2RMKA

Rac1/prk1 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
192
structure length
192
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/transferase
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title The Rac1 Polybasic Region Is Required for Interaction with Its Effector PRK1
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rmkA00
4A8JA 2PT5A 4FINA 5J40A 4JVNA 1FMJA 4PPGA 3AKEA 4JKIA 4MKIA 2GTPA 1KDOA 4F92B 2XB2A 1G3UA 1LY1A 5HTKA 2ZJOA 5C4GB 5JWHA 3JVVA 1DOAA 5IT5A 1ZU5A 2VHUA 1GKYA 2GAAA 2OSBA 3V4FA 1G16A 5IK2A 3LLUA 1FMLA 4L5BA 2ZR7A 2RGDA 3DEFA 3QF4A 4AKIA 1Q44A 2QM8A 1JR6A 1M2OB 3KJIA 2VL7A 2ZR9A 1MO4A 2WVJA 3HWSA 2ZRNA 2F9LA 3R9WA 1W0JD 1JPJA 3LNCA 2Z43A 1FX0B 5EP4A 1KMHA 3O47A 4M1WA 2CEAA 1IAQA 3X1ZA 2HYIC 2OE2A 3AP3A 3PITA 4DC9A 1WE2A 1TADA 1UFQA 2GXSA 1W4CA 2GCOA 2NIPA 3RRZA 3KQNA 2WJIA 4PZLA 3ZJYA 4JLNA 2A7QA 2VP0A 3ZYCA 1N5LA 3QY0A 2KJQA 2JLZA 5L3SB 2RH5A 4A36A 1ZAKA 2CVHA 4KXFB 2LCFA 4ACAA 3TH5A 2DWPA 3IO5A 3AVQA 1RJ9A 1ZU4A 4OKSA 1KJWA 4ERNA 1GAJA 1Z6GA 1ZM9A 2EFCB 3FTQA 4GRAA 1JALA 4KU4A 5HR5A 5F3WB 3WHKA 3LVQE 3B1VA 3KDSE 3K0CA 5EE1A 2CHVA 4OHWA 5JI2E 1G17A 2OFOA 5JEDA 2FG5A 1AS3A 1TTTA 2WTUA 2WOJA 2MSDB 3B13B 3A37A 4YMSA 4OHVA 5IDVA 1T0JB 1ZC4A 1NG1A 2QP4A 3REFA 3DHWC 4HUQB 3ZQ6A 1TX4B 3KKOA 3VAAA 2HT1A 4JLOA 1E9CA 1Z0FA 4MYUA 4DLXA 1Z6XA 3CH4B 3VKHA 2J3EA 1DARA 5JZVA 2XJ4A 2PH1A 1BYIA 2G83A 4V02A 5EXXA 5GJCA 2CJWA 5DI9A 5TDHA 4QC2A 5B57C 3U7EB 3E2IA 2GA8A 3K8YA 1XCMA 1Z06A 3I5XA 1KO1A 3LXRA 5KDLA 1CTQA 4G1UC 3FWYA 4WXRA 4PO9A 2HJGA 2ZE6A 1FQKA 1YR6A 5FUVA 1P2TA 2G6BA 1GRNA 2FZ4A 3HPRA 4Q02A 4RSGA 1TPZA 2AWOA 3KJGA 3KUDA 4WZAE 4US1R 3PEVA 2QE7D 1NVXQ 1W0JA 4Q4HB 4R2IA 5E3HA 4RZUA 2Z83A 4X8HA 2ZRCA 4BLTA 3BORA 1KI2A 3L2OB 2QGNA 2WJHA 4RD2A 3VNUA 1F2UB 1R5OA 1XPRA 3HR8A 3B6EA 5HZHA 1H8ED 1E2IA 1M34E 2FWRA 2K5UA 4PTLA 1BIFA 2IT1A 2MSEB 1Q0UA 4H1UA 3UKDA 3MCAA 1GL9B 3PG5A 1FPMA 4PHFA 2B21A 1L7VC 2WSMA 1P5ZB 1XZPA 2W2VA 2ZANA 1D9ZA 2W6ID 3RANA 3IHLA 1KI6A 4MKGA 5AUOB 2A5YB 2AXPA 3GFPA 1ESNA 1EXMA 1F6BA 1PZNA 1G7CA 5IHPA 3UXMA 3X1DA 3DOEA 3O8BA 4U02A 3BRWD 2ZR0A 2XAUA 3IQXA 3B2EA 2RHMA 3T34A 2SHKA 3KKNA 5LD2B 4JLVA 3W9YA 1Q1ZA 2R6DA 2Z4SA 2D4HA 2ZE8A 3A1SA 2G9NA 2V3CC 3AVYA 3NC1C 2A9KA 4QNMA 2RKOA 2FPKA 4OQNA 5DN6D 4GZLA 4NYMQ 3NH6A 1Q1QA 1OHHA 2J0SA 1KK1A 4JL5A 2HJVA 1DG1G 1G3IA 1GUAA 1T8UA 3GJ4A 5J5CA 2IBMA 1XRJA 1XEWY 4M0LA 4DVGA 3C7KA 3AF1A 4II7A 4YXWD 4BRUA 1G64A 5LB2A 4B43A 4XWKA 4NYJQ 1VECA 521PA 5CB6A 1XU4A 5K8TA 1ODFA 2BOVA 3I32A 3JZMA 2CL6X 4A0HA 1KOFA 4GI7A 3K9HA 2OT3B 2QORA 3QF7A 3VR4A 3D31A 1G5RA 4DDUA 3KKMA 1PLLA 2ZREA 4RD0A 4A6PA 5JECA 1CJTC 2XEXA 4QFMA 3CPEA 4DWJA 1TQ6A 2NZ8A 2P67A 1N6LA 5UKDA 2IXGA 1WB9A 4UKDA 4F93B 3MWLA 5IRCD 1SXJE 1YRAA 3L82B 4I99A 2L0XA 3I4LA 2QE7A 4AKGA 4M22A 1OB2A 2OLKA 4BFUA 4ASUD 1US8A 1W5SA 1KJZA 3R7WB 4GNKA 2MMCA 2ZI4A 3WMGA 3QBTA 2W0MA 1VHLA 4F4JA 1SXJA 2WMNB 2JEOA 2J5XA 1ZM4A 4JL6A 2WHXA 3J81k 2ZU6A 1EWRA 5D3MB 3TMKA 2F43A 5EQTA 3QQ5A 1XXHB 2E9SA 1H8EA 2IUTA 2ZS9A 2C2HA 2VYFA 3GLIB 2D7CA 3SQXA 2OAQ1 5DHFA 3LQQA 4BLRA 5AJZA 3QUSA 1S9HA 3LAWA 2OCBA 3IDQA 4LHXA 1UF9A 4M21A 4WAUA 3V4RA 2W6IA 5AUNB 3HJNA 4GOJA 1A2KC 1OT3A 4DLUA 3ONWA 1YR7A 4V03A 2IEZA 4HAZA 1PV4A 1QHSA 1MH1A 1JQJC 2H5EA 4PAQA 4Q4AB 4Y0AA 5DE3A 2F9MA 2W58A 4JSTA 3AVXA 1KSGA 1NKSA 2N46A 2ZYWX 3SDZA 4DIDA 1R5BA 2O8DA 5HCNA 1MKYA 1UBGA 3Q85A 4MRRA 3T1VA 1Z28A 2ZJ2A 3D8BA 4JSYA 3HPQA 1YZGA 4HAYA 3KFVA 2KE5A 2A3RA 3THOA 4FMBB 4YXWA 1N6RA 2KBFA 1N6OA 2V1XA 4QL3A 3TSOA 4IVQA 3RS0A 4B3DA 1QG4A 2QBYA 2GHIA 3MRSA 3NDBB 4MRVA 1LW7A 3I8XA 1PUJA 1JEDA 4B32A 2QP3A 3AF2A 4M8NE 2BMFA 1MO5A 3SR0A 2NO7A 3T12A 2QSYA 2VIIA 1TL7C 3NBZC 4IW3B 2FEMA 4EDHA 4RCYA 3EAQA 3M4YA 2QPTA 1X6VA 5GJWC 4R7ZA 1S1CA 2Q3MA 4RD3A 1IXZA 4EKDA 4QJ3A 1A7JA 4UJ3A 3A36A 1Z0JA 1IN5A 4I81A 4A8JB 3CW2A 1Z6AA 4GL2A 4ASUA 3SQWA 4O0MA 1D2EA 1YQTA 3DMDA 2QP9X 4EJSA 4Q4JA 3QPWA 3NDPA 3V9PA 2R44A 4B48A 2C03A 3QPUA 2VHJA 3X1WA 2IC5A 4NCJA 2C5LA 2FGKA 2AN9A 1XTRA 2WPDD 4L16A 5HE9A 4DLWA 1K6MA 4EAQA 4R71A 1T3HA 2FOLA 2GJSA 3TR0A 1E96A 1X8JA 2JGNA 3KJHA 2ZRKA 2HDNB 4F4CA 4Q1BA 4QGGA 4KCGA 2QA5A 3GMTA 4YMVA 1KTVA 2BM1A 1KMHB 4V0NA 2VHCA 5FPTA 3TW4A 4B34A 4HAXA 5FH9A 1YE8A 1IOZA 1Z0AA 5BWMA 1W46A 3EWAA 3WP0A 2FPLA 2KBEA 1KSHA 4CEIA 2C78A 2XX3A 3I5YA 4AIIA 3PFIA 2GILA 2ZSEA 5FUXA 1S3GA 2ZI6A 2ZUCA 2GK6A 4M9ZA 5G3ZA 4DDTA 1RJ9B 4ZDIA 2XSZD 1VKJA 4CEHA 5P21A 2ATXA 4RZ2A 4ITRC 3MUFA 3QKSA 4C0JA 1NMZA 4CF7A 4KVGA 3AH8A 3IEUA 2VF7A 4KBFA 4RCZA 5HKKD 1G18A 2QPOA 4GFDA 1COWD 2ZYVX 1T91A 1FOEB 2JCSA 2QAJA 3NHAA 4MGYR 3FPAA 1EGAA 1OYYA 2QU8A 1VHTA 2CBZA 2ZJ5A 1YZTA 4OJKA 4LHVA 3QEJA 4XIGS 4GBMA 2WWGA 1HYQA 2P3SA 1HE8B 3I73A 1LS1A 2UZ3A 4JT4A 4H1VA 1U90A 3TKLA 1OPXA 4I1OA 2ZYUX 4QHSA 2GAOA 5DYGA 3GLGE 1M7HA 4RFVA 3TE6A 4MGZR 4OHZA 5K8UA 2P6UA 4IOLA 2QMOA 4GP7A 2CJWB 1SQ5A 4Q9LA 2YKGA 4UNQA 4LI0A 1FUKA 2VSFA 3PEYA 1KNQA 3GLGA 3KJEA 1E2QA 2WSSA 2WPDA 2FMXA 2FU5C 4IVRA 2N1BA 1Q3HA 2H18A 1G3MA 1OXVA 4B73A 3GJ0A 4LOAA 121PA 2YWFA 4S35A 1IONA 