3STXA

Crystal structure of tomato methylketone synthase i h243a variant complexed with beta-ketoheptanoate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDAVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
molecule keywords Methylketone synthase 1
total genus 85
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stxA00
5CXXA 3BL8A 3M83A 2BAGA 2QUAA 2Y6UA 3L1IA 3FYTA 1GQRA 2B61A 4QA9A 4KEAA 1QTIA 4KR0A 2XQKA 2WUFA 5AM0A 1CUVA 2PVSA 5DWDA 2H7XA 3QPDA 4J0DA 1G5FA 4OPMA 5CH5A 3D7RA 4Y2SA 5HK9A 1O6FA 5JZSA 4UPDA 2WHQA 4X3CA 3AZQA 3BJRA 1LNSA 1X70A 4DYHA 3FWHA 5ALHA 1LPOA 2YYSA 1EB8A 2VT6A 1CUEA 2V97A 1GKLA 4G4GA 5JAOA 4OYYA 2OGZA 1DWPA 1ZICA 3KXPA 1EDEA 4HVTA 1WM1A 5AM4A 5AM3A 4AMYA 2P8SA 3G0BA 3NGMA 1MAAA 5ALMA 4DNFA 5HKBA 3ESAA 5IH7A 3O4IA 1WCYA 5ALYA 4K6GA 5EI5A 3BXPA 2WG1A 1YS2X 1FFBA 4LXHA 2J4FA 4FNMA 1IUOA 1QLWA 2PU5A 3TGLA 4BCDA 1DWOA 4BP9A 3HSSA 5A62A 3RLIA 2C58A 3OPMA 2XT0A 5HQ3B 2Z5GA 4X93A 5FLKA 4WDQA 2WM2A 1SCKA 2VF2A 4EBBA 1H2WA 5AICA 3FVTA 5T4FA 1UK6A 5ALGA 3STYA 4GWLA 2XMRA 4X91A 1I6WA 4Q3LA 3V1KA 2WTNA 3G9ZA 4C01A 3QZUA 1BEEA 4RNCA 3W2TA 1BS9A 1X2BA 1YSCA 2DHEA 1MJ5A 3D3NA 1NU8A 1JT2A 4EY5A 4BC0A 3LLCA 4QWWA 4J7AA 3OURA 5DNWA 3U0VA 3D59A 1ZIYA 5A71A 1R1DA 4ZI5A 3AIKA 4W1QA 2JGIA 1ZGBA 5LKRA 5BV7A 2V96A 4N5IX 1H2ZA 5ALWA 1CR6A 1XQWA 3GBSA 5FUMA 3DOIA 2WHPB 1ZD4A 5AM1A 2JEZA 2WIKA 4CG1A 1MT3A 5BOVA 4F21A 2W6CX 4HRXA 1BN7A 5ALSA 5DTJA 4H7IA 2BGRA 5KREA 3I2JA 3AUKA 4GDMA 1J06A 3IDAA 4J03A 2RONA 1UK7A 2PUJA 4UFNA 5K5EA 3P2MA 4BE4A 2CUTA 3DEAA 5D6OA 1W75A 2J3DA 1N5MA 3I6YA 3WL8A 2PKYX 1CUFA 1HBJA 1XKLA 1XRQA 4Q3KA 2QRUA 1CQZA 2OG1A 1WB6A 4L9AA 2XQIA 1SCIA 2Y6VA 4LXGA 2Z3WA 1DX6A 1CUBA 5JZ9A 4KAJA 3X3HA 1CEXA 4B0PA 3C6BA 2DCMA 3FLBA 1QOZA 5ALKA 1XZCA 4DMFA 4BDTA 4J0CA 1TCAA 5FP0A 2AXEA 4KAAA 4HRYA 4LYDA 4DIUA 4X7BA 3G0IA 5SYNA 4PQEA 4JYMA 1BEZA 1FFDA 5AM5A 1UT6A 4OB8A 3ILSA 3N2ZB 4EA6A 2XMCA 4M0EA 3ZLUA 5T4BA 2C7BA 3A2LA 3F98A 1ZGCA 2ZYRA 4ETWA 4CG2A 2IITA 4W1RA 3H18A 5AH0A 2K2QB 4QDUA 1UWCA 5ALJA 1CRLA 3E4DA 1CLEA 3ZWQA 1XZEA 2ACKA 1Q83A 5FV4A 4ZGBA 1XRMA 3STWA 3G02A 2WUGA 4H7DA 5DLPA 4DNOA 5SYMA 3VJKA 1MU0A 1PFQA 2DFPA 3KWJA 4AB1A 4BTLA 2CJPA 1XZIA 3DYVA 4ZXFA 3UUEA 3SC2A 4H7HA 5ALLA 2QTBA 5IKXA 1XLVA 2VEOA 5K3CA 3I2GA 1DTEA 2HL6A 3G9TA 5LZ9A 4AZ0A 4NS4A 1XZGA 2Q0XA 1XQYA 3S2ZA 4PSDA 4FTWA 2QUBA 1CFJA 1YS1X 1QTRA 4EY4A 1G4HA 4KRYA 2G5PA 1UOQA 2PSFA 4BRZA 1QONA 2XUKA 4KJXA 5E2IA 2HU7A 5JZBA 1HQDA 4G5XA 4YPVA 3PFBA 1WB4A 3EBLA 3W05A 4E46A 5DTIA 3T4UA 4MWTA 4C88A 3ANTA 5LZ2A 5JD4A 4U2BA 1ODSA 1AZWA 3G0GA 4QWMA 3G0DA 3TRDA 4Y2QA 1CUYA 3QITA 3D4LA 2ZYIA 4OCZA 5K3BA 3WK6A 4BATA 5ALEA 5AK3A 1W1IA 4XWGA 1EK1A 4G8CA 1BE0A 2HA3A 5IVKA 1HPLA 1VLQA 2YXPX 2WUEA 3I6ZA 5AKYA 2XMGA 3G7NA 3FOBA 1IVYA 3O4JA 1D07A 2HA5A 2Y1KA 4W9RA 1XZJA 1TCCA 3EIOA 1XKTA 3WKDA 5JADA 2XMZA 3QPCA 1E66A 4A16A 3IUJA 3FCXA 3VISA 4UBNA 4BVKA 1P0QA 3K6KA 1R88A 5ALRA 2B4KA 4EB0A 1A88A 1A7UA 4A23A 1KU0A 5LKAA 2DHCA 2VAVA 1VE6A 4AQDA 3FLEA 4QE3A 4PSUA 4BAUA 3C43A 2I3ZA 1RWQA 3EQ7A 3HZOA 2XUFA 5CW2A 1UXOA 1Y7HA 5FXMA 1OCEA 4PSCA 1CUZA 1K4YA 3HC7A 2WFLB 2WU4A 1MN6A 2XUGA 5AM2A 2HRQA 3DOHA 5ALUA 5HF5A 5FOQA 1QIJA 5CXUA 5AKEA 1YA8A 4F5ZA 1LPMA 1GPNA 1LPBB 5LP1A 2ROQA 3F67A 3EQ9A 3DNMA 2G4LA 4DNQA 4M0FA 4X00A 3WMRA 5CT5A 4G9EA 3VXKA 2C5FA 2XE4A 1IZ8A 2JEYA 4UBMA 3U1TA 4H35A 1KEZA 3O0DA 5A6VA 2HHAA 3WK4A 5FDFA 1AGYA 4TGLA 4A5SA 4J3JA 5AOAA 3PFCA 4KRXA 1BCSA 2WIGA 1EHYA 3DDUA 4LIPD 1Q84A 1QIGA 1EX9A 2ORYA 5ALOA 4ZV7A 1UK8A 2VATA 1H2XA 2HFKA 1XLWA 2GYVA 4IQ4A 2GZSA 3D2BA 3N0TA 2XMQA 4DSAA 3F97A 4UBKA 5BWCA 2WUDA 1CIJA 4FHZA 1MX1A 1QIDA 1WHSA 4Z49A 4DGQA 2JGKA 1PV1A 4E11A 5AKHA 2OAGA 5AK6A 4ZRDA 4B80A 3STXA 4X85A 4BE9A 2WHRA 5D7BA 1MNQA 3CN9A 3DLTA 3QBJA 1SOMA 3WA6A 2RI6A 2XI4A 4C4YA 2QJRA 4FLEA 1Z68A 4BC1A 3BIWA 5AP9A 1XQXA 4MXDA 3IULA 4TVKA 1ODTC 5AHXA 5HZGA 1JJFA 4L72A 3WK7A 1DQYA 3ICWA 1ZJ5A 1SFRA 2ZJ7A 4OUKX 2QXTA 1VOTA 3QPAA 1XZDA 4FBMA 5E4JA 1MO2A 2DHDA 4WFKA 1WPXA 3D5EA 3W9BA 5T4EA 4INZA 2QR5A 1QO9A 3ZI7A 5AI5A 1ACJA 5ALZA 5IVHA 1LPSA 1CUHA 4MEBA 3VVMA 4G8BA 4BVLA 4KE9A 4DTCA 1QO7A 2CB9A 4H18A 5E4TA 5DJ5A 5ISMA 1CQWA 3GELA 5CT4A 1K8QA 3GZJA 1G66A 1RP1A 4BZZA 5EIAA 5ALXA 4PNZA 4QLOA 4XVCA 1AURA 4CCYB 3ESBA 3OTQA 5ALFA 2B20A 3LP5A 1F0PA 1CUGA 1MNAA 1U65A 4U2FA 1ZJ4A 1BCRA 3FYUB 4E14A 4HXGA 4NMWA 1EVQA 1JJIA 3H17A 5EIHA 1C7IA 1GPLA 1FFAA 1N5RA 3IURA 3AJAA 4YK7A 1XZLA 2VSQA 1EH5A 3SX4A 5AIBA 3FSGD 4FDMA 3L1JA 3WWPA 2V98A 1A8UA 1THTA 2OQVA 3ED1A 4X90A 5KWJA 2XQGA 5T4HA 4H7KA 3DQZA 2WFZA 5YASA 3V9AA 4C89A 3D2CA 4AX4A 1YB7A 1QIEA 5KBYA 3STVA 4K2AA 5JD5A 3LIIA 3BF8A 4IH4A 4Y9SA 1XROA 4LYEA 2XQFA 1R3DA 5ALNA 3WQHA 1JKMA 3KSRA 5I9IA 4BTVA 5AK4A 4AN1A 2XUJA 1N8SA 2WG2A 1A8QA 1OILA 3FVRA 3BIXA 4OSEA 4DLNA 3OM8A 3WWOA 5AI0A 1CUIA 4WCVA 3A2NA 1DWQA 4HAIA 2HFJA 1NU6A 4C4ZA 4B83A 4Q34A 2XDWA 4U2CA 4G8DA 4FLFA 1P0PA 3WKCA 5C8ZA 1QIMA 4QDTA 3SK0A 1CVLA 5JALA 3QH4A 5CMLA 3C6YA 1VA5A 1C4XA 1E8DA 2WIDA 2XMSA 5DNVA 3K9BA 2RIPA 1XFDA 4FWBA 3O95A 3RK4A 