1A 4BWYA 1SULA 1P3JA 1E4YA 2X77A 3TRFA 2NZ8A 2F9LA 1SGWA 1XD2A 4ZDWA 5EXXA 4PPQA 1DADA 5TB5A 4URVR 1P4SA 3T06B 3QKRA 2ZI6A 4UXHA 4YMTA 2A7QA 2YHSA 4CT5A 2GCPA 2XTZA 2YOFA 4PO9A 3W6NA 4QC2A 5CM8B 3QVUA 1ZIPA 2QL6A 4IXNA 2KE5A 3LD9A 4HSEA 2MMGA 1T9HA 4QBHA 4JYBA 3MFYA 1J70A 3R20A 3KKMA 1DO0A 4PHTA 1TQ6A 2FH5B 5FFMA 821PA 5FUWA 3THWB 1GNRA 3QY0A 1DO2A 2HLDD 5F9HA 2DCUA 4IHQA 2ZRGA 2QENA 4B48A 1HQCA 4FCWA 3B8HA 4TSFA 4HAYA 4KYIB 1NVVR 1U8ZA 4XTCS 1FX0A 4KU4A 3AP1A 3HWSA 5FTMA 5JSZB 3CLVA 1JAHA 2Q9BA 4Q1DA 3QPWA 1Q1EA 4QL3A 4OKSA 1QHNA 2OXRA 1R8QA 3FFAA 3VMFA 2AXNA 3EG5A 4BPBA 1G16A 4B75A 1OJLA 3U44B 1MR3F 5GJWC 4NCKA 4R98A 4DSOA 3PENA 1NJFA 5J4HA 4MKHA 2XB2A 4HAZA 1JXOA 3CONA 4II7A 4DDWA 1BOFA 3MWLA 1YZGA 1T0HB 3ZJYA 1M7HA 3B82A 4OI1A 4JLVA 3L8ZA 5KDLA 3I5YA 2J3EA 3D6TB 2VTKA 2BMDA 4M8NE 4L15A 1RIFA 5K8IA 1XEXB 1US8B 1RJ9B 1E2LA 3Q5DA 3CKLA 1EK0A 1MABB 4WVFA 1W7AA 4US2R 2Q3FA 4IVQA 3T5GA 2E9SA 2WOOA 1ZRHA 4KBFA 4AURA 4C0LA 2YC4C 2HXSA 3VR5A 3AKEA 3C5HA 1YE8A 2C9OA 2PX3A 3GMTA 1KDTA 2YWFA 2EFHB 2RH5A 4F38A 1NVVQ 4LJ7A 3DM5A 4OK5A 3NEYA 4GT1A 1ZU4A 4OK3A 1Q21A 4BQSA 2ZR9A 3ZGXA 4AK9A 3AKDA 3VKWA 4PXAA 4AKHA 4JLMA 3IIMA 1P5ZB 3B85A 3QXSA 1UADA 2CXXA 4TMKA 2ZJ2A 3EIQA 1N3BA 2IF2A 4IOJA 4XSGA 2WPDA 4C0SA 1ZINA 1ESMA 2QT0A 3DDCA 4CEIB 3HPRA 4DIDA 3I8XA 1I4TD 1ZM3A 5B58C 5P21A 3BWDD 1T91A 1FP7A 2DFKB 1J2JA 5DYIA 5JMTA 1IXZA 1KNXA 2ZJBA 1QDEA 2ZRNA 4ZKEA 2FN4A 1ZJ6A 5E95A 4GOXA 3ZIAA 1G1MA 2IYVA 4QHSA 4EUNA 1NG1A 3FMOB 2MMCA 5AJWA 1EFTA 3DEFA 2GZDA 5BXQC 1DAGA 4EDHA 2CEAA 4CEJB 4DEXA 3GJ5A 3ZQJA 2O8FA 3MJHA 3X1YA 1HT2E 1AJEA 2YZ2A 3KDSE 2AD5A 2R6AA 2UVQA 2QTHA 3A58B 4QJ5A 4TYNA 1KTVA 1GKYA 1ZNZA 4M4SA 3K9LA 4AYWA 1DAMA 2GA8A 4IEEA 1ZYUA 2A5DA 4D0NA 2OFOA 1E9AA 1NN1A 1NN3A 1ONBA 1W4AA 2VYFA 3AEZA 4WZAE 1OKKD 4TLCA 1ZIOA 2C96A 3AUXA 4A4DA 1NMXA 1AQYA 1ZMXA 4E5UA 4A8JA 3TUIC 3C4JA 1FTNA 3WYAA 1Z06A 3K0EA 2XOKD 2BBTA 3FKSD 1ZC3A 5CYPA 3K9HA 1CULC 421PA 3LWNA 3ADBA 2CNWD 4OJQA 4DB2A 2JLSA 4PC7A 1SKQA 2GBLA 1M6NA 1S0UA 3QEOA 5E3HA 3GJ6A 4P0TA 1AK2A 3AQ4A 3BERA 2EFEB 2FFAA 5AJZA 5ELXA 3F5FA 4JLOA 1W44A 1XPUA 5GJBA 4EFLA 2OE2A 2X1VA 3QPVA 3BORA 4BLOA 3FMFA 2JJ2A 2NO9A 3OIWA 2WJHA 3A8TA 3OIVA 4YXWA 3WRYC 2BC9A 1XD2B 3A1VA 2DFLA 1BYUA 2G0NA 3TH5A 1GILA 2C5LA 2OG2A 1H65A 3KFVA 4DKXA 3QKRB 2V6IA 1DAFA 3AM1A 4DLVA 2PEYA 1KJYA 3U6KA 1J90A 2FGKA 3PJRA 5LPNA 2D7DA 3CZPA 5CB8A 1TU4A 2REXB 4NYJR 5EE1A 2QQ0A 4BZPA 3OE7D 1N0UA 1OW3B 3CRRA 3T61A 1XXHB 4DCTA 1HY3A 4Q18A 3O8BA 4OL0A 1GAJA 2QPTA 3BJIC 3EASA 5CK5A 3RNLA 2NO1A 1W2HA 3PCRB 3SYKA 1A4RA 1IN7A 3RRMA 3W8RA 2YJTD 5FOSA 2CHVA 1EX7A 3NTUA 1A82A 3OIYA 4RD4A 2GEVA 1FX0B 1HEIA 3KTAA 2GVDC 1XTRA 1U0JA 4TLEA 3IHLA 2MSDB 1Z8FA 2DY1A 4BFTA 4PQFA 3TK1A 1GL9B 1II9A 5JI2E 3P4YA 4DSNA 4MITA 4B3GA 5BN4A 5C4MA 1CR4A 1NF3A 4M21A 3DZ8A 1KI2A 3N2EA 4LPSA 5L3QB 5E7MA 2CDNA 2HXYA 3CW2A 3FTQA 4DLYA 2PL3A 1E69A 5JBQA 2NTYC 4QHYA 4N3NA 4ZCLA 3HR8A 3R9IA 1EFHA 4D2IA 4KFRA 3DOFA 5F3WB 1QHXA 2IS4A 3K09A 5SZIA 1G21E 3GJ0A 4LGMA 2XNDD 4D26A 4TZ0A 4AKIA 2D74A 3DKPA 3E5HA 1KI6A 4RY2A 2GAOA 3VNVA 2ZSDA 3L0SA 2HT1A 5KYKA 1R8SA 4L4UA 1T3HA 4MGKR 3VFDA 4NYJQ 1XX6A 5KPJA 4M9ZA 3LV8A 5LD2B 3UMSA 1NVUQ 3KB1A 3MGCA 4MKGA 4Q4LA 2R8RA 4V02A 3LO5A 1K8RA 5JS8A 3B2EA 1KY2A 1E79A 2WJGA 5FOXA 1CIPA 4PSVA 3H84A 4UXIA 1W4CA 3CB4A 1OV4A 1WE2A 3ZS8A 2P2LA 3L8YA 3R9XA 1X8KA 3LRPA 1WMSA 1KK0A 2VHCA 2A2ZA 2R6FA 4PC2A 2GCOB 4DSUA 1TQ4A 1CEEA 4HLUC 3SOPA 5FI0B 4BASA 2F55A 5J4YA 4LCBA 4ZDJA 1GOTA 1P61B 4RZXA 1HUQA 1M34E 2ZJZA 2ZQ5A 1XBTA 2BBOA 1VG8A 3FYHA 1OB5A 2F1HA 4Q1EA 3GEEA 3U3JA 3W6OA 4IOLA 1X1RA 1KZ7B 1Q22A 2R44A 1ETUA 1M7BA 2F43A 3OF5A 1NNEA 2A5GA 1KDRA 4H9GA 4LV5B 3LDAA 3VU9A 1E2DA 1KKLA 4QBFA 1NBME 3SC3A 1ZU5A 4PO8A 2XXAA 2QMEA 4P3YA 2YWGA 1XPOA 2VP2A 4P33A 3A6PC 3CUEF 1R5NA 4Q9KA 4LHYA 1YR8A 3R8FA 2PT5A 1WDTA 2FF7A 2NOAA 1Z6TA 2RGEA 2B6HA 1OHHD 3WNCA 3RS5A 2WM9B 1II8A 1Z83A 2B8WA 1JPNA 1PLKA 2J46A 1PUJA 4JJKA 521PA 1D8TA 1NL3A 3PG5A 2FSHA 1X6VA 1G291 1ZW6A 2XSZA 2OT3B 2ZYTX 2F6RA 3AV0B 4NL4H 2J45A 1N5KA 4TTRA 3BE4A 4QHTA 4AKGA 4OHXA 2ZRLA 1ZM4A 1E0AA 2C04A 2V9PA 2FFBA 4KV9A 4C0QC 3BC1A 4F92B 3K1JA 2UKDA 3HYRA 1A5TA 1KI4A 1RC8A 1OFHA 3B7GA 1D2EA 1VYTA 3BB1A 2CMKA 5DI9A 4CIDA 5JLJA 3MCAA 2R2AA 4D80A 5TXGA 1SVIA 4C2TA 4DUGD 3OIUA 3OEEA 1T3LA 4XD7A 4B32A 1R7RA 4OJKA 1GWNA 2GXQA 2V54A 4G5QA 1XEWX 2XX3A 2DFNA 5EZ6B 2FMXA 1FFHA 2R6GA 2ZR7A 2ZU0C 3CR7A 4Q5IA 1Q1QA 4GPTA 3QBTA 2LKCA 4BRWA 3WRXC 1EESA 2FDCA 4TL6A 2GHIA 1G3UA 4TQAA 3RS7A 3FWYA 3EWSA 4US1R 1RZ3A 3CRW1 1L2TA 4TN1A 4PC1A 4I1SA 1AZSC 4JLNA 4KHZA 2NG1A 