3FCOA

Crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with benzamide inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
269
structure length
267
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of novel di-substituted cyclohexylbenzamide derivatives as potent 11 beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 267
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3fcoA00
4K28A 2GASA 2QHXA 2I3AA 1GZ6A 1EDOA 4DLLA 4E3ZA 4YJHA 4QXMA 4GMFA 1K2WA 1RYEA 1MG5A 2X7HA 3Q9NA 4NBVA 1EVZA 4B7CA 3GMSA 4XB1A 1YWGO 4ND3A 1KBZA 3ON5A 3RASA 1K89A 1IZ0A 1E6EA 1YO6A 3GGGA 4YPOA 3HSKA 4BO9A 1PS9A 2I67A 4EJ0A 3GEGA 3L9WA 3JTMA 1FXSA 5F21A 3U3XA 3NX4A 2JAHA 3GUCA 3U5TA 5G0TA 1WP4A 3ZWYA 4BKOA 1R4MB 1SO8A 4GVLA 4XZ3A 4CM7A 4J49A 3GFBA 1A72A 4YAIA 5MDHA 3F5SA 3TNLA 1N7GA 4G2NA 4I8XA 2BFAA 4F45A 2UUOA 5TT1A 1KEPA 3INGA 4M89A 4PIVA 2JL1A 5G0SA 2FMUA 2P9CA 4Q39A 1PTJA 3T7EA 3HNPA 3MJ4A 2VYNA 3NT5A 3CE6A 1GCOA 3K73O 1N2SA 2ZYGA 5BT9A 1JKIA 3PVZA 3ZWBA 1TXGA 3Q9UA 3B70A 4JROA 4XYBA 1NWCA 1P77A 1ENZA 1ULSA 2B35A 2EKPA 4TVBA 5BNIA 1LRJA 3H9JA 3I9JA 1BG6A 4I9HA 2O3RA 4FJ0A 3GY0A 1M2WA 1U9JA 3PK0A 5GMOA 2W2KB 3U9LA 4CQMB 5C37A 4WASA 4B4OA 1BDBA 4X54A 1EK5A 1V3UA 1YBAA 4ZQGA 1C0PA 5H83A 2FZEA 5IJZA 5COAA 1IHYA 4GAEA 2BGLA 1PGNA 2XF8A 1ENYA 2YYYA 3ZHXA 5TS3A 4RL6A 5JFOA 2VWHA 5G0UA 3BTUA 1ZIDA 2GUGA 4CJXA 1V0JA 1WXDA 2ZYDA 1YOVA 4MINA 5DDIP 5JAQA 2GZ2A 2JHFA 3S2FA 3NJ8A 3F1KA 4Z9FA 3N7UA 5HA5A 2WEKA 9LDTA 3EYWA 3W4JA 3HB4X 5K0ZA 2FP4A 3JD0A 1LLCA 2AHRA 3R0IA 2AEFA 3X2FA 4D7AA 2HQ1A 1A9ZA 2UAGA 4BO5A 5BSEA 2NQ8A 1H5QA 1UZLA 4JBIA 3PZBA 2CDAA 2RH4A 2W2LA 3AFNA 4UUMA 4EW6A 2HMUA 5IXYA 1T26A 4JBGA 4MKZA 2R6JA 5ER6A 4L9RA 4KQXA 3JQFC 3DR3A 2QRLA 4FGWA 5H82A 1R4MA 3H9QA 2PZKA 4CMJA 4CUZA 3VH2A 4INAA 3WS7A 3ROMA 2ZCVA 2Y99A 3JCZA 2EJVA 4TVOA 1OZAA 2B83A 3BMNB 3QRWA 5TQVA 1ID1A 1KEUA 3C24A 3JD3A 4A26A 3QY9A 4ALKA 1W6UA 2X4GA 4MVJM 1CDOA 1PL6A 1G0NA 3STHA 4OYRA 4BNJA 1EVYA 4A10A 1VL6A 1R37A 2H1SA 3JD2A 3E1KA 4W6ZA 4PLPA 5IZCA 4Y8VA 3CIFA 1LDBA 4HFNA 4EJMA 3JQBA 2J3JA 3MEQA 4J16A 4RVGA 3U09A 1H2HA 2C0CA 5DP2A 2Q4BA 5ADHA 4HFRA 4LRTB 4YB8A 3A4VA 3T7CA 1YJQA 1XGKA 3ZU5A 2BMAA 3PWKA 1CF2O 4BMSA 2GDZA 1N1GA 1ZH8A 2W2KA 4CQMA 2AQIA 3M2TA 3GVPA 3V2GA 1WVGA 4BO8A 1N9GB 2CVQA 3OJLA 3RU9A 3NAQA 2XAAA 1HDZA 1EVJA 3U4HA 4LK3A 2ET6A 1Q7GA 1E7SA 3JD4A 4OO3A 1HE2A 3C1AA 1JKFA 3JQ7B 4B4UA 3E48A 1U5AA 1XU7A 2J3KA 3DO5A 4BO7A 1EMDA 2BRUA 3TL3A 2C82A 2VT2A 1EZ4A 2BF7A 3IUPA 3S2IA 3LT4A 3VVCA 4CQLB 1ORRA 4FJ2A 4AVYA 1GEEA 5B37A 4AJ1A 4IXWA 1A71A 5F1PA 5ILGA 4GSLA 4NH4A 4IDAA 1DBVO 1SBYA 1FJHA 1OMOA 3AK4A 2Y0EA 2HJSA 1GEGA 1GZ4A 3WGOA 1LQUA 1P1HA 3PJGA 3AU9A 1X0VA 4MP3A 4MDHA 5JAIA 4LCJA 1LA2A 1WPQA 3AWDA 4EUHA 3BMNA 3FN4A 4IY1A 3H8VA 1RKXA 2PKQO 2GF2A 4ZRMA 3EAGA 1T24A 2DBQA 4FPXA 2GGSA 4IJKA 2X23A 3V5NA 1JTVA 4CMCA 1D7OA 1RJWA 1RM0A 2WWRA 4Q3BA 3OQ6A 1T2FA 4NU6A 1ISHA 2QYSA 3H4VA 4CV1A 5JDIA 1UXGA 4PLWA 4MKXA 3UCEA 1H93A 1ZMTA 3IP1A 4E33A 2DFVA 4MVJP 4O1MA 4E5KA 1OOEA 4BKUA 4KWIA 3PWZA 1XU9A 1Y9AA 4YVFA 4E5YA 1DC6A 3ONEA 2EKQA 4Q9NA 2DBRA 3RUHA 1XLTA 4L4RA 3WQQA 5GZ6A 3WFJA 2JCYA 2G76A 4BNTA 5C7IO 3L0DA 4L8VA 3KBOA 3SXPA 3O03A 1N9GA 3JYPA 4P38A 3C85A 1SEPA 1X13A 2YW9A 4HFJA 1L1FA 1E1LA 2YDXA 3LF2A 1PZHA 1SOVA 3QVTA 5JYEA 1U7TA 3UUWA 4BNNA 4ZVVA 3W8DA 5K9ZA 3PRJA 5JDCC 5ITVA 2VWQA 3JQ7A 4YDRA 3PQFA 3OIGA 3RIHA 4F3YA 4J7CA 2BFPA 3GAZA 4I5DA 1GTMA 1QG6A 1KS9A 4ND4A 4DPMA 3R6DA 3ORFA 3KYDA 1T4BA 4CQLA 3CEAA 4XYGA 1DC5A 2IDZA 3MJVA 2VHYA 5IXSA 1ZNQO 1N8KA 4ESOA 2P4QA 3VPXA 1DRWA 4NG5A 4CMAA 1HE5A 3NTQA 2G1UA 4RJTA 5L3ZA 2VRBA 3BTSA 2ZB3A 5KCZA 3QVWA 3E03A 3FR8A 4U0JA 5KNLA 3E5RA 3JQAB 3C1TA 4G65A 4M87A 3FTPA 3OHSX 1DC4A 3X2EA 4Q3NA 1I10A 3T4XA 3TOZA 4JX8A 3C7AA 4M8SA 3GVHA 7MDHA 4FFLA 4RPJA 4NU5A 1HT0A 2D5CA 3P19A 4OKNA 3TFOA 2CSUA 2PKQP 4YBZA 4D42A 1E0DA 1OI7A 3D7LA 2DTDA 2G0TA 1ISJA 2HAEA 3GVIA 4S1VA 4UEKA 3W4KA 1XSEA 3KO8A 1ZCJA 3ZWOA 2RCYA 5DCUA 1WNTA 1JDJA 2DFDA 3CSDA 4D0RA 2VWPA 4ZRNA 4PLYA 3H5RA 4ZQHA 3VOSA 3OJOA 2FY8A 1D3AA 4PRKA 1ZEMA 4FDAA 4PLGA 2YFHA 4WK6A 2PY6A 2OOSA 4ZU3A 3ZWVA 2V65A 4DQUA 3W6ZA 2DAPA 1DIRA 3GFGA 1U1IA 3ITKA 4GWGA 3DB2A 4PLFA 2D0IA 3OIDA 5T64A 2VTDA 4R01A 3HB5X 2X1HA 3DONA 3RUAA 3W8FA 3PYLA 4LSWA 4F6CA 1ADBA 1HTBA 4IGFA 1YGYA 2HK9A 5IZ4A 4PG7A 4BL5A 4A7PA 3LT0A 3VZRA 1B2LA 1ADGA 1I3NA 4RPHA 1KVSA 3UHAA 4ZD6A 2H5LA 5HWSA 5JCXA 4LW8A 4NHEA 3RI3A 3DBRB 4WLUA 3PYXA 1PS8A 4MIYA 4XA8A 1Z82A 1I01A 2GZ3A 3ZWWA 1C14A 4FFNA 4U8GA 1GFSA 4R1NA 3FNGA 3EDMA 3KEQA 2Q50A 3RWBA 1I8TA 1Z74A 5I8WA 3PHHA 4ZQEA 2GD1O 3GGOA 1LC0A 4XX0A 1K6XA 4WLEA 1AUPA 4MOWA 4CLEA 3BHIA 4DC1A 1RYDA 4Y6PA 3WGYA 2VHZA 3KYBA 1BW9B 4TKMA 3JQAA 2F1KA 4OKIA 1I0ZA 1M6HA 5K6AC 3ICCA 1K0UA 1KC3A 2YHIB 1F8GA 2UV8A 3FWZA 1UP7A 4URFA 1DFGA 4RPLA 1PX0A 4E0BA 4J91A 1PZEA 3JQEA 3MOGA 2NU7A 4IQ8A 2E49A 2J5KA 4PVCA 3BZUA 1C0LA 1DIBA 1CEQA 4JQCA 3RUFA 1MC5A 2EP7A 2FRDA 3O38A 4IGEA 4EBFA 4TRJA 4MIOA 3MTJA 4DREA 2Q3EA 4XRRA 1EFLA 3HUDA 1F06A 2BELA 4BNGA 1K6JA 1QMGA 4YTEA 3OETA 