4ILEA

Structure of human adp-ribosylation factor-like 8a binding to gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
176
Chain Sequence
b'KLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 8A
publication title Structure of human ADP-ribosylation factor-like 8A binding to GDP
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 58
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ileA00
2WKQA 4DLTA 2LCFA 3LVRE 4BLTA 3CNOA 1PLJA 1XTJA 1SKQA 3BB1A 2DFTA 2EFDB 3AVWA 2OT3B 2MMGA 3IO3A 4HLUC 3MD0A 2J0UA 4OQXA 2BCGY 8OHMA 2V1UA 2X1VA 2PCJA 1KJYA 4LV8B 4DJTA 4WVFA 1DE0A 1P9WA 2C2HA 4JJZA 5DYIA 1PJRA 1W48A 4QNRA 1NSFA 4Q66C 4NYJR 2ZPTX 4I1SA 4CF7A 3TJZA 2H92A 1KIMA 3OHMA 1T9HA 5HE9A 1OT3A 1W36B 3LXRA 3VR5A 1Z06A 2YWFA 5KU1A 1UBCA 2CL7X 521PA 4TLEA 4TYWA 1JR3D 2GK6A 5EXSA 1U9IC 2QPAA 2IS4A 2IYSA 3IIKA 4US2R 4LX0A 3IUYA 4MGIR 4QGGA 4ZCLA 4G0NA 2ZJAA 2CLSA 2O52A 5EXPA 3CRMA 3PUVA 2F43A 4ABYA 4WOPA 2XX3A 3UK6A 2J7PD 3KKPA 4G01B 3MJHA 2FNAA 1FPMA 3KJGA 5L3SA 3U7GA 1QHNA 2BDTA 2ZYUX 4BLQA 4QXAA 5J4YA 1ZD9A 4MRRA 3AVXA 1F5NA 4D26A 4E03A 2FFAA 1CLUA 4V0LA 2O5VA 1DAKA 1RVDA 4DLWA 1R10A 3RSLA 2ORVA 3HJNA 2OCPA 3OIUA 1G6OA 4HYYA 4NYMQ 4TN1A 3BERA 2O8BB 3AF1A 4JL5A 3TBKA 1ZUIA 2HLDD 4ILEA 2UZIR 3WP0A 3K53A 4BRWA 3QXCA 2KBFA 1UBFA 4A6PA 1R0YA 4XTCS 3RS0A 3CZPA 1E0KA 3ND9A 4P3YA 3WBKA 4OK5A 2IUTA 4GT1A 1XD8A 2F1HA 3GJ4A 2C9CA 1Z2CA 2WOJA 1E0AA 4Z8YA 5FR1A 5DI3B 3SU8A 2AR7A 1IXZA 4NHOA 4D81A 4B6FA 4A2QA 1JR6A 4A92A 5IDVA 1QBKC 3THWB 2D7CA 2FGKA 4QNMA 2WMNB 4M1OA 2JLUA 1E2DA 4A82A 3AGQA 1E2KA 1QVRA 2O0HA 1ONBA 2Z0MA 4TLDA 2YOFA 2UZ3A 3OAAA 4PZZA 5IK2A 1RIFA 3F5FA 1UEJA 1R8QA 2BMJA 3B7GA 3FMIA 3GFPA 4L9WA 4MDFA 1FX0B 1E9RA 4HZUA 5HE8A 4B3DA 4D25A 2IYUA 2ZANA 3TE6A 3BFVA 2O0KA 1SVSA 1T91A 4DIDA 1AS3A 1F60A 2H8KA 1JJVA 3VKHA 4URWR 3L2OB 1I4DD 3W6PA 1FUKA 4MYTA 1OXTA 5FPYA 1CP2A 1BOFA 4MYUA 4F7WA 3AP3A 1VCMA 4KHZA 4MITA 3FTQA 1YU9A 4YDHB 4DUGA 2NO9A 4B6EA 121PA 4KO8A 1BS1A 2V54A 1E2MA 1HT1E 2IF0A 1NVXQ 5CDFA 5JS8A 5KNBA 3NC1C 1Z22A 1N5KA 1ZJ6A 1MOZA 3LV8A 3OIWA 2NOAA 5ELXA 2A5JA 4PAOA 3AVYA 1LF0A 3D6TB 4LY6A 4TQAA 4QGFA 1RYFA 4BZXA 4DLZA 3TIFA 5CB6A 5FBWB 4OHZA 2ZJZA 3U60B 5AR1A 2VLIA 2F9LA 2FFQA 1N6RA 1X6VA 2BIFA 3C5HA 5FOSA 3NBYC 2H57A 3MUFA 4V0OA 4TL7A 1ODFA 4M1KA 4ZPXA 4LPSA 1KSHA 1XB2A 2W6JA 1GRNA 3P26A 4EFNA 2IYLD 5IHPA 4IOMA 3RLFA 2BBWA 4QL3A 1OIWA 4D4KA 2BV3A 4HAYA 2HYIC 4P4UA 3IHWA 1P75A 3EA5A 3EX7C 1M7BA 2VHQA 1G8PA 2D4HA 1NBME 2Q3HA 3A6PC 2YC4C 2O8BA 2IK8A 3EG5A 3GMTA 4NMMA 4IDQA 1WXQA 2F1JA 1Z6XA 4ZKEA 4BFSA 2IX3A 1E1RD 1M34E 4LJ9A 4I1OA 1HA3A 5C4GB 4BASA 4JLMA 5E7JA 3BGWA 1U8YA 2MSDB 4QGAA 2YINC 1PLKA 3F0TA 1YZTA 2AFHE 2JIZD 1KK0A 4RD1A 2QGNA 4US1R 3H0KA 4W7SA 1NN1A 1KI2A 4JBXA 3HR8A 1XEFA 2CL0X 2C98A 5DI3A 1ZU5A 3I5XA 3ZGXA 5JEEA 3QJYA 2EU8A 4MA4A 2WPDD 3GLHB 3QPWA 4QG7A 1J90A 2J41A 4NYMR 3SBDA 4XWOA 2V6JA 4D80A 2OAQ1 5HKKA 4DDTA 3H86A 5JWHA 1GDDA 2EVWX 2NIPA 3AQ4A 5B57C 4Q01A 3F3YA 1KKLA 3AUYA 3KB2A 5TXGA 4PPQA 4FCWA 1MKYA 5FBVB 5AUPB 4EKDA 3CIOA 3IHLA 4MKFA 1FX0A 2WBLC 4UNPA 1E2NA 2ANCA 2CNWD 2BBTA 2OEPA 5EE3A 3C16C 3RAPR 2ZYWX 3ZQ6A 4AC9A 2V1XA 2B8WA 4KCGA 4N0DA 4RSGA 2RMKA 3FDIA 5TB5A 4Q5IA 3UIEA 1TEVA 2BMFA 2QMHA 4LJ8A 1R5OA 1R5NA 2EWVA 4NE2A 1G64A 1IBRA 4JKYA 2RB4A 4EPVA 1CRPA 1G9XA 5H68A 4HLUA 3REFA 3LX5A 1KO4A 4JYCA 3TKLA 3WMGA 4PO9A 2JDID 3AV0B 5CB8A 2JLVA 5TV2A 1XWIA 1VYUA 5JJLA 3AB3A 1TF7A 1X8LA 5DO9A 2B8TA 3KQNA 2DHRA 2J59A 2VSFA 2EFCB 5FR2A 4Q1AA 5H1YA 2D3WA 2KI5A 3VR1A 4IRUB 2FJUA 4LHYA 1P6XA 1IN5A 1QHHB 4LCBA 4MYHA 3RWOA 3CLVA 2VL7A 3ICEA 4M0LA 5C1BA 2YVUA 5FUWA 1G291 2REBA 2JLXA 2FFBA 4LYJA 4EJSC 3V9PA 3BOSA 4U5XA 3U2QA 4B3GA 1LS1A 1N6HA 3FFAA 4A9AA 4FIDA 3RDPA 4TMWA 4AKEA 4HB2A 5JHGB 2OCYC 1ELOA 4Q1CA 1N5IA 5L3VA 1DAMA 4PHTA 2ZM5A 3BC1A 1E9FA 1L2TA 1SQ5A 2BHRA 4CRWB 5SZHB 1G7CA 1AS2A 1RPZA 3LNCA 2X2EA 3RWMB 2HYDA 2PJRA 4HAUA 1KJZA 3E5HA 3SYLA 1EX7A 4F38A 3GJ5A 3LRPA 3ONWA 1TL7C 2VRWA 2DCUA 1WQ1R 2QPTA 3OESA 1UAAA 5GJWC 1AS0A 1N0VC 2EQBA 1G7SA 1T0JB 3BRWD 2Q21A 2BKUA 2OFWA 4TMTA 3OFND 4O3MA 1Z28A 4A6XA 2XTMA 3GLHA 2IBMA 2QT1A 2PCLA 3SYNA 2FU5C 3NG1A 4PR0A 4NDZA 4R71A 4CEIB 4GOXA 3H1TA 3CRQA 4J0QA 4JBWA 2O8DB 2QAGC 3UG6A 2ZE8A 4X8MA 1SVWA 4OHWA 2DY1A 3BXZA 3O47A 4P33A 2GJAA 3RNLA 3QKRB 1NMZA 2FSGA 3B8HA 3QG1A 1KNQA 3SEAA 1EFRA 4JLOA 1G17A 2PEYA 2RGEA 1AK2A 2ZRGA 1KDPA 2XSZA 5FH9A 3C7KA 2DWPA 1E2HA 1KO5A 2ZRHA 1SXJC 3SR0A 2OG2A 2GZDA 1T5IA 3LFUA 4C3ZA 2QSYA 3EZ7A 1QRAA 1Y63A 3AKCA 1R0XA 4PC2A 4BZQA 4EPYA 5HCNA 4DB2A 2G3YA 1D2MA 4TMVA 1JEEA 1XP8A 3TMKA 5EP1A 3LAWA 1OB5A 4XTRA 5HPYB 1QG2A 3ADBA 2DFNA 1OSNA 3SDZA 3OIVA 3AKYA 1FMLA 2G77B 1CR1A 5D3MB 2BJWA 1MH1A 1T3LA 4B44A 3TUJC 4PPGA 2F1RA 1SKYE 1A4RA 2J87A 1PUIA 2ATXA 1XXHB 5DISB 2XTNA 4LYAA 1T5LA 1FL9A 2EFEB 1GL9B 4DLXA 1Z0AA 4LPKA 2DFLA 1QHHA 2RHDA 2WSSA 3SQWA 4H9GA 1N6KA 2PT7A 4M1SA 2JLYA 1NKTA 3TW4A 3TVDA 2ZI3A 2WZQA 3CB4A 4G1UC 1CJMA 4GRAA 3W90A 1U8AA 1QVAA 2QM8A 4LBYA 4IFBA 3KJEA 1US8B 1VTKA 3GLIE 1SVOA 3WYAA 3KZ1E 1RE0A 2Z4SA 4MGKR 1CULC 1TAGA 