4ILEA

Structure of human adp-ribosylation factor-like 8a binding to gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
176
Chain Sequence
KLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ADP-ribosylation factor-like protein 8A
publication title Structure of human ADP-ribosylation factor-like 8A binding to GDP
rcsb
source organism Homo sapiens
total genus 58
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ileA00
3GLIE 3BBPA 1PVOA 1II9A 3AKCA 4NYJQ 1J8YF 4URWR 4ZO4A 1Z0KA 2JAQA 2GJ8A 3SYNA 1NJFA 1OYYA 2GBLC 2QU8A 4B2IA 2W6IA 3X1WA 5FBVB 5HZHA 2QAGA 5BN4A 4PO1A 2XSZA 2CCJA 3EZFA 2Q6TA 3GJ4A 5HCIA 2G0TA 1G6OA 2QTFA 5A0FA 3RS0A 1L7VC 3UKDA 3EA5A 2AFIE 4LYHA 5DI3A 2CVFA 2WJJA 3HR8A 3NVAA 1HT1E 2V55B 1KI4A 4V02A 2V9PA 2PCLA 1T3SA 3BB3A 4OJKA 2PBRA 3TRFA 1RRFA 1E32A 1Q22A 3QVVA 4C7OA 2ZU6A 3CH4B 8OHMA 1HQYE 3AVVA 4A15A 3ND8A 3W6OA 2CL7X 3O47A 4A8JB 4CZ2A 4PC7A 2K5UA 3CF0A 4BLQA 2WSSD 3QKRB 3SBEA 4RZXA 3R7WA 3T1QA 2WJHA 1OH5A 5EP4A 1E2PA 1Z0DA 3FTQA 1GZSA 1AS2A 2OEPA 1CR1A 1QHXA 2EWVA 2GRJA 2F1RA 2BM0A 4DC9A 4DEXA 1NBMD 2XTNA 4QNMA 1CR0A 4US0R 1KIMA 1A2KC 2OZEA 3UK6A 5DE3A 2VBCA 5J4HA 4IDPA 2QN6A 2JGNA 3C5CA 4HATA 2WIAA 5AR1A 4M9SA 1RYHA 1JBKA 3AGPA 1G3QA 2O8DA 4PPFA 3VQTA 3B1WA 2OCPA 3PVSA 4JBWA 2VP4A 4XVRA 4ACAA 1W36C 3S1AA 4LYJA 2QORA 1VCMA 2HYDA 2W6ID 4OQMA 1K5GA 4Q48A 4V0ME 3WBKA 1AGRA 4JYCA 1SXJB 3I3SR 4ABYA 2ZRLA 4TSFA 2XSZD 3AKDA 2X1VA 5CITA 3MJRA 4RKFA 3OEEA 4NHOA 4DJTA 5KUTA 2FZLA 2ECKA 2IYYA 4Q9JA 4BLSA 2ZI6A 1WCV1 1KO8A 2ZJ2A 2DPXA 3B1ZA 3LV8A 2WSMA 2VHQA 2JJ1A 4GT1A 1NIJA 4JLKA 1J2JA 3V9PA 4XWOA 2G3YA 1J99A 1A82A 3U6KA 1AGPA 1XWIA 1Q57A 3O8BA 4A36A 3P4XA 2ANCA 1E0KA 2KJQA 3L2OB 2HF8A 2RCNA 1ZIOA 2D62A 2XGJA 4D0GA 3KQKA 5CM8B 2JLQA 2VIIA 1IJFA 1G3UA 3CR7A 2FSFA 2ZI9A 1PJRA 5G53C 1L4UA 4F4IA 5JSZA 3M6AA 1S1CA 1UEIA 1XEWY 2CHQA 4LZZA 1II8B 1OV4A 3AVTA 3AH8A 3SBDA 4CYMA 4KHZA 4MKFA 1KK1A 2AN9A 5JCPA 1AN0A 1KO1A 4NMMA 2ZJ5A 1JECA 1HE8B 1GDDA 1JQJC 5KOYA 4LJ9A 3FFAA 4DKXA 4QJ3A 2AR7A 1AS0A 3RANA 4DSOA 2QPOA 4YDSA 1XXHE 4P32A 5FUYA 3CRRA 4TSFD 1Q1EA 4RD3A 2DCUA 3OEED 4M0LA 4EPVA 4QGFA 1AJEA 4DSTA 3TAHA 3T1VA 5CK5A 4KBGA 3R8CA 2Q9BA 2R6DA 3AP3A 4OL0A 1IXZA 4RY2A 3B13B 2JJ1D 2P0EA 2W00A 1KNXA 4FD2A 2GJKA 1GILA 4Q4HA 5CB8A 3VR6A 1GVNB 2JLRA 2QBYB 1I4TD 4CEJB 1MO5A 1DARA 3NKVA 5FI1B 1ZVQA 1U2RA 3BB4A 3ZVMA 1DAGA 2J9RA 4DLXA 4Q4AA 3SNHA 3CW2A 3DVLA 4HLUA 5HR5A 2O0JA 5L3SA 3LFUA 2H7VA 4OHZA 2XXAB 4W7SA 2J3EA 4AD8A 3IBGA 1KSJA 1X1RA 4JLJA 4R2IA 4PZYA 2V6JA 3THXB 2CLDX 3KX2A 1G8PA 2YC2C 3HPRA 2GEVA 2DYKA 5F2EA 3REFA 2PJRA 3GP8A 4NL4H 1ODFA 5ANRB 1CR4A 4LJ5A 4IDOA 4AKIA 1NP6A 2CNWA 3CLVA 2V3CC 3I73A 1WBDA 2W6JA 1E2EA 3EC1A 2IHYA 2IHBA 5JWHA 5JS8A 2J59A 1O87A 2KI5A 2CCKA 2QAJA 3IBYA 2F1HA 2J0UB 4PTLA 1VHLA 2DFNA 1US8A 5KDLA 4QKQA 1FQJA 1PUJA 3AF2A 1OFUX 3RC3A 1XJCA 2C8VA 2QT1A 5FTLA 2IYZA 5JBQA 5KTYA 1KI8A 2HT1A 3MJHA 4X8LA 1FX0B 1UKVY 2XZPA 1OHHA 1LS1A 2IYQA 3C4JA 3WP1B 4BEJA 3IIMA 1E2NA 2CL6X 3A58B 4ZDKA 5JEDA 1ZUHA 3IQXA 4QRHA 3A1UA 3UPUA 2C77A 1OH7A 3SFVA 4KI0A 1P4SA 4TLEA 1JR3E 5KNDA 3OAAA 2NQ2C 3CPEA 5TY0A 2A9KA 4ZPXA 2FE4A 2IWHA 1CRPA 2HXYA 2O8CB 3SDZA 3RHFA 2ANBA 421PA 2VSXA 2RH5A 5CDFA 4CW7A 1T4GA 2GZHA 4DHEA 2HYIC 2BKUA 2GNOA 2VP0A 2B21A 2WM9B 5AWFC 4DZZA 1LF5A 1BH2A 2OG2A 2IUTA 2CNWD 4HI0E 2B92A 2EFHB 4ZKEA 4GZMA 2QZ4A 1E0AA 2W6JD 1ZINA 2H1LA 3B85A 3PUZA 4GP7A 1XTKA 3RNLA 5HTKA 1S9HA 2D4HA 4CEHA 2ERYA 3X1XA 3T35A 1X8LA 3ZD6A 2B8WA 4MKIA 4PHFA 2IXGA 3K1JA 1S4QA 4BWYA 2IS4A 4JLPA 1S9DA 3GLGA 4F93B 2P5TB 1YZLA 4OQNA 1YZNA 1DOAA 4PPNA 2ZIAA 3GJ5A 5KNBA 2ZJOA 2ZJBA 2HEIA 1FTSA 4OK5A 1UBEA 4G5SA 3KL4A 1OHHD 2Q21A 4UNSA 3THYB 3QXHA 1YR7A 1S8FA 4R9UC 3RVBA 1ONBA 1CIPA 4M1TA 3KKOA 2YVUA 2D3WA 1W0JA 2VF7A 3DKPA 5C4GB 2RGXA 3DMDA 3EIQA 4JVSB 2OFOA 4B3FX 1XFAA 5KDDA 1W48A 2EVWX 1TF7A 3OAAD 4TLCA 3VR1A 4RJLA 3EIEA 4RZUA 4B75A 1RKBA 3EASA 4GMXA 4A9AA 3CWZA 4Z1MA 1ZM3A 1COWA 5C2JB 3CF6R 2QG6A 4QBHA 3Q7PA 3AQ4A 4A92A 3B9PA 4TL9A 1WA5A 4C0LA 5EXXA 4MRPA 1NSTA 5TDHA 4BZXA 4ZKDA 4YMWA 1MO3A 4MUAA 4CT4B 4TMTA 4UXIA 3T06B 3CPJB 4C0AC 4B34A 2Q9AA 1HH4A 5FH9A 3TUZC 1E2JA 2EWWA 2ZETA 4P31A 2RGCA 1U0LA 3KTAB 2A5JA 1D2MA 1VCOA 2BV3A 3U5ZB 2CVHA 3K0AA 1QG2A 1R5OA 5G40A 2YWGA 1Z0AA 1GL7A 3MWJA 2CK3A 2FEOA 2QENA 1E2HA 3UATA 1VIAA 5FFMA 1QVAA 3SQXA 1AZSC 1FZQA 1XTIA 1Z2AA 4M9XA 3TVDA 1W0JD 4A8JA 2C9CA 3DZDA 3KB1A 4ARZA 2NGRA 4YLGA 4CVNA 1DTSA 5DGXA 1LFDB 2P6RA 3TMKA 1S96A 2QAGB 2W0SA 4LOAA 1Z0JA 4W9MC 2IT1A 2R6CA 3NHBA 1B23P 2J41A 4YMTA 4Z1MD 2G6BA 4A0RA 4Q18A 4V03A 5G3YA 1R7RA 1COWD 2C95A 2PLFA 5E4FA 5DI3B 3MSXA 4KFUA 1OIVA 3W34A 1UBFA 1YZUA 2ZJYA 1U90A 2GEUA 2YOGA 3VHXA 4XWAA 2IF0A 3B60A 3OHMA 3ZGXA 1OFHA 4C7OB 1U9IC 2NO7A 3Q85A 3MGCA 4TMWA 1L8QA 1OXXK 4F4CA 3N2IA 2R62A 2F3TA 3DMNA 4UQOA 4AYXA 3EPLA 4B74A 1Z6AA 1G19A 3IIJA 1XMSA 2GXSA 1G41A 1LV7A 1VYUA 1FOEB 1P7CA 3NH6A 3UXMA 3R7WB 621PA 4E22A 2P6UA 1YQTA 4BASA 2FV8A 2RHDA 4QL3A 4DDWA 4D4JA 4I1VA 4EJSC 4A0FA 4NTZA 1ZM4A 1LY1A 2CK3D 2FWRA 4HYYA 5B2ZA 2HV8A 4B3GA 3L8ZA 3WHLA 3LBIA 1G4UR 