3FCOA

Crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with benzamide inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
269
structure length
267
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of novel di-substituted cyclohexylbenzamide derivatives as potent 11 beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 267
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3fcoA00
3CINA 1FDVA 1FJHA 2P4HX 3RVDA 1E5QA 4RVGA 4QFCA 4PVDA 1NFRA 2GCGA 3QIVA 2GN9A 1YB1A 5K9ZA 2ZIZA 2Y1FA 1GV0A 4BO3A 4GH5A 1F14A 1H94A 1ZK1A 1EBUA 4JP3A 4PRLA 3BMQB 4JJFA 5ADHA 3JQ7B 1P9LA 4BO2A 5T6BA 1Y8QA 2NWQA 1YRLA 4EJMA 4GMGA 4UEJA 2O2SA 2ZTLA 3GN2A 3CIFA 3MJ4A 2BFOA 1SMKA 2ZTMA 1FDUA 5IXSA 5DN9A 2X4GA 1U2GA 1J0XO 2O50A 4A03A 3PZRA 1EVYA 3ZWCA 3F1LA 2C5AA 3KYBA 1NTOA 1ADBA 3ZWAA 1HE5A 3FNEA 2WD7B 5TX7A 3GUYA 5BT9A 4LN1A 4GX0A 1BW9B 3VDQA 1LDEA 4J9UE 5KTKA 4II3A 3GUCA 4IZIA 1LUAA 4GMFA 2G5CA 2VWPA 3X2EA 2YUTA 3QY9A 1X1TA 4UULA 1JQBA 2VRBA 3AOEC 4YEDA 3RC2A 3LYLA 5BR7A 1XG5A 3PJDA 4Y6RA 3GVXA 1EUZA 3GF4A 1E1MA 5JDCC 4CLOB 4XCVA 5JO0A 4QO8A 2RHCA 1CQJA 1U4OA 3STHA 2EEZA 5DNAA 1ZIDA 3RUHA 2TMGA 3L4BA 3R3JA 3G0OA 5DULA 1DLJA 3KVOA 4F46A 1VL0A 4P38A 3AJRA 4FDAA 1H9BA 2XAAA 1VKOA 3VTZA 5CEEA 2EIHA 5LDHA 4F6CA 5JYEA 3HADA 5TJHA 4KDEA 4ALLA 1Z82A 2FZEA 2PZJA 1I30A 4CV2A 3KB6A 4JCOA 1U5CA 1T2EA 5JFOA 3UICA 5I9MA 4RORA 1RYEA 1DOHA 1LTHR 3OJLA 5L7WA 2VZ8A 3SX2A 1JVBA 2B35A 3I9MA 3LT2A 2V6MA 4NBVA 4CM4B 4BUCA 3GEMA 3QVOA 1XR3A 1E1NA 3E6AA 5GZ1A 1I33A 1C0LA 4RO0A 2PNFA 1SBYA 4FFMA 6ADHA 1UAGA 3HSKA 4DREA 1A4UA 1KOLA 1VRWA 1PTJA 4IXTA 4XQEA 3KUXA 4BNJA 5EERA 5TT1A 2NU8A 4CM9D 1BHSA 4MVJE 4Y6SA 4EYEA 1ZUD1 3WLFA 5ITVA 1VSUA 1TVEA 1CJCA 3GOHA 3NTRA 1BGVA 2CDCA 4K28A 2B4TO 3NTQA 2UV8A 4XRRA 1HDXA 3A4VA 4DLAA 4N5LA 4NPCA 1XA0A 1N1GA 3DMTC 4YJGA 2POQX 3D64A 3DZFA 1UXIA 1IY8A 5A03A 1Z7EA 3U09A 2X5KO 4IIVA 3QVXA 4BMVA 3EUWA 2QX7A 3AM3A 4YT5A 3QV1A 3HE3A 1X7HA 2D0IA 2LDXA 2B5VA 3ENNA 1O8CA 4B4WA 1YDEA 4JJIA 3WJ7A 4YT8A 1Z7BA 3I9JA 4PLGA 4J7XA 4H3VA 5DP1A 3IP1A 4FC7A 3T7EA 3FTNA 3UCEA 4D42A 4TQGA 1Q7CA 2A94A 1PU2A 3M1AA 4BHTA 1GFSA 5A06A 1QV7A 3LT0A 4YB8A 4YPOA 4UREA 4O5OA 3RBZA 3K2BA 5I7VA 1XDWA 3ZGYA 1R37A 4TRRA 3K31A 4CLDA 3EK2A 2DU8A 4N5NA 2O3UA 4M55A 3LZ6A 4AJ2A 1EDZA 1UZNA 3F47A 3ASVA 2X9GA 5HA5A 2JAHA 3LC7O 3NDJA 5JSFA 3BA1A 1Q0LA 4BO8A 1U4SA 4HV4A 3N7UA 2F1KA 4E5NA 2EG9A 2W2LA 3DZBA 3GG9A 1CERA 2Q45A 1DFIA 2OP0A 3P19A 4S1VA 2JAPA 3VH4A 2Y1OA 3BAZA 4DUPA 1S7CA 5I9LA 5KJEA 3F1KA 2GN4A 1SOWA 4DQXA 5IFLA 1T2DA 4HFMA 5KJ6A 2X9VA 1G1AA 5IDWA 4YJGB 3BIOA 1E92A 1HKUA 3RUEA 4GKVA 4WECA 3WICA 1MB4A 1X13A 4A5OA 1HZZA 2DFVA 3BMOB 1V3UA 3F6YA 3B1FA 3KLPX 2B37A 3UFXA 4YAJA 1E7MA 4OGWA 3WX0A 1KBZA 1KEPA 2CDBA 1QLHA 2VHYA 4CM8B 4PRKA 3L0DA 3FR7A 1WDLA 1Z6ZA 4KZPA 5DOVA 3DZHA 2TMDA 1GYPA 2WYUA 4CM1A 1ZXBA 1NQOA 3JD2A 4CMCA 3M6IA 1ISMA 3OQ6A 3WXBA 1HWYA 5C5IA 3NJ8A 3ROMA 3LSYA 5B37A 3GNQA 2GUGA 4EZBA 4IXWA 1PQWA 5J23A 2X8LA 4D3SA 2UDPA 1LDBA 1LEHA 4ZQFA 1T24A 4R4JA 2XXJA 4KWHA 5JAZA 4MDHA 4RPLA 2VQ3A 3IDSA 2YY7A 5CPBA 1KVUA 3SBOA 2ZTVA 4AFNA 2GN8A 1DXYA 1MC5A 4BGEA 2EW8A 1NAIA 5U1PA 3V1UA 2YQ5A 5KJCA 1DIGA 1DC5A 4R41A 4F6LA 1VLLA 5CG1A 3F5SA 2HRBA 5DZSA 1IHYA 2YYYA 4RVDA 1DJNA 3GG2A 3L77A 1KIFA 1X0XA 2FSVA 2YFQA 4Z3KA 3B70A 3K8ZA 3RCBA 3HDYA 4QT0A 1KEUA 4A27A 1KVQA 3VZPA 3CUKA 1IYZA 4NBTA 2DC1A 5BQFA 3O9ZA 3SC6A 3GC6A 1YKFA 2B4RO 4LRSB 3WYEA 4YJFA 1UDBA 5TLSA 4YWJA 1R4MA 2CD9A 4CMAA 2FR0A 1F0YA 4IDEA 4WCDA 3HB4X 4ND5A 4CLRA 1DBVO 1VC2A 3JQEA 5COBA 1E3EA 3EVTA 2DKNA 1ZJZA 4IMPA 4RLSA 4WEQA 3GNTA 3KO8A 1I2ZA 1HDRA 3F46A 3TRIA 4YRBA 2C7GA 3WLEA 3ZU3A 3TOZA 1V0JA 3PEFA 2ZB3A 3V2HA 4J1QA 2D5AA 1OOEA 3PYMA 4BB5A 1YBMA 5GMOA 4RCVA 3W8DA 4Z9YA 3NDIA 1MP0A 3FSRA 1DPGA 1N7HA 3W4KA 5AXCA 3RBVA 1U7HA 4FR5A 3WSVA 5KCZA 4GWKA 4MOWA 9LDTA 1CRWG 4MP3A 4BNZA 3FBGA 4JROA 5LDGA 1QYXA 4AJIA 1SAYA 1MG5A 3DTTA 3L07A 1R0KA 3WQRA 3JYLA 3MTGA 3GA0A 3HZZA 1GDHA 1ISHA 1W73A 4ZQGA 2HUNA 1YWGO 4FFPA 1DIBA 1NR1A 1LBEA 1YL5A 4L73A 3WGYA 3ZWWA 2W2KA 1C3VA 2YW9A 3VVBA 5DBFA 1EVZA 4Z9XA 2W2LD 2NVBA 3JYQA 4TZTA 2VUUA 3LC2O 4RDHA 3ZWXA 2H9IA 2Q1WA 4AJOA 1I01A 5B4VA 1NQAO 2HMUA 3PHHA 3ASUA 1EQ2A 3WGTA 4CUKA 3AM5A 4DTIA 2BI8A 4GX1A 4PLCA 4RQUA 3LK7A 4CLRB 1BVRA 2JJYA 2HQ1A 1SZJG 1C1XA 3DB2A 1XU9A 1M75A 4FOOA 3WQQA 3EC7A 1B8UA 3TL2A 5DBIA 3EY4A 2JFGA 4LSMA 1IPEA 3O38A 3F4LA 4KTTE 1YH3A 2W90A 4I9HA 1GQYA 4IS2A 1I2CA 4JK3A 4OXKA 2RH4A 3TJRA 1LDYA 4Y6PA 1V3VA 2GSDA 3BMCA 2JKVA 3C7AA 4XYGA 2Q2VA 3LT4A 4J7CA 2B4QA 4XR4A 4HXYA 4FGSA 1YJ8A 2YHUA 2I65A 3BZUA 3I1JA 3DAGA 3H5NA 3NAQA 3GRPA 5AYVA 1PL8A 3VKUA 2GASA 1KEVA 4LCJA 4IQ0A 4WLUA 3UN1A 3BTUA 3NT4A 3H5RA 3E5RA 4OO3A 3FI9A 1TLTA 3PVZA 4HKTA 4DLBA 1D8AA 1YBAA 3QJ5A 2RCYA 2W2KB 4BKUA 1VKNA 4XGNA 3NJ4A 2NLOA 3ZHYA 3MJVA 3JQFA 4BL5A 4D79A 3IUSA 1KVRA 2OBYA 4MIOA 3RU9A 1S6YA 1LC0A 2ZB4A 3KSDO 4RLHA 5CDUA 1YBVA 2VNSA 1QYDA 4TVOA 1I3MA 3S2GA 5F1OA 1GQ2A 4PLZA 2UVDA 4QEDA 3W6UA 4J90A 2AMFA 4R68A 3PK0A 4PLTA 3EAGA 2IE0A 3JYPA 5DBGA 3DMYA 1H2HA 1W8DA 