3FCOA

Crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with benzamide inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
269
structure length
267
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of novel di-substituted cyclohexylbenzamide derivatives as potent 11 beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 103
structure length 267
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3fcoA00
2OUIA 4BO9A 1Z73A 3PIDA 2UUPA 4J2OA 3HSKA 4IMRA 1O94A 2QIOA 1MP0A 2EWMA 3ENNA 4PVDA 4ZU3A 5AXAA 3RFTA 3CKYA 2W98A 4F45A 4O6VA 4D0SA 4F46A 3WGIA 5ICMA 3IP3A 5JAQA 3AI3A 5HBRA 4W7HA 4J6FA 5GZ1A 4MVJP 1JQBA 3GGOA 2O4CA 3TZQA 5CFZA 5H82A 5ADHA 3ZWYA 4LVCA 1A72A 3E8XA 1A71A 2NVWA 4LRSB 3FD8A 3G1UA 5HM8A 1CWUA 3Q2IA 3QQPA 4IGFA 2HQ1A 2O3RA 1OBFO 2WE8A 3VVCA 3MWDB 2QYSA 2VWPA 3MZ0A 4BKRA 3ROKA 3NTRA 2WEKA 3AM4A 4UULA 5KKAA 1DHTA 1GCUA 1ML3A 1T26A 1DLIA 3NUGA 1H9AA 2VHWA 3GEDA 3EGOA 3DBVO 1NAIA 5JDCC 3DQPA 2PZLA 3GZNB 1GEEA 2CVOA 2PK3A 2ZIZA 2HRZA 4XD2A 4C7KA 4FCCA 4ALMA 3NYWA 1M2WA 3QWAA 3SX2A 5A4DA 4BB5A 1ADGA 4WE3A 2OMEA 5LDHA 3W1VA 4ZQEA 4XGNA 1PGPA 2X8LA 1HEUA 3KZVA 1PIWA 3H7AA 3JD2A 5B37A 3UCXA 2CY0A 3OETA 2C5AA 1XQ1A 3DZBA 4J16A 5JSFA 1HTBA 3GAZA 4PLTA 4AJPA 4BO0A 8ADHA 4XGIA 3CZMA 4BO8A 1TEHA 2E49A 2OL4A 4LGVA 1WW8A 5C7IO 3UH1A 3HADA 3RQSA 2R6JA 3WSVA 3D0OA 5JBIA 2VNAA 2DBZA 1NASA 2W2KA 3BMOA 4NJOA 4D3FA 1ENPA 3EHEA 3H9GA 3UVEA 3WGHA 4RVSA 3GFBA 4FFOA 2BELA 3MOGA 3S2EA 1WDLA 3SC4A 3T7EA 3WQQA 3PQDA 1AN9A 5FFFA 3W4IA 4BNUA 3WICA 4YB8A 3MCVA 3BHIA 4CM1A 4DLBA 4XQEA 5FEUA 4OJNA 3GHYA 3PIIA 4KZPA 5F1PA 1UXGA 3KM0A 5IAAA 3R6DA 3FR8A 1D3AA 3GDFA 4LSMA 4CLXA 4CMEA 5BSEA 3T4EA 1NTOA 5L40A 3VZPA 2PTGA 2B69A 2IRWA 3P19A 1L7EA 4R01A 2HDHA 1XU7A 4CM6A 2W2LD 3LC1O 4ZQHA 2AHRA 4ZD6A 3H5AA 1R12A 2C7VA 5TRTA 2GASA 2EKQA 3RUFA 1A9YA 1UDCA 1YL5A 5JDIA 2PH5A 4YJFB 3RI3A 2EGHA 1D7OA 4MDHA 3DEYX 4LN1A 2C59A 3E48A 4YJGA 2VCYA 1IOLA 2JCXA 2HSDA 2JL1A 3AUTA 4U6QA 3Q3CA 4CLOB 3MJCA 5JY1A 3GF4A 4AJ1A 4K28A 1E3LA 4R68A 4KDFA 3OBBA 4HUJA 4MIOA 4J90A 2W4QA 1OFGA 1PJTA 1SBYA 4R3NA 1XHLA 2OO5A 1U4SA 4CM8A 2P9GA 3JQBA 3K2EA 3O9ZA 1JN0A 1R15A 5JFOA 3M2TA 1N5DA 1QV7A 1R0KA 2Y66A 1NX6A 2BHLA 4NK4A 1V35A 3CTMA 3WGQA 3HFSA 1CQIA 5FF9A 2O3SA 3GVXA 1ZXBA 1TT7A 4U5QA 1QG6A 3GC6A 2G17A 3KRTA 2IZ0A 1I10A 1PL8A 1YKFA 1JA9A 1P44A 5T8KC 1ONPA 5LCXA 1N92A 2HO5A 3WQRA 5B1YA 1H6DA 3VH2A 3FSRA 3DFZA 2A9FA 4PG6A 2NADA 3VKUA 1F14A 1DXYA 1FDVA 4WCFB 3H3JA 3I6IA 4BL5A 4C4OA 4QX6A 2OBNA 4DIBA 1GQQA 2JAPA 4Y98A 1E7WA 1AGNA 3OM9A 1ZMOA 2X86A 3OIFA 3OHSX 4G5HA 1M75A 3CE6A 3DAPA 5JCJA 2EKLA 2GO1A 2I66A 4MKXA 3P5SA 3UF0A 2D4AA 5L3ZA 2YY7A 1XGKA 4MKRA 3ZHBA 3ZW9A 5CP8A 4BNNA 4UVIA 1O6ZA 5I7FA 1ZSYA 1MFPA 1M66A 1OZAA 4IQ0A 2B37A 4E5PA 1HRDA 1LSSA 2Q1SA 3KSUA 3R3JA 5L95A 1TB4A 4XX0A 4HY3A 3MJTA 3ONDA 5U1PA 4O1MA 1KEPA 1UXIA 1UXKA 1DO8A 1OOEA 1ZFNA 5TJ9A 3IUPA 3E5MA 5DP2A 4PG8A 2F1KA 3AFMA 1T2FA 2D5CA 2QZZA 4YJGB 1ARZA 4TRJA 4UEOA 3VPGA 4ALLA 1GZ3A 1H6AA 3H5RA 3PDUA 1E3WA 4J1QA 2O4UX 1NFFA 4B8WA 1UDBA 5JO9A 4I1IA 4EEXA 4YJHA 3GG2A 4OOFA 3NEPX 3OJLA 4NPCA 4BIIA 1UXHA 3JQEA 3F47A 1LBEA 4A27A 1Y5RA 1Q7BA 3VZRA 4Q3NA 3I83A 4CM4B 1EUCA 3DZKA 4OIMA 4F3YA 1N8KA 2Q49A 1X7GA 3RC9A 4WPGA 4CMAA 1SZJG 4XKJA 2PD3A 3HNPA 1E6EA 4M49A 2JFHA 3AJRA 1DC4A 1HZZA 3GMSA 1YRLA 3F5SA 4IGEA 1BVUA 1F0YA 4TWRA 3JD1A 4OO3A 3PXXA 3H5NA 4IJUA 4YAEA 1B8UA 4R16A 2C20A 4FD3A 3SXPA 1LQUA 1G0OA 4PRKA 1XELA 4KMSA 4BO1A 3WGZA 3FF4A 3WBFA 3ZN2A 1ORRA 3L4BA 2B36A 5I8ZA 5EINA 2W2LA 3LT1A 1Z7BA 4K6CA 3DAFA 4WLOA 4B7UA 2YZ7A 5KTKA 1LSOA 1UAGA 2DU8A 4XEHA 3SEFA 3DXFA 1ENOA 2P68A 1UJMA 3WWZA 4E13A 5TNXA 4FB5A 1ZZEA 2W2KB 1P0FA 1RM5A 2GZ3A 3QE3A 4J9VA 4ZICA 1NXQA 4JLWA 4KUHA 4I9NA 2CD9A 2BMAA 4R1TA 3D5TA 1A4IA 2Q4EA 3ANNA 4XYLA 1HYGA 2XOXA 3UGKA 1UZMA 2EHDA 4E2YA 4XGKA 4ZVVA 2DUUA 3TZ6A 4RV9A 3GEMA 3CUKA 4FDAA 3LF1A 1T1SA 1V3TA 3G3EA 3CXRA 2Y05A 4Z6KA 1MLDA 2X1HA 3VTZA 4E2WA 4XZ3A 3PZBA 1YO6A 4BNIA 3F6YA 1KERA 2Y1FA 3LZ6A 4M8SA 3Q6IA 4MVJA 5ES3A 4LVUA 3GRKA 5KWEA 3F5QA 3BMOB 3ZWAA 1HKUA 2FOIA 3QHAA 1SOWA 2IZZA 4YQZA 4QQRA 4XRGA 1E3JA 3EVTA 4CQLB 2DVMA 5JC8A 1HYHA 1R66A 5ILGA 4CMBA 5FYDA 5DBGA 4B4OA 4LK3A 2B5WA 2I3GA 3U0BA 1WAMA 3S2GA 4K6FA 5A3JA 3ZWNA 4FOOA 2Y67A 1DIBA 3OJ0A 4RJTA 4WCDA 2PGJA 2FSVA 1PJ3A 3LLVA 4YAIA 1LA2A 1E3IA 3ZNOA 2DM6A 2BFOA 5IFLA 4RF3A 2PR2A 2Q1UA 3OEWA 2JD2A 3PJFA 1O89A 4P38A 4R3WA 4ND4A 2ZB3A 4CMEC 1BTOA 1LRKA 3W8EA 5A03A 3L9XA 4MVJE 3TWOA 1I0ZA 1FK8A 3L07A 3I4FA 1LNQA 1PX0A 2ZKLA 4IS3A 3K8ZA 1HE2A 1X1TA 2BFPA 3DB2A 1PJ4A 1OC2A 2H6EA 4MPDA 1LLDA 2QG4A 4A26A 1LRJA 2EV9A 1RWBA 1DJNA 1QP8A 2VNSA 3K5PA 3GPDG 2WDZA 4BGIA 1I3KA 1RPNA 1Y81A 3TDKA 2FZWA 3DTTA 3VPXA 1A9ZA 4JBIA 4I08A 1DAOA 4TRNA 3KTDA 1YGYA 1T2DA 3FTNA 5KJEA 2HLPA 1EVIA 1WLYA 3G0OA 3OJFA 5HWSA 1NQ5A 4C7JA 4G81A 4CUZA 2VHYA 3UHAA 1QR6A 2JD0A 1ULUA 5A9RA 1TT5A 2C5EA 2BH9A 1EBFA 5BSHA 2VTDA 4TZKA 1WWKA 4RVFA 1PSDA 3JQ9C 2WYVA 5JMPA 3S55A 2E48A 4YR9A 1LDNA 1NVMB 4RVDA 3GNQA 1NPYA 2HMSA 2X9VA 4NJMB 4RO0A 4XQGA 4GKVA 3ST7A 1Z7EA 