2RMKA

Rac1/prk1 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
192
structure length
192
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Rac1 Polybasic Region Is Required for Interaction with Its Effector PRK1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/transferase
molecule keywords Ras-related C3 botulinum toxin substrate 1
total genus 32
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rmkA00
4OHVA 4POAA 2O8FA 5DH9A 2X1VA 4PQFA 5E7MA 4C9BA 4QJ4A 3LBNA 4RVCA 3SNHA 2X2EA 5C18A 4L9WA 4NBSA 1N6IA 4MRRA 4RD6A 3U6BA 3MLEA 1PLLA 4ARZB 3I5XA 3CF0A 2GTPA 3GLIE 3T61A 3K09A 3V9PA 4BFTA 1E99A 2OCPA 1GL6A 3TE6A 5DNYB 2AD5A 1D2EA 1GZSA 2AR7A 3C4JA 1P2TA 2IYWA 2V55B 3KX2A 2W2TA 1SXJA 1UADA 2XTZA 4DLWA 3QIAA 2C9YA 3CPHA 1VG8A 2QL6A 5B57C 3GLGB 2BCJQ 1U0LA 5J4YA 3SBDA 1RJ9B 1SHKA 3AF0A 3I61A 1U98A 2N42A 1UBCA 4LBWA 1JAHA 3W6OA 3THXB 1YZNA 1UBGA 1XTRA 2BBTA 4YDHB 4Z8YA 2X77A 4ZO4A 4YQFA 1SKYE 1VCNA 3H0KA 1KK1A 1KSJA 2WOOA 4ILEA 3ZVLA 3VKGA 3UG7A 2QT0A 4TQ9A 1ZUHA 4Q4HA 4MDFA 3FMOB 5JSZA 3R20A 4UNSA 3AKEA 4JLKA 4IVQA 1DAEA 1QHGA 4P4TA 3D6TB 4I1VA 1FMLA 4LV5B 3WP0A 5AUNB 4URVR 2RMKA 2C95A 2PH1A 4CEHA 2P3SA 5JWOA 1E0KA 3U44B 3NH6A 2BEKA 5KU1A 2WKPA 4LBYA 1QHHB 2G9NA 4OK3A 4DCVA 4EUNA 5AUOB 1NL3A 1QHHA 1XTJA 3I8XA 5FTKA 2Z83A 5CK5A 4BFSA 3U44A 1W4RA 4RKEA 1EFTA 4DCNA 1YVDA 2CLCX 4BQSA 2WSSD 4L9SA 1WCV1 2ZRBA 3D3QA 3U3JA 2QMUA 3U3RA 5AUPB 3ASYA 1KYIA 1BMFA 1JR6A 3IDQA 5DYIA 3WMEA 3VMFA 1KMHB 2WWFA 3H4MA 3LO5A 3AKDA 1Y63A 2XNSA 4Q5IA 1E2PA 4JLDA 5BN3A 4FIDA 4A1FA 5JLJA 1G6HA 5EXTA 1E98A 2ECKA 2JA1A 3CONA 4PHFA 1Q44A 4PPFA 1G17A 4KVGA 1F48A 1CR0A 3B85A 5A0FA 3AF3A 4Q4JB 4JLNA 4IDHA 1CJUC 1R0WA 1IM2A 2QT1A 5KSPA 3RDPA 3VR2A 5AR1A 4HB2A 3ADKA 3GLGA 3AVYA 1XP8A 4C30A 4A0RA 3GLGE 2A5GA 2P67A 3FKSD 4ASUA 2XGJA 1SXJB 2D62A 3DDCA 2FJUA 3SU8A 1YR9A 3A37A 1OXVA 3HDTA 3B5JA 4DSUA 1ZNYA 3HWSA 1KAOA 1AA9A 4KBFA 1W0KD 3NEYA 1DAMA 2P6NA 3T5DA 1QHIA 1TQDA 3VKWA 4CGZA 4L5BA 2JLWA 4DLVA 1FZQA 1BYUA 2QPAA 3NC0C 1CRPA 4XWKA 5KSYA 3EPKA 1OIWA 5FBWB 2GK6A 1MH1A 3R8FA 3CX7A 1W44A 1MABB 2FSHA 2O8FB 4FMCB 3ZVNA 2XXAB 1N6NA 2ZJBA 1XDBA 3FKQA 2RKOA 4WXRA 5HZHA 1OHHA 1XMVA 4LPSA 4MYUA 1UJ2A 2GEVA 2GKSA 2QM8A 2ZYVX 1GRQA 4OQNA 4E03A 1CR2A 4LHZA 5FTMA 5GJCA 1ANKA 1FFHA 1C4OA 2WICA 1KJZA 5JI3E 2X8AA 3U61B 1DOAA 2HDNB 1SXJC 4M9SA 1DADA 1E79D 4X8MA 2ZSAA 1FUUA 2CLSA 4NCNA 2OFXA 4FWIB 4Q4LA 3F3YA 2UVQA 4A8JA 2QENA 5KOYA 4OI2A 1R8QA 3Q9LA 2ZM5A 5ELXA 4AY2A 1Q1ZA 2QQ0A 4P33A 1E9RA 1P2SA 3ZIAD 1E9FA 2B92A 4LOAA 3AP2A 2N46A 2DPXA 3UATA 3FMFA 2JJ2A 3FWYA 4Z8XA 1A2KC 3QBVA 1P3JA 2ZS9A 2PZFA 1CU1A 2CHQA 5L3RA 1ZU5A 1ZYUA 2YOFA 3E70C 2CCKA 2QP9X 4JT2A 4GZMA 2JEOA 4EPRA 4HUQA 4C0BA 1R5OA 2AWNA 2CL7X 2JLRA 1A82A 3KJIA 2QG6A 5FR2A 3QVUA 4NYJQ 5DN6D 4OHXA 2QBYA 5CB6A 1IJFA 4MGZR 2D74A 4U5XA 4ZKEA 5FR1A 2WPDD 4WBSA 3A1TA 4R98A 1RIFA 2W2VA 3P1JA 3I5YA 4DB2A 3CX8A 2FWRA 3IEVA 3IEUA 2ZI3A 1HH4A 2VF8A 3N5CA 4OQMA 3I1FA 3A6PC 1QG2A 1ZUIA 4IFBA 3F5FA 3QXJA 1HTWA 2CCGA 3VR6A 2FU5C 2WWXA 3K0CA 2ZANA 5LD2B 1G20E 2KJQA 4QFMA 5CK4A 4BGDA 3LLUA 3A1WA 4I1SA 1I4DD 3QKRB 2PT5A 5DN6A 1HA3A 4XVRA 1OJLA 2ZJ8A 1KO7A 1KI9A 4JLJA 2D3WA 2IYQA 3T35A 1G41A 4KBGA 3KKNA 1PLJA 4PTLA 3MWKA 3AUXA 2VLIA 4R2IA 2FPMA 4Q01A 4EQ6B 5D3MB 1J8MF 3BWDD 4N3NA 3THYB 2CBZA 2QTHA 3W3AA 4B32A 4A4DA 4LJ4A 4E07A 4UKDA 1E1RA 1Q57A 3L82B 4GPTA 4NYIQ 2FOLA 2IXFA 3QNUA 2VBCA 2AWOA 3BFXA 4BZQA 2FZLA 2QZ4A 4LJ8A 4DLSA 5L8VA 3QQ5A 1JQJC 4C0LA 1SGWA 1NF3A 1US8A 3ASZA 1JPNA 4YMSA 4KSBA 1E69A 3QEJA 2ATXA 3EIQA 1I4TD 1QG4A 1YZQA 2XTNA 4OQFA 4WOPA 1WMSA 4WW0A 5GJWC 3WHLA 1OHHD 1Z0KA 3A1UA 1ZCBA 2ZREA 2V1XA 3SYKA 5JS7A 3WBKA 4HLQB 2REXB 1GNRA 3GJ7A 1MT0A 2GJSA 3CNNA 4LJ5A 1OKKA 1P4SA 3TJZA 3C5HA 1QVRA 1UAAA 3ETLA 1EX6A 3PUXA 1E1QA 4IOKA 4BFUA 3CKLA 4KAXA 1GFIA 5KNCA 2P6RA 2IYZA 4YC7A 1G7TA 4HDQB 3T1VA 1E2KA 1YZUA 4IXMA 1NRJB 1KIMA 3K9NA 1GL9B 4F4IA 2CNWA 5IHPA 1PVOA 5JRZA 3ZD6A 5L3SB 1NY6A 4XTCS 3ZJYA 4PC7A 3GJXC 2VHTA 2ZRGA 1ZCAA 2A5YB 2G0NA 3NDPA 2C03A 4B43A 3WNDA 4GI7A 2AL7A 4LK2A 1FW6A 1IHUA 2FSGA 3U60B 3NBYC 1Q3TA 4B48A 4Q9KA 2BHRA 2J46A 3U2QA 4EDHA 2UZIR 3KJEA 4O2RA 4UQOA 4DHEA 3U7FB 4KXFB 5C4MA 4HYYA 2YC4C 3GLHE 3Q85A 1WB9A 4BECA 2OCYC 2GK7A 3O8CA 3LX8A 3R9IA 2GHIA 3LA6A 1W36C 3TUZC 1HQYE 3C5CA 2IHYA 2AXPA 4ESVA 3W8RA 3ZVRA 5C4GB 2NO9A 2MMGA 1X86B 2OILA 3K9GA 1ZJ6A 2FPLA 2GETA 4EJSC 2PCJA 2FFHA 4IEEA 3RS4A 1EXMA 1S0UA 2CL6X 3QXCA 4RZ3A 1AN0A 5DGXA 3QXXA 2JLSA 5B64A 5TY0A 4OKSA 1W7AA 4HB0A 3CRMA 3LY5A 3UPUA 2V8OA 4TTQA 5EQTA 4W5WA 4A6XA 1FQJA 3K70B 1L2TA 3F8TA 4MKHA 4DCUA 3BFVA 5BN5A 3UWKA 3X1ZA 4Q1AA 3WY9A 2YHSA 2J7PD 5JEDA 5CJ2A 2EFCB 3NDBB 2OT3B 2VHUA 1W5TA 1E0AA 2O8CA 3K09C 1II9A 2PZGA 1U9IA 4LRWA 4IJMA 4JZKA 4US2R 3PENA 1N6LA 2IYTA 5C46F 3BB4A 3AGPA 3NHAA 4MYCA 1JXOA 3IUYA 4B6FA 2XITA 2GVDC 1KO5A 4XVUA 4TSFA 3CIOA 2O8CB 4URZR 1NLZA 4NU0A 5FOVA 3GFTA 5JWHA 1GKIA 4B47A 2BDTA 1OKKD 1XWIA 3TUJC 2RGNC 2QMHA 2NIPA 4BFXA 2RAPA 2QTFA 2VP6A 4PPNA 5CB8A 2ZRPA 4HAVA 1KDTA 4FI3C 4HLCA 3SJZA 3TAHA 3QG1A 1HYQA 4IVRA 