4ILEA

Structure of human adp-ribosylation factor-like 8a binding to gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
176
Chain Sequence
KLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 8A
publication title Structure of human ADP-ribosylation factor-like 8A binding to GDP
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 58
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ileA00
1Z0DA 4LV6A 2V8OA 1G16A 2GHIA 3PVSA 4JLAA 4KBGA 4URYR 1GRRA 4M9XA 3CZQA 3OIVA 2QGZA 3QF4B 1VG8A 4E03A 3ADBA 3QG1A 2C99A 4JJZA 2ZRFA 1YQTA 1Z0FA 2WVJA 4QBHA 1OB2A 2RCNA 4B3XA 4ZDWA 4Z54A 2ZYTX 4Q7KA 1GTVA 5KOYA 4A8JA 2CXXA 5DISB 5HKKD 2GZHA 2FPMA 2IYLD 3B9PA 1XPOA 4MUBA 2C9OA 4A6XA 4E5UA 4F93B 2NPIA 5L3SB 2O8BA 1TU3A 2QNRA 2VYFA 3H4MA 2IEYA 1NLYA 2QMOA 3HJNA 4C2TA 1H8HD 2VQSA 4OBEA 5EP1A 1GWNA 5EE3A 4LHYA 3EAQA 3AF0A 2NO7A 5JSZA 1GNRA 2W6ID 3UMSA 2D4HA 1TTTA 2NPFA 3VR1A 1CJUC 3OE7A 3IKJA 3BH0A 1E2JA 1SXJB 2QAGB 5JS8A 5IRCD 1BKDR 3DM5A 3L0SA 3IGFA 1NIJA 2WJJA 3KKPA 3OEED 3RSOA 621PA 2RGAA 3A58B 1UF9A 4RCYA 2P5TB 4LPSA 2D2FA 2YOFA 1S2MA 2FOLA 1ANKA 1EX6A 5CM8B 1BO6A 4Q02A 2IHYA 4A0HA 3GEEA 3LBIA 4FCTA 3GLIB 1T0HB 4U7DA 2MSDB 2R44A 2RGGA 4D6PA 3MWKA 2GZAA 2HXYA 4DT1B 4MGYR 3ZZUA 3CRVA 4EKDA 5FH9A 2F6RA 4FD2A 4V0LA 1JJ7A 1T3HA 2GJ9A 2ZSDA 3P26A 3PQCA 4X8MA 3SJBA 3WBJA 1D6JA 4G5OA 1N2CE 1ODFA 4F38A 3MJRA 4MYCA 4YC7A 1NBMA 4B33A 4BFVA 1OXVA 2IYRA 3CUEF 5FPHA 4V0ME 3I3SR 4FCVA 1EESA 1YHNA 2WKRA 4S2EA 2ZS8A 1KZ7B 1DARA 2J0VA 5HCNA 3FMFA 2O8CB 2W6JD 5CK4A 2IBMA 4PQYA 2D2EA 3T1QA 3QXHA 4D0LB 1XXHB 3KKQA 5FI1B 2CCKA 3SJAA 4M1WA 4CEHB 2F1IA 3QJYA 2BDTA 3AM1A 4TMTA 4NCHA 3VR5A 2GCNA 4FWIB 2ATVA 4CEIA 1N6PA 2ZRJA 1GKYA 5A4JA 2WKPA 2OCBA 1KK2A 1SXJE 5JJIA 1HYQA 1NMYA 3THYA 3QBTA 4KVAA 2Q0HA 4ERNA 4Q4JB 5JMTA 1YKSA 4RSGA 1AJEA 1DAEA 2CL0X 1ZC3A 2V54A 2ZJYA 3DDCA 3VR3A 5J4KA 1Z07A 2PZGA 1RJ9A 2J0UB 5DE3A 1RIFA 2DWOA 4JLKA 2AKYA 1L4YA 4PANA 3Q85A 3GLIE 3O8BA 3MCAA 2CDNA 1E69A 3EZ7A 1AS2A 3QKUA 4QNMA 1PLKA 1FQKA 2AKAB 4LHVA 3SFVA 1X3SA 2CL6X 1ZM4A 1CEEA 4D26A 3RYTC 3W90A 4JYBA 4KJZA 4UXJA 2PH1A 1W0JA 4BECA 1FNMA 3WYAA 1JXOA 5BYKA 4MRNA 2VBCA 4HUTA 2ZXUA 3AF4A 4YDSA 1JEEA 5HZKA 4EJSA 3HU2A 1KYIA 1DEKA 3B8HA 4MGZR 4FN5A 4Q21A 4B6FA 2KJQA 4Q19A 3VR6A 3UANA 1LTQA 1WMSA 2CVFA 2OSBA 3FWYA 4JL6A 4ZI2A 2H16A 4EFLA 2QBYB 2GEVA 3THOA 1ONBA 3NIBA 1E1RD 3RC8A 4KU4A 2R9VA 3RANA 2F1RA 3AP2A 2ZM5A 3L8YA 2QE7D 4RZUA 3RRMA 1TQ6A 4YXWD 3NDPA 4LYJA 1U98A 1XEWX 1KKMA 5DI3B 1E32A 3PEYA 2YJTD 4L9WA 2FFAA 4RZ3A 4MRSA 4Z8XA 1PZNA 5JECA 2QA5A 1CR2A 4F91B 2HEIA 2NGRA 3VHLB 1XP8A 2REXB 4A0FA 5M04A 4DRZA 2QTVB 3A1UA 3O8RA 1E9DA 3RVBA 3LX8A 4Q4LA 1X6VA 4TMXA 4YMVA 3P27A 4ON9A 1W4BA 4B3BA 1G7RA 3ICEA 4MYHA 5FUWA 2PLRA 2ZANA 4DLXA 3KDSE 5F98A 3HPQA 4RKEA 2XGJA 3U44A 1VPLA 2Q3MA 4YMTA 3RLFA 3C4JA 1KSJA 1E9BA 1NN5A 1NY5A 1OYYA 1KZGB 1PLLA 2ZRGA 3MGCA 4LCBA 3TW8B 2CMKA 5KPDA 3GLFE 1VKJA 1S3GA 1W4RA 5IK2D 2QRNA 1P75A 1IY2A 1TNDA 4OL0A 1CRPA 1KTVA 4NONA 5CLQA 1FNNA 4NDZA 4HZIA 4HZUB 2WICA 4G3XA 4QM6A 3MG9A 4URUR 3SJCA 2CLCX 4HDQB 3GFTA 4Z8YA 4IOJA 4TMZA 4B71A 4ESHA 721PA 4JLPA 2P5SA 3DOFA 4U00A 1W36C 3SDZA 5UKDA 4D4LA 1JBKA 2QORA 3GD7A 4WXPA 3KJEA 1W2GA 2O8DA 3O8CA 1XB2A 1CIPA 4DUGA 1GSIA 3LRPA 1W2HA 3TLXA 4C2UA 2IS6A 3IO5A 2ATXA 2ECKA 1KJWA 1FP7A 3X1XA 4AWXA 1KMHA 4A2PA 3AVUA 3HYRA 3MLEA 4FI3C 2BC9A 5DHAA 2EQBA 3U7EB 4PO9A 2C2HA 2FGKA 1SXJD 4OKSA 4X8OA 2ZITA 1TQDA 2N46A 4GMXA 4G5RA 1OE0A 2GEUA 3VKGA 2Z4RA 1QHSA 4RD3A 3EC2A 4W7SA 4A8JC 4JZKA 1MR3F 2FNAA 1OJLA 5FPKA 2N1BA 1IY0A 3HYTA 1VIYA 1GFIA 3LQQA 1M6NA 4B32A 5KHOC 1FX0A 4LJ7A 4ZI3A 4KXFB 1WB9A 4LJAA 1T5IA 3BB1A 3IQWA 4LY6A 1VCOA 4N1AA 4PPGA 1IJEA 1Z8FA 1WBBA 2DB3A 3CX6A 3T12A 3R7WB 3W34A 1RRCA 1XU4A 4EPRA 5LPNA 2ZR0A 2JATA 1Z0IA 2XJ4A 3Q72A 1R2QA 2GXAA 3TRFA 5EZ5A 1M34E 3LO5A 4RCZA 3RSLA 4URWR 4YLGA 4HAZA 5D3QA 4GBMA 3QPWA 2GVZC 1Z5ZA 1UADA 3RABA 2QMHA 3G5UA 3MAAC 4XWOA 4P33A 3AKYA 2G88A 1A4RA 1ZNWA 4IHQA 4TSFD 4AYWA 4URVR 4WAUA 2D7DA 1Z47A 4P4UA 2BOVA 5AJYA 2PX3A 2PJZA 2MMGA 4AG6A 3FYHA 3U3MA 1T8UA 3HR8A 5J4YA 2VP2A 2ORVA 3CX7A 4QNRA 4P4TA 1BOFA 2CL7X 1J2JA 2UZ3A 4MRVA 3MWLA 5FOXA 1E2HA 2ZUBA 2C5LA 1Z0KA 4YMUA 2JLSA 2EYUA 2OAP1 1W4CA 2ZROA 5SZKB 4PAOA 3K0AB 3KXLA 2WBLC 1COWA 1ZM3A 3RWOA 4M1SA 5HE8A 3T1TA 1S1CA 3EZ9A 4D4MA 1RC8A 1VCIA 2A7QA 2EFDB 1NY6A 1R8SA 3K70C 2OCPA 5HTKA 2Z0MA 3GJXC 3RRYA 3CF0A 3VNVA 3DZDA 1I4LD 2ZJZA 3C15C 3FMOB 1NVUQ 4IDPA 3B6EA 4Z1MD 2PLFA 1E2LA 2BIFA 3BD9A 3CKLA 4QJ4A 4EAQA 3B1YA 4MDFA 2ZRHA 3E5HA 4QL3A 2ZRPA 1II8B 3SJZA 3VHXA 3LH5A 2ZJAA 2XXAA 2Q6TA 5DGXA 2QP4A 2ZI7A 2IYYA 3TSOA 2MSCB 3FKSD 5TVKA 2ZI3A 4B35A 4Q5IA 4LSGA 4TLAA 4XWKA 4BPBA 2G83A 4IVPA 1F2TB 4EPYA 3BS4A 4IOKA 2RAPA 4TLCA 3FTQA 1KSFX 3SC3A 3GLGB 1CULC 4Q9KA 4EIWA 4JJKA 5E95A 4EQ6A 2FN4A 4Q9HA 3ZS8A 1HE1C 2YWGA 3UIEA 1J70A 4EJSC 1Q12A 2R6CA 4LJYA 4EUNA 4UJ3A 3LQRA 4JIMA 3DL0A 3IPXA 1CJMA 5BWMA 1AQUA 1SZPA 1N0VC 2DY1A 2Q9BA 1U2RA 3FFAA 5AUNB 3U4QB 1L7VC 1QHYA 2W2TA 1GM5A 5DI9A 5B64A 1XX6A 2OE2A 1A7JA 3DO6A 1U9IA 3KTAB 2P2LA 2WWYA 5IT5A 