3ZS9A 2AHOA 4UXJA 3I92A 3FB4A 3R8FA 1EFUA 1QHYA 3A4NA 1BKDR 3K1JA 1XD2A 2IYUA 5C2JB 5L3VA 3PEWA 3TVTA 2FSHA 2OBLA 1CJVC 2V55B 3AKYA 3GEEA 4BLSA 3F5FA 1OIVA 2ZRJA 2O0KA 1NMXA 2C99A 1GNQA 4LV5B 3RRNA 4OQMA 3FHTA 4URYR 4KFUA 4LYAA 4Q48A 4RZ3A 4KYIB 3O8CA 1E98A 4P3YA 1W2GA 3U60B 1E9SA 1UKZA 2C96A 1S8FA 3QKRA 4QGAA 2NO0A 2OESA 2XSZA 4PC1A 1WP9A 2JLWA 2ZUBA 3B7GA 2J45A 4YC7A 2ZRLA 2XJ9A 1KI6B 2ZRAA 4DSNA 1F3OA 4KHZA 1WCV1 3DDCA 1L8QA 2PJZA 3KB1A 4LDJA 5HKKA 3K53A 2X2FA 5BN5A 4FMCB 4EPYA 1M74A 1TEXA 1COWA 2ORWA 2ZEJA 4WVFA 2DFNA 1D9XA 5H1YA 4QGHA 1Z07A 2YOGA 3QG5A 3ICQB 4HLDA 1EFTA 5CB8A 2UKDA 3AP2A 2GDJA 1IHUA 2AD5A 3X2SA 2LWIA 3CRRA 1SKYE 2WWFA 3K09C 1NBMD 1SVSA 3EIQA 3L0PA 4Q21A 5KSZA 2EWWA 1NVWQ 1M6NA 4Q47A 1DAFA 1KO4A 2G1KA 1IQPA 3HYRA 1KO5A 2CNWD 4EPWA 1XTSA 1IBRA 3GLFE 4BASA 3IILA 4DB4A 3ICEA 1AQUA 5HE8A 4XWOA 2GESA 1VCNA 1KAOA 1T3SA 2FE4A 3U6KA 1V43A 4LGMA 2GCPA 3R20A 3EIHA 4MUBA 2IUSA 4HYYA 5JSZB 1TF5A 2UVQA 4AYWA 3GLFA 1BH2A 1G7RA 1G3QA 3KTAA 3LW7A 5EXSA 1WRBA 4OL0A 5FBLB 3VFDA 3LX8A 1R7RA 4OQLA 1GIAA 1NN1A 1GOTA 3PUYA 4IVPA 1DBSA 3BK7A 1OFUX 3W3ZB 3AVUA 1P9WA 1US8B 1XEWX 1RE0A 1SHZA 2XITA 1JXMA 3NEJA 3ADKA 1Q12A 1E9DA 1NVVR 1E2GA 3QKUA 2BCJQ 1ZD1A 3A4LA 3U4QA 2GCNA 3PJRA 2W2XA 2G0NA 1DELA 1X86B 4Q9JA 4EPXA 3ZVMA 1DG3A 3MMPA 3TUIC 1G5TA 2YNMA 2BCGY 1T5LA 2X1VA 3ECCA 3SHWA 2FZLA 3KXIA 4TTRA 1NJGA 2FSGA 1AA9A 1G4AE 2VSXA 1AJEA 3MWJA 2YWHA 2CVFA 4F38A 3G5UA 3W34A 2YOFA 3GPLA 3A4MA 4TYPA 5FPSA 2RGGA 2BJVA 3K0SA 2RAPA 2X77A 2YHSA 5JWRA 2BMEA 4B3BA 3QG1A 1XD9A 1NBME 4TZ6A 2VO1A 2ZSBA 2ZQ5A 2P65A 2QZ4A 1XJQA 4C0SA 3OESA 2FFBA 2V6IA 4HDCA 5EP3A 1EESA 2O8DB 3K0CC 3IIKA 1TAGA 4XTCS 1E3MA 2RB4A 3NKVA 1NLFA 3SBDA 1XTQA 1NBMA 1CS4C 4PQRA 2GBLC 2NO1A 2VPPA 4B44A 4BQSA 2NTYC 1NIJA 2QBYB 2OAP1 2CL7X 2CNWA 3EX7C 5H70A 4FWTA 2HLDD 1KDTA 1KMQA 4Q9IA 4FMDF 3TSWA 3RHFA 4NKRA 1UADA 2V6JA 1VG1A 2QRNA 2ZRFA 3E70C 2YOHA 2PLFA 1R0ZA 1ZBDA 5F9FA 5FI1B 2D7DA 2QY9A 4QJ4A 2XZOA 4PO8A 2BIFA 3QVUA 1CRQA 2CCJA 3A1VA 1D2NA 4QXAA 4Q01A 1N0WA 1G8PA 1R8QA 2QM7A 4IOKA 5FR1A 3TAHA 4A2QA 1E2FA 5J4LA 2CHQA 5L8VA 2O5VA 3K9NA 5A0FA 3B8HA 1RFLA 1ZYUA 5E4FA 1UKEA 2KB0A 1LB1B 3W8NA 4QJ5A 4MKFA 2H17A 3A1TA 1E0AA 2A5JA 3GD7A 3U44B 3CR8A 4ZCIA 1OFHA 4LJYA 4V0LA 4CYMA 1QVRA 1AS0A 1FL9A 1MRSA 2HF8A 3Q5EA 4KO8A 4QBHA 821PA 4NYIR 1II0A 2XNSA 3QSYA 4KFSA 5JJLA 4EFNA 4Z54A 4DCTA 3B78A 2AK2A 2CLDX 3AQ4A 5J4HA 1YZNA 1LF5A 3QEOA 2OCYC 4YDSA 2O8EA 3EZ7A 4Q66C 4FI3C 5AJWA 4L9WA 1Z6TA 4XJXA 3RC3A 3BIFA 2RGAA 4MUAA 2IA5A 3EPJA 4AWXA 3VU9A 4DLVA 1E2LA 4CEHB 3K09A 4C7OA 3W6NA 2JLUA 3OEHA 3QKSB 3SHFA 3EXAA 1ZJ6A 1G41A 4JJKA 3PEUA 4DEYA 2V1UA 1RRCA 1AGRA 2QSZA 2OFWA 1NKTA 4A92A 4HATA 4JLJA 2OZEA 4TLDA 2HLDA 4UNRA 1L4UA 1UAAA 3IO3A 3TK1A 3CZQA 4CEJA 4CRWB 1F60A 2Q9AA 4JVSB 4Q19A 3SZRA 2QT0A 5CIQA 4TMKA 2IF0A 4D0NA 4TYNA 4XH9B 5SZKB 1DE0A 3GJ8A 4MYCA 3SJCA 4M2LA 2BJWA 1VCMA 1UJ2A 2P0EA 1SVIA 3NXSA 1OW3B 4AKHA 2V7QD 4AY2A 4OK5A 4PANA 4TLAA 2G1JA 1DTSA 5BQ5A 3F8TA 4YQFA 1C1YA 5AJXA 4A0FA 3FMIA 5FTMA 1U81A 2WJGA 4K8OA 4ZI2A 4PHGA 4GOXA 4O2LA 3P20A 3UMFA 4IDNA 2WBLC 4NCHA 2GEUA 4CIDA 3IIJA 1A1VA 4NL4H 5ANRB 2O8FA 3QPVA 5A5GA 1BS1A 1W49A 4FCWA 2HUPA 3GJ5A 3CB4A 2QT1A 4OI0A 2WV9A 1SXJC 4Q18A 5SZJA 2TMKA 3RS2A 5JHHB 1NRJB 4C4PA 8OHMA 2C98A 1P2SA 1ZVQA 4ZPXA 4Q7KA 1XD2B 4LJ5A 4B6EA 1B23P 1XJ0A 2ZE5A 3EC2A 4PAMA 1G6HA 1DEKA 4B3CA 2R62A 4NCNA 1IJFA 1LF0A 2ECKA 4P0TA 4D6PA 1XPUA 4BFTA 1TMKA 2JLXA 4Q9KA 1AKYA 5EE0A 1KJYA 4AYTA 2BWJA 4A2PA 3QKRB 4S2EA 2CE2X 3KXKA 4Z8YA 3GEIA 4G5QA 5AWFC 3AVOA 2GBLA 2AR7A 3QVVA 1Z0IA 4JIMA 4E22A 1OHHD 1NNEA 3GP8A 2DR3A 2P2LA 5H8WA 2EWVA 3T15A 2CE7A 5C4MA 5GJBA 2J87A 3CRMA 2VF8A 1J8MF 1VG0B 2HEIA 2PEYA 3BB4A 4IXNA 4XVUA 4TMTA 1P73A 4PC2A 3CWQA 3WBJA 2O8CA 3UWOA 1G20E 2V7QA 4TL6A 1W44A 3L43A 4C0HA 2FPMA 2FJUA 4M9SA 4UQOA 4KVAA 1CJUC 3NHBA 2I1VB 1HURA 3SS8A 3WNBA 3THYA 3R9XA 1CR2A 4GDFA 1SKYB 1XX6A 2Z5FA 4LC0A 1AQYA 4XD7D 4BFZA 2CLCX 2Q9CA 3LW8A 4GZMA 1P60A 4Q7MB 3LVRE 4E5UA 1R0WA 3EPKA 2WIBA 1CR1A 1FP7A 1AK2A 1JAIA 3KTAB 1R10A 4EJSC 4RZXA 4JYCA 1SXJD 3AVTA 3HR7A 2OXCA 3WRXC 2R6CA 1R2QA 4PFSA 4IDHA 2GZHA 2GEVA 2IL1A 3PENA 4W7SA 2H16A 4A4DA 1OXUA 1FFHA 2YYZA 4QGFA 4BPBA 3IHWA 3E1SA 2ONKA 1ZIOA 4MKHA 3K70D 4I4LA 4URUR 5JEEA 1WBBA 4DXAA 2OHFA 5BN3A 4I1UA 4US2R 3EARA 2IHYA 2ZI5A 5JJIA 2HF9A 4LHWA 1B0UA 1GKIA 3TVDA 4E09A 2VH5R 2GJKA 4G01B 1R6BX 1A2BA 3QI2A 2ZSFA 4FWIB 1P9RA 1ZMXA 4UXHA 1TU4A 2A78A 2ZS8A 1NN5A 1VDZA 1HV8A 5G41A 2P6NA 3EA0A 4EPRA 4OQFA 3C5CA 1F48A 1ZM7A 5IF9A 2QEQA 2D74A 3H0KA 1VTKA 1G8YA 5DI3A 2OCAA 1OH7A 1G9XA 4HI0E 1UBCA 2BBWA 1UBFA 4ON9A 4ACBA 3B82A 5GADl 2ZU0C 3AV0B 5DHAA 5L3QB 3CR7A 4GMDA 3UATA 1H8HD 1ZD8A 3MLEA 4MH0R 2FSIA 2PX0A 4WXPA 4XSHA 4DZZA 4C2TA 4IXMA 2DWQA 3BXZA 4B76A 1HA3A 1NMYA 2H1LA 1QZXA 1UEIA 5KDOA 4B2LA 2NO6A 3RWMB 4XD7A 1QF9A 4LX0A 1YRBA 4LJ7A 1SVWA 4US0R 3SYKA 3RLFA 5FBVB 4LZZA 4AC9A 2ERXA 2WZQA 2CCGA 2IYZA 4PPFA 5D3QA 621PA 2A5DA 2F6RA 4PZYA 4PPQA 5FOVA 3VMFA 2GXQA 2Q9BA 2FNAA 1KI8A 2ZETA 1NIPA 4OQXA 2P5TB 5FPYA 1M8PA 