2RMKA

Rac1/prk1 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
192
structure length
192
Chain Sequence
b'MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title The Rac1 Polybasic Region Is Required for Interaction with Its Effector PRK1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/transferase
total genus 32
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rmkA00
3K9NA 4LPSA 4DLRA 2YKGA 2QE7A 1SXJD 3RWMB 1TQDA 5K8IA 1L2TA 1XFAA 1YR9A 2F3TA 5DN6A 3LRPA 1E1QD 3K1JA 2V3CC 2H92A 2BIFA 4QRHA 1RFLA 3RC3A 5FR2A 1IJEA 1AKEA 3K0AA 5IT5A 5FL7D 3WYAA 3TUZC 3GJ4A 3RRZA 4LWZA 1KIMA 3FE2A 2A7QA 3RC8A 4RD0A 2OCBA 4GL2A 2YV5A 2FJUA 2XTNA 1TEXA 4LV6A 3AGPA 1CKEA 1O87A 4PC2A 1UEJA 5CIWA 4DIEA 1S1CA 3CWZA 3N70A 3P1JA 2A5JA 3VNUA 3AB3A 4A8JA 3WRXC 2PZFA 1GL6A 5B2ZA 2VRWA 5SZIA 4NU0A 1MO5A 1SVIA 2D62A 2OM2A 1HY3A 4IXNA 2LKDA 3RAPR 2FEOA 1XMSA 4LBZA 3QBVA 3UXMA 2R6FA 3THXA 1U2RA 3OIUA 4HUTA 3QG1A 4QOSA 3B1WA 1XJ0A 4KHZA 4QNRA 3GEEA 5FOWA 5CM8B 2VPPA 3SJBA 3BERA 3AVVA 1TAGA 4DLTA 2IYUA 1WBBA 1J8YF 2ZSEA 1H8HD 5JZVA 4TYPA 1P5ZB 2ZSFA 5FPYA 3U7FB 3ZQJA 2ZYWX 1MO3A 1OXSC 3BFKA 2JA1A 1YZQA 2IK8A 1G20E 4PC6A 2FOLA 2XJ4A 2ATVA 4LYAA 1X3SA 3OESA 5JSZB 4DLYA 5GJBA 5P21A 4LYJA 2O8CB 4P4SA 3W6NA 4OK3A 3KDSE 4A9AA 3JZAA 5J5CA 1W0JA 2AFIE 1NMYA 2P3SA 3BIFA 4KCGA 4WZ6A 3TSWA 4HDOB 3TK1A 2PH1A 5HZKA 1GVNB 3K09C 1Z6YA 1NNEA 4QBIA 1HE1C 2GEVA 1Y63A 2W2VA 1G16A 1XDBA 3NC0C 4Y0VA 1OSNA 4PTLA 3P32A 4UNPA 4MH0R 1LB1B 3T15A 1TU4A 2FGKA 2IHYA 2BJWA 3GLHA 4LJ4A 4RD1A 1OLOA 3T35A 4OQFA 5HR5A 4IOJA 1EFUA 3KTAA 3U6KA 2P5TB 2ZREA 3F5FA 4NBSA 1OKKD 3THWA 1FL9A 4ZPXA 4DLSA 2VSFA 3W5IA 3CR7A 3H2YA 3SYNA 2NG1A 4MUAA 3F8TA 1TUIA 4OI0A 3NWJA 3CONA 2WWWA 4TYYA 3HR7A 2ANBA 3PEVA 3Q7QA 2NTYC 3PEWA 2NPIA 1OXVA 4XWAA 2A5GA 1OIXA 3ZVRA 3EW9A 2WBLC 3SU8A 3OAAA 3AF2A 3OE7A 4GFDA 3LVQE 2FSGA 1GRRA 3QVVA 1Z2AA 3QXJA 3GJXC 4WAUA 4EPXA 2OBMA 4KV9A 1COWA 1ZD8A 4NKRA 2F1JA 1I4LD 2RKOA 3GLIA 5CIQA 5KSPA 1CR1A 3GLGA 4M9SA 3A4MA 2AKYA 1XPRA 2ZE6A 2IYWA 3BRWD 1E0AA 1KAGA 1Z0AA 3VU9A 2QQ0A 3KZ1E 4NCHA 4Q4HA 4BFYA 1KO8A 1PUIA 4A1FA 1Z0DA 2OHFA 2FN4A 1CULC 4C3ZA 1N6NA 3MWLA 2FEMA 4Q7JB 4Z1MD 1DTSA 1ANKA 4C0QC 3A1WA 2AX4A 2C9OA 2IUUA 2WTUA 1Q1BA 2YC4C 4TSFA 2FF7A 1T4GA 4HAYA 4HAVA 1U9IA 4Q7KA 3RABA 4CT4B 1U8AA 5JJKA 4KSCA 1NRJB 1TMKA 5KNBA 1BS1A 1T0HB 4TYQA 2J0QA 4R2HA 2A78A 2YVUA 1FTSA 2WOOA 4LUCA 2ERYA 4Q47A 1Z8FA 4TMKA 1IN7A 2GZAA 5FBVB 1AS0A 3TR0A 2WWIA 1XPOA 3ND9A 4BFWA 3S1AB 3U44B 1NJFA 2J41A 3KX2A 4FMDF 2IT1A 1TL7C 4ZCMA 2JJ2D 2VH5R 3Q5DA 1DG1G 1DARA 3SEAA 2G77B 1FX0A 4QGHA 1D9XA 1S8FA 2WKPA 3I61A 4B3DA 1OE0A 4N3NA 3LO5A 2P2LA 1VDZA 2ZROA 5JCPA 1X1SA 2V8OA 3J81k 1KY3A 3DMDA 1U0LA 4C0JA 3TKLA 4IHQA 2C2HA 5JWRA 1KSJA 3FFBA 1V43A 3AKYA 4HB2A 1GFIA 4MGIR 4BFUA 1CR4A 3B82A 3OIWA 2D06A 3LQQA 3WHKA 4CZ2A 3TVTA 2GEUA 4TMXA 2O8DB 2V1UA 2JDIA 1PLLA 1QG4A 2EW1A 5KPJA 1RPZA 4AG5A 2EWWA 5FPKA 1II8A 2QP4A 4PO1A 3GEHA 2Z0MA 3RDPA 3DEFA 2WAXA 3LLUA 4Q66C 1G17A 1JPNA 1W0KA 2GAOA 2OZEA 3KL4A 1SZPA 1Z6GA 2CBZA 3CBQA 1YJ5A 2R62A 4HLUC 2W2TA 3K0FA 1E2FA 3EPKA 3QEOA 3FHCB 3FFAA 4FINA 1Z47A 4JLNA 2PT7A 1RKBA 5G40A 2D2FA 2QZ4A 2NO7A 1IXRC 2H16A 1GL9B 1E9CA 4DLUA 3RS2A 5IRCD 3KQHA 1E9SA 4U5XA 3TLXA 1YRAA 3FMFA 4NYIQ 4TQUS 3AP2A 3WNDA 3EZ7A 1FMLA 4O0MA 1LTQA 3BBPA 1G8HA 2P6NA 1G41A 2GBLA 2ASEA 5DLQC 5FI0B 4R71A 4PANA 3T34A 1NKSA 3GCGA 4C0SA 4K81B 3CZQA 4BEJA 2JIZD 4K8OA 4GSYA 1ZUNB 3VR3A 5AJXA 1F60A 4HB4A 1YZKA 5AK0A 2ZRHA 2QG6A 3K9HA 5KSOA 4Q19A 4IOLA 2JJ1A 1Z6XA 3Q8XB 4PHHA 2PZGA 1ZVQA 1I2DA 3KJGA 2DWQA 3R9IA 1H8ED 3FKSD 4MRVA 1U0HC 5EJEA 4Q9IA 3VQTA 3W5JA 1NY5A 2FPMA 5G53C 5KDOA 2C9CA 3RRYA 4DB2A 1ZUIA 3FMPB 4JL8A 3FWYA 5D3QA 1UM8A 1RJ9B 4TTPA 2ZE8A 1RW4A 1NIJA 3CRW1 3AVUA 1W5SA 3ONWA 4H9GA 2HF8A 5IK2D 3I5YA 1HE8B 3M4YA 4NCIA 3GJ5A 1KSHA 4DCTA 2WOJA 2A2ZA 1ELOA 2DYKA 1OW3B 3MWYW 4KSBA 2TMKA 2B7CA 3E2IA 2CCJA 2AR7A 3EWSA 4JYCA 3SHFA 2N46A 1VHLA 4BEBA 2A3RA 2V55B 2PJZA 2WKQA 1SVMA 4ZDKA 4Q4JB 2GBLC 4TLCA 1Q3TA 2QENA 1CP2A 4FMDB 3SE0A 5BWMA 1DE0A 2J0UA 2VP5A 5HPYB 3TNFA 2PEYA 4G5RA 5DNYB 4DB4A 4LBVA 4UJ3A 4DSTA 1IN4A 4GZLA 1VYVA 4MYUA 4RD4A 3VKHA 3U60B 1KMQA 3Q3JB 1DAEA 2OE2A 1U0JA 2YWHA 1BIFA 4DWJA 2HJGA 5KOYA 1IN6A 1HURA 2Q6TA 4A4DA 1DVRA 4NYIR 1XZQA 4NP6A 4DC9A 2SHKA 3EASA 5EE5B 1GRQA 2G88A 2ZI9A 1IHUA 1DG3A 4HEJA 3UWKA 2IYQA 4TLEA 2W58A 3RSOA 1JECA 3UG7A 3CW2A 1A4RA 1PUJA 1XZPA 4HAUA 4I4LA 1M34E 4EJSB 1UEIA 5G3YA 3DO6A 3DM9B 2ZI5A 1VCMA 2EU8A 5C1BA 3W3AA 1AIPA 2GVDC 3FHTA 5LD2C 1KZ7B 2Q9AA 4D26A 3GJ3A 4AURA 2YOHA 1SHZA 2GTPA 1KDTA 1LFDB 1JR3A 2OV2A 2I1VB 4TL7A 4EPWA 3O8CA 5E7MA 3TGPA 4YONB 3B7GA 4XTCS 3DHWC 2ONKA 3TRFA 3C15C 4QL3A 1D2EA 3TR5A 4DSUA 3TSOA 5FBRB 4Q1EA 1ZBDA 3CPEA 3LW7A 2VP4A 5FL7A 3RVBA 4L4UA 4URWR 5DGXA 4XVQA 3R8FA 4PHTA 3B5JA 3SYLA 4D4JA 4B32A 1W49A 3HU2A 1T3LA 1XD2B 3ZIAD 2R44A 4BECA 1GIAA 5FOVA 2MSDB 2CE2X 1T3HA 5TY0A 3C5HA 3W8RA 1GKIA 3SC3A 3WY9A 2ZITA 2D74A 3UPUA 4UJ5A 2CEAA 3LY5A 5JRZA 1JI0A 4JJKA 5EE0A 3SBEA 4Q48A 4BLSA 2L0XA 3ASZA 3VHXA 2QT1A 4HAZA 1ZU4A 