3FCOA

Crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with benzamide inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
269
structure length
267
Chain Sequence
b'QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of novel di-substituted cyclohexylbenzamide derivatives as potent 11 beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 267
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3fcoA00
4YR9A 3IL2A 4IPTA 4E30A 4CMKA 1EE9A 1Y7TA 3KYDA 4XGIA 2WSBA 5DCWA 2OGUA 4YT4A 1I24A 2E6UX 4FJ1A 4P4NA 3FWZA 1H9AA 2W2LA 5IN4A 1YJQA 3HDQA 1P33A 2I66A 3KM0A 5TT1A 3VZRA 2Y1EA 4D3DA 4DIOA 3QP9A 4GGOA 3LU1A 4TZTA 4OH1A 4MKRA 1JKJA 2AXQA 2DBVO 4WCFA 3RAJA 2Q2QA 1E7WA 1KEUA 2IYOA 2VHZA 3F46A 4M1QA 5LDGA 5T67A 2JCXA 4A5OA 4CM5A 1E77A 3GF4A 3TZKA 4BNIA 2NV6A 1UDBA 4XZ3A 4U6QA 2V6FA 1MB4A 4W7HA 1PR3A 4JJFA 5F1PA 3GEMA 3CZMA 5IDYA 2RH8A 1Q2XA 5A9SA 2NNLD 1JKIA 2QRKA 3LT4A 4WCFC 3VDRA 2X6TA 4XJSA 4Y8VA 5A03A 5AOVA 1ZSNA 4CMAA 4TROA 2OP1A 4NBWA 1K6IA 4MINA 2ZJ0A 2JD1A 4DLBA 1RPNA 1B8PA 1A4UA 1EFLA 2JCVA 3DWFA 1N2SA 3VPGA 4BO1A 3WDSA 4BNWA 3F5SA 2OUIA 3Q3CA 5KJ6A 1PWZA 3PXXA 4YVFA 1H2BA 1KC1A 4XYBA 1JW9B 4BNZA 1J49A 1E6UA 4PG4A 2P2SA 4BKPA 1Z73A 3GGGA 4MVJE 2NU8A 3NJ8A 1GCOA 3GN1A 3WJ7A 2C5EA 5B4TA 3JD1A 3WGGA 2V6GA 3WLEA 1E3SA 3ZW8A 1UUFA 1JA9A 4KWIA 2QIOA 3UH1A 4KMSA 3UHAA 4ILKA 2YFHA 2VWPA 3GMSA 3R6DA 5F5NA 4JK3A 4MVJD 5A3VA 4F3YA 4R3WA 3H9JA 1SCUA 1HDXA 3B70A 2E82A 4YACA 1K3TA 1M75A 2J6IA 4XYEA 3DMYA 1O89A 2ZYAA 3NDIA 1BXZA 3A06A 2VT3A 4M89A 3IAHA 4RF2A 5DF1A 3OJEA 3WGIA 3NGLA 1V6AA 4GWGA 4DL9A 1K6XA 1DJNA 3ROQA 3BTVA 1SEVA 5CPBA 4CV1A 3BHMA 3L6DA 3OECA 5JXWA 1GAEO 4JGBA 1PJSA 1VC2A 4CUKA 5TJHA 1IHYA 1ZMOA 1E1KA 3ZWYA 2WYVA 1DFIA 4WOKA 5C7OO 4TRJA 1D8AA 2G17A 5FFFA 3HADA 3JQ7B 3ZN2A 2J5KA 7MDHA 3EVNA 3I9KA 2JHFA 2VQ3A 1DPGA 1OBFO 3GDOA 4DTIA 4LVCA 3E9QA 4FCCA 4IQGA 3GG9A 1LRJA 3DBHB 2CF5A 3GGPA 4UUPA 3O8QA 5DN9A 4Z9YA 3DZFA 3GOHA 1ZEJA 1PS8A 1KS9A 2ZTUA 3NKLA 3QQPA 4XQ9A 5A06A 1ADFA 3S1LA 1UXKA 4Z9FA 4BNKA 2J3JA 3HSKA 1PQWA 2EERA 4PLTA 4F6LA 5LDHA 3U49A 3I3OA 2I9PA 4YYZA 3C8MA 3CINA 1P31A 1PGQA 1IULA 4BNFA 3KEOA 5IXYA 4Y6SA 4YJHA 1F0YA 3INTA 4Z0TA 5F5LA 4N7RA 2ZB4A 4O63O 1CERA 1P1FA 2IDZA 2NTNA 3GUYA 1AN9A 4CLOA 2B4RO 1YGYA 4IDCA 2WWRA 3DZIA 1U8XX 1PGPA 3SBOA 3DONA 1UR5A 3SXPA 4RVSA 4CM4A 1YBMA 4FC7A 4K26A 2O2YA 2X9VA 4DRYA 4LN1A 4NHEA 3WS7A 1E7QA 4LMPA 4NPCA 3KXDA 4J43A 2GN9A 4O1MA 1GYQA 5A1TA 5IJZA 1LXCA 3DBLA 2NUAA 1GPJA 3G1UA 4OOFA 3JQ9A 3H5RA 3FD8A 4ZQGA 4YQZA 5JC1A 3QW2A 2GLXA 2YDYA 3H9QA 4WOJA 1ZK2A 4RF5A 5CEEA 2EGGA 4GWKA 4BNTA 2PD6A 1JVBA 3EW7A 4ESOA 3PRJA 1PJBA 4W6ZA 3PEFA 1DLJA 1R6DA 1U7HA 3KHUA 2JFFA 2BFMA 3ZWNA 1T24A 1X1TA 2CSUA 3LQFA 4TQGA 3GZNB 1MP0A 4Q39A 1C0LA 1QV7A 3GDFA 4L73A 5DCUA 4DWVA 5IXSA 1XU9A 4BVAA 3AK4A 4PG7A 1YDWA 4KDEA 4ALLA 1H94A 5CDYA 5K6AC 5L95A 3TFOA 2NU6A 4BQPA 1Y5RA 4GAEA 4BKOA 4MVJH 1TT5A 2ZTVA 1ZUD1 3I1JA 4IJKA 4OMUA 5G0VA 1HSOA 1NPYA 4UEJA 3TL3A 4HFJA 1XHLA 4WCDA 1PGJA 1ZIDA 1E92A 4PZEA 3TDKA 1HE5A 3RUIA 4EI2A 3I23A 4GL4A 3RSHA 5EESA 1KEPA 1VSVA 3N58A 2B83A 3JYOA 1DOHA 1A9ZA 3FF4A 4FW8A 2XXBA 1YH3A 4MKXA 4TWRA 3PFWO 3M2PA 4MJLA 5AYVA 4IDDA 3BYZA 4D44A 3V5NA 4XRGA 1YB1A 3FNFA 4O5OA 3K92A 1A71A 5JAQA 1V3TA 1MC4A 1OAAA 1H6BA 1SOWA 4J16A 1N92A 4WLOA 4CM3A 4CM8B 4WLNA 5B4UA 1LDEA 2VZ8A 3V2HA 4AJOA 2GZ3A 2WD7A 1BW9A 3GY0A 5AVOA 4RPLA 4J9VA 1Y6JA 5JO9A 4NJMA 4D3SA 4ZA2A 4B4WA 4FR5A 4Z0HO 3DZJA 3PGXA 4KZPA 2ZB3A 3A9WA 2IZ1A 4LSMA 2VOJA 2X0JA 2QG4A 3F47A 2GR9A 4PGFA 1N9GB 5I9MA 5A9RA 1PZGA 3CH6A 1M67A 2FR8A 4NQZA 2OOSA 3INGA 2CDAA 4MP3A 4ALNA 2NTJA 2FRDA 3RKRA 5G0UA 5JPIA 1DFGA 1PEDA 3LZ6A 1BVUA 5KJEA 1FF9A 1L7EA 4GKBA 4LRTB 5HBRA 3LSYA 3TN7A 4ZQEA 2DTDA 5KVSA 4LCJA 1MFZA 4I8XA 3GLQA 2HDHA 1O5IA 3FNEA 1GR0A 2GO1A 5A9TA 3A28A 4CMIA 2GF2A 3S2IA 3FI9A 2P5YA 1DC6A 4R16A 4UVDA 1C14A 1ZK1A 3E9MA 5JMPA 4JP2A 3TZ6A 3PHHA 3F1KA 4R1NA 4U7WA 5B12A 3DHYA 5EQFA 2PWZA 1ENYA 1BGVA 1PJ2A 3HFSA 4M8SA 4WGGA 3ASUA 3LT2A 4IGEA 1CRWG 3T7CA 1UAGA 3UCXA 3M2TA 2VHVA 1TT7A 4N54A 1JN0A 1M6HA 2HU2A 4UVIA 1P9LA 2NVUA 4LMRA 5KJ1A 1LDNA 2PTGA 1WZIA 4BO5A 2BFAA 2BFOA 1ORRA 4YQYA 4N5NA 4FFLA 5EPOA 4EYEA 2P9CA 1PJ3A 3ZV5A 4AJPA 5GZ1A 3GNTA 4RQTA 1QORA 4QUKA 5T8KA 1R0SA 4FOOA 5EJ2A 5JE8A 1SAYA 4B8ZA 1H6AA 2YQ5A 1T1SA 3KUXA 1FDVA 4MVJM 2QZ9A 2UAGA 1K89A 1V8BA 1E3WB 3OFSA 3PIIA 4YAGA 1XCBA 1EE2A 3BMQA 4AJJA 5G0SA 2W90A 3MWEB 4CLRB 3JQAA 1M6WA 3ZHZA 1WNTA 3VAZA 2GSDA 3SLKA 2PKRA 4NNJA 1L1FA 3EUWA 1YBAA 2OORA 3BMNB 2NTVA 4MPDA 1NHGA 3KBOA 4PLHA 3HG7A 3ONEA 5T8KC 3GN2A 2P9EA 1NHWA 1UXHA 4IZIA 2D5CA 4P38A 1XLTA 1I2CA 3V1TC 3G0OA 3NEPX 3JYLA 2GUGA 4E2ZA 4E3ZA 4XQGA 4YDRA 2IXBA 3W4IA 2NLOA 4FC6A 2UUPA 3TWOA 2FPPA 5B4VA 5HS6A 3GQVA 4A10A 3IDSA 3PQDA 5A05A 4E12A 3SC6A 1CQJA 4PVDA 3ZWWA 4ZJUA 1OMOA 4D43A 3BTOA 2X58A 5IDXA 2RHRA 4OHUA 3SJ7A 4Y67A 5JCJD 2YDXA 2QQ5A 2WE7A 4IGFA 4MIEA 1GPDG 3RU9A 4BKUA 4YJGB 3G1TA 4A27A 4ZGWA 7ADHA 2D1YA 3PWSA 3W4KA 2CUKA 4XB1A 1X14A 2DBQA 3JQ6A 3Q2IA 3KETA 2FPIA 3CEAA 4RORA 5C7LO 1SPXA 2P68A 