3STXA

Crystal structure of tomato methylketone synthase i h243a variant complexed with beta-ketoheptanoate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
258
structure length
258
Chain Sequence
b'FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDAVTMMSKPQQLFTTLLSIANKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylketone synthase 1
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
total genus 85
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stxA00
5ALIA 4E11A 3H2IA 5JADA 2HA2A 3F8SA 3CCBA 4B9EA 4MYDA 1XQVA 2QM0A 5CW2A 1BN7A 2WIFA 4KYVA 3H1AA 3WIOA 5E4JA 1E5TA 5JIBA 1CUGA 1XZCA 4BVJA 2XQGA 1VJ5A 4G4GA 2BAGA 2QVBA 4FNMA 4B83A 3ZWQA 4UHEA 3G9TA 4BDTA 2PSFA 4CIAA 3KDAA 1FFAA 4YASA 4U2CA 4DGQA 5JZ9A 2GBFA 3VVMA 3TRDA 4WCVA 4DMHA 2RONA 2XDWA 5FUMA 4UFOA 1DT5A 2NW6A 3O4HA 3FSGD 5ALEA 3TEJA 2BUCA 5T4BA 1KU0A 1CUIA 2JGMA 2HM7A 2WQZA 1JFRA 4JYMA 1XZAA 2K2QB 4HXFB 3H04A 2QRUA 5LLSA 2VJBA 5AK5A 2BFNA 1EK1A 3BIWA 3WKBA 2XQJA 4INZA 3C6BA 4J0CA 1EXWA 2DFPA 1ODCA 1CIJA 1WOMA 4L9AA 5KBYA 3FBWA 3PDCA 5JASA 3D5EA 5JATA 5C8ZA 3DNMA 3FYTA 1U8EA 4EHBA 2XUJA 2C0PA 3JWEA 1JU4A 3H2HA 3LP5A 4P9NA 1E8NA 4C01A 2RHTA 5ALSA 1MAAA 1XQWA 4UBIA 4KACA 3ESAA 2ZJFA 1DT3A 5JANA 5KWJA 1XZBA 5ALQA 2XUFA 2HA4A 3WK8A 3SX4A 2DHDA 3L1IA 3ILSA 4N8DA 2HRRA 5DJ5A 5K3FA 1WCYA 4ETWA 1YR2A 4G8DA 2C58A 4Q82A 5K3AA 2V97A 2CEKA 3STXA 2QMQA 3WL6A 5IH7A 2WUFA 4LYDA 1ZI8A 5EHXA 3F67A 1P0MA 2Y1KA 1JT2A 2Z3WA 5EHQA 1SFRA 2WFLA 3QITA 2RHWA 4BB0A 1TAHA 2DHCA 3QM1A 4HXEB 3V9AA 3ANTA 4BVLA 3AFIA 2CUTA 4IO0A 2AJ8A 4UHFA 4BVKA 4BAUA 3WL8A 4DNPA 3PUHA 1R88A 4BYMA 2Z5GA 3R40A 3BDVA 2QKYA 4BRSA 1CUSA 2OGTA 1QGED 4I4CA 1W4LA 2WJ6A 1LPMA 3BL8A 3G8YA 4FBLA 1CUEA 1XZGA 3C5VA 4J0GA 1XZMA 1JMKC 1GKKA 5DYYA 3WJ1A 4UBMA 2CB9A 1IUNA 1VKHA 3O0DA 2QZPA 5D3KA 4WFIA 3AZOA 5E2IA 1EVQA 3C43A 1QO7A 3ZLTA 2VQ6A 2ECFA 2G5PA 1MU0A 1HL7A 5H3HA 5AIBA 2AJBA 3PF9A 1X2BA 4B84A 4G9EA 3QZUA 4UPDA 5AKEA 3EQ8A 3WWDA 4H7HA 1LNSA 2OQVA 4CG1A 1J06A 2HDWA 2JEYA 3O4JA 3HZOA 3FCYA 5EIEA 3W9BA 1XLVA 1UK7A 5CT8A 4J0KA 4ARAA 3GBSA 2Z8XA 1WPRA 1OCEA 3IUMA 5FPQA 3AZPA 1C7JA 3WK4A 1EK2A 1DWQA 2IIVA 4Y2RA 3G0CA 3GZJA 5E4TA 3KWJA 2O2HA 2ZYSA 3VKFA 5CMLA 2JF0A 1Z68A 4BP9A 1BEZA 4KE7A 3STWA 1PV1A 1MPXA 1GZ7A 1XZKA 5LIPA 4CG3A 1U2EA 1BE0A 5JD4A 1A8SA 5AO9A 3IDAA 5ALYA 4BE9A 5T4EA 3C45A 2VAVA 4OD0A 2XUKA 5T4HA 4Y2SA 2HIHA 3DDUA 4P92A 3WWCA 3BXPA 3KXPA 4KAAA 2WFZA 3C8DA 1GPKA 1TRHA 4D9JA 3M3DA 3A2NA 3EF3A 4GDMA 1LBSA 2G63A 4UHDA 1DWOA 1Y7IA 1M33A 3ZLVA 1G66A 4ZV9A 4K2AA 4X6UA 1UWCA 3WK6A 3PF8A 5JYCA 2OAGA 3ZV7A 5JARA 2R8BA 3QBJA 2J4CA 3ZI7A 3DYVA 3A6ZA 2EEPA 4Y2TA 5SYMA 1WHTA 1LBTA 4B82A 1I6WA 2P8SA 1QIFA 3IUNA 3R3VA 1ACLA 5CH5A 1ODTC 3QVMA 3F96A 1FFEA 3DJYA 5FP0A 4YX9A 1BCSA 1ORWA 1QIHA 2XMQA 1XRPA 3UUFA 5E4YA 3GFFA 4XVCA 4WFKA 5FXMA 5F4ZA 3BJMA 1GQSA 1QZ3A 5ALHA 1ZI6A 2QUAA 3D59A 4OSEA 1QFSA 4NZZA 3H19A 5HK9A 5ALKA 4ZRDA 5JZSA 3SWWA 3M83A 4DYHA 3FLEA 5HCUA 4Q05A 2XQFA 4EA6A 3GROA 1SC9A 2WSLA 1UKBA 3STUA 4KE6A 4IH4A 1LPNA 2PBLA 2GYWA 4H7KA 1F6WA 1IMJA 4N5IX 2H7YA 4N8EA 1H2ZA 1VOTA 3BWXA 2QS9A 4X92A 3EQ7A 4B85A 4Y2UA 4XJVA 5BWBA 3DL4A 4FFWA 2WG0A 4ROTA 3DKRA 3X3HA 3FYUB 2PX6A 4C88A 3ESDA 5ALPA 2AJDA 1EX9A 1FJ2A 4BCBA 3Q0TA 3C6XA 4FTWA 1DINA 3I2KA 3OC0A 5IVDA 4GEGA 5FV4A 4GHWA 3DQZA 3WZMA 5IVHA 1SCQA 2HL6A 1CUCA 2FUKA 2ZYRA 5K3DA 3WA6A 1XZJA 5EFZA 1DWPA 2E3JA 3IB3A 2WHPB 1MNQA 3O4GA 3D7RA 2W22A 5C8XA 4Q34A 4I3FA 3BDIA 5LYYA 1WPXA 1O6GA 3DOIA 1XLUA 2WU4A 4Y2QA 2ACKA 1XRLA 3FCXA 1ODSA 3WL7A 2XUPA 4Y2VA 3DL7A 2DSNA 3H2GA 1USWA 2QTBA 5IKXA 1CLEA 4OU4A 2I3ZA 4M0MA 2QUBA 4FLEA 4KJXA 2PSHA 5DTJA 1VZ2A 5DWDA 3NUZA 5AI4A 1RWQA 2WIDA 2XQKA 2WIKA 1F0PA 5A7HA 1CPYA 4W63A 4GW3A 2WHRA 4LIPD 3GELA 1C4XA 4G8CA 1UKAA 5DYWA 4YPVA 1XZEA 5AM1A 4PO3X 3BJRA 3R3UA 1F0NA 2WUGA 5T4FA 4DMCA 1P0PA 4RGYA 3STYA 4BBZA 4LXGA 5CXUA 1MX5A 3C5WP 4FKBA 5IVIA 4CI9A 7YASA 4F21A 2H7CA 1ZD4A 4X90A 2HU8A 1YS2X 2GBIA 4Z49A 3G9XA 2VATA 2XMBA 2XMDA 5LKRA 4GBGA 1MO2A 4I19A 2Y6UA 5JALA 1P0IA 5FKJA 4ZI5A 2FX5A 4QLOA 1ZOIA 2XB6A 1ZD3A 3I28A 1G5FA 1R1DA 2C5FA 5A6VA 1UK6A 4AO7A 3LIPA 2JBWA 4Y2JA 3WWOA 4A23A 4IH1A 5CT4A 5AKGA 2XUGA 4MEBA 3IURA 3VXKA 5C8VA 5AM4A 4CIBA 5EHNA 1ZIYA 3I1YA 2YXPX 3ANSA 5ALTA 4KEAA 4BCCA 2PPLA 1A8QA 2HHAA 1CUFA 2JGKA 5DNVA 5C7YA 1U65A 4KAFA 3M81A 5ALDA 1HBJA 2Q0XA 4UHBA 1MAHA 2HFJA 4G4IA 1YSCA 1XKTA 3Q8WA 3O4IA 2PL5A 4QLAA 3LLCA 4W1PA 4EY6A 1GPNA 2DQZA 3H1BA 1LZLA 1QIGA 3LS2A 3QYJA 2X5XA 4QWWA 1UFOA 1A8UA 4N8SA 3WYNA 3GUUA 1K63A 1QOZA 4E15A 4NS4A 4TPKA 1BU8A 4DIUA 5I8PA 4B80A 2I03A 3O95A 3FYUA 2XT0A 5ALLA 1UK9A 5I7UA 1LPPA 5I9IA 4Q1VA 5K3EA 5AI8A 2FJPA 3AUKA 1XZDA 4GI1A 4OB8A 1N8SA 1K8QA 4MWTA 1OXMA 3VJKA 4J3JA 5AICA 4EY4A 3WKEA 4W1QA 3WYDA 1C7IA 5AM3A 2O2IA 3E4DA 5AKHA 2H1IA 2XLCA 4FNGA 1BRTA 1XZIA 2YYSA 3VISA 3S8YA 4HTAA 4KRYA 5LZ2A 4BTLA 2PM8A 3OOSA 3WL5A 3PUIA 4G5XA 1CUXA 4BE4A 4X3CA 4U2BA 5AIAA 1D07A 1GKLA 1WB6A 2GYVA 1ORVA 4EBBA 1L7RA 2CZQA 1VLQA 1EDBA 4J0DA 3MUOA 1O6FA 2CBGA 1OILA 4B0OA 5JAUA 4DM7A 3ED1A 4N5HX 1TCBA 