2F1IA 4DCUA 4F7WA 1T8TA 3K53A 4UNQA 4XIGS 2AHOA 4CEHB 3EXAA 1KMHB 2YYZA 2P0EA 3OHMA 1A7JA 2OG2A 2W6ID 3LXXA 3BK7A 4BZQA 2IX3A 1N0UA 2VQSA 2QU8A 1JAIA 3NTUA 4PHFA 4YDHB 5C46F 2BMEA 1R0ZA 4M0LA 4D82A 3A58B 2IYTA 2OEPA 2Q3HA 3MUFA 4FCWA 5HKKD 3Q85A 4RD3A 1KNQA 4RJLA 4F4IA 4OL0A 1XXHB 2ZRDA 4NONA 1FPMA 2FX3A 2B6HA 4X8MA 3T1VA 1ZNZA 3WXMA 4DT1B 3T12A 3NXSA 2F9MA 4KLZA 4U00A 1B0UA 1U8YA 3M6AA 1M74A 4W5HA 3AKCA 4KFRA 3GJ8A 3OF5A 4KBFA 1RRCA 3PEUA 4BLRA 2QSYA 3BAFA 1GZSA 2ZR9A 2QAGB 2XNDD 2HCBA 4B43A 1RRFA 3SDZA 4RSGA 3MG9A 1UDWA 2ZM5A 2XEXA 1Q1EA 5H1YA 3QG5A 3CNOA 2O8BA 3GD7A 3LX5A 4TN1A 2V4ZA 3K8YA 1GTVA 1N6RA 3E1SA 4MKFA 1WE2A 3VNVA 1OH6A 3U7EB 1MR3F 1XCMA 1R5OA 1UADA 2RB4A 2VP2A 2ZJAA 2ZR7A 3DPUA 4QGFA 4RCZA 5FTMA 2C5LA 2FU5C 4BQSA 4KVGA 2VHTA 2DFTA 4M1TA 2CNWD 2PZEA 2W83A 2VHCA 4GMXA 2VP9A 3X1ZA 3LBIA 4AYTA 2IYXA 3C7KA 4PZZA 4AYWA 3BB3A 4JVSB 2VP0A 2YNMA 4B3BA 5JI3E 2AD5A 3U7GA 4BE7B 2CVFA 3AVOA 1H65A 4O3MA 3CRQA 3P20A 5CYOA 3DL0A 5AUPB 1TQ6A 2V6IA 2LCFA 2R65A 1OFIA 1KI1A 2DPXA 3TUJC 2PX0A 4EPVA 4D81A 1HV8A 2JAQA 2C8VA 4KFUA 1YVDA 3PXGA 4TTRA 1US8A 1E0SA 2PMKA 1OFHA 4NH0A 1ZM3A 1XEXA 3K0AB 1DAMA 3R20A 2FE4A 2BBTA 1E2QA 2R2AA 2GXSA 3UMSA 3LV8A 5FL3A 4PC7A 1G5TA 2GZDA 1NVVQ 2ZI7A 4LYFA 4FD2A 2ORIA 4D6PA 2ZJBA 1A5TA 1NY6A 1NSFA 3IBGA 3P26A 1MH1A 4UXIA 3W9YA 5K8UA 4XSHA 4IDQA 5DE3A 4A8JB 4W7SA 4GDFA 4PX9A 1IAQA 1E0JA 2WWXA 3QUSA 5JHHB 3EIEA 4DLZA 1N5LA 3KUDA 3THXB 4NCNA 2WMOB 2B8WA 1G9XA 3A37A 3L8YA 5FOUA 2IEZA 1W4CA 4WXRA 2O5VA 4XVRA 1R5NA 3Q72A 4Q01A 5FBLB 3RRMA 3SOPA 4M1YA 2ZVPX 2Z5FA 4PFSA 4U02A 3X1DA 2AK2A 1DBSA 2KWIA 2ODEA 4IVPA 4LBWA 1KTVA 1JNYA 4NYJR 1BYIA 1W36B 3EZ2A 4EUNA 1E2LA 1YZTA 3RNLA 3IILA 4Q4LA 2JJ2A 3LVRE 3EPLA 2CL0X 5CLLA 2GJ9A 3KKMA 5EXXA 2J7KA 4NE2A 3VHLB 4P32A 5M04A 5TMPA 5EXTA 4MKGA 2AWOA 4PZYA 1N0VC 3ZYCA 4P4SB 2CK3A 1G1MA 2RGGA 2NGRA 3BORA 3IIJA 5KHOC 2ZRFA 5GJCA 2JLYA 1LS6A 2ZUCA 2IF2A 5EP3A 2B21A 1JJ7A 2Q9BA 2ZYTX 3B2EA 3I4LA 4HLDA 4B2IA 1E2HA 1OXUA 5GVSA 1XTKA 2A5YB 1A2KC 2OXRA 3RANA 1W2GA 2IYZA 4ZDIA 3LWNA 1P73A 3EX7C 2R6GA 3GLHB 1M2OB 3QNUA 1WB9A 2NMVA 4HUQA 4LHXA 1QHSA 2QMEA 1P62B 3KTAB 4C0KA 3MFYA 5KNCA 3I3SR 4E09A 2YWEA 4V03A 1NVVR 3QY0A 4KFTA 1CS4C 3PITA 1NVWQ 2DWPA 1P75A 5BYJA 5BXQC 3BOSA 1X8KA 4JL6A 2F55A 2XXAB 2OBNA 2QA5A 1NBME 3LH5A 221PA 4XSGA 3PV0A 2IYRA 2ZRBA 3D7MA 3UANA 1Q12A 1YZLA 2WWHA 1W48A 2GDJA 1EX6A 1Q0UA 1LVGA 4EFLA 3LLMA 3OFNA 2HV8A 3ZVMA 1P2UA 1Z28A 3THOA 4C2UA 1CRQA 3I73A 3VR6A 721PA 3BJIC 2BCGY 1LF5A 2GZHA 2YOFA 3RHFA 4B75A 1FP7A 3IO5A 4V0ME 3VR5A 2JIZA 3GLIB 4HDQB 1XMVA 1E79D 2PL3A 3ZZUA 5H68A 3F3YA 1QHHA 2IS2A 1KO1A 4NYMQ 3GJ0A 3MWKA 621PA 4ASUD 2VO1A 4JT4A 3VU9B 1YR6A 4Q4HB 2GXUA 2HUPA 2QBYA 4JMPA 1FW6A 2XZLA 4JKIA 3A36A 1H8EA 2OCAA 5CYPA 3FKSA 3B6EA 4ZIRA 5IHPA 3V9PA 1IXZA 5KPDA 1PLJA 2ZSBA 4M1OA 2C9YA 1YQTA 3GFPA 3QXXA 3P27A 4URYR 4FWIB 4MA4A 3PEYA 3UMFA 2H18A 4IJMA 2WPDA 5FPHA 1DO2A 4IDNA 5BQ5A 3SJCA 4DLVA 4DEXA 1ZCBA 3K09A 5DO9A 2WJIA 421PA 4B6EA 3CLVA 1E2NA 5DYGA 4X8OA 4TQAA 3K70B 1AJEA 5BN3A 4DCVA 4IXMA 1EGAA 3C5CA 1Z0FA 2OLKA 4CW7A 1OF1A 2IW3A 2W2XA 3GFTA 1UKYA 3KFVA 2QRZA 1CJUC 1GP2A 1P9WA 3HPRA 3ZZTA 2IS4A 2ZE7A 3MAAC 2RGNC 3LDAA 1CRPA 3WBJA 5FPSA 1VG9B 3RS3A 1E6CA 3ZZ0A 2QQEA 3AGQA 3L2OB 1N0WA 1FUKA 4HB0A 2ZI6A 1HYQA 1R8QA 4Q00A 4TYWA 1KDOA 1NBMD 5LBIA 2E9SA 4ITRC 2YJTD 1Z06A 1ZRHA 2RGEA 1U90A 3QQ5A 5E7JA 2YC2C 3WNCA 1JXOA 3RSLA 2OUKA 2W6JD 4EIWA 2QRNA 1XEWX 2MMGA 4A0GA 5GADl 2W00A 4CF7A 1P2VA 1C9KA 2CJWA 3FYHA 5A4JA 5JWOA 4Q02A 1ESMA 4Q9LA 2ZRGA 1TQ4A 4UNSA 1CBUA 3I8SA 5EQTA 2IXFA 3QPUA 3R9WA 2GAAA 1Z6TA 3G82C 4HYYA 4QJ5A 2NPFA 3KJHA 1BH2A 4CDGA 5E95A 3VTKA 2B7BA 1SQ5A 4M9QA 2ZE5A 1QBKC 3V4RA 2QMHA 4WOPA 5JEEA 3HYTA 1II0A 4QC2A 3OIYA 3SZRA 4BZPA 4G1UC 1II8B 2HT6A 2XSZA 2ODNA 3Q9LA 1AM4D 4MYTA 4LV8B 1EFRA 1HEIA 2I4IA 3K0EA 3PIRA 3QBTA 3VX4A 1OPXA 2OT3B 2H5EA 4FN5A 2NZJA 2ZYVX 3CWQA 5CLQA 3K0SA 3K0FB 1G5RA 5J4KA 1RIFA 5J4LA 2E87A 2KJQA 3PVSA 4ERNA 4OHWA 5EP1A 1ZM9A 1UBEA 1ETUA 3C14C 4KAXA 4Q1AA 3O8RA 1V5WA 1T5IA 3H4MA 1G6HA 2GJ8A 2FSHA 4LSGA 5KUTA 1XEFA 2HF9A 4PC3A 1WDTA 1GITA 4KI0A 2DFLA 1E1RA 1KO5A 1N6LA 1W7AA 2PCLA 3LA6A 5CDFE 1G18A 1LF0A 5FH9A 4OI1A 3FGNA 3ZS9A 4DZZA 1RRPA 4GOXA 3T1OA 1NJGA 1FQJA 2IYLD 3TUIC 2QN6A 3CUEF 3LQRA 5K8TA 1Q3HA 3ADKA 2OLJA 4PQFA 1ZNYA 2J3EA 1NLYA 1VKJA 3BD9A 4EPTA 4MRRA 5KTYA 2IEYA 3SJZA 3WP0A 2ZS9A 5DISB 4URUR 1JJVA 3U4QA 2OILA 1S9DA 2XB2A 1J70A 3QKRA 5JJIA 1OIVA 2VIIA 3OEHD 5LD2B 1P2TA 2CL7X 4A0FA 4ZCIA 4V02A 2P6RA 2ZS8A 4NCJA 1NVXQ 3SBDA 3R9XA 3AF1A 1XXHE 4NL4H 1SVSA 3IHLA 3NIBA 5C4GB 2FPKA 1UKVY 3HJNA 2EYQA 4X8HA 3RYTC 3O8DA 2IS6A 4PQYA 4PQRA 3KQLA 1NP6A 3VR2A 4IVQA 1G3IA 3B8HA 1VHTA 1D6JA 3KJIA 4Y0AA 5EXPA 2J0UB 1R0YA 4HLUA 1ZC3A 1R0WA 3AKEA 4DDTA 1E2DA 1L4UA 4JLAA 1W4RA 5JBQA 1FP6A 4GPTA 3AUYA 5D3MA 4C0HA 2GXAA 4URXR 2GJAA 4LHYA 3U6BA 1JXMA 1VYUA 1BMFD 1P72A 4PO8A 4US0R 3HDTA 3A1SA 3HU3A 3QENA 4I1VA 1R0XA 4WXPA 1QVAA 4OHZA 5AR1A 2EYUA 1G3UA 2HCJB 4C7OB 4MITA 2V7QD 2PX3A 4DRZA 4GRAA 1N6HA 1WRBA 4RFVA 2IC5A 1YR8A 5JEDA 