2SHKA 4ZV4A 3N70A 1VKJA 4HUQA 4IOMA 3NH6A 4OI2A 3THYB 3QG1A 3CF6R 4C7OA 4DHEA 4UNNA 4MRRA 2CE2X 1NI3A 4U5XA 3K9GA 4UQOA 2VP5A 3IQXA 3C14C 5AK0A 5JWOA 2A9KA 2VSOA 1Z07A 3BIFA 3GLHB 3OEHD 1G5TA 2J9RA 4W9MC 3IILA 2JAQA 2VF8A 1FNNA 2ORIA 3OFND 2D3WA 2O8EA 2I3BA 1D5CA 2CK3A 2OHFA 1JR6A 3GP8A 4OQLA 1KMHB 4GNKA 221PA 2Q3HA 121PA 4EQ6A 1OXTA 1L7VC 1IHUA 3NBYC 3GLIB 3REFA 2ZU6A 4DRZA 2DHRA 4OYHA 2X2EA 2QMOA 3KTAB 3KUDA 1A2KC 2ZRKA 3RRYA 4JMPA 4ARZA 2ZTSA 3FPAA 4JSTA 1COWD 5HZKA 4EKDA 4JJZA 4WBSA 2RHDA 2JLYA 1IXRC 3SBEA 3ONWA 3IEUA 1DG1G 3Q8XB 1UEIA 2IXGA 2KI5A 4V0KA 5C1BA 3AGPA 4IVPA 4LBZA 1R0XA 1Z0DA 721PA 1LY1A 4V0OA 2QM8A 1E2QA 3M6AA 1Z2AA 2EYUA 2GJ8A 4KLNA 1UBCA 1BS1A 4B73A 2O8CB 1KI6B 1GTVA 1D9ZA 2XJ4A 3AP3A 4IDOA 3TIFA 1T4GA 2N42A 3L0OA 1NBMA 5EJEA 2YNMA 3U5ZB 4KCGA 4UXJA 1PZNA 2G77B 4L5BA 3QJYA 4TYPA 2VLIA 2IYZA 2R6CA 4BFVA 2OEPA 2R9VA 3OESA 2BEKA 4IOKA 3KQKA 4DLTA 1XWIA 4R2IA 2J0UB 4GOKA 4I4LA 4WXPA 1G5RA 2AWNA 1IN5A 3U60B 3PITA 4ASUA 1ZM9A 5CIQA 5FBLB 1F5NA 5KHOC 2WJJA 4L9WA 4TWZA 1HH4A 1MKYA 4ESHA 4IW3B 2ZXUA 4A6XA 4KLZA 1UDWA 5FOUA 3CM0A 2JLQA 4P4UA 4PHFA 1B23P 2FJUA 4ESVA 1Z0AA 1PUIA 1Q1ZA 1SHKA 5CIWA 4Q00A 1N2CE 3V4RA 2ZRPA 4G3XA 4JVSB 5BN3A 5AWFC 1JB1A 1XDBA 3U4QA 4KYUA 1B0UA 1OIWA 3VU9B 2CLCX 4W5WA 5KNDA 1WBDA 3CRMA 2ZE6A 3MWKA 2CCGA 2XXAB 3IQWA 5EP4A 5LD2C 2OZEA 2FGJA 3DO6A 4MKIA 3ZZ0A 1UJ2A 1Z08A 2BVNA 2ZETA 4ZCIA 1HTWA 2LKDA 5EUMA 2J0SA 4XVRA 4O2RA 4XIGS 5G3YA 1WRBA 5FOTA 4JIMA 3A4NA 4JVLA 3B9PA 3REGA 4S2EA 3HYTA 4QBGB 1FP6A 2QP3A 1NIJA 2QPOA 1Z0IA 2ZI5A 3K8YA 3TR5A 2D4HA 2ERXA 3ADKA 4DVGA 2Z5FA 4Q48A 3VR3A 3FGNA 5FTJA 5DN6D 1DELA 1S1CA 3LAWA 3C8UA 3SJAA 1F2TB 1SVOA 3U3OA 1ZP6A 4A0GA 1I2DA 2H57A 1NG9A 1GKUB 1W0KA 1HE1C 2QG6A 3NC0C 4KSCA 4RSGA 3Q9LA 4P4SA 2FEMA 5J4LA 1E9RA 3GFPA 5K8TA 1W1WA 4KSBA 3L82B 5DLQC 8OHMA 1XMJA 2CHGA 3SJBA 2KBFA 2H7VA 2XTMA 2V7QD 3EW9A 4RZ3A 5L3SA 2ERYA 4KXFB 1LNZA 1N6KA 5J4VA 1E2PA 2DWQA 2JIZA 4QGHA 3H1TA 1AN0A 1SXJD 2J87A 2F1IA 4ITRC 1FMLA 5HCIA 3PUZA 1V43A 2ZROA 1X86B 4EJSA 3G0HA 2QRZA 3HU3A 5D3QA 1OF1A 1YRBA 4MUBA 1S8FA 3CX7A 4KODA 5IDVA 4TL8A 4KVAA 1E2KA 2I4IA 3IIKA 2OCBA 1QHHB 1R6BX 4RD1A 4L9SA 1Q3HA 3MSXA 4LDJA 1XTSA 5TDHA 1JR3D 2OUKA 4PHHA 4W5HA 4QJ3A 2ZUBA 1UKZA 4OI4A 4M9SA 2IXFA 2P6UA 4A8JC 2FE4A 4LRWA 4D0LB 4GDFA 4JLDA 1XJ0A 4HATA 4B3DA 4W5JA 3AGQA 3A1TA 5TARA 1RYFA 2GXUA 3NXSA 4IVRA 4URYR 4UJ3A 2A78A 3V00A 1N5LA 4AG6A 2O8EB 4GI7A 4DDVA 1T8TA 2WMOB 1H8HD 4F93B 2P65A 5CLQA 2BKEA 2C98A 2GBLC 3EPHA 4HAWA 1U9IA 4V03A 3FHTA 2EWWA 2HDNB 3BS4A 2IX3A 2VA8A 5FUYA 5B2ZA 1N5JA 3VX3A 3FOZA 3EARA 3LY5A 4NE2A 1SKYE 4ZI2A 2VP6A 2D2EA 3DVLA 2REOA 4B71A 1SZPA 5TMPA 2Q3MA 1G20E 3I32A 3SEAA 3EXAA 3DZDA 5DGXA 5CDFA 2WVJA 1AIPA 2AX4A 3SYLA 2IXEA 2BCGY 4O0MA 3WMGA 2ZRFA 3LQQA 1KMQA 4D4JA 2BKUA 3NBXX 4A2PA 1EXMA 4PQYA 1P7CA 4LY6A 2BWJA 4F4JA 1U90A 3VR4A 1XTQA 3T1OA 3CPEA 2W0SA 3EC2A 3P1JA 4Q47A 5IF9A 1JJ7A 1N25A 1QZXA 2PMDA 4KBGA 2ZJAA 3A1SA 4ZIRB 2CL7X 1TX4B 2IW3A 4TTQA 2OFWA 3MUFA 5FBWB 3FVQA 4RKFA 4FMDB 5GVRA 2LCFA 2OBNA 3VTKA 1PLLA 3S1AB 2NMVA 2VEDA 1EFUA 2GAAA 2EWVA 3VR2A 2ZSEA 4GZLA 3TVTA 4CEHA 4HYYA 1ZUHA 3LBNA 2HCJB 4TSFD 4GMXA 4DT1A 4AKEA 5G41A 1CKEA 2QA5A 1ZNXA 3K0FA 3R7WA 2EYQA 3FMIA 3LLUA 3SI7A 1W36C 1E96A 1KAGA 1ZCBA 2Z4SA 3K53A 3KKOA 4ON9A 5DI3A 2DWOA 3QENA 1PVOA 1F3OA 1XZPA 4LC1A 1JECA 1NLYA 5KUTA 2BBWA 2AFHE 4I1VA 1GRQA 3AKCA 2QTFA 3WHLA 3RYTC 1MRSA 4MRSA 1EX6A 5LDDC 1KNQA 3DMNA 4W7SA 1LS1A 2C2HA 2JLRA 5JWHA 5IRCD 3KJIA 1XEFA 3QKSB 2AN9A 1OXXK 4NCIA 4FMBB 1KO5A 3UWOA 5M04A 4TZ6A 5EUQB 3CPHA 2C8VA 3QPUA 4Q7LA 2QBYA 5FUXA 2ANCA 1P72A 1P73A 1TEXA 4EPTA 4Q9IA 2CJWB 1NY5A 3GJ8A 4F7WA 3SR0A 1DAHA 3LH5A 5FL7A 2V1UA 1F2UA 2ZRCA 4R2HA 1WB9A 3BGWA 2HEIA 2OAP1 4JL8A 4DJTA 4DLZA 1PJRA 1Z29A 3K0AB 4ZPXA 3GLGB 1A1VA 1E1RA 2RGNA 4BFXA 2WKRA 5AUNB 3HU2A 4NBSA 4AYTA 2D2FA 1FUKA 2QUZA 2G3YA 3AVOA 3RRZA 4D4KA 1V5WA 4LHWA 1R2QA 1A7JA 1E1RD 1MV5A 3I92A 2WMNB 2ORWA 1P9RA 2K5UA 1DTSA 3WP1B 4XWAA 1PV4A 1G5PA 4I1OA 3VR1A 5DE3A 5K8UA 3TKLA 3VQTA 2O0KA 4B2IA 3K9NA 2IYYA 4POAA 3TSWA 2V1XA 1KI3A 2ZR0A 3SFZA 3RS4A 1BYIA 1G4UR 2WOJA 5B64A 1FMJA 1T0JB 2ODNA 1UAAA 4RD6A 1LVGA 5JWRA 3LLMA 2PLRA 4B76A 1RKBA 4FD2A 1OT3A 5EZ5A 3V9PA 1W0JA 2IF0A 4PC3A 5E7JA 4BLPA 1NN5A 2WPDD 3CH5A 5CJ2A 5JFGA 2A3RA 1E4VA 4MGYR 1Z0KA 4LC0A 4F4IA 2GJSA 3H2YA 2BHRA 3M4YA 1FQJA 3VHXA 4F4CA 3D3QA 2OESA 3EIEA 1GZSA 1SXJB 3GJ7A 1N6IA 1P6XA 2ZI4A 3KJHA 3I4LA 3IGFA 5CLLA 5EE9A 3J81k 5ANRB 5FPKA 2G1KA 3QKTA 1G64A 3ZIAD 2WIBA 2IYWA 3NDBB 4C0BA 2JEOA 3MJRA 4PHGA 3V4FA 2A30A 3ZQ6A 4HEJA 4QNRA 2KBEA 4FI3C 4K81B 1KOFA 