5K5EA 3D3NA 4BCDA 4P93A 4WFJA 1IUPA 1AGYA 2JIDA 5AK4A 3STTA 5JD5A 1CUWA 1DX6A 1HQDA 1JU3A 3DKKA 2JGFA 3E0XA 3G0DA 1AX9A 1EH5A 4H35A 1TCCA 3DEAA 1H22A 5YASA 5AKIA 1Y7HA 3ZLUA 4EY7A 4DNFA 2D0DA 3WK7A 1QIIA 4QE3A 2VSQA 1B6GA 4L3WA 5HF5A 1GPLA 4Y2YA 2B61A 4K5QA 2PSDA 3N2ZB 2HRQA 4DNOA 3RKSA 2J4FA 1UOQA 4GLBA 2W6CX 5HF8A 4Y2PA 4BAZA 4QDZA 3DYIA 1JJBA 4OUKX 1DU4A 4XX1A 1AQLA 4CCYB 5AHXA 4MQMA 4FDMA 2PUHA 2WIJA 4HRXA 5DLPA 3LCRA 4X7BA 1A7UA 4H77A 5ALWA 5IVKA 2QJWA 4K6HA 1DQZA 3ESCA 4FFVA 5BOVA 4QEKA 2C0QA 3MVEA 2WUDA 1JJIA 3IULA 1CVLA 5FDFA 4G8BA 3C6YA 4BRZA 1W75A 3WI7A 4MQLA 4OCZA 4PSCA 1VA5A 4H7FA 4L72A 1CRLA 5JAPA 5LP1A 1H2WA 2ZVDA 1XLWA 1IUOA 2QXTA 5ALRA 5JAHA 1NU6A 4PSDA 4LXIA 1H23A 3KD2A 4EY5A 2G5TA 4C4ZA 1QIJA 3VJMA 1W6RA 2WJ3A 5SYNA 3N0TA 2XUIA 4HRYA 1J1IA 3CN7A 3BF8A 3OG9A 3SK0A 4QDTA 3RM3A 1XKLA 2BUAA 4GECA 1ISPA 3WLAA 1Q0RA 4X94A 5AOCA 1EHYA 4DNQA 1EI9A 2HFKA 4BC1A 3JYHA 5AOBA 1CUZA 1LLFA 4PF1A 2XLBA 3WA7A 5CBKA 3H2KA 3B3QA 4WY8A 5LZ7A 4GWLA 4J0JA 1K5PA 5A71A 4AZ0A 2WLSA 5CT6A 5HF6A 2BUBA 3VJLA 5HFAA 4MJ3A 2C7BA 2Y6VA 4UBJA 1CUBA 4F5ZA 3D2AA 1MT3A 1UOPA 2H7XA 1E89A 3MGAA 4ZXFA 3I6ZA 5EGNA 4TGLA 5EIHA 4CCWA 2BGRA 4K6GA 4L0CA 1N5MA 4HAIA 2WTMA 4W1RA 2X76A 1CUVA 3G0GA 3HI4A 4WDRA 2ONCA 3L1HA 1K4YA 2RIPA 4UBOA 3W9UA 4OB6A 2OG1A 2GBCA 5AP9A 4MXDA 1CUAA 4PV7A 4UFNA 1XRQA 5J3JA 4RPCA 1J07A 4LYEA 3O9VA 3KSRA 2OGZA 1TKRA 2PSJA 3CCCA 4W1SA 3V1KA 1AURA 3C70A 1CFJA 4JYPA 4X97A 1TK3A 3U1TA 4C6HA 1AMNA 3D2CA 5DYTA 1DTEA 3HSSA 2ZSIA 4A16A 2ZSHA 1Y37A 2BGNA 4EB0A 2Y2UA 3IUJA 2PU5A 3AIOA 5K3FB 4OYLA 2BKLA 4RE5A 5AKXA 3OURA 3QPDA 3V48A 2DQYA 1E66A 3G02A 4Y9SA 1N1MA 1VE6A 5AKYA 2VT6A 1AC5A 1XZFA 3WKDA 1J2EA 1AKNA 3PE6A 5K3BA 5CXXA 1G4HA 2CMFA 2WFLB 4AN1A 2J3QA 1XRMA 4CCYA 4FWBA 5FOQA 1UZAA 3R0VA 5AM2A 3H2JA 4ZREA 3F97A 5ALMA 4H7DA 4IQ4A 3FSGA 2WUEA 1H2YA 4M0EA 5ALNA 4AMZA 4MYSA 5AM5A 1EB9A 4ITVA 1YB6A 3HC7A 2PSEA 5A7FA 1KEZA 1S8OA 3I6MA 4NVRA 2JGJA 4MEAA 3QMWA 2XQIA 2VF2A 3UUEA 3D2BA 4X91A 1KU6A 3I2HA 1PFQA 2HU5A 1W76A 1ZIXA 2WU3A 5CRIA 1BROA 3B5EA 3WWEA 2XUAA 4IHAA 3C8HA 5EI5A 5KREA 4DSAA 3CN9A 4YK7A 4UHCA 5AKLA 2PUJA 4QDUA 3G9ZA 4H0CA 4X93A 2UZ0A 3WWPA 2HU7A 4LKOA 3AIKA 3ZPXA 2O2GA 1HDEA 3RK4A 4BTVA 4PQEA 3AJAA 5ALUA 2QOEA 3HXKA 1B41A 3FLBA 5KWIA 2WTNA 3HLKA 5AI0A 3KWFA 4U2GA 2XUDA 4JH0A 4UUQA 3S2ZA 3TJMA 2GZRA 3QMMA 3WQHA 4AO6A 1VE7A 1L7AA 2ES4A 1GQRA 3O9MA 1JI3A 2RAUA 2WFMA 3NOXA 4G9GA 1R50A 2VTVA 3I2IA 3FYUC 1LZKA 1MJ5A 3K6KA 3PFCA 3PICA 1LPOA 3ICVA 2HA3A 5AI5A 1UOOA 3TGLA 3BF7A 2JGLA 4GXNA 1XZHA 4F0JA 3W2TA 2XUHA 1EB8A 5FLKA 1QFMA 4G1FA 2GYUA 5JD6A 4QDXA 4P08A 5FPPA 4HXGA 2XMCA 4B7ZA 1W1IA 4FBMA 3DS8A 1YA4A 1G42A 2WJ4A 1YAHA 2X8BA 1HKHA 4Y2XA 3H18A 2OAEA 1CV2A 4UBNA 3OM8A 4KE9A 5BV7A 1CQZA 2CJPA 1YA8A 1R3DA 1HPLA 2V98A 5ALXA 5C81A 3EIOA 4RE6A 1ZGCA 3AINA 3NWOA 1W52X 1L7QA 1LPAB 2WIGA 5FRDA 2OGSA 4TVKA 1JMYA 3SC2A 2O7VA 5A7GA 2CKMA 3I2JA 5AKJA 4AO8A 5DNUA 4WDQA 1XQYA 1ZD2P 5DTIA 1Q0ZA 1HLGA 3BE8A 3BIXA 2WHPA 2DR0A 3G0BA 5ALVA 2HA5A 1E8DA 3FVRA 2OPHA 2XMGA 4J03A 1A88A 3R3WA 1WM1A 2PU7A 4DLNA 3K2IA 5HKBA 5AI9A 3W06A 3H0CA 5LZ8A 4O08A 4X00A 1CUYA 1UK8A 3R3ZA 3STVA 5BWCA 2GBGA 4Y7DA 1ZICA 5HFNA 2Z8ZA 1IVYA 3PFBA 5AK6A 1CR6A 4C87A 2H9YA 1LPBB 2JGEA 1XRRA 2R11A 4KRXA 3HEAA 4NMWA 1P0QA 4AQDA 2WILA 2EDAA 4HZGA 4H7IA 5AH0A 3D0KA 4EUSA 3QPAA 4Q3OA 4U2DA 3C6ZA 4JNCA 1ACJA 1YAJA 3IIIA 1VZ3A 1VXRA 5AKKA 2WG2A 5HQ3B 4X6YA 4J0HA 3V1NA 3HYSA 1SCKA 4PNZA 1XFDA 1QIEA 4B6GA 2PVSA 1WB5A 4WY5A 4QWMA 4KE8A 1U4NA 1THGA 3ESBA 2BCEA 2B20A 1ZGBA 3W04A 3R3YA 3V1LA 4E14A 4OPMA 2AXEA 2LIPA 4AN0A 4W9RA 3I6YA 2EDCA 5HKAA 1FFCA 4JEIA 4B0PA 2RGUA 4E46A 4C4YA 3A70A 3IVMA 3G9UA 3HRHA 2O7RA 4Q3KA 3VVLA 3EQ9A 1THTA 2ZJ6A 5CH8A 1SCIA 3WK5A 5ALOA 1SOMA 2AJCA 1BCRA 1RP1A 1Q84A 4J0IA 1T4MA 4EZIA 4B81A 1JKMA 1FFBA 4EY8A 4WJLA 4LXHA 5ESRA 4H7EA 1UKCA 4FMPA 4OU5A 1R4ZA 1IZ7A 3PI6A 1EDEA 1EVEA 1YCDA 2WKWA 5ALJA 2OCKA 1XQXA 3QMVA 4FLMA 2ZJ7A 4CG2A 2IITA 4X71A 2I78A 4C4XA 4M0FA 5ALGA 3QPCA 1X70A 4BAGA 2VEOA 2HA0A 2DCMA 1K6EA 4U2EA 4UFPA 1CUJA 3KOOA 1YB7A 5ALFA 1MTZA 3U0VA 1WB4A 2YASA 5HZGA 3I2GA 4BZWA 1AUOA 4QZVA 4F60A 5JZBA 2GZSA 3I2FA 3E3AA 4G4JA 3IA2A 1CUUA 2HA6A 4BATA 5JAOA 4X95A 5AK3A 5AM0A 4FOLA 5EIAA 3UMJA 1FFDA 3IBTA 3FVTA 1CQWA 3HACA 4BP8A 1DQYA 4B9AA 3B12A 5CURA 2XMRA 2VJCA 1X2EA 4ZGBA 2QJRA 2ORYA 3E1GA 4A5SA 3WKAA 4LHEA 1XZLA 1ZI9A 2J3DA 5A2GA 4OYYA 2OCLA 4PW0A 2PKYX 2B4KA 2C4HA 1EA5A 3FAKA 3AIMA 3T52A 4DTCA 1E8MA 2JGIA 1BS9A 1XRNA 1N5RA 4XWGA 2ROQA 1PJAA 2OCGA 1QTRA 2XE4A 1IZ8A 3A2LA 4ARBA 2HADA 1ETHA 3HABA 4AXBA 1VA4A 3OTQA 1UT6A 3FLAA 2Z3ZA 3H17A 5CT5A 3A2MA 1NX9A 2VT7A 2YH2A 3C87A 1CUDA 2ZYHA 4QDOA 1RYYA 2XUOA 4HS9A 1GGVA 1ZD5A 2AJLI 2XUQA 2ZYIA 3RARA 1GXSA 2XMSA 1H2XA 1AZWA 1QLWA 3HJUA 3G0IA 3MUNA 3NGMA 4HVTA 2Y2VA 1QE3A 4OB7A 3VDXA 2WHQA 4KR0A 2BJHA 4RNCA 1QTIA 1BN6A 4U2FA 1CUHA 5HQ3A 1ZJ4A 1E3QA 2C5GA 3FNBA 3DLTA 1CEXA 5LZ4A 3WK9A 3WZLA 3R41A 2QXUA 3FWHA 4ZV7A 4ZWNA 2ACEA 4DSZA 4FHZA 4JUIA 4X6XA 4BC0A 3RLIA 4PSUA 3AILA 3YASA 1TCAA 4V2IA 5A62A 5D7BA 4AZ3A 4S0XA 