4ZHSA 3AY7A 1KVUA 5HS6A 5A5FA 1PSDA 4E5MA 5JC8A 3HFGA 3KSDO 1VLLA 4TRRA 4F6LA 4CLOB 4XEHA 5I7VA 4Y9DA 3V2HA 4J4TA 3IKVA 1O9BA 4BOYA 3I9OA 4W9NC 1U4OA 1R12A 4EEZA 5JCJA 3E6AA 4ZGWA 4CM4A 2B0JA 2Q1SA 3NGLA 4FFRA 3V1YA 3EVNA 1U7HA 3GR6A 3Q11A 4PG4A 5ENVA 2EGHA 1EBUA 4ALLA 1NPYA 1ZUD1 5T8KC 3RD5A 4U5QA 4OXKA 2I3GA 4PZCA 4XWYA 2GN4A 1R0LA 4CMGA 4DA9A 1EUCA 1PGJA 1J4AA 1YQXA 2HSDA 2QRKA 3DBRA 4J2HA 5THKA 5KTKA 1ISGA 3JQ6A 4MP6A 3HDYA 3WGIA 1O89A 1DEHA 4E32A 1HSZA 1PL7A 2NNLD 4OAQA 4LVCA 1XQ6A 3KYCB 4FS3A 1QKIA 4RO0A 3TPCA 2VYVA 2B37A 1B26A 5EJ2A 3KTDA 3NEPX 3GAFA 1E7QA 9LDBA 3PI7A 1LDNA 3OBBA 1RWBA 2HMSA 1UP6A 1EFKA 2CNBA 4D43A 2VN8A 1GL3A 4KUGA 4WOKA 1VJ0A 1WAMA 3PPIA 4FBGA 2PGLA 1B8VA 4G5HA 1XYGA 2X58A 2IZZA 2JD2A 5KOIA 3RC2A 3LVFO 4EGFA 4YYZA 1BHSA 1Q0HA 1QYXA 2YHIA 3G3EA 3PJDA 3GN2A 2BI7A 5JW6A 4JJFA 3O26A 3R1IA 2O3SA 1ZEJA 4OL9A 5DN9A 5IN5A 2CDCA 2JFGA 3DMTA 4OOFA 3DXFA 2YFQA 3K2EA 1CQJA 4R41A 3IUSA 5BQFA 3OQBA 2I99A 3L4BC 3S2EA 3KLMX 4WCFC 4YT5A 2CY0A 3E5MA 5EN4A 4AJHA 2IYPA 1DHTA 4XYMA 1YB5A 2CF6A 1PGPA 4ZN6A 4WGGA 4AJOA 2C54A 3PJFA 4QTZA 4BNKA 4CV2A 1DOHA 4YAJA 3GH3A 3UF0A 4OJNA 1J6UA 1Y8RB 3IDSA 1U3TA 3RAJA 3V2UA 3I52A 4JIGA 1XCBA 2OL4A 5L51A 5BNFA 1WWKA 2BFOA 3QVSA 4QFCA 1VC2A 3ONDA 4HP8A 4XRGA 2Y1EA 2O2YA 3DZKA 1KC1A 1AXGA 1OAAA 2H9IA 4KTTE 3SJ7A 3MJSA 4RDHA 5EQDA 3B6ZA 4WNIA 4XYEA 3TZKA 1N7HA 4U0KA 2O48X 3TSCA 4TZKA 1IPEA 3WGZA 4FCCA 4HUJA 4W99A 3KLPX 3MWEB 1E6WA 2V6BA 3H5AA 4K6FA 1XR3A 5DOVA 4BO4A 5JPIA 1YBVA 2VOJA 4IS2A 2I6TA 4XQGA 1Y81A 4M54A 4I9UA 4YQYA 3RFVA 3PZRA 2VHXA 3EZLA 1NFQA 4NFHA 4XR9A 2B4RO 5JY6A 1PQPA 2PR2A 2OHXA 3E8XA 3AW9A 2CF5A 4KMSA 4P4LA 1ZVMA 3VC7A 4NBUA 3G79A 5A02A 3IC5A 5COBA 5IN4A 2BKAA 4RLHA 1VI2A 4BV8A 1BWSA 4D3DA 4A73A 3FNFA 3DAGA 1P1RA 1RM3A 1Y8QB 3WGGA 3H9EO 5HRUA 1NQOA 1TA4A 2AEJA 3K2BA 4IDCA 5ES3A 4C4OA 2OGUA 4EYEA 3HADA 2PZLA 4J43A 1EDZA 2ZK7A 2B36A 2X9NA 4DVJA 5L7WA 1MB4A 4B4WA 4CMIB 1I32A 2VZ9A 1MXFA 3NRCA 2VOEA 3FPLA 4CR7A 1E5LA 1KEWA 3NDIA 3NYWA 4IQGA 3DOOA 2OO5A 4RZIA 4IS3A 3LT1A 3N58A 1QLHA 1W4ZA 2X0RA 1LSUA 5EESA 1HRDA 5KKCA 1KY5A 4J1SA 4LVUA 1E3IA 1KVRA 1Y9EA 3WR5A 4MVJF 3NUGA 1Z7EA 2Q1WA 3WNVA 1B3RA 1LI4A 1PJCA 2NSDA 4II3A 3DEYX 1XG5A 4GX0A 4R68A 3GG9A 1PR9A 2GSDA 1Y8RA 1ENPA 3ADOA 1SMKA 4LSMA 3PLNA 2Y1OA 2JJYA 1B0AA 4ROSA 4JJGA 5A3JA 1E3WB 1IL0A 3EK2A 1HDRA 1YXMA 1VE9A 1CYDA 3R3JA 4R4JA 4B7XA 3SVTA 2PD4A 3TDKA 2OP1A 3UXYA 3MZ0A 3C7CB 3HHPA 3DHEA 1QR6A 3UN1A 1IUKA 3KB6A 2D2IA 1E1MA 3G17A 1YDEA 1H9BA 1PJQA 3NGXA 2J3IA 5A9TA 3ZNPA 4Y67A 3MOIA 4W7IA 1HE3A 4CPDA 2ZYAA 4M1QA 4WOJA 3L6DA 2YQ5A 3RQSA 1A4IA 1HDXA 3ZU2A 4EUFA 1YRLA 4JNKA 3SC4A 4PLZA 1T2DA 5A9SA 1P3DA 2EGGA 4J0EA 4N5LA 3A14A 4R54A 3I9MA 5DCYA 4MVJD 1B8UA 2X5JO 5I9LA 4YA6A 4CM8B 4EEXA 3IS3A 1UR5A 1Y8QA 1I2BA 1NPTO 1KETA 5G0VA 5T57A 1E77A 1H6AA 4E5NA 1Q7BA 4LCEA 1PGQA 3ZV6A 3JQ8B 1PIWA 3WOHA 4Q3AA 4CMIA 5BR7A 3U4DA 3L4SO 4DRYA 3IKTA 3DMYA 4GLOA 1NHWA 2GYYA 4BS9A 4I08A 5KJ6A 3H9GA 3MWDB 4DPKA 5JE8A 4DIBA 4ND1A 1O94A 2WDZA 5FFFA 2C29D 3LT2A 3EY4A 4XJSA 4UREA 4AJ4A 3SBOA 2X0IA 1XELA 3KXDA 4NMHA 2R2GA 3KSZO 1K5HA 4YR9A 2E37A 3AOGA 2VQ3A 5JO0A 3LC2O 2WJPA 4HADA 4IIVA 3WDSA 1V9LA 1T2EA 1DRUA 3LF1A 4IDEA 3FPCA 1X14A 2B5WA 4AG3A 2PD6A 2EJWA 4M49A 1GV1A 4HBGA 3SLGA 2P68A 3ZNQA 5GZ3A 4UUPA 3K31A 3T4EA 1NHGA 3DZHA 4AJ2A 1U28A 1VSVA 2D4AA 2FZWA 1ZSYA 5JDCA 2UUPA 4MVJE 1E3WA 1VL8A 5A06A 1C0IA 5KVCA 5F1KA 2HO5A 4U7WA 4GGOA 1J5PA 2HJRA 2RHRA 2P5YA 3VDRA 3WSWA 2DM6A 1QP8A 3VPHA 3GNSA 1E1KA 3SLKA 4GL4A 4IXTA 1PEDA 1B16A 4B79A 2Y0DA 3K30A 3ZWPA 3A28A 3C8MA 2DPHA 4GKBA 2WD8A 3LLVA 4QO8A 1A4UA 2WD7B 2WM3A 4JCOA 4RVFA 5JMWA 3MJCA 3FBTA 4I9NA 3WSVA 2D1YA 2YY7A 4ZQFA 5EINA 1U4SA 4II2A 4YJGB 5MGBA 3NDJA 2YV2A 2Y93A 4IINA 1I2CA 1I3MA 4XDYA 5G4KB 3WX0A 1D8AA 4CM8A 5JSFA 4QSMA 4BO2A 2PTGA 1UUFA 3DBLB 3INRA 1W0CA 5BSGA 4NBRA 3FCOA 2CVZA 1JAYA 4GSKA 1SOWA 5LCXA 1YONA 3L9XA 4YT2A 3FI9A 4DLBA 2NTVA 3GT0A 3JQ8A 4UVDA 2BH9A 1NBOA 1LDMA 5HBRA 1IE3A 4WKGA 5JS6A 2GLXA 2GN8A 4CUKA 4WCDA 4MJLA 2ZTMA 1FMCA 4Z3DA 1I30A 4WEOA 1YL6A 4E21A 4E2YA 2Q99A 2GRAA 1TI7A 2Y1CA 5CEEA 1QYDA 4IUYA 1P1JA 4FFOA 1E7WA 2C5AA 1MUUA 2HRZA 3CUKA 1CWUA 2Y0CA 3KETA 1DRVA 1ZK4A 4L74A 3WQRA 3AFMA 3WQSB 3GC6A 4ZA2A 4P4NA 1PQWA 4R3WA 3RKRA 3ITDA 4TMFA 3FF4A 1GYPA 4I1IA 4DQVA 3GN1A 1P31A 4MP8A 4JJIA 4NIMA 5C5IA 1ZK3A 2D8AA 3K6JA 2GN6A 3KEOA 3BMQB 3INTA 2ZJ1A 4BNYA 3BAZA 4ILKA 3VH4A 2VTEA 3SC6A 3ZNNA 1ZSNA 4XGKA 3ZWXA 3GZNB 1DC3A 3VZQA 3RUDA 4YRAA 3DBHB 2HCTA 3EVTA 2TMGA 3WIEA 5AXDA 3EHEA 2SCUA 2H6EA 1D1TA 3KV3O 4CM1A 2EKLA 1PR3A 1CRWG 3I4CA 3O4RA 2WD7A 3GNTA 4YJGA 3OA2A 1WDLA 4GLLA 3F4LA 5CDYA 1EQUA 2XXBA 1HWYA 4L75A 3AUTA 3JSAA 4P22A 5G4KA 3W1VA 5FWNA 3OP4A 4J9VA 1XKQA 3HN2A 4RVUA 3ABIA 3G1TA 3Q2KA 4NK4A 4BQRA 1L7EA 3DBLA 4B3HA 1MFZA 4R5MA 2Z1MA 3WYCA 1GPDG 4J4HA 2W8ZA 4GWKA 1BSVA 4NDNE 3BMCB 3HJAA 4R1UA 5A04A 5JAZA 1R16A 3GPDG 3KSUA 1NXQA 3A06A 1JAXA 1XDWA 2NWQA 2OUIA 3CXRA 3VVBA 2HK8A 5JNLA 4CM9A 3E9MA 5ICSA 3PHLA 1B15A 1WZEA 1BGVA 1EUZA 3ETGA 3GRPA 1GR0A 1HE4A 2C5EA 