4D81A 2J0UB 1NVUQ 4QKQA 1HQCA 1SVWA 3U3KA 4PZZA 1ZM2A 4BZPA 3B13B 1T3SA 3MGCA 4X8OA 1N6KA 3BD9A 2J0VA 1NN5A 2IYVA 4DLTA 2F1RA 2YWHA 2EFGA 1NP6A 1W2GA 4D6PA 4FCTA 5F9FA 1JALA 4URYR 5J4LA 4D4JA 2W6ID 4II7A 2O8BA 1VG9B 3NIBA 3EA0A 2QAJA 1KK2A 3UMSA 1IN7A 2R6AA 4DZZA 2ERXA 3QSYA 4E22A 3B9QA 4DXAA 4ZI2A 3BOSA 1L4YA 1S1CA 3DEFA 1CJTC 1E1QD 1II0A 5KPDA 2Q9BA 3K70D 3I3SR 1XEWY 1XZQA 3PJRA 4TZ6A 4Q4AB 2H17A 3KL4A 2GAAA 5JJIA 2MSCB 4XH9B 1EFRA 4HLDA 1TEXA 2ONJA 3E1SA 1PJRA 4QJ5A 4V0KA 1TF7A 3KKMA 1JNYA 2P5SA 2R62A 1XD2B 4ZKDA 3KQUA 1U0JA 1YZTA 1E2GA 2NGRA 4HB4A 4AWXA 2HYDA 2BBOA 2ZRLA 3HR8A 3KTAA 3MCAA 4AK9A 5L3SA 221PA 1IY0A 4PSVA 4NYIR 4A2WA 1D2NA 1B23P 2OLKA 2D2FA 2GZDA 2PBRA 4P32A 1DVRA 1NBMA 3PIRA 3ZZTA 2E9SA 2DWQA 2A30A 5KNDA 2OXCA 2GJKA 1E1RD 5TV2A 1T8UA 3MG9A 3JVVA 5FFMA 1NY5A 4K46A 3AB3A 1QDEA 3VU9A 3UWOA 3BB3A 3AVXA 2FX3A 3HYTA 3OZXA 3A4NA 1P75A 1ZM4A 4D80A 3O8RA 4R71A 3MWYW 1G3MA 1GRNA 3I72A 4YXWD 1U8AA 3ICEA 4OHZA 1YRBA 3S1AA 4CVNA 1ZNWA 1E9DA 2H5EA 2J41A 5FUXA 4BFVA 1ETUA 4IDNA 2PJRA 2RGDA 1Q3HA 3ZIAA 1Z0IA 5J4KA 3BC1A 4V0OA 2AFIE 2WMNB 1I2MA 4B35A 1ELOA 2QAGC 3SN6A 1OH8A 4JVLA 3T5GA 2OZEA 3OEEA 3W90A 4ESHA 521PA 1E79A 2W83A 4Z1MD 4B33A 4ZDWA 3B7GA 5CJPA 4C2UA 3PV0A 4HAUA 4AIIA 1VIAA 3N2EA 2AD1A 3WNBA 4ZPXA 2IEYA 4TLEA 1Z8FA 2JIZD 1WQ1R 2RGXA 2DHRA 3LXRA 1A1VA 4JIMA 2DWOA 2CK3A 1Z2AA 2JJ1A 3Q8XB 3CRVA 5TMPA 4R7ZA 2EVWX 1CR4A 4HATA 3SFVA 4OHYA 1OE0A 4L8GA 3VHXA 3WYGA 1S1MA 821PA 2GCOB 2RHDA 2ZRHA 3ICQB 1NJGA 3IQWA 3QENA 4A15A 2J0QA 1ZD8A 1R8SA 3R7WA 1SKQA 3MMPA 4EJSA 2ZJAA 2XAUA 1G3QA 5KSZA 2PLRA 4HLUC 4RFVA 2A2ZA 3AF4A 3OFNA 3I32A 4DDTA 3K0CC 4LYAA 1KSGA 4W5JA 3BK7A 4GFDA 1VMAA 4TQAA 3X1YA 2QPTA 4V0LA 4N0DA 4U00A 1XXHA 3RS3A 3P20A 4B74A 2A9KA 4V0NA 4MRSA 2HF9A 2HT6A 1W36B 1COWD 3A1VA 5FBRB 2P6UA 1D9XA 4H1UA 1W4BA 3WMGA 4JJZA 4AYXA 2OESA 4Q03A 2GWHA 5D3QA 2WWIA 1E32A 2BVNA 3AUYA 4UXJA 2IYYA 2KB0A 1NJFA 1Z22A 4XWAA 4BFZA 3GLFA 1LS6A 3FOZA 3L2OB 2B7BA 4ZV4A 2DFKB 4N0EA 3QXHA 3G0HA 5J5CA 2WSSA 4V03A 3KTAB 2VO1A 2QTVB 1W0KA 4KFUA 1ZW6A 4GRAA 2V7QA 2JLVA 2RGCA 4MITA 4C2TA 4DBLC 2V1UA 2RGNA 3B2EA 2OSBA 5DHFA 4HB3A 3GEIA 4HZIA 2YYZA 1JXMA 3VAAA 2AKYA 1E2JA 1COWA 1J99A 3RABA 1GILA 1E3MA 3OE7A 3TW4A 3CF6R 5JZVA 1ZM9A 1A2BA 2I3BA 3MJHA 3CUEF 1YHNA 5BN4A 1L8QA 4NCJA 3TQFA 2ZUCA 5AJXA 2VEDA 1JAIA 1R5BA 3TW8B 4EFNA 1WF3A 1OH5A 1M6NA 3G82C 1OW3B 3KQLA 1RC8A 1DAHA 2ZRKA 3SHWA 3W3ZB 2W58A 5FTJA 3C41J 4M21A 4B3CA 1JR3E 2IF0A 2QGNA 4KHZA 4LUCA 3AQ4A 4DSNA 4QHSA 2NO7A 2JLQA 4B3GA 2LKCA 1J90A 4C0HA 2WWHA 3CPEA 2OCBA 3W8NA 1FPMA 4CZ2A 621PA 1CS4C 3EZ7A 4NTZA 4AYTA 2IC5A 4O2LA 4QG7A 4US1R 3VHLB 4KITB 1G291 2W0SA 2WV9A 1E96A 3HR7A 3LV8A 1I4LD 3SS8A 5LD2C 1P7CA 2BEJA 1X1RA 4LC1A 3W5JA 1QHSA 1ZM3A 4HZUA 1ZP6A 3SDZA 2JIZA 4HAXA 1X6VA 4KFTA 5HR5A 1Z6GA 1E2LA 1NKTA 1KDPA 1NG1A 5F2EA 4DLZA 4UXHA 3IPYA 2OBMA 4CIDA 3GJ0A 5G40A 2O5VA 3IQXA 3GJ5A 4GDFA 1MKYA 3KJHA 3KDSE 5KPJA 4A0FA 1KGDA 4C3ZA 2RB4A 4AG6A 3PCRB 3PQCA 3B1VA 4JBWA 4EPXA 2R8RA 3SJCA 1HE8B 5CLLA 3KKPA 4YDSA 5FUYA 5EXSA 4FXPA 2HCJB 1W46A 2J5XA 1BH2A 1SZPA 3RS7A 2H8KA 2OG2A 2D7CA 5EP3A 5TDHA 1XTSA 1T8TA 2VH5R 4GOXA 4CEHB 5JJLA 1TL7C 4Q9LA 3THOA 2QMEA 1P9NA 1GRRA 4DUGD 2YOGA 2O8DA 5FL3A 5SZKB 3B6EA 3VNUA 1H65A 3IILA 4W7SA 4M1KA 5EE3A 5G53C 2NMVA 5EJEA 1IY1A 3CR8A 3CLVA 3EA5A 4MGIR 3SJBA 2GXAA 4BEJA 4M4SA 4NHOA 5CM8B 3ZD7A 1N6PA 4Q1BA 2Y8EA 2KE5A 1TUIA 3THXA 2ZI7A 3DMNA 4NONA 4BASA 3REGA 1KO8A 1VKJA 4G5OA 4RY2A 2ZR9A 3FFAA 1IJEA 3HU1A 4MH0R 2Z0MA 1FNNA 3MWLA 4GNKA 4WAUA 5DHAA 1QZXA 2I1VB 2FZ4A 4KYUA 3ZH9B 5IK2D 4U02A 4KLNA 4IOMA 1EFRD 1UF9A 1VCIA 1NVVR 4TT3A 4TZ0A 5E3HA 3WMFA 2AK3A 3H84A 5FOWA 2P5TB 2QSYA 3RYTC 2J45A 5B30A 3GPLA 1AGRA 3BAFA 2OEPA 3JZAA 4EQ6A 3TRFA 5LDDC 5M04A 2QAGB 1KJWA 3LBHA 4GP7A 5CYPA 2ODWA 3VR4A 3TR5A 2JJ8A 2XJ4A 2XZPA 4ZDKA 2R6CA 5HKKA 4UXIA 4PO9A 1OFUX 3K9LA 4P4SB 4LCBA 3CR7A 4M0LA 3PUWA 3IHWA 1L4UA 3K0AA 4LV6A 4URWR 3TVDA 4Q7LA 3TMKA 3FMIA 4MRNA 1LY1A 4OHWA 4JJKA 3TGPA 1GVNB 2VHQA 3B1WA 4YMTA 5K8IA 1LVGA 4B71A 1SXJE 3FE2A 1N6HA 1TQ6A 2AFHE 3L8ZA 3FFBA 1QRAA 2ZIAA 4PAMA 2GBLA 1K6MA 3ZLJA 1LB1B 4A2PA 3BFKA 4MKIA 2EYUA 1S9HA 1US8B 1P5ZB 2CE2X 2BMDA 3NTUA 4CYMA 2ZPTX 3B1YA 4FINA 3PUZA 4M1YA 4MUAA 4TSFD 3W9YA 4XTRA 4E5UA 5F9HA 4DIEA 2IWHA 1XJ0A 3BJIC 4BLSA 3QI2A 1ZAKA 2ZR0A 3THYA 3OIWA 2WTUA 2GEDA 1FQKA 4TL6A 1BIFA 4FMBB 4RFSB 4HDCA 4RZ2A 1G5RA 1NNEA 4JLPA 1RYFA 5C2JB 1FTNA 3WHKA 3SBEA 1KZ7B 2J7PA 3HP1A 2MMCA 1JEDA 2G0TA 3PVSA 4ZDIA 4TLDA 3CO5A 1CIPA 2R6GA 2OO7A 3EIHA 1AS3A 3CZPA 4B3XA 1OB5A 2B21A 1M8PA 3U6KA 3CBQA 1NIPA 2IW3A 4H9GA 3RS2A 4NDZA 3R9XA 1JR3A 1S8FA 5HE9A 2GJ9A 3RRZA 1OYWA 3CF2A 2YKGA 1FL9A 4URUR 1Z0DA 4G1UC 4IRUB 3DZ8A 4MYHA 2C5LA 3BH7A 1HY3A 1NVXQ 4HUTA 4Q00A 5B2ZA 1AS0A 1XRJA 1XTQA 4P4SA 4PC1A 1WRBA 1P2UA 3OESA 3QEOA 4PQYA 1EWQA 5KO2A 1LW7A 4DSOA 4MYTA 4Q7KA 3GP8A 1KKLA 3H2YA 3U7HB 2QBYB 5K8LA 4KJZA 1UKZA 2QE7A 2OLJA 3OAAA 1AQUA 3SOPA 3PUYA 4Q7MB 5G41A 2DYKA 1G18A 4UNQA 4PZLA 3PUVA 1H8HD 5AJWA 4DEXA 2CVHA 2HUPA 3Q5EA 2RGGA 5EXPA 2BV3A 1E0JA 2R65A 3LAWA 