4R5MA 4Y98A 3DZGA 1T2FA 3AM3A 1DAOA 4CQLA 4F45A 1PJLA 2PV7A 4DQXA 1E1NA 5A5FA 4UEKA 3W6UA 4GX0A 4UUOA 2EW8A 4JIGA 5KNLA 4EBFA 3WYCA 1OFGA 3D4NA 2B69A 1PJ4A 1QV6A 4IMPA 3WG9A 1KVTA 3JD0A 3H3FA 4ND5A 3GH3A 3AM5A 1C1XA 4ZICA 4AG3A 5CDSA 2GYYA 4OIMA 4WJZA 1PJQA 3KO8A 1HTBA 1OOEA 2YHIA 3IJPA 4B8WA 1MX3A 4ONEA 5JLAA 4CLEA 2O7SA 1R0KA 4E32A 3PHGA 1TEHA 1SMKA 4HNHA 1H93A 2R2GA 3RVDA 4Q3BA 3OEYA 4PVCA 4IY1A 4UUMA 2DT5A 4DUPA 2O48X 2GPTA 2HCTA 5U1PA 5EQDA 1K6JA 3PYLA 4E2WA 2GNAA 3FBTA 4MVJP 2FZWA 3BTUA 5BNFA 4OXYA 1I10A 1P3DA 2DC1A 2ILTA 3RC2A 1PZEA 3KYCB 5JDIC 4L74A 2B5VA 2ZK7A 3F3SA 4YAIA 5JSFA 4L9RA 2Q50A 3JTMA 4CMCA 1FXSA 3BTSA 1GFSA 1PZHA 2YV3A 1KVQA 1D1TA 4A2CA 5I7VA 3MJSA 2HLPA 2JJYA 4DIBA 3T7EA 2VRCD 5JNLA 1HDYA 1ZSVA 2QYTA 1XYGA 3JQEA 1KVUA 1UP6A 1U5CA 4PRLA 1HE4A 3JQ8A 2WTBA 3ZU2A 4B4VA 1B7GO 3ZV6A 2Y67A 3OBBA 2C07A 3ZGYA 2VOEA 4CMEA 4X54A 4TRMA 4ND1A 4L0QA 4RVFA 5FWNA 2ZTMA 1GZ4A 1MXHA 4BNYA 3E03A 1YQGA 2X0IA 3OJLA 4ND3A 2OHXA 4IIUA 4PLVA 5DOVA 4P4GA 3MZ0A 4BL5A 4EITA 1NM5A 3OIDA 4R1TA 4AFNA 1HYHA 4PLCA 3F1LA 4OM8A 1LLQA 3RC7A 1EVIA 3RUFA 3I52A 2GGSA 4M86A 4XJTA 3TQHA 4DPLA 4PLWA 4YRAA 1ENPA 4YJFB 3DBRA 4NU5A 5JY6A 4EJMA 1B14A 4E13A 3DZBA 4J1QA 3DQPA 3FR8A 2ZKLA 1NXQA 3H6KA 3L77A 1MUUA 3KZVA 1FDWA 5L3ZA 3TOXA 3SVTA 2J3KA 4IM7A 5BR7A 3QHAA 4KTVE 2ZATA 2P5UA 3ROKA 2HMUA 3OIGA 2NU7A 1ZXBA 1ZNQO 3UN1A 1U7TA 4CV2A 2YQ4A 1I3NA 1NYTA 2OL4A 1YWGO 1HZZA 1N1EA 3P19A 1EUDA 5F21A 3D3WB 4ZVVA 3ZNPA 4BMSA 1SBYA 1E1MA 3E8XA 1GQYA 3ZV3A 1IHXA 4OKIA 1EK5A 4MVJG 3U4CA 1ZBQA 4IDEA 4W99A 4RZHA 4XR4A 3PIDA 3VH2A 5DDIP 1VL8A 2DAPA 4IDGA 3AY7A 1Q7GA 1QG6A 4MVJF 3R1IA 4IDAA 4W4TA 3VPXA 1W0CA 1W73A 2Y1CA 3DXFA 3PYMA 2G5CA 2QZZA 4AJ1A 3FTNA 4A0SA 3HQ4O 4O6VA 1UJMA 1LTHR 1HL3A 4MVJA 1MLDA 1ADCA 4UVGA 4DYDA 3RUCA 4BNGA 3MTJA 1JDJA 4E5KA 3S2GA 2EF1A 3U4DA 1HETA 1H2HA 3H8VA 4WCFB 5F1KA 1I5RA 2ZYDA 3E5MA 4GKVA 3RUAA 5JC8A 4CL8A 4FD3A 1PL7A 5I7FA 5KIAA 3C7DB 1QXSA 4CL3A 2VWQA 4OXNA 2GD1O 3R0IA 1P0FA 3W8EA 5G0WA 4NU6A 3S55A 1A9YA 3UW3A 1BXKA 2YHUA 4Z3KA 1OC2A 2OXIA 3B1FA 1P44A 5F3RA 4RF3A 3L4BA 3SC4A 1UZLA 2AE2A 3A14A 3IP1A 1B2LA 1A72A 2WEKA 3G3EA 3GT0A 3NT5A 4MKZA 3RD5A 2CFCA 2J3IA 4AVYA 3NV9A 3EYWA 3ICPA 5TSDA 4BQRA 3ANNA 1NTOA 5JDCC 1ML3A 1RWBA 4KWHA 1R16A 4RPKA 1GUZA 4E2XA 3EHEA 2VTDA 3W4JA 1NASA 2W2KA 4B3JA 2POQX 2O4UX 4EZBA 3TPCA 3PHIA 3VZSA 3ZHBA 1YQDA 3GAZA 2VYND 3L4BC 4JROA 2I67A 3QJ5A 2FR1A 1WW8A 2B35A 3WOHA 4E21A 4J90A 3RUDA 4IBOA 1PL6A 2ZTLA 1IPEA 1XR3A 1NR1A 5C3MA 4FN4A 3TZCA 2A94A 3RCBA 4E5PA 3HDJA 1QLJA 3LC1O 1IY8A 1MA0A 4LSWA 4XYGA 3E48A 1XSEA 3KSDO 3NTQA 4BS9A 1JVSA 3LLSA 3JD2A 4QFDA 3ZHXA 4D7AA 5KVVA 1A7AA 3ZI0A 2BLLA 4E0BA 4CPDA 1QYCA 3ZNQA 3OA2A 3WGZA 3MJTA 3GRKA 5THKA 1R4NA 1DC3A 3A1NA 2DU8A 3BAZA 2EP7A 3AOEA 2GZ2A 3CZRA 4BHTA 1KY4A 5KOIA 3NDJA 1F12A 4NFSA 2RAFA 2QHXA 1YJ8A 4U5QA 1E3LA 4L4XA 4QXMA 4JQCA 4RLSA 3OJFA 4XWYA 1I8TA 2Z95A 3G79A 4B4OA 2NU9A 5TX7A 2EEZA 3AM4A 1QLHA 1X7DA 2J8ZA 4M55A 4A26A 3I9JA 2D5AA 2H5LA 1ADGA 3BMOA 4URFA 4I08A 2X1HA 1ENZA 1UH5A 1WWKA 4RO0A 2FMUA 2FOIA 1V3VA 4JXKA 1M76A 3WTBA 2PGDA 2Y1DA 2J5QA 2VHYA 3EVTA 3O8QB 1ZEMA 1GTMA 5LCXA 1EBUA 4FPXA 3U09A 3ABIA 1N1GA 1RM5A 4G2NA 2C0CA 2HRZA 4GVLA 4FOSA 2HK7A 2DQ4A 2PY6A 2BMAA 4ZD6A 4YJHB 5G2OA 4TVBA 3ZWXA 4BNUA 1VE9A 1UXIA 1I3KA 1DIGA 4PIVA 4R3NA 4E6PA 3PJDA 3VC7A 5TLSA 3ZWMA 1NFRA 1O94A 2Q4EA 3WQSB 1NVMB 1RYDA 1PJCA 3GGOA 4CM4B 2IE0A 2YFQA 4RL6A 2VWHA 3HNPA 1U2DA 2B4QA 1EVYA 4Y6PA 5HRUA 5J23A 1NFQA 1R4MB 2P9GA 2EP5A 4CLDA 1DLIA 2NM0A 3DBLB 1Y8QA 4CM6A 3RFVA 1WMBA 4I1IA 4J9UE 1BDBA 1PZFA 5TQVA 4MO2A 5G4LA 3TZHA 3WMXA 4BO4A 2C7GA 1ISGA 2UV8A 3KEQA 4YAKA 1HLDA 1EEHA 1H5QA 3DFUA 2WD8A 1EVZA 4FJ2A 2CMDA 2EW2A 5L9AA 4U6SA 1DRWA 2DBZA 3NT2A 3QWBA 1YVEI 3B20A 3D0OA 1UZNA 1GUYA 2NSDA 1FDUA 1WPQA 3TZQA 1WDMA 3CXRA 3IQDB 3NGXA 3QWAA 3PVZA 3UF0A 4B7XA 4XDYA 4A03A 4WECA 5A04A 3X2FA 1J5PA 4JNKA 3E9NA 2DTXA 4CUZA 1Y9EA 1PQUA 2D3TA 4E31A 3GPIA 2CDBA 2X7HA 3V8BA 3F4LA 1K2WA 2NACA 3H5NA 2WJPA 2F1KA 3QVWA 4R69A 3PJGA 2C29D 4M87A 3ROMA 3GEGA 1HSZA 4J7UA 2Y99A 3EZLA 4MOWA 2AW5A 2W4QA 1M66A 5L4SA 1FDTA 2WMDA 4BNHA 3QSGA 4G65A 5L4NA 1LU9A 1VJTA 1P74A 2FZEA 4CR8A 1KOLA 4CR7A 1J4AA 2QX7A 3DO5A 1BRMA 4IJWA 4L75A 4ND4A 1IZ0A 4C4OA 1AE1A 1KVSA 1NX6A 1P1HA 2Q46A 3ANLA 3JSAA 1I3LA 3AUUA 3OJOA 4J2HA 1G6KA 1BMDA 1TB4A 2NQ8A 2YY7A 1E7MA 4GH5A 9LDBA 1YKFA 3RFXA 2GASA 5COAA 2FSSA 3JYNA 5I8WA 4U0JA 1Y81A 2Q1SA 3EK2A 4MIOA 4BB5A 2C2YA 3WBBA 2I3GA 4BO6A 3CUKA 1FK8A 3HB5X 5L7YA 3JQFA 4DYVA 1JU9A 1K0UA 1LQUA 3FSRA 4R54A 3HDYA 3PLRA 2FP4A 3ZU3A 4TKMA 2HAEA 4FSHA 3DTTA 4CV0A 2HK9A 4LW8A 3U4HA 5IF3A 2WD7B 3DFZA 4XEHA 1GZ3A 1VSUA 4ID9A 3M1AA 1F06A 1Z7BA 1WAMA 1HKUA 4HFNA 3NRCA 1E5QA 1HDGO 2O50A 3OA0A 3QWFA 3K2BA 3ASVA 2AE1A 2I99A 3B6ZA 3GVHA 2AQIA 2JKVA 3OP4A 1MG5A 3WQQA 1JKFA 2NWQA 4XD2A 3WXBA 4YPOA 1DIAA 2BKAA 1IYZA 5DOZA 2HUNA 4XQCA 4DQUA 3LYLA 2I5PO 5JW6A 4FS3A 2BI7A 2X8LA 4ZN6A 1LDMA 4S1VA 3N74A 4D0SA 5CP8A 5JAZA 3JQ9C 3VVCA 3P5SA 3TOZA 5HM8A 1DRVA 3IS3A 4W7IA 3D1LA 5EL0A 5C37A 1BVRA 2Y1OA 