3H2SA 4R51A 4HNGA 4A03A 4W9NA 4KWHA 4N54A 5C7OO 4MKRA 3RC7A 1T2AA 1OBFO 1F17A 2EEZA 3GMDA 4FR5A 1DB3A 1P74A 4MVJI 3A1NA 3E18A 1YDWA 4E13A 2IYOA 4H15A 3LSYA 1FDUA 1LSSA 3I3OA 3ZHZA 2P91A 3BMQA 4D41A 4KP7A 2VRCA 3RJ5A 1QRRA 3DQPA 3NV9A 3H3FA 3DZBA 2PFGA 2AXQA 2C2XA 4RVSA 2NM0A 3IJRA 4PRLA 2HMWA 5JBIA 1LDGA 3GVCA 1U3WA 1LSJA 4R9RA 2O3UA 4B8WA 3ENNA 3DBHA 2C2YA 3DWFA 5L9AA 1B14A 2JKVA 3TZCA 3IOYA 1NM5A 2NLOA 1DDOA 2O4UX 3IMFA 2ZB8A 2O3JA 2VYND 1A9YA 2IZ1A 3ZI0A 1NYTA 3OJ0A 1EE9A 2YDYA 4HFMA 3PWSA 4NI5A 2VZ0A 3E9QA 2X0JA 5DBIA 5T6BA 4BNXA 2CUKA 2I5PO 4DXHA 3HZZA 2HKIA 2PGDA 2AW5A 4F46A 1AXEA 3NDRA 4I5FA 2WYUA 4PLCA 3HQ4O 4Z9XA 4YRBA 3BMCA 4ALIA 1EK6A 3DDNA 1W8DA 4AJKA 1N1EA 4GGPA 4E2ZA 4DQXA 5TC4A 1M66A 2AE1A 4UVHA 1GU7A 3P2OA 4OQZA 1YVEI 4LN1A 3JYNA 4CLXA 1GPJA 1DLIA 3DAFA 2HMVA 4WLVA 4BUCA 4PG5A 5EL0A 3A9WA 3FHLA 3B1KA 4HXYA 4KQWA 3FSRA 2NUAA 4UVEA 5CPFA 1QYWA 3UOGA 4E12A 3WMWA 4AICA 4XGIA 4YWJA 5GY7A 1O6ZA 3FNEA 3PEFA 1CETA 3H5NA 4IQ0A 3FTNA 3RUIA 2PH3A 3TN7A 1ONPA 2YJZA 1YB4A 3JD1A 4PG6A 1JVSA 4NZ9A 1F0YA 5IDXA 4WJZA 4ZICA 3RC9A 5IZCC 3O9ZA 4AL4A 3K9QO 2DQ4A 4M86A 3NT4A 4N5MA 2QYTA 1SEVA 2W2LD 4KTVE 1HZZA 1C1DB 1NFFA 4PVDA 4W4TA 1MP0A 4FOOA 1LDEA 1PJ3A 2B69A 3DFZA 1U5CA 4QT0A 3WTCA 1MC4A 1WMBA 4B3JA 2VHVA 5CP8A 4EI2A 4WE3A 1ZFNA 5A3VA 1VPDA 4LRSB 1GUYA 2QIOA 4DTIA 5CEJA 1U2DA 3Q1LA 4PCVA 4DYDA 1PJTA 4YT4A 2NTJA 4L0QA 4QO7A 3AOEA 5ITWA 5EERA 1A5ZA 4CL8A 2IODA 3ANLA 4NJMB 3ETEA 3PTZA 5DP1A 3L77A 3BIOA 1YQGA 4MVJG 4BKQA 1DHRA 3M6IA 3S8MA 2GR9A 1P0CA 5TX7A 2AQKA 4DLAA 1CJCA 1GZ3A 2AA3A 1HDCA 3CPSA 3BMOB 3WIDA 3DTYA 4BMVA 1QV7A 3D5QA 4J90A 3PHJA 4QX6A 4FOSA 4CQMD 4CMEC 3AU8A 4RGBA 1BXKA 5T5QA 3QJ5A 1XA0A 4RQTA 4YJFB 2UDPA 5EPOA 5I8ZA 4KUHA 1QORA 1U8FO 1PJBA 1TVEA 3GQVA 1IZ9A 2AQHA 3D4PA 2EG9A 2RBEA 1LNQA 3ZV5A 2WYVA 4DYVA 2I76A 4QQRA 5HS4A 4BGVA 2J6IA 4WLNA 2WYWA 4BO0A 1B3BA 1HZJA 1T2CA 1C0KA 4CM6A 3TOXA 5DNAA 4AJLA 5JDIC 2RHCA 1V3VA 4J9UE 3D64A 3TL2A 3TZHA 1DO8A 3F4BA 3PFFA 3W6UA 4M55A 1ARZA 2V7PA 4ONEA 2HMTA 2IXBA 2PZJA 4FC6A 4R16A 3TFQA 2VHWA 1Y5MA 4MIEA 4CMBA 1ADCA 1X15A 3RFTA 1C1DA 4DBZA 4E2WA 3QWIA 4UVIA 3QIVA 4TKLA 4TQGA 1HF3A 4CR8A 5BSFA 1P1IA 4JBHA 3HWRA 4ALMA 1PJSA 1XHLA 3B20A 4D0SA 3UH1A 5HM8A 4KDEA 1LEHA 1RPNA 1A7AA 3F5QA 1VRWA 2YQ4A 4JLWA 2PH5A 2VT3A 1GADO 3LU1A 1KOLA 3H7AA 1LTHR 1HLPA 1GQQA 1MG0A 3Q0EA 3C1OA 4H3VA 4YCAA 3DHYA 1MLDA 3V8BA 4CLRB 2D59A 3OICA 2Q1UA 3KZVA 3TRIA 3S55A 3GLQA 4CMHA 4NJMA 4BKRA 3I4FA 1ZK2A 4XIYA 1BW9A 1WZIA 4W7HA 5I9MA 5TIIA 2HK7A 1VL0A 4RPKA 4BNHA 4GQAA 1NWHA 4Z3KA 3EUWA 3I5MA 3BA1A 2EIHA 1U3UA 2EERA 2WE8A 4E30A 4K26A 4JP3A 1HEUA 1ZMOA 1Q0LA 5I7FA 2DUWA 2W90A 2ZTLA 3SEFA 3ZWMA 4ALNA 3BMOA 1ZW1A 3JQ9C 4BNZA 1JN0A 4WECA 1UDAA 1Z7BA 3CH6A 2DUUA 2X6TA 2ILTA 4J1NA 1DIAA 3RVDA 4H16A 5I7SA 2ZIZA 3AUUA 4K1LA 3WG9A 2C7GA 3ZV4A 1O8CA 2DTEA 1ISFA 1M76A 4FJ1A 1NVTA 4YJFA 3DHNA 1WLYA 1LX6A 3QWHA 1ZK0A 2DLDA 4FQ8A 3I1JA 3WBBA 2TMDA 3GGPA 4E6PA 1D1SA 5JXWA 4RCVA 5BNTA 1SB8A 2PNFA 2IZ0A 4CLOA 2Q4EA 2X8LA 1L7DA 4ITUA 1OC2A 3CZRA 5JYDA 1LQTA 4BHTA 3K5PA 3QA9A 1PJ4A 1GQ2A 2JCXA 4I5GA 3VPFA 1DAOA 3PQEA 4Q3CA 2NTNA 4JP2A 3H3JA 2Y1DA 3D3WB 2C20A 3LQFA 4RDIA 1E3JA 1I2ZA 4XB2A 2EWMA 5U1PA 4J4BA 1YQDA 4CLRA 2BGMA 3AM4A 2OMEA 1IHXA 2EXXA 3AY3A 2POQX 4ND5A 6LDHA 1T25A 3FR7A 1NASA 3JQFA 1TEHA 1IPFA 1J49A 1SZJG 4U6SA 3GZ4A 5L45A 1KEVA 1Z6ZA 3ICPA 2VUUA 4Q3EA 4BNFA 2IEBA 1WDKA 1ZSVA 3I23A 3TWOA 1LBEA 2VUSA 2UVDA 1GUFA 3KYCA 5A5EA 5TF4A 2P9GA 4S3MA 4HV4A 2ZCUA 5GZ1A 1K6IA 1LXCA 2PV7A 2A35A 1T1SA 4Q3DA 2ZTUA 4IMRA 3DAPA 3SJUA 2DT5A 5FI5A 3VPSA 3M1AA 3RCBA 4QEDA 5TSDA 4UEJA 4YRDA 4R3NA 3I9NA 4FD3A 3B1FA 4FGSA 4FN4A 3V1TC 2H63A 3P7MA 4C7KA 4JGBA 1EE2A 1Z45A 3BHJA 3PP8A 4D46A 4IDBA 5ILOA 1EUDA 1MV8A 2OORA 5CG2A 3ULKA 3D3EA 1PJLA 4BNIA 4DGSA 1AE1A 1D4FA 5COQA 5IDQA 1VJTA 4IPTA 2NU6A 3M2PA 4BNMA 1NVMB 4HKTA 3RBZA 2O7QA 3FRJA 3JQGB 2J5RA 1YJ8A 3AUSA 3WLEA 2VWGA 1SPXA 4RQUA 4Z0PA 5AXBA 1PWXA 3H6KA 4N5NA 1QV6A 4NNJA 4Z0HO 2QZZA 4FB5A 4PZEA 4YAKA 3NT2A 1ML3A 4XQEA 5EMHA 1E3SA 5U9CA 1NAIA 1NFRA 3JQCA 4GMGA 4DL9A 4YT8A 1P44A 4DWVA 1AHHA 4Z0TA 2Z1NA 2OBNA 4IJVA 2PZMA 3ZW9A 2Y68A 1QXSA 2PK3A 3D3WA 2JFHA 4LGVA 5EIOA 4NJOA 3GVXA 3ZHBA 1O95A 1YS4A 3PGJA 4L4SA 5A05A 2JD0A 1NVGA 3EGOA 3VKUA 2O7SA 3IL2A 3VPGA 4RLSA 1GYQA 3WJAA 1QLJA 1C1XB 2D5AA 5LC1A 3WBFA 4AJPA 3Q3CA 5EQFA 2DU8A 5G4LA 1S7CA 2FPIA 3JQAD 1HDYA 2PKRA 1YOVB 3ZV3A 1BMDA 3QW2A 1H6CA 1LLUA 2I66A 1HYGA 3AM3A 5F1OA 2NVUB 3UKOA 2JCVA 2Q1TA 1HYEA 3WXBA 3RKUA 3S2GA 2Q49A 2E48A 3QWFA 3QE3A 1Z73A 4J3FA 1B7GO 5IDYA 1UP4A 4B3IA 3FNHA 1G6KA 2X5KO 2O3TA 5JO9A 3OH8A 1T1RA 4CM3A 2FPGA 2J8ZA 4XD2A 3F9IA 1LRLA 2D3TA 2Z95A 5DBGA 1ZK1A 4RORA 2CDBA 3QV1A 8ADHA 1KERA 4L4XA 4XKJA 3RBXA 3TZQA 3WJ7A 2JAPA 2EP5A 4IBOA 4CLDA 4YAEA 2NVBA 4CR6A 4OXNA 3G49A 3AI1A 4YACA 5JCJD 2YUTA 3DZFA 1PZGA 4BGIA 4TZTA 1Q1NA 3JQGA 3UGKA 3K92A 4AJJA 3ST7A 5JLAA 1YL5A 3OIFA 2JD1A 1WDMA 4Z6KA 4DIFA 3MJEA 1Q7CA 2ZQYA 4BB5A 5DULA 2NACA 3F6YA 3ADPA 3DMTC 1GY8A 1NTOA 4EDFA 2V6FA 1DFHA 4QFDA 1UZMA 4RPGA 4YXFA 3NJ4A 