3WK5A 3B12A 1GZ7A 4IHAA 4AXBA 3WLAA 1Y7IA 4L3WA 5BWBA 4J0IA 1ZI8A 2B9VA 3IVMA 7YASA 4UHDA 3AIOA 3PF8A 1JI3A 4PV7A 2XB6A 1MTZA 4L0CA 2X76A 2J4CA 3MUNA 1J1IA 3WKEA 1IUNA 1YAHA 3NOXA 4QDZA 2GZRA 1IZ7A 4KYVA 2X5XA 4UBIA 3C8DA 2XUAA 2AJDA 4G4JA 1XZHA 4G1FA 4FLMA 2WKWA 2ZJFA 2HA7A 3C6ZA 4IH9A 3DJYA 4HS9A 1J07A 4AN0A 3WIOA 3I28A 2XUOA 4UBOA 1LPPA 4WFIA 3C5VA 4U2DA 3H1AA 4H7JA 3ANSA 4LKOA 3I2KA 4DMHA 1AQLA 4XX1A 5AI4A 1TIBA 4CCYA 1F0NA 4RPCA 4MYDA 4CG3A 2HA2A 4P9NA 1IUPA 1LBTA 2E3JA 1UZAA 4EUSA 5D3KA 2GYWA 3A2MA 1P0MA 1ZOIA 4WFJA 3WJ2A 2QZPA 1GKKA 5LZ7A 1UOOA 1SCQA 1UKCA 4B81A 5IVIA 5CT6A 1GT6A 2VJCA 3PI6A 1FJ2A 4FMPA 4AO7A 2PUHA 2GBCA 4KE7A 3WL7A 5HKAA 4UHHA 3IUNA 5DYWA 3IUQA 4XIIA 3ZLTA 2HIHA 5AKJA 4IO0A 4BCBA 1EDBA 1YAJA 2J3QA 5FRDA 1ZD2P 1Q0RA 3I2IA 2WJ6A 3DL7A 4Y2JA 3O9MA 3QMWA 5AKLA 1LZLA 5AO9A 1VZ2A 1UK9A 3AFIA 1VA4A 3O4HA 2WSLA 3VDXA 3BJMA 4X6XA 1ISPA 4BCCA 4X71A 3GFFA 4EHBA 3CXUA 2BJHA 4X92A 2HM7A 2WTMA 5HF8A 2XUDA 4DMKA 4EY8A 2HADA 2V9ZA 2PSDA 3V1LA 2XLBA 1XZBA 1DINA 2XUPA 4W1SA 1QIFA 3PDCA 1GXSA 2OQIA 1G42A 1TK3A 5DNUA 3STUA 3C5WP 2BUBA 2IX9A 4ARAA 3OC0A 3BDIA 2PBLA 1ACLA 1E8NA 5K3EA 2QM0A 2I78A 5JASA 2PU7A 2VJDA 3DKKA 2HA4A 2OXEA 3I2FA 2RGUA 1LGYA 1U2EA 2XLCA 4V2IA 2OAEA 4Y2YA 3VJLA 5K3FA 4JYPA 1MX5A 3WKAA 4RE5A 3BWXA 4N8EA 4BRSA 3C45A 2CBGA 4RE6A 2O2GA 1WHTA 3EQ8A 2GBIA 3T52A 2H1IA 2O7VA 4UHBA 1AKNA 2Y2UA 3ICVA 2Z3ZA 5LZ5A 2OCGA 4CIBA 3G9UA 4RGYA 4ZV9A 3VJMA 3H04A 3H0CA 5AI8A 3HJUA 2XUQA 5LIPA 3ZV7A 4AMZA 5C7YA 2CMFA 1K6EA 1DT3A 3VKFA 4DSZA 1IMJA 2WU3A 1DT5A 4HXEB 2G63A 2YH2A 3WWEA 4Q82A 3QM1A 2BUCA 1CUXA 2VJBA 4F0JA 1EK2A 3PE6A 3MVEA 1JFRA 3QMMA 4WY5A 2YASA 1WB5A 2H9YA 2C0PA 1KU6A 3FNBA 1XRNA 3LCRA 4J0HA 5CRIA 3WWDA 1DU4A 2EEPA 2ZJ6A 4FOLA 5LZ4A 1HL7A 1UKAA 2VA9A 1QFSA 2O2IA 1TCBA 4P92A 1ORVA 2D5LA 1THGA 3DL4A 1CUAA 2BCEA 2PPLA 5EIEA 4KAFA 1GQSA 5ALPA 3HXKA 3IIIA 4H0CA 2PSHA 1RYYA 4QDXA 1ZI9A 2Z8XA 5JAHA 1C7JA 2QS9A 1H2YA 3RARA 4NVRA 3KD2A 3R0VA 4AZ3A 4F60A 3HRHA 2FJPA 4EY7A 1VXOA 1YB6A 4GBGA 1E3QA 1ORWA 5A2GA 2VQ6A 4Y7DA 4W63A 5AOBA 2RAUA 2GBFA 1ODCA 2CEKA 3CCCA 3ZLVA 1XZMA 4X6YA 1YASA 1XZFA 2ONCA 4B84A 5K3AA 3F8SA 1H23A 2O7RA 1R50A 3V1MA 4D9JA 4GW3A 3GUUA 1AC5A 4UFOA 3FAKA 2BGNA 5HQ3A 2DR0A 3FLAA 2JGFA 3MUOA 2QT9A 3KOOA 3WL6A 5ALTA 3H2IA 3C87A 5LZ8A 1VJ5A 4GI1A 1TKRA 2JGLA 1ZIXA 3BF7A 1B41A 2C5GA 2DQYA 3FCYA 3O4GA 3M82A 5K3FB 1GPKA 2CZQA 3IUMA 2H7CA 3DCNA 4LHEA 2BUAA 1W52X 1F8UA 3AILA 2DSNA 5ALVA 4K5QA 1B6GA 1O6GA 2WQZA 3C70A 3C8HA 4YASA 2HDWA 4QLAA 4X6UA 2NW6A 5HFAA 1MX9A 2ZSIA 2WHPA 5CURA 4MQMA 4AO6A 1FFEA 1K5PA 1R9MA 3I1IA 2O2HA 3DS8A 4Y2VA 1CPYA 3HYSA 3I1YA 4S0XA 2WFLA 5ALIA 3QVMA 5C8XA 4C4XA 5J3JA 4N5HX 3F96A 4DM7A 4XJVA 4ITVA 4GHWA 4WJLA 1XQVA 4KACA 4I19A 3R3ZA 1K63A 5AI9A 1UFOA 3R3UA 1CUUA 2OCKA 5A7HA 2VAXA 2AJBA 4M0MA 4UBJA 4J0JA 4YX9A 3PF9A 1AX9A 3H2KA 3WJ1A 5FKJA 1QIKA 1LPAB 3WYDA 4Y2UA 2W22A 3STTA 1XZAA 4NZZA 2XMDA 2GBGA 2XQJA 4FBLA 1W6RA 1MPXA 4OU5A 4B6GA 1L7AA 5AKXA 2OPHA 1M33A 5HK8A 3FBWA 5AOCA 5I8PA 2JBWA 2D0DA 1JU3A 2EDAA 2RHWA 1JJBA 4GECA 1JU4A 2QOEA 5JYCA 4DMCA 3W04A 1TAHA 4QEKA 1AMNA 2AJCA 4LXIA 5CT8A 4BP8A 4Y2RA 4HZGA 4UUQA 1DQZA 4OB7A 4ROTA 3B3QA 3R3VA 3H2JA 1EVEA 1LPNA 3CCBA 2Z8ZA 2VJAA 2PSJA 4HXFB 5AKGA 4TPKA 4IH1A 2AJ8A 4KE8A 1BU8A 1EXWA 1XLUA 5C81A 4UBLA 2ACEA 4BAZA 3FSGA 1WPRA 5JAPA 1QJ4A 2R8BA 3JW8A 3R3YA 2XUHA 2FUKA 5LYYA 4G4IA 1J2EA 3I2HA 5I7UA 1VXRA 4X97A 4H77A 2EDCA 2OCIA 4QZVA 4W1PA 4FFWA 5H3HA 1CV2A 3H2HA 1QFMA 2JIDA 4HTAA 1UOPA 4P93A 1N1MA 1YR2A 3HABA 2FX5A 3WZMA 2PL5A 3LS2A 1CUSA 5JAUA 3DKRA 3K2IA 2PM8A 4Q05A 2BFNA 4UFPA 2G5TA 3KDAA 5FPQA 2ZYSA 3MGAA 3WWCA 4J0GA 2WLSA 5F4ZA 5D3ZA 4BVJA 3C6XA 3HACA 2OLEA 4JNCA 2WG0A 4DNPA 3WKBA 3PUHA 2IIVA 4EY6A 2HA0A 4Q3OA 1BROA 2JGEA 3OOSA 1XRLA 3E0XA 4JH0A 2JF0A 4CCWA 1LBSA 1S8OA 5DYYA 4BZWA 3FYUC 1BRTA 3IB3A 4MJ3A 2PX6A 4UHCA 1EDDA 4GLBA 3V48A 2QXUA 3NWOA 2C0QA 4WDRA 4C6HA 5JIBA 1TQHA 1R4ZA 2QMQA 3IBTA 3Q0TA 4E15A 3VVLA 3WYNA 2JGJA 5A7GA 2XMBA 5JD6A 5LLSA 2LIPA 1ZI6A 4FFVA 3ZPXA 1WOMA 3WL5A 1E5TA 1Y37A 2DQZA 3PUIA 3WA7A 1JMKC 4Y2PA 1EI9A 3AINA 2Y2VA 2VTVA 4MYSA 2JGMA 3EF3A 1T4MA 1L7QA 1CUCA 3M81A 2RHTA 3TEJA 3WZLA 1T2NA 1LLFA 3M3DA 4B82A 1BN6A 1X2EA 4B85A 2GYUA 3Q8WA 1XRRA 4WY8A 4Q1VA 5E4YA 2I3DA 1GGVA 3S8YA 1P0IA 1H22A 4J0KA 1QIIA 4QNNA 5AKKA 5AKIA 5CH8A 4U2EA 2QVBA 5AIAA 5CBKA 5JANA 2XUIA 4OYLA 3PICA 2CKMA 5AI6A 4KE6A 3SWWA 3G8YA 2ZVDA 4Y2XA 1CUWA 4ZWNA 3WK8A 1VKHA 3AZOA 4U2GA 1MAHA 3BDVA 4I3FA 1EB9A 1QE3A 2UZ0A 4B9EA 5FPPA 5IVDA 3B5EA 3JYHA 4BDSA 4N8SA 4UHFA 2HU8A 5CTAA 1EA5A 4B7ZA 2ECFA 3YASA 2QJWA 1JMYA 3UUFA 1CUDA 4GEGA 5HCUA 3RM3A 4FKBA 1DX4A 2X8BA 1XRPA 3G9XA 4FNGA 4P08A 1UKBA 1L7RA 2WFMA 5A7FA 2VT7A 1XZKA 2OCLA 4PW0A 2WILA 3W9UA 4K6HA 3H1BA 4JUIA 3WI7A 3HI4A 6YASA 2FJ0A 3WIBA 4H7FA 2QKYA 4CIAA 2HU5A 3DYIA 3G0CA 5JARA 4BB0A 4BYMA 4GXNA 3H2GA 4X94A 1E8MA 2AJLI 4H7EA 3R3XA 3CN7A 4B0OA 5ALQA 4BBZA 4C87A 4N8DA 5C8VA 3RKSA 2ES4A 2HRRA 2HA6A 4PO3X 5AJHA 4PF1A 1W76A 3L1HA 1TRHA 3A70A 3O9VA 3R41A 3ESDA 5HF6A 2WIJA 3KWFA 3I6MA 1LZKA 4MWSA 1VZ3A 5ESRA 1VE7A 4JEIA 1R9NA 2I03A 3HLKA 4O08A 5EHNA 1FFCA 3E3AA 1HLGA 2WJ4A 1W4LA 1QIHA 5JATA 4CI9A 1U4NA 4ZREA 4AO8A 3AIMA 3D2AA 5KWIA 3R3WA 1USWA 5HFNA 1FSSA 3BE8A 3WK9A 4K6KA 3W06A 5EHXA 1NX9A 1HKHA 1YA4A 3F9CA 1QZ3A 5CH3A 5EHQA 2WJ3A 1YCDA 1OXMA 5EFZA 3E1GA 1HDEA 1CUJA 1PJAA 5DYTA 1SC9A 1QGED 4UHEA 3GA7A 5ALDA 4G9GA 4MEAA 1EINA 3GROA 1ZD3A 2WIFA 3NUZA 3AZPA 3QYJA 4QDOA 5EHZA 4EZIA 2ZSHA 1AUOA 1ZD5A 4X95A 2C4HA 4Y2TA 1U8EA 1Q0ZA 1A8SA 5AKZA 3R40A 3FYUA 5CT9A 2PSEA 3A6ZA 4OB6A 4BAGA 3JWEA 5EGNA 1ETHA 2H7YA 3OG9A 3ESCA 3HEAA 5HF9A 2BKLA 3IA2A 2ZYHA 4OD0A 4ARBA 5K3DA 4B9AA 3LIPA 2OGSA 3TJMA 2OGTA 4OU4A 3DD5A 4I4CA 1E89A 1F6WA 3QMVA 3V1NA 3UMJA 3H19A 4MQLA 5AK5A 3D0KA 4CFSA 2R11A
