4ILEA

Structure of human adp-ribosylation factor-like 8a binding to gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
176
Chain Sequence
KLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 8A
publication title Structure of human ADP-ribosylation factor-like 8A binding to GDP
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 58
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ileA00
2X2EA 1Z0AA 4P0TA 5JJLA 2ZVQX 2JLVA 2WTUA 1NN0A 1XEXB 5FUVA 1FZQA 2CEAA 2CL7X 4LV8B 2D3WA 5KPDA 3Q3JB 2NGRA 5TY0A 3RAPR 2QE7A 5KDDA 3RNLA 2B7BA 4JIMA 3MWJA 3UMRA 1EGAA 1KJWA 1ZUIA 5DI3A 3D8BA 1YR8A 1T3LA 4RFSA 3IPYA 3SYNA 1E2IA 2GZDA 4JBXA 3M1IA 3AVWA 3LXXA 4N3NA 2OV2A 2A5YB 2JIZA 2ZSBA 2FNAA 4ZDKA 2BEKA 3PV0A 2O5VA 3TW4A 3SJAA 2PZFA 4Q1AA 4MYHA 3PUZA 3V9PA 3U4QA 4M1SA 2EWVA 3KKOA 3DL0A 3N2IA 4Q03A 3W90A 4DLUA 4FCWA 4GOXA 2QMUA 2AWNA 3BAFA 4Q7LA 3WBKA 1ZUHA 1NVUQ 1E2LA 4C0BA 5F9FA 1L7VC 3QIAA 1MO6A 1BYUA 1G4UR 4XSHA 5K8IA 3K0SA 1GP2A 1VCOA 3KQUA 2X2FA 4JL5A 4HB0A 4LPSA 4QHTA 3RANA 1NKSA 1DAEA 2JLSA 2ZXUA 1XD8A 1UJ2A 1MOZA 4D4JA 3DHWC 1ELOA 3A37A 3BFVA 1YQTA 2PT7A 2ZJ2A 4FXPA 1N0WA 4CGZA 5JI3E 3IEVA 1ZC3A 4HZIA 4D0LB 4TLEA 2CHVA 2BJVA 2GJ9A 4BEJA 4R9UC 2RGGA 3A1VA 2DFLA 1UDXA 2GXSA 4UNSA 5JZVA 3ZQJA 1H8HA 1N5JA 2ZUDA 1GITA 4K81B 3C15C 4TQUS 1U9IA 3FKSA 5FPHA 5EUQB 2C98A 3WY9A 4CEJB 4W5JA 2FSGA 4PHFA 4GRAA 2OT3B 4EDHA 5TXGA 3QEJA 1D2EA 2F1JA 1EFHA 3BOSA 5KU1A 3K70C 4QM6A 4F4JA 4LJ5A 1E3MA 2E9SA 2QTHA 3E5HA 1U99A 1ZIOA 4GMXA 5E7JA 2OESA 2GKSA 2JJ1D 3R20A 1HY3A 4LZZA 3CNNA 1U81A 3L8ZA 4JLNA 2H1LA 4BLOA 2W2TA 4LRWA 4GMDA 1HH4A 1W0KD 3CBQA 5IRCD 3QF4A 1Q0UA 5FTMA 1US8B 1WP9A 1AQYA 4Q1EA 4DLSA 1FFHA 4YMWA 3DMDA 2EVWX 2WMOB 4HI0E 1OIVA 2V7QA 5JJKA 3B5JA 3LX8A 2FG5A 1Z47A 2OBLA 3BC1A 3K0CC 2QAGB 2J7PD 1DTSA 4GBMA 1Z0JA 2OG2A 5KDOA 3K9HA 1NLFA 2CCGA 3B6EA 1TQ6A 4ABYA 4MQBA 2FFHA 4AKHA 4AYWA 1TF2A 1AS3A 3A36A 5HTKA 2JATA 1AS0A 3VTKA 4QM7A 4WVFA 3CLVA 3NBZC 3W3AA 3ASYA 3SN6A 4OL0A 4PQFA 4NH0A 2CK3D 3ZQ6A 1YZQA 1NP6A 3RWOA 3V4FA 2AR7A 1OFHA 2OLJA 3H86A 2ZJ8A 1EK0A 3IIKA 2XXAB 5CYPA 2GXQA 4OHZA 5JRZA 1Q12A 4OI4A 4BFTA 1AZSC 3L0IB 4JVNA 3QKRB 3HR8A 3PG5A 4WA7A 4TQAA 3CX6A 5C18A 5LD2B 4GDFA 3SJBA 3WNBA 3CZPA 1LY1A 3LH5A 4A0HA 2ZANA 1Z22A 3GJ0A 1E99A 2ZRGA 4LSGA 3GLIB 3KB1A 1RIFA 4C0HA 2BBSA 4CZ2A 2BMDA 1ZNXA 3SNHA 2GCNA 1E2PA 2HJGA 4B44A 4DLWA 1H8EA 1W2GA 2VEDA 3IQWA 2BMFA 5DGXA 3GLGE 3RS0A 3TBKA 4KLZA 1ANKA 1E2GA 3KTAB 2VQSA 4PAOA 5FPYA 3HPQA 5FL3A 1R6BX 2IYLD 2YKGA 3TSWA 2P0EA 3BH7A 5AK0A 3IUYA 1NMYA 1X8KA 1EESA 1BMFD 2WVJA 1XEXA 4JLBA 1HEIA 2ODBA 1SKYB 2QMOA 1N5IA 3MSXA 4BFVA 3IIJA 2ZU6A 4QBIA 1X86B 1X6VA 3LNCA 2GCOB 1IY2A 3B1ZA 3TUZC 2VYFA 521PA 4PX9A 3GEIA 1JEDA 3BD9A 4EFNA 5KUTA 2J59A 3IILA 3TR0A 2JGNA 3A4LA 3CONA 3UK6A 1P2UA 1JBKA 1S3SA 1NBME 2FEOA 2P6RA 3FMOB 5FOVA 2CNWA 5H8WA 4ZDIA 1AJEA 4RCZA 2PBRA 3NBFA 3CO5A 4PC6A 5H68A 1SVOA 3RC3A 3RSOA 3T61A 3C7KA 2C95A 4L16A 3SU8A 4QKQA 3OE7D 2ZE6A 4HB2A 2HEIA 4I1VA 4IJMA 5GADl 3NXSA 2BEJA 3W6NA 3G5UA 1QHXA 3W3ZB 1UBFA 2O8BB 1M34E 1TL7C 4E5UA 3BRWD 1XTRA 1G7TA 1QG2A 2ZRJA 4A1FA 4LI0A 2FX3A 1CR0A 1CULC 1E2KA 1FPMA 2XX3A 3AUXA 4TYYA 4Q9HA 3ZVMA 4A36A 4EPYA 3CX7A 1IQPA 1ZM3A 3P4YA 4WIAA 3U3KA 4TLCA 4ITRC 3AP1A 2V6JA 3LV8A 2RGNA 1Z83A 3B2EA 5EJEA 4XTRA 3CW2A 2PCLA 4LYAA 1IM2A 1XRJA 5JS7A 2VHUA 2NO0A 4CEJA 1OKKD 1NMXA 2WJVA 4P33A 1G3QA 4URXR 1IN8A 4PC7A 1P9WA 3BXZA 2GVDC 4JBWA 4KYIB 5FUWA 1NLYA 1TEXA 2WJGA 3L2OB 2IXFA 3H1TA 5KNBA 2L0XA 4K8OA 2FZ4A 1QG4A 2GAOA 1KDOA 1K6MA 2N42A 2Z83A 3EW9A 3FB4A 2QP4A 1XXHB 2ZYUX 3TNFA 3GD7A 2OCPA 3L8YA 1GUAA 1P73A 3TIFA 5KSOA 1KJYA 2A5GA 2XITA 2ZRIA 5BW8A 4XWKA 3ADCA 1JI0A 2GTPA 3LVQE 3QSYA 3QQ5A 4JVSB 3GEEA 2VHTA 1SVSA 1YRAA 2OCBA 5JWHA 1Z2AA 1RKBA 1Q21A 3KFVA 2OILA 1US8A 2OFXA 1Q1EA 1G8FA 1VHTA 3B1WA 2CHQA 5KTYA 5AWFC 4MRSA 4OBEA 4ZKEA 1S3GA 4Z54A 1GNPA 2ZS9A 5DLQC 3B9PA 2Q0HA 2QAGA 1XP8A 5CJ2A 3OAAA 3QF7A 2ZU0C 1JAIA 3AKCA 3LDAA 4AI6A 1DAKA 2C9YA 1NN5A 2FFAA 2ZYWX 5KNDA 4U7DA 4LHYA 4A6XA 4Q66C 5IK2D 1JR3A 2OLKA 4I1SA 4CEHB 5E95A 2G1KA 1ZVQA 1VCMA 3R8CA 3RRNA 1E2DA 1TADA 3A1WA 3CIOA 4TL8A 4AYXA 4IKEA 1D2MA 3A1UA 1FTNA 4M2LA 2OAP1 2XXAA 2R8RA 2WIAA 2IL1A 2DWQA 4M1TA 3QKRA 1R5OA 3WBJA 1EFTA 4TMVA 3SBEA 3DOEA 4TT3A 4DRZA 1BKDR 3GFPA 1T91A 4HATA 2FPKA 3GLIA 2FV8A 3UWKA 1OFTA 3UG6A 4ZKDA 4KFRA 1KAGA 3W6PA 2F1IA 4JLDA 2K5UA 2KBFA 2QT1A 4D4LA 4IOMA 1SHZA 4GI7A 3FPAA 5HKKA 2XSZA 1IN7A 3D6TB 1KMHB 1VG8A 1XMJA 3KTAA 3HWSA 4WW0A 2IT1A 4YDSA 1ETUA 3D3QA 1IN4A 1HYQA 2EFEB 1NIPA 3AKDA 4JKIA 3RS7A 4YMSA 1W1WA 4G5SA 3UKDA 4PC1A 4TYPA 5FTLA 3OEHA 1J90A 4PQRA 4DKXA 3KJHA 2ZE7A 1II8B 3TK1A 4XD7A 4TL9A 1RRPA 3KXKA 4LYFA 5GJCA 4M53A 5DSZA 3LBNA 1SXJD 3B60A 3JVUA 3UANA 4BGDA 4I99A 1N25A 3CUEF 2D74A 2XB4A 2GCOA 4ZIRA 1P72A 5EXPA 3KUCA 4GP7A 3MJRA 1KDPA 3LO5A 4QRHA 3KJGA 3W5IA 4HSEA 3TW8B 1S96A 3WMGA 3PEUA 4ARZB 2ZVPX 4NDZA 3SHFA 3CRRA 3S1AB 1M7BA 3FMFA 3GJ6A 4C0AC 4D2IA 2FA9A 2QAJA 4JLPA 3U7GA 1M2OB 3GMTA 1RZ3A 4RD6A 4WXPA 1FNMA 2EFCB 2QAGC 2A3RA 1F6BA 2FPMA 2GXUA 3RLFA 2REBA 2V4ZA 