4JLMA

Human dck c4s-s74e mutant in complex with udp and the f2.3.1 inhibitor (2-[({5-ethyl-2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-1,3-thiazol-4-yl}methyl)sulfanyl]pyrimidine-4,6-diamine)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
242
structure length
233
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
publication title Structural characterization of new deoxycytidine kinase inhibitors rationalizes the affinity-determining moieties of the molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 233
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jlmA00
1OHHA 3PUWA 4P33A 3NG1A 1VTKA 1SVKA 3FPAA 5F2EA 5KPJA 2XGJA 4RJLA 1VG0B 2V7QD 3AV0B 2ONKA 5DIFA 2WKPA 1T8UA 4PHTA 5KPDA 4YMWA 2YOFA 4BZQA 3ZVMA 3M6AA 4RCYA 4W5JA 5EE9A 1KY2A 1A2BA 4E09A 4UNSA 1UEIA 2WAXA 4OI2A 1ZM3A 2HDNB 3HWSA 4JLBA 4JLDA 4CVNA 1QHIA 1C9KA 1DE0A 4IVQA 4B43A 4MKFA 1EFRA 1G7CA 1I2DA 2JJ1D 4LJ4A 1G20E 4ESHA 4NCKA 2WJIA 3F8TA 4D4LA 4LV8B 4MYTA 4IKEA 2GBLC 4BLOA 4NMMA 4BLSA 2D06A 2H92A 1HEIA 3BH7A 3MWLA 1KDOA 1YQTA 2XSZA 3EC2A 3QG1A 1C1YA 3H0KA 1KI8A 4NCIA 1G5TA 5G41A 4PX9A 5SZHB 5DI3A 4A0GA 3ZD6A 1DAFA 1CRPA 4ZI2A 2VIIA 5D3MA 2WAYA 2NPFA 3PEVA 3FFBA 4Z54A 4X8LA 1Z5ZA 4IFEA 2ZJZA 3L82B 1T6NA 3O47A 1M7BA 3QXSA 1NJGA 5TV2A 2OT3B 1Z28A 3TJZA 3K0CC 4HAUA 4QJ3A 1AS2A 2V7QA 3LBIA 1F2UB 2DYKA 1GWNA 1DAIA 1E9AA 2J46A 2GAOA 2RGAA 4EPYA 1MH1A 1Z2CA 4A8JA 1QG2A 4HDOB 4OQLA 4DLXA 1PUJA 3OIVA 1C4OA 2CJWA 1T5IA 4Q1EA 1NVXQ 1F60A 3OIYA 2FSGA 2C03A 5BYKA 1GRRA 3RC8A 4YMUA 1V5WA 1KK3A 2JJ1A 4US2R 2BKEA 2Z0MA 2J0UB 2UKDA 2AL7A 3EZ7A 4TLCA 1OFHA 2OCBA 1DG3A 4DCUA 1RRFA 2A3RA 2WJVA 4TMWA 2CNWD 4WBSA 3RSOA 4FWIB 1Q0UA 3KKMA 2FPMA 1GKUB 1ZUNB 1N5IA 1RJ9B 2IF2A 2XAUA 3EZ9A 3I8XA 1TQ2A 2Y8EA 3VU9A 2ZRPA 1MT0A 3VX4A 2REBA 1G41A 1O87A 2ZSFA 4K8OA 2YYZA 2J0QA 1VHTA 3UKDA 4YMTA 2BM1A 3FMIA 1FOEB 2VHQA 2ZRJA 4HAVA 5KSZA 1OH7A 1GIAA 2PX3A 2R6AA 5GJCA 2DFLA 3ZZ0A 4URYR 3KKOA 2QM7A 4O2RA 6Q21A 1LF5A 1NBME 2IW3A 2ASEA 5BYJA 2WIBA 4MRSA 4AC9A 2X2FA 1CS4C 3BJIC 1GNRA 1T91A 2ZPTX 3LBHA 3ZVLA 2QENA 4ZPXA 1I4TD 2D7CA 1DAKA 3RHFA 3R9IA 3UMRA 2VP2A 5FR2A 3A1TA 1N5KA 2J7KA 3NVAA 4CT5A 3MWYW 4MRPA 4IJMA 4PC2A 3FVQA 4EJSA 1Z29A 1NY6A 4HZUA 1Z07A 1LVGA 1TF5A 2BC9A 2Q3HA 3QI2A 1NLYA 3CF2A 3LXRA 1ESMA 1R5BA 4QFMA 3SJBA 1AZSC 1NVWQ 5JEDA 3L8ZA 4Q19A 2AD1A 2WJYA 4F4IA 3SZRA 2ZE5A 2CNWA 2ZUBA 4MGKR 4DDVA 1DAMA 2ORIA 3RWMB 3HPRA 1VYUA 3LLMA 4OI0A 2ATVA 3PVSA 4HUQB 1E2DA 4YMVA 2BJVA 3MUFA 5AJYA 5D3MB 4BLRA 1FNMA 2ZEJA 2ZI7A 3CRVA 4M9ZA 1XCGB 5JS8A 3QOFA 1S0UA 2B8WA 3T61A 2G0NA 3U4QB 2FX3A 1AS3A 4IVRA 5DYIA 2FFAA 4G3XA 2IYZA 4IXNA 2P0EA 1Z0KA 1IOZA 3LH5A 2XXAB 3U6BA 1F48A 3B85A 3EPHA 1JEEA 4LC0A 4LSGA 2JA1A 3IGFA 2KBEA 1K5DA 3TLXA 1FW6A 3N5CA 1N6IA 1G3QA 4PPQA 4KITB 4B75A 4LHWA 1G3MA 1Q44A 4RVCA 2RHDA 3EZFA 1OH8A 1N6LA 3DKPA 1KI1A 1FPMA 4HLQB 2BCGY 1Z8FA 2CJWB 821PA 4Q9KA 1ZAKA 2OBNA 1E99A 1S3SA 2KBFA 2ECKA 4EQ6B 2VHTA 4D2IA 2OE2A 2L0XA 3OEHD 4GP7A 3ZDQA 2CLDX 1OFTA 1CLUA 2PBRA 2VPPA 2KB0A 4TYWA 3ADBA 1WA5A 1DAHA 4Q7MB 5JJIA 1KMHA 4PPGA 2O0KA 3WP0A 3V9PA 2DBYA 3CRMA 1ZMXA 3A36A 1IXRC 1IAQA 1KZGB 2EYQA 4ILEA 5AJVB 1KTVA 2P3SA 5FUVA 3CLVA 3RS7A 4NTZA 2FWRA 4E22A 1XEWY 2ZRCA 4QBHA 1CJMA 2E87A 1XJCA 4GPTA 1VECA 4UJ5A 3W3ZB 3VTKA 4OK5A 2GEVA 1WQ1R 3VU9B 1Z22A 3ZVRA 3LW8A 4G5OA 1XU4A 2XZOA 4GMXA 3SBDA 4C2TA 1XMSA 2QPAA 1ZP6A 2ZYTX 1XEWX 3GQBA 3OAAD 4QHSA 3TAUA 3VQTA 5TDHA 3BK7A 2NO7A 5GVSA 5L3SA 2GVZC 5KU1A 3AF3A 1PVOA 4DCSA 3QXHA 4EPRA 3T5DA 5JZVA 3WNDA 1Q21A 2EW1A 3CF6R 3V00A 3AM1A 2IYYA 1II9A 1R10A 3QQ5A 3WHLA 4K81B 1VCOA 2PMDA 3W8RA 3VNUA 1XBTA 4XOIA 1XEXA 2BMEA 4QBGB 2YINC 5JJLA 2OCPA 4XD7D 1Z08A 3C16C 3OZXA 4JLAA 4TLEA 2CE7A 3P4YA 1UKEA 4EPVA 3GLIE 2GCNA 4EJSB 2CHVA 3OEHA 3KQNA 1XJ0A 4MKHA 2PT7A 3IHWA 3SU8A 2IS6A 3DHWC 1YVDA 1Q12A 5FUXA 3SFZA 2J0SA 2QT1A 1NIPA 4TMTA 3T12A 4DEXA 4KU4A 3W9YA 2Z4RA 4QM7A 2IK8A 4HLDA 2A9KA 4MITA 1H8HD 4L4UA 5G53C 4BLQA 4A0FA 2VBCA 2IA5A 4LOAA 2VP6A 3PG5A 4QKQA 3W6NA 5AJZA 3BH0A 2ZI4A 1MO6A 3P26A 3RWOA 1PZNA 4U02A 4QG7A 2OBLA 2A5FA 3DEFA 3NHAA 1LS1A 2ORWA 1E3MA 3TVDA 3U2QA 3OAAA 4OQFA 3G5UA 4IDPA 1JALA 4PSVA 2XX3A 2VF8A 1I4LD 4DHEA 2C99A 3SHWA 1TEXA 3GFPA 1TQDA 4OQXA 3W5JA 2QQEA 4D26A 4BFWA 1UPTA 3H1TA 1M6NA 2RGBA 1EXMA 1HE8B 5BWMA 2P65A 1RRPA 1D2EA 1NMZA 2GDJA 2VSXA 3MJRA 4M22A 3W6OA 4BFYA 4IOJA 3T1OA 3L0IB 3U5ZB 4HB0A 4RKEA 5CDFA 4RD4A 5CIQA 421PA 4Q4JB 1AZTA 2OAQ1 4XD7A 2C95A 2JJ2D 4QHYA 1E0AA 3LV8A 2QBYA 3CH5A 4A82A 4DIDA 5C46F 2JCSA 1E2LA 3KX2A 1N3BA 3KQUA 2QP9X 3CNOA 4QRHA 1KDRA 3DZDA 1ZM4A 4XWKA 2BKUA 3U3RA 1KMHB 4LZZA 4B2LA 3RAPR 5A5GA 2W0MA 4LJ7A 1OF1A 5TY0A 3KUCA 1H8HA 4MGIR 4FCVA 5AWFC 4OBEA 4KFSA 1RW4A 3NIBA 2JDID 2RGEA 5J4HA 2GCPA 3QKRB 4NL4H 5EXSA 1NN5A 3CO5A 4W5WA 5EE0A 3C7KA 5J47A 4A2PA 3BXZA 2FF7A 4ESVA 3K09A 4B2IA 1GVNB 2XTNA 4DCNA 5DN6D 2YNMA 3CWZA 5EP1A 4HYYA 1UBEA 2BJWA 2QPTA 3SJAA 1CRQA 2RHMA 2HYIC 1IN7A 4V0NA 3X1YA 2WJGA 2CEAA 2J3EA 4C4PA 1RIFA 2WWGA 4ARZB 5P21A 5AK0A 2EU8A 4KSCA 3JVVA 3KFVA 1IN4A 1CTQA 4HI0E 2EVWX 2QAGA 4DLZA 3IEUA 