4NFSA 3C7DB 5A1TA 3WWZA 3PGXA 1GQYA 2VUTA 2FHSA 5A4DA 1G0OA 2XPCA 1F14A 1X0XA 4DIOA 1U2GA 2Y1FA 1HYHA 2VYVD 2A92A 3LZ6A 4D3SA 5CG1A 1TLTA 1ZBQA 2X22A 1UDCA 4O6VA 2GPTA 5JY1A 3L6EA 2O2SA 1FDTA 3CMMA 4GX1A 3JQDA 4JXKA 1Z75A 1R6DA 3BYZA 4FFMA 1C1XA 5THQA 1AHIA 2IRWA 2WTBA 3TZ6A 3UCFA 3G1UA 5B1YA 2R00C 3LDHA 3ZGYA 1ONOA 1E3LA 2AG8A 2P5UA 3OJEA 3BHMA 1O0SA 4BNUA 4CLHA 5J23A 1NR1A 3OMLA 2NVUA 2B4QA 3JV7A 5I7EA 1N5DA 3OF2A 4W82A 4IDFA 2HDHA 2VNSA 2WE7A 1UH5A 4BO6A 3RJ9A 1LDYA 3ASVA 5AYVA 2FSVA 5IAAA 4Z9YA 3GEMA 3EZYA 1MXHA 3CINA 3OJFA 5L53A 2GO1A 1AN9A 5KKAA 4GX2A 1I3KA 2Q46A 1XEAA 1HXHA 1PL8A 2G17A 2BFMA 2Q45A 4YEDA 1NQ5A 4GVXA 4AJEA 1KIFA 4OXYA 1UXJA 4A0SA 3MCVA 4OIMA 2IE0A 1I3LA 2V6GA 3JYOA 1P1KA 4B7UA 1LU9A 2PLAA 2WMDA 3PXXA 3QP9A 5KJEA 2PWZA 5TRTA 4ZJUA 1JU9A 3F46A 5LDHA 4CMKA 3GNQA 3PQDA 1GV0A 2ZB7A 2Q2WA 2YHUA 2WSBA 1GD1O 3NTOA 5HTOA 2P4HX 4XR4A 4GBJA 3UVEA 3OEWA 3RFXA 1P9LA 3GA0A 3AI2A 5U4QA 3VKVA 5DF1A 1VKOA 3DZIA 1P45A 4J1QA 2B4TO 4N7RA 3V1UA 1HLDA 4BB6A 4PG8A 5ENDA 4UAGA 2ZKLA 4UVGA 2C7VA 2A9FA 2QQ5A 4OM8A 3WB9A 1DIGA 1PGOA 3NTRA 1UJMA 3ZW8A 3MTGA 1NQAO 3ZWAA 1ULUA 4HWKA 2GERA 1C3VA 1HL3A 5AXAA 2ZATA 4R1TA 1YBMA 4KZPA 2LDBA 3EW7A 4R69A 5L40A 3OSUA 4OSPA 4RF2A 1ZZEA 4OQYA 4FIZA 1QSGA 2AEMA 5CHEA 1GDHA 1H0KA 1BVUA 4WNCA 1LRKA 3D4OA 3DZJA 5K6AA 1FK8A 1YB1A 2RH8A 4TROA 4OHUA 3HN7A 3KYDB 2I65A 1BXGB 1LLQA 1BDMA 4DPLA 1IYZA 1HDGO 2W98A 3QVXA 4O5OA 1V6AA 2X9GA 4MPDA 4D79A 3ASUA 4LMRA 4RF3A 2P9EA 1A7KA 3HG7A 3LYLA 4IJWA 4WCFB 1OFGA 4PLVA 4CMEA 4OOEA 1DXYA 4PLTA 1PJ2A 1ADFA 3ZWNA 1DJQA 1N92A 1X7GA 1TT7A 1ZXBA 3WTBA 4XYLA 1M6WA 3HDHA 4UEOA 6ADHA 5L4NA 4DUPA 1Y6JA 1NNUA 1X7HA 2J5QA 1LUAA 3QWBA 3HFSA 1JVBA 1JWBB 3GUYA 3U4CA 3AJRA 4GI2A 5ICMA 1HKUA 4NBTA 4NPCA 4PN3A 3PDUA 4OSOA 1UZNA 1YL7A 2F00A 4PFJA 4J7XA 3EC7A 1UXHA 1V3TA 4K9DA 2LDXA 4FW8A 4BKPA 2AG5A 3ROQA 2VCYA 3OM9A 5B4UA 1TB4A 1LC3A 4UUOA 2BLLA 3EMKA 2CVOA 5T8KA 5CFZA 3VZSA 4WLFA 3U49A 1M67A 3H2ZA 3OQ1A 3PLRA 3DOJA 2Y1GA 3I6QA 3KHUA 1MGOA 3PHGA 3D4NA 3VH1A 1FDSA 1JLLA 4E4YA 3KUXA 2W4QA 3GZNA 4I5EA 4B8ZA 3I9LA 3UICA 4BVAA 1E5QA 1LSOA 1KVQA 5FI3A 1QYVA 2ZQZA 4OGWA 1JA9A 1P0FA 1Y1PA 1UAGA 1U8XX 3GDGA 4YAGA 5AQ1A 3ANNA 5G2OA 3WFIA 3PIDA 5B4TA 4RF5A 1SNYA 3FD8A 5CDUA 4OH1A 3I83A 3OA0A 4A27A 4Y6SA 2RAFA 2GZ1A 2JFFA 1BXZA 5KVQA 3QWAA 3WWYA 2Z5LA 5CEFA 4UUNA 5AXCA 3GRKA 2BGKA 1BXGA 1G1AA 3K8ZA 2A94A 3AM5A 3JQ9A 5I9NA 2YZ7A 1I33A 1VJ1A 4PLHA 5F3RA 3WGHA 2DBVO 2X9VA 2ZJ0A 2NU9A 3L4BA 4HX5A 4WCFA 1GUZA 4WUVA 4XDZA 4AFNA 5L95A 1DIHA 4IMPA 2HLPA 3H65A 4WPGA 4BMNA 3Q2IA 1PZFA 1E92A 5ER9A 3GDOA 2Q2QA 4GH5A 4L73A 4ID9A 1NQTA 3QLJA 5KJ1A 3QQPA 1KY4A 1JW9B 3VH3A 4J1TA 5G0WA 3HDJA 3DBVO 2DBZA 4TRMA 3B1JA 2Y66A 1DSSG 3L07A 1JKJA 1KYQA 2CFCA 3I9KA 2YV1A 3CMCO 2PA3A 4J0FA 1T4DA 1ISMA 3SX2A 2V6MA 3GDFA 3UCXA 3ZZNA 1YH3A 1IB6A 2FPPA 4CL3A 1PS0A 4ALJA 4GKVA 5IG2A 1BRMA 3F47A 3JQBC 3JYLA 1CQIA 2IXAA 3ZU4A 1A27A 5L7YA 3ANMA 2FOIA 4H7PA 4IM7A 4XIJA 2OP0A 4BIIA 1RM5A 1E3EA 2NVWA 3GHYA 2FSSA 2EW8A 1TT5B 2HRBA 4JN6B 3LC7O 1QYCA 1PQUA 3DL2A 4GX5A 5TGDA 5JC1A 4BGEA 2O4CA 4CM4B 2ZB4A 4D45A 4E2XA 4BGUA 1E1NA 1ZO8A 4A2CA 2OXIA 3RC1A 4AJIA 1R0KA 1EEHA 1UXIA 4BNVA 1VKNA 3D0OA 3VHRA 4RV9A 3CTMA 2IEDA 2Y67A 5TT0A 5KJFA 3PYMA 3ROPA 2BD0A 3FWNA 4EITA 3CZMA 2E6UX 2FWMX 1IULA 2B5VA 3KM0A 2UYYA 4XQCA 1R66A 4NK5A 3W8EA 4BQPA 1ZKMA 3PIIA 1ONNA 4CV0A 4P8RA 2HUNA 3RUCA 4BO3A 4EUEA 2C07A 5CAEA 5DCWA 3GPIA 3TJRA 5A9RA 3GOHA 2DPGA 3DOCA 4XGNA 3IIEA 1JWAB 1UXKA 4E5PA 1NP3A 1NR7A 3RUEA 2P2SA 1HSOA 3GEDA 1ENOA 1I36A 4NQZA 3WICA 1MX3A 2BI8A 2NV6A 1DAPA 3IP3A 3RU7A 4JK3A 2XOXA 4TWRA 1RM4A 5TNXA 5L7TA 5B12A 4B4VA 2QRJA 4C7JA 5TJ9A 3AUAA 5T67A 2QZ9A 3U4IA 3ZHYA 4WEQA 4MVJA 3ROKA 1P1FA 1LLDA 4R5HA 1R15A 3DTTA 5KVSA 2O50A 5JAMA 1P33A 1XQ1A 1E7YA 5FYDA 2VZ8A 2FR1A 3KOUA 3Q6IA 5CDTA 1GYRA 4WLOA 2YV3A 3C3XA 4NFYA 3DZGA 1E6UA 3ZN2A 1WW8A 1FDWA 3ONFA 3L6OO 1WMAA 4BNWA 4CV3A 3MJTA 2A4KA 2CZCA 1Y7TA 3ENKA 7ADHA 4O59O 1SC6A 3QVOA 3F3SA 1CIVA 1ZJZA 1FF9A 4GPD1 3VDQA 3ZWCA 4IDDA 4KOAA 2Q2VA 5CDSA 1TT5A 4XCVA 1UDBA 3AI3A 1MFPA 3COSA 4HNHA 4N18A 4OMUA 3ZDFA 4RVDA 5L4LA 2O23A 1ZXLA 1MA0A 4IZHA 2DKNA 2FN7A 5IFLA 4G81A 3LLSA 2ZTVA 1H6DA 2EW2A 1M75A 3E9NA 5H81A 4CODB 4AJNA 4J6FA 3BXXA 3UFXA 2G82A 4CUJA 3M1LA 2GCGA 4RZHA 3QSGA 1U3VA 2X86A 5KVVA 3OFSA 2AQ8A 1BTOA 2DVMA 2RIRA 2C59A 1YKFA 1O5IA 2EHDA 4NR0A 5L4SA 1SCUA 3ZCXA 2QW8A 4CM9D 4BV9A 3DFUA 2NU8A 4IZIA 2G5CA 3IQDB 2I9PA 1KVTA 3IAHA 1I24A 4PZDA 5F5LA 2E4AA 1R0SA 4XJTA 4RVHA 3ETDA 4O63O 1PU2A 1YE3A 3TQHA 2DC1A 5FEUA 3E82A 4U6QA 3ZU3A 4XQ9A 2X0NA 4J7UA 2AMFA 3KVOA 2AE2A 3P2YA 1I5RA 5AOVA 5KIAA 2EF1A 5IF3A 3PJEA 3WLFA 1B8PA 1SAYA 1X7DA 5DBFA 2FR0A 3AY6A 1VM6A 1EQ2A 5DZSA 2EV9A 1K3TA 5B4VA 2XXJA 4FFPA 3GF4A 2E82A 4J2OA 1S6YA 3WGTA 1FDVA 2VRCD 1R4NB 4E31A 4CM5A 3HE3A 2Y05A 4LISA 3UW3A 3HDQA 5TJHA 4D3FA 3U0BA 3GHHA 3VTZA 1DPGA 1V35A 2GNAA 4BNLA 3O8QB 1VSUA 1EVIA 3WYEA 4FSHA 2OFPA 3N74A 4KDFA 3WMXA 1Q0QA 4TRNA 3TF5A 1LJ8A 3LC1O 4YJDA 3IJPA 4EJ6A 4DMLA 2HU2A 3BTOA 1IOLA 1W73A 2OZPA 1H9AA 2R00A 