4JLMA

Human dck c4s-s74e mutant in complex with udp and the f2.3.1 inhibitor (2-[({5-ethyl-2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-1,3-thiazol-4-yl}methyl)sulfanyl]pyrimidine-4,6-diamine)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
242
structure length
233
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of new deoxycytidine kinase inhibitors rationalizes the affinity-determining moieties of the molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
total genus 87
structure length 233
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jlmA00
1T3HA 1IN6A 1T8UA 2Z83A 1VCOA 3U3OA 1ZAKA 4L4UA 1N5KA 2RGCA 1G1MA 3SYKA 4JVLA 4W5WA 2CE2X 3B6EA 4Q00A 3D6TB 4C7OB 3IHWA 821PA 1HEIA 2EFDB 4BZQA 3AVVA 2FFQA 4DCUA 2VLIA 2W58A 3U7EB 1TF7A 2CNWD 3O8RA 1KMHA 4B71A 4B47A 3FHCB 3B78A 3PR1A 4XTRA 5KSZA 3IHLA 4NMMA 5EE3A 5M04A 3THWA 1E9SA 1NN0A 1QVAA 3UK6A 5DN6A 4WIAA 2J0UA 3TMKA 5E3HA 4K8OA 1XU4A 4EPVA 1E6CA 1ZC4A 1NBMA 4DXAA 5KDOA 1GSIA 1W1WA 3LW7A 3QPWA 4EFLA 3K0AA 3LW8A 3WMEA 5KOYA 3R8FA 5BN4A 2ZI5A 4URVR 1E9FA 1OYYA 3TGPA 5FUXA 2FX3A 3TLXA 3WHKA 3SJZA 4LRWA 2QAGC 5G41A 1Q1ZA 3DVLA 2IYYA 2GXSA 2NG1A 2LCFA 5B30A 3K09C 1G21E 4TL7A 1W2GA 4I1SA 2W6ID 3KXLA 2ZYVX 1HT1E 2G9NA 4C7OA 1LF0A 4DCSA 4DDUA 5AUPB 1JR3D 1L7VC 2FFHA 4PXAA 4Q4HA 4HZIA 1EWRA 1G8HA 2PEZA 2K5UA 3VKHA 2XOKA 1DAMA 2QRZA 1P62B 2G77B 521PA 4R2IA 2ERYA 4QRHA 1JXMA 1GIAA 1FUKA 1IQPA 2GAAA 4EFMA 3K8YA 4Z54A 1U2RA 5FTJA 5JCZA 1JEDA 1R0XA 3EA5A 4M9ZA 4HLUC 1DBSA 2G88A 2JA1A 3CUEF 3Q9LA 5H70A 2IK8A 2ZAMA 2ZVPX 1DELA 5CJ2A 1OT3A 4IDOA 2MMCA 4GFDA 5FOUA 4OJKA 3RC3A 1GNRA 1KKMA 3T1QA 1MABA 3BXZA 1P3JA 1S0UA 1GKYA 3EXAA 3QUSA 3CO5A 1TTTA 4Q66C 4Q9IA 2H57A 3TQFA 3W9YA 4DLZA 2GXUA 2ZE5A 3NEJA 4RFSB 5E7MA 3N2IA 2BJWA 1CTQA 4HZUB 1X8LA 5AUQA 4OHXA 3W5IA 5IRCD 1D9XA 2HJVA 1Z29A 1RE0A 4LPKA 3K0SA 1KJZA 2BEJA 2XJ4A 1XZPA 3VR3A 3U44B 4MRRA 3GLHA 1W4BA 1II8B 3KUDA 4ARZB 2EU8A 4B3XA 3Q72A 2IL1A 1CR0A 2D74A 1E9DA 2C78A 2GJ8A 1RYFA 1QG4A 2WIAA 2YKGA 421PA 3F0TA 4DDTA 1CKEA 1G3IA 1GTVA 2B8TA 2C98A 4TMVA 3ZGXA 3RRYA 4KFTA 2QGNA 3AVQA 3FOZA 2ERXA 4MDEA 1Z6XA 5JLJA 4Q21A 4EPXA 3B13B 3AQ4A 4PQYA 1Z0KA 3GLFA 2IW3A 1PJRA 1R4AA 4P4SA 2QPOA 5JRZA 1K8RA 4F4CA 4C3ZA 2IHBA 4P0TA 1N3BA 2ZSEA 1GRRA 3SU8A 3CF6R 4NPHA 2IYQA 4Z8YA 3T1OA 1ZYUA 2X8AA 4QGHA 3DOFA 3SJAA 5HR5A 3QKTA 5LD2C 4Q18A 4QXAA 4ZI2A 3FFAA 3GLGB 3H1TA 2IBMA 3MLEA 1WQ1R 2ONJA 2IYTA 1RPZA 3ADBA 3HU1A 5J4KA 2VP6A 3UPUA 4B43A 3RWOA 1UM8A 5HZHA 4D4LA 2HEIA 1GP2A 4YQFA 4F4JA 5AR1A 5JEEA 2FSGA 8OHMA 1TEVA 4E09A 3I72A 4XSHA 1CBUA 2O8FB 4KXFB 1QHSA 1HH4A 2WHXA 1VG0B 2HYIC 4L5BA 1G3RA 1KAOA 2GEUA 3Q7PA 2WOOA 2ZM5A 4URZR 1T8TA 4NYMQ 1E2KA 1U9IA 3ZZUA 3O47A 1RJ9B 1JJVA 3UMFA 4LYFA 3O8BA 1WDTA 4RZUA 2J1LA 2QAGA 1N5JA 3WNDA 3KXIA 3TNFA 3J81k 2ATVA 3THOA 2F9LA 5KYKA 1XX6A 1WA5A 3AF3A 2WAYA 1T0JB 3D3QA 3I1FA 3NBXX 3QVVA 4S35A 1OXVA 4DCNA 1G41A 1S9HA 4OBEA 4X8OA 4IJMA 4PQFA 2WSSD 4URYR 4L9SA 2LWIA 4OI1A 1XMVA 2VSXA 4CGZA 3ASZA 1OE0A 1X1SA 4QBHA 1LTQA 1NG9A 3KUCA 5E7JA 4DLVA 1G64A 4URUR 2VH5R 3HR7A 4LJ7A 3HU3A 3ZIAA 4CEJA 3T1VA 2JLXA 3WP0A 1OKKA 4M9QA 4RY2A 3THXA 1JR6A 4PHHA 1G6OA 2D2FA 3QQ5A 5SZKB 2J7KA 3EIEA 1KHTA 4NP6A 4E22A 1GILA 2EFHB 3OIUA 4JMPA 5CK5A 4EPYA 4RFVA 1M74A 4HUTA 4OHYA 1A5TA 4A6PA 2GXQA 2Q3HA 4NCHA 4O0MA 4BFZA 2J0VA 4LHXA 4LHZA 2O8BA 2P0EA 2VP5A 2BMEA 2EYUA 1N6OA 3NH9A 3R9WA 2LKCA 2HXSA 2CJWB 1EESA 1ZM9A 4TTPA 2OZEA 2W6IA 3RRZA 4BLRA 3QF7A 3SBEA 2O8CA 5JSZA 1NBME 1KK1A 3RHFA 3P32A 2OAQ1 4JL8A 4UQOA 2ZUDA 4RZ2A 3SFZA 2V6JA 1RVDA 3LVQE 3B8HA 2NTYC 1GFIA 4RD0A 4BLOA 1OIVA 1Z2AA 5B2ZA 4TMXA 3UXMA 2ODNA 3E1SA 3FKQA 4MH0R 3AM1A 4BFSA 4TMKA 1LB1B 4MRPA 4PPNA 1XFAA 2OFWA 5BXQC 2ZRIA 1F2TB 3QVUA 1U99A 1XNJA 3CR8A 5DO9A 4JT2A 4TQUS 3W6PA 1AJEA 1GNQA 1Z6YA 2J3EA 2R62A 1ZD1A 4YLGA 3LXXA 4E07A 2WVJA 3U4QA 2BKEA 4BFYA 1G5TA 1R5OA 3CBQA 4CW7A 1AKEA 1DG1G 1LS1A 2OSBA 4QG7A 4GSYA 5SZHB 3U3KA 4Z1MA 3W6OA 1MV5A 1GL7A 4XWKA 4EJSB 3ZQ6A 5LB4A 1QVRA 4A36A 2XITA 4QBFA 3EAQA 4GRAA 3R9IA 4G5OA 4YXWA 2BM1A 5EXXA 4OKSA 3W8RA 1G8PA 2VP9A 4OI2A 3WYAA 3VFDA 1Z06A 4RD6A 1COWD 3ZVNA 2W2XA 5DI3B 2OFXA 1G7TA 1G17A 3K0EA 4CZ2A 2Q3FA 4BFVA 1DO2A 3KJGA 3A4MA 4RD3A 2J45A 4B76A 1E0AA 2J46A 1E0JA 1E1QD 3U4QB 1J70A 3PUZA 1HYQA 1VG9B 4TL9A 3QY0A 3WMFA 1E2PA 2F1RA 4TLAA 2OBNA 4MUBA 1GRNA 2H8KA 4KYUA 1F2TA 2V3CC 3QPVA 1IJEA 3NBZC 2ZQ5A 2RAPA 2ZJAA 3TUZC 5TVKA 1KSHA 3BFXA 2XTMA 5F98A 5EP2A 2IXFA 2QAJA 2QTVB 1OFTA 1LW7A 1OPXA 1Q1EA 5CITA 4DB2A 2J7PA 2R65A 3EW9A 4G0NA 4QHYA 4D0NA 1JXOA 2V54A 4LDJA 3C7KA 5JSZB 2G1JA 5DGXA 4EUNA 2XNDA 4JLAA 4NCJA 5C1BA 1FP7A 2CJWA 1XJCA 2B92A 2C2HA 4LBVA 1Z07A 3A58B 4OQFA 3KTAA 4B6FA 4EQ6A 3QF4A 1ZP6A 2ODBA 3A1WA 4MYCA 4DSTA 2P6UA 4ZIRB 4II7A 2O8DB 3NDBB 3L0IB 3PEVA 3DM9B 4B35A 2GK7A 4FMDF 4MRNA 5H1YA 2I4IA 3EPLA 4I4LA 4FINA 3FDIA 4HB2A 3U2QA 3I92A 2ZE8A 4QFMA 3THXB 1I2MA 3LXRA 3GP8A 4F7WA 4QJ3A 1NVUQ 5GJVC 1P2UA 1DG3A 1TU4A 1YJ5A 2ZSDA 3I8XA 4DLYA 4UXJA 1CS4C 3NKVA 1LNZA 2ZRCA 3OF5A 3B5JA 4P31A 5FPHA 4US2R 2WJJA 4PPQA 4C2UA 1EFTA 1E2QA 1FOEB 