3OPMA 4AMYA 4H18A 1MX1A 1YASA 3DOHA 1DX4A 4X85A 1QONA 4J7AA 5AJHA 1QO9A 5K3CA 1LPSA 3EBLA 4KAJA 4Q3LA 1QIMA 3DCNA 5D3ZA 5CT9A 4BDSA 1MX9A 1WHSA 2XMZA 3WMRA 4C89A 1ZJ5A 1F8UA 4DMKA 6YASA 3G7NA 3DD5A 1MN6A 5CTAA 5D6OA 2JEZA 5AI6A 5HF9A 1JJFA 1LGYA 2VA9A 5EHZA 2QT9A 3IUQA 3M82A 3FOBA 3D4LA 2RI6A 3W05A 2OCIA 4K6KA 4QA9A 3WJ2A 1R9MA 3V1MA 1FSSA 2G4LA 2OQIA 1VXOA 2VAXA 1QIDA 2D5LA 3LIIA 1TQHA 2WG1A 3GA7A 1TIBA 2HA7A 4BZZA 5LZ5A 2XI4A 5LZ9A 5AKZA 1XROA 4QNNA 2OXEA 5ALZA 1QIKA 2B9VA 4H7JA 3K9BA 1T2NA 3ICWA 2IX9A 3I1IA 4FLFA 1MNAA 5CH3A 5LKAA 2OLEA 3R3XA 4IH9A 1GT6A 1EINA 3JW8A 3T4UA 4UBLA 4MWSA 5ISMA 1YS1X 4DMFA 2VJDA 1EDDA 3F98A 5AOAA 1Q83A 4UBKA 3CXUA 2V96A 2WM2A 3AZQA 3WIBA 4CFSA 4UHHA 5HK8A 3QH4A 3WKCA 2QR5A 4AB1A 2V9ZA 1UXOA 1BEEA 1NU8A 5DNWA 1QJ4A 4AX4A 2I3DA 2VJAA 3L1JA 2DHEA 2FJ0A 3F9CA 4XIIA 1R9NA 3P2MA
chains in the Genus database with same CATH superfamily
3JTEA 2VK4A 1MQ8B 3L7YA 4AF6A 1SN7A 3OPVA 4NU6A 3DE5X 5TT0A 3WL4A 5IARA 3UPDA 5JADA 4DY4A 2VDQB 2WJHA 2H52A 1YE5A 5F5LA 4B9EA 2C2GA 5AT1A 1PX0A 2EP5A 3E22B 5BQXA 3AEQA 3WY9A 1K8XB 1QWSA 2ZUUA 1E5TA 4BLTA 4KLRA 4PCLA 4E08A 5FPKA 2IHJA 1XTPA 1XZCA 4N5DA 4KX5A 2XQGA 2R8YA 3KKOA 4MH0R 4G4GA 1BGWA 3TFQA 7REQB 3VUEA 1B0ZA 2GKSA 3G2PA 1PJ3A 3IPCA 4AF8A 3UWOA 4YAJA 2OD9A 4PFJA 5DHFA 1QOPB 1T4BA 3E9MA 1EK6A 3LQKA 4DJFC 4HNAB 4BO3A 2KHZA 2GASA 1U7DA 5GM2A 3ZX4A 1N7GA 2QMZA 1U2DC 1OFGA 2RHDA 4XIFA 4YQEA 1FFAA 1E3JA 1GEEA 3CRW1 5BW4A 5J5AA 3P32A 3PPXA 4GL4A 2I8LA 1IOZA 3VNAA 1MBZA 4CMIA 4QOEA 2ZIUB 1PVDA 1YUNA 4JLJA 2J7KA 3I34X 3C1TA 1KH1A 2R8ZA 3KALA 4YJ3F 5ELMA 1A5ZA 2V55B 1KK3A 2P2YA 4JNKA 2Y9MB 3T5MA 3VNRA 1ORTA 5CA1B 2QL6A 2ADOA 2JKYA 3G1WA 5IANA 1CK4A 2BGLA 3EMVA 2RONA 3GJ3A 4DDVA 3W4JA 3MIIA 5B30A 1IVNA 5ITZA 2YRWA 4YRBA 3O3CA 2NW6A 4AWBA 4Z6KA 4U8HA 3PL5A 2BUCA 2OC4A 5DT2A 4OLBA 3L8FA 4RA9A 2CK3D 3I58A 2JGMA 3O2NA 3KQKA 3HN6A 3EUFA 2I9PA 3QU2A 4I9HA 1HURA 2P78A 4MYTA 2CXSA 2AJTA 1TFRA 1KJ8A 3IBYA 1U1DA 2MSLA 2R2AA 5EP1A 1U2GA 4I6EA 1XZAA 3H04A 5JJLA 2QRUA 4QFMA 1F5SA 5LLSA 5AK5A 1KOGA 2GRUA 3MA0A 3CLSC 3HB7A 4IDCA 2LPMA 5ABPA 1Q7CA 5FPTA 5TXGA 1CHNA 5IJ9B 3HB4X 2VP3A 4INZA 5CGQB 3G8BA 1EGAA 2QZSA 3CRMA 4J0CA 4RKEA 2NTYC 5F51A 4AG5A 2A92A 4QJIA 5L3RA 4BMZA 4YRSA 1GPJA 1WX1A 2H2DA 4U0KA 2Y0BA 4E4TA 1QH9A 2BHNA 2RHJA 1G17A 1VG1A 5BMOA 2OV8A 4RNDB 4Q4HA 3UAYA 4H7PA 4MS1B 4EHLA 5KX5A 1ZGZA 1KR2A 4EGAA 2CV0A 4DEVA 3GJSA 4HG2A 5KBYA 1BWSA 1J5PA 1XU7A 3B2EA 4FUQA 1JQ5A 3GJ7A 3IJRA 1S3SA 3PDCA 4YRFA 3UJ7A 2TMDA 1B23P 1RC0A 3ZN2A 4HWGA 3D5EA 3DWGA 2R1TB 2ZRKA 5I4CA 5JXHA 2YRXA 1WHTB 1XMVA 5JDCC 3C3YA 1HYQA 1MABA 4YV0A 1NULA 3R9WA 2YHIB 3PITA 1M9NA 3JWEA 5J4VA 3OMXA 3I1FA 3GPIA 3R7DA 2CHGA 3H2HA 1E8NA 1JR3E 1WDKA 1ZJ6A 2RGNA 2RHTA 1W0JA 2WTAA 3DGFC 3DMPA 2DPHA 2DWCA 2QQGA 3E8XA 1GU7A 3MCVA 3PVZA 5LQRA 4DVJA 1XQWA 2P6UA 3LT4A 4TS1A 2ZJFA 2VF5X 4YXWA 3KM0A 4EKNB 2B8NA 1XZBA 3URKA 5KQMA 1V5WA 4PYMA 2H3EA 2O23A 2XRYA 3OIFA 1XNHA 3V8PA 5BP7A 4D6PA 4KN8A 3WK8A 2GZ3A 2VQFB 1E92A 5KWSA 4HFJA 3VTZA 1UDBA 1TTTA 3L1IA 1W36C 3ILSA 1QV9A 1FMJA 5DXJA 1S2MA 1T9BA 2JIQA 3FPKA 2AT1A 3T7AA 4OAPA 5DJ5A 3WLFA 2XNSA 4RH0A 5JJBA 5EZYB 3RAEC 2QTVB 4ETWA 5BSVA 4UMFA 1WCIB 2Q5FA 1H65A 4P3OA 1SUWA 2B36A 4K9LA 5H68A 4LHZA 3KOXA 4G8DA 2R4UA 4PX2A 2C58A 1GNRA 4DLYA 1EVKA 2X13A 2WWVD 3RV4A 3KRTA 4XCVA 4J90A 1XMXA 3R77A 2I1WA 5JCJA 4N47A 3RTEA 3TNLA 4F06A 3UO8B 1PNOA 5FBHA 1LUAA 2HJGA 4KKXB 3WL6A 2B30A 2PMWB 1F6BA 3A7EA 2C77A 3TAXA 4YI3A 3LY8A 3BERA 1ZI8A 4HGZA 4J49A 1P0MA 2ZOSA 3SEAA 1A3CA 4WZ6A 2Y1KA 2CUNA 4TM7A 4J7XA 4HRVA 3CEPB 2WFLA 2RHWA 4BB0A 5IT5A 4HXEB 3AUSA 3NBKA 4F93B 1IHDA 3ANTA 5F5NA 4BVLA 2CE2X 4ISBA 3M9XA 3F6YA 1J2YA 3IAS1 3GBVA 4IO0A 3Q7RA 1E9RA 4XA8A 1GHTA 1QTNA 1X38A 3R7SA 4OHMA 4UHFA 4HQLA 2VPWA 1EVJA 5JPCA 1UZNA 1E7MA 1LLCA 3MC1A 3C8MA 4AVYA 4OL9A 4CEJA 4AJNA 4EB6A 1OWMA 3VR6H 4BYMA 1N9GA 5CFLA 1E5XA 1GFSA 4XWWA 3H86A 3HCCA 2JKVA 2QKYA 1F9AA 1NVKA 3BDVA 3ISJA 3R40A 4BJ1A 4MHTA 4OP3A 4I4CA 4RQBA 1R3UA 1Y7PA 2YZMA 4PSKA 1LPMA 4HEQA 3BL8A 3G8YA 1TJYA 1N6OA 4QATA 5EWMB 1ARZA 4JOBA 3FTDA 3HVUA 5FFMA 3RU3A 3SHOA 3ZE8A 3K0SA 4ZU1X 3EZ9A 3BHMA 1R0CA 2XODA 4D4GA 1A4RA 1UXJA 2GN2A 1DOZA 5L9AA 3C5VA 1GKKA 5H81A 5FPSA 1ZSYA 4LRQA 4YCNA 4KWHA 1L7PA 1SPXA 2QE7A 4MWBA 4C0LA 5KYNA 2RH9B 2GTPA 3CNQS 4MR8B 1OGYA 2AOUA 5J4KA 3DLAA 3FNFA 3LT1A 3O0DA 2BT4A 4GC5A 3S4YA 2QZPA 3OJXA 4WFIA 2B92A 4C7BA 2PZLA 2H18A 4CXMA 2BGMA 1E64A 1EGMB 4C4TA 4RO0A 5EIFA 3ZLTA 2HQ1A 1YRHA 2OMEA 10MHA 3I39X 1HL7A 4C0KA 5KDDA 3GCXA 1S2IA 2ZCUA 3RPEA 2X0JA 2AUMA 3R0QA 3N07A 4GU5A 3KD3A 4DLVA 3JQCA 4COKA 5KHAA 1L3CA 1YBVA 4KQJA 2KE5A 1T6BY 4G9EA 4B84A 4D9HA 1U31A 4NE2A 4UPDA 4MV6A 4J0EA 1P7ZA 2R48A 2P7IA 3CUUA 2EL9A 3L0OA 2FPWA 1I3KA 4KLAA 3WWDA 4CKEB 3GVXA 2MINA 2P27A 2VDNB 2OQVA 3UQYS 2BF4A 5L3QA 5BUSA 2G88A 2JEYA 2PK3A 1Y1LA 3H83A 4XXHA 4D9FA 2CD7A 5EIEA 5ILOA 1XNGA 4EI8A 2J5QA 5C2JB 2JLUA 4YRIA 2JD0A 4J0KA 4ARAA 1PFGA 2VSOA 3E3LA 4KQ2A 1QNLA 3GBSA 4TL8A 1JKXA 1AIPA 3O1LA 4I99A 3IUMA 4M37A 1I5EA 5AVKA 5FPQA 3IDSA 4ZMSA 4GPIB 1VHDA 