4FMDF 2XOKD 3NVAA 2ORIA 4UNPA 1VYVA 1T9HA 2B8WA 4I1OA 3ADCA 1OYYA 2BCGY 2A5DA 4GBMA 5FL7A 3KKQA 1TPZA 5JWRA 4D0GA 1KK0A 2V7QD 4Y0VA 2HLDA 1H8ED 1OF1A 1U81A 5J47A 3NEJA 1GITA 2CNWD 1YQTA 2ORVA 3D8BA 1M7BA 4TTPA 4A8JB 1X1SA 1DTSA 2WAYA 5HE8A 1PV4A 1G8YA 4B75A 1XXHE 4M1TA 3KQNA 2IX3A 2JATA 3AKCA 2CJWA 1CR1A 3K0AB 1RRFA 2OFOA 1EWRA 4JYCA 5BQ5A 1DG3A 1G21E 5DI3A 3UMFA 1NLYA 2WHXA 3BERA 3WRXC 4TYNA 4QM7A 2XXAA 2ZRJA 4BWYA 1KAGA 1KO1A 4AKEA 1VPLA 1ZNZA 2O0HA 3GD7A 2AHOA 1N5KA 3WYAA 3GLFE 2OFWA 2FF7A 2ANCA 4B3DA 3PEVA 1SVKA 4ITRC 1EFCA 2Q21A 3L43A 1WXQA 4DB4A 4JLVA 4XSHA 2VSOA 4Q02A 2D7DA 3MRSA 2GBLC 4KLZA 4TYYA 5FOXA 2QU8A 4KSCA 1D8TA 3AEZA 4M8NE 4V0ME 4LHXA 3R9WA 4L4UA 1HT1E 3RC8A 1W0JA 2GNOA 1JEEA 4Q4HB 2YOHA 1VCMA 2IHBA 1PUIA 4OYHA 1T5IA 4OJKA 2OHFA 1TMKA 4CEJA 1WE2A 2FFAA 1E2IA 1TF5A 2A3RA 2JJ1D 4KODA 5EUQB 4ACBA 4WA7A 5LBIA 2DFNA 3EW9A 4G01B 4OI1A 2QMOA 1YR8A 1JJ7A 4LJYA 5EP1A 2IF2A 4CEJB 2WJGA 2XEXA 1XJCA 3NHBA 3C7KA 2XZOA 1T0HB 5A4JA 2C78A 2CXXA 2IL1A 1J8YF 2CCJA 4M9QA 1CEEA 1DE0A 2MSEB 4UJ5A 4Q47A 2FEOA 3OEED 4M1OA 1GM5A 4ON9A 3AVTA 1M34E 3LDAA 1E4VA 1N6RA 1Z28A 3CRRA 4PHTA 4LX0A 1R10A 2GJ8A 4D4LA 3ND8A 4MRVA 1NLFA 4FWTA 5HCNA 4LHVA 5FBVB 2QSZA 4LC0A 4E09A 4IVPA 3X1DA 2V6JA 1HV8A 4RD0A 3CH4B 4YXWA 3ZS8A 1GNQA 4ZDJA 3W34A 2FH5B 1EFUA 4KYIB 5DI3B 1SHZA 1G3IA 2QY9A 2H18A 3DPUA 4DCTA 2WJVA 2JJ2D 4QRHA 5DYGA 3T06B 1XJQA 1UPTA 3T1TA 1E9SA 1AK2A 2ZRIA 1Z6YA 4NYMR 3SZRA 2REBA 1IQPA 2C9CA 4PR0A 1UDWA 3TSOA 4PAQA 4BLQA 3EXAA 2BMJA 1BOFA 4DT1B 3NXSA 1GNPA 1I2DA 3AVPA 3KFXA 5L3QA 3AGQA 4DCSA 5F3WB 1S2MA 1S4QA 4LY6A 4JL6A 1RJ9A 2QN6A 3GLFB 2G83A 2HCBA 4QHTA 4TL7A 2BM0A 3VX4A 2CE7A 2OUKA 4QXAA 1LS1A 2WJJA 4LPKA 5H70A 4DJTA 2PMKA 2BC9A 3BB1A 3U4QB 2W6JD 3CPJB 2ZITA 2NQ2C 4TYPA 3ZS9A 2OAP1 4O25A 3DZDA 3QPUA 4GMXA 2OE2A 3EX7C 1XXHB 4HAYA 3VR5A 4NYJR 2GF0A 2ORWA 2Q3FA 4Q1FA 2VP5A 3NBXX 3EPLA 421PA 4BE7B 5AJVB 2HLDD 2ZUBA 2ZRDA 2WJYA 2G1JA 4JSYA 5FL7D 4A36A 2WSMA 1TADA 2YV5A 5KHOC 3KQHA 4B73A 4OI0A 3WXMA 2IWRA 2ZRFA 5E7IA 4PO8A 1WA5A 1DAFA 1AS2A 1H8HA 1EK0A 4G5SA 4UJ3A 3GLIA 3GJ3A 1VYUA 1G8GA 4RD3A 2G1KA 1CBUA 2I4IA 3LWNA 1G3UA 1LF0A 1T91A 1V43A 4TL8A 3DOEA 1E94E 3U5ZB 3IPXA 1E2EA 4HAWA 3QOFA 4A0GA 2EWVA 2J59A 2BOVA 4BEBA 1G3RA 1N25A 4PC2A 3VNVA 2PJZA 2G3YA 3BORA 4G3XA 3UK6A 1V5WA 2NPIA 2O0JA 5GVRA 3OIUA 6Q21A 4MDEA 1U99A 3U7EB 2Q6TA 3RSLA 2JLUA 4RZXA 2IT1A 4NE2A 4QBGB 3GFOA 3RRMA 1GIAA 1KSHA 1F2UB 3EASA 2IUUA 5FPKA 1OT3A 3K0FA 1G4UR 1N3BA 4JLAA 4DEYA 4NZYA 2FFQA 2F1JA 2Z4SA 2H1LA 4Q21A 1S3GA 3IO3A 3ZZUA 2XB2A 2C8VA 3C15C 2D2EA 2QI9C 4O0MA 4RCZA 4AG5A 4DIDA 5JI2E 1E2NA 2FN4A 3SE0A 3SC3A 4F92B 2G6BA 4FMCF 4C4PA 3OAAD 4Q66C 4K81B 1IN6A 4ZI3A 2VTKA 3AF2A 5JECA 1DBSA 2WJIA 4M1MA 4A0HA 2IYSA 1XMSA 2V4ZA 2VPPA 2ZI6A 2G77B 1JI0A 1C9KA 1X8JA 2PL3A 4OJQA 4BUJA 4D82A 1E9EA 8OHMA 5L3QB 1RYHA 2EYQA 1DS6A 5K8UA 2R44A 4FN5A 1NN3A 1VG0B 2EW1A 1TQ4A 2ZSFA 3OF5A 1Q22A 1GSIA 1KY3A 2ZRAA 2J7KA 2X2FA 2I1QA 4FMDB 1N5LA 4C0JA 4F91B 4WIAA 1Q1EA 1XB2A 2VSXA 3EG5A 3GMTA 2XB4A 3I73A 4D0NA 2QAGA 1U94A 5GJBA 2IS6A 4BRWA 4LBZA 2XZLA 2ANBA 3DKVA 1DAKA 2VIIA 1G7CA 1KMQA 4A2QA 3L0SA 2EWWA 4D25A 2TMKA 2VRWA 3A36A 2ZTSA 1XX6A 4JVNA 3RHFA 3B60A 1Q1BA 1NVWQ 4OI4A 1IONA 4DDVA 1E4YA 1EGAA 3FTQA 2CDNA 4NYMQ 5CLQA 5HKKD 1E9CA 3S1AB 4TYQA 1M74A 1D6JA 5SZHB 3T1OA 3K0SA 2EU8A 3D7MA 2PZEA 3MSXA 5JCZA 3CB4A 1IY2A 2ZYUX 4Q7JB 4EFMA 3SJAA 4O3MA 3QKTA 1OSNA 4JL8A 3RVBA 2DY1A 4LYHA 2RH5A 1N5IA 3VU9B 5BWMA 1FX0B 2CHGA 3PG5A 4GP6A 1E2HA 2GILA 3RRNA 3I4LA 3K8YA 4G5RA 1CF4A 1KI1A 3IIKA 1IBRA 1QVAA 4OQXA 3TAUA 5KTYA 2ONKA 2CVFA 2BKEA 2UKDA 3WNCA 5HCIA 5FOSA 1G6OA 2N1BA 2W6JA 4OL0A 3NKVA 2F55A 3RC3A 1UEIA 4B3FX 4Q9JA 1P6XA 2JAQA 2BJWA 3I92A 2QROA 3B1XA 2VYFA 5AJYA 2DB3A 3GFPA 1IAQA 1OXUA 2WJHA 1DO0A 2WM9B 3K9HA 3D31A 4WXPA 3X2SA 4U7DA 3IBGA 4RSGA 3ZQJA 5E7JA 1W49A 1AKYA 5SZIA 2ZI4A 3AKYA 2CHVA 1JPJA 1Z0JA 2XX3A 2ZVPX 3AP3A 1JECA 1OXXK 2ZE6A 3T15A 1KI6A 3MFYA 4C7OB 1J7KA 1T5LA 4DDUA 4TWZA 1UDXA 2GCPA 2GCNA 1N0WA 1XBTA 5DE3A 5TVKA 4PSAA 2GDJA 3B9PA 3KJGA 4G5QA 1OXTA 1YZLA 4LGMA 2J0SA 2QA5A 4HZUB 1XCPA 3LXXA 4AI6A 2JDID 2NOAA 4DWJA 4XWOA 1RE0A 2CJWB 1NSFA 5FH9A 3QE0A 3SYNA 3UXMA 2P2LA 2F43B 2F43A 1GWNA 4C0KA 1XCMA 4QHYA 2IYRA 3A4LA 3O8BA 1XEFA 2Q3MA 3KKOA 3NBFA 1R0YA 3SFZA 2WAXA 1PUJA 1Z6AA 3L0OA 5LPNA 3A8TA 2YWFA 1Z07A 1MO6A 1EESA 2BM1A 2D06A 4PHGA 2EFEB 4S35A 2HF8A 2YC2C 2WPDA 3A4MA 1G16A 2QEQA 4WZAE 4DUGA 2KSQA 5HTKA 1R4AA 1PLKA 3MJRA 2WKRA 5DIFA 1OH7A 4AC9A 4TMXA 4ZIRB 1YU9A 2XSZA 1F2TA 4KFSA 2CEAA 3ND9A 3AVVA 4JLOA 5FBLB 4EPVA 3QPVA 2W0MA 3ADDA 4Q1CA 3RLFA 1U2RA 1Z5ZA 4IDQA 2PEYA 4EAQA 3U7GA 2BBWA 3CNLA 2EQBA 1ZUNB 1ODFA 3NC1C 3QUSA 4D26A 4ABYA 1GKUB 3QG5A 4KVAA 2GZAA 5A5GA 2ZI9A 1AGPA 1DO2A 4JVMA 4F38A 5EZ6B 1XZPA 1W5SA 4WZBE 5P21A 2GXQA 2J87A 1TNDA 2IYLD 3LFUA 4QC2A 3W6NA 5FPHA 3VTKA 2XJ9A 2MSDB 1Z0AA 1DELA 1IXZA 4TQUS 5K8TA 1ZVQA 1Z6XA 1KDRA 4TL9A 1XPOA 4KCGA 1LF5A 1OIXA 1QBKC 2H16A 2WZQA 3RANA 3IIJA 1AIPA 3QBTA 1FX0A 1NMZA 4M9ZA 1G4AE 1KSFX 2GJAA 2ZRNA 1II8A 1TTTA 2K5UA 3THWA 4F4CA 