2RGNC 3C5CA 4B2PA 1CJTC 3TK1A 1AM4D 1D2NA 2ZS9A 5KYKA 2JJ2A 5GVRA 4AWXA 4WXPA 1WDTA 2PH1A 3AF0A 1QHNA 1DG1G 2VP9A 4KBFA 1YR6A 3KZ1E 2FGJA 2BM0A 1Z6YA 1G7SA 4TLDA 4Q9IA 2HJVA 5C18A 5EQTA 5AR1A 1G1MA 1XTSA 4B35A 1QHGA 1Z0FA 4G5RA 1DADA 3SS8A 2CDNA 4H1VA 4YDSA 1OXUA 1VIAA 3B2EA 4TTRA 1TX4B 1U0JA 1Y63A 4ERNA 4DDWA 1JPJA 2JDIA 1UEJA 1Z6XA 3EIEA 3FHCB 3R8FA 1J99A 5DE3A 4A2WA 3VKWA 5DO9A 5FL3A 2W0SA 4V0OA 1KAOA 1XD8A 3FMOB 5B58C 1OH6A 3QXXA 4D4MA 2B92A 5DN6A 1YRAA 1RRGA 4DSNA 2NQ2C 1SKYE 3SEAA 4EPWA 2PMKA 3R9WA 2O8CA 1BMFD 1VG9B 4BFUA 3BFXA 4PHFA 1X3SA 3CR7A 1GAJA 4TYNA 2AR7A 4A15A 1KNQA 1ODFA 4HEJA 4ZO4A 2BBOA 2QTFA 2J59A 1AQYA 4UKDA 5J4KA 3U6KA 4DVGA 2W2VA 3FOZA 1NMYA 1UBFA 4A4DA 1E2FA 3SR0A 4XVUA 4QHTA 2ZAMA 2Z6VA 2CVFA 2ZUDA 4J0QA 4JLKA 5TB5A 4BLTA 4KSBA 2J5XA 3AKDA 3KXKA 1IJEA 4A36A 4HATA 3WRXC 5JSZB 2XTMA 4Q02A 1P73A 2DR3A 1OV4A 1NF3A 1COWD 5UKDA 4A92A 4DT1A 4CEIA 2CCJA 2VP4A 3TW4A 1XZPA 3RLFA 4D0GA 3AUYA 1GL9B 3D8BA 4R71A 1BIFA 2DPXA 3CF0A 3K0EA 2HJGA 2GKSA 3THWB 1XXHB 5B2ZA 5KNDA 5A0FA 2ERYA 4LV6A 5CIWA 3ZVNA 5K8LA 1E0KA 1GRQA 4LV5B 1X8KA 3N2EA 1I4DD 3WNCA 8OHMA 2VHUA 5IF9A 1E9FA 1XXHE 1AGRA 4G5QA 4D81A 2OCYC 4PSAA 1JI0A 3ND8A 3RS2A 5BW8A 3PUVA 4LY6A 2JLWA 3WYFA 1IN6A 1UKYA 4LYAA 2X77A 2P5SA 2OLJA 2JJ8A 1V43A 4E07A 1BMFA 4KYUA 3A1SA 2V6IA 2JLQA 4OHWA 2ZJYA 3CX6A 1E9RA 5J40A 4B6FA 4URUR 5KSYA 4DZZA 3TMKA 2IS2A 1E2IA 3IDQA 4PQFA 3MWJA 3DVLA 4M1WA 3VR5A 2V4ZA 4ZKDA 3A8TA 2QAGB 1RKBA 1UDWA 3MAAC 1GFIA 2NGRA 1L7VC 2GF0A 5JJKA 1AJEA 1B23P 4MRVA 3DDCA 4QGHA 4Q66C 3AQ4A 2PL3A 4JVSB 1TTTA 4JLOA 1WBDA 4KV9A 1COWA 5DH9A 3W90A 2ZXUA 2HCJB 3AF1A 4WW0A 1N2CE 3B8HA 5CJ2A 4Q03A 1KSFX 1Z3IX 1JR6A 4P31A 5FTKA 4GMDA 4DCVA 1FFHA 2RMKA 2WIAA 5H1YA 1NSTA 4NYMQ 4KYIB 4WZAE 2R6GA 1F2TB 4F4JA 2XZLA 2WWWA 3Q9LA 2GXUA 1N6PA 4DLWA 2OILA 3MSXA 4N1AA 1OYWA 4ASUD 4F38A 4AYTA 3K0AA 1XD2A 3TKLA 4NH0A 5EZ6B 1P2UA 2HT6A 1N0UA 3VHXA 3KTAA 4PO8A 3O8BA 2LKCA 1U98A 1G18A 4FMBB 4MA4A 3SFVA 3H86A 4ZI3A 4Z8YA 3HU3A 2Q9BA 2BBWA 2XB2A 1N25A 3HPQA 3ZH9B 4M9XA 4AURA 1P9WA 2A5JA 3VR1A 2AFHE 2LKDA 5SZIA 2B6HA 3O8RA 1KKMA 2QEQA 5L8VA 1JQLB 4PO9A 4US1R 1G17A 3H2YA 4M21A 3FKSD 3VR2A 2V8OA 1E0JA 1P6XA 1OJLA 1FQKA 1CJVC 2O8BA 3WMFA 2QORA 2W2XA 1ZNWA 1B0UA 4DLUA 2WSSD 4LHYA 3ZZUA 1A82A 2W2TA 5JFGA 5KUTA 4GOXA 4DT1B 3ZYCA 2XJ4A 4Z1MD 3VHLB 5KNCA 3LXXA 3MRSA 2H57A 4MRRA 1XEFA 2FN4A 1YZTA 4LBWA 1Q1BA 2E1RA 4MGYR 4OKSA 5FTJA 3QF4B 4Q4AB 1F3OA 3K70D 4MYHA 5FOVA 4HDQB 4AIIA 1HV8A 2GWHA 4ASUA 3EPKA 3HJNA 2QE7D 5ELXA 1NG9A 2IYXA 4RD2A 5FUYA 4DLYA 2DWQA 1R2QA 4L5BA 3DOEA 4FINA 1CR0A 4IRUB 1HURA 1NN3A 2CMKA 5LDDC 3CR8A 1W0JD 1VYVA 1GZSA 2G0TA 4PHGA 5AUOB 1XCMA 1GNPA 4P4UA 5IRCD 4IDNA 4XTRA 1SULA 4BGDA 2JLUA 2MSEB 4WA7A 4C0QC 2G77B 2W58A 621PA 5SZJA 1BOFA 2FV8A 3FKSA 1R8QA 1UM8A 4QGFA 3T1VA 2VL7A 2R8RA 2YV5A 2I1QA 4PPFA 2WPDD 3K09C 2NTYC 1CR1A 4HB4A 3I5YA 1U90A 2WSSA 2ZE6A 3QVVA 3GJXC 3P27A 1UF9A 4X8HA 4PXAA 3JVUA 2OAP1 4MDEA 2GCOA 2IYLD 2JIZD 4AYWA 3PIRA 3OEED 5ANRB 4Z1MA 1U9IA 4NZYA 2BWJA 1A5TA 1N0WA 4UNNA 4BWYA 2GRJA 2MMCA 4RZ3A 1JBKA 1KI6B 2IXEA 2EQBA 2VH5R 1KI7A 3GJ6A 4UXIA 2DFNA 3U3MA 2MSCB 2XNSA 4AKEA 2WWIA 1NLZA 2C04A 5JECA 4EPTA 2ZSEA 5BN4A 5KHOC 4QM6A 2G1KA 2OHFA 3S1AA 2QE7A 1G64A 4MRNA 1S9DA 3K0AB 1NJFA 1ETUA 1Z83A 3ND9A 3EW9A 3AVVA 1IQPA 3VR3A 3THXA 4ZV4A 1GP2A 2Z43A 3A1WA 4LYFA 1Z6TA 3NBZC 1U99A 1W0JA 3FMFA 1WRBA 3IEVA 2EFCB 3OE7D 4V0KA 3REGA 2AKYA 3D7MA 3TBKA 2WKQA 1ZW6A 2AN9A 5EUMA 1SXJD 2QROA 1YZGA 2AX4A 2QMUA 1E79D 1F6BA 2XOKD 3IIMA 1IONA 1QBKC 3THYB 1SKQA 3B82A 4TQ9A 1T0JB 1BS1A 1MOZA 1DELA 4BZXA 4F92B 4JLVA 1AKYA 5CJPA 1G4UR 2YOHA 4JLJA 1CIPA 4I1OA 1E9DA 4PQRA 2WPDA 2CXXA 3SOPA 1US8B 2GILA 3AVPA 2YWGA 1IY0A 1DOAA 1FMLA 3ASZA 1KAGA 2C9CA 4HLCA 4NYMR 4DC9A 4D82A 2JIZA 3OEEA 1VCNA 1S3GA 3CZQA 2OSBA 1XTIA 3LLUA 1NN0A 2ZRBA 2SHKA 4MKIA 3FWYA 4P4SA 5LB2A 2PCJA 3QKSB 3VR4A 4F93B 3GLFA 5HKKD 3KL4A 1DTSA 4A6XA 4V0MA 4TL8A 5J4VA 2RCNA 3AVTA 3I62A 1TMKA 1OIWA 3BB3A 1G5PA 3F0TA 4PFSA 2YC2C 3B1ZA 1E2KA 4BRWA 2ANCA 2I3BA 4WOPA 4JSTA 1BYIA 1NG1A 2AHOA 2ZUCA 1VG1A 2DB3A 4AI6A 3GLGA 3OE7A 1HH4A 1SXJA 1E79A 2XOKA 2ZRFA 4HAZA 4OQMA 4RZ2A 3TSOA 4HZIA 3AP2A 4L15A 3VR6A 2EFGA 1VCMA 3QEJA 1GSIA 1Z47A 2F1IA 2GAAA 4WZBE 1MABA 1FZQA 5CK4A 4UXJA 1XDBA 2QU8A 3OIWA 4GNKA 2FFQA 1U0HC 2X8AA 5AUPB 3A58B 1Q20A 2ODEA 1JR3D 3CM0A 1Q1ZA 2WWXA 2H1LA 2QG6A 3HU1A 4FN5A 5EE1A 4L16A 2QGNA 2XTZA 2WICA 3AUXA 1W0KD 2W00A 3LW7A 4IOKA 1KY3A 3CBQA 2AXNA 5HCIA 3CW2A 1E9SA 4JYCA 4CW7A 1E98A 3BWDD 3GP8A 2AD5A 3X1DA 4C3ZA 1ZCAA 2C9OA 2QSZA 1LV7A 4ACBA 4KFRA 4KXFB 2CLSA 3PCRB 5HKKA 4CIDA 3RABA 1NKSA 4JSYA 2ZSDA 3K70B 4JIMA 1AKEA 1KO4A 1SHKA 1EG7A 4FI3C 4Q47A 2QN6A 4II7A 3QXJA 2ZR0A 1IXSB 4GP6A 4EUNA 3S1AB 3GMTA 2WV9A 5JEEA 4BPBA 2DHRA 2IXFA 1YHNA 1DAEA 1YR7A 1LNZA 3NKVA 3OIUA 1KO7A 3SN6A 3T06B 5JCZA 1VIYA 3NH9A 1BKDR 2V1UA 3Q7QA 1OLOA 3QNUA 1NVUQ 4JZKA 4A0HA 4CT4B 2A5DA 3LAWA 3ZJYA 5DI3B 2ZREA 1KNXA 2WJHA 5EP3A 2P2LA 4QJ5A 2E9SA 1TADA 2YWEA 3U3JA 5LD2B 4B47A 4HLUC 2QRNA 4B32A 1LF0A 4NCJA 5G3ZA 1JR3A 1GTVA 3CNNA 4I1UA 5FFMA 5CB6A 