5JBIA 1EK6A 4CM1A 3QVOA 2IXAA 1T1RA 2FWMX 3OMLA 4CJXA 1EDOA 1PTJA 4GX2A 5IDQA 2HJSA 3NX4A 4LRSB 3MJVA 4J2OA 2JAHA 4WNIA 5KTKA 4WUVA 1EQUA 1ZMTA 4I5GA 3HZZA 5I8ZA 3JQ7A 5H83A 1Q1NA 2HMTA 3BA1A 2H6EA 1JAXA 3DBHA 3VDQA 3GVXA 3OICA 1NFFA 2DFDA 3I83A 4XYMA 5HA5A 4INAA 5KCZA 1B8UA 4U8GA 3GG2A 4RDHA 4H3VA 4WKGA 3WWZA 2C20A 3VOSA 3Q6IA 1N7GA 1S6YA 1HT0A 4CLHA 1GCUA 2E4AA 3ENKA 1CYDA 5TC4A 2ZQYA 1AXGA 2WM3A 1X0VA 4FGWA 4ROSA 2G82A 4RV9A 3GPDG 2VNAA 1S7CA 4DPMA 1YL6A 2O4CA 3ORFA 1HXHA 2EGHA 4BGVA 1QYVA 5FI3A 1LC0A 3QVTA 3QY9A 3VPFA 1CJCA 2Z1MA 2B5WA 1GU7A 1Z74A 2J5RA 4ZRNA 4AICA 5BQFA 1QRRA 2HO5A 1HE2A 4ALJA 1RYEA 1EDZA 1YOVB 3S2EA 4KUHA 1X0XA 3H4VA 1BWSA 3I6IA 5T6BA 2RBEA 4LK3A 2RCYA 1CF2O 1X15A 4JBGA 3VPHA 3NYWA 2FPGA 1PIWA 3H2SA 3JYQA 4IS2A 5FEUA 3DMTA 1Z7EA 4OKNA 4A7PA 1IOLA 2P4HX 2AQHA 4PLYA 1XDWA 3SLGA 5JS6A 4CM9D 3AFNA 3I9NA 4AJKA 1J6UA 4J4HA 4BMNA 1SB8A 3GC6A 5G4KB 1FDSA 1AUPA 1VM6A 2VRCA 4M54A 4BNJA 2Z5LA 3GFGA 8ADHA 2PA3A 4PZDA 3ZU4A 1E5LA 3ONFA 3RIHA 2PZMA 2VHXA 3NTRA 1XA0A 3V1YA 3IKTA 2DPGA 5TT0A 3D5QA 5IDWA 1A7KA 1G0OA 5KKAA 3Q1LA 1QYWA 5CG1A 2ZJ1A 3TSCA 1N8KA 2NVWA 1U2GA 4CQLB 4R01A 1Z82A 3RU7A 1B16A 2SCUA 4ALKA 4NG5A 4JJIA 3DZKA 3AWDA 3EAGA 4NBTA 4BOYA 2C82A 2JD2A 4RPJA 4CMJA 2Q1TA 1JWBB 1SZJG 2X9GA 3A4VA 4Q3AA 3PFFA 1PWXA 1PJTA 1SNYA 1PS0A 1WDLA 4I5FA 4P4LA 1D3AA 4RPHA 5BSEA 5G0TA 5H81A 4PN3A 3O26A 1TVEA 1Q7BA 3ETEA 1B26A 1YBVA 2WYUA 3SEFA 3JQGA 3OIFA 3ULKA 3E1KA 3DC2A 1YB4A 3I6QA 3ROPA 3LC7O 5B37A 4B79A 1I3MA 1N9GA 4O59O 1K5HA 2EJWA 2JAPA 2ZB8A 1XKQA 2ET6A 3AI1A 2C2XA 4NMHA 4OOEA 4H16A 4HADA 5EMHA 4GVXA 5EN4A 4D46A 1MG0A 2VYVD 3O03A 1A5ZA 3CMCO 1BG6A 1P45A 1RKXA 3UCEA 1Z6ZA 1LSUA 1U3UA 5TF4A 4QO7A 4ZRMA 1LJ8A 1EFKA 1N7HA 2DUWA 2NADA 3COSA 4NI5A 2AEMA 4BUCA 2EJVA 3LF1A 4R9SA 4CM7A 1B3RA 2EKPA 2VT2A 4GQAA 3WGTA 4CQMB 1ARZA 4Q3NA 2H9IA 3NAQA 5JY1A 1O95A 2OFPA 2Q4BA 4NFYA 3RUEA 4AJIA 4EDFA 3GHYA 4PFJA 2VN8A 3VZPA 5IZCA 5IAAA 1NWHA 3QWIA 3FPCA 2BGKA 4PLZA 4B7UA 5ADHA 1XG5A 4BO2A 3LT1A 1Y8RB 3PTZA 5KJCA 4Y6RA 2VNSA 2Q2WA 4BO0A 2VUSA 2BRUA 4QECA 3WWYA 1ZW1A 3VH4A 1Q7CA 2VRBA 4J3FA 3C1AA 2Q1WA 2WYWA 4D3FA 1VKOA 2D0IA 4E5YA 4O0LA 2EG9A 4W82A 3K8ZA 2DBRA 3AU9A 3DB2A 3H65A 2D2IA 4D42A 1ZK0A 1Q0QA 2O3RA 2RHCA 1GQ2A 4IDFA 4XIJA 5EIOA 1XGKA 4HBGA 4XGKA 1UP4A 5JAIA 5FF9A 4BGUA 2BH9A 4XIYA 3Q9UA 5CEJA 1G0NA 1LQTA 2AG8A 1U3WA 4E2YA 2VYNA 1I01A 3RJ5A 4YXFA 2G76A 3I9LA 4FFPA 3NJ4A 5CEFA 2FN7A 5K0ZA 3M1LA 1LLUA 2O23A 4BNVA 4HX5A 4PRKA 3INRA 1D4FA 3AUSA 2QRJA 2A35A 4IXWA 3AY6A 2CVZA 4J7XA 2B4TO 1U5AA 4IIVA 1PX0A 1BXGA 1P1IA 3BXXA 4FBGA 4RVDA 1CEQA 4N18A 5BSHA 1HEUA 3DTYA 1ISHA 3KYBA 1CWUA 5ES3A 4PG6A 2YYYA 3WNQA 3CE6A 5T5QA 4ALMA 1B15A 1JLLA 4BO3A 4AJLA 3QIVA 1U3TA 4WEOA 1P0CA 4WE3A 2C54A 4II3A 4R5HA 1T2DA 3OF2A 4XDZA 4DVJA 3QV1A 5JMWA 1E7RA 3OM9A 5HWSA 1CIVA 1V35A 1OC4A 1T4BA 3NDRA 4YJGA 1NPDA 3IOYA 4UUNA 1GQQA 4JN6B 2Q99A 4KUEA 3HE3A 1I36A 3JV7A 4HKTA 1HYGA 1LDGA 4BNXA 1YS4A 2FSVA 4Z9XA 3UXYA 1E1LA 5DBIA 4YT8A 3GMDA 2HK8A 1DDOA 2X5JO 4CMEC 4JX8A 2ZQZA 2P91A 5GZ6A 1IB6A 1HRDA 4L8VA 4AJEA 3P2OA 3WLFA 4IZHA 4DMMA 2O3QA 5T64A 3HB4X 3IC5A 2VZ0A 2B0JA 3ZWOA 1B3BA 1KYQA 3MTGA 1SO8A 3AU8A 1UDAA 1AHHA 1XQ6A 3FHLA 1KIFA 1SB9A 3PHJA 1RM3A 2JHGA 3W8DA 3L6EA 4DBVO 4Z0PA 4BKQA 2Q2VA 3GUCA 3JQBA 3V1UA 2DPHA 5HTOA 3IP3A 1C1DA 3FR7A 2BD0A 3BIOA 3KYDB 3PGJA 2O3SA 2V6MA 4RVGA 6LDHA 4II2A 1O9BA 3UOGA 4LGVA 3WGOA 3CKYA 3C1OA 3DEYX 3KRTA 3WMWA 5JCXA 4BO9A 4BGIA 2D4AA 2X0NA 4ALIA 3KLMX 3ZDFA 4KOAA 1LA2A 1WMAA 2Q1UA 5FYDA 1O6ZA 3WSVA 4QO8A 5I9NA 3IUSA 4UREA 1KVRA 3KYCA 4H7PA 1ULUA 1LNQA 3ZNOA 3FN4A 3WB9A 4UVHA 2TMDA 3BMCA 2A92A 1DFHA 3CSDA 2ZCVA 4R4JA 2UUOA 4J91A 3M6IA 4KQWA 1GDHA 1XELA 3JYPA 4QX6A 3S8MA 1XU7A 4FFOA 2A4KA 2PK3A 4JBIA 3E6AA 4WEQA 3PHLA 5MDHA 1ZXLA 4GPD1 1I2BA 5A9SB 2PKQO 5KKCA 4J7CA 1HDRA 5HS4A 1YXMA 1VRWA 1GYPA 4WK6A 5U9CA 4JP3A 3P7MA 4BNMA 1T4DA 2XOXA 2Y0CA 2GDZA 2Q45A 3FNHA 4RZIA 5GMOA 4EUHA 4DMLA 3WIDA 3ANMA 4AJHA 4QQRA 3Q9NA 3L9WA 5TIIA 4FFRA 3CPSA 1E6EA 5DBFA 4JCOA 3S2FA 2AEFA 4DPKA 5AXDA 1UDCA 4YJFA 5KJFA 1MXFA 3DHNA 1HLPA 4GMFA 5DP1A 4TRNA 4R68A 1MGOA 1QSGA 1AXEA 4OSOA 3IUPA 1ONNA 3GEDA 4GX5A 4NJOA 5ITVA 4OQZA 2C5AA 2V65A 4DLLA 3RKUA 3RUHA 4E5MA 2PZJA 2AG5A 3D3WA 3OQ6A 4BO8A 3C1TA 3FBGA 1Q0LA 1WZEA 5FI5A 2LDBA 5CAEA 2OMEA 4ND2A 1ENOA 4J1SA 5CDGA 5DULA 2GRAA 1EUZA 3X2EA 4PG8A 3WGQA 3WYBA 5T57A 1O8CA 4IS3A 2W8ZA 4TMFA 4YTEA 2H1SA 3JCZA 2X86A 3RASA 3NUGA 4J4BA 4FFMA 3ITKA 1QKIA 3DAPA 5EINA 2CVOA 4DREA 4QT0A 3LC2O 1E7YA 4YT5A 4B3HA 3RI3A 1ZJZA 3K31A 5JAMA 1ZO8A 4FGSA 4J6FA 3LT0A 4LISA 4CMGA 1RM0A 4HP8A 2RIRA 1XQ1A 5A02A 1X13A 3I9MA 2PFGA 4RGBA 3K2EA 1XIVA 1E0DA 2PGJA 4CQMD 3PI7A 3AOEC 1ID1A 3D64A 1HWYA 4YWJA 3GVCA 3LVFO 4DQVA 3U62A 4K1LA 4GMGA 4OQYA 4UAGA 4M49A 5ICMA 3OQ1A 1YDEA 3LF2A 1C0IA 4WLEA 4CODB 5ILOA 2I3AA 5GZ3A 3W8FA 3OETA 4WNCA 5DCYA 2HMSA 4JLWA 2E48A 3AUTA 5ENDA 3AW9A 3GZ4A 5TJ9A 3I9OA 1NQAO 4CLOB 4XA8A 3GNQA 2R6JA 1SC6A 1VI2A 1ZCJA 4HWKA 1U3VA 1GV0A 4RDIA 5TRTA 4RVUA 2D59A 3CIFA 3TRIA 1LX6A 2J3HA 4CMBA 3PJFA 1HYEA 