4NP6A 4TMWA 2CL0X 3EAQA 2VHJA 4NPHA 1W47A 4JS0A 2GA8A 4RFSA 3T1QA 4FD2A 1P61B 2FSFA 2YWEA 4TYWA 2BKUA 2IA5A 3UKDA 4YMWA 1ESMA 1J2JA 2Z4RA 3TSZA 1R2QA 4JLMA 2WOJA 1ZD1A 4Q19A 3IKJA 3KXIA 3LQQA 3SYLA 3X1XA 2PEZA 3ZVMA 4OK5A 4EJSB 1Z0FA 3OHMA 3TK1A 4XJXA 3PFIA 4NKRA 3TR0A 2IUSA 4QNMA 4BRUA 2JLYA 3TIFA 2ZXUA 4XIGS 4RD2A 4TMVA 3SQXA 4DLYA 1U9IC 1DAIA 3OE7D 4EPYA 1KNQA 2AX4A 3P27A 4K8OA 2Q3HA 3L0PA 4YMVA 1ZBDA 3ZYCA 1TAGA 5FTLA 3TQCA 1NBME 4QGHA 3HJNA 3QY0A 1CKEA 4BZXA 2GAOA 5FPSA 2ZEJA 2ZUDA 5SZJA 2ZU0C 1RZ3A 1ZC3A 1F3OA 1XTIA 3VR3A 3CM0A 5J4HA 3KB2A 1WBDA 1WP9A 4TMKA 1G1MA 4LSGA 5FI0B 2OXRA 3EZ9A 3KFVA 1BMFD 1RPZA 4QBIA 3UG6A 4CEIA 1N2CE 1XD9A 1Q20A 1W1WA 2FPKA 2R6DA 1GP2A 2F9LA 3NWJA 4DLRA 3EPJA 5J40A 5JRJA 4TTRA 5EE1A 2WVJA 4B44A 3BH0A 4A9AA 3M6AA 4KO8A 3Q7QA 3CX6A 3EIEA 4L16A 4RCYA 1T0JB 1Y3AA 1PZNA 2ZE7A 1BYIA 1D2MA 1IXRC 4PZYA 1X8KA 3NG1A 3QKSA 2PT7A 4PPGA 5BYJA 4Z1MA 1UKYA 3CNOA 1CXZA 2NPFA 3QPWA 3PITA 3MD0A 1VCOA 1P72A 2VA8A 1YRAA 4D4KA 5TB5A 1Q1QA 4M22A 2IXGA 2AXNA 2KBFA 3ONWA 2EFDB 2PMDA 3TUIC 3DM9B 3CW2A 2KI5A 1N0UA 2FGJA 1O87A 1QHNA 3RWOA 2HEIA 3RAPR 4P31A 4IHQA 1G5TA 1DG1G 3QXSA 3GLHB 1E9AA 4GZLA 3LW7A 3WRYC 3WBJA 2O8DB 5UKDA 2JLZA 2VHCA 4MKFA 4ZCMA 2P0EA 3SR0A 1XD2A 4KV9A 1T6NA 1OIVA 3TKLA 3H86A 2XSZD 3B78A 4W9MC 1NG9A 4L15A 1Z3IX 2AKAB 3M0EA 4C0AC 5FOUA 2ZS7A 1UKEA 1OLOA 4Z54A 4S2EA 3SI7A 1E6CA 2ZJOA 2IUTA 3TH5A 1P60A 4NCKA 4GOJA 2ODNA 2VP4A 1P9RA 1CTQA 5G3YA 3FYHA 3VX3A 2ZQ5A 4MRPA 5EE5B 4IXNA 3TLXA 4ZCIA 721PA 3HU2A 5F98A 1F60A 4GMDA 1XPUA 1VTKA 4GT1A 4US0R 2QRZA 2O8BB 5FUWA 4ZIRA 3BBPA 3MWJA 2C9OA 4EIWA 3KUDA 1R0XA 2RGEA 3A1SA 5JMTA 1KI2A 3DVLA 1NSTA 1RFLA 2B6HA 3MAAC 1X3SA 5KSOA 2J0UA 5JJKA 2YNMA 4TMZA 4NMMA 4MKGA 3KXKA 3RNLA 4G5GA 1JJVA 4MA4A 2ZJ2A 4RKFA 4DT1A 5IDVA 3N2IA 1S96A 2XTMA 4JL5A 3PEWA 2YINC 3NH9A 4RZUA 1E0SA 1FUKA 4NCHA 1XU4A 3FMPB 3LVRE 3BS4A 3EPHA 1G64A 4Y0AA 2E87A 2BJVA 2WIAA 3PR1A 3CWQA 1KMHA 3ECCA 3QF4B 3AF1A 2LCFA 1NN1A 5TXGA 1CJMA 2GVZC 1XF9A 2ODEA 2ZRMA 1IN8A 3K0EA 1GG2A 3KUCA 2L0XA 2WBLC 3FPAA 1MABA 3BE4A 3R8CA 4A82A 2Q9CA 2QP3A 4LWZA 1VDZA 4MGYR 3CH5A 3P4XA 3OEHD 2DBYA 5IRCD 2ZAOA 4GOKA 2OCAA 3ZQ6A 3IHLA 2G88A 4FCWA 1UBFA 2X19A 1UKVY 3X1WA 3LVQE 4RD4A 5EXXA 4C7OA 4JT4A 4QJ3A 2V3CC 4LBVA 4Q1DA 2VF7A 4PAOA 1ZC4A 3J81k 2KWIA 2XNDA 2NTYC 1GL7A 1K8RA 1XEWX 3C16C 3JZMA 3QF4A 1A5TA 1C1YA 1KHTA 2F6RA 3LD9A 4M1SA 3GJ6A 4PFSA 4PX9A 4TLCA 5DISB 1Z6TA 4R9UC 4C0QC 1P2VA 4ERNA 4V0MA 4W5HA 4AKGA 4LYFA 4Q9IA 2F9MA 2HYIC 1ZIOA 2PX3A 1KI7A 3FB4A 5JHHB 4PC3A 4M9XA 5JEEA 3HU3A 5FUVA 3ZZ0A 4BLTA 2VP2A 3GLHA 1VYTA 5HZKA 1Z2CA 2W6IA 1SVIA 4M53A 4P0TA 4Q4JA 4QNRA 2VSFA 1OXSC 1NN0A 1HE1C 1OFTA 1OPXA 3V00A 2HV8A 4LJAA 1FNMA 2EFHB 5CIQA 1RKBA 4NL4H 4B2LA 1XPRA 1SVOA 2B7CA 5FTNA 5BW8A 2QORA 3HPQA 2RHMA 4G0NA 2IYXA 2IBMA 4BLOA 5KDDA 3OIVA 3RSOA 2ZJZA 2ZSBA 4JLBA 2JCSA 3QKSB 1DARA 4NH0A 2PCLA 3QKUA 2DCUA 4QGAA 2WKQA 4MGKR 4JBYA 4BLRA 1XMJA 2P65A 5ANRB 5DLQC 4AD8A 1G19A 1QHXA 4DC9A 1T3LA 5EP4A 5H8WA 2AN9A 1FMJA 1AKEA 5GADl 4AKIA 1E2QA 2A5JA 3U3MA 3GEEA 2QNRA 2NG1A 3HYRA 3PXGA 3RRYA 1OB2A 5EE0A 1W4AA 1X8LA 3R7WB 1Z83A 4HDOB 3CWZA 4CEIB 1KDOA 4OK6A 2HJGA 1OV4A 1JR3D 1N5JA 3EZ2A 2HXSA 3FHCB 1CRQA 1UM8A 2GCOA 3E2IA 1Q12A 3PEUA 1E2DA 3EWSA 1CLUA 5JSZB 2BMFA 1U90A 1G8FA 4V02A 4AYWA 1R6BX 4LHWA 2GF9A 1TX4B 2C2HA 121PA 4FW9A 1UBEA 3B82A 3RS0A 2RCNA 1GDDA 1EG7A 4XD7A 1UEJA 3EC2A 5KNBA 3IBYA 3IO5A 1AQYA 1CULC 1SVSA 4QOSA 1B0UA 3LLMA 1N6OA 5DO9A 4B3BA 3TSWA 3VR1A 1R5NA 3FHOA 2V54A 4IFEA 1AM4D 2LKDA 5TARA 2OM2A 2H57A 3RS5A 3T34A 1TQ2A 1Q21A 1W36D 2O52A 1XNJA 2XNDD 3EARA 2YWGA 3FHTA 1KI3A 5CITA 1LNZA 5EP2A 2BIFA 1DEKA 1XCGB 2NO0A 5D3MA 1KNXA 2ODBA 4MQBA 2GESA 2ZRCA 3OEHA 2Q9AA 1A7JA 3THWB 1FP6A 1F2UA 4PO1A 4RD1A 5EUMA 1ZNXA 2NZJA 5L3VA 3RWMB 5GJVC 4WZ6A 4F4JA 5JFGA 2B8TA 3QKRA 1W48A 3FDIA 4Q1EA 2IS1A 2ZYWX 2FMXA 1FOEB 1XFAA 3AP1A 3LBIA 4OBEA 1YZKA 4Q18A 1ONBA 1U8ZA 2IYUA 1KOFA 3EZFA 5FPTA 1RRPA 3N70A 2GRJA 2QUZA 2ZETA 1M2OB 3W5IA 1HURA 3BH6A 1MO5A 5DI9A 2GZHA 4UNRA 1KZGB 4KI0A 1BS1A 3KB1A 4A8JC 4DRZA 1GKYA 4H1VA 5LB2A 2ZSDA 3BRWD 4X8LA 3AVUA 4D2IA 5EE9A 1IXSB 4EKDA 2FG5A 4TT3D 5IT5A 5CM9C 4F7WA 3ZDQA 4TLAA 3HPRA 1CJKC 3LH5A 2C04A 1T3HA 3I8SA 4Q4AA 4HUQB 2F3TA 4A6PA 3AM1A 2FGKA 4DSTA 1VG1A 3GQBA 3CZQA 1YJ5A 1M1YE 1KI8A 2YZ2A 5JHGB 2V9PA 4LI0A 2FDCA 3M1IA 1SKYB 3K53A 3C14C 3B1ZA 3IIMA 1F5NA 1Q0UA 1ZU4A 2ZROA 1TEVA 5BYKA 3GJ4A 2KBEA 3SEAA 5B58C 1II8B 4QBFA 2NZ8A 4BLPA 2HJVA 2W00A 4I1UA 3B8HA 1ZM7A 1MR3F 5KDLA 2QP4A 3Q3JB 4JMPA 1W2HA 1YZGA 1EX7A 1RRGA 4P4UA 4B76A 4DDWA 3U4QA 4PXAA 1E2FA 1ZD9A 3KZ1E 4D0LB 3C8UA 4CW7A 1G5PA 2FEMA 5FPYA 5BXQC 2BWJA 4P3YA 1K5GA 3AVOA 3FVQA 2VP0A 4Z51A 3BIFA 1KO4A 5CIWA 5AUQA 1W0JD 1ZINA 2VP9A 1AZSC 2C99A 3VFDA 4JBXA 3O47A 1YE8A 3FGNA 2J3EA 1CP2A 2GXSA 1MV5A 1XEXB 4PSKA 4BFYA 3LQRA 3W6PA 5JBQA 1OFIA 4R2HA 1MRNA 1E9BA 4N1AA 4CF7A 4QM6A 3VQTA 2O8EB 1VECA 1RRCA 1P73A 1TUEA 5J4VA 5KDOA 2ZS8A 4QGGA 3AVWA 3ZGXA 3ADBA 4QL3A 4Q48A 2Z43A 3SQWA 2R6FA 1WDTA 4YLGA 3GCGA 4B34A 1LV7A 4GSYA 1F2TB 4TLBA 4XOIA 1R0ZA 