3SC3A 4EFMA 1Q1BA 5EP2A 1DG3A 3AM1A 5JEDA 2F7SA 3B78A 1KI8A 3HU2A 1KTVA 2YYZA 1U98A 1HE8B 4XJXA 3U7HB 1GUAA 1KSFX 3DM9B 4ZDKA 4BLRA 4Q1EA 2ZJYA 2J0VA 4OQMA 2FPMA 1ZBDA 1ZVQA 3Q7PA 1KK2A 3PJRA 4AY2A 1NLFA 3M6AA 3VNUA 2GJKA 4DBLC 5C2JB 5EE5B 4XD7D 1CJVC 4QKQA 3DDCA 1W4BA 3FPAA 1E79D 2YC2C 3MJRA 4F4JA 4ITRC 2VSXA 1Q20A 2CK3D 1NSTA 2SHKA 3SJZA 2PZEA 4RZXA 3B1WA 2ZYVX 4QJ3A 2QG6A 3ND8A 3E2IA 1N6PA 1J2JA 4TLBA 2HF9A 3K9LA 1E1QA 1X3SA 4CDGA 1N5JA 1T3HA 2G83A 1ZU4A 1JJ7A 4O2LA 2ZE6A 2IHBA 1KO7A 4CEIA 4FCVA 2XZPA 1SVLA 5FOTA 2EYUA 1YZKA 3HR7A 2O8DA 2XOKA 1DAHA 1SVMA 1JPNA 3GFTA 4V0NA 1WRBA 2ZJ2A 3J81k 4GL2A 2PX3A 1GRQA 1ZAKA 5KSZA 1UBGA 3QF4B 4B73A 4V0KA 3QKRA 3VKWA 3QIAA 1G8FA 3LD9A 1JAHA 3I8SA 3DPUA 3KUCA 4Q02A 5JRJA 1EX6A 2FPKA 2FSIA 4OI4A 3C5CA 5A4JA 221PA 4H1VA 4C0BA 3IQWA 1XCPA 4CT5A 5JJIA 3L8YA 2QENA 3U7FB 4MKGA 4BFXA 3BB3A 5JI3E 4OK3A 3ECCA 5F9FA 4FMCB 1AKYA 3KFVA 2ODWA 2QTHA 4WZBE 1N2CE 1HTWA 2GZHA 4JLBA 3TGPA 3U61B 4A15A 1ZCBA 2QI9C 1SXJB 2XGJA 4LHZA 3TH5A 4LJ4A 2W6IA 4M53A 1MT0A 5FBRB 2NMVA 3CUEF 4TMXA 4WZAE 3FHOA 1XD2B 4YC7A 4LK2A 5E7IA 4K8OA 4XH9B 1W7AA 1XXHA 3TSOA 1U99A 1RRGA 1E9SA 4Q4LA 4ZDJA 3Q9LA 3I73A 5FI1B 3T12A 2ORWA 3LWNA 2O8EB 1WBDA 1N0UA 1XRJA 2GESA 2HCJB 4HB3A 1U81A 2C96A 2AFIE 5E3HA 5HCIA 5EE1A 3OE7A 4WXRA 2F55A 4GI7A 1GKUB 1W36C 1OXVA 1K5GA 2FSFA 2GCOB 3ZVRA 1G5TA 2B92A 1QHXA 2JLRA 1ESNA 3C14C 3SI7A 2JJ8A 4NU0A 5BWMA 4Q7LA 2JGNA 3MGCA 4NCNA 4Q21A 2ZRPA 5GADl 5AJZA 3VU9A 1GWNA 4NKRA 3RS4A 2QROA 2YWGA 1L4YA 1NG1A 3FWYA 3VX4A 3B9QA 1DAGA 1K6MA 4PO1A 5C4MA 3AP1A 3CW2A 1UBEA 2QU8A 3ZLJA 4XVUA 4L16A 3C15C 5FTKA 2YOHA 4Q7MB 2ZRJA 5J40A 4MRVA 1KGDA 3MSXA 3ADDA 4FINA 3WHKA 1G20E 2QPOA 5FPTA 1UADA 4CT4B 2Q6TA 1NJGA 2PLFA 2RCNA 3KXLA 2ZI4A 1H65A 4IDPA 1TQDA 2FSHA 2Q9AA 3AVUA 4KLNA 3UATA 1UDXA 1LY1A 1LB1B 2HXYA 2ZS7A 3OAAD 4C0QC 1P5ZB 4JVSB 3X1YA 1KI6B 4Z1MA 2HJVA 1Z6AA 1Z0KA 3VR3A 5L3QB 2VP2A 3R8FA 3PEUA 4B74A 3GLGB 3R9WA 2AN9A 2W0SA 4QGHA 3AF0A 4YMUA 2OSBA 1LV7A 1BYUA 2B21A 3LY5A 4QBHA 3WP1B 5FOUA 2GEDA 4DDUA 4M1WA 3GEHA 1Z6TA 3GCGA 3X1DA 4DUGD 3QF4A 4LJ7A 3X1XA 1XZPA 2P0EA 4A2WA 5JI2E 1Z6GA 4IEEA 1KSGA 3AVPA 2C9YA 1AKEA 4IKEA 4A0RA 2VSOA 2WWGA 1LS6A 4JT4A 1Q1QA 1F2TB 2JLSA 2QTVB 3RANA 2YHSA 4O0MA 4GFDA 1W36D 3EIQA 2H1LA 3DEFA 1AIPA 3TVTA 1JEDA 1Q1EA 3HYTA 4CIDA 3WNBA 4ZI2A 4PC3A 4GOKA 1Z07A 2XNDA 1J70A 1Z6YA 2JJ2A 2ONKA 2F3RA 3W3AA 3U3RA 3VQTA 2ZSFA 4OHYA 1XMJA 5EE9A 1E9DA 4JBYA 1P2UA 2P5SA 1XCMA 4A8JB 1BO6A 1SXJA 2GEUA 2IW3A 4FW9A 2ZQ5A 4P4SB 1BMFA 1WP9A 4MGYR 5M04A 2IYRA 1U0HC 4IOJA 1XD2A 1RRFA 5JECA 1JQJC 1OKKA 5KO2A 1S1CA 2W6JD 1C1YA 4RD6A 4TTPA 4ZCMA 2BM1A 1UFQA 3NBFA 3THYB 1G41A 2O8EA 5EXXA 2IXEA 5DH9A 4DEYA 5F98A 1NJFA 4BZPA 4OQNA 3L43A 1TUEA 4JLJA 4B32A 3BE4A 3TR5A 3P4YA 1ZNYA 2NTYC 1G6HA 1FTNA 1YZUA 5FL7A 2P6RA 3B2EA 4JLNA 3VX3A 2VHJA 3L0SA 4IOLA 3UANA 3QKSB 4BFZA 3AF4A 4XSGA 3GLFE 3RS3A 4NBSA 1ZIOA 1W5SA 1GNPA 3NXSA 4LBVA 2V7QA 1SVKA 3OEEA 1SKYB 3K09C 3BWDD 2X19A 3EPHA 3X1WA 4DSTA 2C8VA 3DOFA 4FI3C 2CEAA 2NQ2C 3TK1A 4TZ6A 2JA1A 1FUUA 4EUNA 3AF3A 4LWZA 2FEMA 2ZRCA 4B47A 2W0MA 1UEIA 5JSZB 1VHTA 1GILA 1IN6A 2G0NA 4LJ5A 4Q9JA 3RS5A 3EPJA 3RC8A 2HUPA 1M7HA 1XJ0A 5BQ5A 3D7MA 3LBNA 3U3KA 4DLVA 4PO8A 2GXAA 3TQCA 4TTQA 3PR1A 5KNDA 2OZEA 2Q9BA 1ESMA 1KI6A 5L3QA 1YHNA 5KUTA 5CYOA 4A0GA 3GLGA 2ZI7A 1WMSA 4Y0VA 4GBMA 1RC8A 3LW7A 3KUDA 4EPXA 5BN5A 5CDFE 2WJYA 2REOA 3EZ2A 3DKVA 2QORA 2OCAA 2XTZA 5AJWA 2Z5FA 1G7RA 2AXNA 2W2XA 1KHTA 1U2RA 4ESHA 1E2JA 3D8BA 1FNMA 4GMDA 4YDSA 3SJBA 1F2TA 3C8UA 3PEVA 3KJIA 3HU1A 2IWRA 1G3IA 3IPXA 3QENA 5K8LA 1DAEA 1FTSA 2WOOA 3P1JA 4HLQB 3SYKA 1PUJA 1IY1A 1U8ZA 4YMSA 3BS4A 1C9KA 1GTVA 4PANA 2F6RA 1IY0A 3DZ8A 4PHHA 4JVNA 4KLZA 5EE0A 1G3RA 1U94A 3KKQA 2AKAB 4A8JA 2R9VA 3JVUA 4DIEA 4GP7A 4DCTA 1XD9A 1X1RA 5C46F 4TYYA 1J99A 1GZSA 2QAJA 4P4SA 3N2EA 1G16A 1KKMA 4TTRA 5TY0A 1S4QA 4KBGA 4URXR 2H18A 5GJBA 1GL6A 3HDTA 1A1VA 4V02A 4I4LA 1TX4B 1P3JA 3PFIA 2CVFA 3VFDA 3THYA 4B48A 3JVVA 5H70A 2QUZA 1A7JA 1IJFA 2ZRKA 1E2GA 1MO6A 1TNDA 3LDAA 3WMEA 4KJZA 4DSOA 3TUIC 1QHIA 1YKSA 1G3QA 4C4PA 1S1MA 4F4CA 1TQ2A 3RRYA 4NPHA 3X2SA 2GJ9A 4DHEA 1R4AA 4D0GA 4AURA 2G1JA 1S0UA 3VR4A 1E2FA 1XTIA 2GZAA 4EPTA 1G18A 3FB4A 3QKSA 2IXFA 2AK3A 5J4LA 1OIVA 1T4GA 1Z0DA 2DFKB 4B3FX 5F9HA 3THOA 2ZR7A 2IT1A 4PX9A 1N6IA 4PC6A 2VTKA 3B1YA 3KX2A 1QZXA 1GKYA 4NH0A 2WAXA 3NC0C 2A2ZA 4L5BA 2CL6X 4JLPA 1OJLA 1XCGB 2J1LA 2ERXA 2QRNA 2WIAA 3OZXA 5LPNA 5KNCA 1UM8A 5LDDC 2JLWA 3CPJB 2R6FA 5LB4A 4U02A 4CZ2A 1L7VC 4EFLA 1KY2A 2OXCA 1OB2A 2A5DA 1UKVY 5DGXA 2GRJA 2VO1A 2MSEB 1UDWA 5JSZA 3HPRA 4X8LA 1HQCA 1HYQA 4LHWA 2QP4A 3MRSA 3NDPA 4E07A 3ZJYA 5KDOA 5J4VA 4LBZA 3PITA 1DAIA 3LW8A 3TUZC 2C04A 3T1OA 4YMTA 1OXUA 1J8MF 4XVQA 4LSGA 2ZI5A 4KFSA 3Q8XB 2P2LA 4Z54A 1DOAA 5JWOA 3GP8A 1EFRD 2JAQA 4DDWA 2GK7A 1RZ3A 1V5WA 1XEXB 2XSZD 2MSCB 1KOFA 2ZRFA 2QM7A 1IOZA 2ZAOA 4C0LA 4DWJA 3DL0A 5FTLA 1HEIA 1A2BA 1ZNXA 1AQYA 3QQ5A 1VCIA 4E5UA 5DIFA 1G5RA 4BEJA 2A9KA 3CWQA 5DHAA 5LD2B 2IYWA 2A5FA 4FMDF 1NRJB 1E9EA 1P60A 3AF2A 4XWAA 4OKSA 1E9BA 4B3XA 2ZRIA 2QN6A 