3STXA

Crystal structure of tomato methylketone synthase i h243a variant complexed with beta-ketoheptanoate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDAVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methylketone synthase 1
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
total genus 85
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stxA00
4PW0A 4LXGA 2WIFA 5CXXA 2BGRA 4H7DA 5J3JA 4G8BA 3JW8A 5HFAA 1DT3A 3MVEA 2WHRA 1MNAA 2RONA 4WDQA 4XIIA 3EF3A 4M0EA 4OCZA 5ALOA 4BVJA 1JU3A 3LP5A 2VSQA 1QZ3A 1BN6A 2H7CA 4XX1A 2JEYA 3V9AA 4D9JA 3F98A 3WQHA 4P92A 1SCKA 2HU8A 3PE6A 1H23A 1YB7A 2VJDA 4X6UA 1BROA 1N5RA 4KACA 2WU4A 1SC9A 3P2MA 2XQGA 3EQ8A 1FFAA 3FLBA 4BBZA 1BE0A 4FLMA 4HRXA 2XMQA 2XUGA 4FMPA 3JYHA 2O7RA 3RKSA 2Q0XA 1X70A 3ESBA 5K3DA 5H3HA 2O7VA 1MNQA 1W6RA 4ZV7A 1CFJA 2YYSA 3I6ZA 5DTJA 4HAIA 3QBJA 4BZWA 1QJ4A 4FNMA 2DQYA 5JASA 2Y6VA 5A7FA 1DU4A 1C7IA 1Y7IA 3D4LA 3WWCA 1ODCA 3O9MA 2WILA 1EI9A 4L9AA 2WFLB 5AKHA 5ALTA 3STXA 3GELA 1QGED 1XKLA 3D2AA 5BOVA 3G0DA 1LBSA 5IVKA 4X00A 1EVQA 3QYJA 1VZ2A 5ALEA 1WPXA 4B85A 3WK9A 1ZGBA 5ALMA 3MGAA 4V2IA 5ALIA 4H35A 1CUSA 1K5PA 3M83A 1EVEA 4H0CA 1E8NA 1K6EA 1GPNA 1ZGCA 1T2NA 4AX4A 1XFDA 5D3ZA 4DMFA 1CV2A 2WQZA 4NZZA 5JD4A 4X6YA 4XWGA 4KRYA 1G42A 5ALYA 1PFQA 1QO7A 2ZYHA 1E5TA 4HS9A 2FUKA 2AXEA 5HK9A 1LPMA 3VJKA 3C70A 5JIBA 5ALNA 4H7FA 1VXRA 2JGEA 3VXKA 5FP0A 1XZAA 3C87A 4MXDA 1UFOA 2VAVA 3W9BA 3Q8WA 4PSCA 1XQXA 1H22A 3Q0TA 4MWTA 2PM8A 2VEOA 1R9MA 1QIDA 1BU8A 2ACEA 3KD2A 5JALA 5ESRA 4LHEA 4DNQA 2OCLA 2FJ0A 2Z3ZA 1CUYA 2OCKA 4KE7A 4W63A 4EHBA 3BDVA 1MO2A 4F5ZA 1MAAA 3R3ZA 1KU6A 1P0PA 1DINA 2ZYSA 2X5XA 4QE3A 1A88A 1UKBA 1YR2A 2EDAA 3WL6A 3BWXA 1H2YA 5ISMA 2I03A 4G4GA 1CUIA 1CUUA 1YS2X 4ITVA 3DOIA 5AK3A 4WJLA 1M33A 5AI4A 1FSSA 1ODSA 2HU7A 4MYDA 3H1BA 3ICWA 4X7BA 3DKKA 3W9UA 3FVRA 2XI4A 3L1JA 1CUVA 4GECA 4U2BA 5AHXA 5CH3A 2WFLA 2ZJFA 1N1MA 5CMLA 2W6CX 3KWFA 1VE7A 3F8SA 1KU0A 4DSAA 2QS9A 2WLSA 2RHWA 3STYA 2XB6A 3HI4A 5AKXA 3C43A 3VVLA 3BJMA 2JGMA 2HRRA 4RE5A 2XQFA 1THGA 3U1TA 1ZIYA 1UT6A 2PSFA 1HLGA 3G02A 3AFIA 3KOOA 1CUDA 4Y2YA 2Z3WA 5JAPA 2B61A 2BAGA 4Y2TA 5T4FA 4Y2UA 5CT5A 2GZSA 1XQWA 3DJYA 4PV7A 4Y2XA 4HVTA 1S8OA 2QVBA 1TRHA 1CUXA 4N5HX 1HKHA 4P08A 3LCRA 5DNUA 1CR6A 4OD0A 3YASA 4O08A 1AZWA 1JI3A 5T4BA 1VJ5A 4HTAA 5K3BA 1H2WA 4QLOA 4PSUA 1HQDA 5HQ3B 4ROTA 4L0CA 2AJDA 4X92A 4B9EA 4LXIA 1GPLA 1F0PA 5HF5A 4QDOA 2OLEA 2WIGA 4ZV9A 4UUQA 4FLEA 1XZKA 3ESDA 3AZQA 1U8EA 2CEKA 3KDAA 3T52A 3KSRA 5FPQA 4FBMA 4OB8A 2AJBA 3WK4A 4S0XA 1W52X 4ETWA 3CCBA 2VT7A 4J0DA 2R11A 1CEXA 4Y9SA 4J03A 2XMRA 3PUHA 2AJ8A 3QPDA 2NW6A 4HZGA 3HSSA 1QIIA 3OC0A 3ZLVA 2ZYIA 5JYCA 3I2HA 2XDWA 4EUSA 4IH4A 1TCCA 5FLKA 1ACLA 4QDUA 1MT3A 3ANTA 1SOMA 3IURA 1EB8A 1L7QA 4KE6A 1ISPA 2Y2UA 3A2NA 2B4KA 2OQVA 2VTVA 1LZLA 2OG1A 5BWCA 1YS1X 4BDSA 5HK8A 5AKYA 3TEJA 4E14A 4EY4A 4UBMA 1OCEA 5D7BA 2PU5A 1EHYA 4WFIA 3F9CA 1GQSA 1DX4A 2XUDA 2AJLI 4I19A 4HRYA 2VA9A 