3THXA 5JJKA 3ZD7A 2V9PA 4BWYA 1OF1A 2ZRDA 2Q0HA 3U7HB 2VA8A 3L0SA 1SVKA 3ZVRA 5AUPB 1E2KA 1X1SA 2R2AA 4EFLA 1CP2A 5JI3E 4G5RA 4JBXA 4Q00A 4NU0A 1GM5A 2PX3A 1OIXA 3TSZA 4BFYA 1AIPA 1TUIA 3C41J 2EFDB 1OLOA 3CF0A 2H92A 3SYNA 3WYFA 4BLQA 4LSGA 4TMVA 5CK5A 4M1OA 1E1RD 2OM2A 3FKSD 1G5PA 5CDFE 4N0DA 2D06A 3UK6A 3T06B 3ZH9B 4D80A 3K0AA 3WYGA 1G1MA 3QIAA 2ZI7A 3JVUA 2GF0A 3VU9B 2FF7A 4IEEA 2WICA 1KHTA 2IYSA 2C9CA 3MWKA 5EUQB 3B9PA 4U7DA 1DAGA 1XB2A 2PMKA 2ZI3A 4C7OB 5CDFA 4QNRA 2J0VA 3AF0A 4JBYA 1H8HA 2EFGA 4N1AA 1QVAA 2EFEB 4OI2A 3FOZA 3IGFA 2QTHA 1XCPA 1E1QD 2RGNC 5BN4A 421PA 2XZLA 4DT1B 4CEJB 1Z63A 3GJXC 4C2UA 3CPJB 3FKQA 721PA 2QTFA 1NI3A 3IBYA 4FN5A 2IYRA 3A1WA 3U3JA 5EP1A 4R9UC 1U0HC 4A15A 3LRPA 4POAA 3K9LA 1ZRHA 2AKAB 2FV8A 1KY2A 3G82C 3WXMA 4HAVA 4DB2A 3QXHA 1CLUA 1SZPA 1ZM3A 1EFCA 5KHOC 1KAGA 2WSSD 2VP9A 2G88A 5SZIA 1XJCA 2C04A 2WM9B 4G5GA 3SJBA 3SI7A 3QF4B 3CF2A 1XFAA 3NC0C 5FTJA 2NPFA 2Q3HA 1QHIA 4W5WA 4I1VA 1XCGB 4BUJA 4D4KA 2FFHA 1N6HA 1OIWA 1E0JA 4O25A 1CJKC 1ZD9A 2E1RA 2EVWX 2Z0MA 2O8FB 1KIMA 3BAFA 5FL7D 4PPNA 1RIFA 3RWOA 2BKEA 2IW3A 2GCOB 2FX3A 3EW9A 4EQ6A 1E9EA 4KFRA 3S1AA 1GL6A 1UEJA 1T0HB 1G7TA 1I2MA 4HZIA 4JLMA 4MYTA 5BXQC 4WIAA 1YZUA 1E69A 4D4LA 1J2JA 1E1RA 1ESMA 3AB3A 3RSLA 3FKSA 4ABYA 4QRHA 1GFIA 3VX3A 1CJMA 3ZZUA 1G3RA 3CIOA 1AN0A 4JZKA 2EW1A 4C0BA 2NQ2C 4LCBA 4A2WA 2WJVA 4JYBA 1GILA 4V0OA 3NTUA 2HXYA 2REOA 2ZROA 3SEAA 5KNDA 1CKEA 1OXSC 3WNCA 1PVOA 2D3WA 3FMFA 3LA6A 3WHLA 3OEEA 4KSCA 2EYQA 1WF3A 4A6XA 4I1SA 4CT5A 4OK3A 3SNHA 5KSPA 4CT4B 5K8IA 4ZDWA 3WP1B 3LY5A 2ZYTX 4LV8B 1E1QA 1KK2A 1DAIA 5LD2C 3DZ8A 1ZP6A 1W5TA 1XEXA 1WBDA 1KKMA 3VNVA 2ODNA 2VHQA 1T4GA 2IS2A 3AUXA 2AX4A 2QGZA 2QMHA 3IPXA 4N3NA 2IUUA 2FFQA 3MGCA 2F1JA 1W0KD 4HEJA 2WWHA 2Q3FA 2Z6VA 1FZQA 2ORVA 3DKPA 2IYWA 5B30A 1KZGB 1P62B 3P26A 4PSKA 2O8CB 1J70A 1KO8A 1EFRD 3F3YA 2VP2A 3THYB 3CBQA 2F1HA 1Q57A 1PLJA 1I4LD 4HB2A 4L15A 3SJZA 5E7JA 3K9GA 3CX8A 3EC1A 2NGRA 2AXNA 4JJZA 1Z08A 4A1FA 3ETLA 1W4AA 1Z3IX 2FGJA 1Z83A 2HV8A 2QTVB 4B3GA 1CU1A 5J47A 2AFIE 2N42A 1LS6A 1Q3TA 1X3SA 3BGWA 3HP1A 5FL7A 1HH4A 3TIFA 2IEYA 5EXPA 1HT2E 3AGQA 5TB5A 3L0IB 4RD6A 3W90A 2JJ1D 1U0JA 4M1SA 1FUUA 4D81A 2QMUA 1E99A 4UNSA 3SC3A 4DSOA 1A4RA 3U2QA 4PSAA 1XEFA 1GRQA 2ANBA 4QM7A 5AUQA 4LJ6A 2IYTA 1VYUA 1ELOA 2OG2A 3OE7D 4HLUC 4LYFA 5FL3A 1PLKA 4LPSA 4A9AA 1UKVY 3TRFA 4B3XA 1RYHA 4QOSA 2A2ZA 1W36C 4UJ5A 1NN3A 3BE4A 4KJZA 3HU1A 4Q7JB 4W9MC 4LYJA 4LJ9A 5DLQC 3ND9A 1N5JA 4MA4A 4V0ME 1OH8A 1E2NA 1Z22A 1YR9A 4G0NA 1E0KA 1L2TA 4L9SA 1EFHA 3I8SA 4YLGA 1U8YA 3CNNA 1KSJA 1RPZA 2RGNA 4DCVA 4HAWA 1CR4A 4V0MA 1KI4A 4HB0A 4CVNA 2EYUA 2J7KA 4GPTA 3SU8A 3RYTC 5DI3B 1RYFA 3BS4A 4H9GA 1GKUB 3LO5A 4RY2A 3LD9A 4CDGA 5BW8A 2ZJBA 3DO6A 1W7AA 1NVVQ 1W0KA 4PHHA 3UG6A 1YKSA 3CKLA 3LQRA 3VQTA 3BJIC 1E9RA 2W83A 1XWIA 1XTKA 2QNRA 2GZDA 3CNOA 1R8SA 1AS2A 3N2IA 3PXGA 4IDQA 3TNFA 4AG6A 1VYTA 2E87A 5EZ5A 2IXFA 5M04A 2IX3A 2WAXA 3Q3JB 1EFRA 4Q03A 3C15C 1FTSA 1D6JA 5LPNA 1U99A 3C4JA 3MG9A 1I4DD 4C9BA 4MQBA 1QDEA 4G5OA 5DISB 2CDNA 2IK8A 2GEDA 4Z51A 4PX9A 1XTIA 2JDID 5LB4A 1N6NA 4ZIRA 3RDPA 4XTRA 1JAHA 4Q1DA 5FBQB 1SXJB 1P3JA 2YC2C 5JS7A 4LUCA 2ZJYA 2QG6A 3BH0A 1JJVA 4Q4HA 2F43B 2JJ1A 1G8FA 4WZ6A 1E2HA 3THXB 2GKSA 1JQLB 2OBNA 5E95A 3EZFA 2QMEA 1Q1BA 2ZE7A 3IIMA 3NVAA 4FCTA 4DSUA 1E79D 3OE7A 2A5GA 2XTMA 4Q1EA 4KITB 4LRWA 1ONBA 2YWGA 1RRFA 1W36D 4R2HA 4AK9A 2WOOA 1E9AA 2XOKD 2BBSA 3DKVA 3QXCA 1KK0A 4BGDA 2VP4A 1NVUQ 3E5HA 2MSCB 5CJPA 1LVGA 3VX4A 3I61A 1VG8A 5FI0B 2DWOA 2F55A 1RC8A 1LFDB 5EE3A 4JT2A 3OFND 3MFYA 2O52A 1U9IC 1U2RA 2IYXA 4RD4A 4C0KA 1P7CA 4BEBA 2BVNA 1GNRA 2IYQA 3ZQJA 4YMTA 4X8MA 3OEHD 3WY9A 3K0AB 4LBWA 5JWOA 4LJ8A 2DCUA 1KKLA 1Z5ZA 3N2EA 1NSTA 1G8GA 2YV5A 1BYUA 5HCIA 3G0HA 2G3YA 3L0OA 1FQJA 5DYIA 5EP2A 2QQ0A 2RGCA 5FBRB 3KX2A 2DFLA 4BFWA 5C46F 2QQEA 5LBIA 2VP5A 3N5CA 3REGA 2GK7A 3EPHA 5CM9C 4TYQA 3SYLA 2PL3A 2B8TA 4XVRA 2QI9C 4NYIQ 3R9IA 5KSOA 2RGBA 2ODBA 2XTZA 1ZNZA 4NPHA 4EFMA 3RRYA 1FW6A 2BMJA 2X8AA 3VKWA 5HPYB 3PCRB 1JEEA 3Q7QA 4Q1AA 1G7SA 2JDIA 2BKUA 3TGPA 3SE0A 1XMVA 4EJSB 2NO9A 5DO9A 4Q4JB 1KZ7B 4C0LA 2GZAA 1ZM2A 3H2YA 3I3SR 2B6HA 3KKPA 4PXAA 3O8RA 3ADBA 4PO1A 4ESVA 3VR1A 1BOFA 3B5JA 4FXPA 3GLIE 4GMXA 4HLCA 4UXIA 2VTKA 3FHCB 3R7WA 1KSFX 2LKDA 3KFXA 4G5SA 5FPHA 4BFXA 3Q7PA 5EZ6B 3DL0A 4YONB 3WBKA 4CW7A 1GRRA 5D3MA 5B58C 3FDIA 1GP2A 2YZ2A 1E79A 3CNLA 2OCPA 4HLUA 3T1OA 4A82A 4ARZA 4DIEA 3FMOB 1S4QA 1WQ1R 2NG1A 3GLIA 3AEZA 2W2TA 2BBTA 1ZUIA 2J9RA 1TF7A 4WBSA 1GSIA 2REBA 2XOKA 3S1AB 4CEIB 3KXLA 2ZJ8A 5JS8A 2OLJA 3RABA 4F7WA 3HU2A 4LBZA 3OFNA 2CK3D 1GNPA 3PIRA 1OV4A 2VP6A 4IDPA 1T5IA 1II9A 1G4UR 1MABA 4IOJA 4TLCA 1E9FA 4X8OA 4D4MA 3H86A 5FFMA 3H1TA 1QRAA 1W48A 1VIYA 3TQFA 2AFHE 1W4RA 3Q9LA 1DPFA 1HQCA 1ZNWA 4K46A 2ONJA 4XOIA 3K0EA 2ZITA 3GQBA 3B1ZA 1C4OA 2JIZD 1NY5A 3A58B 3QNUA 2ZAMA 1OXTA 2PT7A 5LDDC 3ZVLA 2PZFA 1BMFD 2D2EA 2YINC 5DNYB 3IEVA 4KLZA 5SZHB 1SVMA 1RZ3A 1XEXB 2JAQA 5DSZA 4B33A 5K8LA 1JI0A 4TL8A 4KFTA 1E2PA 4JLBA 4A0GA 4JKYA 3KZ1E 4BEJA 3T1TA 2YJTD 2WWXA 1R5NA 2B7CA 1R0YA 1JECA 