3RS3A 4ZV4A 3BB3A 4PAMA 4RZXA 4A2WA 1AA9A 5H70A 2QORA 4TSFA 1TTTA 3VU9A 4E03A 4D82A 2C8VA 3EPJA 3ZZTA 3BGWA 2X8AA 1BO6A 4N1AA 1UFQA 3ZS9A 1GRQA 4IDOA 4EPWA 1JAHA 2KBEA 5SZJA 4EQ6B 4Q18A 121PA 1G3UA 2O8BA 2JLWA 2YV5A 1UPTA 2QPTA 3ECCA 1U0HC 4HAYA 3LA6A 5EP3A 3B13B 2YYZA 1OIWA 5HE9A 1KO7A 3GFTA 3U6KA 3VR5A 1ZU5A 1PLKA 5LD2C 4U02A 3SFZA 2V3CC 3NWJA 2VL7A 4HZUB 2VHCA 1VIYA 2AK2A 3RYTC 1W44A 2WAXA 5BXQC 4Q4HB 2P3SA 1R10A 4FINA 1LFDB 1CRQA 2D4HA 3FVQA 2BVNA 3LQQA 5TDHA 4QGAA 4TLAA 4W5HA 3K70B 4O3MA 4CDGA 2QM7A 4DEXA 1SKQA 2H7VA 1P5ZB 4DJTA 3W34A 4LJ9A 4G1UC 1E6CA 1W36B 4LPKA 3O8DA 1HT2E 4GZLA 3MRSA 1E96A 4PO8A 1IHUA 2FU5C 5H1YA 4US2R 5CDFE 1RJ9B 1XXHA 4QBFA 2RMKA 2W6IA 2F9MA 2XOKA 3L82B 3EPHA 3I32A 4PFSA 3NHAA 4DHEA 1IJFA 1QVAA 1U8ZA 4HAZA 5B64A 1YZNA 2G0NA 4Q7MB 2GRJA 2EWWA 2YNMA 2DFTA 2NZ8A 5ELXA 2IUSA 1COWD 3TE6A 3N70A 1R7RA 4BASA 1L8QA 2WPDA 4MDEA 2B7CA 1EFRD 2CE2X 1U94A 4HUQB 2ZI6A 4DUGA 4C2TA 2UKDA 4TMTA 3ZVNA 4RZ2A 5KDLA 3ZD7A 2WKRA 1NG1A 1NN3A 2YC4C 4Q1CA 5EXXA 2GJSA 2VSOA 3KDSE 4RVCA 4XVQA 3GQBA 4RD1A 1UBGA 1ZMXA 3P26A 3NIBA 2QGNA 4L8GA 1ODFA 3SS8A 1D8TA 1FL9A 4TQ9A 1Z6GA 4JSYA 1CTQA 5DIFA 2MSCB 5DO9A 4BLPA 1DAGA 4CEHA 2HXSA 2HCJB 4NBSA 1NKTA 4E09A 3QENA 3DMNA 1G3MA 1GG2A 3UIEA 3L43A 3NEYA 1K8RA 1OXUA 3ZZUA 2X19A 4EFLA 3MCAA 1HTWA 4OK3A 1CJUC 2ZRKA 2VHJA 1G8PA 3LY5A 1TAGA 4P4SB 4Y0VA 5E7IA 3AGPA 3NH6A 1LTQA 3WYGA 2FFBA 1W0JD 4DXAA 3DOFA 2ZRHA 3CWQA 2IYRA 1G20E 4IDPA 1I4DD 4IFBA 2XNDD 1F2UB 3CM0A 4FD2A 2C9CA 4RCYA 4MYTA 1UM8A 1KMHA 2GK7A 4M8NE 1OXSC 3RVBA 5JWRA 3VNUA 5EUMA 3PEVA 2ERYA 1QHYA 1U8YA 4LDJA 5FFMA 5JJIA 4IVPA 1XD2B 1GNRA 4Q7KA 4XTCS 3I73A 4JLJA 3I5XA 2HCBA 5E7MA 4RD4A 2V9PA 4NCJA 4X8MA 3BERA 1E98A 3FKQA 4LJ7A 2GXAA 1G21E 1J70A 3KKMA 1SXJC 3DEFA 4U5XA 1TX4B 4FCVA 4C0QC 5EE9A 2PH1A 2RHDA 4IDHA 4BRWA 2JDIA 2WWGA 1ZD8A 3QXJA 1N0VC 2P67A 1DAIA 3EZ2A 4M1YA 4Q9IA 4O2RA 4A2PA 3ZZ0A 5JMTA 1W48A 4HYYA 1U0JA 3LWNA 1W4RA 2G9NA 3SC3A 3OFNA 3KZ1E 3UG7A 5SZKB 1OB2A 1R5NA 4ARZA 5DH9A 2ZJ5A 2HUPA 2QM8A 4B76A 3T5GA 5J5CA 3QG1A 3S1AA 1P7CA 4L9WA 3IHWA 1P3JA 2Q9AA 2YZ2A 5AUNB 3TAHA 2IHYA 1AK2A 2NO1A 5AUPB 2WHXA 1R8QA 1NVVQ 1UBEA 1ZBDA 4C7OB 1IN5A 4Q1BA 1ONBA 1C1YA 5F98A 5AUQA 1CEEA 3KKNA 2ZAMA 5K8UA 3W8RA 5LB4A 4EQ6A 3X1YA 1C4OA 1ZINA 4PQYA 2IHBA 3N5CA 1ZNZA 4C2UA 2N1BA 3SYLA 2H18A 4S2EA 5FOWA 3VKHA 2J0QA 1TQDA 1OH7A 2OUKA 1CR1A 4GFDA 1YR9A 4P4TA 1XNJA 4QHSA 4BFXA 4HZUA 1ZM2A 2CLDX 1IN6A 1NBMD 3UWOA 3QEOA 1C9KA 2OAQ1 4D81A 3AVYA 3QBVA 4NCIA 3P1JA 2VH5R 5FTNA 3EASA 2FN4A 1LV7A 1P2VA 3PVSA 1G64A 4A4DA 3QXCA 2WAYA 4Q9JA 3MG9A 4P4UA 1XJ0A 5CLQA 2VP4A 2WWXA 2ORVA 5BQ5A 3VMFA 4QNMA 3CF0A 4UQOA 3AVOA 1N0UA 3L0PA 1OE0A 5ANRB 4BFZA 3GEHA 3AVQA 3PCRB 5SZIA 4EJSB 1D6JA 1XPUA 2ATVA 4KI0A 1NVVR 1RJ9A 3ADDA 2WMNB 2IEZA 2B92A 5EP4A 3CPJB 5BYJA 5TVKA 3HP1A 3EC1A 2GA8A 1E9AA 1OIXA 1MRNA 2BCGY 1E1QA 1X1RA 2ANBA 3C5CA 3HR7A 1ZCBA 4GSYA 1QHHB 5C4MA 4KHZA 4LYHA 1Q1BA 5KHOC 1P2SA 3RWMB 1Z07A 3K0CA 1E1RA 1SVLA 3IO3A 4D0NA 1JEEA 4HUQA 4IOLA 3LW8A 1CJTC 4JT2A 3RDPA 3QVUA 3X1WA 4BEBA 4IVRA 5FTJA 5EP1A 3DKVA 4P3YA 5F3WB 1JQJC 3VR1A 1G5TA 1OH5A 4TTQA 2XTMA 3U44B 3HJNA 1CP2A 3BH0A 3HU2A 3TSOA 3M4YA 4FW9A 1W5TA 3NTUA 3QXHA 1KMQA 4JSTA 1D9XA 1Q3HA 1SQ5A 3QPVA 4MKFA 1ZJ6A 4IOJA 1W49A 1X8JA 3SR0A 1KI9A 1KI4A 2ZUCA 3QNUA 1KKLA 4J0QA 2QT0A 1Q3TA 2D2EA 3SI7A 3Q72A 4W7SA 1E2JA 4DLRA 1R0ZA 1N6KA 1NSTA 2ORWA 3C14C 3Q7QA 721PA 2LKCA 4I1UA 4P4SA 3VNVA 3CR8A 4RZ3A 2HDNB 3IDQA 2O8CB 4HAXA 5FI1B 1FMLA 5HZKA 1WCV1 4FN5A 4NONA 1G7SA 3ICQB 3VR2A 1OPXA 5EE0A 4ASUA 3AV0B 4UXHA 2YINC 3WHLA 4UNPA 3U2QA 1F2UA 2BC9A 1ZNYA 1DEKA 2QTFA 1VG1A 2A7QA 2DBYA 1LB1B 3AF0A 4WXRA 2GNOA 4MRVA 3VQTA 1QZXA 4AIIA 1FUUA 2QQ0A 3AF2A 4HDOB 5CIWA 1KHTA 4PANA 4Q47A 4B47A 3EPLA 2PX0A 2IYQA 2O0KA 4RSGA 4WOPA 1P2TA 4V0KA 4LJ4A 1XD2A 1W36C 3U7HB 1CXZA 2VHQA 1FP7A 3OEED 3CR7A 1G4AE 4F91B 2NPIA 4MH0R 2Z6VA 4Q4JB 1OV4A 3KB2A 3GLHE 4A8JC 1H8ED 5EE5B 4JJKA 2ZRDA 4ON9A 2XZOA 4DT1B 1YE8A 4B2LA 3ZVRA 2CVFA 3PUVA 2JLYA 5BN4A 1MO5A 5FPSA 1KY3A 3AM1A 2WSSA 4FIDA 2H17A 4LBVA 2IUTA 3TMKA 1XTSA 1W7AA 2VP5A 3TRFA 2A5JA 1FNNA 2ZSAA 3GJ4A 1ZM4A 4PAQA 4QL3A 5EZ6B 4BFSA 2D2FA 4B73A 3AVTA 3QKUA 3U3RA 3NHBA 1IY1A 3V00A 4TZ6A 4C7OA 4X8HA 3T06B 4OJQA 1Y63A 3IIMA 3MAAC 4PO1A 1E2EA 2G77B 1L4UA 1XTIA 2W83A 3OF5A 2IUUA 5AUOB 1A5TA 1PLLA 4A0GA 1UKZA 1TUIA 3VHXA 2ZEJA 4HB3A 4MYUA 4KFSA 1UAAA 2WWFA 3QY0A 2F1HA 1RRFA 3BB4A 2ZI5A 4F4IA 1M7HA 3B82A 3JVVA 4Q9KA 3RSLA 3X2SA 5JI2E 1U98A 3AKYA 3FOZA 1G19A 3VKGA 2VF7A 3PUXA 3QOFA 5CYOA 2C78A 5C46F 2ATXA 4UXIA 3P32A 2FF7A 2J3EA 1T3HA 1NVXQ 4FMCB 2AD5A 3KQNA 4HLQB 4A15A 4TMZA 1NF3A 3EA5A 4JZKA 5JBQA 3RRYA 3I61A 2QBYB 4OI0A 3GJXC 2R6DA 2R6AA 4MRPA 2ORIA 2ZI3A 3TKLA 4LC0A 3FHOA 2IF0A 5FUYA 3TGPA 3KXLA 3MWKA 1K5DA 1AKEA 2Z4SA 3GJ7A 4IOKA 4YMUA 4QJ3A 4I4LA 5KOYA 2WOJA 3LFUA 4A0FA 4KYUA 3A4MA 1G8GA 1RYFA 4O2LA 3WP0A 1U0LA 2REOA 4HAVA 1W0KA 4JLOA 2IX3A 2IWRA 1RYHA 4DDTA 5FH9A 2A5DA 3ZIAD 4NU0A 1Z0KA 2ZR9A 3I5YA 3K9GA 2H92A 1J2JA 3WRXC 1NIJA 3ADKA 2R6GA 2GF0A 4H1VA 1QHHA 1XU4A 2WJIA 2J7PA 