3RD5A 4EITA 5BSFA 4P8RA 5EINA 5KVSA 3P7MA 1C1XB 1QXSA 3IMFA 1IZ9A 1YOVA 4NDNE 5IZ4A 1AHHA 2H5LA 4WOJA 5L4SA 3O8QB 4OKIA 2CFCA 1HLPA 1CDOA 4XQCA 4KUGA 2DBRA 2O4UX 3DTYA 4GX5A 1Y81A 2JD1A 5L7TA 3HN2A 4NK5A 1MXFA 3WYCA 4CQMB 2C0CA 3LT1A 3BTOA 4DC1A 1OFGA 3DFZA 4UUPA 4B7XA 1GZ4A 3JQ6A 4J4TA 1A27A 4TVBA 4PLPA 4ZQHA 3ZV5A 4MKZA 3BMCB 3WTBA 1ZK4A 4FN4A 2BFAA 4IDGA 4R51A 1WLYA 2J6IA 4CUJA 3ZWPA 3B1JA 4XIYA 1TXGA 3FNFA 2EERA 4E32A 1LXCA 4R1SA 3WOHA 5IG2A 2HJSA 1UZMA 5JAMA 1PJSA 3G1TA 3IAHA 4QFDA 2X9NA 2CY0A 4B79A 3OFSA 4J3FA 1IL0A 2YV1A 2NSDA 2ZATA 3JQAA 3OSUA 4NK4A 4IDFA 2HK7A 4U7WA 1P77A 2HLPA 1T4BA 3C1TA 1HETA 2VYVA 4Z9FA 3MJSA 4BKRA 5IDYA 2Y99A 1BWSA 4TZKA 1M2WA 5AXBA 4D43A 4YRDA 1BRMA 3JQBA 5KIAA 1HYHA 4BO9A 1DB3A 2O2YA 2J3JA 2VHXA 4UVGA 4I5EA 1P1FA 3BHIA 3TWOA 3ONFA 1KVTA 3IC5A 1DJQA 1K89A 1LLQA 4BNLA 2Q46A 4LSWA 3PZBA 2BD0A 1LX6A 1LA2A 4XDZA 1GPJA 2QZ9A 1ARZA 4LGVA 4XR9A 4IDCA 4LISA 4RZHA 2I76A 7MDHA 3NV9A 4MVJP 4E5KA 3BMQA 3SJUA 4NFSA 3TSCA 5JNLA 4EEZA 1I0ZA 1I5RA 2UUPA 4J2OA 5CDGA 4OM8A 2A92A 1U5AA 3PHJA 5COAA 3GPIA 2IZ0A 3OA2A 4ZGWA 5T57A 4WLEA 5C7LO 5EIOA 1IULA 2V7PA 2EP7A 3RC7A 1SB8A 2NU6A 2ZKLA 2GPTA 4H16A 2Z95A 1ONOA 1UR5A 4NQZA 4AICA 1EEHA 2WE7A 8ADHA 4RQTA 4QXMA 2WD7A 1U28A 3ZWVA 3MOIA 5FF9A 1B14A 4BKOA 3PDJA 4JGBA 4BB6A 1LDMA 3QWAA 2EWMA 1A7KA 5KOIA 1WVGA 3MZ0A 1M6WA 9LDBA 1CYDA 4JP2A 2X86A 4A26A 4J16A 1FMCA 2XF8A 5EN4A 5CP8A 4Z3DA 2GGSA 2HAEA 2IRWA 3S2IA 1R0LA 1XELA 3ADOA 2OBNA 3OIGA 2P4QA 1V6AA 2HCTA 3RUAA 1HT0A 2EHDA 4CL8A 2E4AA 4XZ3A 4WASA 2X0RA 4CLOA 1VE9A 2C20A 5THKA 3PYXA 4CMKA 4XJSA 1IZ0A 2DPHA 2Y05A 1NHWA 2PY6A 2FPPA 1N8KA 1QKIA 2D8AA 2C54A 3GR6A 1H2BA 4CR6A 4D3FA 1NPYA 1Q7BA 3OMLA 4JBGA 4XGKA 3OICA 4L9RA 5B12A 1AXGA 2V6BA 1Y9EA 2HMVA 1OZAA 3MJEA 3E82A 1ZSVA 2P91A 5KVCA 4KDFA 2QRJA 1HXHA 4EI2A 2VT3A 5ILOA 3WGHA 2IXBA 4PLWA 3K92A 2OFPA 4M1QA 3WJAA 2EGGA 3D4NA 3ADPA 1N92A 4G5HA 1U2DA 1H6BA 2VHZA 2AEFA 2PGLA 4CM4A 5ENDA 1WPQA 3AUTA 4CV1A 3RUDA 4W7IA 4Z0HO 4DA9A 4R3WA 1PGPA 3AFMA 4FS3A 5THQA 4OOFA 4EGFA 1GADO 5JXWA 2W8ZA 3K73O 4UUNA 1ZJYA 3C7DB 3OEYA 4PFJA 1FDWA 3AOEA 1DIAA 4FFLA 4HFRA 2Q1UA 1C1DB 1RM4A 1O0SA 1T26A 1T1SA 3A28A 3HUDA 1LRKA 3U62A 2CUKA 3CMCO 3WGOA 4IGEA 4DXHA 5JDCA 1GPDG 2UAGA 1JVSA 4P22A 5ENVA 2DTEA 3RUIA 5U4QA 3ZV3A 5KVQA 4N7RA 3VAZA 1AXEA 3IIEA 3JQAD 4U8GA 3AUUA 4IIUA 5JCJA 1EK5A 4GPD1 3RIHA 3VPFA 5IXYA 2HMSA 2VYVD 2PD3A 3LLSA 3DBLA 1TEHA 3GH3A 4L4XA 1L7EA 4U0JA 1X15A 4CM7A 2B69A 4D46A 4HBGA 5A05A 4B3JA 4FQ8A 4JN6B 3BMNA 3RFTA 4RL6A 5GZ3A 5TT0A 3QVWA 1NVTA 3TFQA 1ZW1A 4DIOA 1M67A 4QTZA 1F17A 1ZEMA 2Y1EA 5HRUA 1LDGA 4LMPA 3ABIA 4GI2A 5IN4A 5KVVA 4B3HA 2ZTUA 2IYOA 1JLLA 4CMIB 3HNPA 4KQXA 3DOJA 2OHXA 4MVJG 2R00C 1K3TA 3OF2A 2PH3A 2OGUA 3I4FA 1BTOA 3H9GA 3PFWO 1GR0A 2YZ7A 4DQUA 2OP1A 5JBIA 2PV7A 2NM0A 3KV3O 1QRRA 3OM9A 4NU6A 2WJPA 3QWIA 3AI3A 1R0SA 3G79A 2CVQA 1KC3A 4FFOA 1BVUA 2EF1A 3E9QA 1H5QA 3INRA 1B16A 3VZQA 2VZ0A 3GGOA 4AJEA 3DMTA 3RJ9A 4DWVA 4R1UA 3PFFA 3DOOA 2DUUA 3AY3A 5F5NA 4RVFA 5L40A 2O3QA 1U8XX 1YJQA 3C1AA 1HTBA 4C4OA 3KETA 1IHXA 4KWIA 5C7OO 2NADA 4GGPA 4BQRA 1SB9A 4P4LA 4FPXA 5T8KC 4FJ2A 2J5QA 4XDYA 5GY7A 3DBLB 1U3WA 2YDYA 3BMOA 1EUDA 4J6FA 1I2BA 2CZCA 2PD4A 5FYDA 3BMNB 4ALMA 3G1UA 4XKJA 2BF7A 4IDDA 1E7RA 2Y68A 4CM8A 2VTEA 1V3TA 1NR7A 2Y1DA 3B1KA 2X0NA 4YJHA 1BXKA 1DSSG 2J5RA 3MCVA 3OIDA 1A9YA 3VZRA 3JD1A 3H9EO 2EGHA 1PR3A 4UEKA 1OBFO 3W8EA 2G17A 3GN1A 3KTDA 1LSOA 1YS4A 4UAGA 4M89A 3WG9A 4PLHA 3W8FA 1I8TA 2EJVA 3Q0EA 2VUSA 2VZ9A 1E3WA 3WNVA 1VM6A 3U49A 2X5OA 2R2GA 5AQ1A 3S2FA 3AUAA 4O59O 1ZK2A 1GEGA 4RF4A 2E37A 3FF4A 1JDJA 3JTMA 1WMAA 3NDRA 4MVJF 3NYWA 3FCOA 3UAGA 4XQGA 1HF3A 1M66A 1WAMA 3WTCA 4E3ZA 3PRJA 2YV3A 1NWCA 3NKLA 2OUIA 4G65A 4YJDA 3I9LA 1OC4A 4YRAA 3FBTA 2DAPA 1NPTO 3K2EA 2X23A 4W7HA 1HE3A 3GAZA 2NNLD 2EP5A 1ZXLA 1SEPA 3AI1A 3LDHA 1LQUA 3C24A 4TRJA 2Y67A 3NX4A 4BO1A 2E49A 1U1IA 4ALKA 2QRLA 3AUSA 5TRTA 1ZVMA 2GN6A 3FD8A 2EW2A 4YAEA 3ZWYA 3DL2A 2BI7A 5DOZA 1HDYA 4DBZA 3RWBA 1VSVA 4AJLA 3ETDA 3R6DA 2WM3A 3RUCA 3Q3CA 4C7JA 1Y1PA 2GYYA 4FSHA 1NVMB 3OJEA 2AG5A 5JCJD 1VPDA 2I3AA 2CVOA 4ZN6A 4AG3A 3DC2A 3H6KA 1CIVA 3GDGA 5DCWA 2WDZA 3FWZA 3Q11A 4NBUA 5EPOA 2IODA 1QV6A 2DLDA 2X5JO 1K0UA 1Y7TA 4J4BA 1NYTA 1D1TA 2X7HA 1GUZA 3FPCA 4N54A 1T25A 3Q2KA 4YJHB 3VDRA 4CMJA 2VUTA 2AG8A 4IJWA 2HO5A 3KHUA 4IUYA 4IY1A 1K6XA 2VRCA 1MG0A 5EL0A 3ZH2A 3L6EA 4Q3NA 5G4KA 4MO2A 1E3WB 1PSDA 3H2ZA 1ZCJA 1JKJA 3F9IA 4J43A 3QP9A 3F4BA 4B7UA 5B4UA 5HS4A 3F5QA 5L95A 4XB2A 4MIEA 3D4PA 2V6GA 2X1HA 2ET6A 2ZCVA 3HFSA 4QSMA 2PLAA 4OIMA 2GNAA 2D2IA 4WNCA 4D44A 1XLTA 5KJ1A 1I3KA 4L75A 1NPDA 1Y9AA 1DFGA 4BV9A 4NIMA 1YVEI 2PZLA 4UVDA 2O3TA 2ZQYA 2AEJA 4F3YA 1HDZA 1P1KA 4ZRMA 1GUFA 4TRMA 1HE4A 2RHRA 1VL6A 1YO6A 2ZK7A 4OQZA 5BNFA 3I23A 1PJBA 1YL7A 3GHYA 1XYGA 1YONA 4HUJA 1BXGB 3WB9A 2GRAA 4ZD6A 1VJ1A 4CV3A 1F8FA 4BMSA 4EBFA 4YDRA 1HYGA 1CF2O 4IBOA 2B83A 2NTJA 3I9OA 2I5PO 3ZV6A 2ZJ1A 3U5TA 1IE3A 2WYWA 3R3SA 3HDHA 2YV2A 4J0FA 4BNVA 2P9CA 4FGWA 4Q9NA 1JWBB 1DO8A 4Q3BA 3WBFA 4ND3A 3EVNA 3GLQA 3MEQA 4NG5A 