1UKEA 1S96A 2CNWA 4PAQA 3BS4A 3WYGA 1SKYB 3U7HB 3AP1A 4DUGD 5DI3A 3QE0A 4HATA 3L43A 3F0TA 5FUXA 2IBMA 2JLQA 1FQKA 2REOA 3ZGXA 1E2JA 3KQUA 1EFHA 2ZU6A 4S35A 2QROA 2IF0A 4RZ3A 3ZD7A 1E2GA 1R4AA 5TVKA 4DKXA 2C78A 2R6AA 2ZXUA 5AJWA 1M7BA 3ASYA 3UKDA 5E4FA 2VHQA 5L3SA 4QHYA 4PPQA 2V9PA 2ZIAA 3A1VA 4AKGA 4FMBB 4OQXA 1MO4A 4C4PA 3R7WA 3WMFA 4BFZA 4DSOA 4X8LA 4AY2A 3AP3A 1KI6B 5B64A 4JVLA 5DH9A 1G5PA 4B47A 1KOFA 1YRBA 1D8TA 1OIWA 3EIHA 4LJ6A 2AD1A 1AGRA 1DO0A 2ZEJA 1TU3A 2ERXA 4B35A 2WWGA 1K6MA 5J4HA 1HUQA 4KU4A 4CIDA 1IY2A 3NBFA 1N5KA 2QTVB 1Q22A 1F48A 4KFSA 2QM8A 2HT1A 3MD0A 5EE1A 6Q21A 4JSTA 1TX4B 1QDEA 2GEDA 4QBFA 3R8CA 2I1QA 2YOGA 4LJAA 2CL6X 2FSFA 3N5CA 4M1SA 3TIFA 2HDNB 2ZPTX 1KI7A 2QNRA 2RMKA 4WIAA 1ZMXA 4ARZB 4C0LA 1ZM4A 3HR8A 1P9RA 1XTRA 2J7PD 3TH5A 2WIBA 2C03A 3BE4A 3MGCA 2Q21A 3GP8A 4A92A 1E32A 3BFVA 3MJRA 3B9QA 1SVWA 3D3QA 2RAPA 3FMIA 4D2IA 2H1LA 3CM0A 3EZFA 5FUVA 2EQBA 1Z2CA 3B85A 5DIFA 4JLOA 4JVMA 5DN6D 1R2QA 5L3QA 1P60A 4GZMA 3W3ZB 1LV7A 5KSZA 1GNPA 4F4CA 2A30A 5F9HA 3HP1A 3QXSA 4CYMA 4B3GA 2F43A 5AWFC 1R10A 2G1JA 1IXSB 5C2JB 5HCIA 2OFOA 3U2QA 1MABB 3RWOA 1FFHA 3CH4B 2ZSDA 1WBDA 2XITA 3SN6A 2GETA 5J47A 4C30A 5HE9A 3X1XA 1G4AE 4FW9A 2VTKA 5K8LA 4RD6A 4B6FA 3CPHA 2XNSA 4P31A 1ODFA 2O8BB 4RKFA 521PA 2X2EA 4MDFA 4LHVA 4YXWD 4HB3A 5A0FA 3GLHE 4B3CA 5JHGB 5FTKA 5ANRB 5LPNA 2G1KA 3GJ6A 5FFMA 2ZS7A 2DB3A 3KXLA 4A82A 1CF4A 4O2RA 1HT1E 3EG5A 1NN0A 3CX7A 1SKQA 1DOAA 1FUUA 2ZETA 2CXXA 1G7RA 1E3MA 5AUNB 3QVUA 4HLQB 2P65A 2CCGA 4JLMA 3RS7A 3PJRA 4PPFA 2Z43A 1W5TA 5FUYA 1G8PA 1WA5A 2DFNA 3NHAA 2ZUDA 3SHWA 1I4TD 4G3XA 2ODWA 2OCYC 5EXSA 1OH7A 2MSCB 1KZGB 4WBSA 3X1WA 2E1RA 4LDJA 4FXPA 5J4YA 1A1VA 3ZD6A 1W36D 1TEVA 2LWIA 3W8NA 3CO5A 2G3YA 1US8B 1XTSA 1TTTA 1FOEB 1XEXB 2O8FA 3GLIE 4TL8A 4BFSA 1SXJA 4Q1BA 3ADBA 1AS3A 3I72A 1E1QA 3DM5A 5JFGA 1VECA 4WZAE 4J0QA 2X1VA 1XU4A 4E07A 2CCKA 5E3HA 4AI6A 4WZBE 1RRGA 1TF5A 3THYA 4ESHA 4N1AA 1EG7A 1W0JD 1Q20A 2W0SA 5JMTA 3IIMA 5FOSA 5DI9A 4MGZR 3L0SA 4URZR 4JL5A 4D0GA 3AM1A 4KVAA 4BLTA 4Q1CA 1L8QA 2GWHA 3W34A 4MYCA 1E94E 2BBWA 2HEIA 2WHXA 2O8DA 5GJWC 3L82B 5AJVB 1VG8A 2AXNA 1WF3A 4Z8YA 2ZRJA 1EWRA 4MRNA 2PBRA 4EFNA 2QUZA 2QAJA 3QF4A 2NO6A 1D5CA 3CH5A 2OESA 3FTQA 5AUQA 1HH4A 3B1ZA 4L16A 5FTNA 4EPYA 3IPXA 1OFTA 3KKOA 4TL9A 2WWFA 4G5OA 1E2EA 4XD7D 4PAOA 2I3BA 1GNRA 3DOFA 4PHGA 3PQCA 4FMCF 5KU1A 4M1KA 1NLZA 4YMTA 1ZM7A 4KBGA 5AJYA 4CEIA 3T06B 1SXJC 4GOJA 2O0KA 2H17A 2VEDA 1H8HA 3GLFA 3A6PC 2W6JA 5BYKA 121PA 1HT2E 3OE7D 2GK7A 4MYHA 2FG5A 1G3MA 1GNQA 2OAP1 4I99A 4P3YA 3HYRA 2DWOA 4LYHA 1ZC4A 4LCBA 4LX0A 1VPLA 4AK9A 1RZ3A 1TF2A 4GP6A 1XBTA 1S4QA 1G64A 1X86B 2REXB 4CT5A 2V6JA 1XWIA 1OB2A 5KO2A 4N0EA 2HYIC 1NN5A 2EVWX 2RGCA 2O8EA 2PEZA 4RZXA 3B1XA 3QKSA 3KXIA 5CJ2A 1R8SA 2F3RA 1RVDA 4G5GA 2RGAA 2HJVA 3T61A 3I8XA 4HUQB 1E9EA 2RHMA 1CTQA 3GJ7A 4TSFD 3ICEA 4NPHA 1UKZA 3EC1A 5UKDA 2QPAA 2YWFA 1KO4A 1G19A 1E2KA 5EP2A 3TVDA 3K70D 4OHXA 1LS1A 1QHYA 3A4NA 3EPJA 2HYDA 4ZDWA 4IFBA 2AKAB 3WHLA 5H70A 3EARA 1OKKA 1Z08A 1NF3A 4N0DA 1I4DD 5C18A 2Z4RA 4BRUA 5JECA 4PSKA 2A5FA 1Z3IX 1HQYE 2UVQA 5HE8A 3PFIA 4BLOA 3A1TA 2AK3A 4A36A 2CMKA 5KNDA 5JCZA 1C4OA 2IYVA 3EZ9A 1NIPA 1JEDA 3MSXA 3BH7A 3NBYC 2GCPA 3P4XA 1KSFX 1NSTA 4XVUA 4TWZA 2D2EA 2J9RA 3SFVA 4DIDA 4IEEA 1Q1ZA 2IWRA 5C4MA 2ZJ5A 5L8VA 3A1UA 3N2EA 1M7GA 1PLKA 1NN3A 2OAQ1 4XTRA 4A2PA 3FKQA 2D7DA 4LHZA 8OHMA 2FNAA 4GP7A 2ZI3A 5IF9A 3QKTA 1IN8A 3NBXX 1G291 2JJ8A 2QBYB 3BGWA 1W47A 1L4YA 2VF7A 5F3WB 3ZDQA 3FB4A 2H57A 1HA3A 5HCNA 1AQYA 4G5SA 2QEQA 1KI2A 2JLVA 4OQLA 1KJWA 1YKSA 1AA9A 1N5JA 1X8LA 4B3FX 2BM1A 1Z83A 4EJSA 3TW8B 1XJQA 1BO6A 3B9PA 1IOZA 1N3BA 3KKQA 2GCOA 4IVRA 1M8PA 3AEZA 2QI9C 3OEHA 5KDLA 1VYTA 4Z1MA 1W0KD 2PT5A 4Q1FA 1P6XA 4LI0A 1C1YA 4DDVA 4DCSA 2BCJQ 2ZRNA 2G0TA 1XTJA 2WJGA 2VSOA 1JAHA 1JQLB 2IXEA 4LPKA 1J90A 1MRNA 2WICA 2WSMA 1W4AA 4Q4AA 1J2JA 3CIOA 3TAHA 1AKYA 4FMCB 4F91B 3H86A 1FTNA 5FUWA 4EKDA 3C41J 2QP9X 3QSYA 1CJVC 2G6BA 1OYWA 4B33A 2BV3A 4US1R 1G4UR 1XD2A 2KE5A 2X19A 5LB4A 2CJWB 1Z29A 3P4YA 2CHGA 2KI5A 1CXZA 1SVLA 3CF0A 4QBHA 4TTQA 2GRJA 1QHIA 2F1HA 4AIIA 2VA8A 3Q7PA 2ZR0A 1E2PA 4EFMA 5CK4A 4BPBA 4BRWA 1S2MA 1T9HA 3QI2A 4Q18A 1KDPA 2GF9A 1IY1A 3OEED 2JJ1D 2VL7A 4JLJA 3LX8A 4HZUA 4B71A 4LBYA 1U99A 5ELXA 1SKYE 4EQ6A 4F92B 3AVQA 4ESVA 1X6VA 4EJSC 5AJZA 4DUGA 3VR1A 1DS6A 4CEHA 2Z83A 2OBLA 3U3JA 4PAMA 4D4MA 4FCTA 5GJVC 2XZOA 3QKUA 3QIAA 4OK6A 2IA5A 1JR3E 1UPTA 2CLSA 3B78A 4GNKA 4MUBA 4QNMA 4RZUA 4YDSA 3QJYA 1Q57A 2NIPA 3IKJA 4F93B 2FH5B 4RFSA 1N6KA 2QPTA 2GJKA 2AL7A 1XD8A 2FFBA 2J1LA 2BOVA 2PLFA 2R9VA 2V1XA 4ZI2A 4QM6A 5FI1B 2DHRA 4TLDA 3THWB 1VCNA 3PUZA 1ZUHA 3SI7A 1UF9A 1W4BA 1NN1A 2ANCA 1N2CE 3MLEA 1KKLA 1S3GA 5JS8A 2QPOA 4DT1A 3LAWA 2WSSD 3UWOA 3FHOA 4NMMA 4AWXA 5BN4A 4LOAA 4Q9KA 3CR8A 4IOKA 4KXFB 4YMWA 4EAQA 2RGNA 1NMXA 2QAGA 3MJHA 1CR2A 3KFXA 4QG7A 1F5NA 4IRUB 1BOFA 2NZ8A 5DHAA 5B57C 4OJQA 2XOKD 4YMVA 1QZXA 1Z0KA 1NMZA 3V4FA 2ZJYA 4YC7A 4D0LB 1KK2A 3GLGB 2NO9A 3I32A 2RCNA 1IJFA 4TMVA 2ZTSA 4DDWA 4Z51A 1D9ZA 2ZANA 3CX8A 4OI4A 2JATA 3EA0A 1E9FA 