2VSOA 1YJ5A 2ZS7A 2FX3A 821PA 3NTUA 1OPXA 2O8DB 5LDDC 3H4MA 2BBSA 3IIKA 3LLUA 3NDBB 3IEVA 1NNEA 3RYTC 2OT3B 4LC1A 1YR6A 3S1AB 2JLZA 2O5VA 3TAUA 3A1TA 3D31A 2EU8A 4BFWA 1GRQA 2ZYUX 1TQ6A 1XD2B 2RB4A 1CF4A 2R44A 4HZIA 4KU4A 2ORWA 4AWXA 3LDAA 2QQ0A 1OJLA 4WW0A 1F6BA 1IN7A 4MDFA 1G8FA 1HA3A 3UWKA 4DDUA 1NF3A 2G83A 3U7HB 1J70A 4AKHA 4HB0A 1M74A 4LPKA 4FWIB 4E09A 2VSFA 4F38A 2ZXUA 4Q7KA 1KSFX 4DT1A 4RD1A 4TMXA 5CYPA 1M6NA 4EPXA 1FP7A 1GL9B 3U7EB 4DIEA 2FPKA 1TQ2A 4EPYA 4BE7B 1E1QA 3QQ5A 1E0JA 1JPNA 1Z6YA 4I1UA 2JJ8A 2XZLA 2VP2A 4CF7A 1T6NA 1AQYA 3DZ8A 4LC0A 1FPMA 4LPSA 5F98A 2ZITA 1BIFA 4DRZA 5JSZB 1TTTA 4EFMA 1D9XA 4IDQA 3PUXA 4JJZA 1ZCBA 2V6IA 4L8GA 2OFXA 2RGNA 4IHQA 2OSBA 1YRAA 1ANKA 1CULC 5HKKA 4I81A 1HQCA 1J8MF 1UADA 5FI0B 4DLWA 4QM7A 2DB3A 1UDWA 1CJVC 1P75A 5CLLA 3X1ZA 1C1YA 2WICA 3ADCA 1YZTA 1LTQA 3OEHA 2OCAA 3FKQA 4DLSA 4EPRA 1I2DA 1E6CA 4KYUA 2XZOA 4CGZA 3LA6A 5H68A 1N6LA 1XCMA 3W8RA 5F9FA 3QOFA 1ESNA 2WPDA 4EDHA 5L3VA 5FBQB 3TUJC 4B44A 2EW1A 3RLFA 1VKJA 4AYTA 1X86B 4E07A 4DSUA 2YYZA 1DG1G 5E95A 3LO5A 1XJQA 2FSIA 4M22A 5F9HA 1DO2A 2Y8EA 1SKYE 3U3RA 4FXPA 4L9WA 1WB9A 1A2BA 4ILEA 1HYQA 1G21E 3MAAC 4WZ6A 1T0HB 1ZD8A 4XVQA 4ASUD 3U44B 4PAOA 1DPFA 1E1QD 3G0HA 3B1VA 1GUAA 4TYQA 1MR3F 1CBUA 3GEEA 3BRWD 1E2LA 4BLRA 4Q4AB 1M7BA 1K6MA 5L3SB 2C9OA 3AVXA 1E1RA 1E69A 1XEWX 2GAOA 3QIAA 3P27A 4LJ4A 1EX6A 1G8GA 1DAMA 3KXIA 3TSWA 1DEKA 2QL6A 3C41J 1XRJA 5HKKD 3U7FB 4RD4A 4FCWA 5AJXA 1KI9A 2GDJA 1GSIA 3I1FA 1G1MA 2ZAOA 5EP1A 2VP5A 1FX0A 1FW6A 3GEHA 4B3BA 4NYMR 1P6XA 4FMBB 4G5GA 1TU3A 3PIRA 1X1SA 3ICQB 3OEHD 3PEUA 4YXWA 2VPPA 3K09C 2GZAA 4RZ2A 3FPAA 5JHHB 4TTPA 2CJWA 2WPDD 2Z43A 4BFVA 3I61A 2MMGA 3T1OA 4P4TA 4DVGA 1US8B 2YHSA 1GKYA 4DIDA 4IVQA 2NMVA 4C9BA 4GP6A 4OQXA 2OESA 1GRNA 3AUYA 3WMEA 2ZYWX 2LWIA 1OH8A 1A5TA 1E2FA 2ZRIA 3L82B 2GBLA 2QSYA 4D4LA 3ZVRA 3SYLA 4A0GA 3F5FA 2VH5R 4O0MA 4L4UA 2R6FA 1BOFA 5J4LA 3QF4A 2RGGA 1E1RD 3DPUA 2Q3HA 5BN5A 5KDOA 2R6GA 4B2LA 1UM8A 2C04A 3RS7A 1G5TA 1LW7A 2ZAMA 4IFBA 1Z6XA 4C3ZA 2XAUA 4IEEA 4NKRA 3RSOA 4HDOB 5CK4A 5K8IA 1XPUA 1OIWA 5JI2E 4EIWA 3HPQA 3Q5DA 4QBGB 5BYJA 1TQDA 4X8OA 1FQKA 2OCYC 4AURA 3B8HA 4YXWD 2REXB 4HAXA 2PLRA 3CNLA 1PUIA 1U8YA 4PSKA 4PO9A 3A1SA 1T9HA 4M1MA 1X6VA 2PZFA 1KJYA 1AM4D 3QENA 3B6EA 2NG1A 4FCVA 4GL2A 4MRRA 3I8XA 4M1KA 4ZCMA 3KKNA 1ZU5A 3GLGB 2VHJA 1E2GA 4JBXA 1ZYUA 3TSZA 4JT4A 2CL0X 2IYUA 1VECA 2WTUA 3SQWA 3GLHA 5H70A 3A6PC 1DAFA 3CRVA 3Q9LA 3MWKA 3QXXA 4QHSA 1BKDR 1E9EA 2WKPA 1XDBA 3AGQA 3NHAA 1E99A 5UKDA 1NL3A 3ZS8A 5C18A 4BFYA 2JA1A 1TEXA 1J90A 3IILA 1G7RA 4IW3B 2GJ9A 3TGPA 1SGWA 3KJEA 3REGA 1QHNA 1RJ9A 2BHRA 4LBVA 2ZS8A 1WQ1R 2ZRDA 1EGAA 2VHUA 3VR2A 3FMOB 4B2PA 4Q7JB 4AI6A 1X8JA 3K9GA 4NONA 3C7KA 3G5UA 1N5IA 3QEJA 4XD7A 4IOLA 1KY3A 1KY2A 3KUCA 5DI9A 3L8YA 4A82A 3TR0A 2QY9A 1M7HA 1O3YA 4LGMA 4MRSA 3VR3A 3WNCA 4PSVA 4Z8XA 4PC3A 2A5DA 1NLFA 1G6HA 1OFTA 5CIWA 2JLYA 4AY2A 2VEDA 3VTKA 5GJCA 1BS1A 3TW4A 4NU0A 2NO9A 3TSOA 2CE2X 2OHFA 2JASA 2MSCB 3U3MA 4TLDA 3KJGA 3I62A 2QTHA 4DLZA 4LX0A 2OE2A 1OXSC 1Q3TA 4FCTA 2RGEA 3WP0A 5FR2A 5EE5B 2DR3A 2YOFA 3K0AB 1E9FA 1UAAA 1OIXA 2BBOA 3A4LA 2WKRA 1W36D 4S35A 3ADKA 1AZTA 3OIWA 5JFGA 2P2LA 2ZQ5A 4GI7A 1XEXA 3WRXC 3Q3JB 2BEKA 3MLEA 3U7GA 1NKSA 1PV4A 1FMJA 1FNMA 1KYIA 4LK2A 3TUIC 4ARZB 1YZKA 1U8AA 1FNNA 2KBFA 3I8SA 3PR1A 2L0XA 4HEJA 4NCJA 4GOKA 3AV0B 1Q3HA 2FN4A 3U3JA 3W90A 3RRMA 4XTCS 2WHXA 4B3CA 4F4JA 4BRUA 2W2VA 2ODWA 4XD7D 2PCJA 4EUNA 1G3MA 4MRVA 1RW4A 3P1JA 4CEIA 2B7BA 4M1WA 4ESHA 1W4BA 4US1R 2OFWA 3N5CA 2ZI7A 1SXJE 2RGDA 4NDZA 4LBYA 4W5WA 4EQ6A 3HWSA 5FOWA 2VL7A 4QXAA 2E87A 2ZPTX 4TN1A 1D8TA 4BQSA 4ZCIA 4GSYA 3EPJA 1N6HA 3E2IA 5EUMA 4EKDA 1T0JB 3B1YA 1XD2A 1ZIPA 3GD7A 4I4LA 3RAPR 5KSOA 4NYIR 2XB2A 4ZV4A 121PA 3T61A 4B3DA 1ZNWA 2PX3A 1PLKA 2ZRNA 2QEQA 2EFEB 3KQNA 5JMTA 3TK1A 4KV9A 3T15A 3T12A 2GXAA 3P32A 3ND9A 3HYRA 4D26A 4M9ZA 1ZJ6A 1KGDA 2GESA 2SHKA 1UDXA 3B7GA 3VR4A 4H1VA 5LPNA 1AKYA 4Q9HA 3L0PA 3NBYC 1VPLA 1DELA 1RZ3A 2A2ZA 2X2FA 3EX7C 3ASZA 4OI0A 1OT3A 1DAEA 5JRZA 2BBWA 3KXKA 1RYFA 2GAAA 2VTKA 3BERA 4LUCA 3BIFA 4TMKA 1IXRC 1WXQA 3EWAA 4OK3A 5EE3A 4TZ0A 5TMPA 3NWJA 3OZXA 1XEFA 4OI1A 3GJXC 1SHZA 3CX7A 4MUBA 1TEVA 2GWHA 2Z0MA 3RS3A 3SEAA 4B35A 1G8HA 1KHTA 4AG5A 1D5CA 3BFXA 1P2VA 4Q4LA 1FMLA 1CU1A 3PCRB 4DT1B 1XTJA 5EZ5A 4HAWA 3JZMA 4Q1CA 2ZRAA 2C2HA 2ZE7A 2GEDA 1W0KA 5SZIA 4YC7A 2IX3A 1LS6A 5H8WA 2QAGC 3CR8A 2GK6A 2ONKA 1I2MA 5DO9A 1N6NA 2ZS9A 1HY3A 2FDCA 3MCAA 3TQFA 2CMKA 4LJ6A 4U00A 4PZLA 4UKDA 1VYVA 2R65A 1U8ZA 4POAA 3I92A 5LD2B 1XJ0A 5EZ6B 5GJBA 5KPDA 1AS3A 3TNFA 3KFXA 3B5JA 2QUZA 2ZYTX 4MYCA 3R9WA 1S3SA 4FI3C 4IKEA 3QE0A 3U44A 3HYTA 1RRPA 1OXUA 2B8TA 3WNBA 1MRNA 1N3BA 4WAUA 1R0YA 2WWFA 3E70C 1KK3A 4G01B 2ZM5A 3TQCA 1GNPA 4U7DA 3QI2A 4JT2A 2QMEA 3CF2A 3CBQA 4G5RA 3WYFA 4BZPA 2QP3A 2WV9A 5KNCA 5FOTA 1OXVA 2N1BA 3BOSA 1MH1A 4GNKA 5ELXA 2CEAA 1XMIA 1EFTA 3VAAA 2X77A 1UJ2A 2XB4A 4P4SB 2C5LA 1R8QA 5J4KA 3B2EA 3A8TA 4Q5IA 3W5JA 1U81A 1TF5A 2BMFA 4EFNA 1IOZA 3EC2A 3C8UA 1U0JA 2BMEA 3CUEF 2DWOA 4LJ7A 3ECCA 1XTSA 4RVCA 3TBKA 4TZ6A 2AK2A 