2VNJA 4LJ9A 3IPYA 5T7BA 3AZPA 3KHUA 1ZFNA 1JEQB 1QQ7A 1GSIA 1H3NA 4OHWA 4MPPA 4YREA 2NUTB 3LFHA 3ZWOA 3HKDB 4KJZA 3TBFA 4DJEC 1GOTA 3HWX1 3L4JA 1PFYA 4YJ2F 1DWQA 1IQRA 3ZKAA 4AY6A 2JVJA 3QBDA 1U1FA 1TL7C 2CB0A 3GLQA 5JYEA 1LTKA 4JV5B 3L8YA 1KXZA 2O2HA 4GYYA 3VYRB 2OV6A 3UPUA 2J09A 1YUMA 2QJOA 4P4UA 1EQ2A 2CXRA 3SVLA 3GRCA 1W0KD 3P8ZA 4LS3A 5EXXA 2JAOA 1MB9A 3EXFB 3LLSA 4PXSA 5J4LA 5KYWA 4CT0A 1UAGA 1J2RA 5TF0A 1H69A 3AUYA 4NBTA 3ET5A 1I14A 4L8LA 3W79A 4DWJA 2VJOA 4I50A 2QQEA 4P3YA 1BDIA 2Z6AA 4OI4A 2IS6A 3FPLA 2W2KB 2ZM6B 1BEZA 1I2DA 1UP4A 4TTAA 4W5HA 3VQTA 1GNSA 1CNMA 1HTWA 1PV1A 3R5HA 4RF5A 2O8DB 1QZTA 1MPXA 1GZ7A 3C1AA 4WL0A 4AW9A 2IP4A 3H1FA 5LIPA 1OZ0A 2R6GA 1U2EA 1AUPA 1BE0A 2O6LA 4KQHA 4MRSA 4MI9A 4ZI7F 1FZQA 1DB3A 1XCPA 4JQSA 1A8SA 4EZBA 3PPWA 4DV1B 5AO9A 3THSA 1FSFA 2X9VA 4M8KA 4LF6B 1SZPA 2F48A 4O4IF 1D6NA 1MB0A 2PS3A 3NZEA 4JB3A 5ECYA 5FOWA 3TR5A 3C45A 4R2IA 3T9BA 4CR7A 3FNIA 3KSZO 1MDFA 1E20A 3H4IA 1GV0A 3EXHC 4P0QB 1OTYA 4OD0A 1BDMA 5KJFA 4AJ2A 3U7HB 4DCJA 4Y2SA 3PNMA 4A6EA 1MOQA 2HIHA 1KFKB 5EQTA 4V0KA 2DLCX 3LHSA 1N2EA 1NJ1A 4K40A 3B36A 3PCRB 4MUYA 1P74A 4PZZA 5LXTB 2IZ6A 4Y6PA 4CKBA 2P9HA 2G8LA 2I2BA 5IKEA 3RABA 3KXPA 3R9XB 5FA6A 1TF7A 3T54A 1GPKA 2V3CC 1AGNA 4D9JA 4DXAA 5BQPA 3P0IA 4AJLA 3G3EA 3RROA 2JGDB 4E5KA 5AFSA 2IUTA 4CLRA 2W2XA 1KRWA 2RHCA 4ME6A 1GQFA 4N39A 4UHDA 1RYZA 3MINB 4Y9TA 1NKVA 2RJNA 1G8MA 1DUVG 3HGMA 2W43A 2BEWA 2Z1DA 3QVXA 4FGWA 4K2AA 4ZV9A 5B1HA 1RZVA 2R8XA 3WOHA 4AQ7A 4N76A 3A2KA 1YO6A 2WYHA 4H31A 4RLFA 3WK6A 5JVDB 1P1KA 2XAAA 5DM60 3ZV7A 1N3IA 4FMCF 4KI0A 4FDLA 5JARA 3TAHA 1N92A 4V38A 2R8BA 3F78A 3ICPA 3GLSA 1FP1D 5TB5A 2J4CA 4GOKA 4OKNA 2B35A 2F3QA 2GFQA 2RK3A 2X8WA 3GAZA 4QVKA 3ZI7A 4RM2A 4KFCA 3S2FA 1L1FA 1NBWB 2V03A 1I7NA 2Z4RA 1H1TA 3A6ZA 3T94A 2EEPA 4YQZA 3DZJA 4Y2TA 4ZYVA 3SJ7A 4GGMX 1QDUA 4DG9A 4EJ0A 2WP8J 3IESA 2ZRHA 2PO5A 4B82A 1GU0A 1I6WA 3IAHA 1J9ZA 2OHVA 2XJ9A 3PXUA 4H1VA 4QBTA 3IUNA 4TSRA 3MT8A 3Q7IA 4HLUC 2G70A 1U02A 5JJKA 1SUEA 4HMPA 1V3VA 3INNA 3D8SA 4D4JA 3QXHA 1L5GB 5MGBA 2QE6A 1L5QA 1NIJA 4R6XA 2QUZA 4QHSA 3RAFC 4A2CA 3A1TA 2FWMX 3SHTA 2GF2A 1FFEA 4Y9DA 3ILVA 3T15A 3IE1A 1T5IA 3K7EA 3VH3A 2X2EA 2HXGA 4Q9NA 4QUEA 3WRXC 1O97C 2W58A 1GNPA 4YALA 1O5IA 5FBZA 2X6QA 1I94B 3G2QA 5G2OA 3OCWA 3KAPA 2PH3A 2EGHA 3BJZA 3QEAZ 1H6AA 1M66A 2VJQA 1MJFA 4KRFA 4JI6B 4WLVA 3K9CA 4H6PA 4YP9A 2YV2A 2XXAB 5CYPA 3PEYA 5K8CA 4LZAA 5F4ZA 3L7BA 2D5CA 3BJMA 1LSSA 7ADHA 4V39A 4WLFA 3ZGOA 4MIKA 1UJ2A 2FQXA 4MPDA 2FE1A 4UTXA 1D8TA 3AWIA 3ADOA 1HYGA 4JU9A 5DCUA 5EVJA 1V43A 4YN3A 2QR3A 1K06A 2I2DA 2ID8A 2VYVA 3CH4B 3TDKA 2ISSD 1M54A 3WNQA 1YJ5A 3COZA 1PD0A 1LC3A 3V7WA 3MRVA 4IZHA 2B3TA 4K0RA 1TA9A 5EP4A 3RT7A 1RM3A 1WUTA 2GM4A 3GRZA 4DIKA 1E2GA 2UUPA 5I7WA 3NHYA 3CX3A 5JZSA 2XIJA 1GTZA 2LGJA 5FBVB 1HM5A 3SJAA 2C8VA 3W5UA 4HQ0A 4DYHA 1H5QA 3TX2A 2AFVA 1EDZA 1H85A 1QGAA 2JVKA 1EKXA 1W87A 2ERXA 2FEXA 1DS6A 3GROA 2JJYA 4FONA 3ZDXB 1EZ1A 1ATIA 3UWSA 1ZUIA 5HRCA 1UKBA 4P7KA 3STUA 3TZHA 4IH4A 4B2LA 2JASA 3ZE7A 2ZJ4A 5FWAA 1ESEA 2GYWA 2FOXA 5HKLA 1NF2A 2G76A 3T3IA 2H7YA 2OGUA 5JPDA 1VOTA 1SJ9A 1XAJA 3BWXA 5JZVA 2QL9A 3THXA 1NI4A 2ZPTX 2F7SA 5DSZA 1JQJC 1ZGHA 2X19A 3UBMA 1CEQA 2BM1A 1E1QA 3KYCA 1B6RA 4ZQIA 1U4SA 1PDVA 2OO5A 2ZB8A 4XJVA 2PJDA 1KBQA 3DL4A 5BOSB 4RSHA 1BDHA 3RUHA 1OLSA 2PX6A 3WVNA 3N5CA 1X7XB 3IH5A 3IOMA 5P8WA 2V4UA 3QE4A 3FVVA 4K6OA 2AJDA 1EX9A 4INAA 4NCAA 1FJ2A 4Y7CA 3U7FB 3LDUA 1M76A 3PNBA 2HIGA 4F4UA 3NEPX 1E1DA 3WHKA 1H2FA 1PWZA 3WGNA 1A7AA 1A9XB 4TMVA 4TT8A 3SKVA 3C6XA 3SC2B 1VRWA 1Z74A 3I2KA 4CMBA 2Y1CA 2YWBA 3FTCA 3S8MA 2J32A 5IVDA 4AUMA 4E12A 5FV4A 2NT4A 5IT4A 3AQ4A 1BMTA 3DQZA 2HL6A 1M2JA 2FUKA 2YQ4A 2Q7OE 5DT9A 1NRIA 1RCUA 1RLUA 1T3LA 4JODA 5BWMA 4I5GA 2ZUDA 3ZV4A 1D4ZA 1Y4UA 2R6FA 3FNGA 2O05A 1XZJA 2OOKA 3PHBE 3GLHE 2VRWA 4U1RA 1VSBA 3HJHA 1DBSA 3VYWA 1C2TA 4EI7A 1W2HA 4QOHA 3A4YA 3QMPA 4BMVA 4EGQA 5ARBA 3DWFA 4IVNA 4H1TA 1ZA2A 4NNJA 4ZHQA 3RODA 5C8XA 5KNCH 3N2IA 4XQ0A 1YCFA 3PPYA 4GL2A 3OUTA 4RABA 1I10A 2GK4A 1QDLB 4G0VA 3BDIA 1WPXA 1O6GA 1MORA 4WIAA 3SR3A 4A0RA 4DRXB 4RJTA 5AJTA 1JGTA 1K0UA 1SUAA 3FXAA 2HF2A 4GPAA 3W5AA 2NP7A 2BEUB 3VUFA 4EF5A 2WU4A 3GEMA 1GG8A 4Y2QA 1G16A 1B2LA 1PK7A 2A5DA 3CW9A 5C8YB 4OJYA 3ABSB 2H3HA 5TQ0B 4FOTA 3IP7A 4U63A 3VH1A 3KZCA 4JLUA 2F1JA 3FCXA 1ODSA 1XWFA 2WI8A 3DL7A 1RHUA 3EMKA 4JQZA 2DSNA 3AMVA 2JA1A 5FUWA 4Y9SA 3V00A 4IRMA 1ZNQO 2BGGA 2P9JA 3AFOA 3WQRA 4MB6A 1XUOA 4G0XA 3AG5A 3N05A 2I3ZA 4O4LF 5DV9A 3PFKA 1KVTA 3FTFA 2P5UA 1KKLA 3FGZA 3N28A 4ZVSA 4J91A 3RIHA 5HJ7A 2D6FA 4BMXA 4TKUB 2RAPA 3WGZA 3TLJA 3T61A 3ETGA 5JFTA 4UULA 5DWDA 5JZOA 1TM4E 2A7QA 5AI4A 1RWQA 3GL9A 1YDEA 4UD6A 4UEOA 1X8XA 2VJNA 3SHFA 2VF7A 3PKJA 4KXUA 1CJCA 3VYUB 1LB1B 3VR4H 4M1QA 4PRYA 2GX6A 4MK4A 2JK1A 2Q4OA 3K8QA 1B43A 4GW3A 1VI6A 2ODQA 4M8NE 3D5QA 1PV2A 3ONFA 3SICE 4F12A 3LTNC 2V0GA 1FRZA 4MUBA 3VHRA 3ILHA 2QX8A 4ITRC 4NZYA 1P5ZB 3GELA 3VPCA 3TXYA 4G8CA 4CL0A 1UKAA 1K8RA 5DYWA 3LWNA 4FXOA 2HK9A 4GUDA 3BMOA 4YPVA 1SUSA 4HSEA 2PIDA 4Q7EA 1IY0A 4ALJA 3QY9A 2J5BA 3CLUD 3TPFA 3EF0A 