2RMKA

Rac1/prk1 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
192
structure length
192
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title The Rac1 Polybasic Region Is Required for Interaction with Its Effector PRK1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/transferase
total genus 32
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rmkA00
2JGNA 1JECA 1XZQA 4V02A 5FPSA 3CH4B 5JJIA 2DFLA 1IY1A 2J0QA 3FPAA 2ZSDA 3U3MA 2IL1A 1WBDA 2HF8A 4WA7A 4XWOA 2WAXA 1XMJA 2J0UB 2WOOA 2ZYTX 2C2HA 2DPXA 1R8QA 2VPPA 3BORA 4XD7A 4KCGA 1XD2B 1RJ9B 1NKTA 2ZRNA 1G3IA 1YHNA 1Z6XA 1G8YA 2GVDC 1XTIA 1KI6B 1DARA 3UG7A 1RYHA 4D82A 1WXQA 2V6JA 4BLSA 2BEKA 2W83A 3PXGA 3C5HA 4AURA 2QRZA 1IJFA 2V1UA 2FA9A 2W00A 2ZE8A 3CPEA 3AEZA 4D6PA 3U7EB 1EESA 5TV2A 4RD2A 1N6IA 4HZUB 4MYCA 4CEIA 5LD2C 4Q1FA 3QUSA 3O8RA 3LBIA 5HKKA 3CWQA 3DEFA 1CP2A 3I4LA 3NC1C 1NIPA 1P2TA 1G5RA 4WBSA 2RB4A 2HJGA 2ONKA 3B1WA 2WKRA 3W90A 1LV7A 4L4UA 1E9BA 3U3OA 3QXHA 4R2HA 1FUKA 1UDWA 2IYQA 4BLQA 2ZRDA 1YZUA 3AQ4A 2F9MA 2A3RA 5F98A 3X1WA 4CEHA 4Q9HA 2MMCA 1A2KC 4P32A 1ZC3A 2HCJB 1AM4D 2YWEA 2DWOA 2Q3HA 3KB1A 2QTVB 2CMKA 3E5HA 3RRMA 2PL3A 1DEKA 2BOVA 3FMOB 4LOAA 3QXCA 4KHZA 5IRCD 5FR2A 2W2TA 1G3UA 4IVRA 1FP7A 3GLIE 1WCV1 4F4JA 5FOSA 2ZYUX 1UKZA 2YVUA 2ORWA 3A58B 4OQNA 3AVQA 2ONJA 1NG9A 2BJWA 2GJAA 3H2YA 5G53C 4UXHA 4LHVA 4YQFA 2WWXA 3GP8A 3CR8A 2B7CA 3LAWA 3VMFA 1Z6GA 3MJHA 4WW0A 4C4PA 4JYBA 1YR7A 3ZJYA 2ZRFA 3VU9B 1LTQA 4B32A 4M0LA 4BLPA 3A8TA 4PPGA 3UMSA 4PHTA 1JAIA 1VCMA 2XB4A 2ZETA 2D7DA 2GRJA 1E1QD 2P6UA 2WHXA 1IONA 4MDFA 3FMFA 4B75A 1VTKA 2NO0A 2R6DA 4PC7A 4LHYA 3TJZA 5JJLA 3AH8A 4XOIA 3Q9LA 2FGKA 3UIEA 1ANKA 2D4HA 2IUSA 1EX6A 5CJ2A 2WTUA 1R0XA 4NYMR 3FOZA 3GLGA 3WMFA 3VTKA 1GRRA 3C14C 2V55B 3RDPA 4U02A 4MRSA 4TL8A 3HP1A 2JLXA 1E0JA 2QMOA 4OKSA 3TSOA 5E7MA 3BGWA 2FFHA 1VYTA 4A0FA 1Q1BA 3NWJA 3B60A 3T35A 4EUNA 1U8AA 3A6PC 1U8ZA 2BMEA 1OHHD 3Q5EA 3BH6A 1ZNZA 3L0SA 4W5WA 4D4LA 4HAZA 3ZVNA 4JLKA 3K9HA 2FN4A 3K0FB 4P3YA 1KSHA 1DAEA 1F2TA 3FHOA 4ILEA 4PC1A 4NYIR 4DIDA 1K5GA 2IYXA 4JLMA 4AG6A 3THXB 2ZE5A 421PA 2QPAA 3BJIC 4N0DA 3AGPA 2ZRLA 4QHTA 3QBTA 3CNOA 4IDPA 2QAJA 3D3QA 1YQTA 1S3GA 2IXEA 3LRPA 3B2EA 1XJQA 1HUQA 5FUYA 3D8BA 3I92A 3GJ8A 1E2IA 1W46A 3W9YA 2J1LA 2GTPA 3WHLA 3M0EA 5JHHB 2ZTSA 3SS8A 3T61A 2PJRA 3DMNA 3B8HA 1RPZA 3ND9A 1DPFA 2A5FA 3ADKA 1W5SA 4DLVA 2J45A 1P2UA 2OM2A 2OEPA 3PV0A 4BFXA 1M1YE 2A9KA 3CKLA 1QHNA 4FI3C 3LX5A 4RZUA 3U44B 2GEDA 2QMUA 2XITA 2V8OA 2F55A 1XXHB 5FPHA 1G1MA 4R71A 1JPJA 1OXSC 2OLKA 4QM6A 5ELXA 1FOEB 1W4BA 1X8KA 3AKDA 5CLQA 4PO1A 2JJ1D 5L3QB 1ODFA 1R7RA 5JWHA 1YU9A 4JSYA 4QKQA 1NN1A 4MRRA 4BECA 1U9IC 2G0TA 5P21A 1GL6A 1QG4A 4KFRA 3SJBA 4Q7LA 3VR4A 3WHKA 1XZPA 4L9SA 1G3QA 3DZ8A 4US2R 1AN0A 3ECCA 2MMGA 3B9PA 1S9HA 1RRGA 2OUKA 1KJYA 4QBHA 3RNLA 4MYUA 4QGFA 2IYUA 3RS5A 2Q9AA 1XMIA 1PLKA 5L3VA 3V00A 2QENA 3TUZC 2CJWB 3GEEA 1E2HA 1AQUA 2WICA 1XFAA 1G64A 2W6JD 3AF3A 4O0MA 3Q3JB 4ARZA 3HPRA 4MA4A 4JLNA 1IJEA 3BB3A 1NSFA 3IIKA 1G17A 1AKEA 4TT3D 1N0WA 4ACAA 1VG0B 3EC2A 4QG7A 3PITA 3AB3A 5FH9A 3GLHB 4M1TA 1MO5A 4PX9A 3AF0A 3CONA 1P72A 1QF9A 5J4KA 3X1YA 5FTKA 1OXVA 5EE5B 3X2SA 4F38A 1HT2E 1N6NA 4I1UA 1GSIA 3K9GA 4RFVA 4BFUA 1E79D 4LWZA 2AFIE 1T8UA 2ZI3A 3MWYW 1LS6A 2DCUA 3KUCA 4IDOA 4X8MA 1EFTA 1WRBA 4IHQA 4M9SA 1XJ0A 1Z0AA 4C30A 2QU8A 1W44A 4ASUA 2NO6A 2LWIA 3E1SA 4EQ6B 4A8JC 2BBWA 2HT1A 2XB2A 2IA5A 3SR0A 1TF7A 2FMXA 1TUIA 3MSXA 4QNRA 2NIPA 3O8DA 1L7VC 1IN7A 2OESA 1SXJA 2ZUDA 1BMFA 4XWAA 3KZ1E 5KSOA 2J7PD 2ZI7A 1KY2A 3OAAA 1BYIA 3KFXA 2ZRHA 2JLYA 2VSXA 3MUFA 3RANA 1T5LA 2Y8EA 3ZVLA 4TQUS 121PA 3EARA 3A1WA 2QAGA 5KHOC 3SN6A 2G83A 3SZRA 1SHZA 3OIYA 4AC9A 2VSOA 2JDIA 3Q7PA 3CBQA 1FMJA 4LJYA 1KZ7B 4PAOA 3QEOA 1KDTA 3SYLA 1GRNA 1X6VA 2BM1A 4ZCLA 3LX8A 5JRJA 4JZKA 3L8YA 4IDNA 4A2PA 5JRZA 3GLGE 4BLRA 4DCNA 2FJUA 4RD3A 1Q21A 4RFSA 3QF7A 5AWFC 1G9XA 4TYPA 1DBSA 2HYDA 4F4IA 1EWRA 4PPFA 1FTSA 4DLTA 5SZIA 3WXMA 2Q3FA 3CRMA 1BH2A 4BLTA 1NKSA 2XJ9A 1CRPA 4QC2A 1XEWX 2A2ZA 3LWNA 4GT1A 4NMMA 4PANA 4B3XA 2ZXUA 3J81k 3I62A 3DL0A 1LB1B 4P0TA 4PAQA 2GAAA 2IXGA 1W4CA 1EFRA 1Z0JA 2WSMA 1HH4A 1Z0DA 1KI3A 3EG5A 4OHXA 2QY9A 5AUQA 3CIOA 4MGIR 2VF7A 3TSWA 4MQBA 4DEYA 4C2TA 3Q72A 3KQKA 3MAAC 4OHZA 1JR3A 2YINC 2ZAMA 4PO8A 3P1JA 3ADDA 4ABYA 2FH5B 4C0KA 2EYUA 4FN5A 3RC3A 1O3YA 3BFXA 2BKEA 2YYZA 3MD0A 4KI0A 3P4YA 4X8OA 4BFSA 4DDWA 1DOAA 4IW3B 2GAOA 2IT1A 1TPZA 2P5TB 3AKYA 2PEZA 4PQYA 2B21A 5FBWB 2OV2A 4ZKEA 4KJZA 2YWFA 3V4RA 2YWGA 2CL6X 5EXSA 1CTQA 4JL6A 3L0IB 4QJ4A 5IHPA 1KTVA 4Q9JA 5G3ZA 1E4VA 2ZRIA 3ZYCA 2VP5A 1XEXB 4ZKDA 4C9BA 2NPFA 2N1BA 2OO7A 3QQ5A 4DB4A 5KO2A 2GCOB 4Q4HB 4Q5IA 1ESNA 3KL4A 4C3ZA 2ZRCA 4B33A 1MT0A 1S8FA 3KJGA 4AKEA 3U7HB 1AS2A 5K8LA 4OQFA 2OAQ1 1EXMA 4GZLA 1FTNA 1KI4A 3LNCA 5KPDA 5C2JB 3AP3A 2FX3A 3EPLA 1DE0A 1N0UA 4LBVA 4Q4JB 2XEXA 1ZU4A 1N3BA 4G1UC 5AJWA 1XU4A 4B3CA 4NCKA 4ZI3A 3K70C 1US8B 3C7KA 3HR7A 1QBKC 4YMWA 3ZH9B 1UBFA 4JLDA 2EWVA 4PTLA 3FYHA 4JVLA 3OEHA 2QGNA 3SEAA 1KKLA 3WRXC 1CEEA 1R2QA 2QZ4A 2HLDD 1G7CA 2ZRKA 2GK7A 4FINA 