4JLMA

Human dck c4s-s74e mutant in complex with udp and the f2.3.1 inhibitor (2-[({5-ethyl-2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-1,3-thiazol-4-yl}methyl)sulfanyl]pyrimidine-4,6-diamine)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
242
structure length
233
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structural characterization of new deoxycytidine kinase inhibitors rationalizes the affinity-determining moieties of the molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 233
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jlmA00
1S1CA 2D7DA 4B3CA 5FTNA 4UJ5A 1ZINA 1M7GA 2CVHA 2ZETA 2BBWA 4PQRA 4BFUA 4D0GA 4C2TA 4BFSA 3R8FA 4QJ5A 4XJXA 3ONWA 3KUCA 4LC0A 4TZ6A 1R5OA 3A4LA 3Q3JB 3B8HA 4IW3B 1Q3TA 2YJTD 5AR1A 5FBLB 4D0NA 2XOKD 5H68A 4U02A 1XXHE 3KB1A 4M0LA 4NH0A 1DG1G 5DGXA 4BRWA 1NY6A 4QHYA 5FBQB 1N5JA 4PZYA 3KKPA 4G0NA 3GEHA 5FOWA 3AVTA 2WJYA 2VTKA 1OFIA 3K0AA 3THOA 5G3ZA 3BORA 1II8B 4JZKA 5J4HA 1F2UB 3N2EA 3J81k 5EZ5A 1G5RA 4WZAE 1CRPA 2OBNA 1TNDA 3A1SA 2VQSA 3GJ7A 2I1VB 5DIFA 1Z0JA 1YR6A 2Q3MA 2EVWX 2W83A 1TQ6A 4HB3A 1G3MA 4NYMQ 1E0SA 2NO0A 2QNRA 2HYIC 1KHTA 4URZR 1FL9A 3LFUA 2GJ9A 2GNOA 2A9KA 1ZIPA 4LYAA 1R0ZA 1R5NA 3IIMA 4LJ6A 1Q3HA 4KYIB 5FTMA 1FTNA 3KKOA 4N0DA 1G4UR 1TUEA 821PA 4D82A 1E94E 1CS4C 4V0ME 2PBRA 2R6CA 2XTNA 4OHVA 2F1IA 4M53A 4V0MA 1G41A 4A36A 1AK2A 1TADA 3LY5A 3ICEA 2QENA 2YOGA 4Q1AA 3EASA 4A9AA 2ERYA 1E9EA 2VHQA 4ASUA 1IQPA 4FD2A 3VNUA 4F38A 4HZUB 5CYPA 5DYGA 1GAJA 2O8CA 2WMNB 3PITA 2O8EA 1ZC4A 1K5GA 4EQ6B 1OPXA 4IHQA 2IK8A 4V0LA 2OFOA 4M9QA 4URWR 1FP6A 3KZ1E 1RE0A 2QPTA 4KBFA 2GJAA 4QBIA 3VKHA 1F5NA 4OI4A 4LBVA 2D74A 4C7OB 3KXLA 1OH6A 4E09A 3PIRA 3OIWA 5GVRA 3RS0A 2GVDC 2R65A 1X1RA 1GZSA 4II7A 1IN4A 4W5WA 4OI1A 3AF4A 5TB5A 3PCRB 2WWFA 2O0JA 3GJXC 3AF0A 1AIPA 2R6GA 5BXQC 4WW0A 4LPSA 2ZRGA 3W6NA 2HLDA 1KDPA 4WZBE 3C4JA 4ASUD 5FUVA 4Q1FA 3FMPB 1SXJB 4TL7A 5JMTA 2CL0X 2FX3A 5FUXA 2VP9A 3VQTA 1KSGA 2EFHB 2VHCA 3G5UA 3RRYA 3ZYCA 2RGAA 3T35A 1V5WA 4ZKEA 4EPTA 2J0SA 3MGCA 1JBKA 1VG9B 5JECA 1K8RA 1E2GA 4D4MA 4NDZA 5FTKA 2QM7A 1RRCA 2IYWA 3QKSB 5HR5A 4HAXA 4U7DA 1OIXA 5F9HA 1BO6A 1UEIA 2LCFA 1JJVA 2PH1A 5FTJA 1YZLA 3BIFA 2A3RA 5BN3A 1XJQA 2ZI4A 4TMXA 3H86A 4TQAA 2FJUA 3F0TA 5DN6A 5KSZA 4EPWA 2IF0A 1SULA 3GJ0A 5KTYA 2QQ0A 2BM1A 2CJWB 3EG5A 4LJ9A 4P4SA 2G0NA 1WXQA 2HLDD 2ZJYA 1L4YA 2OAQ1 2JGNA 2E9SA 4HAUA 4XWOA 4UNSA 3B1XA 3P20A 4AURA 1IJFA 1D8TA 3CRQA 1E9CA 1PV4A 1Z6XA 3LRPA 2IUSA 3FTQA 1VKJA 1I4DD 4B2LA 1UAAA 1E6CA 5DI3A 2WWYA 4GZLA 2WTUA 521PA 3K0CC 4PHTA 5LD2B 1MRSA 5FUYA 3X1WA 2C95A 2WOOA 1XFAA 2GESA 2CHVA 3NWJA 1AS3A 3OIYA 1YR8A 4Q1BA 3THXA 5JJIA 2AFIE 4IFEA 1CRQA 5DN6D 1OV4A 1XEXB 2AWNA 2NIPA 4DDUA 1HTWA 3U7HB 2IHYA 4WAUA 3QI2A 1G7CA 5KDDA 4GPTA 4HUQA 4M9ZA 4LWZA 4TLEA 4MYUA 2IYXA 3B1WA 2B8WA 3GJ6A 4HAVA 3NVAA 4GDFA 2IEZA 1DAIA 5AJYA 3MSXA 3SJBA 1S4QA 1D5CA 3KQNA 1FUUA 1JAHA 1R4AA 3QG1A 4H9GA 3U4QB 3SQWA 1DELA 1VYVA 1FW6A 2B92A 4FW9A 4QRHA 5FPHA 1E9SA 4R7ZA 4RD2A 1ZU4A 1EFCA 4XTCS 5GADl 3MJRA 4TL9A 3SYKA 2ZYVX 1KKLA 3DOFA 3W90A 1B23P 3AGPA 3K09A 3IQXA 3QBVA 3VR3A 2PJRA 3R9WA 2PT5A 4A92A 3MWJA 2KBFA 4QM6A 4JYCA 1AQYA 2ZI5A 3RNLA 1H8HA 4WOPA 3FDIA 4CIDA 1ZCBA 1M7HA 3CB4A 4Q5IA 2SHKA 3FB4A 4FWIB 3ZVMA 4CT5A 1YKSA 3TUJC 1XTQA 4HDQB 1G8FA 4JJZA 4EJSA 1HH4A 1KK2A 4TMWA 1FOEB 3MMPA 2IL1A 2BCGY 2I4IA 5IT5A 4C2UA 2BHRA 1YHNA 3JZMA 5KSPA 4FI3C 4ZV4A 2FFQA 2ONJA 1OFUX 5FL3A 2ZRLA 3SJAA 5JJKA 2XX3A 4U00A 1EFHA 1E2JA 5K8IA 3UANA 3UMRA 5FUWA 3CZPA 2CE2X 2EU8A 4TN1A 2QBYB 1TX4B 3WMFA 1DTSA 3HP1A 5LPNA 4LHYA 1NLZA 3SDZA 3V00A 4C0AC 2YOFA 3ZZTA 5HCNA 3IHLA 1ZAKA 1H8HD 1HURA 1CLUA 1N6NA 2EYUA 1J70A 4QHTA 2A7QA 2ZR9A 3R7WA 1CR4A 2HXYA 3AP1A 3OEHA 1E2NA 4KSCA 2Q9BA 2QL6A 2AK2A 5CK5A 4BZQA 4TZ0A 3RABA 4OK3A 4F4IA 4F7WA 3U5ZB 2AKAB 4OHYA 1BH2A 1W5SA 1Z0DA 3KUDA 3VX4A 1SXJC 2BEJA 2YOHA 4LC1A 2BV3A 2WJHA 2V6JA 3ZS9A 2N42A 3QNUA 1TPZA 4Q4HB 1C9KA 3LA6A 4TLCA 3W3ZB 1IN5A 2YC4C 1BMFA 3CH4B 2GXUA 5JRJA 4JL8A 2VSXA 2R6AA 4EIWA 2F6RA 4PPNA 3KFVA 1ODFA 3BFXA 4I1VA 2VO1A 3CX7A 1E2FA 1XTRA 3HYRA 4R98A 4ZCIA 3I4LA 2GCPA 2G3YA 4EQ6A 2CVFA 1US8A 3ZVRA 2EW1A 3OEHD 1XTIA 3K9LA 2ZE5A 1GNPA 4L8GA 4B3BA 5KYKA 3NTUA 3GLFA 3FE2A 4ACAA 4KODA 3EARA 2HJGA 3ND8A 3R20A 1P4SA 3PEYA 1N5IA 1NN5A 3K0FA 3UG7A 5CM9C 2FPKA 3U6BA 1CJMA 2NZ8A 3EIHA 4I4LA 4CF7A 4A0RA 5BYKA 5EQTA 2I3BA 3IKJA 3OEEA 4PX9A 4UQOA 4M1MA 2RKOA 1DAMA 2P0EA 1Z2AA 4JYBA 4QOSA 1BMFD 3A4MA 2EQBA 3PEUA 1KI4A 3MWKA 3PUVA 4V03A 2OBLA 4CEIA 2PZEA 4Z54A 1KY2A 5GJWC 1MO3A 5K8LA 1HA3A 1VMAA 4LHXA 1P60A 5C46F 2PMKA 4AG6A 4HLDA 4JLNA 1R10A 1RRPA 1PLLA 2IW3A 3OFNA 2O8DB 3IILA 3F8TA 1JEEA 2AD5A 1E9FA 4GP7A 4QGFA 3SJZA 3LO5A 1RC8A 1EWQA 4DRZA 3Q5DA 3O8CA 1NVUQ 4DLRA 5EUMA 2O0HA 1ZRHA 3NEJA 3EX7C 1JR3E 3OEED 4S2EA 3LDAA 1XEWX 3BB4A 3EW9A 3KKNA 4B6EA 2BBTA 5KDOA 1Z6AA 2GK7A 3C14C 5JEEA 4Q66C 1G16A 2GF0A 2CCJA 3U6KA 4MRSA 4DLXA 4QBFA 5JHGB 2WV9A 1I4TD 5KSOA 1TF5A 2GXAA 4MITA 1X8LA 4JBWA 4A8JC 5CLLA 4L4UA 3GEEA 3GLGB 3AM1A 3H0KA 4G5GA 1AJEA 1F60A 1X1SA 3OFND 5JSZA 3JVVA 3KFXA 