3GVPA 3HJAA 3F4BA 1NPTO 2DTEA 1ZK3A 3DOOA 5JYDA 2V6BA 4YT2A 4NZ9A 4N5MA 1R37A 3C85A 4GX1A 4KTTE 4PZCA 3RBXA 2WDZA 1DRUA 1FMCA 1UP7A 3PZBA 4OSPA 4MP6A 5L45A 4DC0A 1F17A 1WP4A 4KDFA 2EIHA 3UAGA 4I5DA 4CMHA 4FJ0A 4PLPA 3W1VA 2VTEA 2CD9A 3NT4A 2PKQP 1YQXA 1G1AA 1DB3A 4DXHA 1PS9A 1IPFA 5L53A 4RVHA 1HDCA 4K28A 3PLNA 2G1UA 4HUJA 1ULSA 3TNLA 3WIEA 1Y5MA 2HRBA 4HFMA 1ZH8A 1GADO 1BTOA 1VL6A 1DC4A 4IJVA 4IJUA 4NBUA 4ZQHA 3PP8A 3U5TA 3IJRA 3MWDB 5IFLA 1H0KA 4MVJI 1ONPA 4WASA 1TT5B 2I6TA 4RCVA 5CHEA 2ZIZA 5K9ZA 5JCJA 4RJTA 5LC1A 2D8AA 5DP2A 1EQ2A 3VTZA 4CM9A 2E37A 2QRLA 3UCFA 1PGNA 1YONA 2WE8A 1VJ0A 4IQ8A 2A9FA 3G49A 3ZCXA 1PGOA 1ZK4A 1UAYA 1ADBA 3OHSX 1U4OA 1DIRA 2CNBA 2Y1GA 1V3UA 4F6CA 1ISFA 1DAPA 3P2YA 4HNGA 1KY5A 2C7VA 3K6JA 3DDNA 4HXYA 3PK0A 5IN5A 4QSMA 3UVEA 4L4SA 1V0JA 5ENVA 3ZWVA 3ZHYA 2OZPA 3H5AA 4XRRA 2F00A 3KTDA 2PH5A 4AJNA 1ISIA 1EVJA 2XPCA 1NWCA 3PQFA 2HKIA 2Y66A 4WLVA 4Z3DA 5ILGA 3TJRA 4Z6KA 3ZWAA 4MDHA 4IINA 1PU2A 2GN8A 5F1OA 2X5OA 1BW9B 1AHIA 3E5RA 4OL9A 3MEQA 4ZU3A 1GL3A 4NJMB 3BHJA 2V7PA 4LCEA 4WPGA 1LRKA 5COQA 3U9LA 3L4SO 1U4SA 2Q3EA 2IZ0A 3T4EA 1YO6A 3PZRA 1R4MA 5BT9A 4YRBA 3QVSA 1DHTA 3JQFC 1Q0HA 3E18A 4PLGA 4ZQFA 2IYPA 2W2LD 4XB2A 4EEZA 4J0EA 2UDPA 2UVDA 3I5MA 1PQPA 1YL5A 2PR2A 3IKVA 4WLFA 2BFPA 5K6AA 1KC3A 3R3SA 1X1EA 3ZH2A 3WSWA 3ENNA 5A3JA 2CZCA 1NAIA 1ONOA 1KERA 4MP8A 1HZJA 3QRWA 4Q3EA 1D7OA 4B3IA 2DFVA 4BV9A 4S3MA 1F14A 3LK7A 1E7SA 2EKQA 1O0SA 3ONDA 2Y93A 4I5EA 4XX0A 1DIHA 2DKNA 4BGEA 2X0RA 6ADHA 3EDMA 1LC3A 4NBVA 1UXJA 2VYVA 3C3XA 3GFBA 3HN2A 4J1NA 3N7UA 4PLFA 3V2GA 3ETDA 5KVCA 4CMIB 1QP8A 1U8FO 4JBHA 5TNXA 2CVQA 1E3EA 3C7AA 3KOUA 1HE3A 1NVTA 3QE3A 4YAEA 3VZQA 1LSOA 1P1KA 3DOJA 3H2ZA 1PSDA 1P1JA 3W6ZA 1UXGA 5AXAA 3H3JA 4IUYA 1Y9AA 3F6YA 4NK4A 4WLUA 1GD1O 1TLTA 4OGWA 3L0DA 4TSKA 3SJUA 2NVUB 4BO7A 5JO0A 1IE3A 3C7CB 3D4PA 1YL7A 5KWEA 2XF8A 3RQSA 3H9EO 5L40A 1YRLA 4EJ6A 2Y0DA 1C3VA 1NP3A 3EMKA 1QMGA 5C7IO 5DNAA 1LEHA 1JTVA 1LDYA 4RLHA 3R3JA 1I33A 1HDOA 2X5KO 1XEAA 5I7SA 3MCVA 2X23A 4HY3A 4I9HA 3BMQB 4DBZA 3ON5A 2ZCUA 3JQAB 4E33A 4B4UA 3K73O 4I9UA 2OBNA 3ZW9A 1CQIA 3C24A 5TGDA 1DC5A 1T25A 2DUUA 3I4CA 4TZKA 3ITDA 3JD4A 3TL2A 2HJRA 1I32A 1XWFA 3E82A 3EY4A 3PJEA 2PZKA 4RQUA 5JYEA 2FHSA 3JQGB 4MIYA 1MV8A 1NVGA 1OI7A 5A4DA 3GA0A 3O38A 4OAQA 1R0LA 2AA3A 2JFHA 4R1SA 3WQRA 4EJ0A 3GZNA 3PQEA 4H15A 1EMDA 3GRPA 3QLJA 4KQXA 4UEOA 1WDKA 2IRWA 3B1KA 4G5HA 1SOVA 3STHA 2E49A 3LLVA 3UKOA 3Q0EA 3AFMA 3WYEA 1ZSYA 4TRRA 3BHIA 3EGOA 1DIBA 3K96A 4ITUA 3G17A 1U1IA 5IZ4A 5ITWA 3UGKA 1EBFA 2DLDA 3I4FA 2OO5A 5CDUA 5A5EA 3DMTC 3HDHA 4GI2A 4NK5A 2QW8A 2X9NA 4J1TA 1T26A 1ZZEA 3Q2KA 5KVQA 3RROA 1BDMA 2DM6A 1QYXA 4PCVA 1H9BA 4IQ0A 3VH1A 1VLLA 3CTMA 3MJEA 3DOCA 3ZWBA 4J49A 3FCOA 4OO3A 4UULA 3IMFA 4CR6A 3DHEA 2QYSA 3HWRA 3GK3A 1T2EA 2GERA 1ISMA 3MOIA 9LDTA 2DVMA 1C1XB 3FTPA 1F8FA 1VKNA 3DL2A 3K30A 3VKVA 1JWAB 1U28A 3AI3A 1CDOA 1TXGA 3PWKA 3U0BA 5BSFA 4NIMA 4KP7A 3HUDA 1W8DA 3JQDA 4CM8A 5JFOA 1ZJYA 2YHIB 4QFCA 3OEWA 3B1JA 1LSJA 3WFJA 1PR9A 5C5IA 5L51A 3ZWPA 4HV4A 3GDGA 4GBJA 2CF6A 2IZZA 2VUTA 3RJ9A 3WICA 4B7CA 2BF7A 2VWGA 2G0TA 3ICCA 4YB8A 3TFQA 1WVGA 4D41A 4FDAA 2HQ1A 3L9XA 3F5QA 1B0AA 2EXXA 4G81A 3VHRA 1R66A 2LDXA 3OSUA 1LI4A 2FR0A 3DBVO 2EKLA 3U4IA 1VPDA 3WR5A 4NBRA 4R9RA 4XR9A 1MC5A 2Y0EA 3FWNA 3QWHA 1JQBA 1YOVA 5EERA 1BXGB 1NAHA 1OZAA 2PGLA 2PNFA 2JD0A 5ER6A 4TVOA 2I76A 4GSKA 1LLDA 4J0FA 1LDBA 4DC1A 5CFZA 1C0PA 3H9GA 1DHRA 1IZ9A 3JQ8B 5L7TA 3ZWCA 2W98A 2YV2A 3T4XA 1EUCA 4RPGA 1LLCA 1NBOA 4P22A 1T2AA 3MJ4A 2X22A 5G4KA 3MOGA 3GHHA 3QA9A 4YCAA 4FB5A 1N5DA 4Q9NA 1A4IA 4D0RA 3H9UA 4IDBA 2PD4A 3JD3A 4R51A 2B37A 4CV3A 2EHDA 4L4RA 4BKRA 1KBZA 1MFPA 3DBRB 4L76A 3DR3A 3L07A 4BNNA 5COBA 3ADOA 1Z75A 1WXDA 3WNVA 2AMFA 2BHLA 3ZV4A 2BELA 4YBZA 1M2WA 4C7KA 3ST7A 5IZCC 2UYYA 4FQ8A 3WJAA 2RH4A 1AGNA 3SX2A 3KV3O 5U4QA 4FFNA 3OJ0A 4LVUA 1DXYA 3MJCA 4NFHA 3EC7A 3RC9A 1A27A 3HFGA 3F9IA 3WGHA 1E3WA 1GEEA 3GVIA 2HMVA 5DBGA 1BSVA 3TF5A 2JFGA 4D79A 4CLRA 4Q3DA 4N5LA 1VL0A 4TKLA 3VKUA 1ISJA 5JDIA 2O7QA 2XAAA 1C1DB 2PD3A 2ZYGA 3PPIA 4OYRA 3HHPA 4DGSA 2IODA 3BMNA 2R00A 2VUUA 5L4LA 3ZNNA 5THQA 4CUJA 3O4RA 4J4TA 2Y05A 4CLXA 1W6UA 2I65A 2B36A 1NNUA 4GLOA 2Y68A 4NDNE 2X4GA 3DAFA 1GEGA 1HDZA 1PL8A 1U9JA 3ETGA 1ZFNA 2AHRA 2NQTA 2GN4A 2YW9A 3RBVA 4Q3CA 2CY0A 4E5NA 5DT9A 4BNLA 1CETA 4W9NA 3ZZNA 2AEJA 4DLAA 5GY7A 2JCYA 3BMCB 4BB6A 4EUFA 1I30A 5ER9A 1ZKMA 4YRDA 4YA6A 2R00C 3K5PA 1GY8A 3VVBA 1DSSG 3RBZA 3OQBA 4GLLA 4XCVA 3U3XA 5BNTA 3DZHA 4EW6A 3D4OA 1IL0A 4PG5A 4R1UA 2PLAA 1X7HA 3PWZA 2PH3A 3AUAA 4XYLA 4CQMA 4UVEA 3AY3A 3JQCA 1C0KA 3BZUA 5H82A 1J0XO 2NVBA 4E4YA 1Y1PA 1E3IA 2YV1A 3KVOA 4K6CA 4D45A 2YZ7A 4Y9DA 2Y1FA 5B1YA 2AQKA 4IXTA 4W9NC 5TS3A 4DA9A 4F46A 3EZYA 1Y8RA 2O3UA 5L7WA 3OH8A 3PDUA 4P8RA 1ZVMA 3NTOA 3WX0A 2W2KB 4AJ4A 1I0ZA 3WGYA 1TI7A 4RF4A 3KSZO 4AJ2A 3DAGA 4EGFA 2O3JA 4QTZA 1RJWA 1DBVO 3ADPA 2FY8A 1R15A 1VJ1A 2AQ8A 1YE3A 3RWBA 2HMWA 3AOGA 2XXJA 2VZ9A 1F8GA 2IEDA 4R41A 3JQAD 1Z45A 1DJQA 1QR6A 2O2SA 3QVXA 4K9DA 4XGNA 4EEXA 1NQ5A 2OBYA 1KETA 3UUWA 3V2UA 1D1SA 