3PEWA 4UKDA 3HDTA 2EFGA 2G3YA 4DDUA 3FFBA 3LVQE 3HYTA 1PLLA 4W9MC 4OHYA 3ADCA 2W6ID 3K0AA 1E9AA 1NJFA 4LYJA 1G8FA 1QHIA 2OSBA 2HDNB 3P27A 1ZCAA 4DCVA 2AK2A 2J9RA 4ITRC 3KKOA 1ZNXA 1P61B 3B1ZA 3B1YA 1TF5A 3CF0A 4RD4A 5H1YA 3VNVA 1EFUA 4KAXA 3TRFA 1P4SA 3QI2A 3UMFA 2IX3A 1P5ZB 1GL7A 3K09C 3KTAA 3IIJA 3F8TA 3LY5A 4IOMA 1SVOA 4Y0AA 3A1TA 3ASYA 4R98A 1GILA 1E9DA 1XWIA 3L82B 3IO3A 2XZLA 4TZ6A 1XPRA 1NLZA 1SXJE 1M74A 5FOUA 4CGZA 1G5TA 3VHXA 2ZANA 4UJ3A 2Q0HA 1IY0A 2RGAA 5DI3A 2CLDX 3OESA 4KYIB 3RS4A 1EFCA 4PFSA 4MITA 2QQEA 2FPKA 3OFNA 2RGGA 2YOFA 1Z08A 2E87A 5JHGB 1SVMA 4Q1EA 4NL4H 3VKGA 2ZVQX 1KO4A 4IEEA 1Z0IA 4B3GA 1RRFA 5FR1A 2RGEA 1YZNA 4AD8A 2KB0A 4P4TA 3RSLA 1XF9A 3PUXA 2KJQA 2YC4C 3C15C 2V6IA 1IXZA 1VYVA 3C16C 1VPLA 2WSSD 3U6BA 4I81A 2GA8A 3GPLA 4CEHB 3HR8A 4JBYA 2JIZD 2GXQA 1COWD 1SZPA 3RAPR 5EUQB 4B44A 1OT3A 1W36B 4PZZA 4KLZA 4FW9A 2PZGA 3I61A 5J4YA 4BLOA 2QBYB 1LF5A 1QDEA 1W5TA 3FTQA 5CK4A 4JLPA 1G8HA 1J2JA 2FDCA 2GJKA 2V54A 4B6FA 5J47A 2XXAA 5CJPA 5AJYA 1KJWA 3BWDD 2H16A 3K0CC 4OQMA 3CRRA 5J4VA 2HXYA 1KO1A 2WWIA 2V7QA 2NTYC 2QTHA 1E2DA 4Z1MA 2JJ2D 3IPXA 4CT5A 2FOLA 2XZOA 1BOFA 3ADBA 3ZD6A 4Q47A 1VG9B 3GJ5A 4D0NA 2OBNA 1E32A 4ZDIA 4TN1A 3UG6A 4B48A 2VH5R 4F91B 1JR3E 4OL0A 3KJIA 3QG1A 4IOKA 2IUUA 1OJLA 2WIAA 1KI2A 4BWYA 4AK9A 5TY0A 1T3SA 1P7CA 2C9OA 2D7CA 2RKOA 3B1XA 2IYWA 5TB5A 5J4LA 3EAQA 1C1YA 4C0SA 1D2EA 4DVGA 4TYWA 3P26A 1XTSA 1Z0KA 3VR2A 1GNRA 1X8JA 3D7MA 4LHWA 4DSOA 5EP4A 2AWOA 2QNRA 3GLGB 5KSPA 3LBHA 2QPTA 4JLJA 1KHTA 4HB3A 5AJVB 3WBJA 3K9NA 2G88A 1W2HA 1P6XA 4NYJQ 1DTSA 1N0VC 1XTKA 4YMVA 1FUUA 1IM2A 4MGZR 3I8SA 2GEUA 2CBZA 3MRSA 3B82A 4OK3A 4PXAA 2EFDB 1NLYA 2N46A 2QRNA 4EPTA 1FX0B 3TUJC 4QJ3A 3AVPA 1G41A 4HLUC 1YZGA 1YZTA 2XOKA 5FOVA 3W34A 3EA5A 3WBKA 4NYMQ 2VBCA 3CZQA 2NZJA 2WBLC 1VCNA 1F2TB 2CK3A 4M1WA 4TYYA 3SU8A 1KOFA 3S1AA 3BXZA 3A4LA 1FQJA 3T1QA 4ZIRB 2QP9X 1TTTA 4A1FA 1ZM4A 5IT5A 3AVVA 4UXJA 4UXIA 4Z8XA 4M8NE 2QEQA 1P60A 2GZAA 3N70A 3QNUA 4J0QA 4NDZA 3FGNA 2ZR7A 3AF4A 4LC0A 4OK6A 1GIAA 2BMJA 4TMVA 1AK2A 1E9SA 1W47A 4B35A 4HAYA 1ZUHA 2YZ2A 3LH5A 4US0R 2IYZA 3MMPA 4FMDF 4GSYA 1E94E 4NYIQ 2IWHA 2ZJBA 4XTCS 5EQTA 1II0A 2FNAA 5FI0B 2AK3A 4B71A 1CJVC 4CT4B 1Z5ZA 4QBGB 1MV5A 5BN4A 2PBRA 3BS4A 4KFTA 5JCZA 1NY5A 2JAQA 4TYQA 4M4SA 5JEDA 3TUIC 3NBZC 2RGNA 3MWJA 3THWA 1Z0FA 3NKVA 1Q1EA 4Q66C 2IK8A 1ZW6A 5EE9A 1Q3TA 1RFLA 3L8ZA 3QPUA 3R9XA 3GMTA 1U99A 5SZHB 4NBSA 4OI2A 2GJ9A 4RKFA 5DLQC 3MWKA 2ECKA 2VEDA 2D74A 4ZCIA 1DELA 1ZD1A 1E2KA 3D31A 4HAWA 2H1LA 2BCJQ 2ZJ8A 4TQAA 2EQBA 2R65A 1UKEA 2BBOA 2DFNA 3IILA 1Z6AA 1RVDA 4URUR 5BN5A 4BFYA 2A5JA 3M4YA 2CLCX 2ZRPA 3REFA 1Z29A 3B9QA 4LV8B 4QHSA 1EGAA 4ARZB 5JCPA 4B76A 4A2QA 3EZ6A 2FZ4A 1UEIA 5KDLA 3BERA 1JEEA 4EPVA 1XEFA 4JT4A 1NG1A 4R2IA 2ZYVX 1OB5A 2CHQA 3LXRA 1U81A 2YKGA 5DH9A 5G3YA 2V3CC 1UM8A 1NIJA 4M1YA 2ZVPX 5EXTA 5DHAA 3OIWA 3FDIA 1MABA 2VP2A 4N3NA 1JQJC 2PJZA 3KKMA 3KXLA 4HUQA 4HYYA 1ZMXA 4CEJA 1M8PA 1HURA 2F9LA 3SFZA 1A1VA 2XAUA 2H17A 3LO5A 2CCJA 2RAPA 1OKKA 3BH7A 4ZI2A 3GJ3A 5D3MA 4GOXA 1W36C 4DZZA 1ESMA 2ZJ2A 4NP6A 1ZAKA 1DAFA 5E95A 2OZEA 3QKSA 2C95A 1C9KA 3GLFA 2O8DA 1BYUA 1M34E 2GJ8A 1SXJB 2YNMA 1GZSA 1VG8A 4FCTA 4X8LA 2L0XA 3I3SR 2H92A 3OZXA 1HTWA 2HJVA 1HA3A 4M2LA 3U61B 5AR1A 5FL7D 1SVWA 1P73A 1RYFA 3BE4A 4P4SA 4RZ2A 2ZIAA 3FB4A 2WJIA 5M04A 1OFHA 3TSZA 4HB2A 821PA 2I3BA 5DIFA 1GFIA 4KSCA 4TL9A 2D62A 1O87A 1ZUIA 2E9SA 1CBUA 2BWJA 2P6NA 1GITA 1VCOA 4DJTA 1T3LA 1II8A 5CDFA 2GF9A 5B2ZA 5IK2D 4TQ9A 2IHYA 2DR3A 3VHLB 1KMQA 3NEYA 1XTJA 4FXPA 3CPJB 4UNNA 2X77A 4II7A 4D2IA 1AIPA 3IEUA 4R7ZA 4V03A 5HPYB 1GUAA 3ETLA 4AKIA 4LZZA 3EPJA 3PJRA 2YV5A 5CIQA 2IXFA 2GNOA 4RFSB 5FPTA 1YZLA 2XSZD 3ZDQA 3C41J 4ON9A 3U4QB 2UZIR 1NMZA 5EE1A 1W0KA 2Z0MA 1R5NA 5GVRA 2UKDA 2WJGA 5CIWA 2UZ3A 2QMHA 1OB2A 1DAIA 1GRQA 1GG2A 1ZVQA 3AKEA 3RSOA 4EDHA 2PT5A 2IW3A 3QF4A 2CNWD 4TWZA 5FUXA 1R5BA 4YLGA 1MR3F 3KX2A 3LA6A 2XNDD 2ZREA 1SGWA 1CR2A 5BN3A 3TH5A 3LDAA 4YDHB 1TU3A 1ZYUA 2X1VA 3G82C 4K8OA 1QHYA 4LJ7A 3QG5A 5BXQC 4XJXA 2QT0A 1OFUX 1KNQA 1XX6A 5KOYA 3PFIA 3THYB 2Z4SA 2CE2X 5JS8A 1VDZA 1E2EA 1FNMA 1R8SA 1UJ2A 3ZQJA 1NMYA 1W2GA 4LYAA 3WP0A 5H70A 4NYJR 1G291 2X2FA 1A5TA 2RGDA 1KDOA 4QOSA 4TSFA 2R6FA 3MG9A 1OIWA 2ZSFA 4LC1A 3HWSA 4RZ3A 3B5JA 4O3MA 4N0EA 4JYCA 1QG2A 1SKQA 1HY3A 1XD9A 2BEJA 4HI0E 3OF5A 2O8BA 2G9NA 1CULC 3FKQA 4DDVA 2ZJAA 1YZKA 4BE7B 4EPYA 4CW7A 2QA5A 5JSZB 3C4JA 2ORIA 1R10A 2W6JA 3QXXA 4LK2A 3I8XA 4XD7D 4C0AC 3SDZA 3SHWA 3QXSA 3FHCB 3OE7D 3RLFA 2OCPA 1KSJA 1PUJA 1W49A 2GWHA 3HU3A 1IXRC 2YHSA 3NHAA 3P32A 4B34A 1S3SA 1ZM2A 2EFCB 1DAKA 3QKRA 1A82A 4JVNA 1Q20A 1SKYB 3K0EA 3K53A 4D4JA 5FBQB 2O8EA 4E09A 4JBXA 3SI7A 5DGXA 1FP6A 3KKQA 2RGCA 2B6HA 1ZM7A 5IDVA 5FFMA 3EIQA 3A4MA 3JZAA 2XTNA 3OIUA 4M53A 1WBBA 4F93B 2QGZA 2DFTA 1BS1A 1NRJB 4XTRA 3RS3A 1H8HD 1P3JA 4E03A 3PIRA 3PEVA 3WYGA 2WIBA 3DHWC 5C18A 2DWPA 3AVOA 2IS4A 2ZPTX 1X1RA 4OBEA 3DMDA 2OT3B 2JLZA 1E9RA 2NO7A 1XTRA 1Z6TA 2IYTA 4EJSB 1GKIA 2QE7D 3RRZA 1E2LA 5ANRB 1W36D 1YJ5A 2J7PA 2KE5A 4Z54A 5JLJA 621PA 2IYYA 3PR1A 2HCBA 