1W4CA 3AVOA 2JLZA 1R6BX 2B6HA 5BYKA 1AJEA 4M9XA 2FF7A 1KI3A 2WM9B 5JCPA 2D7DA 3IO5A 3EWSA 1XPRA 3THWA 3B5JA 5FOVA 1F2UB 3TRFA 4GZMA 1Q3HA 1G7TA 2XEXA 4M1YA 1Y3AA 1OF1A 1UPTA 2OESA 2QSZA 3FHCB 5FI0B 3TLXA 2ZAMA 2IYVA 721PA 3KKOA 2IS2A 3PUXA 1NIPA 1RKBA 3I61A 3CF0A 1P9NA 3FKSA 3G82C 3Q5EA 4M8NE 1R7RA 1YR6A 4PPFA 4N1AA 2R44A 1W47A 4JSTA 1KAGA 4TYNA 3BB4A 3BFKA 3PG5A 4X8OA 4BPBA 5FUXA 5AUNB 2VQSA 1NL3A 2CMKA 4XWKA 1M8PA 2QP9X 5JBQA 3KQLA 3HP1A 4EPWA 2CJWB 1E2QA 4OJKA 3UMFA 1DO2A 3CX8A 1IN4A 1KYIA 3QE0A 1FP6A 1YRBA 4ZI3A 3LX8A 2VF7A 3Q72A 4CYMA 2ERYA 2G0TA 4B33A 2GKSA 1GM5A 2QZ4A 1Q22A 2JLQA 3ASYA 2PH1A 3GJ7A 3ZYCA 4D4MA 1Q57A 4PAMA 1XNJA 5AJYA 3SOPA 4Q48A 1OHHA 3A4LA 2O0JA 3UKDA 4ON9A 3MWLA 2ANBA 4Q4AB 4JL8A 2PLRA 2RKOA 4RFVA 1EFCA 3G5UA 4R7ZA 2WMOB 4DSNA 3ZH9B 1G8GA 3ZD6A 1E1QD 1ZNWA 1CKEA 1ZC3A 2NGRA 3K09A 4DEXA 3NKVA 3QEJA 4LV6A 4QM7A 4PSAA 4PC7A 1GL7A 3GJXC 2Y8EA 2WVJA 3TSZA 2XOKD 4JVLA 4UNSA 1G4AE 2GAAA 5AUOB 4Q9KA 4FMBB 1CTQA 1Q1ZA 3O8DA 3SFZA 4EAQA 3PVSA 2W2VA 421PA 1XJQA 3AUXA 3GLFB 1ETUA 4RD3A 4B2IA 4B3BA 3RVBA 4ARZB 1EFTA 4G3XA 2FGJA 3K9GA 1XEXA 3EARA 4D4JA 4O2RA 1AQUA 1XTQA 4TLCA 1P73A 3I32A 3M0EA 1DAFA 1NVWQ 1T0HB 3ZIAA 2XXAB 1CJTC 1KAOA 1FP7A 2FWRA 1CR0A 1MABB 4V0ME 3W8NA 2FV8A 4TYQA 2CCKA 3B1XA 4OYHA 4ZDIA 2I4IA 3A58B 3U3MA 2YWHA 4TT3A 4NP6A 2L0XA 2QMOA 2GETA 2PX0A 3P20A 2W6ID 4JKIA 5BYJA 4ESVA 3O8CA 1N5LA 4XIGS 3OIYA 1SGWA 2OAP1 2HXSA 1CS4C 1F2UA 1VIYA 1GITA 3EZ6A 1Z3IX 2E87A 2ODNA 2D06A 3IBYA 4Q4HB 4R98A 4U7DA 4Q7JB 3H84A 5AWFC 5BXQC 4IJMA 2RH5A 3FKQA 4KITB 3DOEA 3OE7D 3ZVMA 4HB4A 3TAUA 4B43A 1Q0UA 4BE7B 4AG5A 1Z0JA 3SJAA 5CITA 4PQFA 4QOSA 4BUJA 1S96A 3U7EB 2QMEA 3CF6R 4LC0A 1CR2A 4B76A 3U6KA 3DO6A 4HZIA 2CJWA 2GCPA 2VP4A 2PZFA 4JJKA 2DBYA 5JRZA 2P6NA 3M1IA 3QPVA 3QSYA 2ATVA 1COWA 4RY2A 3PQCA 5DN6A 3V4FA 3EW9A 2A5YB 4JVMA 4HI0E 2DWQA 1X8JA 2RAPA 1XTSA 4P0TA 1WCV1 5G40A 2VP9A 621PA 2XZOA 2ZETA 1H8HA 5TVKA 5FFMA 4KV9A 4D4LA 1W1WA 4KVGA 2OLKA 1FFHA 3BJIC 4OI2A 4Q4AA 3VTKA 3I5YA 4X8HA 1E6CA 1VECA 3T1TA 1DS6A 4IFEA 4PQYA 1E2PA 1ZM2A 4XVRA 4Z1MD 1KI7A 1NIJA 1W5TA 1OYWA 3W5JA 4DLUA 3HPQA 3NVAA 4TYPA 3R7WB 1HE1C 2WICA 1VKJA 2IL1A 1XU4A 1K5DA 3KTAB 4DZZA 1P2SA 3WNCA 3IIMA 4NCKA 1GRRA 4RKFA 3NTUA 2X2FA 1Z47A 1SHKA 3T06B 5HR5A 3UMSA 4HLCA 4A0HA 2I1QA 3GEIA 1VG9B 2EW1A 3KB1A 1VPLA 2VF8A 4KSBA 1W0KA 5CJPA 1E96A 4ARZA 2CHVA 1XMVA 1IJEA 1YR9A 3DMNA 1P2TA 4MKHA 1W46A 4OQLA 3AVQA 2XXAA 2YZ2A 2GBLA 1S2MA 2IF2A 1MABA 2JJ2D 2XNDD 5SZJA 2EFGA 4MYCA 1QDEA 2J0SA 3D31A 3IBGA 2G1KA 4KI0A 2NPFA 4US0R 1AGPA 3B9PA 2V9PA 1SXJD 2Q9CA 2FG5A 2GF0A 2ZRBA 4M22A 4EDHA 4N3NA 5EP4A 1JI0A 2WSMA 3KXIA 5KDDA 1W44A 2FE4A 2FEOA 3BK7A 4MRSA 4G5GA 1GFIA 2R6AA 2WKRA 1OKKD 2GTPA 2QGZA 3F8TA 4C0SA 1RYHA 5BN4A 3A1WA 3C41J 3L82B 3W5IA 1O3YA 2CLDX 4Q4HA 2P3SA 4PZLA 1GNRA 5FPKA 1OXXK 1N6LA 3B85A 4WBSA 4ZIRB 3SHWA 2P65A 3B1VA 2V3CC 4CEHB 2Z83A 1C4OA 1D8TA 1I2DA 2ZSEA 1JR3E 3KJHA 1B0UA 4ERNA 4KBFA 2NO6A 1OFTA 1D5CA 4R2HA 1R8SA 1VIAA 1ZCAA 4EQ6B 5FL7D 1G5PA 3C4JA 1CBUA 1VG1A 1D9XA 1KK1A 1JXOA 1E4YA 4A8JC 5CLLA 1E3MA 1F48A 5EUQB 4PXAA 2OFOA 1K8RA 1DVRA 1BH2A 2V7QD 3TR0A 3OEED 2VIIA 1GNQA 1CJUC 2KSQA 4PSVA 4A4DA 4MDEA 3QXXA 2QMUA 5CIWA 1P7CA 4F93B 3T1QA 2ECKA 3RS2A 5KPJA 4C0JA 3WYGA 5IRCD 1NF3A 5EXTA 3WNDA 2BJVA 2TMKA 2ZJ5A 2F1IA 2J7KA 2UKDA 3CPHA 3QF7A 4PC1A 2DPXA 5D3MA 2ZEJA 1AA9A 4KXFB 3QBVA 1BIFA 1Z83A 2D2FA 4M21A 2XNSA 4YQFA 1H8EA 3NBZC 3T1VA 4KFUA 1P9RA 1WE2A 4CVNA 1MO3A 4LV5B 3QXJA 4D82A 4Q00A 3EIEA 2R2AA 3PEWA 3Q3JB 5L3RA 1E2EA 1T8UA 3I1FA 3EZFA 3EC2A 4RD2A 3AKDA 1US8A 3KTAA 5FUYA 2BM0A 3K9NA 3P32A 2J5XA 3PUYA 4FXPA 1ZM4A 2C5LA 1IY2A 5FBQB 3VR6A 2IXGA 4M9ZA 3WY9A 1TTTA 4C0KA 1G8YA 1O87A 2ZI6A 4Q1DA 3QEOA 5GJCA 4TL6A 4FD2A 4OBEA 2RGXA 3EWAA 3QBTA 1S9HA 4JLDA 1U0JA 1BKDR 2GILA 2J45A 1MV5A 3T15A 3H4MA 2G88A 3A37A 5CM8B 4JMPA 1ZIPA 1DARA 2ZVPX 3NHBA 1ZMXA 2OCBA 1JQLB 2ZVQX 4KFRA 5CK5A 4HEJA 1R2QA 1Z08A 3QOFA 3K0AB 5FUVA 3CRW1 2AL7A 3LH5A 4F91B 1AM4D 1EK0A 1E2LA 2MMCA 2R6DA 2ZUDA 1XEWX 1EFUA 3A4MA 1OE0A 1P72A 3QG5A 3CO5A 2LKDA 2PT5A 3GQBA 2AD5A 4UKDA 1ZM3A 5IK2D 1QHGA 4GZLA 5CJ2A 5AJVB 2J0QA 5KHOC 1DADA 5HTKA 4AKIA 2BC9A 2OV2A 4A2PA 4PSKA 2ZU6A 1NBMA 2JASA 4DDVA 3AVTA 1F6BA 1MR3F 1KMHB 2PMKA 4YMWA 5DE3A 1S3GA 4ZIRA 2IYYA 3I3SR 5TDHA 4RZ2A 3OEHA 3T5GA 2N46A 4LC1A 1MRSA 3ASZA 3ZVLA 4HLDA 1KDTA 5KPDA 1OYYA 2ZRMA 2XAUA 3PCRB 4EQ6A 2A5GA 3WRYC 3U6BA 3EZ9A 3DZDA 3KQUA 2OUKA 1WBBA 2A78A 2ZIAA 3PIRA 1FOEB 2VHCA 3B82A 1GKIA 1W4RA 2IC5A 4RZ3A 2IWHA 1R5BA 2ASEA 2QE7A 2AHOA 2PJZA 5P21A 3ZQJA 3NEYA 4HDOB 2BCJQ 3CZQA 4K46A 3SHFA 3PUZA 5CK4A 5KYKA 2V8OA 4W9MC 2ZI9A 1XTKA 3ADKA 4TQ9A 2RHMA 4F92B 4WZ6A 3IPYA 2BOVA 2JJ1A 4LYFA 4DSUA 5L8VA 1I4LD 2FN4A 4LOAA 4A1FA 3NH9A 2ZE7A 3AKEA 1DO0A 5FBLB 1LF5A 3N70A 1YR8A 2WWWA 4POAA 2GXSA 3K70B 1TU4A 1YZNA 3K0CA 2IS1A 1KI1A 3KQHA 4DCVA 4ASUA 4B34A 1G8HA 1YQTA 2ZSAA 5DHFA 3PEYA 2QA5A 2FMXA 1WDTA 2XZLA 2ZRNA 1Q21A 1SVIA 4HB0A 1BYIA 4YXWA 2GCOA 3U5ZB 3R9XA 2VH5R 1CF4A 3TAHA 2RGDA 4DB4A 3LA6A 3NBXX 4TSFA 2O8CB 1DEKA 4HZUB 4CEJB 1G4UR 2H5EA 