3I3SR 5DSZA 5FPYA 3PUXA 1W0KA 2VSFA 3NTUA 3C4JA 2GJ8A 1TPZA 3MG9A 1ZNXA 5FOUA 3HU2A 5K8UA 1NIJA 1MKYA 2F3TA 2ZJOA 2IXGA 4MGZR 5DHAA 1DAGA 3DKVA 2XNDD 3TE6A 1E1QD 1MV5A 3PUZA 4RD1A 1QZXA 4BFZA 4A8JB 1CR4A 2Q9AA 5EE5B 2IYTA 5KO2A 5C4MA 1KDTA 2H17A 1XPUA 4ZDWA 2WZQA 1W4BA 2NMVA 4ON9A 4U7DA 2NIPA 3BC1A 4DLVA 3WNBA 1QHSA 4OI1A 1TAGA 2PEYA 3IO3A 4L8GA 3KQHA 2ZJ5A 1W1WA 1ZD8A 1R0XA 4PC3A 1WF3A 4C0LA 1SVMA 5TARA 4TMZA 1G8FA 4XTCS 1Z63A 1XCPA 1Q22A 1YZQA 1RE0A 2EFHB 4W9MC 1MRNA 1NRJB 3HDTA 4KBGA 2I1VB 2BOVA 2O0JA 3GLGB 1E32A 5JHHB 3W3AA 4DLRA 3I72A 4FXPA 4EKDA 4LJYA 2WHXA 1JECA 3NBXX 4PHHA 3GLGE 3U60B 1P62B 2O8EA 3TAHA 3CPHA 3E5HA 1MABB 3AH8A 1IM2A 3ZGXA 4QL3A 4C0SA 1E94E 4BFXA 2Z83A 3IQXA 1J90A 1L8QA 4OJKA 2GEUA 3P32A 2F3RA 1JPNA 5HTKA 4DSUA 2ZYWX 4Q18A 1S96A 1GRNA 2X1VA 5HR5A 2GETA 2PLRA 2WOOA 1OW3B 1XFAA 1ZJ6A 1KK1A 3Q5DA 2XNDA 3K0SA 1E1QA 1ZM7A 2RKOA 4B3BA 4POAA 2CL7X 4D6PA 2ZRIA 1E9BA 1J8YF 4PC6A 4TT3D 1YR9A 5JCPA 3TH5A 1Y3AA 1VG8A 2P6NA 1FQJA 4HZUB 4LYHA 4BECA 2BVNA 2VF7A 4LYJA 1Q1EA 3GLHA 1KO5A 4TSFD 2OEPA 5SZKB 4HAYA 1TUEA 1X1RA 2XZPA 4BEJA 2UVQA 3QJYA 2FSFA 2FNAA 4Q1FA 1L2TA 1E2QA 4RKFA 4YLGA 2EYUA 1AS0A 3QY0A 1KGDA 3KDSE 2IYUA 4HB3A 4JLNA 3QKTA 4OK6A 4QJ4A 1F5NA 3GPLA 1OE0A 2JLYA 1HUQA 2QM8A 3OF5A 3SBEA 5CYOA 4HAXA 3UXMA 5J4LA 1IBRA 4BQSA 3BH6A 4B34A 2ZANA 1KI2A 3EAQA 5KOYA 2UZIR 2GF9A 3ETLA 1XNJA 1P5ZB 3A37A 3K70C 5JWHA 2ZE8A 1XMVA 3ZQJA 3T34A 1EFTA 2HXYA 2IYSA 3RRNA 3AP1A 1FMJA 4JVNA 4D0LB 1CF4A 2XB4A 2ZSBA 4AK9A 3AKCA 1X1SA 1HTWA 1CEEA 3CPEA 5F9HA 3IIKA 2JEOA 1XTJA 2QNRA 3AKEA 1Z0IA 2VEDA 4PPNA 3WHKA 2QTVB 1X86B 2G9NA 5KSOA 3JZMA 4XH9B 4TT3A 3AB3A 2R9VA 1M8PA 4G5GA 2ZI6A 3IPYA 521PA 5L3VA 2WBLC 4QBFA 1EFHA 1R5NA 1S9HA 2IYVA 1XTRA 3K9GA 1M1YE 5JI3E 5LD2C 2PCLA 4G0NA 3ZLJA 2IBMA 4TSFA 2B8TA 3SYLA 4EFMA 1AN0A 4L9SA 2IT1A 4Q48A 4TYQA 2WSMA 4N0DA 1EESA 4US0R 1Q3HA 1UJ2A 3GJ8A 5C1BA 3KXLA 2W83A 2IX3A 1G5RA 2YZ2A 2REXB 5FI1B 4W7SA 1LFDB 4HB2A 3B7GA 1II8A 2PZEA 3M1IA 4R2HA 2VHCA 1ZM9A 2ZU6A 4ZDIA 3WXMA 1Z06A 1R0ZA 2GJSA 4PZZA 4A8JC 3OESA 3LFUA 4HSEA 3D6TB 2IC5A 1XZQA 4F91B 2J87A 2HT1A 2GVDC 3EC1A 1D8TA 3V4RA 5FH9A 3K9HA 4K46A 3E70C 4Q9LA 1T9HA 3K8YA 5L3SB 1RRCA 2IEZA 3T15A 2OXRA 4MKGA 1VYTA 1LB1B 3EIHA 2IWHA 1XP8A 2J0VA 3SDZA 3CZPA 4TL6A 3QG5A 2F1JA 5GJBA 3EA0A 5G3YA 3RRZA 2Z5FA 4AG6A 2ZRKA 1Z6AA 3FHTA 1XEXB 3V4FA 4PZLA 1T3HA 2ZE7A 4GOJA 1EX6A 4JS0A 3RRMA 1SZPA 4Q7JB 3R20A 1G8YA 3SJCA 2GXQA 1W48A 3R9XA 2K5UA 1R5OA 2BEJA 3ZS8A 4MDFA 1W46A 3RRYA 3TRFA 1U94A 3REFA 3EXAA 2QAJA 4GI7A 2CBZA 3PQCA 5CK5A 3TR5A 2O8DA 1A1VA 4GT1A 4XVQA 3CIOA 3OFND 2D2FA 3THOA 2RAPA 1E0SA 3L8YA 2AK3A 4PTLA 1A2KC 3GJ7A 1JJVA 3WP1B 3AVWA 3L0PA 1GL7A 2ORVA 1QHYA 3IHLA 1E2GA 2FGKA 4OYHA 1ZINA 2GA8A 2H7VA 4DJTA 2PJRA 2ZS7A 4Q4HA 1FNNA 1XTQA 2D62A 2BMJA 1WE2A 5KDLA 3KKNA 1PLJA 4CF7A 1WB9A 4NONA 1P2TA 4EJSC 1SVSA 3RVBA 4BEBA 4TZ6A 3EARA 4TL9A 3GJ5A 2OFOA 4DB4A 1D2MA 4D25A 2QTHA 3CRRA 1P2VA 2W6ID 4NKRA 1VMAA 3K0FA 4LDJA 5HZHA 1W2GA 2C77A 1Z0JA 2ZQ5A 4TYPA 3SQWA 4FW9A 3K0CA 1CR2A 1GNQA 1UBCA 4IOMA 4NCNA 2C96A 3Q3JB 1OIXA 1UDXA 1GM5A 2ONJA 1CXZA 3FTQA 1G3IA 4BUJA 4BE7B 1E1RD 5JBQA 5JRJA 1BH2A 2QBYB 1ZU5A 3DMNA 4FMCB 4TMXA 5CDFE 2YWFA 2Q0HA 2D3WA 1NN1A 4ZKEA 4PR0A 4RFSA 3U3OA 4D4KA 3ADCA 1ZNZA 1G6HA 4OHZA 4RSGA 1XX6A 2FH5B 3OFNA 3PFIA 4KHZA 5EUQB 1G19A 3NH6A 3M0EA 3HR8A 1TF2A 3SI7A 4D80A 5DHFA 1DVRA 1II8B 3PEYA 1JAHA 4UNRA 1YKSA 2YJTD 3Q8XB 1MO4A 2IUUA 1OFIA 1L4YA 3R7WA 3TVTA 3TQFA 1NP6A 4OHXA 1W5SA 2A78A 4FMDB 5FBWB 3KKQA 4TMKA 2A2ZA 4L9WA 2ERXA 4C7OA 2P6RA 4LJ8A 3ADDA 4QNMA 2HXSA 2QGZA 1LY1A 2ZU0C 4TLBA 3U7FB 5JWRA 4QXAA 3U7EB 2IUTA 4X8MA 2W6IA 4DRZA 4QGAA 4C0AC 3NXSA 3EPJA 1PV4A 2DY1A 5FPHA 3BERA 4WXRA 2FJUA 2QMHA 2FEOA 1OXSC 2CK3D 3LQQA 2F1RA 4ZCMA 4KJZA 2FOLA 1G3RA 5JRZA 1Z6GA 2FPKA 1HE1C 1E1RA 1DARA 4CEJA 3LX8A 1CJUC 3C14C 1N6RA 1RFLA 4UXHA 3NBYC 1W44A 3I92A 2O8DB 3QEOA 3AKYA 4LHVA 4BFSA 1JJ7A 4QC2A 1VDZA 1P3JA 3FMPB 4B71A 2OLKA 4U5XA 1R4AA 3ASYA 4Q21A 1J2JA 2HUPA 2QL6A 2RB4A 4Q4HB 2OESA 4KFTA 5DI9A 3LA6A 1PUIA 1VKJA 4H1UA 1ZUHA 4Q7LA 2IS4A 2P67A 4ZIRA 1GUAA 1DPFA 3PUYA 4MUAA 1UFQA 2V3CC 1E69A 2VHJA 2O8CB 4Q4LA 4UNPA 3PEUA 4NE2A 4UNQA 3SE0A 2BHRA 5A4JA 4LPKA 1I2MA 3BOSA 3QPWA 4Q1DA 4CRWB 1HT1E 2N1BA 4LJ6A 3AEZA 1S4QA 1OB5A 3K1JA 3X1ZA 5K8IA 2CK3A 3AP3A 4O25A 2ZI5A 4XWAA 1FUKA 5KDDA 1AGPA 4JKIA 4GZMA 3J81k 1P75A 1KSJA 2R44A 3RS0A 3HR7A 2V54A 4OHYA 4PAOA 2G88A 4URZR 2IL1A 3PJRA 3DO6A 4DLTA 2ZRGA 4B3FX 4CEIB 3RYTC 4KO8A 3GEIA 2H16A 4B74A 4ZDJA 4MYCA 2B21A 1T0HB 3ONWA 1CU1A 1NBMD 2DFKB 3FGNA 3I32A 1XWIA 1QDEA 3GD7A 4P32A 5AJXA 4XSHA 4A6PA 3VNVA 2D2EA 3CUEF 1RPZA 3NWJA 5BQ5A 5TMPA 3A4LA 1H8ED 3AF2A 3AF4A 1RYHA 4A0RA 4BFVA 3ZQ6A 4C7OB 4DWJA 1TU3A 1G16A 2OFXA 1KIMA 4JJZA 5EXXA 3WBJA 1ONBA 3KQLA 4R98A 3C41J 1ZBDA 3SYKA 5JLJA 2CL0X 2HF9A 2OV2A 1U8ZA 3UATA 3QKUA 4O0MA 3NDBB 2J7PD 4M53A 2J0UA 1U8YA 3X1XA 4E03A 4JYBA 5CITA 4WVFA 4DKXA 4NPHA 2GXSA 1UBGA 3CB4A 3T5GA 3O8CA 4GDFA 5C2JB 1K5GA 1OT3A 121PA 1E9EA 3MCAA 1FUUA 1E2JA 1RJ9A 3LQRA 2F7SA 1M34E 5FOWA 4NHOA 3IUYA 3KB1A 4RFVA 4M4SA 