4A73A 3LDHA 1IUKA 2P4QA 1RM4A 4IMRA 3KB6A 5AQ1A 1GZ6A 3AJRA 3L6OO 1EZ4A 1TA4A 4YJDA 4GGPA 2BGLA 4FIZA 3VH3A 1H6DA 3FRJA 4OXKA 1R4NB 2Q49A 2VHWA 1E6WA 1R12A 1H6CA 3WFIA 3GNSA 3JQBC 1SEPA 2BI8A 1L7DA 1UZMA 1YB5A 1NQTA 1V9LA 4XKJA 2JL1A 3O9ZA 1E3JA 1GUFA 2GCGA 2Z1NA 4BMVA 1LRLA 4QEDA 1LBEA 1QYDA 5CG2A 1KEWA 2HSDA 1HF3A 3PYXA 5I9LA 3RFTA 2YJZA 2O3TA 4EUEA 4OJNA 5CDTA 5ICSA 1BHSA 3VTFA 4BV8A 3BMOB 3WBFA 2YUTA 1LUAA 4NR0A 5BNIA 3CMMA 4ZQBA 2C59A 2VCYA 2CDCA 1W4ZA 3UFXA 3Q11A 3KLPX 1NQOA 3FPLA 2EWMA 2GN6A 5JDCA 1P77A 3FNGA 4DIFA 4HFRA 4ZHSA 1X7GA 1DO8A 1B8VA 1I2ZA 3RC1A 5BSGA 5MGBA 2BGMA 2PZLA 3D3EA 3AI2A 4NH4A 1WLYA 2OP0A 5AXBA 2ZB7A 3ZU5A 4YEDA 4GSLA 3UICA 1JAYA 4K6FA 4YAJA 4XQEA 3GAFA 4C7JA 3KSUA 4KUGA 1GYRA 5I7EA 1P1RA 5IG2A 1KEVA 1GV1A 3H7AA 3IIEA 3PDJA 2IEBA 1DEHA 3WTCA 1T2CA 1FJHA 5AXCA 4U0KA 3VPSA 4BIIA 8LDHA 3GR6A 3D7LA 4I9NA 5DZSA 3HN7A 2TMGA 1LSSA 2EV9A 2GZ1A 2H63A 3D5TA 3K9QO 5CPFA 4AL4A 1Y8QB 1NR7A 4JJGA
chains in the Genus database with same CATH superfamily
5KNDD 5HGXA 1XTUA 4Q7MB 4IPTA 1H42A 3L0CA 4CGZA 1EE9A 3KYDA 1B93A 1Z7GA 2WSBA 1EP3B 1G5QA 1KMHA 1I24A 2JDIA 1WHTB 2OGUA 5ALYA 5SY6A 3FUXA 5ECWA 4P4NA 2AUMA 1KSGA 1D09A 2W2VA 4HC4A 3IKLA 4LJRA 5JS7A 3ZH9B 3KXKA 1SCAA 2W2LA 2O2GA 1L5WA 2CDRA 2EBWA 2L18A 1W75A 3HDQA 4QYIA 5TT1A 5H5JA 4D3DA 4GGOA 4TV9F 3UJ9A 4DIOA 2DKFA 3IP6A 3SHVA 4PNZA 3OFJA 4TZTA 1IVYA 5LQUA 1ZCZA 1JKJA 3NXSA 3RB8A 3A4MA 2D00A 3I64A 3VU0A 1IUNA 1AB5A 4KIUA 4ZI3A 2WSYB 5LXTB 3HU1A 4O5AA 3U48A 5TE9A 1WS6A 2HO4A 3JAWB 4L8WB 1KEUA 4NAHA 2VHZA 3G13A 3O4HA 4YP7A 5TMEA 4HRVA 4ENQA 5LDGA 1A7UA 3DC7A 4QLBA 2JCXA 3C97A 1LPMA 3LOQA 2QL7A 3B89A 3HEMA 1A04A 2RKOA 1KQPA 2NV6A 1A3CA 4F2PA 2O1WA 4U6QA 3ADBA 4MEBA 1Z38A 4W7HA 5P21A 4F4FA 3CVVA 4YGYA 3N07A 4TOIA 3CZMA 3NHZA 4Y9UA 3FTQA 4MJ3A 4OUDB 1XL1A 2RH8A 3D2AA 1KRWA 2V55B 4O4IA 1RZRA 3EXAA 4BJ1A 3ZBUA 4BLUA 2X6TA 4XJSA 5ALZA 2IPAB 2FFRA 4CMAA 4FFSA 2OP1A 2ZP1A 4NBWA 1K6IA 2ZJ0A 1L9KA 2FAXA 3P0JA 1RPNA 2W43A 5F52A 2JCVA 4TKVA 4KPEC 4BO1A 1S2OA 3WDSA 1TUEA 4MRPA 1J70A 2GX6A 2IY8A 4H77A 3KB8A 1P0IA 3BQ9A 1MJHA 1XRPA 1OROA 1YCHA 3G68A 1J49A 1E6UA 2DWOA 4WK4B 1EYZA 2VP9A 1Z73A 3GXBA 3LUPA 2NU8A 4S0ZA 5AVJA 3W5HA 1VB3A 3EBLA 3WJ7A 5FPQA 5B4TA 3JD1A 4C88A 4URVR 4MVCA 2AWOA 5ECGC 4NU8X 3WLEA 3TG2A 3Q8MA 1PVOA 1NW4A 1ECGA 3ZW8A 3OLXA 1ZWKA 1IN6A 2QX8A 3S40A 2HA2A 4I50B 3R0VA 2VXBA 3T1TA 3GMSA 1GNPA 2ZVQX 3W9YA 3L7LA 2X1VA 2YTZA 2YZMA 3E23A 1AY0A 1V48A 4FW9A 4JK3A 1SR8A 2WOOA 4EA6A 5EJGA 3IAM6 2XTNA 4R2MA 3BB4A 5TQ2B 3B70A 2J6IA 4AO8A 3A37A 1TUBB 3TRKA 4ZYXA 1MD9A 2Q4TA 2YV5A 5HYVA 5FBVB 4DA4A 3L6BA 1PK9A 1FPMA 2IH4A 4I4LA 1PF7E 1CCWA 3DGEC 1P18A 1TK3A 1UMBA 3IAHA 3OJEA 1K86A 2I8LA 2O8NA 3C8ZA 3RM3A 1V6AA 3T0FA 4DC9A 1K6XA 4FZVA 4P54A 1DJNA 5DGCA 4F5DA 4AMBA 1TEVA 2FX2A 3BTVA 4G25A 4JBYA 4HH4A 4X7PA 1NG1A 5CPBA 4BQNA 1E1QA 4EO4A 3OECA 5JAPA 3RVPA 2FW0A 5MN6A 4XX0B 4JGBA 3R77A 5C1OA 5FUWA 5TJHA 1WUIS 3DMGA 1ZMOA 5JD4A 3BC1A 2C2ZA 1IATA 2R5FA 3N8NA 3ZWYA 4ZMSA 1DFIA 2BFDB 2Q7OE 5C7OO 1JJAA 2O8DB 2O7NA 1I6MA 2X40A 4RMIA 2EZ9A 5FPPA 2C58A 1SA0B 2J5KA 3V97A 4WTOA 1PLKA 5CFRA 2ZJ5A 1OBFO 3L8MA 2VF5X 4LVCA 2QE7D 5GJCA 3T7KA 2IQ5A 4BZZA 4TTJA 4PHHA 3DBHB 3GGPA 5DN9A 1JU4A 2ZUSA 2W71A 3OAAD 4FT2A 1PS8A 4H18A 5AW7A 3W04A 1HI9A 1Z5UA 1GGNA 5A06A 3GRRA 3S1LA 3AL0C 1AH2A 2BONA 2QA5A 1PQWA 4F6LA 2I9PA 5I7WA 1P31A 1ZI8A 1ZRSA 1NW7A 2QSYA 3O2JA 4HJRA 2WFLB 1JG1A 2MJLA 1RXEA 3PFCA 4LNUB 3CRMA 4R6XA 4EAAA 5IXYA 1PVDA 3INTA 3H05A 2ZULA 3KL4A 4YRRA 4U9HS 2DWQA 4D9NA 1ULHA 4MRAA 4O63O 3U3JA 2EL9A 1EJ6A 4ZU6X 1V47A 4CFSA 2GD6A 3GEEA 4CLOA 2CXSA 3W8EA 4HVLA 3L8CA 4R1PA 1BXRA 4TUYF 3SBEA 3D6HA 1UR5A 3C5EA 1K7FB 1R6XA 4HDNA 4K26A 4RVSA 3GLVA 2BHSA 3KTFA 3JRNA 4LN1A 3ZWQA 2GAOA 4N6NA 3WS7A 4I2NA 4J6EA 4M9ZA 1TEZA 1P2SA 2ZR9A 3LOUA 1XWWA 2POCA 3ECSA 4H7DA 1ICIA 5IJZA 1KTIA 1U63A 2ES4A 3EUAA 4OU4A 2ZBQA 3LUCA 3DBLA 4PPNA 3U3KA 2XYPA 1L4MA 3E5NA 3VRHA 1J2UA 2IUSA 4E6EA 4RXMA 5EHZA 3JQ9A 1LNZA 3LUBA 1QZZA 2AFHA 3GJSA 1Z18A 4YQZA 3R9IA 2WFMA 3GBPA 3USZA 4FKZA 3VR0A 1QRTA 4HGRA 2H4FA 1RJ9A 3I6MA 4TTPA 4LKRA 1U2QA 3OD5A 4CKEA 3A27A 4OMCA 3M9XA 3GUUA 4GWKA 4FGLA 4RFLA 3UJ8A 1DJOA 2QVXX 3QEMA 3HRHA 4GHWA 1PK7A 4UM5A 3PRJA 4W6ZA 4ZT7A 2PSSA 1DLJA 2LD4A 3KHUA 3PEFA 2JFFA 3M70A 1Q0TA 1E58A 2D1QA 3RG2A 5KNBA 3GZNB 1MP0A 3L01A 3CJRA 4UHBA 4XW2A 4DWVA 3B3AA 5IXSA 1V1RB 5FUQA 4URZR 1WRBA 1KOFA 2NO1A 1E3DA 4RNDB 2VCHA 2VHQA 3EZ6A 3B9BA 4PG7A 4QDXA 3S6JA 3USES 3TTVA 1F4PA 4AYWA 4KDEA 2PZFA 5ALMA 5HUJA 5L95A 3TFOA 2R1TB 4BQPA 3RRMA 5EJ4A 4GNRA 3CONA 1CULC 2BDEA 3I1JA 2Z6AA 5A4KA 1O3YA 3D6AA 4U63A 5G0VA 1HSOA 3E70C 4KFSA 4UEJA 2P27A 1XCJA 2FUNB 2VQ6A 3BIWA 1PGJA 2A8YA 3O47A 1VCOA 1X80A 3BWMA 1U0FA 1HE5A 1GPBA 2C96A 2I2FA 1EX7A 5C4IA 1OB5A 4K6OA 2Z9CA 4GL4A 3DM5A 4HPWA 3RSHA 1VSVA 2Q9AA 1P1BA 2H65A 3JYOA 4RFSB 1YC2A 3QXXA 2BTQA 4JSRA 4N40A 2NP7A 2O6HA 2W6MA 2XMZA 2YHAA 1X19A 3MT8A 4UNNA 1GP2A 5K0SA 1XRLA 5BOVA 4KEAA 1VTKA 2G25A 2RKBA 1UBEA 1IFXA 4CETA 1SIUA 4L2IA 5FUXA 5M34A 3V7UA 3QV2A 1O94D 4YR7A 2ZM6B 