3U4QB 1RYFA 4IOMA 3U3OA 4KYIB 2J7PA 1A82A 3E5HA 2P5SA 3QKRB 4QXAA 4P4UA 2R6DA 1E2IA 3LBHA 1KI3A 2EFHB 1KDRA 3TSZA 4ZKDA 1N5IA 1XJCA 4XJXA 3ETLA 4B44A 2QMUA 4QJ4A 1JR3D 3V00A 4M4SA 4JKYA 1QVRA 1GUAA 5EE9A 1F2UA 1W46A 1N6PA 1XX6A 4TZ0A 3ZH9B 3M1IA 5IK2A 5CITA 3NC1C 3KJEA 1G8FA 3WP1B 4U7DA 1JR6A 2GKSA 5JWHA 2VBCA 3NVAA 1XPUA 2BJVA 3AF4A 4JBXA 4LZZA 3K0CA 4UXHA 4M53A 2QAGC 1ZYUA 5D3MB 2GXQA 1Q44A 2AN9A 1KSGA 3UMRA 2NOAA 1ZD9A 4CEJA 2IYSA 1WQ1R 3WMGA 4KO8A 1PZNA 4M1MA 3AKDA 2OSBA 2A5DA 3L0PA 2C99A 2DBYA 5SZKB 4YXWA 1FX0B 5CJPA 2F1RA 1N6OA 4MKHA 2WWYA 1OXXK 3OIVA 4OI2A 5TARA 5JRJA 2DY1A 1F2TA 2FFAA 2REBA 2EWVA 2B92A 3ADDA 2ZRIA 4LGMA 4Q1DA 1T0JB 2H8KA 2WMNB 5FBWB 2VSXA 5SZJA 3EZ6A 4OJKA 4TQ9A 5DI3B 1WMSA 1CJTC 4DEYA 2EFDB 1GM5A 2FV8A 2GILA 3EIQA 4C0BA 3B13B 2XB4A 3A4LA 4IEIA 4V0NA 3TMKA 3LD9A 4LRWA 3IIKA 1P9NA 4PPGA 5CM9C 3ZVNA 2QGNA 2DFKB 4JLDA 5L3SB 4W5JA 2HXSA 1IQPA 4KLNA 4MGYR 4NYMR 1OB5A 4Q5IA 1ZJ6A 1KI4A 4V0KA 3H0KA 2KSQA 1SHKA 2J45A 1XEWY 3R7WB 4ABYA 2VP6A 4BWYA 3JZMA 3K0CC 4M2LA 3IQWA 1TUEA 2JEOA 4BZXA 3FVQA 3VAAA 2CLCX 3C4JA 3JVVA 2OXCA 2J46A 1IM2A 1ZCAA 5CB8A 3U61B 4HAWA 4NCKA 4AYXA 1KKMA 1ZU5A 3TAUA 1KO7A 4P33A 3W6OA 3GPLA 4A8JC 1NI3A 3TE6A 2JLRA 1ZINA 4OYHA 3TQCA 2QMOA 3PUXA 1CJKC 4Q21A 3ZIAA 2BKEA 1T6NA 2F7SA 4PO9A 5G3ZA 3RRNA 2FWRA 2JLZA 3BB1A 2W0MA 2XTZA 2ONJA 2J0VA 4M8NE 4DSNA 3SQWA 1QG2A 5JJLA 3LW8A 4TMWA 4TMTA 2VHJA 1E9DA 1MOZA 1WXQA 4C9BA 2WIAA 1Z5ZA 3EWAA 5IDVA 1ZD1A 1Z6AA 1CIPA 1SVOA 4JLBA 3G0HA 4XD7A 4L5BA 5TV2A 4BFVA 1N25A 2RHDA 5CB6A 3DKVA 1KNXA 2XXAA 1UBCA 4E5UA 1W36C 3T1TA 2F6RA 4D80A 1W44A 1XB2A 2ZJOA 2W6IA 1YR7A 2JCSA 5L3QB 4FI3C 4IW3B 3SQXA 1MRSA 1EX7A 3O8BA 4FWTA 3LBNA 2V54A 4LV5B 2QM7A 1UDXA 2KB0A 2IWHA 2F43B 1PJRA 1GOTA 3I1FA 3KKPA 1II9A 1QF9A 2PCJA 4IKEA 1MT0A 5HKKA 3U5ZB 1UFQA 5FOXA 3QOFA 2ZRLA 3L0OA 4A0RA 2GF0A 1I2MA 4E22A 4OQNA 3WRYC 1AZTA 1Z22A 1LW7A 1OFUX 1E0KA 3MRSA 5DSZA 4JJZA 1ZM2A 1ONBA 2X77A 1KHTA 4TT3D 4I1OA 3MCAA 4C2TA 3D31A 4L15A 1EXMA 3W90A 1NL3A 3T1QA 2CE7A 2XNDA 2ZJZA 1DAIA 1XTIA 4V0OA 3X2SA 3PCRB 2IUSA 3QXHA 2ECKA 5FOTA 4R7ZA 3CX6A 3KKNA 1D2NA 3TW4A 3ND8A 4NDZA 4PZLA 4LJ5A 4QBGB 3BC1A 5FR1A 4ILEA 1OHHD 2EFGA 4BFTA 3AVTA 2UZ3A 2ZRPA 4LJ7A 5KSYA 4TLAA 2JASA 1XMIA 1BYUA 4JLKA 1YZGA 2NO0A 1VG1A 2OCPA 1ZIPA 1Y3AA 3REFA 2ORVA 1X8JA 2FZ4A 3U3MA 4BUJA 4BLPA 1J99A 3KB1A 2GCNA 3PG5A 1SULA 2O8FB 4QHSA 4TLBA 3ADCA 1VCOA 1S0UA 1SXJB 3IGFA 3BH0A 4QJ3A 2C77A 1S1MA 4IDHA 3C8UA 5H8WA 1G21E 3DDCA 3RS4A 1U94A 3CRRA 3B60A 1DADA 2CK3D 821PA 1Q1QA 3THYB 1TADA 1IBRA 4GI7A 2FA9A 4WA7A 5FBQB 4QM7A 4HSEA 4W5WA 1PV4A 1KI8A 3GQBA 5JSZA 3AUXA 1P2SA 2CHVA 2AFHE 4GT1A 5BW8A 5F2EA 2BHRA 3KUCA 2YINC 3AF3A 4LJ8A 2O8CA 2G9NA 4ZKEA 2BEKA 2BEJA 3PR1A 3CPJB 2Q3FA 1M7HA 3VX3A 4JBYA 2B8TA 2AXPA 2HLDD 1W2HA 4WW0A 4BFXA 1U9IC 4DXAA 1U98A 3E70C 4UNRA 3TQFA 3QF4B 3QEJA 3SYKA 3SS8A 3K70C 1DPFA 4Q9JA 4DCNA 2CHQA 2QT0A 3IQXA 3H1TA 4B74A 1GILA 4CVNA 1G8YA 2EFCB 2Z4SA 5A5GA 4RVCA 1DAGA 4LJYA 4Q7MB 4LHWA 4RY2A 1ZNXA 3L0IB 3FMOB 1KK0A 4JLVA 1ZIOA 4L8GA 4Z8XA 3CRVA 4HLCA 4AKIA 2K5UA 2YZ2A 1AK2A 2C04A 2CDNA 4OHVA 4CEIB 3OFND 2VHUA 3AH8A 3GLFB 1FNMA 4WVFA 2XTMA 1GG2A 1X1RA 1U8ZA 1Z07A 2VYFA 2ZRAA 4KJZA 1QRAA 3CNLA 4AKEA 2QE7D 3ZS8A 2WM9B 3AF0A 1KGDA 2O0JA 2FGJA 5LDDC 4D25A 3BFXA 3AVXA 2ZRCA 2C96A 4CGZA 4TZ6A 2BBOA 4QGGA 2ZAMA 1D2MA 5B30A 2XJ9A 3OEEA 2DR3A 4UKDA 1GWNA 4BASA 5EP4A 3FPAA 3NG1A 2G83A 3GFOA 1NG1A 3G5UA 1GAJA 2O8EB 4B76A 3QXCA 3QKSB 3I92A 1RC8A 3AV0B 2C95A 4Z54A 1DEKA 3O47A 2WPDD 1Z0IA 3EAQA 1UJ2A 2GK6A 4PXAA 1EFTA 1E2MA 4US2R 4II7A 5L3VA 3U3RA 3FOZA 3MWJA 3DOEA 1G6OA 4S2EA 4UQOA 5HZHA 2IXGA 3K9GA 4DBLC 1AS2A 5JI2E 2JLXA 1Z0JA 1OT3A 3QF7A 4JLPA 1G8GA 2ZJ8A 3PENA 5EZ5A 2C98A 1XF9A 2Y8EA 2DCUA 2VF8A 4PC1A 4KODA 5DYIA 2MMCA 1ESNA 2ZSAA 4B34A 2WSSA 1R5BA 4YMSA 1UBFA 3LXRA 4OK5A 1HQCA 2JGNA 1XTQA 2IYYA 2ZQ5A 4B2PA 1G7CA 3IO3A 1P3JA 1J8MF 3BB4A 2J0SA 4P4TA 4D4KA 2NQ2C 4I81A 1VCIA 4M22A 3S1AA 3U44A 2XOKA 2PLRA 4ON9A 2YWGA 1NVUQ 2WJYA 2WZQA 3JVUA 4R98A 1CJMA 4G5QA 5CK5A 3T5GA 3WMEA 4AKHA 4GBMA 3GLGE 3IUYA 4XWOA 1KI9A 2IS1A 1AN0A 3HWSA 3EPHA 4C7OA 4IFEA 1E79A 2OO7A 2UZIR 4LY6A 4TMZA 5LB2A 2BMFA 2VLIA 1K8RA 2ZYUX 3DZDA 2FZLA 1G7TA 1EK0A 2O52A 4ASUA 2GESA 1YZUA 2XGJA 3NKVA 4L9SA 1DAHA 1R6BX 3EA5A 1RE0A 2XSZD 3FDIA 4YQFA 1TNDA 2J59A 1IONA 2GCOB 1EFRD 4JIMA 2GA8A 1JQJC 4TYNA 2BDTA 3DVLA 1YZNA 2ZRMA 2D4HA 2WVJA 4RKEA 2R8RA 1JB1A 4JBWA 3SR0A 4DLWA 4B73A 3RS5A 4O25A 1E4VA 2NO1A 4HI0E 4IDOA 5KYKA 3I62A 3RS0A 4O2LA 4ACBA 4G0NA 4B3XA 5F9FA 4H1VA 1FZQA 4H1UA 1NLFA 1T3SA 4Q4AB 3I5XA 3HPQA 3PUWA 2LKCA 4F4JA 2N1BA 4CRWB 4QKQA 4MRSA 1AZSC 4LJ9A 2QP3A 3VFDA 4MRPA 4E03A 2FSIA 4NTZA 1VIYA 2D3WA 1KI6A 2IL1A 2N42A 1E1RD 1LNZA 5J40A 5EZ6B 4M1WA 1SGWA 3CZPA 3PUYA 1MKYA 1NBMA 3ZQ6A 4D4LA 1OH5A 3L8ZA 2JLSA 2ZU0C 2BC9A 1S9HA 1S3SA 3UK6A 2F9LA 4B48A 5TB5A 3ICQB 4IDPA 3ECCA 1G3RA 1T5LA 2XAUA 1G7SA 3OAAD 1DELA 4POAA 4PR0A 1KK1A 3RLFA 1IN5A 2RH5A 3HU1A 3ZJYA 1RYHA 1OH8A 3NHBA 1DAKA 1COWD 3D8BA 4HZUB 3BXZA 4A15A 1P4SA 3N2IA 4BLQA 3ZLJA 4V0MA 4EQ6B 2IHBA 