2VF2A 3AILA 1GKKA 4KE8A 4G1FA 4NMWA 1XZDA 1XZLA 1AGYA 2CMFA 4XJVA 1C7JA 4GDMA 1EDDA 2DHCA 4CIBA 3VVMA 1R1DA 3O4IA 3OPMA 4PO3X 2PL5A 1PJAA 3FAKA 1DWQA 1YSCA 1AURA 3FNBA 4YPVA 4BAUA 2CUTA 4UFNA 3BE8A 3H2IA 4WFKA 3TJMA 1E8DA 2HFKA 4A5SA 1CVLA 2B9VA 1ZI9A 2HA6A 4QLAA 2QM0A 3H2KA 3WZMA 4ZXFA 1FFCA 1QFMA 2PSHA 4GXNA 5JZ9A 4A16A 1BS9A 1USWA 3FCYA 5SYNA 4BCDA 3X3HA 5JANA 1BCRA 4BRZA 4H7IA 2QJRA 4DNPA 3IA2A 2WSLA 4EA6A 1IVYA 4Q34A 1FFBA 3U0VA 5AOBA 3PFBA 5I9IA 3NOXA 4PNZA 1CUFA 1VKHA 3E4DA 5IH7A 1HDEA 2P8SA 1SCIA 1XZBA 3H2GA 1AQLA 1QIGA 4EB0A 1ZJ5A 1UZAA 1ZD3A 1QO9A 4N5IX 4FWBA 3WI7A 4P9NA 4DIUA 3AIKA 2GYUA 3WIBA 2QKYA 2OCGA 2WUGA 3WA7A 4EZIA 3FSGD 3A70A 1QE3A 4I4CA 5F4ZA 3IBTA 2WJ6A 5EIEA 4EY6A 2XMBA 1EDBA 2B20A 4HXFB 1TK3A 1RP1A 1R4ZA 1UK6A 5LZ5A 1YA4A 1VOTA 2BUAA 1YASA 5KREA 4B81A 2I78A 5DLPA 4C88A 4KAFA 4B0PA 4AZ3A 4UBLA 3FBWA 4U2EA 5HCUA 1EINA 1QTRA 4BCBA 5DNWA 1ZD4A 1EXWA 4Q3LA 3OG9A 4LXHA 4FLFA 1FFDA 4CG1A 5E4TA 5FOQA 1CUJA 2PUHA 3C5WP 2QMQA 4Y2SA 3WKAA 3O9VA 1R88A 5JD5A 2BJHA 2VAXA 2WHPB 4BC0A 2HDWA 2XUKA 5K3EA 2XUQA 4J0HA 2CJPA 2XUAA 4UBKA 4BAZA 3BF8A 4NS4A 5CT8A 4PSDA 4WY8A 4X94A 3WA6A 1CLEA 2VJCA 4EBBA 4PQEA 5AK4A 1DWPA 5HKBA 1TCAA 5AOCA 1MPXA 5KWJA 4Y2VA 3I28A 5AKLA 1H2ZA 2HRQA 1XRRA 3FLAA 2ORYA 2WUFA 2OAGA 2OGTA 2WUDA 1RYYA 1L7RA 3MUOA 5JZBA 2LIPA 5A6VA 3LLCA 4AO7A 3MUNA 2DCMA 1E3QA 1R9NA 1MX5A 1F8UA 3VJLA 4BVKA 4B82A 4X97A 3PF8A 1QIHA 2RIPA 2BGNA 3D3NA 5LYYA 2ZJ7A 3C6ZA 1LGYA 3EBLA 4MQLA 3G0CA 3DS8A 1E89A 5AI6A 2PSEA 4LIPD 4X95A 1WB5A 3HACA 5LZ8A 3AIOA 1DX6A 3KXPA 2OQIA 5LZ7A 3EQ7A 4DLNA 2FJPA 5LKRA 1UK9A 5FDFA 5ALJA 1O6FA 1CQWA 4W1QA 4MEAA 4F0JA 3E0XA 4MQMA 1MTZA 4WCVA 4EY5A 2GBGA 5EHXA 4K6HA 3O4JA 2DSNA 2OAEA 4FFVA 3H19A 1JKMA 1LZKA 2HHAA 4UFOA 3D2BA 1W76A 1DQYA 1CQZA 1JJIA 4DNFA 4TGLA 1XZEA 3CN9A 2WIKA 3R3XA 1Y37A 2V9ZA 4X3CA 2H9YA 4E15A 4HXEB 2C5FA 2O2HA 2QT9A 2WHPA 3BIXA 2GBIA 1LPOA 1CUZA 3UUEA 4B0OA 3I6YA 2G63A 5AKZA 2E3JA 1JMKC 1U2EA 4OYYA 1GT6A 3FSGA 3SX4A 4OYLA 4MYSA 3FYTA 5BWBA 1BN7A 2HL6A 5T4EA 4YX9A 3D2CA 3IUNA 3WJ1A 3LS2A 4EY8A 1O6GA 3OOSA 4IH1A 4ARBA 4UHBA 1QIEA 1DWOA 1ZI8A 4G8DA 5EI5A 4X91A 5ALSA 3TRDA 3VKFA 4UBNA 1P0MA 4QWMA 4IHAA 5DYTA 2X8BA 3HLKA 4W1SA 5ALUA 1QTIA 4MJ3A 1RWQA 5C7YA 2DHEA 2OGSA 4DNOA 1AKNA 2I3DA 3WKBA 3HJUA 2D0DA 1LPAB 1G5FA 2G4LA 1BCSA 5CT9A 5CT6A 3V1MA 3S2ZA 3DQZA 4KJXA 4CIAA 3LIPA 4FDMA 3E1GA 3A2MA 4J0KA 4BZZA 3I2GA 2XMDA 4C6HA 3IIIA 4OUKX 4BC1A 1QOZA 2X76A 3H18A 1WHSA 4ZRDA 4B9AA 3QH4A 1A7UA 4G9EA 2R8BA 5ALWA 4RGYA 4K6KA 3FVTA 1XZJA 2WM2A 5C8XA 5SYMA 1GKLA 1KEZA 4W1PA 2VATA 4HXGA 2ZJ6A 3I2FA 3BDIA 3WK7A 4RE6A 4JYMA 5LZ9A 3H2HA 5IVDA 3QM1A 4K2AA 3STWA 1BEEA 3ZPXA 4P93A 2OCIA 3STTA 3S8YA 2OPHA 5AKJA 2ZSHA 2K2QB 5AI9A 5AK5A 1LBTA 5AIAA 5DYWA 1VA4A 4AQDA 5AM3A 2XLCA 1YAJA 2H1IA 3IVMA 3D7RA 5CRIA 1THTA 3HRHA 4F21A 2WIJA 1XQYA 2JGKA 4N8SA 5ALFA 5A7HA 4RNCA 5LZ2A 4X93A 5I7UA 5LP1A 2IITA 4IH9A 3ED1A 3L1HA 1XRNA 3ZLTA 1EDEA 5K3AA 