4JYBA 1YR7A 4JVSB 1Z29A 4IDPA 4C0SA 1SULA 5HPYB 4DVGA 1VIYA 2Z6VA 2D4HA 3GEHA 3KQKA 4QBHA 1FP7A 3EZ6A 4UNNA 1NMXA 2F3RA 4URXR 4PHHA 3V4RA 2ERYA 1GUAA 3L8YA 1NIJA 1NKSA 2QRNA 4PANA 2E1RA 3LNCA 5DSZA 4B6EA 3EWAA 1TU3A 2H7VA 1Z47A 1KJYA 3AV0B 3LW8A 2JLXA 4EPWA 1G7RA 1UFQA 3BXZA 2ASEA 1TF2A 5EZ5A 3A58B 3PEYA 1T4GA 4B2IA 2WIBA 5JS8A 4XSGA 4BFWA 1DPFA 3LX5A 3M4YA 4WVFA 4A92A 1ZRHA 1N0VC 1NI3A 5G3ZA 4ASUD 2IEZA 3G5UA 3F0TA 2J9RA 3V4FA 2JGNA 2QPOA 1AJEA 2ZJYA 3REFA 5FI1B 2VL7A 3SHFA 1DAGA 3UANA 2C98A 3DKPA 2IS2A 4X8HA 2J1LA 1KI6B 2ZE5A 2FV8A 2QE7D 2IXEA 3TNFA 3U3OA 3CRW1 1QHYA 1TU4A 3CRQA 2ATVA 4RJLA 3UIEA 4LDJA 1KI4A 4BPBA 2OBNA 1S3SA 3KXLA 2V6IA 5GVSA 1XTKA 1RW4A 1QF9A 1MOZA 4J0QA 1E2MA 1IN4A 2CMKA 1G9XA 2F1HA 4KU4A 1NMYA 2ZJ5A 3Q5DA 5AJZA 5LB4A 1FTSA 1M7GA 2O8EA 3DM5A 5IF9A 2O0KA 2UZ3A 4DLUA 1H8EA 1OFHA 4TN1A 4XD7D 1XEXA 4LHYA 4AKHA 1G7SA 3FKSA 4ACAA 4JKYA 4DKXA 1A4RA 2ZR7A 3H1TA 5AK0A 3P26A 2XOKA 3Q72A 5FBQB 4MUBA 2F7SA 4XVQA 1P62B 4AURA 2YVUA 2NO6A 1IOZA 1XD8A 1R7RA 2QM7A 4YMUA 4CT4B 1CJVC 2BMEA 2PLFA 3OFND 4KFRA 2Z5FA 5CYOA 4DLXA 4IOLA 4HI0E 2GXUA 4OQLA 3LRPA 1JBKA 4HLUA 5KUTA 3QVVA 2ZI5A 4EFLA 3O8DA 1F6BA 3VKHA 1Z63A 1IN5A 3NBZC 4ARZA 1YR6A 4M1WA 4HAZA 4CT5A 1BO6A 1OH6A 2W2XA 1NVVQ 2HXYA 4QGFA 5H1YA 5JCPA 1J70A 2IK8A 3QF7A 1HT2E 4PQRA 2CLDX 2CK3D 3OIYA 2FE4A 5AWFC 1YKSA 2OBLA 1KK3A 3DOFA 2QGZA 3Q7PA 4PC6A 1HEIA 4Q9HA 1SXJD 3DO6A 4IDOA 1ZIPA 2WWGA 1U0HC 2FSIA 2HT1A 4LJ9A 1ZMXA 3AH8A 1EFHA 2GEUA 4FCVA 1KKMA 2IS4A 2A7QA 1GAJA 4JSTA 4LJ7A 3P4YA 3WP1B 3DL0A 1U8YA 1P9WA 1LTQA 4B2PA 2FFBA 3GLIB 2PX0A 4CRWB 1RVDA 4I99A 2BBSA 5E4FA 5FOTA 2VQSA 3BGWA 4IOJA 3QJYA 3EC1A 3K70C 1JQLB 2SHKA 2ZAMA 3P32A 3T12A 1AZTA 2ZU6A 1L7VC 4GL2A 2JDIA 1S9DA 2R9VA 2DFTA 1SQ5A 1MO4A 5H68A 1KTVA 2F1IA 2YJTD 2DR3A 3AVQA 3GJ8A 1ESNA 3JVUA 1M7HA 2QQEA 4IEIA 1Z08A 2FNAA 4LJ6A 3E5HA 2RGBA 4D4MA 3IGFA 1JB1A 4HEJA 5C1BA 2RGAA 2OAQ1 1O3YA 4NCIA 2ZSEA 3K0FB 4LYJA 1LFDB 4PPQA 1VHLA 2NO1A 1K5DA 2H92A 5E95A 2OV2A 3TBKA 1W4CA 4EPTA 1SVLA 2ZE8A 1Z06A 1BKDR 2WMOB 3DMDA 1WBBA 1VHTA 1D5CA 4I4LA 4JKIA 5KYKA 1NBMD 4LV8B 3I62A 3L0IB 2C77A 4HSEA 2WWWA 1G8PA 4CDGA 3WYFA 1G8HA 2LWIA 4IKEA 2AK2A 4LZZA 2A5FA 4YONB 2DWPA 4TMTA 3TVTA 2ZYTX 2WWYA 1GOTA 1SVMA 5CDFE 1XMIA 2C96A 2JASA 3DHWC 5CDFA 2DFLA 3UMRA 2Q0HA 2ZVQX 4IW3B 4M2LA 1HUQA 1D9ZA 1MO3A 2A78A 2FA9A 4ZCLA 2R2AA 3K1JA 3MUFA 1GTVA 4I81A 2REOA 4F93B 1MRSA 1KY2A 5IK2A
chains in the Genus database with same CATH superfamily
4GVPA 1CQXA 4Q3CA 2X1VA 4PQFA 1AHHA 3SNHA 3IFSA 4RVCA 2PWPA 2X2EA 3OY2A 3U80A 1NW9B 4Q1VA 5C18A 3IJ5A 5A3RA 3FR7A 3ESDA 3H2SA 5BVHA 3MLEA 4WINA 4I4CA 4AY6A 1Y37A 5ALWA 3F6YA 1GD1O 2JCBA 4LAFA 4EHDA 3AJEA 4JY7A 4ENSA 4B3MB 1FQOA 3H99A 4N65A 3W05A 1IMJA 1U02A 3NT5A 2V6BA 3WZ2A 2AD5A 4DA0A 5DNYB 1D2EA 2X6QA 4DM4A 1NXWA 1P2TA 2IYWA 3FCYA 4DREA 1OT5A 1XNGA 2H1FA 4H4CA 1SXJA 4DLWA 1RCFA 3SX4A 3EPRA 1ZD3A 3O91A 1SPXA 4OY3A 3L9XA 3GLGB 1VBFA 3F7MA 5J4YA 3LZCA 1ESCA 1SUFA 1CUFA 4YRKA 2QMZA 2I9PA 3MBOA 4XFKA 1R6TA 2WYIA 5M2QA 4D74A 2G08A 2N42A 5C32A 5D87A 4S2UA 1T6YA 3BQMB 2AZMA 1EB9A 3WDSA 4OM8A 4YDHB 4I1YA 2E4VA 3IEKA 1SKYE 2PFGA 2F67A 3X43A 2DE0X 1HSZA 1TVKA 2NT4A 2XGOA 3O0TA 3QMWA 3PP8A 1PJQA 3UG7A 4DARA 4ZK2A 1X1AA 1D03A 4BP3A 5B3KA 2FZVA 4ZYWA 5BWCA 3KV3O 3FMOB 3ILHA 4NU5A 2V9ZA 4AQYB 1IBMB 5F4BA 4FQ7A 1WHSA 5KQGA 2FRXA 2FY8A 4AJOA 3TG8A 1PVVA 4P4TA 1DAEA 1JHVA 1SUEA 3NHSA 1FMLA 4OGKA 3WP0A 5I7RA 3KPJA 3I3OA 2OO5A 1CE8B 3NETA 2C95A 4M86A 3AL2A 3IBTA 2C9MA 1L7MA 3LUBA 1CY7A 2XBLA 3CSDA 3QW4B 4RE6A 3RBAA 3UAYA 1JHRA 3N7UA 4ND1A 5KU1A 1JZSA 2BFNA 4NAHA 4X71A 4YO8A 1QHHB 5LR6A 3JQAD 1YH3A 2RAVA 3B8EA 4OK3A 4DCVA 4HNAA 2DU8A 3IDFA 5D1HA 5FTKA 5CK5A 5EJFA 4CLDA 2R60A 3PNOA 3W5HA 4HT3B 4KH1A 1W4RA 4RKEA 1EFTA 4RK4A 2UYOA 2RGUA 2JIDA 4MVJF 5ETJA 1C4KA 4BQSA 2DH5A 3V8VA 4F8JA 1QIGA 4S05A 1QRTA 3BT7A 3D3QA 3U3RA 3UAVA 1KRWA 3H4VA 4HBZA 5K0LA 2VNJA 4LF8B 1H5NA 1K68A 3Q1LA 4BQNA 3HI4A 2UUOA 3WMEA 3VMFA 2QZSA 1XLWA 3H5RA 1BSVA 2WF7A 3EOAI 3BHNA 4CR6A 4DY6A 3LO5A 1GV0A 2FSVC 4Z53A 5JAQA 1E2PA 5CXUA 4FCCA 4FGWA 3NCHA 1TVKB 2PYIA 1R27A 1O9GA 1VJ1A 2CF5A 3KRTA 4FIDA 4NJMB 4WX2B 4F3KA 5JLJA 4L4YA 1Q6YA 1Q83A 3MBIA 4NARA 4PHFA 2O7NA 2HM7A 4KVGA 1CR0A 3B85A 4PPFA 1QU2A 5A0FA 4R31A 1CRZA 1S2LA 4Q4JB 2D1FA 3A9RA 1KZ9A 4U9UA 5KSPA 3OC6A 3RC2A 4MVJH 4AO7A 3UMCA 3VZQA 3IUSA 4R2JA 3NWBA 3SNKA 1NQVA 4KR7A 1EGHA 3PEEA 4CM9D 2A5GA 4HYQA 3WL6A 4ASUA 4NDNE 4ZFNA 3GLGE 2D62A 2VT6A 3ZY6A 4MUXA 1UK7A 2OZKA 5SYNA 3U4MA 3H65A 1VJ0A 1OXVA 4ADSG 4CM4B 1N92A 4DLLA 2ZOSA 1Y1TA 2AA3A 4Y1EA 1W0KD 3NEYA 3VC1A 4DPMA 3NANA 2I0FA 2P6NA 1D1TA 1OGJA 1TYAE 3NCTA 3VKWA 1JN0A 2VSQA 3SC6A 2BR3A 4MUGA 4DLVA 5JZMA 2JLWA 2C07A 1BYUA 2WHPB 3NC0C 1PHPA 5AW9A 4YAGA 1SC3A 4HS4A 4ZEXA 2CMHA 5F5NA 1RM4A 1OIWA 3W5CA 1KYWA 1MH1A 3C98A 2PIDA 5JSUA 1MABB 3JV7A 2AF3C 4D41A 2GN2A 3WMWA 3ZVNA 2GHTA 2PGXA 5WRFA 4XI9A 4JH0A 4R16A 2FPWA 3C3EA 1O6CA 3L4JA 1USIA 3AEQA 1E5DA 3DKKA 3CXUA 4MYUA 3VH2A 2YVLA 1H2AS 3KDAA 4J0EA 1WUIS 1CR2A 5FTMA 5GJCA 1FFHA 1NFRA 5KYUA 2HPZA 3H5LA 2WRZA 