1NBMA 5CLLA 2KE5A 4O3MA 3I73A 3U44A 1W4CA 2ZRMA 2ODWA 4LK2A 3LO5A 1EWQA 4IEIA 1Z2AA 1KJYA 2P6UA 1X8JA 3Q72A 2QAGC 1OPXA 4UJ3A 5DISB 1E2PA 1H8EA 4N3NA 4RD0A 1NSFA 2GNOA 3FDIA 3MLEA 2FDCA 4LJAA 1XD2B 1E2MA 4KCGA 3DZ8A 4D4JA 4G01B 2YOGA 1OB2A 4OL0A 3KTAB 4ZIRB 1TU4A 1ZCBA 2Q21A 2Z4SA 3NC1C 1D5CA 3PR1A 5EZ5A 2WWHA 2YWHA 1KI3A 5H70A 4TN1A 1YE8A 3QXCA 1E96A 3AVYA 2ZTSA 4TWZA 2G6BA 2J7PA 3VFDA 2OFWA 3H4MA 1AK2A 4JKYA 4OQNA 1ZRHA 2ZAOA 4DUGD 4GL2A 4Q1AA 2IF0A 1VHLA 2GZDA 2ZR7A 3BD9A 3CH4B 3GJ4A 4LGMA 4MQBA 1ELOA 4LHZA 2J41A 3K9LA 3IBGA 4PQYA 2O8BB 3UANA 2C2HA 2C9YA 3CX7A 1EFCA 2ZM5A 3TGPA 221PA 4HUQA 1GKIA 3GEHA 5FPSA 4BZPA 3A1VA 3TSWA 2OO7A 1ZM2A 3B9QA 4YDHB 3RNLA 4KVAA 2R2AA 3UWOA 4KODA 2KWIA 3UG6A 4B3GA 3BIFA 2AKAB 3U4QA 5HE9A 1O3YA 3R8CA 2ZETA 2XXAA 2CHGA 2C8VA 1G8HA 4NYIQ 3PXGA 4M1KA 4Q5IA 4KFUA 4OI4A 3L0SA 1JAIA 1II0A 1KSGA 1ESNA 2QY9A 4JVLA 3RS3A 2WWYA 3EPLA 2KSQA 2JLXA 3B1YA 1KI9A 4P0TA 2MMGA 1YU9A 1M7GA 2AFIE 4XJXA 4B3CA 2VYFA 1HY3A 4E5UA 3TIFA 5BN3A 3I61A 2ZJ2A 1IJFA 5EE3A 4V0LA 4EQ6A 2F9MA 4NP6A 2ANBA 1IN8A 2YVUA 3I8SA 3MWKA 4IDQA 2ZRDA 5TXGA 4MYUA 4IFBA 3LX5A 4GOKA 1ZUIA 2DWOA 1J7KA 4DUGA 4AY2A 1FTSA 4DLSA 3MMPA 5CM8B 1VPLA 1T8TA 3KQKA 1M74A 2G1JA 5E95A 4EFLA 2R62A 5B30A 2RGNA 3T35A 2ZS8A 2CL6X 1S1CA 2B7BA 2ZVPX 5FTNA 5FUWA 5KNBA 1KZ7B 4QOSA 2H5EA 5BXQC 2QI9C 2GCOB 3RS5A 3A1UA 4KLZA 4M1MA 3E1SA 1T5LA 3KJEA 1JXOA 3MJHA 5BN5A 2BIFA 4P3YA 4CGZA 2ZI3A 3U44B 3UG7A 2R6CA 1KSHA 2HYDA 4XIGS 1GITA 2Q3FA 4W5HA 4BRUA 1BYUA 2GHIA 3P20A 3TUZC 721PA 1IHUA 3AVXA 3VKGA 1TF7A 5FOTA 4JVMA 4B33A 3GLIA 3B60A 3GEEA 3VKHA 2RGDA 4DDTA 5HPYB 4BFTA 3THXB 2FZ4A 2LWIA 2IYQA 4S35A 3WYAA 4PAMA 2VP0A 4DIEA 3P1JA 3FYHA 4V03A 3AVOA 2V1XA 5F98A 1MO5A 3TR0A 2EFDB 1ZNYA 1J8MF 5DYGA 5F3WB 1T4GA 5L3RA 4TLAA 2ZRHA 3HYTA 4B3DA 1D6JA 5AJWA 4YONB 3NDPA 1XPOA 4LJ9A 4URWR 3Q85A 2V9PA 5G40A 4AG5A 4F7WA 4TL7A 4RD3A 1KJZA 1G291 2UZ3A 1GDDA 2IHBA 2FG5A 3EZ2A 3M4YA 4NU0A 1G6OA 1KI4A 1XRJA 2NO6A 3IILA 1HA3A 3B6EA 3AVUA 1YZUA 2CCKA 1QRAA 1FL9A 1XJQA 4P4SB 3K9NA 4PAQA 3TQCA 3GLFB 1P2SA 4C0BA 2Q6TA 4DCTA 4DB2A 1CKEA 2JGNA 4AD8A 3SYNA 4YC7A 4NYJQ 3N70A 2RGXA 1U8AA 2R6FA 3BE4A 3SNHA 3UMSA 1RZ3A 1DEKA 1W49A 5D3QA 4URXR 5DNYB 3PV0A 1WMSA 3EIQA 3GLFE 2WTUA 1OH5A 2NO9A 4V0ME 3ECCA 1DO2A 1KKLA 2J1LA 4Q1CA 4QGGA 1XB2A 2KI5A 2J9RA 4GRAA 2MSDB 2G3YA 4Q4JA 3C5HA 1Q57A 4LI0A 3QE0A 4JBYA 2F6RA 4HDCA 3P4XA 2XJ9A 1SXJB 2IWRA 2DFTA 1KMQA 4ZCLA 1Z0DA 3ZIAD 1OKKD 3I5XA 3DPUA 1J70A 4YQFA 1NMXA 1OXVA 3ZD7A 4M1OA 3EA5A 3H84A 1SXJE 2A5YB 1SQ5A 3UIEA 5IHPA 2GJ9A 2D74A 3GJ3A 4FCWA 2GESA 4B6EA 1T3SA 3OHMA 1N6OA 1X8LA 4LBYA 1W7AA 2HCBA 2IYWA 2C5LA 4IEEA 4WZ6A 3QVUA 2QRZA 2QP3A 2R6DA 3QKRA 3I4LA 4KAXA 4IXMA 4OJQA 4PSKA 4FWTA 1A4RA 3Q7PA 3NEJA 1AIPA 1N5JA 3IPXA 4PO1A 4AYXA 2IEYA 1A7JA 1S2MA 4JT2A 4RCZA 4LUCA 4IHQA 4NYIR 1E2EA 1KK2A 1QF9A 4FD2A 2NPIA 2D7DA 3SC3A 2PX0A 3UWKA 3VMFA 4LHXA 2BEKA 3JZAA 4Y0VA 1E6CA 1OFUX 2C98A 1S1MA 1H65A 1UKZA 3B1XA 3BB4A 3DMDA 4ARZA 3UMFA 4UQOA 4CZ2A 4AKIA 5H68A 5FPTA 5KTYA 1TL7C 3GLIB 4I99A 1JB1A 4ACAA 1R0WA 4R9UC 2QP4A 1JNYA 4GSYA 3CNLA 2QUZA 4Q00A 5FOXA 2QSYA 1W36D 2QA5A 1SVLA 5FL7D 4DSOA 4M2LA 3I1FA 4JBXA 1U9IC 2JLSA 2A7QA 2FFHA 1Q1QA 1U2RA 2BCJQ 2W6JD 3QENA 3U3KA 5HE8A 4EDHA 5B64A 3ZIAA 2ZRAA 1OKKA 2CLCX 2EWVA 2JASA 3W34A 2F9LA 1XF9A 4BASA 1JQJC 2GK6A 3CX8A 2IUSA 2QMEA 3O8DA 1GOTA 2O0HA 3IQWA 4TQAA 1YZKA 5C4GB 4Q01A 5CB8A 1G8GA 3UK6A 2O8FA 4FMCF 1G7RA 4ABYA 2N42A 3KB2A 2GZHA 1P7CA 1VCIA 3GJ0A 2A5GA 3GCGA 4X8OA 5H8WA 3QPVA 3WY9A 1MR3F 3N2IA 1W4RA 1JR3E 2REOA 3FE2A 4M0LA 2OBMA 1FP7A 2V6JA 4U00A 3F5FA 5EJEA 4XVRA 3LVRE 2WWFA 2AXPA 1JEDA 3AGPA 2IHYA 5CM9C 4C9BA 2FFBA 3KJGA 4JMPA 4DDUA 1L4UA 1NLFA 1OYYA 2WOJA 3EZ6A 1TUIA 1ZD1A 1S8FA 2NZ8A 3LVQE 3QF7A 4FMDF 3KJHA 4NCHA 4A9AA 4A2QA 5FTMA 3DOFA 2ZJBA 4O2LA 1N5LA 2XEXA 4BLPA 3WYGA 5FBVB 3EWSA 3ICQB 5F9FA 3BBPA 2ZJAA 5JHGB 5K8TA 1KOFA 3B13B 4TQUS 1ZIOA 2AWNA 4B48A 3DL0A 5FL7A 1RC8A 1P9RA 1FX0A 4S2EA 3X2SA 2W6JA 5JSZA 2ODBA 4C0HA 3AGQA 4M1TA 2QT0A 1CBUA 4Q9HA 2EWWA 3B78A 3CKLA 5IDVA 3RSLA 3WRYC 2GEDA 2O8EB 5IT5A 2CVHA 1SHZA 2RGCA 1HQYE 4PC1A 4C0KA 4CYMA 4EIWA 1XTKA 3ADKA 1WCV1 4TTQA 3L2OB 2RGGA 1K8RA 3KUDA 3THWA 1XXHA 4JT4A 3W6PA 3ICEA 4C2UA 3A4NA 3K53A 5AUQA 3T1QA 2GJAA 3GFOA 2OXCA 4LWZA 1DO0A 4Z8XA 1G9XA 2OUKA 2C78A 1R8SA 1P9NA 5E3HA 4D0NA 4EAQA 4MUBA 1W5TA 1SXJC 2PEZA 2ZR9A 1HYQA 3L0OA 4NYJR 3FFAA 3B9PA 4M1SA 5GJVC 4AKGA 2BBTA 2P5TB 5HZKA 4JBWA 2F1HA 1E2HA 3W8NA 4TTPA 1XMIA 4I4LA 2FSIA 2XITA 2AWOA 3W5IA 4B44A 4CEHA 5B57C 1E9CA 3FHOA 3GLHB 1GG2A 3CWQA 3MFYA 3NC0C 4LBVA 2X2EA 5FI0B 4TYYA 4JL5A 1ZVQA 3A6PC 2EFEB 4I1VA 4B76A 4I1SA 1ZC4A 4RZXA 1WBBA 3AVQA 3QUSA 4G5SA 3GLHE 4IW3B 4JL8A 5J4YA 2GBLA 2V55B 1N6KA 2WM9B 1KDPA 1G4AE 3DM5A 5GJWC 2CE2X 4KI0A 1WXQA 5J5CA 2IYRA 3BB1A 2QZ4A 3CRQA 4YMSA 4B3XA 5JI2E 4N0EA 1AA9A 1RYFA 4KVGA 1K6MA 3QSYA 1XD9A 1D9ZA 3CONA 1OXXK 3RS4A 5FR1A 1P61B 2NG1A 3Q5EA 2KJQA 1MO3A 3MD0A 5FTLA 2YKGA 2O8FB 2YC4C 1F2TA 4OK3A 2QMOA 1LTQA 4LX0A 1LS6A 2JAQA 2ZVQX 2O5VA 4GZLA 1SKYB 1EK0A 2J45A 2FE4A 3HP1A 1R6BX 1TNDA 