3FCOA

Crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with benzamide inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
269
structure length
267
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of novel di-substituted cyclohexylbenzamide derivatives as potent 11 beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 267
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3fcoA00
4ALNA 2ZCUA 5F1KA 4H7PA 3FR7A 4ND5A 3ROPA 4UVHA 4YT2A 4ZQGA 3KSZO 1AGNA 5CDUA 1F06A 3ONFA 3H3JA 4FFRA 2OMEA 1MXFA 2YW9A 3KYCB 4Z6KA 2BFOA 4YDRA 3O8QA 2DKNA 1P31A 2ZATA 3L9XA 4E0BA 3PHIA 1CYDA 2IE0A 4D7AA 3VKVA 1ULSA 2HK7A 4WUVA 2GN6A 4FPXA 3OJOA 5HA5A 2DUWA 3B70A 1NAHA 3K6JA 3R3JA 3O38A 3RU9A 1GZ6A 3LLSA 1ZFNA 2GD1O 4UVGA 3VPSA 1V9LA 1X1EA 3QRWA 4NBUA 4CV2A 4B7CA 3DTYA 2BMAA 4MVJH 2BFAA 1JAYA 3QE3A 2Y66A 1QRRA 1WDLA 4YWJA 3PRJA 2I5PO 2BH9A 4PIVA 3PVZA 1FK8A 2G17A 2O7SA 2E37A 4BVAA 1M6WA 4RGBA 3FN4A 2PKQP 2BGKA 1BVUA 3M2TA 5A05A 3U9LA 1ADCA 1DIRA 4JBHA 4BV9A 1PS9A 1LDGA 1DC6A 1F14A 3DONA 1ZJZA 1SPXA 2XOXA 3JQ9C 4E5KA 1QR6A 4OJNA 3S2GA 4CMGA 1Y8RB 3MJ4A 3PYMA 3EDMA 3OIGA 3NYWA 3I6QA 4RV9A 1F8FA 3CZRA 3ZV4A 4WGGA 1QKIA 1X13A 2XXBA 4TRRA 4IIVA 4XYMA 5CDTA 4S1VA 4R68A 2HAEA 2PZLA 3WTCA 4CLOA 1UXJA 2IZZA 2DFDA 3QA9A 4D0SA 3JQ8B 3Q9NA 2HJRA 3JYNA 1P1HA 1TI7A 3PQEA 2X0NA 4I9UA 3WWYA 2DFVA 4E2ZA 1DEHA 3E82A 4L8VA 3DAFA 4R01A 2FP4A 2D5CA 3PIIA 4BO9A 1CDOA 2HMSA 3TL3A 2YV3A 5A3VA 4YAIA 4Q39A 3RJ9A 1VJTA 1G0OA 2J3JA 2JFGA 3KO8A 3PQDA 4XQEA 5ER6A 1KVSA 1R66A 2BRUA 4MJLA 1L7DA 3E8XA 3RROA 1JVBA 1YB1A 3JQAA 5AXCA 4KQXA 2P4QA 2CVQA 1M6HA 5C3MA 1PL8A 1ENOA 4WLNA 1EUCA 4R5MA 3ROMA 4ZQBA 4XYLA 2FMUA 5JY1A 2NU8A 1ZUD1 1A4UA 1N5DA 1GYRA 4XRRA 4DWVA 1PTJA 4IY1A 3ZH2A 5CDGA 5EJ2A 3RC1A 2JL1A 1UDAA 2CD9A 5IDWA 3ICCA 2RCYA 4MOWA 2Y1EA 4WCFA 1T25A 5DT9A 5DP1A 4CM4B 4QFCA 3MJCA 1LLCA 2DC1A 2W2LD 4O0LA 4CMAA 2QRJA 3DZHA 2AG5A 4ZQEA 3BMNB 4M86A 1ENYA 3M1LA 1GV1A 3WYEA 2B4QA 2C82A 5L4LA 4TROA 1GUZA 1XSEA 2HU2A 3H5NA 3TL2A 1CF2O 4GX5A 3GN1A 2EJVA 3WGIA 3NJ4A 1VSUA 1WPQA 1B2LA 1X1TA 2IXAA 4GWKA 4HBGA 5L4NA 2Y93A 3EUWA 2O7QA 3I9JA 3NGXA 2FSVA 4DLAA 2O2YA 2AXQA 3E9MA 3JQFA 4TVBA 4XX0A 2D2IA 3U49A 5A5FA 4BNHA 2FWMX 4WE3A 1UDCA 5G0WA 2YQ4A 4FFPA 2DPHA 4FR5A 1EVZA 2R2GA 4IQGA 1WZIA 1MUUA 1O0SA 4TZTA 1U7HA 3FTNA 3Q1LA 5F5NA 3RJ5A 1CRWG 1IUKA 1PWZA 1VM6A 4CR8A 3I9MA 5AOVA 4TWRA 3OEWA 4XYGA 4F6CA 5IN4A 2QX7A 3CIFA 2A35A 4FFMA 3G0OA 4L76A 4C4OA 3KYDA 4WECA 2GO1A 3STHA 1DIAA 3UOGA 2Y1GA 3E5RA 4IM7A 2PNFA 3JQBC 2C20A 3GG2A 1J6UA 5I9NA 5G4KA 2A4KA 2D3TA 4P4GA 4FW8A 5JCXA 2O3RA 2GERA 3ON5A 4FFOA 5THQA 1A71A 1B7GO 4YCAA 1E3JA 3JQ7B 1T2AA 5H82A 1AUPA 2HDHA 4HADA 1PJCA 4CMHA 1PZFA 1U4OA 3HB5X 1FF9A 1U7TA 4OIMA 1JAXA 2X0RA 1O6ZA 2DVMA 2EG9A 4UVIA 3VOSA 3W8EA 1P33A 3I4CA 1EUDA 1B3RA 1KEUA 2VHYA 3B1FA 4CL8A 4CM9A 3G79A 4RQUA 2VYVA 5AVOA 3V8BA 1P45A 1HF3A 4GGPA 4Z3DA 3R1IA 3TOXA 4IDDA 4MVJF 1IY8A 3MWEB 3GNSA 2POQX 2UUPA 4FGWA 4UVEA 5JXWA 3KM0A 4R54A 3AW9A 3DBLA 2B4RO 2BFMA 4PRKA 5FI5A 4MINA 2GLXA 4ZQFA 1B3BA 4Q3DA 5DDIP 2JHFA 1P0FA 3WMXA 1NWCA 1R37A 2DLDA 3PLNA 3ZCXA 3JQGA 2O50A 2B4TO 3AOEC 3S2FA 5JAIA 4XKJA 1N8KA 2DTXA 1E3LA 4B4OA 2PGDA 4OYRA 4UREA 4NZ9A 1Z75A 1AXGA 1T24A 3ZNPA 3I9LA 2ZKLA 1Y81A 2VWQA 1PJSA 3G3EA 2PV7A 1LDEA 1H6AA 1JWBB 4HFNA 2GN4A 4XR9A 1E5LA 5H81A 2DUUA 1VC2A 3KSUA 4I5FA 2X0JA 3VKUA 1ID1A 1RPNA 3ROQA 3RBXA 1E3SA 1E6UA 4YJDA 4A2CA 1ISIA 4Y6SA 1ISJA 4A0SA 1YL6A 4YQZA 5CG1A 3ZWVA 5A06A 2W2KB 4NJMA 4LISA 2CMDA 3PHJA 4W82A 2ZB3A 5A9TA 3DFZA 4EJ6A 1LXCA 4K26A 3V5NA 3ENKA 2YYYA 1C1XA 4J6FA 4B7UA 1KYQA 2HMWA 3W8FA 5IXYA 3AOGA 3C7CB 3BTSA 1GTMA 5EESA 1LDNA 1LLQA 1NBOA 5LDHA 3FSRA 4PZDA 1QP8A 1ZK0A 5JCJA 5IDYA 1YONA 2G76A 4U5QA 2OBYA 3IQDB 1QYCA 1A7KA 1I36A 3OJFA 4RPLA 1BG6A 4BKRA 1VL0A 3H6KA 4FGSA 4JJIA 4EGFA 2YJZA 3GVPA 5HS6A 2GZ3A 3D5TA 4WLOA 5HRUA 1EVJA 4YACA 4MVJP 2QIOA 2VHZA 2NWQA 5G4LA 4CM6A 4QQRA 4YT8A 4MKZA 3IKVA 5CEEA 1Z7BA 2HJSA 1OZAA 2Z95A 2Q2QA 3F4LA 3GZNA 1EQ2A 3I9OA 4GVLA 5A1TA 1LDBA 1E1NA 4WLVA 5BSGA 1C0IA 4RLSA 4N7RA 1EDOA 1BRMA 3M2PA 3UW3A 1JDJA 4MDHA 3EW7A 1ZK3A 5FEUA 2X6TA 1DAPA 1VRWA 2HLPA 1M75A 1X15A 2PY6A 4JX8A 3JYPA 2WJPA 5EINA 3GVXA 3IIEA 3VZQA 1EVYA 3R6DA 4DIFA 4E5MA 2VN8A 3TWOA 1D4FA 1MC5A 3TNLA 2Q4BA 3NKLA 4UUPA 4FN4A 4NI5A 3WGZA 2AEMA 1DLJA 2QQ5A 4BNLA 2CVZA 5AXDA 2HMVA 4UEOA 2H5LA 4DQXA 3FNGA 5JFOA 1LSSA 1N2SA 4GI2A 4W6ZA 3PYXA 3AM3A 4MKRA 3T7EA 1V3UA 3QIVA 1P3DA 1FDVA 4PLPA 5CP8A 4BNNA 2Y1CA 4M54A 2VUSA 1GADO 5A9SB 1T1SA 3FRJA 1J0XO 2X8LA 4IDFA 1E1KA 4CR7A 4A26A 3OBBA 4YTEA 2AQHA 3WR5A 4CMIA 3RUFA 1ZJYA 2VTDA 4LSMA 1ZH8A 3LF2A 1CIVA 1PGQA 4CLEA 3ADPA 4BKUA 1QYWA 1U2GA 1E6WA 5GZ3A 1YJQA 2Q1UA 4FOOA 3H5RA 4E32A 2QYSA 3JTMA 3MTGA 4OO3A 4YAJA 1WMBA 3KV3O 3VH1A 4BO2A 1ZVMA 2B35A 1WAMA 1KERA 1FXSA 3EVTA 5TS3A 1K6JA 1ZK1A 3VPHA 2X4GA 1KVTA 4D41A 1Q0HA 3HN2A 4CLHA 3U4DA 1U5AA 1TT5A 3IS3A 2HKIA 1BSVA 1LC3A 1MC4A 1PJ2A 5I8ZA 4WNCA 1I24A 2E6UX 2Q50A 1UXKA 2JAHA 3INTA 4JQCA 1DPGA 2HSDA 2OOSA 2P9CA 2D5AA 4N18A 4PG5A 4UAGA 2OO5A 4HXYA 2AE2A 