4LGMA 4V0MA 1KGDA 4Q48A 4B6FA 1FQKA 1O87A 1RRGA 5BN5A 2ZM5A 1GAJA 1RE0A 4JLMA 1L4YA 1MO4A 4CRWB 4P32A 3H2YA 3KXIA 1M6NA 1SGWA 1ESMA 1M7GA 5L3SB 4Y0AA 2GVZC 1KO4A 4KU4A 1DVRA 1UDWA 1Z06A 1P6XA 3D7MA 3QJYA 4G3XA 3U44A 1KNXA 1N6NA 2NZJA 5GJWC 1PVOA 1GNQA 2QTVB 1JB1A 1TF5A 2HXYA 1VYVA 1E0SA 5AJVB 1GVNB 4M1WA 3C4JA 2C99A 2OZEA 1FP6A 1A82A 5G3ZA 3U3OA 4AC9A 2GHIA 2OXRA 2ZIAA 1YR7A 4B35A 1E0AA 1IY0A 2Q6TA 4CIDA 3B9QA 1ZAKA 1PLJA 2Q3FA 5KNCA 1P75A 1EX7A 2AKAB 1DS6A 2IYWA 3MJHA 5FR2A 1NRJB 1T5IA 1VCIA 2PLRA 4IDQA 1P62B 4AG5A 4AWXA 5B30A 2O8CA 5K8LA 2ZJBA 3ND9A 3WHKA 2QROA 2GJ8A 3MUFA 4OHWA 3NEJA 2AXPA 4UNNA 3ZGXA 1OYWA 2WOOA 2D06A 4QBHA 3WMEA 1BMFA 2F3TA 3TLXA 1YZGA 3HU3A 3ZJYA 1DBSA 5L3QB 621PA 3CWZA 2LKDA 4F92B 1SXJB 3FWYA 5CK5A 3FDIA 4U00A 3THYB 3N2EA 2IYTA 4US0R 1E2QA 4KO8A 2BKUA 4IEEA 4EJSC 4JLVA 3OIWA 3GLFB 1G41A 1R8SA 1GM5A 3T5DA 1W47A 4Q4JA 2QP9X 4NCKA 2IS1A 2QU8A 5HKKD 4R71A 2XSZD 4LBZA 4DT1A 2HYDA 4FWTA 2J7KA 2A78A 1OHHA 2VTKA 2G1JA 3P27A 3LVRE 2BMEA 3OIUA 1KSJA 1XD9A 1YU9A 2ZJOA 3CF2A 3OESA 4KBGA 4V0NA 5J47A 4GP6A 1KNQA 1KI1A 3OE7A 2GETA 1ZU4A 5A5GA 3PITA 1E2MA 4GOJA 1R5BA 5CM9C 1P9RA 2BMJA 1SULA 2G0TA 4OI2A 1XFAA 1WBBA 1E2HA 3GJ3A 4M9QA 4D4MA 3LXRA 3RRMA 3ETLA 4JS0A 4D4KA 2VF8A 3W5JA 1SVMA 3ZH9B 1QDEA 1OFIA 3MFYA 1IBRA 2QG6A 4YC7A 1NY5A 1YHNA 2V54A 2O52A 2V1UA 2KJQA 1GFIA 2MSEB 4V0LA 3KQHA 4DCNA 2CJWB 4IRUB 2CL0X 4B32A 2FE4A 3W9YA 5L8VA 3TVDA 3B1YA 3UMFA 4TYQA 2XB2A 3BBPA 3A58B 4TMKA 1F5NA 2JAQA 3E1SA 2ZTSA 4Q01A 5CLLA 3RABA 2IWHA 4KCGA 5K8TA 3WNDA 1OKKA 4JKYA 3CKLA 4HLUC 1OXTA 1XZPA 2QUZA 1YZKA 3SBDA 4M0LA 1R0XA 1UEJA 3B78A 1Z0IA 4GOKA 4QOSA 5GJVC 4EPTA 821PA 1KY2A 1NI3A 2JA1A 2WICA 3EPKA 3AF3A 4QC2A 3ZLJA 2QBYA 3QPWA 5AJXA 2GWHA 4KJZA 3PFIA 1HV8A 3ZYCA 4LC1A 4Z1MD 4BZPA 4BQSA 5EE1A 2NO9A 3MLEA 5FBRB 5JRJA 1KSFX 1MH1A 2CCKA 3F8TA 4RD3A 1PUIA 1V5WA 5CJPA 4BFUA 3THXB 4O0MA 1HURA 1ZYUA 2AXNA 4DSUA 4PR0A 1TNDA 1GWNA 4NKRA 2B8WA 3FTQA 4ESVA 1G1MA 4A0RA 2W6JD 2H16A 4MUAA 3VAAA 3KQLA 1OB5A 1Q1ZA 1Z29A 4V03A 4C9BA 2BM0A 4PHTA 4CYMA 4YMTA 2ZJZA 4GNKA 4PHHA 2JLRA 3AVVA 1J8MF 5FL7D 3AVPA 3NC1C 1NJGA 1W4BA 1D5CA 4Q19A 1PZNA 2IYUA 2VIIA 2EFGA 4YONB 5LDDC 3PQCA 1P9NA 2AL7A 2W00A 3DPUA 5CIQA 4DIEA 4LJ8A 2IS2A 1G3IA 2XAUA 2IK8A 3OZXA 2I3BA 3P4XA 3CRVA 1G18A 5AJZA 3TJZA 5IK2A 3VHLB 4E22A 4C0KA 1G291 2D62A 2XOKD 2ZI9A 3H84A 3NH9A 3U3MA 3V4RA 4MKHA 2FMXA 4B34A 5L3SA 3NDPA 4Q9LA 4KODA 3O47A 4BRUA 4D26A 1PV4A 2OCYC 4DZZA 3LLMA 3VR3A 3B8HA 1EFUA 4JMPA 4WAUA 2Z5FA 1KSGA 1T0HB 4LOAA 2DYKA 4BWYA 2OFOA 1AKYA 1EWQA 2ONKA 2ZRBA 3NC0C 3EZ7A 2G6BA 5JS8A 4D25A 2CCJA 2H8KA 2MSDB 4O25A 4B75A 2RHMA 3BWDD 3R9WA 2DWOA 3F0TA 4YMVA 1LS1A 4KAXA 4FMDB 1WDTA 1G9XA 1CLUA 1WF3A 1E2NA 1OH8A 3HPRA 1N6OA 4MRNA 2JJ2D 4NYJQ 3QUSA 5CITA 2PJZA 2HYIC 2GJAA 2JEOA 2BJWA 3I1FA 1Y3AA 2QL6A 2OBMA 5KO2A 3CRW1 1S0UA 2W58A 1FTSA 3VKWA 4NCHA 1VTKA 2GEUA 5FPTA 4ZDWA 4PPFA 1Z63A 4URVR 1KI7A 5J4KA 4MGKR 5L3QA 1Z6XA 3K9NA 1JJ7A 4A8JB 1DE0A 1SXJA 4B3CA 1XCMA 3DM5A 3THYA 1IAQA 3C5HA 5SZHB 1TU3A 1FX0B 3J81k 2VPPA 2V8OA 3NBYC 4PSVA 3GLFA 3BH6A 2JLXA 2BBWA 1KK2A 5EQTA 2SHKA 4XH9B 2ZI4A 2AN9A 2NOAA 5TARA 2QMHA 4BZQA 3GLGB 4R2HA 3SHWA 2PLFA 3ZDQA 1N6RA 1RPZA 1KK1A 3AUYA 1DAMA 1JR3E 4AKEA 5TV2A 1XTQA 2VRWA 5D3MB 1BS1A 1JQLB 1MRSA 4Q21A 2J5XA 4X8LA 3U7FB 3GJ8A 1UF9A 5FBWB 5DHFA 1CS4C 5DI3B 2P6NA 4N0DA 1MABB 4MGYR 4HB4A 4KFTA 4DLZA 4MA4A 1J7KA 2KI5A 1OYYA 1YRBA 4HDCA 4NYJR 3R7WB 3Q7PA 4KFUA 2JDID 1HT1E 1NY6A 2F9LA 2XEXA 3EZ6A 1KJZA 1XMVA 4C4PA 3CPEA 4NYMQ 3GLIE 3U60B 3NVAA 1FQJA 1AN0A 2FEMA 4B33A 3VR4A 5TMPA 2CJWA 1MKYA 1ZD9A 1DG3A 2OM2A 3C16C 3WYFA 1KKMA 2WM9B 4EFMA 1GSIA 2RKOA 4DLYA 4F38A 4PSKA 2DR3A 1SVWA 2PMKA 1Z0FA 2GBLC 3BFKA 1N5KA 4TWZA 5GJBA 1FUKA 4HLCA 3SOPA 4OK5A 2O8FB 1A4RA 2CHGA 3PENA 3LBIA 3MWLA 1XEWX 2IXGA 1GKUB 1OF1A 2P2LA 2MMCA 4C0LA 1Z6YA 1GTVA 1Z3IX 4TN1A 4B71A 1OLOA 2CE7A 4KV9A 1ZM7A 2KWIA 2LCFA 2JASA 2ECKA 2YOHA 4NTZA 3SDZA 1SKYE 2GESA 3NKVA 4AKIA 1YVDA 1CR4A 4V0OA 4OK6A 4EIWA 3R9IA 1L2TA 1Z5ZA 2R6CA 3IPXA 5FUXA 2QI9C 3L0OA 5F2EA 4JLKA 2HLDD 3FE2A 1II8A 2EU8A 3THXA 5C4GB 4BLQA 3ASZA 2AHOA 1XBTA 3DVLA 1COWA 3FMPB 3X1XA 3UXMA 4IHQA 1WA5A 2AWOA 4FWIB 4MUBA 3WMFA 1OJLA 4LHVA 1EFRA 5C1BA 4NYMR 1HE8B 1VG9B 4TYNA 2WJHA 3A8TA 5A0FA 5B57C 1E9SA 5G53C 1XZQA 3SJCA 4M1MA 5KSYA 2ZRFA 3AEZA 4JL8A 4MGIR 1X8LA 1JXOA 2EFDB 3UATA 1E9BA 2RB4A 5DN6A 2F6RA 3THWB 2JJ8A 1J99A 1IOZA 3CX8A 3GP8A 2QGZA 3K0FB 1SVIA 2ODWA 4QGGA 3E70C 3OHMA 2GEDA 4B3BA 1AQUA 5IDVA 2R2AA 1KO8A 2RCNA 2QE7D 1E79A 2NO7A 1R4AA 2KSQA 5JEDA 2BCJQ 2GK6A 2WKPA 2J0UB 2W0SA 3UMSA 2PMDA 3K0AB 4GZMA 1E1QD 3VX3A 3OIVA 4CT5A 2RH5A 4A92A 2F3RA 1G7RA 2E1RA 4G0NA 4YXWA 5IF9A 1GILA 1KSHA 1S9DA 4FCTA 4PZYA 2OCAA 5TB5A 3PEWA 2GDJA 2YOGA 1E1RD 4IVQA 1XCGB 3AKEA 2TMKA 2JIZD 3K09C 1XJCA 2BBTA 4MDFA 4G01B 5HCNA 1W0JA 4F93B 1GZSA 3QE0A 4YQFA 1G8HA 4R7ZA 5EP2A 1RVDA 1ZC4A 3SZRA 1D2NA 3A4NA 3T1TA 1CRPA 3BIFA 1KTVA 2XNDA 4NCNA 1II0A 3LRPA 1LVGA 5F9HA 3B85A 1Z08A 3QG5A 3IQXA 4G5QA 4Q4HA 4JL6A 3CNLA 1NLZA 2GEVA 2JLQA 5HCIA 4DSTA 4LJAA 3DDCA 