2G5TA 5JD6A 2OGZA 1R3DA 2VQ6A 4C01A 2HA4A 1WM1A 4WDRA 1LLFA 2G5PA 2XUIA 2ES4A 4QWWA 5E4YA 5ALQA 4J0GA 5AIBA 4L3WA 5AH0A 1GPKA 3QZUA 3K2IA 3O4HA 3QPCA 1CUBA 2H7YA 4BE4A 5EGNA 5ALPA 5AM5A 5KWIA 1CUHA 4LYEA 2HA5A 4LYDA 1NX9A 3T4UA 3HXKA 4C4YA 1J2EA 3R41A 5E4JA 4INZA 2PU7A 4UHCA 4BB0A 1XRMA 1GZ7A 2RI6A 1HBJA 3K9BA 5ALDA 1UOOA 2BUBA 2ZSIA 1G66A 5CT4A 3RM3A 3V1LA 2PUJA 1NU8A 1XLVA 3WIOA 1IUOA 1OILA 1XZIA 3V1NA 5K3FB 2QR5A 4JUIA 4UBJA 1FJ2A 3PFCA 5AM1A 4BE9A 4N8EA 1JMYA 3O95A 3SK0A 2JBWA 1NU6A 4PF1A 4Y7DA 4ZREA 1WPRA 4X6XA 4B6GA 1J1IA 4BDTA 2XUOA 1ZI6A 1GQRA 4K6GA 4U2DA 1C4XA 5AK6A 3B5EA 3WYNA 2PSDA 2WU3A 3UMJA 5AP9A 5AI0A 4DYHA 5AOAA 3G9ZA 5T4HA 4QDXA 2JEZA 1EX9A 3H2JA 1MN6A 2BUCA 1D07A 4CCYB 1XZFA 5AM4A 3IB3A 4L72A 1AUOA 3R3UA 2XUFA 3C6YA 1ZD2P 1Y7HA 2HM7A 3ZWQA 1Q83A 1YAHA 5JARA 2V97A 2UZ0A 4AN0A 5CH5A 1XLWA 4BCCA 3QITA 4GWLA 1XLUA 4KYVA 1WB4A 4GHWA 1XZHA 3D5EA 1UK8A 5ALXA 2H7XA 5A2GA 2D5LA 2PPLA 4C4ZA 1UK7A 5IVHA 4QDTA 3I6MA 5CBKA 3WZLA 4C4XA 2GYWA 5AKIA 2CBGA 1IZ7A 2XUPA 3TGLA 5HF6A 3I1IA 2OXEA 2VJAA 1ACJA 4B80A 3C6BA 2CKMA 1HPLA 2C0QA 2IX9A 3WKCA 3D0KA 1XZCA 3E3AA 1WB6A 3QVMA 3WL8A 2PVSA 4JEIA 1MAHA 5LLSA 4JNCA 1CIJA 5CXUA 1W1IA 5CTAA 5K3FA 4DSZA 3H04A 1SCQA 4FKBA 5EHNA 4FOLA 1QIMA 5DWDA 4J0JA 5AI8A 4UPDA 1DT5A 2QTBA 4CFSA 5HFNA 3G9XA 4QNNA 4FTWA 4BVLA 5AKKA 4Q1VA 1K4YA 2XQJA 3V48A 4AN1A 1IZ8A 4BP9A 4ZGBA 1LPBB 3WLAA 4LKOA 3HABA 2JIDA 3I2KA 5DNVA 1F6WA 3OTQA 2HA7A 4AMZA 4C87A 1ZIXA 2HU5A 4DMHA 2Z5GA 4OU5A 3RK4A 1UKAA 5C8ZA 1U65A 2QZPA 4DGQA 2J3QA 3WKDA 1GXSA 3DDUA 4ZI5A 2WJ4A 3ZI7A 4M0MA 4G8CA 3H17A 4U2CA 4CCYA 3WK6A 2WKWA 5AO9A 1JJFA 4W1RA 3K6KA 1HL7A 3HEAA 3IDAA 2BKLA 1L7AA 2C58A 5CURA 3M3DA 4AXBA 4F60A 4WFJA 1EK1A 4AO6A 4FBLA 3GBSA 3HZOA 3W05A 5DYYA 4QZVA 5K3CA 1WOMA 2XMSA 3N2ZB 1AX9A 2QJWA 3PI6A 3WWEA 2XMCA 3GUUA 3FYUB 2Z8ZA 1VZ3A 5HF8A 4MEBA 4OPMA 1BRTA 3G9TA 2RHTA 2ONCA 4KAAA 3VISA 1VA5A 3PDCA 3NWOA 1CRLA 1UXOA 1X2EA 2DFPA 2V98A 2HA0A 5IKXA 3FYUC 3IUJA 4UHDA 3DCNA 2VT6A 3DKRA 3WL7A 1CPYA 3DYIA 3M82A 1Q0RA 3AINA 4E11A 3G7NA 2JF0A 1JT2A 1Z68A 4Q05A 3SC2A 2QOEA 1A8SA 4H7KA 1W4LA 1CUAA 3RARA 1YCDA 1PV1A 4DMCA 3WL5A 4GI1A 2WFZA 2XMGA 2ZYRA 5AKGA 2RGUA 4G4IA 5EIAA 4IO0A 1TAHA 1UWCA 4J0CA 3QPAA 1CUEA 2WG0A 3CCCA 3A2LA 3RLIA 1P0QA 3F67A 3QMVA 5AICA 1MJ5A 4G9GA 4FHZA 1WHTA 2O2IA 3G0GA 3LIIA 3WKEA 3BXPA 4Y2JA 5JZSA 2WTNA 1FFEA 3CXUA 2JGFA 1MU0A 2XQIA 3W04A 3VDXA 4XVCA 2J4FA 1MX9A 1TKRA 4EY7A 3C8HA 5JATA 2QXTA 4J3JA 3GFFA 3A6ZA 3BL8A 1XKTA 5JAUA 4U2GA 3DLTA 5HF9A 5IVIA 3STVA 4CI9A 4RPCA 3GROA 3DEAA 5JAHA 3KWJA 1F0NA 5ALZA 2YXPX 1K8QA 4Y2PA 4KAJA 4M0FA 5BV7A 4X85A 5ALKA 2WFMA 2XLBA 3DL7A 4H7JA 3W06A 5DTIA 1DTEA 3DD5A 4N8DA 5JADA 1E66A 1XRQA 2J4CA 1U4NA 4BAGA 4YASA 5LIPA 4AZ0A 4B7ZA 2IIVA 3FYUA 4AB1A 4H7EA 3R3YA 3NGMA 4FFWA 2HFJA 4B84A 1T4MA 3WJ2A 4ZWNA 4ARAA 2WTMA 4H7HA 2QUAA 4Q3OA 4U2FA 5D3KA 5ALLA 1QLWA 3ZV7A 3H0CA 3PICA 3O0DA 3WK8A 3N0TA 2J3DA 2O2GA 2GZRA 3DL4A 