3LXXA 1XZQA 2WIBA 2A5JA 1FTSA 2F1HA 4A2QA 3GFPA 1WQ1R 2ZROA 1U90A 3GMTA 4OQMA 2BKUA 4Q19A 4B33A 4E22A 3IHWA 3NIBA 4C9BA 1GWNA 2J45A 3ASZA 1DAGA 1LTQA 4M1KA 4RJLA 3BXZA 2VP5A 4O3MA 3WMGA 1E2HA 2JDIA 2QORA 2O5VA 1QHIA 3T1TA 3BGWA 1W46A 4MA4A 2NTYC 1W44A 5L3VA 3VMFA 3AVQA 2OCBA 2QP3A 4LI0A 5GVSA 1Q12A 5JWOA 3Q5EA 1QRAA 3BH0A 4EFMA 1UBEA 2FSFA 1GKYA 3B2EA 2G6BA 1KI7A 3BRWD 4M9XA 2IWRA 2ZJOA 2A5FA 3VFDA 3KQLA 1F3OA 4M22A 5J4YA 2F3RA 1R2QA 3V9PA 2QN6A 3L8YA 1K6MA 2BCJQ 4MGZR 1JJ7A 4JLOA 4IOJA 2JLRA 5B30A 5TV2A 2ERXA 1RZ3A 4NU0A 1SHKA 4BECA 2FH5B 3NBXX 4DB2A 4JLAA 4DCVA 2DFLA 2PX0A 3T12A 2N1BA 3CW2A 3TJZA 4ARZB 3TSOA 1M74A 2HT6A 2QRNA 3UMFA 2J46A 4MYHA 2HF9A 2BWJA 2JDID 2FPMA 3IO5A 3QE0A 2GZAA 2JJ1A 2RAPA 3LV8A 1XXHB 3HWSA 1U81A 4TLBA 3RLFA 2ZU0C 1UBGA 4DHEA 1Z8FA 4HDCA 4CW7A 2GZHA 1PZNA 1VCNA 1T0JB 2D2FA 4Q4JB 2BJVA 1Y63A 2GXQA 3CR7A 2X77A 2ZI9A 4NCIA 5K8UA 1XPUA 1YU9A 4JL5A 4Q4AB 3TVDA 4JLJA 1P9NA 2FSHA 4KLZA 1KJZA 2GXSA 4BEBA 4PC2A 4US2R 1P9RA 4HB0A 5E7JA 4HLUA 5SZKB 3K0EA 1LFDB 1T91A 1FMLA 2F55A 3T5GA 2HT1A 1BS1A 1AKEA 1OKKA 3REGA 1NN1A 5C4GB 1W49A 2C77A 3ADBA 1E69A 1Q0UA 2G1KA 1CJTC 4ILEA 4NYJR 2JJ1D 1E2LA 1UFQA 1XCGB 5L3SA 1OJLA 4BLSA 4FMDB 4HAWA 4A2PA 1UKZA 4DJTA 3GP8A 1U9IC 2O8FA 1L4UA 2P6UA 2C03A 2IXFA 3IGFA 3RS5A 4KITB 2ZU6A 3TAUA 3N5CA 4OHWA 5JRZA 4BPBA 2JLYA 1FUKA 2Z0MA 4LYJA 4AYXA 1RJ9B 2P6NA 4QXAA 1OXVA 1P5ZB 2QAJA 4OQLA 5LBIA 2IA5A 4OK5A 4NYIR 3FWYA 3E2IA 4PSKA 4O2LA 1OKKD 3MWLA 4N1AA 4Q21A 3QKRA 1SVWA 3PUWA 4TYNA 1R0YA 3CRMA 1FQKA 1O3YA 4UNRA 2C2HA 4LY6A 3QF4B 3AF2A 2JJ8A 2ZI3A 4M9SA 1OF1A 3H84A 2XTMA 1GRNA 4PXAA 4URVR 4AKGA 3TRFA 2ATVA 5AUPB 1XPRA 3T06B 5JI2E 4D4JA 4EPYA 2VHUA 5AUQA 5L3QA 1OXUA 1RRFA 3CNLA 4R2IA 2P67A 1N6RA 3QUSA 4HSEA 4Z1MA 4DCTA 1IM2A 1F2TB 4TYQA 4XVRA 3QEOA 3THYB 1DARA 5KUTA 4R2HA 2NO7A 1X8JA 3BD9A 3LQRA 1U94A 4H1UA 1KO1A 1GKIA 4WA7A 2QUZA 1IJEA 4A6PA 3BH7A 1NIPA 2ZRJA 3WHLA 4BGDA 2H16A 4ESHA 4KI0A 1AKYA 3BFVA 1ESMA 4FCWA 4HATA 1AGPA 2FG5A 3L0SA 3LNCA 2OLKA 2ZIAA 4IJMA 3WYFA 2J7PA 2OAP1 1KO7A 3ZQJA 3KJIA 2ZAOA 2J0UA 2IF2A 4FMCB 1M7BA 4FXPA 1E79A 2GEUA 2IYSA 2YNMA 4LJAA 3GLIA 4DIDA 3GLHE 1ZM2A 3GLHA 1G3IA 1YE8A 4Z1MD 4LBYA 4OJKA 2O8DA 1P3JA 4LV6A 2BMJA 1N3BA 2KBEA 4KFSA 4XVUA 1ZNZA 1E9RA 2FPLA 1T8UA 4BLTA 4RCZA 4IRUB 2IX3A 1ZU5A 4FCTA 4XSHA 2JCSA 1EX6A 2J87A 2V6IA 4S35A 4C0KA 4LUCA 4CEHB 2RGNC 3DL0A 4BFWA 2OHFA 5A4JA 2O8BB 2GBLC 4HAYA 4W5JA 3K8YA 1ZNXA 2YINC 4QL3A 3BJIC 4AWXA 1DAFA 4PC3A 4BQSA 1CKEA 2WPDA 2J7PD 1AZSC 2B7BA 1GL7A 4KVAA 4G5RA 3TE6A 1OSNA 5BYJA 2QA5A 1E79D 5EZ6B 2IYTA 2JA1A 3HU3A 2GZDA 1KIMA 1Z28A 4DSNA 4ZI3A 2W2VA 4B3XA 3VU9B 4QM7A 1K5DA 3FPAA 1KMHB 4A2WA 2CLDX 3LVRE 1JPJA 4MDFA 2BMDA 3QPUA 1ZYUA 4GOJA 5JCPA 3NC1C 5CITA 3S1AB 1TU3A 1KKMA 4NYIQ 5DISB 3TGPA 1E2QA 2ZRAA 3CF2A 4XOIA 3WBKA 3ADDA 1LW7A 2FSIA 3NDPA 3HR7A 1GOTA 2BIFA 2WHXA 4D6PA 3SS8A 2ZEJA 5H8WA 1Z06A 2ZYTX 1KSHA 3KTAB 4NCJA 1U99A 4LSGA 2F7SA 3P1JA 4TYYA 4NE2A 2X1VA 3TNFA 1DAHA 5LDDC 1G8HA 4RKFA 4P4TA 2WPDD 4F4CA 5JS8A 621PA 2WWXA 4RFVA 3B60A 1P2VA 1NG1A 3SFVA 4ZIRA 1ZUIA 1E2MA 2YWGA 4DWJA 3EXAA 1J8YF 2ZANA 2WZQA 3SBDA 3AUYA 4C0BA 3EWSA 2ZSAA 3OIVA 4B2IA 1B0UA 1F6BA 1OB5A 4IOKA 4LDJA 3M1IA 3IDQA 1E32A 1DBSA 4LYFA 2F3TA 3WBJA 1W1WA 3OHMA 4D0LB 1E2EA 2QU8A 4EPVA 3CR8A 2G9NA 2XXAA 2ZJAA 2A78A 2QTHA 4Q9KA 1W36C 2JLWA 3U2QA 5FPYA 2XZLA 4PSAA 3SOPA 2GVZC 3MRSA 4ACBA 4GOXA 2ZRFA 1WF3A 2GJSA 4R9UC 1CULC 3SYLA 2XNSA 4TSFA 1P7CA 5G53C 5M04A 2QZ4A 1NF3A 1HYQA 4JMPA 2C04A 2ZTSA 1W7AA 1VECA 4PQFA 3QXJA 4Q4JA 5C1BA 2VP0A 3B1VA 3TVTA 1QHYA 1KI6A 1QG2A 4V0NA 1N0UA 4BFXA 4B44A 2D62A 4Q4AA 3B7GA 3CF6R 4G01B 1II9A 1PVOA 4OJQA 1XTSA 2FOLA 3FHOA 3X1YA 5J4KA 4Q1DA 3A37A 3ZLJA 2MSEB 5HPYB 2GCOB 1NLYA 2VHTA 3AQ4A 4D4LA 3C41J 5J47A 2ZUBA 2NO9A 1IHUA 4TQUS 4A15A 1KI8A 1FPMA 5GJCA 4TSFD 4ZCLA 5CJPA 4O2RA 1DO2A 3HU2A 2FMXA 3ICQB 3NG1A 1GNQA 4OYHA 2OEPA 4UXIA 1S2MA 4L5BA 3ASYA 121PA 4EUNA 4D4KA 2VA8A 4JS0A 2ZRBA 3I62A 1EESA 3OESA 4DT1B 1SVOA 1JI0A 1WBDA 1HQYE 4M4SA 3LBIA 4V0OA 5FOUA 1QHHB 5FOSA 1DPFA 4C30A 1NNEA 4PAMA 1N5KA 4M8NE 5BWMA 1VHLA 4Q9LA 1SVMA 1D9ZA 1FX0B 1L2TA 2HEIA 3E5HA 2MSCB 3H2YA 3KDSE 2NPFA 3RRMA 1UJ2A 3E70C 4QKQA 3O47A 2V4ZA 4BFYA 2RH5A 2ZJ2A 1G8GA 4KFUA 4YQFA 2MSDB 3QKTA 1TTTA 3AVWA 1NSFA 4ZKDA 1JR6A 3NDBB 1KNXA 2Q21A 3K70B 4AY2A 5JS7A 1P2UA 3DPUA 1ANKA 4DSUA 1VCMA 1U98A 1YZQA 1QBKC 4FN5A 1S1MA 3ZD6A 3DEFA 1G21E 3PFIA 2PLRA 4IDPA 3PG5A 2OCPA 3TH5A 3W6PA 1MO5A 5FBWB 3KL4A 3NHBA 3I61A 4JBYA 1R5BA 2DB3A 1OH8A 4E5UA 4GT1A 1YZNA 2ZI6A 4TWZA 4GL2A 1F2TA 1YZKA 2OLJA 3DVLA 1DO0A 1IAQA 1UF9A 3RRNA 2GILA 1XD2B 4WIAA 4XVQA 1XMIA 1HY3A 3WNDA 1NIJA 4Z8XA 1YZUA 1VIYA 3TW4A 5JHHB 4DDWA 2AXNA 1S96A 4L9WA 2IYUA 1JXMA 3UK6A 4RZUA 3ZIAA 2ZS9A 3ADKA 1P9WA 4B32A 1T9HA 3MWYW 2RGXA 1QHXA 3Q7QA 2P65A 1Q1QA 4X8OA 1NKSA 2YYZA 5SZJA 4C0LA 3QPVA 5TY0A 2IS2A 1Q20A 4US1R 1FNNA 1NMXA 1KI9A 1KMQA 1G6OA 1P62B 1PJRA 4OI2A 4Y0VA 3SZRA 2V1XA 5LB2A 1QF9A 3VR6A 1RYHA 3A1WA 4GZMA 3VNVA 2G88A 8OHMA 4KFRA 2D4HA 3VR4A 2JLUA 3FVQA 1G7TA 4FIDA 5FBVB 2QTVB 2WMOB 2BDTA 2WJJA 3C16C 