1AM4D 2O8DB 2P0EA 4MYUA 3KFXA 2GEDA 2ZIAA 3HDTA 5G3ZA 3ZZTA 4CDGA 2OV2A 4LSGA 3RAPR 2J41A 2KSQA 3QXXA 2FNAA 5JJLA 4ZI3A 1OH7A 4XWKA 4OHZA 4R7ZA 4LJYA 3OZXA 2G0TA 3WMEA 1RPZA 2VHJA 2QY9A 3ZVMA 1CR1A 4V0ME 4IDNA 1KK3A 2WKPA 2IWRA 2X2FA 4HDCA 2QI9C 1E1QA 2EFCB 3BAFA 5DIFA 2A5YB 4CRWB 4G1UC 1WF3A 1NP6A 2GILA 4LHVA 3THXA 1E1QD 2GXAA 2EU8A 1JAIA 2BMEA 1U94A 1VCNA 3DL0A 3PEUA 3RC3A 1IM2A 3TMKA 3B60A 1R0YA 3WHKA 2UZ3A 3I72A 1E2MA 3M0EA 4QKQA 1G18A 3GLFE 2OSBA 1P9WA 1I4DD 2ZEJA 3EX7C 5GADl 1JXMA 4G5SA 1EFRA 4I99A 1UKEA 1JI0A 1XJCA 1W48A 4YDHB 3U3KA 2JJ2D 1GL6A 2ONKA 2XNSA 4X8HA 5CYOA 4YXWD 2IS2A 1EWQA 3EZ6A 3D8BA 1I4LD 3DHWC 4CW7A 4Z8YA 5KO2A 2FWRA 4HB4A 2IHBA 3QKUA 4Q01A 4EAQA 1NMZA 2CHQA 4HI0E 5CK4A 4D4MA 2I1VB 5BYKA 3RABA 5JI3E 3AVXA 4N0DA 4BGDA 3X2SA 4GBMA 2Q9CA 1OFUX 5C18A 4BFZA 1Q3TA 3H4MA 1G8YA 3IHWA 3RLFA 2W00A 3AVPA 3MG9A 2GWHA 3QF4A 1RW4A 5JJKA 1RFLA 1UF9A 5FR1A 4PZLA 2FZLA 4XSHA 2GK6A 4HAVA 3A36A 3Q5EA 4M9XA 1KSGA 3PEYA 1G6HA 3H0KA 1M7GA 4QGGA 3KQUA 3PIRA 4Q19A 3R9WA 1C9KA 1U81A 3QNUA 2C99A 1NY6A 2QNRA 3QVVA 4G5OA 4NH0A 3U3MA 4N0EA 1F60A 3I62A 3MRSA 4NCNA 2F7SA 2WV9A 3TNFA 3RWMB 2ZRDA 4DT1B 2P3SA 4TYQA 1PLJA 1S9HA 4Z1MA 2ZJOA 2PMKA 3KKPA 3C7KA 2C95A 4JLJA 3DOEA 1CBUA 1CRQA 3IIJA 3KXLA 4PQRA 1VCMA 1NMYA 1W36D 2ZE5A 3HR7A 2JASA 3NWJA 3WNDA 3ZLJA 3GEHA 2NO0A 1TNDA 4GOJA 4IDHA 3CX8A 4TYYA 1WCV1 5AUOB 2ORVA 2QTVB 2WZQA 4MRPA 1E2IA 1D6JA 5HTKA 4FWTA 1YU9A 4B3BA 1N0WA 5KSOA 2YOHA 3GJ4A 3TSZA 3ZVLA 1GFIA 2G88A 1Q44A 2IYXA 3N2IA 3FDIA 3Q85A 3IPYA 4WA7A 4U7DA 3B1ZA 5CJPA 4FXPA 2GJ9A 3IDQA 4DB4A 2DB3A 1F2UB 2IEYA 1QF9A 4DCSA 5JJIA 3AP2A 3LW8A 4D82A 4B74A 2RGAA 2RGCA 2EFDB 1SVWA 4BLQA 2H1LA 2IHYA 1XMVA 2P5SA 4OQFA 2Z6VA 1Z6XA 2HYIC 1FNMA 1E79D 3BD9A 3KXIA 2AK3A 4BEBA 2J1LA 1G7CA 1Q1BA 1D2NA 1KZGB 2W83A 1VYVA 4PAQA 2IUUA 4Z54A 1KK2A 5FH9A 4HUTA 1M1YE 1P2VA 1L4YA 1VIYA 5JCZA 1XTJA 1GG2A 1XJQA 3NHAA 2GEUA 4HB0A 4XTRA 4AYXA 1XMSA 2YYZA 2GETA 3BFKA 1C4OA 4IRUB 4YDSA 1KDOA 3I61A 2DPXA 1SVLA 3BH0A 3WYFA 1BKDR 2FOLA 5C4GB 3BBPA 3AVTA 2YINC 1SVMA 4TLDA 4OHVA 4E07A 5FPSA 1E2JA 1ZBDA 2BMFA 4V0MA 3PV0A 3VAAA 2PEZA 3EIHA 3L0PA 1CRPA 1JEDA 1G17A 4JVNA 3T1QA 4CGZA 4MRVA 1JQLB 4B43A 4FMCB 4Q7JB 1CF4A 2VP9A 3VHLB 4RFSA 1MO4A 3AF2A 2NGRA 1LF0A 5JS7A 3K70D 1XPRA 2O8FB 3QF7A 4XJXA 3P32A 3LXXA 3A37A 1KSFX 2PZEA 2YOGA 4FMDF 1VHLA 2JA1A 4O3MA 4B33A 1Z47A 1ESNA 1R0ZA 1SKYB 2D7CA 3GLFA 3TUZC 4BECA 2GCNA 2XSZD 3D31A 4MYHA 4QM7A 3U7GA 3Q3JB 5BWMA 1QVRA 1W49A 3KJGA 1HURA 2RAPA 3SU8A 4D4LA 1YZUA 2ZSFA 1DOAA 3EAQA 1OE0A 3SNHA 4QM6A 1YKSA 4WOPA 3DM9B 4CF7A 4DZZA 4A8JB 3EZ2A 4NKRA 4EPYA 5A4JA 4M1KA 1G6OA 2QE7A 3RS0A 2E1RA 2ZI7A 4CZ2A 2OO7A 1N0VC 2ZS8A 1SXJC 4DCVA 2FX3A 4E03A 4F91B 4HDOB 3MAAC 5KU1A 3A4MA 3OEED 3TW8B 1A2BA 4XD7D 2JATA 1TUIA 4JYCA 3UG7A 5EXTA 1NN0A 2Q6TA 1UBFA 3SE0A 4M2LA 3T15A 4FCTA 4LJ5A 2KB0A 4LI0A 1QVAA 1E0SA 2EQBA 4ACAA 2Q21A 2QAGA 4G5GA 1YRAA 1L8QA 5FOVA 2NPIA 4IDPA 1X8JA 2OXCA 1UBGA 1NJGA 5EE3A 5IK2A 3A4LA 3TGPA 2GF9A 1ZUIA 1DPFA 1LV7A 1IAQA 1N6OA 2XGJA 2RMKA 2W6IA 1E9FA 3I8SA 2WJIA 2A5JA 2QMUA 3T1VA 2IL1A 2OCAA 3QF4B 1UDXA 3FB4A 2IYTA 2ZS7A 3BH6A 4RZ2A 3O47A 1P2TA 3AH8A 2WHXA 2H8KA 4Q03A 5B57C 1T5LA 4BZQA 3OAAA 5G40A 2IWHA 4C0AC 3P27A 2CK3D 4DLXA 2XTNA 4ILEA 4DXAA 1IXSB 4NYIR 1DS6A 1AS2A 1FPMA 2LWIA 4HZUA 3RDPA 3LX8A 1G8FA 4BLTA 2JJ1A 3BRWD 3SJCA 1CS4C 1T6NA 1W36B 3CNOA 2JLZA 1W47A 5EP3A 4PO1A 3KL4A 1IY0A 1H8EA 3D7MA 4PZZA 4QXAA 5HR5A 4LOAA 1LB1B 3X1ZA 1F6BA 4DCUA 1Z3IX 2HCBA 2I1QA 2DBYA 4MYTA 1G8PA 3M1IA 1P9NA 4RJLA 5DHFA 1SVKA 1CJMA 4M1MA 4Q4AA 4WIAA 3CZQA 5KSPA 2PT7A 5LB2A 2QGNA 3UMFA 3SHWA 4BLSA 1WBBA 3I73A 4HLQB 1KO1A 4TLBA 1IY2A 1IN8A 1FZQA 1GKIA 4H1VA 2WAXA 2GNOA 2BM1A 4JL6A 4AWXA 5C2JB 4JL5A 2FA9A 3RVBA 4LBYA 1KSJA 5DHAA 5H8WA 5JECA 5CDFE 4P31A 1CR0A 3ND9A 4I81A 2WWXA 1G3QA 1DVRA 1NBMD 1J8YF 2ZRAA 2YV5A 1G3IA 1GNQA 3NEJA 4CT4B 4FWIB 3THWA 3U7EB 1S96A 3RS3A 1EFCA 4Z8XA 2VSFA 4WXRA 2CCKA 1OXUA 3SS8A 4TT3A 1FUUA 4NYIQ 4ASUD 1P2UA 1K5GA 3TQCA 2AKAB 2QORA 3RHFA 4TYWA 5JCPA 3GFOA 5KDOA 4A36A 5JSZA 3LW7A 1MO3A 1XTKA 4KAXA 3NBZC 1R5BA 2XZLA 2F43B 4DDTA 1O3YA 2XEXA 4QG7A 1OFIA 4D0GA 2PZGA 3L0IB 3U44A 1E0KA 2IA5A 2J7PA 2CE7A 2W2TA 2N1BA 1RE0A 4H1UA 4MKFA 3RSOA 1KI1A 1G19A 2OLJA 1XXHE 2ZRMA 2J7PD 4EPVA 1TF5A 3K70B 4DEYA 2OBMA 2RGNC 2JDIA 1NRJB 3WBJA 4OBEA 1E0JA 3AVYA 1II8B 4NTZA 2HV8A 2CL0X 1E98A 1UFQA 2BV3A 2R62A 3TJZA 4BFYA 2EW1A 3AB3A 1CLUA 4Q4HA 5DYGA 2W6JA 2ZJ8A 1LFDB 1XEXA 1US8A 1XTIA 1RJ9A 2ONJA 4WZBE 4LX0A 4WZ6A 1XD8A 2XB4A 5KSZA 2IUTA 1N6LA 2QSZA 2WJVA 3KQNA 3ZH9B 2IK8A 1YQTA 4GL2A 2CBZA 3TW4A 2WICA 