2B7BA 3KTAB 2QL6A 1KMHA 3UWOA 2JLQA 2VL7A 1SVSA 2IS2A 4S2EA 4X8HA 3IQXA 3GLFE 4QBFA 3UXMA 4C7OB 1WB9A 2GVZC 4US1R 5L3SA 3AVXA 1ONBA 4FWIB 2QP3A 1M6NA 4V0LA 5E3HA 2PX3A 2PH1A 3CX7A 3EIEA 3U7FB 3N2EA 4QBIA 4B6EA 1IBRA 3LW7A 4JVSB 4NTZA 1RRPA 1L8QA 1GDDA 5SZJA 1F6BA 5HZKA 4KO8A 2HT6A 4V0MA 4FCVA 2VSFA 5TMPA 4FMCB 5DYIA 4C0BA 2V4ZA 4DUGD 5CDFE 4HLDA 4ERNA 3Q8XB 2IWRA 4Z8YA 2Q21A 3KFVA 4HAUA 2WJJA 1RIFA 4AG5A 5DYGA 2GBLA 4EAQA 4URVR 3CPHA 3K0SA 3VNUA 1F2UA 3BBPA 2AN9A 2ZI5A 4Z51A 5AJXA 3BAFA 3PEUA 1KIMA 3PUZA 2W0MA 2VLIA 2ORVA 2PEYA 1R6BX 4TL6A 1KI9A 2IC5A 2VHCA 1Z8FA 1Y63A 2MSEB 5A4JA 3DM9B 4TZ0A 4DLRA 3TW8B 4C0QC 4PC6A 5FPYA 3SE0A 4PHFA 3EWAA 1UDXA 3EX7C 4WZAE 2ZJOA 3UWKA 3IKJA 3Q5DA 4NHOA 1DVRA 2IF0A 4Q1CA 4A6PA 1XNJA 2GILA 1B0UA 3U2QA 1N6LA 1XRJA 4DSTA 4JLBA 4B43A 2F7SA 1R0ZA 3DZDA 3FVQA 1U9IA 1D2NA 1UAAA 1UBCA 1G20E 2WKPA 3AKCA 2Q9BA 3OIVA 4BFVA 1OE0A 4Q7MB 2HYIC 5DHFA 4ZDWA 5JI2E 3ICEA 3NVAA 5DE3A 2VIIA 2ERXA 4B3FX 1L4UA 1ZD9A 2O0HA 5HCNA 1VYUA 1GAJA 1XD2A 1RJ9A 3EPKA 2C77A 3PUVA 3AV0B 2FU5C 2Z43A 2I1QA 1T9HA 5BYJA 3W5JA 4U7DA 3EZ9A 1Z63A 4MRVA 1P9NA 4RZXA 2EWWA 2IF2A 3Q7QA 5K8UA 2AXNA 1Q12A 4KV9A 4NONA 521PA 2D3WA 3K1JA 4HZUA 4HDOB 3LLMA 1PUIA 1XDBA 2H5EA 2ANBA 3EZFA 4MKHA 4A0RA 3A4NA 2PZEA 5DN6A 4NU0A 3GLIB 1OLOA 2RHMA 5AUOB 2ODBA 2WAYA 3KJHA 3S1AB 1UBEA 1NN0A 1OXXK 5IF9A 5CLLA 1T0HB 3L43A 5JECA 5TARA 1QVRA 3VR3A 2JLVA 2OE2A 3KQHA 3IO5A 3BIFA 5EE0A 1Z3IX 4A92A 1E1RD 1KO7A 4A8JA 1E2NA 3NH9A 1A2BA 2F43B 1NBMA 2GDJA 2CCKA 3IHLA 4G01B 4RD1A 1G4AE 1NSTA 2QM8A 3NIBA 1E0KA 3CW2A 4TL7A 4ZDJA 1PVOA 1JQLB 1XEWY 2VHTA 1KGDA 4W5JA 4TLCA 3KXIA 2BIFA 4B2PA 3QENA 1Y3AA 1BO6A 1OXUA 4DXAA 3N5CA 1VMAA 4L8GA 4BZXA 3VQTA 3KQLA 3ZS8A 5BWMA 2VQSA 2O8CA 4V0NA 2IS1A 3VU9A 1N25A 1PZNA 4LCBA 5B64A 3G0HA 4ESHA 5AJZA 4A0GA 2WMNB 4TLDA 4EJSC 4A9AA 4E22A 4QGHA 4I1VA 2GCPA 5KDOA 4AIIA 3O8CA 1SVIA 3DDCA 1G18A 1COWA 4URWR 3KXKA 1SXJD 1BMFD 1NL3A 4JKIA 4A15A 4GL2A 1CR0A 2JA1A 3TGPA 1MO3A 4V0ME 2Z4RA 3RS2A 4URYR 1KK2A 1YR9A 2FFBA 3H0KA 3M1IA 4GOJA 1EG7A 1LW7A 3OEEA 2OCYC 2OAP1 4Q1AA 1U0LA 3ND8A 1HV8A 1VIYA 1X3SA 4B73A 4DT1A 1FQKA 1R5OA 1GOTA 2NOAA 3W3AA 4H9GA 4UNRA 3I5YA 1RZ3A 2ZJYA 1OPXA 2ZS8A 2WWGA 4D81A 2GXUA 5EJEA 1G8GA 4Q01A 4LV6A 1OW3B 1WE2A 5JI3E 5EXXA 4AYWA 4IDQA 1QRAA 2VP4A 1W0JD 4QM7A 4PSAA 3DO6A 1MABB 4Q9KA 4UNPA 4F4CA 5KSYA 3ZD7A 3GEHA 3UATA 1H8ED 1OYYA 3E2IA 3CLVA 4CEJB 5CM9C 2DB3A 3BH0A 1IHUA 5TDHA 3ZZTA 1TQ6A 1X86B 1Z22A 2BBSA 3DVLA 3THXA 4URZR 2PMKA 1Z06A 1DO2A 2ZI4A 3CRQA 4TYNA 4A82A 1IY2A 4BGDA 1VIAA 3GFOA 3ZQ6A 4TMZA 2P3SA 3T06B 4Q19A 3QKSB 3GLFB 2O8DB 2C9YA 5CYPA 3O8BA 2HEIA 4GFDA 2BVNA 4Q48A 2EYQA 2CVFA 1N6RA 3QXJA 4YDSA 1AS3A 4P4SB 4A4DA 3F0TA 3SC3A 3WRYC 1EFRD 1WMSA 4I4LA 4DLYA 4CEIB 1FNNA 3TVTA 4G5SA 1HQCA 3BD9A 3NDBB 1ELOA 4IFBA 2XTMA 5FTMA 4CRWB 4XSHA 5F9HA 3RWMB 1XCMA 1XXHA 1JR3D 2B8WA 2O0JA 2X8AA 4MKIA 4ZCMA 4PC2A 1OH6A 3MCAA 1II8B 2WWWA 2WM9B 4OQXA 2W2XA 2WVJA 3PUYA 2AXPA 1R4AA 1G16A 1KJZA 2OFXA 1SVKA 5E4FA 5J5CA 4MKGA 3KQNA 2FPLA 2CL0X 2XTZA 1D2MA 1G21E 2XJ4A 4EFNA 4GMXA 2WWHA 4OHWA 3CRW1 1YE8A 2JLRA 3GJ0A 1OH8A 2ZUBA 5EP3A 1TU4A 1CIPA 1C4OA 1IN4A 2H7VA 5KNBA 2IUTA 3GFPA 4PZLA 3IIMA 1XP8A 4M1KA 1ZJ6A 5TXGA 5KPJA 3SBDA 1E0SA 5SZKB 3WNBA 3WMGA 3C8UA 5F9FA 3ICQB 1N6HA 2GETA 3TR5A 4ZDKA 3QIAA 2GF0A 1QZXA 3U3JA 1AQYA 1U8YA 3QPWA 3TK1A 4PAMA 4M9XA 2Z5FA 3K09A 3QKTA 2C04A 2WV9A 2ODEA 3U6KA 1JEDA 3QJYA 1NBME 4AY2A 1DAMA 2ZU6A 5KNCA 2DY1A 4QJ5A 3F5FA 1N5LA 1G6HA 3AP2A 5C46F 2TMKA 4HZIA 2ZYWX 3MGCA 4LBWA 4BFZA 5LD2B 4GP6A 1ETUA 2YOHA 3CH5A 4EQ6A 1CR4A 1AGPA 3TE6A 1F48A 3R20A 4MGYR 1U94A 5LB4A 3V9PA 3W5IA 4LSGA 3SOPA 2P0EA 1ZM3A 1AKYA 2C98A 2BBTA 2F1JA 1E96A 2P67A 2WPDA 2I4IA 4BUJA 1MOZA 1RC8A 2PLFA 4Q7JB 1NVWQ 4Q4AA 3LV8A 3CO5A 3THOA 3AVWA 3W6PA 3SFVA 1E99A 5G40A 1X1SA 6Q21A 4A0HA 4BQSA 2FGJA 4UJ5A 5J4HA 4R9UC 1N6KA 2WWYA 721PA 4AKGA 1JAHA 2O8EB 1A4RA 5CYOA 1YRAA 3AUYA 5HR5A 1NJGA 3GJXC 1I4DD 4K81B 1Z2CA 2F1RA 4L9WA 3AF1A 2CVHA 3GEIA 1ZCBA 3R8FA 2IHBA 1Q1ZA 2GZHA 4LJ9A 1YKSA 2VO1A 2FV8A 4KFSA 2KI5A 3K0CA 3W6NA 4DRZA 3CF2A 1G3RA 1HE1C 4NE2A 3QOFA 1LFDB 1U2RA 3NH6A 2NQ2C 4QHYA 5JBQA 2GXAA 1N5IA 4Q9LA 3R9IA 4JVMA 4M1MA 5GVSA 2C03A 1KI7A 4TMTA 4FIDA 3A1UA 2AWNA 3W6OA 1JNYA 1KO8A 2GZDA 1P2VA 1XMSA 4JJZA 1B23P 3CR7A 3SYKA 3IQWA 4ESVA 4D25A 1HE8B 1N6PA 4DB2A 4BEJA 3GQBA 1FZQA 4NKRA 1NVVR 3NTUA 5EE3A 1E3MA 3W8RA 1JR6A 4YXWD 2V7QD 4Z1MD 4QL3A 5FBRB 2B92A 4LJ8A 4Q18A 2BHRA 1LY1A 1TQ2A 4EFLA 3OHMA 4JT2A 1T4GA 4Q03A 3FHTA 1CU1A 3DOFA 2G1JA 5EXPA 1QHHA 1XXHE 3ZVRA 3AVYA 4DCUA 2IBMA 2JLUA 3B78A 1XEXA 4A36A 3U7GA 3W8NA 3ZGXA 4L16A 1DO0A 4HLUA 1AJEA 4Q4HA 3PEYA 1EX7A 4OI1A 4B74A 4FD2A 1GP2A 1E4YA 1CJTC 1OF1A 3IGFA 2CNWA 4M21A 4TTQA 4LJ4A 2ZM5A 5K8IA 5FPKA 4UNQA 2ZSBA 3GFTA 4Q21A 1Z6YA 2A7QA 4MRPA 3SQWA 8OHMA 2YOGA 3HU1A 4HLQB 4Q4JA 3GJ6A 2FG5A 1JALA 4JS0A 1HYQA 2GJSA 4DDTA 3TNFA 1FPMA 4A2WA 1K5DA 3RRNA 4KLNA 5E7JA 4DLXA 1E98A 4BPBA 4LUCA 1KK1A 1A7JA 1KNXA 1W1WA 2ZSEA 3HJNA 5K8TA 2XZPA 3T5DA 2ZQ5A 3DKVA 4KBFA 1E1QA 4AKHA 4E5UA 5GADl 