4XYLA 5I8WA 3AY7A 1PS0A 3NGXA 1DLIA 2O4CA 1PS9A 1LDNA 2P9EA 5I7SA 5MGBA 3EHEA 3LVFO 4JNKA 4OMUA 4EEXA 5G0UA 2P9GA 3PWZA 4R54A 1OAAA 1YE3A 4Q3EA 4E5MA 3GRKA 1EUCA 1GL3A 3X2FA 3O03A 3A14A 4WLFA 3K5PA 1QORA 4XEHA 4UVIA 1DRUA 4BNYA 2W98A 2IEBA 3FHLA 4U6QA 1L1FA 2C2YA 5G4KB 4D3DA 2CMDA 3JQ8B 1J5PA 1U3UA 1P44A 1PS8A 2QW8A 4W82A 3RUFA 2Q1TA 2P5UA 4DIBA 3OQ1A 4J2HA 4IDBA 2RBEA 4KOAA 3ZW9A 4Y98A 4I9UA 2YHIA 3JQGA 2XPCA 1N5DA 2Q2QA 5TC4A 2RAFA 3KSUA 3D3WA 4GWGA 4KQWA 3W4JA 3ULKA 1SOVA 1ENYA 1ISJA 3ANLA 3S2EA 1TI7A 1X14A 5EESA 2BGKA 4B8WA 1XIVA 1JA9A 4MVJH 5DP2A 5KKAA 3JCZA 4MINA 1KY5A 4BS9A 1ENPA 5KJFA 1MV8A 3I9KA 1DIRA 2DBZA 4CQLB 4ZQBA 4E21A 5FI3A 2AE2A 4W6ZA 1IPFA 2O3RA 3KM0A 5T67A 4YYZA 3S55A 3RFXA 4DBVO 3ONDA 4R9RA 3VC7A 3A9WA 3D0OA 5ER6A 3UXYA 1H6CA 5A4DA 2I6TA 2EXXA 3DXFA 2HU2A 1MGOA 1P74A 5CDSA 3EMKA 3RFVA 1UDAA 2QZZA 1NP3A 2YDXA 1YB5A 3ZV4A 2ZJ0A 1GEEA 2UYYA 5JS6A 2H1SA 3H9QA 3O8QA 4ILKA 1HDOA 3IJPA 4R1NA 3IJRA 4NJMB 2HSDA 1MX3A 3PHIA 1DFHA 1R66A 2OL4A 4URFA 1GZ3A 2BRUA 5G4LA 3T4EA 1B7GO 1E3JA 3DO5A 1O95A 3H5AA 3WMXA 4CQMA 1E5LA 1V9LA 2IZ1A 1ENOA 3DWFA 3TQHA 2GDZA 4E5YA 5I7FA 1Z74A 2Z1NA 3K9QO 3ROQA 4WNIA 3ZCXA 4Q3AA 2VRCD 5F5LA 2C5EA 1W4ZA 2Q4EA 3V1YA 3WNQA 3BHJA 4U5QA 4BGVA 1HDGO 1D7OA 2YHIB 3JQGB 3KOUA 1TB4A 2WE8A 3D3WB 4D41A 5JC8A 4FJ0A 1XU7A 3PLNA 3SEFA 4L8VA 2GLXA 1NX6A 3C3XA 5TNXA 4WK6A 1GYRA 5FFFA 2HK9A 1B8VA 3VOSA 5G2OA 1ZFNA 4CM5A 3KYCA 4OOEA 2QYTA 4DPLA 5JMWA 4IJKA 3TN7A 1WP4A 4IS3A 3NGLA 4ND4A 5AVOA 4D0SA 2X6TA 4CMEA 3BTVA 3INTA 1NM5A 1PGOA 4OKNA 1EE9A 4BO0A 5DT9A 1LSSA 1TT5B 3Q9NA 4MP6A 5JE8A 1PX0A 3N58A 3CXRA 2QYSA 1PZHA 4XB1A 1WMBA 1PQUA 4IZHA 2PKRA 4PCVA 4ND1A 2G82A 4M87A 4I08A 3WWYA 5C7IO 2E6UX 2Q99A 1E77A 1XEAA 2E48A 4NFYA 4ZA2A 4BNKA 2DUWA 2GO1A 4RVSA 3ICPA 1Y6JA 3ZZNA 1HEUA 3QE3A 4EJ0A 3HDQA 1PWZA 1EVJA 5JDIC 3AWDA 3TF5A 1QYVA 4E2XA 4YA6A 4PN3A 3DDNA 4DQVA 2EKPA 5L4LA 3OH8A 3RQSA 5L51A 1IOLA 3OETA 4WEOA 2Q3EA 1KERA 2PR2A 3ZI0A 1R16A 1ADGA 3PHLA 1D1SA 3OQBA 1F06A 4Z0PA 4D45A 4Y8VA 3ZW8A 1GQQA 3R0IA 1AUPA 1EFKA 4RPHA 3ETGA 3RU7A 1E6UA 3KEQA 4NNJA 5L3ZA 2C29D 4HP8A 2JD0A 4P4NA 3U4HA 4TKLA 4WCFC 3GVHA 3M2PA 5JO9A 1PGJA 3VZSA 3D4OA 3EZYA 4BNUA 3CE6A 4BNIA 5JW6A 1FK8A 2GZ1A 4A7PA 2DBQA 3RSHA 5IZCA 4BNFA 4QQRA 5JMPA 2ZCUA 3KYCB 4CLXA 4DLLA 4OSOA 1JWAB 4B7CA 3TZQA 4Q3DA 2F00A 3PPIA 1L7DA 1AN9A 3E5MA 5TIIA 3KEOA 3QSGA 2O7SA 3ZWNA 4FOSA 1EMDA 4W9NC 4TMFA 1MFZA 2A35A 3ZWOA 3E1KA 1GCUA 3ZU2A 3GQVA 3FPLA 2OMEA 4II2A 5I7EA 1AE1A 5KNLA 5EQDA 5A04A 2JL1A 1E6WA 1GTMA 3G49A 3TZKA 4BNGA 3DBRB 3JD3A 4ND2A 3TOXA 1R15A 3O4RA 2FPIA 3QQPA 4XJTA 4FJ1A 1R12A 3GK3A 4EUHA 1XQ1A 1PQPA 3UF0A 5FEUA 1A5ZA 4PG4A 1LJ8A 4NH4A 2VOJA 1PJ2A 2FPGA 4E13A 1PR9A 3O26A 4NBRA 4YBZA 3U0BA 4OXNA 1H0KA 8LDHA 3HG7A 2WMDA 5K6AC 4B4OA 1ZBQA 4R9SA 1PZFA 4YCAA 4ZU3A 5A3VA 1E7SA 4JXKA 2I67A 2WYVA 2HDHA 4CQMD 4LRTB 1UDCA 4FFRA 3DOCA 3EZLA 3WFJA 2BLLA 1Q7GA 4HFJA 1E1LA 1UXJA 3ZHBA 3H4VA 5I8ZA 2JFFA 1WZIA 1U9JA 4OSPA 3JQBC 1UP4A 3C7CB 4OYRA 3VPSA 2CF5A 5KKCA 2VHVA 4HFNA 3JQ9A 3OEWA 2BH9A 3QVSA 1YDWA 3BYZA 2FN7A 1DEHA 3Q2IA 2QRKA 2FP4A 3U4IA 1EBFA 4XX0A 3U3XA 1U3VA 1C1DA 1T2FA 1PJ4A 1Y5MA 1X7GA 3G17A 1HZJA 3AK4A 5TF4A 1I36A 3JQDA 2AW5A 3DHYA 4FBGA 4Q39A 5L53A 3HN7A 1WXDA 2LDBA 3HHPA 1LLUA 1PZGA 2C82A 5JAIA 4MVJA 5IAAA 4AVYA 4ONEA 1JW9B 1PL6A 1DAOA 1RM0A 1MC4A 2AQKA 3K30A 4JJGA 4L4RA 4PVCA 4KMSA 4RF5A 3TPCA 4JIGA 4AL4A 5G0SA 1JAYA 1GV1A 2X22A 4JX8A 4OXYA 4CLHA 5IJZA 3ZNQA 4Z6KA 3PI7A 2DVMA 4PZEA 1AGNA 1VJ0A 3PJFA 2J3IA 3QRWA 5F3RA 1DRWA 3ZNOA 5TGDA 1FXSA 1E7YA 4ALIA 1LRLA 3QWBA 2B36A 2FR8A 2G76A 4BO4A 1PJTA 1GD1O 2B0JA 3HQ4O 3OBBA 4BV8A 1C14A 3RC1A 5HWSA 2IDZA 2IYPA 4MJLA 1YQXA 1LRJA 4K1LA 1BDBA 4UEOA 2ZB7A 3CKYA 1O89A 1T1RA 3ON5A 4R16A 4S3MA 3ZWBA 3KSZO 4CMIA 4EUEA 1C0IA 2FMUA 2CDAA 3I6IA 4DIFA 3PDUA 1GZ6A 1BSVA 1KC1A 4WUVA 4MKRA 4RF2A 1WWKA 1DRVA 3Q9UA 1ULUA 1YXMA 5K0ZA 6LDHA 1NXQA 4U0KA 3H65A 3S8MA 2JFHA 2ZB8A 1DC6A 1ADCA 1BDMA 1SC6A 1PGQA 2O23A 3G3EA 1SEVA 4NBWA 1GYQA 2WWRA 3UVEA 3E9NA 4PZDA 1NAHA 4RVUA 3WFIA 2WD8A 3ANNA 4Y67A 3D5TA 2NUAA 3FR8A 3P2YA 4IQ8A 3LLVA 1MUUA 1DHRA 4R5MA 1OI7A 4CPDA 5TS3A 4IGFA 1UP7A 3PQEA 3TL3A 1UP6A 2AQIA 4K6FA 1XGKA 2QHXA 1H9AA 2Q4BA 3A06A 3IL2A 2AA3A 4YTEA 1E3LA 3L6OO 3INGA 5H82A 3RI3A 3MWDB 1KY4A 1Z45A 3LF2A 5GZ6A 1BXZA 2VWGA 1PIWA 2JCXA 4RDIA 1KYQA 2DPGA 2Z1MA 3WBBA 2OZPA 3OHSX 5AOVA 2DTDA 4AJPA 3GFGA 4I5DA 2D59A 3GZ4A 2VWHA 4RPKA 3T4XA 3WYBA 3D3EA 4JLWA 4E2WA 5KWEA 1QP8A 1X1EA 4WLVA 3DHNA 1V8BA 4E31A 1F8GA 5L7YA 2R00A 1B8PA 1P0CA 3EGOA 3U4CA 4EUFA 1NNUA 2BGLA 3CSDA 3QA9A 1P33A 4H7PA 1CQIA 4R3NA 4RGBA 1YGYA 4BO6A 1T4DA 2C2XA 1Z75A 3UUWA 4J91A 5BSHA 3H3FA 4NI5A 4DVJA 4RJTA 4BKPA 1QYCA 5L45A 2NTVA 3WSWA 4HADA 4KP7A 1Y8RA 5DCYA 4MKXA 4J49A 3CMMA 5ER9A 1J49A 3M2TA 5CDYA 2NV6A 4NHEA 3H8VA 2O7QA 2GZ3A 3OIFA 5A1TA 2VTDA 3MJCA 4MIYA 2QQ5A 4O0LA 4DMLA 4O6VA 3AI2A 4YT4A 4RF3A 1OMOA 1Y8QB 3L4BC 1Q0HA 4N18A 4HNGA 5T8KA 1HE2A 4PG6A 4FIZA 2PA3A 3WGZA 1X7DA 4BNMA 3NUGA 4CLEA 1DDOA 3VKVA 1B2LA 3AY6A 1JN0A 5ICMA 1T2AA 3R1IA 3HFGA 