1KSFX 2F3RA 1E3MA 1QBKC 2RHMA 1ELOA 2G0TA 4AYTA 4KITB 2HLDD 4U00A 5DHFA 2WTUA 1DAKA 3WXMA 3WHLA 1W0KA 2XTNA 2QRNA 1KSGA 3CRVA 3AF4A 2FA9A 4GZLA 3A37A 3BIFA 2REBA 3BFKA 2ZS7A 3G82C 2XB2A 1XTQA 4MQBA 2RGDA 2VRWA 1XRJA 4LBWA 2W00A 4CEIB 4QNMA 3OFNA 3KQKA 3SHFA 3U61B 1OIWA 2E9SA 3BFVA 1J8MF 4PANA 4IDPA 1B0UA 3Q85A 4HLQB 4OI4A 4ON9A 2J9RA 3FWYA 4DDVA 5FOVA 4MITA 2CK3A 2RGEA 2O52A 4QL3A 4F92B 4ACAA 1G8FA 4FMCF 4S2EA 5KDLA 3C5HA 1QG2A 4V0LA 4D80A 5F3WB 3E70C 1CJTC 3GLIB 2ORWA 2CVHA 3DO6A 3SQWA 2YOFA 3TR0A 4FW9A 5DNYB 2WJGA 1DO0A 4PSAA 1IY2A 2ZRHA 1BH2A 4EJSC 3LLUA 2GKSA 4GDFA 4AYXA 1II9A 5EXPA 1NY5A 3QEJA 2A5JA 5J4LA 3FHOA 3I5YA 2CLDX 2OT3B 3GJ0A 4GMDA 4ZKDA 2AK2A 3A1VA 4GZMA 3PFIA 5JCPA 4WXPA 1C4OA 2NO1A 3CZQA 4QBIA 1CEEA 4ILEA 3A8TA 1GM5A 2JATA 4B3FX 4KODA 4Q1DA 4LPSA 4PZZA 3W5JA 1I4DD 4ZDKA 4DSNA 5JJLA 5J4VA 2RH5A 4C4PA 1HURA 1KK0A 1RIFA 3NDPA 5C18A 1JEEA 5FBRB 2PMKA 1OF1A 4LV5B 1JBKA 2Z6VA 4BZXA 2JIZA 2QUZA 3HPQA 2GJ9A 1G3UA 2OESA 2WKQA 1II0A 3U7FB 2W6JA 2G0NA 2CL7X 1MRNA 3B2EA 3ADDA 3QI2A 2R6GA 4P3YA 1XTRA 4TYPA 4TN1A 1HTWA 2Q21A 4KSCA 3OEHD 2F1HA 4LUCA 3GLHB 1KI1A 3AVXA 4ASUA 1AN0A 1E99A 5KPJA 4TSFA 1E9EA 3QJYA 4GP7A 4TMZA 4AIIA 1MABB 2ZYWX 3CH4B 4WA7A 1IY0A 5AUOB 3L0SA 4DVGA 5JECA 1HE8B 3FKSA 4MKIA 3U5ZB 2IS6A 2WSSA 3LDAA 1E2DA 4RJLA 2EWVA 3CR7A 1NJGA 1KNQA 1ZM4A 1TQDA 5FI1B 1OV4A 2VBCA 4BWYA 1YVDA 4Q01A 5KNCA 2YZ2A 5FR1A 2C99A 3DKVA 5GVSA 1T5IA 4C0HA 1ZCAA 2NPFA 3P20A 4JKIA 2GVZC 2YWHA 1XCMA 1E96A 3KKMA 3THYA 1H65A 2GA8A 4D2IA 3K0FB 5FOSA 3RS5A 2PZEA 2N46A 5JJKA 4BPBA 1ZVQA 1YR8A 3DEFA 1J7KA 4IDHA 4UNRA 1CIPA 4I99A 4EKDA 3B1WA 4Q4AB 3U7HB 2DCUA 2I3BA 3Q8XB 5GJCA 1W0JA 2VA8A 3P4YA 3QXSA 4UJ5A 2QENA 3ZVLA 1E0SA 4QC2A 2FZLA 4YDHB 4LBZA 2ZRPA 3OE7A 1T9HA 3QE0A 2ZJZA 3I61A 1WB9A 2QZ4A 2WJHA 2X77A 1E9CA 4NYIR 4AKIA 3VKWA 1N6NA 4X8HA 2GJAA 2IWRA 3GLFE 1D2EA 2QTFA 4DLSA 5BYJA 1A2KC 2CEAA 4FWIB 1R0WA 4NL4H 2VL7A 3GD7A 3GEIA 2J5XA 1D2NA 1W5SA 3TVTA 2DFKB 1IN5A 5K8LA 2HUPA 1W4RA 1MR3F 3TRFA 3V4FA 4IVRA 1XTJA 1Z0DA 5UKDA 1KAGA 4XWAA 5CK4A 2O0HA 2VHTA 4C9BA 2VEDA 1XCGB 2ZJ8A 4DDWA 4A2WA 2FFBA 3VU9A 3PENA 4G01B 2CVFA 2A78A 2R6AA 1UKVY 2GJKA 1ANKA 4DUGA 2NIPA 2NO0A 4WOPA 1M6NA 5JMTA 1AQUA 4DLUA 4IOJA 2R44A 1KIMA 5DLQC 4QKQA 3VR5A 3L2OB 1XEWX 4HB0A 4TLCA 4JJZA 2RGGA 2XEXA 2B21A 1G4AE 3IPYA 2E1RA 3T15A 3TUIC 3MCAA 2PLRA 2ANCA 1CU1A 5D3MA 3SJCA 121PA 2EFGA 2WOJA 1E1QA 4DEXA 4HAVA 1NVVQ 2BKUA 2XNSA 4KSBA 1EFUA 1PVOA 1KI7A 2BC9A 4NU0A 1JR3E 3ZLJA 1I2DA 4IXMA 3LBHA 5DYIA 3RWMB 5J4YA 5C4GB 1N0VC 5AJVB 1AS0A 3A1TA 3A6PC 4QHTA 1DS6A 2Z0MA 4DLRA 1YZLA 4TL6A 4QNRA 1OHHD 2IEYA 2WWFA 3MUFA 3IIKA 3SR0A 1Q57A 5FUVA 2R6FA 1NY6A 1U8AA 1HV8A 2AR7A 4PAOA 2R9VA 5JJIA 1JJ7A 1BOFA 4TYNA 2J0SA 2DFTA 5L3SA 3B1YA 4LV6A 4RZ3A 4JL6A 3F5FA 1WE2A 1P4SA 4AI6A 4KV9A 3HR8A 4B3GA 1JQJC 1E32A 5IK2A 1G3QA 1TMKA 2WMNB 3AB3A 4M2LA 2A2ZA 2AWNA 4O2LA 3I62A 4EDHA 1TU3A 3RAPR 2OG2A 1D2MA 4ZV4A 4B3CA 5LBIA 2NZ8A 4HUQA 4UKDA 4OK5A 1AZTA 3RABA 4MKHA 3GJ6A 3X1DA 4LSGA 2OBMA 2PZFA 3LH5A 3UG7A 4M1KA 2IT1A 2B7BA 3N5CA 4PFSA 5K8IA 2KBEA 2R2AA 1ZC3A 5DE3A 4M1WA 1IY1A 1E2EA 5BYKA 1U8ZA 5DSZA 1GZSA 4M1SA 2AXNA 1M34E 4M0LA 1JNYA 3EA0A 4JLDA 2FJUA 1JPJA 2XXAA 4AC9A 1EX7A 2OV2A 1FUUA 3SDZA 2OHFA 4IEEA 1P6XA 2RHDA 4NDZA 2PBRA 2EVWX 2FFAA 3LBIA 3I4LA 1DAGA 3NTUA 2O5VA 1BMFA 1YRBA 3OIYA 2NGRA 3A36A 4IHQA 3K70D 3ICEA 3DZDA 2QSZA 4BFWA 2IF0A 4AKGA 2P3SA 3ZS9A 1YU9A 2YNMA 4JLNA 1SVSA 3O8CA 3RVBA 4B74A 4UNSA 3P27A 4KCGA 2ZUCA 5B58C 3JZMA 2GRJA 2GAOA 4OQNA 3CRQA 4NYJR 4JVSB 1E1RA 3U6BA 4DSUA 1OFIA 4Q47A 4OYHA 1UBFA 4BZPA 5TB5A 1AKYA 3OAAA 2FPLA 2R6DA 4JBWA 3FHTA 3CH5A 2Q9AA 4D0GA 2WPDA 5KNDA 1ZM3A 1TPZA 3HDTA 1NL3A 4DB4A 1NN1A 2IYSA 3ECCA 3NVAA 4M1YA 2CLSA 1P9RA 2CHVA 5F9HA 2AL7A 3VKGA 3W3ZB 4NHOA 1UKYA 4F91B 2XSZA 1OFHA 5AJWA 2QROA 4D4MA 1H8EA 4HLCA 3FFBA 4TYQA 4RKEA 2FE4A 3B60A 4HATA 2DB3A 5G40A 1W4CA 3BERA 3T35A 3LX8A 4YMUA 3VHXA 2ONKA 4B3BA 2DPXA 3AP2A 3OEED 1EWQA 1WXQA 4JLBA 5F2EA 2F6RA 1KO7A 2L0XA 3IUYA 5EZ6B 5C46F 1L4UA 4CEIA 3V4RA 1Q3HA 2C95A 1RKBA 2C9YA 4I1OA 1ZD8A 4J0QA 5FL3A 4ERNA 1TQ2A 4IEIA 1E79A 1NMZA 2IUSA 1KDPA 3QG5A 3KXKA 1XD2B 4MGZR 5JHHB 3VX4A 4TMWA 1KI4A 1YZUA 1H8ED 4ABYA 3T5DA 2KBFA 4D4KA 4C0BA 2H5EA 1J90A 2JLUA 1VCNA 3VAAA 3KKPA 3EPKA 1I4LD 1OSNA 3C16C 2OLKA 2IA5A 4TT3A 3K53A 4ZO4A 3NG1A 3BH7A 3M4YA 5J5CA 1GITA 5GJBA 1VIYA 1N6KA 2G83A 4LHVA 4LC0A 4QBGB 3K70C 1U0JA 1EK0A 4LJ8A 4LJ9A 1ZNWA 1ESNA 4XH9B 4HDCA 2DWOA 1NVWQ 3ZS8A 3PCRB 3C4JA 4MRVA 1Z6GA 3LNCA 3GFPA 2DY1A 1N0WA 2D62A 4ZIRA 2GCPA 1SXJC 4MA4A 2YHSA 3CZPA 3VQTA 1E9AA 1LV7A 2EYQA 1IOZA 1MO5A 3EARA 2DYKA 1R7RA 4BE7B 4MKFA 2AKYA 4F93B 3GJ5A 2XXAB 2P2LA 2OLJA 4LYJA 2BHRA 3LVRE 4HDOB 2V7QA 1QHGA 4A82A 4KAXA 3DDCA 1VKJA 2YWEA 3QXJA 5EP1A 4AURA 1P60A 4XWOA 2WWGA 3BORA 5G53C 2BVNA 1SKQA 3KJIA 4BLSA 5IK2D 1Z63A 3JVUA 4JKYA 1XPUA 3K9NA 4QM7A 3D8BA 3FYHA 4MYHA 1ZU4A 2DHRA 2VSOA 2ZREA 1ZUNB 5CB8A 1E2MA 3OIWA 2ZRNA 2WWXA 1ZM7A 1Z6TA 1U81A 4BFXA 4Q7MB 1XD8A 5DH9A 3ND9A 4TZ6A 1W49A 3KFVA 1EX6A 1Z2CA 4ACBA 5FL7A 4RZXA 4Z8XA 3TSZA 1QF9A 3GFTA 