4F7WA 1E94E 1S9HA 2EYQA 4ESHA 4BPBA 2G83A 1XXHE 2D7CA 3EIEA 1Q22A 2XZPA 2J41A 3LX5A 2OBNA 3KUDA 4LCBA 1CF4A 2VO1A 1PUJA 3QKSB 3KL4A 1F60A 3GLFE 5DNYB 4PTLA 3HYTA 3WNCA 2IYXA 4IXNA 4C0JA 2H57A 5GVSA 4TLBA 1T3SA 4QBGB 4A8JA 3BB1A 2CMKA 2ZRLA 1H8HD 2RGAA 3VFDA 2ZJAA 3AVXA 1FX0A 1HA3A 1KI8A 1CJVC 3FKSD 1XTKA 4XVUA 1NNEA 4CEIB 4DDUA 3D31A 3BORA 2X1VA 5AR1A 1S2MA 1WXQA 1DADA 2VP9A 4BLSA 5CB6A 1KI2A 1T9HA 3IKJA 1ZP6A 3GLGA 3RS4A 3THOA 1JNYA 3OIYA 4NZYA 4QGFA 3AP3A 4MRRA 5DYGA 2D7DA 4BZXA 5JFGA 1II9A 5D3MA 1WQ1R 5E3HA 1P61B 1OH6A 4URZR 3FHCB 2NPFA 4S35A 2ZS7A 2Q9BA 1MABA 1VECA 2BOVA 5DISB 2GJKA 2VBCA 4Q00A 1KO5A 3DZDA 2P6UA 1DOAA 1G17A 1YR6A 2NMVA 3QI2A 4IW3B 3R7WA 2PJRA 2BM1A 4KVGA 3TAUA 3PJRA 4LUCA 4CW7A 4M21A 2WZQA 2OSBA 2JCSA 2XGJA 1FOEB 5CK4A 1KOFA 5J4VA 2V7QD 3EWSA 2UVQA 1CIPA 2WSSD 1LS6A 4JT4A 3KKPA 1VG0B 2ZITA 1NBMA 3AF4A 3WP1B 2C2HA 2R6FA 5G3YA 4DBLC 5C2JB 3PEYA 5CB8A 4AG6A 1XEFA 2I4IA 3EZ9A 5IT5A 3KKQA 2ZUBA 3EIHA 4LX0A 5JCZA 2O8FA 1MO3A 3I62A 4DC9A 4NMMA 1IJEA 1BIFA 2IS6A 4LV6A 1ZM9A 5LB2A 2MMGA 3KJEA 1Q44A 1E2FA 4PXAA 2WSMA 5G41A 2IA5A 2AFIE 4ERNA 2PT5A 4KVAA 1ZNWA 1JXMA 1XWIA 2GZAA 3QKTA 3LAWA 1GIAA 4LWZA 3AH8A 3I8SA 2QEQA 1HUQA 4BLTA 4TZ0A 2C03A 3K0EA 1LF0A 2FH5B 5EE3A 3O8CA 2O0HA 4OKSA 1XPRA 4LBYA 5BYKA 3ZS8A 4QXAA 1Z0DA 4LJ6A 1KK3A 1Z2CA 4EPVA 2F55A 3F3YA 2NTYC 1QF9A 2C5LA 2YWGA 4M9SA 5DE3A 1QRAA 4L4UA 1XF9A 3CH5A 3IHLA 4B2IA 1Z8FA 1LNZA 421PA 4PSAA 1GRNA 2B8TA 3RS5A 1DPFA 4UNRA 2RGEA 3GPLA 2GCPA 4RD2A 4ZI3A 4JBYA 2J9RA 2QRZA 2WV9A 3THWA 4Q7JB 2O8DB 1HE1C 4KBFA 3K0FA 4OQLA 4GL2A 3L0SA 1IONA 4DSNA 2ZYVX 1D9ZA 1KI6B 2PL3A 1EX6A 221PA 2J0VA 1DO2A 1F3OA 1X1SA 2P5SA 2QA5A 4CVNA 2J0UA 1KZ7B 5G40A 4HEJA 1MT0A 1W5SA 3W6OA 5FBVB 5AJWA 1ZRHA 3K0AA 2WIBA 3TSZA 1N6IA 5LPNA 2P5TB 4NPHA 1IXSB 4JYCA 5FOTA 1AGRA 2DB3A 3AGQA 5P21A 3ZVLA 3RHFA 4B3FX 2CNWD 1OW3B 1OXXK 1KI3A 1AIPA 2O0JA 2QPOA 2YWHA 1E9DA 1E9CA 3NDBB 2UZ3A 4GPTA 3JZMA 4HUTA 1BOFA 4LYJA 1MR3F 4G5GA 5FOSA 4BECA 5FI0B 1X3SA 1UKYA 4URUR 4QJ5A 2OE2A 3F5FA 5J4YA 4M9ZA 4JJZA 2VLIA 1VPLA 3FMIA 2F1RA 2ZROA 4DCSA 1WE2A 2JJ1A 3VX4A 3QKSA 2CL6X 3OEEA 2OXCA 4DIDA 5HR5A 2WJJA 3EARA 3EC2A 4B2PA 1JPNA 2R62A 3H0KA 4EJSA 2QZ4A 4TYWA 3AQ4A 1NSFA 2BKEA 1EFCA 2GAAA 1P60A 4Q4AB 2VP0A 4JVLA 6Q21A 1U9IC 4C3ZA 1XEWY 1Z28A 5IHPA 4IDNA 1E69A 2N46A 2ZRMA 2F7SA 3T1QA 2VSFA 4CEIA 1T0JB 1H65A 1N3BA 1F48A 5FTKA 5KSZA 2CXXA 2ZI7A 4WBSA 2YJTD 1IXRC 2P65A 4QJ4A 1ESNA 1R2QA 2XNSA 3AF1A 2HF8A 2DPXA 1XJQA 3GJ5A 4TMXA 3AVUA 3I8XA 1I4LD 4P31A 2ZETA 2IC5A 1I2DA 2QENA 2IXEA 2W2XA 1NJFA 3HYRA 3X1ZA 1JALA 1E32A 1M1YE 2CVHA 2XJ9A 4D80A 4ZIRB 1RC8A 2CK3A 3I92A 2Q3HA 1W4CA 1S8FA 2ZE8A 2ASEA 5JCPA 4MYCA 1EXMA 2IBMA 1XPOA 1VYUA 5JLJA 1NL3A 3VR6A 1VYTA 1N6PA 3E2IA 1XTJA 4UXJA 4K46A 3PUWA 2OEPA 1R0WA 2PEYA 2J87A 1R0YA 2AX4A 1OHHD 2C9OA 2GZHA 4PHGA 5BWMA 2BBOA 4JYBA 1U8AA 2QSZA 3KJIA 4D6PA 4FMCF 5EXSA 2FZLA 2ZSEA 5FPKA 2ZR0A 4AY2A 2QNRA 3FHTA 3VU9B 1CKEA 3OAAD 2OHFA 4B48A 1YZUA 4AD8A 2FGJA 5JEEA 4HLUA 2J1LA 4B3DA 1QBKC 2ZQ5A 3K1JA 3DO6A 2ZREA 3EXAA 1JR3D 4AURA 4EUNA 3LLUA 2WKQA 3MWYW 4II7A 5FBQB 4ILEA 1YZLA 4BLRA 3SEAA 2I1VB 4Q02A 1W2HA 1TPZA 4RFVA 4AK9A 3BK7A 2CLSA 4DVGA 1XB2A 2XTNA 1FW6A 4TT3D 3O8BA 4EKDA 1TQ2A 4EAQA 2NIPA 3ZIAA 3CB4A 1V43A 1Z6AA 2IYZA 2ZJYA 1XDBA 4AKGA 2EQBA 4BFWA 3G0HA 5FOUA 1TUEA 4W5WA 3X1DA 2IYVA 2ZAOA 2DWPA 3CPHA 3BJIC 2BHRA 3DM9B 3GCGA 1WBDA 3KQKA 2I1QA 2IYYA 1N5LA 4WZ6A 1ZIPA 1DG1G 2AK3A 3OEHD 1TU4A 2V6IA 4UKDA 4A6PA 1G5RA 4ACAA 4YDHB 3K9LA 3FYHA 1G7CA 1G3RA 2R9VA 4XD7D 2O8DA 5D3QA 4HAUA 1CR2A 1ZD1A 3IBGA 4LHWA 2GILA 5CDFA 2YVUA 1KI6A 1XMSA 2LWIA 4JVMA 1QHGA 4G5RA 4HLDA 5EZ5A 2CLCX 1U2RA 2EYUA 3FFAA 3PXGA 1M74A 1VHLA 3REGA 1S1CA 4LBWA 3RRZA 1DELA 4CT4B 1OT3A 4OQNA 2BIFA 4TMWA 3REFA 1GRRA 1CBUA 3C41J 4V02A 2ODEA 2ZSFA 3QVVA 2CDNA 2IEYA 4H9GA 4PC2A 4ZI2A 4UJ3A 1ZCAA 3RC8A 4QGHA 5UKDA 4Z8YA 5DHAA 4DDWA 3NBXX 2ODNA 1ZW6A 2ERXA 3LBHA 2FSIA 3Q9LA 4TSFD 2JLZA 1N2CE 5JECA 3ONWA 4NE2A 1NMZA 3CF6R 1T6NA 5HZHA 2QPAA 1OSNA 2QQEA 2YHSA 1O3YA 2AD1A 4JLAA 4XSGA 4DCUA 3U61B 4RY2A 2ZRCA 2R44A 1E0KA 4KSBA 4OHXA 2FPLA 1DAFA 4HAWA 4R98A 3O8RA 4WZBE 4PPGA 1JR6A 1SZPA 3TQCA 5KYKA 3T1OA 2A5FA 3Q85A 1A2BA 4LK2A 4BFYA 1GL7A 4M1KA 2O8EB 2J0SA 2AFHE 3H4MA 5J40A 8OHMA 1E9EA 5B2ZA 1Z6TA 4QFMA 2RGNC 1TF7A 5DYIA 2IYSA 2RGCA 2VA8A 3AB3A 4M9XA 1S4QA 1VKJA 2RGXA 4OJKA 4V0ME 1XCPA 2XTZA 1E0JA 4Q4LA 2YWEA 1E4YA 2GF9A 2QN6A 2G3YA 4Q4AA 3PIRA 4EPXA 1AZTA 1BYIA 1G6HA 4OQFA 4R2IA 3T1VA 2IF2A 3QXSA 1AS2A 1KDTA 1VCNA 1AM4D 3BS4A 2BWJA 2NO6A 3Q5DA 4OQMA 3K53A 2FOLA 4Q5IA 4TLDA 4F4CA 3K8YA 3ADBA 1HQYE 2W6ID 2C96A 3Q8XB 1GL9B 4DDVA 2ANCA 1EG7A 2H5EA 3TUIC 4D0GA 2PEZA 2FDCA 4A2QA 2WWIA 1DARA 1B0UA 2Z0MA 3DKPA 4NHOA 4ZCLA 1KK0A 1S1MA 2RGBA 3QXXA 2Q21A 5L3RA 4Z51A 1UBCA 1E9FA 3GLHB 3U3JA 3CNOA 2QMEA 3LD9A 4X8OA 2PZEA 2WPDD 4M1OA 3B1XA 1P4SA 2F43B 4DLXA 3SYKA 4LHZA 1TEVA 4DUGD 4L5BA 4PO9A 1N6LA 5JSZB 2FSHA 2IS4A 1F2TB 4NL4H 4RZUA 5B58C 1GKIA 2REXB 3Q5EA 3WXMA 1M8PA 1CJMA 2X77A 2ZRPA 2GBLA 4LHXA 1AGPA 3EX7C 2AKYA 2G88A 2C77A 2EFHB 3MGCA 