4IFEA 1R5BA 1W0KD 2O8EB 3BK7A 1NVWQ 2TMKA 4PQRA 1L2TA 2QA5A 2J87A 3GJ8A 3R9XA 5EE9A 5FBRB 2FZ4A 3MUFA 1G3IA 1P9WA 5BWMA 3UWOA 3ADDA 1FFHA 4XSHA 1P3JA 5CLQA 1ZC3A 4QM6A 2QRNA 4XJXA 4BRWA 1JB1A 4CDGA 2YNMA 2KE5A 1YU9A 1BYUA 2A3RA 5FL7A 5EP2A 1GM5A 3AVWA 1X3SA 2V1UA 2P65A 3KQHA 2IS6A 4I1SA 4FMCB 3IKJA 4UNRA 4JSTA 2BJWA 2QM7A 3I72A 4MYUA 1JI0A 4ZDIA 2DWQA 4PHTA 4W5HA 2O8EA 2CJWB 4FN5A 3R9IA 1P9RA 3ZD7A 3FKSA 4TTRA 3SI7A 2KB0A 4G1UC 3QBVA 2FEMA 3EXAA 3VFDA 3K0EA 4DCVA 1EFHA 3Q7QA 2XTZA 4FW9A 2F9LA 3H1TA 2QTVB 3F3YA 4Q21A 1BO6A 2A78A 5KSYA 3KKMA 3GLFA 1KZGB 4PC6A 1NVVR 2N42A 2X19A 2D7DA 1EESA 1Q1BA 1XCPA 3BD9A 3CX6A 2XTMA 4GZLA 1PZNA 2V1XA 3QF4B 3FWYA 4KJZA 4P0TA 2CHGA 5E7MA 1QRAA 4AG6A 4D0LB 4LI0A 1KSHA 4E03A 2YKGA 3KUDA 4QBFA 1MO6A 3OE7A 4TYPA 1QHGA 4FINA 1MABB 2RAPA 3V00A 4EPWA 1Q20A 1U9IA 4IRUB 5JI3E 5FL7D 2UKDA 3CB4A 4L9SA 1U0HC 1G64A 5B30A 5JLJA 2XNSA 1P61B 1Z2CA 4OI4A 4JLOA 2RGBA 1WDTA 2QMUA 4JLBA 4BEBA 3CRQA 4RD2A 3WRYC 1T3HA 1ZNZA 1G9XA 5IK2A 1N6KA 2G1JA 2QGNA 5HCNA 5KO2A 2EFGA 6Q21A 3U4QB 4KODA 3FKSD 3BB1A 1MO4A 2NO1A 4QC2A 3U6BA 3DO6A 1XF9A 5JS7A 2Q0HA 1OSNA 4PPGA 2ZR0A 5GJWC 4Q66C 2IEZA 5AJYA 5J4YA 2ZR9A 2OBLA 4IOJA 1DE0A 1W36B 2D7CA 3GLHB 4PPQA 5SZKB 3W5IA 1X8KA 2O0KA 4M2LA 5DSZA 2GJSA 3E5HA 1IONA 2O0HA 4I1OA 2ZRCA 1RPZA 4LV8B 3FFBA 2R9VA 3M1IA 4LDJA 3VKWA 1GL6A 4PAMA 2IXEA 4AKEA 1F2TA 3LLMA 4B6FA 1E9SA 1NBME 1RJ9B 1UFQA 2ZEJA 1NLYA 2QQEA 1JEEA 3UIEA 3ZH9B 1JAIA 2DWPA 3LXXA 1Z22A 4OYHA 3SJAA 3LD9A 3MD0A 3L0OA 3OE7D 4LBWA 5A4JA 4C0BA 1JR6A 1KDOA 3IHLA 4FMCF 3AF4A 4HB4A 1ZC4A 2AWNA 3OIUA 4PSAA 3KZ1E 2RHMA 2C9YA 4JVMA 3SHFA 2BCJQ 4RCZA 4UXJA 3M4YA 4C4PA 3GLIA 1M34E 2EYQA 4HLCA 4B32A 3LVRE 3CIOA 3LAWA 3QXSA 2WWHA 1GG2A 5DISB 4URXR 2W83A 3VHLB 2A5GA 3FHCB 5AJZA 2OBNA 3AVQA 4PX9A 1G20E 5IK2D 1F3OA 1BMFA 2RMKA 1ZD1A 2J1LA 3ASYA 4D6PA 1QHHA 3NIBA 3FHTA 3QKSA 1D2EA 4NZYA 1W5SA 1ZM7A 1E2DA 4HAVA 4M53A 4U02A 1NKTA 1IN8A 4DCSA 2E1RA 3F0TA 1P2SA 1ZUIA 2F43A 1OB2A 3VKHA 3K0SA 3BGWA 1S1MA 3K9LA 3DEFA 4TMZA 2DBYA 2NO0A 4WVFA 4HDCA 1MV5A 1KO7A 4M1OA 2JATA 2OAP1 2XX3A 2F7SA 3LQQA 4H9GA 3FHOA 1G4AE 5FBWB 5H1YA 3K70C 1G7TA 4BPBA 1XEXB 2FJUA 2JLXA 1AA9A 1TADA 3W3AA 2O52A 1NRJB 3JZAA 5DN6A 4O3MA 2IUSA 5FTMA 4UNQA 3ZJYA 4X8HA 4XSGA 1G5PA 3AB3A 5HE9A 5J4VA 2VHTA 3P26A 1BYIA 4OHWA 1EK0A 1NMYA 2GHIA 2G88A 3LVQE 2ZJ8A 3PENA 2ZRGA 2AKAB 1NN1A 5AK0A 4CEIB 3UMSA 1WRBA 1S0UA 3KJHA 4K81B 4TYNA 2QROA 1F5NA 5FUXA 4C30A 5DNYB 4G5OA 4PR0A 4EQ6B 5LB4A 4RD6A 3A36A 4IVPA 1N5KA 3I5YA 3K0CA 1P60A 3NBXX 3R8FA 4PFSA 4V0MA 1RC8A 3NEJA 1BMFD 2GCPA 5FOUA 2FFBA 2NZJA 3LY5A 3TW8B 1UF9A 2ZE6A 3V4FA 1LVGA 2OXRA 4GOJA 4P33A 3QSYA 3RWOA 1XD9A 2FPMA 3UMFA 3ZZUA 4A2QA 1KNQA 5TB5A 2ZUCA 1P2UA 3EZ6A 4Q00A 1A1VA 1XCGB 4F92B 3K9HA 4BLTA 4D2IA 5FOSA 3P4YA 3M0EA 1MRSA 2Z83A 2ZRPA 4QFMA 4ASUA 4KVGA 5DN6D 4TLAA 3EAQA 3DOFA 1H8EA 2WWYA 2VYFA 2NIPA 3QG1A 3EPKA 1E79A 2ODNA 4MITA 2ATXA 4HDQB 1A4RA 4A2WA 1NJGA 5KSPA 1H8HA 1WF3A 1IY0A 3CZPA 2RKOA 1Z8FA 2VP9A 2GCOA 1NN3A 3BORA 3L43A 1UKYA 4BFSA 3IO3A 1CEEA 1CJUC 4WA7A 1E94E 2J0SA 1NG9A 2VRWA 2PL3A 1OLOA 5DIFA 4URVR 5EQTA 1SVMA 4A8JC 3KQUA 3EZ9A 3QXCA 3ETLA 3QJYA 2W58A 1XXHA 5K8TA 2FFQA 2IS1A 4PANA 2AX4A 1W5TA 2JDIA 2YJTD 4GBMA 3QPWA 3T5DA 5TV2A 1XMJA 4JL6A 1F48A 3AVUA 3FMPB 3ZZ0A 2H57A 3TLXA 2YWEA 2JLSA 2Z4RA 4V0KA 2JLVA 5JRJA 4AYWA 1G18A 4V0OA 2R6AA 3QG5A 4P4SA 4AK9A 1CJKC 3NC0C 2O8BA 1T5LA 3RDPA 1CTQA 1G7SA 4NYJR 4XIGS 1JXMA 2J0VA 3D3QA 4Q9IA 2AXPA 1TU4A 2PMDA 4TLBA 4L5BA 5K8LA 3ZDQA 1W2GA 2YC4C 4YMSA 1SXJC 1NIPA 2H5EA 2QP9X 3OF5A 2JLUA 1H8ED 3RC8A 1C9KA 2LKDA 4XOIA 4OK6A 1E79D 4KLNA 4HAZA 5E7JA 5JZVA 1KDTA 1H8HD 5G3ZA 4DLYA 3CZQA 1KI6B 2GXUA 5E7IA 2B7CA 4EFLA 1W4RA 3C5HA 1YZQA 4JL5A 4S2EA 2ZVPX 2RGAA 3L0SA 5KHOC 1Z6TA 2XITA 1UKZA 2F1JA 2NTYC 4JLAA 1E2QA 4Q1EA 5CIQA 5SZHB 2FGJA 3PEVA 4MA4A 3IUYA 5L8VA 4BFTA 2IYTA 4Z8YA 2PMKA 1CXZA 2EFCB 4OHYA 4P4UA 1MT0A 4HAYA 4OI2A 4Y0AA 3X1DA 4C0SA 2JDID 2ZJAA 3BJIC 3K0FA 1Z06A 2F3RA 2WWGA 2WVJA 2D2FA 4N1AA 3K53A 1NLZA 1RIFA 1XMVA 2AXNA 2ZSAA 5LB2A 2ZSBA 1EFUA 4QJ4A 2QT0A 1IQPA 1UBGA 2W0MA 2I1VB 1K5DA 2PH1A 3OFNA 2X2EA 1NVUQ 2GXQA 4N0DA 3A1WA 3MMPA 4YMVA 3U3KA 1SULA 1S3GA 3U61B 4NCNA 3SOPA 3A4MA 1YE8A 1N6OA 2HJVA 4PO8A 4KITB 2JIZA 2AFHE 4D4KA 1XTQA 4TMVA 1JR3A 1D6JA 1N0VC 4RSGA 4UNPA 3IHWA 1Z07A 1C4OA 4TWZA 1RRGA 4GMDA 4GPTA 4IOKA 5CDFE 1GNQA 2VO1A 3QXJA 5EE1A 1Z63A 1G17A 1Z08A 2J0QA 1K8RA 3NDPA 1KO4A 1E2MA 4LJYA 1MABA 2RGNC 4KFRA 1U94A 2Z5FA 3SJCA 2BEJA 2WAYA 3GQBA 5TVKA 1JXOA 5TARA 2BJVA 4NPHA 1Z29A 3VU9A 3GEIA 5FPSA 2OILA 3SHWA 2PEYA 2XJ4A 1RE0A 3QF7A 4WXRA 2OO7A 4RD0A 3TH5A 4JLNA 2PT5A 2NOAA 3GLFB 2ORVA 5JJKA 4B6EA 1DVRA 4DCNA 1SVOA 4MGYR 5DYGA 3N2EA 5FOVA 1N25A 1OKKA 3DL0A 1SZPA 3GLGE 2A7QA 3EG5A 3HDTA 3KXLA 2IUUA 4ESVA 3U4QA 2W2TA 1NN0A 2IF2A 5DHAA 3H86A 3T34A 2R8RA 3DM5A 1W7AA 5L3RA 1W2HA 4F7WA 4LY6A 1UBCA 5L3QB 5FUVA 2HF9A 1QHYA 1YKSA 4WZBE 1E98A 4L16A 3OFND 1CJTC 2BDTA 2F9MA 2X8AA 3LX8A 4DB4A 1AKEA 1XP8A 4D82A 2WMNB 2ZUBA 5B57C 3VX4A 1P73A 1IN5A 1IN4A 3D7MA 1Z3IX 2JIZD 4G3XA 2OBMA 