2BV3A 1JJ7A 1IN6A 1UBEA 2CL0X 2RCNA 3KL4A 4DCUA 4TN1A 2OO7A 1X8KA 3GLGB 4DJTA 4RVCA 3AM1A 3U3MA 2J7PA 4FMCF 1OJLA 5CYOA 4PAOA 2WJJA 1IJEA 3CRW1 5E7IA 1CF4A 4RD1A 3PUXA 2V8OA 3RNLA 4IFEA 3LV8A 5FPKA 5F2EA 3VHLB 5GVSA 4B2IA 3EPLA 4DLZA 2CXXA 5GVRA 3EZ6A 3W5IA 4AI6A 1P4SA 2ZRIA 1F5NA 3K70C 2ODEA 3KQUA 3PUZA 1FNNA 4ZKDA 3CUEF 3D3QA 1E32A 1OFIA 3AVPA 3RAPR 5J4VA 2PLRA 2J0QA 1M1YE 1P2VA 5FTNA 4MGIR 4ZKEA 1MO6A 1U9IA 2CK3A 2OUKA 4DLYA 2EQBA 3RSOA 4M1YA 4RFSA 5TV2A 4D2IA 2B7BA 3SOPA 4DSTA 3CRVA 2GJAA 3CM0A 4LY6A 1SVOA 2EU8A 2LKCA 4O3MA 1E2EA 3DPUA 1EX7A 3TUJC 3WMEA 4IJMA 3A8TA 3RC8A 3D6TB 2DPXA 2ERYA 4RJLA 4QHYA 2Q21A 2W00A 2JIZA 3RS3A 2F1IA 4C3ZA 1QBKC 4TL7A 5HZKA 1XMIA 2XGJA 2QAGC 1CBUA 2GF9A 4R98A 1T6NA 2IHBA 3MAAC 1QHHA 1ZNYA 2CCKA 1E4YA 3QOFA 1BMFA 1IXSB 4ZDKA 3PUWA 1G21E 1KK3A 3GFOA 3QE0A 4QHTA 4DDVA 1DS6A 4QM6A 3C14C 4MYHA 1X8LA 4L4UA 1OKKD 3DM9B 3V00A 1II8A 4DEXA 2IYVA 2QUZA 3WNDA 2VLIA 5EE5B 1P72A 4AYXA 1ZC3A 2UZIR 2OBMA 3M6AA 5FR2A 5H68A 1JXOA 2MMGA 1IY0A 5CLQA 1ZUHA 1NF3A 5KO2A 1KO7A 4D4JA 4B47A 4TYYA 4GT1A 3LBIA 3GLFB 1S3SA 2XXAA 1N0UA 2FEOA 2G0TA 2JJ8A 2PCLA 4E03A 3I62A 1YZKA 4MDEA 1Q1EA 4M4SA 4P31A 1OE0A 4LPKA 1NLYA 1H65A 4XSGA 4QKQA 4ZIRB 1DO0A 2WMOB 3U3RA 1OYWA 2FSFA 1M7GA 6Q21A 3UMRA 2EFHB 3ASYA 2ZUDA 3NH9A 4EIWA 3ZDQA 1T3LA 5AR1A 3KUCA 3OZXA 5BYJA 4UNPA 3RS7A 3U4QB 3FYHA 4YDHB 4E07A 4URXR 1QHGA 2D2FA 3P27A 1OFTA 4Q5IA 3SJAA 3IKJA 4LC1A 2W6JD 2JA1A 3UWKA 4L8GA 2HCBA 1D2MA 3BWDD 3CX6A 2ODWA 4OK6A 5DGXA 4GSYA 1FTNA 1TQ4A 1VMAA 4HB3A 2GJ9A 3ZIAD 3TUZC 1ANKA 3FHOA 1P75A 1ZCBA 2XZPA 4N0EA 1N5KA 1JB1A 2VEDA 3ZZTA 2AL7A 2J0UA 2NPIA 4BE7B 4ZCLA 3NG1A 4WZBE 2YC4C 1TF2A 3U6BA 4NCKA 3GEHA 4LBYA 4D82A 4IOMA 3UG7A 3GJ3A 3U5ZB 4JVMA 1GL7A 4HDQB 4AKEA 3EWSA 2IWHA 4XVQA 3B1YA 2ZRHA 3TJZA 3UMSA 3EG5A 1N6IA 1KY3A 5JRZA 3CX7A 1OKKA 3QBVA 3BBPA 2YWEA 4HDOB 4IKEA 1ZIPA 4J0QA 5KYKA 2YVUA 4U5XA 1GTVA 2QN6A 4RKFA 4URWR 5F9HA 2FN4A 3P32A 1GITA 3PVSA 1XF9A 4BFSA 2XTNA 1XPOA 5GJVC 1XTJA 1UDWA 3UPUA 5FOSA 3OAAD 5FUYA 1ZINA 2JLYA 1N6PA 1ZW6A 1IY2A 1VIAA 3AKCA 4JS0A 4PC3A 3W5JA 2C95A 4JLPA 3GJ6A 1MOZA 3AGPA 5JSZA 1TQDA 5AK0A 3QKTA 2A30A 4TMZA 4EPVA 5L3RA 4NYMR 5KSYA 3PQCA 3B85A 1A82A 1OH6A 4WA7A 1DVRA 3GFTA 3T5GA 4QBGB 4PHTA 2ZM5A 4CZ2A 4TL9A 1WMSA 2PZGA 3L8ZA 3DZDA 2W6JA 4NYJR 3W3AA 4PQYA 2ANCA 1VCOA 3VR3A 4Z1MD 1U0LA 2XB4A 3P4XA 1LTQA 3LH5A 4TYWA 2GRJA 3SFVA 2DFTA 3DOFA 4NCIA 4ARZB 2X19A 3UANA 3ZIAA 2DHRA 5J4YA 1KDRA 1W36B 2IS6A 1LNZA 3CLVA 3SN6A 1NY6A 2IS4A 1AKEA 5EE9A 2O8EB 1L4YA 3WRYC 3MJHA 1YU9A 4NBSA 5TMPA 1N5IA 2BMDA 2HYDA 2QAGA 4HSEA 3GLHE 1GG2A 3L8YA 3SBEA 1UDXA 3NWJA 4KAXA 2NMVA 1AZTA 1MABB 1ZNXA 1S2MA 4KV9A 3M0EA 4UNNA 2NOAA 3RS4A 3OEED 1TNDA 4IDOA 5DN6A 3VR6A 2GETA 4TQUS 3GLHA 4W5HA 1DAEA 2QL6A 3M1IA 5JFGA 3ZD6A 1M7BA 3Q72A 4B3FX 3AVVA 2QENA 4NTZA 4D26A 2CHGA 4URZR 4LYHA 4B35A 1MO3A 3U7GA 1HE1C 1OXXK 3K0FA 5FOUA 4KODA 5F98A 2DY1A 2F7SA 1SGWA 1D5CA 4WOPA 5G53C 1HT1E 4M9QA 2Z4RA 1OSNA 3MD0A 3CRQA 2R6GA 3LLMA 3OAAA 4DBLC 1MRNA 2ZJZA 2GVDC 1J90A 1NP6A 3CONA 4HZUA 4D0GA 3DMNA 1P61B 3FVQA 1J99A 5TARA 2R65A 2BEKA 2ATVA 1D8TA 1XD8A 2BM0A 4NP6A 1Z2AA 4JLKA 3QXXA 2ZIAA 4GP6A 5AJYA 1Z47A 4LV6A 4W5JA 4Z8XA 2PCJA 2I4IA 4Z1MA 3X1YA 4M1KA 1FNMA 3U44A 2RGXA 4OYHA 3B1XA 3BERA 1E2JA 1NG9A 3CH5A 2O8BA 1YZQA 1J8YF 4BLPA 2QPAA 5E7MA 1UPTA 1F2TA 4FMDB 3KB2A 3U61B 3EIEA 4YMUA 4PC6A 3AUYA 3KQLA 3QXSA 2HT6A 3AKDA 3W6PA 4TQ9A 3F0TA 3H84A 4OI4A 3HU3A 3Q5DA 1KI9A 2V4ZA 3BFVA 1UKYA 1W4BA 3OIWA 2HXSA 3OF5A 1YR8A 2WKRA 4RFSB 4TT3D 2F3TA 3W8RA 3ZZ0A 3JZAA 2IS1A 2VSOA 2ZSDA 1DAKA 4BECA 2AK3A 3OIYA 5TY0A 1E9BA 2R9VA 1V5WA 4PSVA 1CULC 4PZZA 5KUTA 3BFKA 3X1XA 2PMDA 2ZPTX 4P4SA 4V0KA 1S96A 3THWA 1XZQA 3GJ7A 3NEYA 2VQSA 4LK2A 1DAHA 2PZEA 3DM5A 5BYKA 5EJEA 2C77A 3AF3A 2ZSAA 4KLNA 5KOYA 2JATA 2PBRA 4NZYA 4P4TA 1QHHB 2WKPA 5JCZA 2KI5A 2R8RA 2BBOA 1GVNB 1N3BA 4P4UA 1CRPA 3HDTA 3WMFA 2GWHA 4OBEA 3TR5A 2AKYA 1YVDA 1K5GA 4NDZA 1T9HA 1II8B 1KI7A 1G6OA 4LJAA 3AP1A 2OFXA 1S1MA 4TWZA 2XNDD 5FOTA 2C8VA 2IWRA 1WA5A 5FBWB 2F1RA 1E2DA 1IXRC 2ORIA 3NBXX 4BZQA 1GWNA 4OI1A 1P6XA 2GNOA 4MRNA 4NH0A 2XXAB 3GCGA 3ZLJA 1EWQA 4Q1FA 1IM2A 2W0SA 4B6FA 4MITA 1W47A 1I2DA 1ETUA 2RMKA 4HLQB 4OJQA 2GJ8A 2WKQA 1HEIA 1DO2A 4NONA 1FX0A 4B71A 2WWWA 4HAUA 3CO5A 3T1QA 4DLRA 3T61A 4C0QC 3B1WA 4ESHA 5CM8B 5KPJA 2FDCA 4HB4A 3TBKA 4B2PA 1MT0A 1QHNA 4DCNA 2VBCA 5L3SA 2PJRA 1VCIA 5DH9A 4PQFA 1N25A 3FFBA 1K8RA 1EX6A 2KWIA 3B60A 1IN8A 5JCPA 5EUMA 4TT3A 1XBTA 2BHRA 4BFVA 2ZRBA 4Q7LA 4JMPA 2J46A 2QROA 3EA5A 5FTKA 1TEVA 3LFUA 2ASEA 2JLQA 2I3BA 1WDTA 2ZS7A 3C5HA 3FE2A 5KNBA 4TMXA 4F91B 2PEZA 1TUEA 4MRSA 3WYAA 5CITA 3ADCA 3EASA 4JL8A 2FH5B 2GXAA 4D25A 1Z29A 2J0UB 1C9KA 1N6KA 4TMWA 4AURA 1XMSA 1RW4A 5B64A 1OB5A 3MWYW 1RRGA 4CGZA 2BDTA 3RS5A 1QG2A 3OHMA 1KDPA 4TZ0A 2OEPA 2V54A 4MGKR 4JBWA 1KNXA 2J41A 4HUQA 1EG7A 3CPHA 3AF4A 3MSXA 4FCVA 1E6CA 3TW8B 1Z0DA 2BEJA 2ZJAA 1O3YA 4LHZA 3BFXA 5JHGB 1K5DA 2KSQA 1Z8FA 2R6AA 4OHYA 3OIVA 1Z6YA 4PC7A 5JLJA 1DADA 2X2EA 2ZRMA 3T35A 1QHXA 1E4VA 2FFAA 3IPYA 3TAUA 2IYLD 