1E94E 4RJLA 1OIXA 1VG8A 2N42A 1G1MA 4DRZA 3CH5A 4IDNA 3G0HA 4GSYA 1JAIA 2P5TB 5AK0A 1TMKA 2WJIA 3CKLA 3EC1A 4BFVA 4XSHA 5FPHA 2HT6A 4NL4H 1CU1A 3UMRA 3MWKA 2KWIA 4DLRA 1LW7A 3KL4A 4LHXA 1FMJA 3K0AA 5HKKD 3LQQA 3KKMA 4C9BA 4W5JA 1L4UA 4Q03A 4ZKDA 1R0WA 1AZTA 3EA0A 3B6EA 3GLIB 3TQFA 4PFSA 2QP3A 2VHTA 2F9MA 4JSYA 5EP3A 2FZLA 1N6OA 1YZGA 3E1SA 1HH4A 2EWWA 5JHHB 2CVHA 2NO1A 3V00A 4ZO4A 4MKIA 3ZD7A 3FKSD 4R2IA 4M1MA 4R9UC 4Q7KA 5LD2C 1KMHA 1N3BA 1WA5A 2CE2X 4QRHA 4URVR 2FOLA 2W58A 4UNRA 2ZREA 1NY6A 1OXSC 2IYQA 2R8RA 5TARA 2K5UA 2HT1A 4AK9A 4V0MA 2QQ0A 2OBMA 4Q9HA 1KNXA 2A3RA 3PXGA 4CW7A 4C2TA 4NONA 1Z0FA 1TQ6A 3LXXA 3QVUA 1S3SA 1W0JA 3E70C 4KYUA 5G3YA 1II9A 5DYGA 4BFYA 2O8FB 2AX4A 1CRQA 2E1RA 3BH7A 3A8TA 3HU3A 1OPXA 3QKTA 1E0JA 5JS7A 1II8B 4IXNA 4D0LB 5KSYA 3GPLA 3GJ6A 4C0AC 1E2IA 1OHHD 3FE2A 1KO8A 4ZDWA 4PHGA 2VP5A 2WJVA 4IHQA 4D6PA 5E4FA 3IQXA 2GVDC 1E98A 1DG1G 1M74A 1E32A 3EXAA 3JZAA 3LQRA 4IVRA 2IUUA 1FZQA 1YZLA 2EYQA 3IGFA 1LTQA 1S9DA 1GIAA 3GJ0A 4BQSA 4QBFA 3R20A 1CIPA 3WXMA 4BWYA 5IF9A 4IVPA 1WF3A 2GJSA 1XMSA 2R62A 3PUWA 1T6NA 3EAQA 4Q1BA 3GD7A 4AG6A 5B58C 3T61A 5G3ZA 3TW8B 3IEVA 2YKGA 2CXXA 4URYR 3CNNA 3VR2A 3DKPA 4PPNA 1XFAA 2Z4RA 3DHWC 4IDHA 3I62A 2VYFA 1DELA 1D2EA 2GA8A 2BEJA 3UWOA 1YZQA 4MH0R 4M9SA 2V6IA 4TMZA 3R9IA 3NH6A 2QTFA 1GOTA 4W5HA 3R8CA 3ZIAD 4JT2A 1XJCA 4JZKA 3W34A 2GJ8A 4H1UA 2D62A 1XXHE 2O8CA 1NNEA 1M2OB 4CEJA 4Q19A 3LVQE 5FPSA 1KK3A 3UPUA 4LGMA 1QHYA 3CR7A 1NVVQ 1DTSA 4N0EA 4TT3D 2QEQA 5EQTA 2ODEA 4UXIA 5CYPA 1EESA 1D2NA 3U3JA 3T34A 3K1JA 2I1VB 2BMDA 2FFHA 3HYRA 3B13B 3ZS9A 3AVVA 4K81B 4RZUA 1VYTA 3EPLA 1GSIA 3I92A 4LUCA 1OFIA 2B7CA 1CXZA 1G3MA 3VMFA 1MRNA 2EFHB 2XB4A 4AI6A 5EJEA 2OM2A 3M4YA 3BORA 2ZRDA 2HCBA 3GLIA 5HZKA 2DB3A 5JJKA 2CDNA 3QXHA 2WV9A 4LDJA 3BIFA 4NYIR 2H7VA 1XMIA 4PHFA 1RW4A 1OH7A 4RCYA 4DLYA 3EPKA 1IM2A 3FMPB 3FYHA 2FA9A 5F2EA 3LBHA 3K8YA 4G5QA 4QC2A 1VG0B 4Q9IA 4B75A 2GBLC 1CJKC 3FMFA 3CF2A 4L8GA 4DCNA 1N25A 2YNMA 1P62B 3TNFA 3B60A 2R6CA 5SZKB 1TADA 3O8RA 2YOGA 1IHUA 4KODA 1NN0A 4JLAA 4OL0A 4L4UA 2FDCA 1Z5ZA 5FTMA 4C0HA 4AKGA 1II0A 1FQKA 5DLQC 2DYKA 2RGNA 3VHXA 2CCGA 1HQYE 3CR8A 1J7KA 1FQJA 3BD9A 1COWD 2BWJA 4G5OA 4D2IA 1JNYA 5DN6D 2GXQA 2O8FA 3FHTA 5JLJA 3FFBA 3MAAC 2WWXA 4KAXA 2Q0HA 3ZS8A 1II8A 2NPIA 5BN3A 2ZR0A 3SS8A 2BEKA 1H8HD 1W4AA 2D2EA 4AD8A 2G6BA 3S1AB 3ZZUA 3ADCA 3SFVA 1ZINA 3T35A 3FOZA 4DCUA 2AWNA 4QM6A 3H2YA 4LI0A 1A2KC 1N6NA 2IYXA 1IXSB 2YWEA 4TMKA 1CEEA 2WSSD 1G21E 4LBWA 1KJWA 3JZMA 3TSWA 4OHVA 1JR3A 3UWKA 1P4SA 2CE7A 4PQRA 3DM5A 2P67A 4OI1A 3W8RA 5C18A 1Z0IA 2XB2A 5A5GA 2CLCX 2NZJA 2R65A 2CHGA 1NN3A 4MRNA 3X1ZA 4F4IA 2C99A 4RD0A 4AYTA 4B3CA 1OFUX 4Z8XA 1JB1A 3CRVA 1Z2AA 2J7PA 4LJYA 1SXJE 3A36A 3AGPA 3O8BA 4JLKA 2VPPA 1W0KD 1X86B 1ZUHA 2OBNA 2ZSDA 4IEIA 1W2HA 4P32A 4II7A 1KZ7B 4FWTA 3RC3A 1ZUNB 4MUAA 4HAXA 5LBIA 1JBKA 4Y0AA 1IN7A 1UKEA 5A0FA 2KBEA 4FMCF 5H8WA 3HWSA 4IDOA 1GVNB 1NLYA 4NCIA 1OFHA 1GG2A 2XJ9A 4KFTA 3MCAA 3T5DA 4IXMA 4QHSA 2VP0A 4L15A 3W6OA 1RFLA 1U90A 4NCHA 2HLDA 4KVAA 1OH8A 1LNZA 4G5RA 4UJ3A 3GEEA 2D74A 3N5CA 4W5WA 2ZUCA 3U44B 3GJ3A 1Z63A 2QY9A 4QBGB 3QKUA 3PV0A 4A0FA 2WWYA 4DKXA 5CM9C 3WBJA 2ZR9A 2WWFA 1Q44A 3LO5A 5CIQA 3REGA 3GJ8A 3AH8A 2OE2A 2OLJA 1KDRA 1ZW6A 1IQPA 2W00A 4BFTA 1NVUQ 1NVVR 2B7BA 3IEUA 4HDQB 1NN5A 1E9AA 1VHLA 3CWZA 1IONA 3OF5A 3KFXA 2NO0A 2PBRA 4WIAA 4MUBA 3CPEA 4TQUS 3EIHA 3QNUA 4WA7A 1B23P 3Q7QA 5CLQA 4P31A 4O25A 3CRRA 1U9IA 2ZJ8A 4MGZR 4TZ0A 2KE5A 4ACAA 5JMTA 4RFSB 3QPUA 2Z43A 4MQBA 4ACBA 3A1UA 1IXRC 1W49A 3ZDQA 3ZZ0A 2GHIA 2WTUA 3W9YA 4HUQB 4PZYA 1OH5A 1P2VA 4QHTA 1NY5A 5JWRA 1ZD1A 2ZUBA 4EPRA 5GVRA 4V03A 3GLGE 2C78A 2WWHA 2LKCA 4S2EA 1OW3B 2IHYA 4HATA 2R6GA 1NMYA 1HT2E 2GAOA 4Q1FA 5EZ6B 3S1AA 1H8ED 3SE0A 1W2GA 3VHLB 3ZZTA 5JFGA 2OHFA 4DT1B 1EWRA 4E09A 2ZS8A 2DWOA 4LJAA 2GF9A 1D6JA 4AIIA 3GFOA 2AD1A 3PENA 2AK2A 2N1BA 5D3QA 1G3UA 3P27A 4AYXA 2ZXUA 1X8KA 4QJ5A 2QRZA 2Z6VA 4NCJA 3WRXC 1KY3A 3A1TA 1OLOA 2QT0A 2ZJBA 1TEXA 1KMQA 1ZM9A 2JATA 2ZROA 1M6NA 1VCOA 4YONB 4Q9LA 1NMXA 3CBQA 3DVLA 5IT5A 4WW0A 4Q47A 5UKDA 2QBYB 2WAYA 5FL3A 2F3TA 1XF9A 4M4SA 1RJ9B 1SHZA 4I99A 4JLVA 3K0CC 4Q4JB 3W6NA 4C2UA 3L8ZA 1PV4A 4G5SA 1ANKA 2C9OA 2ZTSA 5GVSA 2OFXA 3SN6A 1AZSC 1IAQA 1U0LA 3Q85A 2PZGA 2RGCA 4BEBA 4UXJA 2NG1A 1E69A 5G41A 1E4VA 3SZRA 4B35A 3I8XA 4WAUA 2CCJA 1E99A 1E1RA 1JALA 3U3OA 3NWJA 5FOWA 4GOJA 3RYTC 1QF9A 4NTZA 1XDBA 4P4TA 3U44A 4M2LA 2BVNA 2WHXA 1L8QA 2RGGA 2PL3A 2JIZA 3K0EA 2FPLA 3QUSA 1YJ5A 1NBMD 2IYZA 2XITA 2YV5A 1VDZA 2VBCA 3CNLA 3MLEA 2BMEA 4TL8A 4URZR 5EZ5A 3WHLA 2IYTA 2ONJA 4NZYA 5KDLA 2C95A 1NG9A 5J4KA 4IOKA 2I3BA 5B30A 5KSPA 1VCNA 3OEHD 1X1SA 2FH5B 2WPDA 2W83A 3RRNA 5E95A 1KZGB 3SJCA 2J9RA 1Z29A 4QBIA 3GLFA 1EWQA 3RABA 1M1YE 1HUQA 2V4ZA 3K0FB 5FOXA 2G9NA 5DNYB 4A36A 1TQ4A 2VA8A 1F3OA 4C7OB 1XBTA 1ZP6A 2OXRA 4UXHA 4OI0A 2ZS9A 2QL6A 2IEYA 4HAWA 1J8YF 4RFSA 2QE7D 3UXMA 2RGBA 1XPOA 4OQFA 2Q3FA 1T3SA 1TUIA 1SULA 2CNWA 1A82A 1HY3A 4HUQA 4OK6A 4AWXA 3MG9A 5LB2A 2JJ1D 821PA 4HAVA 1DBSA 4EJSB 1BMFD 5E7MA 4DVGA 2ZE5A 2X77A 3VKGA 2KB0A 2GWHA 