chains in the Genus database with same CATH superfamily
1QDEA 2BP7A 4A2QA 4FHEA 2NU7B 4ZP1A 3BL8A 3HYCA 1UPBA 1TI7A 4KXQA 2Y6UA 3L1IA 3BZUA 3ZKWA 3FYTA 1EUZA 3E0QA 1V5GA 2E4XA 3QNMA 4HB0A 3RJTA 4CR6A 2XNDA 3NVAA 1C14A 1YZQA 1GQRA 3ORHA 1CKEA 4GP9A 1E3WB 1RCUA 3KSUA 1BOOA 2CCKA 2BKXA 2GWHA 1KK1A 4K8RB 2OVBA 4GAEA 4NCKA 3RNLA 3TL2A 3VPFA 4TLAA 1YL7A 1F8XA 1RQ7A 3NFRA 1Y7LA 4ESOA 3SE7A 1LNZA 4IUCS 4OKNA 2BSAA 4BQNA 2ZRLA 1C4OA 5BWOA 3GFTA 1YJXA 4LNAA 3WSVA 3DMDA 3QPDA 1YQWA 4YJFA 2RGWA 1U8AA 3ONWA 2CNOA 4OPMA 3GPDG 1Y80A 1HFKA 1E9RA 4RKFA 4TM8A 3AC0A 2OV8A 2OXFA 4O59O 2A9RA 3MMPA 4LJ8A 4XZ3A 3LX6A 4Y2SA 4YAJA 1L5QA 2W6PA 4A26A 3ZJUA 5I4CA 4DYVA 1SHTX 2R8YA 3BXHA 1U8UA 4UNNA 3BJRA 1YQQA 1WVGA 2C0CA 3IESA 1M6WA 4AWAA 3I76A 2ID9A 5ALHA 1LPOA 2FTKE 2VDQB 2DC1A 2IUFA 4I2VA 2X19A 3BX1A 2FZCA 1T3ZA 2J46A 4R2MA 4TN5A 2HDOA 2VT6A 1KJYA 1CUEA 3KEFA 4G4GA 4U9IS 2VPPA 1C3VA 2QX8A 4MI9A 1NSTA 3OAAA 1JFVA 1WLYA 3FHOA 4FGZA 4FOOA 1DWPA 4H3KB 3E70C 1I5RA 3PLAE 2BTOA 2FJUA 4ZI7F 2FR8C 2W8BB 1TM5E 5DLYA 3PX2A 4XDGA 2A14A 4M7PA 1V6CA 5G0WA 1HYGA 2C1XA 1R00A 2O3SA 4WTOA 1ICEA 4UC0A 2ZRFA 5AM4A 4AMYA 2PVPA 3G0BA 13PKA 3NGMA 1MAAA 4TVOA 4E32A 4O0LA 4E2FA 3BJEA 2HZ7A 3H1TA 4MIEA 4ZQIA 8GPBA 3DF7A 2CUKA 2J5QA 1W85A 2ID4A 3JS5A 4GP7A 2WLTA 5JQGB 5HKBA 1ZY2A 5IH7A 4LGVA 2I3GA 2KM1A 1WCYA 5ALYA 3HGMA 4K6GA 4RKQA 3RS5A 1BKSB 3OQHA 2WVJA 5IKPA 3BXPA 1EFPB 4OP2A 3LQRA 5BR7A 2WD9A 2NZUG 4BLRA 4C1NA 4MVJH 2WJYA 4GGPA 1NJ5A 4EF6A 4D26A 3LYLA 2VHCA 1FTSA 4JJAA 1W5BA 3UT6A 4B31A 4Z7QB 3LXMA 3TGLA 4BCDA 2H3EA 1DWOA 1KPGA 2AN3A 3L1KA 5A62A 4F4UA 1BKDR 4EJ0A 3OPMA 1T15A 2Z5GA 3NHFA 4G01B 4Y9RA 4AECA 2WM2A 4JU8A 1SCKA 2VF2A 1KAEA 1PJBA 2J08A 2CMHA 2WDPA 1H2WA 2XA1A 2XAUA 4QOFA 4RPGA 4EFNA 3D1VA 2I76A 4FS8A 1PI3A 2OECA 4RKEA 1B7GO 2NPOA 5K2MA 5IG2A 1V8DA 4WE3A 2ZQYA 4L9RA 5T4FA 3UT5B 3W90A 4EFKA 5ALGA 3JR3A 2XH8A 3WOVA 1AKYA 2EFCB 3TD9A 1D2EA 3STYA 3PL5A 2XMRA 5DSTA 1RAFA 4KAXA 2Q1SA 5FBQB 3KAPA 1QQTA 1F2UA 4KX3A 1KGSA 4Q3LA 4X60A 2PH3A 3OCXA 1VE1A 2H29A 2WTNA 3V1KA 3ZU6A 5BSWA 2JLZA 2V8OA 3MM4A 3L41A 1ODIA 4GL2A 4RNCA 4ER5A 5EZYF 4DMRA 3Q2IA 4OHMA 5AJZA 2A1IA 4FC7A 1KAOA 1X2BA 4LKRA 4YV0A 1YSCA 4ZEWA 4MVJI 1P61B 3HTXA 2UXDB 2BFDA 3D8HA 3QA3E 4W7SA 2B30A 1E3JA 1U2SA 2W8BA 3LVFO 4O02B 1DJNA 5F73A 4JSYA 3IKLA 3VVCA 4C0XA 4HDSA 1ZUNB 3LLCA 5G41A 5AVUA 1A7KA 2QYTA 2V03A 2V9PA 4QXQA 4RSRA 1RWNA 2NV0A 2R6R1 2ZATA 1NUSA 4TSKA 4N40A 3FPFA 3AESA 4BLWA 2QROA 3B52X 4H2DA 6NULA 4MARA 1YHZA 1YR8A 1ZIYA 2FCAA 4RY2A 2BYTA 4BFZA 3W5AA 5JC1A 1QF7A 4UTOA 3ZY6A 3K1JA 4J3NA 1FP4B 2IEDA 2NT4A 1Z4MA 2Z4TA 3ZGXA 2VJQA 2OBYA 2O8CA 3SCZA 2YMLA 1UP4A 1JHXA 1EFAA 2XADA 2GAFA 3L8YA 4ND2A 2WU8A 4PLPA 2YNMA 2TMKA 4LNUB 3ZHUA 4AQYB 3GT7A 3MJRA 1Z7YA 2HBZA 1ONSA 1WXGA 3KKPA 1V9CA 2YWFA 4JBHA 2V96A 5GVRA 4YQFA 2QU8A 2RG7A 1Z8NA 3ZD9A 1H2ZA 1OPXA 1XDSA 1JTEA 1UJBA 3H5WA 5JLAA 3ID6C 4LDZA 5KC9A 1CR6A 2G04A 3GBSA 1XTJA 4DDTA 2YIDA 3DOIA 3QENA 1GAXA 1CW2B 2Y0PA 3DEIA 3GLHB 3N75A 3DAHA 3OEWA 2O1EA 4HGQA 7ADHA 1U5AA 3WFJA 3RASA 3PL1A 1MO4A 2IHZA 1R18A 1FQWA 2VP3A 2KWIA 1WJGA 5HG0A 6AT1A 2QD1A 3U7QB 3GUCA 2BWJA 1GPMA 1OXTA 2Q45A 3C3AA 3PB3A 2P7HA 1GNSA 3OECA 1TCVA 4BNHA 2O07A 4L15A 4OXNA 2BGRA 2FXIA 2PZBA 1R10A 5JQGF 4AJLA 1USKA 5KREA 5DM60 3PVCA 3V7FA 5B4VA 3AUKA 1ZIOA 1OAKA 4P2GA 2W90A 5JJIA 3I04A 3OPVA 2DM6A 3L6UA 1N3IA 2FF5A 4L8WB 4U4AA 4Y6RA 1CRQA 4H4DA 4C3VA 5I45A 4AQ7A 1JRLA 2GEVA 2RONA 2QRQA 3NG1A 1VCMA 3ONDA 4EW1A 1E1LA 1X1BA 3M1AA 2CD7A 4UDYX 4CE6A 1D2CA 2REQB 3IBSA 4HPJB 2GSWA 3F0TA 3GPIA 4PTZA 3TTVA 2ZXFA 4C6RA 4DDHA 5AVXA 3R9WA 4WMLA 1L5HB 5D6OA 3MWLA 2HI0A 2YHUA 2IHJA 3FOEC 1WBBA 4K05A 1HSZA 2DECA 3VNQA 4O2LA 1CZOA 1I4DD 2I54A 4ND3A 1G4UR 2PKYX 4RESA 1U3TA 5TPWA 4C5BA 2IHBA 4DV4B 4E4RA 5AT1A 2XITA 4J7XA 3ZE7A 5EZ5A 4L16A 1DJLA 2OQ2A 3ES9A 3GH1A 2O2SA 5CJ2A 2QRUA 2A9VA 4NP6A 3Q5GA 4TTRA 3W8FA 2GTPA 1A8PA 1XYVA 3ETHA 3FRHA 4TV9B 4UZFA 2OG1A 3SQXA 2D0OB 5L6LB 4CV3A 1SCIA 2Y6VA 1J49A 2VT2A 5F77A 2PMKA 1WZEA 3KEOA 5JS2A 3C39A 3E9NA 3PG5A 1NBEA 1CEQA 4MGZR 3UO8B 4YV7A 5B2FA 4KAJA 5JZ9A 2HO5A 3V2HA 4CMIB 1X80A 1E2BA 4X3PA 3L05A 3E9EA 4B0PA 2C7VA 4UZEA 1I3NA 1KMHA 4FGKA 4PLTA 6REQB 3VPXA 4ITUA 1OWNA 3E3OA 4IDDA 3GJZA 2BRUC 4IJUA 3RQIA 2PKXA 1T9BA 2N0SA 1GPH1 2QSYA 4RETA 3TSOA 2CT8A 