3EWAA 1QHXA 1M7HA 2I4IA 1P60A 2ZSAA 4AKHA 2PLFA 1TEVA 1W4AA 1NL3A 2LCFA 2VSOA 1PLLA 5LBIA 4JLPA 1OIVA 3QBTA 1NVVQ 3B1WA 3CRW1 3TW8B 3SJZA 4DEYA 5E4FA 1Q3TA 3TSZA 5E7MA 3U7HB 1KYIA 2QQ0A 2ZRNA 2H18A 4QNRA 3G0HA 5E7IA 1KHTA 4LBZA 5E7JA 1GL6A 1DS6A 3LDAA 1CULC 3GFTA 3BFVA 1E2NA 2ODNA 2X19A 2HLDD 3NBFA 1G7TA 5DGXA 3DM9B 1IN5A 1QHHA 4FCTA 4GFDA 2OG2A 5FBLB 1W36B 4A1FA 2OM2A 1FX0B 2DWPA 2ZYVX 2WJJA 5L3QA 3U61B 2RH5A 1TQ4A 1LW7A 1W2HA 3SHFA 3VAAA 1EX7A 1QVAA 5HCNA 1MRSA 4CDGA 1YRBA 3MGCA 4PANA 1G8PA 2R65A 4DBLC 1QVRA 1P4SA 4MH0R 1Z0AA 1G3UA 3TUIC 1XPRA 5LB4A 4ZCIA 3LBNA 3IO5A 2BDTA 3CPJB 1NY5A 2GTPA 3QF4A 4JLMA 4Q4AA 2FSHA 5FOSA 1KO1A 2GXAA 4RZUA 4DSTA 1PJRA 5EP2A 1ANKA 2F43A 1CP2A 2G83A 3A4MA 1YZLA 2ZJ8A 4DXAA 2Q3MA 1G21E 3RANA 1YJ5A 2BBSA 1TQ6A 1YZNA 1ZC3A 1E4VA 3VX3A 5JS7A 2D4HA 2JLZA 4M9QA 3EX7C 4F4CA 3SQXA 3L43A 4M9SA 4LRWA 1IY2A 3LY5A 4RD6A 2VA8A 1FP6A 1R0YA 4CEHB 4EFNA 2JLRA 2OCAA 2OZEA 2WMNB 4NDZA 1UADA 1BO6A 5FPKA 4LCBA 5DLQC 3QPUA 1AQUA 5CLQA 2NZJA 3IBYA 2B7CA 2HLDA 2NOAA 4ITRC 3D31A 1ZD9A 5CYPA 2GZAA 2FA9A 3NHBA 4TZ0A 1HT2E 4LC1A 1GKYA 1IY1A 3QIAA 2HF8A 4OHVA 2N46A 3QBVA 3RC3A 4Z51A 3NEYA 5FBQB 1KK0A 2CCGA 5AUNB 2TMKA 4C0JA 2YHSA 4YXWD 3FKQA 5IK2D 4IVPA 1KO8A 3EG5A 1W47A 1GILA 1KI6A 3TNFA 2VO1A 1SVOA 2AK2A 1RVDA 4HLUA 2PZGA 2O52A 5EXPA 5GADl 2F55A 2PJZA 1XMJA 2ZITA 5FBRB 4P4TA 2WVJA 2PZFA 3K0FB 3TUJC 1ZIPA 1QG4A 1T3LA 2JATA 1R7RA 4WAUA 4C30A 5KSPA 4M8NE 3G82C 1HQCA 4V02A 2FU5C 3C15C 4Q9JA 3D3QA 3PENA 4B73A 4PC7A 3FB4A 2FZLA 4TMVA 2QPOA 4URVR 4WIAA 4JL6A 1E4YA 1U0LA 5M04A 2WMOB 3T1TA 5LPNA 2ATXA 1PLKA 3LNCA 3PITA 1SVWA 3BRWD 1EWRA 3WBKA 3E2IA 3LD9A 4RFSB 4IOLA 5EXTA 2ZYUX 1OSNA 1UAAA 4LPSA 1NKTA 3THYA 3BORA 3BFKA 4NBSA 2ZI9A 4G1UC 4HUTA 4XSGA 1OXTA 2NO1A 2GJKA 4I81A 1SGWA 3BAFA 2FPLA 1UKVY 1CJKC 1OHHD 1QHHB 3BGWA 1NNEA 3F3YA 2HV8A 1US8A 1N6HA 5L3QB 4R2IA 1IXZA 1F2UA 3C8UA 4H9GA 2H8KA 2HEIA 2ZIAA 4GBMA 3R7WB 1M2OB 1N6NA 4QBIA 2BMFA 4Q1BA 5EP4A 2A30A 1EFUA 4HAWA 2ZRLA 2BV3A 3WMEA 3ZS9A 4EPXA 4ZDKA 4YXWA 3UPUA 5IK2A 2VQSA 2VTKA 4LJ5A 4FIDA 3KXIA 4RY2A 5JWOA 1D9XA 3QKSA 2DCUA 5KDOA 1KJWA 2FEMA 2IS1A 2VLIA 3ZZTA 3LRPA 1EFRD 1DBSA 1X6VA 3LWNA 2F43B 3RDPA 1NVVR 4PZYA 1W36C 5TVKA 3B5JA 4Y0AA 3BS4A 4R7ZA 4IDOA 2WKRA 2FMXA 3IKJA 1SVIA 2ZROA 2XSZD 3KFXA 3PEWA 1ZYUA 2GK7A 3U7GA 4M1YA 4CEJB 2CHQA 2VP5A 4JJKA 1NI3A 4IDHA 2JLVA 3KJIA 5JMTA 2NO0A 1FTNA 1YR8A 1ZU4A 4Q7KA 1JXMA 1WP9A 1U81A 2VRWA 2Q9CA 3EASA 3IIJA 3KKPA 4KLNA 4XWOA 2BMDA 3X1WA 3WMGA 1EGAA 2PT5A 3HYRA 1N0VC 1P72A 3B1VA
chains in the Genus database with same CATH superfamily
1NVGA 4PG4A 1AB5A 2QZZA 4DA6A 1VTKA 3GJZA 2XADA 1YB7A 1C1XA 2DJIA 3F9RA 4EVIA 1EX1A 3W0LB 2ONKA 1U31A 4GGPA 4OM7A 2F8MA 3NV7A 4RVSA 5DIFA 4YMWA 2GPWA 2VPYA 5JFTA 5CDUA 3M1YA 2NU8A 4ZCQA 1J9EA 4JUAA 3R7DA 3E7FA 4L28A 5EMKA 2PL1A 5LXTF 4E09A 4QT4A 4WLVA 2FOXA 3LT5A 5CU7A 4IIDA 2BFBA 4HN4B 2X1HA 1CF9A 5EWJB 5IVDA 4UVEA 4CVNA 4PGGA 2WYOA 1ZGGA 3ND5A 3HFSA 4RORA 1DE0A 2IPMA 4IVQA 5KWEA 4B43A 5CLGA 5J5VA 2H31A 2JJ1D 4GWLA 3GBSA 4LJ4A 2NU7A 1NMQA 1L9XA 3C3CA 4KUGA 1DIAA 4A3SA 4MYTA 2VAPA 3AEQA 4G97A 1OWOA 2H92A 3BH7A 4PFQA 3EC2A 3KZCA 5KX5A 2YMQA 4UUMA 1C1YA 1DIOB 1N2ZA 3QHAA 5JSKA 3V4SA 2C7QA 1GZDA 3I2FA 4ND3A 3BJRA 4F4DA 2PUDA 3ZD6A 3ORRA 3OFJA 1MEEA 4H1TA 1H4VB 2B2NA 1CT9A 1Y80A 3F8WA 5D00A 4DL9A 2PTGA 4ENQA 2LP4Y 4TWBA 3WGHA 2DZDA 4BHTA 4PRKA 5ICMA 1XZAA 1JL3A 3K7EA 4X8LA 2DC1A 3V6MA 3CZ9A 2FPIB 2ON6A 4H77A 3B12A 4PYIA 1MZPA 4JODA 3RQSA 5J1TB 2J33A 3WNVA 4A91A 2DR2A 3NBKA 1AHPA 1TIPA 2DYKA 3U48A 1I6MA 1ENPA 5IZCA 2A92A 4ZOAA 4K87A 4EPYA 5AICA 2GF2A 1E5DA 2QM0A 2DWCA 3O7WA 1WULS 3HCEA 1Z75A 3PXCX 3ROFA 5FQNA 4QPJC 1E2UA 1SH7A 4EB8A 5HZGA 3OIYA 2QB5A 1V37A 4ETNA 4CCYB 3RYHB 3N8IA 5AM3A 2OO5A 2OLEA 4EUSA 4E5SA 3TB4A 3V8NA 2BKEA 2X3YA 1C0KA 4V1CA 1OFHA 2B5OA 1GPH1 2OCBA 3UOGA 5C1PA 2NTNA 2G28A 3QA3E 1M76A 1WCIB 2WIJA 3B6MA 4QBKA 4UZSA 4L9AA 2JBHA 2D1TA 1TTHA 2RBKA 1DLIA 1Q0UA 1UPAA 3LG2A 4W9MC 3KKMA 2FPMA 3KYJB 1F8YA 2RAUA 1N5IA 2XAUA 1VHJA 2J3IA 4XI9A 3ZDAA 1CY0A 2Y8EA 3VU9A 3PDJA 3TLKA 2O4UX 3L40A 3VC3A 4BMNA 4A1OA 5J9FA 4BX9A 4FZVA 1Y4UA 1G41A 1W8DA 2PAFA 2ZSFA 4N5HX 4JB0A 2XD4A 4HWOA 5KYUA 4YMTA 4GE3A 4CQJA 1XSEA 3JYHA 5KSZA 4UC0A 4ZOLB 1Z2NX 2PX3A 2R6AA 2V9ZA 5GJCA 2PMEA 3UQZA 3WADA 4ZZ3A 5LU9A 1EFPB 4GKVA 2QM7A 6Q21A 1BJKA 2FN3A 1ISRA 4JT8A 2JFPA 4XE5A 1Q95A 4AS3A 2P9ZA 2XNCA 3O2SB 4KK4A 3RSSA 1DXYA 4E4TA 4JQSA 3BJIC 4MR9A 1GNRA 2BMWA 1L7AA 2QENA 2VK1A 2D7CA 2DUJA 3IKVA 5AJTA 4E94A 6REQB 1P6UA 3R9IA 3DB2A 4D6YA 5IKXA 3A1TA 4LGCA 4WRRA 4ZZIA 4XGQA 2BFBB 2WILA 3HXPA 1OZHA 4PC2A 3NIDB 1MIHA 2ZIUB 3FYUC 3T6KA 1Z07A 4DR3B 4BKPA 1TF5A 1EBUA 2FZEA 3QI2A 1H23A 1W35A 1WEHA 3CF2A 4R68A 4QUKA 2HY7A 1JIUA 3I6ZA 1J8FA 3PTZA 1HSZA 2FJPA 3QEAZ 2JW5A 3CZAA 4DQUA 2NU7B 4QUEA 5JEDA 1M73E 3JPYA 3SZRA 2HMVA 3F3MA 1VE5A 4DYVA 4LSWA 1TCUA 3ISVA 2ZUBA 3FPCA 2Z6QA 5DXAA 4QUAA 3OLXA 3R3VA 4ND2A 1K7EB 4BRZA 1PP4A 5BMVB 5DM4A 5TRTA 3DLTA 3RWMB 4TVOA 3ZC3A 4OI0A 2I4MA 1RJEA 4EAAA 3I64A 3VMMA 3BG5A 2P75A 3QKIA 5CGZA 1SCUB 2O2CA 1U7ZA 5LBUA 4BLRA 