4I1IA 1GUYA 4WOKA 1LLCA 1EDOA 3IS3A 2R6JA 1PJ3A 3GVCA 4NR0A 2WTBA 3JYNA 3EDMA 4YQYA 1D4FA 3WS7A 3ITDA 4ZICA 5EMHA 2FWMX 3KBOA 4MVJD 4CMGA 4YAIA 3RKRA 3P2OA 5MDHA 4XWYA 4KUHA 2D1YA 2EKQA 1I3NA 1ISFA 3MJTA 4UVEA 3H3JA 4NFHA 1B3BA 2DQ4A 2VN8A 1EE2A 1YQGA 4ID9A 1ISGA 1HYEA 2RH8A 4CV0A 1Z73A 1ISIA 3GEDA 3P5SA 4J7UA 1RM5A 2JCYA 4FCCA 3W6ZA 3UGKA 4BGUA 4CR7A 3VH2A 3ITKA 3ROKA 1VI2A 3KXDA 2I3GA 3DR3A 4FC6A 4BMNA 3QW2A 4OAQA 3LC1O 1A7AA 3CZRA 4CM3A 4DC0A 4RPJA 5TSDA 4M86A 2I66A 3EYWA 3TDKA 4DYDA 4B8ZA 2ZYDA 3HDJA 1Y8RB 2I99A 5T64A 1KVSA 4P4GA 4I8XA 7ADHA 3U9LA 1B26A 2OORA 3V2UA 3KLMX 1EK6A 4TRNA 1ZMTA 1E6EA 5AXAA 5JC1A 5FWNA 1UAYA 3HWRA 3VVCA 1W6UA 3IUPA 4TSKA 4I5FA 3C1OA 4ALNA 1NVGA 1XHLA 4XYBA 4QO7A 1WW8A 2XOXA 3D1LA 3DAFA 3KYDA 4GX2A 3DBHA 1HSZA 3SJ7A 4PGFA 3IQDB 3H2SA 3JQCA 3PJEA 2H63A 4RV9A 1RYDA 1BXGA 2IZZA 5T5QA 1M6HA 1W0CA 1K2WA 1ZKMA 5JCXA 4RPGA 3DFUA 1QR6A 4QUKA 3UOGA 2AHRA 3ZU4A 4PLVA 3K6JA 2VHWA 2BELA 1B15A 4DPMA 3S1LA 1TT7A 3GMDA 3ZWMA 3PLRA 1HRDA 1NQ5A 1ZH8A 2IEDA 1ZNQO 2VT2A 3QVTA 4OJNA 4TWRA 4DMMA 2D5CA 2DT5A 4DL9A 1N9GA 3JD4A 1JKFA 1G0OA 1ZZEA 1NFFA 3IKVA 5DDIP 1DC3A 1ZMOA 4BO5A 4J1SA 3TZCA 4BO7A 3Q1LA 2VOEA 3PWKA 1P1RA 2PWZA 4NJOA 4QX6A 3I52A 4RZIA 5IDXA 1ULSA 4PZCA 2D3TA 1H6DA 4LVCA 3GNSA 3VPGA 1CEQA 1QMGA 3GGGA 2HK8A 4AJ1A 3FRJA 4YQZA 2PFGA 5HTOA 1GU7A 3WIEA 3VHRA 5C37A 3FN4A 1D3AA 3GDOA 1CETA 1JKIA 3OJOA 3NEPX 5DF1A 3RBXA 4E2YA 3JV7A 2P68A 3JQ8A 4JBIA 5HM8A 5TQVA 1P31A 4ZJUA 4BNTA 1XQ6A 2C7VA 1J4AA 2G0TA 2ZQZA 3TNLA 4CJXA 3W1VA 4FW8A 2HMTA 3WWZA 4E33A 3ETEA 1E1KA 1JTVA 2PZKA 1O6ZA 3U4DA 1O9BA 2HMWA 3WDSA 2VCYA 3UKOA 1ZSNA 3MWEB 3UW3A 4KTVE 3KYDB 3DBHB 3TFOA 5BSEA 2BHLA 1I10A 1Q1NA 2PK3A 4MPDA 2NU9A 1ZEJA 1VJTA 3E03A 5A3JA 3JD0A 4LW8A 4Q3CA 1HDCA 3DAPA 4UUMA 3CZMA 5F21A 1M76A 5CDTA 1BG6A 4K6CA 3L6DA 1GAEO 4MP8A 1K6IA 4CODB 4CUZA 4CQLA 4CMBA 1UH5A 1ADFA 4Y9DA 3UCFA 4B4VA 2IXAA 2Q1SA 4ZRNA 4EDFA 1O94A 3QHAA 4BNNA 2BGMA 3LU1A 4XYEA 1MA0A 1OC2A 2QIOA 1LSUA 4LCEA 4X54A 1SPXA 4YVFA 1SCUA 3FNHA 3GPDG 1N9GB 1U3TA 4BIIA 3B20A 4FFNA 2NVUA 1DIHA 3RC9A 1WDKA 3WQSB 2FY8A 3GVPA 4GLOA 2PD6A 2HJRA 3DHEA 4BGIA 4E30A 3WGGA 4OL9A 1YL6A 2P2SA 4YXFA 4Z0TA 4L74A 5CPFA 5EJ2A 2DBVO 2EKLA 2OO5A 1RKXA 4DPKA 4NJMA 1QG6A 1U7TA 1NBOA 3KZVA 2BMAA 3BTSA 4GLLA 4GBJA 3AM4A 3CH6A 1PZEA 3QWFA 4IJUA 5CEJA 4J1TA 1GY8A 1LSJA 2FHSA 1VL8A 1FDTA 2O3JA 2PGJA 4R69A 1KEWA 5H81A 3ZHZA 3IKTA 4GGOA 4L76A 1PEDA 1T2CA 4E12A 2GERA 5JYDA 3FTPA 5A9TA 3NT5A 3CEAA 4TROA 2GR9A 1Q0QA 2ZYAA 5TJ9A 5JAQA 5JY1A 5CHEA 1P1HA 2DFDA 1GCOA 1F12A 4G2NA 4TKMA 4ALJA 1ONNA 1Q2XA 1XKQA 1H93A 3DZJA 3I83A 2O3SA 3VH3A 3EW7A 3MOGA 1R6DA 3OJFA 2BFPA 4GAEA 4C7KA 3TZ6A 1B3RA 4PG5A 3LF1A 1AHIA 2VYNA 5BSGA 4I5GA 2NQ8A 2O48X 3FNGA 1ZO8A 3T7CA 1B0AA 2NU7A 3PQDA 1UXHA 5A02A 4XYMA 5U9CA 4GL4A 1V35A 2AEMA 2X0JA 4OHUA 3H7AA 3TZHA 4R01A 3V1TC 5LCXA 3BXXA 5A9SA 4WE3A 5F1KA 5JLAA 2AQHA 3UCXA 4B4UA 1EZ4A 2Y1GA 1TT5A 3D5QA 1EFLA 2PZMA 3V8BA 2G1UA 4XGIA 3ST7A 3DONA 1QYWA 1E0DA 4RVHA 2NVUB 3E18A 2J3HA 1LNQA 3GAFA 4IM7A 5G0WA 4BVAA 4PLFA 4WKGA 1UZLA 4CM6A 3AOGA 5CFZA 3A1NA 1QLJA 3PYLA 3PTZA 2GF2A 4GSLA 5C3MA 2NQTA 1P3DA 4IMRA 2SCUA 4YAKA 2CNBA 3ZHXA 3UH1A 2VWQA 4N5MA 2Y93A 3M1LA 3F3SA 4WLNA 1KS9A 2W4QA 3B6ZA 4YJFB 4A10A 5L9AA 1R4MB 3GDFA 2Q50A 1ZSYA 2J5KA 4F45A 1ZK3A 4W99A 1XCBA 5CEFA 4ZQEA 3QLJA 3OECA 3PIDA 4LVUA 1ENZA 1PJQA 3L9WA 1RM3A 4PLYA 4BNHA 3UHAA 1P1IA 2I9PA 1LC3A 2GZ2A 3V2GA 3AFNA 3DZKA 1E7QA 1J6UA 4J0EA 2D4AA 4YAGA 5IDQA 4H15A 4CR8A 1A4IA 2DTXA 4R1TA 4ZVVA 4KUEA 2YJZA 2Z5LA 4A73A 3ORFA 4HNHA 3QWHA 3SXPA 3E8XA 4EW6A 3ZNNA 3CTMA 4PIVA 4XA8A 5IF3A 1TA4A 4J1NA 5G0VA 4BOYA 3PGXA 4E2ZA 2Q2WA 2Y0CA 3VPXA 3L9XA 5A9SB 4XIJA 3CPSA 2C59A 1SO8A 3I4CA 2PH5A 4INAA 4M8SA 2CSUA 3L4SO 4AJKA 5JDIA 1I24A 1G0NA 2EV9A 2JHFA 2Y0DA 3DZIA 4GQAA 4YACA 1R4NA 3I6QA 4ESOA 1MXHA 2B5WA 3DZGA 5L4NA 3GZNA 3NT2A 1PWXA 4YT2A 2NVWA 3DBRA 4MVJI 1K5HA 3PHGA 4HY3A 2CF6A 3GT0A 5DCUA 3LQFA 4I9NA 4O63O 4LMRA 2FSSA 2YQ4A 4UUOA 4D0RA 4E0BA 5CAEA 1IUKA 2FRDA 4NZ9A 1N2SA 2Q49A 2X58A 4L4SA 2JHGA 4CL3A 1LI4A 3BHMA 1P1JA 1UXKA 4IPTA 2BKAA 4XD2A 1BMDA 5ITWA 3PIIA 3WR5A 4J4HA 4BNWA 3ONEA 4OH1A 2P5YA 5B1YA 3HB5X 4WCFA 1A72A 4FD3A 4E6PA 2ZYGA 3SLGA 4IDAA 3RKUA 2V65A 1ONPA 4CMEC 4ZHSA 2Y66A 3D7LA 3JQFC 4DGSA 5A5EA 2BFMA 1HL3A 1UXGA 4CMHA 1XSEA 4WPGA 4GVLA 1ORRA 4EJ6A 5AXDA 2NTNA 2HRZA 1N1EA 3IOYA 2AXQA 3GFBA 4JBHA 2A9FA 1RWBA 1DHTA 1IB6A 4LK3A 4UVHA 3C85A 5ICSA 3H9JA 2CVZA 3GVIA 4W9NA 2XXBA 3GY0A 3ZN2A 2QG4A 3GMSA 4GKBA 3AW9A 1U8FO 3RJ5A 5A9RA 3WMWA 2VYND 3NTOA 5FI5A 5I9NA 3JSAA 2AE1A 2FR1A 3I5MA 4A2CA 3K96A 4D7AA 2RIRA 3I9NA 1HLDA 4WLOA 3PJGA 3PWSA 3ROPA 4U6SA 2H6EA 1NWHA 3PGJA 2EJWA 5BNIA 2PKQO 3AU8A 2J3KA 3WIDA 2OOSA 1H6AA 2Y1CA 3W4IA 1YQDA 1R4NB 2V6FA 3SVTA 1PL7A 5ES3A 1SNYA 1FF9A 1UJMA 2ILTA 1NHGA 3GZNB 5JPIA 3ZDFA 5EQFA 3DEYX 5CG2A 2OXIA 1I32A 5K6AA 1WZEA 3SLKA 1C0PA 4A0SA 1ID1A 1K6JA 3IP3A 2NACA 5A5FA 1YB4A 1HSOA 2JCVA 5IZCC 4HWKA 2PGDA 1WDMA 4HX5A 4WCFB 2HKIA 3E48A 1FDSA 1JAXA 3GGPA 3ANMA 4B3IA 1A9ZA 1NFQA 2FZWA 2PKQP 2GD1O 