4HGYA 4TMKA 3CPSA 1SVUA 1POWA 4M9ZA 1MIOB 3C4JA 3P9SA 2FQQA 5FT9A 1GA4A 1RM3A 1X86B 2Q8PA 4J0CA 1C8VB 3BE5A 4KHZA 1QZUA 1GCOA 3MRTA 5FP0A 3W4KA 3G5AA 3KAQA 3B9RA 5BVHB 2PEYA 4RYLA 3QP9A 2D7JA 3IMFA 2GN0A 4YV1A 3SYMA 4DIUA 1TEXA 2WRZA 5K4AA 5K0SA 3GGOA 3T7TA 3B60A 5CLJA 2PE5A 3G2HA 1P3Y1 1KVQA 2BDTA 4UAJA 4IV8A 1E6UA 5EEHA 2AFIE 3OMLA 1NIJA 1M3SA 1RM0A 3BFPA 3I23A 3GW8A 3Q9UA 1BEZA 1FFDA 2C57A 2JATA 2NYUA 3PS9A 4B6QA 1AY0A 4LE2A 4EHLA 2YXBA 5K6RA 1VP3A 2REQA 2YTZA 4MRMB 4LQLA 1ECGA 1RPJA 4Q19A 5E0OA 2G80A 4F1KA 3KOZA 4F4JA 1RRMA 1BHQ1 5ILQA 4PAMA 4AF6A 2QTTA 4W1RA 3WHKA 4Q3NA 1CY0A 1RWKA 3H18A 2WF7A 2DU8A 1U99A 3DBHB 3WR5A 2ZAYA 2XSZD 2K2QB 3X0DA 1Q5PA 2RHJA 1SXPA 1IWOA 2FPOA 2QU7A 3NM6B 5D84A 4AK9A 3L1UA 4ZKEA 3C3MA 4YUXA 2CNWD 4YMLA 1BXKA 5IAGA 4XQGA 3GLFE 3QFHA 3KTAB 2I2BA 2GM5A 2FUG1 4MKFA 4YNBA 2DY0A 1E94E 2QY6A 3E58A 4DLKA 5IUNC 1VBFA 4H7DA 3OTWA 1DKRA 1BVUA 2PQ6A 5CCXA 4RK1A 5TEVA 4ACBA 1EUYA 1XZQA 2DULA 1PFQA 2J9RA 4IIJB 1G7CA 4E5UA 3NB0A 1C0EA 3BHNA 4KVGA 4ZXFA 3JQBA 4D9EA 1EESA 4OGWA 1A1VA 1FRVA 3P9QA 3QPBA 4G63A 4WK0B 1O08A 1YC2A 4JQSA 1ZL2A 2XXJA 1YR3A 5AW3A 3M6UA 3H16A 1DTEA 2IGBA 3NX4A 3RREA 4I1RA 1P9NA 4FFDA 3LNTA 3PHIA 2V7BA 4IY1A 5AQEA 3LUGA 4ZCTA 1U2GA 1ND6A 1WY7A 3BWVA 3C5EA 3FPCA 4MW2A 1L4YA 5EY5B 1MIOA 4JI7B 1SQ0A 5TMEA 1YB5A 2FPWA 4RX1A 1LQ2A 4NS4A 5EQDA 4BVGA 3UMCA 3HVRA 3HK2A 1XZGA 2Q0XA 3OOJA 4UOEA 2VQDA 4NCBA 1KEEA 4J8PA 3R1IA 5FHQA 4JP3A 4PSDA 1RZRD 3BQ9A 4PC1A 1DXYA 4HBGA 1CYDA 3JVDA 4E33A 3PJDA 4HYQA 2I7TA 4LMRA 4DLZA 5DT9A 2XYPA 4ZVSA 4E4YA 1O96A 4PEVA 4BRZA 2PSFA 4P32A 4YPFA 3A2KA 1OZGA 4OXXA 4C04A 4CNQA 1Z3IX 3OLYA 4Q7KA 4CGYA 1EP3B 3R0IA 1FXWA 2I62A 4EHHA 4M7RA 4G5XA 4YPVA 3PFBA 2GEJA 1KNXA 4QXMA 4DDMA 1XPOA 4E21A 3ORFA 4DCSA 5DN6D 3W05A 4B3TB 3DKIA 4MB2A 2WSMA 4G0MA 1RRGA 2VLIA 4PXYA 4QXPA 4RQUA 5AWFC 2CBXA 1KI2A 3WQQA 4NOJA 3BT7A 2QLTA 2GNAA 1VJGA 1IJEA 1JSLA 2BH9A 5BQPA 4AG5A 2ZCVA 1MJGA 1DKPA 3VR0A 4JBGA 4PE5B 3HVKA 2R66A 4P58A 1M5TA 2C2BA 2GN9A 3I9MA 2CVFA 2H2IA 4BO9A 5CLIA 1QYIA 1ZXLA 5JWHA 5LZ2A 1F6BA 3IRUA 4QSMA 3SF8B 1LNQA 4TSFA 3LG2A 4BVHA 5CFMA 4UNPA 4U2BA 1COWD 1OC2A 2HCRA 2HF2A 1BYUA 1FUUA 1M2GA 1P1BA 4KQWA 5C1OA 3IQGX 2VH5R 2EERA 3JQ9A 1GY8A 4JT4A 1GYQA 1II8A 1UFRA 3A1TA 4QWMA 2WAXA 4Y2QA 1MEEA 4NYJQ 3TRDA 1CUYA 3D4LA 1QQ7A 4B6FA 4KIUA 2OHVA 1Z6TA 4MVJG 5J43A 4P35A 3UNXA 4BATA 1RFGE 1YI0A 2R47A 3FYCA 3HSYA 3MWJA 1J9ZA 4FI3F 3JQ7B 1R5BA 5D6NA 3ADBA 1GLGA 4BO1A 1KYIA 8LDHA 3TUIC 2Y67A 3OZXA 4CODB 3UFXA 4ENSA 4DBLC 3AJDA 2GRAA 4QYWA 5B1YA 1BE0A 1Z82A 1V1RA 4KLNA 4CCSA 1VLQA 4HMQA 5JXIA 1R15A 2BFDB 2IYTA 5FOVA 4F7DA 3HZZA 1UPAA 2J3HA 2WPDD 2IOFA 2YXPX 3T5GA 5BQFA 4YP6A 1GG9A 1K92A 1N2CA 1QX3A 2AR0A 1YKFA 2IVFA 3NYIA 4GF5A 4E6EA 1LF5A 1PSDA 4EW2A 3OHMA 2ESRA 3G7NA 3I73A 3DBLA 3OWOA 4LGMA 2M6KA 1P1HA 4PLWA 4FJ2A 1D07A 3P9CA 3UGKA 2ZBEA 2G9UA 4XUDA 1PR2A 4Q4LA 5DTQA 4AY4A 2OXIA 4HAXA 2J3IA 2B1QA 4MA0A 3Q8LA 4CLOB 1XKTA 2Q3JA 1XTTA 1E9FA 3RKRA 3QYPA 2BSXA 1E1RA 3QPCA 4PYLA 1FXSA 4RD2A 3WV4A 4KV9A 4E3ZA 3KM0A 1W4ZA 3FCXA 3AKDA 5EXTA 2BHSA 1PGJA 4G9BA 1TM1E 5CW1A 4L22A 3VISA 4CEIA 3O93A 1T8TA 3HKEB 3BFKA 6PFKA 1QU3A 2WMDA 5KSYA 5SICE 5ALRA 2B4AA 1KAGA 5IUKC 3SXJA 4REQB 3GGPA 5EJAA 3WB0A 4YMHA 4LHSA 4QRDA 4IIUA 5K1ZA 2P9BA 5AW9A 3TJRA 4AURA 4MYCA 2DFDA 4DG5A 1V71A 3URMA 1RIIA 3PPIA 7AT1A 5GJBA 1B8PA 3OP4A 4PQRA 1JALA 1YNOA 2PD4A 4EGFA 2WHEA 2C2XA 5JDIC 1Z75A 3UN1A 5K9ZA 3AXSA 2PBFA 1ENOA 4XIFA 1KMQA 3C43A 2PTGA 3EGOA 1FP6A 4GUAA 8ABPA 2FNAA 2OZLB 2I3ZA 3MMSA 4BEWA 2AZTA 4BMOB 3HZOA 1YDEA 4PPFA 5CW2A 5KQGA 3KFLA 1SUFA 3H4MA 1TO1E 1FLDA 2I3AA 1WDWB 3P9RA 5FXMA 5LNK6 3FPEA 2ODTX 2AF4C 3KHKA 1H1LA 3OP1A 4QUBA 3WRYA 4OMUA 4ZARA 3G2MA 3FMOB 3KXKA 1KK3A 4MVJE 3RTDA 5BN3B 1B23P 1AV7A 2XDAA 1EGMB 3VU9A 1NW8A 2AEFA 2VLBA 1XNRB 5F2KA 2PUDA 4M46A 2JEOA 2B7BA 3WLEA 1Q74A 2XUGA 3SPXA 5AM2A 3K7EA 3B2EA 5ALUA 1T5IA 2AC4A 4PNHA 1AO0A 1NVDA 1QZXA 2R2GA 2WI8A 2YOHA 4NZYA 4EPRA 1H4TA 1JQ5A 1YA8A 3HADA 3M6VA 1Z8DA 1G2OA 1GPNA 1YIAA 1X7ZA 4V0NA 5J4LA 3TGPA 2IS1A 1XZ8A 3WGIA 4JQZA 5KJCA 5LP1A 1SC6A 1W88A 2B37A 2PS1A 2QTRA 3T3EA 1XDDA 3DNMA 3WYFA 4DNQA 1RPTA 1ZK0A 4D45A 4NCHA 5JZVA 3T1QA 1E6WA 4X24A 2PGNA 4R16A 1KMHB 2AA3A 5CUQA 3L6OO 3O83A 4YMWA 1H5UA 3L9WA 3LY7A 4Q66C 1I7DA 4L85A 4TS1A 1DKQA 1PSWA 1EFTA 3CMMA 5D01A 2G09A 4ZGGA 1AVTA 2Z09A 4EJSB 2FDRA 3AR6A 2ZRKA 2HXGA 4ZVKA 1RXVA 1VE9A 3BMNB 2QTGA 4L0QA 3VDNB 4L95C 1QGAA 3VSEA 4YAKA 1PYGA 1AUPA 3ENZA 3IKJA 5ED0A 4I36A 2ZJ8A 4A15A 1CDOA 3R8FA 3BUSA 2H1CA 3OY7A 3VV3A 1O2DA 5MHTA 2HHAA 3FTFA 3EUEA 3F3YA 2ZYTX 3PGVA 4FIDA 1YVEI 4LCEA 4GO1A 5AOVA 5C8YB 2QE7D 3C1AA 3IPRA 2OZLA 2OCAA 1QAMA 2FSHA 2WEKA 4J3JA 3PXAA 1EAMA 2QYSA 3D54D 2VAWA 4KRXA 5CDTA 1PU2A 1RFLA 2LNDA 3BTUA 4DA0A 4ZJUA 3GA0A 4ID3A 1FUYB 4LIPD 1QRTA 1R8YA 5DW0A 1IM5A 1WSWA 3HCOA 3ROFA 3PITA 2B25A 5I9MA 4TMWA 4C22A 5DGTA 1TYZA 1S1CA 3GFBA 5BYJA 3TQQA 2GXQA 1IULA 1ZFNA 4ZV7A 3ZCUA 3ZIUA 1V8FA 2X4GA 4NBKA 2VRNA 3AM4A 4LOJA 3ENQA 5TQJA 1WF6A 3ML1A 3EOAI 4OO3A 2YICA 2HOQA 3KOUA 1ZITA 1FC0A 