4BVGA 3H6HA 5BQOA 1NRWA 4TS4A 3CRVA 2PYIA 4HXFB 2UXDB 4M9ZA 5JS8A 1S0UA 2KHZA 2HMUA 1UBTS 3P4UA 3R7SA 3RR2A 1GV0A 4MNTA 3T61A 3U4QB 1AS3A 4BP8A 4YP6A 3SBOA 1GUDA 2CC2A 3E9CA 4X6LA 1DSSG 1UXKA 1KPGA 4ROSA 1F48A 4MO2A 1JEEA 1I30A 2COUA 2KBEA 3IGFA 2PK3A 2BTQB 3BD6A 3M3DA 5JMOA 2PZMA 5KOJB 1N6IA 4LXUA 4YRRA 1FW6A 4QRDA 5EN4A 4B75A 5GIPE 4LHWA 3BXPA 4UD2A 3ASVA 4FZJA 1M1YA 3EZFA 3IEXA 2VT3A 5DTEA 3A27A 1Z8FA 1NFRA 821PA 4IWNA 2CLLB 4H31A 3A04A 5KIAA 3A31A 5D7NA 5M2QA 2IOFK 3OZTA 1PR4A 1TZCA 4CMKA 1N0IA 1HG1A 2IYFA 3BULA 3N2YA 1N3YA 1PR5A 2KB0A 2YCLA 1C2YA 3A06A 3HN7A 4PLZA 4UUAA 3ZHTA 4OD0A 4WT7A 4TYWA 1WA5A 3G85A 4AJKA 4OGKA 4KWEA 4XXHA 4FBLA 4RLQA 4LYDA 1U1EA 2H5LA 3V9PA 3IR5A 3ZHYA 4E11A 1ZGJA 4R2JA 3WGNA 4ILEA 5AJVB 1KTVA 5A7GA 3LHKA 2W6NA 3COYA 4RA9B 4O08A 4E22A 5JYCA 3WNQA 2C3PA 5K3OA 1D7AA 2PLAA 5CH5A 5ALMA 4Y6SA 2B4YA 1Q77A 1IK4A 4DUPA 4HRYA 1K98A 2GEVA 3F46A 3VU9B 3ZVRA 2QD3A 1FMCA 4KH1A 4NFHA 3VH2A 4ZODA 1AQJA 1UQTA 3GQBA 1DO8A 4GI3A 4QHSA 3V42A 4RTSA 3FSGD 2H0AA 4LXGA 2D0OB 1JSCA 2HFKA 4R1QA 4Y6QA 5K4AA 4FJ1A 3K6SA 1A7KA 4HR7A 1RCFA 1BN6A 5I3CA 4JNKA 1U2TA 5JAUA 2GN6A 5KCZA 4HVLA 1OROA 1PVOA 3OX3A 3QXHA 2O5CA 2RHOA 4XGNA 2OOSA 4PCUA 1KEEA 1R12A 4UTPA 1ZI6A 2WYIA 2FEKA 4AULA 2BYTA 4MR9B 1R10A 5HJEA 5CA0B 1I3KA 4FYWA 2PMDA 3W8FA 2FRDC 1ZUD1 2VJMA 4TS3A 1VJGA 5JJLA 4YAEA 3ROQA 2OCPA 3V7YA 4F86A 1H2BA 4H3KB 4C6SA 1MC1A 1SOVA 3BX1A 5A6SB 3OZXA 4D6XA 3KTFA 1LX6A 3P4YA 1ZJJA 4JR0A 5EINA 2GCNA 3IA2A 4EPVA 1I9GA 2UUCB 2YV3A 3OEHA 1YUMA 4RK0A 2C57A 4IJ6A 5HQTA 3L6UA 1MD9A 4Y1GA 3F5QA 5K05A 4CLDA 1F3LA 3SFZA 4U2KA 3E58A 3ETNA 5MN4A 2PGDA 3ER9A 3ER8A 1WD7A 4KU4A 3M4NA 3BBLA 2Z4RA 2IK8A 1YMVA 4MITA 1YQ9A 5ALSA 1RVV1 1IJBA 2GM9A 2X6QA 4L4UA 4BLQA 4E13A 2EQ5A 1H66A 5K3FB 2JJQA 1T4CB 3W2HA 3NNNA 1JXQA 3W6NA 3BH0A 3EEOA 5TGTA 1Y6JA 2AF3C 4QG7A 4U02A 5G0TA 2A5FA 2JIRA 3HZOA 4BV2A 1I01A 3PA6A 4WGGA 4UM9D 2ORWA 3AR3A 5AW3A 2HNKA 5IVHA 1E3MA 4HRAA 1C2TA 3O4JA 2NXCA 3MEQA 3JVEA 4OQFA 3OCYA 3T3MB 1JALA 1DXOA 4EJMA 3QV1A 2XX3A 1EJBA 2NT4A 2VF8A 2X15A 3T94A 4DV6B 2C99A 3G1UA 4BEWA 5CG2A 3SHWA 1G59A 2IODA 4OQXA 3WNZA 3S3TA 3SEZA 1PFYA 4BFWA 4D8XA 2RFLA 1SOMA 3H9CA 1ZD2P 2ZWMA 1L6RA 1NP7A 1RRPA 2MWMA 3KEQA 1C7FA 1ONSA 5ALKA 3TZEA 5C32A 4IOJA 4EQZA 1LPPA 3QJGA 3L0IB 4QDKA 4IFIA 1IUPA 3PHIA 3DHVA 3DFKA 4ZCTA 2M1XA 3KBOA 4RIEA 1AZTA 5CIQA 1JHAA 2OAQ1 3NGXA 4XD7A 3WLRA 1A9YA 1Q7BA 1WDMA 1ZH2A 2YIJA 3QQPA 1JYFA 2C95A 1IULA 1ORRA 1WVGA 1WP4A 4TWIA 2FWAA 1BC5A 3UJ9A 2PD3A 3LV8A 2Y0BA 3BVPA 3HK2A 4C04A 3CH5A 4HJXA 4BWFB 4C5BA 4H4DA 2JCSA 2ZUEA 4DMFA 1N3BA 1NHGA 1EFLA 2FUG1 4QRHA 2JAHA 1KDRA 2JFYA 3DZDA 4YUZA 4FOSA 3BWMA 2M6SA 5HMLA 2JK1A 5F64A 5ENVA 3SJUA 2P4EA 3CCBA 2QJTA 1K97A 4IJUA 4FCVA 1F7UA 2V7XA 1HGXA 2NXNA 4OBEA 5IZCC 3NIBA 3ES9A 2JDID 4TM7A 3L6EA 5J4HA 5EERA 3HEAA 3GUUA 4LI3X 3CO5A 3NTQA 1Y7PA 3VV2A 1A0OA 3T9EA 4N12A 1S2DA 2YVAA 5ITZB 1JFRA 4B2IA 2B98A 1ZS9A 2IIPA 1DFIA 2WNHA 2GM5A 5LDHA 4NBTA 2C2XA 4Q7EA 2ESRA 4L5JA 3GUVA 1EAMA 2YNMA 2J09A 3CWZA 1RJGA 4KMMA 1ISIA 4R6XA 4B83A 2HW8A 4OUDB 2DGDA 3V34A 3R0IA 2AHRA 4FNAA 5HYVA 1CDDA 2J3EA 3EXEA 4RPCA 1JEQA 2QVCA 3HCRA 4QYXA 3DMTA 1T1RA 2EU8A 4A03A 4KSCA 3CC8A 3JVVA 3KFVA 1YOVA 4GECA 3UWPA 4K0KB 2EVWX 4OMCA 2WJAA 2QAGA 1RKQA 1IUNA 5THKA 4DLZA 3L18A 3IEUA 4B2PA 2GAIA 4J49A 2J4FA 1Y42X 3TK1A 4B82A 4KDEA 3WISA 1KXJA 2RK3A 3ONVA 4LAFA 5DOZA 1I36A 1N2CA 3FWPA 1D2NA 4U7WA 2ZS9A 1IH8A 4M38A 4DKJA 4L4YA 5E0KB 1FCJA 2JJ2A 1XWFA 4MW4A 3HJUA 1L1FA 3TOCA 3RM3A 4DDKA 3AF0A 4YS6A 4F3NA 1QHNA 4LZAA 3SLRA 5I8PA 1YR6A 2PGXA 3IEVA 3W9BA 3KZ1E 2FGJA 3K16A 2HWUA 4NEGA 4RY8A 5JY1A 4U7PB 4LF6B 2B4RO 4JJ4A 5AR1A 3G2OA 4CLOB 5ADVA 1QHGA 3PFBA 5ITVA 3PWKA 2CDNA 4D4IA 1OXUA 1JSXA 1Z38A 3C3BA 4OM8A 1ND6A 4Y9UA 4EGFA 1F0NA 4OXXA 1RXYA 4ZQEA 1MXHA 4ERNA 4DDWA 2OCDA 1UEJA 1Z6XA 1Q83A 4HWRA 4MJLA 3IT0A 3MD9A 3FZYA 3VKWA 3VPSA 5AVOA 5DV9A 5FL3A 2E21A 4IH4A 2DJ5A 1ISFA 1KAOA 1PBNA 3LQFA 2XH8A 4V0OA 4YEDA 4DIFA 4OSPA 2ZUFA 4MIEA 2GTHA 5DN6A 3HVRA 1T43A 3U1VA 1SKYE 3AERB 4LQCA 1QH8B 4TRNA 3S44A 5KTSA 1N1DA 3DE7X 4MAAA 2ZBGA 2AR7A 2H8GA 1JHUA 3DFMA 1KNQA 1ODFA 2VXYA 3E81A 4JBLA 4MVXA 4GOLD 4RF2A 5AKIA 5DKFA 4ZYYA 3WAGA 2G1PA 4MVYA 4NE9A 1ORDA 5IBQA 2RAVA 1TZMA 4G63A 4GBGA 5CB4B 5J4KA 5C80A 3U6KA 5JU6A 1O6BA 3K1AB 4L0CA 3VR5D 5IF3A 2H2WA 1GT91 2ZAMA 2CVFA 2ZUDA 4F5DA 1K7FB 4ZJYA 3NHYA 1P5JA 5J59A 2W4QA 1V11B 1BAPA 2VXOA 3HJGA 3KXKA 3MGGA 1YNSA 4HATA 1DZ3A 3WRXC 2WJWA 5JSZB 3IV6A 1S7CA 1IFXA 2DR3A 1T4MA 4WADA 4G0XA 4A92A 2G7MC 1N7JA 2VP4A 5A3VA 3TW4A 3O3OB 1XZPA 3H13A 4EGCB 5BPHA 5JH7B 4RPLA 4FDLA 4ZTZB 2DPXA 3OZSA 3V1MA 1NULA 3ANSA 2E37A 1PFWA 2OAGA 3GGGA 2UV8A 1WIWA 4LF7B 3AR4A 3ROPA 3DOHA 4ND7A 2V98A 2IP4A 1LPSA 3NDIA 4ZC8A 1RAGA 1DXHA 4EO7A 4XIFA 5KKNB 4PYMA 4KHPB 4KXLA 3QPCA 3L06A 8OHMA 5IF9A 4FEEA 4KTTE 3NU1A 2OCYC 4B6QA 4CTKA 2Q6VA 4MSUA 5EJ8A 1QC5A 3WK6A 1UKYA 2AE1A 3QPBA 2Q4RA 1SQSA 1GT6A 2P5SA 2X77A 3FBTA 2Q5EA 3D6MA 5K0FA 4E07A 1BMFA 2P9BA 3LL4A 5KVSA 2V7EA 4L74A 4V3CA 3A1SA 3DJFA 5AK6A 4E08A 4OHWA 2AIRA 2ZJYA 1OI2A 4NARA 3EXEB 