3JTMA 4BKQA 3WYEA 4BNWA 5C7LO 1X0VA 1VI2A 2G5CA 3IUSA 1LEHA 4JX8A 1JKFA 4MVJD 4Y6SA 5L7WA 3EZYA 4JP3A 5BSGA 1D8AA 3G49A 5I7SA 1IB6A 4YRBA 5DDIP 1JWBB 2ZB8A 1NPTO 2YJZA 2ZYAA 4IQ8A 4CMHA 2Y0CA 3UOGA 3ITKA 3O8QB 3IAHA 1HETA 4BV8A 3U4IA 1DRVA 9LDTA 2Y68A 3INGA 2YDYA 3ONEA 3HDQA 3EYWA 3ZU3A 2FP4A 4M87A 3GH3A 3H8VA 3PWKA 3VKVA 5KKCA 5BR7A 3FR7A 3I9MA 3AUSA 3WNVA 1QYVA 1K6JA 4J9UE 1C1DA 1RM3A 3ZWBA 4FN4A 2I99A 1FDUA 1QYWA 4NBUA 3EY4A 5EESA 5F5LA 2I9PA 1E5QA 2HRBA 1JDJA 5CEJA 3OMLA 3WSWA 5AQ1A 1C1XA 2B5VA 4HV4A 1I3MA 1DLJA 3NT2A 3Q11A 4R4JA 4BNMA 3QVWA 2FR0A 1SOVA 4DXHA 3KETA 3LQFA 5TJHA 1LUAA 5ICSA 2FPGA 3OA2A 4YJHB 5FI5A 4A7PA 2HKIA 3S2IA 1OAAA 4RLHA 4OQZA 1ZK2A 3A9WA 2ZB7A 1FDTA 4F6LA 1WDMA 3O38A 1JTVA 1BRMA 5U9CA 1RYDA 5DNAA 3CEAA 3RD5A 1PJ2A 2HJSA 3ANMA 3IDSA 5JC1A 2OZPA 1YQXA 2BLLA 1ZKMA 2D1YA 2RH4A 4JN6B 1H94A 1Y9EA 5CDGA 2ZYGA 1K6XA 1VE9A 2JFFA 2BKAA 1SMKA 1E7QA 3RU9A 2J6IA 1M67A 2Q2VA 5DCWA 2Q46A 4CV1A 6ADHA 3PHGA 5BNIA 3KOUA 3PZRA 4U7WA 4OHUA 2X7HA 4Q3DA 1IUKA 2FPPA 1PZFA 1QKIA 3DL2A 1QV6A 1LDBA 4DLAA 4EEZA 4II3A 3K6JA 2B4RO 4KWHA 4Q9NA 5JDIC 3VOSA 4D45A 4B4WA 4YT2A 4ZQGA 2NUAA 4Z9YA 2TMDA 1QYCA 3K73O 3PDJA 3W4KA 4HKTA 4S1VA 1HLPA 4BNKA 5A04A 1SCUA 2AQKA 3H9QA 1NHWA 3OQ6A 4UAGA 1Z45A 3PP8A 5CPFA 4OSPA 2Y0DA 1GTMA 4KUEA 3TF5A 4BB6A 2C7GA 5KJ6A 2J3IA 2H9IA 4KUGA 1CEQA 3QIVA 4J4HA 4IDGA 1HSZA 4AICA 5B4UA 1MXFA 5C37A 3AK4A 2J3KA 3VHRA 1VJ1A 1WVGA 3FHLA 1U1IA 4CUJA 3D3WA 2JJYA 4NJMA 5LC1A 1BDBA 1HDGO 3CZRA 2PZMA 1ZH8A 2X0NA 5HS6A 2IDZA 1GEGA 5A3VA 1UP4A 2EG9A 4RVUA 4EGFA 4YPOA 4QT0A 2V65A 5BQFA 1L1FA 4A10A 3WLEA 1HSOA 2FRDA 4FJ2A 5IN4A 2BFMA 3ZNNA 1ISMA 2EW8A 1WMAA 1MV8A 1EMDA 2VRCA 4IDFA 4BMSA 1GQ2A 1ZK3A 4GMFA 3PWZA 3A4VA 1ZNQO 2IEDA 4OGWA 3AUAA 3ZH2A 1H0KA 2YDXA 1K3TA 3ZWMA 4PLHA 1EE2A 4WASA 3JQDA 2AEMA 2C29D 3EVNA 4OOEA 3FCOA 3V1YA 2DLDA 4WGGA 3LU1A 3QVOA 3FI9A 3WB9A 1P1IA 5DOVA 2VHXA 2VUTA 5AYVA 2D59A 3QWIA 3IJRA 4EBFA 4CM3A 3ABIA 1MC4A 3L4SO 1BXKA 2ZTVA 3OH8A 3HWRA 1K6IA 2B0JA 4FSHA 3AOGA 1BMDA 4JBHA 1VJ0A 2QW8A 2NVBA 2VRCD 2DFDA 2UYYA 1PJLA 3NJ8A 2WTBA 3RROA 4URFA 4JJFA 1ADCA 4N18A 1LC0A 1T1RA 4EDFA 4LCJA 3F9IA 1ZEJA 4L9RA 3WTCA 2WD8A 2WYWA 3TQHA 3C1OA 4A73A 5IXYA 1X7DA 1XU9A 1A7KA 4OYRA 4FJ0A 4GKBA 4AFNA 5A5FA 1AUPA 2VTEA 3UCFA 1GV1A 4CM8B 1XLTA 4L76A 3OICA 3KYCB 4A03A 2JCVA 4A0SA 4ILKA 4RPJA 3U9LA 3R3SA 2BI7A 1NAHA 1YL7A 2G76A 1ISGA 1WP4A 4J7XA 4NHEA 3JV7A 4HFJA 4PLFA 3WJ7A 5COBA 2DQ4A 3BA1A 3D5QA 1JVBA 3AM3A 3BMNA 4FFMA 1H9BA 1E1NA 5CHEA 5H81A 2V6BA 3WG9A 4O59O 1Z74A 3LF2A 3GUCA 2J5KA 1VJTA 5K0ZA 3L77A 4TROA 5ENVA 3WTBA 5TC4A 4DA9A 1ZJYA 1V8BA 3UAGA 3BAZA 3JD0A 4H16A 5FI3A 2X0IA 2UAGA 4ZJUA 5TS3A 3GAFA 2VWHA 1MFZA 5IN5A 3UCEA 1NQTA 1H93A 1U7HA 4U0JA 3ROQA 3V1UA 3BTOA 3BMQA 4U6SA 4BNYA 1NWHA 1ZVMA 1C1XB 3NT5A 4IIUA 1J0XO 4TKMA 1PEDA 3SBOA 4BMVA 3GQVA 1TI7A 5HS4A 2DFVA 4BO5A 4Q3AA 2JHFA 3D7LA 1DSSG 5CPBA 5B12A 2FZEA 3GVHA 4BQRA 4I9HA 3DHEA 4DQXA 2C2YA 2HMTA 1YBVA 2VOEA 1P1FA 4RCVA 2V6FA 3DBHB 4XYEA 1F8GA 2O2YA 5I7VA 1B14A 3TRIA 3C1TA 2DBVO 4E31A 4WLFA 1PZHA 2GZ1A 1R4NB 3V8BA 3ETDA 3OA0A 5AXCA 1P1HA 4TKLA 5G2OA 1DC5A 4MINA 1ENZA 4DIFA 1NR7A 3JYPA 1ENYA 4I5GA 4IUYA 5JMWA 1GFSA 1KEVA 2CNBA 4R41A 4MIYA 3B70A 2WWRA 4E5KA 1G1AA 3VZQA 1U2DA 2BGLA 3NKLA 2WD7B 3Q0EA 1E7RA 3IKTA 1VC2A 4XR4A 4J7CA 5F1OA 4IPTA 2HUNA 1IYZA 1EQUA 4RDIA 2ZB4A 1NFQA 1HXHA 1F17A 3EZLA 3ZCXA 4L4RA 2Z1NA 1XCBA 1PU2A 1PR9A 2QRKA 1BSVA 5BNFA 3WQSB 4XQ9A 3GVCA 1CIVA 2POQX 1UDAA 1FF9A 3ZHYA 1C3VA 3D3EA 1GZ6A 3GK3A 1DHRA 3ZHXA 4IDAA 4BNVA 3HHPA 5K6AC 1YBAA 2AG5A 4QFDA 5G0TA 1PJBA 3PGJA 3DZJA 3PHJA 2AMFA 2HK7A 2OOSA 3C7AA 5JY6A 1SPXA 5LDGA 1MA0A 2HK9A 4GX5A 2NU9A 3RVDA 1R0SA 4IJWA 1KIFA 4E2ZA 1UR5A 5ITWA 2X9GA 4D41A 4E30A 3HDHA 1UP6A 3MJ4A 1BXGA 3L9WA 4RPHA 1Q2XA 2I3AA 3KO8A 4II2A 3HQ4O 4ND1A 3E18A 4CMCA 3HE3A 3CINA 3QY9A 5L7TA 3ZV4A 3E5RA 4BO4A 1QXSA 4E5YA 3QVSA 3SJUA 1NQOA 1VSVA 3GA0A 3BTVA 4TZTA 4FGWA 3I5MA 2BFAA 3KYDB 4WUVA 3ZV3A 3HDJA 4W9NC 4DPLA 4DQUA 3AU9A 1GR0A 4YXFA 2ZCVA 2BF7A 2BGMA 4I5FA 4IXTA 2C54A 4EYEA 4B79A 1K5HA 3T7CA 4ALIA 2V7PA 3OJOA 1P0CA 1SEPA 1T4DA 2C2XA 4BGEA 1I30A 5JAZA 4WOJA 1EQ2A 3LT4A 4FOSA 4DGSA 2CF6A 4WKGA 3W8DA 4CMKA 5IDYA 5IXSA 5DZSA 5A02A 1Y1PA 4E3ZA 4UVGA 1Y7TA 4X54A 3I9NA 3FTPA 4RF5A 1H6CA 3PTZA 4CQLA 3ORFA 1VKNA 4KQXA 3A28A 3DOCA 1CERA 3TZCA 4FC6A 3KSDO 3MJSA 1E1MA 4M55A 3GRPA 4E6PA 5I9LA 2IYPA 4XYMA 4O0LA 4JGBA 3U49A 3JYLA 5L7YA 1PQUA 5GZ3A 1O95A 3JQAA 3K96A 4J4TA 4LMPA 4I8XA 2IODA 2TMGA 3V1TC 3WJAA 4F6CA 2EGGA 3LT2A 1AE1A 1UH5A 2Y1GA 3BMQB 3PHHA 1XQ6A 1ZW1A 3VZSA 1HF3A 4GX1A 2VQ3A 1R4NA 4B3JA 3GN2A 5EL0A 3RKUA 3U4DA 3WIDA 4J2HA 5JAIA 3TL2A 2G0TA 3WS7A 3D64A 4PZDA 1GADO 4HX5A 3H65A 4BKPA 3LC7O 4NZ9A 3KBOA 1QLJA 3DONA 3CH6A 4IM7A 3RC7A 3VVBA 5DCUA 1DIHA 4EJMA 1TT5B 3JYOA 3GUYA 2PKRA 2X5OA 3H2SA 2OBYA 4QUKA 1KS9A 2AG8A 2PH3A 4CL3A 1PL6A 1HZJA 4FS3A 1E6WA 2WE7A 2DUWA 3LDHA 4PZCA 4IIVA 3IOYA 4G2NA 3ZDFA 2YW9A 4JIGA 3JQAD 3LSYA 3ZI0A 3H4VA 1YH3A 3PWSA 2PA3A 4DRYA 2HMVA 2P9EA 1MXHA 1Z75A 2O3JA 4IZIA 4FGSA 4YWJA 3AFNA 