3UG7A 1XTRA 3CH4B 1XPUA 3NIBA 1IN8A 2HDNB 2RGAA 4FMDB 1R0ZA 2V55B 4ASUD 4DT1A 1FNNA 3D3QA 1E0SA 3KXKA 1G19A 2JDIA 3MFYA 3IDQA 3B1ZA 4RVCA 1TF5A 5DSZA 3SBEA 5B2ZA 1KO1A 3A1SA 4JS0A 1PZNA 1YVDA 4GNKA 5BW8A 2KJQA 4YXWD 1PVOA 1AN0A 3THXB 3KQKA 1VYVA 2AKYA 3CONA 3L0IB 4TSFD 5TMPA 4FN5A 4IVQA 2IUSA 1EXMA 3QXSA 4HUTA 4QJ4A 4GPTA 4GP6A 1YE8A 2WJHA 4TLAA 2YJTD 3A4NA 5SZIA 1EGAA 1NI3A 2ZITA 2QBYA 2UVQA 3AP2A 2Q3MA 1MO5A 2ZU0C 3LLMA 5KOYA 5FTJA 4UNNA 2HJGA 3K70C 1D9ZA 1RJ9A 4Q4JA 3P4XA 3BFXA 5JZVA 2QAGB 3DMDA 1AGRA 4FCTA 3NDBB 4RKEA 5DI9A 3U4QB 4JYBA 3BAFA 1S8FA 1Z8FA 1UKZA 4YLGA 2VHUA 2GCNA 1ZNZA 2WWIA 1T8TA 2ZJOA 4OHXA 2FZ4A 2BKEA 1YRAA 5GJVC 1GAJA 3CX7A 3L0PA 2C77A 2BBOA 4U00A 2GNOA 4URUR 3RRMA 2P6UA 2DR3A 2GDJA 1NLZA 2C03A 3NHAA 3BH0A 4HDCA 4FWIB 1TPZA 3R7WA 1PLLA 3LBIA 4L9SA 2VEDA 3N2IA 3LLUA 4NYJQ 5AUQA 4HSEA 4BLOA 2WIBA 3OFNA 4GMXA 4C30A 2A30A 2ZRLA 3I72A 3RRZA 3VAAA 5B64A 4ZV4A 3RHFA 5ANRB 2J3EA 2A7QA 2HV8A 1YR7A 1RRCA 3VU9B 3BH6A 3K0FA 2QNRA 1W0JD 4BFUA 4TL9A 1DPFA 2REXB 1SZPA 4C7OA 5F3WB 2J46A 4M9QA 3KDSE 3W3ZB 1KDOA 2ZRAA 4AKHA 3SQXA 2J0UB 1UKYA 5J47A 5K8IA 4CGZA 3WYFA 4I1VA 5FTNA 2X8AA 4S35A 2WKPA 4D0NA 2AWOA 3MMPA 1TU3A 4JIMA 3SNHA 4DCSA 2ZSBA 2ORIA 3QVVA 4TWZA 3RS7A 1NKSA 4EJSA 1N0WA 1XZQA 1HURA 4QHYA 1JPJA 1UJ2A 2CBZA 4YMVA 4Q18A 1P61B 4I1UA 4DC9A 2ZYTX 5K8TA 3K70D 4GDFA 4BLSA 1EFHA 3FGNA 4XOIA 1JECA 1M7GA 2VP6A 1I4TD 2WJJA 3A1VA 1QHSA 2RGNC 4DLSA 3MWJA 1ZC4A 2JCSA 4JL6A 1EG7A 2IA5A 2NO7A 4EIWA 2F43B 3IIJA 5HZHA 4CEHA 1NP6A 2NZ8A 2OILA 1ZYUA 2ODBA 3QI2A 2HF8A 4AYWA 5L3SB 3I4LA 5KSOA 1GP2A 1I2MA 4BFWA 4Z51A 2GXUA 1FW6A 2IEZA 4UNQA 4M1TA 1ZRHA 2OBLA 4QFMA 3THXA 4E22A 2WJGA 5J4HA 3AEZA 2PEZA 3GLHE 3L0OA 5J5CA 1CR4A 4ZCIA 2GVZC 4LRWA 2OO7A 4I81A 4HAZA 3VNVA 1JXMA 5JCZA 1V43A 4LYHA 5EUMA 2BBSA 2CHQA 2IS6A 4KYIB 3CX6A 4B2LA 4KSCA 3QY0A 1OH6A 3RSOA 4LHVA 3ETLA 2E9SA 2AXPA 3MWYW 3K0SA 1VMAA 4BLPA 1A5TA 2JEOA 3Q5DA 2QQEA 3KKNA 1XX6A 2GEVA 2QAGA 3K9HA 1Q12A 2XJ4A 4RCZA 5KTYA 4LJ6A 2LWIA 4MRPA 3U4QA 1KSJA 6Q21A 1MO4A 1WB9A 3FMOB 1QG4A 2H17A 1UF9A 3IKJA 1KI4A 2H16A 4BRUA 4WXPA 1KI9A 1LFDB 1LVGA 1Q3TA 4XD7A 4UQOA 4BGDA 4PTLA 1E9CA 1ZM7A 1RRPA 3ICQB 1OV4A 2FX3A 1E79A 2PMDA 3V4RA 2CK3A 3WMFA 4B71A 4BECA 4LZZA 4KU4A 3CM0A 1XEWY 2W2TA 4OJQA 3IILA 2HEIA 3EASA 3ZVNA 3FVQA 5K8UA 1TF2A 3NEJA 1HV8A 4DXAA 5AJXA 5G53C 4UJ5A 3BBPA 4NYIQ 4RD4A 4B2PA 4PAQA 4IW3B 1ZD8A
chains in the Genus database with same CATH superfamily
5AVOA 4QUKA 1JG7A 2LCFA 4I55B 1RHUA 2GPAA 4MUIA 4BLTA 4DMUB 1PLJA 1XTJA 1R6TA 3LUCA 4GBJA 1V8PA 1QWSA 3BB1A 4ZVLA 2DFTA 4H3HB 2ZCJA 13PKA 1U0EA 3AVWA 4HLUC 3HCNA 3IO3A 3OLQA 4LOLA 1TUBA 2GN2A 3M6WA 4KMOA 4BTVA 5A4AA 5JS6A 1SAYA 2WI8A 2X1VA 3L04A 4LV8B 4UULA 4E31A 4B1FA 4JJZA 1P9WA 2DFVA 5DYIA 4U9UA 3OFKA 5D3KA 4ZAGA 1SWVA 1PJRA 3FCXA 4X61A 7ABPA 1GEEA 4NYJR 2ZPTX 3W9SA 4PINA 1KIMA 1BQ4A 2EIXA 1UODA 1FXWA 2NXNA 5EL0A 1Y1KE 2UXBB 1U1FA 2I8AA 1SC4A 3LXRA 3O4IA 3SSOA 3VR5A 2Q7DA 1U3GA 2YWFA 2B0CA 1EBFA 1UBCA 1UPAA 2BR5A 4L78A 4OFWA 2J4DA 4TYWA 4HAIA 2EKLA 2QT9A 4BVAA 4N49A 1TO2E 5LKAA 3IIKA 2BGMA 5LOVA 4EKGA 1VM6A 4MGIR 1OVGA 4OXNA 2PGLA 5A0TA 5EXPA 4JROA 5AQ1A 2ATCA 2DUUA 3ICWA 4S0ZA 4XUDA 2B36A 2HQBA 2WW8A 3A9WA 5CGZA 3T7AA 4BAGA 3G1WA 4WOPA 3UK6A 5E9AA 2GHTA 1L5QA 4UBOA 4FGUA 1U7XA 4Y6SA 5EKDA 2FNAA 1FPMA 1TM7E 3HACA 2Q4DA 1YRWA 3IMFA 4H7PA 1N0IA 4HDNA 4BLQA 1PFYA 4TWBA 1OAAA 1GPNA 5ED4A 2O2YA 2K7FA 2A0FA 1O57A 1XZFA 4LZJA 4TZKA 2FFAA 3THRA 3WHPA 3EMDA 4IL5A 2G67A 1V1RA 4YRDA 5FWAA 3C4QA 1N2BA 5KQRA 5T8KA 4KMMA 2FYTA 3I2HA 2WF7A 5ILOA 2HU8A 4KN5A 3HJNA 5CVVA 4F46A 3WYBA 4NNPA 3ZLTA 4OUDA 4GICA 1QE0A 1PR5A 3CXRA 3VOAA 2O8BB 4B5LA 2CF5A 1EM6A 2HLDD 1ZO8A 3PGMA 4V2UA 3OSZA 5BVHA 1DBVO 5EZQA 2IPXA 3K53A 5B1IA 3WP0A 4D3SA 3ENWA 4BRWA 3IERA 1PI3A 2F3UA 3FNFA 4MROA 4R68A 2YIVX 4XTCS 4D1YA 4RH0A 2FPUA 5AJUA 3WLEA 3PF8A 1T8YA 5TMDA 5LM3A 4RXUA 4RJTA 3NOXA 3WBKA 4KV7A 4D9MA 1T35A 2IUTA 3E9EA 4U5QA 4L1KA 2JB9A 4YDRA 3BCSA 1XYVA 2C2MA 3C5WP 5DWVA 1GLVA 5BYAA 4Z8YA 5FR1A 4R9NA 3SU8A 3X2EA 2QN8A 1IXZA 3QKWA 4JNCA 3O4JA 5GQSA 4M0CA 4RE5A 3OZIA 4TGLA 3DOOA 3QFTA 1DMSA 1AVTA 1GZ7A 1LBIA 1TU0A 2HBYA 4KN9S 3Q87B 5KWEA 4KPUA 4QNMA 1GEGA 2DHDA 1NW4A 2PIDA 2V9CA 3DHNA 1SB9A 2WG0A 3K2IA 3KSRA 3KV1A 5KYXA 4LXUA 2AKEA 4LOKA 4ND2A 4ZCSA 1E2DA 5AH0A 4A82A 2VDLB 3AGQA 4Q3LA 5LJLA 2JLUA 3E7WA 1E2KA 2P69A 2RG1A 2JH8A 2GEKA 3QEMA 3TIIA 9MHTA 1IC6A 2INGX 6REQB 1GCUA 1WZEA 3G85A 4L9WA 4X1YA 3ZV5A 3LPCA 1Y1TA 1CQWA 2IYUA 1QX4A 2IYOA 2D2IA 3OJLA 4KWEA 2Q8NA 1EEHA 2ZJ6A 3DPIA 4YASA 3KR9A 4DIDA 1MC5A 1AS3A 1D4FA 2JVKA 2BFCA 4AP6A 5GIPE 3VKHA 2EQ5A 3NT5A 4URWR 3WGNA 3OJFA 4IJQA 2FW6A 1Q0QA 2YFKA 3L2OB 3WKDA 3W6PA 4YJGA 5FPYA 5I4IA 5F51A 5IMSA 3WL6A 2O6LA 5D6OA 2CV2A 1VCMA 1W52X 4I3GA 3UH0A 3ECSA 3TDNA 1DWPA 5EYPA 2AHRA 4J6EA 121PA 3MHPA 4XX0B 4K0KB 3VGJA 1N77A 1P3DA 2ICAA 3LHIA 1A8UA 4HYTA 4OHOA 3WGIA 3IULA 3T94A 2OD7A 2TMYA 1LC3A 1OA0A 5KNBA 1Z22A 1UBLS 3H5OA 1QS0B 5EWMB 1RS0A 1UEXC 5H3CA 3RFTA 3VU1A 5ADHA 2QVBA 4PTYA 3ZOZA 5ELXA 1NJ6A 4PAOA 4DA7A 3NI2A 