5KSYA 3A1VA 1N2CE 3KJGA 4MH0R 2QMUA 4TT3A 4Q7KA 1G8YA 1UDWA 3ZIAD 3RVBA 1DE0A 2WWGA 1OIWA 4DSTA 3NXSA 2GTPA 2BMFA 2QMHA 1ESNA 3SC3A 1XX6A 4HYYA 3L8ZA 3IO3A 4EJSC 1P6XA 2ZR7A 3FMFA 3WNBA 1KMHA 3B9QA 2ZYUX 2UVQA 4LGMA 1TUIA 2WAXA 4A8JB 3LVQE 3DMDA 1E1QA 1GVNB 4P3YA 5DHFA 3RHFA 5A0FA 4KJZA 3UATA 2QAGA 2G1JA 2PZFA 3EPKA 3C5CA 3PR1A 3ZDQA 5EE0A 1G4AE 1VG1A 4GOKA 4DSOA 3KKMA 2BVNA 4DLSA 1PLJA 2CHGA 4EAQA 4TT3D 2VHJA 1GDDA 3I92A 2JLZA 1TU4A 3NC0C 4RZ2A 1AGRA 3B1YA 1G3QA 1W2HA 3GD7A 4UNPA 3BBPA 3AVYA 1Z0KA 4V0KA 1PUJA 2RHDA 3DO6A 5GJVC 1VYUA 1PUIA 3WXMA 3PJRA 4TYPA 6Q21A 5JCZA 3LX8A 2ZYWX 3EPJA 2ZS7A 4OHXA 4HB4A 3DM5A 4LCBA 2Q9AA 1OH7A 1ZW6A 2EYQA 1SKYB 2C98A 4ZDIA 2JLSA 2PCJA 4KCGA 4IDNA 5DH9A 2FFAA 5BQ5A 4C0QC 2V7QA 1GTVA 1E1QD 1II8A 5CLQA 4DLYA 1KK1A 4P0TA 4CYMA 3GPLA 1GRQA 1F2UA 2ODNA 2ZRIA 2BM0A 2W6JA 5DHAA 3DM9B 3T15A 5JEDA 1IN6A 3VHLB 2ODBA 3KQHA 2FE4A 2QSYA 4UKDA 1U0LA 1VTKA 3LXRA 2CL6X 1Z63A 3D7MA 1EFUA 4N3NA 3DKVA 1U0HC 5B57C 1KI2A 2NPIA 1N5LA 5EP3A 1X8KA 4NTZA 1E0AA 4JLBA 2QGZA 5D3QA 2FGKA 1WRBA 1ETUA 2H8KA 3BERA 3RS3A 1N0WA 3DZ8A 3FMOB 4PSVA 4DUGA 3K70C 4Q47A 1WBBA 1VHTA 1S3SA 2AR7A 2WKQA 3CONA 4RD1A 4YMUA 2QEQA 2V7QD 3IEVA 4OK6A 2BKEA 5FR1A 4BRUA 1NY5A 3QY0A 1IBRA 1W4BA 2C9OA 2Q3FA 2JLVA 3BS4A 3TK1A 4TMKA 2QP9X 1GP2A 3W3AA 2ZRHA 2W6JD 3A1TA 4HZUA 3SHWA 4BFZA 3VR1A 3HR8A 3LH5A 1ZJ6A 4I1SA 4LK2A 5KPJA 2AHOA 4US0R 1ZC3A 1ZM7A 1ZP6A 3PUZA 3W34A 1J90A 2DFKB 3LWNA 2ORIA 1LF0A 3V4FA 2D3WA 3GLFE 1ZM9A 3KB2A 1TEXA 1XD8A 1XMVA 3PUXA 2FDCA 2FFHA 4TQ9A 4F92B 4CEJB 2GKSA 4C7OA 1ZD9A 4LYHA 2AXPA 3T1VA 2ZRCA 2X8AA 1LY1A 2FF7A 1KOFA 2JLXA 1R8SA 1CXZA 1J2JA 4DUGD 1QHHA 3GJ4A 1SHZA 1YRBA 2GK6A 5CM8B 2XSZA 5JI3E 3TUIC 2QT1A 1VG8A 4Q9JA 2H17A 2IYZA 2RHMA 4KHZA 4TTQA 3W8RA 3MFYA 4A0GA 1Q1ZA 1XJCA 4TMTA 1SXJA 4TMVA 3UMSA 3OE7A 2FGJA 1G19A 2VL7A 3QVVA 1W5TA 3G82C 5KO2A 4M1TA 4LV5B 1XU4A 4BE7B 2GRJA 2XEXA 3IUYA 2JAQA 4RD3A 1XWIA 3U3OA 3BB1A 3W9YA 3EZ7A 3CBQA 3B1ZA 5EE9A 4RFSB 5P21A 3AVXA 2XTZA 3IQWA 2PCLA 3RRZA 5JLJA 1Z0AA 4EPXA 2QGNA 3QKSA 2YZ2A 2OFXA 1G9XA 3TR5A 1TAGA 4HB2A 1GL9B 3MUFA 4BZPA 1OYYA 4BWYA 3PVSA 2QMOA 1XB2A 5A5GA 1DEKA 3FHTA 1N6OA 3AVVA 5CIQA 4IFBA 3IBGA 2XSZD 3LQQA 1MRNA 2RGGA 4BLPA 2G83A 1IY2A 2ZAMA 2VSFA 3BC1A 5JJLA 1NJGA 2CJWA 1Z2CA 4LHZA 1GRRA 2QG6A 4JVLA 3VR5A 2V1UA 5AJXA 3M0EA 4PZLA 3RWOA 2B21A 1NP6A 2FEMA 4BASA 1QHNA 4CRWB 5JWRA 1SXJD 1Z0IA 3OE7D 4NHOA 1TL7C 5E3HA 3U61B 1BKDR 2CXXA 3U60B 3PEVA 4GBMA 3U3JA 2UKDA 4OBEA 4LBZA 2F43B 4DDTA 1XDBA 1OXXK 1XD9A 3UWOA 3UKDA 2OCAA 1MABB 3LLMA 2RGCA 2NG1A 5UKDA 4HUTA 1G17A 4OI0A 3AKEA 4IKEA 1NVXQ 3BAFA 4B34A 2G77B 1OHHA 1R7RA 4LJ8A 3N2IA 2QY9A 3GJ8A 3B78A 2BJWA 4Z51A 1G7RA 3A36A 1OFHA 4OHZA 1UBCA 1Q22A 2V3CC 1RIFA 2HJVA 3U44B 1EG7A 1XEXA 2WVJA 2HYDA 2KSQA 2Z4SA 2FZ4A 2IC5A 4P31A 1GL6A 4HDOB 2VF7A 1Q57A 2RGEA 2ZRDA 3X2SA 1UKEA 1MO4A 4MKGA 5H70A 3RSOA 5EXTA 1EK0A 1HV8A 2KWIA 3P26A 1T5IA 1E1RA 3L82B 3BH6A 3SN6A 3U4QA 1XMJA 3L43A 3U3KA 1W0JA 3VKWA 3NH6A 1ZD8A 3L2OB 4LRWA 2C5LA 4B6FA 3X1DA 3FOZA 5HCIA 3P4XA 1GSIA 4TL6A 1NMYA 1OHHD 2PL3A 4PPFA 1YQTA 2REXB 1ZM4A 1KI3A 5DSZA 3SJCA 1W48A 2IYQA 4PO9A 1YZGA 2CL7X 4POAA 4CVNA 1CF4A 2YV5A 5DI9A 3BB3A 5J4LA 3QF7A 1G5TA 3K0AB 4IOMA 4LV8B 1RRGA 4NL4H 4XWAA 1SVLA 3SNHA 1JECA 3UIEA 1MOZA 4C0SA 1JQLB 1Q21A 1T5LA 2WWWA 2ZSDA 4AKEA 3CPJB 1E1RD 3TKLA 4B2PA 5KNCA 3CO5A 3I1FA 3FGNA 4MKFA 3CNOA 4PPQA 5EE3A 1AS0A 1W0JD 4MGIR 4TTPA 721PA 2VH5R 4Q03A 3VX3A 1OE0A 2YHSA 3FMIA 1KK3A 2EWWA 2D2EA 2HXSA 3FYHA 2CEAA 5KHOC 4EFLA 5C4MA 2QBYA 1DOAA 1S9HA 3OF5A 1N6IA 2E1RA 1NBMA 5JFGA 1NVWQ 5L8VA 4HLQB 1DVRA 1MR3F 4C0JA 2FFBA 3GQBA 4AYWA 1J8MF 1N0VC 2IYYA 3EZ9A 5FTLA 2GETA 2PX3A 5TARA 1W36B 2DY1A 3GJ3A 3MAAC 3K1JA 4MRVA 3WRXC 1S8FA 3CZQA 2J5XA 2ZJBA 1HQCA 5F3WB 1KI1A 5EP4A 1Z5ZA 2W0MA 4M21A 3P4YA 3DDCA 2OG2A 4JLVA 2J0VA 2UZ3A 2O8CB 2NO1A 1MV5A 2O8EB 4KU4A 1NJFA 4HAZA 4PZZA 1II0A 2YWHA 4DXAA 1UM8A 2IUUA 1KO4A 1IY0A 3KKQA 1J7KA 1OFTA 5B64A 3LW8A 4YONB 2R8RA 1U8YA 2AKYA 1KY3A 1ZUHA 3LLUA 4Q7JB 4Q4HA 4UXHA 1A2KC 2Z43A 3A6PC 3RS4A 2ZUCA 2ZSEA 1TF7A 1NBMD 1YRAA 2I1QA 5C18A 1NSTA 4YMTA 4HLCA 2GDJA 3Q8XB 4IEEA 3TBKA 4TTRA 2ZVPX 2NQ2C 1HEIA 4LPKA 3SR0A 1EWRA 2WBLC 2ZE8A 3M6AA 1EX7A 1LF5A 3WRYC 4DZZA 3EPHA 4PHGA 1G3UA 2Q9CA 3JZAA 4XIGS 2PEYA 2QP4A 1HUQA 4C4PA 2FA9A 2FZLA 3AKYA 1D2MA 2D7CA 1IN8A 5KU1A 4Q4LA 2V8OA 1V43A 1E96A 3RS7A 4ON9A 4DIEA 1G5PA 1U9IA 1VYTA 2ZRMA 2X19A 4TL8A 3PXGA 1GUAA 2PJZA 4PAOA 3U3RA 1JXOA 3D3QA 2JEOA 1QHSA 1AQUA 4PC6A 2VP4A 1C1YA 4A1FA 5DNYB 3GCGA 4LJ5A 4I1OA 1NMZA 3Q85A 4Q9HA 5AJVB 1CIPA 1CTQA 2IS6A 3GLIE 4MKIA 2QT0A 3HPRA 3R8CA 1BOFA 2XJ4A 2BC9A 4DLTA 3I5XA 1T3LA 2BOVA 1A82A 1GILA 3A8TA 4D25A 1Z83A 2YVUA 2OESA 3AH8A 4DLVA 3LBHA 4OQNA 1NL3A 2CBZA 4JL6A 2HUPA 4AKIA 5DI3B 1M6NA 3MCAA 2GAAA 4M1WA 2XNDA 2FN4A 4ITRC 4NYJQ 4QJ3A 4NCKA 3K0SA 2O52A 4BFVA 5EP2A 4IDOA 4NBSA 2IXEA 2WKRA 1ZIOA 2FNAA 2Q6TA 2QPOA 3Q72A 3NH9A 2C78A 3THXB 221PA 3LAWA 4CGZA 2DPXA 3WNCA 3KXKA 3GEIA 3DKPA 4GNKA 2DWQA 2CDNA 2F43A 2FV8A 2FWRA 4HUQB 5EE5B 4QHSA 3GLGA 1KAGA 2XZPA 2OCYC 1E2KA 3AKDA 1KNQA 