3CO5A 4O2RA 3BFKA 3A37A 2IXFA 1JR3D 2HXSA 1JJVA 4M21A 5KSZA 2G0NA 2WOOA 3O8CA 4B73A 2CBZA 1VYTA 1QBKC 3PUWA 4LHVA 3LH5A 2WJVA 4XWKA 2IYSA 4Q03A 2GKSA 3CX8A 2JLWA 1G8YA 1XBTA 2IWRA 1SVKA 4N3NA 4HUQB 2OCBA 3PUVA 4KVAA 3EWSA 4HB3A 3HJNA 5JECA 3X1YA 1FP6A 1KZ7B 3P20A 2EQBA 2ZSFA 4NBSA 5J5CA 1CR2A 1TF2A 4B43A 1JNYA 3FDIA 3EA0A 2VA8A 3PJRA 2ZRHA 3RRYA 3K9NA 4D81A 3BE4A 4MKHA 4LHZA 4UNNA 2AKYA 3FGNA 3FYHA 1W46A 1IN6A 1OKKD 1XPRA 5FOXA 2IW3A 3LBHA 1WP9A 1F2TB 2MMCA 4QOSA 5B58C 2PT7A 4IEIA 4LHWA 2ZI3A 3KJIA 2FOLA 1SKQA 3CPHA 1ZM9A 4QBIA 4X8MA 5CJ2A 5AUQA 3SFZA 1T8TA 2O8FA 1KI3A 3C14C 2YV5A 5AJWA 1NY6A 4M1SA 4ON9A 1QHIA 2Z6VA 1IBRA 2J46A 2WKQA 4OQLA 3PEWA 4HAUA 3GLIB 1ZNXA 1KMHA 1MOZA 4MKGA 1SVSA 5DLQC 1GWNA 1H65A 2GETA 2WAXA 4PHGA 2G9NA 3TVTA 5EUQB 5J47A 2QP4A 5EXPA 5GADl 1QHHB 3QKSB 1VG1A 5P21A 2FFAA 2QRZA 5CB6A 5FTNA 2F43B 1LB1B 3IO5A 2GVDC 3KKPA 4DSNA 1T3LA 4E5UA 1SHKA 4B71A 1R10A 4TL8A 1KO5A 1Z83A 4C2TA 1ZP6A 3CNNA 3FMFA 4HZUA 4NYMQ 2DHRA 3FB4A 3KB2A 2IC5A 3X2SA 2ZI4A 2OUKA 4Q1DA 3ZQJA 4JMPA 4HB2A 1IAQA 1HUQA 2XOKA 3AF0A 4HLDA 1F2UA 3BXZA 2F55A 2IA5A 1PLLA 4GDFA 1FTNA 1Z6GA 2FF7A 2WJYA 2XEXA 4DUGA 3U3OA 2ZR7A 3WNDA 1OF1A 2WJIA 3B78A 1I4LD 2QSZA 1CRQA 3CONA 1N2CE 3HU1A 2ZE5A 4LCBA 2NO6A 1CJMA 5B64A 2W2XA 2AL7A 4LV5B 5K8UA 2P67A 3KKQA 4NCKA 3I32A 1DAHA 1E4VA 1HT2E 1Q0UA 5D3MA 1XX6A 3W6PA 3MG9A 4JVLA 4KBFA 4BFXA 1N6RA 4O25A 1KAGA 1M7GA 4JBYA 2V7QA 2YWHA 2BVNA 3PG5A 4YQFA 3IPYA 4DDTA 1V5WA 4DLTA 4PXAA 2ZVQX 4RFSA 4D25A 3OESA 2CCGA 4JLVA 1E9BA 1M2OB 1W44A 2FPLA 3NEYA 1CKEA 4MGIR 4Q1AA 3GJ0A 5IDVA 1AIPA 1E9AA 2KWIA 1SVLA 2MSDB 3NBFA 1TQ4A 4DLUA 4R7ZA 4RFVA 2PJZA 3GCGA 1R0ZA 4LRWA 5FTKA 5JWOA 1ZU4A 1GTVA 2XOKD 4NE2A 3DDCA 4V0NA 2ATVA 2ZE8A 3HR7A 4A6XA 4HLQB 1P2TA 1EFRA 4UJ3A 1YRBA 1ZM2A 3KDSE 2H8KA 3SJBA 4DUGD 4TL6A 4URUR 1G7CA 2OLKA 3AVOA 4ZIRA 4EAQA 2H16A 1AQUA 5AUPB 5FTJA 5LBIA 1HE1C 2FU5C 2FSGA 2VLIA 2GCOB 3B9QA 4OHXA 4PAQA 1LF0A 4BLPA 3KQLA 2GTPA 2PZGA 2ZJZA 4ZI2A 4A4DA 3BC1A 4B76A 3OIVA 2PX0A 4JS0A 1OB5A 3T5GA 2VP6A 2VQSA 3NBZC 4OBEA 1YR8A 2I4IA 1XXHB 1GP2A 1KDPA 2V7QD 3NG1A 1VG9B 2YWFA 3QY0A 2I3BA 4LYFA 3LNCA 4MGZR 2BC9A 2CXXA 3VNUA 1HEIA 2ZYVX 3EW9A 4BUJA 5KYKA 2ZSEA 1KI6A 2I1QA 1KK0A 4YONB 2ZTSA 3WXMA 3W9YA 3KFVA 4LJAA 2EYUA 4AKGA 2Q3FA 3AF3A 2O8BB 2GK7A 1E3MA 1N5LA 4KLZA 1XD8A 2IYWA 2XXAA 3EIHA 5KU1A 1L4YA 3F8TA 4G5QA 2ODBA 2ZRJA 3EARA 2N46A 2DFLA 3Q8XB 2WIBA 4QGHA 4B48A 1DAIA 1IM2A 1NY5A 3PITA 2C78A 1KMQA 1V43A 1JJ7A 2B6HA 4R98A 3DOEA 5JHGB 5IRCD 2OXCA 2WWXA 1HV8A 2FFHA 1PLJA 5KPJA 4CIDA 2ZUDA 3CRMA 4MYTA 1EFRD 4C2UA 2HJGA 4OHVA 4WOPA 4URYR 4B3XA 2OLJA 4JYBA 3A1VA 1TL7C 3NH9A 3MFYA 3ADBA 2ZRMA 3WYGA 221PA 1AK2A 4DEYA 1HURA 3H2YA 3LRPA 1GAJA 1ZMXA 2P3SA 2CLCX 4QGAA 3LWNA 1XTRA 1ZAKA 2WJGA 1KJWA 2QPTA 1Q12A 4O2LA 2NPFA 4JJKA 1KJZA 1RRCA 1XU4A 1TUEA 3CH5A 2IYVA 2FG5A 2JJ2A 3RS5A 4OKSA 3PQCA 4DB2A 1SQ5A 2EFDB 3ZVNA 3K0FB 1Z47A 4ZDWA 3ZQ6A 1ZD9A 3R20A 4XTRA 2D74A 1EX7A 1N0UA 4MRNA 4WXPA 3ONWA 3AP2A 2QMOA 2Q9CA 4FWTA 1IY2A 1UPTA 1M8PA 3CNOA 3NXSA 4WZAE 4Q9LA 2IEYA 3SC3A 4Q7MB 4JL8A 1UEJA 2GJAA 4JLDA 1R0WA 2ORIA 1W47A 3AP1A 5IT5A 2UVQA 1KAOA 1G16A 4JSYA 4IXMA 4NYIQ 2P6NA 3CWQA 3U60B 1W4AA 3THWA 3L0IB 5CJPA 3O8RA 2A5YB 4QJ5A 2GCNA 2HT6A 3W3ZB 2XJ9A 4EPTA 5L3QA 3EPHA 1Q1QA 2LCFA 2C96A 4K8OA 1E9CA 4TQUS 4U5XA 1OH6A 1N6PA 3QNUA 4N0EA 1J7KA 3VU9B 2C98A 4R71A 1XB2A 4QG7A 1VDZA 4IXNA 3BH7A 4OQFA 4PC1A 1N0WA 3ZIAA 1DBSA 1ZNYA 2JJ2D 2GA8A 2F1IA 3T1TA 2HUPA 3CM0A 1T91A 2AD1A 4HLUC 4TTQA 1D2NA 5EXTA 1IHUA 4EJSA 4M8NE 2VF8A 4TYYA 4BZQA 1XNJA 3AF1A 2GF9A 4LBZA 4Q4JA 2CDNA 3MRSA 5DYIA 3GLHE 4HUQA 1KSGA 3W6NA 2V4ZA 1ZBDA 4YDHB 3VNVA 5JWRA 4NH0A 2WOJA 4P3YA 1W4CA 1OXTA 3LW7A 4GRAA 1IJEA 2BKEA 3C16C 2FA9A 1QHSA 3RABA 3NC1C 4ACBA 1FUUA 2WWIA 4M9QA 4D0NA 3IQWA 3PEYA 2A5FA 2J7KA 2CLSA 3UG6A 4Q9KA 2GVZC 2H17A 3GJ6A 3UG7A 4DDVA 3ZLJA 1KOFA 4TQ9A 2MSEB 3UMRA 3ZVLA 2HDNB 3SR0A 4NCIA 2YOHA 1G3RA 4KO8A 4C0KA 1IY1A 4DLVA 1GFIA 1DO0A 3G82C 2KBEA 5FBLB 2D2EA 3K70D 1NG1A 2OAQ1 1NN5A 3QKTA 2J45A 3ZIAD 1Z28A 2G1KA 1JAHA 2WMOB 5AJVB 4MH0R 4A0HA 4TQAA 5BYKA 5D3QA 2CE7A 3ICEA 3TIFA 1ZCAA 5DHFA 1S2MA 3LBNA 2FMXA 1VCIA 4Q7LA 4BGDA 1R2QA 3JVVA 1VG8A 5EE0A 4ERNA 5FUWA 1U99A 1N6IA 2IYLD 4B47A 2O8FB 1NVXQ 4IVRA 3TKLA 4D80A 1NMZA 5FPHA 3SU8A 4AIIA 3QKRA 1NI3A 4TYWA 2G77B 4A2PA 1GKUB 1KMHB 3GFTA 2QGZA 1FUKA 1E96A 4TT3A 3IEUA 2ONJA 1KI7A 1SVWA 4D4MA 1T8UA 3RS2A 3WYAA 2ZSDA 3GFPA 4BFUA 2FNAA 4G0NA 1D9ZA 3BS4A 3FOZA 4HSEA 5C4MA 2ZROA 4A1FA 1M1YE 1JEDA 3J81k 1P9NA 2FGKA 2YINC 1MKYA 1FL9A 4Q1FA 5CYOA 3VMFA 3QPUA 3W8NA 3QVUA 5BN3A 1SXJA 2ZU0C 2XNDA 3GMTA 3H84A 3FMIA 1GNRA 4HZUB 4PQYA 1QG4A 1E4YA 4M4SA 3MWLA 1EWQA 2J7PA 4B33A 1Z0FA 3CKLA 4MYHA 4Q19A 3RSLA 3TJZA 2D06A 5FPYA 1VCNA 1XZQA 2ZANA 4KCGA 4CT5A 1F2UB 1R6BX 3C15C 3WBJA 1SVIA 5JCZA 4M1YA 3SJZA 1JQLB 3LW8A 3RRZA 1CLUA 2IL1A 5GVRA 3EZ7A 3IDQA 3LQRA 2YZ2A 1R8SA 1TUIA 3VX3A 5FL3A 5FR1A 1GITA 4GFDA 3UANA 1E2IA 3ZS9A 2PEZA 1E0SA 5C46F 4IJMA 3VR5A 3K09A 2UZ3A 1XPOA 4FMDB 1NVVQ 1VHTA 4OJQA 1OE0A 1KKLA 1YVDA 5D3MB 2IS2A 1G5RA 5AUOB 