3B9QA 2ZAOA 1W1WA 1BO6A 2XNDA 3P4YA 3C8UA 4KSBA 2B92A 4LWZA 3AVWA 4QBFA 2O0HA 4P33A 1FP6A 2GXUA 1ZCAA 3FMPB 1CXZA 4B75A 1YHNA 5FOXA 1YZLA 3I1FA 4NHOA 1MR3F 4K81B 4EUNA 1Q22A 2RGEA 3EZ9A 3PUVA 5CK4A 4Q4LA 4NMMA 4KBGA 1P9NA 2GVZC 4A8JC 1JPNA 3BC1A 3IQWA 1ZUNB 4LJ4A 2WIAA 5KPDA 3RRMA 4DHEA 1JNYA 3PV0A 2AWNA 4U00A 2WAYA 3K70B 4FIDA 2JJ2D 1GDDA 2C9OA 1S9DA 1YJ5A 1F2UA 1IY1A 1Q20A 3CF6R 3EZ2A 4IFBA 2WWYA 5G40A 1T8TA 1G19A 2H7VA 3IUYA 3NBYC 4OHXA 1GZSA 4D0LB 3ASZA 4M1TA 4ZV4A 2JLSA 2VHTA 3O8DA 4PR0A 5JBQA 3VHXA 2ZXUA 5C1BA 4M9XA 5KU1A 1PJRA 2ZTSA 1N2CE 4M1MA 3KQKA 3P1JA 2DBYA 1Y63A 5A4JA 2BC9A 4TSFD 1HUQA 2D62A 1NLZA 3FGNA 1JR3D 2HCJB 3VR5A 4EPTA 1XNJA 2IF2A 3VTKA 4BZXA 4FD2A 3ND8A 4RKEA 1MV5A 2QAGB 2JASA 3LX5A 2C9YA 4WW0A 3PR1A 5J4KA 3ZS8A 3DVLA 1XP8A 1J7KA 4O2RA 1U94A 1KI1A 1G8HA 1SULA 1TU3A 3H4MA 4C0AC 2ZRGA 2P6RA 1CR0A 4TLEA 1E0SA 2ZVQX 3TLXA 4ZCMA 3GLHB 3N70A 4ZI3A 1HQYE 1HY3A 1IN7A 1R0XA 4LBVA 5ELXA 3A6PC 2R6FA 3U7FB 2O0JA 3R8CA 4M53A 1LV7A 5TVKA 3SFZA 2AD1A 3UIEA 5L3QA 2DB3A 2H57A 2OV2A 4DRZA 4C30A 1XMJA 3D7MA 4XWAA 3K0FB 3LXXA 4Q1CA 1E2MA 1KYIA 3TQCA 5EXTA 3BD9A 1R4AA 1PUIA 221PA 5CIWA 5CLLA 1AZSC 4JVLA 4ZO4A 4X8LA 3T5DA 1U8ZA 1RVDA 4DKXA 4DUGD 2DFKB 1VYVA 1NSFA 5FUWA 1O87A 1Q21A 3BOSA 4F4IA 4P32A 3CWZA 4B74A 2P5SA 1KI3A 1TQ2A 3A1UA 4KI0A 3W6OA 2REXB 2DYKA 1XXHE 4HZUB 1S0UA 2IYYA 4IRUB 5TXGA 2J7PD 4ILEA 4MDFA 3BB1A 2RHDA 3MJRA 3LBNA 2CMKA 3I72A 2QRZA 1X1RA 2JJ2A 4DDWA 4TTPA 4MRPA 1NJFA 2VRWA 5IK2D 1XXHA 3NBFA 1XDBA 4GOKA 4IEIA 5FOWA 4DCSA 2F3RA 4URVR 2JLVA 1DAMA 1JR3E 4EQ6B 4QBIA 4DLSA 3KKQA 3ADDA 2OXRA 3U3OA 3KQHA 2CLSA 4NE2A 3LDAA 5AJVB 2O8BB 1AM4D 1HTWA 1U98A 5B2ZA 2G77B 4AG5A 3QJYA 1F2TB 4TSFA 2WJYA 5FTLA 3Q8XB 2WWIA 1SKQA 1JR3A 1SHKA 3ZVNA 4Q4AA 3LWNA 3ZGXA 3BH7A 1N0VC 4KYUA 3QXJA 4BLOA 1E94E 3C16C 4ZDJA 5KNCA 1SVLA 4LHYA 4Q9HA 5KDDA 1JBKA 2ZRPA 3NIBA 4JLDA 4TQAA 3BH6A 2NZJA 1NN0A 4IHQA 4YMWA 4A0RA 3OIUA 2JLRA 1Y3AA 2Q6TA 4DLTA 2A5FA 5C18A 4TLBA 2B8WA 5CJ2A 3U3KA 1UM8A 4AD8A 1RRPA 3FFAA 2FA9A 4P4SB 3LBHA 5DIFA 1OH5A 4QG7A 2OILA 3THWB 2H8KA 1CEEA 4HUTA 1A5TA 1Z0KA 2ZVPX 3HYTA 3VKGA 1VG9B 3IBGA 5CYPA 1U8AA 2J59A 4FW9A 5KTYA 1CIPA 2J1LA 2Y8EA 1KGDA 3QENA 4Y0VA 1G291 4TTQA 4BRWA 5JRJA 1WXQA 1IN4A 1EK0A 2IXEA 3BB3A 3CZPA 4DT1A 1AGPA 4JLAA 3RVBA 4DUGA 1I4TD 1Z2CA 1NL3A 1P2UA 1RKBA 2I1QA 2ZI9A 4BZPA 5G3YA 5JMTA 1VPLA 3VR2A 4G3XA 1W2HA
chains in the Genus database with same CATH superfamily
3F9RA 3HCDA 4FINA 5HKLA 1ECPA 4DIFA 1FMJA 1GN9A 1N8NA 4JKIA 3C3CA 2GTPA 4WI1A 2XB2A 4XVCA 3TNJA 2YVQA 5KINB 1GPYA 4KXXA 1J2RA 4DNOA 2O7QA 2J31A 4GQBA 1H2YA 3LTNC 4L5IA 2A0KA 4BMXA 2WIDA 3O84A 3PRJA 3E2PA 3FYUA 5ESWA 2C7RA 1G16A 3VJRA 1JA0A 1VZ2A 2R47A 4ZWNA 2GBIA 1O0CA 1PW5A 2WKWA 3JQ8A 4LGYA 5EZYF 4N48A 1JR6A 4UCQA 3T3PB 4C3OB 4BLUA 2VP3A 1JFFB 3KHSA 3RVPA 1MO4A 3SE7A 3DVRX 3V2UA 2A59A 3FOWA 1MEJA 3R9WA 2SECE 2FRDC 4U39A 3UHAA 2JHFA 3EISA 1U02A 3G2LA 2QQ5A 1I33A 1FX0B 3JQGA 3O47A 3G2IA 3PC7A 4KTVE 4PR3A 3TIIA 4B3IA 2Y76A 3QELB 4GEKA 4IJQA 3X1ZA 3X2FA 2HYIC 2A9JA 2W6OA 1BMQA 2NIPA 4ZVPA 3RSGA 4DC9A 1JBQA 2GCOA 3LU1A 3AFOA 4M1EA 3LUBA 4S1VA 3MCUA 5GOZA 3ZDAA 1QGUA 3QW4B 3ZJYA 4HVTA 4LX8A 3ZDRA 1N5LA 2KJQA 1Q15A 2RH5A 1XZIA 4MWSA 5A4MS 2BTEA 2CVHA 3WDSA 2DTDA 5G4KB 3JSAA 4A8PA 4KPUA 1ZU4A 4OKSA 1IVNA 1GAJA 3FTQA 4JP5A 4ZQEA 5HR5A 2BMAA 3I2KA 3HO6A 2HRQA 5ERYA 2DHEA 2CLEB 1N7GA 4QYIB 3B1VA 2IZZA 4L8LA 1NBEA 3KDSE 1VLJA 3KQSA 1ZMTA 5I4CA 2OD9A 1HT3A 2FR8C 1TTTA 2HO5A 3VGJA 5LKAA 4FZRA 4IS3A 1QKJA 4JJAA 2MSLA 2WOJA 2G6TA 3B13B 1QONA 2H9IA 3FVVA 1I3CA 2E6UX 1NG1A 2QP4A 4BVFA 5HOEA 3HB9A 4M87A 3REFA 4F71A 3GEBA 4XDGA 3VAAA 1ZJYA 2XVZA 3N9IA 3T9CA 3PDCA 1ULHA 1UJBA 4JLOA 1WCXA 4YPOA 5KNDD 4DMGA 4FNOA 4Y67A 4KQEA 1DARA 2IOYA 3N7TA 5EEGA 5EKSA 1JAXA 2FCAA 3CLTD 3AUKA 1BXGB 1L3IA 1TRKA 2XJ4A 1TCCA 2O50A 5E3JA 4OKIA 5FO0A 5GJCA 1E63A 4HWRA 1CX9B 5LQCA 4BRSA 2A35A 3Q8KA 2X5OA 1KU6A 1WJGA 1XVVA 1TB4A 5DEOA 4L6AA 3IAFA 2ORED 5LSAA 1SB9A 2BFEA 4BVLA 3FWYA 4WXRA 1NC3A 3T54A 1YB4A 5JPCA 4L8FA 3VH2A 2O2DA 4JBGA 1RABA 2IU0A 5KTMA 3FA2A 1TK2A 4R6WA 1J22A 3E35A 4IIDA 4E6EA 4WECA 3KUDA 3AIIA 3PEVA 2I7VA 2MSNA 4N03A 1W0JA 4XD2A 2ZYDA 1X87A 2QX6A 3P2KA 4MVJI 4YT8A 1FFAA 4LRTB 4RZUA 2CXOA 1TKCA 4LVUA 4UM7A 4BX8A 5JO0A 1WDLA 3P0HA 4P54A 3QITA 5ICGA 1Q0ZA 4E1BA 4ZTUB 1Z3CA 4UEOA 2W71A 3A6GA 4YRKA 2WVAA 1F2UB 5JS2A 1XPRA 1GQQA 1JU4A 2VYQA 3G8YA 2IHVA 3B6EA 5HZHA 2CB0A 2FWRA 4MAFA 4MJLA 4U7JA 3O4FA 4DCOA 4G1EB 4O8ZA 4PONA 4QD3A 1ZLXA 5CX4A 5HP4A 4I3GA 2HO4A 5DWDA 4LVOA 3LLCA 2WSMA 3IAS6 5ARCA 3CUYA 1D9ZA 2XZDA 1NUQA 1T1RA 1KI6A 3EODA 4MKGA 4S1NA 3T7IA 2AXPA 4AAYA 4LHEA 1ESNA 3O94A 2EHDA 3UUWA 2OFFA 4FNGA 1YBVA 3DOEA 3O8BA 2AFVA 4PF1A 1P4GA 1XRNA 2Z56A 2ZR0A 4H3HB 5KVQA 1VL8A 2XQFA 3CFYA 4PSDA 4AY6A 3T34A 3OQIA 1Z5UA 3W9YA 4H17A 1N2CB 2V3CC 1FXUA 3QWIA 4U8HA 1XFDA 4MR8B 3C8DA 1UBLS 1B7GO 1UPCA 1OUMA 2RKOA 4I55A 4GZLA 4LQLA 4O2AB 4OQNA 4RK0A 4G37A 1DRKA 1KK1A 1ODCA 4JL5A 1G3IA 3GJ4A 4P98A 1JSZA 2IBMA 2YUTA 3A11A 2VHZA 4ID3A 4WLFA 5IAGA 1PFVA 4M0LA 1PG2A 