1G64A 1GKUB 2ZUDA 2GEDA 1UKYA 1A7JA 2K5UA 2QQEA 4UNQA 4W7SA 1M8PA 3PV0A 4RKEA 5CB6A 1W4CA 1GIAA 3MJHA 3EA0A 2XNDD 4F93B 5KOYA 2P2LA 3ZVNA 4JVNA 2RB4A 4LHVA 1F48A 3SFZA 3WMEA 1KJYA 3AF3A 3I72A 4X8HA 3AVUA 4A4DA 4AKHA 5G3YA 3TSZA 3IIKA 3DOEA 4JLPA 4DLZA 4Q1CA 5IRCD 2GHIA 4ZPXA 5FI1B 5FI0B 3QXHA 2GBLA 1KZGB 4TLDA 2ZJZA 2AD1A 1CU1A 5DO9A 1G291 2B7CA 2HF8A 4YMSA 2C8VA 4MRPA 1G3RA 4BLQA 1NLFA 4XSGA 1CR0A 3PUYA 1TQ2A 4EJSB 4PR0A 1YR9A 1TMKA 2QE7A 1XCMA 2REOA 1GG2A 4I81A 4ARZA 3TLXA 3FHCB 2BEKA 4RCYA 4B3FX 3K53A 2VLIA 4Z8YA 2RMKA 4QC2A 4Q01A 1RW4A 2QMEA 2IBMA 1TEVA 3KJEA 1W0KA 3PENA 1XXHA 4Q9IA 2ZXUA 4ZO4A 5E7IA 1S3GA 4M1SA 3V4RA 1XTKA 2QM8A 5FPSA 2XITA 1LV7A 5B2ZA 3AVPA 1LNZA 3B6EA 4GFDA 4DC9A 3THWB 1L8QA 4G3XA 2J59A 2BMEA 3EWAA 3QXSA 1EFRA 2C96A 2HV8A 4B73A 3AF1A 3TSWA 2F9MA 3R7WB 2ANBA 2R62A 4KLNA 1KK0A 2GCNA 1Q44A 4KV9A 2QROA 2QE7D 1XF9A 1G1MA 4I99A 1KO8A 1R0WA 1E4YA 4KSBA 5CYOA 3X1ZA 3RC8A 1ELOA 5JWHA 2L0XA 1T8TA 3VHXA 3EZFA 4CZ2A 4PC1A 3EIEA 1W0KD 5HE8A 5FFMA 2HCJB 3D8BA 2A5GA 2J7KA 4ZDJA 1CP2A 1G7SA 2ASEA 3FFAA 4PAQA 5AJWA 2QTFA 2ZRNA 3EZ6A 3CX8A 2P6RA 1RVDA 2YC2C 1AA9A 4KXFB 2OE2A 2ZR0A 1LS1A 2GJ8A 1OT3A 2XZOA 1RFLA 1X86B 1RJ9A 3RYTC 1EFRD 2B8TA 3C8UA 2HDNB 4ZDWA 1US8B 2OV2A 4QGAA 4DEYA 2J3EA 1S0UA 2NGRA 3A1UA 3U7GA 4Q48A 1X6VA 2GEVA 3CKLA 1G8PA 3IPXA 2F9LA 3GLFB 5LB4A 4AG5A 5C2JB 5HTKA 3QXXA 4P4UA 2CLCX 1SVIA 4AK9A 3K0FB 3BWDD 3MG9A 3QF4A 1QVAA 3CRW1 4G1UC 3DZDA 5G40A 5HKKA 4NPHA 5BW8A 4B43A 2R6FA 5FBRB 1W36D 4L9SA 4JSTA 4PO1A 3IPYA 4Q18A 4PC7A 1BIFA 2V55B 2GWHA 1MH1A 3SHFA 4DVGA 3QXCA 1FMJA 4CEIB 3P27A 3U7EB 2CLSA 3LD9A 1JEDA 2XAUA 4QNRA 1G20E 3RANA 3NBZC 4FWTA 3THYA 3G0HA 3IEUA 1E2IA 2VPPA 5HZKA 3W6OA 1YVDA 3AVOA 3NBYC 1Q1BA 1QHGA 4LBWA 1N6PA 1NN0A 1P2TA 4M1YA 3UPUA 4B74A 2V9PA 1W2GA 1E2DA 4DCUA 3EA5A 3L0IB 5TXGA 3CH5A 2PLFA 1N25A 4JJKA 4TLAA 5IK2A 1JB1A 5JBQA 2EFGA 4JVSB 3TMKA 1S9DA 5HKKD 4LJ7A 4MDEA 2WSMA 4ERNA 1TQ4A 1ZNWA 4LOAA 1XZPA 3Q9LA 4IVQA 4J0QA 5F2EA 5AUOB 1NG9A 3E1SA 1T3HA 4GMDA 1HT2E 1ZMXA 1IXSB 3T5DA 1JAIA 4YXWA 4IVRA 2DWOA 1GFIA 1J99A 4URXR 4NZYA 1MKYA 3QSYA 3VR2A 4FMDF 1OB2A 2IYRA 4CEHA 1BYIA 2ODEA 3I3SR 3K09C 421PA 2IUTA 1AZTA 4B47A 2O8BA 2F1JA 5JSZB 2QAGC 2ZI7A 2XJ9A 5BN4A 1D9XA 2IYLD 1G18A 5B58C 3AUXA 5IK2D 4ESVA 1Z6GA 2ZREA 1ZCAA 5TVKA 5CK4A 4QBHA 2GJKA 2P5SA 4Q02A 2J1LA 2CCGA 4LZZA 3T1OA 2JLQA 3A4NA 4B75A 3AB3A 3HPQA 4NONA 2DFNA 1NKTA 2YWFA 3VU9A 1N6KA 4QFMA 4E03A 1N6LA 2ATXA 2JJ2A 2H18A 3EIQA 3BFKA 2QI9C 2BBOA 3CF0A 5CB8A 5KNDA 2WKPA 1CEEA 1QVRA 1UPTA 4YXWD 3S1AA 4MYCA 3K0CA 5FOXA 1XEFA 4MGKR 3OAAA 2CE7A 2LWIA 3C15C 1FP7A 4ABYA 2VF8A 4DDVA 4AC9A 1XPOA 3QKUA 3T1QA 3KTAA 1KSFX 1UADA 2ECKA 3SEAA 1XTJA 2FEOA 4PANA 4MRNA 2H92A 1X3SA 2GA8A 2VIIA 1GITA 4MGYR 3TQFA 2VEDA 2CNWA 1SQ5A 1IXZA 4DKXA 2ZE7A 2RCNA 3SQXA 3BK7A 1P2SA 1OXTA 3ZGXA 1XBTA 1H8EA 2DBYA 4I1UA 4D80A 2ORWA 3H1TA 4D26A 3FKQA 2IT1A 1EFTA 3CX6A 2JJ2D 1ONBA 2WICA 3SBEA 4B35A 3QVUA 4B48A 2WIAA 2Z5FA 3ECCA 4KFTA 2NOAA 4PFSA 2LKCA 3EC2A 3QPWA 4FMCF 3VKGA 1AN0A 2W58A 3CLVA 3R9XA 3OAAD 1E99A 2XB4A 3VTKA 4B76A 4L15A 3D6TB 1CBUA 3I5YA 1XJ0A 1O87A 2H7VA 2OFWA 3B5JA 2ZJ8A 3QIAA 4OKSA 4OQFA 1MO6A 1W4AA 4DCNA 3UXMA 2ZS8A 1ZBDA 4X8MA 2IS1A 3CUEF 4M1OA 2LKDA 1WCV1 4KYUA 5CDFE 1I2MA 2CNWD 4EFNA 4DCSA 5CDFA 4YC7A 2GF9A 1ZM3A 3K9GA 4OL0A 2WJVA 3B85A 3MLEA 5TDHA 3QG5A 2B6HA 1H8ED 1XNJA 4IEIA 4IDQA 5AUNB 3THWA 5L3SB 3KJHA 2YKGA 1NRJB 4O25A 4PHHA 1OXSC 1UDXA 3FFBA 2O8FB 2D06A 1KO5A 1YJ5A 3WYGA 2DHRA 3AKCA 4XWKA 1C4OA 2GCOA 4DLUA 4G5QA 4BEJA 3KQKA 4AD8A 1U8AA 5FOVA 3Q7PA 5E95A 4FINA 3OIUA 2TMKA 1NI3A 2OSBA 3NEYA 5EJEA 2ODWA 2J0QA 5H1YA 4HI0E 1SVSA 4KO8A 2RGDA 4A6XA 4AIIA 5K8TA 3RS2A 1P72A 4NCNA 3T34A 3WP0A 4O0MA 4URYR 3W5JA 3O8BA 1DAKA 1VG0B 2C99A 5DE3A 2X2EA 3KX2A 3QKRB 3GJ5A 2WOJA 2O0KA 3LBNA 3PQCA 1Q1EA 3T61A 4DT1A 4V02A 2WWHA 2EFCB 3BE4A 5DLQC 2CHQA 2R44A 1VCOA 4AYTA 3AP2A 2P5TB 3TUZC 2R6DA 2REBA 1FX0A 1T3SA 1DG3A 2OZEA 2IHBA 1VCIA 5L3QB 3HDTA 5D3MB 3IBYA 4EDHA 2J41A 4D81A 3REFA 1SXJE 4L16A 3AGQA 1TF2A 4PTLA 5E4FA 2R2AA 2W6IA 4BZXA 2FSGA 2Q0HA 5FOTA 1NVVR 4HZIA 5FL7A 3TAHA 2QRZA 2N46A 2GAOA 1A5TA 1HT1E 2OBMA 3C7KA 4D2IA 3A58B 1P75A 2PMDA 3ND9A 4F4JA 4EKDA 4JT4A 3WYAA 1WDTA 4K8OA 3KXIA 2VP6A 1E2PA 5HZHA 3QENA 4RSGA 3CPHA 2Z83A 2Z6VA 4IVPA 2XB2A 2KI5A 4MUAA 2A5DA 2J0UB 5LD2C 1DS6A 1EGAA 3HYTA 5TMPA 5IHPA 1XD2A 1LB1B 1WA5A 3N70A 3GLIB 1CJVC 5GJBA 5FH9A 1E4VA 3GLHB 3TW8B 2DWPA 5HE9A 1GNRA 4XTRA 4KBGA 5IDVA 3ZZ0A 2W6ID 4DLWA 1P73A 4Q1EA 3K70D 2Q3HA 2VP2A 2ZQ5A 5FL7D 4PPGA 4NMMA 3W8NA 5SZIA 2OXRA 1LS6A 2KB0A 1T6NA 3F3YA 1IONA 4BLRA 1YR7A 5ELXA 2EWVA 3AEZA 1JR3A 1LVGA 1GM5A 3RSLA 3UG6A 3HU1A 3CIOA 1UKVY 2WJGA 2W00A 2IYVA 2YWEA 3AP3A 3VAAA 3WP1B 2EFEB 1FNMA 5KPDA 2ZM5A 4RD4A 2ZSFA 4XH9B 4BUJA 4B71A 1T0HB 1Z29A 1R8QA 3QOFA 1JPNA 4WVFA 4QJ4A 5EXXA 1CR2A 1R0XA 1Z6YA 1CJKC 3CWQA 2CCKA 1KDTA 5AJZA 3M4YA 1W4RA 2JASA 1OIVA 4DB4A 3C5HA 1OH5A 3TR0A 4ZDKA 1Z0FA 3EPLA 1WE2A 2OM2A 4X8LA 1U0JA 1AM4D 2G0TA 3ADCA 4NKRA 1P61B 5CIWA 1SVKA 1JR3D 3GFOA 2W2TA 3LX5A 4LJYA 3UWKA 3ZJYA 1E9BA 2WSSA 