4AP5A 2MSNA 4GR9A 3THSA 1WNTA 2QLBA 2GTHA 4MINA 1OZFA 4IQ4A 1L4EA 4KFTA 1DJPA 2ON6A 4OIMA 1YA6A 3OZBA 1ND5A 3T06B 3IP6A 2I2WA 4LZZA 4E2ZA 4EPXA 1WD7A 2XMQA 4DV5B 3MBIA 4DSAA 5AVOA 3AMVA 1RKUA 2GAJA 2OFXA 3BWCA 4ZO7A 1U3FA 1UJ4A 1Z33A 4UATA 4WACA 3ZGLA 1X1TA 4HDKA 1A50B 4UDXX 4C1BA 1MX1A 3AI2A 4AMVA 1D1SA 2A9KA 1NN5A 2I7XA 2GA9A 2ZWIA 3DKVA 4MCIA 1SVNA 3EXAA 2B3DA 5FCDA 3R6WA 3PGJA 2PAAA 3ZWKA 1Y5MA 3GNLA 1TU3A 1C0IA 1P3JA 1QHFA 1V2HE 3WLOA 3M2PA 3ZDYB 1GPYA 3TLCA 3KQLA 2XZLA 3L8FA 3WLMA 4G2NA 3V8NA 2JGKA 1PV1A 5JYDA 4GXQA 3ZNOA 4ZHQA 3UAXA 3L4JA 1TK2A 2RK6A 3J80A 1PS0A 1UC9A 2VNAA 3NBMA 3UG7A 4G5FA 4K8OA 3STXA 1F9AA 2P2SA 2CC2A 5TT1A 1LLCA 4GBED 3CA8A 5EP1A 1WWKA 3QBJA 5E8RA 1UM8A 5EHGA 3OE7D 3ULKA 1KEPA 2A9FA 5AVJA 4YCSA 3LO8A 2C5BA 4LJ4A 4ALIA 3UMBA 3A4YA 2P67A 2QJRA 2JAXA 1W5EA 4NMHA 4ZOLB 3V97A 4NFYA 4ZVMA 2JFPA 1DUVG 4CU5A 1CC1S 2GKOA 3AGPA 4WOCA 3O6VA 4DLXA 1F14A 4MV8A 1X15A 1U4OA 3P71T 4YMIA 3C15C 3EVBA 2NXEA 4FM9A 2OG2A 3COVA 1YC5A 1ZBDA 3FF4A 2IOQA 2YY7A 3BN3A 4OHBA 3KTDA 2VDUE 3IULA 3PNKA 1NSYA 3HZRA 3VNAA 2C00A 4RTPA 4GZLA 1NZJA 1ODTC 1IB6A 5AHXA 3T0GA 3NS7A 4QGBA 5HZGA 3OM0A 5E9QA 4HWSA 3RKUA 3U3MA 3GA5A 3KTOA 4ICIA 1DQYA 3JQCA 3S2YA 3UY4A 4KBYA 5F3RA 4EB3A 3BM5A 4TTAA 1CJUC 1TMKA 5AXAA 2O0LA 1JKIA 4V0SA 1PWXA 2BFPA 2JH3A 2QTMA 3K9LA 1ZNXA 3NASA 3CPEA 4Q7JB 2NG1A 3AV0B 4FT2A 1NRWA 1Z73A 2Y4OA 3H1FA 4OGFA 5E4JA 4MVJF 2F64A 2HJSA 1KXJA 5C8YF 3FRIA 3H97A 1WPXA 3OU6A 5T4EA 2PMFA 4AJNA 1RQLA 4L8FA 4PYQA 4RK0A 4YMUA 5CFLA 3GEIA 1ZK4A 3IR6A 2QIOA 3THXB 2CXUA 3EODA 4D42A 1MB0A 5JXGA 1GA1A 5PNTA 3IV6A 2DB3A 2W2TA 3BDAA 2QUZA 4J7CA 1AT1A 4HEQA 1SBQA 2FZWA 1XP5A 2V54A 2P30A 2AI1A 3DR3A 3PFGA 5ALZA 1P75A 3ZVNA 3S2EA 1C9YA 4NEHB 1LPSA 1XNJA 4G8BA 1DUIA 1LRJA 4BVLA 4HGPA 5A5VA 1TU4A 4KE9A 2A5LA 4H18A 5E4TA 2P9TA 3CSDA 4RSHA 5ISMA 3NEAA 4D81A 1JSCA 2OV2A 4LRTB 4PZZA 3U39A 3KFXA 3NJRA 4HAWA 4YRJA 1R9GA 4XOUA 1FB5A 3W5VA 2QD2A 2NU6A 1NONA 1EVKA 2NZJA 4NZNA 5CT4A 1T25A 1IZZA 1TUEA 2JCBA 5DXAA 2GPNA 4QFDA 5B53A 1I9GA 2ZJ4A 4PHGA 1Z18A 2QM8A 1RADA 2ZI7A 1XMJA 3WMGA 4IO1A 5L3ZA 1R7RA 2JI7A 1R5JA 1LFDB 4LSMA 3O1HB 1JHUA 2GPBA 4LBWA 3AB8A 3WDLA 5E8JA 3WLLA 2UDPA 2Z1DA 1M2HA 3DVSX 4FCTA 4CETA 1BSVA 1SCBA 2YFQA 3PPYA 5ALFA 1Y0BA 3LCMA 4EQZA 4KZKA 1PW5A 3DBOB 4RCZA 1CUGA 1EDOA 2CVZA 1T9AA 2NO6A 4J16C 3T7RA 3D4NA 3TCKA 2FB9A 1BCRA 5KMGB 1IN4A 2ZBVA 3WGOA 2P3LA 1I2ZA 1ILWA 1EVQA 2YJ3A 3UJPA 3H17A 4A8JA 4C6TB 1QORA 5KOJA 3SHTA 3H9CA 3A1WA 1SG9A 4BN4A 5HOEA 3GLFB 3GRKA 4MUNA 1N5RA 4ERNA 5B6PA 3OY2A 2E85A 4CM4B 1BVRA 2ZCUA 3HU5A 2JA1A 4I55B 4YBRA 3KDSE 4ZOBA 4ZOAA 1P44A 4ZU1X 4E2XA 1Q0HA 2IF0A 3S8EA 2AJTA 3WRWA 1ZN7A 2JVIA 2XD4A 3WWPA 2V98A 3MWKA 3G5UA 1G3UA 1A8UA 1T1JA 1N25A 1THTA 1TVCA 2XYGA 3EZYA 3MYRA 2CL0X 4IVNA 4C7VA 1FS5A 1QFJA 4TVBA 5C32A 5CLLA 2XQGA 2AL7A 4LBYA 1L0BA 4D0SA 4I6EA 3TUJC 3FCSB 5DNYB 3GV0A 4R2WA 3D6NB 2V5UA 3LPDA 4AX4A 1ISFA 5JH7A 4XYBA 1H42A 4I2NA 2CYCA 3ZI4A 3NONA 1R8JA 1GAWA 4CV2A 1JTVA 4DLAA 1XNQB 1SZDA 4HAYA 4OIFA 5LMNB 1RWPA 1B93A 1TTPB 1KY5A 1VYHA 4Y98A 5FO1A 4B4DA 4C4TA 1XCPA 4I4IA 1CIVA 2V9CA 3EOZA 3GB9A 4GMKA 4EKIA 5JROA 1L4BA 3BF8A 3IKTA 5EFOA 3E22B 4PG4A 4XFDA 2FMXA 3BHJA 3B8EA 2P6OA 1VECA 1KETA 4WUTA 5LUBA 3RCBA 1JKMA 3KQKA 2O8EB 4GMDA 5U4XA 1OI7A 5ERXA 1X1QA 1FJGB 3OU7A 5LQJA 5I9IA 1JQDA 2ZI4A 5F2EA 4B3IA 3RAFC 5CLHA 3ZNNA 4BTVA 1QAOA 1C1YA 2XUJA 4KW7A 1OA1A 5JE8A 4QU0A 1R27A 1RP7A 2AK3A 2PZ8A 3WZ2A 2GCPA 4ALLA 4ZO8A 1Y4ZA 2WG2A 5EKXA 4ZT4A 2WKQA 3UGQA 4ZCMA 1A8QA 1KJIA 3OIFA 3QJ5A 1JMVA 4CMHA 3AR4A 3CNEA 2FOLA 1Z16A 2YJGA 4HKTA 4IKEA 4LJLA 3AI7A 2HBRA 4WA8A 4W4TA 4XIGS 3WGNA 4F2DA 3D9QX 1TKCA 2Q1YA 4NJMB 4QOJA 4UEQA 4X84A 2IELA 3NC1C 4FYMA 4UVDA 1L4LA 1ZW6A 1QVRA 2VPWA 3IT3A 2EOAA 4HQNA 5EINA 3GXOA 2HFJA 1I4EB 4B71A 4HO1X 1Y4DE 1LBHA 1XELA 3SF0A 4QATA 2CNBA 4OBXA 4IRXA 3Q8KA 1X1CA 4ACAA 1THMA 2Q9AA 1SCUB 4B83A 4TRRA 2WE7A 4Q34A 1SM4A 4ZI7A 5JRDS 5KX5F 3UPTA 2QQ0A 3N2GA 3KQHA 1Z22A 2Y9MB 4M0CA 3IP7A 2HQRA 4LWOA 1P0PA 1XJQA 1KP9A 1Y5RA 3BGSA 1SB8A 1YFJA 2I29A 4NJOA 2AUMA 5C8ZA 5JO9A 2O7NA 2W2PA 5REQB 5CEJA 3D5TA 4MEJA 1KOLA 4MR7B 2QJOA 3NETA 2PH7A 5KNLA 4HDCA 1SKMA 1PLLA 2HMVA 3OMXA 2C8LA 1IJKA 2ATIA 5LQSA 3V8VA 2H59A 2P41A 4JLSA 4YAGA 2G67A 2LBPA 2ZE8A 1VA5A 2R5NA 1EIZA 2ZAGA 3C6QA 4HHEA 3U62A 3UAVA 1YR6A 1DEAA 4D82A 2DVMA 4MPRA 2ZYUX 3KWMA 1JB9A 4W99A 1G19A 1NMQA 1U28A 4QRIA 1JWAB 4QUJA 2C5HA 5CCDA 4RCVA 4AP6A 4RWEA 1NI4A 1O0SA 2FRXA 2GEDA 3DPSA 3OQMA 2AT1A 2R6CA 2IOYA 2X9QA 1KDZA 1NVAA 3RK4A 3CINA 3O95A 3QEMB 2QPAA 3B12A 1GZ7A 3K31A 3LUHA 2YXNA 2YYYA 3WLAA 2PZKA 4EYSA 1U7DA 4J0IA 3IOEA 4DE5A 1ZI8A 2AH5A 2DWCA 4BUJA 2B9VA 3HRIA 4GEKA 1V3VA 2OO5C 4OEHA 4UHDA 4A82A 4MWDA 1R0CA 3C8MA 3E03A 3PJFA 2H5LA 1SHKA 3NRBA 4QO8A 3QXSA 2XE8A 4G5YA 3KBOA 2VTEA 1HZJA 4EA7A 4L0CA 3MHPA 1QR2A 2J4CA 5TGZA 4R0MA 2EQAA 3KWLA 1ILEA 1R0XA 2OPBA 1LFAA 1YAHA 1H6AA 3LC7O 3NOXA 3EGCA 4MQBA 4U8GA 4BN5A 3B6IA 1NE2A 1DQRA 2ODBA 5K09A 3S29A 1IZ7A 3OU2A 2NQ2C 3PGMA 2R7KA 1PWZA 4KPGA 3TEMA 4KYVA 2HMUA 2X5XA 3A1VA 