3X1ZA 2FDCA 3T1TA 4LJAA 2OO7A 3K0CA 3BWDD 4EAQA 2PH1A 1NP6A 1G291 4JYCA 3ZD6A 4Q9LA 3GJ7A 1JR3A 4JLJA 4NYMR 3E2IA 2QPTA 2ZJYA 4AG6A 4KFRA 1QHXA 4RD1A 4XOIA 2V55B 2F55A 3K09A 4JBXA 5AJZA 5CIQA 3DOEA 4DUGD 3KX2A 2TMKA 4PO9A 1IN4A 4FN5A 2CBZA 3X2SA 3A1SA 4PX9A 3ONWA 4KLNA 1OH5A 1NG1A 3N70A 4EPRA 3BE4A 2C04A 3AP3A 1IBRA 4NYJQ 2ZU6A 1RYHA 3MGCA 1XB2A 1WCV1 3L8YA 1U8YA 4GOKA 4JLPA 2WSMA 2QE7A 3X1XA 3AVUA 2KI5A 5FL7D 5CDFA 4Q7JB 3ICQB 3BK7A 4A15A 4LJ4A 1OB5A 2AK3A 2R8RA 4WW0A 1AK2A 5HTKA 1YQTA 2JDIA 3UANA 2ZJBA 1WRBA 3AUXA 3BB4A 1Z0JA 2WJYA 3P1JA 1KKLA 2GZAA 1GDDA 3CNNA 4KYIB 4AD8A 3TSOA 2XZOA 4KU4A 2CDNA 621PA 3PUWA 1SULA 4WZBE 1M7BA 1M7HA 4G5GA 5FFMA 4PSVA 1US8A 5H68A 2CLCX 4YMVA 4TLDA 3QSYA 1SGWA 4UJ3A 4JVMA 4DLWA 2DFLA 3VU9B 1KOFA 4DSOA 2RB4A 1E94E 2A30A 1R0YA 3AVYA 4Q4JA 4QJ5A 4N0EA 1AS3A 2O8CB 2IYLD 1LFDB 2XJ9A 1GKIA 3SQXA 5FBWB 2QY9A 1IHUA 2QP4A 5EXTA 4OQXA 3DMNA 4V0KA 4B34A 1TUEA 3DPUA 3GFOA 2BMJA 4JLOA 4TSFD 3R9XA 2GESA 5JWRA 4LYAA 4RKFA 4M1MA 2ZRAA 3OEHA 1CJUC 2BMDA 1XTIA 2EFEB 1G7SA 4LHWA 2WWWA 4TQ9A 4W7SA 3CB4A 2IYZA 2ZRDA 3DMDA 1ETUA 2ZI9A 3H4MA 1IXRC 1R6BX 2ZJ2A 4CEJB 2JIZD 4MGIR 1KY3A 4BUJA 2RGAA 2QT1A 3L43A 4LCBA 5B64A 1YHNA 2ZIAA 1SXJE 1G9XA 2RKOA 4JL5A 2YINC 3L0PA 4D4JA 2H7VA 3ADKA 2QL6A 4WVFA 1SVWA 4WZAE 2IYVA 1G16A 1UKEA 2QBYB 3SJBA 4Q02A 4V0NA 4PPGA 2QAGB 3U60B 4IOKA 4A8JA 3THYB 3DZ8A 5TV2A 1YZKA 2B8WA 1J8YF 3EC1A 4LJ6A 1XEXB 2ZRFA 2VP0A 5AUNB 1QHHA 2DWQA 3AKEA 6Q21A 4Q19A 4KFUA 1AS2A 4P4TA 2OILA 1T91A 5AK0A 2ZXUA 1E1RD 2O8FA 1P9WA 4C0SA 5LD2B 1ZUIA 4WZ6A 3RS7A 1AM4D 4HB3A 2FOLA 3ZZ0A 5DI9A 1A4RA 1J2JA 3T12A 4JT4A 1N5LA 1LY1A 4LOAA 3K9LA 4HEJA 4LBYA 4B44A 2GF9A 3CF2A 3T5GA 2EQBA 3UG6A 1A82A 1XPRA 1XJ0A 4H1UA 4BRWA 4I1UA 2A7QA 1G19A 1R5NA 4BECA 5FR2A 1ZD9A 1Z0FA 1H8HA 4URXR 3CNOA 5L3QA 3AP1A 2DR3A 2FMXA 4B2PA 1KGDA 1E9RA 2P6RA 1MRSA 1E2HA 2E87A 2ZJ5A 4UNNA 2OM2A 2ZYTX 2BWJA 1T4GA 1ESMA 5FTKA 3VTKA 2QP9X 2NO7A 2WM9B 5JHGB 2XSZD 4HB4A 4US0R 5IHPA 5JI2E 2X2FA 2KJQA 5CYPA 4A6XA 5CB6A 4MRSA 5JWOA 1AGPA 2IYUA 4U5XA 5HPYB 2CE7A 4EIWA 3ADCA 4MYUA 2RCNA 4PHFA 4TQAA 1SVMA 3PITA 4V0OA 2ZRGA 2WJVA 4EPTA 3GQBA 3C41J 2ZE7A 5G3YA 4A0RA 5AJXA 5FUYA 3GJXC 1DVRA 1QHIA 2WAXA 2ODEA 3MWLA 4HLDA 4C30A 3C5CA 2VTKA 5BWMA 3OESA 5L3QB 1VDZA 1II8A 1S96A 2QI9C 3U44A 1XTSA 2ZPTX 1QRAA 3AVPA 1QHNA 1HQYE 4Q1CA 4CRWB 2HCJB 3TH5A 5HKKD 3SE0A 1DEKA 4CVNA 3FMPB 3H2YA 1F60A 2FH5B 3GLIA 3KKOA 1J99A 1JI0A 1FMJA 2LKDA 3NC0C 4B73A 1IAQA 5FBVB 3IO3A 3SHWA 1KI3A 3EZ2A 1KI9A 3QXCA 1Y63A 2AD5A 1U0LA 2X1VA 4TT3D 4C0AC 1TX4B 4A0FA 4QHSA 3LX5A 4RCZA 2AFIE 3SYLA 2KSQA 4BFUA 1KO8A 3FMOB 3ASYA 3WBJA 1VCMA 2IWHA 3U7GA 2RGXA 1XEXA 1K5GA 1UDWA 2OE2A 5FOXA 1G7CA 1K5DA 2PMDA 4C0QC 3B9PA 4FXPA 1UEJA 2G1KA 1L8QA 1OYWA 1SXJD 3RSLA 3FTQA 2UZIR 5EUQB 3VR2A 4OHVA 4PHGA 1OH6A 5KHOC 1PLJA 2H16A 1XEWY 4JLVA 1OH8A 2WMOB 2PT5A 3SBDA 1ZUHA 2G3YA 4XVRA 5ANRB 3VR4A 2YV5A 1R2QA 2JJ2D 3NWJA 1CRQA 5GVRA 1Z8FA 4IXNA 4IDQA 4DLTA 1U90A 2J87A 1RZ3A 3CWZA 4V02A 5DISB 4BGDA 1XXHB 4Q1EA 3TSWA 2NQ2C 3UIEA 1GUAA 1DADA 1UEIA 3SNHA 1YKSA 1OKKD 4A2PA 5KPDA 2V6IA 4JVNA 2PCJA 1W48A 1VMAA 2H92A 2J7PD 4Q03A 4R2HA 4BLPA 5H8WA 2QMUA 2F43A 4UNPA 2H1LA 3GLIE 3GJ3A 3ZIAD 1B23P 4WBSA 2BDTA 3RRNA 3AKYA 3R7WA 4M4SA 4IFBA 4LGMA 1ONBA 5CYOA 3W8NA 4OHZA 3K0AB 1QDEA 3QIAA 1X1RA 4TTQA 5D3QA 1D6JA 1CXZA 2HDNB 3RSOA 1X8JA 4LYHA 4JS0A 3KKQA 4NE2A 4DCTA 4FI3C 2W2VA 4NKRA 3THWB 4O2RA 2WZQA 1LF5A 1GKUB 2DFNA 4N0DA 4BQSA 2I1VB 3KTAB 3KZ1E 4IRUB 4EQ6B 1WF3A 5KTYA 1ZNYA 4UXIA 3FGNA 1GNPA 2V1UA 3W90A 3PUVA 4DJTA 4RCYA 3EZFA 1KJYA 2ZITA 2NZJA 5LDDC 2Q3MA 1NF3A 4URWR 4TLBA 2GBLC 3WY9A 3R8CA 1GVNB 1M2OB 1W46A 1SVKA 1UBEA 3BH0A 4DKXA 3X1YA 1UBGA 1TF2A 3K0CC 1H8HD 4PTLA 1NI3A 4KBFA 2QNRA 3E5HA 2QT0A 4GL2A 2C9CA 1XCPA 3BB3A 2GZDA 3SC3A 1GL9B 1X3SA 3TUJC 4I81A 2SHKA 3NHBA 4I1VA 1CULC 4BEBA 1G7RA 2BBSA 1FNNA 1Q22A 4HI0E 1ZIOA 1SVOA 4KBGA 1OIXA 1KJWA 5J47A 1U94A 2HV8A 1OJLA 5TMPA 2MMGA 5L3RA 1CR1A 3U3JA 3ZYCA 3B7GA 4TWZA 3ZH9B 5A5GA 1W47A 2F1JA 1FNMA 4FD2A 1RRFA 1VPLA 4M8NE 4TTRA 1E2FA 5TXGA 3TBKA 3TE6A 1UADA 4C0JA 2AD1A 3CPHA 4BFTA 3CM0A 1DAEA 4DIEA 2GCOA 2QA5A 1OXSC 1KO1A 5DI3A 1PLKA 5C4MA 3KQNA 2PCLA 2Q9BA 4GBMA 4HSEA 3MWYW 3SN6A 5JEDA 2DWPA 4Q9HA 3B1ZA 2NO6A 3RS0A 4XJXA 4EJSA 2KWIA 2WICA 4DRZA 1IN8A 1OLOA 1KK2A 2YC4C 5FOWA 2JDID 2IF2A 4BLQA 1XD9A 2IYRA 4YONB 2GHIA 1KI2A 2CMKA 3IPXA 3NC1C 1Q1BA 1RRGA 2B6HA 1E2IA 1Z08A 4PC1A 1MH1A 4HAZA 1DAIA 1G5RA 221PA 2JJ2A 5CM9C 3EPHA 1TADA 3DHWC 2VHCA 4LK2A 1CJMA 2Q9CA 1TF5A 2AKAB 1HQCA 4R7ZA 1W36D 4GPTA 4CEHA 3QKSA 1N6RA 3IEVA 4B33A 1F3OA 4DC9A 2HF8A 1G8GA 3WYFA 1N2CE 1LVGA 1TEXA 3AGQA 2XB4A 3TJZA 4ZCIA 3MRSA 4JSYA 4AY2A 2O8EA 4Y0VA 3I32A 3UWKA 1OB2A 4GOXA 3CPEA 4X8LA 3RDPA 1N5IA 2FF7A 3L8ZA 5EE1A 5A0FA 3R20A 2ZYUX 4CYMA 5EE5B 1P72A 1F5NA 4FMDB 1XP8A 2C96A 2FGKA 1FX0A 5EE9A 5FBQB 4DWJA 3AEZA 1BKDR 3A4NA 5ELXA 2OUKA 2BBTA 2ZJOA 4Q7LA 4G5SA 4A8JC 3NEYA 5FPTA 1Z3IX 2RGNA 1YR6A 2W6JD 4K46A 4DEYA 3KDSE 4AWXA 2JEOA 4L15A 5EJEA 1A2BA 5TY0A 3QKUA 3CX8A 3KB2A 3N2EA 4RD2A 4NBSA 4D25A 1TUIA 1Q1QA 3HPRA 