3GFTA 4RZ3A 2VBCA 3I8XA 5ANRB 4A8JA 4HLUC 4ZIRB 1KDOA 1KGDA 1KJWA 1JALA 3QQ5A 1ZVQA 3QEJA 3WY9A 3U7FB 2WAYA 1NVVQ 1VIAA 2OT3B 3RAPR 2BBSA 4ZCMA 2DFTA 1IXRC 5FR2A 1FZQA 2Y8EA 1CJUC 2XXAB 2JATA 3PEWA 2ONKA 4DEXA 2WWIA 3CRRA 4KVGA 5SZHB 4FMBB 4Y0AA 5E7MA 4CT4B 4UXJA 1ZD1A 2ZPTX 2NZJA 4B3GA 3B13B 1SKYE 2AK3A 4QNMA 2WSSD 4WBSA 1L7VC 5JZVA 4R71A 1ZNYA 3ZQ6A 2NMVA 3CRVA 4PHFA 2NO6A 4BLOA 4GRAA 3HJNA 1NBME 1WB9A 2AL7A 2VRWA 2P3SA 4OQXA 1KI6B 1E9DA 1I2DA 1KAOA 2DYKA 3B9PA 1XEWY 4JKIA 2W0SA 2WJIA 1ZUNB 1XMSA 1A1VA 4MKHA 4UNNA 1QZXA 2MMCA 2ORVA 1XRJA 1U8ZA 1Y3AA 4F91B 1IN7A 1OW3B 3OZXA 3TIFA 5F98A 3ZH9B 1SKQA 2AX4A 3D31A 4ZI2A 1M2OB 2F1RA 1IOZA 1A2BA 1PLKA 1VDZA 1I4LD 3KQUA 3K9NA 3ZVLA 4Q7MB 1RKBA 5KNBA 2R9VA 4LX0A 4IOLA 2C9YA 2H57A 4WZ6A 4B3DA 4PO8A 3SYNA 4A0FA 1Z6TA 1M34E 2DR3A 4FCVA 4N0EA 5CJ2A 3H4MA 3X1XA 2XGJA 5F9FA 4BFTA 2WM9B 4QGHA 5EUQB 1H65A 5EXSA 4JVMA 4YDHB 1EXMA 3K9HA 1XP8A 4IXMA 2Z4RA 2JIZA 1Z08A 4JBXA 3EZ2A 3I32A 3IIJA 3RC3A 1VPLA 2DCUA 3L0OA 3FKSA 1M1YE 2ZE6A 3NBFA 3ETLA 3BOSA 2A2ZA 3R9IA 1U2RA 4JT2A 1OYWA 2FU5C 2CK3A 4EPRA 3P32A 1AS2A 1WP9A 2W2XA 5J5CA 3CPEA 2C9CA 2UZIR 1D6JA 4CEJA 4QBGB 2VSOA 4W5HA 2J9RA 3QBTA 1IY1A 3SI7A 1SZPA 4IDHA 2PEZA 2ZSBA 4HEJA 4W9MC 4H1VA 3CWZA 3O8RA 5AK0A 4KAXA 4NP6A 2ZJ5A 1KZ7B 4JIMA 1COWA 4G5OA 1A4RA 4MQBA 5AWFC 5D3MA 1WMSA 2H5EA 2JIZD 4TYWA 5EE1A 3SU8A 3ZS8A 4K81B 1JNYA 2RGBA 4YLGA 2IS4A 1KSJA 2KE5A 4U5XA 4JLMA 2AFHE 3AV0B 4K46A 5DYIA 3NKVA 1Z07A 1E3MA 2H1LA 3B82A 2OO7A 3FKSD 3LW7A 3QJYA 4P4SB 1G6HA 2X2FA 4MYTA 5KDLA 2OILA 2CK3D 4RFSA 1UEJA 4P32A 2QPAA 4RD6A 4JKYA 2IWHA 3U3MA 1BYUA 1TQDA 1SGWA 2PT7A 2A5YB 1HE1C 5FPTA 1DADA 2IXGA 4PQYA 2PZGA 4JSYA 4LHWA 4JLKA 1OLOA 1KYIA 3NHAA 1HE8B 3EC1A 1E0JA 3O8DA 4GSYA 4M2LA 2ZRKA 4XD7A 4A0HA 1JQJC 4NYMR 3MD0A 5FPKA 2OXCA 2CMKA 1N6HA 4GP6A 1D2EA 1RYFA 1T4GA 2V54A 2ZRPA 2ZVQX 1UBFA 1COWD 1KDRA 2AN9A 1RPZA 1E9AA 4RY2A 1QDEA 4LJ4A 1R6BX 5G41A 3ZZUA 2OUKA 4A82A 4QGGA 3WHKA 3L0PA 1FQJA 1YZTA 4YDSA 5BN5A 4GI7A 1W47A 3F5FA 3RWMB 1DAEA 4YMVA 1NN3A 1CR1A 1KTVA 4JLDA 3EAQA 3W5IA 4G5SA 3GLGE 4TMZA 1E98A 2IEYA 2KJQA 4RZXA 1Z47A 4NCHA 1MABA 3JVUA 3SE0A 2A30A 1E0KA 5J4VA 3CM0A 3I73A 4UJ3A 1FFHA 4RD0A 1XCPA 1MT0A 4QG7A 5IF9A 4XD7D 2VYFA 4P33A 2ZITA 4YMWA 4RVCA 3I8SA 4IXNA 2AWOA 3RDPA 2XOKA 3U44A 4CDGA 4AI6A 4C0HA 4E07A 1Z3IX 4C3ZA 4MRRA 1Z22A 4WXRA 2QSZA 3CNNA 3DMNA 2HCBA 4DBLC 5EP1A 2ANCA 2MMGA 2RGNA 3DHWC 2EFDB 4MUBA 4Q7LA 5L3RA 3TQCA 5J40A 1D2NA 4URUR 1QG4A 3ZD7A 4Q00A 2QAGB 4WXPA 5EXPA 2E87A 4GMXA
chains in the Genus database with same CATH superfamily
2BFNA 3T7RA 2EC5A 3KS9A 4IQ4A 5KCZA 3FUXA 4DSAA 2WW8A 1M7GA 3RSHA 4F5YA 1WKCA 1EUDB 2G4CA 3DFFA 4D0GA 4IEFB 3H4VA 1D5WA 4LC0A 1WU7A 4EGFA 4E7PA 3K0HA 1W88B 3B8HA 5FDFA 4GM0A 4RGQA 3MTBA 4D0NA 4DBLE 2D54A 4QXMA 1Q74A 3O9VA 1Z6PA 4RNDB 5H68A 3ZW8A 4PGAA 3A9RA 5I9NA 3BX1A 3AFNA 1DG1G 2Z2JA 3F9CA 1Y0BA 3GAMA 1FRZA 3BMQB 3JQBA 3PA8A 4ER7A 4QHYA 3CUVA 5CFNA 4WLEA 2WD7B 2Q8NA 4JQOA 4D43A 4FDAA 2WJYA 3FDFA 4O0LA 5G3ZA 3BORA 1II8B 4GPIB 5B1EA 4LCEA 2G9RA 4RHUA 1F2UB 1UC8A 3N2EA 5J4HA 1O97D 4AS1A 4WZAE 3GGPA 1CRPA 1U1CA 1ISRA 1XI2A 5EHIA 1V37A 2AZXA 3TZ6A 4RM2A 2GYUA 4DFDA 3ISTA 4HB3A 3ZV3A 1G3MA 4G41A 1YZFA 3OE4A 4EITA 2NO0A 2Q3DA 3BK1A 5T6MA 3WSWA 2HYIC 1LW6E 1BFKA 1WCXA 5BMVB 3DAPA 3LFUA 3PJFA 2GNOA 3K5WA 3EXIA 2P78A 2C88A 4V1CB 1Q3HA 1BZYA 1OBVA 1Z17A 4E31A 2CL5A 1J21A 2B5VA 2WU8A 3N8NA 2C3UA 3MMZA 5CRIA 5KYUB 3SVLA 1CS4C 4LMRA 4V0ME 4PF1A 4Y0NA 4V0MA 2VBGA 4UARA 4QU8A 1LJUA 4H0NA 3RU7A 3WGGA 3EASA 1I7NA 4NG4A 5A5VA 4G9BA 1E9EA 4ASUA 2X8LA 3VVLA 3WWDA 2Q5IA 1Q17A 3Q0IA 1DEOA 4LG1A 1ML3A 5K20A 3EIXA 1GV1A 2FWJA 3ZHOA 1T9GS 3PITA 1ZC4A 3L7IA 5F23A 5PNTA 4EQ6B 1V8PA 4YBRA 4JHLA 3SC2B 3R5HA 2JAHA 1P4JA 5CA0A 3DW1X 2UYHA 2UYQA 4HVAA 4U8HA 5E7QA 4BCCA 1HE2A 2WFMA 1IRIA 3BXOA 3G2PA 4KBFA 4QPNA 1F0NA 1KOLA 4CHTA 3ZKWA 1F5NA 4CIYA 1DGQA 1E6UA 4Y1RB 4C7OB 3KXLA 4CUJA 1OA0A 1OH6A 2Y6VA 2QT9A 3E9EA 3GBVA 4JCOA 3RS0A 1ILEA 4WKNA 4E7OA 3H05A 3W2GA 1GZSA 2W22A 4II7A 3UXEA 2FQQA 1IN4A 3TD2A 3A2MA 5K0NA 4GE0A 2A59A 1ENZA 3GJXC 5DNAA 4E33A 1AIPA 2R6GA 4IV5A 2YIMA 4P3NA 4LPSA 1A04A 4QJIA 1X13A 3UAXA 1IG0A 1M8FA 1VKNA 5GOZA 4R1MA 1JQKA 3C4JA 4BFCA 1QPGA 5EIHA 3KELA 1FA9A 5A2QA 3ROGA 3BZWA 1RM5A 3DLIA 3MWEB 4P38A 4TL7A 5JMTA 2DULA 1E5QA 5DIZA 5B3JA 3VQTA 3WNZA 3ZW7A 4ENTA 3ZYCA 4XGRA 5DYIA 4TV8B 2MSNA 2P69A 1L8XA 3COPA 2P62A 3HJTA 3OZTA 4FYHA 4R54A 4AZ0B 3SVTA 2J0SA 2EHJA 3MGCA 4Q82A 2FMUA 1L5ZA 1VG9B 3CG4A 3ZJ4A 1ZGJA 2RBKA 4KDRA 3IAS6 2IYWA 1IHXA 4GX2A 1PI3A 5HR5A 1AK1A 1OIXA 2IOHA 1G98A 1PYOA 1P4GA 2OMEA 4WLFA 5NULA 4UEWA 3A06A 2PH1A 3CISA 2CV0A 1YZLA 2ZTHA 2VNAA 4TM7A 4DNFA 4K1LA 5CDGA 1GEGA 2DQSA 1AQ6A 4WESB 4KIWA 4CFZA 3PLAE 1YULA 5K3SA 1PR0A 2IF0A 3GJ0A 1Z7WA 3IOCA 1H93A 4QULA 2QQ0A 2W2PA 1ZH8A 4P4SA 1C7ZA 3VYRB 4JY7A 2HK8A 4KQGA 3WB0A 1L4YA 4G0MA 1W94A 5EYPA 3TZBA 3UAZA 5BN1A 4BTVA 2NU7A 3B1XA 3P20A 4UNSA 1W19A 1IJFA 3CRQA 3W9SA 2XF8A 3LGXA 4ZQFA 1OV6A 3BGOS 1ENPA 4B2LA 1UAAA 1GARA 1SURA 5F35A 3PFNA 3ELDA 1ISGA 3D3JA 3A9SA 4DY4A 4PHTA 2VHYA 