4WBNF 3GRPA 2I6FA 3FPSA 4TQAA 4BMOB 1RYFA 4F2DA 1VA4A 3TIFA 3KYDA 3UJ9A 2CVZA 3BFPA 4DIBA 3U60B 1DQSA 3S2FA 3TM5A 1M1YA 3G23A 1LRLA 4WXYB 1KP2A 1XT6A 4LMAA 2JZCA 2X6QA 2XQIA 2HHAA 2FJ0A 1VLHA 4XSVA 4DA8A 4P5PA 4H08A 3LOUA 4ZJZA 1WMFA 4LAFA 4RC9A 1JYFA 3BQMB 1UR5A 4TL7A 2C07A 3BDVA 3UT5B 1CDZA 1XB2A 2W6JA 3ZCVA 1GRNA 5BWNA 3MAGA 2C1XA 4QL3A 3HFSA 2BV3A 4P4UA 1O4WA 2PD6A 1P75A 2V9ZA 2ST1A 3D4BA 3EA5A 5HW0A 3E1KA 3MIZA 3UYKA 1KZ4A 3K3PA 4A27A 3K05A 1IBKB 3JD0A 1JDZA 2L69A 1XA3A 2WD7B 4QUEA 5T57A 2BT4A 4KXWA 4GI2A 1V37A 3PU6A 2FPIA 1T43A 4QPPA 3L18A 10MHA 3OOSA 5FLYA 3IP6A 4E1AA 1H22A 2IU4A 3UJAA 2JAOA 2FP4B 3K0KA 3V48A 1N34B 4UATA 2GB4A 2I3AA 3FFTA 1HDIA 1AXEA 3EY9A 3FTCA 3G2HA 3MUNA 4JLMA 5E7JA 3UXYA 1G8JA 3BGWA 1U8YA 1PFWA 3DEIA 1PR9A 3E53A 2XUGA 4GLJA 3NHMA 4QGAA 2YINC 3PR3A 4M54A 1GZUA 4NJEB 2YMQA 3RFXA 2N3ZA 1SBQA 4MI9A 4KDRA 1L5OA 1ZU5A 1E1CA 5JD5A 3PHJA 1KRXA 2EU8A 1SHUX 4H7KA 2DGDA 3QPWA 4QG7A 4NYMR 2Q1WA 2WU8A 1EMDA 2WC1A 4PZEA 5HS6A 2NZWA 2OAQ1 5HKKA 3N7UA 3RTDA 5E6RB 2JFBA 3UVEA 3GWZA 3KHKA 3LGAA 5JWHA 5KTSA 1GFSA 2EVWX 3AQ4A 3IEKA 1ODIA 5BYBA 3OH8A 2AZXA 1ZQ9A 2I6GA 4QPZA 2FAXA 3IOBA 2VZ9A 3KB2A 3VO8A 1I7PA 2FEXA 4PPQA 4ZYZA 4MINA 5JAPA 5AW8A 2VAVA 2C5GA 1LSUA 2PXAA 3ANNA 2HWXA 1YHYA 2WBLC 3RARA 2P7HA 3NYRA 4UNPA 2PZBA 1ZHFA 2CNWD 2WUFA 3ZD8A 2XB8A 2B0JA 5H81A 2RI0A 1MF7A 4KCGA 5AW9A 4Y2RA 1M6HA 4AC9A 1A77A 1DXQA 4GG1A 3B7PA 4OQPA 2R5WA 5KQSA 1TEVA 1XTBA 5LBTA 1RAIA 1R5NA 2JFYA 2EWVA 1CUSA 4I6EA 4ODIA 4NE2A 5JAMA 1AKWA 1IBRA 1SG6A 2IYAA 3AEKA 3ZG6A 3LX4A 4EPVA 4EYGA 1XHEA 4TKUA 1V48A 4PBSA 3TNJA 3D8SA 1GG8A 5K51A 3LKVA 3REFA 2ZOSA 4NZ9A 5AI8A 4J7CA 1U7PA 3M1LA 3TKLA 3DLTA 1E61A 4PO9A 5IARA 2UYQA 4HNQA 4J0EA 5TEVA 3PCXA 4UTRA 1YQDA 3AB3A 4E5VA 3MNFA 4JVOA 1DFHA 3JQBC 1I7NA 1JZSA 3UAGA 2DHRA 3VHQA 2YJZA 1EKXA 5FR2A 2CYCA 3GEDA 4L73A 2M6KA 5AKXA 1L5ZA 3I05A 3VR1A 2FJUA 4KQ9A 5B3LA 4UHBA 1P6XA 1NMEA 1PGQA 2BFWA 3LQFA 1S5PA 4K9DA 4M0LA 3ZW7A 4OHRA 1T26A 2BDUA 3BHJA 5CA0A 1VBNA 2REBA 4F84A 4LYJA 4MUMA 3RUFA 4U5XA 3RUDA 1LS1A 4A9AA 3FFAA 3ZV4A 1E18A 2G1PA 5AW1A 3P9ZA 4J1NA 1OUMA 2XE7A 3OTOB 2FX2A 3UMFA 1JB9A 3G2LA 4BL5A 1BN6A 2Q0SA 4LZNA 1S8NA 3VZPA 2QG4A 3A06A 1PDVA 1ELOA 3L7CA 4Q1CA 1N5IA 1NI4A 1U4OA 2P27A 2ZM5A 4DCGA 1SQ5A 1T0IA 3DTVB 3FFXA 3R0ZA 5SZHB 1KY4A 2NU9A 2V6FA 3JTEA 1RWKA 2WRZA 1V16A 4RZIA 3F6RA 4G4GA 3QBJA 3PJGA 4PPYA 3MT9A 3O38A 3OCZA 1XL1A 3AUTA 3SG0A 4H1HA 4M8SA 4BNGA 5JQWA 3IQIX 1EX7A 1XWFA 3CEMA 1FFEA 1L5HB 1NT4A 5IUNC 5JJCA 1E3LA 1ODLA 3KELA 1TL7C 3AI3A 3PRKE 2AR0A 3HWRA 2GZSA 1L7PA 3ENZA 3NHLA 1AS0A 3DGEC 5IH3A 2Z58A 1TVKB 4PSUA 2VA9A 4BGEA 2E49A 1LPSA 3NTQA 3FYUC 1G7SA 5E7QA 3A6ZA 3FVWA 3IUPA 4XDGA 3SVZA 1FX1A 4PWZA 1Q15A 2ZIGA 2OFWA 4B3MB 1J8FA 1W85B 2HA0A 3ANSA 2Y1WA 4XXHA 3WDSA 5CYGA 2XTMA 2QUKA 3JD3A 4YK7A 4J6FA 4LDPA 1CQZA 2FPGB 4FR0A 4FS8A 4NU5A 3SIWA 1BDMA 2X15A 4FLFA 3BXFA 1E7QA 4NDZA 4PR0A 4BJHB 4GOXA 4QZVA 4J0QA 4UQPA 3UAYA 5DNWA 1W29A 4IINA 4D8YA 2EZUA 3PR2B 1RMTA 1WZUA 2QAGC 1Y8QA 4EJ0A 5CXUA 4AJEA 4X8MA 1DJMA 1BFKA 2PS0A 3PNMA 1SBNE 4L08A 1Y1QA 2YY7A 4BJ3A 3HJTA 4G1MB 2OHGA 2E37A 4PYOA 1NMZA 3B8HA 3PDWA 3QG1A 3KLBA 2ZRGA 1GYRA 2EJWA 4G0OA 5LA6B 3SC4A 5CFRA 3ZY5A 4XLZA 3MJVA 4RPGA 1RI4A 2GZDA 3LFUA 4KX5A 3EZ7A 2D1FA 5ECWA 3NS7A 3VR4H 4BZQA 1UBTS 1TRKA 2JHCA 4JQYA 3ZUPA 4EPYA 4F2WA 2G3YA 1D2MA 4UCQA 4RADA 4KNYA 1OB5A 1J8VA 4CR8A 4HADA 4JD5A 3PDUA 4ZZIA 5HPYB 3KP1A 3G2JA 3A6FA 2HIHA 2E55A 5C5DA 4Y6GB 3P19A 3FUXA 4G9BA 4Y0NA 4OLAA 3DEJA 2J9XB 1V3QE 5D3MB 1MH1A 3MTQA 1KFJB 1QTRA 4CFZA 1T3LA 1GPDG 2RJOA 4I4TA 4HDAA 2UUCB 1A4RA 3WLIA 1GNTA 4JELA 1XXHB 3JQAB 3MCWA 2VDWA 5KNCH 3FLBA 4FGJA 4F3TA 4LYAA 1T5LA 1FL9A 4CM1A 4DILA 4F4HA 4B6QA 4UM7A 4YMHA 3GRKA 1VHJA 2VQFB 2X86A 2X9GA 3K35A 2Q2VA 1U7TA 3SQWA 1UJNA 4X6XA 1QIHA 3KSZO 3DA8A 2PT7A 3JVDA 3U9TA 2PNFA 3TW4A 4DBZA 1QQ7A 2WZQA 3CB4A 5F1OA 4LBYA 3KJEA 3JWEA 1VTKA 3GLIE 4O2AB 2XUIA 4RY9A 4K6KA 3QX8A 2Z4SA 1VLLA 2ZIXB 3BTVA 1L3IA 1CULC 3F74A 3QELB 3F49S 3O83A 4X6LA 1LZKA 4JI3B 5HRUA 2FLVA 1KI8A 5E2IA 1KTVA 2FQ1A 3O9MA 1U98A 3Q12A 4ZRDA 4XJXA 2WD9A 2XMPA 4NDAA 2JPDA 3FDXA 5H9VA 3LC2O 1DBPA 3I2FA 3CO0S 1ODJA 3ETHA 2IYPA 3RUEA 2JRLA 4GUDA 4UTPA 4W7HA 2BFDA 4KQ1A 4OQMA 3ITDA 4I5EA 4PLPA 4D56A 3C0KA 1RACA 2AX3A 3O1JC 4PYKA 4V1CB 3PJRA 1GKLA 1CZRA 2HDOA 3KHTA 3M6AA 2DP4E 3NGMA 1X7GA 2GJKA 5IM4A 4XD7D 5FBKA 5IAOA 3LF2A 1CJVC 2PA3A 4YR9A 2Q6KA 1IZYA 4DQDA 1NDHA 2CLHB 3WLSA 1Q20A 5JAUA 1NSTA 1R6UA 3M8KA 4JP5A 3SJZA 4RZXA 2H2DA 2R6R1 1EXDA 1EYZA 3BCHA 1JG3A 3E2IA 3DH0A 3CUSA 3CTPA 1T5HX 1N9GB 4MS4B 5MN6A 3ABSB 3AR9A 2A86A 4RU1A 2O23A 2BSQA 1B74A 1X7DA 1JJ7A 3FGPA 2ZULA 2IHBA 1KF0A 5EJ4A 2EL9A 2XZPA 3EYAA 4G6ZA 4TWJA 4RK5A 5FOTA 7GPBA 3QVGA 4IH1A 4FQ5A 4O4HF 1SVMA 1A9ZA 2ODQA 4CMJA 2R1TB 4Z6KA 1TMGE 1Y7LA 2H0RA 1F9AA 3I9OA 1ZISA 4IQ4A 1XZLA 3FSEA 1F4LA 3N8GA 4QOHA 5A06A 2J85A 1EUCB 1NT2A 1T9AA 1XRMA 1VHDA 2IU3A 2UUOA 1NW8A 3QIAA 4UOZA 4GMHA 1G8FA 5COQA 2H4XA 3KUCA 2ZFUA 4QICA 4BP3A 3I9KA 4OI4A 1TGVA 2H00A 2NTVA 4RZSA 3G79A 3R76A 4L8LA 4ZU6X 1ABFA 3IQWA 