3OECA 4YJHB 2X5OA 3ZH2A 4MO2A 4KUEA 1CERA 1HDOA 2CMDA 3W4IA 1JQBA 1F12A 4ND2A 1X1EA 3ZNOA 2DTXA 4EZBA 1GCUA 2QX7A 4K6CA 4D44A 1GAEO 1EBFA 1X1TA 4IDGA 1XWFA 1DLJA 2CD9A 3FBGA 2O3QA 3P5SA 4UULA 5CDGA 1PWZA 2J3HA 3CKYA 1H2BA 3H9UA 4L76A 2GN9A 4R9SA 3KRTA 2NQTA 5DOZA 3WGQA 3BTVA 3RROA 3F1LA 5A9SB 3PHIA 5DT9A 3GK3A 4LMPA 4MVJH 5CPBA 4ZQBA 5KJCA 1DFIA 5JMPA 4R1SA 4Y98A 2VNAA 2NADA 1NAHA 3GG2A 1AGNA 8LDHA 3AOEC 1H6BA 1H94A 3DC2A 3VTFA 3WYBA 4Y6RA 4DC0A 4QECA 1V8BA 1Q2XA 3R3SA 4IJUA 3PDJA 4O0LA 4DMMA 4RF4A 4HY3A 4IIUA 1IY8A 3WNQA 3PFWO 3RSHA 3VAZA 1J0XO 1E7MA 2OBYA 4NBWA 1ISIA 5FF9A 5LDGA 5C3MA 2BHLA 5BSHA 3S1LA 3D1LA 2FR8A 3QHAA 4FC7A 3RBVA 3LK7A 4YQZA 3UAGA 1ZJYA 2PD3A 1R4NA 4QUKA 1DJNA 3JYQA 5KWEA 3K96A 1UAYA 4PGFA 4DBVO 2PGJA 5IDWA 3U62A 2QG4A 3D5TA 3VZPA 1NPDA 3I6IA 5F5NA 3NKLA 1XIVA 4A5OA 3O8QA 5AVOA 3OEYA 1E7RA 4BO1A 5TLSA 4TSKA 1F8FA 5C7LO 1SB9A 1HETA 3G0OA 1OC4A 4P4GA 1BVRA 2JHGA 1Y5RA 5A03A 1NX6A
chains in the Genus database with same CATH superfamily
3GLIB 1U6KA 1RMQA 3JAKB 1DV2A 3RO7A 5C8YF 2C2BA 5AI4A 2CJWB 4DLLA 4E3ZA 2H2HA 4YJHA 1Q57A 4R1PA 3TI9A 1EE1A 1NDUA 1SR8A 1ODKA 4XIIA 3DT6A 4B74A 2HQRA 5CUQA 1ZH2A 5GWXA 1U7OA 3N8IA 3Q9NA 1US8A 1EVZA 1JHQA 4NBVA 1M1NA 2Z9DA 4HLUC 4XB1A 2X6QA 4ZYZA 1PK9A 5K8TA 4TM8A 3OCUA 3R74A 1P0PA 2OQ2A 3UQZA 3GGGA 1KGSA 3ZVNA 4DWWA 4YPOA 1PS9A 4EJ0A 3WMRA 1NUAA 4JLSA 3JTMA 5ELMA 3IA2A 4RZXA 5F21A 3MW8A 3NX4A 1OZ0A 3RPEA 3U5TA 1VSTA 2G9NA 1FLVA 3SBXA 4GVLA 1SO8A 4XZ3A 3GFBA 4YAIA 3UIEA 5MDHA 1PSZA 4N5IX 4I8XA 4K6KA 3ZHUA 1ESEA 3RTBA 2ZIXA 1WA5A 2ZETA 3RVMA 3A70A 1U7DA 5TT1A 3KKLA 1BWQA 3LBHA 4XWTA 1UFRA 4Q4JA 4AUKA 3P9KA 1W93A 4E09A 4PE5B 1MABA 4M89A 1FLAA 1ZJJA 5G0SA 1QH8B 1E69A 1ZS9A 2BV3A 1TM3E 1QAQA 5JTTA 3ZEAA 4AZ0A 4EGCB 4O3FA 3SKXA 1XUOA 3TOSA 3RSQA 2H4HA 1E79A 1N4DA 5LQUA 1MB3A 3WKAA 2QTTA 1MC1A 2VYNA 3AETA 1L7PA 3A6FA 1SRQA 3C3EA 2A9OA 4G23A 2WZDA 4B31A 5K0BA 2ZYGA 1TW2A 3ZWBA 4OK6A 2QZPA 3H87A 1OLSA 2X2PA 3QXSA 3WE7A 4JROA 1DBRA 3GRVA 3UJPA 5JADA 3CH5A 1ENZA 2EKPA 4IVQA 4TVBA 1YQQA 1KMIY 3RJTA 3C14C 3WL7A 4MCAA 2ZRJA 3W6OA 1A4RA 3GBPA 3AVVA 3JVEA 3WLRA 1NP6A 4IKEA 4KO8A 2I7DA 3U9LA 3HP1A 1JMVA 3PA6A 3ZIAD 5C37A 4C7OA 1OYYA 3KOOA 2CD7A 5H83A 4JU8A 4K0KB 4NDZA 1UC4B 5CK4A 2PGIA 4KIGA 3NTLA 3MWKA 1PGNA 4GRDA 1J25A 4M0DA 4M9XA 1ZRHA 2EF0A 3L5KA 3F90A 5TS3A 3ZHXA 1R18A 3GLIA 5G0UA 5I6DA 5DJ5A 3S68A 2CJWA 3BTUA 2IBMA 3FNRA 3PFNA 3Q85A 2OESA 1YR8A 4U02A 4E14A 1YOVA 1YJXA 1XAHA 2YC2C 1JV2B 2JHFA 3DQZA 5JAQA 3CFYA 2PYZA 3NJ8A 3QBJA 4Z8YA 2W2VA 3CT6A 5DB4A 4Z9FA 3N7UA 1QIFA 4N76A 3W4JA 1TIBA 3HB4X 3DL4A 2QUAA 3HO1A 2FP4A 4RMNA 2C03A 4MDFA 1R8XA 2J30A 1M34B 1T5SA 3R0IA 3X2FA 2HF8A 3NIFB 4D7AA 3AKZA 2HQ1A 2UAGA 5BSEA 2YIMA 1UZLA 3WP0A 3JX9A 3PZBA 2W2LA 3AFNA 3HY3A 4N4AA 1JEDA 2FKAA 4UD2A 3G2OA 2HRQA 2PYIA 1OH7A 1XTTA 2QR3A 4LTMA 5J2UF 3B8EA 1FNBA 4R7TA 3KEFA 1R9NA 2XLCA 1TKAA 4X84A 4CMJA 4ZREA 4V0MA 1TU3A 1WW3A 4BJ5A 2PBRA 2XR1A 4IIJF 1NRWA 2W2XA 1MJGM 2YINC 3JCZA 4YUYA 2B83A 2QPLA 3BMNB 3K6KA 3U1TA 4PF1A 5TQVA 2X7XA 4DSZA 3C24A 1V45E 3I1IA 4M7RA 3S7ZA 5K3CA 3L02A 3GFVA 4AY4A 2X4GA 5AVUA 3IUEA 4YLEA 1QH8A 3CC8A 3ZQKA 4HQLA 1VPTA 1PL6A 2V45A 1A8UA 1G0NA 3U4AA 4CT5A 3KKZA 5HVNA 2A33A 3F2IA 1VL6A 1R37A 1PZXA 5JALA 2ZIWB 5CXXA 3CIFA 1LDBA 4Z7NB 3RHFA 1J07A 1LNZA 2PS9A 3JQBA 4ZQIA 1XD2B 3VR3A 1ZM3A 4I4NA 5DW3A 4QFMA 3O1IC 3VVMA 1QBKC 5EJGA 1H2HA 2C0CA 4LHXA 1BVYF 1Z39A 3EIUA 1ZOPA 2B4YA 4YRRA 3VV2A 4QWMA 3TTSA 4DCGA 1YAJA 5JATA 4LMAA 1FYDA 4LRTB 4YB8A 5J63A 1KJWA 3T7CA 1U7PA 3T1OA 4NESA 1U0HC 2BMAA 2WB2A 4D26A 5K2OA 3I5XA 4BMSA 1CF2O 3ECCA 3HSSA 3OTQA 1C8LA 2FDCA 1ZH8A 3K0HA 3G8YA 1ISRA 2AQIA 4AKIA 4O4LB 3M2TA 3VR2A 4AIIA 1G16A 2FOLA 4G5RA 2WF6A 1ODFA 2JC3A 4R8VA 5AK3A 2QTWB 4FOTA 1YV9A 2CVQA 4QELA 3WMGA 4HEA6 1TZMA 1W0KA 3RU9A 2WVJA 1HDZA 4X97A 1EVJA 4ZAXA 2IKSA 2XHEA 3U4HA 1V47A 5IH3A 5EP2A 1W0JA 4LBYA 2B25A 4Y18A 5EJIA 2B78A 1JKFA 3JQ7B 4BN0A 5BXQC 1L7RA 3AR2A 4YRTA 3VAAA 1XU7A 1ZQ1A 4HXGA 3RABA 2BRUA 3FCYA 3TL3A 1QAOA 1WXWA 5AK6A 2A5FA 3QFHA 3DDUA 2YN4A 3LT4A 3F6PA 4HYTA 1RC8A 5BN3B 4OQFA 4FJ2A 4AU1A 3MBKA 1M34A 4UW9A 3GU3A 2C88A 1ZAYA 1U0BB 4AJ1A 1R0ZA 3ADKA 1WD5A 1A71A 3LNTA 4IXWA 5F1PA 5ILGA 4AYXA 1ZD4A 3NUQA 4NH4A 2A59A 1SBYA 5I8PA 2ZUEA 3DTVB 4YN3A 3SGLA 4LF8B 4Z0NA 2NAFA 4K9PA 3JXEA 2D8MA 3GROA 2O1EA 5KSPA 5FADA 4EF5A 4L28A 2V3CC 1KRHA 4LUCA 1UBMS 3LHIA 4OHRA 3LOUA 3NHSA 3BS4A 5HDBB 2HU7A 1KZGB 3AU9A 3MQ4A 1L9KA 1EKXA 1U9IC 1Z2DA 1C7RA 3AL3A 3HUFA 3NIWA 3KAQA 4RX1A 2NPFA 2QTZA 1XZFA 5KMGB 1MOZA 5JJKA 1U0OC 2R7KA 1VIVA 2PX8A 4C20A 1H0HA 3BMNA 2WBLC 1TMYA 1XP8A 4IY1A 3I61A 3AVPA 3A2KA 1YUMA 2GF2A 2XE4A 3NJRA 4WK2B 1AV7A 3EJWA 5L3VA 3LBYA 1DKQA 2DBQA 4L15A 2GGSA 4BZWA 4DMRA 3U44B 1KJZA 3BE8A 3U80A 4CMCA 1JJFA 1FU7A 1OD6A 1C8VB 2V7UA 4ZYUA 4Q3BA 3TK1A 1FVXA 4BVGA 4D9HA 1FFGA 2FW7A 2O5VA 2V54A 4FOPA 4Q6WA 2IOFA 2QYSA 2MINB 4JUBA 1LY1A 3FZNA 4PLWA 4PAQA 4RZ2A 1GQRA 1NLMA 4MKXA 4MI6A 1M1XB 1PWEA 4YXWA 2PZAA 3IOEA 3IP1A 5AIAA 4E33A 3OLQA 4O1MA 1N6PA 1OOEA 4BTEA 4E5KA 3N07A 4F8EA 