1E69A 3H0KA 5FBLB 1G6HA 4MYTA 2NOAA 1U98A 3GEHA 2JLVA 1OFUX 3MMPA 4L16A 2ZSFA 1I4TD 2OAP1 3AF1A 4M9XA 4B6EA 4JSTA 1AQYA 4M1OA 5FPKA 3OHMA 4GT1A 2X2EA 1W0JD 5KSOA 2XOKD 3AVWA 2ZAOA 3IIMA 1NN3A 4TMTA 3UATA 1F48A 5K8UA 1NMXA 1FTNA 4ZI3A 3QBTA 2OCYC 3SS8A 3IILA 2JLWA 2YOHA 3NXSA 4YDSA 2FU5C 1RJ9A 2YC2C 5BN5A 1LS6A 4H1VA 3JZAA 4FMCB 1M8PA 1W0KD 3NIBA 4CT4B 1L4YA 4FWTA 1XJQA 2AXPA 2FSFA 3AV0B 1DAFA 3OE7D 3P26A 4KJZA 4M21A 2XZLA 1NVVR 1MOZA 5J40A 2ZS9A 4G5QA 1TQ4A 3PEUA 2JLZA 3VHLB 3TVDA 2EWWA 3BS4A 1HUQA 2QTHA 1Z47A 3BD9A 4TYYA 1U9IC 2ZS8A 4AYWA 3K9HA 2HJGA 1G18A 4OI0A 1AZSC 3MWKA 4M22A 4HYYA 2WKPA 4R98A 3VR6A 1Z6AA 1ZNXA 1KDTA 1T6NA 2P5TB 4GP6A 4P32A 1R5BA 2O8EB 1PUIA 5CM8B 5JS7A 4Q5IA 1NIJA 3M6AA 2FN4A 5J4HA 1Q12A 4PC2A 3T34A 2BIFA 1BIFA 1P5ZB 1SHZA 3HJNA 4LHYA 4D81A 4P4SB 1YZQA 4V0ME 2DBYA 2D06A 2G6BA 2YWFA 3OFND 3GLFB 5JFGA 2BBOA 2OFOA 3CLVA 1NRJB 3PXGA 2A3RA 3RS3A 3CRW1 3SZRA 2EW1A 1W2HA 2VIIA 4U02A 5JBQA 1G3MA 4M1TA 3SEAA 4YMSA 5E4FA 1COWA 3PG5A 2A5GA 5JZVA 2VF7A 5KSPA 2RGNC 4NYIQ 3TAHA 3QG1A 3CNLA 4MKGA 1ZRHA 2NO9A 4ARZA 2FNAA 2GWHA 4C0LA 1NBMD 1VHLA 2J0QA 3V9PA 1X8KA 4U7DA 1Y3AA 2XNDD 3IQWA 1SVLA 1GRQA 4NTZA 2GCOB 4DZZA 1XF9A 4RFSA 1VYTA 2C77A 3IIJA 4HAXA 2ZSBA 5A4JA 3NHAA 3LBNA 4KO8A 3I3SR 2CCGA 4Q4LA 1SKYB 5JWHA 2A5DA 1JAHA 1SKYE 2V4ZA 4JLMA 4QJ4A 3U6KA 1E79D 4PZLA 1S8FA 1MKYA 3SFVA 3PVSA 2GVDC 4BRUA 1CP2A 2UVQA 4HUQB 1CF4A 1IONA 3AUYA 5EE0A 2NPIA 1BYIA 2GCNA 1ZM2A 2QSYA 1XMSA 2FEOA 4LJ5A 3HU2A 1FFHA 2QMOA 1WP9A 3KQUA 2XX3A 1N6PA 3CX7A 3TKLA 3VNUA 3LQQA 4ZKEA 5HCIA 3RS2A 3BBPA 1KI6A 4ZCLA 1L2TA 2B7CA 4Q4HB 4DCVA 2PZGA 2HCBA 4YC7A 3AVTA 1MT0A 4D26A 2NMVA 3A1UA 4PQRA 4RVCA 2P6NA 1GWNA 4GMXA 1KI8A 2D2EA 3AKCA 4HDQB 3BJIC 2AX4A 3KJEA 4LC1A 3QENA 2N42A 1DARA 4G1UC 1RFLA 1W7AA 2GDJA 2ZRMA 5G3ZA 5B57C 3RS4A 2F3TA 1P2TA 4QGFA 2IUUA 4WAUA 2WKRA 2XAUA 4GI7A 1AGRA 1PV4A 5CLQA 1CJVC 4JYBA 3I73A 2MSCB 1F6BA 4LX0A 1E4VA 2EFCB 1ZW6A 3Q5EA 4JZKA 2ZI4A 5CIWA 3EZ9A 4YMTA 2GEDA 4QM6A 4IOMA 5FOTA 1SXJB 2IC5A 2J0UB 4B75A 1R10A 2JLRA 3R7WB 1KMHB 3L0OA 2VQSA 2XTZA 2F43B 4Y0AA 1TQ6A 1MO6A 5E7IA 2JCSA 2JJ1D 1P73A 5GADl 4PSKA 1XPOA 1KY2A 2OCBA 2FSIA 1E2LA 1XXHA 1P9NA 4G5RA 2VP4A 3OZXA 4DT1A 5LB2A 1S3SA 2GK6A 1TAGA 2C9OA 3QXXA 4PZYA 4Z1MD 4IKEA 3Q7QA 1G4UR 1X86B 1GL6A 4B3DA 4DIDA 3FB4A 4IW3B 2FEMA 2C5LA 3EIHA 3EWSA 3NBFA 3W6NA 4OQMA 2IEZA 3T61A 5CLLA 3LO5A 3V00A 1KO4A 1S4QA 1ZMXA 3CWQA 5BW8A 3BAFA 4P33A 3EWAA 1S9DA 1VYVA 2AWOA 5F9FA 2HXYA 4PAQA 4YMWA 4KVAA 2ZETA 3IQXA 1SQ5A 4L8GA 1RC8A 3K1JA 2BMFA 4E03A 1ODFA 1XMIA 5EQTA 3IO5A 5KU1A 3I5XA 3H86A 4V0MA 4IVQA 3KQHA 1R0ZA 1FL9A 3EX7C 1VCIA 5GJWC 3SI7A 1NNEA 4NCNA 2IYWA 1G5PA 3FMIA 3PJRA 2VO1A 2O0KA 1KTVA 1R8QA 2CHQA 3GJ8A 3HYRA 4LY6A 4JJKA 1FP6A 1S1MA 4BEJA 5CJPA 3MJHA 1NIPA 2D3WA 4MUAA 1FW6A 1T5LA 2ZSAA 2V9PA 4Q4AA 3OEEA 3QBVA 3LQRA 1CR4A 2Y8EA 1IN7A 3BC1A 4KLZA 3GCGA 1OXUA 1P2VA 3AVOA 4W9MC 3K0FA 3L82B 1IXSB 4XD7D 2GETA 3W34A 3B85A 3GEEA 3ZJYA 3QOFA 2QPAA 3PEYA 2JLSA 1NSFA 2Z4SA 5AWFC 5IDVA 1DAHA 3O8DA 4HLUA 4PR0A 2WWIA 3BOSA 4TL8A 5JRJA 2FGJA 2JJ8A 1KZGB 4NONA 1P7CA 2QGZA 2ZU0C 3S1AB 2CCKA 2VPPA 1XWIA 3FMFA 1MO4A 2WIBA 3GLGE 1HT2E 1VG8A 1XTKA 2CXXA 4A0HA 3JVVA 5IT5A 2ZI6A 3QEOA 2C8VA 3ETLA 3AGPA 3CRMA 3SOPA 4F38A 3QKRA 3AF2A 3ZZTA 3ND8A 2CL6X 2FSHA 2QORA 4FMBB 2GTPA 1KSJA 1NLZA 1N6IA 1Z5ZA 1FPMA 4ITRC 1SHKA 2HT1A 4DLXA 2R6CA 1JPNA 2V7QD 4HAWA 1YZNA 3K9GA 1GG2A 3S1AA 1YZGA 3TW4A 1QHHB 3NBYC 3U3MA 1BMFD 4FCWA 2QMHA 2ZVQX 3EZ6A 4TYWA 1HE1C 1KYIA 3RANA 4L9WA 2MSDB 5JS8A 2H17A 2PEYA 3KJHA 4A8JB 2BOVA 1NLYA 1ZJ6A 2IUTA 1YRAA 3LA6A 3LY5A 3WP1B 2QBYA 4NH0A 3RLFA 1XEFA 1T3LA 2CCJA 2VSFA 1VIAA 2JGNA 4Q1AA 1NMYA 1BS1A 3P4XA 3W3AA 4UNQA 1S3GA 1N6HA 3IGFA 3Q3JB 4P4UA 3U3RA 5BN3A 1JAIA 1W36B 2A9KA 2HLDA 1ZIPA 3ZVMA 3IBGA 4PHTA 3F3YA 2BCGY 1E2GA 1KNXA 2VHJA 4Q9JA 1CR2A 4HAUA 2YOGA 2W2TA 4Q1BA 1QHYA 3ZQJA 2MSEB 1UDXA 1AIPA 1F2UA 3EG5A 4W5JA 4M53A 3ZD7A 1Z83A 3FVQA 1IM2A 3CPJB 1UJ2A 2I1QA 3KB1A 4OL0A 4PO8A 5EP3A 2PJZA 5EUMA 2PLFA 1P61B 2WJIA 3BGWA 4B2IA 4AKHA 1NJFA 5SZJA 4NZYA 1TNDA 2ZRBA 2J41A 2CL0X 1RRPA 5L8VA 1ZCBA 2V1XA 4Q4JB 1PUJA 2FG5A 4BLTA 3D31A 4US1R 5AJYA 2QMEA 2RGBA 2BBWA 2YJTD 4Q48A 5TDHA 3GJ4A 3OAAD 1N25A 3REGA 2F9MA 1Q3TA 2W83A 1Q44A 2P5SA 3TQCA 3KKNA 3CIOA 3T06B 4AKEA 1US8B 3G5UA 1ZBDA 4IDNA 3VNVA 4DT1B 2P65A 1GAJA 2W0MA 1XXHE 3FE2A 1XBTA 2JASA 2ZRLA 4IFEA 4JLKA 1KO5A 3B1VA 3RYTC 4B2LA 4ESHA 4XVQA 1NSTA 1DPFA 2Q0HA 2GILA 2ZI7A 2VHUA 3WRYC 1VYUA 2PX3A 3QNUA 1PLLA 1D9ZA 4OJQA 2F7SA 3TAUA 3EC2A 4AG5A 3LAWA 1W36C 1WBBA 1FQKA 1VTKA 3TR5A 5DN6D 1SXJA 2Z43A 2V8OA 3MD0A 4OK3A 2BJVA 3PV0A 2IX3A 1YR9A 2A5YB 1AA9A 3FKSD 2YYZA 1XMJA 5P21A 1E2JA 1JQLB 1UBCA 3MWJA 2O8DA 4XD7A 3QF4B 4Q9KA 3EZ7A 1YE8A 1JECA 3CX6A 4LI0A 3K70B 3D7MA 1X6VA 3TW8B 1ZU5A 1Z28A 4CIDA 1KK3A 2ZROA 4B48A 3CW2A 5BQ5A 2ASEA 4K81B 1V5WA 4UXHA 3VMFA 2PT7A 3IEUA 1FTSA 3UKDA 1HA3A 3AF0A 2QEQA 1KI6B 2X19A 3F8TA 2ZR0A 3UMRA 3LD9A 3M0EA 1JALA 4FCTA 3LLMA 2VHQA 1VECA 2GNOA 4ZDIA 2GEVA 3BRWD 4PC3A 4GNKA 4KI0A 3WRXC 2AFHE 1ZINA 5K8TA 1T3SA 5KSYA 1GOTA 3PUYA 1C1YA 