4AJHA 1XVIA 3UFXA 3VR5D 4FDTA 1Z7YA 4ZOQI 5FIUA 5JJIA 4CPDA 3K6SB 4AG3A 3LKDA 4KTVE 3C70A 2M32A 1ZXLA 5F9FA 1JIKA 4FMCB 1CUJA 1OU4A 3IAAA 1I3LA 3TLGA 4Z3KA 5AW2A 1N2CE 4UM8B 1HTWA 2GZHA 2VN8A 3COVA 3TGPA 4YGXB 4A15A 4G4SO 1SXJB 2XGJA 1RJWA 4LHZA 4Y9TA 1IK4A 2BELA 2PUTA 2Q45A 1U8CB 2W6IA 3BWYA 3QHAA 1LFAA 4M53A 3TD6A 1HOTA 5E0KB 2HDHA 2WHYA 4UBLA 5FWYA 4G8CA 4LK2A 4K8OA 4XH9B 1QGOA 1H5UA 4D43A 5DNCA 3P0RA 1YJAA 1RRGA 2IYFA 3I73A 4GC5A 2EGHA 4MIKA 2V6BA 3PFWO 3M83A 5EJ5A 1JW9B 1Q1AA 1VE3A 2AFIE 3H0CA 2C5HA 4BNDB 4LI3X 4MGEA 4L4XA 4R41A 3JRNA 4DC1A 4X85A 3IC5A 3RVQA 3ZGVA 1OXVA 2B1IA 3S99A 1K5GA 2ZT5A 4UDNA 2GCOB 3FH0A 4HMOA 1G5TA 2R1UA 4L72A 1UK7A 3A9SA 3SI7A 4YRAA 4Z4EA 3S5JA 2C7RA 1LW6E 1CIJA 2DUWA 3MT0A 4Q7LA 5B5SA 4RTOA 2ZRPA 4MR8A 4KSYA 2IZ1A 4NAVA 4YUYA 2ORYA 5JCJA 2BGJA 4YJ3B 3NDJA 4NKRA 3GA0A 2QROA 2YWGA 5DWQA 1A8QA 1L4YA 2CFIA 2YZ7A 5HF8A 1DAGA 3TLBA 3FBWA 2OCGA 3HRKA 1P5JA 4F2GA 1EK1A 3TZBA 2I22A 4XVUA 1LEHA 2CXOA 3C15C 4G25A 5GV7A 2QUJA 2R85A 3VJMA 4BXOB 3HJFA 1LA2A 1DT3A 1GL3A 4MRVA 3VR2D 1KGDA 2FSSA 5KB3A 1GGMA 3QVWA 1UOQA 1HMYA 1J09A 1ODCA 4B7XA 1WAMA 1XLTA 2RHGB 3OLXA 4HN4B 3WK7A 2I4MA 4E32A 2PLFA 4J0CA 5A3RA 3KXLA 1C9YA 2QUHA 3OTWA 3HBAA 1ECFA 1H65A 3OCVA 2FSHA 5KC8A 2QR3A 3HUFA 2HA2A 3HMQA 1Z5PA 4PIMA 4A91A 1K5HA 1A7AA 3DE0X 4R3NA 3UATA 1UDXA 4BV3A 1LB1B 4D45A 4J4HA 2ZYIA 5C8YF 5IJZA 1NMSA 3IBCA 2DWCA 1MU0A 3AJRA 4JVSB 1A95A 1CZKA 3GN2A 3U4MA 1Z6AA 2EARA 4HKTA 5C8ZA 4AO6A 3W2GA 3PEUA 4B74A 1GY8A 5CGQB 2X8LA 3C5VA 2AXEA 3EG9B 1RWBA 3IUJA 3UV7A 3IQDB 1Q2UA 1NBOA 2VP3A 3UZUA 4FN4A 3QWIA 4KP7A 3LYLA 1EFLA 4K6MA 4MJ3A 4QQ8A 5EVJA 4W1QA 1PUXA 3HKDA 4ILKA 3X1XA 4UFPA 1Y6GA 1XZPA 2P0EA 1N8NA 4IEEA 1H6DA 4IKEA 4A0RA 5SY6A 1PV1A 1F2TB 2IXDA 4U6SA 4DIOA 3RANA 5KNBD 4QVIA 5EEHA 3PFNA 3UAZA 3LQYA 3EIQA 3G0DA 4PSCA 1ZKDA 3D64A 3DBIA 3MMZA 5AT1A 4GOKA 1GZ3A 2ONKA 2GN8A 2OA0A 1CF9A 3ZU4A 4YJFB 3U3RA 4BMNA 4CIXA 2QMZA 1QP7A 5DNYB 3AXSA 1DKQA 1P2UA 4A8JB 3VZRA 1K08A 1BO6A 1WHSA 3DR5A 1JSRA 2X41A 1TIPA 2M9MA 1BE6A 4FW9A 1HYHA 3DZHA 2QMYA 1QJ4A 2XXJA 2WF5A 4CMEA 1M0EA 4MGYR 1VI5A 1Z16A 2IYRA 3NIFB 3DC7A 1H9AA 2EX1A 1NFRA 1XD2A 5JECA 1KFKB 1JQJC 1HETA 3DUWA 1WXHA 3NWBA 1S1CA 2W6JD 4BWVA 1J2RA 2P2SA 2BM1A 1ZWLA 2H1FA 3GBSA 4YV0A 2O8EA 2NYUA 3BHIA 4JP1A 2O3SA 3B12A 2FR0A 4C14A 1T10A 5D5PA 1Z34A 3H1BA 5DBHX 3OLWA 4GKVA 4MJXA 4OQNA 3CZRA 4JLJA 4MKXA 4ZQFA 4E51A 3TR5A 2GD2A 3WLAA 1ZNYA 2NTYC 1IJBA 4IYRA 3OURA 4JLNA 2VHJA 4IOLA 3VX3A 5HJEA 5C4IA 4RO0A 4F06A 3AHJA 2A6PA 1F8FA 3ETNA 5ETJA 4BGUA 4XIIA 1ZIOA 1UOPA 1Z12A 2H52A 1THGA 3DFZA 4LBVA 4ARBA 1P1JA 4L2IB 1MC4A 2DQKA 3K09C 3BWDD 3O93A 4KYTA 4BN4A 4KE6A 3X1WA 1WY7A 1ADCA 3V8MA 3ZKAA 4DSTA 2JK1A 3O3NB 4KKVA 3WQRA 1IB0A 3GUUA 2XCTB 2XCLA 5EZYF 3R41A 2NQ2C 1CUEA 4FFRA 1R0CA 4MSUA 4OG2A 2HK6A 1G59A 3R4VA 4TXNA 3AF3A 2OCKA 1JL3A 1JYEA 3TX6A 1IBLB 1JXQA 4ER7A 2W0MA 1DX4A 3A70A 3RC8A 1HC7A 4OY3A 4JOCA 4LJ5A 4Q9JA 4A23A 1W88A 2OORA 3CX3A 3SC6A 3WDKA 4HDSA 4F97A 3NVKI 1C81A 1FDVA 3K9CA 1F0YA 3UCFA 4DLVA 3GUVA 4RHEA 4PO8A 1R1DA 3TQCA 5ADVA 1B0AA 2JGIA 2PRZA 2PGOA 3EEQA 4N6GA 3ETDA 5KNDA 2BFMA 4DG9A 5L7WA 1H2AS 1VJ0A 3QYAA 4D3DA 1BVRA 5JV5A 1Y5IA 1EB8A 4XJVA 5CYOA 4A0GA 5KUTA 1KP9A 2RE8A 4H18A 2VPZA 4JJ8A 4YT4A 3V42A 2I4LA 2QUIA 1CJSA 4OHCA 3N7TA 4RVFA 3G0GA 1QO0A 3EZ2A 3ZHYA 1BQEA 3DKVA 3EDCA 3AF5A 4KR9A 1Q1NA 2L42A 3A6LA 1XJ5A 3EZLA 3V1UA 1AHPA 3GNTA 4PHCA 3I04M 5IPFA 1U2RA 4KIGA 3WLHA 4E4YA 3AI7A 3JWIA 1JQBA 3D8BA 4YDSA 4Y2UA 1F0KA 3N8HA 2HB6A 3N2YA 3C8UA 2GNAA 3SYMA 2ZATA 2YWCA 3HU1A 2IWRA 1GTZA 1MJNA 4B4WA 1KZHA 4D6YA 1GQSA 2PVCA 1ZI6A 3A3NA 3CZAA 4E4RA 1IY1A 1G5FA 1U1EA 1U8ZA 3ICVA 1GTVA 4PANA 3WJ1A 4RABA 3O8QB 4LGCA 3KYCA 4TX1A 3W78A 4BNZA 5F5LA 2BMWA 3HUTA 4LOHA 2Z9DA 1WWKA 1H2YA 3H18A 3G49A 2POQX 5T4FA 5KYYA 2CLMB 3AIMA 2PU5A 1J99A 2QAJA 4XQCA 4XFKA 1G16A 1KKMA 2R8OA 2VWGA 1YJBA 3PHHA 2RH4A 4LXHA 3WOHA 3UMBA 1H2ZA 1YBHA 2X9LA 1Y7PA 3EULA 5TY0A 1V45E 2FR8A 3HJRA 4GR9A 4J3JA 1S4QA 4URXR 1RWXA 3D7LA 5JZMA 1J8DA 1P3JA 2PNJA 2CVFA 3LUAA 1I3OA 1ICEA 3CYFA 4I9FA 3THYA 5JYBA 1BGVA 4I55A 4KQGA 1IJFA 2HSZA 5F23A 1E2GA 3A28A 3LDAA 5DEIA 4DSOA 4Z9FA 1YKSA 1G3QA 4C4PA 1LDGA 3L5KA 3RRYA 1PNRA 3PNLA 3L0BA 2QSJA 3LKBA 1QV9A 4BQIA 1O6CA 4F12A 1TD9A 2NXWA 3FPKA 2Y0CA 3DDOA 3Q9UA 3A26A 2WVHA 5I9BA 3RJZA 1T4GA 2DFKB 1CFZA 5IS2A 4IIGA 5T6MA 4NH0A 1KA9H 1GKYA 3CPSA 1VKOA 4A6DA 3MJEA 3O1HB 2WTAA 2WAXA 3NC0C 4FW8A 2A2ZA 4RSMA 2FWJA 5AXBA 2F3QA 1OJLA 3HSSA 1VPEA 2ERXA 1WXEA 2Q62A 3S28A 3HXOA 4U0KA 4UHDA 5C32A 1A97A 4OXXA 2ZIUB 5LB4A 4CZ2A 1L7VC 2NVWA 3R5SA 5HIJA 1UKVY 2A9PA 2ADMA 3DZCA 5EA2A 3UAWA 2C3PA 1UDWA 2OKCA 1HYQA 4LHWA 2QP4A 3SKVA 2W70A 4UCWA 1GU0A 3RYHB 4BVBA 4LDZA 4DMRA 5KDOA 3R5JA 1VL5A 2G36A 2MYTA 4R7GA 2X13A 2IUEA 1T24A 3R77A 5DYYA 3OJWA 4AP9A 4HHEA 2O54A 4YMTA 1Y3DE 1OXUA 4O2AF 4XVQA 4UUBA 5JSKA 3PLAE 2J8ZA 2ZI5A 4KFSA 1FMCA 3Q8XB 4NHEA 1DOAA 2ZAGA 4Q3NA 1GGEA 5CR9A 5EESA 4K88A 2GK7A 2A84A 1FLDA 1XEXB 4IFIA 4OJTA 4LECA 4HWOA 1AGYA 2IP2A 3E7PA 3HB4X 1HEIA 3PE3A 4KE7A 1ZNXA 4OQ4A 4YT8A 5MN4A 