3LLMA 2CE7A 3C8DA 5C5IA 3RUIA 5DNAA 4DLPA 2AJDA 4REMA 3CZPA 3IR7A 4G4JA 3GFPA 4FLMA 2ZJFA 4OYHA 1TGYA 1EFLA 2IW1A 2VXBA 1QP4A 3C16C 4GRDA 3DBLB 4IH9A 4DLLA 3NGLA 1IB0A 4RZUA 1QG6A 3UA4A 2WR8A 3W8RA 2Z1NA 2WW8A 3R5TA 5CGZA 3ZWWA 1DEXA 2YBEA 3D4BA 5CX1A 2E87A 5JXJA 4IJKA 3WIOA 4EEXA 1J2YA 1OFHA 3I28A 4M2LA 5IT4A 4PCAA 2FG7C 3G23A 3UMMA 1JHVA 4JBYA 3P0HA 2JD0A 2RB4A 1B3BA 3UAOA 4JZKA 4C43A 3ANSA 2WVHA 4LKOA 2FW8A 3CUKA 1NBWB 3K8QA 4DMHA 2EBUA 3ZZ1A 2E5FA 4LYAA 5AI4A 2YXDA 2FVXA 5AHRA 4U63A 1OROA 2RIRA 1A9ZA 4M7OA 3TMKA 4F4FA 2LUOA 1XQ1A 3ZWNA 3ZLJA 4MVYA 1KAQA 4A8JC 2R62A 4CCYA 5FUWA 5JNUA 3EDQA 5B55A 1F0NA 1J6UA 1QDLB 3OT1B 4MYDA 4YP9A 1NI4B 4MV3A 3LUPA 3F5MA 4CQLA 4LXXA 1IUPA 1X7XB 1E4OA 5LYJF 1L6IA 4KQXA 1NLZA 2AHOA 1A2QA 1NURA 3AHCA 4GYWA 4LRYA 4NDAA 4NU8X 3FLMA 5D3KA 3A2MA 4RHTA 5EVCA 4AP9A 2H57A 1JA0A 4F38A 4X1YB 1UOOA 5LZ7A 1UKCA 3PPVA 1H9AA 1DKUA 1RI1A 4MWBA 2RH8A 5BR8B 3I5MA 1UUFA 1IY0A 1KDTA 5IVIA 4P5EA 2HMWA 2H0RA 3PQ7A 5EWJA 1OB5A 4KQMA 1GT6A 2PZLA 1DCMA 1S9DA 2AMJA 5LD2C 2ZJ1A 1RXEA 3H7AA 5CA0F 2Z5LA 1KJ8A 1G8PA 1NDUA 2C2GA 4FMPA 5A4DA 2A92A 3ZWCA 3HJCA 1T9GS 3IVGA 1JDPA 2QT0A 1KWGA 2GBCA 3P9XA 2ZR9A 4KNWA 5EE3A 2GCOB 4YGXB 1F3OA 2FSUA 1V26A 5HKAA 4UHHA 3IUNA 4GZ6A 1M8JA 2AFIA 1AS3A 2ZE7A 3KQOA 4NU6A 1GL7A 4DRYA 3AKZA 3HEBA 3NNDA 3ZLTA 4MQ5A 3ABOB 3HB4X 5C8DA 2IZ1A 1FX0A 1D2AA 5C4GB 1ZD9A 3ZJTA 3VR5D 2F17A 4D0NA 4W7IA 3PFNA 4MUEA 4QBFA 1OLSA 3VFDA 1TFUA 4PLYA 2QN2A 1UMBA 4CMKA 3PUVA 1D5CA 1KMIY 3NPAA 5F51A 1U7UA 2REBA 3L7AA 5FRDA 1FDWA 1ZD2P 2G77B 1C30B 1NPDA 4R40A 4MRVA 4PBTA 1HTTA 1SA0B 3AEUB 4PGHA 3V8MA 3JATA 1GUAA 4YI5A 2XDQA 3CUWA 3DL7A 2I2CA 4Y2JA 3DEZA 1RHQA 3DVAB 3O9MA 4FSDA 2B5WA 4G23A 2AMVA 2O23A 4LY3A 4UULA 5FPKA 3MT9A 1E4EA 1ZJJA 3GDFA 1UK9A 2DPMA 3KAKA 3N8GA 3A1CA 4G6ZA 4IYJA 3DP9A 2HREA 4MI1A 1VA4A 4BLPA 2WT4A 3ZCXA 5K3OA 4FEEA 3LRPA 3NAZA 2UZAA 3PEUA 3CR8A 3QGMA 5G0UA 4TYWA 4X6XA 1HOXA 2GFQA 1NFQA 1XUOA 3AETA 3HA2A 4BCCA 1YFLA 3THYA 1TOAA 3AKYA 3NR2A 4EHBA 3TJZA 4LZAA 2V6FA 3E2PA 1RLUA 1IDN1 3KALA 3VPAA 5L3SA 5FUBA 3C3EA 3NAMA 4S2UA 1NVKA 2PWBA 1UFKA 4KXVA 2PXHA 3V1LA 4E09A 1DINA 3ICPA 3TN7A 4MS3A 3INYA 4MVXA 1WSDA 3BSSA 3G82C 1RMYA 1YDGA 1PJZA 3UMGA 4TXJA 3RS7A 4EUNA 3IAUA 1T0HB 4L4UA 5L45A 5B1HA 3QJGA 2Q0SA 1SZCA 4YFVA 4FINA 5C2JB 5B30A 3STUA 2D8AA 5CDHA 1VL5A 1SXGA 3OZEA 2GYYA 1AH2A 1M0SA 3EXEA 1FW8A 1G59A 4JYAB 1UPXA 2GCOA 1WCXA 4O6VA 2VBIA 3BDIA 1RABA 3GRPA 1XAJA 2OV3A 5G3YA 4ADSG 1ACLA 4ZTZB 5IX8A 1I32A 2Q1XA 4O2BF 2ECPA 1N5JA 1L8QA 1UDAA 4KMOA 2FI1A 3UBMA 3VOAA 1QRRA 2XBMA 5BXYA 2NWQA 3I2FA 3P97A 3BB3A 4Z8XA 5B3JC 4RVFA 4LF6B 4N41A 3KKQA 3KUXA 4E13A 2PLRA 1VPTA 2VOJA 3ZTTA 3B3AA 1IN5A 2OAEA 2IODA 2EZUA 1E1MA 3M2TA 4LI0A 4B1FA 5K3FA 3EAFA 3QVJA 4OI0A 3AVYA 3R24A 5EGSA 1PGQA 4L0MA 1J2JA 3OIWA 2G9VA 4NAHA 3BWXA 3FFBA 4F9TA 4IBOA 3TCNA 2Z2IA 1OVMA 1SXJB 4MQ4A 4BX9A 1XLTA 4V1CB 5JMWA 3IQDB 5CA0B 3B48A 4RLSA 3BH7A 4EZBA 3W4JA 1MGPA 3A1DA 5ER6A 3ADDA 4DLBA 4FEYA 3JARB 4PYNA 3H65A 5A0FA 4PZPA 1NUUA 4MUXA 3BK1A 2IYUA 3REQB 3U1VA 5JUWA 4W5OA 2X9VA 5MN5A 4J0QA 3P9IA 4GPTA 1SG6A 3KSAC 5K3EA 1TJNA 4MS1A 2BPOA 2H1IA 1K4MA 3AF4A 2Y2UA 2WSBA 4AMBA 3TAUA 1M8PA 4C2UA 3VAYA 3H4IA 1XJ0A 2PWPA 4CIBA 3G9UA 4HAVA 4F5YA 1QVAA 3M6XA 4ZXPA 1UC8A 2W6ID 4C7OA 4PZEA 4ZV9A 3VJMA 2I9KA 2QTCA 3P2JA 3WYGA 4FZJA 3SHOA 2QL7A 3DFUA 3IJPA 3LO5A 5AI8A 2RDMA 2PL3A 4UXJA 2ZCJA 4JJEA 4MR8B 2JCXA 2F1RA 4PX3A 4PXSA 2G4CA 3CKMA 3KHSA 2XUQA 2QV0A 4URYR 2KJQA 3OT5A 3ZG6A 5CEEA 5ITWA 3OAAD 1JLKA 3JD1A 1IE3A 2FR0A 3QVGA 1D2RA 1OT5A 3B6MA 4NYIQ 3T8YA 5C7YA 1J8DA 2R97A 4CZ2A 1M73E 3N2YA 4GL4A 3IPLA 5LA6B 1IMJA 1JA9A 1VDZA 2JIQA 2WU3A 2G63A 5TPZA 3WWEA 5FWDA 1D0IA 1TA0A 3URKA 2VUSA 4KITB 5DF1A 1N1GA 3B9QA 3RC1A 1RHRA 3SDSA 5IT5A 3ZIAD 4BNGA 4JA0A 1QCDA 1TUIA 1NNUA 3WDMA 4UPEA 5CTJA 4F3KA 2BUCA 4DWVA 1CUXA 1QC5A 4TZTA 4YRBA 2WJJA 4F0JA 4OK6A 3VKWA 4YRSA 1YBHA 5K4HA 3WNBA 2X2OA 2FPIA 3DD1A 1JFRA 2QMEA 3QEMA 2W98A 3THRA 1QF6A 1OC4A 4MS4B 5E9AA 2NADA 4EL5A 1HDZA 4WY2A 4WY5A 1JDNA 1H2AS 1P1IA 1PGNA 3OZGA 2G0NA 1DG9A 3HV2A 4ONEA 2C0PA 4P33A 3CX3A 1DIBA 4TROA 4AF7A 2Y1WA 2IIQA 1KU6A 2O8DB 3DV0A 1JQEA 7MDHA 2O3TA 1CY1A 1SVKA 4HB3A 4MUGA 5FNVB 1T4GA 2FFJA 4J0HA 3C3JA 1YE8A 3KOYA 4GXTA 4U0KA 3SIXA 4B32A 2FK7A 2QE7A 2YUTA 3Q7PA 4GYKA 5BO5A 2YWXA 1DU4A 2EEPA 2ZJ6A 3H87A 4FOLA 4W6QA 2W2XA 4FGLA 5LZ4A 2XKKA 2OLKA 1UKAA 4CN9A 2ZJZA 2P11A 3RRYA 1QFSA 2O2IA 4JT2A 3RVDA 1Y63A 2JVKA 3TRIA 1TCBA 2QHXA 4O2BB 5DK4A 1VI2A 1X0XA 1BX0A 1PHRA 1GZ3A 2JZCA 3UJAA 1EVLA 3L40A 4BS9A 1ORVA 4DEVA 1ITZA 3LCCA 1G9XA 1UEIA 4IX1A 3CVWA 2GCIA 2R9VA 4J3FA 4PNPA 1HORA 3BMCA 4WK2B 3WRYC 2P5TB 1V0JA 1Z9BA 4RD4A 4IOKA 3TLYA 5SZHB 1VIAA 1GGJA 3Q2KA 4KAFA 2I55A 3DHVA 4P81A 5ER9A 2VC2B 5DW3A 4L8LA 4PYKA 3CWZA 1RYYA 2Q5LA 1T43A 2C3OA 3GRUA 4B76A 2F3UA 4CL2A 1ZI9A 3TEFA 3ZXIA 1PFUA 4DADA 4K7JA 3W5SA 2BDEA 3LXUX 1C7JA 3IAAA 4QULA 2QS9A 5JAHA 1M2KA 4PCVA 5A1TA 4MTCA 3NMUF 4CEHA 5U1PA 2GRUA 4I50B 2EEZA 3CNBA 4KXYA 1IG0A 3USZA 5JMTA 3K70C 4Z3OA 4KBFA 4B75A 3OPXA 5CJPA 3ZZTA 