2GTPA 2O8EA 2GRJA 1R4AA 5HKKA 1XJQA 3AB3A 3LDAA 2VP9A 3ZVRA 4V0OA 1Q0UA 4V0KA 4AYTA 2W58A 3B1VA 1EFRD 1G8FA 2FPLA 2ZUDA 3ADDA 4WA7A 1ZAKA 1UBFA 1PLJA 4H1UA 1KK1A 2CE7A 3SYNA 1H8HA 4ACBA 2ZRKA 2IWHA 3QY0A 1E98A 2W6IA 4TL6A 3EWAA 5CK5A 3U3OA 4IKEA 4DDTA 1J90A 3OF5A 4JKYA 3AEZA 2A5GA 4MDEA 1ZCBA 3GLGE 1BMFD 2J9RA 5GJWC 3EWSA 2GA8A 3OEEA 4GFDA 5EP2A 3ZQ6A 4DLYA 4LGMA 1AKYA 5FPSA 3K8YA 2BM1A 2BM0A 1KO5A 3NHBA 3UMFA 1H8ED 2CLDX 5KNDA 1AS0A 3PR1A 4D0GA 4FW9A 2MMCA 1WP9A 2ZREA 4LV8B 4TMWA 2QT1A 2FSFA 3MUFA 3F5FA 3PXGA 4DLUA 3A1VA 1ZUNB 1MO3A 3TJZA 2EVWX 4MKIA 3CM0A 3IHLA 4XSGA 2NG1A 5EP3A 3CBQA 5E7IA 2R2AA 5CDFA 4UNQA 2OLKA 4AC9A 4KYUA 2WOOA 3AVQA 4W5WA 1CJVC 3VU9B 4K46A 1Z2AA 1Z29A 1AS3A 1OH8A 3WP1B 2FEMA 2YV5A 2W6JA 2ZJ5A 1GDDA 3FFBA 1C9KA 4XIGS 3PG5A 4B6EA 5L3QA 1IBRA 1KO7A 2FEOA 2LKDA 3ZLJA 3ZDQA 4C0BA 4HAYA 1U8ZA 3DKPA 3ADKA 4AD8A 3OIUA 3SYLA 4DSUA 2R6GA 2ZQ5A 2GCOB 3I32A 4LHXA 1SULA 2CJWA 4WVFA 5J4LA 2V1UA 1OFIA 2O5VA 2V3CC 5JWHA 2P0EA 2GJAA 2X2FA 3WYGA 1OF1A 2VP6A 3I72A 2WHXA 2QTFA 3B2EA 5FOSA 4TYYA 1Q57A 1TF7A 1E2DA 1G64A 4QM7A 2JLWA 4HB2A 4XWAA 2A5JA 4QXAA 3CH5A 3ZIAA 2ZTSA 3AF1A 3FB4A 1E94E 3TW4A 1GL6A 4ILEA 3EG5A 2ZETA 5SZHB 3R8CA 1W48A 4KSBA 1MABA 1A2KC 1NLZA 4UXIA 3P1JA 4BUJA 4PZZA 3RWMB 4EDHA 2G3YA 1QHHB 4Q48A 2VSFA 3BIFA 4BLTA 1F60A 3QI2A 2CEAA 4PC1A 1FTNA 1NIPA 1Z2CA 3ZD6A 1TQ2A 4X8LA 4ZKDA 4QHYA 4FMDF 5TMPA 4IDQA 1OIWA 3CZPA 3UG7A 1FQJA 3Q5DA 4BEBA 4A92A 2NQ2C 2OBMA 1T3LA 2W0SA 4Q4HA 2ZU6A 5EE1A 2O52A 3A36A 4KAXA 5E3HA 4BE7B 1E2NA 3SZRA 3KQUA 2ZUCA 3RS0A 5TY0A 3AVYA 4GDFA 3W5JA 1Q22A 4TZ6A 1GG2A 1N5KA 1ESMA 2YYZA 2ZS9A 4TMKA 3OEHD 2O8FA 4UKDA 1E1RA 3M6AA 2F3TA 3RRNA 4E22A 2UZIR 2I1QA 4PQFA 1VECA 3D6TB 1G1MA 1M7HA 3RS7A 2NMVA 2J1LA 4F4CA 3QVVA 2Q9CA 4XJXA 821PA 4LOAA 1M74A 1OYWA 2GDJA 2QE7A 2VRWA 1OXXK 1SKYB 5AJXA 5C4GB 3MD0A 4JVMA 2VEDA 3OHMA 3QPUA 4YXWA 3B78A 4DDUA 1ZNZA 3VKHA 4EPTA 2IC5A 5H1YA 2QP3A 4QKQA 1NRJB 3BE4A 2DFNA 2OFXA 2VLIA 4TLEA 4C9BA 3QKRB 4XVUA 2GBLC 4U02A 3RC3A 1E9RA 2IEZA 2JAQA 2EFGA 3KUDA 5EZ6B 1KY2A 3QXXA 2C9YA 3U7GA 4B3DA 4GNKA 1Q1ZA 1LVGA 1XPRA 2HXSA 5FPTA 3ICQB 1VIAA 2REBA 2ZJBA 3EIQA 4B3CA 2DR3A 1FTSA 1P7CA 3PV0A 4B3GA 3HU3A 5FOUA 1FMJA 1HURA 1DOAA 2OXCA 1TMKA 4QG7A 3QOFA 1Q20A 4DCUA 3THXB 3K0CA 2ZSAA 4M9SA 2ZVQX 3C5HA 2G6BA 3L0PA 3QF4A 4IDHA 4PXAA 1Q1EA 2H5EA 4PAMA 5G53C 4DIDA 4OQFA 5IK2A 1N6RA 4POAA 5EUQB 5B58C 1JALA 3GJ7A 3FHTA 1JB1A 2EFEB 1FP6A 3BB4A 5FTKA 4UJ5A 4DCSA 4V0MA 3QXSA 4V03A 3ZVLA 4QBGB 1VYTA 5DLQC 5D3MA 1NN0A 3TR5A 1OIVA 3IQXA 5L3SA 3QKTA 5AUOB 2JASA 4A4DA 3LAWA 1ZD8A 2VHQA 3UPUA 4NCIA 4CEJB 4DKXA 3QSYA 1JPJA 1RKBA 3SHWA 1M2OB 1AN0A 1Z22A 4HDCA 3AVVA 1Z3IX 4O0MA 3V9PA 1RFLA 3MFYA 5C2JB 3AKDA 5BYJA 3QXJA 2ERXA 2XB2A 1IXSB 1SXJA 1U9IC 3BORA 2QAGA 3VKWA 4RFSB 1AZSC 2RB4A 2RGNA 4TTQA 1DBSA 2QT0A 2HT1A 1CJTC 2AN9A 2YKGA 2ORIA 5SZIA 5BN4A 1IJFA 1NVXQ 1P9WA 2RGBA 1XTJA 1UBCA 4KFSA 4NTZA 4US0R 2VHCA 3GLIA 1D2MA 2YWEA 2HV8A 2PCJA 5E7MA 3ZD7A 2W83A 3LNCA 3NC1C 4DT1A 1TUEA 3BB3A 3PEVA 3BXZA 3TH5A 2O0KA 5DN6D 3EXAA 5HPYB 1ZIOA 4KCGA 4TN1A 3VR2A 1VG9B 1Z6XA 1P2VA 4D4KA 4L9SA 5HCIA 2JLZA 2YC2C 2NTYC 4P0TA 4BRUA 3RDPA 3AP1A 4EPXA 2IS1A 3CIOA 3AH8A 1I2DA 1KKLA 2ZRNA 4MH0R 2WIBA 5AJWA 3DM9B 3CWZA 2JCSA 2XOKD 4OI2A 3T1OA 4Q00A 2IS2A 1K5DA 3OIWA 4A36A 4IDNA 3R20A 3T5DA 3MWJA 1FUKA 3ONWA 1TF2A 4Q01A 4UNNA 2NO0A 4MGKR 3NC0C 4MKHA 4TSFA 3PEWA 1XXHA 3LXXA 1S1MA 1G41A 5CB6A 4HLUA 1IN7A 3I1FA 1ZINA 1US8B 3DPUA 3MWYW 5FI0B 2BVNA 4HB3A 2G1JA 5FPYA 1DO0A 4EFNA 1TADA 5L8VA 3Q7PA 1U94A 4FMCF 1T91A 1TPZA 1XTKA 2GEDA 4IVRA 1UAAA 3WHKA 1II0A 4DCNA 1NLFA 3T5GA 2XZLA 4NBSA 4TT3D 3U6BA 4Q4JA 3KFVA 3IIKA 4OI0A 4TYQA 4CGZA 3NXSA 3W8NA 4DLWA 3EPLA 3B1XA 3Q3JB 4ZCLA 5J5CA 4OHYA 4R71A 2FV8A 4QFMA 2O0HA 3IBGA 2L0XA 1XEXA 2OILA 4BZPA 3PENA 3SFZA 3DMDA 1JAIA 3AVPA 1G7SA 4F4IA 3J81k 1P5ZB 2EWWA 1D2EA 3PUZA 1W44A 1B23P 2QPTA 2ZS7A 4NCJA 2F43A 4GOKA 1I4DD 2GJSA 4G0NA 4JL8A 1QHNA 1FOEB 4XVRA 4LUCA 4JVSB 3CF2A 1G5RA 4NPHA 2A5DA 3WMGA 3D31A 5JS7A 1HT2E 5KNBA 6Q21A 2OFOA 4TL7A 4BFTA 3LX5A 1NSFA 1HEIA 2CNWD 2E9SA 4I1UA 4L15A 3LLUA 4LYHA 2AR7A 4M1MA 3B1WA 4XH9B 3SBEA 4DWJA 5KTYA 2OBLA 2OV2A 4L5BA 2H57A 2RHMA 5EE0A 5H68A 5ELXA 1HE8B 2FWRA 1X1SA 2PMDA 4NZYA 2J59A 3FKSA 5A5GA 4R7ZA 2F55A 3RHFA 4OI1A 2QBYA 1DAFA 5DO9A 4A8JB 2ANBA 4P3YA 3RS4A 3CPEA 2F7SA 4XTCS 5EP4A 2ZRDA 3AKCA 3WBKA 4NCNA 2FGJA 3W3ZB 3A6PC 2FDCA 3FVQA 1CJKC 2KE5A 3WP0A 2O8BB 1MO4A 3CNOA 1QBKC 5TXGA 1T8TA 1JQLB 2IYSA 3L8ZA 5HR5A 5B2ZA 4UNRA 1U0JA 4OQMA 5DI3A 3VTKA 3O8DA 5JSZB 3ETLA 2C98A 3EPJA 3QG5A 3SNHA 3TUJC 3DZ8A 3FKQA 4OJKA 1YVDA 1QRAA 2IYZA 4TTPA 4C0JA 5LD2B 3EA5A 4Q9JA 1IY1A 3P20A 3KQHA 4LBZA 1B0UA 1K8RA 1N3BA 1Z08A 3SS8A 5KSZA 5IDVA 3VX4A 1S3SA 2P67A 2QGNA 3CR7A 3EIHA 1DELA 2HYIC 1KO4A 5GJVC 1JEDA 1H65A 3PEUA 2F9MA 3PJRA 1LS1A 1E3MA 4IRUB 2XNSA 3S1AB 3ZH9B 4WXRA 3GLFB 1EFRA 1SGWA 2B6HA 2BBWA 2ERYA 4DLZA 4Q1CA 2BKUA 2X1VA 1A1VA 2WJYA 2QQ0A 3TVTA 4HZUA 1QG4A 4BFUA 3E1SA 4H1VA 1HQYE 1G20E 3CH4B 3EPKA 4M2LA 3MJHA 1FFHA 4KLZA 4BFSA 2IK8A 3GLHB 5CYPA 