3ZD6A 2F3TA 2GJKA 3DKVA 4Q21A 3WMFA 5EXPA 5EXSA 4IXMA 4A0HA 2V6JA 4Y0VA 1XMIA 4Q9JA 5UKDA 1BMFA 3QI2A 3RSLA 1W0KD 2JLXA 1M8PA 1UPTA 4UNQA 4KITB 2QN6A 2VF7A 3HP1A 3IBGA 2ATXA 3BH7A 4V0LA 1QHGA 1ZNYA 2PH1A 3UK6A 3GJXC 4YQFA 1R4AA 3LXRA 5HKKA 3FHCB 2UZIR 5FI1B 4PPFA 1U8YA 2Q0HA 4YMUA 2ODEA 3G5UA 4S35A 2OBLA 2ZSAA 2JIZD 4TMTA 3CRQA 3W6PA 3EZ7A 5SZHB 4DIEA 4M1SA 3CF2A 3Q7PA 4LHXA 2RKOA 4HUQB 1NVWQ 4G01B 5JEEA 3PEWA 4HLDA 3SFVA 4C7OB 2GKSA 5GJCA 3PUXA 1VCOA 4MGIR 1E2GA 1VDZA 2WSSA 3NKVA 2X8AA 2V3CC 5SZKB 3LBIA 4A2QA 3ICEA 4C3ZA 1G3RA 2ODBA 4Q66C 1L4UA 4D6PA 2GZAA 4C0KA 4TL9A 5LB4A 5L8VA 4M1YA 4UNRA 3LVRE 1U2RA 2VH5R 2PLFA 1GSIA 4A0RA 2ZS9A 4JSYA 4ABYA 3OHMA 1GVNB 4M1WA 4EQ6B 1AA9A 4BUJA 2G1JA 1Q12A 2OCYC 4UNSA 3CIOA 5BQ5A 3CX6A 4ARZB 4OK6A 4P4TA 4URWR 4X8LA 1KI9A 1U0LA 1XEWY 2ZE7A 1LS6A 4G5RA 4LYJA 4JKYA 3U7FB 2XZOA 4CVNA 4YLGA 3L2OB 3AF0A 3B1WA 1DAEA 2ANBA 3EPLA 1W4BA 3I5XA 1JQJC 5GVSA 2DWPA 4NYMR 1J8MF 2QQEA 4FMCF 4DCNA 4EPRA 4MDEA 2N46A 3CO5A 1UEJA 1S4QA 4JLBA 4PSAA 3PVSA 1AQUA 1EG7A 4GMDA 4OI0A 1JALA 2W2VA 3MWJA 3U3RA 2ZYUX 4Q4AB 5A0FA 4BEJA 1TTTA 1OH5A 3SQWA 4ZDIA 5FUVA 3NHBA 2GTPA 2QM7A 4C9BA 5FPTA 2XITA 2C03A 1BIFA 1ELOA 3T1TA 2MSCB 2IS6A 4NPHA 3TQFA 4Q9LA 1KO7A 1KIMA 3U7HB 2OILA 5J40A 2KWIA 1TQDA 3KUCA 2HLDA 1XXHA 2WSMA 2GRJA 4Y0AA 4NCHA 4B3FX 3VKGA 2WTUA 4RD2A 1VPLA 2HYDA 5FR2A 4URUR 2JJ8A 2BM0A 2O52A 3T35A 2PX0A 3MD0A 2Q9AA 3PUWA 2F1JA 2ZE8A 3GD7A 4EPWA 1OH8A 3EC1A 4OHWA 1VIAA 2HJVA 4DWJA 2QU8A 1E94E 2IYQA 1M2OB 3ETLA 5TV2A 3TE6A 1YZLA 1FTSA 4A92A 3PEVA 4PZYA 4GFDA 3VX4A 2J5XA 1FQKA 3G82C 3K09C 4EPXA 1ANKA 1UKVY 3IEVA 2O8BA 5AUQA 2A5FA 1IY1A 1E6CA 2ZPTX 3U4QB 2Z43A 1DE0A 5L3QA 3GLHE 5FOWA 2IUSA 4NYMQ 5EP1A 5FTKA 5FBVB 1LF5A 4IEIA 1ZM2A 1E2FA 3A1UA 4KFSA 1AS0A 3WP0A 3AKYA 2C78A 1IQPA 4OHYA 2AHOA 1IBRA 2ATVA 2ZRBA 3CH4B 3QUSA 3SZRA 2X19A 5AJYA 3F8TA 2IYLD 1Z0FA 5FL7D 4LZZA 5E4FA 2PJZA 3E1SA 3UIEA 3GLIE 1XB2A 4FINA 5JEDA 1BO6A 1E9SA 3B13B 4GZMA 4FN5A 3IO3A 3W3ZB 2R6DA 4Q4HB 4Q1AA 4JS0A 1MRNA 3B1VA 4B44A 4IFEA 4AG5A 3CNNA 3EA5A 2ZI3A 2FEOA 1OLOA 5AJXA 2CLSA 4LWZA 2CL6X 2FSGA 2O5VA 4A9AA 4P4SB 4XVQA 2CCJA 2V4ZA 5KSYA 2VL7A 5TY0A 3ASZA 3C15C 3GPLA 5F98A 1ZD1A 1N6RA 2H17A 4RCYA 1J99A 1RRGA 2GCOA 3FFBA 4ZDKA 1KJZA 3K0SA 2ZAOA 3CWQA 4CYMA 1OSNA 4LV8B 5HPYB 5FTNA 1W0JD 4M9QA 3K70C 5JZVA 1Q57A 3UMRA 4OQXA 3T12A 5L3SB 3P4XA 2QGZA 3W34A 2OCPA 2Y8EA 1IJFA 1G8GA 1F48A 3TSOA 2NPFA 2WIAA 2ZREA 2ZVQX 1S3GA 1OYYA 3AUYA 3UPUA 1CJTC 4EJSB 2WWYA 4LUCA 1TL7C 1I2MA 1S3SA 2JLUA 5KTYA 4LJ6A 3TUJC 4B34A 1JBKA 2V55B 3QE0A 2HF9A 4PANA 3T5DA 2JGNA 5JHGB 3UG6A 2QMHA 3PXGA 1MOZA 2ZSBA 2WWFA 1IN6A 3KZ1E 4LBWA 4AC9A 4RKEA 4B3CA 4RFVA 1O87A 3B1YA 1YVDA 4Q02A 4A2WA 3PUYA 3GCGA 4IJMA 1ZAKA 1HA3A 2JLWA 1W46A 1AGPA 4MH0R 2BJVA 2BEJA 4ZCMA 1AKYA 2XJ9A 4JVMA 4D81A 4RD3A 1OIXA 1OKKA 2AWOA 3SN6A 3TAHA 2WWGA 4I1UA 4HAXA 1HE8B 2BMJA 4FCVA 1ZCAA 1Z22A 3CPJB 4OQNA 4JZKA 1D2MA 1VHTA 3GQBA 4URZR 2XOKA 3FKSA 2PCLA 2RHMA 1OIVA 4Q9HA 3WY9A 3K0CA 4GP7A 2G83A 5CITA 2QAGC 1KK1A 2W2XA 2CNWA 1SVSA 4LJ4A 3WYGA 3B6EA 2QPAA 2EFGA 4P32A 1YR6A 2H5EA 2DR3A 2NQ2C 2JLVA 1EFRD 2NIPA 3O8DA 3QXHA 5E7IA 5CM9C 4DC9A 4GRAA 3NIBA 3AVQA 2WWHA 3ZVRA 1X3SA 5AJVB 4BZXA 5KPDA 3PFIA 1NVXQ 1ZM7A 2F1RA 4Z51A 4TMZA 5KNCA 3ZYCA 1QBKC 2CVFA 2ZUDA 1MT0A 4MYCA 1DG3A 1P60A 3EPJA 2YKGA 4PAMA 4AI6A 4MRNA 3U2QA 3DMDA 3IO5A 1Z2CA 3BB4A 1KHTA 3THYA 1KSHA 4TQ9A 3B5JA 3CF0A 1Z6GA 2WBLC 2YVUA 3CNLA 4RCZA 1KI8A 2VIIA 4LV6A 3T34A 2C77A 2Z83A 5H68A 3W5JA 1CR2A 2ZUCA 3CBQA 3GLHA 3OE7A 5GJVC 4M22A 1LW7A 4X8MA 4CEHB 4OQMA 1GDDA 1KO8A 3PUVA 1IJEA 2FFHA 3K0FB 3R7WB 4KI0A 1KAOA 4NHOA 1Z0JA 2H16A 1KYIA 3PR1A 5DI3B 1IN4A 3B78A 3BXZA 3W90A 1KMHA 1OFTA 4RZUA 3W5IA 1Z6AA 5JHHB 4Z1MD 4U02A 1NKSA 4NMMA 5EQTA 2Z0MA 4YMWA 2BIFA 1XZQA 3GLIA 2DFTA 4RD0A 1Q0UA 3ECCA 3AF3A 4MA4A 1II0A 1ZD8A 2VHUA 4B3XA 1RRFA 1VG0B 3I1FA 3RRNA 3THOA 1XF9A 2RGXA 3CR8A 5SZJA 4DLWA 3F0TA 1S9DA 3JVVA 2ZRIA 2AFIE 4WAUA 4E22A 4AY2A 4IFBA 2O8BB 1WP9A 2DYKA 4O2LA 2QRNA 1N6PA 1W5TA 5J47A 3KX2A 2QBYB 1CJUC 4Q4JA 621PA 1XRJA 2PBRA 4DLUA 5JRZA 2BBSA 1EGAA 1U0HC 1ZNWA 2VSXA 5J4KA 1E32A 1G3MA 2IC5A 2XNDA 3ZDQA 3SQXA 1JEEA 4MQBA 4LYHA 1G8HA 2OFXA 3QXJA 1N6HA 2AD1A 1G9XA 2OLKA 4JLKA 2D06A 3NBFA 3P20A 3FMPB 2AXPA 4NDZA 2QZ4A 4B6FA 2O8CA 1XP8A 4HAUA 1R0WA 2VRWA 4BFSA 1NIPA 2ODWA 3L43A 4MUAA 4DDUA 5G53C 4M53A 3RANA 5A5GA 3QIAA 2YC2C 1E3MA 4BFUA 3IUYA 1YZKA 1E2EA 4HDQB 4DSTA 2BCJQ 4PR0A 5J5CA 1GNPA 1TADA 2J0UA 3W3AA 1YR7A 2WAYA 3TBKA 4C4PA 5HZHA 3VNUA 4A0FA 2IEZA 3CRVA 4QBIA 1OYWA 3TLXA 3BFXA 1K6MA 1M74A 5TVKA 4NZYA 4DLRA 2AK2A 5LBIA 4ZO4A 1GRNA 2HJGA 1T3SA 4JBYA 1N6NA 5L3RA 4YC7A 2J59A 4QJ4A 3BK7A 3GJ3A 1N5IA 1KI7A 3X1DA 1ODFA 4LJ9A 4PX9A 2H18A 1MO6A 1TPZA 4HB3A 5H1YA 1D9XA 1NSFA 1BH2A 1ZD9A 4NP6A 2FPKA 4URXR 3KQHA 3ICQB 4DLSA 2GZHA 5IHPA 2YWHA 2V8OA 3QEJA 1OHHA 2D62A 2GF0A 2IYSA 4Q7MB 1GITA 1E9CA 2ZVPX 3SYNA 2FZ4A 3MWYW 1P2SA 2ZYVX 3RWOA 2NO7A 3H86A 1KKMA 3NVAA 3PQCA 3LA6A 1YZNA 3ADCA 1GM5A 1E2HA 3QXCA 3DPUA 3SBDA 4B2PA 1CJVC 4FW9A 3O8RA 2FSFA 4U00A 1FL9A 1WA5A 3AF1A 4KFTA 2WWWA 3ZD7A 4XVUA 2QSYA 1JNYA 1RRPA 2QE7D 2QP4A 4B35A 1F2TA 1UKYA 3THXB 2P5TB 3I3SR 2B8TA 4A6PA 3QG5A 3N5CA 1DAKA 2RGDA 5KDDA 1R5OA 3UATA