4CF7A 2VHJA 4BEBA 4JL5A 1OYWA 4RSGA 3SBEA 4GMDA 3O47A 4DSNA 2OBMA 1T0JB 2CK3D 5FTLA 1Q0UA 3I73A 4G3XA 4DC9A 1GNQA 2OCAA 4KXFB 3BOSA 3SHFA 2J46A 1S1MA 4MYHA 4O25A 2VP0A 4Q9IA 2FSGA 1E2QA 2XX3A 2PMDA 4M1OA 3F3YA 2QAGB 1TADA 1J8MF 4LYHA 3WMEA 2CXXA 4GBMA 5EUMA 2IYRA 4I1SA 3WYFA 1ZC4A 3OE7A 5GJWC 2ZSAA 3TBKA 4DCSA 5H68A 5EZ6B 2BMFA 4LY6A 4IJMA 2NO9A 4URXR 1OHHA 1I4LD 2PLRA 2ZR0A 4DWJA 3FKSD 2D2FA 1FL9A 1CJMA 5HTKA 4HUTA 2IS6A 1IN5A 2X19A 3NBYC 4MYTA 2J0SA 4HAXA 3PG5A 2IEZA 4U00A 3VKWA 3PUWA 3EXAA 2F6RA 3H84A 4EFMA 2BJVA 4RJLA 2ZROA 1CJKC 3BC1A 4HB0A 4L5BA 1H8HA 1TEVA 3ONWA 4Q4LA 4LPSA 2H57A 1KDRA 2C9CA 1PJRA 1D5CA 2EW1A 3TKLA 4G5GA 3D6TB 1OIXA 3FWYA 3K8YA 4Y0VA 1YZQA 4PPNA 1I2DA 5FTJA 5KYKA 3VFDA 1AA9A 1M2OB 2O8FB 1TMKA 2QE7A 4JKYA 1ZNYA 4HB4A 3P4XA 4A8JB 2QBYA 1XPUA 2GKSA 1CF4A 1TQDA 5LDDC 3R7WA 5C4GB 2BCGY 2Q6TA 1BKDR 1J7KA 3CX6A 2CDNA 2PX0A 4IVQA 4YMTA 2JJ1A 2C99A 4LX0A 3B6EA 1WQ1R 1D9ZA 4DIEA 3NDPA 4GDFA 3SJAA 1M7GA 1XD8A 3P20A 3ZIAD 4E07A 1IN6A 3B7GA 3H1TA 2QT1A 3RVBA 3CM0A 1XTQA 3SYNA 4MUBA 2CE7A 2FEMA 3DM5A 2PCLA 3EASA 1G8PA 2FFQA 1MKYA 1AZSC 3NEJA 4BASA 1E9EA 1KZGB 3CB4A 1NY6A 3SJZA 2O8CB 2AD5A 4IFEA 3UANA 3VR1A 4LI0A 1D9XA 4LRWA 1K8RA 3QBVA 1T8TA 1OKKD 1Q22A 4IKEA 2ZAOA 1ZM9A 2QTFA 3A36A 3I72A 1XB2A 3L0OA 1P9WA 1WP9A 4DUGA 2AFHE 2QQ0A 4D80A 4C0JA 3B1VA 1JJVA 4D26A 1OH7A 4XVRA 5AUPB 4DEXA 4TT3A 1MO6A 3IDQA 3BB1A 4DBLC 5CITA 3V4FA 4BZQA 1E9FA 1GNPA 1II9A 3L2OB 4DLZA 3EPHA 1H65A 4M9QA 2J3EA 2WOJA 2GESA 4LV5B 2DHRA 4DT1B 2EVWX 1X8LA 3T12A 2DBYA 2G6BA 5HKKD 1LNZA 1KK3A 3U3KA 1E79A 2A78A 2F1IA 2ZI9A 2QSZA 3N2IA 4RVCA 1NVUQ 4OI0A 2IEYA 1IN8A 2ANCA 2GCNA 5A5GA 2AX4A 3MLEA 3SJCA 3K0AB 4PC3A 5TVKA 1L4YA 1FX0A 1U90A 4TTPA 1G4UR 5JFGA 1G5PA 2FZLA 2JEOA 1T6NA 1QVAA 2AD1A 2ZE7A 3B85A 5HCIA 1N2CE 3W3ZB 3DPUA 4FMDB 4IXNA 1I2MA 221PA 1JXMA 1OV4A 3QEJA 1UKVY 2LCFA 1UPTA 1SVLA 4JSTA 1K6MA 2JJ8A 4QXAA 2P6RA 2GBLC 4ZIRA 1S4QA 4B2LA 1W0KD 2ZRBA 1TAGA 4TLBA 4C0HA 5B58C 2R8RA 1VHLA 4NH0A 2R6GA 4BFTA 4F92B 1J90A 1YR6A 2KSQA 3CX8A 2YWHA 1U98A 5FOXA 4ZO4A 4JLOA 3I32A 4P31A 4V0OA 2VA8A 5JMTA 1T5IA 4ZV4A 5DI3B 4PR0A 2FPMA 4D4MA 2MSDB 3QVUA 2HV8A 3LFUA 1OXTA 1ZD8A 2EFHB 3VKHA 3T34A 1FMLA 2UVQA 2ZRGA 3I5XA 4DLUA 2VP9A 5EP1A 1F5NA 2ZS9A 4IDHA 1SXJC 1TL7C 3LQQA 4DHEA 1VECA 1VG1A 3K70B 4GI7A 4JLVA 4LJ6A 2RH5A 3NG1A 3L0PA 5EP2A 4TSFD 3HYRA 3A37A 1IOZA 5CM8B 5A0FA 2J5XA 2QAGC 4G5OA 2OFOA 1U0JA 1G19A 4PQFA 2ZU0C 1NF3A 1XMVA 1JB1A 4LPKA 5F2EA 2KBFA 1E2PA 4GZMA 2VP6A 1WF3A 4M1SA 4UQOA 3T1VA 5LBIA 1E1RA 2ZEJA 2ZJ5A 1N5KA 2XXAB 1ZBDA 5G41A 1V43A 4IVPA 5FUWA 3VAAA 1VKJA 4W7SA 3RHFA 4PSVA 3WYAA 2LKCA 5FOTA 2C5LA 2NPIA 4XIGS 1KK0A 3MWLA 2RGXA 3NC0C 4YONB 3RS0A 4FWTA 3M6AA 2R6AA 3H86A 1MO4A 4YMUA 4EKDA 5DO9A 2OXRA 4H1VA 4QNMA 4TLEA 3SQXA 4UNSA 4IEIA 3REGA 1PV4A 3FE2A 4CYMA 4HATA 3C5CA 5KDDA 4A6XA 1KSGA 3JVVA 3KQUA 2D06A 5HE8A 4RD0A 4HDQB 1CKEA 2J0UA 2WJVA 3FMIA 5E7IA 4MDEA 4M9ZA 3T1TA 2E1RA 4JJKA 3U60B 3PCRB 4O2RA 2J7KA 1KI6A 2CHVA 2ZRAA 3WY9A 1NNEA 1XBTA 3BFVA 1G7RA 1GWNA 4S35A 3AM1A 2AL7A 2AR7A 2W58A 3LW8A 5UKDA 3QVVA 3WNCA 4NCHA 4BZPA 1GKYA 2ZUCA 2WJHA 4WXPA 1ZINA 3EIHA 1SHKA 1YR8A 3CF6R 4JIMA 3VR6A 4OI4A 2ZE6A 3H4MA 1UFQA 1KKMA 4CVNA 2FE4A 1JI0A 2REXB 3KKPA 1IAQA 4Q4AB 2AKYA 4GPTA 1PLJA 2AHOA 1IQPA 5C1BA 4WVFA 1W7AA 3EZ7A 2VTKA 1GM5A 2OCBA 2HLDA 1ZUNB 1OH5A 1CLUA 4PQRA 1EWQA 1D8TA 2CL7X 2G1KA 2A5YB 2W6IA 2JATA 4N1AA 1CS4C 1SULA 3WNDA 2JLSA 4TTRA 1W0JA 2Z83A 1E0AA 3X1DA 1F60A 1H8EA 4WOPA 2KBEA 4QFMA 5FOWA 3WP1B 4RCZA 4EIWA 2A5GA 5CK5A 3LXXA 2ZR9A 4KYUA 2IYLD 3ZVMA 4Q7KA 3U4QA 2FSHA 5EZ5A 3SNHA 1CRQA 1Q1QA 5KNDA 4FMBB 1DS6A 2N42A 4KVAA 1E2JA 3MJRA 3T1OA 3TVDA 1XJCA 5JEEA 3A1SA 2ODWA 4DLSA 4WXRA 3JZMA 4EPXA 2BMDA 4DKXA 3HPQA 3R8CA 3IBGA 2VF8A 3TAUA 4G5QA 1QHGA 2ERYA 1CXZA 1WDTA 2O52A 1Q3HA 4OJQA 1OFIA 5B30A 2GXSA 2CEAA 3A1VA 3QPVA 2HUPA 5KU1A 3RABA 2H18A 5DNYB 1JPNA 2NO1A 3TMKA 5KSZA 4AWXA 1ZNWA 2IYSA 2H8KA 1UBGA 2MSCB 3THWB 3JVUA 1NLFA 1R0WA 2R9VA 1KI1A 3IUYA 1JJ7A 3K9LA 3THYA 2R62A 4ASUD 2R44A 4OHVA 1DG1G 1J70A 1QHSA 4MH0R 5KTYA 4MUAA 2FFAA 1LF0A 3DOEA 2WSSA 3AF2A 2GHIA 3EW9A 2FF7A 1JXOA 1KYIA 2JIZA 3X1XA 1GL9B 3BRWD 4AYTA 1KY3A 4H1UA 5L3RA 4XVUA 1RRCA 2JCSA 1QHHB 1NN5A 2EU8A 1W4AA 1XCPA 1ZIPA 1AZTA 1OIVA 2QORA 1FFHA 2ZS7A 2WMOB 3OAAD 3UK6A 1NVVQ 3AP1A 1Q57A 1TX4B 3EC1A 1CJUC 3QY0A 3RYTC 4MRNA 1M7BA 5CB6A 4RCYA 5JSZA 1J99A 2RHDA 2ATXA 2P2LA 1LVGA 1VCIA 3PQCA 4LDJA 3NXSA 3RRYA 4P4UA 1ZIOA 4OK5A 2JDID 3PENA 4EPRA 2ZRMA 4HSEA 4RKEA 2JJ2A 2QSYA 1GTVA 2XNSA 3IPYA 2O8FA 4HUQB 5F3WB 1D6JA 4Q1DA 2O5VA 1RE0A 3CUEF 3K0FA 5FBVB 4QGGA 2P5SA 4B2IA 1MH1A 2NG1A 2DYKA 2JASA 2FSFA 2O0KA 1BIFA 1S0UA 2J0VA 2K5UA 5D3MB 3LLUA 1P9RA 4KSBA 4EPWA 2RMKA 4KITB 4CIDA 2QUZA 5DN6D 3NBXX 4IOJA 3KJEA 5AUNB 1DG3A 2DWQA 4XSGA 1MRNA 3E70C 4LHZA 4P33A 3BFKA 3U3RA 1NI3A 3U5ZB 4KBGA 3RC8A 5AK0A 4HAVA 2WZQA 4TMWA 5CB8A 4B3BA 2F1HA 4NPHA 2QP4A 5BW8A 1NMXA 4EJSA 1IXSB 2J59A 1KO5A 1F3OA 4NZYA 2IYVA 3U44A 1S2MA 1OSNA 2P65A 3ZS9A 1XPOA 1NBMD 2XGJA 3AVTA 4CZ2A 3HU2A 4Q02A 1P75A 4OYHA 1E2FA 