1E9SA 2J87A 4BQSA 1DAGA 1GILA 1OHHD 1BMFA 5G40A 2WSMA 4RD6A 5FUVA 5A0FA 1RYHA 2XTNA 4LJ4A 1S9DA 3CB4A 3WMFA 3I61A 3K70B 5CB8A 3EC1A 3KB1A 3K0CC 3U2QA 1CKEA 1H8EA 4QRHA 4C0AC 1QZXA 1TEXA 2QMEA 1NMZA 1Q1BA 1VG0B 1W0KD 5JJKA 3FMPB 4ESVA 4V0NA 3WXMA 4BFZA 2ZRMA 3C41J 3FHOA 1TQ4A 5LB4A 3SI7A 1NVWQ 2AWOA 3N2IA 2UKDA 1NKTA 1ZIPA 2Z5FA 2B7BA 2IYQA 4K81B 1XZQA 2JDID 2VH5R 2ZSEA 1XNJA 2ZRLA 1GOTA 3GQBA 2R62A 2JLXA 1G3UA 1EWQA 1VMAA 1N5JA 3SBDA 4D81A 1N6NA 2SHKA 3LWNA 1QDEA 4F7WA 3GCGA 3R7WA 1MRNA 3TVDA 5EQTA 1KI6B 2OG2A 3I92A 1SXJC 1NBME 2QAGC 4DSOA 1XMIA 4YMWA 3UKDA 1UEJA 2RGNC 4QBIA 1KI2A 3GLHE 2GF0A 1E2MA 1P9RA 1U90A 2PJRA 4ZDJA 2ZSBA 4AKEA 4IEEA 2FFQA 1IHUA 2BMFA 4NKRA 3U60B 4OYHA 1UJ2A 4OHZA 3T06B 5JI3E 3T15A 1R0ZA 4P4SB 2C96A 4TYPA 2IL1A 3U6KA 2E87A 2FPKA 2WWFA 1P73A 2C78A 1SVLA 1U81A 4RY2A 3UG6A 2HDNB 1S8FA 5EE9A 2WAYA 1OB5A 5FTMA 3SHFA 1P6XA 5K8LA 2GWHA 2XZPA 4ZCMA 1N25A 3AKEA 5JHGB 2NOAA 3IIJA 1GKIA 2QPOA 1DS6A 2EFCB 4QHTA 2IXFA 1KIMA 2NZ8A 2PMKA 3U7FB 2YHSA 4ACAA 1DE0A 1XTIA 3LBHA 1K6MA 4HLUC 2ANCA 3QKSA 2J7KA 3N5CA 2PL3A 1K5GA 3K53A 3I73A 2GKSA 4M4SA 3OEHA 1BS1A 3BWDD 4CF7A 2IA5A 4Q9LA 1JR3E 2OUKA 2JLUA 1GNQA 2ODNA 3WNBA 1U8AA 1ELOA 5G3YA 1P3JA 3D8BA 1II8A 1VG1A 3EZFA 4GI7A 4A9AA 2VHJA 4I1SA 1XCMA 1E79D 2BWJA 4O25A 1F2UB 2KWIA 1GITA 1J7KA 2RGXA 4CYMA 4NMMA 2WV9A 2H92A 3V00A 4NL4H 4OJQA 3L82B 1T6NA 2AL7A 3ND8A 1F2TA 4MRPA 4NCKA 1R7RA 2YINC 4WIAA 3E2IA 3Q5EA 2VL7A 1FPMA 3BOSA 4OHXA 2GETA 2QUZA 3B9QA 2GJKA 3LLMA 4LC1A 3U5ZB 1GKUB 4PPQA 5KSOA 4DEXA 3CW2A 3FPAA 1UKEA 1DTSA 1G21E 5C18A 4DLTA 5TB5A 3PUVA 2BCGY 2QM8A 2G0TA 3CPHA 2BCJQ 1YR8A 3DKVA 3U4QA 2J5XA 2JJ1D 3EASA 1YR6A 5EXSA 2DWQA 3ZQJA 2P65A 3K0FB 1XD2B 1KDRA 3K9NA 4OQNA 1E0SA 1E0JA 1Y3AA 4RVCA 3KTAA 4OQLA 1RZ3A 2ZE8A 2QSZA 3THWA 4Q4AB 2OM2A 2D06A 4PPNA 5GJBA 2QL6A 2WAXA 2XJ9A 1CR0A 2CCGA 2HF8A 2JJ8A 3QPVA 4A2WA 2V55B 1Z28A 1ZUHA 1UPTA 2R6FA 4JYCA 4PAQA 1N6OA 3NTUA 1CR1A 4KI0A 4DC9A 4F92B 3RS2A 1EFTA 3A8TA 3T61A 1VCNA 5DYIA 1I4TD 3K09A 1AQYA 4Q7MB 4LPKA 2FH5B 1JXMA 1G7TA 2CHQA 2I1VB 3A4LA 5JBQA 1WQ1R 2H8KA 4E07A 3A4MA 3L43A 3PITA 5DIFA 3V4RA 2OO7A 3B85A 2WWWA 1UKZA 2VP5A 1TF5A 3IILA 4AK9A 4DDWA 2AD5A 3B1ZA 1NL3A 4JSYA 1NN1A 3QE0A 5B57C 4CIDA 3W6OA 4AI6A 4UNSA 3QF7A 4KFTA 2DFKB 3PUWA 2OLJA 1GL7A 5DSZA 2PCLA 2GNOA 3K70D 3ZS9A 1VYUA 2BEKA 2ZR7A 3EIEA 2G9NA 2AFIE 3GJ8A 1KI7A 3WRXC 1YRBA 4KSCA 1KY3A 1EFUA 4QJ5A 2VIIA 4URZR 4XSHA 4NP6A 4GMDA 5C46F 1LB1B 5DN6A 3LV8A 3CR8A 5JWRA 1G5PA 4I4LA 4DXAA 4ASUD 3IDQA 2QMUA 2ODBA 3ZGXA 3AGQA 3L2OB 1SVKA 2GCPA 1N0WA 4WBSA 5HZHA 3IEVA 1MO6A 4JLBA 2TMKA 1DO2A 2KSQA 1AA9A 3VAAA 5JRJA 1MH1A 3BFXA 3VU9A 1P9NA 2XOKA 3K9LA 1DVRA 4PHTA 3KZ1E 1T0JB 4YQFA 1Q21A 4AY2A 1CBUA 2P6NA 5H70A 1IXRC 3C8UA 3G82C 2QEQA 4CT5A 3EZ6A 4PZLA 4B47A 5FL7D 2GK6A 2C03A 1F5NA 3ZZTA 1JR3D 1MOZA 2H17A 5FBLB 3LVQE 2J7PD 1NF3A 2ONKA 2REOA 2GCOA 2VHTA 2ZYUX 3GP8A 2UVQA 1KNQA 4TT3A 1OXUA 2LWIA 2ZR9A 4GRAA 3A1SA 1P61B 4GSYA 3V4FA 4DHEA 4PSKA 4D2IA 3DOEA 3PCRB 1OIXA 4TQAA 2FZLA 4IFBA 1W49A 3CONA 3KB2A 4Q7LA 3QBVA 1KNXA 3ASZA 2AXPA 3BFKA 2FMXA 3AF3A 1KK3A 3JVVA 1X8LA 3K0EA 1MO5A 5KO2A 1EWRA 1E0AA 4HDOB 1AK2A 4ARZB 2X19A 4FIDA 3SEAA 1E2FA 2J3EA 2FFHA 2ODEA 2V1XA 4JLMA 3C5CA 2IS4A 3U3JA 2AX4A 1QHHA 5F2EA 1PJRA 1ZM7A 1RW4A 5KU1A 4ZPXA 1EGAA 5EXPA 1J99A 3TSZA 1V43A 2CNWA 1W4AA 4HUQB 4QGAA 4D0NA 2RGCA 1L8QA 1OT3A 4TLBA 1YZTA 3I5YA 1Z6AA 2W00A 3R8FA 5P21A 3LW8A 5JRZA 5FOVA 1SVSA 2FSHA 4RKFA 4TYWA 4D25A 4D80A 1G291 2O8EB 2QPAA 3IUYA 4JT4A 3K9HA 4IJMA 3FMIA 4A82A 4KFUA 3K9GA 4TL9A 3ZVNA 2PT5A 2YZ2A 2XX3A 3D3QA 4ZKEA 4B74A 2A78A 4A0RA 4E09A 3UMRA 2PEYA 1CLUA 5SZJA 1XMVA 3WRYC 4C30A 3SR0A 1RYFA 5G41A 4M0LA 4GP6A 2C77A 3TBKA 4GZLA 3WYFA 3NVAA 5L3VA 3IHWA 4IEIA 1UM8A 4ZO4A 4G5SA 3QKRA 2IYVA 1R5OA 3KXKA 4BGDA 1YZLA 2AK2A 2IUSA 1CF4A 2Z6VA 3VMFA 2XZOA 3VR4A 1WA5A 5AUPB 1WXQA 2I3BA 2RGEA 2YWHA 3OAAD 4BZXA 2GF9A 4PX9A 3CRMA 1KAOA 4W9MC 4HAWA 2JEOA 4OQXA 3CRW1 2PZEA 3AV0B 3QENA 3F0TA 3C14C 1CP2A 2OHFA 3MMPA 1RRFA 3THXA 5JFGA 2JIZD 1S96A 3KXIA 2PZFA 3UK6A 4EPWA 1GL9B 4BLQA 3L0OA 3Q8XB 4RD1A 1W5TA 1VHTA 2RGDA 4MUAA 4YMSA 5FR1A 3EA0A 1OSNA 2C8VA 2HLDD 3TK1A 2DFTA 4PC3A 3P32A 2JA1A 1YRAA 2V9PA 3W3AA 4FINA 1IM2A 1X8JA 2ASEA 2DBYA 2R6AA 1GUAA 1Q1QA 3I4LA 1OHHA 2RHDA 2XNDD 3F3YA 3JZAA 1IN6A 4QC2A 3AQ4A 1VYVA 3DHWC 1X8KA 3MSXA 3R9XA 4JL5A 4Q66C 4O3MA 1R6BX 3H0KA 1AGRA 2CK3D 3NH6A 1RPZA 5AJZA 4DSTA 1HA3A 1KI4A 2A5YB 3CNLA 4NYIR 4DLVA 1ZD1A 5CYOA 1II9A 1W0KA 2WWXA 4FWTA 2BV3A 3I5XA 4RFSA 1D9XA 4LBYA 4M1TA 1YJ5A 2WPDD 2FFBA 2NO9A 8OHMA 4GP7A 1KJZA 4XTRA 1F48A 2WJGA 5J40A 1M1YE 2XEXA 5FOTA 4TWZA 3TUIC 4RJLA 1QHIA 3UWKA 4R2HA 2JDIA 2VO1A 3GJ0A 4AKHA 4A15A 1E4VA 3VQTA 4FXPA 5FBVB 4AYXA 2V7QD 3K09C 4U5XA 2V6JA 3JZMA 2QRZA 5ANRB 3HDTA 4C7OB 2ZU0C 3HR7A 4GPTA 5DYGA 5FFMA 2FSIA 1MABB 1Q44A 4HSEA 1VTKA 3T34A 4KYIB 4BLPA 2BMDA 4FCWA 4R9UC 2F1HA 1VDZA 1E99A 1SVMA 3H84A 3GJ5A 1ZMXA 3CNNA 4UQOA 4C0SA 1G6OA 3W5IA 3JVUA 4L4UA 1ZU5A 2H1LA 1BIFA 4KHZA 1OXSC 3W9YA 2EYQA 4Q1EA 4HYYA 5H8WA 1RE0A 1IXZA 1E2QA 3Q7QA 2JJ2D 