3O8DA 4KSBA 2CHVA 4TT3D 4GOXA 1II8A 1KK2A 2HLDA 3BAFA 4NCHA 2R2AA 1KKMA 4XVUA 1ETUA 3H0KA 3D8BA 1YZGA 4LYAA 4XH9B 2NPIA 2REOA 2V8OA 1WMSA 4JZKA 4TL7A 3EZ2A 2WBLC 2KSQA 1P5ZB 4RFSB 5JJIA 5BQ5A 1DS6A 4I99A 4RZ3A 3OIYA 1ZW6A 3HU2A 3Q72A 4KFSA 2C03A 1SXJD 4LHYA 2XNDD 4JKIA 4KYIB 4W5JA 5SZJA 1KI1A 1YHNA 1DG3A 4LJ8A 2HCBA 2NZ8A 4ZI3A 2J7PD 3THOA 2ZRKA 4RCYA 1LNZA 3LXRA 3DKVA 4J0QA 4C0HA 1ELOA 1TNDA 3MWYW 4MQBA 1TAGA 5EXSA 1Q1ZA 2ASEA 3FVQA 4ZIRB 4IOMA 2PZEA 3HP1A 3QEOA 2WWWA 4L15A 1I4DD 2AWOA 5DH9A 3V4RA 1E9DA 2BBTA 4Q02A 4A6PA 4JVNA 4WBSA 2ZRBA 2QBYA 4CEJA 1N5JA 2H92A 1Y3AA 2BMJA 1OYWA 3BWDD 5HZKA 4Q1BA 5FPKA 5M04A 4BFZA 4NP6A 1Q44A 4CRWB 2J5XA 4AC9A 3SYKA 1U98A 5GVSA 1YR9A 3THXA 2HLDD 5HE8A 3BFVA 5GJVC 4ITRC 1B0UA 1DAKA 3I5XA 2QNRA 4C0QC 3RWMB 1EWRA 3GJ7A 1ZUNB 4Y0VA 4BLOA 3B1XA 3QPVA 2BM1A 4URZR 3SS8A 5IHPA 1KDRA 2IK8A 1VMAA 5E3HA 4Q4HB 4BECA 3AM1A 2JEOA 1VTKA 1SKYB 2ZI5A 3AKYA 4II7A 4KXFB 3IPXA 4Z51A 4F91B 2FH5B 4IDNA 4KFTA 1EG7A 3WY9A 2ZRFA 2IYXA 4YMUA 1QF9A 2BCGY 3CRW1 1RFLA 3K0CC 3FE2A 4QNRA 2Z4SA 2J0UA 3SZRA 5A5GA 1QVRA 2OV2A 1UKEA 5AUNB 2WZQA 4LHXA 1E2KA 5F3WB 5G41A 1TX4B 2BWJA 3AVPA 2QPAA 3DHWC 5EJEA 2GILA 3SN6A 4FMDF 721PA 1R4AA 2P5SA 4US2R 4PZZA 1T5IA 4DBLC 4RKEA 1Z5ZA 2ERXA 5C1BA 1W1WA 3AEZA 1A7JA 1R5NA 1CS4C 1II0A 1Y63A 4DCUA 3JVUA 2O8CA 3AVYA 2HCJB 4V0LA 3BH6A 4IDHA 1E9RA 1JPJA 1OFIA 5TXGA 1W49A 3LX5A 3HU3A 3B82A 1NMXA 3U2QA 1DADA 1G291 2DFTA 5LD2C 4ZCLA 4Q01A 4DWJA 1KTVA 2BIFA 3GFOA 1ESMA 3DM9B 3ZYCA 3GLFE 5CM9C 3IGFA 3Q5EA 1TMKA 2AD5A 2C99A 5FPTA 3RRNA 3I4LA 2QI9C 3D6TB 1P62B 4MDEA 4FIDA 5JJLA 4PC2A 2DFKB 3E1SA 4QGGA 3PV0A 2ZREA 4K46A 3BH0A 4WIAA 3THWB 1KI2A 2UZIR 1P72A 2QE7A 4DCTA 5BXQC 4Q47A 1JALA 2QMHA 4PHHA 3WMGA 1HTWA 3THYA 1RVDA 1F60A 2Q3MA 1ZRHA 1TPZA 1QDEA 4DXAA 2REBA 3VKGA 3K70B 1WE2A 4MGKR 1R0XA 4QHYA 1Q21A 2IBMA 4ZDJA 3N70A 5JEEA 5BW8A 2VHCA 4CEHB 2BOVA 5IF9A 3GPLA 3QUSA 5J40A 2BMDA 3K8YA 3QBTA 3SE0A 4HUTA 4EJSB 2AK3A 1NSFA 1XZPA 4UXHA 3PFIA 2E9SA 4Q4JB 2V54A 1Z0IA 4QHTA 4Z54A 2FSHA 4KAXA 2ODEA 3WHKA 4JIMA 4LWZA 1GOTA 2QM8A 1EFCA 2A30A 1VIYA 4JLMA 1VG0B 3AUXA 4H1UA 3PUYA 1WBBA 3AKEA 2OM2A 3QKUA 3TR5A 1GRRA 1EXMA 2WSSA 4PQFA 3GJ3A 4C0JA 3RS4A 5EP3A 4JKYA 2F6RA 3KTAA 2GF0A 4LSGA 1QZXA 2LKCA 4DLRA 4KSCA 1GKIA 1NBMA 2H18A 3A4NA 2DY1A 4LV6A 2IYRA 2QE7D 3ZZTA 5HPYB 2GZDA 1OW3B 2AHOA 1IXSB 1GIAA 2JCSA 4R2HA 4UJ5A 521PA 3PXGA 3WMFA 3TE6A 1CP2A
chains in the Genus database with same CATH superfamily
5K8CA 1AKVA 3TN7A 4NYJQ 1J8YF 4URWR 2XF8A 3EQ8A 4EHNA 5FA8A 1H9AA 1Q3KA 1EWYA 1D03A 4PGAA 1VPDA 1XDSA 5FBVB 3T4XA 3ZDBA 2QAGA 3VR5H 3M82A 1Z7GA 2Q6TA 1V48A 1QDUA 3AIOA 1G6OA 4XX0B 1U3CA 4GZ5A 3RS0A 3UKDA 5FI3A 5FWAA 4RULA 4R8KA 3EA5A 2E37A 4ENRA 1V6CA 5DI3A 1LBHA 1ORRA 3ZWDA 3HR8A 2OCLA 4OFZA 2GPJA 2XYGA 4TKUA 1PW7A 3V4OA 2PCLA 1TLTA 4OJKA 2PBRA 4PTZA 4O2BB 1E32A 1RLIA 4H6VA 2VK2A 2WD9A 1Q22A 1KH2A 2YVKA 3BN3A 4JUFA 4RVNA 4WFQA 4PTYA 3CH4B 4EEXA 2LZ0A 3ND8A 4JX9A 5BSFA 1U7XA 4PC7A 4GPZA 1RPAA 1NGSA 4G5HA 4HC4A 5D84A 4BLQA 3C6YA 4E3ZA 1M2VA 2WSSD 4QVKA 1CJBA 2F48A 4ZXFA 3FYCA 1L5YA 3H17A 1WZEA 4IWXA 3EAGA 4X20A 1OH5A 1NPTO 5EP4A 1Z0DA 2QUKA 2UV8A 4OQQA 1AMUA 3VUFA 1GZSA 2OEPA 5AM1A 3VI3B 1CR1A 1QIKA 1QHXA 2EWVA 1WMBA 3EUAA 5FWNA 4INZA 3ESXA 4BMOB 3GN1A 4DC9A 4URHA 4QPDA 1A2KC 2OZEA 3BVPA 1GLGA 5J4HA 2JFHA 2JGNA 1M1XB 3EVFA 2DEUA 1EVZA 2QVGA 2V6BA 2WEKA 1BTOA 3V97A 5AP9A 2G8NA 3B1WA 2OCPA 1DKPA 1EWKA 2F8LA 3DMRA 3OM8A 3O83A 4G36A 4PF1A 3OURA 3H5LA 2M6RA 2QORA 1QP0A 3SG0A 3PX7A 3OD1A 2P3OA 2QRQA 4V0ME 4BGUA 4ABYA 1ZWLA 5BN3B 2XUJA 1JWAB 1SXJB 2VQ3A 2G5GX 1OYVA 3DZHA 2XSZD 1RM5A 5I7SA 4ZOAA 3AKDA 3TQQA 2LCIA 5CITA 1MHTA 1W8IA 1RC1A 4RKFA 4NHOA 1M8GA 1SU7A 2ZI6A 4O2AA 1JIXA 1KO8A 1JHOA 2ZJ2A 5FBKA 5GGYA 5DW0A 1NXWA 3SKXA 1SZDA 2UXBB 3LV8A 3CJRA 2JCBA 3HRIA 1JEOA 4GT1A 1NIJA 2X4DA 4IGIA 1SZCA 3E3AA 2GKGA 4C2AA 1J99A 2VTDA 2G5PA 1XWIA 3ORSA 3GL9A 3F7NA 3RVLA 4RBNA 1E0KA 4DG8A 5JC8A 2PA0A 2RCNA 4FE4A 2XGJA 4LF5B 1G6Q1 3OPQA 3KQKA 1X1TA 2CLLB 5AFSA 1TTPB 4GNRA 4J07A 3O21A 5CDSA 2R1ZA 2ZI9A 1YDWA 2Q6LA 3DTYA 1L4UA 1HDOA 3FFTA 2IFTA 5K3BA 2B2XA 1FQOA 3L93A 4HY3A 1UEIA 5ESDA 3CBGA 4E1VA 2VDJA 3W7VA 3CGWA 2ZT5A 3AH8A 2VNAA 3M6IA 4CYMA 1PK8A 3ZHSA 3PRJA 4N5LA 1AN0A 1S8NA 4NMMA 4QZVA 2FLKA 4J3FA 1HE8B 3VPFA 3ZEIA 1R3DA 4KDRA 4FFVA 2L42A 4LDPA 4LJ9A 3F73A 1QP4A 1GNLA 4U7WA 4J6EA 1RVV1 2RC6A 3FYUB 1C8KA 1V11A 2C0CA 3QVXA 1J4AA 3BXHA 4OXYA 4P32A 3TTWA 1P31A 2W2KA 3PFHA 1Q1EA 1MCZA 3BK2A 1JFFA 1EUCA 2ZLBA 2B1GA 1V16B 1TXGA 2DCUA 2Z98A 4FHEA 4PCLA 3HJAA 1RAGA 1N1MA 2PMBA 1AN9A 4KI7A 3Q7TA 4FB5A 5KOJA 3GIWA 3U56A 2QRMA 1BA3A 1T1SA 4O2BF 2OGSA 3EVTA 3KQMA 4JX8A 1TFRA 3FVVA 2DMRA 3AP3A 4OL0A 5BSWA 1IXZA 4BJ3A 4RY2A 2SICE 4YRQA 2QD1A 1XUOA 2JJ1D 2C4NA 4F2HA 1PWXA 2P0EA 3HBLA 1TZKA 5ITSA 1I2CA 3QBJA 4U0JA 2W00A 1KNXA 4FZRA 1RYZA 4K3UA 1CRLA 4EA7A 3IUBA 1XRRA 2JLRA 2UU9B 4BB0A 4DCOA 4CEJB 4ZREA 5KYUA 1V1RA 1Q7BA 2FMFA 2JZNA 5FI1B 1G21A 3JWEA 5FQOA 3ZVMA 4JMLA 3TW0A 3O2NA 2PR2A 3FF1A 4Q4AA 4ATNA 4IRXA 2QTWB 3LFUA 2H7VA 4IP0A 2BW0A 4OHZA 