4PO9A 3VX3A 2BDTA 2QM7A 5L3QA 1SQ5A 4L15A 1DADA 4G5RA 4Q1BA 4C7OA 2OBLA 4ACBA 3BB4A 3CNNA 2FWRA 4KVGA 3GD7A 2KWIA 4LJAA 1VHTA 3CRVA 5C4MA 1E2GA 3PVSA 1E6CA 1W4RA 5BQ5A 2HF9A 1TF2A 2CJWA 4ZPXA 2HXSA 3LBNA 3QF4B 1KI8A 2PT7A 4TMKA 3TQCA 4KFUA 5DI9A 4TLAA 1T3HA 3R9WA 5JWRA 4OQLA 4PHGA 5GJVC 4Q00A 5L8VA 3Q85A 4WIAA 3GLHA 1UADA 4MKFA 4C0LA 4U5XA 5KUTA 4D0GA 4FCWA 2OG2A 5DISB 3AUXA 3R7WB 1W48A 2CCGA 2ZITA 1V5WA 4RY2A 3OEED 2G77B 5GJCA 1N5JA 1NN3A 2D2EA 3QE0A 3OEHD 1G3MA 2W0SA 4XVQA 2FSIA 4C2UA 1E9CA 3LD9A 5J40A 4YXWA 1DAGA 2C78A 2A5DA 5B57C 2J41A 1G7TA 5FTNA 2Q9CA 1S1CA 4IRUB 1DAHA 1KDPA 2O8BB 1S96A 4I99A 2QI9C 2OHFA 4LJ5A 3IHWA 2WWFA 1JBKA 1R0YA 2BC9A 4YC7A 4WZBE 1E2MA 4BRUA 1Z28A 2WKQA 1EFHA 4BRWA 5DSZA 3VX4A 4RD6A 2GEVA 2QMEA 2A30A 3ASZA 3AGQA 5FL3A 1RKBA 2ZJZA 2REBA 2RGBA 5D3QA 3GJ4A 1P2SA 4WAUA 4NCNA 5HE9A 3UMRA 1EK0A 1XCGB 1Z2AA 2V9PA 2RGNC 1GVNB 3QKRB 1KAGA 4XH9B 4BFWA 4B47A 2JLWA 4WZ6A 3T15A 2B8TA 2J87A 1AGRA 2G0NA 3AVUA 4PZYA 4GOKA 5JJKA 5LB2A 4O2LA 4TMXA 4DCTA 3FMPB 1UEJA 3OFND 4AYXA 2R6CA 1KSFX 2Z6VA 1Z83A 3CZPA 4XWKA 2NGRA 3TIFA 3BK7A 1T91A 3IBYA 4IXMA 1YVDA 4GRAA 1E69A 2Q3MA 1MRSA 1HEIA 4HEJA 4V0KA 3ZZ0A 3TAHA 4LBZA 2OILA 3K70D 4JBWA 4IOLA 2OLJA 3GLIA 3LQRA 1Q44A 3IEVA 1SKYE 3GCGA 4GP7A 1N6OA 4GNKA 2F3TA 3TR0A 4M22A 2OFWA 2DFKB 5FL7A 4LGMA 1HQYE 1TEXA 4PSKA 1GKUB 3TLXA 3B13B 4DLWA 1U0HC 2ODNA 3DKPA 3NBFA 4JL8A 1KMHB 4DSUA 2OXCA 1RW4A 2NZ8A 1P62B 4HLCA 5GJBA 1UKYA 4B3DA 4NCIA 2X2EA 2F43A 1S9DA 2BV3A 1M7HA 2FEOA 5H8WA 1QHXA 4NCJA 4PPQA 4PHHA 1CR1A 5L3SB 1AS0A 3KUDA 5IK2A 4MGKR 5JWOA 1I4TD 1TNDA 4G0NA 2QROA 3FKSA 1G6OA 2PCJA 2QG6A 2REOA 3CNLA 1ZRHA 1NP6A 2CLSA 1FW6A 2VYFA 4LBYA 2ATVA 3LVRE 5BYKA 1L2TA 4CDGA 3ZLJA 4YMSA 2SHKA 1TQ4A 1KAOA 2C8VA 2XSZA 3RWOA 4F7WA 4LYFA 4QGAA 2CHGA 2QN6A 4QRHA 2VHUA 2ASEA 2GCOA 3MFYA 3T5GA 3UKDA 2GK6A 3EZ2A 1Z47A 4D4KA 4D0LB 5HZHA 3KB2A 1UF9A 1J8YF 2BM0A 3TW4A 4W5HA 2NMVA 1F2UB 3G5UA 2R2AA 3EA0A 2XNDA 5FBLB 4LHXA 3EWSA 1HT1E 3NHBA 4JLAA 2WJYA 4POAA 5LPNA 2VRWA 3KKNA 4HDCA 2VHQA 2I1VB 3X1ZA 2ZRJA 1LS1A 2WPDD 1US8A 2W2VA 2YC2C 2YJTD 3FFAA 2QPOA 1YRBA 4FMCF 4I1OA 3VR5A 1OFTA 2PZFA 4KU4A 4AI6A 2F3RA 3I1FA 5JS7A 2BKUA 2C96A 2V1XA 3QKUA 5FI1B 3RS7A 3TQFA 3GJ7A 4K46A 2XOKD 5FUVA 3ZIAA 1WA5A 4JMPA 1ZU5A 2RCNA 3QSYA 3GLHE 1NVXQ 1Z07A 1TUEA 2LKDA 2ZI6A 3KDSE 4KODA 1G7SA 2EFEB 2AKAB 4OJKA 5JZVA 3UPUA 1ZP6A 3CWZA 3ZZUA
chains in the Genus database with same CATH superfamily
1Z0SA 1I01A 2OO5C 4JBIA 4YUAA 5B6PA 4V02A 5F4BA 5FPSA 3TI7A 2NT4A 3CH4B 4B5KA 3OE5A 4JH0A 2YIDA 2G5CA 2DFLA 1IY1A 3CE9A 3VZDA 2ZSDA 3E9QA 1JGTA 1LDBA 5EUBA 4NENB 3OTGA 4WA7A 4WKGA 3FUTA 2WAXA 4AUKA 4C03A 4E30A 2ZYTX 3G59A 2WOOA 3P9KA 1EINA 1PGPA 3OM9A 3BFJA 3PNYA 1B8NA 2WHYA 3SKXA 5AVRA 1XD2B 1NKTA 2ZRNA 1YHNA 2EL7A 5FF9A 1RLOA 1K89A 3VC3A 1XKTA 3IP3A 4P3PA 5I8PA 4Q9NA 3NTXA 3W7VA 1HPLA 3UG7A 1RYHA 3RM3A 5AH0A 2BEKA 1LEHA 3M6MD 4EGSA 1Y5MA 2WU3A 4NZOA 4OXKA 5JROA 2W83A 3TQHA 2JVKA 4AURA 5JQGA 1RRMA 2JAPA 5TT1A 4H35A 1EESA 1K27A 1WWKA 4D6PA 5H83A 3D4BA 1IMOA 1Q77A 4GLJA 5JASA 1YNSA 5BPFA 3HN7A 2TYSB 2X4DA 2BHNA 3F6RA 4LF4B 3DEFA 5TQ0B 3I4LA 5I48A 4R5MA 1N7IA 3EULA 4FOSA 3I9NA 4XAQA 5K3EA 3H9JA 2ACEA 3ELYA 1PD0A 3DPIA 3JYOA 2DERA 1C3JA 1OLUB 1TIKA 3IEIA 1KVSA 1IHPA 1X13A 2FHSA 4GOND 2ZM6B 1E9BA 2DT8A 3C43A 3HRIA 1U8CB 3QXHA 4N8EA 4R2HA 2IYQA 2ZRDA 1YZUA 1TCCA 1FYDA 2PT6A 3OFKA 1DC5A 2F9MA 4L0CA 4B09A 1FDWA 1H5UA 2BZ0A 4GR4A 4U3JA 1Y6QA 4P32A 2XB6A 1CVIA 3MLAA 1AM4D 5IXJA 1QCZA 2DWOA 2Q3HA 4HKTA 4QYIB 4UTZA 5CNKA 4RX1A 3VNSA 4HUJA 4JUAA 2ZZNA 3E5HA 5CVTA 1BEEA 2B8EA 4O8ZA 1JILA 1QYDA 3FMOB 4YT8A 3QXCA 5IRCD 1P31A 2K7ZA 3HJAA 3U7RA 4G4SP 2AIRA 5DHUA 1SXIA 4NIMA 1G3UA 2FX5A 1PD1A 2M2IA 3N2KB 3SQLA 3PD0A 1FP7A 3OP1A 2R5NA 1G8AA 2ORWA 3HE3A 5LUAA 1JYFA 2QYSA 4DILA 4P53A 3FBTA 3WLNA 5AI5A 4UU0A 3EGXA 2D1TA 4HMPA 2YXDA 2WWXA 3BA1A 5F5LA 1U02A 5E6SA 3CR8A 2B7CA 2C20A 2G80A 3MB5A 3DAHA 2ZRFA 4KPGA 4RA6B 4YCLA 2FZEA 4Q3KA 2C9MA 4B32A 4YPVA 3PX2A 5F64A 4BLPA 5KQPA 1USUA 5H16A 2UUAB 3GDGA 1DJQA 3IE1A 5AKGA 1PJCA 3IBFA 2QI9F 3Q8MA 1JAIA 3V4VB 2X5NA 2ZETA 2ZYGA 4J4BA 3TRKA 1Q19A 4NLLA 1ACLA 1E1QD 1KJJA 2P6UA 1IONA 2O7QA 2NO0A 2P9TA 4PC7A 4ZRDA 3GDFA 3MJ4A 1YR2A 1LNQA 2ZPAA 1S3IA 5LU8A 1N1DA 4FUTA 3PPIA 1W87A 1X19A 2B1QA 4KWIA 2D4HA 5JXHA 2CXQA 1MB0A 2Z3VA 3NV7A 5CJ2A 3L4BA 4G56A 1QQTA 3UHJA 1Y5RA 1N8KA 1R0XA 5TIIA 3SVLA 3VTKA 1JVSA 3HP1A 4J6EA 4BXOA 5CT8A 4ND6A 3D0RA 2IU3A 3ZXSA 3TSOA 1T4CB 5E7MA 5F4ZA 4DG5A 4B83A 1B93A 3OEYA 1BJTA 3GLQA 1UJCA 1Z4LA 4LRXA 4IGKA 4LXQA 1QPBA 2XIQA 4FMPA 4BZZA 1QVVA 4JNKA 3B60A 3T35A 4O4LA 4P2GA 1U8ZA 2BMEA 4A6EA 1WSWA 1E64A 3L0SA 1V1MA 2EQ5A 3H04A 3MTEA 3KQMA 4HWGA 4XDYA 1KPGA 2VWQA 4D4LA 3F3SA 3RC9A 1E3WB 4JLKA 4UEQA 5ED0A 1D6MA 1DAEA 1F2TA 4MAMA 1LU9A 5D51S 2XUPA 4NYIR 4PC1A 1K5GA 4M46A 1XZLA 2B25A 2JAXA 4P7GA 3NQ41 3U49A 1GTG1 1SUBA 3BJIC 4N0DA 5KINB 3DE7X 5FUMA 4IDPA 3CNOA 4C3UA 1FYWA 1USVA 2BFFA 1YQTA 3G49A 2IXEA 3JRXA 5ADWA 1MP0A 3I92A 3T5TA 1E2IA 3HYNA 3LRTA 2AG8A 1JEYB 1CQWA 1JIQA 2GS9A 4KUHA 2QZZA 