1Y5RA 3VH1A 3PQFA 4NMHA 3GEGA 2JD2A 1YOVB 1I3LA 1PGNA 4JQCA 3ZU5A 3E9MA 4WGGA 4XRGA 4WJZA 5HS6A 5B4TA 1MFPA 2A4KA 4K26A 3VPHA 3ICCA 1G6KA 4J9VA 1P0FA 4BKQA 4E5PA 2VNAA 3I3OA 4YR9A 1JU9A 3N74A 4PG7A 1DC4A 4QECA 5IN5A 3JYOA 3DQPA 2DM6A 3ENKA 3KRTA 1E3IA 3JQ7A 3MTJA 3PP8A 1LLDA 1PJLA 3RAJA 1LU9A 2PTGA 1DAPA 4AJ4A 4ITUA 3COSA 2Y0EA 3ZNPA 1NASA 4L0QA 4O1MA 5H83A 2WEKA 1E7WA 1ZK0A 2X0IA 1NQTA 3V5NA 4E4YA 1RJWA 4AJHA 5LC1A 4OQYA 4XQ9A 4W4TA 1P45A 4ROSA 4R5HA 5F1PA 4M54A 4G81A 1E3SA 3PXXA 4MVJM 1WNTA 2UUOA 4DRYA 3RASA 4CM9A 5ILGA 1N7GA 2C07A 3RROA 1LQTA 2FOIA 4PG8A 5HBRA 3HJAA 1UUFA 4DYVA 1BW9A 1KETA 4IJVA 3FWNA 1C0KA 5COQA 4AJNA 1CWUA 3WGIA 3OJ0A 3Q6IA 3JQAB 3C8MA 3H9UA 2E82A 2AQ8A 3JQ9C 4NU5A 3SC4A 1XWFA 4AJJA 1QSGA 2YFHA 4FB5A 4BQPA 4GSKA 5G0TA 3AU9A 1ML3A 4BNXA 1MLDA 2WSBA 4K9DA 1A71A 4IQGA 4M49A 2J8ZA 3OA0A 1O5IA 1EVIA 1X0VA 3VTFA 1EQUA 3DBVO 5BNTA 5JY6A 1RPNA 4GVXA 1PJCA 3GHHA 4IINA 3OP4A 3WGQA 3NRCA
chains in the Genus database with same CATH superfamily
2H7CA 3SLRA 3ZI7A 1FJHA 1SXJE 1XEXA 2Z6VA 3MRVA 1DIOB 2I3ZA 3GFPA 3SIWA 3MWFA 4RVGA 2QZ4A 1NFRA 3ZTTA 3BD6A 4Q93A 2GN9A 4WZBA 5EIHA 2R8YA 4D9CA 1GDDA 3K7EA 5HSGA 5K9ZA 4EYQA 1WD7A 1K9VF 5DWDA 1C2TA 1H94A 3H8WA 1EBUA 4LHSA 1ZI8A 4QBKA 3AR5A 4QUHA 1KE2A 1DXHA 3DC7A 2B3TA 3PUHA 2F8SA 3UJPA 3NOOA 3BDIA 2OR3A 3FPEA 1P9LA 3I39X 5T6BA 1Y8QA 1OX4B 3FCSB 3IIMA 2NWQA 3QG1A 1U2PA 4B84A 2IXTA 3Q7PA 2GPBA 3PKJA 1QHSA 2G36A 3GN2A 1YF3A 1JG3A 1OBCA 2LV8A 4K05A 2BFOA 1PE0A 1SMKA 2CXNA 2ZTMA 1DO2A 1FDUA 1VDZA 3EXEA 3KT6A 4QGGA 5IXSA 2X4GA 5KOYA 1R8JA 3LX5A 3T7TA 1EVYA 2YWFA 3AIKA 3L8FA 3NHZA 3MMPA 5KJ1A 5BMVF 5IJ9B 1ADBA 3IV6A 3DJYA 4OQDA 2P69A 4RVOA 4Y1EA 2IEGA 3FNEA 5TX7A 4DUZB 1YAJA 1H1DA 1U8TA 1Q17A 2IDMA 3KVYA 1UFRA 2Z2ZA 4B3SB 5BNZA 5E1OA 1BW9B 3GB9A 2J30A 1K7SN 2H52A 4WBNF 1BZYA 5KTKA 4F1KA 3ANXA 4II3A 1XKXA 4HH0A 2W9XA 1HQCA 3TGLA 1N3LA 3ESRA 4I36A 1NE7A 2DMRA 1E9AA 3RIXA 5JQGB 2PG3A 2G5CA 4D2IA 2ORWA 1OQAA 1QIEA 3ABSB 3KT0A 4UULA 4AECA 3AOEC 3PE6A 2P7IA 2XYGA 5HGXA 5BR7A 2BT4A 1G291 3PJDA 1T9DA 2W0SA 2IKQA 3GVXA 1XAGA 4QHTA 1GIAA 4D56A 1BEEA 3GF4A 4S0ZA 4CLOB 1OLSA 2H08A 2HJHA 7GPBA 5LN1A 2D06A 4PZLA 3LY5A 3RANA 4DSUA 3K09C 4UDYX 1LK5A 3BICA 4R2HA 3RUHA 1W93A 4Z8YA 4A8JA 1D2CA 2TMGA 1WXEA 1N8NA 3H1AA 4K81B 3ZVNA 2NYUA 5KSOA 2GEKA 1RADA 4FMBB 5A0FA 2W6NA 3HJRA 3VR4A 3VYRB 4FDAA 4DUGA 2BMWA 2HA7A 1JQKA 1VKOA 5JCZA 2JGDB 4ALIA 2EIHA 3V3TA 1Q0PA 1E9EA 3FWHA 3GRUA 5ESWA 2DZDA 1SUIA 2HV8A 2VK1A 5FNZA 2V55B 1I30A 4UATA 3MUOA 9GPBA 1GUBA 2AG6A 4UOQA 5JFOA 3VU1A 2VHUA 3V4RA 3JVDA 4ZU1X 1W88A 2O8NA 2IEZA 5GTDA 4RHYA 1NMQA 1ZN9A 3SX2A 1JVBA 1RTKA 4DLKA 4OYYA 1HUQA 5BQXA 1GTVA 4TL6A 1E9RA 2QN7A 4CM4B 1R0XA 2ZSEA 2P7HA 1KRWA 1PDOA 1XR3A 1CZUA 1FX0B 3E6AA 2GM3A 1SBYA 4FFMA 5E2AA 3GJZA 1HV8A 3JZAA 1UAGA 2XV1A 4CKYA 3GJ3A 4FI3F 1A4UA 5EIXA 1RZRA 4FK8A 3F8SA 4XQEA 4BNJA 5KQRA 5EERA 3UEOA 1MOPA 2MR6A 4Y2HA 2RJ3A 1VHWA 2FVXA 2CHGA 3EEOA 4ZODA 3FMIA 1OWNA 2PU7A 5FLXA 1E1CA 4HNAA 4BP9A 1GNLA 3FSEA 5C34B 2GVDC 1I0IA 1MX1A 4QSHA 5FR2A 1FFXB 1GJRA 5ITVA 2XUKA 3NHUA 4MCJA 2YWHA 5DBOA 1YVDA 2CDCA 3I37X 4W8GA 4FDUA 1HDXA 1CULC 1H8HA 2VBCA 2NZ2A 2JGFA 4N5LA 5HNKA 4BZXA 3A1WA 1XA0A 4ZANA 1ZJ6A 3DMTC 1PG0A 4ZV4A 1A98A 3K2QA 4COOA 3I2IA 3VRHA 1XYYA 3MUEA 5CCXA 1USWA 2HTFA 4U7HA 1FTWA 3BK2A 5B3LA 2WWGA 2XF2A 5LR6A 2CCKA 4DOMA 1UK6A 1BYIA 3QLVC 3S5UA 1A95A 5CX1B 3U3OA 3ICQB 3U09A 2VP3A 1NUQA 2Y2VA 3EUWA 2QX7A 3R9XA 2E0IA 4M0EA 3QV1A 4YT5A 3HXQA 1YHYA 2B5VA 3ENNA 3K9NA 4WESA 1XC7A 4PW0A 1YDEA 4JJIA 3LL4A 4KAFA 3SSNA 1XZQA 3NO4A 3OTQA 4DDVA 4J7XA 4AQYB 5AJWA 1U3FA 3MA0A 1NURA 4US1R 3T7EA 3ONWA 1XK6A 2AR7A 4RE5A 2MYUA 2A94A 1NONA 5ERGB 2XUQA 4TKZA 2YWCA 2ZSKA 5BSKA 5A06A 1QV7A 4YB8A 2O5CA 4CF5A 3PXCX 4MEAA 1VHLA 1YZNA 3MAGA 1Y7LA 1RAGA 5EMNA 3IE1A 3RBZA 1JE1A 4YRMA 3HZRA 1JXAA 2WU0A 1QNLA 4EW1A 5I7VA 3K31A 1N34B 4J3NA 4CLDA 1OI4A 4TXNA 1NATA 1SQSA 1T8WA 1EDZA 4KE7A 4C30A 3OZAA 3VGPA 4X41A 2QTNA 1C7RA 2VNIA 2X9GA 4TXLA 1BKDR 3RVOA 5B6JA 1V39A 3DEFA 5HA5A 3W1EA 3WK7A 2AOUB 3FCCA 4C0KA 4I6GA 2H1RA 1C9YA 1A7UA 1WDWB 2GILA 2Q27A 2WFZA 3DKIA 4P1ZA 3PQ7A 2WNHA 1Q0LA 1GFIA 2F1KA 3MTQA 1U8EA 3RSLA 5DNCA 4MKIA 2W7TA 2XNKA 3ZVMA 3GG9A 1SVLA 3ADCA 1JLMA 3LQ2A 4ACAA 1DFIA 4JA2A 3L6BA 1Q19A 3VH4A 2JAPA 5JXJA 3T6KA 1VE6A 4MW1A 2H7XA 1E1YA 1S7CA 3ANSA 3MT0A 1Z25A 1UJ4A 3KFLA 1SOWA 4DQXA 5IFLA 4HFMA 1R64A 4HH3C 2GAIA 4FMDF 1RBYA 5KJ6A 3FCYA 1CJUC 3O84A 2PX8A 4TXHA 1KU0A 3OJWA 4OREX 1E92A 5B57C 1M2VB 3WICA 4D96A 4AQDA 2CW5A 2BFWA 1E62A 4DLYA 3MAAC 3K72B 2FW9A 1E7MA 4YAJA 1SUWA 2ECOA 1KBZA 2BFDA 1IONA 1CF9A 2H9AA 2VC2B 1L5WA 2QRZA 1QLHA 3FYSA 1CF4A 1VI5A 1JA1A 2F3RA 3FNQA 1IG3A 3FR7A 1YFZA 4ZYYA 1AT1A 4KH1A 1ATZA 1Z6ZA 3ODGA 4IMJB 2EFEB 5A3QA 4A15A 1YVPA 2GA9A 3LQQA 1QDUA 1ZXBA 3JD2A 2BGTA 2IHZA 1ISMA 4D4IA 3EIEA 3WNZA 4M6WA 1FJGB 3WE7A 1FQKA 1CIJA 2ZXEA 3MD0A 2VO1A 1DAMA 5B37A 3QMMA 5IUKC 3GT3A 3VMMA 1K4YA 1T9BA 3MIZA 4ZQFA 1DKLA 1KO4A 4XIFA 2C03A 1RPZA 1KL7A 4K46A 4MDHA 1O6GA 3K0BA 2VQ3A 4MRMB 2D7DA 1KVUA 4CKZA 1QIJA 