5B1YA 4R51A 2IODA 4J16A 3WIDA 3BA1A 5IAAA 1FJHA 4IZHA 4BB5A 3NRCA 1PS8A 2ZTVA 3OIFA 4AL4A 4BNYA 4EW6A 1U3TA 1P1FA 3C8MA 3FWZA 4LW8A 4PG7A 1R4MA 3WGHA 4N5NA 2ZYDA 3L77A 1XEAA 3DBHB 3WLEA 2BKAA 1R4NA 2WSBA 5ES3A 1QG6A 2OORA 3ETEA 3HZZA 3U4CA 4JXKA 1GZ4A 1DO8A 1HZZA 2VWPA 4IZIA 1DIHA 4E30A 4BMSA 1SAYA 4NIMA 1K2WA 2C59A 4NBTA 1XCBA 3G49A 1NHGA 5DN9A 4FIZA 2VUUA 1LSJA 5JW6A 3ZV3A 4MO2A 2BGLA 2BHLA 4YAEA 3L07A 3X2EA 1UH5A 4N5MA 4RCVA 3SLKA 3KETA 3D3WA 1HT0A 4L9RA 4ND3A 2GN8A 2FPIA 1DRWA 2OXIA 2QZZA 4E2XA 3LT0A 3DQPA 4E31A 5CPFA 1ZSVA 1YRLA 1LA2A 4JIGA 3GHYA 1QYXA 1YQDA 4XWYA 4QXMA 4TZKA 5LDGA 2YUTA 1EQUA 1CJCA 1S7CA 1O5IA 3M1AA 4CV3A 4BNMA 3ETGA 3ZWBA 3H4VA 3ZW8A 3V1TC 2AHRA 1T4DA 3L4SO 4PLCA 5DZSA 4RZIA 1CQJA 4E21A 4ZICA 1T2EA 1GCOA 3GGOA 4RL6A 2WM3A 5EL0A 2CDBA 5KKAA 1VI2A 3WMWA 1YOVA 3IP1A 4FB5A 4TMFA 1U28A 5TQVA 2JCVA 3ZWMA 2EEZA 4CLXA 4R4JA 4CODB 3IUSA 1NYTA 1NQOA 3BTUA 5EMHA 1WXDA 2PFGA 2VT2A 2EKLA 5BSFA 4J1NA 2X1HA 1I3KA 3WGQA 4YRAA 5DOVA 2NU9A 2I66A 4DBVO 3AY7A 2TMDA 2VRCD 4FS3A 4YT5A 4DL9A 4JJGA 1LDMA 3BMCA 4DMMA 4C7JA 1NHWA 3QVTA 1PGOA 1HDZA 2GRAA 1M67A 2Y05A 3ITDA 3ASUA 2O3SA 3ANNA 4ZU3A 3ZDFA 2X22A 1ZSYA 3PLRA 2FY8A 2WTBA 3NT5A 4HP8A 1V6AA 4E6PA 2VRBA 2W98A 2Y68A 3GK3A 2F1KA 3U0BA 2ZCVA 2JKVA 3RFXA 3H5AA 2XPCA 1U8FO 2FRDA 1KY4A 1RM5A 5A9RA 2YHIB 1Y6JA 2DTDA 5JC8A 3FBGA 3ZHYA 4Q3BA 4ZQHA 3TQHA 1HZJA 3ZGYA 1AN9A 5JC1A 4L74A 1HDGO 1SEVA 3QY9A 3DZBA 1IYZA 3GPIA 4O6VA 2DTEA 4PGFA 3VVCA 3P2OA 4YAKA 4NFSA 3KTDA 3IJRA 4DPMA 1HLDA 5I7EA 1XQ6A 1HE4A 2GDZA 2BF7A 2B83A 3BAZA 1QORA 1IZ0A 4ESOA 1RM4A 1NFFA 4Z9YA 2FPPA 4PG8A 5F21A 3X2FA 3H65A 1A5ZA 3I83A 1QV7A 2GYYA 3AFMA 3ZNQA 1JKIA 5C7IO 3WLFA 3LT1A 3OECA 4W4TA 3I4FA 3UAGA 2D8AA 1WDKA 7ADHA 1B8UA 3LF1A 4NPCA 1EE2A 1PJLA 4YA6A 2NLOA 3IUPA 3LC2O 3O8QB 4A27A 4A5OA 3K5PA 3K96A 3Q9UA 4PLWA 1ZMTA 4JCOA 1B8PA 1ONPA 3HSKA 1NWHA 4RVGA 5G0TA 3ZWAA 3AJRA 5JSFA 1GD1O 1KEPA 3E48A 1ZO8A 2I65A 3WQRA 4RVUA 4JBIA 3C1OA 2EV9A 1PEDA 3AFNA 2UAGA 1CQIA 2V65A 5JS6A 4FFLA 5DBFA 3QJ5A 4F45A 4YJGA 3EZLA 4YPOA 3FPLA 4QEDA 3WGYA 4PFJA 5FYDA 1LSUA 2J6IA 5FWNA 4BGUA 4XEHA 1Y8QA 2OFPA 3JQEA 2X23A 1MFZA 1RM0A 2P91A 1LSOA 4DTIA 1SC6A 4EITA 2VHXA 1WVGA 4NQZA 3W1VA 5COBA 5U1PA 1UR5A 3KEQA 3AUTA 1PS0A 4S3MA 3RAJA 1JTVA 5T6BA 2FPGA 4UVDA 4DRYA 4CV1A 2OGUA 1HXHA 3GQVA 4Q3NA 2X5JO 3IL2A 2A94A 2QRLA 4RORA 5GZ6A 5BNTA 3QSGA 1NR1A 5C5IA 1N92A 2CUKA 3HJAA 2VT3A 3GZ4A 2W90A 4J90A 4YJHA 3OQ1A 4P8RA 2IEBA 3WJAA 3GLQA 4CM9D 3IDSA 3LK7A 2PWZA 4NJOA 4EEZA 4R16A 1NFQA 3C1TA 3GEMA 4OXNA 3T4XA 3U62A 1A27A 4ID9A 1Z73A 4DREA 9LDTA 3AU8A 3BHIA 1T4BA 2JFFA 2VYND 1NQ5A 3OJEA 4R69A 3UHAA 3JQCA 2O3UA 4A7PA 1C1DB 1HE3A 3I9KA 4BNIA 1KY5A 4G5HA 3FR8A 1XG5A 2V7PA 4BKOA 3EGOA 4BO8A 2GASA 4XDYA 3PJGA 1Z74A 4E13A 1K89A 3E9QA 4EJ0A 4I8XA 1D3AA 4M1QA 4NNJA 2FR8A 2I3AA 4HY3A 3SX2A 1P9LA 4EI2A 4L75A 3IMFA 3LU1A 2VWGA 5EQFA 2YV1A 4YRDA 3NAQA 2C2XA 4HX5A 2YZ7A 3H2SA 3NT2A 4QFDA 2PZJA 4R3NA 4LMRA 1SBYA 3PZRA 2AA3A 3WWZA 4FOSA 3DXFA 1UJMA 2NTJA 4WKGA 2C0CA 1E3WA 5JLAA 5TSDA 3RBZA 5I7FA 4EUHA 2NTNA 3RASA 3WQSB 1I0ZA 4PN3A 2PGJA 5DULA 3D5QA 3OIDA 2OP0A 3RUDA 1M76A 1X0XA 2ZB7A 5I8WA 3CEAA 4UEJA 2NQTA 3V2UA 4ZJUA 4RPJA 1GPDG 3QWIA 1U2DA 4X54A 1I30A 4TRNA 3DB2A 1E7YA 2E4AA 2VCYA 1HRDA 1SO8A 2GF2A 4LVUA 2CY0A 3G1TA 1YDWA 3FNEA 1JLLA 3VH3A 1JA9A 4EDFA 2B0JA 3RUIA 4AJHA 4I9HA 2HRBA 3B20A 3MJTA 3E6AA 4YBZA 3HWRA 3LC7O 3H8VA 5KVVA 5TF4A 3BZUA 2B37A 4DUPA 1O89A 2GZ2A 1ZZEA 2NVWA 2B69A 1FDTA 3AUUA 2P4HX 1YL7A 4OKNA 3PK0A 3ZWPA 4NK4A 3D64A 3UUWA 4AJJA 3KYDB 2H6EA 3GGPA 1OC2A 4CQMD 2GCGA 4R5HA 3VH4A 3ZN2A 5BQFA 1Z45A 3KXDA 2PKQO 4JP2A 4I08A 5G4KB 4CUKA 4CQLB 1O9BA 1JKFA 4JP3A 2YQ5A 3K31A 1T2CA 4J2OA 1N9GB 1N1EA 4CM5A 3Q2KA 4H3VA 2NADA 1LDYA 5T64A 4RVDA 3BTVA 4JBGA 4N5LA 5FI3A 1O8CA 4I1IA 4GWGA 4BUCA 1TT7A 1VSVA 3MTJA 1NTOA 2C5EA 1OOEA 3TOZA 3A9WA 1EZ4A 4RVSA 4CMJA 4DBZA 1MB4A 4D45A 3MOGA 1E7QA 1UDBA 2NVBA 4UEKA 1NNUA 1KS9A 1NXQA 1P74A 5JDIA 2XAAA 2H63A 3DWFA 5L7WA 1UZLA 1H6BA 3JQ8A 2QW8A 4GQAA 3WX0A 5ER9A 4OAQA 4BNJA 5C7LO 4J7CA 2G0TA 2IYOA 3MWDB 4ZHSA 2V6GA 5JO9A 2VWHA 1DSSG 2I6TA 1ADFA 1NPYA 3COSA 4E3ZA 5KNLA 3CSDA 4CLRB 1HE5A 1SCUA 4PLZA 3Q0EA 5T8KC 1B14A 3RUCA 3E03A 3MCVA 3EMKA 1B26A 4BMNA 1XR3A 2VHVA 3VZPA 3HQ4O 4IDAA 3GDGA 1Z6ZA 3LSYA 4GSKA 4TRMA 4XB2A 4AG3A 4OHUA 1ZXLA 4BQRA 5IF3A 1PR9A 4KOAA 2J3HA 5KJ1A 3EK2A 5AXAA 4I5DA 3OA0A 1Q7BA 4AICA 1ENZA 4GKVA 2X5KO 2O4CA 4Q3EA 3VPGA 3DZGA 3OJ0A 4CM1A 3IC5A 4DGSA 1PX0A 3F1KA 4OL9A 1C0PA 2EGHA 4CM4A 1X7HA 5LC1A 1YJ8A 5KKCA 3DZKA 1Y5MA 2X0IA 8LDHA 1BW9B 3L6DA 2PR2A 1E7SA 5JDCA 3MZ0A 4OM8A 1B0AA 1J4AA 1ZIDA 3C1AA 3BMNA 5JAZA 1BMDA 3DC2A 1ONOA 2D1YA 2RIRA 2JCYA 3KHUA 2NVUA 4CUJA 2WE8A 3OP4A 5JMPA 4OOEA 4AJ4A 4PLTA 2HQ1A 1G6KA 2EWMA 3ZV5A 4DLLA 1OFGA 2G1UA 4L4RA 1EE9A 1U8XX 2I9PA 1MV8A 1O95A 3DOOA 3EY4A 3OQBA 3ITKA 4W9NA 5BR7A 2Y1DA 3C7AA 4XIJA 2NSDA 2X86A 3NDJA 3S2EA 4DPLA 3L6EA 2EKPA 4FBGA 4WOJA 5CAEA 3F9IA 1UXIA 1OI7A 3CINA 1BXGB 3ANLA 4EUEA 2XF8A 5DP2A 4CMBA 3TFQA 4AJOA 3CXRA 3IAHA 4D79A 1VJ1A 3AK4A 