3N8IA 2C5HA 2P2ZA 5AJUA 2X8WA 3PGXA 2QYSA 4CCSA 5K8TA 4R51A 4ZVMA 1V3TA 2D1YA 3I32A 4YCMA 1VE7A 3R5XA 1KOFA 1MUUA 3ESQA 3J81A 3QF7A 3CE6A 1N8SA 2RI0A 1UCFA 1XVUA 2C82A 3A3KA 3UY4A 3K71B 2WQ7A 5GZ1A 3UJDA 4HEHA 4NBWA 1F9AA 3KKMA 4MS3B 4ADSG 4BJ5A 4ENQA 5JXJA 3QMWA 4UKDA 1I7QB 1DXYA 3MWLA 1RKQA 4XX0A 3GBPA 2ZT7A 2AXEA 3AOEC 2DQ4A 4ZXPA 3S2EA 4N49A 1Q7RA 3G2OA 2O3JA 3H9QA 3B48A 3OH8A 1PKXA 3FAKA 4BO2A 3WNVA 5JH7F 3ADPA 3I4LA 4PGFA 2Z1MA 5FD8A 3H5RA 3O4IA 4DV7B 3ODPA 5JUWA 2UUCB 1US8A 1QG0A 5CX1A 3WLSA 4I6JA 3VNRA 1KJZA 2AEFA 3MLAA 2ZI4A 3OTQA 4GNKA 4JYPA 3PNSA 4IO1A 1YV9A 1ZRNA 1RC0A 5A9SB 2ZYHA 2JEOA 3QRWA 1ZM4A 2ECFA 2EP8A 4PLYA 2ZQZA 1NW4A 4J0IA 2PKQO 3I5UA 2GJ4A 2QX7A 2ZKIA 3DAGA 3FCYA 1PW7A 1JLKA 3IHKA 1HYEA 4PX2A 4XPIA 3BQNB 1H8EA 4CN9A 4ETIA 5BV7A 3HBFA 3GVPA 1KEKA 1M6VA 3C1AA 2LCIA 1P5RA 2IV3A 1UC9A 1S9HA 5FLEX 4IJUA 4C07A 3K5PA 3IDQA 5M29A 2W6IA 3TEJA 2E5WA 3V8BA 4GOJA 4DLUA 2CXTA 4JKOA 5I01A 1ONOA 3H18A 3WLTA 4KQFA 4HAZA 3ELYA 3ZCRA 2Q8NA 2BEVB 2PYDA 3UUGA 3LFTA 3BRWA 3BTSA 5LYJB 1JQJC 4Q4AB 3V1TC 5DE3A 4ESEA 2W58A 1EGMB 1PE0A 4BVKA 3AVXA 4QO7A 2N46A 3N3BC 4HH0A 2ASVA 5EG5A 4O4HF 4MRRA 3GQBB 4DR5B 2ZJ2A 2YHUA 1P1JA 1C29B 3D8BA 3HPQA 2N75A 5HS6A 4CMBA 2BE7A 1YZGA 5JD3A 5CXSA 4EH1A 3AL0C 5LP6F 1L6IA 4WCVA 1RE1A 2HCTA 1C4WA 4LEIA 4CLEA 1XCJA 1WVIA 1ZNQO 4R7GA 2V1XA 1J8VA 4QL3A 4E2YA 4OO3A 1HOXA 4IVQA 3TSOA 3VTZA 5LQUA 2OV3A 3LP6A 3ZYZA 4BZZA 3MRSA 4MRVA 1U04A 3FOAA 4IDBA 1LW7A 5H5JA 3C39A 4K3UA 2BHLA 5T8KC 3IKVA 2G7ZA 1YB6A 2HX1A 3CY6A 3ETCA 4W9NA 1DV2A 4QJIA 2RHLA 1CRLA 3P9NA 4OQYA 1GGFA 1DQNA 3QNMA 3GOQA 1Y1QA 5CT6A 1UDRA 1UOOA 1V6AA 1IXZA 2VZLA 4M1QA 4EKDA 1A7JA 3PDJA 1KQFA 1QLJA 4A8JB 1Z6AA 2QW8A 4YQYA 4KFCA 2FEPA 3SQWA 5LLTA 9LDTA 5ALVA 1RWBA 1WY5A 1YQTA 4MINA 4KV7A 4BVGA 5C7YA 3L0YA 3CX3A 3V9PA 2R44A 1HE2A 3VR4H 1Q1NA 3X1WA 4CM7A 4LIPD 3O93A 5HE9A 4FNMA 1G98A 4M8LA 4Q9NA 2DUUA 2GJSA 3DAFA 1SUDA 1X8JA 4MW9A 1L5RA 2CNOA 3KJHA 2ZRKA 3FCEA 2B30A 3PGVA 3AHIA 3GYBA 4HL6A 4UOEA 4MO2A 1D2CA 1Q11A 2HMVA 4Q1BA 4TXMA 5EJ6A 2PS9A 3GMTA 1W75A 2KHZA 2PX8A 4XFDA 2ZXFA 3ZHOA 4V0RA 1E5TA 1Q91A 1T15A 1XTBA 4JOQA 1TOAA 1SCKA 4JUBA 4OB8A 3V4ZA 3VXKA 4B34A 5J2UF 3K6SA 3AEKB 4C4SA 1IOZA 1V39A 1PQUA 2HFJA 2OK8A 2GLXA 5F1YA 3OOWA 3WP0A 3EZGA 4CMEA 3GGPA 1NRIA 1FJ2A 4Y2JA 1L8AA 3I5YA 1E7RA 4OHFA 1C7FA 2R3SA 4GI5A 3VC1A 3LK7A 2DUNA 2ZSEA 1NYLA 3A28A 4MOWA 5IYZA 4M6WA 2BGUA 5BNWA 4UM9D 4B80A 1RJ9B 1V1RB 1M2HA 4N6NA 3S1LA 4R1PA 5DEIA 4CR6A 3MCTA 1IWPB 1PWZA 1RM3A 1Z5WA 2G5GX 4GLJA 1JSRA 4N8EA 4RPKA 5BSFA 3AH8A 2F67A 3AUSA 5IT0A 4G5XA 4XIFA 1TM7E 3LQKA 1CB0A 2GZRA 3DVAA 5DOZA 4F86A 4E5NA 4EY5A 2ZDHA 3JXEA 1COWD 3ROZA 4QJ3A 1LI5A 2WJWA 3A4VA 3VOTA 4Q6WA 1ZMBA 1YDHA 3RJ5A 2OVFA 4R05A 2OOSA 1VHTA 2ZJ5A 5A4IS 4IDEA 3QEJA 1KPIA 2ORYA 4GBMA 3TOZA 2VK4A 1ZOIA 1HE8B 2P3SA 1SKUA 3R3VA 1U90A 3VGPA 3FDFA 1PZFA 1OPXA 4J2OA 2FF5A 2O1EA 4I1OA 1TLTA 4LKOA 3C85A 4CKCB 2GAOA 2Z2XA 1GNVA 1MORA 5HEKA 1LTKA 1HYHA 3TE6A 2XCIA 3DE3X 2XB8A 1CSEE 3O2QB 5TPWB 5K8UA 2P6UA 1D1SA 1WEHA 2NZWA 3I9V1 2CJWB 2OXEA 1UMDA 4G0XA 3RSHA 1ZN8A 4WD3A 5JYBA 2HMUA 4IHJF 2NUPB 3PEYA 3ZWXA 2WSSA 4UDYX 2XMGA 4G4GA 2WPDA 2REQB 3FWHA 4MHTA 5FNVF 2OP0A 2HIHA 4BFXA 1P9LA 4O63O 3NBQA 4OQQA 3L1UA 2MIIA 3GNLA 4BO7A 5JE8A 4CUZA 2GN2A 3ZS9A 2AHOA 1JR2A 1DKMA 4J07A 1ECLA 2H2FA 2OGUA 2NYAA 4EYOA 1E3TA 3LM8A 4E12A 2Q27A 1I2AA 3B51X 4LYGA 3TVTA 2OBLA 5DX1A 4KUHA 5ALRA 2C99A 1YACA 1RXWA 1GGKA 3RRNA 4OQMA 4FZ5A 3KOUA 4R0VA 4G5HA 3MT9A 4E21A 1RZRA 4KACA 3FR8A 3OSZA 4KFUA 4LYAA 2XD4A 2H2DA 3ITDA 5G2OA 4LY9A 4EMSA 3OJCA 1QHEA 1RM0A 2ZR8A 2O59A 2RHRA 3SYTA 1I2ZA 1E9SA 1RMYA 1VSVA 4ID9A 4RAOA 2XSZA 1WP9A 2B5OA 2ZUBA 3B7GA 2QZZA 3KXPA 2HQOA 2IHZA 5U4QA 1WNFA 1YQEA 2X2OA 2HA2A 1AGNA 1WCV1 2IX9A 3LCUA 1WPQA 1M34B 5EINA 5HJEA 3JAMA 5BMVA 1E62A 3K53A 4LYEA 4WY5A 3IUPA 3ZE1B 4XOUA 2PUJA 2GKOA 3AEQB 5P8WA 2ORWA 3MHTA 3H2SA 1YRYE 2P9CA 2R1ZA 1CUHA 3H7IA 4DDMA 1GPAA 2X4IA 2JVKA 4DA6A 3PDHA 2J09A 4MSUA 3VTFA 4HLDA 1EFTA 2CKDA 2NZVG 2PSFA 3O83A 4MHOA 4TGLA 4WKOA 4DM4A 5CB8A 2HA3A 2RGRA 3TL2A 2GDJA 2AD5A 2XGMA 3VISA 3WGZA 4EW1A 3W9BA 1E6UA 2LWIA 1SKYE 3PC2A 2PA0A 2HB6A 1N2SA 3DOJA 1BWQA 3K32A 4U2DA 5KSZA 1QO0D 4X54A 2I8CA 1E7MA 1KO4A 2G1KA 4G8BA 1QTRA 2HRZA 1KO5A 2OM6A 3ZWBA 3IP7A 1U2PA 1XTSA 5F1OA 2VQFB 5JPDA 3IILA 3O1LA 3HA3A 4XWOA 4QASA 1A1SA 4F84A 1VCNA 1T3SA 1V43A 2GCPA 3DE0X 3VJKA 2IUSA 5JSZB 2HK6A 4WH0A 3PX3A 1SBQA 2CWDA 2ODPA 3I6ZA 4MMXB 3KTAA 4C7JA 5FKJA 2GHTA 1WRBA 4EVRA 3D6JA 1TRHA 2FSUA 1ENYA 1GIAA 1Z8NA 1GOTA 3HGMA 5LMZA 3QEBZ 1FF9A 3BK7A 1KZ6A 3HZHA 3W3ZB 1K5PA 3MINB 3AVUA 1P9WA 1L5FA 2PO7A 3NOQA 3OO1A 5EN4A 2GHRA 5HGJA 1SHZA 2OSVA 3R3XA 1Q12A 1NVVR 3VYUB 1ORHA 2GHQA 1UMBA 1TCVA 3A4LA 4Z0PA 2OUIA 2GCNA 3V32A 4CE6A 1P1IA 3U4QA 1X86B 3DB1A 2G9QA 4CF6A 2I91A 3MMPA 3A1DA 3TUIC 5I7OA 1QRTA 2BCGY 5CA1A 1BMDA 2IDKA 1JZSA 2FZLA 7ABPA 1RJGA 3UFBA 1AUOA 1UJCA 3K0KA 5F7JA 5ILGA 3V2IA 4C6SA 5KIAA 4DR4B 3LX4A 1SCQA 5BO5A 5T6BA 4DWOA 5F5LA 1QGED 2VSXA 3LT4A 4F38A 1J0BA 4YJ2F 3DO8A 4BTLA 4TYPA 4AY3A 1MHTA 