3C5VA 3WWDA 1VXOA 3WWOA 1IUPA 1AC5A 5E2IA 3G8YA 4C89A 1BEZA 1H2XA 4OB6A 4IQ4A 5FUMA 2WG1A 4MWSA 5D6OA 4CCWA 6YASA 2V96A 4DM7A 2C4HA 1LNSA 2PBLA 3F97A 5EHZA 4FNGA 1B41A 3OM8A 2PX6A 1EK2A 1XZGA 1R50A 1XRPA 1K63A 2ZVDA 2QXUA 5CH8A 5A71A 2QUBA 4X71A 4DTCA 1UOPA 4UFPA 7YASA 3UUFA 3PUIA 4H77A 1A8UA 1EB9A 1OXMA 5EHQA 5ALRA 3WWPA 3QMMA 3I2IA 3G9UA 4UBOA 3FLEA 3AZPA 3C8DA 4WY5A 1WCYA 1ORVA 4UHEA 1CUWA 1GGVA 4QEKA 1ZJ4A 2CB9A 5I8PA 1VE6A 1ORWA 2W22A 5HKAA 3I1YA 3BIWA 3ESAA 3WYDA 2Y1KA 1XZMA 5ALGA 5KBYA 3NUZA 4G5XA 1AMNA 1ETHA 2WIDA 4KEAA 3L1IA 2C0PA 3WMRA 4I3FA 1ZICA 2C5GA 5CW2A 3D59A 1ZD5A 2WUEA 1DQZA 1QIFA 4BTVA 4CG2A 1QIJA 2I3ZA 1EH5A 5FPPA 4Q82A 3EIOA 2AJCA 1XRLA 2Z8XA 4QDZA 2DHDA 2XT0A 5C8VA 5AI5A 1TCBA 5AJHA 2XE4A 3FOBA 3C45A 3EQ9A 1QFSA 3DNMA 3IUQA 3VJMA 2HA3A 2WG2A 3AIMA 5AKEA 5AM0A 2C7BA 3PF9A 2DQZA 2Y6UA 3CN7A 4QA9A 3WK5A 3BJRA 1TIBA 2DR0A 4GLBA 3JWEA 3BF7A 2HADA 1XROA 5K5EA 2BCEA 4TPKA 1W75A 3V1KA 4BP8A 4NVRA 2GYVA 5ALVA 4BRSA 2Y2VA 3G0IA 1YB6A 2VJBA 3R3WA 5YASA 3F96A 3IUMA 1QONA 2PKYX 3R40A 5FXMA 4GBGA 1LPPA 4DMKA 5EIHA 1TQHA 4A23A 3SWWA 3GA7A 1MX1A 1JFRA 2GBCA 1N5MA 5AM2A 1UKCA 4J0IA 2BFNA 1YA8A 1CUCA 4X90A 5FKJA 3B3QA 4KRXA 1ZOIA 3R3VA 2CZQA 5ALHA 3DOHA 2ECFA 3ICVA 2HIHA 1P0IA 4JH0A 1JU4A 3AZOA 5LKAA 3W2TA 3IULA 1J07A 1B6GA 4GEGA 2XQKA 5HQ3A 3G0BA 4BYMA 1Q84A 4Y2QA 2XUJA 3B12A 4K5QA 4Y2RA 1G4HA 3DYVA 1N8SA 5JAOA 3GZJA 4AO8A 3ANSA 3C6XA 3AUKA 2JGIA 3OURA 4E46A 2WJ3A 2XUHA 4B83A 1E8MA 4BATA 1QIKA 1XQVA 4H18A 1SFRA 3O4GA 1X2BA 1EA5A 3M81A 2ROQA 2EDCA 2HA2A 1UOQA 4GW3A 4J7AA 2WHQA 4OU4A 2JGJA 1J06A 5DJ5A 4UHFA 2XMZA 3ZLUA 4Z49A 3I2JA 1A8QA 4KE9A 1IUNA 4BTLA 4CG3A 5LZ4A 1CUGA 4Q3KA 4OSEA 1I6WA 1IMJA 3ESCA 3H1AA 5HZGA 3HYSA 2QRUA 5FRDA 3R0VA 4AMYA 2YASA 4UHHA 3QMWA 3ILSA 2EEPA 3AJAA 1JJBA 3FWHA 2PSJA 1ODTC 3HC7A 4YK7A 1LPNA 2RAUA 5FV4A 5A62A 1LPSA 3STUA 5A7GA 2ACKA 3FCXA 4W9RA 2GBFA 2JGLA 4G4JA 4KR0A 2FX5A 1Q0ZA 5EFZA 4JYPA 4OB7A 1VLQA 2YH2A 4UBIA 5C81A 4TVKA
chains in the Genus database with same CATH superfamily
3FHOA 2NYVA 4R71A 3HM9A 2JHGA 2X5JO 1RKBA 2R65A 1P39A 3L18A 5EHIA 3RD5A 3Q7EA 2G1UA 2WIFA 4EFKA 1EUYA 1T36A 2ZSUA 2G76A 4OXXA 1GUDA 2ZETA 4Q6BA 2BGRA 3MHPA 1PFKA 4LJ4A 2G9NA 4EHLA 2PJRA 1FLAA 4G8BA 2C5AA 1E4VA 3BMCA 4XGRA 2OYCA 3GZ4A 5HFAA 1BDMA 4Q7EA 4QVKA 4TTQA 5JI3E 1DT3A 1EEXB 1SG6A 2VHXA 2WHRA 2EJBA 3N07A 3NHYA 2RONA 4I50F 3BC1A 1R4NB 4H0FA 4DRXA 3B2QA 3K1YA 4OHYA 3TNYA 2J3LA 1H5QA 4OCZA 4DC1A 3HCAA 3PEWA 3NGLA 2VRCD 1QPGA 3LP5A 3AUAA 3LDFA 5B1SA 4Q9JA 5BNWA 1G2QA 5DFAA 4XWKA 2QAGC 1DTWA 1QQTA 1NDUA 1X77A 1C2TA 1HG1A 3B6MA 3ROMA 1BOOA 3FDFA 4XX1A 3N39C 2ZB8A 1T5SA 3PQ4A 2D2EA 2E4AA 3WQHA 1HSOA 2Y1WA 1NVFA 3OX1A 1RABA 2HCFA 2ZBVA 1XPRA 2C5SA 4J16C 5L4LA 4BMCA 1PD0A 1QH8B 1H23A 4KTTE 4OQMA 3W90A 4X6UA 3M5CA 4IIYA 3EG5A 3SQOA 1KJZA 1ZVVA 4EFNA 3JZDA 5H16A 3GFOA 3KD3A 3HXMA 2BGKA 2CKDA 2WU4A 4XIJA 2KQUA 1P9NA 3QY9A 4ZTBA 4YRCA 3V42A 3ZQ6A 5KNBA 4GYKA 