4ITUA 4M1QA 5KNLA 3JQ7B 4W9NA 2GSDA 3ICPA 3JQ9A 1K2WA 1E7YA 1T25A 5DN9A 1GL3A 2Q1WA 1PGQA 2QRJA 3NDRA 4IDEA 2Q50A 3UICA 3VC7A 3WYCA 3ZHZA 1CRWG 4NBWA 2H5LA 2GRAA 1BGVA 3HB5X 3NDJA 3UN1A 1P1JA 2NVUA 1B8PA 4FFRA 1TVEA 3RFXA 2XXJA 2RAFA 4BGVA 1YS4A 2C0CA 1U2GA 3ITDA 1MGOA 3FN4A 3TFQA 2WD7A 4LISA 4A2CA 5I9MA 5EIOA 2H63A 3KLPX 3AI1A 4QO8A 2PKQO 3ROMA 4CMJA 4RZHA 4XYBA 4AJEA 4GWGA 3JSAA 2ZATA 4D44A 4DTIA 3GN1A 4CQMB 1DC3A 3EC7A 4NU6A 4MP3A 4BOYA 2QHXA 2OHXA 2ZTLA 2VZ8A 5AXBA 3DBHA 4HXYA 3S8MA 2P4HX 1I36A 4RF4A 1I2BA 1KVRA 1SC6A 1S7CA 5JCXA 2Y99A 4NFSA 1GQYA 4J3FA 1GD1O 4DIOA 4K1LA 3W6ZA 2GYYA 4GSKA 2OP1A 5A9SA 1U5AA 3CSDA 3D4PA 3RUAA 1B0AA 1GUZA 2GN8A 8LDHA 5TF4A 3HFGA 1UUFA 2PZKA 3V5NA 4ND5A 3QRWA 1PWZA 1T2EA 9LDBA 1YL6A 2YFHA 2FWMX 1KBZA 1YWGO 1UXJA 3TPCA 2F00A 2I6TA 1G0NA 2X4GA 1EZ4A 3RKRA 3EW7A 2J3JA 1RM4A 3GNSA 4M54A 2XXBA 5H83A 4D7AA 3C1AA 3A06A 3OQBA 3DHYA 1DIAA 2X58A 4UUPA 2O3TA 3AI2A 1I2CA 1PGNA 3M1AA 2NTJA 1EFKA 3HDYA 5KVCA 1U3TA 1E7MA 2EJVA 4GH5A 4I9UA 3ZV5A 4BUCA 1YOVA 2YFQA 1GCOA 3WBBA 2Y1CA 3M1LA 3CMCO 2CUKA 1CDOA 1NFRA 4OQYA 1IULA 3GVPA 2GN6A 4GSLA 4UUMA 5L45A 3BTSA 1WZIA 1EK6A 3LYLA 1W4ZA 3GFGA 1MG5A 3GPIA 4DC1A 3SVTA 1E92A 2V6MA 3RJ5A 3IS3A 4JQCA 1Y8QA 2FMUA 1P74A 2X23A 1YJQA 3EAGA 4LRTB 5KVQA 3B20A 4TVBA 3Q2KA 3PLNA 1HDRA 1Y6JA 2PKQP 3H9UA 4Y9DA 3WNQA 5JYEA 1SEVA 1M6HA 1CETA 1Y8RB 1LXCA 5T57A 1WNTA 2Y1OA 4YJFA 4GLLA 3RUIA 1LJ8A 3TSCA 4Z9XA 1YE3A 4W82A 2BD0A 4L4SA 2VZ9A 4MIEA 3F4BA 1B3BA 2VHVA 2PFGA 2QZ9A 5F5NA 4XDZA 1YB4A 5AXDA 2Q3EA 4MVJF 4DPKA 2EP7A 3JQGB 1RKXA 2B4TO 1F8FA 3QLJA 2CVQA 4I5EA 4DREA 3GR6A 5IZCC 1CYDA 1FDWA 4MJLA 3HN2A 1H2BA 2Y0EA 3JQ7A 2NU8A 4DWVA 2SCUA 2QQ5A 1R16A 3I9KA 1LLQA 3DBRB 1T4BA 3R1IA 3ULKA 3ZWWA 3WDSA 4EW6A 4IMPA 2HCTA 3U4HA 1Z6ZA 4IZHA 2AEFA 2EIHA 3HB4X 2O48X 2YV2A 1RJWA 2EKPA 3W6UA 4XYGA 3TFOA 4HNGA 2OXIA 1ZK0A 1XA0A 2EEZA 5JDCA 2VZ0A 1GU7A 3DMYA 4MVJH 3PQFA 5F21A 5IG2A 3WFJA 4DUPA 1MX3A 3INRA 5KIAA 4N5LA 4RQUA 2AE2A 4ROSA 4Y6PA 3DOOA 1DJQA 5BNTA 2RCYA 5L4SA 2J5RA 3F46A 3FPLA 4ZRNA 5THKA 3QVXA 1ZMTA 3EUWA 3FPCA 4CUKA 6LDHA 4R54A 3U62A 3BMCA 3MWEB 1ONNA 2ZJ1A 3FNFA 1E1KA 4CQMD 3EDMA 4CV2A 1OMOA 3ZV6A 5I9NA 1XWFA 3PPIA 5L53A 4YRAA 3ZNPA 2VYNA 3O26A 1SO8A 3IC5A 3AU8A 3JQAB 4CLDA 3KEOA 2AQHA 3OIDA 1SB9A 4PGFA 1IPEA 1FXSA 1GUFA 2NQ8A 1ZK1A 5A1TA 2J3HA 2X6TA 1NR1A 3RSHA 2NVUB 1J5PA 1OI7A 4GX2A 3U5TA 2GZ2A 4UVHA 4WEOA 3TZKA 4OMUA 1C0KA 2WSBA 2DC1A 4BS9A 1YDWA 2BGKA 4XQCA 4BNHA 4EJ6A 4QTZA 1VRWA 3F1LA 3V2HA 2GDZA 1KEUA 3PLRA 1WXDA 1T2CA 3AY7A 3JQ6A 1PTJA 3VTFA 2FY8A 5I8WA 3K30A 3JQFA 4EUFA 1NVGA 4FFLA 4UVEA 2CZCA 4R9SA 1EEHA 1U5CA 2A94A 3PJEA 3NT4A 4GAEA 5EPOA 1N2SA 5L4LA 3DZFA 3FNHA 3COSA 4HFMA 1BG6A 1BW9B 3RAJA 1X7HA 1U9JA 3X2EA 2JAHA 4RPLA 1H6BA 2R00C 5K6AA 4R1UA 4E2XA 5DOZA 4GX0A 4BGUA 2GLXA 5ER9A 4PLYA 1P1RA 4Z0TA 4NQZA 1GV0A 3NRCA 5THQA 2Y1EA 7MDHA 3KVOA 3PGXA 5JLAA 5JXWA 3PYXA 4FQ8A 1E3SA 2EF1A 4WCFA 2PZJA 4DBVO 2CDBA 3E03A 4ZN6A 1PQWA 2G1UA 1CQJA 4ID9A 4WLNA 2JFGA 3ENKA 4P22A 4EUHA 4JROA 1BXGB 1GYRA 1YVEI 1O0SA 4INAA 4YVFA 3HJAA 3TOZA 4N7RA 1BDMA 4B3HA 5DP1A 1PJCA 1ADBA 3ZZNA 1HDXA 1Y9AA 4UVDA 3TOXA 5G0SA 3LC2O 2NWQA 2PD4A 4RF2A 1ADFA 4CMIB 1KC3A 1K0UA 4OKIA 1DRUA 1Q7GA 2CFCA 1W6UA 1I3LA 4LMRA 4CQMA 3OSUA 1Y5MA 1KETA 4DPMA 4U0KA 4P4NA 2DPGA 3R0IA 1D4FA 3CMMA 4O63O 1ZEMA 1ZSVA 4IY1A 5COQA 1E5LA 4NI5A 3A14A 3BTUA 4CLEA 3U3XA 3RUHA 3QP9A 2Z5LA 3H2ZA 3IMFA 3C8MA 1PJQA 2PY6A 1B15A 3FRJA 1WDKA 3VPSA 3K31A 4GLOA 3WLFA 4NIMA 5COAA 3PJGA 1P45A 1HDOA 4B4VA 4UEJA 1E3WB 2FSSA 4J0EA 4CM7A 5DT9A 1UZNA 1I8TA 2FN7A 4O5OA 3K2BA 5K9ZA 1X1EA 2LDXA 5ENDA 5CDUA 4HBGA 3GGGA 4FJ1A 4DLLA 3ZWOA 4H7PA 4FIZA 3O4RA 1GYQA 3GNTA 4GVLA 4DBZA 2C82A 4OXNA 2DPHA 2YHIA 3SC6A 2E82A 1JKIA 2RBEA 2HU2A 2JD1A 1Y8QB 1IHYA 3GOHA 2PD6A 1ZK4A 4IJVA 4H15A 4QSMA 3RC1A 4J0FA 4JK3A 4NH4A 5G0VA 4E12A 5T67A 1X15A 1JVSA 4OKNA 1V0JA 1GYPA 2A4KA 4PLZA 5DBIA 3H9EO 4D79A 4KQWA 4CR7A 1N1GA 3NJ4A 4LSWA 2PGDA 1JU9A 4WCFC 2CMDA 5ER6A 1IL0A 4J1NA 1KOLA 5I7EA 3VPHA 3CIFA 3RUEA 2E4AA 1LLCA 3DOJA 4NU5A 2NACA 1IZ9A 2CSUA 1D1SA 1HLDA 1PWXA 2FR1A 2GUGA 2RIRA 3DBRA 1YQGA 4KOAA 2WMDA 4PLPA 4PIVA 1LI4A 2VUUA 3OF2A 4TMFA 3ON5A 2E37A 3RBXA 2IE0A 4R5MA 5A9SB 5EJ2A 5BSFA 2ZCUA 3FWNA 3WR5A 3JCZA 2ZQZA 4FFNA 4ZQFA 3X2FA 2NTNA 3MTJA 5T8KA 4YAGA 4JBGA 3B1FA 1N7HA 1PGJA 2P91A 1R0LA 3NX4A 3TZHA 1LRLA 2OORA 1N7GA 3IIEA 4TVOA 3L6DA 4Z0HO 1DFIA 1HYEA 3W8FA 1C1DB 3F3SA 3ZNQA 3I3OA 4S3MA 2YHUA 1U3VA 1U8XX 1YB5A 3PQEA 2P5YA 5JYDA 3FNEA 4BV9A 2O2SA 4FBGA 2AE1A 5A06A 2NU7A 4IDDA 3WWYA 1AHHA 3D1LA 5FWNA 2VUSA 3HN7A 1A4UA 4GVXA 4IXWA 1PL7A 4UUOA 2X22A 2ILTA 3DBLB 1ZSNA 2XF8A 3OP4A 4QFCA 4PZEA 5CEFA 4FPXA 4XDYA 2A35A 4MKZA 4RORA 3BIOA 4Q39A 1IPFA 4YTEA 4Z3KA 4AG3A 1YBMA 2P5UA 1KVTA 1XDWA 1DBVO 2QX7A 3QV1A 1ZBQA 2J8ZA 4UEKA 4FC7A 4CV0A 1KYQA 3AOEA 3LVFO 1Z82A 4PRLA 5IDQA 3KXDA 3DTYA 4XWYA 1HE4A 1QYXA 4KP7A 2X9NA 2NU6A 2PV7A 1C0LA 4BHTA 4J1TA 4GQAA 3H3FA 4Z3DA 2YV1A 5KVSA 4KTTE 4KDEA 3AW9A 4ND2A 4BO7A 4ALKA 4B7CA 3RWBA 4G65A 4TQGA 4YJDA 1V6AA 2EXXA 5EERA 5C3MA 