3AY6A 4BGEA 3PGXA 1EDZA 4ALJA 3RI3A 1E6EA 4MVJG 3GDOA 4GMGA 4NHEA 1ISMA 4DC1A 3KZVA 3ZNOA 1GPJA 4CQMB 3BMOB 1T2FA 5TJ9A 1QYDA 4NU6A 4J1SA 1CWUA 1DFGA 1PQPA 2E48A 5K6AA 2GGSA 3F6YA 4MP8A 1L1FA 3ABIA 2ZQYA 4E5NA 3QV1A 1GQYA 1PZGA 2D59A 3DTTA 3V1YA 4Z0HO 3R0IA 1UAYA 5KJ6A 5F5LA 4HFJA 2PH5A 3QVOA 1X0VA 2Y0DA 4J4TA 1JQBA 1DC4A 1C3VA 3JQ7A 1DIGA 3EC7A 3RFTA 5ENDA 3AUSA 1DIBA 3WB9A 4AJIA 1R0LA 4ZVVA 2V6BA 3VTFA 4CMIB 1AE1A 3GPDG 4ALMA 2DBQA 2OBNA 1ISHA 3EYWA 3U5TA 1OMOA 3AWDA 3B6ZA 3P2YA 4WEOA 4GX2A 1E77A 1UAGA 1YVEI 3DOCA 3MEQA 4MP3A 1KVRA 1AHIA 4RVFA 3F46A 3LYLA 3TRIA 3QHAA 5MDHA 3F4BA 4YEDA 2A9FA 2PK3A 3VDQA 3WNVA 4JJFA 5L9AA 1ZSNA 3A14A 3DEYX 1NQAO 3ZWNA 2HMTA 3TJRA 2C5AA 3BMQB 4WJZA 1C0LA 4IQ0A 3QLJA 2AEJA 2JCXA 4Q9NA 3D0OA 3BTOA 1TEHA 3DMTA 4IJVA 2EIHA 4F6LA 3O26A 2O2SA 1JKJA 2CVOA 3WS7A 3CPSA 3F5SA 4OSPA 4J0EA 3EAGA 5ICSA 1XWFA 3FWNA 4BNWA 5JBIA 1W0CA 3I9NA 5J23A 1CEQA 3F47A 2I67A 4J4BA 1M2WA 1B8VA 5EIOA 5JYDA 2X5OA 2W2LA 2AE1A 3KLPX 2HCTA 4EUFA 3GUYA 3PJEA 4RJTA 3JQ9A 2GSDA 2W2KA 1PR3A 1UUFA 1YS4A 7MDHA 1EMDA 5ILGA 3SBOA 2I99A 5IG2A 3ZU4A 1C14A 3VZRA 1NPTO 2W4QA 3LT4A 1EBUA 1Q1NA 3K30A 3NGLA 4I9NA 4PG6A 3S1LA 1ZK2A 4RF3A 3I23A 1NX6A 3INGA 1YDEA 4YT4A 3ORFA 1I2ZA 2VNAA 1E0DA 1I2BA 3S2IA 3DAGA 3DAPA 3LLVA 3TN7A 5CDSA 1SOVA 3CE6A 1ZBQA 2BI8A 2TMGA 4IPTA 3WOHA 4YQYA 1PGPA 3V2HA 2R00A 1KC3A 2CDCA 4IDCA 4B3IA 4AJEA 4D3FA 5TGDA 2B5WA 2WEKA 4U8GA 1AHHA 1LC0A 4XZ3A 2Z1MA 3WSVA 4NU5A 3UXYA 1IPEA 3WDSA 4TQGA 3UCFA 2D4AA 3K9QO 3FBTA 3IOYA 2Q2WA 2WD7B 4GH5A 4D3DA 3NT4A 4NFHA 4YJFB 1I01A 3OICA 1AXEA 1MA0A 1QV6A 3H9QA 5ICMA 4XQCA 3ZHXA 3RD5A 4K9DA 1KOLA 1K0UA 3DMYA 2O3JA 4ALIA 2YHUA 2W8ZA 1GEGA 4BO4A 2NNLD 2DAPA 3CTMA 5B37A 4CM8B 4P38A 3WSWA 1Y5RA 1I5RA 4IJWA 3ENNA 1NVGA 3FI9A 4ROSA 2BELA 1P1JA 4D3SA 1YE3A 4ND2A 4MVJE 5AQ1A 2RHRA 2WD8A 4BNGA 4FD3A 3H9EO 4FC7A 1OC4A 4RDHA 4BHTA 1WW8A 1FDSA 1K6IA 1LX6A 5A9SA 1BVRA 3DR3A 3IP3A 5FF9A 1N7HA 1V35A 3AI1A 3I5MA 4A03A 2NU7A 4DPKA 4LCEA 2WWRA 4J3FA 3NDIA 2NV6A 4XQGA 2CZCA 2FZWA 5TLSA 3ICPA 3NUGA 3KOUA 1GUFA 4J0FA 1ULUA 1MP0A 1TXGA 5L95A 2VUTA 1TB4A 1U5CA 4WCFC 1ZK4A 5KWEA 1PIWA 3PGJA 3RWBA 4BO7A 1GCUA 4E4YA 1QSGA 1ZKMA 2DBRA 3IJPA 1YO6A 3GVIA 4E2WA 3JD1A 1F17A 3DZJA 4J4HA 1GQQA 4TKMA 1N7GA 3PJFA 5C7OO 3HG7A 3DBRB 5JPIA 1PGJA 2ZTLA 3SJUA 4L4XA 1XKQA 4G2NA 4UUNA 3FNFA 3VH2A 2ZQZA 2PLAA 1NVTA 1IULA 4HFRA 4LK3A 3WQQA 4UUOA 4J2HA 4O63O 1SZJG 3JQFC 3WG9A 1LQTA 3ANMA 3G1UA 3NJ8A 4BO0A 4CL3A 8ADHA 4XGIA 1IE3A 4RLHA 1XU7A 3U4IA 1GY8A 4XJTA 2EP5A 3RCBA 5JDIC 2ZB8A 3DBHA 2B5VA 2YY7A 5C37A 2Z1NA 4AJLA 4IUYA 4ND4A 5H83A 4U6SA 3ZHBA 2FHSA 3H3FA 2J5KA 3JQAD 4IDGA 5CHEA 4PVCA 5KJFA 2AMFA 3RU7A 1A72A 3LQFA 2G82A 4CLDA 1KEVA 2ZIZA 3TZKA 1MLDA 1YQXA 3A1NA 4BL5A 1YWGO 4IDBA 4GL4A 4KTTE 4ALKA 1SEPA 4Y6PA 3KYBA 2RHCA 5HWSA 2WMDA 3MJVA 5L53A 2GR9A 2ZK7A 3FHLA 3LZ6A 1UP4A 4D0RA 1LLUA 3HB4X 1EFKA 2PGLA 4FDAA 3RKRA 3ZNNA 4Z3KA 3UF0A 1I3NA 3D3EA 3D4PA 1HYGA 1D1TA 3TZCA 4KP7A 2NACA 3C7DB 3BHMA 3EHEA 4PLHA 5JE8A 3PHHA 5DCWA 4D44A 4KDFA 4TVOA 4OKIA 4BNKA 2CF6A 4GX0A 2Q1TA 1MG0A 3ADOA 2UVDA 1ZEMA 3I6IA 4Z9XA 5L51A 4BNXA 3GHHA 4HNGA 3UCXA 4GLLA 4YYZA 1E7RA 1W6UA 2JJYA 3GF4A 1WMAA 1P1IA 4ND1A 2OL4A 1V0JA 3QVXA 4KTVE 2ZYAA 3DOJA 2PH3A 4CMEA 1R0KA 5I7SA 3QWHA 2PTGA 4YVFA 5A3JA 4PG4A 5F3RA 2QYTA 5JAMA 1A7AA 4IJUA 1U1IA 3C85A 3S55A 2CFCA 1LQUA 3ZWCA 3INRA 4LCJA 4MVJA 4AVYA 1Y1PA 2VTEA 1VE9A 2ILTA 1DHRA 2IZ1A 4DQUA 4JN6B 4RO0A 3PXXA 4GPD1 4O5OA 4D46A 4MVJI 5EPOA 4L4SA 3PHLA 1P1RA 3Q3CA 3CH6A 5KIAA 4OQYA 4QX6A 2H9IA 2NU6A 3CMCO 4ZD6A 2YHIA 1NPDA 4ZA2A 3UICA 1DRUA 4R1UA 4XJSA 4B4WA 4BNFA 5K6AC 2C54A 4IS2A 2H1SA 2YV2A 5IFLA 3K2BA 1IZ9A 3L9WA 1NM5A 5IDQA 3DZIA 3H9GA 1X7DA 5BNFA 2EHDA 2VZ9A 2HO5A 5U9CA 4RPHA 4B3HA 1WWKA 3W4IA 4CLOB 1Q0LA 4E2YA 3ZWOA 1RM3A 3W8DA 2VYVD 2P2SA 1HYHA 2JD0A 1Z7EA 1U3WA 4U0JA 1I3MA 2Q46A 2ZYGA 3NEPX 4BGIA 2QHXA 4JGBA 4CMKA 3WFIA 3TZHA 3WJ7A 3PWZA 3PI7A 1QMGA 3LDHA 4RPGA 4NBWA 3C24A 3GG9A 4R1SA 3NX4A 2J8ZA 5TJHA 4CV0A 3JQAB 4J9VA 1E3EA 2AQ8A 2ZTUA 1VL8A 1H0KA 4ONEA 4GSLA 5DOZA 3L0DA 1BWSA 2FR0A 3Q11A 1GQ2A 4DIOA 4BGVA 4J7XA 4Z0PA 2P9EA 4IXTA 2X9VA 3T7CA 4XB1A 4NBRA 4XDZA 3SJ7A 1RWBA 1LRKA 1S6YA 3PTZA 4HV4A 3G17A 4FJ0A 1ZCJA 1FDUA 1KEWA 4Y8VA 3P5SA 3HFSA 4WCFB 1UZMA 5KVQA 2V6MA 1NAIA 3RC7A 4EJMA 3DMTC 4GGOA 1PSDA 4NFYA 3JQDA 3T4EA 2BFPA 2P9GA 3PJDA 4UULA 2PZMA 4WLEA 1B16A 1LU9A 1VL6A 4OXKA 4XQ9A 2C29D 4ZGWA 1EK6A 4OGWA 5DCYA 3KBOA 3GNQA 5B4UA 2PZKA 2Y67A 4R41A 5ADHA 3JD0A 3GMSA 2HMUA 4OMUA 1JWAB 4EBFA 4AFNA 3KLMX 1LRJA 5B12A 2Q49A 5CPBA 3RBVA 3MJEA 1V3VA 4P22A 5JCJD 1K5HA 4K6CA 1XQ1A 1NP3A 1H2BA 1TVEA 2LDXA 1WZEA 1PL6A 3HFGA 3LVFO 4PLGA 4WLFA 5KJEA 3HADA 2O3TA 4BNTA 2AEFA 2OUIA 1I32A 3JYQA 5U4QA 5L40A 1NFRA 4DXHA 3A28A 5B4VA 1KBZA 3EVNA 3KYCA 2JHGA 3ZU3A 5L4SA 1HDCA 2J3IA 3PWKA 2QZ9A 2UYYA 3PPIA 1LJ8A 1YBVA 1DHTA 2C07A 1DDOA 1JVSA 4KUGA 2O48X 2VRCA 5ITWA 1IL0A 1E7WA 4FC6A 3N74A 4E5YA 1KETA 3WYCA 3JD2A 4NDNE 2VNSA 4W7HA 1ONNA 1D1SA 2R00C 2PD3A 4XYEA 1O94A 4Z9FA 4ZRMA 4IBOA 1FDWA 3VAZA 1H93A 1DRVA 3BYZA 