3C7KA 4JLDA 4N0EA 4KBFA 4IXMA 2BJVA 4LBVA 1IOZA 4P32A 1IN5A 3Q9LA 3AVWA 2Q21A 4DIEA 2Q3HA 1JR6A 2XTZA 1IONA 1O87A 1R0YA 4XD7D 1KO1A 3X1WA 1E2PA 1T5LA 1LY1A 2J45A 4PC2A 4B73A 4Q7JB 1EX7A 2ODWA 3RRZA 2DYKA 1G8PA 4PHFA 4IDOA 4A0GA 4B2LA 221PA 1Z83A 3IEUA 4MA4A 2ORWA 3BH6A 4WW0A 3QXCA 2A30A 1VHLA 4PFSA 4PHHA 2WM9B 1G18A 2DPXA 2IXGA 1EFHA 3BK7A 1BYUA 4BFWA 2AD1A 2MSEB 2QU8A 4WZAE 1G3MA 1AKEA 2AXNA 3BH7A 3U7HB 3WNCA 1KGDA 4LHZA 1YR7A 4JBXA 3CX8A 4WZBE 1NSTA 3ZZ0A 2OFWA 3QEJA 1SVOA 2G1KA 2ZRBA 4DZZA 5AWFC 3TUZC 5BQ5A 4HAUA 3REFA 3RNLA 3BAFA 1JJVA 4NYJR 2O8CA 5EJEA 1SHKA 4NYMQ 2WJVA 3CPJB 4FMCB 1E79A 1YR9A 2GAOA 121PA 1QVRA 5FR2A 4CEHA 2FSGA 2IYXA 1KJYA 5KNCA 4BFXA 1W1WA 3X1YA 1HH4A 3PUXA 4ABYA 1BYIA 4BLRA 5EXXA 5D3MB 2NO1A 4S35A 4NU0A 2J0QA 1QVAA 2OXRA 3IO3A 4JVLA 2F9LA 4ZDKA 2FE4A 2YWFA 2B8TA 3NEYA 3TQCA 4ZV4A 2J0UA 2WWGA 4C0LA 3FOZA 4A1FA 2RKOA 3AP3A 4JVNA 4RFVA 1G8HA 1NNEA 1WCV1 4M1YA 1ZCAA 1TUIA 4GOJA 4ZIRB 3KFXA 1LF0A 5AJVB 4CW7A 5CITA 2JJ1A 1W36B 3EPHA 3KX2A 5J47A 1KI8A 5B30A 3BERA 4QGHA 1R5NA 3ZYCA 1O3YA 4Z1MA 4M9ZA 5KSPA 2P6UA 1ESNA 1OH5A 2NIPA 2ZEJA 5J4HA 3M4YA 1SHZA 1V5WA 4KLNA 2IX3A 3OZXA 1IN4A 1XTRA 2ZRIA 1XD9A 5FTJA 2Y8EA 4IVQA 3UATA 1OKKD 3S1AA 1OV4A 3GLFA 1XCPA 3FHCB 2WJHA 5LBIA 1CXZA 4PSVA 5IF9A 1PV4A 1W47A 1NG9A 3BBPA 4Q1DA 1JPNA 1OFTA 4NYIQ 2X2EA 2V6IA 5EE5B 4Y0VA 5FBRB 3EARA 2CHVA 4PR0A 4KO8A 4JS0A 3REGA 3U61B 3WMEA 3MRSA 2YVUA 3HU1A 1N0UA 3HP1A 3O47A 4G5QA 2Q3FA 3GLHA 1E1QD 2OAQ1 3NEJA 3X2SA 4EFMA 5JHHB 1NMXA 1HT1E 1UDXA 2WJIA 4I81A 1E0KA 2BBTA 3FDIA 1SQ5A 4IXNA 5CIWA 3U3KA 3QQ5A 1F3OA 3F8TA 3A1WA 3CO5A 1EFCA 4PO8A 2BJWA 1ZVQA 2JLYA 3TGPA 1OFUX 2B8WA 3OFND 1UDWA 1NP6A 3A4NA 1XCGB 3SE0A 3SQXA 4NH0A 1N5IA 1G6HA 4JBYA 2EW1A 1Z0AA 1WRBA 2N42A 3UXMA 4BASA 1ZW6A 1CR4A 2OZEA 4DEYA 4JLVA 2B21A 1GZSA 2FZ4A 2GK7A 5CJ2A 3TIFA 2A5FA 1CS4C 2ZI6A 2GAAA 2D3WA 1E9FA 1OFHA 1CU1A 2X77A 4ASUA 1KO8A 3ZIAD 1QF9A 1YZKA 1KAGA 4AG5A 1XEXB 2KBFA 4OHWA 1QHGA 3CWQA 4DSNA 3U3RA 1NVVR 2BBSA 2ZRAA 1M7BA 2F43B 3PFIA 5KYKA 2ZRCA 2FA9A 3G0HA 2IW3A 5GJCA 5AK0A 1E9CA 1KI6A 4I1OA 5FL7A 2ZI9A 2QG6A 5J4VA 1ZUIA 1JR3A 4NHOA 2FF7A 2QM7A 3GPLA 2PEZA 1G9XA 4I1VA 2EFHB 1WBDA 5CJPA 1EXMA 1TL7C 2GVDC 2ZJ8A 2XSZD 4CVNA 2IUUA 2J7PA 3EW9A 1NJFA 2BKEA 4YDHB 2R8RA 4M53A 1G3IA 2C95A 1XXHE 1IAQA 2XITA 4I99A 2B92A 2VF8A 1ZD9A 3NBXX 3M0EA 4V02A 3R9IA 4CEIB 1TAGA 4AURA 1TX4B 4LX0A 5JI2E 1XTQA 4P4SA 2YOHA 1ZBDA 2AFHE 4BWYA 5DNYB 3HWSA 4J0QA 3THYB 4QJ3A 1MRSA 5FTNA 1DAIA 1R0XA 1YZQA 1NN3A 1YE8A 1YZUA 3GMTA 4ZDIA 5TDHA 1KMQA 1YU9A 1RJ9B 4NYJQ 1F6BA 2NZJA 2NO6A 2IYUA 1JQJC 1SVIA 3CF6R 3PIRA 1J8YF 2ZE6A 3GEIA 2VA8A 4GOXA 3X1ZA 5JCPA 2AWNA 4US2R 4MYTA 4OHVA 2VP0A 4MITA 3KQKA 521PA 1A82A 1XJ0A 3QVUA 3T1VA 1XPUA 1T4GA 4Q1AA 4PO1A 1W5SA 1G17A 5KUTA 3NBFA 4TZ0A 4N0DA 4L16A 4NE2A 1G8YA 4EJSB 3GJ3A 3KJHA 1R8QA 1OH6A 2VSOA 1KOFA 3BC1A 1Z6YA 3NKVA 1RRGA 4JMPA 2ZJ2A 4IW3B 2P6RA 3KKNA 1MKYA 1F2UA 1G5TA 2C9CA 1WDTA 3KL4A 5C4MA 5K8TA 4FMBB 4RZXA 4KFRA 1UKYA 3IPYA 3H2YA 1TU4A 4AIIA 3K1JA 4CDGA 3LXRA 1GRNA 1W7AA 2DCUA 3IIMA 1ZJ6A 4PSAA 2J41A 4HLDA 2GXSA 2OEPA 2WKQA 3OAAA 2PX0A 3QEOA 5JJLA 3DEFA 3BRWD 1DAHA 3K0AA 3B13B 4JLOA 4HAVA 2EWVA 5LDDC 4JSTA 2XTMA 1YZNA 4M9QA 3B60A 1W36D 4ZCIA 1D5CA 1MV5A 1XMJA 2I4IA 2F3RA 2JIZA 1G3RA 3GFPA 3K0FA 1XD2A 2RMKA 3LBNA 4JBWA 2A3RA 1OH7A 4M8NE 3VFDA 3R9WA 1HUQA 3A37A 4Q4AA 2WSSD 2CVHA 1U0LA 1G7CA 2HLDA 4TLDA 3U44B 4O2RA 1E2KA 3IBYA 3EX7C 4PTLA 1KI1A 1GRQA 4B76A 4IFEA 4A2QA 2BHRA 2XB4A 4W5HA 3ZJYA 2XNDA 1D8TA 4LJ5A 5BN3A 1Q3HA 3AVOA 2AK3A 2ZYVX 4H9GA 1IN8A 5GVSA 2DFLA 5KDOA 5LD2C 3OIYA 4KODA 4LDJA 2CK3A 3I8SA 4PC6A 1NG1A 4Q47A 4LJ6A 2WTUA 4JT2A 3GLGA 4TYNA 2O8DB 2ZSFA 2WPDA 2KI5A 2EU8A 2ZAMA 3QIAA 2PBRA 2WOJA 1HQCA 1KSGA 2IYTA 1X1RA 1NVVQ 4B48A 1KMHB 5JEEA 1Z0JA 3TAHA 2V7QA 2Q9AA 3OE7D 1DPFA 3P4YA 2ZIAA 4JKIA 2PT7A 3NHAA 2WMNB 3N70A 2HCJB 4DCTA 2YC4C 4GZMA 1U99A 3AUYA 2QTHA 1ZU4A 4XOIA 1AZTA 1SKQA 4HB4A 3HPRA 3TQFA 1E4YA 3CRRA 3AUXA 2IT1A 1FX0B 3SU8A 4G5GA 4OK3A 2J0SA 5CLLA 3W8RA 2B7CA 2JLQA 1W46A 3B7GA 2VP4A 4LJ8A 1LNZA 2GZDA 3KQNA 3RAPR 2ZAOA 5FUYA 2ZVPX 2GBLA 2JJ2A 1UBGA 1UEIA 3QKSB 4OK5A 1T9HA 3GFOA 1Z6TA 4HB0A 2GESA 4GT1A 1NBMD 1E9EA 4XVQA 3NDBB 1PUIA 4N3NA 1D2NA 3LFUA 3X1DA 1G19A 1KDTA 1N6HA 3KKOA 1C4OA 1G8GA 2CCJA 1NKSA 3NBYC 4XD7A 2JLRA 4G01B 4ITRC 1GAJA 3TR0A 4D4JA 1EK0A 1Z63A 2QQEA 2VF7A 3LA6A 2W2XA 1LS6A 5G3ZA 2IF0A 1CRQA 4RD0A 1HV8A 1NI3A 5L3RA 4LHWA 1M8PA 4LZZA 1R0WA 2W2VA 4L8GA 1N6KA 4Q1FA 4ARZA 4KV9A 2BMEA 3ZVMA 2HJGA 2QY9A 3FE2A 1WF3A 2QROA 1E9AA 1NJGA 2GXQA 5E4FA 3KJGA 2D74A 5KSYA 3E70C 4HLQB 5LB2A 1KSHA 2JLVA 4HEJA 3NH9A 4HUQA 4A6PA 2BEJA 2BBOA 1P60A 1DADA 3TE6A 2KB0A 1AM4D 2ZE5A 4BEJA 2G77B 2BMJA 5BXQC 2QSYA 4C4PA 1KDPA 4MRRA 5JZVA 3QUSA 2IYWA 2H7VA 1N6IA 5FUXA 2OESA 2XAUA 1W0JD 1PVOA 4LYAA 3THWB 5HE9A 4WZ6A 4EPVA 3TAUA 4LYFA 4TTRA 1ZC4A 4BZQA 1L4UA 4R98A 4DVGA 5KPJA 4US1R 3WY9A 4KVGA 2P3SA 2D62A 3H86A 1FW6A 3LVRE 2FJUA 4B2PA 3D7MA 4JLNA 1ZYUA 2XXAB 2K5UA 1FUUA 1U0HC 1G4UR 2OCAA 2WWHA 5DHFA 3W6NA 3WNDA 3M1IA 4QGFA 1UKVY 1JI0A 