4I5EA 4JN6B 3M4JA 3GXBA 4KMOA 2NZ2A 2Q3EA 3WLQA 5EAIA 2IS2A 4WK4B 3VO9A 1E2IA 1YOVB 2VWHA 3EBOA 3IDQA 5ECDA 4BKUA 5JJ5A 2QAGB 1CQWA 3L46A 4P2BA 1W85A 1A9QA 1LDGA 1ORVA 1L7VC 2V6MA 4BFLA 5JJKA 3ZDEA 4LJSA 3D1VA 3VR2D 3SM9A 2B34A 2ZLBA 1M34A 1KORA 1N2CB 1PHPA 1BSVA 1SU8A 1Z7WA 1LQTA 4OHKA 2YVLA 1DPGA 1PYGA 3OTQA 3AQ4A 1TTTA 1VSQA 4GDMA 3W90A 5DH9A 4G4SP 5BSEA 1SOAA 4CXMA 4ARBA 5TSDA 3SAJA 3B8HA 3SXUB 3RSZA 4Q03A 1Q5PA 3M6UA 4P31A 2EOAA 2B8EA 1FFEA 4DCVA 1FFHA 3D2CA 4P7BA 5CFPA 1NVTA 5KNCD 3WGVA 2ADMA 1NSTA 4NYMQ 4O4HA 5AI6A 5FYDA 3F49S 2FF5A 1K63A 4W8OA 4UUNA 2ERCA 2FPPA 2BGLA 2R6GA 2CNBA 1WTAA 1O89A 3F4BA 2V3VA 2WWWA 1ABEA 3FLBA 2GXUA 3NOOA 1AF7A 2OILA 2G09A 5KJEA 4JITA 2WWVD 4RH1A 1MQ8B 3K0AA 1O77A 2ZJ3A 5EZ6B 4RHTA 5CR9A 1VE6A 2NSJA 1MHTA 1N0UA 1KBOA 2CWWA 2AG1A 3OWHA 4QU5A 3WK8A 4PO8A 4YAKA 1LTHR 3O8BA 2HO5A 3EK2A 1Y3CE 1G18A 1K9VF 4FMBB 4IUBS 2PKXA 4V0RA 2R48A 4HNSA 3HSYA 3FBGA 1CS0B 5EMLA 4EKIA 1JFVA 2EJVA 3HU3A 4EL5A 1O6ZA 5ALFA 3GV0A 5EIBC 4F5ZA 1GHTA 1GTRA 2C4WA 5CXUA 1MXFA 1A9OA 1P9WA 3VR1A 1JA9A 1LEHA 1SK8A 2B6HA 3RB8A 1QYCA 3O8RA 1KKMA 1JQLB 1WXHA 3V4LA 4ZXPA 4JP3A 3Q9SA 4CM7A 4BKRA 1CJVC 3FYDA 4U39A 2Q8PA 4P3OA 3WDLA 3MIIA 2W2XA 2PRYA 1MX3A 3H1AA 2WSSD 1V95A 3DKKA 3T5AA 4I50F 4DJFC 1A82A 5JFGA 5KUTA 4GOXA 3TD9A 3WKDA 3I2KA 1EVYA 1JAZA 2P0AA 2VDVE 1XIVA 3NXKA 3OKFA 4EYOA 1TM5E 5FWYA 2XECA 5F4BA 4X24A 1MNAA 3JD0A 3LXXA 4RVHA 2QTTA 1XK6A 2TYSB 4N8DA 5FWDA 5BQPA 1XEFA 3ZE6A 2I91A 5CEFA 1Q1BA 5FTJA 1J00A 5KYNA 1MDFA 2HU7A 1Y1PA 3ZLUA 4HDQB 1YSCA 4AIIA 2GWHA 4FBGA 3ZU2A 2QE7D 1NG9A 1SQFA 5FUYA 5EHZA 4TKVB 3C45A 3VZQA 1YBHA 4MJ7A 1QK3A 5C4IA 3PJFA 1QC5B 4GE0A 1YAJA 3NORA 4NMLA 5I5GA 2FG6C 1ONNA 1GZSA 1VYVA 2JLCA 3VNBA 4F2WA 1XTZA 3NANA 4MYRA 4I1PA 4FS3A 3ZEIA 4XIIA 1NUQA 1ZKMA 3KU1A 1GNPA 3SQOA 3FJ1A 1G60A 1GTG1 1N2XA 4N5NA 1JH9A 2VJDA 5LA6F 1FYFA 3BCHA 5AK3A 4MZXA 1ITZA 1BOFA 3FKSA 5KVQA 1R8QA 3AM5A 3T4UA 3WLAA 1UM8A 2Q4DA 1M34B 2R8RA 5EPUA 4O2AF 1JTFA 1T24A 4PPFA 1GTMA 2UYCA 2AEMA 2WPDD 1CR1A 3I5YA 3ZYZA 1U90A 2OK7A 2ZE6A 3QVVA 3GJXC 5E1DA 3N2KB 4RLSA 2FEWB 2HRCA 3JVUA 2GCOA 2IYOA 4GM4A 4RV4A 2M98A 3OEED 3HMQA 4MX8A 4GMFA 2X8LA 1GL3A 4BWYA 2PH3A 3WLKX 2WT8A 2MMCA 4X1KB 4RZ3A 1FS6A 5FHQA 4YRMA 1Y4ZA 3WS7A 4ZU6X 2P11A 5KTRA 3U7FB 4UXIA 3U3MA 3LWDA 3DMTC 2XNSA 3PCTA 5JECA 5HX7A 2FPPB 2JHPA 3AZQA 2WMYA 2I87A 1J97A 3G49A 2V3WA 3C3EA 3C8MA 4A26A 1RI4A 4YRGA 1YVRA 2IYEA 2ZAYA 1JQKA 3WLLA 4JP2A 4MP6A 1FDWA 1S9DA 2QU7A 2ZFUA 3K0AB 4EARA 1S6YA 3K1ZA 4R1SA 3UW3A 1Z83A 2H51A 4BNYA 3JYPA 3AIOA 1QMPA 1P1BA 4MMYB 1GP2A 4NPCA 3A1WA 4OJTA 4EM6A 4FZ5A 5INTA 4Z4IA 4FN4A 1W0JA 1NYLA 4C4TA 1CZNA 3OE7D 4RMIA 4V0KA 4L2IB 1C7QA 3NHUA 2JZNA 3WV4A 3WIEA 1TFRA 1SXJD 5AM1A 2EEZA 1YZGA 2EDAA 2AZTA 1F6BA 1WZUA 2XOKD 3IIMA 2L69A 1M8KA 1IONA 1S3FA 2TRSB 4MLZA 3I9KA 5TC4A 2PGJA 4WKBA 4ZYLA 3V5NA 3V7WA 3CH7A 1J20A 1X42A 4BZXA 3PA8A 2Z2ZA 4F3RA 4NNOA 1G4UR 1WPXA 4MGEA 4G41A 4J16A 4EOGA 1E5TA 4JLJA 2I2DA 3FCAA 3NBAA 4X1YA 4YQZA 3RVLA 2NQTA 4E3ZA 2F00A 2GPYA 4NWIA 2Y99A 2CXXA 3LQ2A 4PQRA 3SOPA 2H6EA 4S05A 1IY0A 5LUBA 4ZCRA 4BY9E 3TXXA 4HLCA 4DC9A 1KAGA 4PZEA 5JASA 2BHTA 4EY5A 3CX4A 3IJPA 5KJCA 2HU2A 1OAOA 2JIZA 2P9EA 5E6UA 1VCNA 1W76A 4H17A 1NI4A 3CZQA 1JE0A 3H9JA 4ALIA 1XTIA 1NZJA 1L5FA 3DDWA 3H9GA 1IG3A 3PD7A 2JGMA 5E6RB 2C1EA 3TQQA 3VR4A 4BVLA 5FUBA 5J2UA 4C1NA 1CUVA 4IIUA 2GR9A 4PO3X 2JGDA 5DM0A 3RQIA 1RXSA 2BGNA 2PPLA 2VDMB 4BV8A 1LTKA 4HBZA 1KP3A 4Q34A 3BB3A 2VWGA 5J3JA 5EZYF 1RBMA 2Z3ZA 5BR1A 2GPJA 3D7NA 1C3VA 1DX9A 3ZN2A 3SX0A 3ZWXA 3VZSA 3DBLB 5EVCA 1UFVA 3R3YA 4JR1A 5EZSA 5AVVA 1FRNA 1D4ZA 1VSUA 2AHOA 1BVHA 1XEAA 2FZ5A 3ESAA 2ZUCA 1AKWA 2DB3A 3WSWA 4AI6A 3ADPA 5BWOA 1F6DA 5DBFA 3KM0A 1HH4A 3FPGA 3PKZA 2JAUA 1ADFA 3ACBA 4PR3A 4OQMA 3WWPA 3AOEA 1DCKA 1VLVA 4KP7A 4L15A 4RIHA 2EFGA 1Z47A 3LQ4A 5FA5A 3DUWA 4WZBE 4YCMA 5AW4A 5HIKA 3W5CA 3UCXA 4ZEVA 1N8KA 1YFZA 5TQ2B 2QU8A 2VZEA 2QV7A 1YDHA 1PFQA 1CLEA 1SA0A 3EN0A 3CEAA 5HEKA 3C3YA 2FVXA 3WXBA 1ZN2A 5EIFA 4DLLA 4IHKA 4NDAA 2P7IA 4WQMA 4C76A 2QG6A 3E9ZA 3HU1A 1ODJA 4LEIA 1C9YA 2XTZA 4J4BA 1UMBA 3Q7RA 2W00A 1YIAA 4GMKA 2V0NA 3CW2A 4JYCA 3CJTA 4CW7A 2XUKA 1VHWA 3SE7A 1VI6A 1XAJA 3MWEA 3A6DA 3U26A 1U0FA 2D6FA 3TTYA 2QSZA 5DGHA 3FY4A 4R81A 3VBCA 4DMHA 1JIKA 1ORWA 3FF4A 2QVGA 2P2YA 4DAEA 4MTLA 4Z99A 2X4LA 4CIDA 1YI8A 2OAEA 2P1ZA 3I23A 3H1EA 1UPCA 3BZBA 1GLGA 4RKWA 2GZMA 3CUSA 4JSYA 2ZSDA 3K70B 3BGDA 4JIMA 4Q47A 1DIBA 1SHKA 4CKXA 3I8OA 2UYHA 1L7BA 4GP6A 5JEEA 3ETEA 4WL0A 2VP3A 3EYWA 3R5FA 3UJBA 2BZGA 2IXFA 2FHSA 3T9AA 5LMUB 1BZYA 3EPPA 3ACCA 4UUBA 2YN2A 4KN5A 5GZ3A 2PZ8A 2V1UA 1IU9A 1OLOA 3VPAA 4UM9B 1NP3A 1D04A 4NS1A 4UMVA 3TLGA 1TZKA 2PDAA 4LECA 3LUJA 5D6NA 3KPUA 4A0HA 1ATIA 4Z5XA 2ZM6B 1WZ2A 2PGLA 1L7RA 2R8OA 4K8RB 1NBHA 3AK4A 4RA6A 4WNIA 5DI3B 1T2VA 5DNUA 1NVMB 4G5HA 5HXAA 3TLBA 4BAGA 2WJHA 1X19A 3NTRA 1T36B 2NUPA 1NAIA 3K4PA 1TADA 2YWEA 4PRZA 4CL0A 1DL5A 1JILA 1H4SA 5I9LA 4MUMA 4KQKA 3EMBA 1QH1A 5JCOA 5CXQA 4NCJA 2Z3WA 1SHUX 3FIUA 1JR3A 3FOWA 1UH5A 4GEKA 4PG6A 5KYWB 1NQOA 2HMAA 4I1UA 3A9VA 5DSZA 4Z4EA 5D3ZA 2VSFA 