chains in the Genus database with same CATH superfamily
3D54D 4AU1A 3NR2A 1YULA 2OECA 3MGAA 4LPKA 4XARA 1CY7A 2QVBA 2HT6A 4EJSC 4PSKA 1B4DA 4GECA 1OJ7A 4YJ2F 4YO7A 4DUGA 5ICCA 4W1PA 1E99A 1KS2A 1KO4A 2XAUA 3J7TA 3CWZA 4JT4A 2G1PA 2G9NA 3WWZA 1HT3A 3N74A 3P97A 3PC2A 4JEMA 2AKEA 2GK4A 2VJNA 4UHJA 5A9RA 1CZRA 3ZVNA 2FRDC 1F20A 3D4LA 2OORA 4UE3S 3SC2A 3MEQA 3U61B 4JT2A 2JCSA 1RYZA 3BGDA 2VP0A 2J7KA 2TMKA 3W9YA 2VPPA 3ETJA 2Y0CA 4RA6B 3EOZA 2J33A 3UB2A 1HYEA 4G86A 4HHEA 3KSDO 4WNAB 5E3IA 2L0XA 3B3JA 2CUZA 3WIEA 3OFKA 1XNJA 3ADDA 3KT3A 2CBGA 3EG9B 3K0KA 1IONA 3BB3A 4QGSA 2Q7XA 3SVTA 5DM70 1KVQA 3DE3X 2HF8A 2ZJYA 3HB5X 3PIIA 1X13A 2NXEA 4Q1FA 4R3WA 3BCUA 3K7EA 1HE2A 3QOFA 4QOSA 1ZN8A 2E87A 2GNPA 4BZZA 4C0JA 4ZQFA 3EE6A 2WD8A 2YVLA 5DSZA 3KB8A 2JLAA 2B69A 2B7CA 3DAFA 3IXMA 1DRWA 1Z5ZA 1W76A 1NYQA 1UM8A 1RCTE 1BXKA 1Y3AA 2Z5VA 1AS3A 3EQ9A 4KNYA 3BK2A 1JG7A 4XVHA 1CUJA 3OAAD 4DTCA 2O0HA 1TC1A 3WK7A 4F1KA 5B2FA 4EUEA 1K7FB 1PJ8A 4YI3A 4KOAA 2WA2A 1KFKB 1W9HA 1XTUA 5JRJA 5C0OE 1D7AA 2BJWA 5BSKA 4GIBA 3ILXA 3HB0A 4M0FA 5ALHA 4RPHA 3C16C 3VSEA 1FP2A 1VG1A 2BFMA 3LCRA 4Y2GA 1FBNA 3WIDA 4KVFA 3VSCA 1S3IA 1SHZA 2HCTA 4J03A 1MPXA 1QTRA 2PRIA 3NG1A 3RFVA 5HCNA 5J5VA 1S2MA 2RC6A 4DLXA 2GDJA 1NVDA 1U3TA 2BTOA 1U99A 2G5PA 2Y1OA 3BZWA 1SCUA 3HNPA 4LXXA 5CTAA 1OZGA 1OBHA 1IOZA 3E9EA 3C45A 3KVRA 3ESYA 4R16A 1GN8A 1USIA 4MIKA 3PICA 1P4RA 4KGVA 3P19A 4PCLA 4UKDA 2CSXA 2ZSUA 4PQGA 3TVDA 4XYLA 4E4TA 4TKMA 4WW0A 2BKXA 1ZMRA 3AI3A 4B4OA 1P33A 2R97A 3KJEA 2CLIB 3AM5A 2PANA 1FW6A 3EF3A 1TUEA 4KAAA 3EY4A 1U98A 3CLTD 3LVQE 4NEHB 1NZDA 4R8RA 1V4VA 3MMPA 1O6CA 1Z63A 2VF5X 3OOSA 4Q3OA 3UC9A 1L0BA 1VI2A 5AKJA 4ZJYA 3E5NA 1FOEB 1CZOA 4PLGA 4YUXA 1DXOA 4OMFG 3PWSA 1GYRA 2P2YA 3DHEA 1T5HX 1Y37A 3ZHCA 1NURA 3UXMA 4HAOA 3EVDA 3GVIA 3Q0TA 4KK3A 4BV8A 3WQQA 3A2NA 2HEGA 1EVJA 3IODA 3QHQA 2G28A 3HVHA 3A9WA 1T3TA 2QVXX 5DNUA 5T3YA 5BR4A 3NWOA 3T5BA 1SELA 4HB2A 4W7HA 4C21A 1XC7A 3O21A 4HQ0A 2CMFA 3FYDA 1NLZA 1JE1A 1G7RA 3AIIA 1XZIA 3JZMA 2QYSA 4TMYA 4WD3A 5AUPB 3I2GA 3Q98A 1O95A 1FYWA 4JITA 3R5FA 4UAUA 4BLRA 3M5WA 3RIYA 1UZNA 1TMKA 3VZCA 2WTNA 4B45A 4HLUA 1TAUA 4OY3A 1GCIA 2OCKA 3C3XA 3JAWA 1JHXA 3FTNA 2OSVA 5A04A 1G7SA 2F3RA 2PE5A 4LK3A 3IESA 3G5LA 2FP4A 5G2OA 3O8CA 3QKSA 5A7GA 1GZ7A 1CJSA 3ZDDA 2MOKA 3MJSA 4JNKA 1C1XB 4MHSA 2JDID 1VMAA 2B34A 3B48A 3KPJA 2WP8J 3W2TA 1RLIA 4DG5A 3EZ9A 3B6IA 3M4XA 1EQUA 4ZQCB 5IANA 2O3SA 5KOJA 4LJ8A 2J3IA 2CJWA 5AM0A 1POWA 1Y3DE 2VHQA 4UHDA 1EK6A 2J09A 3ABQB 3LKDA 1Z0ZA 3FSRA 4QTTB 3MQFA 3WXMA 4YCLA 4DR5B 1L5WA 4TMWA 2IU0A 4XLLA 3SIWA 3K0AA 5AVTA 1ISGA 3BMCB 1G4AE 2WKQA 3VR6A 4YRMA 1YHNA 5FWDA 4CMIA 1X7GA 1VECA 4QECA 4FLMA 4OIFA 3NJ4A 4XCXA 1XCMA 2C9YA 1J2YA 4XI9A 4AD8A 4A82A 1UMDB 1J56A 1G66A 4FIDA 5H5JA 3HI4A 4HQFA 4DA6A 5KC9A 1AHPA 1BMFD 2D2VA 4BIIA 3LYAA 3VPCA 3ELYA 1RRCA 5C5CA 4DARA 3TCXB 4AUEA 4IHJB 3DMYA 4XRRA 2NSYA 1E9EA 2GPAA 2YJ4A 4OGKA 5IBCA 2E6UX 5GZ3A 1NAIA 1RKUA 4QWMA 1RPNA 1NOIA 4AS1A 1NJSA 3RH0A 2EGHA 3WC4A 3TYXA 8ATCA 4WJKB 2HTEA 1HYQA 5DO9A 1PL0A 4L3WA 3RV4A 1CT9A 3P2MA 2YHIA 3WAKA 2GN9A 1ODKA 1QDLB 1V9SA 3A28A 3RC2A 4R71A 5HRCA 2YMMA 4LJAA 2HU5A 4R9UC 4HZIA 4GX0A 1NNLA 2H5LA 1B6RA 2VNIA 4KPUB 2F3QA 4NY1A 4FYIA 3DMFA 5HZMA 1QTIA 4INAA 4IQ0A 4LYEA 4XCQA 1SXJA 4FU0A 3SK0A 4UTZA 3BK1A 3IUMA 2V59A 2FSSA 3DLTA 4ITUA 4C2UA 2GEFA 3L04A 2AR7A 2B1GA 4CEJA 2P9GA 5FPQA 1C9EA 1JG2A 4Z86A 3DOHA 1Q19A 2FYTA 5FADA 3V48A 3LFHA 4O4IF 4YDRA 5LQSA 2V45A 2WJYA 2H0QA 2XT0A 4PAOA 4KR9A 3WZ2A 4F97A 1GADO 3REQB 1XR3A 2NZJA 3G23A 3QJGA 3SDZA 2K7FA 3OE4A 3HPQA 2VQSA 3U9SA 2NV0A 3RS2A 3IBYA 2A0XA 3VU3A 3FSJX 4EI7A 1V8FA 2FWBA 1V4BA 3NQ41 1EMDA 3IE1A 4R84A 2ZRJA 1TFUA 1K6XA 2FXVA 4IZOA 2K7ZA 4LBVA 5LMCA 3D0QA 2HPHA 1KY3A 4M7PA 2JFYA 5L4NA 3NBQA 4G41A 2MSEB 4WFIA 4JI3B 3UGTA 5DKFA 3V8NA 4PBRA 1WPQA 5EWJA 4PTLA 4RTKA 1J20A 2P0AA 1LTQA 3A6LA 3L4BC 5D5QA 4C0HA 5BYJA 2FSIA 4FVTA 3Q87B 1AB6A 5IXJA 2R5NA 1LQTA 1MGPA 5EP2A 3WMXA 2VO1A 3NDRA 1LWOA 