3EG5A 3EWAA 1RRCA 5FBLB 5KSPA 4AYTA 4ZPXA 1YZTA 4DEYA 3LQRA 4Z1MA 2PCJA 4BUJA 3R9XA 1A7JA 1UKVY 2ZRAA 3RS2A 5J4LA 3B1VA 4LV5B 4G5OA 3U7EB 5A4JA 3T35A 1WB9A 1LF5A 2Z43A 4C30A 4OHYA 1XX6A 3JZAA 2B21A 2FGKA 1MV5A 2W6JA 4E07A 2OFWA 3IBYA 4GT1A 1QVRA 2ZE5A 4MKGA 5FL7A 4RKEA 3TR5A 4DLTA 1RW4A 2RGDA 2C04A 4YLGA 3P20A 4DB4A 4UJ5A 2ZYTX 3FFBA 2DCUA 3SQXA 1KIMA 5FOXA 2ZSDA 4RD0A 3TUJC 2OO7A 3TVTA 3SQWA 1QHNA 1QHIA 3TQFA 4BE7B 1OFUX 2FFQA 1TQ4A 4H1UA 1I2MA 2J45A 4PPNA 1I4TD 4RJLA 1U90A 1G8YA 2FSFA 1G16A 4RFSB 4LY6A 1KYIA 3ZD6A 1Q57A 4A9AA 4OYHA 4L9SA 1LW7A 1DAHA 2V55B 2WJYA 4W9MC 3G82C 2HT1A 1KAOA 1KO1A 4FMDF 4QG7A 3K09A 1K5GA 3U4QB 1UEIA 3OFND 4N0EA 4DCVA 1A2KC 4IXMA 4UNQA 2QSYA 2W2VA 5DN6D 1UADA 2FWRA 4MGZR 2RAPA 4ZDJA 3QBTA 2YOFA 4XOIA 2JJ2A 3WRYC 1W4AA 2DHRA 3BE4A 4OQXA 4KITB 3W8NA 5HE8A 3UPUA 2WWYA 1N6HA 2JLUA 1E79D 1WRBA 4NYIQ 4MITA 5L3VA 1T4GA 1VDZA 4A82A 1KZGB 4WZAE 1NN1A 3IGFA 1VMAA 2QRNA 5JHGB 4B3GA 2A30A 3I72A 1W46A 4YXWD 1GDDA 1B23P 1YKSA 4HDQB 5GVRA 4CF7A 4KSCA 1T5LA 4Q1FA 4XWAA 1FMJA 1PJRA 3CH4B 4B3XA 2O8EA 2VP2A 3LW7A 3SJZA 4MKIA 3HU1A 1IXZA 3T15A 3SE0A 4ZCMA 5JWOA 1BH2A 4KLNA 3PR1A 4IFEA 1G6OA 2E87A 1GOTA 3A1SA 5KPJA 2Z4RA 3K70D 1QHSA 4FI3C 2HJVA 1JECA 5E4FA 4TTRA 4POAA 2Q9CA 1CU1A 3M0EA 4PZLA 3SFVA 1SHKA 2YC2C 2BV3A 4ACBA 1SVKA 2A2ZA 2A9KA 1Q1QA 1ZUNB 4KXFB 5LBIA 4B43A 1W36D 2PX3A 3IO5A 1VIAA 1CJKC 2WBLC 4DSOA 4EPRA 3EIQA 1A1VA 2ZR7A 1YJ5A 5M04A 1E9RA 4URWR 1G5PA 3MD0A 3QPUA 4PC3A 3A6PC 3QF4B 4NYIR 1JPJA 4QNRA 3I3SR 2W0MA 2ZS8A 3C8UA 3KX2A 3T12A 3IEUA 4TL6A 1UKEA 1KDRA 4I1OA 3FGNA 4DWJA 4XWOA 1Q20A 5JHHB 3GLHA 4US1R 4C0SA 3U5ZB 1TMKA 3CRQA 3MMPA 4TL7A 3U6BA 1T8UA 3KFXA 2F43A 4I81A 4RKFA 2R65A 4DCTA 3AP2A 4OHVA 2XZLA 4PPQA 4M22A 4Z8XA 5JSZA 5BN3A 1F2TA 3EZFA 4DB2A 5J4HA 2NQ2C 4DLVA 3B7GA 1JJVA 3TH5A 3GFOA 3EA0A 4FMBB 3ICEA 3CRMA 2HT6A 4PZZA 1E4VA 5EXTA 5HPYB 1RFLA 2YWFA 2Q3MA 2XJ4A 5FR1A 3BFXA 2HF9A 2KE5A 4M4SA 4L15A 2DFNA 3NG1A 3R8FA 1XMIA 2UZIR 2VP6A 2IW3A 1SXJE 3EAQA 4TTPA 2ONJA 2DY1A 3DZ8A 1OXVA 3I4LA 4IEIA 4NP6A 1HQCA 2HLDA 2CBZA 1T8TA 4XJXA 1GKYA 2ZPTX 3A1TA 5CM8B 5AJYA 3T34A 2B6HA 3CZQA 4ZO4A 2PZGA 3ND8A 4OI1A 2WWWA 2EW1A 4XVRA 4LJYA 2WWHA 1NVWQ 5DI9A 4XIGS 1DO0A 2Y8EA 4QHYA 3M6AA 3WYAA 1NG9A 2FJUA 2KB0A 1EWRA 2NG1A 4Q1DA 3HDTA 3PUYA 2V1XA 4ASUD 2QP3A 2BDTA 2J46A 1J8YF 4B74A 4URYR 2QY9A 2VSXA 1WMSA 4B6EA 4ZCIA 1GL6A 2ZRNA 2HV8A 2DFKB
chains in the Genus database with same CATH superfamily
1HG0A 2GEFA 4IJ6A 3UJ6A 2ZVQX 5B1IA 1K4MA 2PX2A 1ZH4A 3UXYA 3ZLTA 4J1NA 1Y8ZA 2CEAA 1U7ZA 2HADA 3AIKA 3WBBA 3GFRA 2D3WA 1UCFA 4LV8B 1OWNA 4Q93A 4WA8A 1MX5A 3GV0A 4YECA 1JTEA 1TM2A 3TQRA 3KZMA 3FBTA 4E08A 1CYDA 4JIMA 3MWJA 3ROEA 1JEYB 3MJFA 3SX0A 1JYSA 3BRSA 1GXSA 5DI3A 1YR8A 1ZRNA 5EQDA 5CB4B 2J5QA 1T3LA 5CDTA 2ACKA 1L7EA 3R09A 4L6CA 3DZFA 1QTIA 3IEPA 2G9VA 3DKKA 4YDRA 1GQRA 5FA8A 1WKVA 5HS6A 1LPNA 2A5YB 1UXJA 2JIZA 4OFZA 3GUZA 2F9FA 4ZDKA 2WIJA 3S2UA 4I55B 2FPIB 3TW4A 3SJAA 4Q1AA 1ID1A 3DMHA 3V9PA 3DEJA 1MCZA 3LT2A 4R1OA 5CBPA 3W9BA 4DGQA 2P41A 4FCWA 4BNYA 2Q2NA 2XLBA 2AWNA 4V1CB 2TMYA 4J29A 3WBKA 3G13A 3EXG1 4WXMA 1E2LA 1VI2A 4C0BA 2JI6A 5JUWA 4ZEXA 1VPWA 5F9FA 4L7VA 1NXPA 1ZH8A 4JQYA 3AF6A 4OHUA 3K0SA 1Y98A 1Z4IA 4ARAA 1JAZA 3FDXA 4DE5A 5DK4A 3QLJA 4OH7A 1JF8A 3D2LA 4U3JA 2ZXUA 3TRKA 1WHSA 3A37A 3KR1A 1AB6A 4FZRA 2ZIEA 4J3FA 3RUAA 1YQTA 3VI4B 2GR9A 3AHDA 3O90A 3PVCA 3DZCA 5JI3E 3IEVA 1ZC3A 4D0LB 3KS9A 2BJVA 2GJ9A 4R9UC 2H59A 2AOVA 4J94A 2DFLA 1FU8A 2RAUA 3RYFA 3WWCA 3H16A 5MN6A 4UNSA 3RTEA 3L8GA 3ZQJA 3LY8A 2QW8A 3WZ2A 4G4JA 1JGTA 2Q50A 1PYOA 4WERA 3WQHA 3NTOA 1HTTA 4K81B 3C15C 4TQUS 3NVKI 1FRQA 3WO0A 5AHRA 3WY9A 2OBBA 4K6FA 4DSZA 2FSGA 2OBFA 4KR3A 4MSUA 1B3RA 1V3UA 3D6VA 4GM0A 4LNUA 2YVKA 4WXEA 5TXGA 4B4DA 5I7VA 5IZ4A 1BDHA 2HLHA 1YRWA 4I50F 2DT8A 4YP9A 1MZVA 4F4JA 4LJ5A 1E3MA 4NIMA 4XD2A 5LU9A 4D43A 4E5MA 1ODLA 2QTHA 2LW7A 1ZOIA 1JDUA 3E5HA 3LDGA 3ZW8A 3S7ZA 2GZ1A 1R64A 1YL5A 1R5JA 3R20A 3DT8A 5KQSA 4PZAA 2CUZA 3CNNA 4JYPA 4MJ7A 1QE3A 2JCGA 2I4MA 4MUYA 3LRXA 4PRZA 5KCZA 2Q8NA 3BXHA 4F3CA 4X1IA 1ZJJA 1ZOSA 1W0KD 2JHCA 2VDJA 2ZBPA 3CBQA 3QSYA 4KO3S 1A96A 4N3AA 3OHPA 3OICA 3O2SB 1AQYA 1P33A 3C1UA 1FFHA 3G7SA 1WIWA 3R77A 2WMOB 1OIVA 1JE1A 5TQJA 2NUAB 2YFHA 2FG5A 3BC1A 5BSHA 4M8SA 5DT2A 2A7XA 4YYZA 1ADGA 2Y99A 1RIIA 1U2TA 3K9HA 2PV0A 1NLFA 3R3WA 4Y9UA 4W6ZA 4N8EA 2Q4DA 3B6EA 3PTAA 5FB3A 1E2BA 4CKXA 1DTWA 4AKHA 1TF2A 2HA7A 3A36A 1P7VA 2IPLA 5TNXA 4D9FA 5HTKA 1FYVA 4JHLA 4QM7A 2IXBA 2Y93A 3HCCA 3W3AA 3ASYA 3G88A 1C80A 1QFZA 1YO6A 2WU3A 4AO8A 1D1SA 3F6SA 4NH0A 2CK3D 1YZQA 4HWPA 4MVJF 4P35A 5EI5A 1PBNA 2AR7A 4RDIA 2OLJA 4EG8A 1IVYA 2ZJ8A 3FRIA 4D44A 2XXAB 4OHZA 2GXQA 2O05A 4DQUA 4OLAA 4EF6A 4ZJYA 4GI3A 1AZSC 4FLEA 4WA7A 3HR8A 3U4AA 4EJ0A 1QMGA 1A9ZA 3CX6A 4IQ8A 1L4NA 3GRRA 2WFAA 4CDNA 1MIOA 3A0UA 3SJBA 3WGIA 1QRSA 1LY1A 3LH5A 1M6VB 1JDBB 1X7GA 1ZLYA 3U48A 2YHAA 1G8AA 2X6RA 1XZ8A 2HIMA 3CZMA 2HXGA 1C41A 4HN9A 1KBOA 4D9NA 2HJGA 2QS9A 3SKXA 1YDWA 2FHPA 2CMGA 3N53A 1VXOA 2Q2OA 2VDVE 5EJ7A 3KTAB 2AW3A 3EQZA 4F3YA 4V1CI 1RDFA 