3FAZA 5C31A 3RARA 2DH5A 3A28A 5IFLA 3KD2A 2D13A 3WGQA 2A58A 3JYPA 5F64A 3GLGA 3L4KA 3CO0S 2HBYA 4LRXA 3Q9SA 4AZ3A 4G07A 4RPLA 2CXPA 2PLAA 1RQGA 4GYJA 4JB3A 3HRHA 4EY7A 4BB9A 2CFCA 4GBGA 5EE9A 1CJBA 4GGMX 3GLFA 2HJVA 1E3QA 4IDAA 4EFMA 4GBMA 1O54A 3LF1A 4MRRA 5EMHA 3DE0X 3QFCA 5J47A 1T9ZA 2GM9A 3WQBA 4BJHB 4F84A 5BYAA 1TJPB 3PGA1 2CEAA 2I4IA 1NC3A 4ZZ0A 4G36A 1HLDA 2C31A 2RAUA 4QPPA 5JSUA 2GBFA 2AN1A 4GR4A 4MP3A 4O33A 2NUTA 3HKDB 4HLUA 1F8GA 2CEKA 2X42A 3BGDA 3CZQA 4TYPA 4E2YA 1KQNA 2XVAA 1ZONA 3JAWB 4H1UA 1KJZA 4GI7A 4NENB 3UYLA 2ZWVA 4C7MA 2AK2A 1U3GA 2XNDD 1NZDA 1VE3A 1NAHA 1XTVA 2ECQA 2JLCA 3AW9A 4G1VA 5SY6A 5KNBH 2GFIA 4BP1A 1TQ6A 3HXOA 1GVNB 4BV2A 4CMEC 3UWPA 3PUJA 2AE1A 3AEZA 4V3BA 1AA9A 4XM2A 5FORA 1YR7A 3VOBA 4E70A 1SVMA 2NSJA 1N2GA 4GW3A 1UOEA 3GUUA 2QN1A 3FNGA 3D8UA 1UKYA 5AXDA 2AR9A 1IH8A 2BZ1A 2JHFA 5BW6B 3VYRB 4NH0A 2Z9DA 3LE8A 3ESQA 3U16A 1Q7BA 3G79A 4MICA 5B7PA 4F3TA 3FLAA 4MZDA 2H0QA 1ZESA 3LECA 5BNIA 3KOOA 3WL6A 1PQWA 3FETA 2GJ4A 1US8A 2NACA 3HU3A 2FQXA 4JGGA 5DHAA 2WTXA 3VX3A 5TVKA 3LK7A 3OEHD 2Q2NA 3W4IA 3JQ9C 3GFVA 2ZITA 4DB4A 2JK0A 3RUDA 2JGLA 1L3BA 3AFMA 3DQPA 1VP9A 3PRJA 2ZDQA 4RF3A 3VGPA 3VO9A 1H4VB 1G9TA 1B76A 5CX4A 1VKNA 4YRFA 3TW8B 5HGXA 4P3KA 2WU1A 3CUTA 3EWAA 1OWPA 2QN3A 4J7UA 5BN3A 4HNQA 1D4OA 4FMCF 2I2DA 3FCYA 5CXSA 5DHUA 1JDUA 2AEMA 1GHTA 3ASVA 1DRVA 1L5YA 4M99A 3GLGB 2CZQA 2Q21A 1DWUA 2F62A 3I32A 3CHYA 2DF8A 1G8FA 2EP7A 4WAUA 4R2HA 4JJIA 2BUAA 4O63O 1NHGA 5DIZA 1SO8A 3S5JA 4HFRA 3AILA 2H07A 4NAUA 3C2QA 4OAOA 3M6WA 4RTLA 3BG5A 4WZAA 1SUEA 5ADUS 5ALVA 2ZJ2A 5FWYB 1GUFA 3QF4B 2RI1A 1B6GA 3K16A 3KYCB 3AB3A 3C70A 4O2AF 2GZ1A 2YMQA 4QLAA 4O4JF 4ES6A 3FPBA 3O2QB 2W93A 4D97A 1JG7A 2IT1A 3AESB 2Y92A 4L8VA 4W5RA 3HCPA 1L7EA 1SHJA 2NW6A 1VMKA 1PEDA 4MH0R 3T7SA 3EZ9A 4ZZ1A 4B3CA 4O3FA 4G1UC 4R7TA 5DI3B 4CM9D 2WHPA 5M04A 4EPWA 1CVIA 4MQMA 1A71A 1FFEA 2VYVD 2IYWA 2YCLA 2BGMA 3D6HA 3TNLA 3SIWA 5C4IA 4OUDA 3HJHA 4BFXA 2NXJA 3FOFC 4H6XA 3HN7A 5D3MA 4ZVRA 3DFKA 3L6EA 1KDOA 4G97A 4TTPA 3UFBA 5HJEA 5IDVA 3QWBA 2PR7A 4N39A 2YHIA 4L8GA 4P83A 4MLDA 2FSGA 2PZJA 4XSVA 2HNAA 4KR7A 4JYBA 1JSZA 2PY6A 4G1EB 4GKJB 1H69A 4X41A 5AVSA 5IEJA 3NPMA 4UEKA 3OQVA 5KKAA 3OIGA 1AMOA 2OCPA 1U11A 1G3QA 2HLHA 2HXYA 4H3VA 1P74A 4YHHB 3SQWA 1YJQA 3HB0A 3QQPA 1D03A 1OGJA 4KGZA 2ZETA 1I7NA 1PR4A 4YUWA 2V5VA 2HSWA 3JQBC 3PEWA 3JQ8B 2JJQA 2AXPA 3F5QA 1UFOA 5CB4F 1W88B 2DWQA 5A7HA 3RG8A 5AVQA 1ZM9A 3UV3A 2VAXA 4D5GA 2H5EA 2AJBA 2HK8A 1N9ZA 4O5OA 1L4UA 3OE4A 4ZT6A 1AX9A 3ISJA 4MIKA 2X3YA 1BNCA 3E1KA 5FKJA 1U8TA 2J30A 4OHPA 3VYWA 3A36A 1IXYA 4XDZA 3AB7A 3UHPA 4F12A 3P9ZA 1M5RA 5CVDA 1GCGA 3LKDA 1VJDA 3NXSA 1QPZA 2F1OA 3L4BC 1N5LA 4QX6A 1XDUA 5KCMA 2XQJA 1KH1A 4XRGA 3AGQA 1Z5ZA 5K0TA 2IUSA 2ZS8A 3A9CA 3LV8A 4OU5A 3JQGA 4GC9A 5KVQA 1L7AA 1Y1TA 2AG0A 4BQPA 4OQMA 1ST3A 2IEZA 3BB1A 4ZMSA 3OF3A 5IXYA 2NV2B 3NNSA 4FE3A 1M33A 1MOSA 1J0BA 4GICA 3H5OA 3MGBA 1XZPA 4JJZA 5HK8A 1J7JA 2P8JA 3E5MA 1X1SA 1DFHA 1HDXA 2P9EA 3BA1A 5EKUA 1E9EA 1SXQA 1XGKA 3DNFA 3LQFA 1JU3A 3MAJA 4F46A 4I1SA 5AXCA 1U0NA 2HGSA 1ESDA 1JDJA 1WU7A 1E2EA 1IY2A 2B8EA 4ARZA 5JDCA 2P79A 4RA6B 4R9UC 3RT7A 4ISBA 3MGKA 2QOEA 4IFTA 1YRHA 1SKYB 4FFBB 2GTIA 4CM5A 1AHHA 3AERB 5KUTA 3BD7A 4KLAA 3L01A 3SXUA 5JYCA 3VR5H 5C5CA 3W04A 4Z3KA 1P9WA 1W87A 4MRAA 7MHTA 2AG8A 4IM7A 4S1TA 4V39A 1Q1QA 3I09A 3CBQA 4P36A 1JYFA 2ZBRA 3OIVA 4XLZA 1P6XA 1NUAA 1Z4LA 2W83A 4DVJA 2F55A 1PGPA 5E1OA 3R6TA 1EJ2A 4Y2RA 1JFLA 2QDKA 3VTFA 2FKAA 3R7FA 3C0KA 3V8EA 1SBNE 1G8HA 3DA8A 3OVMA 1P7YA 3B3QA 3R3VA 3H2JA 2I4OA 1MPTA 1U8YA 1EVEA 1SCNE 2X8JB 3RVPA 1A2BA 2R5FA 4YP5A 2Q4OA 4MTLA 1U5CA 1ZNWA 4KN5A 5ES4B 4I1PA 1YCFA 1WU8A 4O4LB 2IYVA 3JQQA 3DOJA 2D1FA 4IVQA 3I6IA 2AJ8A 4HEA6 1EXWA 4DL9A 1XLUA 2DLNA 2B4QA 1XKQA 2ACEA 1R8SA 1TZCA 5CB8A 3DBHA 4BAZA 3IR5A 4O25A 4X64B 4EI9A 2VYFA 3MTGA 3M5WA 4RA9A 3V4OA 1WPRA 1JSRA 1QJ4A 2GKSA 3HY3A 3JW8A 2N47A 3L8HA 5CGQB 1B0ZA 3AVTA 2XUHA 2BHTA 1TE2A 4AG6A 5BW5A 2A30A 1A3CA 2EX1A 3JRXA 2Q3HA 4OMCA 3WO0A 3WV5A 4LWPA 1F51E 4G4IA 1HE4A 2HRZA 3A6KA 4Q4JA 3AR3A 1PR3A 1GZUA 4WKCA 3FR7A 1DXHA 4L28A 3EYWA 1W36B 1A5BB 2NTEA 4BVKA 1TM2A 2EDCA 4IHQA 5A2QA 1WAMA 2ZI9A 3GJ6A 4CKEB 4IZOA 3FTPA 4P5DA 1QH1B 2CV0A 1CV2A 1W9MA 4UU1A 3P9NA 4KG7A 1BMTA 3K0AA 4IQFA 3ZY2A 4AS3A 1PDOA 1Q57A 4RJTA 1I2CA 2HK6A 1B0AA 2ATVA 3QW4B 1XCGB 2YOGA 1AXEA 1ZEMA 2FX5A 2JFZA 2YIVX 4RTQA 2ZPTX 3BIJA 1C3OB 3ETEA 2GHTA 1CUSA 1CXZA 2QZZA 1U0OC 4LMPA 4UEOA 4RS4A 3VUEA 5JAUA 1GTSA 2BFNA 4P0TA 2ANBA 3UV6A 4C4PA 5KOYA 3KDAA 2OHIA 1C81A 3LBYA 4MR9B 4F6RB 2NPFA 2JI6A 4M60A 4LJRA 4J0GA 1O97D 1BJKA 1I4WA 3CRQA 5E6SB 4CN8A 3Q7EA 1Z5GA 3GLGE 2O8FA 5F21A 2VWPA 3EK2A 3GT3A 5JEEA 3HY4A 1OXVA 3MZ0A 3NHRA 4EG1A 5E2BA 2WG0A 3EULA 3T7JA 3VPSA 4DNPA 2GILA 2Q8NA 1E59A 1IY9A 4Q3CA 1JBKA 5ARBA 3TNJA 3EGDB 3M49A 1BKYA 5H16A 1YULA 4Q3OA 3CVUA 2GCGA 2ZTUA 4FNAA 1ECPA 2YRXA 1DMRA 3U4AA 2WB2A 2HU2A 3U7IA 1RXUA 5CITA 4UXIA 2W71A 4JB2A 1CY2A 1LBSA 3VHQA 1YBVA 3PHLA 3TLGA 2A5JA 3Q9NA 2GD1O 5CP8A 2VFAA 5M29A 1ZM4A 5AVKA 4FD3A 2Y71A 4P86A 