4NBUA 4HJXA 4MUMA 4QPCA 3OE5A 1KFEB 3OJFA 4XZ3A 5IT5A 4AIIA 5J1SB 2VPZA 5JQGF 5LJLA 2J0QA 3PE3A 5JNSA 2XYVA 1ULUA 2OZLA 2PH7A 3S81A 3GYBA 1L7XA 3K0BA 1W2WB 3ZHTA 3DC2A 2GLXA 5JJCA 1SQSA 1XCPA 2EJUA 1DBPA 2QYOA 3N86A 4XXHA 1WG8A 2IT1A 2LP4Y 1V3TA 3R3UA 5BR8B 1Z56C 2HJ9A 2XWQA 1SULA 1JTEA 4G5XA 1E4YA 4I14A 1EWTA 4K9SA 2H1VA 2NZ8A 2F9LA 2VT6A 3BQMB 4HCJA 1RI3A 4PPQA 3KYDB 4ROTA 4UM9D 5TQ2A 1DC8A 3PEEA 3UTCA 3FPSA 2VH2A 3QKRA 3AU9A 2GPJA 3LHKA 4RLHA 2A7QA 3KVNA 4OFBA 5ERGB 5EQDA 3QLEA 4QOFA 2OYCA 3W6NA 3FHLA 4CT5A 3D2BA 5CUQA 2VJPA 1NYLA 3D1LA 4NS1A 2DHDA 4RZIA 3IX7A 3CNHA 4XJTA 3WYNA 2WMYA 3D5QA 1ZIPA 4ZICA 5DM0A 2KE5A 2WE7A 4EH1A 4HSEA 3U81A 4KAFA 2MMGA 5EMLA 5L7YA 1T9ZA 3AONB 4J16A 2Y71A 2I7TA 1FEZA 3R20A 3V4VB 4EGSA 5WRFA 3NYRA 5HRAA 3CE9A 1DO0A 5EIEA 4OXXA 1H6BA 3WB1A 1QPZA 1TQ6A 2FH5B 5F1KA 1HM5A 1Y7HA 1XVIA 4H4CA 4DABA 5A0VA 4S1NA 4YNBA 5FTWA 2B9VA 5AKIA 1GNTA 4NBKA 2DCUA 3S68A 1QX3A 2ZRGA 1FA9A 4AUKA 4B48A 2K6GA 3DZJA 2W70A 4REQB 4FCWA 1ODTC 5JAMA 3W5CA 4HAYA 4BQIA 1CX9B 2O2SA 3V80A 1P5FA 2AZDA 2VPXA 3RLIA 4JBHA 1SIBE 2DBQA 2O05A 3IAM6 1Q7RA 2CKDA 1V45E 3WGKA 4PE5B 5A5DA 1YC2A 4CHTA 1ISSA 2JD2A 3CLVA 3GRPA 4ZVOA 4Q1DA 2CNOA 2VK2A 3KBOA 4YRNA 3PNVA 4Z7JA 4Z4CA 1RTKA 4P92A 4X60A 2F4VB 1XZKA 3RVOA 4YMGA 2DT5A 1GAWA 5JZBA 4JASB 2L82A 2VI5A 3TLBA 3HRKA 1ORDA 4GE3A 3U26A 1P7PA 3QYAA 3OQMA 3TNDA 4FYWA 3ZX4A 3TMYA 4DSOA 3IQGX 2GCIA 3NANA 5J4HA 2G6TA 2KYRA 4P7FA 5FI3A 5GV7A 3DW1X 2CC2A 4KUHA 1T0HB 2C5FA 3O4VA 3U7QB 1RMQA 2FP4B 1NZFA 1YRLA 2IPXA 3HADA 3REOA 3A11A 3HFJA 3B82A 4D74A 5KDLA 3T4EA 1NUSA 1LZKA 5GY7A 1BD3A 1XZFA 4N0QA 3RVJA 4XVCA 1X7ZA 3O4IA 3RGWS 4BNTA 1P2FA 4L15A 3DFIA 4OHMA 4DNOA 2WJPA 3PNOA 2DFDA 1VB3A 2YRFA 1SHTX 4Y2SA 1Y1PA 4PN7A 1DV2A 1E2LA 4LMAA 5K8IA 3CKLA 2NP6A 4C88A 1K2VN 4CLXA 3L6OO 3LZCA 3SZGA 1IZ0A 1SK9A 4HYQA 4US2R 1FK8A 2CXRA 2X4LA 4ZJUA 5TLSA 1LZLA 3KELA 3AM3A 4YROA 4XYGA 3V55A 3TMAA 4K28A 3IRVA 1QKJA 1DTEA 3GRKA 4C0LA 4AURA 2VJOA 2XUFA 3KQYA 4N6NA 5MHTA 1YQQA 3AOGA 1KC1A 2EFHB 1P4JA 3LK7A 9LDBA 3FTDA 3QBJA 3NW9A 4BKOA 3GPBA 3DCJA 2UYQA 3CWCA 3NEYA 3PUIA 4WKPA 5E6UB 4Z3OA 3I1YA 1ZSNA 2V0GA 1KAEA 3VTFA 4F6RB 2VDUE 3B7WA 1BWSA 1LI7A 3HS3A 3UPTA 3VKWA 1OLUA 1T4CA 1Y80A 2VHEA 2IDJA 4JLMA 4F12A 1VCHA 8MHTA 3PQFA 5CB4A 3B85A 1G60A 4YO8A 5EVJA 1ZJJA 1QMGA 1MBZA 3HBJA 1UKBA 3IP3A 2P75A 3IBCA 5JARA 2CL5A 4IOJA 2QD1A 3W3AH 3KWFA 2Q4BA 5F2OA 1V7QA 3HPRA 4BN4A 1LJUA 1ZM3A 2ID9A 2YHIB 3I8XA 4YJFA 3I6ZA 3ODPA 1T91A 3VVBA 3HXOA 3ERCA 1R6TA 2C2YA 3PXBA 4FNAA 5AI5A 1TO2E 3F7MA 2WJ4A 4C0XA 5HQ3A 1KNXA 4WDRA 4MPPA 5AVZA 2FN4A 1A5AB 3QJ5A 5E95A 4GOXA 4DYHA 3BIJA 4TUYF 4TVBA 3A70A 4JEUA 3HO6A 1H23A 3FMOB 1U2QA 3JD4A 4BQRA 1XK7A 5FQNA 2B5OA 3WGGA 3DEFA 5D85A 2GZDA 4CMGA 1DAGA 4EDHA 4CEJB 3DDZX 1N7HA 4C43A 4DEXA 2GNAA 3MJHA 1FDRA 3VBEA 1LPPA 2PSSA 2YZ2A 3O0TA 2QZJA 1DUSA 1Y48E 4CF5A 1L5SA 2OD2A 2QTHA 2Z04A 2ZK7A 4QJ5A 4ZTBA 1KTVA 3KJXA 1VZ2A 3OZEA 4M4SA 4C01A 1DLIA 4WXYB 4AYWA 1JN0A 3H9BA 4LY0A 1XDSA 3LT5A 2XBUA 3UO8B 1C3VA 3HJRA 1AV7A 2E0IA 1W4ZA 3EQ2A 2I66A 4IGAA 4RENA 4D0NA 1E9AA 2YQ5A 4QOEA 3A7DA 2I2XB 3VYRB 2C96A 2VAMA 4ARSA 3MLBA 1IJKA 1NMXA 1QSGA 1VKNA 3OG9A 4Y18A 3CZCA 3JZDA 1HNWB 1RM5A 2I7VA 1UBKS 4A8JA 2WYVA 5KX5A 4FCCA 2NZYA 2SECE 5EWJB 3A10A 1I5RA 3KV3O 3TX2A 1QWOA 2WWRA 3I9OA 1ZOOA 4CI0B 2HU8A 1ZC3A 2V3WA 3DE7X 1CULC 1RRMA 3OQHA 421PA 3TW0A 2ZWVA 3IT0A 2IHNA 1TJNA 1Z4OA 3Q8WA 4Q6BA 4PIVA 1KIAA 2QTAA 4O1IA 3W5VA 2WF5A 3WLJA 1Y1LA 4I0WB 2Q8NA 1NMEA 4AJ1A 4F4UA 4P98A 5CH3A 3GJ6A 1F9EA 3H13A 3RU7A 3I64A 1AK2A 2WVHA 3K9BA 3WOVA 4IDAA 5AJZA 4ZI7B 2D5IA 2PXCA 5GJBA 2W8ZA 2X1VA 3X44A 3FMFA 2JJ2A 4RVSA 3OIWA 3JZIA 3M89A 1OX4A 1MZVA 1RWKA 3A8TA 3H1FA 3OIVA 4LRTB 4IYRA 4LZLA 3A1VA 5KNCD 5LQKA 1BYUA 5TQ2B 3WG9A 5B6JA 1N3IA 2Y77A 1S2IA 3OLCX 4DKXA 3QKRB 2BFFA 3HSKA 1H22A 3QKWA 4KQKA 4DLVA 2IY7A 2PEYA 5KTRA 1D4ZA 4JU9A 3HCWA 1KJYA 1PT7A 3JYPA 3MAGA 3C3DA 1EJBA 3U6KA 2FGKA 4NATA 4ARUA 5JSHA 4KXNA 3HKEA 1H1DA 2R8BA 2REXB 2ZZMA 4RF3A 5EE1A 1YACA 2AJCA 1F5SA 2G9RA 2FPIA 3LXMA 5IW8A 1NULA 3VOSA 4B84A 1CFZA 1P0IA 4G0PA 4I2VA 1HY3A 3VDQA 3ZE9A 5I7WA 2ZULA 1GAJA 2HJHA 2QPTA 2QUAA 3ZCRA 3RNLA 3D59A 4LE2A 1W2HA 1NVBA 3N3BC 1YQUA 3FYCA 3QOXA 2XMBA 1IN7A 2AW3A 3K92A 4G8CA 5EHGA 5TEWA 3W8RA 3OZDA 4ZEXA 2ZP1A 2Z3WA 4RD4A 2GEVA 3JVIA 3TFWA 1ZK4A 4BJ1A 1PR0A 1U0JA 1ZSYA 2C8LA 1VIMA 1Z8FA 2DY1A 1YJBA 2Z57A 3OM1A 3OU2A 4KQ6A 3DD5A 4PQFA 1II9A 5AW7A 1O0SA 1U3GA 3P4YA 1CPYA 1HFWA 3H2HA 3ITNA 4FEAA 4LWQA 2Z6QA 5BN4A 3GPIA 3MXOA 3PQ6A 3EZXA 3I8OA 4TYMA 4M21A 3SXJA 3DZ8A 4LPSA 1NM5C 5E7MA 4N03A 4BP8A 2FN7A 2HXYA 