3WNZA 1DUVG 3ZDEA 2Z04A 2W83A 4Q9NA 2J32A 2DPYA 3PEUA 4NV0A 4HMQA 3PS9A 2P1DA 1USIA 2CLFB 1FNCA 3R41A 4XGRA 2G76A 1JHAA 1AQIA 1OF1A 3IOBA 4UD6A 4A8HA 2P9BA 2XKAA 4O4LA 1YDMA 3KU4A 3SXPA 1QTNA 1Z6YA 3D8BA 4G5XA 1Y1KE 2GKSA 1Q1AA 1R6TA 1GGVA 3K32A 4C06A 3EMVA 4KN5A 2CNKA 1P1BA 1B6TA 1YK0A 3C85A 3R8XA 421PA 4WKCA 4GI5A 5FJIA 3RREA 4E5VA 1NYLA 3GLHB 3LF2A 1JZQA 1SOVA 4BYMA 2XUQA 3QSYA 1CE8B 1XC7A 3EX7C 1W8IA 3W8DA 2XTNA 2ZRKA 4O4HA 4BNNA 3LUGA 1KQNA 1CRQA 3JQ7A 4CN9A 4WXMA 1NVXQ 3PPVA 4YRQA 1GCAA 3QENA 2P40A 3FFBA 2CCKA 4AIRA 4EHDA 5I3CA 1IZYA 4I19A 4J3NA 1IIBA 2XBLA 3KAPA 4QDTA 3U4GA 5KSWB 5B7QA 3KYDA 4MKHA 5DHPA 4EIWA 5JBNA 5BN3A 4XYGA 2AXPA 2EZ8A 2VHYA 5IXSA 1ZNQO 4IF4A 2ZSJA 1F38A 1YA4A 3P4YA 3O8RA 4NG5A 1NVDA 2OC4A 3DTVA 4XX0B 2P90A 1HE5A 5JZVA 2G1UA 4RHFA 4AN4A 5GIPE 3S70A 1GPBA 1Q3KA 1SK8A 5JNUA 3FR8A 4U0JA 3QTBA 2REBA 4RHTA 3OZXA 4TXJA 2J41A 5TMDA 1E6CA 1FX0B 1K5GA 2A6PA 2PL3A 3C1TA 1TD1A 1TEVA 3D7RA 3FTPA 1DC4A 4G65A 4Z86A 4B81A 5B1EA 3T3NA 1U1EA 2YMPA 3SKYA 3AB8A 2GTIA 1FQJA 1KEZA 4JSTA 3I5UA 4DNQA 4BEWA 5KMGA 4K6HA 5IXJA 4BRWA 4C1NA 2F8LA 2RHOA 3M7IA 4M8SA 4FFLA 3L8YA 4KSCA 2IFTA 1SVIA 1GNSA 2CSUA 3G2QA 3OUZA 4PTLA 3FROA 3TSYA 1PZNA 3U44A 1UOEA 4JI4B 1JHOA 3HJHA 1D5CA 1BYIA 1S5PA 2G0TA 4ID3A 2HAEA 4QXAA 5KB3A 2O54A 2JVKA 3PRYA 5DX8A 1LPPA 3WYDA 3CEJA 1R88A 1XSEA 1I5OA 1Q0UA 3CLTC 4RH1A 3G7SA 4L0MA 3ANYB 2DFDA 2MINA 3CSDA 3HYCA 4RGYA 3V4SA 4MRMB 3SBDA 2GESA 3H2BA 4XX1A 1E5XA 1QHGA 5FV7A 1EFTA 3GP3A 4DMKA 5JAOA 5JZMA 2NO1A 1Z0AA 3ESBA 3OCVA 5TQJA 3S2ZA 4OU4A 4PRKA 3IV7A 1ZVKA 4ZYLA 3SJCA 4WK6A 2PY6A 1JKXA 3ZWVA 2M32A 4CGZA 2CXPA 5LQMA 2C4KA 1Z4PX 3F6CA 4CQNA 1J56A 3GH1A 2YVKA 3T0GA 4IKOA 5H0IA 4PLFA 3D4IA 1Y4AE 3BICA 3FTEA 4AY2A 2BUCA 3MTQA 2PT9A 2X1HA 3DONA 1A2KC 4LSWA 1ADBA 1L6RA 1HTBA 1YGYA 3GLHA 4MV5A 5I9SA 2KSQA 1CE8A 4ARSA 4D96A 1KNXA 1ECPA 5ECYA 3DO8A 4Y0VA 3JASA 2FGJA 3CLTD 3FRIA 2ON6A 4NHEA 4ZD6A 3RI3A 1QHYA 4HDCA 4WLUA 3HU1A 1JR3D 1W88B 4HQ0A 2V7WA 5TV2A 4MIYA 4NMMA 4ZJYA 1YE8A 1AGXA 2P6UA 1NI4B 2QE6A 4KRXA 1MW9X 3FOEC 1PR6A 3PE6A 5LZ9A 4FFNA 4U8GA 4FZ3A 3EXG2 3ZDQA 1T9KA 3M9WA 3IHKA 3QEJA 3GDHA 5JD6A 1Z74A 3IBTA 1C7QA 4DV5B 1N36B 1P73A 3JWJA 2HPZA 3IUNA 5KYVA 4R2LA 3ZWDA 2W6PA 4XX0A 3I2KA 2CBXA 5CJJA 1JR4A 1T9AA 3KXKA 1TQ8A 4CLEA 1PQ4A 3T35A 1BW9B 4TKMA 1VCIA 1SXPA 1FX0A 4CG0A 5JJIA 5IARA 2P9JA 5JBQA 2O0KA 1I0ZA 1M6HA 3F6RA 5FI1B 3ICCA 1CLEA 1U7ZA 2XGMA 1K0UA 5E7IA 4IIGA 1MO6A 4KQ9A 1MMFB 3BXGA 4L9SA 1DFGA 4NRDA 4RPLA 2VPIA 1WUTA 1F0KA 4BMDA 1CUDA 4E0BA 2Q3CA 3S2UA 1PZEA 1U2RA 1NATA 3QEOA 3MOGA 4I2NA 5A7HA 4BP1A 3B78A 4I9FA 2J5KA 3TQOA 1C0LA 2ZLBA 1DIBA 3K2QA 3M34A 3ZOKA 2HPVA 4RK5A 2DLCX 3EMDA 1MC5A 1MZVA 1E0KA 5I51A 2WSIA 4IGEA 1VJGA 4TRJA 3U7HB 4FHFA 3MTJA 1DAMA 1P4HA 1NN1A 3C74A 3PQ3A 4XRRA 5C81A 1NT2A 3OETA 3I1YA 3KD3A 1N6LA 4NV1A 2AMLA 5FWAA 5A5FA 4CDMA 4E5MA 3HFGA 3CRVA 4IDOA 1P4AA 2BBSA 4X62B 1VE1A 1WBBA 4F6LA 4OUDB 1C9YA 5LIRA 3QOFA 4X92A 4BQOA 3V2HA 1CZHA 3FDZB 2R8YA 4IIFA 4FP9A 1R12A 3QA3E 4WN9A 5KYTA 1W36C 3ABZA 3VZBA 4YAOA 3JVIA 1ZC4A 2ZT8A 3OZWA 2VXBA 2Q1SA 1JX6A 4FFRA 2QMZA 1RVDA 3EVNA 4GP9A 2XUAA 5D00A 5IW8A 3BFVA 4HT3B 3S4YA 1K06A 3WLMA 4AJ9A 2NYUA 2EGHA 1WBJB 2ZVQX 1U8AA 2VA9A 3PWTA 5T4HA 3KB2A 4LOLA 4X20B 2WAOA 4AS1A 2I3GA 1DIOB 4RDCA 1KBQA 3EVCA 1BCSB 1TGYA 1Y6QA 1NW8A 1YQXA 4ZZ1A 5KTKA 3JQRA 1EA5A 3RS4A 3VR4A 2I33A 3ZS8A 3PQ5A 2LNDA 1S2OA 1NW6A 4B80A 1O89A 4QPZA 4KSYA 4QGSA 3WGIA 1TF2A 2AYZA 4INPA 3TIIA 4B6OA 4BGDA 1DNPA 2J9XB 4GIBA 3R77A 4LVCA 5TB5A 4ZOAA 3ABOB 5F12A 5AVYA 2BISA 3GRRA 3KTDA 3NEPX 3PQ8A 4U2EA 5EGNA 3AVWA 2GH1A 2WI8A 2OYRA 1M8GA 3AHDA 4NFLA 3PI7A 4W8GA 1USVA 4IOJA 5GJWC 1OJLA 1UP6A 2CNBA 2OCGA 3DE4X 4MGHA 2VN8A 1USGA 5EEHA 4FKZA 4XM0A 4D43A 4DUGA 3OUTA 2ZSKA 2PUJA 1OT3A 3WWEA 2EKDA 2WM8A 3V00A 1IQUA 4TLCA 4ZC1A 3RC2A 1EVLA 1BHSA 2HYIC 2D06A 4GXNA 1JG1A 1IY9A 3GD5A 1K3UB 1OI4A 2QTFA 4MJ3A 5JW6A 4JJFA 1UFQA 4FBLA 2PSDA 2OK8A 4OL9A 4AROA 5CCBA 1A98A 3ESDA 4DV6B 3TAXA 1P0MA 1UQTA 2OE2A 3C5VA 2G80A 2ZIAA 4MV7A 2Z2ZA 1W7AA 2VK8A 4C05A 2NO4A 1B41A 3WRYC 1L5HA 4I1YA 4WCFC 2QX6A 3G0HA 2QJOA 3E5MA 3TMKA 4XYMA 4A3SA 1YB5A 2VSXA 1PGPA 1UJ4A 3NETA 4KQIA 4PSKA 4D81A 4WGGA 3S7TA 3AM1A 3BE6A 2YNMA 1T34A 1QHFA 4OJNA 4Q4AA 2L82A 1D04A 1J6UA 1Y8RB 1Z4OA 2J9FA 2NV2B 3CPEA 1SBHA 1U3TA 1ODLA 1VI6A 2VDKB 4HGYA 4IWYA 4JIGA 4MUAA 3V2UA 2LPMA 4OUDA 1OTHA 1BAPA 5L51A 1OXUA 3OI7A 5BV0A 1GZVA 3KQTA 3FDZA 1VC2A 2PN1A 3QVSA 4DQ0A 2ZUFA 1Y1RA 2WINI 4CU5A 1KC1A 2BSAA 4LKOA 3MJSA 3ZBTA 2YZGA 2V7QA 3MT7A 4I1SA 4WNIA 4XYEA 3VJLA 2QRUA 3MSCA 5K0CA 3PD1A 1QP0A 3ZDAA 2HCJB 1YBFA 1AA9A 1T6XA 1RACA 3AHFA 3KHKA 4FCCA 3DWIA 2B2CA 4KOEC 1E6WA 1W85B 4HLNA 2EEPA 3H5AA 2IHUA 2PZ8A 4K6FA 4IVNA 4Q7QA 5JPIA 1WCYA 4QYXA 5KTRA 3CJTA 3LRTA 4X20A 3OQJA 1QDUA 1IG0A 4C0BA 2A2ZA 1U11A 2MSCB 1K8YB 3EMBA 4EJ2A 5JSQA 2BR3A 4NFHA 1QKJA 3TRHA 4B9EA 4F92B 1L5ZA 1UCFA 1ATZA 2PR2A 3HFJA 2OHXA 2GYVA 2J3EA 2V98A 3KKOA 2UYCA 2ODWA 4NF2A 2VJNA 2XDWA 3IEKA 1G8FA 4HB4A 2JFUA 4EUNA 4NAUA 3WAGA 1BMQA 3LBFA 4IUCS 4CKXA 1BWSA 1Z7GA 