1XWIA 1XD8A 1FZQA 1XDBA 4AKIA 5K8IA 2VHUA 2A9KA 4M22A 2HCBA 1YZGA 2QP9X 5EUMA 3AVTA 1LV7A 3H1TA 1HTWA 1XJCA 3LD9A 3KKMA 4EQ6B 4BRWA 4CRWB 3I8XA 1JNYA 3I62A 4HAXA 1XFAA 3NG1A 1Y63A 4C0QC 2R6DA 3W6PA 3SQWA 5DH9A 1KHTA 2A2ZA 1XEFA 1C1YA 2AHOA 4PZYA 1E2EA 1D9ZA 3BGWA 3PUYA 2QZ4A 4LK2A 1OKKA 4UXHA 1LW7A 1LFDB 5FL3A 3L0IB 3NWJA 4Q9IA 4KITB 2CLSA 4PC7A 5JLJA 2VTKA 5CIQA 1GVNB 1DG1G 4UNPA 4F4JA 2E1RA 4LC0A 1XMSA 5TARA 4O2LA 1XBTA 5TV2A 4B43A 1P4SA 1RVDA 5BN5A 1BH2A 1SVWA 2IHBA 3T35A 1E2GA 4WOPA 1E1QA 1AGPA 2HJVA 1E6CA 1LF5A 2YOGA 4MYUA 4R2IA 3WHLA 2R65A 4CT4B 1WE2A 2J46A 4M1KA 4HATA 1N6LA 2HT6A 4B44A 2QAJA 1ZM9A 4DB2A 3GEHA 1ZRHA 4NYMR 2ZPTX 4DLRA 4LV5B 2HYDA 4BLSA 4URXR 5KDDA 4GL2A 4FMDB 3OFNA 5AR1A 5JCZA 1P72A 1HY3A 4DCVA 2IUTA 421PA 1FL9A 4C0KA 5F9HA 2F1JA 1ETUA 2ZI4A 3DVLA 1DAMA 1OPXA 3OESA 4DUGD 1P2TA 2C04A 2VSXA 4B75A 1T3SA 2VPPA 4AKGA 1XRJA 2O0JA 2RH5A 1J8MF 4LI0A 1JECA 5AUQA 1E96A 1GNPA 3QNUA 5FOWA 1MT0A 4C7OA 5F9FA 3CLVA 1M7GA 1TEVA 1AIPA 4MKFA 2FU5C 3BFVA 2WMOB 4DLSA 4MKGA 2CE2X 1A2BA 1OW3B 1QHXA 3ECCA 3B82A 2FX3A 3KQLA 2KBEA 1GIAA 2D7CA 3AVXA 3VNUA 1CTQA 1UFQA 4MQBA 5F3WB 3LY5A 4TQ9A 3ASYA 1EG7A 2ZJOA 4Y0AA 4LWZA 1PUJA 2XSZA 4OI4A 1OXTA 1QG2A 1KDOA 1KK0A 2LCFA 3BJIC 1RRPA 5C1BA 4DB4A 4CEJA 3FGNA 1X86B 5L3QB 1UBEA 1S9HA 3N2EA 1VCMA 4CZ2A 5K8UA 1FMLA 1L2TA 1I2MA 2Z83A 1Z6GA 4DDVA 4BLOA 2WWIA 2LKCA 3TSWA 5IHPA 4LJ9A 3VX3A 1S4QA 2CJWB 2H18A 1XTSA 2WZQA 3SOPA 4D82A 3A1TA 4Z51A 1ZNXA 1IQPA 4HLCA 2WIAA 4B3FX 4QGGA 1JAHA 1S0UA 1ZNYA 4PPFA 5GVRA 4LBWA 4QHSA 1P62B 1GP2A 4JLJA 3ADCA 4B2IA 3DMNA 4X8HA 2ZI5A 5KDLA 2CHGA 1G4AE 3EZ2A 4TL8A 1KI9A 2DWPA 1R10A 3SN6A 5FBQB 2IWRA 3RS3A 2X8AA 3LW7A 1N5LA 3SYKA 1ZP6A 3P4XA 5CM9C 3TKLA 2ZYWX 3B5JA 4C3ZA 4C0HA 4QOSA 5CDFE 1COWD 1Z06A 5EXTA 1ZM2A 1U8YA 4M1OA 4YONB 2OT3B 4Q03A 2GJ8A 4TMVA 4Q4HB 3TNFA 4BFYA 1DAKA 2HF9A 1P2UA 2JGNA 4QBFA 2HUPA 1Q3TA 4HI0E 4K8OA 3AGPA 1G3QA 3CRQA 3K0SA 4M21A 4MGIR 2O8FB 3RS5A 2DHRA 2IXEA 2V4ZA 1A5TA 1US8A 5FBWB 4RD2A 2ONJA 4DJTA 5FTLA 1XEWY 1E2IA 3KJIA 1P2SA 4TQUS 1XF9A 2IF2A 4PQRA 2QI9C 4G1UC 1SKYE 2FG5A 3ND9A 4PHGA 4Q1BA 2OCYC 2G0NA 2QENA 5BW8A 1XZPA 3KUCA 3NBZC 4LRWA 1OLOA 2ZE7A 4W5JA 3GJ6A 4RZ2A 4IOLA 5JWOA 5GADl 2Z43A 4IOMA 3UWOA 2OBNA 4ZIRA 2YNMA 2W0MA 3AF2A 3GJ4A 5JEDA 3TMKA 2CBZA 1KI3A 4B34A 4DBLC 2Z4SA 1R5BA 4Q18A 5E7JA 4II7A 2GILA 4OK6A 3C16C 4P31A 1DG3A 4RD4A 2QN6A 2GXUA 2WSSA
chains in the Genus database with same CATH superfamily
1T9ZA 4EF6A 2GRAA 1L5KA 3PVSA 4JLAA 2K4MA 4J1TC 4KBGA 2Z1DA 1J09A 1OTXA 1EWKA 1J2TA 1U8FO 2QGZA 4AVYA 2FWBA 4NU6A 5FLXA 3KWJA 5KMGA 1Z0FA 2ZUSA 1XDDA 3DV9A 4QYTA 1N2CB 2BZSA 1OB2A 3TN7A 1K68A 1RQNA 1WNFA 1U0NA 4IZ6A 1GTVA 1Q6YA 2CXXA 5DISB 4A8JA 5BV0A 1V9LA 3X0DA 1PL0A 4DDMA 2C9OA 1J2RA 4ALKA 1RLIA 3C3CA 4X71A 4NAUA 5BSKA 2IDZA 5GIOE 3WKCA 1D4AA 4U7JA 3QFSA 5L3SB 2ZBPA 1DKNA 3CLSD 2O8BA 1IE3A 3K8QA 3H4MA 4N8EA 2B3TA 3R2JA 5FQNA 1W1IA 3P45A 3TTVA 4OBEA 1GWNA 4XX0B 1C2TA 2NO7A 2QX7A 2H65A 4JI7B 4QLBA 1OZAA 1ZCJA 1GNRA 4IXWA 4KR6A 2OCGA 3JD0A 1B76A 2KS6A 3SE7A 1O96B 2COEA 3RU3A 3WHPA 2NPFA 2XMDA 1CJUC 2X2OA 3VR1A 3IKJA 3WIUA 4FB5A 1HC7A 5U4QA 4MDHA 1E2JA 4F86A 5JS8A 5IRCD 4GG1A 3K4QA 4Q12A 3NC4A 2IV3A 4JSRA 1X77A 4ZRNA 4F3KA 1KJIA 3OEED 3RSOA 4UZEA 2DLCX 4RCYA 1M2WA 1O08A 2P5TB 2HRQA 2JGIA 1CY6A 1F0PA 3WKDA 4E31A 2YBEA 1LX7A 2FOLA 5BN4B 1ANKA 2I71A 5IC5A 1BO6A 4Q02A 3MB8A 5TGDA 2CNDA 2DXIA 4MVJG 5C3UA 1LC0A 1R0KA 1U7XA 3DOUA 3RVDA 3UB2A 5GONB 4WK2B 2RGGA 1YGPA 2WF9A 1IBSA 1JG1A 2GZAA 1X94A 3LP6A 3MJTA 2I87A 3MWKA 4U7PB 5FBHA 1SXGA 4BIIA 4DCJA 1QGZA 3KT8A 3HCDA 5ALRA 4FD2A 4V0LA 2GJ9A 3PQCA 4MA0A 3ICOA 5KHAA 3ROZA 1GQRA 1D6JA 3QLTA 4G5OA 1ODFA 5CP8A 1WSWA 3O2JA 4EHAA 5CLFA 4LWQA 3F6PA 2RBGA 2YFQA 1NVGA 3N76A 5LQAA 2C94A 3PWTA 4BFVA 3CUEF 2IYRA 3I9NA 4PX3A 4DIBA 3ZHSA 1V4BA 4ND8B 3T9CA 3I3SR 4FCVA 1SG6A 2DFDA 1QK5A 3AIMA 2ST1A 5C53B 2JFGA 1ZK0A 5IVPA 2J0VA 3O7MA 4LYDA 5KYWB 1KKUA 4ITVA 2JHGA 3FKJA 1XXHB 1K8ZB 3BD7A 4HNAA 4DMCA 3QJYA 5KQSA 2BDTA 2PMFA 2GQ0A 1RQXA 4TMTA 3VR5A 3H0EA 1FEZA 4LRTB 1Z82A 2IU0A 2B61A 2ZRJA 4KYVA 2PD3A 4J6EA 2Q45A 4CIBA 2PLNA 1BJTA 1F9EA 2IZ6A 2TMYA 3KTFA 2GD6A 3LDUA 5TQ2A 2XT0A 4NEGA 1NMYA 5JO0A 3THYA 4O2AA 2IE0A 3L1HA 4HNSA 2Q1TA 3KQTA 3QBTA 1K6JA 3H8SA 3OQPA 4O3FA 1CYEA 1YKGA 3T95A 5KI6A 3VR3A 1ECBA 4PCAA 4AN1A 3HO6A 5J4KA 1R37A 1YS1X 1RJ9A 2I2BA 2J0UB 1MEJA 1HE2A 1N7JA 1MG5A 2JL1A 2P90A 1DKOA 2VTVA 2HX1A 3KPUA 5DE3A 2AKYA 4EG4A 3A9CA 1SZCA 1PGNA 1T0PA 2A9PA 3E82A 3GNTA 4JOCA 3EZ7A 3L8CA 3UT5B 4F6RA 3W5DA 2FI1A 1ZVKA 2FCRA 1YGYA 3PPWA 4OQPA 5AVXA 1T9AA 2G9RA 4D26A 4JX8A 3ZE0B 1VE9A 4JYBA 3D64A 2C5AA 4RE5A 1W0JA 2AEEA 2A33A 4UHDA 1IVSA 1V25A 3EGDB 2C2YA 5CCDA 1SK9A 4XGIA 3D3JA 3C85A 3I3OA 4BO3A 3Q6IA 4QU0A 3GPIA 1HYBA 2FZGA 4Q21A 1C1XB 3KCQA 5ES3A 4RIFA 3GR6A 5LMUB 3ZTTA 4Q19A 5FNZA 3TOCA 5I4CA 1DQRA 1WMSA 4BNGA 1C9YA 1M1ZA 2NVWA 3EN0A 3G17A 1A4XA 4JEHA 4C3OB 2BW0A 4ZI2A 1K0UA 5HMLA 4EFLA 1P2BA 2JC3A 2QBYB 2GEVA 1E1RD 5CEJA 1C8KA 3MXOA 4QAJA 4TS1A 3AP2A 2NAFA 3IA2A 4E4TA 1GZ6A 3LUPA 3WV5A 5C37A 