4RS3A 1AQLA 4W7SA 1Y4AE 2XBUA 4QU8A 1MV8A 1KSJA 4C7KA 2Y0BA 1TO6A 4JLJA 1WM1A 2G9UA 3NAGA 2C8KA 2IU3A 4PINA 4R2IA 4DBVO 3KX2A 4L22A 2YZMA 1Q1NA 1QU3A 3EH1A 3GP8A 1J5XA 1UC5B 3T7TA 1GNSA 3ONEA 4V1CI 2Y2UA 4R8SA 2JRLA 4PNHA 1Z75A 2BFFA 3I73A 3I12A 1TO2E 4M0UA 4BCBA 2W6JA 1NQAO 2F3QA 1ZGZA 3ESQA 3M9WA 1IUPA 4EKGA 1RWOA 3LY8A 4F3NA 5I3CA 3I0NA 1I2BA 1I9GA 2IQIA 3DONA 4MB2A 4RMGA 5EPOA 2ILTA 2CCKA 2F1HA 4PTLA 4H77A 5BSRA 3TFOA 1PUJA 2CFIA 4PE5B 2NV2B 1LSJA 2QT1A 1NHWA 5FFFA 2CLEB 1GPNA 1C2TA 5JBQA 5KTYA 1KI8A 2YHIB 5B58T 1DC3A 4F84A 3UMGA 4J3NA 1OHHA 1LS1A 4IGKA 3K9WA 3IIMA 2RHCA 3ZCRA 1Y3HA 3RRBA 1XE3A 4ZDKA 2PUEA 3DFZA 3OWXA 1INLA 2TYSB 3QGMA 2BEVA 3O9ZA 1PR9A 1JR3E 4XDZA 3HI6A 3BTVA 3JYPA 3P0JA 3OAAA 3FOEC 5AVVA 1TRKA 5EIHA 5TY0A 4XE5A 2FE4A 2FQXA 5L3ZA 1CRPA 3LP6A 3V4PB 1ENYA 1H3NA 3UMVA 2O8CB 1P44A 4YBRA 1OQAA 2ANBA 3FHTA 2XQVA 1HMYA 4RHCA 1KAQA 2RH5A 3X2FA 5GZ3A 5MHTA 3N87A 5IANA 2PX6A 4D3ZA 3EDMA 2VSQA 2FEXA 1FYFA 3E3LA 5K03A 2WG2A 4DMRA 2R7MA 2IUTA 4F0JA 5ADUS 3KUXA 2B92A 3IBFA 2F59A 4PGHA 4I2NA 4AZ0A 4G1EB 3SCZA 3OY2A 5CJJA 4TPKA 3KSAC 4S04A 1N8KA 2C31A 1CUVA 1V95A 4WEOA 2BHNA 2V7XA 2ERYA 4RACA 4AF6A 1Q50A 4YUXA 2VS1A 3ZKWB 4KW7A 3ST7A 2Y1CA 1NW4A 2D3TA 2R7KA 3SX0A 1U28A 3PNQA 4BWYA 4V1CA 4F93B 2P5TB 1YMQA 1RU3A 1YZLA 4C7OB 1QZUA 1T0IA 1T4BA 4YWHA 4ZYZA 4P3KA 4X7BA 2HEIA 4OK5A 3KL4A 4NQRA 1DRKA 2Z3ZA 4G0OA 2VH1A 1RWXA 1UWLA 3OPXA 1VFPA 3BDVA 4UNSA 4CQMB 3AIIA 2DSNA 3IJEB 3RVBA 3WLSA 4C20A 4M1TA 3L6EA 5SY6A 1GPMA 1X0VA 4KXXA 2D3WA 4WZBA 2XMGA 1N1DA 1Y5RA 3EIQA 5AW2A 1UZLA 2DCMA 4BNJA 1W48A 1UJBA 2GN1A 4L02A 4RJLA 5DBGA 2NZWA 5T4FA 1QVZA 2OC4A 3ESDA 4GMXA 4A26A 4A9AA 4K9PA 1TJPB 2I22A 2FSUA 3EQ6A 3LNTA 3QLJA 2P11A 3UJHA 1ZM3A 1Y8RA 2FG7C 2IDKA 2ZB4A 3DDZX 4KYTA 3ZTYA 3AY7A 1IWOA 3RC2A 4B84A 4A92A 3CY6A 3H5TA 1NI5A 2QLMA 1QCYA 5EXXA 4MRPA 1EJ6A 3AHJA 1CY6A 1J8DA 3NBQA 2HCRA 4ZKDA 1SC1A 4HNSA 4OX9Y 4YMWA 1FRQA 4FR2A 4F1KA 1QJ4A 1W4ZA 1MO3A 3LUHA 2FFJA 5CFQA 3X1JA 5JW6A 4CT4B 2Y0EA 4Y2UA 4NZZA 2FE1A 4UXIA 3G1WA 1PR3A 3CPJB 4GDMA 2J4DA 4UEWA 4JEHA 2ZUUA 3S7TA 4EMTA 2Q9AA 1EZ4A 3V7UA 1H6CA 3TDMA 1IM8A 2QY6A 4BNWA 2EWWA 1U0LA 3B3FA 3T3PB 3G8DA 4P36A 4BBJA 1X7XB 2QX8A 1ZIDA 3KOWA 1V3QE 2D5AA 3K0AA 5G40A 5JPIA 2H31A 4DUYB 2FEPA 4H7EA 4RMJA 1N0HA 4F3TA 5K8VA 1E2HA 3HJBA 1WLSA 4ZN6A 3F9IA 3ZX5A 3RVOA 4LWOA 3WDMA 1IBCA 5TS2A 2QN8A 5J5VA 4OO3A 1QVAA 3BHIA 4FLEA 3SEZA 3TVDA 3R3VA 2P90A 8AT1A 4CVNA 1YQUA 3BEOA 4PIVA 2VZ0A 2ZPAA 4NV3A 3KWJA 1LFDB 5BNZA 1WEHA 2X6QA 1UDCA 1XWFA 1OZAA 2AG0A 2W0SA 4LHSA 5BN4B 4W9MC 2CVOA 4KVZA 1JAYA 1UM9B 5ALMA 1AHPA 2J41A 4WFJA 1Z0UA 3GUUA 4QASA 1HBJA 1EE2A 3FW1A 5LCXA 2GPAA 1S4MA 2O1XA 4V03A 4JCCA 2PLFA 4A0RA 2C95A 4MB6A 1U2QA 4E5MA 1IH8A 4DY6A 2D5IA 4DVJA 4JN6B 2Q46A 4PY2A 3RFXA 3UUWA 4YJ3F 1BU5A 4P92A 1U90A 2GEUA 1XMXA 3I9V1 4IS3A 3FN4A 3N2YA 4OKNA 2DKOA 1T36B 1U1FA 2FUG6 2HSJA 4RMNA 4ZRMA 1NDQA 2NO7A 3O2QB 3Q85A 4CM6A 4F04A 5YASA 1YJAA 4JJ8A 5IM5A 4CDMA 2B3TA 2R62A 4UQOA 3RBZA 5LJLA 1E58A 3SLGA 1NE2A 3I2JA 1WJGA 3IUQA 1G19A 4UZSA 4AJ2A 4DRXB 4ENQA 3IIJA 1XMSA 1U65A 1G41A 2GXSA 1VYUA 1FOEB 2GN4A 3QX7A 1F9EA 3UXMA 4H35A 1M2HA 4UBIA 5EFOA 1SB8A 3OWOA 3ZJTA 4BASA 2V7BA 1F20A 4IIDA 1FDOA 3SVZA 4BGEA 1OXMA 1RHKA 5HZGA 5CVCA 1MGPA 3TRDA 1ZM4A 2R8YA 2CK3D 4B3GA 3L8ZA 1RDFA 3LBIA 3KAKA 4LKOA 4ZC8A 3WDLA 5EIBC 1MVNA 2ZS7A 5G0VA 3FAKA 4BXOB 3DE5X 1N2CA 2FVYA 2O8DB 2BBSA 1Y9ZA 3IIKA 4Z99A 3IEVA 2E4AA 2OD7A 4UPVA 3VR6H 3NDBB 3R3SA 2PS9A 4LW8A 3ZZNA 1RZVA 4UBKA 3SXUA 1NVAA 3UFXA 1ZN2A 3EVDA 4UHKA 1XD2B 2RB4A 1KAHA 2R44A 1XLWA 3L8CA 2YW2A 4KGDA 1XFDA 5CVJA 1F6BA 1IN7A 1XPJA 3DWGA 4HWPA 1KIFA 1POXA 1HA3A 1NF3A 2G83A 2H3HA 1XCLA 3IA7A 5EMHA 5LUAA 1M5UA 4EUFA 5FEUA 1AKQA 2R00C 3DXYA 4LPKA 4E09A 3JASA 4F86A 1UC9A 1V9CA 4AB1A 2QRGA 1T5HX 1D8AA 1YI8A 2R1TB 4RD1A 1N7JA 1FP7A 1U3WA 1W9HA 2C5BA 3UY4A 1THMA 3TG2A 4QXQA 2OO5A 1Z4NA 1IULA 4S1TA 2YZKA 3FLMA 1Y3IA 1E0JA 1QGZA 3I2YX 3QQ5A 1JKXA 4PLPA 3WL3A 1OOEA 2VP2A 3ANTA 3QPCA 4LDZA 2XZLA 4UU1A 2H2IA 3GYBA 4BLWA 3DZ8A 5LP1A 2HK9A 2AX3A 5K3FA 4X97A 2ZITA 3WK7A 5I7WA 2J6CA 2ADFA 1L9XA 4PNZA 4EFMA 1Z18A 1SOMA 3D8NA 3OBBA 1EUZA 1ZCBA 2V6IA 5B6IA 1Z7EA 8LDHA 2QXTA 3IQDB 1UP6A 3DXFA 1KBOA 4HNUA 3R5HA 3NT5A 1UDWA 2GSWA 4KUEA 1GQYA 1MPXA 2HQBA 5JS6A 1SCUA 1M54A 2A4KA 2IX9A 3CIFA 2G1PA 1YZTA 1TYZA 4NBNA 3L0ZA 4E6PA 5SYNA 1LW6E 2OCAA 2C82A 3FKQA 4DLSA 2VTEA 1OA0A 1XDZA 1I2DA 4KYUA 3QOYA 4HAOA 3VNBA 1M1NA 1TT7A 5H68A 3SFTA 3STHA 1N9KA 1Q17A 1UFOA 1XCMA 2ZYAA 1ESNA 2WPDA 3FPCA 5BT9A 2FEWB 5F9FA 2X22A 4O08A 1IRIA 3TUJC 1BCRB 4B44A 4ENUA 2PKCA 3GGDA 3S40A 4AYTA 4BNNA 1JVBA 1V96A 4DSUA 1HFEL 2PFKA 2B5VA 3LO5A 3KL2A 3Q2OA 2PJUA 4ZU1X 1VGVA 3M1LA 2H9YA 2IV7A 1CC1S 3KJFA 1SKYE 4JDUA 2BFPA 2HRDA 3UCFA 4FXPA 5F9HA 2A4MA 4DNOA 1H9BA 3TKYA 2MJLA 2X4IA 2HKIA 2HDWA 2JI6A 2B37A 3VOAA 2JAUA 1TZMA 1CUSA 1O94D 1ZD8A 4G89A 4XVQA 4YJFB 3SIWA 4HRXA 4PAOA 4F4FA 3U44B 1E2UA 2FSVA 2NU9B 5DT2A 3A9UA 3B1VA 2BGLA 2JAHA 2NUBA 4TYQA 4UQPA 1VYHA 3ROXA 4CL8A 4RYLA 4KN6A 1U6KA 3A04A 4TKVA 1H2HA 1HOTA 2C9OA 1XEWX 