3U61B 2X8AA 1U9ZA 1R12A 2AGVA 1Q0ZA 1E7MA 1SXJC 1AKTA 2NADA 1DADA 2PPVA 3EVGA 4M9SA 1YS9A 5EWLB 2Z6UA 4Q4LA 1MHTA 3K1YA 1QOZA 2UVQA 1BU5A 5BP7A 5KOYA 5CR9A 3ABQB 4YYZA 5J59A 4HRVA 3JQRA 3Q9LA 1MX3A 4B85A 3RFFA 5KX5F 1KQGA 1FS6A 4QQRA 4P33A 4R2XA 3AUAA 4X94A 1P2SA 1JE1A 1G8AA 1HLDA 5DEIA 5F77A 2OGTA 3DXFA 5AXBA 3ZD8A 2VDJA 3GU3A 5ALIA 2I8AA 2NVUA 2MWMA 2XRFA 1KYZA 1DDGA 2Y0PA 4FYHA 4Z8XA 2FTKE 2JGDB 1A2KC 2EW8A 4AUKA 1VL8A 5TGTA 1LX6A 1CU1A 5FV7A 4EVQA 3QK7A 3LPMA 3SEQA 3VPHA 1MC8A 3N8NA 4WCFA 2ONYA 4CMIB 4Z9FA 2XMZA 1A9TA 3Q9SA 3E70C 5F2NA 1U3VA 5CHYA 5CRIA 3TEMA 4DNOA 2GVNA 2YFYA 1IZZA 4HUQA 3G0IA 1R5OA 1N7HA 2AWNA 1CR6A 2P2SA 3EAFA 4C0BA 4ZJYA 5HA5A 1PX2A 5FR2A 4JENA 5BURA 5DN6D 5KQMA 4OHXA 3QM1A 1ZA2A 1B76A 3ESQA 5K3EA 2W6ZA 5CP8A 5D01A 1IQUA 1P91A 3KYCA 4U5XA 5F52A 1WDMA 4EI2A 2A88A 5A6SA 2WPDD 2QJOA 3DZBA 1JJFA 1TMYA 2FP4A 4M99A 2ZT7A 2P8SA 3N0RA 1B8VA 1M2VB 4ND8A 5HTOA 3IEUA 4YGXB 4CU2A 1ZZGA 3FCOA 4KXUA 4REOA 3I1FA 1ZUIA 3K1AA 3WV5A 3O4JA 3DVQX 4O6VA 2H0RA 4AJNA 5KAMA 3PNKA 4RSMA 2DBQA 2CCGA 3C24A 2WWXA 2H2AA 1ZK0A 4TM8A 2AZTA 2R8YA 5HJ2A 1U3GA 5HXAA 2KJQA 1U2QA 1J09A 4U3JB 5FNVA 4TKMA 4AJHA 2OOKA 5KYGA 2GK3A 4UUAA 4IV8A 1I4DD 4RV5A 1HA3A 3K2BA 4D5EA 2ZJ8A 4UULA 1QLHA 5L95A 3EXEB 1O94A 2R48A 5EERA 3V2HA 4JLJA 4KQ9A 1ZQ1A 4TV9A 5CH8A 3UHJA 1ITZA 3VTAA 4C6TB 3M6FA 4BUZA 1HSOA 4EJ2A 1TPYA 3GD5A 1NR7A 1E6MA 1WPRA 1PLJA 4PTLA 4MVJA 3MWKA 3AUXA 1D2GA 3RUEA 4DGQA 4BNJA 5TGDA 2BGJA 2FPMA 4Y2JA 1LX7A 3USCS 1J8MF 1VL1A 2HNKA 3I5UA 3QWBA 5U4XA 5FHQA 1ES9A 2Y6VA 5IJAA 4A4DA 4E07A 3LDHA 1U1EA 4GPTA 1NATA 2L42A 3W9UA 3BJMA 5ECDA 4R8LA 3C3YA 2OSVA 4LJ8A 1DJMA 3QQ5A 5IT0A 2ODQA 4JWKA 1KBQA 1E2BA 1NF3A 1VLQA 3ASZA 1Y33E 2H9IA 1OAKA 5EMNA 4L57A 1HLPA 4CQLA 3GVPA 4XXHA 1MEJA 3WWCA 3HKCA 4ZVVA 3K2EA 4DMHA 3RJZA 4CF4A 2EXXA 1UXOA 2XTNA 3PGLA 2V59A 4IIJB 4WOPA 4WW0A 2EIXA 3HV2A 4MR7A 1ZCBA 4O63O 4AULA 3CH7A 5BVGA 3SYKA 1NW8A 5JS7A 2REXB 1PV2A 2RBKA 4FYXA 1HNWB 1GNRA 1QR2A 2I6TA 3LZ6A 5JJBA 3OZCA 2XYGA 1UAAA 5ISMA 3H2HA 3SD7A 4BFUA 4F84A 2REQA 1GFIA 4HLNA 4LNUB 2IYZA 4XGNA 1GPBA 4PX2A 3CZ4A 4YC7A 1E2KA 5M3BA 3FYUA 4Y9UA 4U2CA 2I5PO 1KIMA 1SQGA 3K9NA 2PUCA 1MJGA 5JMPA 1R6UA 4DILA 2OCIA 4GGMX 3PSAA 4OOEA 5IHPA 1G0OA 1RPNA 4OQEA 5AM0A 2I66A 3QFHA 5C9ZA 1NY6A 5ENDA 2H5IA 1MPTA 1INLA 2XYPA 2C2YA 3CWCA 5THKA 3FWKA 3BMOB 2G8NA 3HY3A 2AS0A 4CUZA 1IHUA 3KSBC 1Q3TA 4KQIA 1Q0TA 2BHRA 5A9RA 3UV6A 4MO9A 4MS4B 2ZT8A 1WX1A 3U7FB 4TXNA 1TKAA 3H97A 4E31A 4Q24A 5TGZA 1BFUA 3SX0A 1KEKA 2EERA 1BCSA 3IV9A 2OCYC 2GK7A 4UVEA 2YZMA 4WADA 4YRDA 5KHAA 4ZZ3A 2ZATA 1N5DA 4BE9A 5JT1A 3CSSA 4OXNA 3KHUA 1QH1A 4PGAA 3ZR4B 3HWRA 4LQ4A 1HQYE 2IHYA 1WM1A 2AXPA 4ESVA 1NUQA 1V4VA 4YP7A 5K01A 4FWBA 4JUCA 2W2LA 4W9NC 1V37A 4DG5A 2OILA 5KZMB 1ZJ6A 1CT9A 1YI1A 4HQRA 4EJSC 1C7JA 4IEEA 3LSTA 3RS4A 1ODJA 2QD3A 2B78A 2FXVA 4TV8A 2CL6X 4RZ3A 1AN0A 3AXSA 5FULA 5DGXA 2O2CA 1D3AA 1KS2A 1UPBA 2W37A 3PZBA 3FGPA 4FFNA 4WH0A 2ZIVB 1A8QA 2P78A 5TY0A 5U4QA 3V1TC 2WU3A 3ZI4A 1W7AA 4RU1A 2PMFA 1IHYA 2X0NA 4IQ0A 3UPUA 4CF5A 1Q17A 2NT3A 1IUKA 3UV7A 2R1TA 4CT0A 3R3XA 3EJWA 4YXFA 4RXUA 4A6XA 4EMUA 5JAPA 4KRYA 4MKHA 3K70B 2XEDA 2PTHA 4XGIA 1SVNA 2DFPA 1REQA 4QTYA 1YULA 3L4BC 5B7GA 1I3CA 5J5AA 5JEDA 1HC7A 2ID9A 1VPDA 3B38A 3O90A 4P9NA 2A6PA 2OT3B 5GWXA 3WLTA 3GH3A 4FDVA 1T4CA 4GUDA 2O8CA 1TM2A 2IKSA 2R00A 4R5HA 5EMKA 4WOKA 1I24A 1VCHA 1IK6A 3WGYA 2ZB8A 3PENA 1VE5A 2OHVA 1L5NA 3RS9A 1TCUA 2IPXA 1JXOA 5AOBA 5CG2A 1JU4A 4GX2A 1KZ6A 1RXCA 2W4QA 2J9FB 2FPXA 3PDJA 4W5TA 4NU0A 4RMNA 4V1CI 1CRWG 3GFTA 2X5KO 5IDQA 1BKSB 3P9SA 1F5SA 5GV8A 3AESA 2IHKA 1XZBA 1GKIA 3DV0A 5CNKA 1TEZA 3LSYA 3CUUA 2X9GA 5JXIA 2RGNC 3K4PA 4RTSA 3DLCA 3G6WA 5D51S 1JJIA 4LXIA 5IKMA 2AHRA 2W98A 1Z74A 4PPNA 1E92A 1E64A 3FPCA 4M3NA 4FI3C 2WLSA 3DLAA 1KA9H 4QKQA 2J0UB 2WJAA 1HQCA 1SVWA 3H2ZA 3IP8A 2HXGA 3U3KA 1JKMA 3SLGA 1RI4A 1PL7A 1TM7E 2R4QA 4GH5A 5CDUA 2IZ5A 1T3SA 1J0BA 1SU7A 4WNYA 1FBNA 2J0VA 1NN5A 1EK5A 4X63A 3V8RA 1ZG3A 2YWHA 2EFGA 5FUQA 5DK6A 1NP6A 4YV0A 1BDHA 2HSWA 3H9BA 4IG4A 4UHCA 5J4LA 5ICMA 4D4JA 1AUOA 3B6JA 3RIGA 1VG9B 4L73A 1WS6A 3NIBA 3HA5A 3PBKA 3V9AA 4I0WB 1WNFA 4N4AA 1S6YA 1Z5VA 4RACA 3UMSA 4B4WA 2R6AA 1M8GA 4UM8B 3W3AD 4ZCTA 3OIDA 2ILTA 1SUIA 3B9QA 1DCFA 4ZI2A 4ZREA 3BOSA 4E5VA 1L4YA 5JADA 3DEFA 3OJEA 3T3EA 2R6HA 1CJTC 2WF9A 4QVGA 2X3FA 1II0A 4HNAB 3K5HA 3L1KA 1USGA 3I3SR 1XZQA 1XKXA 1KVQA 2PX5A 2ZIGA 4O3FA 3ZCUA 4CMBA 4D5GA 8ADHA 4BXOA 5H3HA 5JJIA 4OMCA 5CMLA 1PUXA 2ZDQA 1EFRA 1TEXA 1DRVA 5CFLA 5AW1A 4B31A 3CZ9A 4INZA 3UICA 1JNYA 2P5SA 2VDVE 3T94A 1PD1A 2O2ZA 4RJIA 2R6R1 4DV3B 1FDOA 1RDFA 2AXQA 2BFEA 2HWWA 5F64A 3MCAA 1FSFA 4AWXA 3I9MA 3OCYA 221PA 5DOZA 5KNDD 4PSVA 4A2WA 3H6KA 2HMWA 2OLKA 1RBMA 3UCXA 5K9ZA 5IAGA 1U7DA 4IZ6A 4E2XA 4O4LA 3HDGA 5C1DA 1NXXA 5KNCH 3DTYA 4H7HA 1R0CA 3D5EA 1BE8A 3SKXA 1P7VA 2D5IA 3L04A 3PUIA 2HO4A 5TV2A 1WWKA 1GZ7A 4OU4A 2UXDB 5CU7A 4KNYA 4G2NA 4MR8B 3V32A 3ED1A 4MYRA 2FPGA 4K46A 5FTWA 2VATA 4OD0A 2QVBA 1A9SA 4RTMA 5JATA 4HTAA 2FX3A 1A0OA 1P75A 2ZTVA 3NFRA 3NU1A 3CVXA 2P2NA 2WJZB 1XZFA 