1BGVA 1I10A 3FF4A 1GL3A 2FSSA 3WBFA 1KVUA 4MKXA 1OAAA 1C1DA 1GUYA 1FMCA 3AU9A 1LLDA 2PA3A 3ZU2A 1PQUA 3JSAA 1H94A 3UFXA 3HE3A 1Q7CA 2IXBA 2Y1OA 2X9NA 1E1MA 3GY0A 4JNKA 1PJ3A 2C2YA 5CEJA 1SB8A 5TIIA 1JW9B 3KB6A 5HM8A 4FCCA 3F3SA 3KUXA 4BO3A 1YB4A 2VHWA 3HDJA 4RF5A 3PFFA 3TFOA 5I9MA 4Q3AA 1H9AA 2DBVO 4WCDA 5T57A 3ZV6A 4B8ZA 2BI7A 3DDNA 2C7GA 5BSHA 4ZRNA 3H2ZA 5IN5A 1BDBA 1Y8RA 1EFLA 3MOIA 1I2CA 2Q4EA 4AJ2A 1XYGA 3GMDA 1DFHA 1R16A 4M87A 1W8DA 4WNIA 1IPFA 5TX7A 3PFWO 4QT0A 1ENPA 2NVUB 3ONEA 1MFPA 1WNTA 3I3OA 2NUAA 1A9ZA 1DOHA 3OA2A 3GA0A 4XGKA 3BXXA 2Q1SA 3ZWWA 2EXXA 3V1UA 1BXZA 1Q2XA 3VC7A 3QVSA 1J49A 3VPXA 4DQVA 3W6UA 5G2OA 5T67A 3DBLB 1VJ0A 3NTRA 1DC3A 2D0IA 4Q3CA 3V2GA 4DYVA 5IJZA 3WBBA 1A9YA 5KOIA 4AJNA 4BMVA 2GPTA 2DT5A 1IHYA 3GFGA 4RF4A 1XELA 3JQGB 5AYVA 3DFUA 3R3SA 1NASA 1F12A 4O59O 1U3UA 2O3QA 5JYEA 1G1AA 1CERA 2X58A 4KMSA 3JD3A 1PZHA 1QYVA 3WNQA 1P77A 3ST7A 1LUAA 4J7UA 3E1KA 4DA9A 4GKBA 4N54A 3L4BA 4GBJA 5DBGA 2Y99A 3WGGA 2AQIA 3OJLA 3K92A 4IMPA 3S8MA 5BT9A 1H6CA 5I7VA 4KZPA 4BV8A 3GFBA 3OFSA 3JCZA 1PJQA 4ALLA 1NQTA 1DC5A 3D4OA 4LRTB 5IZCA 2FOIA 4PRLA 3RKUA 4BO5A 3TZQA 4J91A 4NJMB 5CDYA 2PD6A 3GNTA 3F1LA 4GX1A 1DJQA 1XIVA 2I3GA 3GEGA 3VPFA 1BTOA 2EGGA 1E92A 1C1XB 3E9NA 4WPGA 5KCZA 3TDKA 5BNIA 1WP4A 4CQLA 3KVOA 1GV0A 1QLHA 4NG5A 4RVHA 1N9GA 5DNAA 3DL2A 3RUHA 3NTQA 2AG8A 2RBEA 1RYEA 1ZNQO 4W7IA 5THKA 2HUNA 3SXPA 5HTOA 2VQ3A 4K6FA 1GDHA 3AY3A 3CUKA 1XGKA 4DIBA 5HS4A 1DB3A 1GFSA 3JQ6A 5B4TA 2B36A 3AM4A 4M89A 1ADBA 1LBEA 1U4SA 4JK3A 5IXSA 1Q0QA 3JD4A 4HUJA 4BOYA 3GZNB 1QXSA 5EQDA 4RF2A 3SC4A 3FNHA 1B15A 6ADHA 1DJNA 3I1JA 1J5PA 3RFVA 4B4VA 4MP6A 3ETDA 4GVXA 1T2DA 3QVWA 4IIUA 4KWHA 3WFJA 4II3A 5FFFA 2YFQA 4UUMA 5A4DA 2VYNA 4XR4A 2QG4A 3FCOA 4NH4A 4XYBA 4WK6A 3RQSA 5A5EA 1OBFO 1T1RA 4FFNA 4CLRA 1VLLA 3GGGA 2C7VA 3EZYA 2JFHA 3WGOA 5TNXA 4NMHA 3ZWXA 1UXGA 4R1TA 4IINA 5K0ZA 1E1LA 4BO6A 2J5RA 2XXJA 1NVMB 3PDJA 1Y9AA 2EW8A 2WYVA 4F3YA 3PZBA 3PYLA 4NK5A 4EZBA 1P0CA 3UVEA 4B7XA 1XA0A 3ASVA 4IQ8A 5HBRA 3IKTA 4RZHA 5L3ZA 1QLJA 1YBMA 1H6DA 1R12A 4Y6RA 4PCVA 2Q99A 2JD1A 5KTKA 3HDHA 3F5QA 4J1TA 2V6FA 3QP9A 3NV9A 2I76A 3GRKA 4CMEC 3CZMA 2IRWA 1LRLA 1WLYA 3CMMA 1M66A 1BW9A 3ZI0A 2CDAA 1F8GA 2HK8A 2ZJ0A 3OETA 3GH3A 4FJ1A 4R1NA 3D4NA 1JU9A 5I9LA 2P5UA 2EW2A 5L45A 1E5QA 4JROA 3RUAA 3E5MA 4WEQA 4LSWA 1ZEJA 4J1QA 3CKYA 4CM3A 4PVDA 4A73A 4PLVA 1HTBA 3P7MA 3QQPA 4G81A 2SCUA 4B3JA 1K6XA 4INAA 5ILOA 2WYUA 2WE7A 1W73A 1KIFA 4OXYA 1VKOA 2DQ4A 4R9RA 3VVBA 3WICA 1TT5B 2CSUA 2GNAA 4WOKA 1RJWA 1IB6A 1DAOA 2Q1WA 4CPDA 1EVIA 1R15A 2RAFA 3FPCA 1H5QA 2ET6A 4CM7A 3O4RA 4URFA 3WTBA 1BXGA 2Q45A 3WGTA 2HRZA 4XCVA 4YXFA 1UP7A 4MIYA 4LRSB 4O1MA 4FQ8A 4CJXA 2Y0CA 1YB5A 3GDFA 4P4LA 4EYEA 2GUGA 1R4MB 4XRGA 4IXWA 3HN7A 5JMWA 3PHGA 2FR1A 4YR9A 1R4NB 4GAEA 4CQMA 3BMOA 2DM6A 3DHYA 4CUZA 3OM9A 5A02A 2FZEA 2Z5LA 3O03A 1HWYA 1YL5A 3VTZA 4LGVA 5G0SA 4FJ2A 4K1LA 2P5YA 4RQTA 1LTHR 1CETA 3OF2A 1DXYA 5COQA 1GEEA 1KC1A 1I33A 4WLUA 2VOJA 3FD8A 1YBAA 4CMCA 2OP1A 3ZWYA 3UN1A 2X7HA 2J5QA 3GVHA 1GYPA 1LEHA 1GAEO 1Z82A 1YH3A 3AUAA 3HHPA 3D3WB 1EUZA 3HNPA 2NQ8A 2IEDA 1H9BA 3SC6A 1R0SA 3VDRA 3P19A 1F0YA 4HKTA 5ITVA 1UZNA 2GN9A 3JYLA 1GZ3A 5JAQA 4MVJD 2F00A 3DHNA 1K3TA 1PQWA 3GAZA 4B79A 3BHJA 2EKQA 2UDPA 3JV7A 4G65A 4QTZA 2JD2A 1RYDA 1BXKA 1D7OA 3D1LA 1E7MA 4RPKA 3B1JA 3PIDA 1MG5A 3N58A 5G0VA 2O23A 4R9SA 4HNHA 4A10A 3OHSX 2GZ1A 1NR7A 4XD2A 1P44A 4B4UA 3OQ6A 1HE2A 5A03A 3DHEA 1YOVB 1X14A 4MIOA 3SEFA 2NTVA 2R6JA 3W6ZA 4E5PA 4AJKA 4W99A 3OEYA 4OQZA 3BMQA 4BKPA 5JNLA 2RH4A 3I52A 4L0QA 4Z0TA 4M49A 1HSZA 4D42A 3PEFA 5CEFA 1ISFA 5TT0A 1PZEA 1MXHA 3BMCB 4IDEA 3PWSA 1N1GA 1PJBA 1MGOA 2EF1A 1G0NA 4ILKA 4KUHA 5DF1A 1ORRA 5GZ1A 3PQFA 4CR6A 1C0KA 1PJTA 4YB8A 2ZB4A 3KEOA 1ML3A 5A04A 3GRPA 2HK9A 2QRKA 4NR0A 3SLGA 3LT2A 3W4KA 2RH8A 1HKUA 2BD0A 3OSUA 4P4NA 3Q2IA 1EBFA 3ONDA 3GAFA 1XHLA 3VHRA 1YQGA 3VZSA 4RDIA 1XDWA 3KSDO 4F46A 1RKXA 3RVDA 2NM0A 5T5QA 4M55A 1JN0A 3B1KA 2J3KA 2OHXA 1PGNA 4H16A 3U4HA 4B8WA 5F1OA 2VZ8A 4DVJA 3NTOA 3A06A 2ZJ1A 3MJSA 3WIEA 1YXMA 3GEDA 4WASA 3RUEA 3TZ6A 1HL3A 4QO8A 4XGNA 3AM5A 3DZFA 3LC1O 1Q7GA 4AJPA 3KRTA 4ITUA 4H15A 2YDXA 3ULKA 3RIHA 4U6QA 1HEUA 3E18A 5T8KA 4PLYA 4BQPA 4TKLA 3PDUA 4HFMA 4QSMA 2BGMA 3UH1A 3RC2A 3H9JA 3JQBA 4FSHA 1GYQA 1PL7A 3BIOA 2WD7A 4I5EA 3UKOA 3WYBA 4BB6A 4BO1A 4TSKA 4YJFA 1BDMA 3H7AA 1U9JA 1GU7A 2Q2VA 5COAA 5F1PA 4KDEA 4DYDA 2UUOA 5EN4A 2YDYA 3U09A 1EK5A 1VPDA 2CF5A 1HDXA 3K2EA 1ZXBA 1L7EA 1V3TA 2AQKA 4PZEA 4HWKA 5JY6A 1LNQA 3ZU5A 5GMOA 1TLTA 4KWIA 3TPCA 3Q6IA 4CM8A 5JO0A 4JLWA 3QW2A 4BNZA 2IZ0A 4TRJA 3UGKA 2O4UX 3QWFA 4BNVA 2G5CA 1U3VA 4EEXA 1BHSA 4E33A 2DPGA 3HDYA 1ARZA 4Y9DA 2UV8A 3TF5A 5EERA 3UCEA 4J9UE 4AJ1A 2EJWA 1HDRA 2WYWA 4DC0A 4YJGB 2JAPA 2E82A 4PZCA 1GR0A 1DLIA 4I5GA 5KVSA 4GLOA 4E12A 6LDHA 4IGFA 3GVCA 2VOEA 1YGYA 4Y67A 5G0UA 3L4BC 1VKNA 4L73A 1Y8QB 4NBVA 5BSEA 1SMKA 2WDZA 4Y98A 3DO5A 3L6OO 1HLPA 5KJCA 4MVJM 4MPDA 1HYEA 3WXBA 3FTPA 4DMLA 5IZCC 4XA8A 1A4IA 3AOEA 4OH1A 5K9ZA 1ISGA 1UP6A 2BLLA 3K73O 3K8ZA 4K28A 4LN1A 3GUCA 3GN2A 4YRBA 