2GAOA 2R66A 3QIAA 2QXYA 4W7HA 2JH3A 1G8GA 3EMKA 5CXQA 3TSWA 3D4LA 5IUJC 3PD1A 2PZKA 2BPOA 5EXDA 1W5EA 3U7FB 2C1XA 2WIGA 3NOXA 4QDXA 3DPIA 3R7SA 2XMZA 3D8TA 4S24A 3RLIA 2VP5A 3AR8A 4BTVA 2AMVA 1ZICA 5I5GA 2LE0A 3QMMA 2FRVA 2RI0A 1DTWB 1KJJA 4FMBB 5ICSA 3PIRA 3LT2A 4Z9BA 1IE3A 5DYTA 1X1SA 5I4BA 2ZJ3A 1N2OA 2I4MA 2PKQO 3DE2X 2PM8A 3OEHD 3PEUA 5AXBA 4YXWA 3FZNA 2V0NA 2VPPA 4Q7EA 3UT5B 1RKQA 4LSMA 3AM5A 4RZ2A 4CM4B 4D9GA 3VO2A 3AIKA 3D8RA 2Z43A 3NRCA 2WNHA 3M4NA 3NQ41 4MR8B 4AJEA 3GDHA 1QGUB 1MAHA 3VH4A 3RBAA 1N2IA 4EP1A 5IXSA 2Z5VA 3OZEA 4WGGA 4DVGA 1US8B 3ZY6A 4EHFA 4EG6A 1GKYA 3THSA 1GCIA 4IVQA 5HCUA 2BFBB 1A9YA 4GP6A 1YVRA 1QP8A 2ZBVA 2I4OA 1GRNA 3AUYA 2ZYWX 4X54A 2GUWA 1S3IA 5AVXA 1FK8A 4GC9A 3RGWS 2H59A 3R5XA 4YAOA 1E2FA 1F4VA 2JZOA 3IELA 4J0JA 4P8RA 1MC1A 2BDUA 4QJBA 5THKA 2C84A 5B55A 3BZUA 2NUAB 1LBTA 4D4LA 3GAAA 4YAWA 4HFJA 4CG2A 3SYLA 3T9AA 5DZSA 2XHEA 4A0GA 4H0NA 3M2PA 2I2FA 2VH5R 4WH0A 4AX4A 2I7CA 2R6FA 2WD7B 5K6AA 5MFZA 2Z4TA 4UQLA 5FAXA 5ALNA 3EGCA 5BN5A 4Y6RA 2WHRA 1E6MA 1U0TA 2V6MA 3CXRA 3E81A 1Z4PX 1NVFA 1G5TA 1PJTA 4IFBA 3T7JA 2I6QA 4KE8A 4AZ3B 4C3ZA 4NKRA 3EDOA 2VT3A 1PL8A 1XPUA 5B37A 1ZSNA 1U8UA 1XU7A 1ND5A 3PUJA 1R88A 3Q5DA 1KFJB 4GU5A 3ZHBA 2FPWA 3CVUA 4ZALA 5JZSA 2PL5A 4CV3A 2OBXA 1N32B 1PV1A 4ZEXA 4DGSA 5KCZA 3EISA 3TD2A 1O0BA 3EC7A 2P40A 3K05A 3HP4A 2D4AA 3AFMA 4HPWA 5ALSA 4Z7NB 3CNLA 2H0AA 2YR0A 3UFBA 3TGLA 4CTOA 4PSKA 5CNMA 4IDAA 1W5BA 4BAZA 3V3KA 4B3RB 4IWNA 1KJYA 3G17A 3CZAA 4XGRA 1OZ0A 3B6EA 4LA4A 4FCVA 3ZBUA 4AZSA 4H2DA 5FTWA 1RHQA 1R5JA 3ICVA 1TVKB 1YL7A 4M1KA 4ZCMA 3TM4A 3RVPA 1E2GA 3GFRA 3HXOA 1WUTA 4JT4A 3HCBA 3TZ6A 4WLUA 1H6AA 4CF5A 2VJAA 4UHBA 1T13A 1NMQA 1RAFA 1OLUA 2VPXA 2P62A 4RHXA 4LNUB 4UFOA 3W2IA 4YH1A 1BKDR 1VXOA 1EGHA 1KJIA 2F4NA 4WECA 1KQGA 3OPYI 1TEXA 3WGIA 2E4XA 3GGSA 3AJAA 1JEJA 4MRMB 4RHFA 4J0EA 2FPPB 1N3YA 2Q28A 3KJEA 1QHNA 3L92A 3L7CA 4G07A 1QNFA 3FLEA 4O1HA 2ZS8A 2ZRDA 3OI7A 1NONA 2BUCA 3FMOB 4FFOA 2Y92A 4CWAA 1YZYA 2CF6A 4Q7JB 3KCQA 1CEYA 3K9GA 1O6FA 1VE5A 3EQZA 2DH5A 2X9GA 3QEJA 3QFSA 4LS3A 1MB2A 1KY2A 4XD7A 5IT0A 2PKYX 4C3OB 3N86A 1NQ5A 1QV6A 3A1CA 4ROTA 3L8YA 3OPVA 4V3BA 3TR0A 1O3YA 1R6TA 3PFFA 4Q4CA 4QARA 1NLFA 5CIWA 3RVSA 4LCEA 1GKKA 2O07A 4P3OA 5GJCA 3ANLA 4AM8A 1XVAA 2RGYA 1NF8A 3FGZA 2B82A 2Z04A 1BWRA 2VR1A 1JLHA 3QZUA 3BSWA 3FCUB 4RDHA 4XX1A 3EEIA 2JASA 2MSCB 2DT8A 3VPHA 2JFUA 1VKOA 3QU7A 4LYYA 4B0OA 2HHCA 1RBQA 4UBOA 1U1DA 1IHDA 3H04A 1USVA 1YCHA 1OXSC 1Q3TA 5F23A 3X1MA 3U7RA 5A62A 2UXDB 2RGEA 1YQQA 3Q7EA 5EE5B 5FR2A 3KO8A 3ZCSA 1A8QA 1BX1A 4MUHA 1ZD5A 3A4LA 2E0IA 3A0RB 2YXPX 4S35A 4CIVA 4XVCA 1VJ1A 5J58A 2CXSA 3BSSA 2P2LA 5JFGA 2ZQ5A 1G2OA 1BC5A 1MAUA 4NU6A 5KINB 4JJEA 2V5UA 1PV4A 4MW2A 4MHSA 1FMJA 1KYIA 4ARZB 1YZKA 2KBFA 3O6VA 3PR1A 4HEJA 1LX6A 4EJMA 3CLSD 4HVCA 1E9VA 1DX9A 1TK3A 4I5GA 3T54A 4WBXC 1PR1A 4B3CA 4F4JA 3ANYB 4IDGA 4BRUA 2H4JA 3RUEA 2W2VA 1HDCA 2PCJA 3BSFA 3EYAA 4OP3A 5E6SB 2PVCA 4MRVA 3THRA 4CFZA 1WUIS 5KMGA 4BVAA 1RQXA 2DTEA 2PWBA 3D3WB 4EY5A 3OPYA 3VHXB 2RGDA 4NDZA 4IILA 4EQ6A 3PTLA 1W85A 5FOWA 2VL7A 1DRUA 2E87A 4QXAA 1D8TA 3R5SA 3SX4A 3A3NA 1N6HA 1PR2A 3KPWA 4EKDA 3OQNA 3WL5A 3S29A 4YJHB 1ISIA 2ZCVA 3UHAA 2UZ4A 5JVDA 1AXGA 1JAXA 4LQ4A 121PA 3PLNA 4I0WB 5FJJA 4B3DA 4ZV4A 2IIQA 3FCYA 1PLKA 2I65A 5PGMA 3N8NA 4OHCA 3UXEA 4B7ZA 4S1OA 1D2CA 2XT0A 3G0CA 1ZCZA 3KQNA 4HL6A 1LPNA 4TX1A 3WLIA 3G2OA 3ZV6A 3IEMA 3ZU3A 3P32A 3MAJA 1JBQA 1CF9A 3ND9A 4J7CA 4DNXA 3LCCA 1ZJ6A 2GTIA 2NTJA 3B7GA 3GARA 5AMXA 3VR4A 4BFVA 1AKYA 5CDGA 3NBYC 3ORRA 2YIMA 1DELA 4O59O 4PONA 4U39A 1FP1D 1B7GO 1RZ3A 2ILVA 3HMKA 3QUQA 4NOLA 4CKZA 1T2AA 2FR8A 4UATA 4R9NA 1PIWA 1IB0A 4FZ5A 4NZ9A 5H81A 4ZAXA 3SKYA 4AXBA 4DA7A 2ZIVB 5AI4A 3E1GA 3L5OA 1WXQA 5IYZB 3HJCA 4UAJA 4HK4A 2DHEA 3NWJA 1PSDA 3VPXA 3GJXC 1EM6A 1QKKA 1SHZA 2XECA 1TEVA 3SEAA 3AKZA 4L6IA 3UMJA 1G8HA 1UMCA 1T8SA 1E8MA 1IN1A 4MP3A 1D5CA 2DT5A 3BFXA 3DVQX 3ENKA 1C0KA 3V6MA 1VL8A 2HF2A 4KMSA 4RTLA 1OAKA 3I45A 1TD1A 1ADFA 4HR7A 2HIAA 3STTA 3H2BA 5LIPA 3JZMA 3RK0A 1U2DC 4RGYA 4HQFA 4OXQA 4I5FA 3SVLA 2IX3A 3MIZA 5KOHB 2D1TA 1D6NA 1SURA 1K2VN 3QA3E 1GQSA 2W7TA 2W37A 3HFRA 3QNWA 5EKDA 2B1JA 4E2XA 3QLUC 1N7HA 4FOSA 4M0PA 1MA0A 2CMKA 4ZO9A 5GZ6A 4U00A 3DEJA 3G2QA 4AJKA 1VYVA 3FNGA 2R65A 1Z4JA 4U3JA 4X94A 4EI7A 5LD2B 1BJKA 2GPNA 2LXNA 2YW9A 3SMVA 5EZ6B 3UENA 2JGFA 1B6SA 3FPLA 4Z0NA 4TKLA 1S3SA 1YFKA 3QE0A 1IJBA 1GT91 3OEWA 3VH1A 3VBCA 1RRPA 1BVHA 1OXUA 5HFNA 2OYRA 4D9IA 3S8MA 3EVBA 2B8TA 3TQOA 3WNBA 3IUSA 2WWFA 2IE8A 3WISA 4Q3AA 5A5DA 1U0OC 4IIUA 1CHNA 5E1BA 1VI2A 3NHFA 1ODLA 2H4XA 2VAWA 3IOYA 3QI2A 3HKDB 4ARCA 4ND1A 3CBQA 2IP4A 3PGKA 1HC7A 3WYFA 2J31A 1R6XA 5KNCA 1OXVA 5ELXA 1W93A 3CNBA 2FK7A 4XYEA 4ZEVA 4IMPA 2P30A 2X77A 2FKNA 3EXHA 4PX3A 3TLGB 5KS2A 1CS0B 1UJ2A 1ECGA 2VHEA 5CVUA 2HQOA 3LUDA 3I5AA 3ZC3A 3B2EA 4B8WA 5J4KA 2OGWA 5KYTA 3W5JA 3W5SA 1U81A 1EE1A 2BMFA 4AO8A 4LJ7A 3EC2A 3C8UA 1U0JA 4ZCTA 2E5FA 2DWOA 3FUTA 5ITVA 3FHJA 3NIDB 3PHJA 4GAEA 4RVCA 3L5KA 2JLAA 1V8FA 2DH6A 1R5BA 1W0KD 5AVZA 2PO5A 1FY2A 1RCUA 3N8DA 3EJ6A 3FWZA 3ZHZA 