1TPZA 2QTFA 3EC2A 4RZ2A 1EFCA 4KITB 1XP8A 1ZW6A 4ZI3A 4ARZA 4EDHA 2ZI4A 3K9LA 1AGPA 2Q0HA 3NEJA 4URVR 1J7KA 1OJLA 4HDCA 1GKYA 4Q9HA 5AUOB 3NEYA 2FFHA 2G0NA 2R6CA 3DMNA 4RD2A 5HTKA 3VKGA 2YHSA 5EE3A 5G41A 2P6UA 4KYUA 4RFSB 4ZO4A 3IHWA 1HTWA 3NDPA 5TXGA 2BMJA 3TJZA 1YHNA 1EESA 5F98A 4MGKR 3B1VA 3DKPA 3AVPA 4NZYA 1Q21A 4JSYA 1JEEA 4Q03A 4ZCLA 1RJ9A 1E98A 4L9WA 3ZVLA 1GRNA 1KJZA 2GJSA 2P67A 3WNBA 4HAXA 3WYFA 3NDBB 5FTJA 4DVGA 3VMFA 4JVNA 4LK2A 2D7CA 1IY0A 2OFXA 4AG6A 1WP9A 1MABA 3IBYA 2FPLA 3NBZC 4D0NA 5E7IA 3IEVA 2ATXA 1K5DA 1E96A 2HXYA 1G3QA 4XH9B 5DHFA 3DZ8A 1M6NA 3Q5EA 1W1WA 4I1SA 4BGDA 1KY2A 4Q4JA 4F38A 2WJHA 3KQNA 1GSIA 1K5GA 4JYBA 2PJRA 3NH6A 1Z63A 1VIAA 4NYJQ 1GKUB 3M0EA 2O0HA 3C16C 2ZAOA 1T91A 4AC9A 1ZP6A 1QHHB 4MKIA 4P0TA 3B1YA 2X2FA 4DLXA 3GMTA 1A2BA 1M1YE 5SZHB 2GHIA 2BMDA 2RGXA 3D6TB 4GMDA 2QSZA 2QY9A 3W6PA 2A9KA 4A6XA 2OFWA 5TDHA 4A2WA 4ZIRB 5KDDA 4YLGA 1L7VC 1ZAKA 1XCPA 1XD9A 2J5XA 3KXKA 2FMXA 3SFZA 2JDID 1XCGB 4TL6A 5JLJA 5J4VA 2CLDX 2MSEB 1F2UB 2BBSA 4R9UC 2BKUA 1CLUA 3AQ4A 4NHOA 5EUQB 5FPTA 4DJTA 1ZNWA 3QPWA 1XMJA 3CRMA 4LC0A 5JS7A 1XRJA 4OHYA 3CB4A 1P7CA 4V0LA 2GNOA 2WAYA 4M21A 2ORWA 4OQMA 4PSVA 1TQ2A 1XNJA 3LFUA 1UBGA 4A6PA 1E4YA 1TF7A 4RCYA 4CEJB 3PUVA 4ZV4A 1JBKA 4QHTA 2RGBA 1E9RA 2RGDA 4FCVA 4TT3A 1KYIA 3KB2A 3UIEA 1NG9A 1DAFA 3SJAA 4A2QA 4EPRA 1OXTA 4JS0A 2FDCA 1CU1A 2XX3A 1QHNA 1NKTA 1EWQA 1BMFA 1F2TB 4Q7LA 5CDFA 1QHXA 2QORA 2X8AA 5EUMA 3UATA 2GVZC 1YE8A 1VG0B 5GVRA 2KBEA 1OHHA 1LY1A 2BWJA 2EFEB 2V7QA 3IEUA 3NH9A 2WKRA 4JT2A 1WCV1 3CKLA 3AVYA 1FMJA 1B23P 3KQKA 3A8TA 4R2IA 2ZVQX 1FNNA 3OZXA 4ACAA 5BN5A 2QTHA 1UAAA 3H84A 3BH6A 4QGAA 2ZUBA 1YU9A 3WBKA 4PPNA 4AD8A 2PMDA 1R7RA 2ZJ2A 1T8UA 1KMHA 1OV4A 4MQBA 4UXJA 3MMPA 1JALA 1SXJE 2J87A 4UNNA 1N6IA 3AVWA 1MO6A 3U3KA 1U81A 1P61B 2JLUA 4B2LA 1E9AA 3SNHA 1F3OA 2BVNA 3GEIA 4M9XA 4GOKA 2ZRKA 3VKWA 1GDDA 1CR0A 1XXHA 2H7VA 5B58C 4W9MC 2WJJA 1BKDR 1SVKA 3REGA 1CEEA 3CF2A 4JZKA 2AWNA 2QL6A 2FFQA 3LNCA 2HLDA 1VMAA 4DDUA 3UG6A 1E69A 1MV5A 4G01B 4I1UA 2CVHA 2XZPA 2Q3MA 1VTKA 1KJYA 3BWDD 2BM0A 3IDQA 3CF6R 5FTLA 1PVOA 2UKDA 1E9BA 3CNNA 1E99A 2QGZA 2Q9CA 4HZIA 1GL7A 2KBFA 4PSAA 1OYYA 4M9ZA 1AQUA 1F6BA 4LC1A 1JPJA 4MDEA 4C0AC 3T5DA 3TBKA 1O3YA 4DHEA 3VR4A 2IUTA 4K46A 2ODBA 4OBEA 4A0HA 3IPYA 4XOIA 1KK3A 2WJVA 4FIDA 4XWKA 3X1YA 3GLFE 4ZDJA 2Z6VA 1KAOA 3QPVA 2JLWA 4OKSA 1QHGA 4QFMA 4YMUA 5L3RA 2WV9A
chains in the Genus database with same CATH superfamily
1QZZA 3K9NA 4LPSA 3KSAC 4YR9A 3H17A 4HRAA 1NR7A 3S28A 2EKLA 1TQDA 3MNFA 3VNQA 4EB8A 1L2TA 1FFAA 1IMJA 1Y8CA 2BR4A 2WTBA 3Q12A 4INOA 3LRPA 4OHKA 1L4BA 3MCVA 2XUGA 4WLOA 3I2FA 3OX1A 5CT9A 4DG9A 5CA1A 3GLKA 4L74A 3WV4A 1H23A 2BIFA 2LVBA 1J2EA 3ORFA 4K05A 4EYEA 2FCRA 1AKEA 4O4JA 4FC6A 5IASA 1Z7YA 4UMEA 5AKEA 4QECA 3NT5A 3WYAA 3DPSA 4OFZA 4LWZA 2H7CA 3NWPA 1KIMA 5AVUA 2ETVA 2PRSA 2A7QA 2H52A 4XYGA 2OCBA 5FPPA 3ORRA 4AXXA 5SV2A 3RVQA 4ZYVA 4KQ6A 1PJ8A 2WUWE 3H3XA 3AGPA 1YH3A 2FW8A 3E1GA 3CCCA 5CIWA 4K6CA 2J4CA 1NRIA 1CUBA 2PZ8A 5CX4A 3QQPA 4L4XA 4FKBA 5KTRA 4O4LB 5DMXA 2C8LA 1UCFA 3AB3A 1V7CA 4BNNA 1H4SA 2AN1A 2VRWA 4ZXPA 4NU0A 1KZHA 4C2BA 2PM8A 4FM9A 3DAYA 1ODJA 2Q46A 2DSTA 4D9EA 1IK4A 1XMSA 4J76A 4LBZA 3KQYA 2R6FA 4PZ9A 1U2RA 4A5SA 4QOSA 1DCFA 2YHIB 4KK4A 5K3CA 4MUKA 3PHGA 1QQ6A 2FZCA 1T5OA 2IP1A 5CT4A 5FI3A 4IJUA 1S6YA 3EIOA 1KWKA 5BNFA 2VPPA 3IHTA 3SJBA 4C76A 4ND4A 1TAGA 3BZUA 4PTYA 2IYUA 1WBBA 1JKFA 2QG9A 2FZGA 1TZMA 2ZSEA 4UZEA 3R7FA 3E4DA 2B61A 4G37A 4IGKA 3RKSA 1IXYA 2A5LA 3JWJA 2B98A 3AM3A 4ZAZA 1LLDA 4KQWA 4F3NA 1H4QA 3CEJA 3IFSA 3U7FB 1TVEA 3KBBA 3TTSA 2EP7A 2QX6A 2WHRA 2AKEA 3GU3A 4IMPA 3BFKA 3NYIA 4ZA2A 4AJEA 4HXYA 2EDAA 2QMYA 2IYEA 2FOLA 3HHPA 2HUNA 1CERA 1Z2DA 3WQRA 1T9BA 5FO1A 5G0WA 3IPRA 3GQBB 1TEZA 4PONA 1DINA 5JPDA 1E8MA 4X1KB 2RAUA 3ER6A 1HDYA 2CLFB 3W6NA 4OK3A 4UHBA 4MEBA 4JD5A 2VQ6A 4X85A 3KWLA 2AFIE 4NR0A 4Y9DA 4AIRA 5I7VA 1V8PA 1QDLB 4ATNA 1GTL1 4HDOB 3LCUA 3IR7A 4NZNA 2RK3A 5L4LA 2PGXA 3JD1A 1PL8A 1GTJ1 4FS8A 1UWCA 3NDIA 2GEVA 4JHLA 2BN4A 4LTMA 4O4IF 1TJ3A 2GO7A 4TKVB 3TKYA 1PR6A 5H3CA 2XUHA 3FCEA 5JNRA 4ISBA 3VKFA 1OSNA 3BPSA 1M2VA 3IBCA 2P6MA 3CG0A 4LNUA 3DP9A 3UT5A 3KLBA 1U3GA 2IE0A 1E4EB 2NWQA 3G68A 3P32A 4UPEA 3TLZA 4Z4IA 1C9NA 1TU4A 3RRXA 3D6UA 3T7EA 3E9ZA 3ENNA 3TRDA 5C37A 1RQXA 3KVNA 4RD1A 2AUNA 3A6JA 1QSGA 1U7WA 1CY2A 1YZ3A 3BREA 1M6EX 3BN3A 3FNFA 3KTAA 4IOJA 4NJMA 4EYOA 3U6KA 4PYMA 3THWA 2RGWA 4ZPXA 1I1NA 2FRDC 4MUJA 1AGYA 2V97A 5DHUA 4A91A 3D1LA 4Y9SA 3SICE 4F4UA 3OZGA 1MQAA 2R96A 3D6AA 3NWJA 4DRXA 3GK3A 3KKLA 3Q7QA 4LJLA 1Z0SA 2I55A 3PEWA 1OXVA 1AK9A 1HORA 2QRGA 4MI6A 1KY4A 3FUTA 4ZGBA 4KRFA 3EW9A 1JDJA 1XJWA 3KCQA 1NXTA 3FPBA 4C4TA 2WBLC 3OAAA 2OL4A 4GFDA 1MN6A 4R69A 3N3AC 2WF5A 4G0MA 1WMFA 1GRRA 2FSGA 4WAUA 5E1OA 2ICAA 2XAAA 4KV9A 4Z9FA 2RI6A 2F1JA 2V5AA 2GQ0A 2RKOA 5MFZA 3I6IA 1DKUA 1CR1A 3GLGA 2YIJA 3VISA 1IVSA 2C4VA 1QONA 3R3ZA 1E6EA 5EJAA 1EJ6A 1YUNA 4FGJA 3BRWD 1NM5A 3IP1A 3NTRA 4WZBA 4E3WA 2QQ0A 3DS8A 4Q4HA 1PJZA 2UZ0A 1PFGA 3OO0A 4CCYA 1EB9A 1FPQA 2N3ZA 3HJHA 5ESRA 2VZ0A 