4L5CA 4QJIA 5EHNA 3E8SA 3A6JA 3A28A 4IV8A 3SS8A 2PJRA 4XB6B 3ND9A 3Q1LA 2A5FA 3K4HA 4XGKA 3ADKA 4DLVA 4M83A 3PV0A 2GUGA 2OM2A 2RHLA 2NAPA 2ZAYA 4S1VA 4BFXA 5B3LA 5AO9A 3U4HA 4DM7A 2PX8A 1IWBB 1LJ8A 3U44B 1E1MA 4E2YA 1DXQA 1CHNA 2PFGA 4X90A 3IYLW 1JPJA 2BKLA 2OLKA 3MJCA 4WXYB 4QM6A 3OJCA 3AR8A 5KJFA 1ZO8A 4YREA 3BBLA 3DLBA 5JWHA 3HVKA 4QKQA 4H16A 4MRRA 1J9ZA 5CB0A 3BCUA 2G0TA 3G1WA 1PV1A 1WU8A 3P2JA 2OO3A 4Q7LA 3WHKA 4L9SA 5K0EA 3ICWA 3DZ8A 3UV3A 3ZYZA 3AEUB 3M8KA 1XV5A 3ZHTA 5J23A 2VRBA 2ZYRA 1KJYA 1VL8A 4QBHA 3CH6A 3GFBA 4UQLA 3RS5A 1WTAA 4LQCA 4BMDA 4BP8A 2BAGA 1E63A 1XMIA 1QO0A 2JKVA 4L7QA 1YA8A 3LNTA 2WUFA 3GEEA 2ZSUA 2HBRA 3DW3X 5AIBA 2HO4A 2G09A 3EVEA 3F4LA 4ZARA 2OZPA 3Q3JB 1LLCA 4ARZA 2UZ4A 5TF4A 4MA4A 1HLFA 3V1YA 1EX9A 3CISA 2F48A 1HNWB 4HL6A 1ZK3A 2ID8A 1AKEA 5CEJA 3QMMA 5FAKA 5JDIC 5H81A 4JP1A 3PITA 1H4QA 4M1TA 4BGUA 2JGMA 2GO1A 4G9EA 4O4IB 4UULA 2PGNA 1R4NA 4IO1A 4BO9A 1WW2A 4B80A 9MHTA 2GASA 2PVPA 3U4AA 4RDIA 2QSJA 3OLZA 1UZAA 5DEIA 4CHGA 1XGKA 3DE5X 3JVEA 4AJHA 2HZBA 3FPGA 2I2AA 4I1UA 1GSIA 4RVHA 4BFUA 5HWSA 2PUVA 3MWYW 5C5EA 1I2CA 1LS6A 1UJBA 3KUCA 4N0QA 1WRBA 4WSOA 1NR1A 5DWVA 4IHQA 3LXUX 1LGYA 1L1FA 1Z0AA 1W44A 1OC4A 4DCMA 4EQ6B 4A8JC 2EJCA 2WYHA 3HVIA 3KFLA 5J1SB 3R6LA 4EJ0A 3NWOA 1W5EA 2C5GA 1TF7A 1EP1B 5IKXA 1TUIA 2E4WA 3MSXA 4QNRA 1B43A 3DNMA 4M7PA 3SHQA 4R1UA 2OESA 2QZSA 3C3XA 3IAFA 4HFRA 4LSMA 5EIFA 3RKRA 1WOMA 1RPAA 2XE6A 4XWAA 3DF9A 2P4SA 3UICA 1DAOA 1MEJA 3WXBA 3TINA 2ZI7A 4DPLA 4IRXA 4OOEA 2ZRHA 3FWZA 1VRWA 1MVOA 2ZZMA 1C7FA 4MVCA 3ZDCA 1NM5A 5I5EA 5KAMA 3WTBA 3OZFA 3ZVLA 121PA 2QQFA 1RLIA 3SJUA 5DWQA 3A1WA 2Q1WA 3MJFA 1SOVA 3K6SA 2Q5CA 2QYTA 3A11A 4Y6RA 1Y8AA 4KXQA 3R7SA 2VSOA 3VO2A 1T5SA 1M2KA 3HGTA 1M1UA 3Q11A 3QEOA 3SX4A 2ZYHA 4BMPB 2XKKA 1N34B 4C7KA 1PW5A 1GRNA 2H6EA 1Y3HA 2VTVA 3F90A 3BTSA 4ZOLA 1YS9A 4JZKA 1WMBA 4ZU6X 2XDYA 1JG6A 4A2PA 5JRZA 3FCEA 3UJ9A 4EX7A 4XWGA 3EXIB 1T4MA 1LPOA 2CMHA 3GGGA 1L7XA 4RFSA 3SXPA 4FX2A 1V9SA 1G9XA 1DBSA 3L93A 3A6ZA 4G4GA 1EWRA 3FNHA 4PPFA 1NNSA 3ZLUA 4F4IA 2ODQA 2HJ9A 2XMSA 5SZIA 3ZWWA 4DLTA 1DRWA 1H3FA 1EAYA 1QVZA 2H5LA 2D3TA 2IY8A 2JBWA 3CRMA 3H3XA 1BH2A 2AI3A 3HGMA 2B0JA 4A7PA 4BLTA 2GPSA 1QRTA 2CYAA 4G5XA 3G02A 3LX4A 1KEEB 3ABZA 2P9BA 3DC7A 3ITEA 1LRJA 3JVIA 3M89A 3N2NA 4GT1A 4NMMA 4ODIA 4PANA 2UZAA 1RHJA 4EJ2A 4P0TA 4PAQA 1XR3A 5KVSA 2IXGA 1JG1A 1MW9X 1QYCA 4M6WB 1Z0ZA 1K7FB 4C7BA 3DOIA 3CIOA 1VL1A 4ROTA 4KMOA 4MARA 1YZVA 3ONEA 5IN5A 3E9YA 4QYSA 4JJ8A 3IULA 1Y1SA 3RYFB 4E2WA 2PUGA 4P0PB 2YINC 4PO8A 1LSJA 4ABYA 3RROA 3ZWPA 1V3UA 4E5DA 5A1TA 1Z2PX 1WSAA 3TDNA 4DDWA 3CCCA 1DOAA 2FEAA 1DC4A 2PEZA 2RGUA 1HFKA 1YDGA 2OV2A 2YWFA 4RTOA 1OBCA 5EXSA 3I9KA 3BXFA 4DV6B 2PBFA 3ISTA 1ZAYA 4V1CA 1A98A 1E4VA 5AKIA 3VSAA 5ECGC 4GPIB 1U1IA 3IVXA 5CVVA 1YWGO 5A7GA 1VM6A 4DBLE 4KR2A 1ESNA 1XCOA 3ER6A 3AUSA 3GRPA 3KL4A 4L6IA 2NU9B 4M87A 3THSA 4EI7A 3H3JA 1MT0A 3M1LA 3IQEA 5JY1A 3DCIA 4AKEA 4RVNA 5KOJA 3AOEA 2EZ8A 2WUWE 2G1AA 5K8LA 5CW1A 2A9OA 3FOAA 3QJ5A 4BMXA 3IT1A 4IPTA 3ERCA 2P4QA 2UUOA 1FTNA 4JVOA 4EYGA 2WP8J 1N0UA 2VDLB 1Z4JA 2A9RA 3DXFA 1T6ZA 4LBVA 3GL9A 1N3BA 3HVJA 4Q82A 3QVGB 4ZI3A 1NSYA 3F9CA 1NQVA 4YI5A 3ZH9B 2VJYA 4LGYA 1Q7TA 2UUCB 3JSXA 3UAZA 4DNXA 2MYNA 3PHLA 3LTNC 4PONA 2FW7A 1YCDA 3CWCA 1R2QA 2X7JA 3K31A 2QZ4A 2QV7A 3PD7A 2HLDD 4FINA 2WG1A 4MB2A 1QRSA 1XZDA 2TS1A 4UKDA 3HDTA 2EFGA 2G3YA 4V0RA 3K0AA 3TLGB 3I83A 3G0CA 4RUKA 3L5OA 2FCRA 1E4EB 2IODA 2HDNB 2XMGA 2YYSA 3CA8A 3KQSA 3WBFA 4DMMA 5AHWA 4I4CA 3L6DA 1GA1A 4ITRC 5CYGA 2FQYA 3KKOA 3GLVA 3L6RA 4HNAB 4MW4A 1P61B 3B1ZA 4RD4A 3KTOA 1TZCA 1U3TA 3MB8A 3T3IA 2MCFA 4BAUA 1TCUA 3WVNA 4X8LA 1P4SA 2UXBB 1E2UA 1FFBA 4RZIA 5KNDD 1JIVA 3EXFA 5BQPA 2AJBA 3TSCA 1P7ZA 3IIJA 1S5PA 3LY5A 4F5WA 3M9XA 2NYAA 5TJHA 1FUIA 2PQ2A 1IVSA 1GILA 2E4AA 1XWIA 3E7DA 4RWEA 3F98A 2R7LA 3KZOA 4UE2A 3AUFA 4KAJA 4YRSA 2Y2UA 5BXYA 2XZLA 1I80A 5JQGB 3KAKA 1X1TA 2G67A 1AV7A 2AMYA 4UZSA 1U0SY 1SWWA 4EEKA 2VJAA 2QF7A 3P7MA 1YGPA 2RGAA 5KWEA 1KP2A 1L7PA 1NWHA 4KYIB 1NFFA 2Y1LA 1KMIY 3D2BA 3GUYA 4YAFA 1EK2A 4I4TF 5TS3A 2FPKA 3NVDA 2YOFA 2IV7A 1J6UA 1QE0A 2VNHA 3B1KA 4AX4A 3VKGA 3LVBA 1UUFA 3PE3A 4RO0A 4C87A 3BQMB 4IEEA 1JHOA 2F90A 4Q39A 5FR1A 3HJBA 4JITA 5IW8A 2XUOA 1ZD5A 3F3KA 3RSLA 4HD8A 4MQLA 4CLDA 2YC4C 2VYQA 4CNQA 1BU5A 3QU4A 1IXZA 4HDSB 4DJDC 3GEDA 4YMGA 2NP6A 2R00C 4N0PA 3GPLA 4AZSA 2HKIA 1KWKA 5KTSA 1COWD 3E3OA 3OZTA 2VPIA 1VSBA 3GHYA 1OT3A 3FWKA 3A9RA 1SC6A 4PZZA 4FW9A 4QDXA 4QGSA 3ZXIA 1W36B 3IBTA 5J4YA 2QBYB 1LF5A 1URPA 2GN4A 3ITKA 2RB5A 5CK4A 4BP3A 4JROA 2Z6UA 1U8XX 3ZDRA 1PR6A 1Y7IA 5ABPA 1YL7A 4RCVA 3MGAA 2DHCA 3BE8A 3FRIA 5FXMA 1AZWA 4EI9A 1EFPA 3UAWA 2FDCA 3LTEA 3W3AD 4B6FA 5J47A 1ZI9A 1LJUA 3HZHA 3PE6A 5D3KA 4PVDA 2G5TA 3KLOA 2ZT6A 3P9CA 1KJWA 3HXLA 2QD4A 5A0VA 2AN4A 2R60A 1GAWA 2JHPA 4K6CA 4ILKA 3K0CC 1QMPA 3H8JA 2HXYA 1G2OA 3EGXB 4DCGA 3TIVA 1NXOA 1C7IA 5HJ2A 3ZZMA 1JR4A 2XZOA 4B3MB 1YULA 3ADBA 2JIRA 4EGJA 2QVZX 2IE0A 4YACA 4Q47A 4LXTA 5DGDA 2WTNA 3GI1A 3TDKA 4AFNA 1PDOA 2HLHA 1T36A 3H7IA 3LQ4A 1I2BA 2OBNA 4YAWA 