3RSHA 2EERA 1PWXA 4D43A 2E49A 5JDCC 4J49A 5CFZA 3GC6A 5TT1A 1PU2A 1XU9A 2OZPA 2X9GA 4BIIA 1H2HA 4BNUA 3N7UA 4U0KA 3HDQA 3DBRA 3C3XA 4LVCA 1LI4A 5IDXA 5CG2A 1ADGA 1KVQA 3NDRA 4J43A 4YJHB 3ZZNA 4BS9A 4M8SA 2PKRA 4KUEA 3SVTA 3AI3A 3HUDA 1SOWA 1DFIA 3OMLA 1ZW1A 4DLBA 4IJKA 4ZN6A 4W9NC 1ZMOA 3W4JA 2IYPA 5MGBA 4IS3A 3U3XA 5IZ4A 2PD4A 1XLTA 1UXHA 4YAGA 2FN7A 3D7LA 4OSOA 1TA4A 3JYOA 2LDBA 1Y9EA 1YKFA 2DBZA 2VZ0A 1I3LA 4PLFA 1W4ZA 1PJ4A 5AXBA 5L7YA 5DCUA 3RC9A 2DU8A 4XIYA 2Y1FA 3ZW9A 1DBVO 1E3IA 1P1KA 3QWAA 4OOFA 4LMPA 1EEHA 3DBVO 4R3WA 3GT0A 4U7WA 3ROKA 1I8TA 4C7KA 1V8BA 2P68A 5KVCA 2AW5A 1WDMA 4IGEA 4QUKA 3GOHA 5TC4A 1Y7TA 3O9ZA 3PP8A 5LCXA 1HDYA 2A92A 2Y0EA 1HSOA 5ENVA 4QO7A 5DBIA 5L7TA 1R6DA 3GR6A 1IHXA 1SNYA 2CNBA 5GY7A 1HDOA 4II2A 3M6IA 2EP7A 4IMRA 1IOLA 1E3WB 3A4VA 4QECA 3AI2A 4BKQA 2ZTMA 3OH8A 3ZHZA 1D8AA 5TRTA 2IDZA 1X7GA 2YFHA 4MIEA 3TSCA 2Q3EA 9LDBA 1SB9A 1T26A 3QWBA 4GMFA 1HETA 1MX3A 3H9UA 4KQWA
chains in the Genus database with same CATH superfamily
2P3SA 2RAVA 3PF8A 5FAXA 2BGJA 2WJWA 2ZCUA 2OQ2A 4L4UA 5F1KA 4UVHA 1RJGA 2CC2A 3KSZO 4JBYA 1E2IA 4N5IX 2ZUTA 3SJZA 2GESA 4TQUS 4UARA 4Y2SA 2BI4A 2VPPA 4G4GA 1TJ5A 3CW9A 3AM1A 1MXFA 1UMDA 3ZQ6A 1KDRA 1XRMA 2HEGA 1YRBA 2BFOA 3WBJA 1C3OB 3O8QA 1N2XA 3ZEAA 1SD1A 1P31A 1JAZA 2ZATA 3COVA 4FXOA 4PPGA 3T52A 1K5DA 1K9SA 1FVOA 1GGMA 1RP1A 2APJA 3QLTA 4HI0E 2QY9A 4GI7A 3VKVA 2HK7A 2CB0A 5JYCA 1PVVA 4FPXA 4JFAA 2R7NA 1R6BX 2O6HA 5IK2D 1Y1RA 1OE0A 5HA5A 5JAHA 3PE3A 3B70A 1FUKA 1NAHA 1DAKA 3RRYA 1LY1A 3O38A 4PS0A 5KC9A 1KA9H 3LLSA 4HB2A 2FDCA 3LCMA 3AH8A 4FCWA 4D02A 3FLMA 3G2JA 3QRWA 3SSOA 4NBUA 2FVXA 2C1XA 4TQAA 2ZBUA 4WN9A 3ZIAD 2EZTA 4CV2A 4G26A 3HA5A 4TMKA 4CTMA 2BFAA 3U7GA 1JAYA 3QE3A 3G8BA 3P2JA 1KGSA 1SG0A 2M6SA 3HUEA 2AEEA 4YWJA 5BWCA 1EUQA 2BH9A 2FX2A 3PVZA 4FOLA 4YYEA 1H8HA 4DCOA 5EMNA 4RGBA 1W5EA 4YN3A 4G97A 1V3QE 1VGQA 3U9LA 2ASEA 6REQB 2XNHA 1DIRA 1RDFA 4ZT2A 2MYNA 1QKKA 1WPXA 2AHOA 2JIZD 3BD6A 3N7AA 3H2KA 2XD9A 1Z6PA 1AY0A 2WVJA 2XOXA 4IJMA 4JOCA 5K0FA 1TF7A 2XWBF 4RD4A 1J09A 4QYMA 3VQTA 4EZIA 5IJ9A 2G8NA 1SG6A 2W2PA 3GJXC 3EDMA 3OIGA 4HRAA 4MI9A 4BLUA 1AKTA 4WZBE 1E9FA 1F8FA 1PG5A 3CZRA 4LJ7A 4F85A 4EL5A 3AEQB 2HA7A 1X13A 2XXBA 4AMVA 2Z3WA 4KIJA 5LIPA 2O8CA 5CDTA 1AK1A 3TM4A 4LY3A 4I0WB 1ZESA 3MBIA 1OX4A 1JKMA 2IZZA 3NWBA 3QA9A 3CX8A 5CXQA 3PQEA 3T9BA 4C6TA 5FR1A 4E2ZA 2R1TB 3UMMA 3L4KA 2ONCA 3ELUA 1CF9A 3T0GA 4R01A 4DVJA 2D5CA 2ERCA 5BN3A 5JCOC 1SHKA 5AD1A 1CDOA 3AMVA 2HMSA 3TL3A 5KTNA 1SCBA 4W8GA 1FVFA 3X1WA 4Q39A 1KI6A 2ALJA 1MX9A 1CIJA 1SCUB 2P65A 1G20A 3W04A 3N0VA 4H7KA 2BBWA 3OF5A 1KVSA 4HXFB 1B0ZA 2ID8A 4IWNA 2IKQA 4JU8A 1X19A 1XDZA 1VJRA 4RJJA 1SHZA 1OT5A 3V2IA 1YB1A 1MB0A 1TA9A 2W5UA 2Z98A 4KQXA 3L0OA 4ISBA 2WR8A 3EXFB 4ZP1A 3TIXB 5EPEA 2LE0A 2I1VB 5D5HA 1UINA 2XUAA 3IKLA 1O87A 3DZDA 3CX3A 4QOEA 4ZQBA 1RE0A 2FOXA 4GO1A 3HLYA 4RHYA 1P81A 3FHTA 1A4UA 2BMVA 5JNTA 3RAGA 4DHWA 4DWVA 5HZKA 4RD2A 1PTJA 1WZCA 4IY1A 3UWPA 4R0NA 1D04A 5HUQA 2H7XA 1UDAA 3PWTA 4R8RA 5KOHA 1T25A 2BM1A 5DT9A 5F1YA 3ZCQA 4DMGA 1E4EB 3C43A 1FS4A 5CNJA 1LLCA 1SC1A 2CEAA 3GEIA 4B8YA 1SVSA 4DMFA 3RK4A 1DARA 1Z7GA 2E9SA 2RI1A 3BMNB 4Q1CA 1O57A 3A37A 1XTVA 4KC0A 2BGRA 3ELDA 2X2EA 4J0IA 2B4QA 1Z3CA 2C82A 4QXOA 2VHCA 3PUKA 4RY0A 1GUZA 1XSEA 1S2GA 4TROA 1T5BA 2WU3A 1Z13A 3VO9A 2YVUA 3GT4A 2CHVA 4W63A 4ZZ0A 1VA5A 3I1FA 1RQRA 4FWTA 1XNHA 2GCPA 1SHTX 2GEJA 5FWYB 3V8VA 2E4UA 1GILA 3F8TA 1VSUA 3NJ4A 2JAXA 4OHFA 5ICCA 2Y93A 1ZIPA 3ANXA 3NGXA 2FSVA 1ZVVA 1SHLA 2FZVA 3PEVA 5TMBA 3R5HA 3JQFA 2D2IA 2HF2A 3H1TA 4LXIA 3UYLA 3R8FA 5I6DA 1WXFA 1Q19A 5G0WA 2LGJA 2FCAA 1GXSB 2YQ4A 4PTZA 3V97A 2DPHA 2E0IA 3NBMA 3U7IA 4EA8A 1EVZA 3VISA 1WZIA 4FHGA 2GEFA 3NR2A 1W75A 2A1UB 2XMZA 3HCPA 1U7HA 4Q7KA 2R44A 3FTNA 3IQXA 4BWYA 1PFVA 1PWZA 4WK4B 4DABA 1FY2A 1UQRA 2B6NA 2Q5IA 4GPIB 4H0NA 4F6CA 1CV2A 5EMJA 3T1OA 5IN4A 2FX3A 2P3OA 2QX7A 3UK7A 2A35A 4EJSA 1E94E 1RPZA 3G0OA 3GRZA 3KYDA 4KQ1A 3LXRA 1F2VA 1XI2A 2AZMA 3JVVA 5FX2A 2Z43A 521PA 1TJ3A 3E58A 1E9BA 4QDOA 4UHEA 1KQNA 3TSOA 4NCAA 3L05A 2RHDA 3CB4A 1P4JA 2VNKA 1J6UA 5I9NA 2Q6KA 1YHYA 4MGKR 1SUPA 2BGIA 3G8YA 4QDZA 4ZRDA 2D3TA 5L3SA 4YRGA 1V7QA 4P7GA 4EYQA 3S1SA 4RHTA 1ECFA 2IZ6A 5FPQA 5LMZA 1AT1A 4B6OA 1B7GO 1ECGA 1E5DA 1NN3A 1ZN8A 3D0KA 3RC8A 3TM5A 4O2AB 2F17A 2OXCA 5H82A 3AETA 3OLWA 1AUPA 2JJ8A 4LMAA 1ORVA 1VI6A 3CNBA 1PJCA 1PZFA 2L0XA 2Q3MA 3EXIA 2RDMA 3FKJA 4LGMA 1BZYA 1FF9A 1V1MA 2AMYA 2FSPA 4OIMA 2E5FA 1BRTA 1BX1A 5A4JA 2NT4A 1NONA 4W5HA 3HXOA 4UVIA 1SCKA 3W8EA 3T99A 1N3YA 5A3QA 3EX7C 5SZHB 1RT9A 3H18A 3R5XA 1SKMA 4OYLA 8OHMA 3G2LA 1XL0A 3G79A 1L3CA 1P45A 4HN9A 1LJUA 1SQFA 3EXG1 4L95C 2P9HA 4QBIA 3O2QB 5C9ZA 1JG7A 3KFLA 3K71B 4TMVA 2Y0PA 5JXWA 1BMFA 3T3HA 2WSYB 3N6VA 4OF4A 4IWXA 3AW9A 2E4VA 4R54A 3D3KA 3AHHA 1AUQA 3SI7A 4MINA 2JLVA 3C6YA 3R0QA 1TRHA 2JHFA 4NBSA 4OTZA 5DDIP 1L5HA 1DGQA 1RIIA 1BO6A 4WA8A 2H18A 1L9KA 4EVIA 2DKFA 1ID8A 3AERA 2JI4A 2UYQA 5GOZA 3PQ6A 5J4VA 3T3MB 3WRVA 4MB0A 3AESA 4HF7A 2PSDA 2JGFA 4UREA 3AVYA 5C8YB 1T24A 2GWRA 3WRYA 3I9LA 1ICIA 2VWQA 