1DHRA 2NPFA 5CB6A 1MXHA 2CLMB 1OFIA 2HJWA 2OR3A 3NHWA 4QG7A 1JNXX 1JG4A 1VIAA 5G41A 4IPTA 3K0BA 4MJ7A 2MMGA 2HWKA 3K6JA 5T4FA 5LP6B 1Y8QA 5LIRA 2C3PA 1DG1G 4Q1DA 2DWPA 4R1PA 5FFFA 5I7AA 4EFDA 3JSXA 3DSRA 3QEMA 3N8KA 4MAAA 3WYAA 1P33A 2GF0A 3ND5A 1YIDA 2IS1A 1MX5A 3DTVA 7YASA 3ZDYB 5IYZA 5CJPA 3AHFA 4HWRA 2G1KA 3ORYA 1I2CA 4DCMA 2VZLA 1A8PA 4OQLA 1WW8A 2WT9A 1M74A 3CHYA 2JJ2D 3SF8B 5BNIA 3IAUA 3DA8A 2QD1A 2HYDA 1RPTA 1BSVA 1YS4A 4RETA 1HV8A 3BHJA 3DVLA 3KQVA 4LDZA 4KIWA 2AFHA 2EARA 1T1GA 4RORA 3ZWDA 1X7YA 1ULHA 4CLOA 2QMHA 3OFVA 2O2CA 3RJMA 4X0EA 1EFRA 3IFSA 3RVOA 2WEKA 1IIRA 2GDJA 3FPHA 3HRKA 4V02A 4M9RA 3WRVA 4LVCA 4QC2A 4DLAA 3PTZA 4RD2A 1FBTA 4FMDB 3ZWCA 4UASA 3CT6A 1I3CA 2CXOA 4OGKA 2P0AA 2EIXA 4G5OA 4HH0A 4F9GA 1EESA 4BMPB 2WWFA 3G1UA 2XDAA 3HSKA 2FX5A 1L5OA 1ZOIA 2CBXA 3HLTA 4FN5A 4Y6OA 1XN1A 4RJKA 1A1VA 1R4NA 1YR6A 1ZRMA 4GX1A 1RHQA 3A6GA 4RVUA 3HB5X 1U2GC 2ASVA 2G83A 1Q0QA 1WNFA 3CRQA 4FC7A 4Y0NA 3CVOA 5KSPA 1FC0A 5EKDA 1R1DA 3MJVA 5EL0A 5FR1A 3WGLA 5IK2D 1CB7A 1I3NA 2G17A 3I5AA 2H2IA 5F9FA 3QKRB 4HH4A 4OHBA 1Z62A 4HZIA 4WKNA 1QK3A 1SHZA 2OC9A 3J80A 2PUWA 1TMKA 4JZKA 4RACA 1KMCA 3VR3A 1QRSA 3HA5A 1JQEA 1E0SA 3ABOB 4O33A 4MGIR 3UFXA 1W581 3J81k 1FLNA 1U8TA 2OHHA 4P5DA 4EMBA 4B3MB 2OBLA 1RKVA 1V3TA 3GVIA 3WWOA 3K1YA 1OV6A 4MJLA 1KAGA 2IYZA 3VYSB 1CZKA 1OFVA 3JAWA 4QASA 2QROA 2O1SA 4DT1B 3EDQA 3ELWA 1DKLA 2DUNA 1BHQ1 2RHMA 5GTDA 4MEBA 4G1CA 2DOKA 2R85A 1FP2A 2OBBA 4XSHA 1NMSA 4LVOA 2CCGA 1NFQA 5DEIA 1TFUA 5AR1A 3PEEA 4ENPA 2FZKA 3IE2A 5EHNA 1GPAA 3TQTA 1C3VA 4N6OA 5GZ3A 3I1YA 4CQMB 1EAYA 4JB8A 3ANSA 1UC4B 1V5FA 3RVPA 1AOXA 5A3JA 5BSWA 1CYDA 3FW1A 3RF6A 3C2QA 1I4DD 1EBFA 3ROMA 2WZCA 5CPFA 3SQWA 3IHWA 1RM0A 1SULA 2PPLA 1D2RA 2OHIA 2RGNC 3UMMA 3DLPX 1T0IA 3V1YA 2HHAA 3PNVA 2J9YB 1NNEA 1HZJA 1OKKA 4E09A 3U3KA 3ZZUA 4UU0A 1R4AA 5DNVA 1U0NA 3LH5A 2X5OA 1JEYB 2VO1A 3P9IA 4NZMA 2W2OA 3HZZA 3GUHA 3CZ5A 2BKAA 5DYIA 3ROKA 8ABPA 1DSSG 4NAHA 4CKYA 4LC9A 3B6IA 1THMA 1ZCBA 4BRWA 3UJNA 1ZM3A 4ALIA 1IN8A 3FBTA 3OU7A 2RG1A 4L73A 1T2VA 1Y1QA 4HYTA 4N7BA 3G8AA 1RAAA 1U1IA 3SQDA 2JI4A 4J6FA 4R9VA 5EPOA 2V7QA 3O4IA 1DKOA 1RAHA 2A78A 3ABQB 4ONEA 2HPHA 4TL7A 3S44A 4ANFA 5CA0B 5JC1A 4TLAA 2HHHB 3VKGA 2V3VA 4OHUA 3ND6A 2WJYA 3RR2A 4W1PA 4B3SB 1ADCA 5ANRB 3JAKA 1Y3FE 4EY6A 3WGQA 1PEDA 3PD0A 5H3LA 1QIGA 3LPLA 3JASB 3Q3JB 3CLRD 4AN4A 4ZQHA 5DXAA 2EKDA 2P6NA 5E4FA 1IY9A 4NPAA 4QAJA 1NOKA 2PKEA 4UOZA 2JC3A 4NK5A 3WYNA 4E15A 2QPOA 3L6OO 2GRAA 4WEOA 2GGSA 4HKTA 1M8FA 3GNQA 6ADHA 2WKRA 3AKEA 1T0PA 4B80A 3AKDA 1TUBA 3I3OA 3DWEX 1OIVA 3OE4A 2JAXA 5ALLA 1ANKA 5FL7A 2ZYGA 3L8EA 2WWYA 1BMFA 3JWGA 3PHCA 1JMVA 4F5YA 2P2DA 4JI4B 1UC8A 3QI7A 4GR5A 5I9IA 2OB2A 4QEDA 4A7PA 3AP3A 3BFXA 3EXG1 4HXYA 1TJ5A 1WRBA 4LYHA 1ML4A 4MVJI 3VKWA 1JWLA 3HVIA 3VR2D 5K45A 4NZ9A 1MR3F 5AI8A 5HBRA 4K05A 5L51A 1P17A 3WLTA 3U5ZB 3OOYA 4M49A 5EIXA 3NEYA 4L2IA 3ZY5A 1P3Y1 3ZHOA 5JY6A 1DMSA 3G1TA 1PR3A 4GH5A 2TSYB 1RU3A 5FOUA 1TTPB 2XA2A 3ND9A 5BUCA 5TDHA 1N8SA 3DEZA 1TVMA 1R0RE 1KI1A 1I7LA 3HDQA 2NQ2C 3TSYA 1E9CA 3VJKA 4DUPA 2IP2A 5AICA 2BR3A 4X62B 2QYSA 5AM3A 4W1QA 1C8VB 3D3QA 3HNOA 3SYNA 2ESRA 1QVAA 1PFVA 2IXBA 5LUBA 1KGDA 2QIOA 2W6PA 1UQUA 2J5XA 2KS6A 4XOUA 2XDQA 5E1DA 1TJNA 2JCVA 4NNOA 2D1SA 5BN3A 1PJ4A 3LQFA 4MNTA 3SNKA 5K3OA 4MW7A 1TT5B 3A06A 3GDWA 4RY2A 4BTLA 2GVZC 2HSGA 1QX4A 3D1JA 1ZU5A 1NJ5A 4PYLA 3OZ7A 4M38A 1S1CA 2GKGA 2IW3A 4J3FA 5KTKA 3UJ8A 3BQMB 2PLFA 3KYBA 3LA6A 4B6EA 1ZCFA 3C85A 4HGYA 4BN0A 1U6JA 4M8LA 4XFKA 4X3CA 2DQ4A 1D07A 2QK4A 4RQTA 1WB6A 2GYVA 2PGXA 3NRJA 4Q37A 2OV3A 3PC2A 2TMGA 4WZAA 4EBBA 5F2NA 4GYWA 1GY8A 2CZQA 3LOUA 2JHFA 2H0RA 1KZ9A 4ILEA 2LDXA 1SZCA 1SU4A 3CEJA 2CBGA 1Y48E 3TEMA 2FW8A 3DT8A 3M33A 5JAUA 3KJIA 3TINA 2W93A 1OIXA 3FTPA 3T1VA 3S7TA 4Y30A 1FFGA 3ZW8A 1FYDA 4ZQCB 4ZZ1A 4REQA 1JIKA 3TCXB 5K5EA 4E33A 1OH6A 4P93A 2FSVA 1DQRA 5BSHA 1IUPA 3DTNA 2JIDA 1WUJS 4KSYA 4XSGA 1YKFA 4DCGA 2OD7A 3STTA 2FR8A 3M6LA 5K09A 1PG0A 1VTKA 3CWZA 1D2CA 5COAA 4U5XA 1VCOA 1HQDA 3EGVA 1GKIA 3L8CA 2OXFA 3MWYW 5CVEA 1NLYA 5H82A 3WFZA 3DMTA 4ZODA 2Q9CA 3A26A 1V8OA 1ZNZA 2V65A 4CM4B 4TTIA 3UNXA 2RC5A 5EYPB 1QFZA 1GGKA 4KQMA 3ZZMA 2CMKA 3GFTA 3TSCA 4MJXA 4UUAA 3V8NA 4JP8A 3K5WA 3DEAA 1E7YA 4MQ5A 1QPBA 3LYLA 4X3OA 1T26A 2C5BA 2GN6A 1O58A 1P7VA 1RYNA 5DISB 4DZRA 3QGMA 5E7MA 4R2XA 2XF8A 3HJFA 1RRCA 4KNWA 3BRQA 1IBLB 2QB5A 1RMQA 5F12A 2GEJA 3V9PA 4BQFA 2GS9A 2VDJA 2GRJA 2I7CA 3R6DA 4EY7A 3DOCA 1Z6ZA 4PFQA 2JFGA 2PR2A 3ND8A 3UMFA 3WK7A 3IS3A 4QKQA 2QLBA 4CL3A 4NCXA 4TV8A 4HQ6A 2B6HA 2BL4A 4X8MA 3B6JA 2WIAA 1P2TA 2XTZA 2IA5A 1F8YA 5G1NA 4ZAGA 2RDMA 3KHKA 4AZ3B 5KVVA 1DO2A 1U3GA 1JBQA 2VSQA 4AMGA 3LUGA 5H7XA 5J2UF 3AVVA 2OCXA 4X20B 3HJNA 2PSDA 1C3JA 3PG5A 3MNFA 1IIBA 1OWNA 2VS1A 2XWQA 4G5FA 1MEEA 1RRVA 3RKSA 3SVTA 2J4FA 3M5WA 4Q4JB 5JCXA 5F9HA 3EFOB 5E1BA 1HQYE 1Y33E 1LDEA 1DBVO 4JQCA 1DC8A 2RI0A 4A2WA 1WL8A 2F43A 5I4KA 3KTFA 1DC6A 4M53A 4BAZA 3AF4A 4QDZA 1SKUA 3CKMA 1XFAA 2JLCA 5P21A 4NQZA 3E18A 2GZAA 2DR3A 1JB9A 1V0JA 1TIKA 4AJKA 4M87A 4AC9A 2OVBA 4IMIB 3JVUA 4B6QA 3AC0A 3DV0A 