3BPSA 4JP3A 1WD7A 3QM1A 4Y1GA 2ECPA 3DDOA 2PL3A 5HG0A 4HNTA 1SEVA 5DCUA 1GG8A 2NTYC 4GXNA 1FU8A 3HCDA 4ZCLA 3R9IA 1EFHA 2OHOA 1NI4A 1TVEA 2GD6A 3FUWA 1UQTA 2EJWA 2GEBA 3BXGA 4ZT5A 5JAUA 4ZT6A 4OJYA 2IS4A 2NTNA 4EVSA 3WYDA 2XNDD 1B0PA 2WPNA 3S2ZA 2H31A 3B3QA 3DGFC 5JY1A 5DX1A 4TZ0A 4K8RB 2OZPA 1T2VA 1BXGA 1ESZA 4D9IA 1IUNA 2HT1A 2V7XA 4L2IA 1R8SA 4TWIA 5F7JA 1GUZA 5EEHA 1JAZA 1JQBA 1NR5A 5A6VA 4NYJQ 1XX6A 4QXOA 5KPJA 1BHQ1 5LD2B 1MQAA 1X1AA 1MX1A 5I7FA 3KB1A 4MKGA 3GDHA 3IKTA 4IJUA 5JS8A 1JEOA 4LF5B 3INRA 2O5CA 4TT8A 3KJNA 4UXIA 3MF4A 4RK0A 4UARA 3ANYB 2CXNA 4U9HS 3ZS8A 3L8YA 3LRPA 4CLEA 4RVDA 1WMSA 5ENDA 3EZGA 3LUFA 4R0MA 2GCOB 4FX5A 2EKBA 4I1RA 2DQSA 2IE0A 4I1IA 4W99A 5FI0B 2FRVA 4IM7A 4BMSA 4BPRA 5BMVB 3Q3CA 1KR2A 4MPJA 1GOTA 2LIVA 3WIOA 4RZXA 1HUQA 1M34E 1U4OA 3VOBA 1QRDA 1PFGA 4D96A 1OLUB 1T4CB 3DL4A 2XWSA 4OHBA 3U3JA 4C7MA 4IOLA 5IABA 3ECAA 2F43A 1TYEB 2LVBA 2PDAA 5ICSA 2O2DA 3MTBA 4LV5B 1BDBA 4UCWA 4UEKA 3ZWQA 1KKLA 2P9BA 3W79A 1QGZA 4QBFA 5D87A 4GYJA 3SC3A 4GPD1 3UH0A 4DDHA 3LUPA 1JFFA 4FFSA 4HH0A 4MSUA 4P3YA 4JXKA 4PCUA 3W2HA 5JANA 3BMQB 3ZK9A 1E3JA 5JR3A 4A6EA 3CNQS 3GQVA 2PUFA 5JS1A 4EW6A 1SBIA 2AX3A 1V1MB 2I54A 4PFKA 3E7WA 3W7VA 4FE7A 4PYRA 1SBCA 2FP3A 3KHKA 4G09A 1CCWA 2B6HA 4FC6A 5A9SA 1EUQA 3WNCA 5D86A 3JZFA 1MJGA 2WM9B 5DCWA 3RS5A 1Z83A 3TPZA 3V4LA 4AAYA 4CKBB 1PLKA 2NSLA 2J46A 3I3OA 3LT0A 4JJKA 1D8TA 4PZAA 5DP1A 3PFCA 3PG5A 521PA 3IV7A 1GGNA 3T54A 1C9NA 1RBMA 3GT3A 1L5FA 1A72A 2J4DA 2ZYTX 3GMSA 1YJQA 3V7NA 3NT2A 1S7GA 1QO0D 3QRWA 2CNLA 1GZ6A 2D7JA 5JCOC 2GI4A 4K9DA 4LF7B 3UFXA 5A05A 5JXIA 4AQDA 2AVNA 3D81A 3TPCA 4WZZA 2I6XA 3MS4A 4ZOBA 2QN9A 1F51E 2GX6A 2UKDA 3Q3IA 1A5TA 1HPLA 3RUIA 1OFHA 4MS4B 4ZXFA 1FF9A 2XKKA 5EJFA 3HZOA 1TYDE 4QDUA 1K7CA 5KX5B 1ZJZA 1KMCA 2GM3A 3F74A 3H2KA 3HCEA 3ML1A 1NOKA 4CIDA 2VPIA 1MQ8B 2CSUA 4X6YA 4HNUA 2VWQA 1V8ZA 4ZI5A 4AMUA 3I2HA 1SVIA 3LDGA 4OB7A 3IVAA 4OEHA 5TXGA 3SPXA 4CCWA 4DUGD 4C2TA 2ZG6A 2DJ5A 3AW9A 3PNLA 5G0TA 1R7RA 3NTLA 1GWNA 4IL5A 4ZVNA 5EZ6B 4G5QA 4A26A 3ZNQA 3HKBA 4NECA 2NXCA 3BMNB 3CR7A 2PUBA 2MR6A 4CE6A 1Q1QA 4B9AA 3QBTA 4NZNA 1U7OA 4NAVA 3IP1A 3RTGA 3CVXA 2ROQA 2LBPA 1R9GA 3AF5A 4IMIB 4QYSA 2GHIA 4TL6A 4ZP1A 4IRXA 3WR5A 4JCCA 4EUSA 3GEMA 4U0JA 3GGDA 2RH4A 4UTRA 1L2TA 1OX4B 4JJAA 4TPKA 4I1SA 4DZTA 5DLYA 1V11A 2RHLA 5ER9A 1XAIA 3R8XA 3A4VA 4H6VA 3TWOA 4HUQA 4OI2A 4ISCA 5GINE 2Z5LA 1EP2B 1JHPA 2BFFB 2RK4A 3CF6R 4GM1A 1DU4A 4O2BB 4TKVA 3LA8A 1NI3A 3CUSA 1J2TA 4D1YA 1XKLA 2L17A 3S8YA 2A9KA 2FSVA 1Z07A 5ECGC 3RT7A 5KQSA 3ZCSA 4W9MC 4MZXA 3I04M 3GJSA 4C7JA 5C3MA 2VF8A 2AUTA 5IH3A 4TV8F 5IZCC 3I45A 4KV7A 3IR7A 2I3BA 2AJDA 1LH0A 2CK3A 4ER7A 2Q2QA 3M1YA 3P0IA 3GP8A 2OGUA 3ICOA 1G21A 1T4MA 1EM8A 1L7VC 3E7XA 2WD7A 1CETA 1LI4A 4L5JA 2NVBA 1KBOA 5IH7A 3V8PA 5L45A 2VZEA 5CT4A 2AS0A 1M3SA 1JIKA 1SCAA 2X2EA 3DXXA 4PZDA 2HRRA 4CL0A 1HNZB 4YCAA 1ULAA 2DHCA 1O9GA 2A0KA 3OVMA 4JMPA 4PEVA 2ZTSA 3NAZA 5IJAA 3DFZA 1X94A 3NALA 5BN4B 3RU2A 1N7JA 1IXRC 2FR8A 2P3QA 1Q1NA 1QWSA 4C7KA 4F72A 2XWJI 3Q8XB 2IXGA 4FYYA 2Y4OA 4D56A 4J3FA 1SFRA 5DHUA 4HGRA 3PR2B 5JPIA 2VJBA 1E2UA 1Q7BA 4DJJA 5JALA 1SUFA 4Y2RA 2JPDA 3INGA 3TN7A 3UXEA 1Z0DA 2NQTA 1G6Q1 721PA 1LY1A 5DYYA 2VDKB 1E2QA 3QSGA 1ILEA 1J0BA 3WTCA 1NSYA 3T5PA 1BS1A 1U11A 1Z6QA 4TMFA 3PGJA 3UMJA 1D9ZA 1U9ZA 2EQAA 3QNWA 4DXHA 4YXFA 1USKA 3AM4A 1F14A 5D3KA 1K3UB 2BDEA 2WKSA 4JQSA 1GD1O 3TSYA 2RGRA 3FTFA 1OI3A 3C5EA 3SYTA 3H0EA 5IAOA 5D51S 4Q3EA 1YS6A 4TYPA 5FAXA 3TOXA 2H0AA 4GG1A 1UXIA 4BFVA 4IOKA 2R9VA 3KQKA 2BEKA 1L9XA 5D5HA 1FQOA 3U7JA 3I42A 3M34A 2H00A 3QNMA 5JFTA 3H19A 2CDBA 1PV1A 1D2RA 3EWIA 1H5QA 1V96A 3CJQA 2QRVA 4O2AA 3VOAA 3WGJA 2QVYX 3WQHA 3G5TA 3KTDA 3OLXA 3R5SA 1F5NA 5FBLB 5TMBA 3DHNA 4MI6A 5K0NA 3DL7A 3QITA 1H05A 2E4XA 1CHNA 1SN7A 4QZVA 4KOEC 2QRQA 4ESHA 1V9CA 1K27A 4C06A 1O95D 2I2CA 4CPDA 4Y1FA 4LFBB 2JLQA 4P4UA 4QSHA 4PHFA 3QPCA 1K8QA 2FJUA 2X42A 2P5YA 3M6LA 3J80A 1GEEA 3BF7A 1SHKA 3UUFA 4EI2A 4Q00A 2X14A 5IDYA 2RIRA 1IY8A 4RL4A 3DNPA 4JVSB 1N77A 1N3LA 3MRXA 1JB1A 1UAGA 2I6TA 4J90A 3JX9A 1J33A 4COOA 4Q3LA 1B0UA 5KNDA 3U4QA 4W5WA 3FYSA 1UT6A 4DG9A 2Z6UA 1QAMA 2RHTA 3DV9A 3LY8A 3MWKA 3O8LA 5U4XA 3RK0A 1Z7GA 3DO6A 4JJ8A 1K0UA 5LOVA 3O1HB 1WD5A 3L0ZA 2WUVA 2WU0A 1BU8A 1Z08A 3NGXA 2PL1A 4LQCA 3WLHA 3D6NB 3V4OA 1P5RA 3H4IA 5I5GA 1UQRA 3DMGA 3GBPA 4XIGS 4XVRA 4V0SA 4FFWA 5FOTA 1HR0B 1TLLA 3GMIA 1ZGZA 1XTBA 3QX3A 3A1EA 3I34X 4ZQBA 2A9PA 1UL1X 1OLXA 1FP6A 2O7NA 4PLPA 3LKBA 3VR6D 1OLSA 5FV4A 1Z0IA 2O7SA 2R47A 2D4HA 3I6YA 2X0RA 4PX3A 2XKAA 1YO6A 3QA3E 1JIUA 4NK5A 3FIUA 3DE0X 1EXVA 1LC3A 1SRQA 1SVOA 1RZVA 