4B7XA 4NDNE 3L6EA 3PJDA 1P1KA 3GVIA 3OJEA 4YQYA 4GGOA 4W99A 4R5HA 3KYCA 2I76A 2YUTA 4CV3A 1AHIA 1UP7A 1N9GA 5TT0A 2B35A 2GR9A 2RHCA 3DAGA 2AQ8A 3Q9NA 1LDEA 4WECA 1N1EA 4WLEA 3ROPA 4Z0PA 1ZCJA 3DZGA 3GHHA 4CMGA 4PFJA 4UREA 1DFGA 3DR3A 3F4LA 4J43A 2E6UX 3B1KA 1KY4A 4IDBA 2YYYA 3E6AA 2VWQA 1LC3A 1RYEA 1EUZA 4RPKA 2VRBA 3AUUA 1HE3A 2ZK7A 3VH1A 4Z9FA 1H5QA 3H6KA 3RUCA 2X0RA 4WEQA 3TNLA 2JCYA 4RDHA 2Z1MA 3GZNA 3L6OO 2IYOA 2P4QA 3HUDA 4KWIA 2UVDA 4K9DA 3E9QA 2AEJA 1PR3A 1UZLA 1LX6A 2HMWA 1BHSA 5DULA 5TSDA 1M6WA 1KVQA 3RUDA 1AXEA 3RIHA 2AXQA 1VPDA 3UXYA 5TIIA 1S6YA 1I32A 2YV3A 3VH3A 4ZHSA 4CM9D 1YXMA 1ZXLA 2NQTA 1A5ZA 3NAQA 1C0IA 4BKUA 3OIGA 5L9AA 7ADHA 2Y1DA 4R69A 4I5DA 5TGDA 4BQPA 4CMIA 2NTVA 4TRRA 3AY6A 4R9RA 3VDQA 4CLRB 3RBVA 1EVJA 1B16A 3I6QA 1LDYA 1E7SA 4P4GA 3BYZA 3WGGA 5IZCA 1ISFA 1KEWA 1NQAO 1YB1A 4N5NA 4HFRA 5CAEA 1ULSA 2A92A 2AQIA 2ZQYA 4ZRMA 2DKNA 1EDOA 4CR6A 1GDHA 4YDRA 2GERA 2HAEA 4MVJM 1WMBA 2YQ4A 4PVCA 4AVYA 4PG5A 4ONEA 2C07A 4HWKA 1V9LA 2O7QA 3RU7A 3I1JA 3JQ8B 3KSZO 3H9JA 1EDZA 3A1NA 3U09A 3C3XA 4YBZA 3RJ9A 1LDMA 3BHMA 1EK5A 4RPGA 4Q3CA 5G0WA 4AJKA 3KV3O 3UW3A 2ZJ0A 3WMWA 1XKQA 1A7AA 3PHLA 1DEHA 4AJLA 1XYGA 3SJ7A 1E1LA 4L74A 5JPIA 4D3SA 4ESOA 3SLKA 3B6ZA 4YYZA 2EJWA 1PZGA 1F06A 3LT0A 3VAZA 3FWZA 4RQTA 2VHZA 1ZJZA 4DMLA 4AL4A 1QORA 1HDCA 4NFHA 4NK5A 3DWFA 2PWZA 4Q3EA 4DYDA 3MJVA 4BO3A 4Y8VA 4LW8A 4CM9A 3JD4A 4EITA 3IKVA 2FR8A 2PGLA 3O8QA 5GY7A 3P2OA 1I33A 2VYND 1V3VA 1I2ZA 5EQFA 3QSGA 4L75A 3W4JA 3I23A 5JAMA 1HT0A 1VL0A 2B4QA 4PLVA 4BNZA 3BHJA 1QRRA 3G17A 3C7CB 4CJXA 4XA8A 3WMXA 1AXGA 5L51A 3WGTA 3AY3A 1FDSA 3TL3A 5B4TA 3IP1A 1W0CA 4AJOA 4CPDA 3INTA 3GEGA 4ZGWA 4IDCA 4D46A 3DZIA 5C5IA 2VT2A 1MC5A 3BXXA 1GAEO 3OEYA 4YA6A 4WJZA 4XJSA 4NBVA 4RLSA 1WPQA 3C24A 3QA9A 4LCEA 2CDAA 5T6BA 1UAYA 1FMCA 3ASUA 1EE9A 5CEEA 3QWBA 1A27A 2IZ1A 1XR3A 3I4CA 1GUYA 4IINA 1R6DA 1VKOA 2OP0A 4XIYA 3ZU5A 3DDNA 4CR8A 2R00A 2VOJA 4QXMA 2HK8A 4RGBA 1G6KA 1JAYA 4GPD1 1EFLA 1JW9B 4HADA 4PCVA 1U3UA 3ETGA 5ITVA 3AM5A 4BNJA 1O8CA 1VL6A 2Q45A 4D0RA 1VLLA 2PNFA 2IXBA 1HDZA 2AA3A 3PEFA 4FFPA 4PLWA 4BO6A 1MUUA 1HL3A 1I3NA 4IBOA 3GG9A 2ZTMA 4OH1A 4L8VA 2RH8A 3RC2A 5CG1A 3ANLA 2AW5A 5DCYA 1ISJA 4DVJA 3D4OA 5C7OO 2CDCA 1HWYA 1P77A 1DC6A 2O3QA 3ZGYA 3JQBC 1IHXA 2EW2A 2IXAA 3FBTA 1NYTA 5MGBA 3MTGA 2CVZA 3PK0A 1Q0QA 4A5OA 4D43A 1NM5A 1EBUA 3AOEC 4E5NA 4JXKA 1P33A 3L4BC 2LDBA 5KVVA 2ZYDA 2Q99A 4K26A 3PHIA 5HA5A 4NR0A 1U8FO 5HTOA 3PVZA 1PZEA 3TJRA 4WOKA 2X5JO 3F1KA 2DTEA 5EQDA 4EI2A 5TX7A 3QWFA 1P9LA 3GGPA 5A5EA 3KUXA 4TSKA 3MOIA 2W8ZA 1CJCA 3E82A 1W8DA 4GI2A 4CLRA 1L7DA 2GPTA 2GNAA 3BZUA 3OQ1A 5KJFA 1LDGA 3ETEA 3QVTA 3PI7A 4ZA2A 1GPDG 1SAYA 3ZWXA 3I52A 2NV6A 4BNXA 3WIEA 2I65A 3GDGA 3TN7A 4CM5A 3KB6A 1GZ4A 1U4OA 1YONA 3QJ5A 1W73A 1PGOA 1RM0A 2HMUA 5G4KB 1ISIA 1VSUA 2WYUA 4GGPA 1Q0LA 4Y67A 2BI8A 4D42A 1DAPA 4BNGA 1LSJA 1ID1A 1MG0A 2D2IA 3I9JA 1NWCA 4R1NA 3Q9UA 2YHIB 5G4LA 2CF5A 1T24A 4P8RA 2ZTUA 1HDYA 2R2GA 3GMDA 2DTXA 3NDIA 2HJRA 2Q2QA 4L4XA 1NPDA 4XIJA 5U4QA 2GGSA 4NNJA 4AJ4A 2D5AA 1LU9A 2JKVA 4QO7A 3VDRA 4EZBA 4YRDA 4OXKA 2QYTA 1FJHA 2P9CA 4N54A 1JLLA 4HNHA 3STHA 1HE5A 3RCBA 2FHSA 3HG7A 1DB3A 5B4VA 3ZW8A 4JJGA 3ZU2A 3KEQA 1BVRA 4PN3A 3DMTA 3ONFA 4GBJA 4L73A 1PQPA 4DYVA 5JNLA 1QYDA 3JQFC 1NNUA 1IE3A 4MOWA 1KC1A 1R37A 4J49A 1XG5A 2O23A 3B1JA 1E77A 3DZHA 4GMGA 5T64A 4NMHA 4J1SA 4W4TA 1ONOA 3I9LA 4ALJA 4CL8A 4RVGA 4YT4A 3RBZA 4MVJI 2I5PO 3ICCA 3WGOA 3NGLA 2DTDA 1YQDA 2ET6A 3E9NA 4GL4A 2GN9A 4N5MA 4NBTA 2RHRA 1BW9A 3M6IA 3AWDA 4IQGA 4RZIA 3Q1LA 3DO5A 5EN4A 3OFSA 4R51A 5IDWA 2UUOA 3NV9A 4EUEA 3JQGA 1PS0A 4OM8A 5EMHA 5A05A 4W6ZA 3D4NA 5MDHA 3BMCB 1PJSA 3K9QO 4OL9A 3NTQA 5TT1A 5KJ1A 4OSOA 3RASA 1WZEA 3FBGA 1DIRA 1EVYA 4J91A 1JAXA 3KLMX 1NVTA 4RVHA 3KYBA 4IJKA 4U8GA 5IDXA 3WXBA 4GWKA 1QMGA 4DQVA 4ALNA 1ZIDA 3UUWA 1KY5A 1VM6A 4AJNA 3G79A 5HRUA 5F1KA 5DF1A 3N74A 1R4MB 3V2UA 5L4NA 5GZ6A 4YCAA 1K89A 3WX0A 4W7IA 4HFNA 4YEDA 3EMKA 3KYDA 3QW2A 1E3EA 1M76A 5AOVA 1B3RA 1TLTA 2JHGA 4E4YA 4DC0A 1JWAB 4E21A 4E32A 1Q7CA 4CLOA 4XR9A 2VWGA 2W90A 3ADPA 3DC2A 4WLUA 3PYMA 5IF3A 1BXZA 1GY8A 1DIGA 3DFUA 1IY8A 4YAJA 3ZWPA 4D3DA 4JP2A 3ADOA 3BMNB 1ZUD1 3I9OA 1QLHA 3LLSA 1I01A 4PG7A 2OGUA 1VL8A 1YDEA 3ZU4A 4BMNA 1V3UA 4WLVA 5TLSA 1KVSA 2X0JA 4P4LA 5G4KA 5DBFA 4BVAA 2YQ5A 4NBRA 1D1TA 4JNKA 1GPJA 2DT5A 3JYQA 4TRMA 1O5IA 3PFFA 4J7UA 4AJHA 2NSDA 2D3TA 2X5KO 3DBLA 3GDOA 3C7DB 4WK6A 5TQVA 3C85A 3S1LA 3EK2A 2D0IA 2DBQA 4KTVE 4CM4A 4L0QA 3PYLA 2GF2A 3GLQA 4MP6A 4NFYA 5BT9A 1ISHA 1EUDA 4ND3A 3GT0A 1DOHA 1Q0HA 4Y6RA 5JS6A 4MVJG 5T5QA 4WNCA 3E1KA 4JJIA 1J49A 3UFXA 3LK7A 3SLGA 2H1SA 5GMOA 1T2AA 3PFWO 4BNLA 3WFIA 4FR5A 3V2GA 4QECA 1H2HA 1KVUA 2UDPA 4IS2A 2Q4BA 4M86A 4MO2A 5JE8A 4RL6A 5JO0A 4PG4A 1J4AA 3MJEA 4B8ZA 3MEQA 1F12A 2NM0A 3O03A 5CDYA 2QRLA 2O3UA 2P2SA 2OFPA 3M2PA 4DMMA 2WJPA 2GD1O 3P2YA 2V6GA 2Z95A 1U28A 1PS8A 2DAPA 2Q1TA 1OC4A 3JQ8A 1X0XA 4NG5A 5CG2A 4B4UA 5KCZA 2I67A 1IZ0A 1PS9A 2NLOA 2XAAA 5IZ4A 1I5RA 1Y8RA 3DMTC 2EERA 2O7SA 5F3RA 3KHUA 1P3DA 1C0PA 3G1TA 3L0DA 1XSEA 1SB8A 3D3WB 