1BXRA 4ZDIA 3GYBA 4ZTZB 2O2HA 3QFSA 1JR3E 1HLPA 2OXTA 3BCRA 4E70A 4CKEB 3HR4A 1FXWA 4F72A 1CRZA 1MC8A 4W5QA 2ZUUA 4AK9A 5TY0A 4IJ6A 4MQUA 3FVTA 4Q15A 3H65A 2C9OA 2F8MA 4YLEA 2K7FA 4MK4A 1IN1A 1FP4B 4HMQA 2QD3A 3G68A 2C0CA 4XYMA 1K2WA 5LP6A 2IOHA 3AESB 1Y9ZA 1XTSA 1DZIA 3UB3A 1GNRA 1X8JA 4TWBA 3R5TA 5TGTA 1UM9B 3MWEB 3VKVA 1VSTA 5EP4A 3V32A 4C5CA 3FD8A 2AWOA 3K2QA 3ICCA 2QNRA 5DCYA 3EIWA 2Q49A 2ID4A 3UK0A 1UXOA 1CY0A 2QPTA 5AJVB 3V97A 3WMWA 4EW6A 5K01A 5E2BA 4PYOA 4BXOB 1BOOA 2LZ0A 1R0BA 5TQJA 5EC8A 2BFPA 3RIHA 2ZP1A 2OD9A 1BRTA 3PC8C 4KQFA 1U0FA 1FX0B 3I5MA 4I2VA 1QANA 4MKXA 4O4LB 1ZJYA 1KFBB 3FGOA 3TUJC 4EJMA 2H9IA 4QEDA 3B6IA 5F76A 4NFYA 1YZGA 3D7SA 5DSXA 5FOVA 4E1AA 5KVAA 2PE5A 4UAUA 3W8FA 1R15A 3WBKA 2X9VA 3UJHA 2C4MA 2Z1MA 2NZJA 2WBLC 1VCNA 1F2TB 1W96A 4H59A 4TZTA 3CCBA 4QELA 2XZDA 1NW8A 1ZM4A 2ZDHA 3U80A 3ZNNA 5IT5A 3AVVA 4FDAA 4UXJA 4ZZ0A 2BFFB 3HQ4O 1C8KA 2Z8XA 3QBEA 3ORHA 4I36A 4UTOA 4YP9A 3N70A 4M0MA 3NPAA 4RAQA 5B4TA 4HVLA 4C4RA 4D3SA 1V4VA 1TCBA 2O2YA 1C0PA 4GUAA 4K0RA 1IDOA 2EZ9A 5IG2A 1E9SA 4HDRA 2QTTA 3QRWA 2PU7A 1U2PA 1ZUHA 2HNAA 2X5XA 3K5HA 5ES3A 4BNYA 2IWHA 1TUBA 3WLLA 2JGFA 2ZJBA 2RG7A 5CT9A 3KYCA 3TQTA 4BQRA 4BO1A 5HQTA 3BD8A 4O08A 1JWAB 5DW0A 1V35A 4CDRA 4TXHA 2HV9A 1MV5A 2VPYA 3BXHA 3C7CB 3FYDA 2ZWOA 1DJLA 2FI1A 2PBRA 3E5NA 3G9UA 4W8OA 5JCZA 1N2GA 3QIVA 1RVV1 4MVYA 2QRLA 5T41A 2HWXA 2J48A 3HADA 5JH7B 4YIKA 2AOWA 5ICGA 4A0QA 3M70A 2JKYA 1GADO 1GZDA 3RUEA 2AEFA 1H4SA 1Q1EA 2IK8A 2F3UA 5ENZA 1RFLA 2C7BA 2LW7A 2DGDA 3L8ZA 3O94A 2BKAA 1Y98A 2CVQA 3JASB 3QELA 5DLEA 3GMTA 1OXKB 1WB6A 4EKYA 3USES 2PIDA 3C3YA 5DX0A 2X6QA 2QN8A 4FFSA 4FOLA 4OI2A 3G1TA 3MA0A 4WLOA 4BAZA 4EY7A 2VEDA 1JKJB 3FFWA 2D74A 5HRAA 3HFGA 4KAFA 2IH5A 3D31A 4L8YA 3CNQS 3DGFC 4YJKA 3R5KA 2DFNA 3UENA 4KIUA 1RVDA 5DCWA 3W9UA 2A5JA 3DCYA 4MVJE 2CLCX 4YAKA 3LUJA 4NQRA 1U5CA 2O7VA 4ARZB 2VR1A 5I7FA 1W59A 1KH2A 3GFQA 3PE4A 3G13A 2FZ4A 2I3ZA 1JEEA 2WTEA 4RK4A 3MBKA 2G9UA 2VDUE 3VPHA 2AN5A 4BKQA 1NG1A 2ZYVX 2CHQA 5AM1A 4ZGGA 1U81A 2P7HA 2Q5LA 5I4IA 4BO2A 5G3YA 2H1WA 1DIHA 2V3CC 1R4NB 2JAUA 5E1BA 5HMLA 1DV1A 2GZ1A 5J5AA 4TQGA 1DEXA 2ZOSA 3H9GA 3FDIA 4M7OA 1MABA 3D2AA 3ZE1B 2OBBA 4HYYA 2PVCA 2HMYB 5EHGA 1PHPA 2WJWA 2XAUA 3I9FA 2CFSA 3LO5A 5B5SA 3WR5A 1OKKA 3K5PA 4Z99A 1UT6A 4GSLA 2HMVA 3AEKA 5D3MA 2HSWA 1ODLA 4MWCA 1W36C 3T7KA 1GLVA 5IVIA 1QV6A 5GMOA 1PR2A 1ESMA 1DAFA 3ZW9A 2A86A 3ACDA 5HF6A 4IFIA 3BXOA 1UFVA 4B7AA 2C95A 2O8DA 3MSCA 1VC2A 1IPFA 4UVIA 4KTVE 3FW1A 1BVUA 1VG8A 2CNBA 3MIIA 2MWMA 2B8NA 2G72A 2H92A 4FCTA 4XQ0A 1HA3A 3HB4X 3U61B 1R18A 5FL7D 1I3MA 3BE4A 5LMCA 1PX0A 2WJIA 5M04A 2J4CA 5HDBB 1IHDA 3FCXA 1JLKA 3M9LA 821PA 5DIFA 2DBVO 4MS1A 1YJAA 2E82A 3DOJA 1YK0A 3DE1X 3S55A 5BV0A 3CJRA 1HG0A 5A7FA 1B2LA 1KYWA 1PR5A 1XA0A 4MQEA 5AVJA 4YHHB 4S04A 1CBUA 2BWJA 2C31A 2P6NA 4ZAGA 1KDZA 1T3LA 1II8A 4H1TA 4TRMA 5ER9A 1TGYA 5CDFA 4TQ9A 1IOVA 3NTQA 1Q0QA 4JQOA 3NEYA 4FXPA 1JFRA 3WGJA 1EVJA 3B53X 2X77A 2LR0A 4MOWA 3NCHA 4XB1A 5CTJA 4D2IA 5HPYB 3VI4B 3Q41A 2DP4E 4PLYA 4LZZA 3EDQA 4TV8A 2IYAA 4UW9A 1WHTA 3PJRA 1WQ4A 1XVUA 1DEHA 3AM3A 1SXPA 1QP4A 4RFSB 1C0IA 1YZLA 1BG6A 4YAOA 1NAIA 3VPDA 2UZIR 5JY6A 4QVIA 4WBNA 1O9GA 1W0KA 1HEYA 1ABEA 2C3OA 2Z0MA 2WJGA 3WOHA 4E4YA 1YZYA 3N74A 5IHXA 4JU9A 1T9AA 5GP1A 4B31A 1GRQA 1OB2A 4OLBA 1SHJA 3VYWA 4C0XA 3IL2A 2QLBA 3AKEA 2VDMB 1RM4A 2ZZKA 2PT5A 4PYRA 2IW3A 3M3DA 4LNHA 4ENSA 2J9FB 3VISA 4YLGA 5T8KA 3T5BA 1RWMA 3E4CA 3QUBA 4X5OA 4IX9A 2Z9CA 2QUKA 2ZR8A 3O31A 5LC1A 2OWDA 5K3BA 3F7TA 4JX9A 4TVOA 1TU3A 2X1VA 4K8OA 5G4LA 4N6GA 2WM2A 1H05A 2IDKA 3QG5A 4XJXA 3TQSA 2QT0A 4BQOA 5J2UB 1KNQA 3VR5D 1VYHA 3K1YA 4E2FA 2B82A 2PYDA 3FUXA 2CE2X 3S5UA 4D9EA 2HWUA 1VDZA 2C2OA 2V0CA 3GARA 1R8SA 3F1KA 4KW7A 4K6HA 3ZQJA 2I4NA 1NMYA 3QFCA 1W2GA 3MPUA 4LYAA 3WP0A 2IGTA 4EDFA 4I3HA 1BX3A 3AYZB 1HOTA 1KDOA 4QTZA 1OTHA 2NV2B 1QDLB 3O84A 4ERXA 1EWKA 4O3MA 4OJMX 1NX9A 1T2CA 5C1IA 4V1CB 4S1TA 3COJA 4HI0E 1XD9A 2V3WA 3EDRA 3EGCA 3OF5A 2RHHA 4X6LA 4D5GA 2RGRA 3W5BA 3LL4A 5CG1A 4YJDA 1MC5A 2ZJAA 4GR5A 1Y1LA 2IJGX 4WFJA 1AUPA 1VBKA 3BJZA 4EPYA 1R6UA 4J7AA 2BW0A 5DHPA 3OQJA 4NVRA 2Z57A 1T6BY 3C4JA 3EZYA 5KOJB 3QXXA 1U9CA 4LK2A 2VPXA 3D5EA 4XD7D 3PNMA 4C0AC 1WVMA 4ZCQA 5LQDA 5MN4A 4GKJB 1CY1A 1XHFA 3UFXA 2DKNA 3FHCB 4G1VA 5M5BA 1SUFA 1KSJA 1PUJA 1W49A 2MSKA 1O97D 1RI2A 2PXHA 4B34A 5IH7A 1J1IA 3F6CA 3HHPA 1YIDA 1JPVA 2BI8A 3LYUA 4D0NA 4DCOA 3T1TA 1A82A 2ISQA 1CHDA 1Q20A 3K0EA 2OZKA 2H2HA 2VF5X 3K53A 2NX2A 1X15A 4R7TA 4KQXA 4RA9A 2X41A 3ESAA 2HREA 5DGXA 2YZGA 3KKQA 2I03A 3T5AA 5IDVA 4ZVNA 3A4MA 2P62A 3JZAA 4INOA 4C6TB 2O8VA 4M53A 2X9NA 1V4BA 4GI5A 4IM7A 4ENVA 1BS1A 4XTRA 2H07A 2GZ3A 1ODIA 3P8ZA 3SVZA 1ZEJA 4E03A 2NNLD 3IAHA 4Y2HA 4ZT3A 4AVYA 5AYVA 2J9YB 2XKAA 1L5FA 2R6HA 3DMDA 3UJCA 2YW9A 4RMIA 4OMCA 1H85A 1E9RA 4JQZA 2NO7A 3CYFA 4W63A 2IYTA 3OKFA 3KWMA 1E2LA 3PC7A 4YV1A 1XTVA 2OENG 4IDGA 2W2LD 3TLKA 1ZONA 3ZGOA 2PGDA 1J2UA 2J3HA 2X42A 1OYOA 4MW0A 4Z54A 4MZXA 3U7QA 3EXFB 4GQAA 2HCBA 2B7BA 2Y66A 4Q3OA 4YV7A 2QL6A 4KIFA 1KMHA 1A9ZA 4WXEA 4H7KA 1A9QA 