4O3MA 4R9UC 3VX3A 4C0KA 5DHAA 1W5TA 3LFUA 4A92A 3I8SA 4H9GA 3RRMA 1UAAA 2VF8A 721PA 2ANBA 1RW4A 2OBLA 3PQCA 4LZZA 4MDFA 1P2SA 1M1YE 3LV8A 4X8MA 4TLEA 1WMSA 3KFXA 4RSGA 2H18A 2IS2A 2C03A 2GXAA 2IS1A 1BYUA 1R8SA 3HP1A 2QN6A 4QGGA 3KQLA 2FZ4A 2OXCA 5FPSA 3UWOA 2ZEJA 3MSXA 1UPTA 5KDDA 4QGAA 3PEWA 2HYDA 3M1IA 1Z22A 2WWYA 4N1AA 2CK3D 4V03A 3MJRA 2QE7D 2AN9A 4KHZA 1CRPA 3B1XA 4D82A 4D0LB 3Q5DA 3WBKA 3AH8A 5FH9A 1VG1A 2JJ1A 3B82A 4IVPA 1A1VA 1YZTA 3EIQA 4POAA 5HKKA 1N0UA 3H84A 1O3YA 3HWSA 2FV8A 3WMGA 1YR7A 2JLQA 2FPKA 2W0SA 3CKLA 4R71A 3IDQA 2Z4RA 1KZ7B 2IXGA 2REXB 1QZXA 3LRPA 1D8TA 3FPAA 2VP2A 3MAAC 3RC8A 5DYGA 3MFYA 3WYGA 4LJYA 3CF0A 5HZKA 4PO1A 2Q6TA 4HAYA 4O25A 4ZDJA 1UKZA 2YWGA 1XD2A 4NCKA 4XIGS 1ZNZA 1UF9A 3REFA 4GOJA 5L3VA 2ZANA 4JBYA 2ZRJA 3TIFA 1E4YA 4DBLC 4OK6A 1HY3A 1KMQA 2WPDD 3GPLA 2P67A 1U0HC 3ZVRA 5EZ5A 3BH6A 2UZ3A 4F4IA 1SVIA 2KE5A 1EFCA 1EFRA 2BV3A 1CJKC 3IKJA 2HT6A 2D4HA 4ZPXA 2BM0A 2CNWA 3C8UA 3NH6A 2O8BB 1K6MA 4OQLA 4PC7A 4PPFA 4CT5A 2D7DA 1G20E 2ECKA 1PZNA 4G3XA 1Q21A 4A4DA 1KDRA 2UKDA 5FTNA 1F2UB 2ATXA 1S2MA 1OH7A 2QM8A 5FUWA 4Q7KA 2OEPA 1NN5A 4ZDWA 3LWNA 2XGJA 2QQ0A 5KUTA 2GBLA 2ORVA 2PL3A 4LV8B 4XTCS 2PJRA 1EFHA 1RRCA 5FTLA 3GLHE 2ZTSA 3QPUA 5KNBA 4PAMA 4OHWA 3HYTA 1W4AA 2REOA 5HCNA 1FQJA 2XZPA 1FMLA 1W44A 4DHEA 2GF0A 1P75A 1TL7C 1M7GA 4PC6A 3A4LA 2FWRA 2ZUBA 3UMSA 1E2NA 3CONA 5HE9A 4RD4A 1E0KA 3ZDQA 4XSGA 1EG7A 3C14C 4ASUD 2IYXA 3PUXA 1KDOA 3DM5A 4BASA 2ORIA 2N1BA 3G0HA 1NKSA 2QM7A 1V43A 4WXRA 3AKDA 2ZRKA 4A9AA 3B9QA 1DE0A 4CDGA 4QOSA 1BO6A 4AK9A 1EXMA 5EXSA 3RNLA 1DOAA 5E95A 3EASA 1E98A 2O0JA 2CHGA 3WNCA 2ZI3A 1SZPA 1C9KA 1FX0B 1NVXQ 3MG9A 2QP3A 4ESVA 3QKRB 5C2JB 1NLFA 5IF9A 2D7CA 5DIFA 1Z0IA 3TK1A 3WNBA 4EFNA 4EPWA 2JLYA 2GZHA 1Q0UA 3QXHA 4A0GA 3GLGA 4TZ0A 2OXRA 3SYNA 4NCIA 2BCJQ 5LPNA 4JIMA 3KL4A 1UFQA 4D6PA 4ZCMA 4B32A 4A1FA 4CF7A 3DL0A 1CLUA 2IHYA 3QKSB 4CEHB 1Z0AA 4E5UA 4A2QA 1VHTA 3OIVA 3EPJA 1OXXK 2ZR9A 1WBDA 1G8YA 3PIRA 4N3NA 1EGAA 1DTSA 3DKPA 4C2TA 1T0HB 2WV9A 2AHOA 1A7JA 1IJFA 2Z5FA 4Q1FA 5TARA 3VR1A 5L3SB 1JB1A 2PX0A 2VYFA 4YXWD 2FPMA 2J59A 3BB1A 4MGYR 5EP4A 1O87A 1MO3A 1OW3B 5JI3E 4KVGA 2ZE6A 5FPYA 4Z51A 2OCAA 2IS4A 4FIDA 5FTMA 2RMKA 4FCVA 3IBYA 2IXEA 5KO2A 1OXTA 1NKTA 2JAQA 4XVUA 4HZUA 2QG6A 1E9BA 1IXZA 1S1CA 4IOLA 1FZQA 4W5HA 5SZIA 5HE8A 2WWHA 4KFSA 3C15C 2KB0A 2OCPA 1OHHA 2GJSA 2HF9A 2WBLC 1N6LA 2ODWA 2ZR7A 1XZQA 5D3MB 2A5FA 5FI0B 2BEKA 3CRRA 1Q20A 4M9SA 1XDBA 2F1IA 3GMTA 4LWZA 1D5CA 5CDFE 2YVUA 3X1WA 4MGKR 2QQEA 1EFRD 2QU8A
chains in the Genus database with same CATH superfamily
2OCXA 3WLSA 1L4GA 2HXGA 3B5EA 3DDHA 3HK2A 1FFGA 2REQA 1T8UA 2ZZNA 2B34A 2OO3A 3OZBA 3ASUA 3IEPA 4XWGA 4RY8A 4R2XA 4FQ7A 1I7QB 3HB5X 1O9HA 1ECGA 1JZTA 1RJFA 3C24A 4QDZA 1M2HA 1THGA 3IKVA 5DGIA 1QH1A 3TTSA 4NZOA 4F3KA 1BZYA 821PA 4KR6A 5DCLA 5IJ0A 1GRCA 2JGMA 2WK1A 4PYKA 4PQGA 4DCUA 5GOTA 3CCCA 4PX3A 3H16A 3U7EB 4N65A 4QGSA 3WTBA 3EZNA 1R9JA 1CRZA 1X77A 5SY4A 5K7SA 2R5WA 5IXYA 4XTRA 3VTFA 2WG1A 1C0LA 2B4KA 3IHLA 4NMMA 4YGYA 2I4OA 5KSZA 2ISSD 1NN0A 3THWA 3AL2A 4NCAA 2AOWA 5KWEA 5DN6A 4DV4B 1F6WA 3ZE8A 3ZDAA 4DMHA 3I28A 1NBMA 3HEAA 4MQ4A 1JZSA 1G9SA 4COOA 1T35A 5IAGA 4XB2A 5KOYA 5IKEA 1IOWA 2MT9A 5BN4A 2PV7A 1E9FA 2C1XA 3RK4A 1V71A 5H7XA 5BR7A 2FX3A 3TLXA 4MLZA 2QAGC 3ELUA 4XEHA 1Q1ZA 2A92A 2IYYA 1EHCA 3DVLA 5LBUA 5KAPA 1X9IA 3K7EA 4UM5A 3UAVA 2XUAA 2BFEB 3P0RA 4TL7A 3GO4A 4KRGA 3KXLA 2QGFA 4OX9B 4N0PA 1MC5A 1Y9AA 4DDUA 3FYCA 1RTKA 1TAQA 1GN9A 1Y7LA 3CLSD 3TB4A 2WIJA 4BO4A 4LF8B 4PGMA 3MMZA 5KDLA 3H3JA 4C21A 5KQLA 1UINA 1EWRA 1G8HA 2CXTA 5IBPA 1E5XA 1R0BA 2XOKA 3BMNA 2Y6UA 3SJUA 2VZ9A 2VCEA 3E9CA 1DRVA 4N8SA 2G77B 4RSHA 4BIMA 2XRZA 1P80A 4QRHA 1CDOA 2YY6A 3LNTA 4M55A 1ESZA 4RIFA 4TYYA 1Y33E 1FUKA 3DZHA 4FFSA 3QFHA 3UQYS 4ZYYA 2I6UA 2NVWA 2H5LA 4Z54A 4ICIA 4UE3S 1PT9A 4BNTA 3MJ4A 5EIXA 3S8EA 1DBSA 4X71A 2JA1A 2R11A 3CUEF 4M83A 1CNEA 1N0IA 1DELA 1F4LA 1P4AA 1Q17A 1RAIA 1XT6A 1YFZA 3DDNA 3IOBA 1KS2A 4HFMA 5BW5A 5IS2A 4IJ5A 1GSHA 1QAOA 5HRUA 2XGGA 1GNRA 4FGJA 2O50A 2ZB7A 4MV0A 3N8GA 3T1QA 1QR2A 3JARA 4ODIA 3UT5A 5BSMA 2A88A 5E7MA 4J3NA 4DUPA 5KVCA 3LLVA 2V7PA 3G0GA 2Q0XA 1A9PA 4OHXA 2UUAB 2HJVA 1W59A 1Z29A 4LPKA 4XWTA 4F97A 4CKZA 4G89A 1E4EB 3WLKX 2B8JA 4NU5A 2R6HA 3GLHA 4P36A 1PL0A 1U8UA 1W4BA 1Q7RA 1A8QA 1WAMA 2EZ8A 3CURA 3D8UA 1H2YA 2IL1A 2BFAA 3RRXA 4WKBA 1CR0A 2Z8ZA 4MR7B 4XZ3A 2C78A 1H1LA 1RYYA 2Z3WA 1QG4A 1ZS9A 3A3OA 1P4HA 5JJCA 2AN5A 1QHEA 4YP6A 2BSAA 2C98A 1GTVA 3QLEA 2PKWA 3ZBUA 3ZGXA 3RRYA 4KFTA 4LDPA 3ESYA 3DV9A 1JUDA 3PE4A 1UXOA 1FUYB 2V7XA 5ELMA 4LF9B 1E59A 1CQPA 3AQ4A 5DF1A 4CIAA 4GPD1 3TLZA 1G98A 2R8XA 3GLFA 4NBNA 3EWIA 4QRIA 1PJRA 2I6FA 3OUZA 4P4SA 3IJRA 4HH0A 4K5QA 5CVJA 4C3ZA 2ZIXA 4GWKA 4P0TA 3IBFA 1C8VB 1N3BA 2VJDA 1GRRA 2WHEA 4S05A 3ZHQA 3CF6R 3WBBA 3TL3A 1CFZA 1DBIA 3KHTA 3T1OA 1WXIA 4PO3X 3RRFA 1NU8A 1XXLA 3DOFA 4FGZA 1IVSA 5BVHB 4Q18A 5HOQA 2WIGA 2BR5A 4NJEB 2OHJA 4ZI2A 1BDHA 5FQNA 2QTGA 5FA6A 4BJ5A 1LK7A 3H2SA 1TJ4A 2E18A 3L6UA 3MLEA 1RPZA 2IEGA 4LJKA 2JI8A 3HU1A 3LP6A 1SCJA 2VP6A 3GRPA 1B43A 1VLQA 1YZ3A 