1LQTA 4HP8A 1U7TA 1B7GO 4QEDA 4E0BA 5CDSA 3P7MA 1SNYA 4DL9A 2VYVD 5ILOA 2EP5A 5JW6A 1B2LA 4R1SA 1EVZA 1E0DA 2WM3A 4FW8A 1NHGA 4PLGA 3WGYA 4E33A 4YT8A 4WNIA 5KJCA 2FPIA 3U4CA 1U3WA 2B83A 3ZWVA 1ZO8A 4OXYA 1DDOA 4UUNA 3ASVA 1Q1NA 4YACA 1LTHR 3VPFA 5KOIA 1MB4A 1DFHA 1DRWA 1O9BA 3JQCA 4XCVA 3RFVA 3UKOA 4XB2A 3IL2A 4AJIA 2D8AA 4CODB 3ZWCA 1C14A 4XB1A 2VT3A 4ZQBA 3WYBA 4CLHA 1DPGA 2IEBA 2VN8A 3JD3A 4Q3BA 5G0UA 3IJPA 4B3IA 3WOHA 1I24A 3OECA 2GCGA 4XRRA 3GY0A 3HZZA 4H3VA 1YJ8A 2Y93A 3IQDB 3T4XA 4E5MA 1X14A 1NBOA 2O50A 3N58A 3S2FA 1TXGA 3NTOA 2BRUA 4BNTA 3K92A 3CPSA 3GZ4A 2XPCA 4BO2A 3JYNA 2J5QA 3NGXA 4OAQA 1XIVA 4M89A 3PRJA 2DBRA 1YOVB 4J4BA 1R4MA 5IJZA 1NP3A 1JKJA 1N9GB 1E6UA 3E9MA 1TA4A 1XEAA 5J23A 3N7UA 4EJ0A 2GN4A 4XJTA 4AJJA 2G82A 2Q2WA 4JCOA 5AVOA 1BWSA 1QSGA 2PLAA 1P31A 3FNGA 4PLCA 4AJ2A 4BKOA 4YAKA 3VH4A 5CDTA 1B8VA 4MP8A 4YT5A 1LSUA 2NNLD 2UV8A 5JCJD 5A9TA 1J6UA 1B26A 3QWHA 4BNFA 1CF2O 1X13A 2VYVA 3DHNA 1LLUA
chains in the Genus database with same CATH superfamily
2OD7A 2OUIA 4KJZA 5AW2A 1KYYA 2FPGB 2UUPA 1M5TA 1R6UA 3O1LA 5C35A 2DERA 2QG6A 1KI6A 4HAUA 3GT7A 1UJCA 5WRFA 3SIXA 4ZFNA 3RSCA 5BMOA 1SOUA 5A6VA 4FU0A 2GK3A 3E4CA 4YN3A 4IV5A 3FTEA 4FZVA 5A5VA 4ZTZB 3KZNA 1N0VC 1SUBA 5C4IA 5CLLA 2Z2IA 5ICMA 1UPBA 1XZBA 4MVJP 1EU1A 2Y1KA 5F51A 4D5GA 3TZQA 4MV5A 4NC9A 2Q21A 4LVCA 3E8XA 3HKCA 3JVIA 3GO4A 1T6YA 3FKJA 1IIBA 5GV8A 1RQ2A 3EXG1 3Q2IA 1RWQA 4IGFA 4MSUA 3EOZA 4QUAA 3AEKB 1OBFO 2WE8A 3DCIA 4FCTA 3VYUB 3WYDA 3SDBA 5J2TB 1GILA 2QYSA 4TTIA 5MGNA 3BGWA 3EY9A 3NTRA 2QBYB 5F64A 5KKAA 1TM4E 1HGXA 3EX7C 1GCUA 3HWX1 2FZKA 2UYCA 2DT8A 1LNZA 1C4KA 1ML3A 3A1TA 2GTIA 3NUGA 3AM1A 3F2IA 1ND6A 2CN1A 3DE5X 1BXRA 3W3AD 4HVLA 1VPVA 2F67A 5LZ4A 2BKLA 4HQLA 4BGDA 2GPNA 1OCEA 1M0SA 1CB0A 4I1OA 2KB0A 2V3CC 3OTIA 4FMPA 1P29A 5GVRA 4XD2A 4C7KA 1QGDA 3IPRA 3SX2A 4JUAA 5JQWA 5AK3A 3DL4A 2W83A 3DDUA 4PNPA 4H1VA 3MYRA 4PZAA 1PGPA 2WLSA 2X8LA 3N07A 3UEOA 4YRQA 5JSZA 3H7AA 1X94A 3T7IA 4ZDWA 1I51A 1NG1A 1X80B 1A5TA 3T52A 3G82C 4EG7A 4UPEA 5E6UA 3IKLA 3I04A 2C5AA 5F77A 4HO1X 1P5FA 5AKLA 3LQYA 5DYWA 4PLTA 3FFTA 3T1HB 2I4NA 4XGIA 3COZA 2OL4A 3GT3A 2NSHA 2VO1A 3L7IA 2WZQA 5FR2A 3UH1A 2R6JA 3IPCA 1QQBA 5LQAA 3I2FA 4X9XA 3CCCA 5CAEB 2W2KA 2QMEA 4D3FA 4B46A 3HCBA 1RQXA 1Z38A 4RVSA 2XNCA 2Q3JA 3P9RA 1N6PA 2XTMA 2J7PA 2YY5A 3U80A 2BELA 1JECA 3MOGA 3HDVA 2Z57A 3C0KA 2WF9A 1AN9A 5FFFA 5HMLA 3E22B 3W4IA 5FBHA 3LDGA 3CGGA 4W6QA 2NT4A 4P1ZA 2O14A 5G53C 5T3YA 3F97A 3VR5D 3BHIA 2VP2A 5B3AA 1FW8A 1J00A 1N2JA 2Q3HA 2REQA 1SCKA 2JA1A 4FW9A 1S8AA 2GHIA 2KJQA 4UBKA 4RKQA 1Z33A 2V7GA 4GBMA 2MCFA 2MSNA 3BUSA 1K88A 3ZDRA 2GSWA 3FCYA 4ZODA 5F1PA 1G5PA 1UXGA 3KM0A 2BMFA 4NS4A 3STUA 1D3AA 3GDFA 1PN3A 4LSMA 4INPA 4CMEA 3WLHA 4I9FA 3NWJA 3V32A 5EHGA 3VZPA 2QY6A 1E8NA 3L82B 3WMFA 4X1IB 3THRA 1TK3A 5P21A 4AUKA 2HDHA 4Q1AA 2AOXA 2V55B 2WI8A 4QOFA 5LXTF 3RAFC 1ZG3A 3CF2A 2R7AA 5SZHB 3H5AA 2FFQA 5BMVB 4IIEA 5KWSA 1SRQA 3FYHA 5EQJB 4AKTA 1A9YA 1D6MA 4OHOA 3IV6A 3K1AA 1P5JA 4LN1A 3K16A 2VCYA 4PR3A 4ZWNA 3V9AA 1X1AA 3MJCA 3PSHA 4AJ1A 3KKEA 4K28A 4R68A 3T54A 2W4MA 4HUJA 2XD4A 4MIOA 3P52A 1I7SB 1RW4A 2W4QA 2Y4NA 3DT6A 1KI9A 3BCRA 1QC5A 3VNSA 2FWNA 1II8A 3V42A 4KO3S 4Z4QA 4Q7JB 5JFOA 3QNUA 3L40A 3GLGA 2W6NA 2YX1A 1ISRA 5HF8A 2D1SA 3UJDA 5C1OA 4P98A 2BHLA 1AUXA 3BK2A 4MCAA 4NV3A 1EFDN 4YALA 3F8TA 3GC6A 5LKRA 2G17A 3KRTA 4GS5A 1I10A 2HA5A 3BVPA 4IQ4A 1QP4A 1ONPA 1TMOA 1TTPB 1N5IA 1N92A 2HO5A 2YYZA 3D6AA 3H0CA 4OK5A 5M3BA 2QTVB 3WB2A 3RSQA 1H6DA 3FSRA 4U63A 2A9FA 2I4IA 3VKUA 4KQMA 3LPDA 1Z2NX 3PPVA 5CCDA 3TRHA 5M2QA 4BL5A 1G60A 3CUUA 3KQQA 4C4OA 2X5XA 3BGDA 3H9CA 3VYTB 2QV7A 1GQQA 2EX4A 4RHFA 4QTTB 4ZALA 3ZY5A 5B6PA 1E7WA 2R4QA 1AGNA 3HS3A 1ZMOA 1YQ9A 2IYYA 4XWKA 1Z07A 3IV7A 3OHSX 1M75A 3CE6A 1Y7IA 5JCJA 2WHEA 2NX2A 4MKXA 3AHIA 3P5SA 1EZZA 3M9LA 1J23A 5D3QA 2IV7A 2OCKA 1S2IA 3G59A 2OCYC 3ZHBA 5CP8A 4D4LA 3CO5A 4BNNA 1AV6A 4GYYA 4UVIA 3VJKA 1CJUC 4DE5A 4IYRA 1Q74A 2ZITA 6ABPA 2FMXA 4MQ5A 3OJXA 3GV0A 1Q57A 2C5SA 3LYUA 1R9JA 2PXCA 2Q1SA 3KSUA 3LYHA 1TADA 3TEFA 3QNWA 1G20B 5BW4A 3BXFA 2RHMA 3ONDA 3L7BA 2V7UA 4O1MA 4OI2A 3UB2A 2JJ1A 2HF2A 1NIPA 3AYZB 4BN4A 4NV1A 4ESEA 4PYJA 1GTZA 3C5WP 3LDFA 1E8DA 4X65B 4Q37A 5DP2A 4XSGA 2R48A 3EZFA 2YWJA 2V98A 4RHUA 4HAZA 5CM8B 4AX8A 2GNPA 4TPKA 3HKBA 3U1VA 3FZYA 2ODWA 3QLVA 5KSWB 3VPGA 1W36B 4KL8S 2QUAA 1H6AA 4QRDA 5BOSA 4OHWA 1CY4A 1E3WA 1QHHB 3VU8A 3PE4A 1PEAA 2GB4A 1UDBA 2HXYA 2P6OA 2WTXA 3MJRA 5ALTA 4EEXA 1FOEB 4YJHA 3AGQA 1UK6A 3R7WB 4LQLA 3O75A 1E2IA 4KSBA 1RXWA 4BIIA 4HB4A 2VPIA 3AL3A 3I34X 4JJ6A 1LWOA 1BN6A 4HN9A 2SNIE 3EC2A 3AF2A 4TMTA 4J6EA 1GCAA 2DCUA 4Q7QA 1Q7BA 2JLSA 3I83A 3WO1A 3O8CA 1UINA 4YNBA 3KKPA 5FHQA 4F3YA 6REQB 1XVAA 2C2OA 5LBUA 1X7GA 5TMBA 3W5JA 5G41A 3V4FA 3QV2A 1EVLA 3AJRA 4RK1A 4DA6A 3H6HA 1N75A 5LL6P 1HZZA 4RUKA 3GMSA 4FK8A 3CVJA 1BVUA 1TJ5A 4A36A 1F0YA 1RIFA 1VMDA 3WL7A 2N0SA 1FU7A 1VLMA 3NS7A 1Z7WA 3O4JA 3R7SA 4FD3A 4U7GA 1LQUA 3SXPA 1BZYA 1G0OA 2WT8A 1NI4B 4AN4A 1FFHA 3BICA 3DQQA 4HWTA 4PRKA 1JFSA 1VG1A 2GETA 4UNRA 5JAUA 3WBFA 