4RY8A 2EIHA 1G0OA 1QO0A 3E9ZA 5FPYA 3CLRD 3JQCA 4OGFA 4INAA 5I5GA 2QIOA 2HWXA 3HFRA 3USES 2PH5A 2UVDA 4MVCA 1D1PA 2P0EA 4IHJF 3OOJA 2R7AA 4MMZB 4U6SA 5AK0A 3VPXA 4E7PA 2FXIA 1PJTA 3UPDA 3DE1X 4NAHA 2GLXA 1EDZA 3JV7A 3VU1A 3HNRA 4DQXA 4JLBA 1BCRB 4XX0A 5K3SA 2ODBA 5G0VA 2QMOA 4GVPA 3H8WA 5BXYA 1W5EA 1QIHA 1YQQA 2B9EA 2N0SA 2ZU6A 3EXG2 3DLBA 2J30A 3RU2A 4LE0A 2GHQA 5FWAA 3B1ZA 5CNJA 5D7NA 5EHZA 1F0YA 1UBUS 4QFDA 3BD9A 5CNIA 2DERA 3GQVA 1JJIA 4ZP1A 1WY5A 2YV3A 3IILA 3RVSA 4BVEA 5KYGA 1PR5A 3UK6A 3N0TA 3T5MA 3J7AC 4V39A 4RPGA 1E8MA 2H85A 1NBME 2H63A 2A94A 2IHTA 4GNRA 2C3OA 4KQJA 5FOVA 5H8WA 2B3TA 2NZUG 3PQ3A 5HF6A 4D9HA 2X0KA 4WX2B 4E51A 4RCZA 4JI4B 3T3OA 1FQOA 2NV2B 1TW2A 2A92A 2HC9A 2PBRA 2Q4RA 3F46A 3IELA 4LWOA 4PC6A 5A6SB 3WLTA 4C6TA 1NI4B 3C7KA 2ZAYA 1NXWA 1Y8CA 3HB1A 3WOVA 4L16A 2IHNA 3TLEA 2ZBUA 4OXYA 4FFWA 1H94A 4QFBA 1TJ4A 4HB2A 4R2XA 4IJMA 4B3TB 4NMLA 2HTFA 1KS2A 1QHXA 2O8BB 4UE6A 2E4XA 2WZDA 4E5UA 1G7TA 1QG2A 4A1FA 2QVZX 1CY1A 3LPDA 5DKFA 1F2VA 1FPMA 2PA3A 3BGOS 3O84A 1C7JA 2BLLA 1UUFA 2W9XA 4CV1A 3WJAA 1QE5A 1VMIA 2FWPA 3M4NA 4D3ZA 3CX7A 2FPUA 3T7AA 2ADOA 3U3KA 3AUJB 3KZNA 3LHSA 1TC2A 2RGNA 3PQ6A 3LDHA 2Q7DA 2P91A 4YRDA 1CPYA 3EHDA 1W0CA 3AR8A 1Z15A 4CIXA 1XLUA 2VHUA 4BPRA 1GGJA 1ZN2A 1DFIA 2BF4A 2CXRA 2NO0A 3HKEB 4QULA 4ZU6X 1RZRA 3L6BA 2Q4TA 3REQB 1CVIA 4K87A 1PHPA 4IBOA 1A8HA 1L8XA 1NM5A 3BXZA 5FUWA 1NLYA 3UFXA 3UN1A 1KEWA 5KNBA 2L0XA 1QRDA 5HGJA 4TV8F 1QG4A 4XCXA 4G8JA 2JD0A 1KDOA 1K6MA 2N42A 4RVUA 4YRZA 1FFBA 4CMIA 1YK1A 3EW9A 1VFNA 2JH3A 2ZYUX 1OTXA 3GD7A 1NV8A 3FYTA 4Z4IA 2OCPA 4MVJP 3VKUA 1DC3A 1KAEA 3PQ7A 1KJYA 1WNFA 3J7TA 3QNWA 1HE4A 5B6PA 1L3BA 2ZWOA 3BVPA 3QRWA 4CUZA 4KE7A 3F90A 4XSVA 5EQFA 4RK0A 4EX6A 4P54A 3F1LA 3GIWA 4FFSA 5JWHA 2V7UA 3IOBA 4PZPA 1YQUA 1THGA 3IP6A 3WDMA 3BXEA 3KFVA 2OILA 3RVRA 1US8A 4MDHA 3EEQA 2OFXA 1V6CA 1Q1EA 2I67A 3HN6A 4EZIA 3INTA 3B1WA 6REQB 3LCJA 4QT4A 5AWFC 3AB8A 3M6FA 4OBEA 3VNAA 3PGMA 3R9KA 3PDIB 5DTJA 5DCWA 1E6KA 2Y4OA 3B9PA 2P4UA 4TTTS 3LA8A 4RXUA 2Q0HA 3GDGA 1FYEA 2OC9A 3GQBB 2VWHA 3K96A 4MR9B 5E1MA 2ZU0C 3AKCA 3PRYA 4FHFA 4BBJA 3K94A 3ZDEA 3H9GA 4LHYA 5JH7F 4P5DA 2C4KA 1CP3A 1TA4A 3NJRA 2OLKA 2QYHA 3D7KA 4NSNA 1TIPA 4KLRA 3QH4A 2G1KA 1VLVA 1I13A 4TZTA 3RRNA 1E3WB 1E2DA 1TADA 4AYXA 1WOMA 5D84A 5JNLA 3PYLA 4LGVA 1NQWA 1MDBA 2QVLA 1N9KA 3R0JA 2LZ0A 3R6DA 2Q7OE 3OOSA 2WIAA 1SQSA 4A6DA 1AKRA 4G81A 4M1TA 4QDTA 2J9YB 3QKRA 1G8JA 3V5NA 2P2GA 3UOGA 1HFJA 2H7XA 4FD3A 4DR5B 1XYYA 1Q11A 2CVQA 3DOEA 3EXHA 3GZJA 3M8KA 4Y2PA 1EQ2A 2HRRA 5ALXA 4ZD6A 4ZYUA 4R3NA 2VKTA 4Z4FA 5THQA 1O5IA 2FPKA 2FEPA 2PXCA 2ZSJA 1FTGA 1IAVA 3OLWA 1KAGA 2ZIFA 3H42B 2F1IA 4BVHA 5JSFA 2EEZA 4G41A 1NW3A 2AHRA 3GB9A 1BROA 5IAJA 2EBWA 4B40A 4GI7A 5JD4A 2QLJA 2XSZA 1KMHB 1VYHA 1Z7GA 1XMJA 5BQPA 5ED4A 2IT1A 4YDSA 1QQ6A 2VT7A 6YASA 1IN4A 1HYQA 1YTUA 2ECFA 1GQSA 1NIPA 3AKDA 4JKIA 1W1WA 5HRUA 1XRNA 2QTCA 2Z56A 4JEHA 1PJ4A 1J90A 4NBWA 5JBIA 2Q6LA 4PQRA 1R8YA 5HK8A 4DKXA 1H05A 3KSDO 1EFVA 7AT1A 2FQ1A 5IC6A 1A7UA 5IXJA 3P9SA 3I5AA 2YBEA 3DZGA 1DKUA 1M0SA 1MB2A 2VPIA 3PNLA 3OMXA 3QM1A 1QGAA 3JVUA 4UBJA 4BGDA 4I99A 5JJBA 3ZCXA 4BMCA 4D9GA 4OXQA 1M73E 3CUEF 2D74A 4RPHA 3EVNA 1CJCA 2AQKA 2I2BA 4QDJA 4ZIRA 3EQ7A 3M2PA 3AETA 2E89A 2HPAA 4CQMA 1KDPA 4OHRA 4CF5A 5ALLA 3HBFA 5A3SA 2JFXA 2P1RA 4Y6OA 5AK5A 3WMGA 4BTVA 5JSHA 4EUEA 4NJMA 3IPLA 3SHFA 3CRRA 3BHIA 2E21A 1M7BA 4C0AC 3UW3A 4C6RA 5JS6A 3BRCA 5DM2A 1M2OB 1J97A 2QAGC 4XIFA 3ZKWB 1RHJA 2GXUA 2FJPA 1SK8A 4PAMA 1K92A 2QORA 4X45A 2AN4A 2KMLA 3FVTA 4E03A 1MEJA 2WAOA 3HVHA 4ARBA 1SXPA 2X8AA 5HGXA 1L7AA 1UFQA 2ZDHA 1HI9A 5HKAA 3UGJA 1G3UA 3C3KA 4R9NA 3M9WA 2WTAA 1CUZA 4EGCB 2JLWA 1J2TA 2A9RA 5EP3A 1NUHA 2YYZA 3AC0A 5FCDA 2XCSB 2VAVA 1G60A 5KWIA 1HNWB 4BNFA 3AL0C 1OCEA 2AUTA 2I9PA 1PLKA 3NAMA 4TPKA 4R2MA 4GWLA 4Y2JA 5L4NA 3RFFA 1TO1E 1Q92A 2YQ4A 2G06A 3QQPA 3ZY6A 3MELA 1W96A 5AH0A 3SFZA 2WHYA 3AHJA 2V3CC 4QEKA 5CFMA 2VHCA 1Y8RA 1OLSA 1VIYA 3E53A 3HACA 4R8VA 1W44A 1IHXA 2QRVB 5AI6A 1C0IA 4HDSA 3RLIA 1EM8A 2ORED 3MT0A 5LJIA 1YFKA 2XADA 4EAAA 3FVQA 2VWPA 2BVNA 3HFJA 3LQQA 5TDHA 5KEIA 3ASVA 3D1VA 3FCAA 4GH5A 4NLLA 1BXGA 4M46A 2QM7A 4CWAA 4FZ3A 5CXSA 3C8MA 4ND6A 2PUCA 1P5ZB 3HCPA 4OB8A 3CKKA 3S1SA 4BVGA 1KMMA 1VLQA 3JQPA 3I6BA 3D3KA 2EXXA 1K98A 3LOQA 1Q2UA 4YCSA 4FOLA 1W36B 5LOVF 1DRUA 1SQGA 3D3EA 4UUQA 4PXSA 4ND4A 5FYDA 3VKFA 2PT6A 3LYHA 2X5NA 7MDHA 1E3TA 1O9GA 1YJQA 1DCTA 1R9NA 4US2R 4QELA 1RJ9B 3AK4A 3GI1A 2JGAA 3W9SA 3TOXA 1GPMA 1IBLB 4AZTA 1CY6A 3QUCA 1NVBA 1QYXA 3HHPA 3I32A 1C7IA 3KOWA 4LRXA 4PX5A 3ANYB 3RHZA 3T4XA 5FUQA 1IJFA 1GRCA 1QVAA 1ZRMA 2VAWA 3IUNA 4PYRA 3BMCB 3MMSA 4HAZA 2BFCB 4XFKA 5B64A 1QP7A 2UXCB 2C20A 2GRJA 3SBOA 1JFVA 2EWWA 2LDBA 2YNMA 4D9BA 2UYHA 4LVOA 1COWD 1H2RS 3B9RA 2H4HA 3JPWA 3LVFO 4U63A 5CFNA 5KB3A 4O4JB 4IZOA 3KT0A 3F8SA 3WLRA 4K9SA 1H85A 2B7CA 4X5OA 1X39A 2ZI6A 3QIVA 1E5DA 4NU8X 4PY2A 7REQB 4NENA 1UDCA 2UKDA 2XODA 1H4QA 3AR9A 4IF4A 3UAVA 5LNK6 3OCZA 4YV2A 4RZ2A 3RU3A 1OR8A 3NT2A 1NN3A 2YC4C 2QRHA 1KE2A 2VSOA 3KDSE 2FVXA 3OUZA 2VZ8A 4E14A 3LF1A 3NIBA 