3TRFA 1MQ8B 4YUXA 4IVPA 1BE0A 4D8VA 4I1OA 4Z3KA 1YZGA 1M6VA 4BNWA 3D6JA 2UUBB 2FCRA 4HRXA 4PFQA 4KWIA 3Q41A 5H82A 4FT4A 4D9KA 4LZLA 4GXRA 3A37A 1U6KA 3ZX4A 4YRNA 4OI1A 4KPUB 3EGEA 3NRCA 1JIKA 3OJWA 3JYHA 2DWCA 2QRMA 1Y89A 5E38A 5G02A 4CF6A 3THXB 4F3YA 1QFZA 2VF4X 1NR7A 2C94A 4O2AB 4R16A 4FOTA 3PPYA 4EW2A 1V16B 2MWMA 3ESBA 3FMVA 4UE3S 1X13A 1B0AA 3LUPA 2IYWA 5H3HA 2QN9A 3L6CA 1ECPA 1NGSA 2O7VA 2YINC 3GLQA 4J0EA 4KVGA 4ZV7A 3W8RA 3ODPA 4QKQA 2Q9AA 3GNQA 4OX9B 2CBXA 5DTJA 1ESEA 4OBXA 5C7LO 3WLLA 5LQDA 3QBJA 3F73A 4MS4B 9LDBA 4KAXA 2HB6A 4HWRA 5K8IA 2O5RA 4OQYA 1PT8A 2OHOA 2Q3DA 2UZIR 1OFIA 2VHJA 3NLLA 3NANA 3OZGA 4IZOA 4ZQGA 5JAQA 3TUIC 3V7NA 3NFYA 2A7QA 1QGUB 3U3OA 4DM3A 1U2RA 4HH0A 3CNNA 2OYSA 5EE3A 4PNEA 2GSDA 4HH3C 3GEEA 3M4ZA 4A91A 4ND7A 2O8CA 2FPIA 1BW9A 4OFBA 4TUYB 3AGQA 3PQ2A 3ROEA 4YGYA 3RS0A 1JXOA 3NKFA 2AUMA 1YZYA 2QIOA 5DB4A 3IEKA 1DU4A 2EEZA 4OOEA 1NVEA 4ESOA 1ZGJA 4AJIA 1E1QA 1JQJC 2GHQA 3DOCA 1ODCA 3EY9A 3OZXA 1OXTA 3WGQA 1PJCA 1VHDA 1W5SA 4XGKA 3OFSA 1WB9A 1AHPA 2QI9C 3LWDA 4OH1A 4BGIA 2X9QA 4BWGA 2RB4A 1DKOA 3QX3A 3GJSA 4HC4A 4GNRA 4HBGA 3QA9A 4REOA 2C5BA 3K8OE 3EGOA 1VL5A 4RD1A 1H65A 2PWPA 4EI7A 3RU9A 2NNWB 4ER6A 1WW2A 2CWWA 3KPWA 5G0WA 3VYUB 3KYDB 2OM6A 1QHSA 3U2QA 1OBVA 2Q5QA 1SVLA 4QUJA 3HK2A 1YQQA 3LU1A 2O5VA 3L7NA 5ALMA 3M4JA 2F00A 3UG6A 1ZJYA 5BPHA 4V2IA 1Q17A 1F8XA 2GMWA 1PZHA 4LQLA 4LNUA 4XR9A 5ALIA 3WNZA 1EVEA 2CNOA 4YP9A 3EGIA 1E8NA 1OZGA 1YC5A 2ZYDA 3I1FA 2WQ6A 1GPNA 3G2MA 1T2NA 3PC6A 3HJAA 1PL8A 2PMFA 3CH7A 1DPFA 5KSPA 1IRIA 2QENA 3EXIA 5FI0B 5LCXA 1CB0A 2WQZA 2W2KA 3ZE2B 4Z2AA 5ADVA 3E8MA 4NZZA 1SAYA 3ZZMA 1JKFA 2GN4A 4D6XA 2DERA 3DO6A 3IVCA 4X6YA 3KFLA 1OREA 4XWGA 4ZKEA 4CGZA 4G0MA 4JBNA 2VXOA 3HCWA 2OZLB 5E8RA 3SR0A 3ZI4A 1V3QE 3FMPB 4FYIA 5A6SB 3BIOA 4EJ0A 1FUUA 3RYTC 5KVVA 2QU7A 4EMBA 3PT9A 4HS9A 2UYOA 3D3QA 5ILGA 2QM3A 2WSMA 3HJHA 3I64A 1CEQA 2P6RA 3JAWB 3Q1LA 1PW5A 4XEHA 5LOVA 1F6DA 3VJKA 5JIBA 3C70A 5L4NA 2CNLA 1L9XA 2LV8A 4KDFA 1NOJA 2HEIA 4IL5A 4WBXC 3NYQA 3GRCA 4D3SA 2C61A 2J9YB 4Y6PA 5FP0A 3IP1A 2YOHA 4CT0A 4UTVA 1A8HA 1XZAA 1E2JA 2ZWVA 4EJMA 4R1LA 2BFFB 3L07A 5REQB 2V7PA 3P9IA 1JTEA 2VP3A 4S1PA 3K0FB 1Z35A 1XXHB 3W9BA 4E4YA 3Q8WA 1IPHA 1L6IA 1PL6A 1PP4A 4PSCA 1XQXA 1V8FA 3W6PA 5T41A 3R3SA 1EWTA 3S4YA 4ZGWA 1MXFA 2G07A 2PM8A 3UK1A 5BN4B 3H7IA 4WIAA 3ORQA 2HMWA 2VEOA 1R9MA 2I62A 3F3MA 2FW8A 4UAJA 1P8JA 2OV3A 2RAFA 2RGYA 3LZ6A 4O4HA 3K0AB 5T8KA 2YJ4A 1V3TA 4RS4A 3IC5A 3UN1A 1QTNA 1VL1A 2IZ6A 1S4MA 5LB2A 2C9BA 4URWR 1G41A 3PHJA 3PUVA 2BPOA 2VNHA 2BE9A 2OCLA 1SD1A 1A72A 1BMFD 2FJ0A 4BNLA 2IDJA 4KPFC 2NVUB 1U3FA 2P3LA 2Z3ZA 3MOSA 3SHTA 4EK9A 1OHHD 1FSPA 2WWHA 4M6WB 3EPPA 5DDIP 1G7CA 1H6DA 1MO2A 3D6UA 3LQQA 4YAFA 1BA3A 1Q7RA 1AGNA 1QVRA 3S27A 3KFVA 1M76A 1YDGA 4X24A 1ONPA 3AHDA 1W4CA 1BD3A 3QU7A 3R3ZA 1P0PA 3BE5A 4H7DA 1TTPB 1TJYA 3NWPA 3ZV4A 3NX4A 1L0BA 3QKWA 4K8RB 4PIVA 4CM9D 3OY2A 2ZRBA 4TX1A 1A88A 4YUWA 5D8DA 3T15A 1A96A 1BWRA 