1VL0A 1VOTA 3LF2A 4O8CA 2D1QA 2WHYA 1H5NA 2ISQA 4FHEA 3EW7A 3F98A 3X2EA 2EG5A 3JD2A 5FULA 1XR3A 3T7IA 4N6NA 1TQ6A 3V55A 3NDPA 3ZV4A 4YXWD 2QV7A 1XEWX 3RI3A 3KLNA 1SBNE 3ENZA 1L4FA 4F8YA 4BY9E 5DI3B 3G0BA 1HETA 2VDMB 1I3KA 5E4JA 3PEYA 2UYYA 1UDCA 2DLDA 3NBKA 3IMCA 4OO3A 4ZA2A 4XYLA 3B36A 3T7DA 5JECA 1CQPA 2P9FA 1ZVJA 4Y1RA 1ADBA 1RWVA 3IAHA 4LY9A 1PR0A 2FK8A 3MD9A 3EAGA 1NDQA 3ADPA 2ONYA 3ANMA 3OCVA 3EEIA 2WJ6A 2QN1A 4HH0A 4EB8A 1QH0A 2PLRA 2ZANA 3GT3A 3KDSE 4IZHA 4RKEA 4W8GA 2ZUFA 4JV5B 1XZKA 1X7YA 3FWPA 1VPLA 2Q3MA 3PX3A 4O2AF 4UD6A 4MV4A 4LMBA 3ZJ5A 4M0EA 1PLLA 1KZGB 1YBAA 2I8LA 3PDCA 3JR3A 5F35A 5DM2A 1S3GA 1OU0A 1SKBA 4GKAA 3E6AA 2QRNA 4RMGA 1P75A 1TNDA 4F45A 4F85A 3V33A 5TPWB 3Q3HA 1FNNA 2DM6A 4JU8A 3U7RA 4HZIA 2PVCA 4QM6A 3L8MA 3MG9A 721PA 2CLCX 4HDQB 3KVVA 4TMZA 4WT7A 2I7CA 2P5SA 3HWRA 5DHUA 1EVIA 3DTTA 3L18A 1H2FA 2FOXA 1XN1A 3DL2A 3NQ41 4FGZA 4MUKA 4D4LA 1IPEA 2VF4X 3GD7A 4UUOA 3B5EA 3MJSA 2CYBA 5DRYA 3GGOA 1NBWB 2PGNA 1XB2A 3RSHA 2FRDC 1SCNE 4CETA 2WRZA 5AW4A 2FJPA 1S7CA 4HDAA 4YFVA 3IO5A 1Z2NX 3ONFA 4AP6A 5IT0A 3X1XA 4AWXA 3M82A 2ICAA 2BC9A 3FLEA 4ZU6X 1FK8A 5A5VA 3UYLA 4OKSA 3UHOA 3TPCA 1TQDA 4RSMA 2Q8QA 1OE0A 3V7WA 3A05A 1R64A 2PJDA 1JG6A 3FM9A 2MJLA 3KBBA 4RD3A 3UUGA 4KE6A 4A8JC 2FNAA 1OJLA 4ZJYA 1KJNA 1IY0A 5FPKA 4WERA 5AI5A 2C2KA 2ZQYA 2QRGA 5U1PA 2YRFA 2HMTA 3H5RA 1XNGA 5KHOC 3TG2A 3VM6A 5HQ3A 1SKUA 2H9YA 3DBIA 3DMYA 3MM4A 3LQYA 4RENA 1YIAA 1SUCA 2RHTA 1T5IA 2QLLA 3EIUA 3AHGA 1VCOA 1J22A 4J7AA 1LPNA 1MVOA 2LE0A 4FZJA 4PPGA 1A50B 2ZWMA 4AT1A 3COJA 3CX6A 5LC1A 4MK4A 3T12A 3EQ6A 2DB3A 1KEWA 3R7WB 1I13A 2JS7A 3BE8A 3W34A 3I2KA 5IAGA 5CVCA 1NE2A 1TI7A 4HXGA 4FQ5A 4FS8A 3FPKA 5F5LA 4F9FA 1Y82A 1RRCA 1J6UA 1CY2A 2ZR0A 4HD8A 4ME6A 4EARA 2AC4A 3Q72A 3AIIA 1K7FB 3TRFA 4MR8A 2OORA 3RSLA 1GA1A 3ORQA 4RCZA 1LWNA 2F64A 2PS0A 2QUHA 2ATCA 1ITZA 2VJPA 2P9CA 3K9WA 3Q1KA 4BNZA 5K0TA 5LQJA 2LW7A 3NONA 3QPWA 1P4HA 1UADA 3RABA 1LGYA 1C30B 2QMHA 3G5UA 3MAAC 1Q7BA 1AO0A 1VP9A 3AKYA 5CVVA 3SDBA 4AYWA 4F6LA 1BHQ1 4WAUA 2D7DA 3VVBA 2BOVA 2PX3A 2E48A 1AK1A 1PBTA 2AGVA 2JHPA 2MMGA 2Y66A 3I04A 1PR2A 3FOAA 1EU1A 2JVIA 3IT2A 4W7IA 3RBAA 3U17A 4AG6A 4DCOA 1F17A 1X7ZB 1EPUA 3HR8A 5J4YA 4FDTA 1BD3A 4QNRA 3ITEA 1BOFA 3F71A 4YX9A 4QNNA 1B93A 1J2JA 1Z6PA 2TS1A 3SS9X 1YK1A 4FZ5A 1FJGB 4LOHA 3IPAA 2B2NA 3E7DA 5JZBA 3DCIA 4YMUA 4TS3A 2EYUA 3I64A 2Q41A 2OAP1 1W4CA 5SZKB 1IIBA 4PAOA 2OR3A 4AJJA 4ZPJA 3KXLA 1QYDA 2WBLC 4U9HS 1U3CA 1ODKA 3D7NA 3LUFA 5I9LA 3EZ9A 1VPVA 2QYHA 2P6OA 3FNRA 5DHSA 1PJAA 1W94A 1JU9A 2BI4A 1X1AA 3HB4X 2X0FA 2AG6A 4BE9A 1MVNA 5JCJD 3ICVA 2O2JA 2AZMA 3MINA 4IR7A 1U2ZA 2QIPA 1VI2A 2I1WA 3GJXC 4QQRA 4ZVKA 4N0MA 5AXBA 3T9FA 5F7OA 4PIVA 2Z2IA 1HOXA 4AW9A 3UGKA 1ZIXA 1EJ0A 3B6EA 1NF8A 3BKWA 1LVHA 1RWKA 2BIFA 1L4MA 1R6VA 4HF7A 4INJA 3BHNA 1ENYA 1YC2A 3OLCX 5A4KA 4IEFB 2ZRHA 3E5HA 4JQOA 2VRCD 9MHTA 4Y6OA 2JA2A 1I80A 2HJRA 3TF5A 2QYTA 4CR6A 1NA5A 1V2HE 3L7BA 4O4LA 2IYYA 1EFVA 4LOLA 1P3DA 3SEZA 1CQJA 4PGMA 3F47A 3WISA 4ZVLA 1CY7A 1T1JA 2D5LA 4Q5IA 1REQA 4HS9A 3FR8A 1WUKS 3W7AA 4IIJF 2MOKA 2O0MA 4RF3A 4U7TB 3COPA 1ZLXA 2ZCVA 1Q92A 1QB8A 3QVWA 1RWNA 1HGXA 3OHSX 3BS4A 2I8CA 1PT6A 3QYAA 4TLCA 3GLGB 1CULC 4EIWA 2CT8A 4H08A 4EQ6A 5LP1A 4Q9HA 4JDPA 1Z3CA 1M10A 3ZS8A 4F4DA 2I7DA 4BU0A 1PWHA 1MENA 4ZAXA 4XI9A 2N0SA 3TLZA 1V8BA 3MCZA 4JCOA 1L5HA 4CKCA 3SR3A 5C3MA 2J8ZA 3IPXA 1CJMA 3SG0A 4YROA 5DBGA 2PMEA 1ES9A 1NGSA 1SZPA 2Q07A 5LZ9A 2R7AA 3U4QB 3NTRA 3L8HA 3MAGA 3BTUA 2MSLA 3KXPA 1DZ3A 2V7EA 3K20A 1GM5A 3DCNA 5DI9A 5EG5A 1MPTA 1A7JA 2Z3WA 2NQ8A 5I7SA 1JDNA 2QN8A 3G8DA 1ZMTA 1U9IA 2W6OA 3CRNA 3G68A 3KTAB 1SNYA 4GKBA 4GPIB 4LVOA 4TKVB 5DNAA 1GCUA 5JVDA 5DSTA 4R2MA 2GTPA 4C3UA 3OOHA 3EG9B 2GRJA 1R4AA 3EVNA 4DFDA 4CTMA 4DMRA 3GZTB 3LDAA 4I9GA 3O9VA 1T25A 3U80A 1M6WA 3D8RA 3ZVRA 2BELA 2W58A 3VZPA 1XZLA 2ZW9A 1G8FA 3NWBA 2ZUDA 3II6X 3I0MA 3MB5A 3IR6A 3IL2A 3ZE1B 4CM9D 1U5AA 3ER8A 5IDYA 4GECA 1HO3A 1UBFA 5CX1A 1CY8A 3BVPA 3DFUA 4NZZA 1Z5WA 1C7ZA 5EWMA 1BU5A 5DM60 3K35A 1WM1A 5CBPB 2J85A 2RH8A 3DMRA 4BMCA 1TE2A 4TL6A 1RXYA 3ZBUA 4OP2A 5K4HA 1ESDA 4TTAA 2J30A 4DDTA 4JUIA 3OF5A 5JSHA 5JV5A 1ONPA 3GVPA 4JI1B 3AEZA 1RQPA 1CWUA 4MDEA 1D4ZA 1I2CA 2ID4A 1BMFD 3NDIA 2WD9A 3PFBA 1EAMA 5GJWC 3VU3A 2GA8A 4NV3A 4X61A 3HB1A 1U0RA 3HZZA 3VJKA 4K88A 1YCFA 5FPSA 1IFXA 1E1YA 4ILKA 4GMGA 3TL6A 3ELDA 3UMFA 1H8ED 3HCOA 1CB7A 3ZXYA 1PSWA 1Z26A 3R4VA 4HDKA 2ZREA 2AI3A 3KAKA 5CPBA 4TMWA 4YJ2B 1YR1A 4KJXA 2FSFA 5FT9A 4RHEA 3F5FA 2IEGA 5IAEA 1ZQ9A 4O4LF 1G60A 1ZUNB 3A1VA 1E2BA 1FBNA 4MKIA 1ZGHA 3CM0A 3GAFA 3IHLA 3D2BA 5E7IA 5JNUA 1FLNA 2R2AA 1SBCA 3M7IA 3B12A 4NJMA 4UNQA 1DGQA 1UZNA 3L9XA 2CZGA 4AC9A 4KYUA 2WOOA 4L6IA 2C7BA 5KINB 1ZEJA 3RFVA 1SJ9A 4EHLA 4Q93A 1CJVC 4AJIA 1TLFA 4PO3X 5E0OA 4MQEB 1AS3A 3BMOA 4QBKA 2FEMA 4LTNA 2W6JA 2ZJ5A 5IBQA 3MTAA 4FU0A 2IIBA 3JD4A 5IC4A 5IX8A 4R68A 3PG5A 1T5OA 3NOQA 4BVKA 2LKDA 3HMQA 4P5DA 4OMUA 1GPNA 5I9IA 2HZ7A 3R6DA 8AT1A 3ZX4A 4BC1A 1ZK4A 1GPMA 4JC8A 2CLLB 1UK8A 2C92A 3BA6A 2EP8A 2Q1SA 3QMMA 5TGTA 3GRKA 4ZYYA 1O0CA 2R6GA 5AVYA 3GRUA 