4D3DA 4A73A 3LC0A 4X95A 3DAGA 1BDHA 4V38A 4ENTA 5JROA 3C6KA 5TGTA 4HAZA 3M3HA 4IXMA 2Y1KA 1EZZA 2AEJA 3K2BA 4WKBA 3W6PA 3DM5A 5JHGB 1P9NA 2PZLA 5L7WA 2IP1A 3E5HA 2JLAA 4UUBA 4B4WA 1XTVA 2VXCA 4Y0NA 4ZKDA 1UOPA 2VZ9A 4TTQA 2VOEA 3FPLA 4CR7A 4RLQA 3DE0X 2WVGA 1E5LA 4YP0A 4X9XA 1KEWA 1ESZA 1U04A 5JS7A 1VZ2A 4FUTA 4JMPA 3TVTA 4C5CA 3T9DA 1WUHS 1SHZA 3CUWA 2B7LA 4PSVA 4OX9B 3OZGA 3BDVA 1W4ZA 3RRMA 5D86A 1LSUA 4Z1MA 5KKCA 2IS4A 4J1SA 5GJBA 1SKAA 1OY1A 1H69A 3U2QA 3A4IA 4NV3A 1FFWA 2ANCA 3NUGA 1GA1A 1Z7EA 4PSCA 4BN4A 1QS0A 4D4HA 1VLJA 2QTGA 2JBHA 2NSDA 3AI7A 1T5BA 2JIMA 4R68A 2OHOA 1V9SA 1Y8RA 1JHZA 3TQIA 1ENPA 4D8WA 5JLJA 1H2WA 2HSEA 2PJDA 4MDYA 1B0AA 4PNZA 4ROSA 3O2JA 2NT4A 4R3UC 1E2QA 3MCTA 3E9ZA 3OE1A 2V0GA 4ETWA 4KR3A 1WKVA 1XHFA 3EK2A 1XVTA 5P21A 3CF4G 1IPHA 1WZUA 4R4JA 3SVTA 1DOZA 1IXKA 3UXYA 3C7CB 4AM8A 4BLVA 3U61B 2EJUA 3B38A 3F3YA 4QDUA 1Q3HA 4TMTA 1QR6A 4YC7A 1W96A 3KB6A 3NPAA 1E3QA 1E1MA 4MXDA 4U9HS 1M6VA 3UANA 1H9BA 1PJQA 3NGXA 2AFIE 2J3IA 1G7SA 3W5VA 2P2GA 2JJ1D 3O7MA 4X85A 2A67A 5D85A 4TZ0A 2ZT5A 2ZYAA 2WD9A 3AJAA 4J07A 4MI1A 1RI1A 1VMKA 4PONA 5EIHA 1A4IA 1HDXA 2ZS8A 3CX4A 3MK31 4JQOA 4J2TA 3NNNA 1UBLS 4JNKA 1SBIA 3HCBA 4C4RA 4HGZA 1TK9A 3UB3A 3G9UA 4J0EA 2G9QA 2ZAYA 3QMPA 5DCYA 3QMVA 2W6CX 3LKBA 2X5JO 4HAUA 4CM8B 1ODSA 2FPLA 3IS3A 4MUGA 2CE7A 3ASYA 3OCCA 2RD2A 1I2BA 3RRXA 1QVRA 2WAMA 3EWAA 3L6RA 5G0VA 4Y2RA 3RVSA 3K70C 3T5AA 3ZVKA 1T4MA 3VYWA 4LFAB 4F4HA 3NRBA 1GPNA 2RAVA 2X14A 3CF2A 3PI6A 3ZV6A 4ZZ3A 3CXUA 1JSZA 2DMRA 3MXTA 4JLAA 2ZAMA 5BR7A 3U4DA 2CFSA 5JOQA 3F67A 3DMYA 2AUMA 3Q7PA 4WX2B 3U7QB 4BWVA 4BS9A 1ZJ6A 3EG5A 4L0CA 2FQXA 5KJ6A 3H9GA 2FETA 4QNRA 4YMGA 1FJGB 1W30A 4ND1A 1F60A 1UADA 3GELA 4LVNA 3B51X 3ZXYA 4EYGA 5ULLA 1OX4B 2JGNA 4P98A 2GTPA 2ZRMA 1NMSA 1Z2CA 4UREA 3B5IA 1EHIA 3K9HA 3MG9A 2ATVA 2IEGA 4ZC8A 3MPOA 4NS4A 5IABA 1B23P 1Z2OX 4L3VA 2R2GA 3KSZO 1K5HA 1LPAB 1X80B 3WK4A 3QBVA 3PA8A 5LXTF 5J1TB 2BMEA 2WJPA 1G8KA 3LQQA 4HADA 4ISBA 4P5EA 4JC0A 4OIFA 3S44A 4DR1B 2VJDA 3W3AD 1DRUA 4IDEA 3GW8A 3FZYA 4ZGGA 1Q95A 4IJ6A 4B7ZA 1PFVA 1Q0RA 3JWGA 1NMXA 5GZ3A 1NHGA 3HY6A 4LTNA 2PLFA 2C3OA 2MSNA 3LMKA 2FZWA 4DOMA 1GCIA 3IEVA 2JIRA 5JDCA 4JUCA 2PIAA 2R5FA 1ND6A 5A06A 4NMLA 2FX3A 5K0JA 1TVKB 1C9EA 2XOKA 4QOIA 2C1EA 2HO5A 2QVCA 4U7WA 1T9BA 2EU8A 2GDJA 4FYJA 5U4XA 4FI3F 2A57A 5C4IA 4CKZA 3WSWA 1SG9A 2BIFA 3HA7A 3OQPA 1QP8A 4YMVA 3D2BA 1Z0ZA 1GCGA 1E1KA 2F90A 2HXYA 5C5EA 1U0SY 2PWBA 5AK0A 3NWOA 2XKKA 3K30A 2ADFA 2WD8A 3QFFA 4K81B 2G06A 1DXQA 1OHHA 2WD7B 2WM3A 2P79A 2XA2A 2Y0BA 2QL5A 3INNA 4XTRA 3WSVA 4I4TF 1EWQA 2YY7A 2NSYA 3FTQA 3NDJA 1A9OA 2XI4A 1W29A 1I3MA 3R7AA 4G8DA 5G4KB 2KBEA 4L1KA 2C7PA 3DAOA 5AFSA 1UPFA 2RGCA 4CM8A 3ANTA 1YK1A 2WLSA 3PV0A 4LJLA 2OWDA 4PSDA 1S8NA 5DM0A 1XALA 1NE7A 1Y9ZA 3DDOA 4Z4HA 1GUBA 2XMGA 3A4TA 3KPJA 5IKPA 5CX1A 1SOWA 5LCXA 2EIXA 1YONA 2ZBFA 3L9XA 4FLEA 3BAFA 3FI9A 2NTVA 1UF9A 3GT0A 4DLBA 3T1YB 2BH9A 4A5SA 3R8CA 4P3XA 1LDMA 5C9ZA 5KWJA 4RANA 1X9HA 4GGMX 1KMHB 3CKLA 4FFSA 1H8HA 2MYUA 3BJIC 2RGNC 1U3GA 3U7QA 4FZVA 1O9GA 2PR7A 2VHUA 3DXZA 4CUKA 4M22A 1FMCA 3N2NA 3CE9A 1AY0A 1JHUA 2H9YA 3G7UA 4S1WA 4TV9B 5E38A 5JS2A 4E21A 4ZDJA 1IBRA 2ID9A 4M8IA 1J9EA 1WSDA 2GRAA 2OORC 3IVXA 1EINA 2YCLA 4I8IA 1ODJA 3H84A 4IUYA 1MTOA 1ZL0A 2ID8A 3A3KA 3PGA1 1DQZA 3CU5A 2NNWB 2AFRA 2C5AA 3M4XA 3MLBA 4NYMQ 3DOHA 4F72A 3CUKA 1MAHA 1X80A 5AD1A 1J9GA 1VHTA 1DRVA 2PZFA 1ZK4A 2F64A 3FCCA 3MBIA 4L74A 2VDQB 4N49A 5DTJA 1RCTE 5THXA 5MHTA 4NMWA 4FYYA 4R3WA 4G67A 4D9GA 5ES4B 2ERCA 3FF4A 1GYPA 1NDQA 2J0UA 3GN1A 3K5IA 1EP9A 4NIMA 1VDMA 3IULA 5IHXA 2VYCA 3IBCA 4O5AA 3RQIA 3LVRE 10MHA 1M5RA 3K6JA 1MC8A 2FR8C 1SXJB 1U2TA 1KQ3A 2GEVA 3DLIA 4EFKA 1KJNA 3KEOA 4LYAA 4EG4A 1CJKC 3KD2A 3T1TA 3NDPA 3FPFA 5IUNC 5LD2C 3CJQA 4EKYA 4HLCA 3BMXA 3DVQX 4BNYA 5JEDA 1TVKA 3OF5A 2BAGA 2BLNA 3DKIA 3QLUC 4M6WB 3KXLA 4YLYA 2ZKIA 4MV0A 1ZSNA 1OIWA 2PEZA 4F5YA 1X87A 4NP6A 4F21A 1EG2A 2DUMA 4J3JA 2QL7A 2VXOA 1RAGA 1DC3A 2Z8YM 1TIPA 3QH4A 4ZVUA 4EKEA 3E5NA 1FTSA 2JIPA 3AL0C 4C7BA 2O06A 1E20A 2XNSA 3EN0A 3R2JA 4HTFB 3I8XA 2D54A 5IP5A 3UXMA 5KTYA 2H6EA 1D1TA 2EBUA 2PX5A 4P33A 4CM1A 5KC9A 1CRWG 5A0TA 5H02A 3GD7A 3O4RA 2F7SA 2WD7A 3UWKA 3F49S 4L07A 3RYIB 3KS9A 5A4FS 2I6SA 1G3IA 3M6XA 4X6XA 3RK4A 1UANA 3BIJA 1IG3A 1WDLA 1XTIA 1Z2NX 2OAP1 2WUVA 5CDYA 3W1VA 4L75A 2H11A 2CBGA 3JSAA 5G4KA 3VXKA 1Y8CA 1MT0A 3ED5A 3WDLA 4KH0A 4YP6A 2BFEB 3ABIA 2R2AA 3G1TA 4FK8A 3D54D 3DMDA 5D01A 2WUEA 1MN6A 1CUWA 1FFSA 2Z1MA 4EHNA 4OB8A 2Z6QA 1GPDG 1UFKA 4H08A 1BA3A 1DP4A 4PSAA 4F3KA 2ICAA 4FKBA 1ZGJA 3I42A 1BSVA 2GA9A 1KFCB 1XTQA 5MN5A 2CL5A 2Y76A 4QOHA 4R1UA 4BEJA 4DRXB 4O08A 4NQRA 3RRFA 1KMHA 4GZ6A 4MRNA 4TLEA 3WISA 3X1JA 2RGRA 4A36A 1J7JA 3CEPB 2IHBA 1NXQA 1LH0A 1CBUA 3GA7A 5IVIA 4DNFA 4H6XA 1O6CA 3IB6A 3RWMB 5JNLA 3CXRA 1F3LA 1V8FA 3OQVA 2HK8A 2QW1A 4R1MA 5TS2A 5CFMA 1PV4A 5ICSA 3E9MA 3C7KA 3E1GA 5B1HA 1KRWA 1GGKA 1YMVA 1GR0A 1I13A 2MYPA 2ZRQA 4KWHA 4KFUA 1W5TA 1E9VA 4QE3A 1P2FA 4Q82A 1KKMA 1F17A 1HFJA 2YJNA 3CVUA 4I3HA 2XZLA 1EH5A 3E18A 4KNVA 4UNIA 1L7VC 