3LDFA 4BO6A 3OZRA 5KTTA 3KT0A 4MQMA 3UMBA 1PS8A 4KRGA 4HT3B 2WIJA 3NX4A 4J1TA 4HRXA 3KPJA 3M6WA 1NQWA 2XH8A 2PNFA 1N5JA 3BD9A 3M5CA 4MROA 4MW4A 4QYSA 4BV2A 1IK6A 1SQ5A 1TM3E 1HO3A 3L0IB 1XCMA 5BYJA 5GADl 1A7UA 4Q48A 1D9XA 5ICGA 1Z8HA 1ISGA 1RRFA 1E3WA 2AFIB 2IDKA 1WIWA 3AW8A 1BJKA 3VHQA 2VPZA 3E8SA 3T3OA 3EZFA 3A6JA 3ZNPA 1M2OA 1WP4A 4EX6A 4CEHB 2QYOA 1XB2A 2NZXA 4PIMA 2VP4A 1TMGE 1Y42X 3OF2A 4YCJA 1X74A 3SSNA 4L3OA 2MHCA 3TTYA 2P0EA 3TX6A 2E5LB 1PR5A 1QMGA 4C7KA 5I9LA 4G0OA 4H1UA 4EQZA 5K01A 1D6SA 3RUFA 1K86A 3IR6A 4RTSA 2BFFB 3QXJA 3WDLA 3WI7A 5FEUA 4OCZA 2A9OA 2H2AA 2ZROA 4NOMA 4XTRA 3B6MA 3W7BA 3LJKA 2P11A 3Q2OA 1IBMB 5A4DA 1KEUA 4RS3A 1VA5A 2NN3C 4NAUA 1I2AA 4IIBA 4WZBB 4A2PA 1N1DA 1SXPA 4ENVA 1GU1A 2I80A 1SXJE 1DIHA 4IV5A 1P2GA 1XHLA 2ZAMA 3QUQA 4JLNA 4L72A 4CR6A 1V11B 3AF1A 5DE3A 1GQOA 2ZWMA 5JAPA 1QH0A 1CC1S 3HYTA 2COKA 4OOFA 5DIZA 3UK1A 4BFZA 1IUOA 2QXTA 3N2NA 1TX4B 1OFUA 1YQWA 4PAMA 2A4MA 5KI6A 1S96A 2QD5A 4RFVA 1K2WA 2DMRA 3NATA 4JITA 1U3DA 2DWOA 3KAJA 4PSDA 5A7FA 3VJRA 4IDGA 2IL1A 5JZMA 3NC0C 4EYGA 4MKIA 4F8JA 1A97A 4LAFA 4A1OA 3DVRX 3PC3A 5D51S 4B7CA 3AF3A 2YV5A 3PIDA 5EIBD 2DKFA 3GLGB 4C4ZA 4NP6A 1WBJB 1NVEA 1NY5A 1PRYA 2BFMA 3DZDA 3OJOA 3PYLA 4CN8A 5L3ZA 3GD5A 4OIMA 1W6RA 5H9VA 3IUEA 1F2DA 2XUIA 3KYDB 3QELA 4LV8B 4CMCA 2IYVA 1VMEA 4DUGA 2QLMA 5KKNB 2E7ZA 4ZT2A 3NNDA 1WCXA 4OXXA 2IYRA 5E6UB 5KU1A 5HRUA 1MVLA 3ONNA 3RM3A 3D0QA 3G7UA 3F74A 4UKDA 2WYWA 1DC5A 1Z5PA 6CHYA 1XKLA 5IJ0A 3KQUA 5CLQA 4TVSA 1DP4A 1SZJG 1GO2A 1Q0RA 1ES9A 1SC4A 1ZGGA 4J4HA 4EG0A 4DUZB 4N03A 3NG1A 4OUDA 1CQJB 1VJCA 4P35A 4D80A 3OAAD 1EI9A 1KMNA 2Q3BA 3LNCA 3D7SA 4A6XA 4D7AA 5D5QA 1MO4A 1XP5A 1M1UA 3GRUA 2VCHA 1MB3A 1JFFA 4HAVA 3ZJYA 5AD1A 1Y3BE 2YZ7A 4X64B 3J7TA 4DA9A 4EPYA 2CDRA 1BVUA 1M5TA 4UEQA 3AEQB 4HB0A 4UDXX 5FCDA 1OIWA 1ZONA 2OO5C 4P3KA 2VCYA 3L18A 1GZ5A 4K1LA 3THRA 3H2KA 4LY9A 3KK0A 5GP1A 1FU4A 1T13A 4B2YA 4YMLA 1JZQA 2Q9AA 3DFIA 3KKKA 1OFTA 2RGGA 2VK8A 4IDBA 4R7TA 4NDZA 4N1AA 3HJAA 2VDUE 1K5PA 5FUBA 3ZYCA 4KTVE 1UPUA 5K1ZA 1C9EA 3KHSA 4EYQA 4IDFA 5C4IA 5HGXA 1HE2A 4AZ0A 2WLSA 1UFKA 2PLRA 3LCVB 1ULBA 3PS9A 3RSSA 1P80A 3ZU6A 4AX8A 4W5TA 4HR7A 3LUCA 3EJWA 1E4OA 1JHOA 4RULA 1MENA 1QNFA 3VJLA 3AEUB 3PWKA 3CGWA 3ZBPA 2C7BA 2Y6VA 3CO0S 2R1ZA 2HEGA 4B3RB 1EE1A 1RXYA 3AVYA 2J0VA 2JA2A 3ONDA 1AKWA 4X41A 1E1LA 2BGKA 2IOQA 3CISA 4G1MB 3SBEA 3VVCA 1E89A 4F5DA 3MJDA 3ZUGA 1SVKA 4K87A 1I4OA 4ZXFA 4MVJH 2DE0X 3C98A 1ZW1A 5EIHA 1I6KA 3B70A 3VC3A 2VZ0A 2XUZA 4RZHA 2Q07A 3N2GB 3I9V6 1OBOA 3PGLA 4UNSA 5KNBD 4O8ZA 3CLKA 4A26A 1EE2A 1NPDA 2BGRA 2M1ZA 3T3HA 1N5MA 1WZIA 1ADFA 2JKZA 4HAIA 3S2EA 3EVGA 3KETA 4W1RA 5I3ZA 2X76A 1TMYA 2BVNA 4LRTB 1J0DA 5IT9A 3BCRA 1KEKA 1Y8AA 3DOFA 4BEJA 4LSZA 3F5MA 3G0GA 3FNQA 3MBKA 4XWAA 3QIVA 2ZJ8A 4RCZA 4DLZA 5LNK1 3ZLBA 1DTWA 1DXHA 1EFVB 1TQ2A 2MWMA 2QU7A 3KXKA 1BA2A 5B1YA 3HMKA 3NV9A 3SX2A 4EW3A 4ZHSA 5K4GA 4LC0A 4G5QA 2FWNA 2Z6VA 4ZPJA 3OP4A 4Y2HA 4JXXA 4MIEA 4XKJA 4ZU6X 2O8BA 1T5TA 4MXDA 4RC9A 5TT1A 1J0EA 3ID6C 4KIUA 5FJJA 1DBWA 4UE2A 2VHUA 1SCJA 3G2KA 1D4FA 1JSCA 2BE9A 4Q4HB 2WM8A 1KYWA 4LCJA 3WNCA 4HUJA 5IS2A 1QCZA 5I9BA 1XRQA 3PJDA 1FDWA 4QL3A 2WSMA 3DXZA 1CP2A 4CDNA 4J16A 2NZYA 4WAUA 3U4IA 4IFIA 2V7UA 1TYDE 1KBZA 3OBIA 5JY1A 5KVAA 1MABB 1N2HA 1JA1A 1X1CA 4LF5B 1XVAA 1HG0A 2RG7A 2P6MA 3U7QA 3F7OA 3VR6A 1KFBB 1NZDA 2VC2B 3C70A 2GSWA 1CFJA 3HYNA 4HGQA 1YJQA 4JYPA 5BPFA 1W93A 2Q3LA 3KAQA 2GD2A 5LB2A 1TK3A 4G09A 5I5GA 2WU8A 4UTRA 1X92A 4Y1EA 1NVDA 1YS9A 1UEIA 2A1IA 2M32A 2NXNA 3HSSA 1XU4A 4NBUA 5LQNA 2A0KA 2GILA 3ZDZB 5ITSA 1DC7A 1L4LA 3VZSA 4ZVPA 1XNRB 3P2JA 3HDTA 4BNFA 4D42A 2NAPA 4DTIA 3KSBC 3IEIA 3VBEA 1YS7A 2XOKD 2Y2UA 4UUMA 5HGJA 4D4IA 4PCUA 3KHTA 1QK4A 1IXSB 5BT9A 2NTVA 4EDHA 4OYLA 3Q11A 1AB5A 3K0FA 1E69A 1M6WA 1V25A 4HP8A 2JHAA 3CH5A 4JAVC 3VR5D 4OJKA 1SUPA 2B5OA 3EPJA 3OURA 1T4DA 1KA9H 3QPDA 2W2PA 4B31A 4DLLA 2QG4A 3HDGA 1U0HC 2RBGA 2VT3A 3EH1A 4ZO8A 3V48A 5CDFE 1O9BA 2F00A 1ISFA 1DAFA 2J41A 2OBXA 3JV7A 4HEHA 3ZHRA 2V1UA 1KQOA 4G36A 2VT6A 1AC5A 4EGFA 3KQTA 1XZFA 3PD7A 4U0JA 4ZDIA 2AZTA 2J46A 2GM5A 3NBFA 2WFLB 1KO1A 5EHIA 1TXGA 4W7HA 4YCLA 4AN1A 3PGXA 1XRMA 1IBCA 1LW6E 3CNEA 3A9UA 4FWBA 4JKYA 5E8JA 4UPVA 4FFPA 5FOQA 2Y93A 4DR5B 5TJHA 2O50A 2AVDA 3FZGA 4ZREA 5A4AA 3F97A 4D3XA 1OASA 3KKNA 3GLUA 1UBKS 4IWNA 4NENA 3B7GA 2XXJA 3FSGA 3V4OA 1AS2A 2WUEA 4XUGB 3CUTA 3ZXSA 4YUAA 3BMQA 1X77A 5KHOC 1VYVA 2BR5A 2QAIA 3B1XA 5JE8A 3WIDA 1ZITA 2CMHA 4AZWA 1N9GB 2XQVA 4FYKA 4XQEA 4EB6B 4BJ3A 5LL6P 2G7MC 1O0SA 3DHVA 1R6VA 3AU9A 4PTZA 1EB9A 3E7XA 2DECA 4B09A 1QC5A 4EYKA 1YTLA 1JFLA 2JFPA 2FEOA 2MSEB 1RWOA 4Z0PA 2PSEA 3O5AA 5JXJA 3KV3O 1USUA 1ZD9A 1WLYA 2PYZA 3QXSA 4FT2A 5H5JA 4JLMA 4BO5A 1ZH4A 1LWNA 4DYVA 4ZFNA 2HCFA 3OHMA 2O2ZA 5CX4A 2YHSA 4G4SO 1MEOA 2FK8A 3DV9A 3OZXA 2GN1A 2PAAA 4WRRA 1U2TA 4U3JA 5CAEB 3LQRA 1MRNA 1TEXA 2JGJA 3T4EA 4F97A 3IOCA 1HWYA 4ZCMA 3HXQA 1AJEA 3LRXA 3HKBA 3HCNA 2IIQA 3KB2A 1CY7A 1KP2A 4D6XA 4EHNA 3KKMA 3BORA 3HCEA 3A1FA 3ELUA 3O8OB 4MR7B 1XX6A 4R1UA 3Q8MA 3D0OA 2XQIA 2PS0A 1PE0A 2AOUB 4LJSA 5IAGA 1DRVA 