2ZYGA 2RAPA 1QOQB 5JWRA 5JD6A 2BMEA 1X2BA 1GT91 4ZOCA 1V6CA 4L5CA 2WD9A 3H0CA 4XW2A 1ECFA 3E7DA 4A91A 3TLJA 3JQRA 2BFBB 1UZMA 4JHLA 3ZI7A 1TYCA 3OHSX 1WXIA 2R6R1 5TT0A 2ZQ5A 4H18A 1XJQA 2Z3VA 1H22A 2I67A 2SKEA 1K8XB 1EESA 4CF4A 2GT1A 1Y3IA 3IIKA 2NZYA 5LN1A 1KAEA 4DJAA 1PGQA 3HJRA 3NKVA 1CV2A 3L07A 3SBDA 4A5SA 9LDBA 1XCLA 1E7YA 3NTLA 1Y9ZA 4QPDA 5GONB 5B1IA 1L7BA 3H8WA 3P0RA 1DCMA 1JPUA 2X8JB 5BR7A 1FFWA 2HJSA 2NTYC 3TYXA 2HA6A 3ONNA 2QBYB 2CNWA 1YO6A 5H70A 4BVAA 2HLDD 3E22A 3G1UA 1DBIA 2EGUA 3NUGA 2VXYA 4FMDF 1KAQA 1FFGA 1XR3A 3HP7A 2V6JA 1MW9X 2JZCA 1FRQA 3VZBA 3AETA 2AQ8A 2QRNA 2ZRFA 1J5XA 1VPVA 1J49A 5IKXA 2QMQA 1ZVJA 2ZBUA 4IXDA 4O4IA 5AXDA 5TEWA 2Z09A 3A32A 4V1CA 1YB2A 1Y6QA 4ILKA 1GG8A 2XZOA 4KQWA 3QVLA 3M5PA 5J1TB 4FB4A 2CCJA 1T0UA 4NEQA 5LMUB 5DKFA 1A4UA 3V5NA 1VKNA 1N0WA 4FN4A 2OGZA 4ZT3A 5FR1A 2GH1A 1QE5A 4EOGA 1E2FA 3OLZA 4KP7A 5A3VA 4BC1A 5L8VA 4NCAA 4LGVA 2DR2A 5A0FA 1PSDA 1L7RA 5TQ0B 3EMDA 5E4FA 4E2FA 4FYMA 1VPTA 2NLOA 4NJMA 1I7NA 4PNZA 4LNUA 3P2JA 2XNKA 3U44B 4D41A 2QSJA 3BEDA 3ISJA 5D86A 4OGFA 4RZQA 2V7WA 4C06A 1E3EA 4AMVA 2XCSB 3ZK7A 2COEA 4CYMA 1LX7A 1NOKA 1MRSA 2HF8A 3Q5EA 1EPUA 3TZEA 1Q50A 1SC3A 2XNSA 3OT1B 4MCJA 2P9HA 1IB0A 3CF4G 1V16B 2JGAA 3T99A 5LZ9A 1YFLA 4JGBA 3AQ4A 3QEOA 3A9VA 3WICA 1TD9A 2ZVDA 1JJFA 3R7DA 4U1RA 4FI3C 3F2IA 3K1ZA 4MVYA 1ZS9A 3EF0A 1EUCA 1VJGA 1L7DA 1I4WA 1T35A 2C5GA 3RC3A 3BIFA 5AVKA 2RGAA 2I33A 3EPJA 1TW3A 3VU9A 4DLVA 1TI7A 4XRRA 4CEHB 3QTTA 3I53A 3P96A 2V9CA 1LBHA 5LXTF 2WJ3A 5HF6A 2QZJA 4ND6A 1E7SA 5GIPE 1ZJ6A 2FX5A 3CF4A 4XA8A 2IZ0A 1VIMA 4INJA 2QSZA 3I0MA 3NQ41 4WMLA 3GY0A 5B1SA 1HLPA 3M34A 4LRSB 4TLDA 2NSHA 4RHCA 2EF1A 4Y18A 1ZSVA 4OSEA 3CZQA 3HS3A 4BQRA 5K05A 4DR1B 2HSDA 2C83A 2X1HA 3E27A 3L5OA 3BSSA 4JVSB 4P5PA 4GMGA 4EA8A 3CCCA 2ECQA 2PWPA 2IF0A 4J0GA 1M2JA 4LE1A 3HN6A 2Q28A 2AVDA 4M2LA 3VSDA 3DFIA 4JFAA 3WL8A 1JHXA 1OW3B 3G8DA 2V7QD 3HUFA 5SY9A 1EFKA 3A6ZA 1YBAA 4TLAA 4B8ZA 1DTSA 3MMXA 2FDXA 3HKEB 3N58A 3QQPA 4PXYA 2JGDA 2QLLA 3OJFA 4A0FA 3GPBA 1U81A 2WJGA 1LDNA 2OG1A 3A6LA 2ID4A 3W1WA 5H3LA 1FLDA 2WQ6A 4ZEXA 5FA8A 1VHQA 3DHEA 4CIDA 5IC6A 1TO2E 1WVMA 3QPVA 4EW6A 1J5PA 3HR4A 2OCGA 3ORFA 5IVIA 4ZMRA 2Y66A 3WGOA 2WV9A 1R4NB 4MTCA 4OI0A 3RS2A 1IN1A 2TMKA 5JHHB 1Z9BA 3VM6A 3O4JA 2B2CA 3ZY5A 1S2OA 1RC1A 8OHMA 3I3OA 1Y42X 3M4XA 3EGXB 3K0BA 2O57A 4WNIA 1RQNA 1XD2B 4LJ5A 4I4TA 4YECA 4BOYA 1O9HA 1KERA 4PAMA 1RLUA 1I4EB 2AQHA 3H83A 2R62A 4MW0A 3UH1A 5CNKA 2C92A 4D45A 4E1AA 5CA0F 3R3UA 1QBGA 2ZJ0A 5AW0A 3G85A 3O2SB 3OIDA 1KYTA 1T5TA 4MUXA 5A1TA 1O95A 2XBUA 3N53A 4KO1S 5K3BA 3JYLA 2W42A 4AVYA 2BWJA 4EYEA 1I94B 1PFGA 1NW3A 3C7AA 2BL4A 4XQ0A 2CE2X 2AOVA 3EDQA 1DIOB 1ECBA 1XZJA 3EZYA 4FSXA 4FVTA 4R5MA 5IX8A 2XVYA 4R7TA 5AWFC 5FQOA 4YCDA 3NNDA 4WFIA 4ND5A 4YEDA 4FZVA 1Z0IA 4KO2S 3L40A 4TS4A 4UEWA 4E13A 1COZA 1FTGA 3FSRA 5D84A 5BN5B 1T2AA 4OMDA 2XUHA 1V96A 1Y4DE 2KM1A 1UJ5A 1I8TA 3T94A 5JSFA 5AVYA 3DULA 4WOKA 1VSQA 1T36A 5H8WA 4FPXA 1SBIA 4BNUA 4DLBA 2B36A 2X23A 2DFPA 2J87A 4JLUA 3A4IA 4KK4A 3PQ8A 1P19A 3PYLA 4Z9YA 5MFZA 1EK6A 2JK1A 3BB4A 4FR5A 1GZ6A 1YJ8A 3GPDG 3Q7TA 3UENA 3RFXA 1P73A 2DBQA 5ITVA 1GKLA 2LZ0A 4F6LA 3WBJA 3G17A 1G20E 3HRHA 4ISCA 1XIVA 3O91A 4G1VA 5EJ9A 2QXYA 4W9NC 2R1TA 3K7EA 3WAJA 1JHYA 2FJUA 1P81A 1U0NA 4X1IB 4BX0A 1SUIA 3WNBA 4ZAXA 2ZWVA 3THYA 1CR2A 2DP4E 1ZCFA 1FXWA 2R68A 1Y8QB 4LS3A 2J9YB 4DCGA 3D3WB 1G20A 2BLLA 1I32A 1WSDA 2BGLA 4GPAA 4KIUA 1J1IA 1B0ZA 3VRHA 1E3IA 1FS4A 2WLTA 1YDMA 3W8EA 3R0QA 4MW5A 1ZWLA 5JAIA 1G8JA 4JGGA 5F7ZA 4DWVA 4E5UA 4JR0A 2ZJ4A 1MQ8B 3EXHC 4PLTA 4UE6A 3M3DA 3T7JA 2B20A 1HF3A 1AK2A 3LL7A 1RI2A 3U4AA 4YJDA 5CVJA 3JRWA 3VNQA 3AVTA 3DAHA 3C3DA 3WKBA 1W85B 2C5BA 3LHIA 2YJ6A 1X7ZA 2QR5A 5D01A 3AV3A 1MZPA 1LC3A 2ZIFA 3D6UA 4W7SA 5EHNA 3W1EA 1AKQA 3PENA 4A4DA 3EQ2A 1X92A 1GAEO 1FFHA 2SNIE 4D9NA 2YYZA 2C9ZA 3IHWA 3VHQA 3U49A 4AUMA 2AUTA 2G1PA 3MAGA 5G0VA 3HI6A 4I4LA 2OHFA 1TVMA 1ABFA 1IOWA 1Y9AA 3NHKA 3A9CA 1G8KA 3O38A 4BB0A 2X3FA 2ZYSA 3ACBA 4WNAA 3PQ3A 4C14A 4O3FA 3W6UA 3LPLA 3LWBA 1U4SA 1PNTA 2VH5R 4FLEA 2HCRA 3VZCA 2OO5A 4Y6QA 3WLOA 1WB6A 2NVUB 2JD2A 1PEAA 3E48A 2VQ6A 1GCGA 3MILA 4PRLA 3QVGA 3GZTB 4TWJA 3MT0A 1P9RA 3HSKA 3WK7A 3QWFA 1RHMA 4PZUA 1TU4A 2ZS8A 1N57A 1VDZA 1HV8A 5G41A 1TYAE 1VI6A 2HI0A 3FVWA 4OQFA 1LRLA 3C5CA 1EE1A 1JIXA 3MOIA 4MVJE 3TS1A 4I2VA 5B36A 1VHWA 3ZU6A 3VH1A 2DMRA 1G8YA 4DA8A 3CUTA 1L5HB 3D5EA 2OCAA 2K7FA 1UBCA 1UBFA 3WDLA 4B82A 4EB3A 1ZI9A 4NAVA 4QELA 1GZ7A 3AV0B 2MJLA 5DHAA 4MVJA 2QE6A 3DCIA 1F5SA 4FYYA 1EZ1A 4NZOA 1RPTA 2O9JA 1EX9A 2QTCA 3M7IA 3KT8A 4LDNA 3UC9A 1HETA 1EP1B 1CUYA 1KJ9A 2RKBA 3MLEA 3MN1A 1H2EA 4L0MA 4MH0R 4UCFA 4WXPA 1BX1A 3KOYA 4TKUA 4H6WA 4IXMA 3BXZA 5DPMA 5LMNB 2XAAA 1XXLA 4OPMA 1RJFA 1EUYA 3VH4A 4B2LA 1DIHA 4WKCA 4XD7A 2R4UA 4BVBA 3OQHA 2JGFA 5AH0A 1X7XB 3QLJA 1LSJA 1V5EA 1X1BA 2ZFUA 4I5FA 4K3VA 4YP5A 3SYKA 4RZIA 3DW3X 2NXWA 1K0UA 4BXOA 2ERXA 2X6QA 2IYZA 3JW8A 5CVVA 1QFXA 2A5DA 3A06A 1JU3A 2F6RA 5FOVA 4PPQA 1D0VA 3VVMA 5EWMA 3EVEA 2Q9BA 3BHMA 4AZ3A 2D6FA 1KI8A 2C00A 3O2JA 1ABEA 2R8PA 