2VTBB 4ZALA 1BEEA 1ENZA 1QONA 2Y1KA 4CF4A 3CWQA 1AV7A 1Y3CE 5K0TA 4M7OA 4D8WA 4DRYA 3AF2A 1JKJB 1D6NA 2FE1A 2GDZA 2I8CA 4XWAA 4ALLA 1E9BA 3V9AA 3VJLA 3CV3A 3BXXA 3I5AA 3ZU6A 4C2AA 2PUBA 1FFXA 2V45A 2JLZA 4G4JA 1WNFA 2XUZA 2BTQA 1ONNA 1LGYA 2W8ZA 1KQPA 4BX0A 5BV1A 1AJEA 2OXIA 4ZEMA 1PJBA 1U5BA 2QTWB 2WM9B 3INYA 3ZKWA 2BDEA 3VHRA 1DC8A 4WKGA 5JBNA 1BXKA 2OBXA 1RM4A 1WB6A 2XEXA 2CXSA 3QUQA 4YUVA 3KFLA 2QSZA 4LQLA 4DIKA 4EF6A 1SIOA 2FQXA 721PA 1KZ9A 1UZMA 1FYDA 3KKOA 5JD3A 6REQA 1WCYA 4PZDA 1NIPA 1SCUB 1PZFA 3DL4A 3AFGA 4YY3B 3JR7A 1T36A 1X7HA 1JNXX 1CIVA 2RK3A 4UVGA 1DZIA 3P2MA 1R7RA 3Q5EA 2GGSA 2X7XA 2R44A 4ME6A 1KAGA 4KQJA 3BB4A 1UJCA 3ISVA 1RCTE 1VI6A 1Q7RA 4IIEA 2QRJA 4X8OA 1PJZA 5FUXA 3PLNA 5I45A 4IGIA 1ZOSA 1WW8A 5TJ9A 1TDJA 2Y1CA 3ROZA 2MINB 5ITZA 4DV1B 4JCCA 3VC7A 3LFHA 1N2CA 1YRBA 4L6IA 4L95C 4ZZ3A 4LRUA 1N5MA 4CYMA 2Q28A 1KR5A 1RKQA 1FLVA 2WYUA 3EPPA 5B3AA 5EWMA 3GPDG 1SIWA 2QZ4A 3IALA 2JLQA 1N92A 2ZT7A 4H7IA 4JA0A 3PGA1 2P8SA 3IUMA 4JUDX 3V4LA 3I04A 3ZYCA 4BB6A 5JXIA 1E3WA 4MVJI 4AAYA 3SOPA 5FAXA 3QWHA 4Q48A 3ROGA 1HNWB 1BXGA 1I5RA 2AOTB 1V1MB 2LXNA 4ON9A 2YWXA 4JL8A 1FJHA 1DDGA 1I6KA 1Q5PA 1EFCA 3G5UA 4R7ZA 7AT1A 3CS3A 3V8QA 2QAIA 2G1AA 4ZT5A 4Z53A 2NGRA 1XZ8A 2B2NA 2FK7A 2CL5A 2FWNA 3F6EX 3IKMB 3N2NA 5HGJA 5FOQA 1UC9A 4PSAA 5CXQA 1GL7A 5DCLA 3MERA 3TSZA 2FRDC 3VZSA 2FSVC 1G4AE 1IM8A 1NTOA 2Z3VA 1DQYA 4Q9KA 1H23A 4DTCA 4AT1A 1PCXA 4N3CA 4FMBB 1W2WB 1GAEO 2CSUA 5JNSA 1WX1A 3SFZA 2RHHA 1U1IA 4OQEA 1K7CA 3QY9A 2W2VA 1DWQA 4PS0A 4QVKA 421PA 1XJQA 3AUXA 4RD3A 3CNHA 2PX8A 1I94B 3RVBA 1SCAA 4G3XA 3K9GA 1FXWF 5IDYA 1MFPA 3P9PA 2P9FA 1JIXA 4O2RA 1PAUA 1NBIA 1UAGA 3V7NA 2DT8A 4MZDA 3PICA 4UMEA 3D4PA 4X60A 4YJ3F 1NVWQ 4HNHA 2XXAB 1CJTC 3GROA 1KAOA 3FHLA 3K8QA 4QBKA 5ALHA 1FP7A 2FWRA 3INRA 1C1XA 4QE3A 1NXQA 4V0ME 2DMRA 1OCEA 2FRXA 3EEIA 4QYSA 2GYUA 4TYQA 3U3XA 4DMKA 4OYHA 4ZDIA 1PKEA 5D1NA 5AICA 4RH3A 1U2PA 2VYQA 5I7EA 1JLLB 2YWHA 4IIHA 2L0XA 3ZWDA 2QMOA 1UC8A 4TS1A 3P20A 5SYMA 3AEQB 5HGXA 2W6ID 2VFAA 3K96A 3O1LA 5I5EA 5IBPA 3KQSA 1T6YA 3ZWQA 4I1PA 4FOTA 5ER9A 1JEYB 3IEMA 1N5LA 4CJXA 4LRQA 4MVJG 4NCBA 4WLUA 1E89A 1SGWA 1GITA 3UW1A 3NPAA 3Q15C 2ODNA 3T6KA 5CDTA 1HT0A 2D06A 1ZD4A 1FDTA 1QJCA 2CVPA 2ZBVA 3IBYA 2WG1A 2PO7A 4R98A 4RXMA 5EMLA 3T5MA 4JI4B 1CYEA 1YK1A 1TYEB 3GQVA 5EG5A 1VSQA 1Q0ZA 3UK1A 3V33A 4BOYA 2BLLA 3ZZMA 4IJMA 2QK4A 2YIDA 2PRKA 2DETA 2ALJA 1KL7A 5KYUA 5LSAA 4RTJA 4GOND 1N1DA 2RC6A 1A9YA 4RNCA 3Q41A 3TE7A 4P82A 1AXRA 4C7JA 4J16A 5LYJA 1Q3KA 4HDMB 4ZO6A 2F9FA 3T95A 3CF4A 3O9VA 3SJAA 4H1WA 4PQFA 1M5RA 1YNOA 2B82A 2G5CA 4Z2YA 3E9CA 2YDYA 2J0SA 3FROA 2P0YA 3IV6A 3U7EB 2P90A 1SXIA 2QMEA 3L0CA 3MOSA 4XUGB 5TF4A 5HM6A 3C8DA 4HNUA 4M6WA 3W9BA 4C5AA 3U6KA 1O77A 1U0NA 4LCEA 1Z5WA 5JCJD 1CZOA 4HZIA 2CJWA 3WB9A 1OI2A 1JDNA 3EIUA 2VP4A 4CF6A 2DBYA 3ONVA 2P6NA 4IIVA 3H5RA 5JRZA 2HRQA 2ATVA 2JVIA 3KQTA 4RY2A 3PQCA 3WL3A 1P1FA 1JZQA 5DN6A 4QDKA 1F4VA 3ELBA 2CV0A 2VYVA 1OBVA 4FC6A 4W9NC 2PGIA 2A5YB 2IPNA 2XWBF 3R6DA 1EE9A 4JP8A 1VJTA 3NBKA 3W9UA 2VI5A 3H1AA 3KD2A 5THXA 2XLBA 2DWQA 4X92A 3AM5A 2D54A 1WCV1 3R9KA 2VP9A 3STHA 2X8JB 2P9QA 2IQ5A 3PI7A 2P9YA 5LL6P 1YK0A 2H51A 1EDEA 1CUGA 1PEKE 1YJCA 5AW5A 1W1WA 4Q4AA 4D4LA 2J33A 1QIDA 1LQ2A 4X8HA 1WVGA 2GM9A 3DNFA 2Q5FA 1VECA 4YP6A 3ZW9A 4E2YA 3JWPA 3T1TA 5F35A 4RGBA 1HDEA 1YDWA 2FWBA 2Y0DA 1W5TA 4V2IA 5D01A 3G9TA 4DIUA 3NVAA 1QZZA 4KACA 3ZCPA 1PK8A 1VKJA 2IL1A 4HVLA 3KTAB 2MSNA 5I6DA 1JTVA 4OFZA 4QEZA 3K9FC 2W4QA 3ENQA 5DV9A 4RKFA 3DBRB 1X14A 3NTUA 4ZVRA 1SHKA 4A0HA 3C4VA 4HLCA 1KZ6A 1PBTA 3LNTA 4MV7A 5JLAA 2D1QA 1VPLA 1AKTA 1OGYA 4J91A 1XMVA 4S2UA 2P30A 3V6MA 1TVCA 1RWQA 4MKHA 3EGOA 3JW8A 1F1BA 4IG9A 1L5HA 2IF2A 3HDGA 3KT6A 1M2JA 1BOOA 3LKZA 5CRIA 2AE1A 1QIIA 4HTFA 5E8RA 4MMZB 5JJBA 4HV4A 2G1KA 4WLOA 2ZW9A 3EGXB 2C8LA 1M66A 2YW9A 3EBLA 2R6ZA 2GF0A 4M0KA 3RFFA 4EW1A 5LP6A 4ID3A 3PNKA 5HXAA 1W9HA 4G0ZA 3NP9A 1FB5A 4WDRA 4N3NA 3FR7A 2ZIVB 5EP4A 5FNZA 4HNTA 5HUHA 2JIRA 4J0DA 1QIJA 3IFSA 3CJQA 3GQBB 2FE4A 3BK7A 4KGVA 1W85A 2KLHA 1GT6A 1VBFA 2AG5A 5PNTA 1JU9A 1I14A 3QPCA 1KDYA 2XVZA 2PH3A 4EG8A 4CKZA 5HJ5A 5BN4A 3M9LA 3C41J 1YFZA 1ZCZA 5AKLA 3RBXA 4FDLA 2FPOA 2GX6A 1Q7EA 3FDJA 3OPNA 1OJ7A 4XWWA 4BQPA 1GNRA 5FPKA 3B85A 4W5OA 4H16A 3SHWA 2P65A 1T5DX 2ZBRA 4XRRA 3PK0A 1D8TA 1I2DA 2EZ9A 2HMAA 3HSKA 4UDYX 5BOVA 1JR3E 1IEWA 1X38A 2EKPA 3GUHA 3QQPA 2RHTA 5JSUA 1D5CA 3HB0A 3EUAA 1Y42X 3P9XA 5SV2A 1R8SA 1ZCAA 3U4HA 1EVIA 2X0NA 1BU8A 5KYWA 1P18A 4ARCA 1D9XA 1LBHA 3K5HA 3NBQA 1JXOA 5AM3A 4D4HA 4DMLA 4ESEA 2RI1A 5FT9A 4L5AA 1E3MA 2C4TA 1Q74A 2ZP1A 3O84A 4L22A 3TDKA 4PXAA 3UNXA 2Y1GA 4C08A 5IX8A 1CJUC 4MDEA 1DKRA 2GASA 4KXMA 3QXXA 3FPLA 1FNBA 3MXOA 1H93A 2QIOA 4KDEA 3KAJA 3LQ4A 4NAUA 1P7CA 5FLXA 4FE3A 1GPUA 1YB7A 3DDHA 3MT7A 4TKLA 5E9JA 3T1QA 4DUPA 1NA5A 2DBQA 2P7IA 5AK3A 1GA1A 5IRCD 5IHXA 2ILVA 3WNDA 1VBMA 2BJVA 2TMKA 4PC1A 1TA9A 2PXXA 2V7EA 3CPHA 5D3MA 3A6DA 4FXOA 4X6YA 4CM3A 2I66A 1L5YA 1AA9A 1TZCA 1BIFA 4RA9B 1E1DA 2D2FA 3DBVO 2C2XA 3JXEA 4LYGA 5IAKA 3FOWA 5C3UA 1KEEB 4PBRA 1H8EA 2XIQA 3DLIA