5B1IA 1PZXA 3K92A 4N6GA 1LVGA 3TEFA 1V3TA 4WACA 1MC4A 2C61A 2IEGA 1OAAA 3BZBA 3I42A 2XDWA 2JGNA 5AIAA 3OEHA 5J2TF 4BZWA 3MFQA 2A1IA 4RK0A 1H2ZA 2JIQA 4NECA 4CM3A 1Y7IA 4CM8B 4G2TA 4WLNA 2B94A 4J2TA 2GZ3A 1BW9A 4G84A 5AVOA 4V3BA 5AJZA 4HATA 5TARA 2ACKA 4JI8B 2E21A 1P80A 2O5VA 1BJKA 3CXUA 4NJMA 3A9UA 2B99A 2I3BA 3F78A 3C5CA 5JO9A 3NHYA 3W2EA 4A16A 3FMPB 1UOPA 4PGHA 5G1NA 5A0FA 4KZPA 2W70A 3QMPA 3A9WA 1RP1A 4JAVC 4C21A 1OPRA 2GM5A 3Q40A 1Z5PA 2IYSA 1Z4OA 5JAUA 1FSPA 4BP9A 1VIVA 1M67A 1ZCAA 4XUDA 5EIFA 1F51E 4GOKA 4M7OA 2FETA 1HQKA 4Q7LA 4D4KA 2H1IA 4ZYWA 1RAHA 3R0JA 4BRUA 2G09A 4FR2A 4CTOA 3P9IA 2CDAA 3EZ2A 4KAAA 4MP3A 4ALNA 1IEWA 2FRDA 1PNQA 2I33A 1PEDA 3BD8A 2CDNA 2XLCA 4KPUA 1QRDA 2QRHA 3LZ6A 3W6PA 4FONA 1TNDA 3ZDXB 1I6LA 2E4YA 1UC9A 1FF9A 3WL3A 2W6CX 4OQQA 3CWQA 4ZO7A 1UM8A 3WL6A 1QH8B 4ZQEA 3U7IA 5KVSA 3WWEA 5JZSA 3G2MA 3SQDA 5CB4B 2GLUA 3PQ3A 3CNEA 4CCAA 2XIQA 4B87A 2ZJOA 5BNWA 3BWXA 3HVUA 2PYZA 3ASYA 1EUCB 3A28A 5A9TA 2GF2A 4BLTA 5AOCA 1DC6A 4R16A 3JWPA 4UVDA 3DCJA 4K3UA 3PC7A 5ALLA 4J07A 2ZXUA 4C2UA 4UTXA 5FBKA 2YVKA 3E9MA 5KNCD 4LVNA 3AF5A 4OL0A 3GB9A 4PXAA 5JMPA 3TZ6A 3F1KA 4MV4A 3BFPA 3M6UA 4XLLA 5EQFA 1FFSA 2OYCA 4TSRA 3I5UA 3B9QA 4B7AA 4R2WA 1G20E 3AEKB 3T7CA 1EXMA 1UAGA 3G1WA 4ZOQI 4AIIA 4FCTA 1P9LA 5BXQC 3QUTA 4X3OA 3BL5A 3D6MA 3HJHA 3BGVA 3URMA 5ED4A 2G72A 2PGNA 4FCVA 4QOHA 3H1TA 4KVGA 2BFOA 1JDBC 2VL7A 1GPNA 5M5BA 1KDVA 3EDYA 4EWLA 1IZ7A 2P9CA 3IDOA 2PS3A 3OIYA 3X1XA 3PG5A 1IC6A 4ZZ3A 4YCDA 3D1JA 5GZ1A 2A58A 2EP8A 1GQFA 1QQ6A 3EW9A 1Z39A 4MYCA 1R0SA 1QCZA 3PNBA 4RQTA 1SAYA 1QYRA 5CT4A 1H6AA 3HYNA 5G3YA 4KR6A 1KMNA 3KUXA 1L7OA 4BLWA 1CEXA 4PHFA 2HY7A 1MH1A 1K89A 4OBEA 1E3WB 3U40A 3GPLA 4OQXA 4RFVA 3S2ZA 5LB4A 4ENVA 5I48A 4TXMA 1EE2A 1UBMS 2FLKA 2O2CA 3BMQA 3DEKA 1E60A 3FLMA 3MWEB 3JQAA 4FQ5A 3WLKX 1ZY2A 1U28C 4B4DA 4CLRB 3RSQA 1WNTA 1CE8B 4ARUA 3ELUA 1Y6QA 1TW2A 1OLOA 1N8TA 2PKRA 1Y1TA 3UJ7A 2XOKA 1MA3A 3EUWA 1BMQA 1X1DA 4ENTA 5A5DA 5FFMA 4MPDA 3KBOA 2AMJA 1MVOA 1AV7A 3CLVA 2JI7A 1I2MA 1M6VA 1ZNZA 2R3SA 1UXHA 5EYPA 2IY7A 3OURA 3JQPA 4FOTA 1KRXA 5FO0A 3NEPX 4OMDA 4ICIA 2CFRA 4Q4JA 5TEVA 4XQGA 1W2WB 3SC3A 1SHUX 2I2BA 1ULBA 3T9EA 1T6XA 3RLIA 1NVBA 4EG0A 5BW5A 3JRWA 1U8EA 4UDNA 3Q0IA 5GOTA 4WNYA 1I4WA 5HS6A 5JVDB 3IDSA 4BFCA 4DMRA 5ARBA 4Y2QA 2NAFA 1PNVA 1D7AA 4L57A 4LQCA 1N7IA 2C77A 4FHFA 3TM4A 3IQHX 1F2UA 3UIEA 1IN1A 4B6JA 1IRXA 3CB4A 1BN6A 4K9SA 3U81A 2XHZA 3BXPA 4BZQA 4EZEA 1TM3E 5LLSA 1M1NA 1R64A 1ZHFA 4HZGA 4MIEA 2WE7A 1A76A 4Q7JB 3RU9A 2PXAA 3W1EA 1QHEA 4A27A 2QBYA 4HH1A 2JIZA 16PKA 1MPTA 2IQIA 3AWIA 3ZWKA 3RYCB 3W4KA 3I5XA 4XB1A 1RTKA 5I4BA 5KDDA 2DBQA 3Q2IA 3DE3X 5H70A 4X61A 4BMOB 1D6SA 3SHTA 1SUIA 3CEAA 1N2EA 4RORA 1JR6A 1SPXA 3DEAA 3DZGA 1T2FA 1TMYA 4HGYA 4F45A 2CK3A 4ER5A 4F3CA 3VKGA 1DRJA 4Q93A 3HUTA 1VLJA 4EMTA 1O1YA 1ZGBA 2PGAA 3JR7A 2ILVA 3KQSA 2VJPA 3C6KA 4MQUA 5FI1B 4MVYA 3O8LA 2AIRA 3B78A 3HY3A 4JUCA 4L5BA 4LJYA 2IU6A 3EGVA 3PE6A 5HKKD 4OLJA 1YS1X 1PJ4A 1QV6A 1YD7A 3MUOA 4KOEC 1G21E 1F2VA 4ND5A 4ZYLA 5KTSA 4U5XA 3GH3A 1KH1A 3PX3A 4JODA 3BHNA 1TA9A 4OEHA 2N0SA 2ZRBA 4ZICA 1VBFA 1Z7YA 2WF8A 2Y27A 4AG3A 5CDSA 3FGNA 4HSEA 3NNSA 3QVGA 4N1AA 3QPAA 1THMA 2IYZA 3G2QA 3IJPA 5CVDA 4B8WA 1XTSA 5KYGA 4I1OA 2C00A 4ONEA 4JASB 5JLAA 5FUYA 3NANA 1IM8A 3FVTA 3H99A 3PHGA 3FDZB 5B1SA 2QEQA 1FC0A 1FP2A 4HNHA 3WLNA 5EJ9A 2D7DA 4Q3BA 2Z2KA 2A7QA 3BMXA 3OE5A 4MYHA 3PCTA 3SF0A 5FRDA 3HU2A 2HCTA 5U1PA 4ZTBA 4Q15A 4ZFNA 5AJYA 4E2WA 1DBSA 2P6UA 5ECYA 3EA4A 2GNAA 5KNDA 1L5KA 4ZHQF 3NC4A 1VKHA 3FOBA 4M7PA 3SKXA 4DM7A 1JF8A 1JQAA 3RSGA 3B52X 2AJBA 4JJZA 3ACBA 1I10A 1P3DA 2I4MA 4U7FA 2JLYA 2LIVA 1I7NA 1KSJA 3KYCB 2VDRB 3CGWA 4IO1A 5I7OA 2GA8A 4LGCA 4DLZA 5JDIC 2B5VA 2ZK7A 4FEEA 1A8IA 3R9XB 3HLKA 2EX0A 4L9RA 4MV7A 1J97A 5K03A 1JIUA 1U9YA 1FXSA 3AFGA 3OOHA 4EP1A 4DV7B 1XD9A 2AHOA 2MR5A 4BLOA 1HGXA 1PZHA 2A1TR 2GM9A 2IF2A 2YV3A 4A2CA 5D2CA 3X43A 1VHWA 1QX3A 3MJSA 3MT0A 4KBGA 1X74A 2VRCD 4GM4A 3V32A 3WHPA 2QMUA 3C5WP 1VLZA 3S27A 2R84A 2O9JA 3KP1A 5HIKA 1U5CA 3STTA 2YWCA 5GJWC 1HE4A 3JQ8A 3ZDDA 3UMVA 1ULTA 1SKMA 2C07A 2VLIA 3IRUA 4X54A 2NUPB 4L0QA 1HURA 5HK9A 1E2EA 1W49A 1GZ4A 2I3ZA 4BNYA 2GM4A 2EFEB 5DPMA 4ZAGA 4DV4B 3E03A 4OF4A 4FM9A 3ZHCA 3AG6A 2IOHA 1YACA 2A9KA 2Z2XA 4ND3A 1UKEA 2E6KA 4DLXA 4W5NA 5KTPA 4GPZA 2AH5A 1U7XA 1NM5A 1PBNA 2XMDA 1FSGA 3OIDA 4R1TA 4BX2A 4ZC8A 1OTXA 2NSYA 3F1LA 4MS4A 2PXCA 1EVIA 1XEXA 4M86A 1T1EA 3ZKWA 4PLWA 4EKNB 1ENPA 4YNBA 1NUPA 3LHKA 4O2BF 1KI6A 2P0YA 5AKHA 3QOYA 1B14A 1J7JA 2WYOA 4J1QA 4MWBA 2CHUA 4E13A 1BIFA 3PUHA 4PY2A 2OCBA 4IHJF 3W8NA 1AVTA 1NXQA 2LKCA 1MUUA 3H6KA 1JB1A 2VAXA 2JBWA 3L77A 4FIDA 2YXDA 4YRZA 1A96A 2VDJA 2ZSKA 2JKYA 4HD8A 1FLDA 2P5UA 3CS3A 4XB6B 4QLAA 1ZXBA 2ASVA 5EAIA 3TXYA 4PAGA 2G9ZA 3RVKA 4CT4B 1YWGO 1HZZA 1N1EA 3DG9A 13PKA 2YYZA 4WXPA 1NBMD 3GFFA 4QIHA 4TS9A 3Q7SA 1HOXA 4MVJG 1ZZGA 3GFTA 3ZQ6A 4BDTA 3ZBPA 4RZHA 3PIDA 3VH2A 2XXAB 3DKKA 5DDIP 2FK8A 2H7CA 3AY7A 4MVJF 4MB6A 3LCJA 3DFIA 3VPXA 2Q3JA 5ALRA 3WHIA 3CQ9A 1WB6A 1L4BA 3NWOA 3U7EB 4KC0A 3GLGB 3HQ4O 2ECPA 5FNVB 