3NDJA 1Z45A 4O33A 5IKOA 3R3WA 1Z25A 3PU6A 3TZHA 4D3ZA 1AGXA 2WU1A 3UENA 4M46A 2WAAA 8OHMA 1GARA 1J0DA 1TEVA 1QGDA 2PS9A 3V7NA 2UVPB 1QOZA 2FPIB 2OGTA 1RDFA 2WHXA 1VG0B 3NHSA 4L5BA 3Q3HA 5HILA 2OOSA 2BE7A 2GPJA 2Z08A 2I65A 3E82A 1RI5A 3LIPA 3QUCA 4HBGA 1T8TA 4NYMQ 4MVJP 3V42A 1G1AA 2FJ0A 4LYGA 5EQJB 3S5JA 3ZE0B 5AI0A 5CNJA 4RPKA 2PVCA 2H1WA 1L7RA 5G0SA 3IB3A 3UMFA 4LVOA 3O8BA 4MAFA 2QAGA 3C3EA 3DLAA 3QW4B 3AUAA 3CNBA 1NTOA 4AQDA 1RCTE 2F9LA 1HDXA 4FYMA 4G63A 5FO0A 1TVMA 1XX6A 2PDAA 2W6MA 5BWBA 1YBHA 4EMUA 3E5NA 4QEDA 3NBXX 1LNQA 3QVVA 4MW7A 1OXVA 4S35A 4UNIA 4DCNA 5FWXB 5KYTA 3N2LA 3DQQA 4ZI7F 3ZDBA 2HRCA 2VN8A 1S9HA 1PO7A 4OBEA 2WJ3A 3F4KA 4EZEA 2LWIA 2D4AA 4AX8A 2P7IA 1E6EA 2VS1A 3MTGA 1QRTA 3ASZA 1OE0A 1X1SA 4RJIA 1NG9A 2F62A 3KUCA 1G38A 1BD3A 3DV2A 3H5TA 5HM6A 3WGKA 2GO1A 4LJ7A 3GNLA 1XVLA 4EGJA 3T1VA 2AOTA 2JLXA 3FNGA 1ZLXA 1OKKA 1BKSB 1UMCA 4HQRA 4H31A 1Y1QA 2EIHA 1FNSA 1D8AA 3K1YA 5SZKB 3WC4A 1JR6A 3T1HB 4J16A 1P1IA 3BFJA 4EPYA 1EMDA 1NUUA 2GMWA 2QZ9A 3N0XA 5LYJA 4WERA 2I71A 4A6PA 1NVBA 1UJBA 4IMRA 3ASVA 1A0OA 1QQ7A 1YB2A 4NCHA 4RK4A 4D1YA 1KJIA 2SBTA 4QBTA 1YDEA 2YXNA 4J3FA 3EGEA 4MR8B 4PY2A 4EB6B 2VP5A 5JUWA 2UYHA 2AEJA 2EYUA 3K4PA 1H3FA 4GMHA 4BBJA 2LKCA 4CDNA 2IBTA 2C57A 4LS3A 1ZM9A 4W7HA 1UC8A 1LKZA 2Q5FA 2XVYA 4DYDA 3P96A 1WKVA 2P7HA 3R24A 4PU0A 5ESXA 4JL8A 1ZOIA 4NNJA 5IF3A 1QQBA 3I42A 2JHGA 1UFKA 3AINA 3PRKE 3B8HA 2NTYC 4FFRA 4BLOA 3V7WA 1C1HA 1G5IA 4MK4A 3QV1A 4X1KA 4BFSA 5ESRA 3ANYB 4R8SA 4PPNA 4WPGA 2O07A 1PZFA 1E7QA 3QVUA 1QYCA 3R2JA 1U99A 1BN7A 3T7SA 4JT2A 1OWNA 1ZMBA 3MW8A 4AM8A 4D6XA 4EHHA 3OKAA 2B2NA 3UWDA 1P3Y1 1IEVA 4DARA 3WGTA 3LY7A 4KTVE 4DNFA 3FR8A 1G5TA 1NVAA 1USWA 2R8ZA 4BFYA 4PN3A 4KQ1A 3CVUA 1AKEA 1DG1G 1GR1A 1K7YA 1NW6A 1PEKE 1TJPB 2AUTA 2OSBA 2V0NA 3AX6A 3B6MA 4QG7A 1DC6A 5SZHB 1AH2A 3UKOA 1SBIA 4Z1MA 5JD6A 2PGXA 3PVZA 1KAQA 4U8HA 3U3XA 2H52A 3V1KA 2J5RA 3SXUB 4EJSB 2XITA 3F8WA 3EAQA 4QBFA 3OM0A 2DCMA 2V3VA 4YXWA 1AGYA 1L6RA 2BM1A 4OKSA 2V65A 4P34A 1VLZA 4YMLA 2ZBFA 2QK4A 4F85A 2IGBA 1G55A 4JJ8A 4WJLA 1Z06A 3DAHA 1COWD 2AFIA 3SR3A 1Q7CA 3ZVNA 2FRVA 3K0EA 1I3NA 2UUBB 4CM7A 1QHFA 4J2HA 2F59A 2ZDHA 3P0JA 3PX3A 1IN1A 1ZISA 2COUA 4YECA 4GNRA 5CGZA 1DCKA 1UP4A 3NDIA 4UM9B 1YOBA 4B76A 2C5EA 3VU0A 1IXYA 3VZQA 1E0JA 4TPKA 3U4QB 2VDUE 1V41E 3VU8A 4F4HA 2P9YA 2VRCA 4E0BA 4P0QB 4JWKA 2F1RA 4HQ6A 3ITNA 4L6IA 4HVAA 5KOHB 4YMHA 1WOMA 2Y92A 4PLVA 4ZHSA 4I0WB 3L7MA 4CM1A 1ZUNA 4B4WA 1J22A 1IJEA 1FLVA 1XAHA 1JDNA 4C04A 4QJIA 5BW4A 1AMUA 2ZWIA 3ICCA 4H7JA 1WZNA 4RV5A 3BFXA 3HVUA 2IRWA 3Q1LA 3R7BA 2E5WA 2OORC 2V03A 1LJUA 5AKKA 5DNEA 5EP2A 2O7RA 2OXTA 2W22A 1OPXA 2D1FA 4G2TA 1VQ1A 1PYDA 2J7PA 2YIJA 1LDMA 3EW9A 3V8EA 3M9XA 1K6IA 2DHDA 4D0NA 4GI1A 3EUFA 3WNZA 3LC1O 5JSZB 3AILA 1KY4A 3H19A 5LIPA 2P30A 2AMJA 2CJWA 1GQQA 5K45A 3EEIA 2J3LA 1AVTA 3E03A 3PT9A 4JGBA 1L1RA 1XKTA 1YVUA 2FCAA 5NLLA 1AHNA 4BQPA 1GKKA 4INJA 5A4MS 4DSTA 2EP5A 2P6UA 4II7A 3BMOA 1TUBA 3FKJA 3NDBB 2VXYA 1Q7TA 2XLCA 2X9LA 2OB1A 2DWUA 2GK7A 5F1YA 1PG5A 2QR2A 3WYCA 2FP3A 5MN6A 2KMLA 3BXXA 4FINA 4OFXA 5HIJA 4HB2A 3S44A 3MEQA 3WK7A 2UXBB 1I0IA 5BNWA 1ISSA 4QFMA 1BVRA 2I2CA 5C7YA 1TM2A 3V8PA 2PL9A 3EZYA 4WINA 4QJ3A 3DH0A 2CXOA 4J75A 4ZVLA 1P2UA 3I8XA 1TU4A 1YJ5A 3GJTA 2BR3A 5D85A 5GJVC 2ET6A 3V4LA 3GCDA 4DLYA 3G0OA 2YN2A 4WY2A 4YBZA 4PPQA 1E2QA 2HDHA 2GPAA 2C7OA 3RYIB 4C2BA 2G0TA 3QLUA 4KITB 5TJHA 1WHTA 1DC7A 3LYLA 5EL0A 1Z62A 5T64A 5TQJA 3U3ZA 2WTUA 1UBKS 1DUSA 3WHLA 3CE6A 2NAFA 2XTNA 4I9FA 1H0KA 2Y68A 3TTVA 4JX9A 3S3TA 3UT6A 1KVQA 3SF0A 4JJ4A 2REBA 2ZS7A 4N6NA 4HX5A 3PFHA 1XTQA 2HHHB 2RGDA 4DWVA 1Q0TA 1XRJA 2GWRA 3EVDA 4LBWA 4WGGA 5LP1A 4CEIB 1T2VA 4QNMA 5D2CA 3OFNA 4P4GA 4KL8S 4K40A 3U61B 3U48A 1JHDA 2PQ2A 1I1QB 1B0UA 2B1IA 2VDWB 3K0HA 3OBBA 4IIJB 3PBKA 3O2JA 4WKGA 3CC8A 3INGA 3L7OA 3V4PB 5TPZD 4ZMRA 3LDHA 4RXUA 1G8FA 3LC2O 1LJ8A 3L3BA 1MVLA 4FMCF 1RXVA 3C5HA 1NQOA 1T2DA 3D2LA 1QG2A 3P9YA 4D80A 3E70C 1DOHA 1XIVA 2O6HA 3MGKA 1MB9A 2CVHA 3N3AC 2GEBA 3X1JA 2C7BA 3DO6A 4ZVMA 3SQWA 2HSWA 2H51A 1C8BA 2J85A 3ZWCA 1XDDA 1CY4A 1N3LA 2VHZA 1IYZA 3G6KA 4FW9A 2X0DA 4AUMA 4GC5A 5KNBH 4FFPA 4X6UA 4AJPA 1DXOA 2BHTA 4F8EA 4Y2TA 3FLEA 1PVVA 3M6FA 4IDCA 1EFVA 3L04A 5EXPA 4JYZA 2K6GA 3EOAI 5J4LA 3FHOA 3MJFA 2R6JA 2OT3B 2ZIWB 4S1PA 4YP1A 2AK2A 3O8QA 3I5YA 3OJ0A 1X14A 3R3YA 4KPFC 3V8NA 4WXPA 1C4OA 2NO1A 3CZQA 5BN3B 2A33A 3FFWA 3A8TA 1GM5A 4B3FX 4MHSA 3ZGYA 4UHFA 1U1EA 5A4FS 3RADC 2YVQA 4IYRA 1MEEA 5DCUA 4JJFA 2WI8A 1RIFA 3GZNB 3NDPA 4WFJA 2GM3A 2FUG6 3JD3A 4PYMA 1JEEA 3QLTA 1Y3IA 2FPRA 4MMZB 3RYFA 5LXTB 3FFTA 1NXQA 1JBKA 1RHQA 2Z6VA 3AY7A 3AR8A 3QWFA 5LA6B 3ZHZA 4NQRA 2PNJA 2W2KB 4BZXA 1JLRA 1UIMA 1V95A 3FPKA 4QE3A 1GA1A 5H3LA 3HPQA 3TOXA 1G3UA 5C35A 1ZH8A 2Y3IA 1ZJWA 2BT4A 2W6JA 1YVPA 1NR7A 2W8ZA 4J9VA 4PZDA 4TYPA 1U7UA 3ZNPA 5K0GA 5ALWA 4KSCA 1HNZB 3JR7A 3UEOA 2F1HA 4LY9A 3GT7A 3AVXA 2DLDA 3SHQA 2NT3A 3LOUA 1AKRA 1JIKA 2VUTA 3ZBPA 2HA7A 1E9EA 4DG5A 1M54A 4M7PA 4GP7A 3JVEA 3O84A 4HN4B 1VCHA 1GG9A 4EMBA 2BP7B 1MEJA 1NA5A 1RM5A 4WUTA 1Q0ZA 3QFSA 1JMKC 3VV3A 1EA7A 5AUOB 2IS6A 