3I32A 1SULA 4WVFA 4ND2A 9LDTA 2O5VA 2WHRA 2GJAA 1U02A 3HU5A 2VP6A 3I72A 2WHXA 2QTFA 5FOSA 4N3AA 3AR3A 3CTPA 3ELBA 4HQRA 4JI8B 3CLRD 3GVXA 1E1CB 1NZDA 2PA3A 3CUTA 4QM7A 3VPAA 2FLVA 1CE8A 4HB2A 3CY6A 3GROA 1V26A 2E6UX 2X2PA 1E94E 3TW4A 3RK1A 3TRHA 1QZZA 4O1IA 2JFVA 3LPAA 3P9YA 1IU9A 4GHWA 1GL6A 3RIXA 4I08A 3SC6A 3F78A 4ILEA 5CXUA 3JRXA 3F9IA 2OBXA 1W48A 4CQMB 5HIMA 1L9KA 1HG0A 2CL5A 2WJAA 1MABA 4FJ1A 1JH8A 4KSBA 2HCFA 2W4IA 4TSRA 1SK8A 4BUJA 3A4IA 1K88A 4PZZA 4M0UA 2Y4OA 1TMGE 2YL2A 4F1JA 1QHHB 4I8IA 4KR0A 3DDHA 1F60A 3QJGA 2OORC 2AV6A 3S2UA 4WASA 1WABA 1TA0A 2Q6OA 3EJWA 3ZV6A 4FMDF 4GLJA 1OIWA 1JHRA 3Q5DA 4U9UA 4B7CA 3IEMA 2ETVA 4JUCA 2H1OA 3WGHA 3GEPA 3ZWMA 3X44A 3KLPX 4LVUA 3B48A 4CTKA 3FPFA 4E5YA 4OX9B 3K4HA 4ZT4A 4MIOA 4BMNA 5E3HA 3JQAB 1K7YA 4CDRA 3RS0A 3L7OA 5TY0A 2CLOB 3SK0A 4BMSA 4BNKA 1Q22A 3PNLA 2AMJA 1Y4SA 3AU9A 3TLGB 1N5KA 3HLYA 2P40A 2ZS9A 5AMXA 5JJCA 2O8FA 1T2AA 3RPEA 4DBLE 5I9NA 2F3TA 4RANA 1K7EB 2UZIR 4YY3B 3D6TB 2X58A 1GZ7A 5KHLB 4NIMA 3HUEA 1U4NA 4CQLB 4G4JA 821PA 1M74A 4F3CA 2Y93A 2GDJA 1NXQA 2QE7A 1OXXK 3FJ1A 3OA2A 4MI6A 4W9NA 3RVKA 3LHKA 5C4GB 3EXIA 3OMXA 3WBFA 2J9GA 4X6XA 2X8WA 3B78A 3A14A 3IEKA 1Y6RA 1I6MA 1P5JA 3HKEA 1T35A 2KM1A 3UC9A 3HHEA 2QP3A 3NORA 1A9RA 1TYAE 4FKZA 1CUWA 3UZUA 2GEFA 4B85A 3VJRA 2XRMA 2DFNA 4KTVE 2OFXA 1HDEA 1NX9A 3AYZB 3H4TA 3GELA 2GBLC 4U02A 3G0GA 4Z3KA 2OB2A 2PL5A 4GQIA 5A04A 2JAQA 4GX2A 3OU6A 1JIVA 3NP7A 1G38A 1FRVA 2QS9A 2OA0A 3MUNA 3ETGA 1QUFA 3HBJA 4KXQA 1WSBA 1RJFA 1GU0A 2R11A 2I4LA 3ICQB 4XCQA 5FPTA 3JQQA 8ATCA 5LP6B 4MQLA 3HU3A 2PUJA 2Y2UA 3GMIA 3KD2A 4RABA 2BGWA 1TMKA 4KPUA 2O50A 1RYYA 1QFSA 1Z9BA 2XZDA 2XWQA 2BI7A 4K6OA 4QYXA 4LFCB 3K0CA 5LQUA 5DHRA 3L0PA 1YS4A 4IDHA 1E5QA 2CXTA 3N2NA 1J00A 2HPAA 1WJGA 3Q3EA 2P3OA 2FY8A 3D6JA 3HDQA 5IK2A 4AJPA 3JTMA 1E4OA 4DMKA 1N2OA 1ULSA 3F7OA 5B1HA 3FHTA 1JZSA 1N9ZA 4Q05A 3RLIA 4OXNA 3WWOA 4IG9A 1J23A 2L42A 4AZTA 1MUUA 3M8KA 3QXSA 4V03A 4V0MA 3UA3A 4I1RA 4EKIA 1H4QA 3WMRA 3E9EA 1E3SA 3B3JA 4GWGA 2JASA 4UUBA 1JHUA 5IYZA 2NU7A 3LAWA 4GOMD 4IUBS 4JBLA 4WH0A 5F3DA 4BPRA 3UPUA 1U8EA 1VQ1A 4DKXA 4J1QA 1JPJA 1M2OB 1AN0A 1Z22A 4XQEA 1GLNA 1GLGA 1GQQA 4J9VA 4O0MA 1RFLA 5ALTA 3INRA 3BEDA 3AKDA 1T9GS 5BYJA 1E9VA 3LUKA 2ERXA 5K3FA 3BGSA 4PICA 5KWJA 1IXSB 1U9IC 2VNJA 1GTJ1 1X14A 3BORA 4MKZA 3SKVA 3VKWA 2HU8A 1AZSC 2ISCA 2H5IA 3IUPA 2Q5IA 4R1TA 2YS6A 5GY7A 2QT0A 1V71A 2HT1A 1RM4A 2E4XA 2EP5A 3OJFA 1CJTC 4CG2A 2ORIA 2NX2A 3C6KA 1ZGAA 4ND3A 1IJFA 4G5YA 4NTZA 2FN7A 3D4NA 4ARBA 3GLIA 1VMKA 3NHSA 3RS8A 1GA6A 2LDXA 3FAKA 2WA2A 2XNHA 1BC5A 4DT1A 5THXA 3BXZA 4ENPA 5JXWA 2W2MA 3C3AA 4FX5A 4MQ5A 4TN1A 2BFCA 1VG9B 1IQ0A 3NMUF 5BMOA 2WJPA 1FSPA 3W2TA 1NE7A 2AYYA 2YC2C 4LNUB 5K0NA 1QAQA 4JP2A 1L8OA 2RHLA 4X3OA 1DTWB 3RDPA 3M4JA 5FO1A 3T9BA 2IS1A 3AH8A 2ZRNA 1KKLA 2OHXA 3A4VA 1L7QA 4TMFA 2J3JA 1M72A 3DM9B 2XOKD 2HRZA 1XCLA 2IS2A 1K5DA 4A36A 4IDNA 4BP9A 4BBJA 2PGLA 3QFCA 4Q01A 2NO0A 3ZK9A 1HDYA 3TCKA 5AM2A 1SC9A 4Y2HA 4WJZA 1A2OA 1PIWA 3LXXA 3WWZA 3WJAA 2FDXA 2BYTA 2JFQA 3K9CA 2OK7A 3QIVA 2OV3A 4HLUA 1DHRA 4CNQA 4C7XA 5B7NA 2D6FA 5IT9A 3KC2A 3BGDA 2H52A 2AFHA 5FPYA 4BKPA 2V65A 1GUZA 4EFNA 2IZ1A 2XWJI 1U94A 2HA5A 4IVRA 1UAAA 2CVQA 3R09A 4DN6A 4FS3A 1NLFA 3L4EA 2GTHA 1U9JA 2DKOA 3CUSA 3R40A 4TT3D 4WOKA 3VVMA 5LCXA 3ZWBA 3E9CA 3KFVA 2I67A 4CGZA 4X95A 5EPOA 1CETA 3NXSA 3DAFA 4DLWA 4FDUA 3CCCA 3DAHA 4R2XA 2HA2A 4LJLA 3D6FA 4M60A 1OYVA 2O0HA 5HYVA 3IBGA 1XEXA 3I4CA 2ZIGA 1JAIA 5IYZF 2QIOA 2H4HA 1ZCFA 1OPRA 2QTMA 1P5ZB 3TZHA 2EWWA 5HKAA 1ESZA 1D03A 1P0IA 1TVKB 3KWMA 2HR1A 4Y6RA 1Y89A 1KY5A 4XJSA 3S0JA 5LJLA 2F43A 3DULA 4GOKA 1I4DD 4PLYA 4XVRA 3CF2A 3FYDA 2A5DA 3IULA 4QODA 2OFOA 2YWBA 1NSFA 1BW9A 3UYKA 1X9HA 4PRLA 4DWJA 5EWLA 5KTYA 4FHDA 5FHQA 3IT0A 2WJ4A 1DXOA 1Y3FE 4DRYA 1RR6A 3AERA 2X1HA 2YWJA 2H57A 5KYYB 2HIAA 1VHWA 5DW0A 4ISBA 4HMQA 1X1SA 2PMDA 3SHQA 3Q15C 4HMOA 1P0PA 3QFHA 4NZYA 2D1RA 4OL9A 4R7ZA 3ZY2A 5JS2A 1RXWA 4OI1A 5DO9A 4LHSA 4WECA 1QIJA 2ANBA 3K5WA 4A8JB 4AJNA 1CFZA 3PSAA 2OC9A 4L3OA 4BGIA 4BLWA 1XAGA 2ZRDA 3AKCA 3NV7A 1B6TA 2IY8A 3W3ZB 3X1JA 5JT1A 3A6PC 3L77A 4DV6B 3FSGD 4MQFA 3U49A 3WP0A 1RAGA 2O8BB 3CNOA 2C0CA 1QBKC 1YTLA 3N0TA 5ADWA 2CLEB 4F3TA 2CV1A 1U3VA 4L8FA 1LVUA 4UNRA 1U0JA 2XUZA 3VTKA 2AEFA 2SBTA 3D9QX 2OV8A 1ACLA 4UUQA 4ZRMA 5IKPA 3JARB 1CIVA 3EPJA 3ZY5A 1PW7A 2PO5A 3NBAA 4JWKA 4Y2SA 1T4DA 1XZNA 2FW6A 5HMMA 1M76A 2NVUA 3EA5A 7MHTA 4HRYA 1THTA 2Q4BA 1U5BA 1S3FA 2IZ5A 1LXCA 4HNVA 3H2GA 4LDAA 4OHCA 3VR4D 1K8RA 4UEQA 1YDFA 2H2DA 3RAFC 4YUYA 1NUSA 5IDVA 2ONCA 3KSRA 5ELMA 2J08A 1DZIA 2HYIC 1BH6A 4BNUA 1D6MA 1KO4A 2Z2YA 4L2IA 1KARA 3K05A 2TYSB 2VH2A 4W9NC 5ICSA 5L95A 4W5QA 1PL6A 2PX4A 6REQA 2X0JA 3L1UA 2XNSA 5I9BA 3S1AB 4XVHA 1M6EX 4E2XA 5K45A 4LZWA 1SG0A 2VDVE 3TW8A 3VPGA 1SGWA 1F6DA 1YL5A 1L3IA 4A8PA 3ZXUB 4CPDA 3KSDO 2ZSUA 2BKUA 1LDYA 1XHFA 3PXAA 1LTKA 1A1VA 1K89A 3GBVA 2WJYA 2R6JA 4AN4A 4D9MA 1J8FA 5A62A 5J2TA 1I01A 3A9SA 4PQEA 4S1VA 3KU1A 3E1SA 2Y71A 1M34A 2R47A 2VJCA 1NQOA 2Q4EA 1G20E 4PXYA 3SZUA 3W3AD 5C81A 3B9BA 1IN1A 4JWTA 4WFKA 3MWDB 