3MWYW 5C52B 3LHIA 2RH4A 1N1EA 1EFVB 3ICEA 5HDQA 3ZUGA 3O83A 4W9RA 3DE3X 1WW3A 4L6AA 1PR3A 1YT5A 4U6NA 2O5EA 1MNQA 4BFVA 2YX1A 4EUSA 1CY1A 3OPYA 2CUNA 1XWWA 5J2TB 1H6DA 3A9UA 1PT8A 1M2EA 2WMNB 1EE2A 1P2FA 2VXCA 4R81A 4WCVA 1C7RA 1ICEA 4JVLA 2OORA 3OEEA 3W90A 1DAOA 5CJPA 2J09A 2VT3A 2KPOA 3AW9A 3PV0A 4FGJA 5CNIA 5ALSA 1VIAA 4ECAA 3ID6C 3Q6NA 5KKCA 3VZBA 1V5EA 2B1QA 3TXYA 4IG9A 1Z8FA 2PVSA 4NIMA 3IDOA 4OHMA 2G17A 3VUFA 2GDZA 1WOMA 4FS3A 3AHGA 4MUJA 1NNUA 3E9NA 2CFOA 2DWOA 4BVGA 2CUZA 3Q8XB 4JUDX 1NVFA 1PYOA 3CRVA 3DCNA 4R7ZA 5TMPA 1A96A 1COZA 4V0QA 3SFVA 3DXYA 4L8GA 4EQZA 1S1MA 4MO2A 3UVEA 5DNEA 2ZRHA 4R1NA 2OMEA 3IQWA 3QENA 1T3ZA 1ZD8A 3EXHC 4DHWA 3A6JA 4QUHA 4S24A 4G07A 4EJSA 3NNNA 3M3HA 3HHEA 5K0TA 3DWGA 3CSUA 4L74A 3UGTA 2A2ZA 5B2EA 3T52A 3VC2A 5CCBA 2NP7A 1MTOA 2O1XA 4UM7A 1J9EA 3I32A 4DDTA 4LYAA 1SUAA 3LFHA 4FT4A 2C5SA 1WAMA 4W5JA 5C5DA 4P81A 4GFDA 1IG3A 1Y8RB 4TQAA 3GGJA 3NV7A 4XCQA 3OJFA 5G02A 4U00A 2FCAA 3LCVB 1XXHA 2K2WA 3RS3A 4N41A 4IIVA 4JLSA 1F0PA 2Q6VA 1D04A 1PZFA 3A1VA 5DV9A 5FBRB 4O4LF 3SHOA 4KXQA 1G21B 1XA4A 2QRMA 3RYCA 3LOPA 2YZNA 4O3MA 2IGBA 2Z04A 4R2MA 4C6SA 1ILEA 4INAA 1EQUA 3HJBA 4TQGA 1JUDA 2IELA 5JSQA 3FWPA 3JQFC 3RTEA 5FWYB 3RJTA 3AUYA 5EN4A 4MTCA 4XWAA 2KB0A 1Z73A 3D3EA 5I01A 4BFZA 4ND4A 1PT9A 1LS6A 2UUBB 2JFBA 2B7BA 2EEPA 2P68A 2PJUA 3QXHA 4KHPB 2H1HA 1DQPA 1VJGA 3IALA 5HQ3B 4XE5A 3SZGA 4ZVRA 3UUWA 2E4AA 5AMXA 1XQ1A 2VO1A 1CUBA 1GPMA 2VDKB 3TM4A 5IXJA 4JGGA 4Z4GA 1B3RA 1ZW6A 4G37A 3T7RA 1WETA 1BWPA 3A10A 4NNOA 3CE9A 3PFHA 2JLVA 2RGCA 1GRVA 4C2TA 1HQDA 2EBHX 3U40A 4ES6A 2OSBA 2QTNA 1PQYA 5CLFA 2YYZA 1C29B 3IJPA 4RMHA 1JXMA 2XUAA 4G9BA 2AKYA 2W71A 1ZJYA 1E2JA 3A1DA 3LIPA 3FLBA 3RABA 2CLKB 1SIWA 1E3MA 1LDBA 1AKVA 1DQSA 3EDOA 1A2BA 5JZVA 3Q98A 1F17A 1OAOC 2XCTB 3TQFA 1GN8A 4FQ8A 3VBCA 2YN4A 2ZUCA 1QO0D 3ROMA 1JFTA 4MROA 2P3LA 5KCMA 3PQ8A 4J76A 4H6VA 3USES 3IUMA 4BDTA 4EYSA 1OH5A 2WV7A 3E2MA 3SHWA 3W3ZB 5C5CA 2LRHA 3C41J 2L69A 4HDNA 2FPUA 4RO0A 4RH3A 2QGNA 4LTDA 5CX1A 3UUFA 1P6UA 1N9GA 1SRRA 2YJNA 1VLHA 2BHTA 2JLQA 1N2CA 1V3VA 2HSDA 3AW8A 4QHSA 5E6RB 2PQMA 3H8WA 4EW1A 2OCBA 2O7QA 3FTCA 4UMEA 3W8NA 3G9UA 621PA 1CS4C 3EZ7A 4JU9A 1Y8QB 1GZ4A 3CW8X 4RNDB 1V16A 2ZB7A 3I0ZA 2JHGA 1G291 2C31A 4FHGA 4MQ6A 4US1R 3WLLA 5LD2C 1P7CA 5JPCA 5K2OA 4UZEA 5FV4A 1XLVA 3M5DA 3AIIA 3DE1X 1DIAA 1FNSA 3LMKA 1PWYE 1JLHA 4LYEA 4JXXA 4CM1A 4HAXA 1N5RA 3E35A 4KFTA 4TVKA 5HR5A 1BEEA 4NCBA 3H5AA 3DDNA 1NKTA 4DANA 3OZVA 5EMMA 3S3TA 4B45A 3DC2A 2DFVA 4BO6A 1OFVA 1Y81A 1YV9A 1PJ4A 5E4YA 5IU6A 2BSXA 1S2IA 2ERCA 1XKTA 2YMPA 3JAWA 4LDPA 2VVTA 3GJ5A 3HA3A 4MJLA 4KGDA 4CI9A 3GHYA 5A9SA 1HYHA 5HIIA 2X0FA 5CBKA 4C3ZA 2RB4A 3B1VA 1GU1A 4JBWA 4B9AA 1GG5A 4U2DA 1SUSA 4MV5A 2M2IA 3LX6A 5KVSA 2Y4NA 1EQAA 4MVJP 3KKPA 1CUXA 3T9BA 4JYPA 4XVHA 1JB9A 5EXSA 3G89A 3AOGA 4AWAA 2HCJB 5TMDA 1W46A 5ICSA 3ZWPA 3LUPA 1XTZA 2QJWA 2VJQA 1XOIA 4JFRA 3FGOA 5EP3A 2IX9A 4EYKA 4I4TF 1ZR2A 2R7MA 1VSUA 2HRRA 2VH5R 1BQ4A 2QRKA 3GGGA 4DSAA 1Z0UA 2X0DA 2J0EA 5JJLA 1AKUA 1TL7C 1RS0A 3OTGA 4N3CA 3T5TA 3TQQA 2QZ9A 1ULAA 1P9NA 1E66A 1GRRA 1I6LA 4DUGD 2YOGA 2O8DA 1IHDA 2HSZA 5FL3A 1N8KA 3B6EA 5SZKB 3VNUA 4GX0A 3NORA 2D1QA 4M1KA 2QYOA 3A2MA 5EE3A 5ES3A 5BNTA 2C1ZA 1YRQA 4JJ6A 4TVOA 2OZVA 1FDUA 2W4MA 1NW7A 3CR8A 3EA5A 4HNSA 3ETDA 2LCIA 4K9QA 4MGIR 4PSCA 1U2GC 4LOHA 4BEJA 1JWLA 1JDJA 2MJLA 5BW4A 1IJKA 2VZLA 3ZD7A 1N6PA 4Q1BA 2BUCA 4Y9TA 3TZ6A 4QOJA 4Q3DA 3BDVA 5SYAA 1Y5IA 2OORC 1DLIA 1GG8A 2DJ5A 5CT5A 4BC0A 2XVYA 4NONA 1KO8A 3ZX5A 4RY2A 4YQYA 3SC4A 3FFAA 3UAXA 3SM3A 5LQJA 3F8WA 4Y1GA 1FNNA 1VPVA 4GNKA 1QZXA 3F2IA 3CG4A 1JL3A 1QIDA 2A9FA 4KLNA 2VF5X 5K0SA 3DNMA 1EFRD 2YNMD 3CLUC 2JGMA 2X3YA 2HLPA 4J16A 4JA0A 4TT3A 2XB8A 3WMFA 5E3HA 1SC1A 4JUBA 5K0EA 3CFYA 3L3BA 3H7AA 1VMKA 2JKYA 3MTDA 4YJ3F 1DC6A 2J45A 3MJSA 3RYTC 5HHTA 2J67A 3BXFA 2EJVA 3BAFA 3JZAA 1J1UA 3TRFA 4HDSB 2IH4A 1RI3A 3L1IA 4ZEMA 3K92A 5BV8A 5KTOA 4JP3A 3NIGB 5TQ2B 2ODWA 2JJ8A 1A4XA 1JFLA 3E03A 1W88A 2VNAA 3HFGA 2BONA 1QO9A 4ZDKA 5IWAB 1LDMA 3NQ41 4UXIA 1U3CA 3ZCPA 1AHPA 1PZHA 2JK0A 3MCWA 4PO9A 1BRTA 1B8UA 3INGA 3NBKA 4TKLA 5A2QA 5IVIA 2EV9A 4JOSA 2X0JA 2WNSA 3WYCA 3KT3A 4LQCA 3W6UA 4OHWA 4YX9A 2NV2B 5EHQA 5IVHA 4JJKA 3L7BA 2I7TA 3I2YX 3K3PA 1GVNB 1ARZA 3DEAA 4RHYA 5B4VA 1FYEA 4ZALA 3KEQA 1VYHA 4B71A 5IDYA 2Z95A 2AFHE 1B93A 1MVOA 4X60A 3NTRA 3MWEA 2EBUA 2X22A 1JDZA 4PAMA 1SEPA 3QGMA 5ALTA 1U28A 2GBLA 3FPLA 3KWMA 3PUHA 4GI2A 5LQCA 3ZLJA 4A2PA 5CEEA 4MTLA 1QNLA 3KE9A 4BKRA 1JSCA 5IJ9A 3TOXA 1US8B 1A7UA 1P5ZB 3INYA 4FR0A 4J03A 1GDTA 4LJLA 1ULHA 1SHLA 3PUZA 5GMOA 1A8IA 4K9NA 4XTRA 1JILA 5E8RA 2JGAA 2D0PB 4DLNA 3BJIC 4KEAA 1QRUA 1NULA 4A2CA 1IWOA 2JCGA 3IUBA 4RL6A 5NULA 5JTUA 1R88A 1WXHA 3L5KA 2WTUA 3MJDA 3CE6A 2QPLA 5CM2Z 4BHTA 1RAGA 2Q62A 2RI0A 1BIFA 3DMGA 4TL6A 4WFKA 4B4UA 1BQ3A 3QRWA 1T1JA 2FOIA 2IDZA 4HDCA 4D4HA 5JC8A 1O0CA 4EGCB 1TKRA 3LQ2A 4PZCA 5IUJC 4IH9A 1N4DA 5C2JB 2HCTA 5AKKA 4WWHA 1OLUB 4YJGA 3ZOZA 1JEDA 2G0TA 4HXGA 4TLDA 4LYYA 2OO7A 1AS3A 2BKVA 5IKOA 3U6KA 3BK1A 4WLEA 3BMCB 2UXCB 3HLTA 2J9GA 1JR3A 2FDXA 