3FKSA 2ZVJA 3CW8X 3NBUA 4HYEA 1T3ZA 4DYHA 5ALVA 1FF9A 1I32A 1E2DA 1SUSA 1Y5NA 4RJLA 1W93A 2CXQA 3S27A 2EIXA 4G1BA 1TQDA 3HO6A 5A1TA 1HFEL 2ZUWA 3ISTA 2VBCA 2DPLA 2FWPA 2V0CA 1I3LA 3F1LA 3R40A 2FN3A 4IH1A 3RVNA 5C9ZA 3TPFA 3SQMA 3WDKA 1WNTA 4NECA 2W9XA 4KXNA 4Q01A 5FR1A 1MZPA 4EQZA 2C99A 1PHPA 3ROZA 2I62A 3U0VA 3LECA 2XHEA 1T5IA 4AJEA 4DDHA 1XRNA 1ZCAA 1CUJA 3P20A 4JP1A 2AUMA 4Q16A 5CUQA 3H2KA 2PKQO 1NX9A 1QCZA 2HIMA 1YGPA 3Q3IA 1JWLA 3RS5A 1ICEA 1TLTA 2N46A 1W0CA 1NLMA 3FPBA 2PGDA 3ENNA 3PCTA 3PWKA 1THZA 2H7CA 5G0WA 3VPCA 2PYIA 2QVGA 3OCWA 3NNNA 2FEKA 4IDHA 4UNRA 1O4WA 1WMFA 2X7HA 4Y1GA 5JJBA 2IH5A 3B1WA 3ZVKA 1GPYA 3NS7A 2RHCA 3WA6A 3Q8XB 4AW9A 1H9CA 1W0JA 4DMMA 2VA8A 3QXSA 2Q2QA 4KI7A 4NENB 4P3XA 5AHWA 2ATEA 2D2XA 4CG2A 1TJYA 3LC0A 2AVNA 4E5MA 4MQ6A 1VZ2A 1Y8RA 1XZJA 3EDMA 1P2GA 3I61A 3AHCA 4P7GA 5AD1A 1WB9A 2QZ4A 3AHDA 1QJ4A 1KGSA 4C6SA 3QU5A 4M37A 4HDKA 3TLEA 4BDSA 1W6RA 2CHEA 3TTTA 4CKXA 2HJRA 2GJAA 3T3GA 1EHYA 1DV1A 4DLSA 4UUAA 1ISRA 1LPBB 1N2ZA 4MZDA 2E4AA 4YA6A 3ABOB 3H99A 1A2KC 1TKRA 1ACLA 3MCWA 1WJGA 1R0WA 1V8ZA 1OFGA 1Y5RA 4MV8A 4ZI7B 3CKKA 1J39A 2BFDB 1AHIA 1PG0A 2J6CA 1B8VA 1MT3A 3TIGA 2AZTA 3GT4A 5TVGA 4L8FA 3TRFA 4X94A 3K4HA 3EMDA 4TUYF 5LQRA 5MHTA 1L7MA 1MA0A 2FW7A 3R0JA 3DTVB 3C3BA 3PT5A 1J21A 2WHRA 2FETA 2VEDA 4IUDS 2EW2A 1WP4A 2KS6A 3LCVB 3ECAA 4ROSA 3VO1A 4DDWA 4OD0A 2CVFA 3KP1A 1WMEA 2HMWA 2C9MA 5HQ3A 4HD8A 2GJKA 5EIBC 2VCHA 2XQIA 2QB5A 2IIPA 4FZVA 3GPIA 3AESB 2R44A 1KIMA 2ZAIA 3C87A 4TLCA 2VFAA 4ZQHA 2B83A 4DWOA 4XXHA 3IPYA 2B21A 1RXIA 2IXAA 2IEAA 2YR0A 2NQ8A 3LE8A 3PHBE 3T15A 1W30A 1M76A 5DU2A 4FU0A 3STYA 3TUIC 1TIKA 1CU1A 3WE7A 4N47A 2WOJA 4HGYA 2X0IA 1E1QA 5AOAA 1CQWA 4ID9A 4JXJA 5GPBA 3HGQA 1UPXA 1VKZA 3Q5GA 4HAVA 3ZLTA 1GCOA 1JKMA 3B7PA 4KSBA 1WHSA 1PVOA 1YVEI 2FHPA 2BC9A 1DGQA 1JR3E 4WN3A 2C3OA 2JAOA 2RHBA 1I2DA 4R40A 3DOCA 3BTVA 3TXXA 4R2JA 2OMKA 3LBHA 5DYIA 3RWMB 3BDAA 5AVQA 1Q6ZA 2HIGA 1XDZA 5TQ0B 5C4GB 5AJVB 1U3UA 3L0YA 1A3CA 5J5AA 4RPHA 2Z0MA 3IERA 4W9RA 1YZLA 5BP7A 1DFHA 2A9FA 2VNIA 2PFSA 4QNRA 3VJRA 3RW9A 1NQUA 1JMYA 1RQLA 3NXKA 2JD1A 1BHSA 5FO1A 1OLUB 4RY0A 4TRNA 2HDWA 2ID7A 3AL3A 3IEXA 4IO0A 4TZKA 3SR0A 1BXGB 3V7FA 1NY6A 4KIJA 4ESEA 3R4CA 1BOFA 1BX3A 1IB0A 4TYNA 2HWYA 3HN2A 3TLGA 2RAFA 2PSSA 3GROA 1FNBA 4YT4A 3IA7A 2KLBA 4P5DA 4WJKB 2FQYA 4NC9A 3W2TA 1KZ1A 1BC5A 3N7AA 1JXAA 1IVNA 4DY6A 1JIQA 1I3CA 4ZTZB 3JQRA 1N3YA 1KJ9A 2AWNA 2NACA 4O2LA 5AP9A 3RJTA 5CDSA 1TU3A 3JD4A 4OHUA 1H3NA 2OG2A 4EF6A 2VOEA 2NZ8A 2PVSA 4UKDA 4ZO8A 4F0JA 3HSSA 4MKHA 4HAOA 2OV1A 1XRRA 3I83A 4LECA 2H2WA 4LSGA 1UBJS 2IXTA 4BVKA 2NU8B 3UG7A 3WGMA 3HRKA 5K8IA 1SXHA 2IHZA 1VXRA 2QJRA 5CP8A 2XUFA 4NEQA 1IY1A 1E2EA 1EFLA 1U8ZA 1ZQ1A 1WDLA 1GZSA 1W76A 1V96A 1H94A 4EX6A 4M87A 1VLVA 1JPJA 3CZ4A 3RU7A 1YACA 1Q0QA 1DEAA 1N3IA 4Q6WA 1UH5A 3L40A 1EX7A 2W4IA 3VGJA 4DR1B 1DLJA 4L3VA 1R27A 3OZVA 4K9RA 5AKZA 1UBHS 1CS0A 1CY1A 1MIOB 1NULA 2G7MC 2PBRA 2RHDA 1FW8A 1VL8A 3D0RA 3TXYA 1I5OA 5DNVA 1UMBB 1PJQA 1DAGA 2C5BA 1WVGA 3F4LA 3VDRA 1X2EA 1XZMA 1YRBA 3OJFA 3A36A 1X80A 4F7DA 3K70D 4OP2A 3ZE2B 4G1FA 2PZLA 3SZ3A 3ESZA 2IF0A 2EL9A 4B8ZA 3ZS9A 2VDPB 3MBOA 1SVSA 3O8CA 3Q4GA 4UVGA 5I7EA 1SU7A 2UVDA 3QA3E 1EUDB 2CBGA 4N01A 4TKMA 2E4VA 2RFLA 2E4UA 3UWMA 2ZUCA 1OBOA 2QZPA 4H7FA 4TTTS 1TU0A 1BDMA 3AONB 4JVSB 3W78A 3VPHA 4UEWA 3SP1A 2P9FA 4LDNA 4BMZA 1OFIA 2WJ6A 2C1EA 2V6FA 1B4DA 3NHWA 4OYHA 1U28A 3S29A 4KO3S 3B2NA 1MEOA 3OIFA 2IUYA 4RM2A 2ZBUA 4EY4A 4ZEVA 1JA1A 2R6DA 5LJIA 2HBZA 2JD0A 2XYGA 2J08A 4PF1A 4UFNA 4WXMA 1KZHA 1J09A 5JQGA 3A6LA 5KNDA 2J5QA 3BHJA 3HDTA 1NL3A 4GOND 1VLMA 2CNOA 1JSLA 3G2OA 3ONEA 4PNPA 4JP5A 5AHRA 3UUFA 3I2KA 3GA5A 3JTEA 5B3JC 4FX5A 3EXEA 1P9RA 4W1PA 3WADA 4EK9A 3UQZA 1A4IA 5CX1B 3P2MA 5F12A 2QG4A 4NOMA 3U1BA 3L4JA 3NM6B 3B6IA 3W3AH 2P3LA 3MXTA 4HLCA 1EFAA 5K6AC 3D3KA 3FFBA 1SQ0A 1JB9A 1WZCA 3KUUA 3NWOA 4TYQA 2FE4A 3B60A 1R3UA 3K15A 2Z4TA 3Q7EA 3GY0A 3NUZA 3BERA 3MQ4A 5TNXA 3O4JA 4XX0A 3T35A 4Z3KA 3KETA 2XRYA 1QKJA 4PTYA 4YMUA 5FNZA 3AO0B 1A88A 2H3HA 4FBLA 4GLBA 2ZIZA 3RKSA 1J0AA 1WXQA 2XUIA 4K9QA 4P58A 5JQGF 3WAGA 1VDMA 4L4SA 5AFSA 3NR2A 1NNI1 1P7WA 2C2KA 2KYRA 3TEMA 2CLKB 4XRRA 5FF9A 2C95A 2ZOSA 2ZYHA 5DKFA 1QCDA 1ZD8A 4F56A 4DIOA 4RLFA 5K8VA 4BB6A 3WRXA 4IEIA 4MB6A 1OI3A 1NMZA 2IUSA 3EDQA 2G28A 4YBRA 1SUFA 1XD2B 1U7PA 5K6AA 1QU2A 1K3FA 1FLAA 4CQLB 4TMWA 1KI4A 5B4VA 3CVOA 3FDFA 3T5DA 1Z2NX 3PD0A 4I7EA 4Y2PA 3VBCA 1VCNA 4XW2A 3TIIA 3VAAA 1I4LD 2OLKA 3MPUA 4OATA 3EGDA 2YZGA 3ISJA 3NG1A 4R2KA 1OU0A 2VJNA 1DFGA 1GITA 3M83A 5CVUA 2I2FA 1VIYA 2G83A 3HDJA 4I5FA 1I3MA 1KORA 3W7BA 4H4CA 1ZNWA 5EHIA 5KMGA 1WPRA 2A9RA 2E4WA 3LSYA 2DWOA 4XH9B 3NGXA 1ZDMA 1NVWQ 3ZS8A 1JH8A 3MGAA 3KD2A 4X3PA 4MRMA 1PDWA 2J0EA 1MJHA 2GBGA 3LNCA 4O2AA 3PL1A 4CIVA 2DY1A 1N0WA 4W8GA 3DNFA 3ZXUB 2BFBA 3MS4A 5AM2A 3D5TA 1BWPA 2IZOA 1CUYA 1Q19A 2YHSA 1EVYA 5JPDA 3EARA 4MVJA 4PBRA 4EO7A 4H3HB 3V4VB 7ABPA 4HDRA 2XXAB 3RUFA 4KQIA 3HBNA 4IF6A 5AO9A 5A3VA 1KXZA 2VVTA 1I5EA 1PR5A 4RETA 4A82A 2QJOA 4HEQA 1Z12A 1NBEA 1P60A 2GBCA 4BUZA 4LFBB 1J5PA 4W6ZA 3IUBA 1SKQA 2FYTA 