2ZWOA 1DC5A 1X7YB 1E9SA 2PMDA 4U02A 3WV5A 4EA7A 1M75A 1VM6A 1BE1A 5ISMA 4TTAA 1RRVA 4G4GA 4TS4A 1TYDE 4HTFA 2ZT6A 4FFSA 1M1YB 2ZJAA 1CUUA 3R7WA 1Y63A 1YS2X 2AWNA 1LA2A 4H9GA 4OYRA 5AK3A 2QMOA 4RKYA 4UTRA 5BSEA 4WK4B 2A9KA 4OI4A 1XTSA 3GVIA 2B98A 1A9TA 3T6KA 1XZ8A 4MJXA 2HU7A 1ISSA 2PGJA 4MPPA 1Y4UA 3HWRA 1ZR2A 2KW5A 4P4NA 4OL9A 5JFGA 5TMEA 3AKCA 1ORHA 3V8BA 1QS0B 2BLNA 3KOXA 3PHLA 2C2XA 2GK7A 3BAZA 3KQSA 4H7PA 4PHFA 1YRQA 2FH5B 1KKLA 3DVQX 3SEAA 2H2DA 5E0KB 1O5TA 3VNBA 3WRXA 4EZEA 1E2EA 5CEFA 1VJTA 2XI4A 4GI5A 4GECA 2GN6A 1U8CB 2WIAA 4FFLA 3U4IA 3QLEA 4QXAA 5AHXA 1OLSB 5TPZD 5CH3A 4G4SO 2DBYA 4HH4A 2Y0CA 4A0HA 2IHTA 2ET6A 1B26A 1TPZA 2ZBFA 3R7SA 2W6CX 5IHXA 2O4CA 4NY1A 1Z25A 3ETGA 1KJ9A 2QS9A 1C3JA 4RFLA 4BNDB 3WDMA 4PN3A 3UEOA 5FTLA 2WJPA 4YRZA 5A4FS 3BHMA 2GVDC 4TT8A 1HMPA 2OESA 1PR0A 4D6PA 5B30A 2G9ZA 4XUDA 1NI3A 2DQKA 3H5RA 4MUGA 3HI4A 3LX8A 3IPXA 2BEJA 2VAPA 4I8IA 4TKZA 2ID7A 5CBPA 3FROA 3Q3CA 1G2PA 1KF0A 2WD7A 3HVUA 4YJHB 2R44A 5G1OA 2J30A 3L4BC 3L0SA 1GJRA 4RC9A 3VVLA 3BJMA 1UBKS 2NO4A 1FNMA 2W2VA 2JGMA 1EJ2A 2HRRA 2O8EB 2F90A 4RE5A 2W48A 4PO9A 5J2TA 2A84A 4RV5A 5HP4A 2UU9B 3WMWA 4RACA 4BJHB 1ZIYA 3PUXA 1MO3A 4IDPA 4KPGA 3ZU3A 2R87A 5IHPA 1PFWA 2XW6A 1UANA 4ZI7B 2C1ZA 3G02A 1W94A 5HWSA 2JK0A 4ZPXA 2P68A 3DLPX 3DZKA 4NWIA 1QAQA 2IFTA 2VRWA 2V5UA 3W9YA 4BLPA 2BAGA 2UYHA 2PD4A 2VIIA 1T0HB 2QTFA 5EE0A 4Y2UA 2AQIA 1IFXA 2DLDA 4YBZA 4DQUA 2A1UA 4RGBA 1XQWA 5CT5A 5IAEA 2X4DA 1ADFA 1RHMA 3RRFA 3C14C 2Q6LA 1KY5A 1HFJA 2KSQA 3GDGA 2WSBA 4Z9XA 4J1TC 3TQOA 1RWPA 4HVTA 4CKBA 2D4HA 2QVBA 4FFPA 1URPA 1TRHA 2B1RA 2SBTA 3LUJA 4I1UA 3ZCRA 1CUXA 1ZIOA 2FN4A 4NEQA 4EI2A 5K8CA 1G0NA 1I13A 3H1GA 5KTSA 1AQNA 4RZQA 3LCRA 1FF9A 2H1CA 2JAOA 1E3WA 2QG4A 3VTFA 4MMXB 3SXUA 4OD0A 4P4GA 1J8DA 3ITEA 4DLUA 5EWJA 2ATCA 5B37A 2NUTA 4I55A 3G1WA 1JI3A 3EXAA 1Z75A 1VJ5A 1PIWA 3HE3A 4HEA6 1HT0A 2FG6C 1UBLS 4RZUA 5J5CA 2R8RA 5K3BA 1X7GA 2PGAA 3ER9A 3PT5A 1G5RA 3RUEA 4BQRA 3ZQKA 2FV8A 4L0CA 1E3DA 1NV9A 2WY2D 3W8DA 3IBYA 5H4GA 4B34A 3UOAB 4DCMA 1ND5A 2X3FA 3KKKA 3HY4A 5B2EA 1KMHA 2A9QA 4BKPA 2IPXA 2A59A 3D54D 5I01A 1UBGA 1XAIA 2UVQA 3HJGA 4QDOA 4N6NA 4KV7A 5BT8A 1NE7A 2WIGA 2WZQA 4HX2A 4ZV9A 4D3ZA 2NV0A 1GCUA 2VSXA 4DR3B 5GJBA 5BV2P 1G8HA 3X43A 3EHEA 3UMBA 1U1GA 5SICE 1H2RS 4TTIA 5FO1A 4MMYB 1FDVA 2CHGA 2VT3A 5HZHA 2ZYUX 1AA9A 3KDAA 5FBQB 4EO4A 2AXQA 3U4QB 2AZXA 3WB9A 5K0CA 1O6BA 4DR2B 1VIMA 4OB8A 3QEJA 3DAOA 3NALA 4MVJG 4B5LA 3B1WA 1WTAA 1KPIA 4ZAWA 1GV1A 1SG0A 521PA 5AJUA 4D9FA 4KO2S 1SCJA 1DBSA 4ZTUB 1W52X 5CJ2A 4X63A 5IF9A 1J8QA 5G0VA 3G6KA 5CGZA 3IXQA 3AR4A 1MKYA 2KM1A 2IE0A 3DBOB 4ZXPA 4OHCA 1IJEA 2BWJA 4QRHA 1QYDA 2VO1A 4LK3A 1T4DA 4RDCA 4ZU1X 3ADCA 4OHPA 1XF9A 3DR3A 4HZGA 4CLHA 3UG7A 4F2GA 3LOQA 3HSSA 1X87A 3GP3A 1IH8A 1QIIA 2ZYIA 2FUEA 2VHVA 1WU7A 2RK6A 1ZK2A 2VC2B 4FFMA 5EIOA 2PLAA 5IANA 1DBVO 4I14A 3EVNA 2RDMA 1A50B 3A28A 4TTJA 3OPYB 1WUHS 3RUAA 4PZDA 5A3SA 2VDWB 1KH3A 4HVLA 1P73A 3K96A 