5GIPE 1R10A 1ZR4A 3T95A 4U2FA 5CB8A 2OFOA 4O2AB 3FTQA 5I8ZA 1JG3A 2W2LA 2WV7A 3LT1A 1DWUA 4K6CA 3DAFA 3VU9A 5KTKA 1NUTA 4OI4A 1E2KA 2P68A 1KEKA 2QX6A 1KPGA 1UJMA 3FGNA 3EBPA 5KNCA 2O1XA 2CXOA 4LMAA 4UM7A 3FMGA 4WW0A 2W2KB 1QG4A 2W6PA 3C6KA 3ZE9A 1VMEA 2J7PD 2GBLC 1NXQA 2HHAA 3W5CA 4KUHA 4LXYA 1ZM9A 2P4UA 2JGEA 3CWCA 3NWOA 1MC1A 1Q1BA 1FVXA 4D97A 3N8GA 1Z4MA 2WSIA 5EG5A 1Q7EA 4URVR 1U6IA 2B4YA 1W29A 2XOXA 3BD7A 3OZDA 3W1WA 4O4IA 3E1GA 2EHDA 4E2YA 4ZO9A 4ZVVA 3TQFA 2PT5A 3OFVA 3HJHA 4M7OA 2I7DA 5AW0A 4OHRA 1UMBA 3K0KA 4BFTA 1O95C 2D2FA 3WLMA 4DQLA 1IN7A 3H2GA 3G3EA 3G8AA 4F2DA 1YNSA 2X1HA 1TU3A 1B0ZA 4B48A 1GGVA 3PZBA 5B1HA 2XE7A 2HOQA 2W8BB 3NVKI 1QOZA 1YO6A 3F6YA 1KERA 1H0HA 4LYFA 1FRZA 1HLFA 5FBVB 2TRSB 2EATA 2D1FA 5ES3A 3L05A 3QLVC 2BIFA 2YWEA 4LVUA 4U00A 3IAAA 5KWEA 3ABZA 2PMDA 2X0DA 1EX9A 1F4VA 3UPDA 2IXFA 1A1VA 4QQFA 3QHAA 1E59A 1Y9JA 4Q9AA 3AR4A 4XRGA 2C31A 2YWBA 4OFXA 4G4IA 1IBLB 4CQLB 4GM4A 1ZRMA 4TWZA 2OGSA 3PA8A 3PDIB 1U3GA 4CMBA 3KKKA 4B4OA 1EXMA 3K8QA 2O57A 3QF4A 2I3GA 1W44A 3BDVA 1WAMA 4LK3A 3G2LA 3S2GA 4EPWA 5J2UB 2OR3A 2XNSA 3C41J 1DCTA 2HA6A 5CXUA 1XT6A 2BM9A 3W1EA 4MUHA 3DCYA 4YGYA 1GAQA 1SCJA 1U65A 2W11A 4ZT7A 3LK6A 1S7GA 2JPDA 3NI2A 3TXYA 1Y6RA 1CUHA 2ODPA 1GAXA 2XX3A 2GRJA 4BLOA 4RL4A 4RF3A 4CG1A 4LRQA 2H1HA 4DV0B 5LUBA 1NBWB 2JD2A 1AQ6A 1O89A 4P38A 3PFBA 2QE7A 3KOYA 1PK8A 2XI4A 4CMEC 2IYTA 3GCGA 3LZCA 4EKIA 3IDQA 2ODQA 1NLUA 1I0ZA 1P0MA 1XTRA 2GEVA 3I2KA 1WSAA 3L07A 2ZKLA 4FFDA 4IS3A 4EI9A 2BEVB 3E7PA 3H8WA 1O58A 1E3QA 3EXEB 1ZA1A 1SXJE 2EV9A 2H4YA 3K5PA 3M82A 4GGMX 5LZ9A 1N34B 4OLHA 2OXCA 1CUVA 4MV8A 1LFDB 1S2MA 1WA5A 2FZWA 1H5NA 3DTTA 3NBYC 4PX3A 2W6ID 3L92A 3CZ9A 4JBIA 3WLNA 3ZDXB 1CR0A 2RH9B 3MRVA 1KHTA 4A8JC 3UK0A 5D5PA 4PTLA 5TMEA 3BBLA 1V7QA 3KTDA 1T2DA 1ECJA 3FTNA 3WGLA 4HLNA 4LY3A 1EVIA 1N2OA 5HJ2A 1WLYA 2DFLA 4TYYA 2NTEA 5GOTA 3S70A 4H6VA 2G9UA 3NHAA 3IJEB 4P34A 1XEXB 4LV6A 5DHPA 5J5AA 1NQVA 1V9SA 2I2CA 2GNOA 3KSAC 2M1XA 2BH9A 4UNSA 3ETJA 2VTDA 4RIIA 4B09A 3IHLA 3IP6A 4MPJA 4TZKA 4C78A 4YP0A 2MSCB 2QX9A 2IE8A 4RVFA 4LFCB 2L82A 4DAEA 2YC4C 1PSDA 3GGDA 2WYVA 5JMPA 1XMOB 4L2IA 2E48A 1LDNA 1QQTA 1KNQA 2ZI4A 3HNOA 4PAOA 4PYKA 4BC0A 4RVDA 1GCGA 3CRRA 3HWSA 4WZZA 2X9VA 4RO0A 1P5ZB 1R9NA 5E6RB 3WI7A 3ST7A 3IURA 5BSRA 3G8BA 1B73A 3IPAA 3NQ41 4IIBA 5D85A 2OMKA 5C7LO 4M0MA 4UJ5A 4ZO7A 5EWJB 3WLTA 2IVFA 1YBHA 1J07A 2AR0A 1NUPA 3MJHA 4ZJYA 1EDDA 3NUZA 4JX8A 1G1MA 3CNOA 3SKYA 1RNLA 4MVJD 3U4AA 5HSGA 4XGQA 2ZDQA 4D96A 5L7WA 1LCIA 5FYQA 1V6CA 2C4HA 4OFBA 5BSGA 1XQVA 4YRBA 1II9A 1DV2A 1P9NA 1S96A 3B9QA 2ZYAA 3FPGA 5DHAA 4IQ8A 1XTSA 4CCYA 1Z3IX 4PZ9A 5AHXA 2YJ6A 3O8QB 1KJNA 2IYUA 4RSMA 3TBKA 1TUIA 1QKKA 2GCOA 2OO7A 1CE8B 3JPYA 1H8EA 1LJLA 3DEKA 9LDTA 1P7CA 1CDZA 3DLPX 1J8MF 1YR3A 3HDQA 2CNLA 2HPVA 2H2FA 2P35A 4OMCA 2C83A 4WNYA 3UMCA 1TQ4A 4XWAA 2FP4A 3GH3A 2JJ2D 4IUBS 2EFJA 5KKCA 5DK6A 3N1UA 8MHTA 3K2IA 3BE8A 1PT8A 4GM0A 3NRJA 1K6JA 5AESA 3GPBA 5ARCA 10MHA 3ZWBA 4FN4A 5B3JA 1Y4AE 2FWRA 1FDUA 4NBUA 4TKZA 5F5LA 3T12A 2RCNA 5IMBA 3ZWQA 3TW0A 1GSIA 1OILA 1IUOA 2MSWA 3KVYA 2O6HA 5EPUA 1RLMA 3OMLA 4W1RA 1XAGA 1Z62A 1I3MA 2BUBA 1DLJA 2RG7A 3NT2A 5DTJA 3V7UA 5IAGA 2CNNA 4BNMA 2VJYA 1NF2A 1QK3A 2XVZA 4P3KA 4A6DA 4DXHA 3KETA 1TM5E 4PC7A 2WRZA 4X6YA 4A7PA 3BMXA 1N25A 3COJA 4M1ZA 3GX1A 4E1AA 1WY5A 1OAAA 4RLHA 3SYNA 4EPXA 1KMQA 1PKEA 2HEIA 4FLFA 2FH5B 4IOKA 1FDTA 3VR3A 2J0EA 5E2IA 1MEEA 1WDMA 4UD6A 3O38A 3B7GA 3DNFA 1L4LA 4UBOA 4NMLA 2WIAA 5DYTA 4E7PA 1F0PA 2X40A 2C3YA 1XXLA 2HC9A 2VK2A 1AB5A 1IDN1 2ZROA 2AJBA 3CSSA 1U9CA 3D7KA 3KPWA 5DO9A 5UKDA 4EHLA 3F3KA 2PVPA 2BLLA 1ZKMA 2RH4A 3KJFA 4FEEA 3OAAD 2CMHA 4HN4B 3ZDEA 4TWAA 5JCOA 3RFUA 4OAOA 4W9RA 2XCSB 1XD2B 4DMGA 3Q8LA 1E7QA 2YWRA 1AGRA 3LUCA 2J6IA 3GAMA 1E2MA 2Q2VA 3AY0A 3OCWA 2Q46A 1SUIA 3OTHA 4NJEB 5DCWA 3U39A 1NRJB 3T61A 1JJVA 3PZRA 5FBKA 5BNIA 6ADHA 2X7HA 5JJIA 2YJGA 3VYWA 1QS0B 1IUKA 1TKRA 3U7JA 2B8EA 3GAAA 5IABA 3KZCA 5FA6A 1QKIA 5EE3A 3R24A 4EEZA 2XV1A 3GLUA 2ZIUB 5TXGA 2B4RO 2JZCA 2NT3A 4N6NA 1DKNA 2AX3A 5LA6F 1U7UA 1Z2PX 2BFCA 2MYNA 4QOSA 4ZQGA 1WBBA 2IOQA 1UFKA 2TMDA 3UAZA 3K73O 1RWXA 3FOWA 3TNDA 2HWKA 4Q93A 3FGZA 3HTXA 1HLPA 3G6WA 1ES9A 2R97A 4MAAA 3FZNA 4R7GA 4Q0MA 4M8IA 5LBTA 1VPTA 3AERB 3IHKA 1S1CA 1MR3F 5AM0A 2J0UB 4HJXA 1I6WA 1EP2B 4C3OB 3PP8A 3FTFA 4D4GA 2XYVA 2WWGA 2FSVC 4ZDJA 3GRAA 4BB6A 2QJRA 5KJ6A 1JRLA 2J3IA 2OCGA 2I34A 3QMWA 1S0UA 4Z8YA 1GZ7A 3QIVA 2QZPA 4GBGA 2PU7A 5DTQA 3SJBA 1MXFA 2NSYA 4MS3B 3CF4G 1JTFA 3RK0A 4BFWA 1Y6GA 2BSQA 2YW2A 3T1OA 3FMOB 4RD1A 1VJ1A 2HQOA 3FHLA 3D3WA 4JP8A 1Z0DA 2O2ZA 4BPBA 1DO2A 1FP4A 3LP5A 1M1NB 4UM5A 2QI9F 4MEBA 1CY8A 5LC1A 1BDBA 3OZUA 1O97D 4I3HA 2JGIA 3OMWA 1L8OA 1UC8A 1ZH8A 4R2HA 4EYQA 4DMFA 4AD8A 1GLGA 4F3CA 5A3VA 1WIWA 4EGFA 1K3FA 4QT0A 2F9FA 1YZ3A 3EH1A 1DEKA 1U2TA 2HO4A 2IP2A 3MTAA 3T9DA 4A10A 3TG2A 2OYRA 1DTSA 1F9EA 4UNNA 1C2TA 5AWFC 3TYXA 3ZNNA 2EW8A 3TDNA 4JYMA 1MV8A 3ONVA 4GMXA 4N8EA 5JXJA 5M34A 3H1AA 1GQ2A 3KLNA 1JEEA 4Y1GA 3KQKA 4KFCA 4F8JA 3IEVA 4Z4CA 3ICEA 5KWJA 1H0KA 1TMYA 3ZWMA 2CXQA 1EE2A 