2PUJA 2QJFA 1BU8A 3IKLA 3KJIA 1AY0A 3P8ZA 2GFHA 3VHRA 10MHA 3ZBQA 1OYOA 2FP4A 3F9RA 3D8BA 4M98A 4D3YA 2B4RO 3P52A 1SD2A 2H0QA 3NETA 2JGJA 2ZREA 4O4LF 2YRFA 1E2MA 3ZK9A 4BNDB 1ZM7A 2IYFA 1BWQA 3QPDA 2CL5A 4RVHA 4CF4A 4B4VA 1S4MA 3AK4A 3KPVA 4X62B 1XD8A 4ZOLA 3MTIA 1ODKA 4XRGA 4TZ6A 3GLTA 1JU9A 5C3MA 3OUTA 1UBNA 1C3EA 3G6WA 4NXMB 1UC4B 3BXGA 3KQPA 1GNSA 4C4SA 3T1TA 2FDCA 4DJAA 5HA5A 1NVDA 2ILTA 1Y4AE 1NP6A 1WQ4A 2MYUA 3GJ7A 3CF4G 1FNDA 2V7EA 3A9TA 4DIKA 5CG2A 2VT2A 1VFNA 4XOIA 1XEAA 3PQ8A 2F55A 3K09A 1CUZA 3ZTYA 3KEFA 1B41A 3K3PA 3WKAA 2Q1TA 4PLFA 1VI5A 3FYSA 4L5JA 1RLUA 3NTLA 1Y8QA 1LRJA 3G5TA 3GOHA 3GZ4A 3A1SA 3HLTA 4PO9A 3ONWA 4D3DA 1OH5A 4AWAA 2GF2A 7AT1A 3BE4A 3RU9A 1IBRA 1IHDA 3N59A 1KHHA 2AOVA 2VHEA 1TD9A 5BRNA 4LXTA 1XB2A 3AKZA 4GOKA 1EP3B 2X0KA 1U1GA 5GGYA 4I9NA 1R5JA 2QE7A 3L1JA 1QFXA 1LX6A 1IRXA 1EVQA 2FZVA 1AZWA 2H29A 2KI5A 2DH6A 1KETA 2LE0A 2P3QA 2PZMA 4KMMA 1VP9A 3IAXA 3GC6A 2O06A 4NARA 4WZAB 5F35A 5FFNA 3RSFA 4LQLA 1DPGA 4BJHB 2CLLB 2QD3A 1OB5A 3PKZA 1XHFA 3IUEA 4RK6A 5EIFA 3BB4A 2WJYA 1KKLA 3LVBA 2HU2A 3G9UA 3IPRA 4UHBA 3TSOA 3ZCQA 1EFPB 2XB9A 4F46A 1L4LA 1RM3A 4KU4A 3RS9A 1N9GB 2BZ0A 3F97A 2P4EA 1M7HA 2OGSA 4U2KA 3L7BA 1V11B 1U5BA 3T9AA 9GPBA 2JPDA 4PSVA 4G09A 1ZH2A 1YR2A 2D5IA 1Z6QA 2DQ4A 3H1PA 4NH4A 4TLDA 3GELA 1FRZA 1SGWA 3KDAA 4L9AA 4GC9A 1K0FA 2FQXA 5DJ5A 2VDKB 1X1TA 2DERA 3OCJA 4YRQA 1W85A 2JGLA 4CKEA 4DSOA 5CNMA 2NU6A 5IARA 2LPMA 2A30A 2PY6A 3E5MA 4OVKA 1A9RA 3AUFA 1TMYA 4J1TC 4TQGA 2Y1DA 5FYQA 5AW1A 4IIDA 3VR5D 1TO1E 2JZNA 2IYLD 1VMDA 4D56A 1RP7A 1Z6ZA 2C3YA 2JKYA 4GF5A 3SSOA 1GKIA 1GVHA 1RHKA 4WMLA 4E15A 3QEBZ 5B53A 1S8AA 2VSNA 3K30A 2HKIA 2QY9A 3QEMB 2R86A 4ZK6A 2C83A 3GDFA 4NWIA 1QP7A 4DMUB 2FX5A 5CFZA 2ZVDA 3EQ2A 1IHUA 4GS5A 3MB5A 3ZTTA 2Y0BA 3K8QA 3IVRA 3DEAA 2DM6A 3GFOA 4JLOA 3P2YA 4LYAA 4BB0A 1JTEA 4GW3A 2J67A 4M1MA 3ZC3A 1U3WA 5F1KA 3OEHA 1CJUC 1XQ9A 1G7SA 2BFWA 3R7NA 2CLEB 4DBVO 4UVDA 3AY3A 2OL4A 2PLWA 3DMDA 2ZI9A 1IXRC 2ZJ2A 4MULA 2J32A 4G5YA 4UM7A 1KJJA 1R0LA 4QXPA 4IHKA 1U4OA 1QGZA 3QYJA 2JJYA 1XZIA 3PPXA 2GM5A 4TXLA 4BUJA 5L9AA 2RGAA 4LCBA 3MT8A 5DLPA 5H02A 2HJHA 1YHNA 2FPOA 1RQXA 4G07A 1Z4PX 4TKZA 1X42A 5K3CA 4JL5A 1XELA 2RSLA 3ADKA 2WC1A 1U3TA 4X97A 2UUOA 4B81A 5GTDA 3PFGA 4G0UA 5CVEA 3W6UA 2YXDA 3S2GA 4RZIA 3PI6A 4Q34A 4D42A 2OXIA 1NT2A 3ZCSA 2RH8A 3ANXA 1WUJS 5JSHA 3A6GA 2VP0A 3BRSA 3KLBA 3KTOA 3II6X 1ZMRA 2VUSA 4F4UA 3S8YA 4DC1A 2VF4X 1USKA 1QJCA 1D04A 1CD5A 1SD1A 3KJXA 4Q19A 1NQ5A 1F3LA 1E1RD 1MC1A 3KJNA 3QP9A 3PDUA 1U2GA 4R0NA 3JALB 4EHNA 1FFXA 4XIFA 2FR1A 5K0SA 4HB3A 1P1CA 1WUTA 1GGEA 1RC1A 1XSEA 5IABA 3T4EA 1O97D 4JT4A 4LOAA 2YJ3A 5HDQA 3VAYA 5ALEA 3ZX5A 4KWEA 2QVLA 3T5GA 3ZWNA 4JY7A 1ZD5A 5LQCA 3HDGA 1PJBA 2ADMA 1QLHA 4D8WA 1PJ2A 2AS0A 3IVCA 2VDLB 1AV6A 2IIBA 2W8BB 3ZCRA 3C3CA 1E1CA 2WYHA 2XT6A 4FC7A 3UOGA 4BE4A 5HJ7A 4KQMA 3OHSX 2F4NA 2I78A 3HDVA 4LX8A 1MRSA 4BN4A 4JB3A 5EZQA 4RQUA 3DR5A 1ZUWA 2ZYTX 4JUFA 4O5AA 3I9OA 4NNOA 4JQZA 2NO7A 1ZVJA 4X1IA 3G3EA 2OLEA 4DQLA 5JHGB 2WD7B 1T6ZA 4K88A 2IPNA 4U6QA 4US0R 5AVXA 5JI2E 2HZ7A 2HSJA 2QX4A 3LWDA 2IYUA 3MCZA 1REQA 3KYCB 3PTZA 4PHFA 5HVNA 1C1DB 4P08A 2CFRA 5DGCA 2FRXA 1ZXLA 3UK0A 1NGSA 4LMPA 1KDZA 4C5AA 1WPGA 3GQBA 1GR0A 4DGSA 5ICGA 2QIPA 3QWIA 1EM8B 2XOEA 5JNTA 3WIDA 3WHIA 2FRDA 3GQVA 3LZCA 4L8LA 5FUYA 3GJXC 4X1OA 1ODIA 4HLDA 3RODA 2ODEA 2CW5A 3OIDA 1V1MA 1ID8A 3IAM6 3O90A 4NMLA 1N7HA 3B3JA 1RRMA 5L3QB 5DYYA 5FHRA 3RIMA 2Q5EA 2QI9C 3DEZA 3IP6A 1K9SA 1NNSA 3HXKA 4BNIA 4RK5A 4D97A 8GPBA 1EWTA 4KG7A 4Q1CA 5F52A 1KQNA 1YCGA 4CRWB 2JL1A 4OQYA 4CVNA 1LBEA 3FMPB 1WV0A 1EI9A 1V6CA 1FQWA 2HAEA 3SKYA 3WB9A 3WAJA 4LOJA 2G70A 4OQ4A 3QHQA 3UV6A 3C5VA 1GLNA 1ECLA 4IHJF 3WQHA 4B73A 3BSSA 2ZRQA 5I7AA 3IO3A 3SSAA 1KI3A 1MQAA 2O3UA 3WGYA 3UHJA 4R0MA 4PX5A 1A9SA 3EFHA 1D09A 1PWXA 2XYQA 2DJIA 4A0FA 3JZFA 4JFAA 4KXUA 5LQSA 3TGWA 1Z4QA 3SYLA 1C9YA 3BE5A 3SK0A 2PTHA 3SBOA 4KLRA 1YOVA 2QZSA 2YFYA 2K4MA 2XGSA 4IIXA 1T3GA 1LPNA 2OE2A 4OJTA 1K5DA 4AJJA 3MD9A 2QW8A 4MUKA 5AK5A 1X7WA 1OYWA 3FROA 1WG8A 2EJBA 2UZIR 1D5WA 3FTQA 1C2TA 3VJMA 3VYVA 4BDTA 4OMDA 2UDPA 5HK9A 1OH6A 2H16A 1IBKB 3DO5A 2LVBA 2R8YA 3HKDB 4JLVA 4AJIA 5K8CA 1OH8A 2WMOB 2PT5A 2VWHA 3NAGA 1SA0B 4J0KA 4PYQA 1XQYA 4XVRA 5ANRB 4XFDA 3SBDA 1R2QA 4MVCA 2JJ2D 4R05A 3NWJA 3RUPA 1Z8FA 4JI2B 4BGDA 4V02A 1RZ3A 1CJBA 1X7XB 2PNFA 4P2GA 4QTYA 4CF6A 1TPYA 4Q1EA 4XJSA 3C5WP 1DADA 3W5BA 1YKSA 5KPDA 5E9JA 2WJZB 4Q3BA 5E8RA 2PCJA 1W48A 1MB0A 4O59O 4R2HA 2JFOA 3DE5X 2IV2X 5JVDF 4UNPA 3DMFA 5FIUA 3FRJA 4E6PA 3W5AA 5ITZA 4M4SA 3QUQA 2ID9A 4IFBA 5CYOA 3W8NA 3ODGA 3EIOA 1G6KA 1QZ3A 1UXGA 3IXLA 3QIAA 4WHMA 4TTQA 4R1QA 4DNPA 1D6JA 1O08A 3AU8A 3PNBA 3KKQA 4Q12A 4II3A 1GQFA 4NKRA 4L2IB 2WZQA 2I80A 5JAQA 1L4NA 4X95A 1H1DA 3VVBA 1RQNA 2GZ2A 4IRUB 3KAJA 2QD1A 3BXEA 2XMCA 1WF3A 3CUVA 1YASA 1R12A 4UXIA 2OHOA 3BGSA 2GD1O 3FGNA 4FBGA 1GNPA 3KM0A 4WOKA 5DOVA 5TQVA 4ZJZA 1CJCA 3PUVA 3UXYA 4DJTA 5LQAA 1KXJA 1SZCA 4RCYA 3P4UA 2ZITA 4PCVA 1L6IA 4ERXA 2GBLC 1YI8A 3JAWA 4YACA 3R8CA 2O7SA 1ADFA 3D0QA 3O3CA 5GMOA 1DXYA 3SKVA 1SVKA 1UBEA 3T9DA 4ENWA