3D6UA 3QLUA 5A6SB 1BHO1 2YHBA 2WIBA 2YXLA 1HZZC 1ZW6A 1P4SA 2XNDD 3QKSB 2PSEA 3S2GA 1J9EA 2IYAA 5EZ5A 1MN6A 3WGJA 1YIAA 3RSLA 4XTRA 5CRIA 1JIIA 4UE3S 5EHNA 2PLWA 3SBDA 3EULA 2HBQA 3FTFA 3EWNA 3Q3IA 1IOVA 2BEVB 2OYSA 4GKVA 4LRQA 4MGIR 4WDQA 4QSHA 4CMIB 5JC8A 3L46A 1Z68A 4P08A 4GEKA 3EIUA 3G9XA 4CHTA 2DH5A 2GF9A 3WADA 1GQRA 2CFOA 4IYJA 1QXSA 1V9SA 4KQIA 4OXNA 4ZU1X 3R0IA 1VCIA 3HS3A 4R1LA 1A9YA 4Q37A 1BXKA 2PMCA 1M5RA 3COZA 1WM1A 1PSWA 2N1BA 5F3RA 1GILA 3AO0B 5H1YA 1V2GA 1RPTA 4UBIA 2XQIA 3KWFA 4X6YA 5E2AA 3SC4A 2C42A 1L9XA 4FHZA 4FFBA 3UV3A 4CG2A 1RHUA 3RD5A 3IPCA 3GT0A 2QE7A 3R0QA 4UEWA 3KEGA 1DG3A 1OXUA 2CLOB 2CFCA 2W2XA 4HCJA 4EIWA 3KKZA 4YRTA 3OAAA 4GYWA 3NV9A 4MPPA 2Z2IA 2FEMA 3G82C 3QPDA 4MPRA 1NYQA 2PGXA 2W22A 1TU0A 3ANNA 3W6NA 3EGDA 2P2CA 4ND6A 1ML3A 2C4NA 3GCDA 3QW4B 1F2TB 1H1DA 2P3LA 2VP5A 1NVKA 2H7YA 1BMFD 2IYLD 3DCYA 2D54A 2X9LA 2VSQA 3DVQX 2Q5LA 4UM9B 3PNSA 3PHIA 2WF7A 4DV6B 3QXCA 4LIPD 1E69A 1YQDA 2X7JA 3QJ5A 4UATA 4ZALA 5FJJA 2QTCA 1DKQA 2I4RA 4L51A 2XCUA 2H85A 4QU8A 4IBOA 2EC5A 4RY8A 1PL6A 3V7NA 2BCJQ 2ZTLA 2VDVE 3HXMA 1XR3A 4EPXA 4HEQA 2NZWA 3NETA 1GAWA 3IUBA 1I5OA 2ZJ7A 1ANKA 2XNSA 5ESXA 2C7PA 1L7RA 5EIEA 3JTEA 3IDQA 4KKXB 4XYGA 3ER9A 1EHYA 4X1KA 3O8BA 2PJRA 1NXPA 2VT6A 2EBHX 4QFDA 1XZLA 1IB0A 3QX9A 3OLCX 1B74A 1JAIA 2G83A 2ID8A 2BLLA 3BH0A 4KIJA 1M5UA 3R5KA 4X6UA 1SCUB 1TMOA 3VYVA 4E0BA 1XZNA 2BEJA 3DWGA 4O4JB 3ISTA 3AEXA 3MJTA 4HEA6 2GEDA 3A1NA 2K7ZA 5E0OA 1JL3A 4FS8A 3BAZA 1Y5NA 2EP7A 1D8TA 4PZUA 1KYWA 3AR2A 4F2WA 4MICA 1UKVY 2GCPA 2ODAA 5GVRA 1JJVA 5CUQA 4KL8S 5LOVF 4O25A 3EZ9A 1RYHA 1AZLA 2AJCA 4U5QA 4TXJA 4L4XA 4RLSA 1YI1A 4I4CA 2ZE7A 1L8XA 1LZKA 2Z95A 1W4CA 1XRQA 1T5SA 1YB2A 2VCEA 3OJFA 4XWYA 1W9MA 3PUKA 3UO8B 1NVUQ 2YL2A 3AM4A 3AEQA 3EEYA 5DSZA 3WNCA 3PNMA 1QDEA 4PW0A 1OA1A 2ZE6A 3KHKA 5LD2C 1PNTA 3SHFA 4Q9LA 3PE4A 2YOGA 4M21A 3K9CA 4CQNA 2X1HA 1P72A 1F3LA 1UH5A 1O96B 1Q84A 1F4VA 4RO0A 3MGAA 3UWSA 1I3OA 1RYZA 2DHDA 2HPVA 3M6LA 1R8YA 5BWCA 2ZZMA 3WTBA 2J3LA 1DINA 3KR0A 2F43B 4O4HA 3DE7X 4FNAA 5B3JA 5CT8A 3QI2A 2VHYA 3RSFA 4YUYA 1M1UA 1WPGA 5J59A 3KB1A 2ZFUA 3CYFA 1OFTA 1P5FA 1AXRA 1ZI9A 5KTYA 4NPHA 5HGJA 4U2FA 1GL6A 2I6UA 1JQEA 2YVUA 1B0PA 5DM2A 5DYYA 4BQFA 1OREA 5KWVA 3NHLA 4QGBA 1F6WA 1QGDA 3ZCPA 1DV1A 1KGSA 4TVBA 1K9VF 3MBKA 4PIVA 1UXIA 4R3NA 4E6PA 2GK6A 3PJDA 4HTFB 1L5VA 1QIIA 3ZWMA 1NFRA 1O94A 3HKDA 4QQKA 1GSHA 5IJAA 1BCRA 3LDFA 5E9QA 3EUEA 4CM4B 3QHQA 2YYAA 4RL6A 3VV2A 1U2DA 1EWKA 2XWSA 3MLAA 4Y6PA 1MO2A 2VKQA 4FKBA 2HYIC 4DMGA 4ZYTA 3TR0A 1GNVA 1GA4A 2C83A 3FFWA 3UHPA 1R4MB 2EP5A 3Q8KA 4AXBA 1KBQA 3LXMA 3AJEA 1LTKA 2CNNA 2FEOA 2NUAB 2HCJB 3B9RA 4QWWA 3U7RA 4CM6A 3R7DA 3KALA 4JP5A 5AVWA 4IFIA 4MO2A 3TZHA 2ACWA 4DA6A 5LM3A 1VJ5A 5DCLA 2C7GA 1ISGA 3Q7QA 4BPBA 1Z12A 1JILA 3U5ZB 1P6XA 1XZPA 3O4GA 2WD8A 1ZN2A 4FJ2A 1T9HA 3QE4A 4KDRA 1IU9A 1DAFA 3LBHA 5B6PA 3K8OE 5C1IA 2IZ7A 3BBPA 3DW1X 1JR2A 3HJNA 3NT2A 2QL5A 1YVEI 3L06A 1J0DA 3D0OA 2X2FA 2NSDA 3OZDA 3QM1A 3RVOA 3UK7A 4PFKA 4PAOA 1KHHA 3CXRA 3OM1A 3ZKAA 2D5IA 3NGXA 5FWAA 2ZBFA 4UOQA 2LIPA 3D0RA 4B7XA 2XTJA 1G64A 1T35A 1TQ4A 3VR5D 4F1WA 5A04A 2Q5CA 3X2FA 1J5PA 1ORDA 4JNKA 4PWYA 4BN5A 1KF0A 4B3SB 4I4IA 3AV0B 3NB0A 4C08A 1K7EB 2QI9C 2ONCA 1AJEA 4LZWA 1GL7A 3H5NA 1PV2A 4HBZA 3WWCA 1I13A 2A33A 1LJLA 1NJGA 3EXEA 2BHRA 3KUUA 1TIKA 3DXZA 1I80A 1NDQA 3AF0A 5CURA 4FOPA 4X0EA 1SQFA 3EZLA 1OW3B 1U02A 3E35A 4MOWA 5B2FA 2HHAA 3LQ2A 2IX9A 1FDTA 2WMDA 5L4SA 2GT1A 3K71B 4G65A 2EU8A 4RMGA 1ACJA 1XCMA 2D5LA 3L1UA 3OPYA 4DJJA 2OC9A 5A0TA 1IY0A 4H0CA 5HF9A 4EVSA 1FFXB 2FZEA 3WMEA 2H2GA 5DHFA 1BRMA 1QIGA 1KL7A 3LW7A 1GT91 2G4LA 1IZ0A 2VPYA 3TMKA 3KWLA 1AE1A 1NMZA 1QZTA 4P3OA 4C4OA 4YV1A 2ZGVA 4IXNA 5ALNA 1K0FA 3ZDEA 3OJOA 4FE7A 2CB0A 8MHTA 5IABA 1G6KA 4H9GA 4WY8A 1BMDA 1TB4A 3TGWA 3ZG6A 2QN1A 2HNKA 4DMUB 3UMBA 4RDXA 1E7MA 2J08A 1ZM7A 1KH2A 4NAUA 3T41A 3WV5A 3R3ZA 2GASA 3CLUD 3GLHB 4L6AA 4RK1A 4AZ0A 3CC8A 5JMTA 2Y71A 1BJRE 2B8NA 3EWIA 1Y81A 5FQOA 3RRFA 4MIOA 1QBKC 2PLNA 2D7CA 2I3GA 3LZDA 3MCWA 4YJ2F 5L7YA 1GSIA 1B00A 3JQFA 3IDZA 1JU9A 3FSRA 4GEGA 3WNDA 3CUWA 5JSKA 3PLRA 2FP4A 3GLGE 4TKMA 3CZPA 1I94B 2PTHA 4LW8A 3D6NB 4X84A 1PK8A 3DL0A 1GZ3A 4XEHA 4ID9A 1JPNA 3KIPA 1WX1A 4X45A 2ZT7A 1HKUA 2ZSHA 1VL5A 2O50A 1HDGO 1RQPA 3NBUA 2VHUA 3OA0A 3QX7A 3T35A 1Y7LA 3OZVA 3ASVA 5A4JA 3JY6A 2ANBA 1A9TA 4DIDA 1FFHA 5IAEA 3SQOA 4B4KA 4LWQA 3VR6H 1MG5A 5HRAA 1JKFA 3VM6A 2J32A 1N6LA 1X7ZA 1DG1G 4IL5A 4XQCA 2Q41A 4RLFA 4CNBA 1IAVA 1UPAA 3UBMA 3I2KA 2I5PO 3LYLA 4FS3A 1PLLA 2IXEA 4EEKA 1X39A 2QX4A 4B9AA 1V6SA 1JHAA 2PX3A 4D0SA 2JVJA 2ZI7A 3ZD7A 3VVCA 4RHYA 5BWBA 3D3KA 2NO9A 4MR7B 5F73A 2EJUA 2AG1A 3SJBA 1FA9A 2OBMA 1W5BA 1C50A 2VDNB 1YDFA 2Y1OA 3BRWD 4KE9A 4ME6A 4WCVA 2NXCA 3HV0A 5DMXA 5FI0B 4ER0A 3UBTA 1D07A 1T1RA 2YKGA 1PW7A 1N6IA 2C31A 3OMLA 3KFLA 5KU1A 2D2FA 1AKQA 4LTMA 1DWOA 3T3GA 5C8YF 3L8EA 5CLLA 1XN4A 1BYUA 2AOUA 1IAQA 4KQKA 1M2VA 1ZICA 5KYXB 4J2OA 4A1FA 3NOOA 4TYWA 4UOEA 1VJCA 4YRIA 4WNIA 4Z4GA 4WUVA 2ICAA 4QAJA 1WKBA 4I5GA 3SQLA 3JQ7A 4FN5A 5I7HA 1XEWY 4OBWA 1LPSA 4D1YA 