2WJJA 1IIBA 3H97A 3H2JA 2ECFA 2ACEA 3G3EA 3AONB 1PEKE 4CIWA 3JAMA 3U60B 1FSPA 4U63A 4ZEMA 2GN4A 3GA7A 4V2IA 5H81A 3REQB 1TKRA 2ZJ4A 1E9EA 1ULZA 4DUYB 5EXSA 3PJRA 4Z0NA 4PN7A 1E99A 1E6UA 4H2DA 4YJDA 4A2WA 2NUBA 1ISJA 4A0SA 1YL6A 2QSJA 3SE0A 5JEEA 1FTYA 4P84A 1L5VA 4M60A 3BJRA 4KN6A 4RH0A 5A06A 4NJMA 2C0PA 3TI7A 3TW8A 3PHJA 2VPQA 1K7YA 5A9TA 3DFZA 2GCOB 1L5SA 2A33A 3FWPA 3P9KA 4NXMB 2CL6X 2QDXA 2WSMA 3DYBA 7REQB 3GLUA 4UM8B 1IBCA 1ZIYA 4LRXA 5C5DA 2CXOA 3BTSA 3L8GA 5EC8A 4JI5B 1LDNA 1XVVA 5BQPA 4JLPA 1QP8A 1ZK0A 3VSBA 3R5TA 3GA5A 3NU1A 3OJFA 4J3JA 1U7PA 2JDIA 4JJIA 4EGFA 4M9SA 3CC8A 2YZGA 4JYBA 1DO2A 4NBLA 3T0FA 1L8LA 4YACA 3PDCA 4MR9B 4AF7A 4MVJP 2QIOA 3IILA 2P8SA 3G6WA 4QSHA 3WMGA 1FYVA 2W6MA 5IVHA 3Q0IA 4QQRA 3MAAC 2OKGA 2VLIA 3IBYA 1J0AA 1JFTA 3IKVA 1UMKA 1Z7BA 1OZAA 1DKMA 1RLJA 1M6EX 2PJDA 2Q2QA 3F4LA 4N8SA 5K0JA 2QM3A 4WLVA 1WR8A 2HRCA 5DYTA 1KJJA 4WXRA 3LDAA 4HS9A 4ZPXA 3HKEA 2WILA 3UW3A 3JX9A 3EW7A 2UVPA 4LSGA 2X6TA 3RYTC 2JLYA 4X63A 1WU7A 2HB6A 1T5SA 2PY6A 5K51A 1T4CA 2II6A 5LVAA 2WJPA 3KG2A 1ZJ4A 4N65A 5EINA 3HTXA 3IIEA 1D2RA 1ZM3A 1EVYA 2H1OA 5EIFA 4RKEA 2YHSA 3BH7A 4CG0A 2H4FA 3LMKA 3TWOA 4QM6A 1D4FA 1KDOA 1MC5A 3LQRA 4X97A 1P7VA 1UC9A 3TUIC 3UK0A 3QVMA 1G8JA 1CUVA 5KQMA 4C20A 4NI5A 1NN1A 4UEWA 2ZJ6A 3VR4D 3DMDA 4BNLA 1ZOPA 2P1DA 1DCTA 5JFOA 4GI2A 1LFAA 4W6ZA 3AM3A 5H4GA 1P3DA 4EHBA 4PLPA 1T9HA 3QXJA 4WBNA 2M6KA 5EYPA 2ZRIA 3MFQA 1HFEL 1MAAA 1TTHA 3EIWA 4LDNA 1RBMA 4IDNA 5CBKA 1ZR4A 1HNWB 1AKVA 1YJAA 2BWJA 2VK2A 4XJXA 4EI7A 4CR7A 2QVBA 1KMHB 1KI2A 5FNVA 4ZAWA 3OBBA 2RE8A 2OAP1 4TV9A 5AUPB 4YTEA 4GD3Q 3RUFA 3H2BA 2V7XA 5AIBA 2WIKA 3N8GA 1ZH8A 2WWGA 4LSZA 2DWCA 1Y7HA 3S5UA 1XCOA 3SMVA 3SNHA 4NPHA 4CLEA 4EW1A 1KAQA 1M7GA 4BKUA 5H3HA 4XQ0A 1YJQA 4EELA 1RKUA 4PY2A 2Q1UA 3U1VA 4E32A 1PR6A 3JTMA 1UC8A 2TMKA 4FP9A 3D6TB 4B17A 5DT2A 4WADA 3R3XA 3CTPA 1J8YF 5K0NA 2B35A 4C0WA 1ATZA 3OLQA 1OXSC 1KERA 1U3GA 1U0GA 5ED0A 2YZNA 4CU5A 1HT2E 1VRVA 4UJ5A 4DV3B 3OE4A 2PMFA 2Y1XA 1KVTA 2JAWA 3D7SA 4D41A 3HN2A 3U4DA 1BSVA 1MC4A 4WNCA 4KXMA 3RVNA 4IUCS 3GLHA 4JQCA 1UXKA 1YRYE 2GYWA 3INTA 4I46A 4NBVA 4UAGA 3WK4A 4C4AA 2D5AA 5I5GA 5GJWC 5TLSA 2GBIA 2JGLA 2OO5A 5AICA 2IUEA 4CCYB 1TM3E 2ROQA 2IODA 2NV0A 3O4GA 3OKPA 5B1YA 5ES4B 3NMUF 4GXQA 4NC9A 5IAAA 1LD3A 4QUDA 1FJHA 4IZHA 1M2OB 1Q91A 1QOPB 1SWWA 5DBOA 4MR7A 5K3DA 4MJ7A 5FTMA 1U3TA 4CIAA 4B7AA 2PJRA 3IP6A 4CEIB 3WGHA 4GOJA 4UTOA 2VJOA 4NYMR 3DBHB 3QK7A 4X20B 3WLEA 5ES3A 1X94A 2OORA 3HZZA 3I2YX 3MELA 4JXKA 1IEVA 2XWSA 1GZ4A 1QUEA 1W0KD 2VWPA 5IFKA 3P9XA 3R24A 4LDQA 2BSQA 4BMSA 4AY4A 5C8ZA 5KYGA 1SAYA 4EX7A 4XW2A 2OLKA 2OSBA 2O1WA 3X1MA 2QLJA 4N0DA 3QKTA 2A5DA 2VUUA 3MUOA 3ZDRA 4H4EA 1ZUIA 3K6SA 4ZEOA 3ZBUA 1T10A 4P0PB 5CURA 3E1SA 4N3BA 2BRUC 4X6UA 1Y3AA 3L07A 1UH5A 2QMYA 2C9ZA 3FGOA 3LKBA 3URMA 5LPNA 3T9CA 3N05A 4R1PA 2HQBA 2PVPA 4XJVA 3NTUA 2GN8A 2FPIA 2J3MA 3DXXA 4DZZA 4OQQA 4E2XA 3QXHA 4A2PA 1UBHS 3N0TA 3QY0A 1UEJA 4EW2A 1RHRA 3R8XA 2C4UA 4JIGA 3TLGB 3GHYA 2XY4A 1QUFA 4LBZA 3GAMA 2R85A 5FV7A 3WI7A 1EQUA 1CJCA 1W46A 1X1BA 4CKZA 3NS7A 4BNMA 3KEGA 5EQTA 4DM7A 2J31A 2HDNB 4ER5A 3ZLUA 3SBDA 2XTJA 4JJ8A 3ZW8A 5F23A 1BHO1 3K9FC 1E1QA 3ZPXA 3QTTA 3NHZA 2VQEB 1LPAB 1WMSA 2QW0X 3MINB 5A5GA 1PZNA 4KAJA 3DKIA 4MUMA 4E21A 1SURA 4FI3F 5DIFA 1R9JA 2GZAA 2HHCA 3AY0A 1LS1A 4F12A 1U8AA 3FYUA 4XUCA 3WMWA 1QK4A 1IJFA 1VBKA 4DKJA 4C7BA 1AF4A 2CEKA 3FZQA 1D9XA 2WU0A 3PG5A 1LV7A 3A1SA 2Q6VA 1K8XB 1KSFX 2Z1DA 3KPYA 5HKLA 1AZLA 1JPVA 3T9EA 4P35A 3ZWMA 1AGRA 3Q8WA 2E5WA 1FFAA 5JSHA 1U6JA 1YR1A 2ID7A 3L8YA 1UMBA 4J1NA 2VAMA 5GJVC 1BA3A 2X1HA 1I3KA 1NW3A 2VYFA 3WGQA 2ENWA 2EYUA 2QZJA 1SD2A 3DZCA 3AY7A 2MTBA 4O4LB 2TMDA 2VRCD 4U9UA 4YT5A 5JV5A 4GW3A 2P4SA 1LDMA 1E2UA 1IMJA 2W4MA 3PEUA 4DMMA 4C7JA 1NHWA 3QVTA 5EMLA 4IRUB 3L0YA 2HUPA 1M67A 1E2FA 4BWFB 1HY3A 1VMKA 1FZTA 1G5RA 1QAQA 4KZKA 5ALQA 2XHZA 2O3SA 4QASA 2X22A 4TYPA 3T3IA 3DNMA 5H8WA 1ZSYA 1NVVQ 1E6KA 3MJHA 1V6AA 3A26A 2G80A 1XQVA 3NT5A 1RRGA 3GK3A 4HP8A 4N0QA 5HIJA 1KY3A 2O0MA 3EBOA 5EXTA 4WL0A 4Q21A 3GJ0A 4MRPA 2FPMA 5IYZF 2XPCA 3NB0A 4YJ2F 1U8FO 1JBQA 1GG8A 2V1XA 3LCUA 4S1PA 2NMVA 1SQ5A 2WUGA 2YHIB 4QUAA 3NC0C 5EE1A 4B7ZA 5JC8A 3ZHYA 2HHAA 1KQFA 3OG9A 3TQHA 3B9QA 2YOHA 3U7JA 1TUBA 5JC1A 1M8JA 3HFJA 2IXGA 1KEEB 2PZFA 1XRNA 4ZO7A 5IMBA 1FQWA 5I45A 3GPIA 5F5XA 3P2OA 1C2TA 4QATA 3ICWA 4GZLA 1Q95A 4H9GA 1HLDA 1PWYE 1ST2A 2HSJA 3WP1B 5I7EA 1U7DA 5F7XA 5HOEA 1AF7A 1Z4QA 5FBZA 4YQFA 4IH1A 3BAZA 2VPWA 3PC6A 4Q01A 2ZM5A 4CGYA 2O7RA 5A0VA 2FPPA 4LGCA 3U7FB 3ORYA 2QY6A 4EG1A 3ZJVA 3ZQUA 3DTVB 3RREA 4G86A 1H2XA 2X3UA 4RADA 2GYYA 1I80A 1VE7A 2HTEA 3DG9A 1KRWA 1JKIA 2Q9BA 3LT1A 1SELA 3SPXA 2D8AA 1WDKA 4NPCA 3H6HA 3M34A 3WKEA 4TWAA 1L6RA 1JU3A 3G5AA 3F5DA 3ZJYA 3OSZA 4A27A 4BVLA 2PKEA 4TXJA 3Q9UA 4ZK2A 1GKKA 1GSOA 1RRMA 2IPOA 2ERYA 2BFCA 4C2AA 3WBKA 3HR8A 4N01A 1CP2A 4RVGA 3ZWAA 3RTGA 3NNNA 4TTJA 1B0UA 3M83A 4EQZA 3PE6A 2QRZA 1KEPA 5JSFA 1XROA 3E48A 1ZO8A 1I2DA 4AK9A 2GBGA 1TFUA 1E2LA 3VXKA 3U19A 1UPTA 4YCJA 2YL2A 4WK2B 5BRNA 2VTBB 2ZPUA 3FROA 2YYSA 5FOXA 3PBKA 