1GSOA 4GBJA 3SZUA 3M0EA 1ACLA 3PL5A 3AMVA 1V71A 4M1QA 3SHOA 1NQXA 4QDUA 5J9FA 1WPGA 2HXGA 1SC3A 5CYGA 1WZNA 4AKSA 1EB8A 1A5ZA 5JSKA 3TCKA 2PZGA 1ISPA 2HJVA 1LUAA 4N5DA 4E1VA 2HPHA 1KQGA 2YYZA 3A2NA 3G0HA 3EF0A 1VYHA 1QGOA 2ZPAA 1MV5A 2BGMA 5BWCA 4NF2A 5HIKA 1Y5RA 4NMLA 2Q27A 2VCEA 3EFOB 5A9SA 3FWYA 4QVIA 5B5SA 1XAJA 3AFMA 2BFCA 3T7KA 4TTTS 1HQKA 5HK8A 3OEEA 5HRUA 3DTTA 4EY4A 4JQYA 5CVVA 4P84A 1NVDA 2GUWA 2PU5A 3TPFA 4BKOA 3L77A 1DZIA 3W2EA 4U0KA 3HNRA 5BNTA 3UPTA 1HEYA 5CDSA 1IBRA 3K70D 2XOKA 3B13B 3RAJA 1YRHA 4LA4A 2XRYA 4Y1GA 3TRJA 2P41A 4D0LB 4COOA 3OHPA 1ZUD1 1EVLA 5G0UA 2VF2A 1YO6A 2ZI3A 4Q93A 4TM8A 4A8HA 3AILA 4PLWA 2GAFA 5KOHB 3PUJA 5KYVA 1PU2A 3KAKA 1ODKA 1GAEO 4F3KA 4NMWA 1YS6A 2O5CA 3K16A 3C8ZA 3JVDA 3NHMA 3S2SA 3FUUA 1CVIA 5ILQA 2H4FA 4OA5A 2NN3C 1ZCZA 4IXWA 2OSVA 4AZ3B 3D3EA 4BLVA 4DIFA 4JUDX 1HYEA 3GJ6A 4GDMA 4DLKA 4OFXA 2JG3A 1R37A 3L0BA 1T0JB 1US8A 2A33A 1UBNA 3ON5A 5LQCA 4AY5A 3WV4A 4CIBA 5IJ0A 3LTEA 1EDZA 1KJNA 4ARUA 3V1UA 5JH7B 2Q3HA 1Q92A 1QSGA 4DSOA 4NOJA 1QCDA 4KN9S 5AXBA 2RHBA 4GICA 4XWOA 1AIPA 5H9WA 4G81A 1DWQA 2G1AA 2XE7A 3FNBA 3LKZA 1TEHA 4I5DA 2R1UA 4CCAA 4RGQA 1Z45A 1HORA 1II9A 3NVAA 2WZDA 4DCGA 3X1MA 1VPDA 5ENZA 1NDHA 2B6HA 2OORC 1ZQ1A 3B9QA 5A5FA 4AK9A 2DP4E 4GPZA 4QGFA 3U39A 4B09A 1H42A 1S2MA 2HLDD 3UNXA 4DUGD 4XDHA 1KSGA 1XTZA 3LC0A 4CM3A 1E6EA 3E23A 3AF1A 3IMKA 4M88A 3RIXA 5KCZA 3GRVA 3DTVD 2V7BA 1E8DA 3TINA 1RTKA 4A5SA 5FBVB 4XRRA 5T6BA 1NVMB 2B9VA 2WE8A 2HA6A 1WX1A 4FJ2A 4RZXA 3ZIUA 3IHLA 1GRQA 4FDVA 2C4MA 1RPTA 3ADPA 4U7PB 3UGKA 3UJ7A 1H5UA 3N8NA 2FWMX 1PGOA 1ZNQO 1WSWA 3JQ8B 4Y9RA 1AKMA 3WZMA 3RUPA 2M6SA 4RAOA 5K3OA 4BXOA 2CD9A 2IEDA 2QTMA 4W5JA 2Y1XA 1M74A 4OUDB 1ZN2A 5EP4A 3RVLA 4QGHA 2XCRB 2VZ9A 3OM0A 1Z83A 1J8YF 3U62A 4RK5A 1BC5A 3EXHA 2H31A 3NWBA 4P0TA 4RADA 5ERYA 2OECA 2WSYB 1V25A 3MWDB 4BKMA 4DIMA 3LT0A 3ZZUA 4BCDA 4DANA 2LKCA 1A5TA 4CT4B 1KAGA 5K0ZA 1UM9A 3T5BA 1BCRA 3NB0A 5DRTA 2HJ9A 4BRZA 1OASA 3LI2A 3WHKA 4O4IA 2QJRA 4GKVA 1TTHA 4U3JB 5TVKA 3VU3A 5HCNA 1OT5A 4BFVA 3IA2A 1YHNA 1FU7A 2IP1A 2P9GA 4HQ6A 3K70C 4CQNA 4E2YA 4JAVC 5KDLA 3WTBA 3JD2A 4O02B 4OKNA 1KPGA 2AXNA 2UUOA 2SKEA 3NTLA 2H2WA 5MGNA 4KLRA 4NK5A 1P17A 3I4CA 4C3OB 1L1EA 2D3TA 1VKHA 3BTOA 4MITA 3ZV3A 3EPHA 3EGWA 3CE9A 2ADOA 2MSDB 3GB9A 3SJBA 3KP1A 1ILEA 4BO9A 3UV6A 5CFZA 2AMJA 4S1TA 2NXJA 1RWBA 2W93A 3KJZA 2Z4SA 3ZVKA 1AQLA 2IW1A 2PUWA 4ALKA 2JCSA 4MVYA 2W6JA 2YWEA 5LSAA 1ZJ5A 4PHCA 3KB8A 3LPNA 3FGNA 3BMNB 4NZNA 5KYTA 1QHXA 1UDAA 3NRJA 2PXHA 3QLTA 2EGUA 4DIUA 3AIKA 4F45A 4OLFA 1DRUA 4FGWA 3PUYA 2XCSB 2GYUA 4JBHA 4KQKA 2IODA 2F64A 2VPPA 2QKYA 4YCMA 2OCGA 3I42A 1AHNA 2HV9A 3DR5A 4B33A 3MN1A 2WUGA 4B74A 4A82A 4BCCA 4M21A 4EZIA 1Y4DE 1PT6A 1OU4A 1JQEA 4GLJA 4I4CA 4DCUA 5H70A 3AEYA 1B6TA 3G49A 2WJ6A 4I9HA 4UAGA 4KDCA 4HXFB 1RAAA 2CXRA 4FB5A 1R4ZA 3OQIA 1ZITA 4R2WA 3INYA 1E18A 3KEFA 1UK6A 2I3BA 1XFAA 3DE7X 3KZCA 4RPLA 4ZMSA 3NVKI 2YY5A 1AVTA 5HILA 3QA3E 1YASA 