1YCFA 3ORQA 3OZAA 4A0GA 4X7BA 4CUJA 1NG9A 1W0KA 1BE8A 4FFLA 1LDNA 4DLAA 3JWEA 3AESB 4EEZA 5L4SA 3RFUA 2G5GX 3VR5H 3ZGLA 4EVRA 4P3XA 4NZZA 3W5AA 3GCWA 1UXGA 4W6ZA 4YY3B 5TQ0A 1XU9A 1U7TA 2KBFA 2N75A 4QTXA 4BQOA 2YMLA 3EDCA 2J5RA 5HDBB 4GOOD 1B6TA 1QIGA 2C83A 3SMVA 3N59A 1JMYA 2JB9A 2XNHA 3TQSA 4CIWA 5L3SA 2O2XA 3P9CA 1N6KA 3DWFA 5I9IA 4M8IA 1JRLA 4QGHA 1AN0A 2OR3A 1SXJD 3LPNA 4UTOA 4ITRC 1T0UA 3SF8B 3GZNA 5HCIA 3VPFA 3OHPA 2I33A 3ZCXA 1EUZA 2ZROA 3K35A 4A3SA 4BCDA 1IG3A 3HU3A 3T7JA 2REQA 3MMNA 4AWAA 2JEYA 5JD4A 1YRBA 3CX7A 4KODA 3E27A 5B4UA 4QQFA 1E2KA 1NT4A 2GPTA 3RFFA 3IIKA 4EB8A 3SXUA 3B52X 1R6BX 2AJLI 3ND6A 1DAOA 5HIJA 1RTTA 4FKZA 1Q3HA 1DINA 3MSXA 2G72A 1L6IA 3R7SA 5AJUA 5K6AA 2A0WA 4W1RA 1PJ3A 5AKZA 5BSWA 2XGGA 4QUKA 5EAIA 2QD4A 1UKZA 3PL5A 2XCIA 4B46A 4LRWA 1FSFA 4C4SA 4HATA 3TBFA 2P4SA 2OMEA 3ES9A 3S27A 1NXWA 4ZANA 3NYWA 1C0IA 1IYZA 2A78A 1ENPA 2I7CA 1N5LA 3ROXA 3V00A 4GI7A 4DDVA 5DGTA 5M7EA 1T8TA 1NXPA 2WMOB 3C1TA 3IHKA 4HJRA 5CLQA 1M83A 2WW8A 3HXTA 3MJVA 5A1TA 1RI1A 3COJA 3TNJA 2GBLC 4UFOA 3ZE1B 1SMKA 1QQBA 3DOJA 2HDNB 1DIAA 1K5PA 1W85B 2C20A 2WD7B 4RM3A 5B2ZA 3ZY2A 5KOHA 2A3NA 3VX3A 4CQLA 1JFRA 1SKYE 4UHEA 1BFDA 3BN3A 4BO7A 1Q11A 4OGFA 2L69A 2D2EA 1J0AA 1UXOA 4TXLA 1SZPA 3WHPA 4B71A 1QP0A 3IKLA 4XEUA 4DMRA 3MHTA 1E92A 4BO5A 5DGXA 3AEYA 1QYCA 1AIPA 2WVJA 2GM9A 3L41A 1YDGA 1NXSA 2ZRFA 5H7XA 3DE4X 3T41A 3VXKA 1WHTA 4EW3A 4A2PA 4J0EA 1EXMA 5FQOA 1W52X 2HIAA 2I8AA 1V9LA 2BEVB 3DZBA 4MUJA 4N47A 4EOGA 2BWJA 1P1HA 1I4EB 1NF9A 2WTAA 3GUCA 4J7CA 2D0OB 5DVZA 3T1OA 2I22A 3ND7A 4XUDA 4LNAA 3UPDA 3EC2A 5AT1A 2P1RA 1DIRA 5I9SA 3MSCA 1N25A 1QZXA 2IHVA 3A1SA 5K01A 5ILQA 3K5PA 1WUKS 1YDWA 1JU4A 2IW3A 4XUEA 3MUFA 3SQMA 3FVQA 1N2CA 4PRKA 1KDVA 3P9YA 3IBTA 2WIFA 3COYA 3UY4A 2ZKLA 4ER5A 3CH6A 1JLLB 3N7AA 4JI8B 3VR2A 1USWA 1YOVA 2JJYA 5EN4A 2IELA 4GMXA 5U9CA 1B16A 1HLGA 4N5DA 1AQLA 1K6EA 2K2QB 4WERA 4ZO8A 3BJRA 4CCSA 5FUMA 1LBTA 3CTMA 3FMIA 3LLUA 3IUBA 4LRUA 1D1SA 1M8KA 1E96A 2HTFA 1KAGA 2OUIA 3L7BA 3UT5A 1X7HA 2CV2A 3IEPA 3KKOA 5LU9A 4UQLA 3WWPA 2DWOA 1BEUB 1C50A 1PVOA 4NFYA 5JU6A 4F8EA 3IP5A 4JOCA 1JECA 2YN0A 3S2SA 5LQMA 3H1AA 1QP7A 1NLYA 5ARDA 3E6AA 3D64A 3GGSA 2BBWA 3HJGA 3SEQA 4UDXX 4L4YA 1NJ2A 4YS6A 5KWSA 1IU9A 5DHSA 3MBOA 3M3PA 2HA4A 1JQDA 1BQ4A 1EX6A 3EQ6A 3LUBA 1W5BA 4JH0A 2QTVA 5LDDC 3D6UA 2HSDA 4FIZA 5EPEA 4BFCA 4BQEA 1IHPA 2BI4A 1UJ4A 1WHSB 3KJIA 2AN9A 1I33A 4MWOA 5IJ0A 5K03A 1A9XA 1IAVA 5LA6B 4FMBB 3ZDCA 2QLJA 3EY9A 4I66A 4KGZA 4X20A 1YZYA 4FDAA 1FRQA 1WXIA 4HN9A 5G4KA 1R27A 3HL4A 3PVCA 5GMOA 4AJLA 1BGWA 4KLCA 4EPTA 2RI1A 3V8QA 1WZ2A 5LOVB 2XE7A 2PMWB 3R0XA 2V1UA 3DD1A 4NZMA 4R2HA 4GPAA 4Y2VA 5IBQA 1JA9A 1V71A 2HEIA 7ABPA 1EUCB 3ADPA 1TXGA 4DNQA 1Z29A 1CW2B 2WR8A 3F97A 4NZPA 5DBIA 5HFNA 4QA9A 1E1RA 4MKZA 5M29A 3GLGB 2VTBA 1URPA 1ODCA 1KOLA 5BSTA 4BFXA 3KWLA 3UMMA 3ZQUA 4AY4A 2FSPA 2D2FA 4L8WB 3RRZA 5JJ5A 1OLXB 1MV5A 2BSXA 4LE0A 2QXTA 3KQWA 2CFCA 3T7IA 3K6SB 2HA0A 2K5UA 3DVRX 1DHRA 4B6PA 3HJTA 2B3DA 4OQZA 4L50A 4TS3A 1YBHA 3TKLA 2O0KA 4B2IA 3K9NA 4KIFA 1WSBA 4NU6A 3VNSA 2HWUA 5ALRA 3WK4A 2V1XA 2NQ8A 3IUSA 4LC9A 3G2LA 5IP5A 3A26A 1WSAA 1UT8A 4IFTA 2HMVA 4YQYA 2C2WA 3OQVA 5HQJA 3I2JA 5D7BA 4BKRA 3LLMA 4WADA 3RB8A 1IDOA 2PLRA 5JWRA 4JA0A 3R44A 4XDGA 1UBRS 1Q5PA 3BL6A 3IULA 2IF0A 4PC3A 1KRWA 5JFGA 1X7YA 5B6PA 5G0UA 4LGCA 3W5DA 1E4VA 1XQ1A 4MGYR 1Z0KA 4F71A 4L76A 1N8NA 4F1WA 2FCRA 3FCCA 4HF7A 1FQJA 3H99A 4DJAA 1VJTA 2C88A 1F38A 2OESA 2Z9DA 1P6XA 1E9VA 4ZO9A 2EL9A 4D79A 2HJRA 4ALNA 3ZKAA 3J81k 2G1KA 3MB8A 2IX9A 3QKTA 2J3QA 3EOBI 4INZA 2OGTA 2X9QA 2AC2A 5DSTA 3DV0A 3W78A 4B8ZA 4DV0B 1LD3A 4NI5A 4O4HF 1KH3A 5K9ZA 1TTQB 1YBAA 1V26A 2REQB 1P2GA 4L4ZA 5JAQA 3NWEA 3VAZA 2XVXA 3EHEA 1G42A 4KPGA 1BMDA 4DCPA 2W71A 2B30A 2DU8A 4QXPA 3UJNA 1RADA 1XLTC 2P0EA 4MYUA 1PJCA 3HDTA 2X0JA 3ABSB 2OV2A 4Z9YA 4OF4A 5A4KA 1V6AA 1TTPB 3QXXA 3TD6A 2XUPA 3H5RA 3HA3A 1HWYA 3P0JA 5TPWA 4JYZA 1AGYA 3E0XA 1KXJA 1OOEA 4OHZA 2R8ZA 2YJNA 1RPZA 3WFJA 1IK6A 1XA0A 4R3UC 1SPBS 1CR1A 4RHCA 3SVLA 5AKKA 4ZOAA 1VA4A 1R4MB 1SVUA 1HOTA 2DUWA 1E1QA 1LPMA 3JQBA 3LCCA 4HDCA 4P5PA 1CQZA 4ID3A 1QH1B 1K4MA 3KWJA 1W34A 4XFDA 5CT8A 4H7HA 1F4PA 4G1UC 1GGFA 1RZUA 3PGXA 4WK6A 2LTAA 2PZBA 3PHHA 5B2EA 3CX4A 3UXHA 3RG2A 2EU8A 4PYJA 3KE8A 1X1EA 1U94A 1VCNA 1Y89A 2JGFA 3PEUA 5ILOA 1IM2A 2VDNB 2PMEA 1ACLA 3B60A 5E6SB 3V8EA 2HSEA 4G0WA 1BVHA 2AJ8A 2UZ3A 3JQPA 1E2MA 1OREA 2YYSA 3T7AA 5INTA 4JYMA 1G18A 1VI6A 1YL7A 4I4TA 2ZEJA 1U2GA 4G0OA 4AULA 3BCHA 1O7JA 4JLUA 4QRIA 4I99A 3PX7A 1QLJA 1UKEA 1GSHA 1RWBA 1TPYA 3EMVA 4PYKA 2JJ2D 1GL6A 2ONKA 3A1CA 3C5VA 3I0NA