1L2TA 2GPBA 2ZQYA 3R9XA 3HYCA 4S1NA 2GFQA 4FYPA 1JWBB 1ST3A 5FBRB 2FZ4A 1RR6A 1P9WA 3LU1A 1OTHA 3ADDA 1IRXA 1FJHA 1K8QA 3HB0A 3A9SA 5I4CA 1DQSA 1U7UA 4OM8A 3W5AA 1K08A 1BKYA 4QM6A 3U3ZA 3VPBA 3BBLA 4XJXA 3TIIA 2Z6QA 1HXHA 2A9JA 1T1RA 1JB1A 3DLIA 4MW7A 1QX4A 2AI1A 3H05A 3VBEA 3KSBC 1YR2A 1NJ5A 1YUNA 2KE5A 2YNMA 3AWDA 3FTCA 3JQ8A 3SZ3A 4YMIA 1EZ1A 4U2DA 1ENPA 2YDYA 5HZMA 3JPWA 3DT9A 1S8OA 4L3OA 4M99A 5IYZF 3O4HA 4FMCB 4QLBA 2IS6A 4IWYA 4UNRA 2CXRA 1K75A 1L5OA 1T9KA 3CS3A 3DFIA 3KNZA 2YHUA 4JSTA 5GV7A 2OGTA 3I72A 4F6RA 1C9DB 1RXCA 2J6BA 3R6WA 3W1WA 1W76A 2KX7A 1ONSA 2R8PA 3MA0A 4PHTA 4W5HA 1NNSA 3R9IA 1J00A 1K7XB 4DBZA 3U9SA 1IK4A 3KJNA 2AFHA 4BP9A 3FKSA 4S1WA 4D9MA 3SI7A 4EG0A 5A6SA 5B2FA 3MPUA 4Z0TA 1O2DA 1NVTA 5BRNA 3V8PA 3VZRA 3UB3A 3L8HA 3QBVA 5C7YA 1FBTA 3VFDA 2X0NA 3O94A 1XLTC 1UEXC 3FXAA 5EIEA 2F1OA 4YASA 1KOLA 3AFNA 1NQXA 3CNEA 3H1TA 3GRVA 2DULA 2QTVB 4YMHA 4QSMA 4WCVA 1W581 4GM1A 4Q21A 5HIJA 3OOEA 3RC1A 2A78A 4B3JA 5KSYA 2NU7B 1HDGO 4WKGA 3ZDFA 4PC6A 3CU5A 1EFPA 2XQFA 4FQ5A 4ND5A 5CPBA 1WMDA 4MULA 1EESA 3WKEA 2OXTA 1G63A 2Y76A 2R5WA 2H5LA 3OZVA 4XIJA 2IH5A 3TE7A 1SBCA 1YSCA 1JMVA 3QF4B 1NQUA 5ALEA 4P0TA 1I32A 5E7MA 1QRAA 1U5CA 2IQ5A 4R1MA 2OCGA 3A9RA 2UZ0A 4AG6A 1KSHA 4CKYA 2C2BA 4IIFA 2JBAB 1VI6A 4F7DA 4A6DA 3WA7A 3EOZA 3GZ4A 2H1VA 1Q7GA 1H0RA 3GCXA 3OMWA 2QI9F 1UXOA 1QAQA 2XKBA 1S6YA 4IRUB 3FNIA 3CB4A 2JFQA 2W93A 1JG2A 1G64A 2DLDA 4R8RA 5JLJA 1XZFA 3GLVA 1YS2X 4ALKA 2ZYGA 3DAYA 4QQRA 4ZCRA 2VJNA 4ZVOA 4JLOA 2XLCA 1QUEA 3FBTA 5CNKA 3TYXA 4AJ4A 2K7ZA 3UA4A 3QHQA 3QRWA 1T3HA 3AXSA 5I7OA 5GM2A 2CSXA 1CB0A 1VCHA 1G9XA 1DKQA 3I0ZA 4UCWA 4WOJA 1N6KA 5IK2A 1EMDA 1XHLA 4K9LA 5KO2A 2H65A 2EFGA 1WXWA 4KODA 4YLYA 4BEWA 6GPBA 1MO4A 3R3UA 1NYLA 2VJCA 2NO1A 1Q1GA 1ENOA 4Q24A 4QC2A 5DX1A 3ZY4A 4ZYTA 2WA2A 3MK31 2Q0HA 4R1UA 4JQCA 4PICA 1OSNA 3IP9A 3I3OA 4JQZA 3RC7A 1B6TA 4B45A 5KYWA 2R8EA 1ZH6A 4WY8A 3D9QX 5CT8A 3GLHB 1E3TA 3K92A 5SZKB 4JBLA 1X8KA 3LY7A 3PGLA 5DSZA 2GJSA 4I1OA 1IONA 2FPGB 2O0HA 4B3TB 2YYAA 5CMLA 1RPZA 4WLOA 4LV8B 4RTRA 2R9VA 1QH1B 4G0UA 3VKWA 4PAMA 5JDIC 2QR2A 4AKEA 1PV2A 4QULA 3BCSA 1E9SA 1NBME 1BA2A 2I2BA 2C8LA 1C3OB 1UFQA 1W1UA 3I2IA 3ZQUA 3UIEA 4CLOB 1FRZA 3GJQA 3LXXA 2GM9A 2ON6A 1Z22A 2C7PA 3QLVA 1G2IA 4PX5A 5LOVB 1B41A 3K1AA 1VKZA 3L0OA 1OLSA 3SX2A 1JU9A 1LK5A 4UFPA 1JG6A 1MGOA 1NBIA 2D2XA 4O4IB 5ALOA 4C01A 4C0BA 5HWSA 1JR6A 4FMCF 1L5SA 3C3WA 4I46A 1ZC4A 2M98A 3OIUA 4FGZA 4C05A 4CTNA 1FSPA 3CGGA 4U2BA 5TPWB 1E3JA 1AKUA 1UQRA 2OR3A 2EYQA 3F49S 3NVMB 4J91A 4X91A 5HRUA 2F3PA 1IWPB 1V4BA 3JS5A 4NARA 2ODPA 2GZSA 1EB8A 2GJ4A 5CDUA 1JKJA 2W83A 1E1CA 3FHCB 7ABPA 3JW8A 1FRFS 3BICA 1G20E 3MT7A 1BMFA 1RI1A 2RMKA 2J1LA 2YJ6A 1D2HA 3O3MB 4UTPA 2AJDA 1ZHOA 2WPNA 1A88A 1D2EA 1UJ6A 4NZYA 4FEAA 1ZM7A 4DR4B 1SIWA 1WHSA 2PD3A 1NKTA 1KQNA 3UHJA 2NM0A 4ZGBA 5KJ1A 1ZUIA 2W6OA 3T7RA 4X9XA 3BMXA 3D8HA 5TMBA 4E5NA 3VYRB 4I6JA 2BISA 1Y0BA 1DRWA 3Q7IA 4OYRA 5EA2A 2D2VA 4QO8A 4JODA 2J3LA 1MC4A 2PVPA 1MV5A 3H1FA 1KO7A 3AW8A 4LXUA 4M1OA 2M6LA 1J20A 2P75A 2F7SA 2VRCD 3DCNA 1FFXA 1POWA 1G4AE 5EL0A 3U62A 4AZVA 5G4KA 4C21A 1XEXB 1BJRE 1NI4B 1BDIA 1C8LA 1L9KA 1R66A 2D00A 3JZAA 4WGFA 2IUFA 3KOYA 2IUSA 3G9XA 5TRTA 4A6EA 3MCWA 4O3MA 3SD7A 1GFZA 2BGMA 1BW9B 5IX8A 3T5CA 1GTL1 4X8HA 1NQTA 3AX6A 3KTFA 4I9NA 2A92A 4X62B 3SHTA 1ZHHA 1GFWA 1L6RA 3HGTA 3PC8A 3K8OE 3P26A 1JIUA 2JVIA 4DYHA 1CW2B 2KLHA 2X8JB 1IATA 4ODIA 3HWRA 5ICEA 1C1XA 2B1QA 2ZRGA 1X74A 3CLHA 5AK0A 2J5RA 4FNAA 1L3BA 3SFZA 1S0UA 5MN6A 4YJ2A 1KVQA 1M1YB 2IUYA 2M1XA 1ZCJA 3L02A 4P86A 5CX1B 5DM1A 4G5OA 1V9SA 1HOXA 4PR0A 3IA2A 4RH1A 3CLUC 2GR9A 4IVPA 4RA6A 1R0RE 4J43A 4PXSA 3QHAA 3E0XA 3I5YA 3ESBA 3K0CA 1QZZA 2O7NA 1S2LA 3NBXX 3HVKA 5CD1A 2DAPA 4QOIA 4CTMA 2GCPA 1XOIA 3DZFA 3OFJA 2CY0A 4LQLA 5JOQA 1YZHA 2JFBA 3RU2A 1RI4A 2G67A 3N59A 3TW8B 1OWMA 1UF9A 2ZE6A 4BVFA 3BGDA 2Q99A 4HXFB 3DMPA 1FDTA 4GOJA 4OXRA 2O5CA 1Y3BE 3RWOA 2FPMA 3IESA 4K6FA 3DKKA 1NXXA 4LEIA 1C3XA 3ZZUA 2NSJA 1JR4A 4Y2PA 2XCUA 1LNSA 2ZDGA 2VNKA 2ZAYA 1OMOA 1WG8A 3C6KA 3EZ6A 4JBIA 4NDNE 4OFBA 2R5NA 3CSDA 1M2OA 3REQB 3F5SA 4LI3X 1L4GA 3R74A 1HK7A 1ZJJA 4FLFA 1DJOA 1R9JA 4M8KA 2MSKA 3N8KA 4JGBA 3W3AD 3C3YA 1LC3A 3O9VA 5DN6D 4EO9A 1BDMA 4WVLA 1U0EA 3RVQA 2IEDA 3X43A 5AW1A 5LOVF 3DBRA 1L8XA 4KN9S 4K6OA 2FZGA 3QG1A 3UOAB 3EPKA 4OLFA 4O4IF 3AF5A 2ODNA 2HH9A 2IPXA 2ATXA 3MMZA 4OLBA 3DC2A 4JWKA 1F0KA 4P58A 3TTUA 2B7LA 4BZWA 4R83A 5EQFA 1I24A 3CZPA 2Q4OA 1TM7E 1U0NA 3H11A 2GCOA 3L43A 3RBVA 4H7JA 1ZEJA 1TIBA 3G2LA 3IO3A 2ZIWB 3Q3HA 3U4DA 1E94E 3KLBA 4K03A 1UINA 4GUDA 1NG9A 2J0SA 2POQX 3L6OO 4IIJB 4URVR 3PGJA 3F3MA 4A8JC 4D57A 3FCSB 4RADA 3NAMA 3HCRA 4URFA 1QM5A 3AEUB 1P77A 3UJ3X 3QJYA 5B3LA 1Q0ZA 1XXHA 5DGCA 3UXHA 3T4PA 4KFCA 4PANA 2YJTD 1AO3A 1J0DA 2HMSA 5K6TA 4JL6A 3VGPA 3KQWA 13PKA 3HBFA 3NETA 3VDNB 2F8SA 1O95C 3QY9A 5JRJA 4O6VA 3UAXA 1J25A 1LK0A 2XGGA 3ICWA 5AO9A 4AK9A 1N2HA 4ZGWA 1T5LA 1RNLA 2FDXA 2RHRA 2FMTA 1O7JA 3QYJA 4LXHA 4XIGS 2J0VA 2XVZA 1K0FA 4A73A 4ALIA 2FF5A 1X19A 2YY6A 1M10A 2WKWA 3IT3A 4MVJG 3EA4A 3JD0A 4TLBA 1M33A 4X1YB