3MLBA 3AFOA 1XMPA 4LJYA 4U9HS 4RTNA 1N0UA 3F2VA 5B1EA 2GN8A 1AKNA 4YRNA 1KYVA 2DETA 2PRSA 1SU8A 2AS0A 2H85A 2ZJ8A 3A8TA 3V1UA 3DLIA 2GPSA 2YQ5A 1I4EB 4R41A 2DCMA 5I4KA 1VLLA 1O6BA 2PGAA 3A32A 3BSSA 3IPLA 2NYVA 4ENQA 1IHYA 3LSTA 4ZQIA 3RUPA 4IDNA 1M6EX 2Y1LA 4TMVA 2PX4A 2JGMA 3AVWA 4WVFA 1KIFA 1X0XA 2YFQA 3QYAA 3RCBA 3EXIA 5C5DA 4QT0A 4BVHA 3B1WA 4PBRA 2J0VA 3A9VA 2P3QA 5C1BA 1D07A 4ZV9A 1R5BA 2FG5A 2YZGA 5KAMA 2EEPA 3VU9B 4B76A 1NW8A 3ZJ4A 3OU6A 3QOWA 2BV3A 2YZKA 3UC5A 3NFYA 1T8TA 1JDBC 4DMUB 1PNVA 5DSTA 1NV9A 3ROXA 3UAWA 4CMAA 1LV8A 1TOAA 2J41A 4H1UA 2J4FA 3BFVA 2QSZA 1RVDA 3U4MA 3S1AB 2QSUA 1FE8A 2C3UA 3G6KA 4ND5A 4CLRA 1L8XA 3DKVA 2V0CA 4G23A 4MTLA 3CE9A 3QTBA 4OI0A 2PIAA 4IDPA 4QBFA 2CL0X 2P90A 2OQVA 5COBA 3KQUA 3K6KA 2YH2A 4B3XA 1ZJZA 4AROA 1CU1A 1CK4A 1SZPA 1ZOPA 3FZQA 4W5NA 2GEVA 3O8OA 1CUZA 2VHQA 2YV4A 3TNYA 4QJBA 1BJRE 4TS3A 4UE2A 2A5YB 1FQJA 2C7GA 3TOZA 1EHIA 4D3ZA 5AI4A 4DEYA 3V2HA 2UZ1A 3VKFA 1PVDA 1OOEA 2D5AA 3PYMA 5IVIA 4BB5A 4JI4B 3W6OA 3UYKA 3DP7A 3W8DA 3CIOA 2WJ6A 2OBBA 4FMCB 2DWUA 1FVXA 2PMKA 2Z30A 4R2IA 4QTYA 1A5SB 2UZAA 3KLNA 3CLUC 2XGSA 2PAAA 3W4KA 3CZCA 1AH2A 5AXCA 3PFCA 3PLAE 4FR5A 4YUZA 3ZX5A 1W5FA 4XCXA 3IMCA 3IX7A 2PRJA 3FBGA 1D09A 5CH5A 3DTTA 4OBWA 1ZCZA 4UNPA 4XEUA 3KYIB 3IJ5A 5F2KA 2ZS9A 1V48A 4AZ0B 4PFQA 3WL4A 1LB1B 2QTFA 3GA0A 5CT4A 4BEVA 3DE7X 2YYSA 3F8WA 2X0KA 3TG8A 1XKLA 3EZ9A 1I3CA 1RRMA 4RPIA 5A9SA 1D9XA 4FFPA 1TQ6A 2RGGA 1NR1A 2JFVA 3AHFA 1Q1GA 2YMMA 2XKAA 3T3GA 3TNFA 3W77A 2O52A 1B6RA 3URMA 2NVBA 2FEXA 3JYQA 2QD2A 2JBAA 2XUJA 4TZTA 3VGJA 3ZJVA 3IEVA 3DT6A 3L8EA 1I01A 5B4VA 5I9SA 2XI4A 4RJJA 1ND5A 2WU3A 3CLRC 3PF9A 3PHHA 4US0R 3SZRA 4DEXA 1EQ2A 3ZC3A 4CU5A 5IX8A 2BIFA 2Q0HA 4FYYA 4MWZA 4JOQA 1QE5A 3DPUA 4GX1A 4RQUA 5DTIA 3O9VA 2I9KA 2QUIA 4AWAA 1SU7A 2ZJOA 2ZRIA 1CS0A 4R8SA 2BJWA 3D2LA 4RNDB 4FOOA 3L49A 1TM5E 3WQQA 3TL2A 4C6TB 5J2UA 2GPAA 3EWSA 3PBKA 3W5DA 1CZOA 2XWPA 1JLSA 2RHDA 4FWIB 3O38A 2J0UA 5BV1A 4LWZA 4I4IA 3RRJA 4P58A 4LZOA 4KTTE 2W90A 1Z28A 2NUTB 1GG2A 1HLFA 3ZE2B 4LGMA 1ZH4A 2RH4A 5HDBB 3TJRA 3TG2A 1LDYA 3LK6A 2HMAA 3ND8A 1V3VA 2WABA 3D43A 2GSDA 3OKCA 1OGJA 4OHCA 2JKVA 2ZSJA 3QNMA 2DF8A 4TUYA 1RRCA 2Q07A 3UAZA 3CT4A 1I7SB 1Z56C 3HB1A 3LT4A 3MJRA 3BCHA 3HLKA 4OA8A 3G8AA 4FE3A 4XR4A 4FGSA 1MB0A 1A5TA 3NH6A 4I4TF 2NUPB 1FP2A 5KYYB 3DAGA 3UTDA 1M34B 3RM3A 4IWXA 3GRPA 3RTAA 3VKUA 1MAWA 3MFQA 2CJXA 4QBIA 4YALA 3T9AA 1PP4A 3LP5A 4PPQA 3VNQA 3X44A 5C4GB 2X15A 4PV7A 3BTUA 2NO6A 1LF0A 3T3IA 1X80B 1TLTA 1J07A 1YCDA 1IZZA 4HKTA 1D8AA 2P8SA 3MQ2A 2AFHE 2W2KB 3PENA 4MQEA 1U7PA 4NAUA 2ZRGA 2NLOA 4EY8A 3JQFA 3GPBA 2H48A 3IUSA 3RJZA 3HM2A 1PFGA 4MIOA 1S6YA 3KSDO 3LVRE 5B2FA 3R5KA 1HOXA 1QYDA 1YA6A 1P75A 1Z33A 1I3MA 1KZ4A 3UWSA 4UEWA 3RVRA 3MM4A 1PHPA 1DEXA 4N3AA 2Z3ZA 3KAKA 4PAWA 3T9FA 2PZFA 2IXGA 3PK0A 4R68A 4FDTA 4AZ3A 3QEAZ 1RQXA 5JZMA 1X1QA 2I3DA 4B5LA 4LVNA 3B60A 5DBGA 3CUTA 3DVLA 3PUIA 2P3LA 4V3CA 4NP6A 3OPMA 4YQEA 2XUZA 4BEWA 5IZ4A 3WKEA 4CIAA 3KQQA 1SZDA 2H5LA 4WOJA 3QXXA 4LSGA 4PTZA 5GQSA 3BEDA 3WBKA 2WU4A 1X7YA 1G5RA 4LOLA 4NNPA 4XQCA 4DA0A 4DRZA 1DS6A 2FOLA 4FEGA 2DBRA 3B5EA 1V8DA 2O4UX 2YIVX 1XFAA 3H8JA 1A4RA 1UJ6A 3QOFA 4LQLA 1BA3A 1TUBB 3TQCA 3MS7A 3O8NA 4QPJC 5BNWA 4Q1VA 4CWAA 3LT1A 4D9NA 4A82A 3HRHA 3DYIA 2QLNA 4LX8A 1OFGA 5IKXA 4QG7A 2IYUA 1E9FA 5ALUA 2PVCA 4NECA 4B7XA 1GZ4A 2BZ1A 2WBLC 4C4PA 1UBFA 3AESB 4ZQHA 3AVTA 3ZV5A 2HHAA 2P0AA 2BFEB 4GHWA 1EGQA 3SVLA 1ZK4A 1TVCA 1XHEA 1Z2CA 3GP3A 3PC8A 3DUFB 2ZS7A 4R51A 2YMLA 2OXTA 2W70A 4CUJA 1AKTA 1XVAA 3AVPA 4IUDS 5CYPA 4E32A 2MOKA 421PA 2YY6A 1YC2A 1OAOA 4ARZA 3I30X 2EX1A 3RRNA 4DR3B 4KNYA 3V4SA 1LXCA 4XW2A 4B4DA 1JR3D 5IG2A 5LD2C 1W46A 1QIKA 2ZU0C 3DTNA 1QUEA 1A5BB 3NBFA 2I6FA 3EEYA 2Z58A 3L7JA 2X9NA 3L8ZA 3PRHA 3VV2A 4B79A 4C7MA 4YRSA 4DQKA 3OFSA 4PGAA 3ORYA 4DDKA 3T1NA 2QW0X 1JEYA 2NO4A 3IBFA 4DM7A 2OM6A 3Q7EA 1IL0A 4PXAA 5JPCA 1A9OA 4MGKR 4AY3A 1HPLA 1RYHA 2H4HA 1FNSA 2ZATA 3OSUA 4Y2SA 4Y1FA 3MNFA 4K6HA 2Z0MA 1I7QB 1L1QA 2GHQA 3GLHB 4KLRA 4N8DA 2HU5A 4TTQA 2HLPA 2F8LA 4QHYA 1NRXA 3V32A 3F90A 1AUQA 1EE1A 5AI0A 3A31A 3MJSA 4DQ0A 4BKRA 5IDYA 1D03A 2QXUA 4RTLA 3KKOA 3GJ8A 5BMVB 1UQUA 1L8AA 4YRDA 2PS1A 1KQOA 3F5FA 3P4YA 3PPVA 3SSOA 4MRSA 1KP3A 3WJ1A 4ARBA 5BUZA 3R3ZA 5JAPA 1P1FA 1U6IA 2XDAA 3D8NA 3E8SA 3DE5X 2WOJA 1GXSB 2AIRA 4FHEA 4X3CA 2ATVA 1HT3A 4WBNB 3COWA 1DKOA 1G1MA 4E14A 4URXR 5K8LA 1NQUA 3RIEA 1HMYA 4XDZA 2Q6TA 3WYNA 1GPJA 2QZ9A 2E4ZA 3DEJA 4LTDA 1Q11A 4J0GA 4XSHA 4OKSA 4XR9A 2J9RA 4RZHA 2N47A 4PFSA 2BTQB 2EW1A 2FX2A 3SJUA 1KDPA 3VSCA 4H4EA 3TSCA 3U1VA 2H18A 5JNLA 1FP4A 4CQNA 1I0ZA 3JS5A 5FL3A 1S1MA 4F38A 4HEJA 1Y5IA 2QPOA 4B3MB 1R8YA 2IZ0A 2PL9A 2WTXA 2NV0A 5AW4A 2H3EA 5T57A 2YXDA 3ZZ1A 1D2MA 1N3IA 4B3RB 1L7PA 1MQSA 5C7LO 4HB0A 1MB9A 3RSQA 1SB8A 2Y1KA 1D2EA 1KNQA 1U7XA 3LQ4A 1A69A 2IW1A 4HTFA 4RH1A 1BCSB 2NU6A 3RSFA 1P7ZA 1JFFA 5IC4A 1A7JA 2ABWA 1ONOA 2Z95A 3C3PA 4FW9A 1UQRA 4TV9B 1HDEA 4CF4A 1VJGA 2GPWA 4E1AA 2D62A 2JHAA 3BK7A 2A5GA 4PO3X 4GRAA 4RHTA 2EQ5A 4ZVKA 4CF3A 4W9MC 1UT5A 1JPNA 2VQ6A 3MHTA 1KP2A 4BMPB 