5AW8A 4K6FA 3N59A 3CUKA 1B15A 5AKJA 2DTEA 4H4CA 5FD8A 3ICOA 3C98A 4NV3A 4L3OA 3HKCB 5EUCA 3INNA 4U63A 2CJFA 4DMLA 4EFKA 4EMSA 4HNUA 3THXA 2OFPA 5JJIA 4LA4A 5IW8A 2OWDA 2AFIE 2GCGA 2GZ3A 4M0CA 1P4AA 2NADA 1C29B 1CRQA 3TCNA 5DN6D 2AFIA 2NIPA 2HU7A 4ZOLB 1RCUA 3AR5A 5K0JA 1KEPA 5EKSA 4LOKA 2JIMA 4B7CA 4TX1A 4LWZA 2XNJA 4DR4B 3JYHA 1ETHA 1LA2A 2VHXA 2PLAA 4BNJA 2IYXA 4KGVA 3IVGA 1Y3HA 2B8WA 3GJ6A 4F4DA 5AJYA 4C7BA 1UQUA 2AJBA 3MSXA 4B3JA 1IBMB 1TCBA 1D5CA 2AKEA 4YEDA 1JAHA 1DFGA 2X0RA 2Z2ZA 3B8EA 1R4AA 3OTGA 5B1IA 4O29A 5J3JA 4IRMA 2JAWA 1XZEA 3L7LA 5REQB 3W77A 5EKTA 4FW9A 1Y5RA 5C4IA 3B6KA 3I76A 3AHDA 2EP7A 4G07A 1UBTS 1QYCA 1XR3A 3NNSA 3ZWKA 4UHEA 5GADl 3MJRA 1U0NA 3MS7A 4HN9A 3LY7A 4J0EA 2TMGA 1IU9A 1KKLA 3AEYA 2OBBA 3DCJA 4TL9A 1RQRA 3W90A 3I01A 3AYZB 1QU2A 3K09A 4IJVA 4ZJUA 1CK4A 1SU4A 4LZJA 1N2BA 3LPAA 3VSBA 5L3ZA 4I4TB 3R9WA 1OGYA 2YV1A 3NWEA 2YDYA 3RGGA 3QTBA 1MJ5A 1N3IA 3TNJA 2ALJA 3T3OA 2KBFA 1PFVA 2WE7A 4B09A 4QM6A 1AQYA 4LJSA 3KEGA 4WOPA 4AM8A 4BHTA 1FDRA 3COSA 5HOEA 1YDEA 1M2GA 1OCEA 4TXJA 2J6IA 1HDXA 3R3ZA 1U2SA 1AQIA 4CT5A 4UOQA 3DMRA 3TUJC 4AP5A 1JH9A 1Q91A 4JJZA 3KPYA 3ESAA 3WIDA 3PQ6A 1JJFA 4QDJA 1UZLA 2IL1A 5AVWA 2BCGY 4MWTA 4ND4A 4C2UA 2PO7A 1L5MA 1TIKA 4Z7JA 1HFJA 3B6ZA 2XI4A 3TGLA 3WYEA 2FXIA 1Y6JA 2ZRLA 1V9CA 3IOMA 4M0MA 3SJAA 1E6LA 1M75A 1C3VA 1J20A 1OUMA 1Z26A 3FWKA 4JJGA 2RH4A 1ZOLA 4X9XA 4MKZA 1TX4B 1JUDA 2ZSUA 3T4PA 3MXTA 2NUPA 1GQQA 3TB4A 2BH2A 4XPZA 4RTRA 1QTNA 1QV9A 5AKGA 4O3FA 3OD5A 4JOCA 1D7OA 3HCNA 3HZZA 4F56A 4I2NA 2YMQA 3RIGA 3ZDXB 2ZZNA 4I1YA 1RYEA 3C5WP 3CMMA 3OG9A 2F1KA 2JFHA 3O8LA 4BP1A 2LDBA 2ZR9A 2DGDA 1JLHA 1XZGA 3GRUA 1PG5A 2R4QA 2XE4A 3CY6A 2Y0EA 4KSCA 5EZYB 4NAVA 4X62B 4FYWA 2ZJ0A 4UBKA 2H2GA 1H66A 1FSSA 4QOEA 3U5ZB 3E3AA 1U3DA 4OHYA 2O7QA 3COWA 4EW1A 1BH2A 1YCHA 4V1CA 1DUSA 2VYND 2HHLA 1V8DA 2JFXA 3FPKA 2FSVA 3IMKA 1GN8A 3KUDA 2FYTA 3O95A 5HMLA 3VUEA 3VX4A 8ABPA 5HSGA 2X7HA 3PGVA 3ZS9A 2N42A 3QNUA 1Z4JA 3LA6A 5FX2A 5J43A 1K8YB 3MWFA 3U31A 1IN5A 3H7AA 1CUVA 3NUQA 2X4IA 2NU6A 1NC1A 5DX1A 5BWCA 4IVNA 2B82A 4JL8A 3A7DA 2R6AA 3HS3A 4J90A 2ZK7A 2F6RA 5B7GA 1HYHA 1ZJJA 1SB9A 4H60A 5FBZA 3GGOA 4I1VA 2VO1A 4CF3A 2VKTA 4BMVA 4P3KA 3DOJA 4GZ5A 4ZCIA 4WCFB 1YB2A 2GCPA 4EQ6A 3OUUA 1KHHA 3TO5A 4YIKA 3FTNA 2HN9A 3OEHD 2PGAA 1XTIA 3H2JA 1Y4SA 5CFLA 3ONFA 2ZE5A 5EMMA 4L8GA 2BGTA 2C8KA 4IIJF 4WK2B 4QT4A 5JYEA 3NTUA 3VU8A 4ACAA 2FK7A 5G4KA 1VHWA 3RVMA 4PSUA 4RXTA 1N3LA 2HJGA 1ZGBA 3ND8A 1SKMA 4MV7A 3G2OA 2JD1A 2VHEA 3GFQA 1FYDA 4GWKA 2XA1A 5LMCA 3DG9A 1WABA 2HF7A 3AESA 4L0DA 4UUPA 4NVRA 4F6CA 4M1MA 4G2TA 1DAMA 1CZNA 1EVZA 4QAQA 2XMDA 4LGVA 5CLIA 3KQWA 4MUFA 1QZZA 1Z2AA 4QOSA 3R8XA 1XA3A 3PEUA 3RVPA 2BF7A 4V03A 2OXTA 2OBLA 4CEIA 4YP1A 2PZEA 3AHJA 5GJWC 2NXJA 3MWEA 1MO3A 1JA0A 1VMAA 1LTKA 2O1XA 3E22B 2FQXA 2V96A 1P1JA 2AFHB 4I5GA 1SR8A 2HI0A 2MYPA 2VJOA 2J3QA 3OKAA 1U2DA 4PGFA 1QF6A 1ESDA 2IVZA 3IA7A 4HLDA 1TYEB 4G0OA 4KXVA 4C5BA 5CA1B 1J2EA 4XZ3A 2FWAA 2OHOA 5CGQB 1SHTX 3F8TA 3DAYA 3WKAA 1WDWB 2AD5A 1KAHA 1UZMA 5EKUA 3BSSA 2I2WA 4CMEC 4XDYA 3SJZA 5EMHA 5A0TA 3UWMA 1A9RA 1OI3A 5C8YA 1T1IA 1RC8A 3TXXA 1U6IA 7AT1A 3C7TA 3GOQA 3L7KA 3CRZA 3O8CA 1NVUQ 7REQA 2H07A 5I7RA 4JC0A 3MBOA 1YVRA 1ZK0A 1OROA 1P80A 3BB4A 4W7IA 5NLLA 1PZMA 3A4TA 4YALA 5KDOA 3JPYA 1Z6AA 2AMYA 1A8IA 1SOWA 2A8YA 1G16A 4EO7A 1ZMRA 3SSAA 3DJYA 4UVDA 4KPEC 1VPWA 2JD2A 1XVAA 4RM3A 3AB7A 5JHGB 2JGRA 3ZX4A 4MI3A 2WV9A 3KETA 4ETWA 4LOIA 1EWTA 2PKQO 4KW7A 1HYEA 3BRWA 3PVZA 4MITA 5MN6A 3BXFA 2UXCB 2EQ5A 2ZBUA 3GEEA 4L4UA 3GLGB 1M8GA 1BW9A 3AM1A 1F60A 1EJ2A 1PWYE 4QU0A 3PGXA 3R0VA 3RVOA 3PNKA 4BVBA 2MYNA 3D2AA 3LIIA 4GVXA 4XXHA 5CCBA 1XZQA 1IEVA 1X0VA 2WIBA 1FTSA 1NDUA 2F1HA 2H3HA 1WUJS 1XZCA 1U90A 1FFEA 2BKUA 3V2UA 3OWOA 4KV7A 2GVNA 5MGBA 1GWNA 1E3QA 1KMIY 4M1KA 4RJLA 5CD9A 1X74A 4B7ZA 2VP5A 4PFKA 2BSQA 4IBOA 1E2HA 1W581 1WY5A 4O33A 2O5VA 1OX6A 3ABRB 3T1TA 3RARA 2J6CA 4AS3A 4BX8A 5AIBA 5ICFA 2XUJA 2NTYC 5D3ZA 4JDPA 4UMDA 5FAXA 4LI0A 1B6RA 5GVSA 5I7UA 3B36A 3WLLA 2N75A 5E2AA 3WDKA 3DC7A 1H1LA 4P92A 2KW5A 1OLUA 3V97A 2AFRA 4M9XA 3WBFA 3KJXA 2ZJOA 1R5JA 2GCIA 1GG9A 3VFDA 2PRKA 1I9GA 4TUYF 3ZGOA 4OYRA 3MILA 4EBFA 4YRBA 2MINA 4XIYA 2G07A 2HSJA 1DKUA 1NDHA 2QN6A 1R8XA 1NAIA 1JJ7A 4JLOA 5B30A 1X7ZB 2CXTA 5TV2A 3KTOA 1SHKA 4PGHA 4U2DA 5AVZA 3KPWA 1BXRA 3B38A 3VJKA 3DVAA 1CP3A 1UP6A 2HAEA 5E9QA 1LZLA 1TT5B 3KM0A 3HRIA 3RYHA 4B45A 4TVSA 2DMRA 3AR7A 3I6QA 3PWZA 2QLNA 2HF9A 3F2IA 3UJCA 4I4TA 2FPMA 2WYVA 3BWEA 5KTSA 1P18A 2JJ1A 4AECA 1XXHB 1Z8DA 1YA4A 2C2YA 2WFAA 5KX5F 1U02A 3R41A 3ZE1B 2YXDA 2ZU0C 4R6WA 2OVFA 3WWYA 1AUXA 4CW7A 1NXVA 4J3NA 1ODKA 3HQ4O 2QW0X 3MQ4A 1VCNA 1T0JB 4Q4JB 3A28A 2BJVA 3DBLB 4LKOA 4ZK6A 2R8EA 2ZI9A 3KQQA 1JFTA 2FDXA 3W3AH 4B4DA 1Y8AA 1DHRA 4KVFA 3CSSA 4JLJA 2Q0QA 4ZAZA 4KLZA 4BNTA 1YDHA 3CG0A 5IS2A 4DV1B 1PG0A 4US2R 4COOA 3IA2A 4HB0A 3BTOA 1Z6QA 2JK1A 4RVSA 1FMLA 4MP6A 5JTUA 3KVOA 1AKEA 1OKKA 4UBJA 2VDMB 3NONA 3REGA 2BYTA 5C4GB 2X0EA 3QP9A 3ESYA 1LBIA 2G1KA 4RW0A 1CNFA 3IIEA 1RAGA 3BL8A 4ILEA 1XCGB 3OX2A 4D6XA 5L3SA 2VDLB 3JQ9A 1T8WA 1MJHA 