4M1ZA 5FJJA 1H5QA 1NUUA 2BGKA 2GJ9A 1PFYA 4GM0A 1A9OA 2A3NA 1ZXXA 3CX3A 3PEFA 5JDCC 4IRUB 4IRMA 4GAEA 3BH7A 1RAEA 1YXMA 3JQAB 2YFQA 2LTAA 1IIRA 3A9WA 3DAFA 1ST2A 3SC2A 1HDRA 1AS0A 1UJ4A 1G98A 2B69A 3MTBA 4MB6A 4PBRA 1ZJZA 3M34A 3UB4A 3BE8A 2Y66A 1P2UA 3P0FA 1GUYA 4UDYX 1QONA 1RHKA 2P9GA 10MHA 4PZPA 4LZOA 3V2GA 5EIAA 1QC5B 4MYTA 4Q7KA 3ZNOA 5K6AC 3CN9A 4R1UA 2A9QA 3H2YA 3C7AA 1Z5OA 1L1EA 4N6NA 1G5QA 2CWDA 1AQUA 3SOPA 3PPXA 3PUYA 4HDSA 2BTEA 3ETGA 2R00C 2GKGA 4GM1A 4UNQA 2VAVA 1D2CA 4EP1A 3N8KA 3QMPA 3INNA 3Q5EA 2NP6A 3ZJ5A 2XOKD 1Z12A 4ZN6A 2WVGA 3LT4A 4ZD6A 1VYVA 3P9YA 4CNBA 4DTIA 2JFHA 3WJ1A 4EI7A 1OLXB 1RE1A 3ZHYA 3UQYS 5G4KB 1Z45A 5I8ZA 3HDYA 3AM5A 3KKQA 3DBRA 2C8LA 3SP1A 3RSGA 4PG7A 4Y0VA 1XRQA 3ABRB 4CV0A 3H2IA 3TPCA 3NEJA 4HO1X 1GITA 4A8JB 1YJCA 3A2LA 3DTVB 4P3OA 1JQDA 3DFKA 1U7OA 2BISA 3V8EA 2VRNA 4XIIA 1X1SA 1W4ZA 4IINA 4D45A 1UC8A 3UA4A 4B75A 4MQLA 4EO9A 4Q39A 1BHSA 4UU8A 4C3OB 2QLBA 3A9TA 1QIKA 4R7TA 2QUIA 1EBFA 1SQSA 4MVJG 5GY7A 3ZCRA 1GPWB 1DOHA 1G21E 2AOUB 2Y0BA 4RTJA 4W5RA 4MHSA 2PUWA 4M98A 3T7IA 4BP1A 4MRMA 2JFZA 4B1FA 3HUEA 1E59A 3C87A 5GTDA 5KNDH 5LM3A 4D3YA 1BJTA 5CDTA 1NJ6A 2O0HA 1R6XA 5JYDA 1U1CA 2AHOA 1N5KA 1U8TA 1SCBA 3PC4A 3TDKA 3ZU5A 4C4ZA 4DUPA 1APBA 3DYVA 1TC1A 3GLFE 2XDQA 3LY7A 1MX9A 1NBIA 2FPPB 3PEVA 1E0DA 4JLVA 1Y1PA 1ULTA 4TTIA 1C80A 2C4VA 2XR1A 5LWHA 2AC7A 5AP9A 5GIOE 1U28C 2GBLC 5KJFA 1UL1X 2QU8A 2F3UA 3TTUA 5SV2A 3G0OA 1JP7A 4M8NE 2I55A 4P35A 3OMLA 3R9WA 4JUFA 1NQOA 1C1XA 5ER6A 3CINA 4WBNB 3OM9A 2Y1GA 3WWZA 4GOMD 1HDZA 3M1YA 4AF7A 2YOHA 3D4IA 2IHBA 3VDQA 1PUIA 1A72A 1ZW1A 3ESBA 3ZZMA 3ZYZA 2V58A 2HHHB 2OHFA 1CJSA 2GNPA 1TMKA 4QYWA 4RANA 1ZOSA 3HKDA 2XZDA 4Q34A 3BQNB 4EUKA 5A3JA 2ZDHA 2CMGA 2QDKA 3L6CA 1QFJA 2FRVA 3LC2O 4HF7A 5TE9A 2R8EA 3RT9A 4HVLA 5BRJA 1RYZA 3GFQA 4FFBA 4IHJB 1UOOA 3VDRA 5A4JA 3NJ8A 4FOPA 2FMIA 1PGOA 1M34B 2X9LA 4P82A 1J8YF 2RK3A 3DEIA 1DE0A 8LDHA 3AY6A 4JA2A 1IH8A 3PC7A 1GM5A 4M89A 2EJUA 4QDUA 5L51A 4YMLA 1I7NA 3AVTA 1QYCA 2YIJA 1E4VA 3MT0A 3CRRA 1Y34E 5JNTA 1RLJA 4LX0A 1R10A 4E94A 1RWNA 3GO4A 1E3TA 5ERXA 2VTDA 4M0CA 3WK4A 3IT1A 3GPCA 3UNXA 4DCGA 2R47A 5HCNA 1SBTA 1AX9A 3RT7A 1Z33A 1T6BY 2XXJA 3KSUA 4S1WA 3FUXA 2DKFA 5L53A 5IDXA 2GZ3A 5H80A 2YVKA 4ZGWA 4A8PA 3W34A 1TM1E 2X4GA 3PJEA 1NM5A 3OQHA 3TSCA 2P2ZA 1G3IA 1SHZA 4F04A 3JAWB 2QY9A 4P5EA 5F23A 4CUKA 2JJ2D 2B8JA 3FKJA 2BGLA 5DYGA 4AZ0B 4ENRA 1ZOIA 1E9SA 4BGUA 1TKBA 1Z6YA 2UZ1B 1A2QA 3GUCA 1IQPA 4IZIA 5HNKA 2PQ2A 3R5XA 4K0RA 2NWQA 2QVZX 2LVBA 4XUDA 3EXAA 4UFPA 2J3HA 4N47A 5BSTA 1KL7A 4Z7NB 4RZHA 3EZYA 3NXSA 2JFVA 1GNPA 4EYQA 3KFXA 4QDOA 4HPWA 3T1NA 3KR0A 1M67A 4AICA 4B4DA 4DCSA 2XNHA 3VPXA 2HBQA 5LDGA 4CV1A 3M2PA 1A97A 4JL6A 4JYAB 2GD1O 2G83A 1Y8QA 2HCBA 2CE7A 4EB6B 4UUMA 2OUKA 1O96B 4QXAA 1LS1A 1ACMA 3GMSA 4LPKA 3ANLA 4PGGA 5H70A 4DJTA 4EY7A 5DGDA 1ULBA 1YKFA 4HYTA 3HN2A 4AP9A 3U4QB 1ZGHA 1TYEB 2XODA 5FWAA 3CPJB 3OJOA 4GDMA 3LK6A 1OROA 2HCRA 1VDMA 3A1NA 1DC8A 2Q2NA 1U2TA 1WUYA 4NVRA 1TM4E 2QG9A 3QPBA 2OE2A 2NQ8A 1XXHB 4MUEA 4M8IA 1EZ1A 4NS4A 3S5UA 2PXHA 3FCEA 1IB0A 3HCRA 4WKOA 5LA6B 4ERXA 2PS1A 1Y8RA 3L0BA 4DMUB 1ADBA 3UGJA 4I8XA 1NJ2A 4ID3A 1EIZA 5COAA 4B3IA 1CY4A 3EQ2A 2HLDD 3WRVA 1BEZA 1C8KA 1HBJA 4U2FA 1NX6A 2M6SA 5E1BA 5E6SA 4AT1A 1XCJA 3NJRA 4JSYA 1G6Q1 4A36A 4YREA 5TJ9A 3QSGA 2MSLA 4WY5A 2VK2A 1LK5A 2NZVG 4DFDA 1Y3DE 3B6ZA 4IEFB 4WNIA 2F1OA 5IM5A 4J1QA 5NLLA 4MSUA 1R64A 3WXMA 2IWRA 1OC4A 4A1OA 3OU7A 5DULA 5BV7A 4TWAA 3LUJA 3UJ9A 1AS2A 1H8HA 1W34A 2VAWA 5KCZA 1ZVKA 4BMZA 1WL8A 2VFAA 2CLEB 3F49S 4RD3A 4ZT3A 1BW9B 1ECLA 1X1CA 5BMVF 3DLBA 1VHWA 1MB0A 3LWNA 1Z4NA 2BUBA 2H1CA 4R9SA 5J2UF 2ZZNA 1T91A 4TL8A 4LXYA 3DOEA 3PWSA 3U5ZB 4TWIA 3AG5A 4Z5XA 2XVXA 3QOFA 2EWVA 3VSBA 4YT4A 4OJYA 3O8OB 4MWZA 4QWMA 4DMGA 1CDDA 1G3RA 1TLTA 4Q7EA 3EN0A 4NCXA 4HXEB 3ZY5A 2W2OA 2NPIA 2O0JA 1K7FB 5AM5A 5GVRA 4DV1B 2Q6TA 4NOKA 1VL5A 3R5KA 5K0FA 3N8HA 4ZHQB 4PNPA 2MINA 4IJKA 1E2UA 5ALPA 1J22A 3EASA 1KZ1A 4FUTA 5HFJA 1ZXLA 2IUUA 4C06A 2WZBA 3K0FA 5IC4A 4YRAA 3X2EA 4BO4A 5AT1A 4DEYA 3ESRA 2J6BA 4H7JA 3RFUA 3AJRA 1IWBB 1YQ9A 4W8GA 3SJ7A 2F1JA 4Q21A 2H1LA 4KSYA 1HG0A 1GADO 1PG2A 3IO3A 4MMZB 1VRVA 2C8VA 5IAEA 2C61A 4CG0A 3C15C 1SHUX 3C3CA 2D2EA 3R6GA 4DBLE 4AG5A 3FLEA 5IZ4A 1NRWA 4HJRA 1E1CB 4WKBA 3ZCVA 2NSDA 1GTJ1 1NJ5A 4ARVA 1TTHA 2DHQA 3L7OA 3QVJA 4Q66C 1B00A 1FVFA 4YAEA 2A57A 5TPZA 4KIFA 5EIOA 3UYKA 4DCMA 5JECA 4XUEA 3BHIA 1ZK2A 4M1MA 4Q3EA 5JQWA 3WIEA 2FPGB 1DCKA 1NBAA 2X8JA 3REQB 2V4ZA 4IVNA 4BBZA 4MQ4A 3WHPA 3PRKE 1C9KA 4OJQA 2PL3A 4M88A 4BUJA 3T9CA 5KTSA 3G6KA 3WKDA 1RYHA 4COKA 3JQDA 5K8UA 2PSEA 1AOXA 3O1IC 1NN3A 4HHEA 2ZSFA 1IEVA 3DWFA 1GSIA 1JKJB 3KPVA 1QE3A 1KY3A 4ZC1A 2J7KA 2OHXA 1HL7A 1SU8A 2R1VB 4FMDB 1ZGBA 4ZVKA 3TINA 2VSXA 5JANA 1VA5A 3N74A 3G7UA 4D0NA 2QAGA 4BOYA 1U94A 5KKAA 5GJBA 4HQFA 2C29D 5AQEA 4P2BA 4LBZA 1L4NA 3DKVA 3D0RA 3H18A 4AJ2A 4K3VA 1G7CA 1KMQA 5CPBA 4X1KB 4EHJA 4F5YA 5BOSB 4BNZA 2EWWA 7REQB 5CDHA 4D25A 1TIKA 1G2OA 2TMKA 3FDZB 3FUUA 3R3JA 1I4OA 3JS5A 1XX6A 2GQ0A 2O57A 3RHFA 3B60A 3EYWA 1TW3A 4QBKA 1NVWQ 3HNR