1YA6A 1Z0DA 2OHFA 3DXZA 2TRSB 4C3ZA 3MWLA 1A1SA 2Q7DA 4C6TB 1YWGO 4Z1MD 4ID3A 1ANKA 1B1AA 2H1RA 4I1RA 5KOHA 3C3WA 1XZLA 4DIOA 3NS7A 2IUUA 3CT4A 2BFPA 1WB5A 1YRHA 1WETA 1T4GA 4HAYA 2IPLA 3CZCA 1U9IA 4HAVA 4Q7KA 3ZE0B 3N2KB 5TEVA 5BWBA 1ZFNA 1TMKA 3B36A 1T0HB 4EG5A 1A04A 4MYRA 1PGQA 1VE5A 1LLCA 2KW5A 1PP4A 2WOOA 2ERYA 4I55A 4TMKA 5ALMA 2RKBA 1IN7A 1MQ9A 2P4SA 5TT1A 4LF9B 3TR0A 5D2CA 1WU7A 2BTQA 4LJSA 5TT0A 1SBNE 2NP6A 3KUKA 2PUCA 3TJRA 1D4ZA 4BUCA 3H1FA 4IIJA 2J41A 3G7NA 4KIWA 2JFYA 3ESBA 3L84A 4MLCA 1TRKA 5K0LA 8MHTA 4FGZA 1YONA 3Q6MA 1GYPA 2G77B 5JRDS 2P7IA 4UM9B 2WKPA 2AG1A 3K8QA 1SC9A 4CG1A 4C0WA 1ISRA 5DTQA 1WU8A 1WL8A 4N3NA 5IYZA 3TSAA 1TA0A 1B8NA 1V95A 2P2LA 5M5BA 2A14A 1QS0B 4D3YA 2NU7A 1CE8B 3QTBA 4C0JA 4IHQA 2C2HA 3T9AA 1UODA 4CPDA 3F49S 5JWRA 5JZMA 4LF5B 4HK4A 2C8JA 3RASA 4EZBA 4GE0A 1CR4A 3OIWA 1IHDA 4MVWA 2D06A 4O4IB 4OP2A 5G0UA 4EJ0A 1NONA 4ZEVA 3TVTA 2GEUA 2V5VA 2O8DB 4DR7B 2JDIA 1PLLA 2OMEA 4ZOLA 1E1YA 4FLEA 4P38A 1T9DA 1GV0A 3QHQA 1RRVA 5DF1A 4KXMA 4PO1A 1YAJA 1OJ7A 2Z0MA 3GEHA 1U2DC 4Q05A 5B5SA 2PUFA 2XWSA 2PKEA 2WILA 2XQJA 1Z5NA 5IVPA 1W0KA 2GAOA 2V7XA 5AIAA 2LP4Y 1MNAA 1YQ9A 1CCWA 4F04A 3K0FA 3RB8A 5LLDA 1ESCA 3ANTA 4G4JA 1K88A 3FFAA 2Z2YA 4FINA 4JLNA 4P98A 1BFKA 4QXPA 2NVWA 4TRJA 3UHJA 4EHLA 4YDQA 5EJ7A 4ZODA 4IQ8A 1NUPA 4YJGB 1ULUA 1LCIA 2H16A 4G0UA 3R2JA 4UAVA 1PEYA 1FYVA 3C48A 3IUBA 3IQGX 1E9SA 1H85A 4OQEA 4QRIA 4NYIQ 3TLXA 3W77A 2G9RA 2JHCA 3AP2A 3ROQA 3K5PA 3ILYA 2H0RA 2ZYIA 5FI0B 1G8HA 1I80A 1QE0A 1UP7A 3STHA 2X6RA 2W4MA 3AESB 3VR6D 5AVTA 4PR3A 3AF6A 3OBBA 1W85B 3KIPA 4K81B 3O90A 2OWDA 1AXGA 1JG3A 1R16A 1ZUNB 4HB4A 1YZKA 4UHCA 4BU0A 4NENA 1U6IA 1H6BA 1JH8A 2VA9A 3AHIA 3M33A 1YASA 2BFNA 4X00A 5FI5A 4B4OA 4CMIB 4KR6A 4PLFA 3H2SA 4QTXA 2Y1WA 1GCAA 4IIUA 1GQ2A 3KJGA 1TAHA 1NVMB 4YTEA 3RJMA 3STTA 3URMA 2I6SA 2YVLA 3FKSD 4Y2QA 2GKOA 3SSOA 1V5IA 3IIEA 5KQSA 4MZDA 4W8HA 3H75A 2P9FA 2YJNA 2RHBA 1F2DA 3F74A 1UM8A 4EMSA 3E2MA 1HE3A 5U9CA 1KZ9A 2Y6UA 4ME6A 4CR6A 4TTPA 3AVUA 3ROZA 4FW8A 4LQ4A 3VYUB 3HDHA 1W5SA 4XCVA 3HCRA 1AHPA 3AHFA 4G1BA 1ECLA 3HSSA 3AZQA 3CUKA 3HJFA 3F6BX 5LA6F 3R3JA 1RT9A 2WOJA 1L7BA 2ATEA 1JFRA 2ACEA 2ECPA 1UQUA 1OW3B 5DX1A 3UK0A 3VOTA 2XKJE 2TMKA 1Q7CA 1QGOA 1SOVA 3EWSA 1XDWA 5BT9A 2I2XB 2N46A 1I0LA 2V55B 3E7DA 3QOWA 2WKQA 4G9BA 3BBLA 4GM0A 1BA3A 1T8SA 3EF1A 4J0HA 4NOMA 1T13A 5DHPA 2GBLC 1PNOA 1Q3TA 3HV2A 2WRZA 4TUYF 3RK1A 4FB5A 5BWMA 4JKOA 3PGLA 4HEA1 4JC4A 4UAGA 5IN4A 3TNFA 4DY6A 5L4NA 5DNYB 4DB4A 2YVKA 1WD5A 4LBVA 4UJ3A 2VCEA 2ODPA 5ICSA 3R4CA 4H7DA 1QHFA 4Z49A 4MYUA 4KX5A 4MAMA 3VKHA 1YFZA 3DE1X 1DDIA 2HPHA 4KR2A 3DKKA 1U0JA 4P9NA 3EMBA 1NDQA 4L4SA 4X1OA 1H2ZA 4R5MA 1NUTA 2PAFA 3PXXA 1IN6A 3PWZA 1OTXA 1HG0A 2FPGB 3CVXA 4G2TA 1NBOA 5EE5B 4GO1A 5ALNA 4RCVA 4HEJA 5D85A 1WMBA 5T4BA 1KARA 4KH1A 2NNWB 5T4FA 3EWNA 2QGFA 2Z1MA 3ROEA 3RSOA 4YRBA 3V7YA 1XZPA 4X97A 1ZGCA 1NBWB 2V3VA 1UEIA 4F56A 3F4KA 4XIJA 4HDMA 3DM9B 2ZI5A 1VCMA 3W3AA 1AIPA 2GVDC 5ALHA 2DX7A 2R6ZA 2JIMA 3X3HA 1U3DA 3BXHA 1OXKB 4MR8A 4BVEA 2PUHA 3DAPA 3H05A 3OZBA 1KDTA 2A94A 4U39A 4YN3A 2I1VB 3D4BA 3ECAA 4TL7A 3SK0A 5E7MA 3C7CB 3QUAA 4DNQA 1EZ4A 3DHWC 3CKMA 1YC2A 1ZN9A 2J4FA 3LKVA 5HIKA 1D2EA 1L5FA 1PE0A 2F62A 4DSUA 3O0DA 2VKQA 4JJGA 3PVCA 4QYXA 3RVBA 3Q0TA 4L4UA 5DGXA 5HFJA 3T3IA 3Q41A 3EA4A 3FYDA 4GUDA 5K0ZA 1QNFA 3SYLA 1AT1A 1ZD4A 1N2CA 4MI1A 4AECA 1XD2B 3HSYA 1VLJA 1N8NA 2C2WA 5EEGA 1GIAA 2QTBA 3ID6C 4HYQA 4N5HX 4CKYA 3W8RA 1NI5A 2F1KA 5EOVA 5CH5A 3UCEA 3GH3A 1GKIA 2QTVA 1LWOA 2B9EA 3GRRA 3I4CA 4UC0A 4OB8A 3EVFA 4N0PA 5FDFA 3O2SB 4R1OA 5A71A 4YBRA 4Q48A 421PA 2L0XA 4BLSA 3VHXA 5BUSA 5BN5B 1ZU4A 3KEQA 1GG8A 5KQMA 1DHTA 3HNOA 2LCQA 3R6WA 2VFAA 4L5CA 4UNQA 4LOLA 2XY4A 2XMZA 2I99A 2B8NA 3L7LA 3EXAA 1A2QA 3NWOA 1C5KA 2OD9A 3EDCA 4KXLA 1ZEMA 1ST3A 3ELYA 5KMGA 3I9LA 2W6ID 1EHIA 4CIAA 4BZQA 1CJBA 5DK6A 2VQSA 2YN4A 3L6EA 5FBKA 4JQCA 4PHFA 4YDHB 3U9LA 4Y1RA 5FA5A 5REQA 5TGTA 3JWPA 2BMEA 1R0ZA 3OURA 4YAEA 2O54A 3N8NA 2XUQA 5LA6B 2WSBA 5IKXA 2YWDA 2ZR8A 3VR5H 4BQPA 4J1SA 5HKKD 3Q85A 1R3DA 2GZ1A 3C6ZA 3DXFA 4NH4A 1P7ZA 4RJLA 4EHHA 4QICA 4F4IA 2JIDA 3PE3A 4FFLA 4B09A 3GXOA 2I4MA 2AOUB 1E6LA 1ZNZA 1AXEA 3WXMA 2UZ4A 3LF2A 4MO9A 3RU9A 3T12A 1EHCA 1T36A 2PVPA 3OU6A 1ICEA 4ZZ1A 2Z8YM 4TUYB 1ECJA 1JAYA 3HP4A 2DJ5A 5EVCA 1NC1A 5DDIP 4RVNA 2OY0A 1FSGA 3F9IA 5C1DA 3PEUA 3DE0X 3AIIA 2ASVA 2GPSA 2ZR9A 4D46A 3T4EA 4ZCRA 2EQ5A 4RE5A 3MRVA 3N74A 4DSAA 2HCBA 1RU3A 4MVJH 4KW7A 2XEXA 1Q1EA 1BOOA 1OXBB 3QG5A 3R0IA 2NM0A 3KZCA 1ISMA 4P36A 3QVGB 1N6RA 2WF7A 5FV7A 5G1OA 3AL0C 1JHVA 1PQUA 4EKYA 3PKZA 5HZGA 1MR3F 2B2XA 1UK8A 1R5OA 4C7MA 2RHWA 4R1MA 1CQJB 3PGA1 4XPZA 3IUSA 4OOFA 1U28C 1VXRA 5LDHA 2ZPUA 4FPXA 2PZEA 3EDYA 2VHCA 4GMXA 2IH2A 2IP4A 3LBIA 2GARA 2P91A 1Z6PA 1S3FA 1SHUX 2OB1A 4LC9A 4PZZA 4AYWA 2VXOA 3BB3A 3WIVA 4JVSB 4RHUA 1KDVA 4LSWA 3SIXA 1DQYA 2R8BA 4YRSA 5JI3E 2AD5A 2PWZA 3DLAA 4UATA 4FE3A 2FPOA 2PGJA 3P20A 5E4TA 5IJWA 1BHSA 5HBGA 1MU0A 3SXJA 5HDQA 5HJ2A 3V1KA 2Q99A 2R65A 1U3FA 2ZSHA 3L04A 2WM8A 3TUJC 4HG2A 4D6YA 3B1KA 3NHYA 2XOEA 3C0KA 2DTEA 