4LC1A 2V7EA 3FY4A 3BA1A 5KU7A 1UJBA 2GAFA 3THYB 2ZSUA 3ELBA 3S5JA 4C76A 4Y6QA 3VDQA 2R8PA 2I6FA 3BK1A 1VPTA 4L4UA 3S1AA 2DFDA 1P2VA 4EPRA 2J85A 2ZWOA 4HB2A 3TPFA 4M9RA 4X6XA 3OE4A 4LSZA 5AK4A 4YV0A 1B8UA 2IZOA 5HILA 3GG2A 1YS2X 4G97A 5KCZA 1VYTA 3CRVA 4BUJA 2C20A 1ZJWA 5IP5A 5J58A 3HKCA 3OCXA 1V43A 5AVSA 3ZGVA 3VOSA 4P7FA 1EHCA 1N7GA 2O2XA 1N9KA 2EQAA 3M33A 4EVIA 5DXAA 1Y5LA 3NM4A 1AD2A 1B76A 1GCUA 3QFRA 5HKKA 2PX8A 3ENKA 4BECA 2C5SA 1SKBA 4EG5A 3THWA 4FGWA 2G82A 5CJ2A 3QZUA 3RHTA 1CLUA 5CYOA 5IWCA 3GRVA 5J2UB 4AN0A 2X8JA 3TX2A 4XJVA 5CH8A 4HVAA 3I01A 2QP9X 1Y5IA 2A9OA 1LC0A 3HRIA 3SVLA 3HA2A 2PX6A 2OA0A 5EQJB 3SZOA 1CJCA 1LI7A 1NJ6A 3EXHC 3K5IA 1BU5A 1QKJA 4LE2A 4AICA 5B1EA 1Z74A 2H5IA 2FWAA 2RJNA 3VNBA 1FU8A 2HO5A 3DWEX 1OZGA 4HG2A 1M0TA 3FOWA 5DM0A 5SZHB 1FPQA 4B44A 1RI4A 3WA6A 5FKJA 4KUHA 1GO2A 2COEA 2NZ8A 3H4VA 3I6IA 2P69A 1FSZA 2RCYA 1CF2O 1FP1D 2FX3A 1SXIA 2ZSIA 2WK1A 2GJ9A 3VPHA 5KKNB 2FPGA 1OH5A 1PIWA 4HJXA 4MARA 5JCJD 4L3OA 1I6WA 3E0XA 3AX6A 1M7BA 2P4HX 1NXTA 3L2OB 1XDWA 2D0DA 1WW3A 2NG1A 2IOQA 2WU1A 3PHCA 5JS6A 1G3QA 4J4HA 4M1OA 5D3QA 4BMNA 4GT1A 3H2BA 2C95A 5G4KB 1FS6A 3DL4A 2WPDA 4V0MA 3SDSA 4ER6A 2AMYA 1CQJB 2VRCA 1DKPA 2FRXA 5A6VA 2ZJ4A 2NSJA 3TSWA 4AS2A 5JLJA 2JJ2D 2QAGA 2PA3A 5FTNA 4PZDA 1HE1C 3ONFA 4OP3A 4LEIA 4YLGA 2O1SA 2R6ZA 3NTRA 1HTWA 2XE4A 1M6YA 3IKTA 3KYIB 3G9QA 4NPAA 7REQB 2OFWA 3Q7RA 4FT4A 1M8KA 3ZDCA 2AN4A 1WSDA 2HGZA 1QC5A 1OWLA 2ZJ1A 2ATXA 1N8KA 3EGCA 4G8BA 2Y6UA 3DA8A 2VXYA 3V1KA 1XTPA 3PFKA 3KK0A 4DR4B 1VL1A 2YN0A 3MXOA 5JASA 5AICA 4FLEA 2GN1A 4F7WA 1WQ4A 4MR9B 4R01A 2HIMA 5AW9A 3IAEA 3RARA 1B16A 4URWR 3TL6A 3KUDA 1RWKA 3E8MA 4NG5A 3S2YA 4JJIA 2W2MA 4X5OA 2D2EA 1QVVA 2QRMA 1RJGA 3MINA 3D5EA 2O2JA 5CLGA 2JD2A 3C0KA 1E1CB 1YRHA 2Q1TA 1F0NA 3HVHA 2OCIA 5JI2E 1MABB 1C5KA 3PFFA 1T8TA 2FSUA 1CUIA 1JPVA 4WZBA 1WMEA 1SNYA 2OY0A 1KEEB 1WDLA 1RWOA 2ZAYA 5DYIA 4M1EA 1CUSA 4PPFA 5GAJA 1VE7A 3WLJA 4DSAA 1O03A 1OYVA 3RJZA 3STYA 1NX9A 2FVYA 3GP8A 2PYIA 2IHZA 2GJ8A 1MZPA 3HPRA 1NDUA 2RK3A 4PN3A 2RG7A 2SNIE 1ZINA 3DNMA 1M83A 1L8OA 1O4WA 1B26A 3ETEA 4R9NA 4TKUB 1NBMA 3IMKA 1RJFA 2WYUA 4E3WA 5JZVA 3WK9A 4LFBB 2ZIEA 3E1KA 3DQQA 4R2JA 4AB1A 2AR9A 1Y3BE 3I6QA 4FILA 4F85A 2OO7A 4B79A 1WR8A 1N9GA 2EJWA 4GRDA 3RO7A 1C1YA 1IJFA 3PC2A 3EQZA 5AKJA 5DEIA 5BYAA 5H59A 2GVZC 2L69A 2WHYA 1DS6A 1FTWA 5EMHA 1T2VA 2CL5A 3CCFA 3CR8A 4XGRA 5EN4A 3RS9A 1QK5A 1MG0A 2VYVD 1YS9A 1A5ZA 4AU1A 5FOQA 3TD6A 2R48A 5E3JA 2WHRA 1N0HA 4NZNA 2DY0A 3FUTA 4Y2XA 5TF4A 2GBLA 2XNDA 3PC8A 1EFKA 4EJSB 3COSA 5CITA 4IP0A 1GXSA 5LZ9A 1TVKA 4KCGA 3LF1A 3IIKA 3R41A 4XJXA 5AOAA 3SGLA 5GADl 2FG6C 1K1EA 2GPSA 3FSEA 1Y82A 5AM5A 1DAHA 2OO3A 2DPXA 4CQMB 2F8MA 4ARZB 5JY1A 4K9QA 3GLKA 1GGJA 1UKBA 3QPCA 1WMSA 4AJIA 5KQMA 4PFJA 3GLHE 5EE0A 4BASA 3WAGA 1T0UA 5IZCA 5JNUA 3QXJA 4NTZA 3KXLA 4REQB 1XZAA 4B7UA 2BGKA 3G0DA 4PLZA 3V2GA 4F9EA 5ADHA 4HQOA 2ZWPA 4E07A 3L49A 3BCUA 5EIAA 3VDXA 1XA3A 4UU8A 2VNSA 1E99A 4Y6RA 3I45A 4YRSA 2VUSA 3H1BA 3A1TA 4JBLA 3EIQA 2B6NA 3PC8C 4C0KA 4L8FA 5K9ZA 1RHQA 4C0BA 4TWIA 1XZJA 2WRZA 3R7NA 3HTXA 1N33B 3U37A 1TTQB 3OX2A 4O0LA 4W82A 4EMSA 1Z6YA 2J33A 2CL7X 2MR6A 2OBLA 2VAVA 3TLGA 2I2CA 4MW0A 4HWRA 1M0WA 3H6HA 3QU2A 4X64B 5AUPB 1Y1LA 2HNAA 2RHCA 3ZQJA 3W5CA 1XGKA 4RQBA 4S05A 1BMFA 1YE8A 3P0HA 3AYZB 2P7IA 4LXGA 1TAUA 2OVFA 3OCJA 2E5FA 3AHDA 4FGJA 4MRSA 2FZLA 3V4VB 1UDXA 1DTWA 2YV4A 1U3WA 4AS3A 1CRLA 4EHFA 4YXFA 3U4QB 2VBGA 4C9BA 2LKDA 1WD5A 1UBGA 3VVLA 1XEFA 2J3EA 2CNWD 4HN9A 1E2DA 2OK8A 5CEFA 2FN9A 3LRXA 3GBVA 4RSGA 2WSLA 4C07A 1KI7A 2YNMC 1XBTA 3C70A 3MLEA 1NLYA 1XRMA 3QU7A 1XXHE 2TS1A 1D4FA 4QULA 4EM6A 1KZ6A 2QRJA 4NARA 5ULLA 2XKAA 2FMIA 4IXWA 1UZAA 4N3GA 3SYTA 4AUMA 1HO3A 4DCUA 1WDTA 3GO4A 4LC9A 3SMVA 3JR3A 3TS1A 1DXOA 1Y80A 1L4GA 2YWDA 2QQFA 2J4CA 4IHAA 4LDNA 4RBNA 5EUMA 4F3KA 1LPAB 3D7KA 4JR1A 2DJIA 5JROA 3GV0A 5BSHA 4CF7A 5ES3A 1JEQB 2IUEA 4PG6A 1TA0A 2YYYA 3GEHA 4H6VA 4YDQA 1B15A 3UAZA 3KE8A 1JLLA 4PYOA 4AZWA 2WB2A 4A1OA 4AJLA 1XZDA 1BA2A 1U3TA 1T4CA 1P0CA 4HDRB 4IFTA 4D99A 1UT8A 1RMYA 1BX1A 2GCEA 3EEBA 3QMMA 4OHXA 3WZLA 4OQ4A 3M1YA 3NBXX 1T2DA 1I2DA 4NVRA 5I8PA 2HC9A 4E4RA 1WABA 2DMRA 3C1UA 3MG9A 3BREA 3PNKA 1Z8FA 4FHDA 4TTRA 1B1AA 4WXHA 3K1AA 1OH6A 1ADJA 1V5IA 3OIWA 1H22A 2GJKA 5F9MA 4QEKA 4I3GA 3UPUA 4GE0A 1OC4A 5JNVA 5E6UB 3AP3A 4POAA 2HM7A 4UUNA 1MR3F 2IKQA 3EQ6A 2Q99A 2FZ4A 3HE3A 1DRKA 1HYGA 3KUKA 3ZK7A 3SM9A 3RK4A 1UAAA 3IA2A 4DQKA 4I4TA 4Q48A 3WK5A 2QUZA 4YT8A 4QBTA 1DDOA 4CMEC 4QJ3A 1YCGA 4TT8A 3UMJA 5F7OA 5KREA 1HTTA 2P91A 2DH6A 4Q12A 4DMKA 2EF0A 5EUQB 4DCPA 5K8IA 4IZHA 1UWCA 2O3QA 5FULA 2O8FB 2CJXA 3IC5A 3OJWA 2FW8A 5JOQA 2B0JA 1TZCA 4HYYA 3TUZC 1H4QA 1YMVA 3PGLA 4D8WA 1KYQA 5BOSA 2JVIA 3AU8A 2VSNA 3O8DA 1AHHA 2O8CA 1XQ6A 1KIFA 1KXJA 3RS5A 2IXDA 3O7MA 2GVDC 1AK1A 3UXMA 3LCVB 1L4LA 4Z0PA 2P2GA 3W5DA 3EC2A 4O8CA 2G0NA 1U1EA 4KGXA 4BKQA 4DNOA 1EFDN 3FZYA 4LBVA 5DIFA 2RJ3A 1XDDA 5IRCD 1YZFA 2XMBA 3QLVA 3IP3A 4QUJA 3SDBA 3BIOA 4MZDA 1HLGA 2O5RA 3L1JA 3OIVA 3PGJA 4PPYA 6LDHA 1WUHS 3OCVA 3DULA 1N2GA 2GFQA 1N5JA 3JYHA