1AQLA 1YI0A 4DMCA 1VP9A 3GGSA 4JWKA 1RQLA 4FJ1A 1J24A 4IWYA 5HCUA 4JSYA 1CTQA 3RTBA 4HQ0A 1JKJA 3GLVA 3OQNA 5DO9A 1JJFA 2BP7A 2FPPB 1DAGA 4OATA 3F1KA 1CEYA 2YMQA 1NKTA 3D0KA 1BHQ1 4X90A 3DMNA 1DIGA 4U39A 5AVKA 1M1YB 4PNHA 5IARA 3L43A 3NEYA 1KZ6A 4RMJA 5JVDA 1OILA 2X19A 4I4IA 3MCAA 2I71A 2X9NA 4K1LA 5BSTA 5LQUA 1CJUC 2ZRKA 3VHRA 1BWPA 1M0WA 1Z36A 3LP5A 4HDNA 3OO1A 1J56A 1H4SA 1LQUA 3VGPA 3LKBA 2J3LA 1PR6A 1WZCA 2AMYA 1R0LA 5E0OA 3UMVA 3FSRA 2IYRA 3KJNA 4EEZA 5A2QA 3FOCA 4TV9A 2C7OA 2PXXA 4IFBA 2XNDD 1UP6A 5E9WA 5T3UA 2VATA 3FGZA 1NC3A 1VE3A 2QLBA 4IIFA 3CIFA 4KPUB 4RCYA 3V8BA 4YAUA 4FS3A 5JALA 5KJCA 1EDDA 3KKZA 1QPZA 5IVKA 1UM8A 4M7WA 2L18A 2POCA 1EVYA 1OXSC 3LC1O 2BEVA 4M8NE 3ZD8A 1KERA 1PT7A 1VPEA 2V7BA 1MAAA 3TEJA 3GVPA 1U8YA 4CV0A 4XB6B 3KL2A 2VUSA 5ALKA 1YR1A 3NGXA 4IVPA 1GNRA 4WLUA 4RVDA 1K88A 3L05A 4XTCS 1J33A 2QZSA 4RD4A 2V9PA 1Z6ZA 1X19A 3TGWA 1XZHA 3FCXA 4L3WA 1E98A 4PSCA 1G21E 1V8OA 2RBEA 4KQHA 3KKMA 4QOEA 1SXJC 3ZIDA 5BUQA 2VHZA 3KAQA 4RYDA 3WV5A 2XBLA 3IP3A 3U5TA 2I78A 2JBAB 4IDHA 3TLBA 2JDIA 2Z3WA 3SXUB 2WU1A 4Q9IA 2OSVA 1N0VC 2F90A 4BC0A 1EESA 3UB3A 1QTQA 4O2RA 2G28A 1DC5A 5LA6A 4AP5A 5BN4B 3M6UA 5JXGA 2Q07A 2RONA 1AHPA 4J2OA 2GASA 4KR0A 4Y30A 2CFIA 2JCBA 2GTHA 3PFCA 4UZEA 5DNUA 1E4EB 3SC3A 3WFJA 3TFWA 1VZ2A 2ASVA 3GRPA 3A9UA 1U3DA 2ZJ5A 3A25A 3OPMA 4DLAA 4B76A 1G5FA 2X5KO 5J5CA 3S1AA 4X66B 4ARUA 5FXMA 1AO0A 1E3EA 1DBWA 5JNSA 3TAHA 1RI3A 1ECLA 2JHGA 2NO1A 3FI9A 1GU7A 4N5LA 1NVVQ 4YPOA 4YV1A 3UW1A 4YAIA 5HK9A 4D8YA 3QUBA 1YB2A 2I8LA 2WP8J 4BFCA 3I30X 1BE8A 2ZAMA 2AMVA 2GERA 1ZEJA 2C84A 2JFGA 3GHHA 4HDRA 1VLLA 1T9GR 4AZVA 3PFFA 3ZCUA 3QNMA 3T9EA 1G42A 3TYXA 4EQ6A 1FEZA 2HSZA 4JMLA 3X1YA 2BZGA 3DULA 4QQFA 3P2EA 4GPZA 1ZPDA 5EHNA 5LMCA 4MUNA 3FPEA 1P74A 4G9GA 4B17A 2HH9A 3WV4A 5G02A 2XE4A 3F49S 4K9PA 4RPLA 4PYNA 1TTHA 4FDLA 5ADHA 4HLNA 4ZVOA 1YR9A 3UT5B 4YJGB 1QCYA 1JHUA 5K3BA 3OVMA 4A26A 2AUNA 4QHSA 3SZ3A 4BFXA 1ZM2A 4B3IA 3FNRA 2PUAA 1IN6A 1ZW1A 2ZP1A 5FJIA 3NOVA 1UKAA 3AVYA 3IOCA 1MNQA 2J6HA 1X7ZA 5ESXA 3P1JA 4JP3A 2VH5R 4DA0A 5FTNA 3H18A 3V8RA 3Q0EA 1JSZA 3HGQA 2FN4A 3PVSA 1S89A 1JDNA 3IP5A 4IJKA 3MG9A 4ISBA 2E4UA 2FZ5A 2VFAA 2VP4A 3HDHA 1N2CB 4FWBA 4P4UA 5CLQA 4QOJA 1E3QA 2WWXA 3CPSA 5ALQA 5DMHA 5BQ5A 3PFGA 2P9ZA 4CQMB 2X8JB 4JWTA 4TWBA 5JIBA 4WNAA 4CIAA 3MRVA 3GBVA 4BO5A 3ADOA 3PCRB 1ZSNA 3Q15C 2PUGA 4D9JA 1XPUA 2XWJI 1JU4A 5M29A 1ULHA 2WTBA 2LNDA 4ERXA 3ADDA 3EZGA 2WMNB 4MR7A 2PBFA 1MJHA 3D0OA 3PD7A 2B92A 2NP7A 1EK2A 2Q1XA 5BYJA 3DBHB 2DETA 1YIOA 3DDSA 3KWFA 5BRJA 1NA5A 3HP1A 4E94A 5HSGA 3IKTA 2NU6B 3HR7A 4YWHA 1ZCBA 3QW4B 4AMYA 5C4MA 1ZO8A 3CEMA 1DOHA 1VIDA 1Q1BA 2NU9A 4LYHA 2RC6A 3RWMB 4Z7OB 1DNPA 5AM1A 1SVLA 3G9XA 1T36A 4K2AA 5KYYB 2BGTA 4HUQA 3INYA 3OWXA 3E9NA 2MINA 3FOBA 3GOQA 2JZCA 4KWHA 1DKRA 4JT2A 3RDPA 1WDLA 5BW5A 4AUKA 2FSSA 2XPCA 4YRTA 1XT6A 2B8JA 2JBWA 2PS3A 4FJ0A 1Z62A 4WY5A 5ALEA 3OTOB 1G5TA 2JFOA 3CB2A 2VXYA 4EY8A 3PXEA 3U44B 4DAEA 1LLQA 4LZAA 4M55A 1RZUA 3HU2A 2M1XA 3OJ0A 1VPVA 1HTBA 4K7JA 5B7GA 3QVJA 3IOEA 1Q3HA 4PR3A 3H6KA 4TWJA 1E7YA 1I4OA 1V71A 2I6TA 2OY0A 3HKCA 3N28A 4JC5A 3JQFC 4MKFA 2XXJA 1EGVB 1KI9A 1KU0A 2HLNA 2ZUCA 4ZI7F 3HM2A 2GAIA 4J0QA 2QT0A 3O1HB 2G76A 2I3ZA 4WOCA 4W7SA 2WJWA 3OZRA 4UUOA 3M5PA 1FVOA 4K8RB 4Q3NA 5EJGA 4DLRA 5DOVA 4DV0B 2BGUA 5DTQA 4H0FA 1B74A 3C14C 3EGXA 3K15A 2W4MA 3Q7QA 1W59A 4I1UA 4RMIA 721PA 3CR8A 4RZ3A 4YGXB 4IHKA 2VF5X 3WZLA 4HAXA 5HZKA 4EFKA 3HJTA 2CN1A 2LVBA 4QBKA 3A26A 5TX7A 1DT3A 1MTZA 2P9QA 3W4JA 2I4TA 4RPIA 2P9JA 2PKEA 1DKPA 4QD3A 3RC1A 1IQ0A 2EZ8A 3U2QA 1ZNYA 1NPTO 2QTFA 1GG8A 2C8KA 5H3CA 1OBCA 2PVCA 1VG1A 2DBYA 2I7DA 2R8PA 4H2DA 2GNOA 1QQTA 3FVWA 4MRVA 3VQTA 5KYUB 2W4QA 1FUUA 3GIDA 3AF2A 3KT6A 3OQBA 4L5IA 4PANA 4UPDA 5CIWA 3RIXA 8ADHA 4PSUA 2IYQA 4N6OA 2CHUA 2OGUA 1EDEA 1VPTA 3G49A 4NK4A 3OO0A 4W4TA 5CBKA 4O8ZA 1I24A 2A0XA 3JYPA 5JTTA 3U7HB 4FHGA 2FRVA 2VHQA 2WWTA 4PGMA 5B2FA 1ECGA 2P6MA 2HBZA 2YV4A 3NLLA 3D6MA 4ITVA 3UAOA 1KJ9A 4DNPA 5JAQA 2W2KB 4FEGA 2DQ4A 2IOYA 3JWEA 4W6QA 6ADHA 3KB2A 1YGPA 1N1EA 3KVRA 4BMVA 2AMFA 4YJKA 3OQVA 1CDEA 3KEOA 4KVFA 3A1NA 1HKUA 5BRNA 3WHIA 4NPAA 2DX7A 4EG4A 4DT1B 2FP3A 3KRTA 1ZK0A 2ZVDA 5ECWA 4B2LA 4JOBA 2C2MA 3H3XA 5HMLA 4BQPA 1XNRB 5FPSA 4X6XA 1KY3A 3R1IA 3DMYA 3BJRA 1BA2A 2VNSA 3SEZA 3IC5A 3V9AA 4BO0A 4BCDA 2ZT8A 4LBVA 4Q3BA 2IUTA 4X6LA 4ZQGA 5EMNA 2FW7A 1XTSA 3HB4X 2VP5A 1W7AA 4FOTA 2A5JA 1TAUA 3QHPA 2ZSAA 1REQA 1ZM4A 3OM0A 5EZ6B 2D2FA 1M6HA 1NBWB 4XIJA 3V00A 3NHBA 1IY1A 3FHLA 4Z1OA 3T06B 3F2VA 1Y63A 3MAAC 2W83A 1PO7A 2YXBA 1Z12A 2WJ3A 3RYHA 5AUOB 3IV7A 1A5TA 1DOZA 3Q9SA 1L4KA 4MV8A 3UNXA 3ZHCA 3VYSB 2FDXA 1UKZA 5KREA 1QG0A 3KP1A 3OOEA 4MZXA 1GGNA 5ENZA 2H06A 2WWFA 3PC6A 3PGXA 3O4JA 1QYWA 2P4HX 2YMPA 3VR6D 2D6FA 1OT5A 1RRFA 2ZI5A 3CG0A 5FHQA 1XZJA 3JVVA 4OA5A 3RSLA 3UICA 2VPWA 2ZG6A 2VQ3A 3OI7A 4L8YA 4AFNA 2XBMA 4Z0NA 3GX1A 2EGUA 3FOZA 2YTZA 4AS1A 4NFHA 5JPIA 4LN1A 1PI3A 5KJ6A 4HH3C 3D7NA 3HLYA 1X1EA 3P32A 4UXIA 5AKYA 1SWWA 2FF7A 3K4HA 3DAGA 4GX0A 5TJ9A 2Z8XA 3AI1A 3B3FA 2QU7A 1PGOA 1WHTB 3IA2A 4JZKA 4WKPA 