3D3WA 3G7SA 4FOPA 1TPZA 5BYAA 1OAAA 4MDHA 2C3OA 2F3TA 3ZJTA 3PNOA 2GS9A 1CV2A 3JQAD 3PNQA 3EVZA 4U7JA 3PUZA 5DJ5A 3TE6A 5C5DA 1NI4B 2YV4A 3PHGA 4H7HA 3QNWA 2IYTA 2NZXA 3ROXA 4GRIA 5KO2A 1ECPA 5KQMA 4G56A 3WZMA 1CUJA 2WZQA 1OBOA 3LM8A 4KSYA 4KX5A 5DU2A 4CJXA 2C2KA 3P97A 3DW3X 4TROA 2B0JA 3BK2A 3RRBA 1OI7A 2A0UA 3E8SA 3AY6A 3W5UA 1MPTA 1DUVG 3C6XA 3NI2A 5K3AA 5TARA 1G8FA 3DBRB 2CGEA 2W42A 1XCPA 4K9NA 3H04A 3EG9B 4NV0A 5CCDA 4F21A 1T6YA 1NI5A 1QFYA 4CV1A 5SYNA 3DJYA 1AD2A 4WACA 2I1VB 2JEZA 2O7SA 2Q5JA 2ZPAA 3M5WA 1FPQA 5JHHB 4DUYB 2FVYA 1JE1A 3ZWVA 4DLRA 3ROKA 5HZMA 3RADC 1W5BA 2WLSA 2WHXA 4P34A 1AK9A 1XA4A 4DNQA 4YO8A 5CLHA 3D9QX 3GLRA 3U60B 1T26A 1O94C 3RKSA 2O8EA 3TAHA 3F3KA 3TI7A 3AH8A 3I6MA 4RPKA 3Q88A 5HF5A 2W2MA 4UU1A 1SA0B 2QG9A 2IYNA 1I1HA 4DA0A 3JD3A 1L8QA 4P93A 4AICA 2X0KA 4CQMB 1XZEA 2F3RA 1EK6A 4GLFA 1N5RA 4Q18A 3CEMA 2R7KA 4EA9A 3X0DA 3T8YA 5HR5A 4QTXA 4ZVUA 1ZJ6A 4M8IA 5LKRA 1KK1A 2I6XA 2XNDA 3K0SA 3IUQA 3KEFA 1L4EA 2ZDGA 3MWEB 4Z7NB 2HREA 1BD3A 2V7TA 1XZMA 2FPXA 4DWOA 2O2GA 1RMYA 1JVNA 4G0PA 2KW5A 4CTMA 3QPDA 5JCPA 3TH5A 1Y3AA 3QU5A 5IDXA 4GR5A 4U4AA 1Z16A 3D8TA 4BECA 5BR8B 3VNRA 4PCVA 3QWBA 4O4LA 3WGUA 4DV4B 1Q1EA 1KO5A 1USKA 4TSFD 1E92A 4BB0A 4HAYA 3S2ZA 3FETA 3B36A 1M1NA 5COQA 4YECA 4BEJA 1SD2A 5K20A 1P29A 1DDGA 1MOPA 4ARUA 3W2GA 2V0GA 4C1BA 1L5VA 1TPYA 1M8GA 2FNAA 4Q1FA 4QARA 3GD5A 3MS4A 1E2QA 3WA7A 1TM3E 3R5XA 1O03A 2H2HA 3WGYA 2JLAA 3LUKA 4HPXB 1QX4A 2IYUA 4HB3A 2WF6A 2HMSA 3B53X 4KX3A 1P80A 1PK7A 1G55A 1XQYA 1YACA 4RA6B 5AVJA 1DC8A 1JTEA 3ZK8A 5CYOA 1Z4NA 5LLDA 2UZIR 4E2YA 2Y1OA 4Z4GA 1OA0A 3TLJA 4P3PA 5IXJA 2WZDA 2ZT6A 2CYAA 3DEIA 1P5ZB 1QH1B 3A37A 4RL6A 2RKBA 5JWHA 3K70C 1OI4A 1XMVA 4CR8A 4BCBA 1PNTA 3T34A 3SMVA 4GYKA 4GX1A 1H22A 1EJ6A 2IYSA 3FI0A 4G0YA 1FMJA 3WLSA 4D0LB 3U4MA 3JSAA 3EEBA 2PGAA 3VZBA 5A3SA 3D3WB 2ZSBA 4AK9A 1CFZA 3AKCA 3C8ZA 3I0ZA 1HTWA 4Y2JA 4KO1S 2CHUA 2YWCA 3QFHA 1GFWA 2JEOA 3LCVB 2QNRA 4L3WA 1HZJA 3D64A 2W22A 4W7HA 1X86B 3N2LA 4FFSA 3GNTA 2M6LA 1GQ2A 3BCSA 2PKRA 3JZMA 4TT3A 4XH9B 4C21A 3ZZMA 3NASA 2JBAA 2FR1A 2WBLC 4QBFA 1R5NA 2IYVA 4L0DA 1XTRA 5B1SA 2QXTA 5K8CA 2PCLA 3ZLJA 1WQ4A 5T7BA 2B99A 2RHTA 2YVKA 4J3NA 3VVCA 1CE8A 1R64A 1NFFA 1AN0A 4HDMA 4EFMA 4G4IA 4J16C 4TYQA 3ITNA 1NC1A 2C20A 3BAZA 4US0R 2GO7A 4DY4A 1V0JA 3QW2A 2EF1A 3H0EA 1Z4JA 3ZKWA 1B8OA 2BEUA 4D45A 3IT2A 3AI3A 2XVZA 2DLNA 4MIOA 2GPAA 3VAZA 1ZSYA 4MP8A 2VHCA 3C87A 2ZU6A 4BJ5A 3L8DA 4ZREA 3WXMA 3R9KA 1K7XB 3DEJA 3OESA 3GFSA 1TM1E 4TUYA 4AUKA 5B4TA 3QBEA 4BDSA 1T4DA 4NQRA 2HT1A 3WC4A 3V4RA 3W6ZA 1NW5A 4XAQA 1FTQA 2J0EA 3GFVA 2B6NA 3L1HA 1H0HA 1XRSB 4PBSA 2O7NA 2OV4A 2X9NA 2H1VA 4Q9LA 1CUCA 2J48A 4KGZA 5MGBA 1MX9A 2R85A 2VWQA 2IEZA 3MYYA 4XSVA 4EA6A 4HPWA 3PNBA 2IWHA 2PR7A 2ZOSA 3SDZA 4BMOB 1N8NA 2GSDA 1QK5A 2I3AA 5FHRA 2XBMA 3DT8A 4MW1A 4AX4A 1EGHA 1Z2EA 1QCZA 2Z5FA 2N75A 3B38A 5B2FA 1F2DA 1Z6AA 4RTOA 3VPGA 3V4FA 3RHZA 3OJFA 2ZE7A 1Z74A 3FAKA 3ROZA 2JG3A 3KOOA 1EX6A 2ILVA 3AOEC 3KVNA 4LRSB 1YFKA 3BMNA 3P71T 3SLGA 5IH7A 3R20A 2DQSA 4KACA 1NTRA 1UK9A 1NJ1A 1V48A 1W48A 4PCLA 4WK2B 4XUGB 1DDOA 1A27A 2PXCA 1GQYA 3LY8A 3SHQA 4O4LB 7REQB 1N8TA 2P6MA 4OHMA 1RJWA 2MT9A 1T35A 3L0YA 3RFCA 1QU2A 3LJKA 1D03A 3AXSA 3FUWA 2P2DA 5FEMA 5EYPA 3VRHA 2O8DA 2YZGA 1U8UA 1A1VA 3BUSA 3OFND 3IKLA 4TPKA 4AMBA 1E0SA 2PMWB 2W2KB 2AK3A 3EMDA 3IALA 3L8YA 4PTLA 4S1PA 4TV8B 2QLMA 3HO8A 3WP1B 2GVNA 4HT3B 1KJQA 1OI3A 2QXUA 1D3AA 3IHLA 2FGKA 1NFQA 2ODAA 1DMSA 1ZINA 2Y3IA 2QQ5A 2PVPA 3HJCA 4BO7A 1DTEA 1H1LA 5JANA 1QTNA 2PJRA 4HQNA 2ZG6A 1CUYA 2Z8ZA 3PI7A 4Q4HA 2AN3A 3DTYA 2C5EA 1QP8A 1WO8A 2YHAA 3T0FA 3DXYA 4Q9DA 4F3CA 3M9XA 1PLJA 2HK6A 5A02A 4EJSC 5CAEB 3MXOA 4OJMX 4KLRA 4RELA 5K09A 3JYOA 2EKBA 1X7YA 3R6GA 1M5UA 2EX1A 4V3BA 3TBHA 2YMPA 5JXJA 2LPMA 4HX5A 3VTFA 4L73A 2PUHA 3PF8A 2FLWA 4MQ6A 1XZDA 3OP1A 1QYRA 4X85A 5D6OA 3U9LA 4BAZA 8MHTA 4K6FA 3FM9A 3S29A 4DM4A 4TTTS 4PONA 4RH0A 3M49A 4LDJA 2JGRA 3EOBI 1W2GA 1TM2A 2C07A 3TZ6A 3U9TA 3ZJ5A 5HZHA 3SQWA 3OLCX 4MVJM 1ILWA 4KAAA 1SG6A 4PSUA 3UH1A 4DMRA 3VAYA 2BDEA 1SKMA 1GM5A 3N28A 1CXZA 4DDMA 1E4EA 3HEMA 3HUTA 4JC5A 5LQJA 1YVPA 1RI3A 1A96A 3AYZB 4RQBA 4BFCA 5JRJA 1BH2A 2JBAB 3GF4A 4ADSG 2QBYB 3UAGA 1EDEA 3HKBB 2BEVA 5EKTA 4JJEA 4ZMSA 5JCOC 3ADCA 1SXQA 4I6JA 2QYSA 4GXNA 1CE8B 1I3OA 1JW9B 4RYLA 1G6HA 4OHZA 1W8IA 4RSGA 3AEXA 3VTZA 1XX6A 2F17A 2YV2A 3HH8A 5ESXA 5IC5A 1DMRA 4B8WA 3KZMA 4MW5A 3KQSA 4HDSB 3ZKWB 3GEBA 5GGXA 3UZUA 2BEUB 1MAAA 5JZOA 2HHHB 2QVYX 4GPAA 4HDRB 5CFNA 3B5EA 3MPOA 3TRIA 2AYZA 1JAHA 4UNRA 2GTIA 1YKSA 1BS2A 3PEYA 3NS7A 1JEJA 2FSVC 1KJ9A 3GDHA 1W75A 2IUUA 3NWOA 4TUYB 1GRVA 2A58A 2PO7A 2XUDA 3VH4A 5A4AA 1V2HE 1EYZA 3A14A 3PXAA 1X94A 4OHXA 4POOA 3KKQA 3F4KA 1XNHA 3DYVA 2WR8A 4AJ4A 1EWTA 1H9BA 2G8NA 2P6RA 3MFQA 1U2PA 1CUFA 1Y4AE 2IPXA 3ADDA 1Q6ZA 2EBFX 4XDHA 1E7YA 5LYYA 2HRZA 4DMCA 4QOEA 1YVEI 2ZU0C 3OQIA 1J49A 5JWRA 4YK7A 3DD5A 2IUTA 4X7PA 1Q74A 3EUWA 1GAXA 2W6IA 3G8YA 3HUFA 3GFFA 3MTJA 3NXSA 4L08A 5A3QA 4EELA 1FFSA 2WQZA 2A57A 5K0ZA 4WXRA 4PZPA 5JIBA 5BSUA 2FEOA 1GDTA 2CK3D 3LQQA 3IVAA 1DU4A 3K8QA 5EEGA 3JRWA