2ZBVA 4R05A 1ZLYA 2FPKA 2JFXA 3UUEA 3B9QA 4AJPA 5JNVA 3FOZA 1OUMA 4HN9A 3BQNB 1C1XA 2H4WA 4DHWA 1UPFA 3SSAA 1PFQA 2AXPA 2O2JA 1JE0A 2Y0PA 4QEZA 2HH9A 7MHTA 3E3NA 4OK5A 5I45A 3EGCA 3FX2A 3IOEA 4B43A 2DR2A 4U2KA 1ZIXA 1SA0A 3RGGA 5FBRB 1J7KA 3ECCA 3EC2A 1RQ2A 1UIMA 1BROA 3TQIA 3WWEA 2QAGA 2ZAOA 1KTVA 3BBPA 4H3VA 4PZEA 4ER6A 4L9SA 4Q24A 4Q7QA 2XUAA 2JNWA 2CF5A 3C8HA 4RGQA 1NFRA 1NURA 4YK7A 4UM8B 2AW3A 2MINB 4PWZA 5L3QB 1E0JA 1N6IA 1URPA 3EN0A 2XW6A 2G09A 3CV3A 1Q19A 4QDUA 3P9RA 4DXDA 3DAFA 4M4SA 1ECCA 5BMVF 5EZ5A 2IUFA 4XJTA 2UZ0A 3TLYA 3RTAA 1QH8B 2FQWA 3INGA 4LFAB 1VIVA 3WWPA 1PUIA 4IIHA 1QGUA 1SC3A 3S7ZA 1Z35A 3ZPXA 2I76A 3M6IA 1HDEA 2EERA 3SMVA 3G8CA 2Y1FA 1C8BA 1Q7RA 2FMKA 2X4IA 3SXJA 1XMPA 3OPXA 4NE9A 5AUOB 4RTKA 1MC4A 4TTQA 3FLBA 2EJBA 3MMSA 3N74A 4Q1AA 5IBQA 4D2IA 4ZMBA 1ZVVA 3LQ4A 4PC2A 1ZMBA 2WJPA 5C9ZA 1VBNA 2WTNA 3NNNA 4UAVA 3KWFA 4X7PA 2ZTVA 5EJEA 5CYFA 4RJIA 2ZE8A 4G3XA 1WKVA 1HYEA 3NHJA 4UUQA 2YDYA 1B73A 1VE7A 4XQGA 1GQRA 3KB6A 3O9MA 2PZBA 3MTIA 3AHGA 1TJPB 3PLRA 5BVHB 4ER5A 3G5LA 4WMLA 3TIGA 3WNDA 4BNUA 1RXVA 4G9GA 5T67A 2EFJA 2YWEA 5JRDS 4BLSA 4RK1A 2FSHA 1IPEA 3K6KA 2A30A 3PFCA 4CFZA 4QECA 3NP9A 3PL1A 2PMFA 4ZAZA 3DBOB 2ZCVA 2Y4NA 5KNLA 3ICVA 4I8DA 5AI5A 4BNKA 2HHJA 1NN5A 2CF6A 3KT8A 2GLTA 4HTFA 3RC2A 4O59O 3GLKA 1UT5A 2JGLA 2LTAA 2REBA 5KC8A 1TW2A 4G0UA 3OWXA 4GXNA 3PFGA 4M54A 1U9JA 3WBJA 4GSKA 4D9CA 1OA0A 4LOKA 4HPJB 4XH9B 1W73A 2ATXA 2XSZD 3QKUA 1KHHA 5JQGB 4XD7A 5AVQA 4YCCA 3WSWA 3PZBA 2B8WA 1JYFA 2DCUA 2E49A 4FFMA 1DIRA 1K6XA 4NESA 5FPPA 4A82A 3D3KA 4DRZA 4HFRA 2GI4A 1XEAA 1BFKA 3AM5A 1YQQA 1WSAA 1G64A 2IHTA 1XAGA 4JXKA 4TYWA 1RYDA 2I4RA 4RGBA 4Q7LA 1NVFA 3BK7A 2TRSB 1N5IA 2HRCA 3A6KA 4C29A 2VSXA 4US2R 1NVXQ 1YA4A 3UOGA 2PWZA 2AF4C 1NV9A 4AL4A 1N2CE 3H97A 2P75A 3RVQA 2Q49A 2QDKA 2F1HA 2ZWOA 1ST2A 3BSFA 3FWYA 1RLMA 4XR9A 2NO9A 3IDQA 5GIOE 1H05A 1QHYA 1TECE 2A5YB 2AD5A 2CC2A 2EYUA 4WCFA 3WGHA 4BFSA 5B5SA 4CLRB 4FFRA 5HG0A 3KVVA 1V45E 2PFSA 3H1EA 4KE9A 5BV7A 1MF7A 4N48A 4D43A 3T7EA 3EPLA 1ZOPA 1V16B 1TIPA 3QOXA 3DZKA 2BEWB 3OU6A 2IKQA 4O2BF 5KCZA 3ZY4A 1R3DA 1YDMA 4LZNA 3EIOA 5DNDA 3ZDBA 4HK4A 3RRFA 4F71A 1JL3A 2XKKA 4X66B 2H8GA 1W52X 4Q01A 1XD9A 2RFLA 1E9AA 5KWEA 2BW0A 5DBEX 3ZJ4A 4RHUA 4LQ4A 3JZIA 2QTZA 2O3QA 2EF0A 2AEFA 2A86A 4Q1FA 2FUCA 4PICA 5DP1A 4UMVA 1SKMA 1G20A 4YMSA 4TVKA 4Y98A 2DTEA 1JMYA 1C1YA 1DEAA 1ZM4A 2VAMA 2Y66A 3FIUA 3IPRA 4XWYA 1FIUA 5A7GA 3REFA 3SZGA 3X1JA 3GQVA 3RUCA 4ZYZA 2HMVA 3T38A 1NRJB 1WAMA 7ABPA 2ABWA 4MQ6A 4MQBA 3ZWXA 2K87A 1T9AA 1FRQA 2HMWA 1TUIA 2FSVC 2I4MA 1Q0ZA 1HLGA 4RQUA 5KNDD 3BE8A 4R7GA 4TZ6A 4UCFA 4LGMA 2O48X 1OLXA 2NV0A 4JUFA 4WNIA 2FR8C 2PRYA 3BL6A 4DIMA 4XDGA 2O0JA 4C6SA 4OTZA 2IIPA 4FD2A 2GZHA 5DOVA 4TWIA 2CL0X 1KJWA 2HA5A 4ISCA 5K05A 4XCXA 2OPHA 4GKAA 3M34A 1XHFA 2JLYA 3DMTC 3H1GA 3B51X 2IELA 3K31A 2SKEA 3MMNA 3R3WA 4JJEA 2HIMA 1XBTA 1U7ZA 1GQ2A 4DLNA 3AM1A 3K2IA 4AY4A 2OM6A 2QRVA 4KCGA 1P2DA 3KQLA 1X13A 2EWMA 3QYPA 1VGQA 3W06A 1AZTA 4TS9A 1X9GA 3K53A 3UHOA 1VG0B 2BBSA 3O3NB 2I6GA 4O3FA 1FOEB 1Y3IA 3KQQA 3GMSA 3OZGA 2ZPAA 2P4QA 2W48A 3LUKA 4Y7DA 1ZICA 4I8XA 3C5EA 3HCBA 2W70A 3J7AC 2VXCA 1SD1A 2ZB7A 3LVQE 4ND1A 2OAP1 5GONF 3DUFB 2GPSA 4LZLA 3GFSA 4OQEA 2H00A 3A1UA 1XDUA 4MP3A 2QZZA 1LWOA 1JG7A 1Y4ZA 4IIXA 1WEHA 4NCHA 1ABFA 3KFLA 4RANA 2Q1SA 1H0RA 2R11A 3AJ9A 1GA4A 1ZD1A 3Q5DA 1P44A 1W85B 1Z29A 3HEAA 5FWYB 4BNLA 4FEEA 4N18A 1PFUA 3I5XA 2AN5A 2D5AA 3AETA 4UC0A 3V3TA 4O2AF 1XF1A 3S55A 5L45A 1DG3A 1EM6A 5A3QA 5F21A 2AH5A 3OQ1A 2AQIA 1U6KA 1AG9A 3GWZA 5CDGA 3HJTA 1NE2A 1CJMA 2FZGA 3D0KA 1P0CA 2BGJA 3E9CA 3MEQA 5FNVB 3RU7A 4F7WA 4FINA 1KVSA 1L7XA 3DVAB 4FI3F 1JAYA 1NI3A 3E70C 3C6ZA 4U2DA 1ILEA 4JNCA 2R6CA 3EHEA 3TI7A 1YK1A 3F7MA 1YAJA 2VPYA 1GFIA 1LA2A 1YDGA 5HQ3B 3RBAA 1VL1A 3L9XA 4HAYA 3V3KA 4J0HA 4OBXA 2K2WA 3L7KA 1SCKA 4N54A 3KYCB 2ZYTX 3CX4A 4G0YA 1V7ZA 1YVUA 4L15A 9MHTA 3SM3A 2AE1A 1UPAA 2YWGA 4Z4EA 2FPIB 4B7XA 4QUHA 2OT3B 4XD7D 4QSHA 3ZCVA 1EX1A 4JT2A 4QWMA 1N32B 3DF9A 4J1TC 2E4AA 2P65A 5FL3A 4IICA 3RSCA 1XJ0A 1OLSB 1HE4A 2JIRA 3BEDA 4GZLA 4TWRA 3OIVA 1P9WA 1WLSA 5J43A 1K5HA 1ZGBA 1TCUA 2YIJA 1VIYA 3DLBA 1EWQA 2O07A 4E14A 3O84A 1XF9A 1NM5A 3B38A 4OPMA 2X6TA 2LIPA 4DARA 4KIFA 1R5NA 4ARZA 3OE7D 1JZSA 1A9QA 5MN6A 1Y3DE 3I6YA 4QELA 4P0PB 3EWIA 4JEIA 3UJCA 5EMJA 2WE8A 2VK2A 3ZWWA 4LC1A 3WB9A 5JYBA 4WK4B 3VZPA 4L4ZA 2JFWA 4NF2A 4C4YA 3VR4A 3N75A 2X2FA 3HP1A 4YDSA 1Y7TA 3QU9A 2X0NA 3EC1A 3FNRA 4LSWA 4WA8A 1FX1A 4JELA 4Q9IA 3UHPA 1ZUNA 3NASA 3UT5A 4RTOA 3JD1A 3H75A 4GDFA 1NJ2A 2ZRMA 1GRVA 2O7RA 1NBIA 5MFZA 1GV1A 2FETA 3NTLA 4LWQA 1Z4QA 1E79A 1THTA 3D1LA 2FN9A 4KPEC 4DZTA 3E5NA 4ZHQB 4ZCPA 3GDHA 1F2TA 1FS5A 3M4ZA 5D86A 1DIBA 1Q0LA 1SOMA 4MI1A 3EGDA 4WGGA 3UMCA 2AJCA 3WR5A 2CT8A 2MYTA 3RS3A 3C3PA 4UCWA 1NGSA 1BCRA 1BIFA 1U5CA 1LCIA 2DYKA 3CQ9A 4IFTA 2IS4A 4UXIA 3P2OA 1DQPA 4L5IA 3K73O 3UF0A 1U6IA 3OI7A 3LFUA 1JKMA 3T5TA 4ZDJA 4P1ZA 5B2EA 1OI3A 1WG8A 2M98A 4HX5A 3E1SA 3SD7A 3R8XA 4S04A 5DW3A 1JQ3A 1NQ5A 4OU5A 4DAOA 4AKGA 3R5KA 4MUGA 2ICAA 3I01M 1P7WA 5KVCA 4OP1A 1ZC4A 