4LWOA 1KFKB 1KPGA 3L6RA 4RE5A 5K0ZA 2WM8A 4KH0A 2V9PA 1KE2A 1OF1A 2ZRDA 4V38A 4BWYA 4E5SA 2VTEA 1Y3BE 3TSCA 1V45E 2Q0HA 5CVDA 1SFRA 4U9IS 3QEKA 3RVJA 3OWHA 2GPTA 4MW2A 3ZHSA 1P5JA 5CGZA 5AUPB 4EFLA 1T4MA 3AR4A 1CP2A 5LIPA 3D7NA 1GYPA 1RLJA 2QB5A 4TTSA 4F3TA 3KWLA 4Q00A 5EMJA 2QXTA 2PX3A 3HMQA 2QF7A 2G36A 3V9AA 2SCUA 5GM2A 1AIPA 1TUIA 2G4VA 1SUAA 2EFDB 4XGRA 3TNYA 4KGXA 2VHXA 2H92A 3WYFA 3REQB 1JLLB 1X1DA 2YV2A 3GU3A 4TMVA 3THSA 2CFRA 4GR5A 3NTQA 3DQQA 4KN6A 5T67A 3UBTA 2OM2A 2PIDA 1EUDB 4AG3A 1Q1AA 2P6PA 3EAGA 5CDFE 1M3SA 3HEMA 4X0EA 3K0AA 3H6KA 1G1MA 3JVUA 1BROA 1OFUA 3HKCA 3NBUA 5D8DA 1HL7A 4FHEA 5DVZA 4DNQA 4EENA 5ICSA 4LFAB 2B4QA 1EQAA 3EFHA 3T5CA 2WICA 3MWKA 1C9MA 3T41A 1JHAA 1F06A 2PANA 4MAAA 4AF8A 4E51A 5CDFA 3K73O 2PFGA 2J0VA 3UAGA 4JBYA 1MO2A 4Z99A 3STHA 5T4EA 3U37A 5INTA 2I87A 2EFEB 1JEAA 1EI9A 5A2GA 3IGFA 1JQ5A 1XCPA 2B5WA 2RGNC 4IHKA 1ZK0A 3ROQA 3IUSA 2CLHB 4GC5A 4JB8A 3QEMA 3CPJB 4M98A 1NI3A 1DLJA 3LJKA 5AIBA 2C58A 3S27A 1QX3A 2WHRA 3HP4A 3RYIA 3KELA 2ZQYA 1L4MA 3PDIB 3SS7X 4AQ7A 3RBZA 1AKTA 4GVXA 4FGJA 5B6IA 4U6SA 2HH9A 1DKRA 1KY2A 3WXMA 3UCXA 4ZZ0A 1GCOA 3RADC 1FMFA 1Z15A 5EIBD 3PSAA 3PL5A 1VMEA 1DC7A 1X2EA 3OUTA 2C04A 3QFTA 3QF4B 3WHIA 3CF2A 2E4ZA 2R8YA 3L8FA 2EFJA 4Q9DA 3TEFA 3IOMA 4B17A 1TT7A 3PC4A 1PV1A 1JG1A 1P0FA 1XCGB 3CHYA 2RI6A 4D4KA 4O25A 4X41A 3IRVA 3UMVA 2GWRA 2G40A 1M33A 1MJGA 2VPZA 3LPCA 4KDEA 3ZE6A 4CLRA 4RTRA 2O8FB 1KIMA 1KJ8A 1PTKA 3DTVD 3IHTA 4A2CA 1LU9A 3PQ7A 3VMMA 2BKEA 4DLKA 3BK2A 1OBVA 3NHWA 4KFRA 3KZOA 2WDZA 2IGTA 1UZAA 1T0HB 3KWMA 2R6JA 1FA9A 2ONZA 4MPRA 4S24A 4HRVA 4AX8A 4WIAA 5F7OA 2QT9A 1AZWA 1P2BA 3AW8A 5BQ3A 3K6KA 4CKBA 3RSLA 2YN2A 4ZQGA 3ZBTA 2C4KA 1E8DA 1CUGA 1CJMA 3FTDA 3GH1A 1TKBA 1WW3A 4LNAA 1G3RA 1IC6A 2NX2A 2NZUG 3HU5A 3MVEA 5G4LA 3LIPA 3RC2A 4ENUA 3GGCA 4P58A 3ISTA 1U11A 3IMCA 3L0CA 5IKEA 1GILA 1XDSA 4V0OA 4GI2A 2AI2A 2ZROA 3I23A 2QS9A 3WNCA 3PYMA 4R1OA 4W1PA 1SBHA 3FMFA 3F3SA 3OEEA 3T3OA 1O77A 2V5UA 3RS8A 1WTAA 3OCZA 2QQGA 3E61A 4CT5A 3AYXB 2DPLA 3MCVA 3OX4A 4MLDA 5KSPA 5DLYA 3LUDA 3UHJA 3WP1B 4ZZ1A 2VRBA 4ZV7A 3EBOA 4IGKA 3OUUA 2RI1A 4EG0A 3P7MA 4IKOA 3S7TA 3V4LA 1WBDA 1KKMA 1KP9A 1VB5A 5HUHA 4G25A 3UJPA 5AHWA 3COSA 3H1GA 1GCIA 4YLEA 2BGMA 2J3DA 5K20A 1KIAA 2H7XA 3MGCA 4HSGA 4WL0A 5AKGA 1XA4A 3FGOA 1XE3A 2HWKA 4CL8A 2Q3FA 4KN8A 2IYWA 1HT0A 1KZGB 2GDZA 2M1XA 2QZ9A 2JH9A 3AZPA 1NXOA 3IEIA 2K87A 3MT7A 4P3KA 3UQZA 1O89A 1CJSA 4IJ5A 2G28A 1WZIA 2VTDA 1GARA 4RMHA 4OHPA 4PPYA 1ZI6A 2MWMA 1ZJJA 1JH8A 1PQ4A 2V59A 1O8CA 3IA2A 3CW8X 1I4LD 1ISIA 5ENVA 4U7TB 1CFJA 2CVZA 3LS2A 3E81A 5DLDA 5E7JA 3EC1A 1OAOC 3ON5A 1TFRA 2AXNA 4INZA 1Z08A 4JJZA 4NQZA 3OJ0A 1K4MA 3MTEA 2HV8A 2QTVB 4Y9SA 3MD9A 4MULA 3EXEB 2CLLB 1CU1A 1WABA 2AFIE 2E4YA 2CJYA 2H2IA 4PFQA 1Z34A 2XNJA 1H6AA 2CNKA 4M7OA 3RAGA 1TZBA 1X3SA 3OETA 1KQ3A 5TC4A 3VAZA 1UM9A 5B1EA 2FX2A 2YFQA 1JFFA 2IEYA 4P4LA 5EXPA 3UKOA 1E58A 2I3DA 1LA2A 2K6GA 3FFWA 2X9NA 4WY2A 3FJYA 1C7ZA 2Q6LA 2Q5FA 3PNYA 3D3KA 3WADA 3HI4A 1UXKA 4RTPA 1P6UA 3C7TA 2AFIA 1FVOA 2YNMD 4IYJA 2MCFA 4WLEA 3HY4A 4DSOA 2A33A 3U2QA 3L7MA 1XEFA 3MQ4A 2F4NA 2C2MA 3E0QA 1NOJA 5E0OA 3TJMA 3CZCA 4ZYVA 3AHEA 1UBRS 3EIXA 3MB8A 4LJ6A 2Y0PA 1BDMA 5I9MA 3LRXA 4Z7OB 4HLUC 4UOQA 5L6LB 1I0LA 1JLRA 3COJA 5ITZA 2BR4A 3TRFA 4B3XA 4QOSA 4FYIA 1W36C 5K01A 1NN3A 1EVJA 1IPHA 4KJZA 4W9MC 4PLPA 1E60A 1VSTA 4LYJA 2PUGA 2I2DA 1E2NA 4HPJB 1UKAA 1W52X 4YUZA 4DANA 1H3EA 2D1SA 3NWOA 2EAUA 2XQGA 1R1DA 2OV6A 5KU7A 5KTOA 4HQKA 4XJSA 1LPOA 1M2KA 4O5OA 4YLGA 3WKAA 2HGZA 3NEPX 4H7EA 2BKVA 2WUEA 4ZYUA 3N8NA 4G07A 4HAWA 2Z2YA 4XM2A 1JHOA 4HAIA 4JOCA 2YWDA 4HB0A 3RUEA 2JI8A 3DAPA 2EYUA 2J7KA 3IVCA 4GPTA 3MPOA 4M1ZA 3K70D 2C7GA 3PX2A 1ZUD1 3A2NA 4UUNA 5DI3B 3RHZA 4AQDA 1YCHA 4RBNA 3T95A 3LBFA 1LQUA 1W0KA 2DJ5A 2JFGA 1ZL0A 4RCVA 1OJ7A 3NOOA 4QSMA 4COOA 3LQRA 3KKZA 5KTRA 1YFJA 2VJYA 3F6EX 3QLUC 1ZXLA 5HF8A 3PFKA 1GQRA 2F1OA 1J09A 5L6MB 3CNOA 4AG6A 3LHFA 4LXGA 2E87A 4YRFA 5M04A 3ZOZA 2WAXA 1B26A 2OL4A 4FOLA 1BXGA 4Q03A 5K8JB 2AYYA 4W99A 3VDXA 4BJ6A 4UREA 4NBTA 1KQPA 1XWWA 2JGKA 1U99A 2Q2NA 2MYUA 4GC9A 6CHYA 3R0VA 5DRTA 2AC7A 5I7UA 1N9KA 5DISB 2O7VA 4H4CA 2DPGA 1Z5VA 5I4BA 5CCBA 3ICVA 2FP4B 4QPPA 4FJ1A 1B2LA 1D1TA 4DM3A 1YR3A 4FYJA 1N6NA 2HPHA 3DFFA 2P0YA 3RLIA 1BA2A 1EFDN 1EFLA 1L4LA 2UUOA 4TS9A 2WY2D 1E6KA 1P3JA 2YC2C 4RTLA 3KS9A 3D0RA 3RJZA 4XI9A 2DHCA 3INRA 4Y2QA 2QG6A 5CDGA 5EMKA 2F43B 1EZZA 1JYSA 4KMSA 1G8FA 5BOSA 1XAGA 5CEFA 5LA6A 5ICEA 1DJOA 1DC6A 1JQLB 2GN8A 2GKSA 2GYUA 2OBNA 2QMEA 3EZFA 3QLVA 1U9CA 3DE4X 5FNZA 1I1QB 1U9ZA 3R77A 1JG4A 2P2YA 3AOGA 3BL5A 3DGEC 3T9EA 4L08A 3ZBUA 3BZUA 1PS8A 2RJOA 1E79D 2ROQA 2VC2B 4GYWA 3U48A 2WUWE 3HCAA 4KITB 2H1RA 2CVOA 3EG9B 2IUYA 2I71A 3GROA 3IP8A 5E6RA 3ROMA 2YWGA 1HEYA 1RRFA 5LWHA 3ILHA 4TRMA 2W2OA 5I9SA 1A2OA 2DUWA 3E4CA 3PNKA 2RH4A 3DKVA 4YH1A 5B4TA 4BGDA 5HX7A 4KR3A 3KZXA 3E5HA 2MSCB 2BONA 3RVRA 5CDHA 4G4SO 5FI0B 2F55A 3JQBA 3AHCA 2A9QA 1L8XA 4KKXB 1C0IA 5LR6A 1B1CA 1UL1X 1U2RA 4C0KA 1KS9A 2B34A 3THRA 2ZUSA 3L6CA 2VG8A 3R3ZA 2FEXA 1RT9A 1V4VA 4MVCA 3TN7A