4TXLA 1JFTA 4KQ2A 2UUAB 2X15A 1PDVA 2RH8A 4HBZA 4WCDA 2E0IA 1F1BA 1QNLA 1UMDB 2QUKA 2R6AA 3GJXC 4MRPA 5K0JA 4OI0A 4H3SA 3FHOA 2IF0A 2F3QA 1QYVA 2I7CA 3TGPA 4QATA 4RM3A 3MWKA 5CT9A 1K5DA 1AKEA 1YQEA 3LBFA 4GL4A 1DJMA 4ZVRA 5DFAA 1QOPB 1NMQA 2WOJA 5BT9A 4KYUA 4G9EA 4N9WA 4PAGA 4Q39A 1RYFA 4UVHA 5EXDA 4ZZ3A 1DWUA 1U0LA 2WYIA 1W0KA 2IX3A 3VJRA 4WZBA 3GEBA 2A5DA 3ZIAD 1JLMA 2Y1LA 2ZULA 3GLTA 4D5EA 2O2CA 4R0MA 4LVUA 3WAJA 3WJ2A 2DTDA 3RV3A 1HSZA 3ZW9A 2GI4A 2JW5A 4LF4B 5U1PA 1ODTC 2GF0A 3DBRA 1CLEA 3GPIA 4XYMA 3EIWA 1EFPB 1A88A 3OM9A 2RSLA 2R6ZA 2C0QA 3M4JA 4LGMA 4V0MA 3C6YA 2OMEA 3DNFA 4NS1A 4W9NA 2K2WA 3AESB 2WNHA 1NXOA 1O87A 4RETA 4ZEWA 1HDZA 4AMUA 3AILA 1DZ3A 3KPUA 3PL1A 2QQGA 4AY6A 1MXFA 2FMKA 1ML4A 3BMQA 4HXFB 4LCEA 2XDQB 3BA6A 2VZLA 4P32A 4WFQA 4WECA 4ZGWA 3KXIA 1LRJA 4PIPA 1SGWA 2AN1A 3T7EA 3TBHA 2XCQA 3G1TA 4RDHA 2GVZC 1R74A 2FETA 3FNBA 3KOZA 3CW9A 4R8KA 1EE1A 3UTDA 3UBMA 3HB5X 3HJUA 2AN5A 3OX2A 2M98A 4HGRA 1V47A 1MB0A 3AZPA 2NZJA 3UWDA 2Z2KA 2QTVB 4ER5A 3EVDA 2NV0A 1JB1A 2HXYA 3DDNA 1VYVA 2UV8A 1GQFA 5IC4A 5JASA 1GVNB 3PUHA 2PUDA 5JYCA 4R84A 3L7CA 1AKWA 4NX2A 3G6KA 4X54A 2CUTA 3R5HA 2GHIA 2OXRA 4I4CA 4AVYA 2ZIAA 2QX6A 3EF3A 1YR7A 2YZ7A 2DZDA 1GUDA 1IY0A 4PG4A 2IHZA 4F7DA 3RIYA 1J9GA 1PLJA 1DPGA 1P75A 2O2ZA 3AU8A 3F6YA 1DS6A 1RP7A 2Q4OA 1RXEA 4XPIB 1VCIA 4DAOA 4IDQA 5B30A 2RAVA 1J20A 1U0NA 1U7PA 2ZJBA 2ZW9A 2D54A 2Z6AA 3FZQA 3WHKA 3UA3A 3GXOA 3MUFA 4UBIA 5LQNA 5I9LA 3L1IA 1SWVA 1U1IA 3H1PA 1OYWA 1O77A 2PYDA 4KIWA 3GYBA 2BGRA 1YS2X 3BKXA 3H99A 1W6RA 1IXKA 1WD5A 4QBHA 4M89A 2F3TA 3TCNA 1I30A 1DBSA 4RTLA 2JK1A 5IYZA 4A23A 621PA 4B0PA 2I6FA 2LKDA 1I94B 1NVEA 1U3CA 3FWYA 1E3SA 3UC5A 2CC2A 3BCRA 3ZZNA 4XCVA 5EUBA 5CXUA 2IYTA 1WDWB 4P3XA 4IV8A 1T3GA 1Z7WA 2H3EA 3V8PA 3FLAA 3GDWA 2FQXA 1O6BA 4GLFA 4G0QA 4B6OA 1XKLA 3OPYB 5EJ6A 1W47A 1NFQA 3A28A 3E03A 5DXAA 1EZ1A 2YFYA 4NCKA 5FLEX 1FNSA 3DHNA 4KRXA 2IS1A 4BN0A 4HH0A 4HBGA 3HK2A 3PPYA 5HWSA 3MMZA 4Q4DA 2GYVA 3DCJA 3LLSA 4ZMRA 3P27A 4I9UA 1KFCB 5KYXB 1LBHA 1TZCA 2NNWB 4HAIA 2QE6A 2ZJOA 4UCFA 5DHQA 3KT3A 5C5IA 5F7OA 5CCBA 4KBGA 1XALA 2FWMX 1C7RA 1TEHA 3LCUA 2P8JA 1NX6A 1T15A 2G04A 2A0WA 2QOEA 3E81A 3NONA 2WQ7A 1K0FA 1E59A 1L3IA 4Y2VA 4B4VA 2XQFA 2BUAA 4GOJA 4N5MA 1QK5A 2XKJE 2YJ4A 2BMJA 5G0WA 1D2RA 4DADA 5I7OA 5GM2A 1WBBA 3IR6A 1UOOA 5DNAA 3C3PA 1DT5A 3GJ3A 1BDMA 3OOWA 4B4WA 1ZR4A 3N58A 3QA3E 4WUTA 4E4RA 5K3DA 4YB8A 3EIFA 2YDXA 3LHKA 1RI2A 4GYJA 1HEYA 3LWDA 1CJBA 2VF8A 3T7RA 1F14A 2IDZA 1OFIA 1VSUA 2QG6A 4EY3A 4GUAA 5BWMA 4EGJA 1RHRA 1NAHA 1WSWA 2O52A 2V1UA 2KJQA 1ZG3A 2XDYA 1DKLA 5C1OA 3AJEA 3ID6C 2CJWB 3EFOA 3B6KA 3H9EO 2CL0X 2FEWB 2FE4A 2PJUA 4IRUB 4B32A 3W9YA 2I2CA 2DGDA 4RCVA 1EUCB 3B1YA 3V8MA 3LL4A 4TYQA 4B8YA 4AF7A 4CMJA 3B6ZA 4GE3A 4I3GA 4OYLA 3CLHA 2JAQA 3E1SA 4Q01A 4CLDA 1SHLA 4KCGA 5JD6A 1JIKA 3BGSA 1DBIA 1M2JA 2XUQA 1GAWA 2I87A 2Z98A 2VDRB 4NXMB 3B78A 4QOSA 1Z4NA 2ZCVA 2XBUA 2IPXA 3T7CA 1GA6A 1N5DA 4AZWA 3UKJA 1JEOA 1ZWLA 3ZLJA 2B8NA 3KVYA 1OTHA 3DE7X 3A3OA 3UAXA 1HV8A 3PPIA 1I1QB 1QSGA 4JLSA 4I1RA 4OBWA 3JQ9C 4BZPA 4BQSA 2K7FA 3DLHA 3DQQA 1EUZA 1O97C 1N9GB 1TLTA 2F3PA 2QMZA 2XD4A 3DMTA 4PM4A 3MLEA 5FBRB 3UBTA 4IDDA 1D2GA 2FK7A 3FY4A 2G07A 2WM3A 4XM0A 1PUIA 5LLDA 1SZJG 1GARA 4PXYA 4C3UA 1PL6A 4O0MA 5CG2A 4CMKA 1ZYUA 3MAGA 4UHKA 4PR0A 1TNDA 2X6TA 4NKRA 2B8WA 4B79A 3CSDA 2W2OA 4UULA 1G1MA 2FWBA 1V11A 4A0RA 2Q1TA 1U1EA 1YGYA 1IHDA 1F51E 3B89A 1KYTA 4LZPA 1Y3HA 3H5RA 4PCLA 1OB5A 3AJAA 3O8LA 2EL7A 4YCNA 1C3OA 1NTOA 2J3QA 4B6PA 1EM6A 3AEQA 3U19A 2CWDA 3AVVA 1J8MF 3NC1C 1W4BA 4Q19A 1PZNA 1UIMA 2IYUA 1EG2A 2EFGA 3D3WA 2Q0XA 2MYPA 3JQBA 3JQ8B 3OU6A 4YONB 4Z7QB 4DY6A 3PQCA 5TPZA 2HSGA 2IS2A 3OZXA 2EZ4A 3HXQA 1E8DA 1WTCA 5CT8A 4ND8B 3C8DA 5AJZA 5T4EA 5CDYA 1U7DA 4FVTA 1NE7A 5A7GA 4C14A 2D62A 3KE9A 2ZI9A 3OQPA 3N7TA 3RBZA 3TN7A 4MKHA 3B12A 5GIOE 4GMKA 5L3SA 1FDUA 2AJ8A 5B3AA 1D6MA 5GINE 3P9XA 1PK7A 3MT9A 1A7KA 1ZY2A 1WB5A 1T0HB 3OPYI 4NH4A 2JGIA 1QZUA 2N47A 2QUJA 4NABA 2HHHB 1AKYA 5JBNA 5H3LA 3FYUB 3NC0C 4EY7A 1JHVA 2J3IA 3OH8A 4D25A 2CCJA 1ATIA 1SIWA 3HJAA 4GOND 3L0YA 2DPYA 4LMAA 3RM3A 4ZQEA 4GC9A 2IZ7A 1FTWA 1Q7EA 3EIUA 1CERA 2C5SA 4GPBA 5F3RA 1MQAA 5AVWA 5IVIA 4HVAA 4F6CA 4ATNA 4CMGA 4FMDB 2NWQA 1XCJA 1WDTA 4OREX 3MMNA 3LCCA 4P3OA 4ROTA 1OH8A 1HE3A 3ISVA 4MRNA 3OY2A 1JTVA 3RNOA 3Q7EA 3E58A 1XZAA 4B1FA 1UBJS 5CITA 3V4LA 3DV0A 1Z5WA 3OBIA 2OP0A 4WTOA 1N1MA 4FOOA 3JTEA 3JR3A 2FVYA 2BJWA 2JEOA 3I1FA 4CJXA 3K6SB 2Y92A 3NYWA 1GA4A 2W58A 1FTSA 1IBCA 2O48X 2FRXA 5BNTA 4BNXA 3PNKA 4F21A 1JQAA 3K1AA 4ZDWA 1YRHA 3UUEA 4PPFA 4FE3A 4CODB 2CDRA 2BSAA 2WF6A 2XUZA 1WMBA 2YJGA 3BREA 3DTVB 1TO2E 2QM3A 5CX1A 1R66A 1I1OA 2QX8A 1Z6XA 3DXYA 2F48A 5CH3A 3UO8B 3WB1A 5K6RA 5CR9A 3DHEA 4G65A 1IDOA 5ENDA 3NAGA 5EESA 7ADHA 2B0JA 1M2VA 1H2YA 3PK0A 1A50B 1SCAA 1X80A 2XF2A 3LUFA 1GTG1 1LK0A 4G0OA 3VU8A 1N78A 1XQ9A 2I3GA 4TS4A 2I76A 2M6RA 1J5PA 4Y6GB 1CQXA 2BKLA 3BH6A 4MVYA 2JLXA 1D0IA 1KK2A 1U7OA 1EXWA 1U28A 4XH9B 3L02A 3U4CA 2ZI4A 3EYAA 4UVIA 4HN4B 1P6QA 3EAGA 4KXUA 4HSGA 2HF7A 5TARA 3SM3A 1Y7IA 3ELBA