1LDMA 4KZKA 5HFJA 3WQHA 4CTKA 2EWMA 1A7KA 3W3AD 4E08A 1DWOA 5LBIA 4MRAA 1R1DA 2GK6A 4XAQA 1B93A 4A36A 3C70A 1MHPA 3MGAA 3F6EX 2X86A 4A26A 4F2WA 4J16A 5CP8A 2GGSA 4PF1A 1XELA 2OBNA 4OQFA 2A84A 3OIGA 5KYUB 2ONYA 4PNPA 1HT0A 1VLZA 2FQQA 5KTOA 2AJTA 2E4AA 3DT9A 4CL8A 1UOEA 2BM8A 5CA0A 3SEZA 4XJSA 2DPHA 5EOVA 5KX5F 2PY6A 2V3VA 2FPPA 2R79A 2V9PA 5F77A 2C54A 3GR6A 5H59A 1H2BA 4CR6A 1WZ2A 4G0WA 1Q7BA 5FO1A 5TGTA 2Q4OA 4L2IB 4D57A 1Z6AA 3PFIA 4JODA 3IPXA 5B12A 5CLHA 2V6BA 4KIWA 3KQHA 3MJEA 2XMPA 4EKNB 5AUNB 3BDVA 3H1TA 2AXNA 5M7EA 3BFPA 3U56A 4HAWA 2FN3A 4MDEA 2J31A 2PO7A 4C78A 1N0VC 4EI2A 3IUEA 1V4BA 5EXDA 3JU3A 4Z99A 4YYEA 3WJAA 1E61A 3D8BA 1L4NA 1GZ7A 4KLNA 4DNQA 2XMCA 2JKYA 2DP4E 4K88A 2AG0A 5AH0A 2FH5B 5DTMA 4G5HA 5M3BA 3ABZA 4MDFA 5CB4A 1N8TA 3BZBA 3OUZA 5ENDA 3UJ3X 4E7PA 1LH0A 3Q3GE 5HIIA 1ZU5A 2OAP1 2QVYX 1PGPA 4G63A 4EPVA 1USIA 5JXWA 4OOFA 4EMSA 5U4XA 3OLZA 4UUNA 2ASEA 3VHXB 1W44A 1YR2A 2B8WA 3PHCA 4PFJA 3HKEB 1DIAA 2L17A 2G9UA 3UT0A 1BOFA 4HFRA 1NOKA 4BNDA 2Q1UA 4CIBA 4EMUA 5A0VA 2YJ3A 5LU8A 1F2TB 3EMBA 3CMCO 4KNVA 5KVAA 4P0TA 1SVIA 4E03A 1XZNA 1JVSA 2QV7A 4JZYA 4P22A 1RBQA 1RRFA 2DTEA 3H9BA 2OD2A 4K7JA 2O19A 3ZV3A 5KVQA 2YWDA 3K20A 3T1VA 3IIEA 2AN9A 5A4JA 2ANBA 1BD4A 2F9MA 1JHZA 5EXTA 2UUBB 3LT5A 1DCKA 4RTQA 3S99A 5JCJA 2KX7A 1KMHA 4GPD1 3OUTA 3HB7A 3RIHA 2WUEA 4FBLA 1AB6A 4L0CA 4OHVA 4JAVC 3W79A 5CFMA 3BQNB 3DBLA 1TEHA 3GH3A 1L7EA 4TXMA 4NCNA 4Y3UA 5JFTA 4PY2A 4D46A 1WUKS 1QE0A 1V1MB 3CGGA 3OVMA 4FQ8A 4P7JA 1SUPA 2RFLA 3S5JA 3RFTA 4AZVA 2EFHB 3LRPA 2V98A 1E6KA 4WFKA 5GZ3A 2WM9B 4ZXFA 4MS4B 3H8SA 2HWUA 5ULLA 4GI3A 3G2MA 1BD3A 1IY0A 4L07A 1VTKA 3CF4A 2OWEA 2X1LA 3F7NA 3T38A 4L5CA 4D9BA 1F17A 1C3OB 4FMDB 1VCIA 2RBGA 1YVUA 1T8UA 4HGYA 5HRUA 1L8LA 5FWXB 1UPXA 3ABIA 3EZGA 5AVJA 2QG9A 2IYOA 2JFQA 4IIHA 4CMIB 4EYSA 1UAAA 2BZGA 3ND5A 2X5XA 3AEKA 2P67A 2R00C 4AY2A 2D1TA 3FKJA 2AZDA 3MS2A 3OOWA 2OGUA 3Q7TA 3I4FA 1YIAA 3PFWO 3RT1A 5BVGB 2PV7A 2TMYA 3IVXA 3KV3O 3ET5A 3OM9A 2GOYA 2GYUA 3O2NA 3QWIA 1AKMA 4Q1CA 4RHXA 5IJ0A 5K0BA 2GK7A 3KE9A 3FHCB 3G79A 2ODAA 2MYPA 4MAMA 1ACMA 3BA6A 3FSGD 5BQOA 4YY3B 4U02A 1G5PA 2VPXA 1LJUA 2VT7A 4KJXA 3SE0A 2WIFA 1QF6A 2C4VA 4UJ5A 3O4JA 3QA3E 5H4HA 2ZI3A 3VPDA 2BAGA 3H6GA 3B3FA 3LLUA 2OSBA 5JSKA 2WHEA 1MKYA 4R1UA 1SQFA 1Z4QA 4RMIA 1VBFA 2A9RA 1KI9A 2IZ5A 4I4CA 3DOOA 2DUUA 4EQ6A 2RGXA 3AY3A 3UAYA 4HNRA 5L40A 2O3QA 5G1PA 4QDJA 1WB6A 1EZZA 3KUCA 4HB3A 4C4OA 1D2GA 3OCUA 2NYRA 3R0JA 4OD0A 1IHXA 4KWIA 4KG7A 1JHOA 4KO4S 5C7OO 2LKCA 4P4LA 2ZIUB 1SCKA 4FJ2A 4OXXA 1HNZB 3OJCA 3QPBA 3WWDA 2AC7A 3DAHA 1CKEA 1SVKA 2Q8NA 1VFNA 2Z9DA 1HNXB 3BMOA 3TOCA 2F4VB 1I2BA 4BLUA 3EIHA 2OHGA 2RGWA 3M6MD 4RZQA 4X24A 5DTRA 5K8VA 4ALMA 4FNOA 3G1UA 2FDCA 4XKJA 3NP9A 2BF7A 4Q01A 1E7RA 2VTEA 4OHYA 5EA2A 1GPWB 1V3TA 4UHJA 3PCXA 5AJHA 4JUCA 3NEAA 3FPKA 1Y4DE 4HLUC 1QGYA 2X0NA 1ZP6A 1JB1A 3OIDA 2WIJA 2PKYX 3N2NA 5EJIA 3HJUA 1IK6A 3GD5A 4KO1S 4O2AA 1PR3A 2P6PA 4UEKA 4DMGA 4ZI7B 2WSIA 1PW7A 1C9NA 1LSOA 4UAGA 1OI3A 4GBED 4M89A 4KYTA 1R8QA 1DELA 1I8TA 3I9V1 4MLCA 3HVJA 3WNVA 1ORTA 2FWNA 1HX7A 4H9GA 1HI9A 2OV3A 1M1UA 2R2GA 3AUAA 4O59O 4WKNA 4UJ3A 4CIVA 5CR9A 1GEGA 2QP3A 4OK5A 4R1LA 1Y3IA 4Z1MA 3FOZA 1NYQA 1RT9A 1JDJA 2F62A 3CJRA 5AKKA 1L5LA 4DV3B 2WFLA 4MHSA 2I6GA 4QQ8A 1ZCBA 1NBWB 2L0XA 2Z9BA 1HF3A 3DS8A 3HO8A 1VBMA 3KTAA 3P2OA 4P2GA 2XZDA 5HKOA 4NYMR 3I0ZA 4CEJA 1XRPA 5J58A 3BXZA 3FPSA 2NXEA 2DGDA 2FKNA 3TSWA 4KOEC 4E3ZA 3NKLA 1NWCA 1WPGA 3AB7A 1WETA 1OC4A 2GRUA 3NYQA 3OEED 4ME6A 3SXUA 4TMYA 3L7LA 1HRKA 4AXXA 2DSTA 2QN3A 4C0SA 1SEPA 4BO1A 1UFOA 2E55A 3KOYA 3COYA 3NX4A 2OV4A 1FUUA 3WLQA 3JALA 4YROA 4WKBA 2YVKA 4ALKA 4QGSA 3BJEA 4HDMA 5TRTA 2PE5A 4M1ZA 4WUTA 3AR9A 3WB2A 5DOZA 2AOTA 3DB1A 4BQQA 2J0QA 1CVRA 4L6CA 3SFTA 3PGA1 4GL2A 5LOVB 4N9QA 1XZPA 1DU4A 3V34A 1XD2A 2X8WA 1Y1PA 2Y4OA 3Q3CA 1ABEA 1EUDB 4L02A 4TWIA 3GCGA 4UMFA 3C5CA 2AG5A 3GYGA 1N3YA 1VPDA 3BKXA 1NT2A 1ZYUA 5F12A 4AG3A 1WKCA 1V47A 2HEGA 3H6KA 3MRTA 4ZPJA 3UMVA 5BURA 3EVAA 2WDZA 2H54A 3Q11A 4NBUA 2O2HA 1QV6A 2VPIA 3RS2A 4YK7A 1OXKB 1K0UA 3CCCA 1Y7TA 3DL4A 1NYTA 2AZTA 2X7HA 3FPCA 4J4BA 4N54A 5SY4A 2EQBA 2FMFA 1JLHA 2XGOA 4XVRA 2VUTA 1TD1A 4LKRA 4QTXA 5EHGA 3P97A 2HO5A 4RENA 2CVHA 3B85A 2OCBA 5JYBA 4P2BA 2VRCA 3JVUA 1MG0A 2CXTA 4LXIA 4G0MA 1MMFB 2CJFA 1STOA 3EASA 3WHPA 2MSNA 2C2KA 5JCPA 4TXJA 2Z3WA 3M6AA 1JKJA 3CA8A 5JJ5A 2DFLA 4RSMA 2FEAA 2GNPA 4TN1A 1MVLA 2OYCA 4B7UA 5E9JA 3D4PA 5KOJA 4PHCA 2IYWA 1LCIA 2IHVA 3GL9A 3EUFA 3HFSA 2R85A 5DGTA 1A9XA 1NF9A 1RQLA 1W581 2QTZA 4WNCA 3G2JA 3LC0A 3PV0A 4NZZA 4B47A 1Y9AA 1RIIA 2PO5A 2ZYIA 4DDHA 5JXGA 4NNOA 5DYGA 2PZLA 1XU4A 5DASA 2I2AA 4X8LA 3TTTA 1RWOA 2FK8A 2ZQYA 4ZOLA 4F3YA 1HDZA 4M60A 4ZRMA 5T3UA 1HO3A 3EH2A 2ZK7A 1XVUA 1KDZA 1JG6A 3L92A 2C2ZA 1ICIA 1R8XA 1KI6A 2LUOA 3IT3A 5K51A 4ZYUA 4UTNA 1C9KA 3LBFA 4NU0A 2H2FA 1P80A 4UHFA 2BMDA 4TQAA 3HWSA 1I4OA 1F8FA 4OTZA 3CRVA 2VXOA 2O5VA 4DQDA 5LJIA 3W7BA 4MUXA 2VYCA 2O8EB 1C4KA 4GMHA 2JLXA 1EVKA 4OL0A 3WK4A 2JGEA 1OW3B 3KPUA 3TQSA 2ZJ1A 4KPUA 3P9PA 2CGEA 4A23A 4CIXA 3ESZA 3HDHA 