4TTRA 1US8A 2B6NA 1E0SA 1PGOA 1OFHA 1XALA 1TZKA 4MW0A 4NH0A 4XGRA 3SG0A 4M54A 2Z2KA 1DAMA 1LPMA 4TSRA 3O3CA 2ZYDA 3SLGA 4CG3A 3R41A 4KUEA 4U0KA 2QDXA 2IZ7A 1E2QA 2GXSA 3UMSA 4UU1A 3FNGA 4BX2A 1GQQA 1XTPA 1G5TA 3F5DA 2ZI7A 3A06A 5KTTA 3DE4X 3ZWYA 4WJLA 2G1UA 2J8ZA 1SRRA 4R0NA 3ZTYA 3P26A 4P53A 3P9YA 1NX9A 4R2WA 1TLTA 1V8DA 4KWEA 2G7MC 3EY4A 3I2KA 1MF7A 1W1UA 3RVMA 4C0XA 1V0JA 1LPPA 3DE6X 2FX5A 2VNIA 4UTZA 4W7SA 4Z86A 3UB3A 2DC1A 2NUAB 1JKJA 1S3IA 3AIOA 2GD1O 3GHHA 4J2TA 1R6UA 3T7SA 4YMIA 3THXB 4RGBA 1FQOA 3RRJA 4K9PA 3ZCSA 2WMOB 1H94A 5EGNA 3RVOA 3A37A 2Y1DA 3O2JA 3S8YA 3OEYA 2CVPA 1WHSA 3L9XA 5FOUA 3O2QB 3VPFA 1ZQ9A 1CVLA 4AROA 4U2GA 2P1RA 2J3LA 3Q72A 4FYXA 1Z68A 2X0KA 3RRMA 4O8ZA 2Q8NA 2ZATA 1VSQA 3TINA 4EEXA 4PFSA 1CQZA 5G0TA 5I8PA 5BRNA 1GCUA 2PA3A 3W7AA 5JADA 3KR0A 4WXHA 4B4DA 3GFSA 4REOA 1J21A 4LXYA 4MKRA 3U5TA 1WPGA 2PSDA 1W36B 3Q9NA 4EVRA 4CV0A 1E2LA 1YZTA 2PYIA 1DI0A 3DOHA 5AJTA 5IBRA 4HAIA 4F1JA 4ND3A 3P2MA 1ID1A 4GNRA 5M04A 5TMPA 3P0FA 2ETXA 5J58A 2D1QA 2BEWB 4WN3A 1J2UA 4OX9B 2AWOA 3OO1A 2JW5A 5FB3A 1N0VC 1IHYA 2NV6A 4FYPA 5K5EA 2UVPB 3VDXA 5DCLA 3PDJA 4P4GA 3SOZA 1RWVA 2GERA 2P9TA 3P71T 5E6SB 3C8ZA 2RGGA 2NGRA 5HUHA 2RK6A 1YZHA 5L7YA 1W8DA 3CMCO 2D3TA 1KR2A 5B6JA 5JAMA 3ZY5A 3PRYA 2OOKA 2FPIB 4J2HA 3WL3A 1XMPA 2P4EA 1XTVA 2IF2A 2GBGA 2DBVO 5EP3A 2Q8QA 2GK3A 2Q9BA 2ZYTX 3I4LA 4GYYA 4PYIA 4DGSA 4UD2A 1VE7A 4PAWA 3BGOS 1SBTA 5CB0A 5LP6B 1RABA 4BNJA 1A2KC 3U7IA 1RAIA 4BVAA 1U1GA 2OXRA 4R68A 4N12A 3M9XA 4MS1A 3LWNA 3OZVA 4RFLA 2R6GA 3NUQA 1JGTA 2V96A 2IHJA 4LHXA 3N0VA 1QHSA 1QRDA 4MB0A 3MRXA 2IDZA 3CVOA 4C0KA 3RTCA 3I3SR 4E09A 2YWEA 4IG9A 2R3SA 4MHSA 4NS1A 4JBIA 4FR0A 3TAXA 3PR2B 3LT1A 5CAEB 4TYMA 3W5AA 1WSAA 1MZPA 3MBKA 3HUFA 2XA9A 5BQOA 5D3ZA 5BXQC 6ADHA 1N7HA 4FEGA 1X8KA 2O1EA 4R3UC 5CXQA 3UA4A 4P7GA 1L4NA 3EFOB 3DVAB 1CY0A 1NBME 3LH5A 5I8ZA 1B00A 4XSGA 5DXFA 2ZRBA 3GFVA 1Q12A 3PPWA 4V1CB 4IJVA 5BPHA 2O6HA 3LLMA 4PSCA 4C78A 4D41A 3TIVA 3BGVA 5EWLA 4D9KA 4C2UA 1RVV1 4KLAA 4OD0A 1PW7A 3DCJA 5EZYA 3H2GA 3VGJA 4EY3A 1UMCA 3I73A 5L9AA 4Z7OB 1X13A 2P8SA 3RHFA 3BM5A 4B75A 1FP7A 4V0ME 3VR5A 3GLIB 4I6JA 1TVCA 2B1RA 3HJTA 4H0CA 4RACA 3W2IA 1E79D 4BGIA 5K8JB 2VQFB 5AW4A 2NZUG 3R5XA 2I67A 2ZW9A 4I3GA 1KO1A 2EW8A 4FDLA 4NYMQ 4WZAB 3WSWA 2IS2A 1EDOA 5AI8A 1CYEA 621PA 3GB9A 2VO1A 4P5EA 5DTRA 4ASUD 3RUAA 3VU9B 3FYCA 4K40A 1HE5A 2OO5C 5BSHA 2WU3A 3GZ4A 2HUPA 3EZXA 1FW6A 3GAMA 3EMDA 3A36A 4ZIRA 5KQRA 3B6EA 3C3EA 5IHPA 2O1XA 2Z3WA 5EPUA 3DDUA 2C9YA 1U8TA 4URYR 4A0SA 2P27A 1Z37A 3ZDZB 1MPXA 1JP7A 4IJMA 4UU8A 4G67A 5FFNA 1DO2A 3OLXA 4WOBA 5ECYA 5BQ5A 3UXHA 4DEXA 2EF0A 1ZCBA 3K09A 1C0KA 5DO9A 1U8UA 3IDFA 4MYDA 3LUPA 4HJXA 1E2NA 5DYGA 3FWZA 4TQAA 1IC6A 1EBFA 1AJEA 4UTXA 4IXMA 4DCVA 1EGAA 3C5CA 1Z0FA 3MUNA 4CW7A 1IZYA 3GFTA 1Z12A 3I6BA 3UXYA 3LGXA 5C1PA 4DKJA 3NPMA 2WIJA 2IS4A 1QK4A 3O92A 3WBJA 5FPSA 1C3JA 4YRJA 1UJNA 2QQEA 3AGQA 1N0WA 1CUJA 1FUKA 2YJ5A 5JCOC 1C8VB 3O2NA 3OZAA 4TYWA 5K3FA 3PFNA 1VKHA 3DH0A 1DWPA 4M88A 4ITRC 1V37A 3S1LA 4H7JA 2ZXFA 3A0UA 3AWDA 1U90A 1FTGA 3ESYA 5E7JA 1JXOA 4XYLA 3CIFA 4IJWA 2O3UA 2W6JD 3RSLA 5J1SB 2QD3A 3PNKA 5AM5A 4G1VA 3LHKA 4CF7A 1DLJA 2Q1WA 2FPWA 4E1VA 2H6EA 4YLYA 3G9XA 3FYHA 3SZMA 2ZWIA 3FUVA 3TIGA 5A4JA 4DQ0A 4YY3B 4WLFA 1CBUA 3PX2A 5EERA 3T1HB 3NC4A 3R9WA 2CDBA 5EHQA 5I7WA 2GAAA 3ER8A 2IVFA 2YV3A 4J1TC 4HYYA 3FPJA 1NNUA 4Y2HA 3MXTA 1BH2A 3R5KA 4MW5A 2HNKA 1UMDA 3C24A 3UYLA 5CBPA 4HPJB 1SQ5A 1K7XB 1LV8A 3OU7A 3P2JA 2OXIA 2AW3A 3FX2A 4M9QA 3SIPA 4DS3A 2E4ZA 2PT9A 2QMHA 5BSFA 3H6HA 2IW1A 2QQ5A 2XNCA 3G8CA 4G1UC 2XSZA 4OXNA 5AKHA 2QIPA 5LMUB 4WNAB 3RK0A 1AM4D 4I4IA 4MYTA 2VJYA 1EFRA 2BR3A 3R7BA 3CINA 2ZT7A 4AVYA 2GEJA 2PJUA 1FSFA 3DMGA 1HDXA 4G56A 4J9VA 4MWEA 3VX4A 4UHEA 5J2UA 3ZDCA 5C53B 4FN5A 1BW9A 2ECOA 4MQFB 3K0SA 1FMFA 4FONA 3QJ5A 3Q1KA 3PVSA 1J56A 1OAAA 2PO7A 4UM5A 4ERNA 1ZM9A 5JDCC 5SYMA 4CKCB 4B3SB 1T25A 1NYRA 2FN9A 1ETUA 1PIWA 2FUEA 4XRRA 1T2CA 1K3TA 3C14C 1RAGA 3L07A 2NZVG 5H02A 2EOAA 2VPQA 1NP3A 3VTZA 1SUFA 2FSHA 5TC4A 3R23A 5IT4A 1QU3A 5HUQA 2Q0SA 4PC3A 4RK0A 1YI1A 5A7FA 1WDTA 1ODKA 3OFSA 4JSRA 1JNXX 4KI0A 4X6UA 1YE5A 2LE0A 1E1RA 1W7AA 5CT6A 2PCLA 3LA6A 4MS4A 1NULA 4ZHQF 4AMBA 4ZMSA 3GT3A 1G18A 4OI1A 1V1RA 1QIFA 5EKTA 3HCEA 4GOXA 2BFOA 4BZWA 3JS5A 4ALIA 1Q15A 5GIPE 3OZEA 4E30A 2QTZA 2HRBA 4G0VA 3TUIC 3S70A 1BFUA 3GZTB 3PHIA 1FRFS 2HJSA 3GGGA 3GMIA 3NM5A 1WP4A 4W4TA 1J42A 1Q3HA 2GAIA 2QVBA 3UWMA 3JWEA 1Q83A 1ZGHA 2J3EA 1NLYA 1XZBA 5AW1A 1W6RA 3ZCUA 3BD9A 3RJ5A 4GKJB 4AUKA 2GN1A 2WMDA 2VF2A 1J9GA 5E3JA 5B36A 2ZCJA 5DISB 4S05A 1TMYA 1J9EA 4ZQBA 4FNGA 2OILA 1S9DA 1OLUA 4L5YA 4BJ5A 2XB2A 3WK9A 3H0CA 3CXUA 3BWCA 1J70A 3WWPA 4Y0NA 1M6YA 1OIVA 3TPFA 2VIIA 3L18A 1YTUA 3IRUA 1AQIA 2C82A 2GRAA 4V02A 1K6JA 2ZTHA 4A73A 5ENDA 1XXHE 2ZOSA 2VS1A 2FVYA 3AHEA 3HJUA 2BF4A 3IHLA 2FPKA 2EYQA 4OIFA 3T3NA 2HMTA 1J7JA 2LD4A 1NP6A 3U0BA 3VR2A 3M1AA 1T43A 3AZPA 1ZI6A 3D3NA 1QYWA 4Y0AA 3FVTA 3OG9A 2XB6A 1TC1A 1RM3A 4PSDA 3FHLA 4DLAA 2QV7A 3LBFA 3AKEA 1CK4A 4O1IA 2DWCA 2W6QA 2FR8A 4F3CA 5JFOA 1FP6A 1CG6A 