4U6NA 4KRFA 2FVXA 1X9HA 2A0XA 4FYVA 5F7XA 3CX4A 1YVDA 4AMZA 1ZHOA 3CCBA 2NOAA 1OFHA 2RAUA 4PZ0A 3FCOA 1QKJA 3FLMA 1FRVA 3IT0A 3LAWA 2DLDA 3V1YA 4XOUA 5J59A 3O3CA 3LU1A 1Q0UA 4I6EA 2VF4X 2JGNA 3THSA 2P6UA 2VUTA 3AGPA 4YONB 4ZVPA 3U3JA 4DCNA 5EJ7A 1QTIA 1PSZA 1WXXA 3HUFA 3M34A 2I7XA 4JMPA 1BFUA 1M6YA 1R50A 1XNJA 2IDJA 3N2YA 4JJEA 3IXQA 2ZTVA 4R8SA 4K9KA 1HOTA 1K3UB 1BXRB 3E3OA 4EBBA 1BMDA 1Z0AA 1MU0A 1L4UA 3IUYA 3WK5A 2PUDA 2NVBA 4P84A 2DFDA 2UYYA 3SWWA 5IVPA 3SEAA 4NOMA 4JELA 3NBXX 1A1SA 1T3LA 3RROA 1ADCA 1D1PA 4N18A 1LC0A 4A9AA 1T1RA 2AN5A 1B23P 1CQIB 3OT1B 3GUHA 3UAXA 4YRKA 1ZEJA 3IOCA 4JYZA 4PZYA 4MMXB 4YRMA 1PX2A 2KBEA 5IXYA 2DY0A 1X7DA 4HDMB 2J9GA 3WGMA 2C2HA 1RE1A 1AB6A 1Z4KA 5A5FA 1DCKA 3O31A 3ZQ4A 4LOLA 4C03A 5FTWA 1JL3A 4FI3F 3K5IA 2QNRA 1VHLA 1LQ2A 2L18A 4EG3A 3KYCB 3X1DA 4LZAA 2XMDA 1YA8A 4DJAA 3G2MA 1SG0A 3PNSA 3H1FA 4ILKA 1IN8A 4KWCA 3AW8A 4RPJA 5DMXA 1NM5C 3KWLA 2GM3A 3LY5A 5ALLA 5JROA 2W6JA 4J7XA 1JB1A 4NHEA 5HBGA 3JV7A 3ZTTA 3WJ7A 4WY5A 4MQLA 1NSFA 3GIDA 4N3GA 5COBA 4RTKA 3X1MA 3NAMA 3O82A 4B6OA 3AVOA 5IHXA 4YUZA 4X61A 3K9HA 1VTKA 2WM8A 3ABSB 1M2EA 3K0BA 4CG0A 5AW6A 5CHEA 4EABA 4CF5A 3VR0A 4O59O 2WKWA 3GUCA 1JA0A 1JEOA 3B85A 3L77A 1E2HA 2CJXA 3OJWA 1N4AA 2AI1A 3TTUA 1SCIA 5JAHA 4O3MA 2P9BA 2JFVA 2Q5JA 1GG5A 3AB8A 4MV3A 2GT1A 3KL4A 4MI9A 1V8BA 2V54A 1IN4A 2NZXA 5FHRA 4GOMD 2WU1A 2I6QA 2UAGA 2JFZA 4WL0A 2QSZA 3E2MA 1PEKE 3HKEA 3H5OA 3MLBA 3TNYA 1OGIA 2YJ4A 3CLTD 3QKSB 3DG9A 1MFZA 1XE3A 2XY4A 5FOVA 1H93A 1P2GA 1CZKA 2GXQA 2XTNA 4MQ4A 4DV3B 1ZVMA 5TPWB 1PEDA 3L8FA 1DRKA 3GQVA 4AP6A 2IHZA 2G0AA 3B7PA 1W1IA 3D8SA 1EG7A 4GFDA 4Q3AA 4TV8F 4ES6A 2EIXA 3H8SA 3RH0A 1DSSG 4GZ6A 1QVAA 4UNPA 4E46A 2QVYX 3EQ6A 3GVHA 4A2WA 4B6PA 4BQRA 3L2OB 3H84A 1NW4A 2YFYA 3DHEA 3OCJA 4GRAA 1MTOA 2JVJA 5IASA 1IEQA 4EJ2A 3GLHB 2BFNA 2FW1A 4GXNA 2V0GA 4C06A 2V6FA 3C6XA 3DBHB 1I4OA 5ADUS 2EZUA 1OZFA 3EEQA 3A1DA 2CNDA 2GZ1A 1UK7A 3CRMA 4JLKA 3L1JA 1U1DA 3V8BA 3ETDA 1ABFA 3OA0A 3ZYZA 5G2OA 3U3MA 4MINA 3BEDA 3N2ZB 1KP2A 4EA9A 1ENYA 1YB6A 5DMHA 4E3WA 5FIUA 4R41A 3CW9A 3L43A 1MJ5A 3B70A 3OZIA 4I8DA 1IWBB 4E5KA 4EMUA 1ILEA 3K70C 3VZQA 4J94A 1U2DA 3RIEA 1AGPA 4DEXA 2BGLA 1FUUA 4FIDA 3NKLA 1VMAA 5DBOA 3UIEA 1TO1E 1EM8B 3Q0EA 4OHYA 2JKZA 4UQLA 4O4HB 2OA0A 1CBUA 4TXNA 4UQPA 5ES4B 3NO4A 4BRSA 4IH9A 4AT1A 2BPOA 1NFQA 3ZUPA 1HXHA 4V0KA 4P82A 4L4RA 1L1QA 4KDCA 4WIAA 5LQJA 2JLXA 3S4YA 4MB6A 3QU4A 4P7KA 3MB5A 4Q02A 3DDWA 1PU2A 4GEKA 1SOMA 5LMUB 1BSVA 2Q4TA 3MPUA 2XMGA 1MD9A 4XQ9A 4ETNA 4F2HA 1CS0B 2EWVA 2PG3A 3Q7PA 3MMXA 1C3VA 2L2QA 3BXGA 3D3EA 5HE8A 2OBMA 3FYUB 4IDAA 1IUPA 3HGTA 5K6AC 3BSYA 3QNMA 5IJ9A 3LZDA 4XX0B 1QHIA 4QFDA 3K71B 4WY2A 4MMZB 4OBXA 1PJBA 4KE7A 3PHJA 3A2KA 4LKOA 4MXDA 4XFKA 1HKHA 4NYIQ 5FJJA 3C7AA 3N2IA 4DEVA 2VDLB 5ITWA 2IIBA 4X94A 2X9GA 2FEPA 4E30A 1BXGA 1RCUA 1SQ0A 3L9WA 4KIWA 4WHMA 2BY4A 3HXLA 3KTAB 1EX1A 1QQ6A 2A5LA 2Z2KA 4II2A 2BFEA 2LR0A 5FLEX 5IS2A 3TLJA 1KAOA 2JGLA 3CINA 3HE3A 5L7TA 3ZV4A 4DANA 5FNVF 4MJXA 4ZYWA 3QVSA 1TCCA 1TO6A 5U4XA 4FYJA 4TZTA 3S28A 4EPYA 1N3IA 4EMTA 1I7NA 1DUSA 4LJAA 2Q8PA 2Z2JA 3KX2A 4WD3A 3BULA 1XJWA 2MHCA 3KYDB 3ZV3A 4IIYA 1O6GA 1C7FA 5FI1B 4IVQA 4C0KA 3GLGE 4YXFA 2ZCVA 2BGMA 2HI0A 4I5FA 4EYEA 1M1YE 4RAQA 4UDYX 1J8QA 1OIVA 3N3BC 3T7CA 1VG8A 5E2AA 3JSXA 4L4UA 5D1HA 4PGAA 1P0CA 4MICA 1SEPA 3SE7A 1XL1A 4OA5A 4ARIA 2ZSEA 2IA5A 5EIEA 3UMYA 4DGSA 2WJ6A 2CUNA 3W8DA 4BATA 2DHDA 5DZSA 1U02A 2BFCB 1E2BA 5AHWA 3LWNA 2I2WA 3EH2A 3BJIC 2Y4OA 2H1RA 2ZS9A 4Y9UA 1Y7TA 4X7BA 3P9KA 1JFRA 4MGZR 4CT5A 4XPZA 3FJ1A 2EFEB 3BIWA 5BWCA 5KC9A 1C3JA 3JATA 1LBQA 3ZHVA 4RF5A 1SURA 5H68A 1H6CA 3UJCA 5CB4F 1CJSA 3R76A 1VKNA 4KQXA 3A28A 2IPOA 2XKAA 4F4CA 1A98A 1G8YA 2IU6A 1LV8A 2ZSFA 3MJSA 4M55A 3GRPA 3TGLA 3ADBA 2QTLA 1J0BA 1EEXB 2IYPA 2PX6A 2C9MA 2J59A 2R5FA 1JH8A 2VC2B 4G36A 4I7EA 4IFTA 4KFTA 1MBZA 2XD9A 4G41A 3VR6H 4C0AC 5GZ3A 3NBFA 3M8KA 4GI3A 4K81B 1NX9A 1VLJA 4D57A 3BE6A 5BV8A 1RWOA 2GEJA 2IODA 3FSGD 2JCBA 2RC5A 2IGTA 4CIXA 3DT8A 1AE1A 1UH5A 1KAGA 2ZSAA 1ZYUA 3I73A 5ALUA 3PHHA 5EJFA 1TEZA 2HV8A 2XE8A 5JWHA 1ZMBA 1ZW1A 2R1VA 4PCUA 4GX1A 2VQ3A 1GU1A 3HACA 3PVCA 2EAUA 5JAIA 2P9ZA 3FPKA 2G0TA 4WESB 4Z0NA 2Q5CA 4UTVA 2O2DA 1SM4A 1H2YA 2H1CA 3FDFA 4KV7A 2F17A 3C14C 1Q3TA 5BOVA 4BKPA 4NZ9A 2XZOA 4QU5A 4OATA 1I9CA 5SYAA 4FDUA 4IM7A 3NHBA 5BWMA 1JLKA 2FMHA 5DCUA 3GUYA 1SXGA 5DN6D 1AO3A 3BJZA 2R4UA 1WB4A 4L5YA 2V59A 3H2SA 1BA3A 4P3NA 4QUKA 1EUQA 1RRVA 2FLVA 3AH8A 1XB2A 4MCIA 1PL6A 4MKGA 4TV9B 5J4VA 1E6WA 2WE7A 2DUWA 2ZRBA 3LDHA 3PRYA 4HNTA 3ANTA 5E9AA 2YW9A 4JIGA 2ZVJA 3ZI0A 3H4VA 1YH3A 3FRHA 4O8ZA 3WV4A 3O4HA 3T34A 5A62A 4DRYA 1HNXB 2C78A 1ZI9A 4KXYA 4QUBA 1K7FB 3OX2A 2FI1A 2HMVA 2P9EA 3GRVA 4U9HS 3VHXA 1Z7GA 4ANFA 2W9XA 3H11B 5K0LA 3O4VA 5JYCA 2X9LA 5K8LA 1AZWA 4G6ZA 2HL6A 2EJBA 3ZBTA 2YBDA 2C4UA 3ICPA 5AI8A 4DJFC 3A6EA 1OLSB 5K3BA 1JQDA 4GR5A 3SXUB 3UICA 1QLWA 2UZIR 3GDWA 3N05A 2Q50A 4AM8A 1QAQA 2H7XA 2WQ6A 2H8KA 5AJUA 5J47A 4RDCA 3U7RA 4KQJA 1RYZA 3NDJA 4DG5A 3BD6A 4FFRA 2CLMB 1TVEA 1I94B 2JCSA 4IL5A 3FWPA 1WTCA 5HXAA 1F1JA 