1X1RA 1YL7A 4MGHA 2Z2JA 5CB4A 2EG9A 3BRWA 1RI2A 1YCDA 2RGYA 1R6XA 1ZH6A 1ESDA 1LH0A 4ZANA 2FMXA 2WM9B 2CCKA 3LL7A 1PX2A 2X22A 3C6KA 3NBUA 4HNVA 1XTUA 1XDDA 5L53A 4V0MA 1U8ZA 4HADA 2FQ1A 1WKCA 5LSAA 5I7VA 3BMNB 2ZJ7A 2EQBA 4Y2GA 4MMYB 3N86A 1KXJA 2A0XA 2BCJQ 4DILA 2G71A 2GK3A 2QVLA 2PXHA 2PRIA 2YDXA 4HWKA 4BVBA 2XWJI 2AB0A 3U5TA 2DUMA 2D2VA 4TRRA 5JI3E 4BVEA 2CMDA 3HXLA 1Q22A 1T3SA 3P1JA 1CR1A 1FPMA 5F33A 1X70A 4BAGA 2QM7A 5GGYA 2HA0A 4CMAA 1R12A 3Q10A 4OJNA 3S1LA 4HYQA 3I0ZA 1QU2A 2JS7A 1K6EA 1PG2A 4J9UE 1M6HA 2J3EA 3BMOB 4UFPA 2DPGA 1H4QA 4KGVA 2OK8A 4POOA 5L4SA 4CW7A 4BO2A 3KPVA 4CZ2A 4LFBB 1Y34E 3W6ZA 2YASA 4XZ3A 4IX1A 1RKUA 4II2A 1CF9A 4Q9JA 4BQQA 4QODA 1AUOA 3L43A 3O8DA 3UC5A 4BZWA 3X43A 1L5LA 4F60A 4RKFA 2YL2A 4XLZA 5JZBA 1PT6A 2C5EA 3Q3CA 2GZSA 3BFKA 3KELA 5D00A 4G4JA 1X3SA 2B7CA 3FDZA 1W44A 1NQAO 2G04A 4K9SA 5H1YA 1QANA 3FZYA 3BXFA 3QEMB 4YLEA 1O6CA 1KVQA 2VHYA 1GGNA 2WT8A 3EXEB 3K5PA 4JK3A 3VTKA 2PX8A 5IXJA 2PL3A 1BHJA 1OI7A 2BKEA 5EKXA 3V6LA 4HSGA 3NJ4A 1YZGA 1CDOA 3HJRA 4C20A 2WWHA 1J22A 3PJGA 3H13A 5AM0A 3LX8A 3X0DA 2QN8A 1SO8A 5EIAA 3UMJA 3ZHYA 1KE1A 1GZ4A 2R47A 4UUBA 1DRUA 3FVTA 1UBSB 1X7YB 2EWWA 1J8FA 2OV4A 3OQBA 5AHWA 1KRHA 3ZTTA 4CLOB 4D9KA 4BP8A 5LQJA 3TF5A 3FCEA 4YDRA 1U3VA 4OHPA 1OOEA 2Q62A 3B12A 5LQMA 1EPUA 4ALLA 5AQ1A 1J8DA 3LD9A 1R0KA 2VJCA 1A4IA 4GR9A 3DBIA 3P2YA 4D8XA 3OTWA 3GK3A 5FUMA 1E3SA 1NRXA 3NRBA 1FTWA 1O3YA 3ETNA 1JJVA 3E1GA 2ZYAA 3P9ZA 4ZXPA 2I3BA 3EZYA 4LDNA 2J07A 3ET4A 3IVGA 1R4NB 5A2GA 1WXHA 3M2PA 3OU2A 3EOZA 4PTYA 3VAAA 4MCJA 1PYGA 4LJYA 4OHXA 4OYYA 4GPZA 4CF5A 2I3AA 4KHZA 2ZRIA 1JG3A 4MAMA 1DBIA 2Q9BA 2PKYX 3NTQA 3QVGA 4TZKA 5J23A 2JBAA 3F3SA 4ZOBA 1QPZA 3PQ5A 2EJCA 3NBQA 3FAKA 4XIYA 5L3SA 1ILWA 3AIMA 2VOJA 3EIEA 1E8MA 4PYIA 1O89A 3OLVA 3RS7A 1SKYE 621PA 4Z2AA 1FMTA 3NORA 4Z0TA 4DG8A 2C97A 3VAZA 3K70D 3ER9A 3Q7TA 1BMQA 1G6KA 1XRNA 3G2JA 5KYGA 3F71A 2QJFA 2AQHA 3REQA 4WBNF 3JAWB 4X65B 1U81A 2OCGA 3DHYA 4CDMA 1NAHA 1SBTA 3EOAI 3BE5A 3HWWA 3K35A 4I4TB 4OGFA 4AJ4A 1SXIA 2RGWA 2VQDA 4D25A 1HDOA 1EAMA 5LOVA 3H8JA 3HM9A 5K4AA 4CM5A 1RQXA 2E48A 4M1WA 4FB4A 1R6DA 4BO9A 1Z0FA 1B0PA 4JS0A 3HJGA 1ETHA 2ORWA 1P6XA 1S8NA 1HETA 1XVVA 2Q1UA 3HABA 2AKEA 1VA4A 1B1AA 3OTQA 3RJ9A 5C5IA 1UZUA 1KH3A 3RE1A 3ZKWB 1ZIPA 2ZCJA 3OMWA 5TX7A 1E1MA 2EFYA 4QVGA 3NHPA 5ENZA 2AL7A 2VTKA 4RZIA 3RSLA 1NJFA 2C2HA 4C5AA 5CT5A 1P8JA 1JQBA 1C9YA 3A2MA 1R8SA 2C78A 3GA0A 4C7OA 1FUEA 2YJZA 2WJAA 3MJFA 4G5HA 5EA2A 4BIMA 4QGSA 3X2EA 2VT7A 5EE0A 5J9FA 3OLQA 3KJZA 1USVA 1ULSA 1EFPA 1RYYA 2BFOA 2CJXA 1PNRA 1LNZA 4AM8A 1ZINA 2AJLI 3WLJA 5T64A 1GXSA 1OBCA 2XMSA 3BB4A 3I8OA 3HR7A 3UWDA 1Z2NX 4KUEA 4CNBA 1HMPA 4GKJB 2RB4A 2C2KA 4IQ0A 1FJHA 1BW9A 3MYYA 4JHLA 4KGXA 1L8OA 1WS6A 2VL7A 3MUNA 2DPLA 1W5BA 3JAKB 4XEHA 4LY0A 1C50A 2DUJA 3D5TA 4JVSB 3QVSA 4QQNA 2RI1A 1V7PC 4BNGA 2WE7A 4CDRA 4OB7A 1KI9A 4EA7A 4ZK2A 5ECDA 5LMNB 1XA0A 2NMVA 1QTIA 2YJ5A 3PSAA 1EMDA 4K3UA 2RH4A 1RJWA 5HNKA 2K5UA 2Y27A 5FADA 1O96A 2IZ1A 1E3QA 2C5GA 1DDOA 4IV8A 4M9XA 4QBIA 5TGTA 3AU8A 4FB5A 2NZJA 3NH6A 3R41A 3Q6MA 3ZXUB 5LLTA 3KKQA 1MJGA 3ELBA 1A96A 3GEGA 1D04A 2ACEA 3HHEA 1BRMA 5HX7A 5IM4F 4LY6A 4TS3A 1TUBB 4CHGA 3EF1A 1YHYA 4JUIA 1QVZA 1OD6A 1TZKA 1UP7A 3GJQA 1BOOA 1JDBB 1RXIA 5TS3A 3QKTA 4ZO4A 3OEED 3U4HA 2B1GA 4JIMA 3ZTWA 4DLUA 4GLJA 4XSVA 2DTDA 3K8ZA 3NV7A 3Q98A 3W78A 4GIBA 4C4AA 3PGMA 2HSEA 2QBYA 4BUCA 4CMKA 1TC2A 2FP4A 5D7BA 5DHSA 3ZH2A 1RM5A 4IRUB 3VKVA 2QX9A 1T8WA 4C08A 1MX1A 5CP8A 2Q5JA 1SU7A 1RJEA 2GZ2A 4BP1A 3BWEA 3P0FA 3LVRE 3H3XA 4XD2A 1QONA 4YA6A 3UJBA 2ZULA 1Z4IA 1NQVA 4DABA 3ZJVA 1AK1A 1K3TA 2Q1TA 3TNJA 1F3LA 2K6GA 1LDNA 2CVHA 5DXFA 2H1WA 5K3CA 1I1OA 1KFJB 3EBLA 3KJHA 4IHJA 1WXGA 4F1KA 1KZGB 3NANA 5FULA 5JH7A 2YINC 3BE6A 1QIMA 2ZT5A 2JLAA 3DGEC 4MS3A 4DCTA 1DQSA 3K9HA 3KLMX 4UTPA 1RAFA 3BTUA 4A9AA 4S0ZA 5IVPA 5D3ZA 3TCKA 5CT9A 3T0FA 4BDSA 2C83A 4AJEA 3G5TA 3FN4A 1OTXA 4IRXA 5DO9A 4RX1A 2XMZA 4RMIA 2HRZA 1N7IA 3TFOA 4HL6A 4DA8A 2VRBA 3JQAD 3K1TA 2B94A 4W8HA 3HCPA 1A76A 1PNTA 3E48A 3T3NA 1DUSA 4DQKA 1HT3A 1GADO 2BKXA 2HTFA 3DD5A 1UJBA 1X19A 3HCDA 1JTFA 4S24A 2F1IA 5J58A 1EM8B 1M34E 2RHOA 1JQDA 3DMHA 3DWIA 1R6TA 2FPMA 1P4AA 1VKJA 1C4KA 1ZMTA 3LL4A 4M86A 5AI6A 1K7YA 1IWBB 3LBYA 3ZV3A 2QAGC 2NV2B 3ICEA 4WE3A 1UFRA 3H6GA 3DDZX 4WZAB 1NUQA 1L2TA 2OXRA 1P9NA 2VPTA 3BXHA 1A9ZA 1L5ZA 3O4RA 1W8IA 5AUNB 1POXA 5IF9A 3RFCA 2HNBA 3BZUA 1ZHHA 3M82A 5TSDA 2GCPA 2UVDA 3I9OA 1TT7A 1U8UA 2ZIXA 3D4LA 2RI6A 4GLOA 5BRJA 1EG2A 3Q5GA 1XPRA 3ROTA 4QA9A 1F38A 4DJJA 3LW7A 2CDBA 5ESWA 1R9MA 3V1MA 3TI9A 2VAXA 4Q21A 4Q47A 2B6NA 1RQPA 2PLNA 1QIDA 1UUFA 3QTLA 4DANA 1NDUA 1F0KA 1Q0PA 3IELA 2HJRA 4R2WA 6ABPA 2NTNA 4W9MC 4QM6A 1B7GO 4UNRA 1SAYA 1US8A 1UC9A 2O3UA 2OKCA 4D98A 2F8LA 5ECWA 1VM6A 4Y6RA 4O2RA 4ZVNA 5EKTA 4PVCA 1GCOA 4DIEA 2UU9B 2FZWA 5BPHA 4DMMA 4FFOA 4MR9B 4HV4A 2WG1A 1QF6A 5AW5A 1F2VA 2C84A 4M9SA 4BNVA 3GY0A 3TLCA 4P4GA 4DR1B 2Y77A 1Y5LA 4R4JA 3A6DA 2C3OA 3GJYA 2A14A 1E2MA 3PQDA 3QFCA 4FGLA 4I55A 4MYRA 3GT0A 3W34A 2FUNB 2GN0A 4DPMA 3C3MA 4RK5A 2PUGA 2ZVQX 1BS1A 4JC8A 4TTVA