5DHTA 1AKTA 1F20A 3O7WA 1CY7A 3R7NA 2VAVA 4RQAA 2IYYA 3BSSA 2AFIB 3HMKA 1YDWA 3C87A 3RGGA 4X90A 3ZVLA 3GLUA 1FY2A 2YOHA 4Y7CA 1SXJA 1Y37A 3NANA 4H15A 3LSYA 3PQCA 4PZ9A 2A5JA 4CTOA 1PFYA 2P91A 2UZAA 4PQFA 3W2HA 4KP7A 4ZMRA 3AF5A 1SHKA 4R8SA 4C2TA 3CH7A 3CUEF 3TLAA 3DZBA 2PFGA 1D09A 4M6WA 1RJFA 2AXQA 1MQSA 4HG2A 4XIGS 3V32A 1AQNA 5AKHA 5JCOA 4PRLA 5EQJB 5IVKA 1U2GC 2KQUA 1GFZA 5EVJA 4C0AC 4R9RA 1V8DA 2O3UA 2W6ZA 4I7EA 4Q3LA 2XF2A 3QVLA 4HTFA 4NSNA 3JATB 2C2YA 5LB2A 3P20A 4QRHA 1B14A 2OCYC 3IOYA 1CCWA 1NM5A 2OHJA 3I0NA 1R00A 1PAUA 1ZMXA 2QVYX 5EJ8A 3W7BA 4IRUB 2ONZA 1PT6A 3OC6A 3TJMA 3TZLA 4BV2A 1E79D 2VYND 4OHVA 3RYIA 3IHTA 4GR9A 1JFRA 5IBPA 4YCCA 1P7YA 4QJIA 5CFRA 5CDFE 1KYVA 1X7XB 3AW8A 2BFEA 1QIJA 2BGUA 2I5PO 2PLRA 2PL5A 3UHPA 4DXHA 2CLSA 4J0GA 3VI4B 4PPNA 4LVOA 1M0EA 4BZXA 1X1CA 1N6IA 1E2HA 2P9QA 13PKA 1Z25A 3JWHA 4L16A 3V97A 4C5BA 2I6QA 3H2JA 3M6UA 1OB5A 4WA7A 4DRXA 2OGSA 4J0DA 4OHMA 4GGPA 3HMQA 2XA1A 1JSXA 4BCBA 1W4LA 4E2ZA 4LZJA 3O4HA 4Q4CA 3P2OA 4LZOA 1FXWA 1YVEI 1JXAA 2R60A 3B12A 4MA5A 5BRAA 2E4YA 2XUFA 2N75A 4QGHA 2WKRA 4CN8A 1U2QA 2Z9BA 3RTGA 5C0OE 3B1KA 1WX1A 3TEJA 3FSRA 5EE5B 3MJHA 4QDZA 2JHAA 3A04A 3CVJA 5AJHA 4AICA 4XGIA 4MAAA 1DL5A 1XDZA 2FUKA 2WDPA 3CA8A 3B2QA 4JA0A 4OJYA 3KZMA 3OTWA 1CETA 4TMKA 5GY7A 3TN7A 1A04A 1L4HA 1AK1A 3JD1A 3T5GA 3NGMA 1F4VA 3PQ2A 3DP9A 4WJZA 5A71A 4ECAA 1BWRA 2AFIA 3K9QO 3GRFA 1AS2A 4LY9A 3RSCA 3UAVA 4BLQA 2IYQA 4TWZA 2ARKA 2QYTA 1CJVC 3LS2A 3DNPA 1LZLA 3CWQA 4PGHA 2W2LD 4EFLA 1WCXA 1HZZA 1C1DB 2Z4SA 4AKSA 1NFFA 4PVDA 4WADA 2IHJA 1Q0TA 4L78A 1EIZA 3PHCA 1NVFA 5IU6A 1PJ3A 3BFXA 3SBEA 5A1JA 4PRYA 3OSZA 1GTVA 1U6IA 1Z08A 4K9LA 4KU4A 1OXMA 4G4SO 4G0PA 2VHVA 4K9RA 5KTTA 1VPDA 3AVUA 4G4IA 1KS2A 4L4UA 3IQFA 4FHDA 4Q1AA 1GUYA 4FCTA 3WYAA 4DTIA 3I9V6 4KQCA 4OFZA 3EWNA 3Q1LA 3EZGA 2JLRA 3JATA 4AD8A 4DYDA 1K8ZB 4QDJA 1PJTA 4YT4A 2ZWAA 4L0QA 2PPLA 3AOEA 3ICOA 3AL2A 4NC9A 1Q1BA 1R74A 3AKEA 3ANLA 4KXLA 1GL7A 1MNQA 1QOZA 5L3RA 3V42A 5BUSA 1SU8A 1M7HA 2QV0A 3H1GA 1YQGA 2QRZA 4MVJG 1XTRA 3NOOA 3PPWA 4R2HA 4ZTBA 4JT9A 3S8MA 1ORWA 1RYYA 3VR3D 4H59A 2BRUC 5SZIA 4DABA 1HFKA 2IP2A 4JP5A 4QQ8A 4X45A 1X7XA 2QB5A 1DE0A 3FOAA 2PUCA 1GZ3A 3MS2A 4C22A 3BMOB 2G9RA 2PGOA 3WZLA 1KI8A 3DTYA 3OLZA 4K3UA 4ZZ2A 4BMVA 4YGXB 3KJQA 1QV7A 1KP9A 2QTRA 3HVUA 3IAUA 3FGOA 3AFHA 3ZGOA 3KQKA 4EY4A 4BMCA 2AZMA 2YWJA 3HNRA 3L8DA 1K6EA 1MIOB 1EYZA 1NMEA 2AMVA 3RIYA 3RVNA 3VR2D 1OB2A 1QG0A 2MJLA 4NE9A 4UBIA 2C4UA 1SCQA 3Q41A 4A82A 5I8ZA 4IQ4A 1W0KD 5FKJA 2CL6X 5IT4A 1TVEA 3TIFA 2UKDA 4MRRA 2EG9A 2MTBA 3DF9A 2VUHB 4H1TA 3ZZ1A 4DYVA 2ADOA 1W0JD 2XYVA 4H7IA 2JGJA 5DYNA 3VSAA 2J6IA 3VO2A 2BFWA 4BGVA 2PQ2A 3DMHA 5FFNA 3SIXA 2WYWA 1NBHA 4UPDA 3WL8A 3PC7A 4KO3S 1GLGA 2G6BA 3R7DA 3Q7IA 2J3DA 4JVNA 5AJWA 3EA4A 4RPCA 3R24A 3WL4A 2RHCA 4R81A 1V3VA 4RWEA 3SKVA 3D64A 3TL2A 3ZDYB 2FW8A 3HKCB 4B35A 3W6UA 4LDNA 4M55A 1ARZA 2GUWA 5DISB 2ONJA 4R16A 4EO9A 2XT0A 4JB2A 4MIEA 4E32A 1X15A 4O4LF 1C1DA 4DBZA 5IKOA 4NENB 4UVIA 1ZJ4A 4DG8A 3B53X 4X41A 1M8FA 2A9RA 5ESXA 3E9DA 4YV7A 5M29A 2XMCA 1T3ZA 3C3KA 3PCTA 4P4UA 4NXMB 3HWRA 4ALMA 3AVXA 2INGX 5EZSA 5C1IA 3IMGA 5JXHA 4AKGA 5D6OA 1VP3A 4D6PA 4F91B 2YQ4A 2PBLA 1KYXA 4I4LA 1GADO 1P9WA 1LTHR 3H7AA 1MG0A 1GQQA 2P4EA 1BJRE 2QQEA 3C1OA 3ME5A 1C7EA 3Q0EA 5AKYA 3O1JC 2JFXA 4HQOA 3OICA 2IZOA 3HI4A 4FX5A 3OPVA 4ZAVA 5BQOA 5K99A 2JLVA 4D3YA 2HWKA 4CKEB 3GLQA 2BE7A 4BKRA 3AVOA 4GOXA 1C9DB 1QQBA 4XIYA 4W7HA 2QSZA 1IQRA 1ZCAA 1HI9A 2H4ZA 4RPKA 6Q21A 4CETA 1Z4MA 2WJ3A 2YZ2A 4GQAA 4KLCA 1PYDA 2BCJQ 3BA1A 4Q3OA 4YXWD 2GETA 1M5UA 2E5LB 4Y1GA 3QE4A 4K26A 3EDRA 3TW8B 1F7UA 2CL7X 2M6LA 3ND5A 5I7FA 2DUWA 2W90A 3DFKA 5HIAA 3N2KB 4HSEA 4N9WA 4LYJA 4ALNA 1P75A 3II6X 3BMOA 1PSWA 5KO2A 4BNZA 4UFOA 4LV5B 1Y63A 2XUPA 4N5HX 3QKUA 4H16A 2QTLA 4ER6A 4K1LA 3PSHA 1MIOA 3WG9A 2HCRA 2EWWA 3ZV4A 2GPBA 1M76A 4FJ1A 3TX6A 1NVTA 5C51B 2OEPA 4XWAA 1QNLA 1ISSA 1ZK0A 5ED0A 4YONB 3C45A 3RRBA 3WBBA 3GGPA 1DT5A 2QMYA 5FPHA 4AY5A 2ZWIA 3M82A 2K7ZA 4RCVA 2XUKA 4BKMA 3DMGA 5ELXA 1A7UA 4C1BA 3KB1A 1G4HA 4DCCA 3CM0A 3TM4A 3EPHA 2W93A 4ITUA 4I6EA 3PNOA 3K5PA 3W2EA 1PJ4A 5ICCA 2DR2A 1V39A 1QFMA 1QIMA 4KR9A 5EA2A 1QCDA 2FG6C 3KT3A 4EY3A 4JC4A 3VISA 3H3JA 4ZTUB 2Y1DA 2C20A 1FBNA 1G8HA 3LQFA 1DZ3A 2YJ4A 1P60A 3BH7A 3OIWA 1JKMA 2QPTA 2LD4A 3HKCA 1YQDA 5AJXA 5DI3B 5SICE 3T7SA 3KJEA 2OMEA 4OM7A 1NF2A 1HT3A 1KOJA 3DTVD 2XTAA 5AUPB 1XMXA 2CEAA 1XJ5A 2BFCB 1FS5A 3WBJA 4YYEA 2POQX 4G0ZA 3SYTA 2CFIA 3CKKA 1X92A 3IEMA 4U7GA 3I72A 2ETVA 4C08A 1A9QA 5DEOA 1Q92A 2V9CA 1NN0A 1IPFA 1KO5A 1J49A 1IAVA 3NHZA 3OY2A 4IMIB 4V2UA 4JI7B 2AWOA 2F3RA 1K86A 1Z6ZA 2VDOB 3N1UA 1KPHA 3M6FA 1Y82A 1WDKA 4UNNA 2HXGA 1C9NA 3I23A 1W9MA 4GU5A 4A16A 2UVDA 3KYCA 2GZSA 4LJ7A 5J43A 2M6SA 3KC2A 4KWEA 5BW4A 1IBCA 4RMGA 2FFJA 2WF8A 1T1SA 3TPFA 3DAPA 2J9ZB 4JBYA 5F51A 1QHXA 1B8OA 4QD3A 4CKEA 2AN3A 3V7NA 2XB4A 1GAJA 3WYGA 2BBTA 2C1ZA 4R3NA 1EVEA 1AH2A 1V16B 3B7PA 3OZ7A 4FD3A 3B1FA 2C8KA 4QUHA 4FN4A 4JSRA 3AB7A 4ABYA 3CR7A 2H63A 2YVQA 3L8GA 3TW8A 4F6RB 3BB1A 3BORA 3BHJA 1Z63A 2V74B 2XUDA 2ZR0A