3GCDA 2JH8A 3C5EA 1SH7A 3VKFA 3WQHA 1FNSA 4WKCA 1TAUA 1ORIA 3GLFE 3E7FA 5A4MS 3ZWBA 2DH5A 3L9WA 1XXLA 5ALDA 4AICA 5L3SA 4ADSG 5B3JC 1ES9A 5JVDA 1PQ4A 2H1SA 4P3NA 2QP3A 2XYRA 3EIEA 4KGVA 4L5YA 3PX7A 1PG2A 4B6EA 5CVDA 2VCEA 4G6ZA 3KEFA 5JS2A 4JYPA 1R4MA 4ZICA 4KOEC 1N0IA 4K87A 3TFQA 1F8XA 4C5AA 4DTCA 1L8QA 5HZKA 4FLMA 1QFXA 4UBKA 2HT6A 1K7CA 3BIJA 1TOAA 2NN3C 3CC8A 3S68A 3WS7A 3RIEA 2C2GA 2FJPA 4GD3Q 1S8AA 2IWRA 3IOCA 2FK7A 3NW9A 3ANLA 4QWWA 1WMEA 2PSJA 1YFLA 5CGZA 1MX9A 2H06A 1RIFA 1OR8A 4MGEA 3LP5A 8ABPA 3B7PA 2QUJA 2JIDA 4QDOA 3W5UA 3SGLA 1F2UA 2OD7A 3BBPA 4MP8A 4D56A 3NM5A 2AVNA 2QXTA 5EJ2A 1RLUA 3PEUA 3PUZA 4R2JA 2VLIA 3ZWQA 1EFPB 1R6BX 2PEYA 3J7TA 1I6WA 2XAAA 1VJCA 3EWNA 2P2YA 1K63A 4TL6A 1KI9A 4WLFA 2VHCA 5IAGA 2MSEB 2IIVA 3TXAA 4HT3B 2A1TR 2VT3A 3WWPA 5AKHA 2YVKA 4D9MA 3RHSA 2CXTA 2VAPA 4U7TB 4PHFA 4Y1RB 1UDXA 3A3KA 4MR9A 3GVPA 5A6VA 1JSCA 1Y80A 2ZJOA 3F6YA 2PRJA 4INJA 4NHOA 4I4NA 1GXSB 1UZLA 1NVDA 4ZEXA 3ZNOA 2KS6A 4Q1CA 1BXRB 1ZH2A 2DKOA 3U2QA 2AJ8A 3N58A 1VBNA 3L3BA 4DBZA 1JFTA 3DMTC 5EMNA 4P6VF 3GDOA 3UJ7A 1M1ZA 1R0ZA 3DZDA 2L17A 3SSMA 2BR3A 4KE9A 3V3TA 1U9IA 1YB2A 1A8PA 1UBCA 3AG5A 1G20E 1LTKA 3DTYA 2Q9BA 5JZBA 2HSEA 4RJIA 4ZDWA 1U6KA 5LQKA 3ICEA 3NVMB 2VI5A 3KKZA 2VIIA 5LP6B 1DKNA 2LDBA 4PBSA 1U7ZA 4JN6B 2C77A 1D1TA 1PF7E 1WULS 2BSAA 2Z43A 3O1JC 5A5VA 5A3JA 3W78A 2P4EA 2IOFA 1T9HA 4YBZA 4CLXA 3SBXA 4UTNA 2ZBFA 1S7GA 3N39C 1F6WA 4I55F 4YRBA 1Z63A 3ZUGA 1MAUA 2FMUA 4YWJA 1OVMA 3BL8A 2EWWA 2Q8QA 2ADOA 2IF2A 4RJJA 3Q7QA 4NOKA 521PA 2D3WA 4HZUA 1OI7A 1PV2A 2ZUSA 4N6OA 2X8WA 3FNFA 3I9V1 3QWBA 2H1CA 4J16C 1JKIA 4A0RA 2FMIA 2GLUA 2C54A 3H5LA 5GY7A 1AKNA 1DIAA 4FHZA 3FTEA 1WABA 1MU0A 3DEJA 1CQJB 3C6QA 2ZUEA 2FPIA 2WT8A 1SIBE 4J2HA 2P1RA 1BE8A 1EDBA 3IHTA 1KZYC 4AMVA 1T0BA 3DL2A 3ICVA 1MJFA 1MAWA 2R1ZA 2HY7A 3OZGA 2A84A 3AOEC 1PJQA 1CQPA 1NN0A 2VBGA 1OXXK 2EZ4A 2P69A 2DPMA 2DH6A 2VAWA 5CBKA 1H2BA 5JECA 2ST1A 1QVRA 3BRSA 3FNRA 3KQHA 1M2OA 3KVVA 4WKOA 2BCEA 1XTUA 3WSTA 3PX3A 1ZEMA 1E2NA 1WHSB 1RWOA 4TWRA 5BSTA 1QFMA 2HX1A 1WETA 3HI4A 2PKYX 5KTTA 2GDJA 5HFJA 3KALA 4LQLA 3II6X 1R9MA 1TUBB 3GXOA 1RQGA 3CW2A 1U2EA 3ANYB 3LC2O 1GV1A 1UWKA 2HOQA 2HU2A 1KGDA 3LCRA 4TMYA 2PKEA 5B2FA 1LWOA 3KXIA 1RI3A 4RPCA 4UCXA 2XA9A 2YX1A 2ZIVB 4B2PA 2DTXA 3K1ZA 4INAA 4LW8A 4PYQA 5T57A 4KPUA 1OXUA 4DXAA 4L8GA 4BZXA 3I9LA 3OZVA 5IDQA 1TCVA 5FJJA 2O8CA 3F5QA 3DBHB 4V0NA 3V1TC 4AJNA 4EHNA 3Q5GA 5B64A 5AW0A 3ANSA 2WMNB 4TLDA 4MW1A 5LIRA 1VE1A 4B17A 2ZYSA 1AKMA 2R8ZA 3QELB 1NNI1 3VTFA 3RUIA 2H1IA 2LRHA 2UZ1A 3JSAA 4ZAWA 2X15A 2UZ0A 1V37A 4UCWA 4AIIA 3O8CA 4P93A 1PGJA 5AKJA 3DV2A 5TLSA 2PX6A 1A9XA 1TKAA 3DDCA 4PS0A 5KQLA 2DT5A 2IPAB 3UXEA 1COWA 2CZQA 3DV9A 4DYDA 3E48A 1G66A 2R5WA 4JUIA 1BMFD 3GBSA 1NL3A 3ILHA 3R5JA 4L8VA 1ONSA 1CR0A 2JA1A 3A7DA 1MO3A 4ZPJA 4C5BA 3TGPA 4S12A 3ZCXA 4N54A 3L7DA 2AW3A 4UBOA 1T9GS 4AC9A 1LW7A 4OB8A 2JFHA 3ND8A 5SY9A 1V3VA 4DT1A 1QQ7A 5LYJA 3W3AA 4GWKA 2NOAA 5JTTA 1KYYA 1I6KA 1RZ3A 2ZJYA 3GBVA 4LKOA 1OPXA 2WWGA 4D81A 2XRZA 3QVKA 2AOVA 1G8GA 2R2GA 2XCIA 3H2JA 2F3SA 4Q01A 1GPNA 4Q16A 5BV2P 1MQ9A 1WE2A 5FULA 1RKXA 1REQA 5ERGB 5BR8B 1DXOA 4BUCA 3QBJA 3R6DA 3EVCA 4OL9A 3CCFA 3AR9A 2YS7A 3DO6A 1C9JA 1MABB 1KZ4A 1U5AA 2NQ8A 2XMPA 1TTQB 3DYIA 4UNPA 1H2XA 2XVMA 5C81A 1H8ED 5KSYA 1TVEA 4DARA 1A7UA 2DB3A 1P80A 2AXQA 3BH0A 1IHUA 2P9EA 2YTZA 3GIWA 4ZVQA 5TDHA 3ZZTA 3H5VA 4MRAA 3VUFA 1WXGA 4DADA 1HMPA 4WKBA 3HKBB 3AEKB 4BBAA 4KRXA 3O3OB 1FFYA 1R74A 1UWCA 1VA4A 3CRQA 4XXHA 4AO7A 3E35A 1B1AA 1T1GA 2H1OA 1WMFA 4HRYA 3JQFC 3IPRA 3NR2A 5TRTA 3R3HA 1UP7A 4E11A 4KHPB 1Y8ZA 2EJBA 3H2HA 2O8DB 3AR2A 4RU1A 5CYPA 1P1RA 1D4OA 2YWCA 4BYGA 5ESRA 5BOVA 1OWLA 1F5SA 3RAJA 5TMDA 1SK9A 3UGKA 4I4LA 4DLYA 1FNNA 2YUIA 3BSYA 3WICA 1YQDA 3RIXA 4H0NA 1AG9A 4XARA 2BDUA 2PWZA 4IFBA 5F9HA 5FTMA 3R3ZA 4CIBA 1XCMA 4NNOA 2BGNA 4MKIA 3T1HB 1OH6A 3H87A 3SZLA 4KI7A 3DDZX 3DDOA 3ICOA 1II8B 4GZ6A 2OB2A 2W11A 2WVJA 2ORED 3PXEA 1TEHA 2IOYA 4RXTA 3E9NA 3O2QB 3TG8A 1XNRB 4JT9A 4M7RA 1D2CA 1SVKA 4RF4A 4MKGA 4YAUA 3HM2A 3STVA 5C35A 2FPLA 2YMPA 5IUKC 2C7RA 4XPIA 1GO2A 3GELA 2XTZA 1D2MA 1CB0A 3R77A 1NXQA 5IC6A 6LDHA 4A10A 1WHTB 5DTJA 4BRSA 2QIOA 2XJ4A 4DV3B 1EKXA 1I2ZA 3T3HA 2HMTA 5DHRA 3WL8A 2C8KA 3KUKA 5HOEA 4KX5A 1W75A 3F6PA 4FSXA 3GJ0A 4WBNB 1IH8A 1DG9A 1OH8A 3N0WA 2ZUBA 3N9IA 3NHFA 1NBIA 4FKBA 2M6RA 4WNCA 2EX4A 1D07A 1RHRA 4P8RA 3DBRB 3CVUA 2A0UA 5F51A 3GFPA 2P35A 3IIMA 1XP8A 3OZAA 2ON6A 2UVDA 2VA9A 3QUAA 4GC5A 3CURA 4P98A 5TXGA 4A1OA 2GM5A 1H3NA 1LDMA 3B6KA 1JXQA 1JEOA 1SU7A 2XVZA 5SZKB 1R0LA 3A0RB 3ICQB 1N6HA 2OGTA 4N5LA 4YJGB 1NJ5A 3WYDA 1HQDA 1QZXA 2J6CA 4B6PA 4FYJA 3QMPA 5DMXA 2Q5EA 4M9XA 3QV2A 2KQUA 2P2NA 3RJ9A 2ONYA 2BFMA 3A4TA 3UV7A 1WJGA 3RTEA 4X65B 2D1RA 2WV9A 2CUZA 2EFJA 2ODEA 4IKPA 3RC2A 2C92A 3U6KA 1JEDA 3P2OA 4FE7A 3LUDA 3QJYA 5AI4A 4ARBA 1J00A 4DZRA 4E88A 5CBPA 5JG7A 4DNPA 2DY1A 1IC6A 3JWEA 1KAQA 3OVMA 4WN3A 1L5MA 1UANA 1XAJA 4TUYA 1G6HA 1ZK2A 1GG5A 1L7NA 3AP2A 4R9VA 4TKZA 5IMBA 3R74A 5CHEA 2ZYWX 4HX2A 3RRBA 4BFZA 1ISJA 2OPHA 5LD2B 5K45A 1BDHA 4FYPA