4BNVA 3PNLA 2V3WA 4I4TB 4MV9A 1KIAA 1QVRA 2YKGA 1U94A 4ZJZA 3WBFA 3OX1A 3EVNA 3GLQA 2EL9A 4GXNA 4W5TA 1QS0A 4X6UA 1X1AA 1RWNA 2ZE8A 5I8WA 2LR0A 5LXTA 4S1NA 1NXSA 1RYMA 2QDXA 3LUJA 3NGXA 5ALFA 3VO1A 5F9HA 4QARA 2BR5A 3SOZA 4GUAA 5BQ5A 4X20B 2BJHA 2OENG 4PC2A 2BKVA 5MGBA 3OZGA 4H0CA 3EHEA 3Q40A 4IAOA 4MQLA 4MV0A 2NPFA 2ZYSA 5IASA 3U61B 1YZYA 3OTGA 2JCSA 5ALTA 4E5MA 4AYTA 2WF6A 4GSYA 3RVKA 4HN4B 3X2FA 3PQ2A 4KFSA 3O03A 4XEHA 4AKTA 4XLTA 3BXFA 1DRUA 4YRIA 1G21B 4IO0A 2I3BA 2IEBA 1T5DX 3FHLA 4XGRA 5BW8A 4PR0A 4UOEA 2YMQA 5CD9A 4HDSB 1II0A 2CMDA 2BHTA 3P9IA 5EWLB 3OOEA 5HKKA 1P44A 1PS8A 3Q4GA 4TQ9A 4D6YA 821PA 5C8DA 3AKCA 1ODFA 2Q1TA 2W2MA 4EHJA 2FZ4A 2V74B 4J2HA 1TAUA 1C8VB 4IDBA 4RUKA 3RVJA 3TLCA 2JJMA 2OFXA 1ILEA 2WQ6A 3JQGA 4LXUA 2FETA 4UM9B 1CPYA 1UDRA 3BWYA 3D3WA 4RKFA 4B6GA 4RTPA 2IOQA 5UKDA 1SOVA 1P72A 4DM4A 1MNQA 1QMPA 3WRWA 3GDWA 4UPEA 1CJKC 5E8JA 3NIDB 4ZXPA 5IK2A 4D9FA 3TKLA 5CDHA 1X14A 3NATA 2I8AA 5EESA 2BGKA 1XIVA 1JA9A 1W85B 5DP2A 5KKAA 1GVNB 1T4CB 3DMDA 4C6RA 2O05A 1RJFA 3OCXA 1E79A 2FFQA 2HADA 3BBPA 5KHAA 4D02A 1CUAA 1P8JA 1QFYA 3VVLA 2DBZA 2VP4A 1HGXA 4HJRA 4R6XA 6AT1A 4FXPA 4R2MA 4UASA 3A05A 4W6ZA 3ZGZA 5EZ6B 1WSDA 1Z0AA 2XYHA 5T67A 3S55A 4E7OA 2AOXA 4BLPA 3TX6A 5IC5A 4KBYA 5IANA 1KYWA 3ONDA 3CX4A 1B73A 3A9WA 1JMKC 4BU1A 1H6CA 1PWYE 4KPYA 4ZEXA 4YV2A 3JWEA 3NB0A 4JLDA 1MGOA 1XE3A 1QHEA 3HI4A 2IZ6A 4M7RA 1IY9A 2IH4A 1UDAA 4P4UA 1T3GA 1U0BB 2ZJ0A 3LVQE 2J87A 5J59A 1TD9A 1Q14A 2H1SA 4B3FX 3RYCA 4HUQB 5JATA 2W42A 4BFXA 4YCLA 3H9QA 3QU7A 3QVLA 1XCJA 3LTNC 2P9TA 4NTZA 1U31A 1I14A 1T3TA 4M8LA 5ARCA 5BN4B 2XRMA 1R0BA 2DPXA 2OL4A 3PHIA 3PI6A 5EMMA 3T4EA 3NVKI 1B7GO 1E3JA 4LXYA 4D8XA 1JEQB 5DWQA 3WMXA 1MIHA 1RLMA 2VKQA 4OYHA 4UMDA 3LNCA 1P2UA 4NZYA 5JSYA 5GP1A 1QRUA 4O2BF 4ZYLA 2OG1A 4MPPA 2J85A 5TGZA 4L4YA 5EWJA 3LFHA 3ZCXA 2JAWA 1G66A 4DILA 2OXEA 3VUFA 4AYWA 3HDVA 5FTWA 3V4OA 3WNQA 2GQ0A 3BHJA 4XIIA 5JRDS 4R7TA 1CUWA 5K5EA 3H75A 1D7OA 2AL7A 2DBYA 2WE8A 4ZMRA 1EIWA 4POAA 1QX4A 1WOYA 1A2OA 4Z4QA 3ILXA 4L8VA 2GLXA 4PWZA 1NX6A 3C3XA 5TNXA 1B8OA 1Q1AA 2AF4C 3HYSA 4WK6A 3FM9A 3NRJA 4TLEA 4UARA 3D1JA 5T4HA 1ILWA 1QC5B 4UPDA 1B8VA 5J2TF 3D8SA 3IQGX 2CB9A 5C52B 5G2OA 3D6JA 1E5XA 1U2SA 2QYTA 3NS7A 3BC1A 3EE6A 2RK3A 3D6UA 4YPFA 3TCKA 5JMWA 5LMNB 3D6AA 4UQPA 5CFLA 1WP4A 4IS3A 4XFKA 4R7GA 4G0UA 3OM0A 5JJBA 2IP2A 2WIGA 3PGVA 3QFSA 4OKNA 3T7SA 1O0CA 1EXDA 4Q9AA 5A3RA 3Q9NA 5BPHA 1G8YA 3M8KA 5KINB 1FVFA 3B9BA 3FAZA 1J0CA 3A4TA 3U0VA 2IYTA 1NG9A 1PZHA 5D85A 4XB1A 4AS3A 2JG3A 1PQUA 2A1TS 2VYFA 1O1YA 4M1TA 4RK4A 1SUSA 2G82A 3H9CA 3N0TA 4I08A 1REQA 3T95A 2FUNB 5EJFA 2Q99A 3W2EA 3WWYA 4B46A 1RPTA 2C2BA 3PEEA 3MJHA 1BVYF 4MS1B 4MWEA 4ZA2A 3RVBA 3ICPA 3R3YA 5C31A 3MINA 3TLEA 2Y71A 5EP2A 1O57A 2RKWA 1P5RA 2FSIA 3HDQA 3K4QA 4KXWA 3BFJA 4UQLA 1PJAA 2ZREA 1QYVA 2JS7A 3AEQB 3RYIB 4YA6A 5CH3A 4E2XA 3G5LA 1VGVA 4ZEOA 4QGHA 1U0HC 1WXHA 2EKPA 3T1OA 5L4LA 3OH8A 1I4TD 3DHWC 1V8ZA 2VQSA 4PZPA 3N8GA 3E3OA 2KBFA 3RSSA 3LQRA 5L51A 3OETA 4OFXA 2GTIA 4TOIA 3TGWA 3MYRA 2FFBA 4GS5A 3R6TA 4LC9A 1JR4A 5FULA 2QUAA 3TLKA 3LUPA 4YFVA 1A2QA 5EGSA 2D2EA 1ADGA 4QWMA 2WM8A 2WV7A 3CLUD 1D1SA 1ECGA 3PHLA 3IR7A 3ZW8A 3FMFA 4CG1A 4CN9A 2J46A 2C5FA 4PIPA 3LPLA 3GWZA 4IQFA 4NARA 4JS0A 2YYAA 3RU2A 3I92A 4EFKA 5KX5B 3CN9A 5L3ZA 5FH9A 3KWFA 2DOKA 3NJRA 5DMXA 1L4MA 4QJ3A 4X66B 3ETHA 3DTVB 4FFDA 4A1OA 1FZTA 1KH2A 4MR7B 3SMQA 4D4HA 1PGJA 4H7EA 3D4OA 4X85A 2OCLA 1Z5PA 3D7SA 3B13B 1GITA 3CE6A 3EGDB 3V46A 1UBGA 3E15A 5B3JC 1YBFA 4N8SA 1CY0A 1Q12A 4FCTA 1JQJC 2HBRA 1FK8A 2F4NA 2X5NA 4TTJA 2J6BA 5AM4A 3WRVA 4BB9A 4N76A 4BNFA 4QQRA 5JMPA 4M1MA 4DLLA 4GOKA 1CQWA 4B7CA 1ZS9A 2LTAA 2EYQA 4NYIQ 2F55A 2FE4A 4Q1DA 2P4SA 4OGKA 1P0QA 4JXJA 4XE5A 4IIDA 2YN2A 4PSUA 2CLDX 1OBOA 4OU4A 3ZWNA 3CLRD 1ABBA 1SA0A 1EYZA 2N1MA 4MQFB 2A35A 1MFZA 4TMFA 3TW4A 3ZWOA 4C7VA 1GCUA 2V7XA 1L7MA 5BRJA 1L5ZA 3O2QB 1NZFA 2YY5A 3FPLA 4II2A 5I7EA 2JIRA 3WLTA 1L4GA 1VSBA 1AS3A 4R2WA 3AV0B 5TPWB 3TZKA 4L22A 4BJ5A 3BGSA 4ND2A 4Z2AA 4BLQA 3O4RA 3QQPA 4FLEA 4XJTA 1R12A 3H4MA 2Q5FA 3OE4A 2OCPA 3GK3A 4M0LA 2XZTA 4ZFNA 4LXTA 4B45A 4EI9A 1OLUA 3TD6A 3EQZA 1HFKA 1ZN2A 2CXXA 2G04A 1XZEA 1LJ8A 2VOJA 1PJ2A 2FPGA 3SHVA 3U4QA 1PR9A 1L1RA 2CBXA 3T7DA 4L57A 3D6HA 3HG7A 3RIMA 5E7JA 3W2IA 5K6AC 5AHKA 1TKRA 4FZ3A 1GQFA 4M0DA 4R9SA 5BN3A 1OE0A 5MN5A 1QHHB 4HMOA 4M7PA 1I9GA 2LXNA 1KEEB 1JFLA 1GAWA 1ULHA 4TWZA 3R7WA 4G0VA 4OI1A 2F9LA 2WYVA 2ZRBA 1N2JA 1BX1A 4DHEA 2RSLA 4CCAA 2OB1A 2W8BB 4ENPA 2BLLA 4BWFB 4DSNA 3BX1A 3GLGE 1G4HA 2VXCA 2VNJA 3QELA 1K5PA 1E2KA 2ZZKA 3W78A 2WAAA 2XDQB 5JEEA 5I8ZA 5JTUA 3WP1B 1ZD8A 2WPDD 3KCQA 2YS6A 2QIPA 3JQBC 3C7CB 4HOYA 1HM5A 4OYRA 4X7MA 4KI7A 3UGTA 3VHQA 1T8RA 2OK7A 4QODA 4I50F 1QQAA 3VYTB 4LRXA 4M76B 3JQ9A 3QVSA 4ER5A 4YV1A 1H2ZA 1DEHA 2FN7A 3CRZA 2WU1A 5CFPA 1ANKA 1KEZA 2HBQA 2XB6A 4XX0A 1R8SA 2AOVA 2Q8PA 3L7MA 4XWGA 2VH2A 2YIJA 5IH3A 4HVCA 3G17A 5KYWA 2OZLB 4Z53A 4TLBA 1I7LA 2Z8ZA 1JT2A 4KMRA 2QUZA 5TF4A 1I36A 1V2GA 3CNEA 1WF6A 3OZFA 3S0JA 5AM2A 2BGUA 1LLUA 4PHTA 3U7QB 3UV3A 4IXMA 3V8MA 5JAIA