3GLHB 3LGSA 4D9NA 4BQSA 1Y7LA 1UFKA 4P92A 1MG0A 3HBMA 4J3NA 2H7CA 1U3GA 1QNFA 1W59A 2XUIA 4Q4DA 5G40A 1NYLA 2O7SA 5P8WA 2IP1A 3HY3A 3IHTA 5A0FA 2C4TA 1MA0A 1AKMA 4HNAB 4EG8A 1H1TA 1GZHB 2WZCA 3OFKA 3CB4A 3K70B 1B00A 2FPUA 2HM7A 3EC1A 1V8FA 1XMOB 1KP3A 3K0CC 4P7GA 3DV0A 4E2ZA 5LOVF 2HMUA 4DR6B 1GPWB 1LDMA 1QZXA 4UVDA 2QYSA 2V9ZA 4EL0A 5JSYA 1VG0B 1XTZA 4KXUA 5TQ2B 4GX0A 4KVFA 1WZUA 4IDFA 3WXMA 3FHOA 3OF3A 2PTHA 3BILA 3DFFA 5H4GA 2J3IA 2UKDA 4LY3A 4NESA 1NKTA 2G5TA 1RAFA 3AHFA 4K81B 4LEIA 5DRTA 3EVFA 4CLRB 2C5GA 3BQ9A 2ZSEA 3OJLA 2ZRLA 4MJXA 1GOTA 5HJ2A 5FJJA 2JLXA 2EX1A 2F00A 3DQPA 4UHJA 4LSMA 3RR2A 1ZITA 3I30X 4G1VA 2X40A 4EFKA 2PK3A 2ZPAA 4KN6A 4ZTZB 3TIVA 2H31A 5BR8B 1FFCA 1NPYA 2EJCA 3MUOA 2B78A 1H0KA 1VJTA 3JQBA 2CMFA 5IH3A 3PXUA 4F7WA 5COQA 1GQ2A 3UMBA 1MRNA 4G41A 2PS1A 4PBTA 3FR7A 1KC1A 1KI6B 1XQWA 4UFNA 2VNSA 5CTJA 4J7CA 2O2XA 1QF7A 3CLTC 3LUGA 1XMIA 2C8JA 4O4HA 3TMAA 3EK2A 3TOZA 4DSOA 3VVCA 3NI2A 3GBSA 1KA9H 3R4CA 4I4TB 1XG5A 5F1KA 3B51X 1RXVA 3D2CA 4RGVA 1E4EA 4ZDJA 1QDUA 3C3YA 1YHZA 1BCSB 2X5OA 3BIJA 1ECJA 2FFQA 1EP9A 1PJ2A 5F3RA 1KAEA 3UICA 1EFAA 2SNIE 2I4MA 3T9EA 4OYHA 4OHZA 3RAGA 3RSFA 5JI3E 1XQVA 2K7ZA 1R0ZA 5TC4A 3F3MA 1PYGA 2OSVA 2JGDB 3LKBA 5EPUA 4DIFA 2ZBDA 4ZYUA 4N7JA 3UW1A 3GP3A 1P73A 1UPBA 5G0SA 5AP9A 1X8XA 4YBRA 2QDKA 3HUDA 3UG6A 1IPHA 5J2TF 4N49A 1E3JA 1MH9A 1BXZA 1P6XA 3SHFA 3KCNA 5C9ZA 1YB2A 3HJCA 4J0KA 2GNAA 1G21B 1YAJA 3PRJA 4V2UA 2GWHA 3K8OE 1M75A 3H8JA 1G0NA 2XZPA 1YUBA 2JARA 3L7KA 4ZCMA 1C3VA 1WZNA 2G80A 2NOAA 2VWPA 4ZAFA 4KZPA 2B5WA 1DS6A 3GG2A 1UANA 1Z88A 2EFCB 3I09A 4GI2A 4QHTA 4XPZA 1DP4A 1QFXA 1QKJA 5K1ZA 2C61A 3HYSA 1RP1A 2PMKA 4C03A 3U7FB 2YHSA 3X43A 4HWPA 3OOWA 4ALMA 4DWOA 3AVXA 2AT1A 4HLUC 2MINB 2PXCA 3OU7A 3QKSA 3OWOA 2PL3A 1Z13A 3N2YA 3IP5A 3IE1A 3ZE8A 2PGJA 1A5ZA 2GKSA 4TVBA 4DMMA 4I55A 2IA5A 1ZX1A 1LLUA 3JAKB 4WV3A 2HGZA 2OV6A 2DJIA 1M2GA 2ZIXA 3IJRA 2GPJA 2JGLA 2JLUA 3A25A 4MV7A 4QUEA 3DBLA 3VDXA 2PV7A 3UN1A 5G3YA 5LQRA 2JFNA 4P0QB 1QPBA 2ZWOA 3D8BA 1VG1A 2AN3A 1HLPA 2RONA 1ZOIA 1DJOA 3A9WA 1DJQA 2H3EA 1BHO1 2VWGA 1J97A 4I1SA 4N18A 4UULA 3ZR4B 1XCMA 1E79D 3P2JA 4X9XA 4DPKA 3SS7X 2DPLA 1F2UB 2H29A 4ZI7A 5JQWA 1AKQA 1GITA 2KWIA 1GXSA 3P8ZA 4X1OA 4XQCA 1NATA 4JK3A 4NMMA 3K70C 4OJQA 3HZRA 3L82B 3N2GA 2P2ZA 4RNCA 1Z74A 2BFBB 2PXXA 4C4OA 1RKQA 3GN1A 5JO9A 4C3VA 1TFUA 3MPUA 1D04A 4C78A 5C1IA 1F14A 1GUDA 2VLBA 1IHYA 1QGOA 3F1KA 1MQ9A 2RJ3A 3HZOA 1FSZA 3E2IA 4D0SA 1IMJA 3MOGA 2CVOA 2QUZA 3B9QA 2GJKA 4LC1A 4TRNA 4I0WB 3ZW9A 2QQ5A 3UT0A 4JI0B 1PKEA 2Y99A 2YZNA 4JC0A 5KSOA 4BNMA 5C18A 1DTSA 2LV8A 4DLTA 5JOQA 4UPEA 2Z8XA 4FYJA 3KG2A 5TB5A 1UJCA 2Q4RA 2ZXFA 4CCSA 1L4EA 1SG9A 4QU9A 2G0TA 3CPHA 2BCJQ 2OCLA 4OQQA 3EEYA 2ZBFA 4IYRA 4RKWA 1YR6A 2DWQA 3CUVA 3O03A 3TDKA 5FPPA 4KQFA 1VA5A 4OQNA 4XB1A 3HBNA 2ODAA 1RXSA 4E3WA 3HFGA 1SXQA 2A57A 2ASVA 3VC1A 1Y3AA 1JWLA 3EHDA 1ZGCA 5LUAA 2ZE8A 2F62A 3VPSA 4TXLA 2OM2A 2D06A 3FI0A 4MTLA 4PYNA 2MSKA 4YCSA 3AHJA 3GLRA 1A27A 1QFYA 2HF8A 2PS3A 4PYQA 4TS4A 2VYVA 4DG8A 2V55B 1Z28A 1AURA 1XKXA 5HQ3B 1CQXA 3C98A 3NTUA 4P3XA 4HNGA 1JWBB 4KI0A 4IIJB 4G4SO 3RS2A 3A8TA 2UVPB 3GCZA 5K05A 5K4GA 2XUHA 5DYIA 3K09A 4HJRA 3OUZA 2Y3IA 1TECE 2Q3LA 4E21A 1QO7A 3AFNA 4QX6A 1O95D 4DY4A 4KUEA 3STYA 3A4LA 1MX1A 3N87A 1SIBE 3SZGA 4RK0A 4MUIA 4B09A 3B85A 3DZGA 2FFRA 2WWWA 4RKQA 1XJ5A 2ZDHA 1TTPB 1FSFA 4AK9A 3IILA 2EJUA 1AX9A 5FNVB 3W79A 1ZI8A 1D0VA 1FMCA 1RZVA 1VSBA 1NN1A 1Y1QA 1T3GA 4TXJA 3LTEA 5B57C 2HXGA 4EB0A 2XTJA 4UNSA 4I55F 2Y2VA 1OLUB 3DTVB 2OLJA 5T57A 2PCLA 2WT4A 1IUKA 3E61A 3PGVA 3ZHTA 1H5UA 1K97A 1VYUA 4NXNB 4O08A 5EXEA 3FFTA 3NHUA 2G9NA 3E7PA 5BWOA 4MW7A 3TGWA 2AQHA 1GCGA 3GJ8A 3WRXC 1WLYA 4XM0A 3OIGA 4Y2XA 2DBQA 1KY3A 3V8BA 4HDMB 4ZI7F 1LBEA 3BFJA 4KPEC 2C58A 3HJGA 1UEXC 1GPDG 3PLAE 3EGOA 2PAAA 1ABBA 3LV8A 1RABA 4LFBB 1G55A 1IRXA 1G5PA 1ZJJA 1FFEA 3T7JA 5HX7A 1NMQA 5EINA 4ZAZA 3FTEA 3IKTA 3E05A 5ESXA 4YRCA 1MO6A 1QOPB 4S3MA 5JBNA 3IEVA 3ILHA 1V3VA 3VAAA 1FDUA 5JRJA 4L72A 3OJCA 3JQFC 1OXMA 1R4ZA 4INOA 1ZOPA 3DAOA 4YQFA 1JLRA 2HAEA 1ILWA 2LZ0A 1CBUA 2P6NA 3M9WA 5LYYA 1IXRC 1VL2A 5CPFA 2XOXA 3A06A 4CT5A 2RH9B 3LWDA 4B3MB 5JAOA 4FDAA 2J32A 3G8AA 3S27A 1WOYA 3I6YA 3HA3A 5CNJA 3ZZTA 3WLEA 1ESCA 3LZ6A 4R2LA 2BGNA 1YZVA 1MQ8B 4GXRA 1E63A 5JATA 3MTDA 1SBYA 3P9CA 1RPJA 1FS6A 2ONKA 2REOA 3FFXA 5K99A 3GP8A 4XJTA 2XGGA 5HM6A 5M34A 2LWIA 1QR6A 2ZR9A 4GRAA 1NBIA 2ZJ0A 2HRDA 1CQJB 4RGYA 3INGA 1JEYA 3FZYA 4KXXA 3UT6A 3LFHA 4ZYTA 4NS4A 1H22A 3CONA 3ASZA 2AXPA 5K0FA 4YQEA 3S5JA 1GKLA 1JILA 2C88A 2M6SA 3I6MA 3JQBC 1X1CA 2Z2KA 1B42A 1PX0A 1E1MA 4HN9A 1A95A 2H59A 3DNFA 4GXTA 2C5FA 5JARA 4KR7A 2O48X 2FFHA 1RMQA 3BCHA 2CXPA 2ODEA 4JLMA 2YASA 4QOFA 4DNXA 2HO4A 2YJ3A 1U5CA 3MK31 5F2EA 1PJRA 1Z33A 1QYIA 4QTTB 1RW4A 2P8SA 1L5HB 4CKCB 5KU1A 1Z39A 3TI7A 2HFJA 3Q3VA 1EBBA 3OKCA 4OHFA 3K6SB 3EF1A 4GX1A 3HO8A 4J7UA 3R44A 1QH8B 4ZHQB 1YZTA 4E6PA 5B1SA 3IESA 4Q3DA 1X7GA 1YFZA 2FR8A 5F12A 3V6MA 3I04M 5I4KA 1KRXA 4JZYA 3ROQA 2GVNA 4MVJP 1YE3A 1YOVB 5FOVA 5JRZA 1R3DA 1Z4MA 2RHRA 4LVNA 1AA6A 1DBIA 2QPAA