5C80A 3GP8A 2AW3A 1SZDA 1U9IC 3QEMA 3UT5B 4JI6B 2O8FA 2E89A 2P6UA 3OJLA 2AF3C 2A84A 4C2BA 1JDVA 1WVGA 1VSVA 3IGFA 1PGQA 1YQXA 2ZU6A 3L6DA 4B80A 1H2XA 2XZTA 3FBTA 3N8GA 3FLAA 2FWPA 3D8SA 4L4SA 5JRZA 4G8CA 4NV0A 2JLYA 4BPBA 2ECQA 1FUKA 1UBSB 5COBA 1B16A 1CZLA 3NDJA 2QLFA 1FRVA 3KWJA 3IDAA 4NOKA 2NTVA 3A31A 4JT9A 4QQNA 1RLMA 4QXAA 2QAJA 1Y9ZA 4GOOD 5LBIA 4OK5A 3VYTB 5BT9A 3D81A 4N0PA 2PT6A 4G97A 3ZHBA 4MYDA 3C3DA 4IIUA 1L6IA 2IE0A 3MWLA 4Q21A 3W5DA 5JANA 1HPLA 3JQRA 4J16C 3DC2A 1S6YA 1R0YA 4KGXA 4P4NA 4DPLA 3CRMA 1FQKA 4WK6A 4UNRA 4TYNA 2C2HA 2LVBA 4LY6A 4MUYA 4MV4A 2PPVA 3A6JA 4EB6A 3B70A 4JHXA 3JAMA 3W8DA 1GRNA 1W1IA 5CVJA 5L4NA 2ATVA 2V5AA 1R0LA 3PCXA 4KQEA 1QUEA 3G9QA 1NQVA 2PYZA 1ZY2A 4H15A 4WZBB 4HSEA 4HNVA 2YYSA 1XCBA 3AEUA 5IJXA 3HCRA 4ZFNA 3EXHC 2Z1MA 3JQ7B 1X8JA 4JB3A 3LQRA 1U94A 5DM2A 1GKIA 2O1SA 4F71A 4BE4A 2QLJA 1SB8A 2OBXA 2HK9A 3BH7A 3LOQA 3V3KA 4EARA 4CETA 1VMIA 4ESHA 4JI0B 1EAYA 2YJNA 2P2SA 1RCTE 4HHEA 4FILA 4ZRDA 3JW8A 1AGPA 5C3MA 3LNCA 5BNZA 1BQEA 2ZIAA 1U3UA 5E9WA 2J7PA 2OAP1 1J4AA 4HBZA 4MR9B 3OPVA 2J0UA 4FMCB 2AG8A 1KZ1A 1UBHS 4CLEA 4XW2A 3VOAA 4BNFA 2RIPA 1I4OA 2IYSA 2OPBA 2XOEA 4FOOA 4H7HA 1TK2A 2XVYA 4LJAA 3JQ8B 3GLIA 4LECA 1A71A 4Q7EA 4IS3A 5HKBA 3C4QA 3V32A 5IVHA 3JASA 3PR2B 4BNDA 1P3JA 5ILGA 4R68A 2FVYA 4KFSA 2BMAA 2O05A 5ECGC 1T8UA 4MQ4A 4B4UA 3ZHSA 2ID9A 3UHAA 3IT3A 4YDQA 3KLMX 3ZWBA 1YACA 4CEHB 2OXEA 4S35A 2TS1A 5I48A 4A23A 1N8NA 1NQUA 3I8OA 4MMXB 2OHFA 1LQ2A 4OKIA 3PC8A 2GBLC 5A9SA 4FR2A 2EP8A 1TQ8A 3BMCB 3ROQA 1UBOS 1TRHA 2Y93A 2DR2A 3LP6A 5BN4B 3AI7A 4QL3A 3SSOA 2UZAA 5E4YA 1NF2A 3KB8A 3B52X 2J9FB 4G5HA 4BQSA 4CFSA 5T5QA 2WPDA 3DZJA 1AZSC 4XSVA 3IUJA 1GL7A 3DOHA 4KVAA 4MQLA 5JZSA 3W5AA 4G5RA 3TE6A 4UDXX 4K3UA 2QA5A 3I9FA 3BXEA 1F4PA 2IYTA 2X0NA 3CLKA 2IRWA 2XRYA 1KIMA 4HMOA 4TTAA 4X94A 4DSNA 3ILHA 2W2VA 2YWRA 4HNAB 1P1BA 1GYPA 2IP2A 4Y98A 4U2BA 3VU9B 5IDWA 5IUJC 5MN5A 3RODA 2PD4A 5C5CA 4CLRB 1Y80A 3IR7A 1CVIA 4DMFA 5JCPA 4FLEA 3S1AB 1JSZA 3FJYA 1KVSA 1TU3A 1P31A 5KOHB 1HE3A 1KKMA 5DISB 3FPHA 2ZRAA 3CF2A 2WKSA 3SXPA 1LW7A 2DY0A 2FSIA 3ESZA 2RK3A 3HR7A 1QFZA 1GOTA 1G5FA 4ZANA 2WHXA 1JDTA 3A9CA 5GZ6A 4RA9B 2LUOA 3L4BA 3TL3A 2CYAA 2EGUA 1GCUA 3IS3A 1Z06A 4URFA 3L77A 4LSGA 5AM4A 4A73A 2F7SA 2HHAA 4Q9DA 5K99A 2BEVB 1G8HA 1MVOA 2JRCA 2QUHA 3DV2A 1ZCZA 5H16A 3WK8A 1VL1A 3QX3A 2J3DA 1Y7TA 5C1PA 1I24A 1Z18A 2JB9A 1VBKA 3JQFC 4TV9B 4YCDA 3WIOA 1X7DA 1PZXA 3QYPA 2J8ZA 4AF6A 3EXAA 3TB6A 2WZQA 4MB6A 3IAAA 1NZJA 1R4MB 4Q6WA 5CT8A 3OIVA 4RF3A 4B2IA 1F6BA 3P9RA 3MD9A 4KYVA 3SDBA 2BEWA 3CQ9A 3S81A 1OB5A 2R00A 1LEHA 3IDQA 1Z5UA 4MUKA 2I3DA 2QD2A 3P2EA 3AOGA 1C80A 3U16A 1PR4A 3OHMA 2QU8A 4S1OA 4D0LB 2ZJAA 3RG2A 3C7DB 3T95A 2Z9DA 2PA0A 1BWRA 3HLTA 4F06A 1XZNA 1H9AA 1T5SA 5ENDA 1BXGB 4KH0A 1FNSA 1KBZA 2XZLA 1B0PA 3D64A 1WF3A 4JROA 1YFLA 4E0BA 1Y1LA 2EBUA 3V8EA 4K2HA 1P7CA 1KIFA 2C1EA 2DTXA 4FGLA 5G53C 1D2GA 1NF3A 2IXTA 1W4ZA 3O1HB 3DZGA 4JMPA 2Z8XA 3OZFA 3OLYA 2VNJA 1AQNA 3PFGA 3QXJA 1ECJA 4KKXB 4Q4JA 3NT2A 5CH8A 3VZQA 5ALVA 4BX3A 4JC8A 2W6CX 3WWCA 5JQGF 2HSGA 4ZU3A 4DR3B 5L40A 5ITWA 1NNSA 3MJ4A 5EI5A 4BFXA 4HDSA 2J9GA 3KJFA 1PVOA 4OJQA 3IL2A 1OPRA 1HZZA 2MTBA 3NV9A 1ZUNA 3FHOA 3RCBA 2NP7A 3RE1A 3PPVA 3AXTA 4BMYA 1YTUA 1VL2A 3FUCA 2DUUA 2GSWA 5HPYB 1TKCA 4QE3A 3DWEX 3UKOA 4C6TB 1M0SA 5AM1A 3H2IA 2BDUA 1IRXA 3WA6A 4A15A 2C4KA 4G81A 1T4DA 3VTAA 5BSEA 4EEXA 3MINB 4JI3B 4GKAA 4EUFA 3RC2A 1EUCA 5L95A 4NI5A 4PTYA 5AXBA 3ZWOA 1JLSA 4HWOA 4L9RA 4L5BA 4DG9A 3SC6A 3L7OA 5D86A 3JAKB 3SNKA 4EUNA 1Y6ZA 3N0XA 3R7FA 3W1VA 1WBDA 2HIGA 5LCXA 3UMCA 1B3BA 5CT5A 4BB5A 2XTJA 5FOSA 3AB8A 3SEFA 4EJ2A 1NNEA 4OHOA 5I7SA 4Q9LA 2XYVA 1TLLA 4FC7A 5HF5A 3D4IA 3WZMA 1PTJC 1JKMA 1FX0B 1HFWA 1Z62A 2MSCB 2QW1A 3KDSE 3RUFA 2I54A 3IAM6 3EY4A 2NPFA 2BZ1A 3RRMA 1UJ2A 3ZHQA 5DM70 3O47A 2V4ZA 1P6UA 2ZJ2A 3HCFA 2J67A 2DKNA 2H85A 5ESDA 4L4XA 4O4LB 4U2GA 2IPLA 4ND8A 1TTTA 2JCGA 1NSFA 3DT8A 3FDJA 4PY2A 1JR6A 4I5DA 2FEAA 2O3JA 3FPBA 3FGOA 2DBRA 1U98A 1YZQA 1OI2A 3FUWA 4D8UA 1MH9A 5IJ9B 1VZ2A 4JN6B 5B6JA 4C4XA 2YN0A 4M87A 1DUVG 1V0JA 3E2MA 5CAEB 4OP3A 2O2DA 1EP1B 2P8JA 4F84A 2OCPA 3DMTC 1MO5A 1H23A 4J1QA 1JHQA 3DMGA 3KL4A 3NHBA 1HLDA 3T9FA 2B36A 2R8YA 2I3GA 3TQTA 3OUZA 2YWBA 4GT1A 2ZI6A 3RUCA 4E14A 3NVMB 5JD4A 3F67A 2OLJA 3T7JA 5GONF 4Y2TA 3D3NA 2BKLA 1XD2B 2VNIA 5EJ6A 1MX5A 1HY3A 3WNDA 1EVYA 2V3VA 2HRQA 3TW4A 3LHKA 2QX8A 1ISMA 5JH7B 5KJEA 3F5QA 1TKBA 2AXNA 4YO7A 3GEMA 3ICVA 1CUJA 3FGZA 4KL8S 4RQTA 4GPBA 4RZUA 1ZRSA 5DBOA 3V2HA 1H6CA 5IBQA 4ND3A 1KPGA 2YJ6A 4AF8A 1L4MA 1ODSA 5D1NA 4IGIA 4JEMA 3V4SA 4QIHA 3RW9A 4RV4A 3X2EA 4AU1A 1FE8A 1QHXA 1Q1QA 3QVJA 1IOLA 1XDGA 4X8OA 3WQSB 4HNHA 2IS2A 1Q20A 4MW9A 1PSWA 3KV1A 4U2KA 1G6OA 2C4WA 2Z2KA 2FW0A 4NR0A 4NU6A 4LYEA 2L17A 2GFQA 3CLSC 2JGDB 4JOQA 4RJKA 3WGLA 4AG3A 2WKWA 4CL3A 3KBOA 3SZRA 5CA0F 1KJIA 2V1XA 3IV9A 2LIPA 2Y76A 3P97A 2QTBA 3FDZA 2BISA 3VR6A 3A1WA 3AG6A 3WHPA 2G88A 8OHMA 5JCOC 4RIFA 1W1UA 2V6BA 1Q16A 1ADGA 2R6ZA 5C52B 5IVKA 2W2LA 3HFJA 1E7RA 1UK8A 4WMLA 4R1NA 2NUTA 2WF5A 4DQ0A 2BDTA 2VWHA 2QJFA 4MKXA 2A0UA 1E4OA 1CUCA 