2XF2A 1V16A 4INJA 2C0CA 2X8JA 1U2GA 3NALA 4FHCA 3TFQA 4O2RA 1PZNA 4MQBA 2ATEA 2Q3BA 5I9MA 1CVIA 1DG9A 2Q6LA 3V3KA 2C2BA 4E22A 4QO8A 5I9IA 3ODGA 2JLCA 4CMJA 5CYPA 1SHTX 3AFIA 4AJEA 4CEJA 2FMKA 1JHDA 1T36B 3G9TA 3PKZA 1S4MA 2ZATA 4IHJB 4XSHA 1DAKA 5IF9A 5EWLB 4H7HA 1U11A 1N6IA 2Q0HA 4E3ZA 3RJZA 3GN1A 1N5LA 1JVNA 3JQQA 4CQMB 2ZBVA 4TUYB 1C3OA 4BOYA 1VE5A 2QHXA 1JJAA 2ZTLA 5TEVA 5J1SB 3DTVD 1N0HA 2CDRA 4EKDA 3I58A 5IM5A 1I36A 1RRFA 4RF4A 3T9EA 1SC6A 2O0JA 4JL5A 4J3FA 4MHTA 4YMVA 3OCVA 1TM3E 1JXQA 1C8LA 4K1LA 5B3LA 5KWIA 1VYTA 5IKXA 2OOKA 3SZOA 4P35A 1TLFA 5JG7A 3SNKA 1NDHA 4U3JB 2WUFA 3CSDA 3SS9X 2YIMA 5CJ2A 3LKBA 1U1GA 2ZUBA 3QX8A 3KZKA 1UM9A 3V5NA 4ND5A 1NBMD 1SZCA 2XNJA 1T2EA 1H65A 1YL6A 1FU8A 4HLCA 2FWMX 5BSUA 4UC0A 4BN5A 1L4GA 1UXJA 1P7PA 3K53A 2QRPA 4LE2A 4RC9A 3DLTA 2J3JA 2UZ3A 1A4RA 3PR1A 5IAJA 2E87A 4A2PA 5CW1A 3OQBA 5LMCA 1DIAA 2OGZA 2X58A 5DM1A 1KIMA 1EFTA 5FL7A 1W1WA 3UC9A 3PNBA 4AY6A 1ULAA 2QQEA 1PI3A 1J06A 2JAWA 3N39C 1L8AA 1NVAA 2NTJA 3L1IA 3G1WA 3Q7EA 1F51E 4PNZA 5KVCA 2AHOA 1RAIA 4GH5A 4Y2TA 4B9EA 1TC2A 4BUCA 2FN3A 2OC9A 1R6AA 3IPXA 4RKEA 3UT0A 2XTZA 3CMCO 1P17A 2CUKA 1Y1TA 1QF7A 2A2ZA 3U0VA 3DD5A 1IULA 2ZUDA 2GN6A 2W2TA 1KAEA 3L7NA 5GIOE 3BTSA 1W4ZA 1UC4B 2Q3MA 3GFGA 3SVTA 4RZXA 3IS3A 2I4TA 4JGGA 1KQGA 1T5HX 2FCAA 3IB6A 1UOQA 3OPXA 3SF8B 5C7YA 1CUDA 2UZAA 4WKCA 4EI8A 2ZYVX 1VHWA 3EAGA 3JQPA 3WYFA 3B20A 3ONNA 4UZEA 4HMQA 1FJ2A 5FWAA 1E4OA 2HSJA 2VEDA 3BWEA 3LW8A 1GHTA 2N75A 1EXDA 1VBNA 2D6FA 1SEVA 3BGIA 4BQIA 1M6HA 4NOKA 4V3BA 3ZD7A 1LXCA 3U7QB 5TB5A 1E9DA 2Y1OA 3CUEF 3ETLA 4GLLA 1Z26A 1LJ8A 3OM8A 1T9KA 4Z9XA 3AB7A 4W82A 1B41A 4L4SA 2CHEA 1RTKA 1K92A 2GZHA 4MIEA 1B3BA 3ET4A 4NESA 2VHVA 4R40A 5SICE 4ZO6A 4W8OA 2F8TA 3V1KA 2Q3EA 1RI2A 4ENSA 4XSVA 2ADFA 4DLRA 3FNIA 1RKXA 2EBHX 1F8FA 1MJHA 3H5LA 1OF1A 1Z0FA 3UQYS 4HGQA 4DG8A 2L19A 3PB3A 2VDWA 3WC4A 1K5DA 3PQ2A 4ZOLF 3DLAA 4ZVMA 2H9AA 2BC9A 3I09A 3CN7A 4LYDA 4NBLA 1H2BA 5LP6C 3F7NA 2NU8A 1V47A 2AZTA 2SCUA 4B7ZA 3I9KA 1JR3D 3ZWWA 1P72A 3QU9A 1T4GA 4IMPA 3H86A 4UM9D 2ZZMA 1XX6A 3U4HA 3I2HA 5KOHA 4EG8A 4O02B 5LYJA 4BWYA 5HDBB 4IUDS 1RJWA 1N1MA 4XYGA 1C4WA 3V00A 3TFOA 3DO8A 5F2EA 1ZK0A 1U04A 1XA0A 3TSWA 5JDCA 2Z6VA 5KKNB 4BRUA 1NVKA 3ESQA 3OTQA 4X20A 3KKQA 3T3NA 5AJXA 1MX3A 1M2NA 2QJFA 2XDYA 2XGGA 4HWPA 4BIMA 3RYCB 3W5BA 1AKMA 2WF5A 4N5HX 8ATCA 5C53B 2XHZA 5THKA 4D80A 3U1TA 1QO7A 4LYYA 5GJWC 4LY9A 1JT2A 1ZMTA 2HCRA 3LWZA 1W581 4AQDA 1GRVA 1RHQA 3AV3A 5E1DA 3AR8A 5I7AA 4KAAA 4EG0A 3IXMA 2DQYA 3MTEA 4AKHA 1KFCB 4RZ2A 3JARA 4UHDA 1PDVA 3BMCA 1YOBA 5DWDA 3AVQA 3EDMA 3K1ZA 3LY9A 1UAAA 1OZHA 1FNMA 4JC0A 3ZV6A 3G13A 3I92A 3ZNPA 2VYNA 2QTHA 1NJFA 3IC5A 4DMKA 3M4XA 3AU8A 1D7AA 4I19A 1HFEL 4V0RA 1YACA 1QFJA 3IUBA 5SYMA 5FWXB 2AC2A 4PGFA 4MV7A 4X84A 1WEHA 1G21B 2AZ4A 2BEWB 2ZM6B 2WK1A 5KEIA 1DADA 3HJCA 3RSHA 3UM9A 4U3JA 4YXWD 2IHBA 2ON6A 1QVRA 3D6JA 3QTBA 3GFSA 4JBWA 2J1LA 3C3WA 2GZ2A 4GPTA 4UVHA 3TZKA 2M6SA 2NZJA 1TAQA 4JEMA 1QZTA 2WSBA 1DE0A 3DEHA 5FPPA 2W2VA 4JB2A 1TMKA 3HMQA 1LPNA 2LPMA 4NF2A 1J90A 2POCA 1OB2A 4KH0A 2I3BA 2C00A 5IVIA 1S2DA 1YR1A 4QNNA 1MRSA 3L4KA 3JQ6A 1MQ8B 2P7HA 2FY8A 1SA0A 2ZAYA 4M4SA 3TW4A 3TW6A 5AHKA 4EVSA 3AF0A 3K30A 2MYTA 3ZTWA 4Y2RA 5AW9A 1BWQA 3J81A 1P81A 3GWZA 1EHIA 3LX6A 2EARA 2IIQA 3L1HA 3RS8A 4EAQA 4CCWA 1CNMA 4RJLA 1YT5A 4DIKA 2PUTA 2Q5IA 5ALOA 5JS1A 3IALA 4UHHA 4H3HB 4LJSA 4QSHA 1ZCZA 3X2EA 2JAHA 3P9IA 4RPLA 2Q5HA 1YMVA 2R00C 2X8JB 4N1AA 4PC1A 4WZAB 4R1UA 2IW3A 2VSFA 3BC1A 4Z7QB 4D26A 1TKBA 1QVVA 3OM0A 3P97A 1T10A 1VLZA 4Z7JA 4PLYA 2JS7A 4Q34A 1R27A 5GGXA 1GV0A 3GQBA 3LC0A 3K1JA 1OH6A 4D1YA 1T4CB 2GN2A 4ITVA 3CUWA 3FTCA 4O8CA 2NXJA 4ZO4A 5CU7A 4WN9B 1XTTA 4BP8A 1Y7HA 4R0VA 4QOEA 4DNQA 2VTVA 4LS3A 1AKVA 3QYFA 1RPTA 2JFGA 3ENKA 3MD0A 3VSEA 1BXGB 3A6PC 3VVLA 1QIFA 2AZDA 4UDNA 3JTEA 1B00A 4INAA 1U7PA 2R7LA 1HQYE 5IEBA 3ZQKA 3AP2A 3KE8A 1KO7A 3AR3A 1S3GA 1E5DA 1TUBB 5K05A 5DP1A 1AQIA 3PC8A 4RQAA 4EO9A 1EH5A 1HDXA 1DAMA 3ENQA 4UTXA 2NWQA 2PD4A 1T3TA 2HSZA 3NFRA 4PONA 2G5GX 4CMIB 4EHNA 4WFIA 5B6JA 1KC3A 3C6ZA 4BEJA 1K0UA 4C0XA 1DRUA 2CFCA 2PSHA 4DPMA 3PTAA 1HFJA 5EP4A 2H1WA 1LPBB 4ISCA 4ZT5A 4U0KA 2P67A 3RRJA 1D4FA 2B7LA 3BGVA 3BILA 3CMMA 4DDUA 1KO8A 4PPYA 1ZEMA 4RLQA 1K0FA 3HU1A 3TKYA 2BR5A 1ZSVA 3QM1A 4XWGA 3Q72A 2PAAA 4G1BA 2P2DA 4O29A 1HOXA 2ZULA 3A14A 1RXCA 3BTUA 2O0HA 3GP5A 3IIKA 3LFUA 3AJ9A 3QP9A 3H2ZA 4L8GA 2HWXA 4PANA 3U3XA 5IUJC 1PJQA 4LPSA 3FRJA 4HYQA 3UV7A 1ZIXA 4I50A 3KTFA 4M6WA 3TI9A 3LUHA 4OYHA 4P31A 1TC1A 4NIMA 5DBEX 5COAA 1SUPA 2H1LA 5E3IA 3ZJ5A 3UH0A 2HEGA 1WW2A 1Q12A 3FY4A 3MCAA 4HC4A 4CIWA 1X1EA 3M3HA 1XRPA 2CL0X 3WK8A 2AK3A 4IHJF 4WN3A 2JIBA 4KMMA 4BMXA 6PFKA 4HDMA 4JH0A 2R11A 4H7PA 3F3MA 4J7AA 4XUGB 3I05A 1KYZA 5FXMA 4R1OA 2DPHA 1M2HA 1JA1A 4CEJB 4PX5A 2E82A 2P3SA 1TAHA 1II0A 1QZUA 4PSAA 2XNKA 3STTA 1EK0A 2O8FB 3DZ8A 4ZAGA 4BFYA 2O1WA 3DEJA 5AVWA 4H35A 4DN6A 2FUEA 4ZCQA 1TFRA 1ZK4A 4H2DA 3MBKA 4IJVA 5LP6A 2EEPA 1DAEA 1H3NA 2WJJA 3RC1A 1YE5A 4JK3A 4NH4A 3I9V1 4LMBA 1V1RB 4RH3A 1SOAA 3HY4A 3QVJA 2RHOA 1NP6A 1FMJA 2ONYA