2ZETA 2UAGA 1TVKB 1CQIA 4LZLA 4OVKA 1H42A 4RKQA 1VA4A 2QKYA 2AZ4A 2X7JA 3TBHA 4IILA 4QEDA 3EF0A 4P7JA 1PX2A 2OG1A 4ARZA 1JFVA 4C4TA 5TRTA 1E0AA 5CJJA 4QC2A 4TTRA 4MQEA 1Y8QA 4YAFA 2OFPA 3JQEA 5CM2Z 1Q22A 3OWHA 1UBNA 2DHEA 4RVOA 5A0TA 3UUFA 4X8OA 6YASA 2F2TA 2V54A 3KVNA 4DTIA 3IDFA 4BQOA 4EITA 2VHXA 3G88A 3U44A 2V7BA 5COBA 3CEJA 3QOYA 4ZCLA 1LVHA 4M8NE 4POAA 2MCFA 3KEQA 1XQXA 5HDBB 2OPBA 1HBJA 1ODCA 1PS0A 4S3MA 5JSYA 2WF8A 3U9SA 4B5KA 2FPGA 4UVDA 2CXHA 1QG2A 2C77A 3EXHC 5DJ5A 4EY6A 3OTWA 1UZUA 3FY4A 1X1QA 4MV4A 2OGUA 3JU3A 1FNSA 4CV1A 1UM8A 4Q3NA 2IYZA 4P58A 1W88A 2MJLA 4RQAA 1E0KA 3GEPA 5BNTA 3IL2A 3BXFA 3QSGA 1RXSA 2P4UA 5C5IA 3MSCA 4B6GA 4DA4A 2QLBA 3DBIA 1IJBA 5IS2A 3LQKA 1T0UA 4K9NA 4LFBB 2VT3A 3GZ4A 1WDWB 5HIIA 2Q5FA 3BRQA 4R84A 4C4PA 4P8RA 3ESAA 4HUTA 3MJRA 3GLQA 1DAHA 1G3RA 1IY0A 1R5JA 1UT5A 2B5OA 1YB6A 2EG5A 3KCQA 4TT8A 1XZ8A 2HJGA 4MLDA 3GOQA 3K1JA 4BFVA 4R16A 5EZ6B 4DT1B 3DB1A 4HDSB 2ZREA 1IHPA 4X62B 4DREA 1BMFD 4G6ZA 2IYUA 4AIRA 4OD0A 3N8KA 1VSBA 3ZKWB 3W7VA 3SFTA 3WQBA 3ZY6A 5BUSA 4R69A 1G8SA 4V0MA 4GOXA 3R7FA 2IYNA 4A7PA 1C1DB 3CX4A 1L4MA 1Z4JA 1KY5A 3O4VA 3KK0A 2LNDA 3HSSA 2FUG1 2PE5A 1PUIA 1XG5A 4MARA 4U9HS 3G89A 2YWRA 1JEDA 3EGOA 3CWCA 2WZQA 4DSTA 5GIOE 4XDYA 1XTTA 4LBWA 1V25A 2NU8B 2R6FA 1UPCA 3C97A 1K89A 3PNBA 3K1ZA 5CFNA 4B47A 5EY5B 4NNJA 4M88A 4MUJA 3TQQA 2A0UA 1QU3A 2QXUA 1P9LA 4EI2A 1IDN1 3H2HA 3LU1A 1QHHB 4YRJA 3LKZA 3ROZA 4R1LA 1INLA 5JPCA 2WG0A 3SS9X 5JVDA 2NSJA 5DBHX 3NAQA 4HX5A 5L8VA 3N59A 3W2EA 1GGVA 3NT2A 3QKWA 4R3NA 4CFZA 3ZE6A 4M3NA 5I8PA 2ZJFA 4KPUA 3UWOA 3PZRA 3AUXA 1RPJA 4GR5A 4YRPA 3VAYA 1VKHA 2DFPA 2C7QA 1O97D 1OBHA 3WL8A 1PSZA 4EUHA 2XUHA 8ATCA 2ZRPA 3B38A 5EXXA 3RASA 4Q1AA 1GSHA 1RJDA 1QFXA 2RONA 5E7QA 4KSBA 3RH0A 3ROFA 1SD5A 3D5QA 3I09A 3NHFA 2OP0A 3EGCA 4QDKA 1M76A 1N0IA 3KKQA 4IP0A 4XWOA 3CEAA 1FSFA 2NQTA 1Z0IA 2IYRA 3Q8LA 5CGQB 5K3EA 3EPPA 4JLNA 4CI9A 1XD2B 4L15A 1Q0ZA 1E7YA 3Q3JB 1SPBS 2E4AA 2P0EA 5EVCA 2IU3A 4RD6A 4QKQA 1SO8A 2CY0A 3JATB 2ZSFA 1GSAA 1EXMA 4GOND 2QN7A 5FWAA 3VH3A 1JA9A 4MV5A 3ZLTA 4EDFA 2B0JA 2GMWA 5KPJA 3LAWA 3QBTA 1I2MA 8MHTA 4LX0A 1S8OA 4G5FA 1T29A 3KBBA 4AJHA 3V8QA 3B20A 3MJTA 3D3NA 4LY0A 3E6AA 5FHRA 4YBZA 5JQGF 3H8VA 4L8YA 2LXNA 3BZBA 5TF4A 3SMQA 3A4IA 1I5EA 4O2BA 3V1NA 1F6WA 5KNBH 3PPXA 1QDEA 3M5PA 3CLVA 4DUPA 1KH3A 2G5PA 2GZ2A 2NVWA 1UT6A 4W5TA 4G23A 2WBLC 3AUUA 3C3EA 4US2R 4CDMA 3C41J 4FBLA 3GYGA 1AQNA 3ZWPA 2IYFA 4OP1A 3CM0A 3UUWA 1TTTA 2BKXA 2CMFA 1IB0A 3E9EA 3G0DA 2GK7A 1MIHA 2XDAA 5HUJA 2X41A 1C1YA 1E60A 1UBCA 1V8ZA 4J16C 3C3DA 3VH4A 3THWB 5JXJA 5BV1A 3ZTWA 3PS9A 1JZTA 1ZNXA 2CCJA 3U6KA 5ALFA 2HZ7A 3O9VA 3R2JA 4A8JC 1T1GA 3HABA 5IAKA 2B8JA 9GPBA 4J2OA 4MWDA 2QVLA 3RDPA 3CPHA 4CT0A 1LDYA 1S1MA 1TZBA 1Y4AE 4K3VA 4QG3A 4RY8A 4O8ZA 5T64A 2DR2A 1Z29A 4L02A 3RHTA 1ZMXA 2G9VA 2VZEA 4PFQA 2R62A 2WUEA 1P0MA 4DCTA 1JDNA 3DCYA 3I04A 4I1IA 5AIAA 3SS7X 1TT7A 5IU6A 1VSVA 3OVMA 4X1IA 3MTJA 2WNHA 3OKCA 4JLAA 3J7AC 1M1YB 1T0PA 1Z17A 1XLVA 3A9WA 1OU4A 2DY0A 4FZRA 3U13A 4CMJA 4BQEA 1Z56C 1MB4A 3C2QA 4JJ7A 4D45A 3L04A 1UDBA 3VZBA 4UEKA 2VJAA 1NXQA 3BL5A 1BAPA 4R71A 4NWIA 2GFIA 5JDIA 2AX3A 2DP4E 3QLEA 3REOA 2LZ0A 3FFAA 4R98A 1U0BB 1TRKA 4C7MA 1GG9A 3SX4A 3WWDA 2OBXA 4TN5A 4YFVA 1VHJA 3IAAA 5ER9A 2HXSA 2JIMA 4EO9A 3LT5A 2FMFA 2G0TA 1MZPA 3RJZA 4F3CA 1SXGA 3MWDB 4I8IA 4ZHSA 3URKA 1DSSG 2HREA 2I6TA 1NF3A 1I4EB 4E3ZA 5KNLA 1L7XA 3RNLA 3KD3A 1HE5A 2IV2X 1YA4A 4CLRB 4JBXA 4YV7A 1PR2A 2W4IA 3GU3A 3MW8A 4V0SA 1Y42X 1B14A 3QPWA 5T8KC 3VHXA 3VSCA 1OX5A 3E03A 5LQNA 4RK1A 1EFDN 4QGFA 1T4MA 2N46A 1VHQA 4IDAA 4P3KA 3D31A 4Q4JA 1UBMS 4BQRA 4YV2A 5IF3A 4EP1A 4KOAA 2UU9B 5JJIA 3ZLBA 2ZRKA 3WK7A 5G40A 4PAQA 5CLHA 4P86A 4P4UA 4ZHQA 1RI4A 1P2TA 1U0TA 2OAQ1 3JWPA 3ZX5A 4QZVA 5KMGA 1OW3B 2XT9A 3VPGA 4KMRA 4BPRA 1I9CA 2VJMA 5HKKD 5KTRA 4JKYA 2YXPX 4JXJA 3F1KA 5GJCA 2J3DA 4Z2YA 1C0PA 5IJ0A 1XZBA 2EGHA 1T4GA 4UNSA 3QX8A 1GRRA 5GP1A 3AHGA 8LDHA 3MJDA 5IW8A 4DCUA 4GECA 1TIBA 2PR2A 5JDCA 1VI5A 1U0OC 3A10A 3MZ0A 4PHHA 2AMLA 3R44A 4QUIA 4LRYA 3AEZA 1FP1D 2D1YA 5EWJA 2IOYA 4A8TA 2JCYA 4ZCTA 2HD4A 1K3UB 4HS4A 4CUJA 1KSHA 3OQNA 4AJ4A 3COWA 3K0AA 1E9SA 1XZLA 4PLTA 2D74A 2OBLA 1G6KA 4NZOA 2FJUA 1JL3A 1RHMA 4NHOA 2OV1A 3LFHA 3SHQA 2BH2A 4A23A 3ETJA 1F4LA 3B8EA 4ZDKA 1QRSA 4AZ3B 1O95A 3EY4A 3F2IA 1Q6YA 1TZCA 1A04A 4TS3A 3KKPA 3ITKA 2VH1A 4RGYA 5CT5A 4EHLA 2CB9A 4D4IA 2EFYA 4W9NA 3C7AA 4IFIA 4LYDA 3TQIA 4LJRA 5SICE 4XIJA 2NZ2A 2MT9A 1ZZGA 4DRZA 4KAXA 3IEMA 1XNRB 1Z0ZA 4L27A 1HYBA 3E3MA 1GUAA 3INYA 1ADYA 3F9IA 4CKWA 2Z58A 1MQAA 4C5BA 1ZM4A 3IP5A 2AN3A 4DMUB 3CINA 3PTLA 1BXGB 5E1MA 4EUEA 3S4YA 3TFQA 1W6RA 2QAJA 4GLBA 2Q1YA 3CXRA 1EAYA 5G1PA 3WRWA 1DVRA 1VJ1A 4D79A 4BGEA 1UMCA 2D0OB 2WAYA 4HWPA 4X3PA 5BORA 1NYRA 3O4JA 1JQ3A 3RRBA 3GWGA 1AMOA 4NHEA 1ISMA 4BEJA 2QT9A 1GPJA 1FX0A 3P0HA 4JUAA 2PL1A 2XBMA 4IYJA 4K1XA 1E2EA 3H84A 2HR1A 3SF8A 2ZS7A 1W52X 2HYIC 2QLTA 1DFGA 2E48A 2QD2A 4ENVA 1WBDA 3UHOA 1QCYA 2JIOA 3RYCB 2WIFA 2C04A 5K4AA 3LI2A 4IIJB 2CWWA 3I01A 5FTNA 2VF5X 2ZQYA 3WV4A 4E5NA 2UYGA 1PLJA 