1M2NA 2QMUA 1H2RS 4TT3A 4X1IB 3ZHZA 3NETA 1SBCA 1DE0A 2J9FA 3O1LA 3ZLVA 3AHEA 1D07A 1ESNA 2HMWA 1ZESA 7ADHA 3HUFA 2CBXA 3HGMA 1U3GA 3FCEA 4EJSC 4UREA 4QVKA 5JY6A 1UPXA 3OZDA 5KWVA 3VVMA 4MIEA 2TECE 1QXSA 1VQ1A 2UVQA 2ZYDA 2RG7A 2OCIA 1I3KA 5KVQA 1G5IA 1TUIA 3WKCA 2Q6LA 3V33A 3DMDA 4S1WA 5EIWA 1E1QA 5F4BA 5A02A 1OMOA 3D2BA 2XBUA 3GZJA 4V38A 2J9YB 2OHVA 2QAGA 1K2WA 2G1JA 1VB3A 4H4DA 4CODB 3I39X 3ZDQA 3EPKA 4R2KA 3GB9A 3H9QA 3PD1A 1G2PA 3L6RA 3WGOA 1VG1A 5FPPA 2FPGB 4ZVSA 3S99A 2CHGA 1PDOA 4TLMB 1T13A 2VCYA 5IAAA 2BMWA 3DBRB 5LU8A 5DPMA 3ZCUA 4U1RA 4MVJI 2DECA 1M67A 2PQ2A 3KIPA 4FNGA 4V0KA 3K3PA 3EF0A 2F90A 4TYPA 3PJRA 2OXFA 3LX8A 3EPJA 4LCBA 4BNNA 2C2OA 4CLDA 1OH7A 1D2HA 4X41A 1OU0A 2F1OA 5DHUA 5KVAA 1E3WA 1U0FA 2YX1A 3RSSA 4IIEA 2WT9A 4EGSA 5DH9A 5CX1A 5BQ5A 2Q3JA 4C0QC 4F3CA 2VDWB 4A2CA 4ZAYA 3GPLA 2BI4A 4CYMA 3W5CA 4NZNA 1RACA 2ODNA 4FFMA 3GCZA 4GX1A 4N7JA 1CUZA 4KO2S 5JEDA 3O3NB 3T15A 1ADJA 1BXGA 1L4EA 1Y48E 1N7GA 3USCS 4EF5A 3KQHA 2P75A 2QSYA 3PC3A 2VR1A 1ULAA 1QPBA 3I2YX 4FCCA 3J7TA 2FJPA 3OT1B 3QJGA 3ABZA 4JX9A 4UM9B 1ZJ4A 3O2SB 3FSRA 2XCQA 2BTOA 2W2NA 3NATA 2X0IA 4G1CA 4U5QA 4LXHA 4W82A 2EJCA 5EKXA 3O2JA 1LC3A 1N5LA 2GAFA 2NPIA 2XTAA 2RI1A 4XEUA 3LZDA 5EP3A 2QGZA 3TX6A 1E0AA 4HFMA 4BJ1A 1N2GA 1ETUA 4EF6A 3BERA 1L1EA 4EYQA 3VPDA 1N0WA 2OLEA 4W5QA 5J9FA 5FAKA 4PSVA 2E4VA 1PL6A 4F2HA 4YBZA 1WBBA 4PYNA 2WP8J 3CZ4A 4Y2VA 2WKQA 2K4MA 4IGEA 3H8WA 1JQAA 4PZPA 2V7QD 1XL1A 1FBNA 4M36A 2OK8A 3HHPA 3HSYA 1NY5A 3O7MA 2CDRA 2NYVA 3RJ9A 2Q3FA 4CM1A 3BS4A 4QEZA 3KCQA 5FI3A 3KAQA 3A1TA 1XKXA 3SHWA 3PCTA 4UZSA 1WCWA 1AF4A 2C3MA 2PUVA 3GARA 3QX8A 5EAIA 1GQ2A 3A0RB 1FDTA 1FXWA 2AHOA 4FS3A 3TI9A 4US0R 3BJMA 2YXNA 3E27A 3JRNA 4M1EA 5EZSA 4C2TA 4PZEA 3HUDA 3EXFA 3O21A 4G56A 2DFKB 3RK0A 2ORIA 3ZQ4A 2XYHA 2A9PA 1ZM9A 3WMWA 1TEXA 1XMVA 3H87A 3OJEA 1M0WA 2FPWA 4NU5A 3NHPA 3HCPA 4TQ9A 1UXKA 2GKSA 5EY5B 4XDHA 3H83A 5LQNA 1NUUA 5ENZA 2EKLA 2RGUA 4JB2A 3GRRA 2LE0A 2PMEA 1M3SA 1R88A 2VDRB 5CU7A 1USWA 1YE3A 2QUJA 4H31A 4CTKA 3O6VA 4PXSA 3GZNA 4JKOA 4AJOA 4DUGD 5ALUA 4UVIA 5CM8B 4MUGA 4BMZA 2NP6A 2VHWA 4Z4GA 1VG8A 4CFYA 2YZKA 1MIOA 3L4EA 2H17A 4F4FA 4QTUB 3FPJA 4KHZA 4A0GA 4BKOA 1X80B 2YS7A 1E1LA 3C1TA 5FIUA 1V45E 2OYRA 2Q6IA 2QI9F 2HGZA 2EBFX 2OYCA 1Q1ZA 3I34X 3UMSA 3OE7A 2VL7A 1G19A 1TDJA 3P9KA 4M6WB 5AHRA 4Y2PA 3C6QA 1XU4A 3MUEA 2OHXA 4IMJB 2AF4C 2XEXA 3MMSA 1XWIA 2VKQA 4QBKA 3U3OA 3T3HA 1HDEA 2HBQA 1AV7A 2I2AA 2V7TA 3PTZA 1R4NB 5TE9A 2DKOA 2XCRB 3PUIA 3AVXA 4BEWA 5EIXA 3OD1A 3RRZA 3QKSA 1PEAA 1ILWA 1G9XA 1Y3BE 2YZ2A 3IT0A 3Q2IA 1TAGA 5ALRA 3OQIB 9MHTA 2PUDA 2ZWPA 4MV1A 1OYYA 2G8LA 2RFLA 4HL6A 1WUTA 4BWYA 3STTA 2I80A 3JALA 2X42A 4B3IA 3FROA 4UEQA 3RF6A 4JQYA 2RGGA 1NOKA 2F48A 1JKIA 1FJHA 1TM1E 2ZAMA 1O94D 1JS1X 3R0JA 3LG2A 3LHDA 4TXHA 3BK2A 1NJGA 1VSBA 2RGYA 1Z2CA 3K96A 3MERA 2X6RA 5DCWA 3T3EA 4F97A 5BMVF 3M0EA 4PZLA 2PH5A 2V6FA 4JP1A 3MHPA 4DQXA 2FEMA 4KFCA 2WDPA 2Q5OA 1TM2A 1SXJD 2VUHB 1JDBB 4KLAA 5GM1A 1GKLA 4F85A 3WO0A 1I1NA 3U61B 1H6DA 4KN9S 4L8LA 2ID4A 4DMGA 1UBKS 2OUIA 5A3RA 3UKDA 4F2DA 3UMMA 3EMKA 4R0VA 1R3DA 3GMSA 4BB9A 2CUKA 2V9CA 3SHVA 4UCXA 4C4YA 2C97A 3NPAA 2P7HA 5J2UB 4DSZA 3DNFA 1OBHA 4PYJA 5JVDB 2OENG 1IBCA 3OQHA 1VE6A 3IJPA 2UDPA 4LJ8A 3N2IA 4CDMA 1QLWA 3AERA 4F46A 3GAFA 2WHPB 5L6MB 1L7BA 1OFHA 1A8UA 2Q3EA 4OGWA 1Q22A 2C0QA 1DKPA 4MCJA 4QUDA 3SC4A 3SZGA 1EG7A 3VNBA 4DGSA 4EZEA 3U44B 4MMYB 2AYYA 3QUBA 2ZJ3A 4G0UA 1YCGA 3NRBA 3PYLA 3I0MA 4GXNA 1F0PA 4FE7A 1AHNA 4HDOB 2VF7A 4RKRA 3EDRA 5SICE 1Q57A 2A7XA 2RGEA 2X8JB 1JVBA 2ZRDA 4ZGBA 2JVJA 1UKEA 1VSTA 2XIJA 1RBYA 2IP1A 1BC5A 1MC8A 3PF9A 1CUFA 1JU3A 1RPJA 4DRXA 3WRVA 3KYDB 4J29A 1CQIA 2YN4A 2QN2A 2CLHB 1F8UA 2OC4A 3U3KA 3LLVA 4G8JA 4BO6A 1R3UA 1Y5LA 2HQ1A 2PS0A 4RWZA 3VYSB 1ZD8A 3L2OB 5BSUA 1QVVA 1QKIA 3OMWA 2OFFA 3U9TA 3X1DA 1V7PC 1MC4A 3ZLBA 3P4XA 4J0FA 4OO3A 4GI5A 3VKVA 3NYQA 3WGNA 3HCDA 2Z4TA 1KI3A 5DSZA 1J09A 4AN0A 4ID9A 3PX2A 1W48A 3OC0A 2CL7X 3GK3A 4B5KA 1G1AA 3BWMA 4RESA 3C0KA 3BB3A 3GRAA 4NL4H 4RK7A 1SVLA 3UIEA 4C0SA 3ROEA 1T5LA 3DBRA 3EGXB 5ALTA 3QLEA 3M8KA 1E1RD 1ESCA 1UXOA 2CWDA 2EX0A 2VPZA 3TKLA 3I1FA 1PT7A 3W7VA 3CNOA 2C82A 4BYMA 4PPQA 5J2TA 1CUGA 1W0JD 4TTPA 721PA 2QDXA 4G0PA 2GYWA 2VH5R 5T4EA 3EJWA 3VX3A 4CTJA 2B4TO 2RK6A 3COYA 3T1YB 4DA4A 4CCYA 1KVQA 4D6YA 2LV8A 2Y0BA 4KK3A 2CEAA 1V16B 3ZV6A 4HCJA 2ZIWB 3N1UA 3R9KA 3G2HA 3PKZA 5FLKA 3SX4A 3ZY5A 1DOAA 4EFLA 1S9HA 4NDAA 3OF5A 1N6IA 1BQ4A 1NVWQ 2VDWA 3SIXA 1FDUA 2HJSA 4YCBA 4C0JA 1YBFA 4M49A 1J8MF 1N0VC 3E23A 2IYYA 3O8QB 1YAHA 1ZVVA 4UFOA 2GETA 1MB3A 1NU6A 4BBZA 2ZWIA 3OJWA 1RWMA 3ANMA 1XYYA 1CQJA 3MWGA 3SEZA 5C7OO 5C1DA 4LDPA 2BKXA 3L79A 2B3DA 3OT1A 2J09A 1E77A 4UTNA 1HQCA 1TFRA 1KI1A 2W0MA 4M21A 3K35A 4ZOLF 3TM4A 1OLXA 1X7WB 3K6JA 1ISJA 2AX3A 2H7YA 4LFAB 3SXJA 4B8YA 2O8CB 2O8EB 3BQNB 5F9MA 4PYKA 2IUUA 4WN9B 2ECFA 2IZ1A 3PIDA 1X14A 4QWWA 4TN5A 3I4FA 1EU1A 1MT3A 2EG9A 1J7KA 3GYGA 3PRJA 5ADVA 4CCWA 1QYVA 4YONB 3JD1A 5EP2A 1KY3A 1ZUHA 1M54A 1QC5A 3LQ4A 3B3JA 4Q4HA 3QEBZ 1UBMS 3EYWA 1GADO 1V1RB 1J5EB 3T41A 1GCOA 1NBMD 1UIMA 1YRAA