4Y6LA 3T3MB 1QE5A 3RFFA 1AV6A 4PG8A 3GEPA 1C4WA 2FN3A 4LVOA 2BGWA 1JEAA 1EE9A 1YB1A 5ESWA 5C5DA 3FNEA 1DIGA 1Q3TA 4LWZA 1CY6A 4DSOA 2N1BA 4HATA 4IVPA 1W7AA 1GQYA 3TQIA 3OJXA 5F98A 2J0EA 2B1RA 2ZRBA 4YREA 2ZT7A 1T13A 3WLIA 4A0GA 5H9WA 3VI3B 2CFIA 4OTZA 4IDPA 3TFWA 1OD6A 4MB6A 721PA 1G20B 4N49A 3NYQA 3VU1A 4EL0A 5C80A 4G0VA 3E84A 4FGJA 4LY6A 3RSHA 1SURA 3F6PA 1RS0A 3U13A 3V9PA 3N3BC 3JQEA 1HT0A 1KAMA 2W70A 4EA9A 3OUUA 4Q9LA 1R4ZA 3DW1X 4C3OB 1FYXA 3VHXB 4MS1B 3IBTA 1L5RA 2JA2A 4Q4HA 4ZO9A 4D02A 2CXHA 1KIMA 3BKWA 3VVLA 4C6TA 4DILA 5GV8A 5LL6P 5EE5B 4JBIA 1B42A 1Y6GA 3ZQ4A 4B6EA 2BE9A 2FA9A 5IHPA 3KPVA 3EN0A 1H4QA 1V95A 1DZIA 3EUFA 4LZPA 2LIPA 1XRJA 1K3TA 2F3PA 4P4UA 1P1RA 5LLSA 3RBAA 3ZDRA 5DNDA 3U61B 3KT3A 5I47A 2JJYA 1N2EA 2JBAA 3AV3A 3OQ6A 1BMQA 3KU1A 3LTEA 4FFVA 3TFOA 3U48A 2NIPA 3ER6A 3I01M 1UC5B 1PFGA 4JOQA 4Q16A 1MC1A 2CCJA 1VJ0A 3U3DA 1NF3A 1ZEJA 2CNKA 1T1EA 1B16A 1SEVA 2Q4TA 1GL9B 3BIFA 4URUR 4CLRB 4BQIA 1A9OA 4FIZA 1R5OA 1YMVA 5C3UA 4I4TF 1P7ZA 2NZXA 2DQZA 3K9GA 4I9FA 4XGIA 1FQKA 3ROPA 1ISMA 4TTJA 4ZO6A 1T4CB 1P9LA 5DIFA 3ZY4A 1JMKC 4YRAA 4YS6A 1HKUA 2NNWB 2ZSBA 1M0EA 2PS9A 5EUMA 3AINA 1UMDA 5AW5A 3U7HB 2ONYA 1N7JA 4MW0A 1RWWA 2C7GA 3LT2A 3ZHCA 1EUQA 221PA 3LX4A 4R1SA 1KFCB 3MTQA 2OYCA 3VMMA 4GM4A 4BU0A 2D2XA 2L19A 4Y9UA 1JIUA 1DAFA 2QX7A 2BKAA 1B1AA 2VYNA 3MJDA 2AFRA 4X1KB 5IS2A 3L46A 3VBEA 2OFFA 2JLYA 1KEUA 2RKWA 5JAQA 4CGZA 4G37A 1XAIA 2UVDA 1IJBA 1DFGA 1T36A 1COWA 1VIVA 4M1MA 3UTDA 3M81A 3PR3A 4CQMA 1JHOA 5EJ8A 3M4XA 2O8DA 5GVSA 1RBYA 3FKQA 3ZDXB 5BQ3A 3R75A 3AJ8A 3IEMA 4TKVB 3K53A 1G20A 2WM3A 4JOCA 2H1LA 2JHAA 3I8OA 1P17A 3C1TA 3KQTA 4IWYA 4WBNF 4KR2A 1BO6A 3JTMA 4C5AA 5BMVB 3PC6A 2I91A 1F60A 3PFKA 3EVGA 5CM2Z 3RVNA 1H1LB 3EXHC 4EAAA 4FX5A 3QUCA 3F49S 5BW8A 4UU0A 2GYUA 3G2KA 1H5QA 1Q11A 1XRRA 3ABZA 5KDLA 4Z4GA 4Q1VA 1Z5VA 5FTNA 4LDAA 1E79D 4QJIA 2D8MA 3IV9A 1GGVA 3MJ4A 4A8PA 2FZLA 4YRNA 3S8YA 1E96A 1P0IA 3G1TA 4IF6A 4LC1A 4MWCA 3TQHA 5E6RB 2RK4A 4J0KA 5INTA 3GC6A 4MJXA 1WCV1 3TVYA 4RGVA 2JIBA 1ATIA 3CEHA 1DV2A 3G68A 2D2FA 1NL3A 4PHHA 4QNNA 5AKIA 1SG0A 4G89A 3U80A 5JV5A 3WOHA 5IC4A 1NVVR 2V6BA 4U2EA 3B3JA 5BV1A 3FPHA 2BEUB 2VRCA 2IH4A 4TMZA 3ABSB 5JANA 3L82B 5KYKA 1ZP6A 4RMHA 3SSAA 5DN9A 5COAA 4ZVQA 4GMFA 4XE5A 2VDNB 3LHSA 4C0BA 3GVHA 4G3XA 4B35A 5HA5A 2AQIA 2YZ7A 2HMYB 2W9XA 5C18A 2XUIA 3E7FA 4QUKA 1ZNZA 2W6JD 2C7RA 2V3CC 1XEAA 5TQ2A 2QN9A 3P19A 4N0PA 4B7AA 4Z6KA 5CFPA 3O8NA 1ZJZA 4XWOA 3QF7A 4PRYA 1UBNA 2BMWA 5A02A 2YWEA 3SFZA 3SWWA 5COBA 2XVMA 4Y2XA 5EJ4A 4PS0A 1RJWA 1Y9JA 3DT8A 4ZCRA 2OHHA 4E3WA 4H1TA 2A1UB 4EI8A 3VZSA 1EK6A 1BDJA 4C2BA 1NVEA 3EW9A 5KO2A 1FRNA 3AZOA 3L9XA 5BSMA 2C7QA 1O96B 2PZMA 2QE6A 3KR0A 3CRZA 5HCNA 4Q48A 3UGJA 3ZD6A 2XBUA 3HKDA 1PR6A 1MLDA 1V48A 3FYHA 2I4TA 4J0EA 4PQGA 5DCYA 4BQQA 3REOA 1YTLA 1U02A 4JP8A 5FBWB 1XXLA 4M98A 4RM2A 4B9EA 3KETA 3PHJA 2X13A 1ES9A 1KXZA 2YYZA 4UNIA 1L7DA 2JAWA 2J5KA 1SIOA 3OE5A 4DCGA 3WBBA 1NJ6A 3HXPA 1KMMA 4IHJF 1U90A 1T6BY 1FDVA 2HU8A 2H6EA 3DEYX 2BW0A 2I99A 3LH5A 4FYIA 4INPA 3SBEA 4B7ZA 4U0JA 1FFWA 3YASA 2NYAA 5EJ6A 3N58A 2XCIA 4FZ5A 4IIYA 4U6NA 2X1HA 2P9CA 1M75A 3DEHA 1UC4B 4F3CA 4JLNA 3BXEA 4GEGA 5BSFA 3Q41A 2VJOA 3EA0A 2X8BA 4L5JA 2DBZA 4V0OA 4KO4S 3GP8A 1XRPA 1P4RA 4NHOA 1NXSA 2GCEA 2WF5A 4U2KA 4HTFB 1QZTA 1VGQA 2WFMA 3H4TA 1NKSA 1M2VA 5HP4A 2C2MA 3E7PA 1RT9A 2QAGC 3KNZA 3TECE 1G4AE 2DWPA 4JUIA 3WI7A 1UBRS 3RSCA 4EFDA 2DUWA 4LYJA 2NZ8A 2ZRNA 2DGDA 2C92A 2IHKA 1IK4A 2QTZA 3CMCO 4FYKA 4H7FA 1KRWA 2C1ZA 3ESZA 1GCUA 4BB0A 2J6CA 4DA6A 3LI2A 4EARA 3UFXB 4P84A 4ESVA 4GQIA 4GYYA 3UK6A 2Y05A 1O89A 4CW7A 2XF8A 3NTOA 2GN8A 1I7SB 3VR6D 3PYLA 4NYMR 1RVV1 2TMYA 4JLOA 5DM1A 4M1ZA 2CXRA 2PS0A 4H7EA 2UYHA 4KGDA 2IY8A 1XN4A 1N2CB 5LQCA 4EB6B 3EWSA 3KYCA 4MR9A 1W0CA 2AIRA 4YJ2F 1H0KA 1RZVA 2G06A 2RBKA 4G8JA 1KP3A 2GAOA 3E61A 5EL0A 3RF7A 3SLKA 4DQKA 2LVBA 5CDGA 3PJRA 1S2GA 1L8XA 1FSFA 1V4VA 2IXDA 5E9JA 3HB1A 2G8LA 4BKQA 1QCCA 5JQGA 1MAUA 1CZRA 1HE1C 2YRWA 1W581 3KB2A 3IFSA 5SZKB 3VM6A 1HZZC 1P6UA 1SKUA 2P4UA 3MEQA 3UB3A 2G82A 4AX8A 4MQFA 2ZVJA 2I6QA 3H83A 2E89A 3ZCRA 1TRHA 3A70A 3O9VA 1BMFA 3IEVA 1FRZA 1Y3DE 4FFLA 1TL7C 3R41A 1YDFA 2JIZA 3LUKA 3FR8A 5D00A 4IOMA 2XCTB 1E9CA 2NO1A 1I1QB 3JYNA 4GSYA 2VUTA 1ABBA 1JDTA 3AX6A 1SJ9A 1NZFA 1QS0A 2B8JA 5GONF 3VNSA 1GR1A 2OC9A 4JLAA 3BXXA 3G2LA 4PWZA 3AU8A 3L6RA 2I7VA 4FGWA 2WZBA 2GBPA 1K86A 1UBGA 1Y5LA 1MEOA 3K15A 5EEGA 3SIPA 4M1SA 4FMDF 2IZ0A 3LUAA 1KH2A 1SULA 2PYDA 4HPWA 2JAHA 4N01A 1FFCA 3SLRA 1XPUA 1N33B 4J94A 1X8LA 4UVHA 1HLGA 2VPXA 2WJ4A 6GPBA 1W4LA 1T0JB 4AL4A 4G0QA 4GRAA 3THWA 4QLBA 4CI9A 1U0JA 4PQFA 4CU2A 4MVWA 3AIMA 2Q1UA 1M2VB 5KWIA 3P96A 2I3BA 3R3WA 5HFNA 4J49A 4E94A 1VB5A 1P6QA 3B3FA 3BE8A 3N9IA 4AUNA 5KTPA 4N3BA 1XD8A 2R1UA 1DG1G 5EHXA 4PBSA 3R0ZA 2MT9A 2EHDA 2YZMA 5D5QA 2H4HA 1D4FA 1MABB 3G2QA 4BXOB 5GV7A 4ZCQA 1RJDA 1AHIA 4EO7A 3Q7TA 3HNOA 3AHFA 2HIAA 3VHXA 3DTVA 4WEOA 1GFWA 2P2LA 3BRCA 3NIBA 1U4SA 4RD1A 2IPNA 4D80A 1NVUQ 1WHTB 2G3YA 1KBOA 2VH1A 4AY2A 2PT7A 1G8KA 3GA7A 4UHEA 4W5QA 5DBFA 4FPXA 2IDMA