2FXIA 5GV8A 2OGSA 4ADSG 1WSWA 3DFMA 3RVSA 3SFVA 3U2QA 4Z0HO 4UNRA 4KBGA 1C9NA 1PP4A 4B40A 4QAQA 2PH5A 2QMOA 3W2GA 1WVIA 3WB1A 1N2GA 2CVHA 2QTMA 3LBAA 1II8A 1RCUA 3AF2A 3IVCA 3RIYA 5MGNA 3CZPA 3RAFC 2J0QA 3G5TA 3RFTA 4E7PA 4RENA 2FZGA 3PC8A 1NRJB 2ESRA 3QG5A 4H1HA 3CH5A 2C2WA 3P0FA 3M6LA 1ISHA 3GCWA 2REXB 3FJOA 3ND9A 3QYFA 5LYYA 4AYTA 1TJ4A 1M2FA 2WAOA 4RY9A 5JPDA 4KWCA 4WEOA 5KTYA 1WUIS 1T6XA 4AM8A 2JGNA 1XPJA 1W2WB 4MP3A 5E2BA 4LF7B 2BGGA 1A2OA 1AHIA 4RVFA 4TL6A 9ABPA 1RC8A 2NVOA 3LHDA 1JMYA 4LJ5A 4UM7A 1GN8A 5A4FS 3AFOA 5MDHA 4KPYA 2FMXA 4QPDA 5AW0A 3ZGZA 1WVMA 3UV7A 2WLTA 3WYAA 3M8KA 5F76A 3V3KA 3SZ3A 3H19A 1LJLA 2AR0A 3KIPA 2EBWA 3RVPA 2XB2A 2FWJA 2VF7A 3QI7A 2FLWA 1GRNA 3GRFA 1IXZA 2PDAA 4O8CA 3U3KA 1J2UA 3L0PA 1QHFA 3DEYX 3HWX1 1NQAO 3KX2A 4FYJA 5FEMA 1J8FA 3F5MA 4U2CA 2OM2A 4EJFA 3RYFA 5MF6A 1YKGA 4WJZA 1QTIA 2EDAA 3UHPA 1NATA 2G8LA 4IQ0A 1WEHA 5I47A 2AEJA 1U5BA 2W0SA 3A6LA 3D0OA 4Q9NA 3SQMA 5KTTA 4YJ3F 1KJQA 5E1OA 3K5IA 4Q9HA 5K20A 5IVKA 1GPKA 2AOXA 5IAEA 4DTCA 1W0JA 3IAFA 5DNVA 2EEPA 3HJHA 4X5OA 3CPSA 3F5SA 3QEBZ 3II6X 1QGOA 1HFKA 4IHJA 1NVFA 2P2ZA 3TW8B 4EG6A 1ESEA 3FWNA 3ML1A 1E2KA 3VJLA 4V1CA 3ZGNA 1Z4LA 3SGLA 2J5XA 1D7AA 3GIDA 4MCHA 5JLJA 1Y3BE 5B3JA 3DDOA 1DWPA 3IAS6 5F7JA 1JYSA 2HCTA 3C6ZA 3V34A 3B1ZA 1WCIB 2KMLA 3OM8A 3H13A 2FX5A 3FPSA 3QMVA 3KC2A 1H3EA 2H0QA 1PR3A 2NO0A 4Q4DA 5AM0A 1T6YA 2NZXA 1EMDA 1NBWB 1XZAA 2JAQA 2JH8A 5E4YA 3QU5A 3STXA 5IG2A 1AO3A 4JLOA 1C14A 3I8XA 3AVPA 3C6MA 3QVKA 3LT4A 4GPTA 1E2JA 1RQNA 4I9NA 1WHSA 3C98A 4PG6A 3S1LA 4E4RA 2M2IA 2RGRA 1PSWA 4RF3A 4W5NA 4ZCQA 4R05A 4YT4A 3ORFA 2ZEJA 1NUTA 1MQSA 3Q1KA 4JR2A 3CJRA 2CNNA 3T7DA 3FDZA 4PGMA 3ZXYA 3CVXA 1O1YA 1SCJA 2GLUA 2K7ZA 2UZ1B 3TN7A 3KQOA 1SOVA 4NCJA 1N6IA 2Q3BA 2M1XA 4LHSA 3FNBA 2A3NA 3O8BA 3OHPA 5CITA 2AXNA 1KC3A 2PRYA 4DUGD 2K87A 5REQA 2CDCA 4EDHA 4IDCA 2AJLI 1AZSC 4DIDA 3GH1A 1Q1GA 4ENPA 4ZO4A 4R1OA 3FSGD 4TUYA 5JZ9A 3F90A 2X2OA 3FX2A 4XZ3A 1UPAA 4W1QA 2R25B 1O58A 3O8OB 3R0JA 5F3DA 4NU5A 1QJ4A 4Z4GA 1YI8A 1PO7A 3QPUA 1JHDA 4TQGA 2XIQA 3DVSX 5AMXA 3A2MA 3GFFA 2Q5EA 2OCDA 4GH5A 1F0NA 1DS6A 5DYNA 5KU1A 2YVQA 3OICA 4P36A 1CFZA 1AXEA 2H7VA 2MMCA 3TKAA 2XDQB 4Z4EA 4RFSB 4HAIA 4MV9A 4GDFA 1AHNA 2QMEA 2JVKA 2Z2YA 3OFKA 5JADA 1KOLA 3CN7A 2MSWA 2WG1A 4M0UA 3I30X 1ODJA 1SXJB 2GZHA 3ZGOA 4CM8B 2XMDA 3WSWA 1Y5RA 1ZVJA 1T8UA 3SKVA 1JPUA 1U2DC 1YNSA 3GMIA 5LZ4A 1B73A 1H4SA 3NXSA 1DBQA 2OBBA 2FG7C 4IW3B 4K6KA 4ER3A 5JD5A 1NVGA 2QLMA 3FI9A 4P4SB 4TZ6A 1IXYA 1FS6A 3HY3A 5EKXA 1YE3A 2JCBA 4IG4A 4ND2A 4PXSA 2NP6A 2RHRA 3AQ4A 3WL5A 2QGNA 1JDUA 1WW8A 3A6FA 4JVNA 4ZKEA 4JGGA 1AB6A 1YZYA 2H57A 5AHRA 5IH7A 2GS9A 1T1EA 2CLLB 2XCLA 1SUSA 1T2VA 2ZRFA 3QKSA 3QXCA 2BJVA 4M7WA 4OU4A 4BMDA 4P32A 3THYA 3O1JC 3EGDA 4LCEA 5J47A 3PNPA 3OPYI 2EARA 1ACMA 1VDMA 1JQDA 1VPLA 4A16A 1EG7A 2CZCA 4G0MA 3QF4B 3ICPA 5EHXA 4WWHA 1JFFA 4J0FA 4NABA 1MP0A 2PUJA 1IZZA 3OURA 3TXXA 3KKLA 1ZK4A 5DXFA 1MAUA 4UATA 3BE5A 4KAFA 3CXUA 3R7AA 5IJWA 2Q3FA 1PD0A 3R6TA 3HB0A 1CY7A 5F51A 1ZKMA 2DBRA 3FHCB 2Z3ZA 3P94A 2OENG 4A0HA 4WSOA 1TYCA 2PG3A 3MRXA 2V8OA 1GQQA 1RI2A 3DV9A 4TKMA 2CN1A 1F3LA 1N7GA 3PJFA 2H5JA 3WGMA 2FV8A 4PPYA 3ZHSA 3NIDB 2ZT7A 4WY2A 2ZSUA 4BTVA 2FFHA 4OMCA 3ZY5A 3VH2A 1EWVA 3NO4A 4MPTA 1CULC 2A1IA 4LK3A 2ONKA 2H5EA 4UUOA 4GC5A 2ZXFA 1IWBB 5JNVA 3BC1A 1HRKA 5F3WB 1H4QA 2WVGA 4MRMB 2GH1A 4CL3A 8ADHA 4KREA 1SUDA 4RLHA 5TGTA 4BXOB 1L2TA 3U4IA 2P2LA 4G0WA 5BSVA 1XFAA 3UBTA 5EXEA 4YCSA 4MPJA 1D2HA 1WUTA 3AF3A 5EA2A 1RD4A 4KDRA 4YMTA 2YY7A 1S4QA 4AJLA 1XA3A 1KNXA 1QQ6A 3BILA 5ANRB 1G5HA 3NTXA 4ND4A 4LGYA 1AA9A 2ZYVX 1XOIA 2RD2A 5CVDA 2J5KA 3JQAD 4LQ4A 4KXFB 1IATA 5DM60 4PSAA 2XNCA 5C51B 1T6NA 3MM4A 4HRVA 3TQTA 3WLSA 5KJFA 1EM6A 1SR8A 2GSWA 2G82A 1KEVA 1IUPA 1MOZA 1W19A 1IRXA 5KHAA 5FUWA 2OZLA 1S1CA 3SSMA 3MYRA 2DHDA 1YWGO 5DSZA 5H0IA 3CWZA 5CXSA 3V80A 1CY6A 3BH0A 4KTTE 3CLUD 2WHQA 3H6GA 5LJIA 3DNFA 2Q0QA 3D6UA 4UHFA 1K8QA 4HCJA 3VMFA 2GR9A 4Q7MB 5LQAA 2H4WA 1QX4A 3HB4X 1EFKA 2YYAA 3RKRA 3I45A 3C0KA 3ZNNA 3TUZC 5AW7A 3UF0A 3D3EA 3ZCRA 1S2IA 2FFJA 1WG8A 3QIAA 3LHSA 1D1TA 1QE5A 1LB1B 4KP7A 3O92A 5HF8A 3TZCA 4ER0A 4F5DA 5LU8A 2J33A 2IE8A 1YCFA 1GVNB 2P0AA 4D0NA 1RLTA 3BHMA 3KJGA 8AT1A 3DPIA 3ZCVA 2ADOA 3RS7A 1SRRA 1OY1A 1CP3A 4KDFA 2VJPA 1EJ0A 1MBZA 4G0YA 4JI6B 1XN1A 4YRRA 3X1KA 4OKIA 3FTEA 1E4OA 2AFHA 2CF6A 4LTNA 1P7YA 2P40A 2PX2A 2EBUA 1ZEMA 5IM5A 4MWSA 2ZVPX 4EPWA 1BDHA 1UMDB 2IW1A 3F5FA 2R7MA 1A7JA 4FFSA 4FINA 5IAJA 5L51A 4BNXA 1DL5A 3KKEA 5K3OA 2BJWA 3AKDA 3N70A 2HQRA 1W6UA 1SOAA 2JJYA 2C2HA 1NIJA 1TUGA 1YRWA 3B52X 1KXZA 1V0JA 2BT4A 3NM6B 4O4IF 2ZYAA 4ZVSA 3L84A 3TQSA 3DDUA 3PL5A 1JECA 5G02A 5I7SA 1M2GA 3JALA 1OFUX 1D2EA 2WU8A 4FHZA 2J6HA 5E2AA 4YVFA 5HMLA 1ZRHA 1W49A 1UF9A 4TGLA 5DM0A 2VSQA 2CLFB 1NLMA 5F3RA 2A59A 2NSHA 2AFIA 1JALA 3SEAA 3C85A 1E6LA 2CLIB 2CFCA 2OCPA 3F74A 4RH1A 4YP7A 1LQUA 2RC6A 1YTUA 1U11A 3OCYA 3QVGA 2F9MA 1U0NA 2GD6A 3INRA 3M9WA 1Y3FE 4HLUC 5DHRA 5DXJA 4NBKA 4INZA 1ODFA 5FO1A 1NJ1A 3WL7A 4ATNA 1DHRA 4B3CA 5FBVB 4J6EA 1XUOA 4DQUA 4JN6B 4O5OA 1QRTA