1RI4A 4IPTA 3FNBA 5D3MA 2HPZA 4URXR 4O6VA 2GJAA 3U80A 2DPYA 4ND8A 1AV7A 1LGYA 4RS4A 4CM8A 3M5WA 3A1SA 1ECGA 1NQTA 3QENA 3EVZA 1SD1A 2XGOA 4ZVRA 4F9FA 1PYGA 2HCJB 5I4BA 3DV2A 3ETEA 4YRPA 4UEWA 3U3DA 1N6HA 2ZDGA 4H0NA 1E1CB 1P7YA 4MHOA 4W9NA 5JG7A 4MVYA 1VM6A 2MHCA 3IBTA 1V5GA 4Q3NA 3WYGA 1Y1PA 4P3NA 1XAJA 1ZH2A 1SKYB 4X41A 5AK4A 1QG6A 4DUGD 2WF8A 2WP0A 5BWOA 3QE0A 2H1WA 4HATA 3KV3O 3G0IA 4Q7QA 3Q0IA 3DHYA 2F3PA 2F1OA 3ZGXA 2IJGX 3KQUA 1BD4A 4ARIA 5ALDA 4QVGA 1TM2A 4JOQA 4QNNA 5IWAB 1XL0A 1ZL0A 1JEQB 2B0JA 1R4AA 1ITZA 3ORYA 4R54A 4HNTA 2FQWA 3IP9A 5AJWA 4EARA 3H04A 4PZUA 5L3SA 4LY3A 3MTQA 4JX8A 1UBUS 4F5DA 3CE9A 2WTMA 1G4HA 1OILA 1ENZA 4O63O 3DBOB 3LCVB 4BMOB 3GC6A 4C4PA 2V8BA 1UMKA 3OUZA 1BAPA 3AEKB 5AI0A 2PRZA 4B80A 1S02A 3AP3A 3I76A 4IHJA 3B3AA 1GUDA 5EHIA 1CIJA 2ISSD 2WTEA 3C97A 4H1WA 1RMQA 3EIHA 3BSYA 4LJ6A 4NCXA 4ZHQB 4R3WA 1ZR2A 2IGTA 1AGRA 1DO0A 4F9GA 3WLRA 3FPLA 4HGZA 1WR8A 2ERXA 3Q2OA 2KQUA 4MP6A 4WHMA 5F7XA 1H6DA 2C9DA 2ATCA 2CLKB 2F17A 1DBVO 1K6MA 3L77A 4KU4A 3T1NA 3ZXXA 4CMBA 4CIDA 1IY2A 3NBFA 4AL4A 1N5KA 5ITVA 2YYSA 1F48A 2BUBA 1N9GA 4OXRA 3H4IA 1FDOA 2HT1A 2WHYA 1Z5UA 2AEEA 1ENPA 2I22A 3MBOA 4FYJA 2QJFA 4P34A 4QBFA 4BNUA 1P81A 2BZ1A 4LNHA 4ZOEA 2FSFA 3N5CA 4WADA 3WA7A 3TIFA 2HDNB 2ZPTX 1KI7A 2RMKA 3BDIA 4ARZB 1ZM4A 1AHNA 1JHAA 1KPGA 1X1EA 2JLAA 5HJ5A 4X65B 1JSXA 3HXKA 2JHFA 5F4BA 1DAPA 3QRWA 1VI2A 2EZ8A 3PD7A 4NBLA 3HTXA 3T7KA 4QPJC 1UBRS 1HMYA 3HBAA 3WXBA 2Q21A 1T5TA 3THRA 3HO1A 1E32A 1VJ5A 2CXSA 3S6JA 3SR4A 1SVWA 1REQB 1DCKA 2EGUA 1XTTA 3FBGA 3LLVA 4WKCA 3CM0A 4D6XA 4RETA 5FUVA 1G38A 2HK7A 3MTGA 1Z2CA 4WECA 4B6GA 4QQRA 3L7BA 4KAAA 5F64A 4JLOA 2O05A 1WS6A 3CY6A 3EY9A 2DFVA 3FCCA 1WPQA 1JQ3A 1R2QA 1V25A 3JVIA 1P60A 5DU2A 5DN6D 2FFJA 1CWUA 5L3QA 1LV7A 4D3FA 1XIVA 1GNPA 2QYHA 4BWVA 1O0BA 1IUKA 3HP1A 2PGAA 3FFWA 3G02A 4B3IA 2E4WA 3ZDDA 3LQFA 1L5QA 2F43A 3D6VA 1R10A 2H7XA 1IXSB 1W94A 4KIGA 5AWFC 5HCIA 1MJGA 3PCXA 3U2QA 2DECA 3RWOA 13PKA 4OQQA 3ST7A 4NSNA 4K9OA 1C4WA 3OQNA 2ZSDA 4PBSA 2GETA 1HWYA 4C30A 1E3IA 2IY8A 2OYSA 4ZREA 1WZEA 4YJHB 2RHGB 4FW9A 1TCAA 5CR9A 1PU2A 3D1JA 5KQGA 4DM3A 2XNSA 5A05A 5EINA 3AJ8A 1YQDA 2E6UX 3LQ2A 2X2EA 1WZNA 3OCCA 4NBNA 3R3VA 3AMVA 1R12A 1RI3A 4B3CA 5JHGB 2WJPA 3GDGA 8AT1A 4FEEA 2RJNA 1MVNA 3NBKA 3O73A 2G1KA 3GJ6A 2PIAA 5ANRB 5FFMA 3VC7A 4PNEA 2BGNA 1E6KA 3GELA 3HCCA 4OU4A 5EY5B 4A82A 1JEAA 5BP7A 4O2RA 1CF4A 2AQKA 1ZN2A 2QRMA 4RMHA 4A3SA 3TR6A 1SKQA 3K9FC 1DOAA 1FUUA 1RNLA 5KVSA 3B2NA 1O9GA 4KDEA 4DIUA 2ZETA 3ZW9A 3C4QA 3LL7A 1T9KA 2QXUA 4JLMA 2CCGA 1CZKA 3DT8A 3N2NA 3KTOA 2Z43A 3P0JA 1H6CA 3NHAA 3R6LA 3PFHA 5T3YA 2X86A 5E2BA 3ROPA 3CLTC 2ZPAA 1NVKA 1OH7A 3INYA 2B7LA 2QL5A 3HEBA 2SKEA 3EXHA 4LDJA 3ETNA 4FXPA 2ZYRA 3K31A 3KD3A 1IPFA 2PSEA 2LWIA 4MWCA 2G3YA 2C7VA 3P0HA 2O8FA 1LDBA 4DCCA 3E7PA 4BFSA 3BIOA 3WGKA 2OP0A 3AT1A 4Z3DA 4Z7QB 3MTAA 5ITZB 1GPJA 4Z4GA 1XVVA 1DQRA 4J0QA 1LD3A 1YQQA 3ZI7A 3JAMA 3B8EA 4E07A 4KPUB 4R7TA 1MG0A 3LCCA 1PHRA 2M1ZA 4N1AA 3RU7A 3OTOB 4JUIA 1CE8A 1G0NA 1NP7A 3SKVA 3GGCA 1ZRMA 3F96A 3BGSA 3L0SA 5F7JA 2G9VA 5AM3A 4DR2B 4BO0A 1AKQA 4BKRA 2D1SA 2O7QA 3JWHA 1THMA 4GXTA 1EE9A 5ALSA 4Q1CA 4ISCA 4K28A 3WFZA 1IZZA 2GWHA 4BMXA 2O8DA 2BBWA 2WHXA 3B5EA 5GJWC 4XLTA 4YLEA 4BB5A 1JIVA 3P45A 1EWRA 4HFRA 3V55A 5B1YA 3KR1A 4MRNA 1OA0A 4XAQA 3H5OA 3OY7A 4M8IA 4U8HA 4DJEC 2OD2A 4IQ0A 3MWEA 2Y4NA 1Z9BA 1ZH8A 2EJCA 4H77A 4D57A 4Q12A 3KKOA 4PLYA 3P8ZA 1N5OX 1RQLA 2WWFA 1M5UA 2PTGA 2AZTA 3RREA 3EF3A 2QVYX 5D3KA 1ABEA 5IFKA 4TVSA 4XD7D 4GXQA 4OFXA 4PAOA 4XJSA 3RVSA 3UJ7A 5KKCA 2DR0A 3KETA 2O1WA 3T54A 1WOYA 1Z4KA 1VL6A 1WMAA 3IV9A 4NZPA 3JALA 3PF8A 4QU0A 4YJGA 4I1IA 3ETDA 3H9CA 2ZYSA 3ODGA 4H3SA 5E0OA 3Q6NA 4M1KA 3JSAA 1LJLA 4YMTA 3M3HA 5IKMA 1G63A 2ZJ7A 2VEDA 1HFWA 2XYGA 3IMEA 3UOGA 1URPA 4ENWA 121PA 2J3HA 4NBKA 16PKA 4OJTA 4PF1A 3ZTTA 1G3MA 4LWOA 4K6GA 4L3OA 5HCUA 4YAOA 4GP9A 3BXFA 4WINA 4XEHA 8ATCA 1JR2A 4DV1B 1VPLA 2PRKA 1MTZA 3DSRA 1ZUNA 4AK9A 1OBFO 1TF2A 4J2OA 2PXCA 5DEOA 4NX2A 4L76A 2I7VA 3V8EA 1G64A 3QNWA 1K2WA 4WA8A 1R66A 4NBVA 5F12A 5G0SA 2WD7B 4MKZA 1X15A 4NNJA 1V11A 5HJEA 4Y2RA 4AF7A 1JKMA 3GG2A 4D9GA 1EINA 2CT8A 4LYEA 3LYAA 3FTPA 3IAUA 4GR9A 4XI9A 1QAOA 3PXEA 1VC2A 3B1XA 1VPEA 4DWVA 3O94A 4NOKA 1RVDA 1SG9A 4J0FA 4YCDA 2RGAA 5ARDA 3HNRA 2ENWA 3DV9A 3U4AA 4MR9A 3OIGA 2PSFA 2Q2OA 4JGIA 5T67A 3FUCA 3GJ7A 1U04A 3FCSB 2PLNA 4RTOA 3P9PA 3EC1A 1SBCA 5UKDA 2JVKA 5BV8A 3QYAA 4MS3B 4I9FA 1KO4A 1E2KA 2WG0A 3TVDA 3ELWA 4KNVA 4OHXA 4OQZA 4UFOA 4P81A 4FFWA 1TUGA 1RI1A 4TXMA 1CQPA 1FFGA 3N2ZB 4JR1A 4XCQA 2NTEA 1UOOA 2QDKA 1JLRA 4IIHA 2NU8B 3WHLA 2DXIA 4C5BA 4OFBA 1NF3A 1TE2A 4N0DA 1KEEA 3PWKA 2Z4RA 3CR3C 5JECA 3E3AA 2A5FA 1P91A 2IZ1A 3BG5A 3AFOA 1NW9B 1SUSA 1YVPA 4C1NA 3PFIA 3O8OB 2B34A 2Q5IA 3FPEA 4KK3A 4MDYA 1FSSA 3PHBE 3RU2A 1XGKA 1C4OA 2GM3A 3UK1A 4M0KA 2VRCD 3PGMA 1THGA 1JEDA 2PWPA 3MSXA 4INJA 4LY0A 2RDMA 2J67A 1RXIA 3FAZA 3MS4A 2EG5A 4GX1A 5L53A 4DIDA 1P4AA 5I4CA 3C3KA 2O19A 5FEUA 4PBTA 4ESEA 4UE6A 2O20A 1MEEA 1XZFA 1UQTA 2WM3A 3TMYA 1KVUA 1IZ0A 1NN3A 1SBIA 4LZAA 3FRIA