4OKIA 1K97A 1SXIA 1KAEA 5BR4A 4OXQA 3VU9B 5ECYA 4B81A 1HDRA 1ULZA 4RKWA 5DLPA 4ZKDA 4U6NA 4C88A 3J81A 3UO8B 4BE7B 4RENA 4BNZA 2C59A 3GD5A 4CTJA 1FTNA 3N2LA 2FEMA 4HGNA 4JLJA 4MROA 3QRWA 2BM9A 3B85A 2HO5A 1C0LA 1GLGA 1KEPA 3KLPX 4GXQA 4BLQA 3TECE 4ZT7A 3GWGA 4ID3A 2A9RA 4CMEA 4IJ6A 2Q0HA 5K0EA 3MHTA 2F4VB 3ONVA 5BRAA 1IHDA 2OBLA 4IUCS 3LHDA 1XCBA 1X6VA 5AW1A 1ESCA 3UJ8A 4G1EB 4BZPA 3VZCA 3OLQA 3BGWA 3GRKA 1OV4A 1T5OA 4JP1A 1UPCA 1X15A 4F4CA 3ENKA 1TKCA 2C4WA 3TGPA 3TQRA 1KIMA 1Z22A 2XODA 3LT4A 4LOKA 4YCDA 3SJUA 4UDNA 5BYAA 2H1OA 3LYAA 4FFNA 1ESNA 3EOBI 1K8XB 1FFDA 2GH1A 2D5AA 2YWXA 3BA1A 3M49A 1LLDA 3TLGA 5CHEA 1TADA 1ZWLA 1Z13A 3GLUA 4WZAB 1CIPA 2DQ4A 4CKEA 1M6WA 4BLOA 2P4HX 2P0EA 3UWPA 3O9VA 3SLGA 4RTSA 1C1DA 4BVGA 1L4BA 1TRKA 5JAIA 3LDHA 4P53A 1QP7A 3TGWA 4KO8A 2AHOA 4EX6A 1ZXXA 1IXZA 2OXFA 2QZSA 2FRXA 4HQFA 4P7JA 4HWTA 4JI1B 4LY0A 4BC0A 4FYPA 2CLDX 1GQ2A 2BD0A 2ZJ0A 3MCVA 4OQ4A 1SVKA 1RYZA 4NOLA 1AQUA 1CQIB 1UIRA 10MHA 3SXJA 3A9TA 1VCNA 4ISBA 1U2TA 4M1ZA 1LJLA 2OZKA 4C0XA 2JHFA 3BRWD 2UYYA 2XUQA 1GQQA 4NESA 5KJ6A 1E1KA 2XUAA 2DFVA 4BNGA 2IWHA 3IEMA 1OA1A 3B36A 4NEGA 3LUFA 5DI3A 3Q8MA 2W7TA 5U9CA 4CW7A 5DNCA 5CIWA 4EO9A 3THOA 1P45A 2Y0PA 4PSDA 1X14A 1HDIA 1DXYA 3AIIA 4OK5A 4QQRA 5K09A 3DFUA 2QMYA 3ZV6A 3BFPA 3RGGA 5I8WA 4AJKA 4YR7A 3C6MA 1MDBA 2UUAB 1K5GA 1NXQA 3WGHA 1AKWA 1DWPA 4Z51A 2CV2A 1TCAA 2GERA 1ZW6A 2CMGA 4AMUA 5AOCA 4I6GA 1H0SA 1U3DA 1VLHA 5FBWB 1Z4NA 4CUJA 3BFKA 1GAWA 5LXTA 4ND8A 2GK3A 4CDGA 1WJGA 1D09A 3LK6A 3OSZA 3I28A 5A1JA 3RHFA 3LLMA 1B0UA 2Z6QA 1H2ZA 2HRQA 4L4ZA 3IQXA 3X1ZA 2B2CA 1I4TD 4IKOA 1VHTA 2XGOA 2ORYA 4TRMA 1KRHA 5KX5A 1QG4A 5CVUA 1SUPA 1NJ5A 1XP8A 2OGTA 1GGKA 4UM9D 4YJDA 5EJGA 1YDHA 1GEGA 1Z5NA 3DNPA 5A6VA 5JZBA 4FYVA 1KJ8A 1U0LA 5AUNB 3CINA 3CS3A 3DEJA 2X7XA 3L7OA 2DCMA 4JA2A 4UU0A 5K8VA 3V2IA 4PLYA 3BSWA 5DYNA 4KYUA 4BVKA 5HUJA 4B82A 5LZ9A 3PF8A 4A26A 4JGGA 4Q3EA 1G2OA 1ZH4A 1I6LA 4RH0A 4DIKA 1R8XA 1DLIA 1IYZA 3I23A 3MAAC 1JWLA 2PL9A 3COVA 3DS8A 1A77A 1D6JA 1EFKA 2W37A 1HNWB 5HCIA 2JJ8A 1E89A 1MRZA 3F46A 2PSEA 1ML4A 2WC1A 1VC2A 3VR2A 2EXXA 4LIPD 2B1GA 4K9RA 4X95A 3VO2A 1V8ZA 3ULKA 2MSNA 1MB3A 2R3SA 4OI2A 3R4CA 5IU6A 1V48A 4IJWA 4XUCA 1GZ5A 4CTMA 2OQIA 4U1RA 1GITA 1H93A 4HNSA 5F5LA 3SHQA 1JWAB 2YWGA 3BGIA 3EW7A 3V3TA 4A0RA 2AFRA 3GC6A 1JJVA 5CCEA 1NBWB 4FVTA 1JAZA 2JLRA 1D2EA 1LI7A 3A9RA 2D13A 3EQ7A 1NW6A 2RBEA 5K01A 1CR0A 3SSAA 1UMCA 2BGIA 2E5WA 2HHJA 4N0DA 5ESWA 4LZZA 5TMPA 1N2XA 1F5NA 4XWAA 1WHSB 4RJJA 4AMVA 5A5EA 5HBRA 1N36B 4A36A 3UJNA 3ZGZA 2Y1DA 4MEAA 4F0JA 3DBLA 2I4IA 2BGUA 3AJ9A 4UCQA 3UFXA 1DKPA 1OX4B 2JRLA 4MWGA 2AVDA 1XLTC 1SVSA 2GBGA 5A03A 3K5HA 1I7SB 1NP3A 3KTDA 3O4FA 2YWDA 3D4IA 4R7GA 2YXLA 3G82C 5GMOA 5HEKA 3O4JA 5P8WA 4XOIA 5E7QA 3BXEA 1M0TA 4CKCB 1B43A 3MTQA 1JKMA 5JTTA 1GNRA 3HVHA 4L9WA 3NHFA 2ZTMA 1MW9X 2X5NA 4UFOA 2X8JB 1YFLA 4BEBA 1TYAE 1PK9A 2R00A 4CMBA 2OD2A 3CG4A 1CTQA 3CX4A 1CQZA 3H2BA 1SCUA 4MOWA 4AWXA 1JXMA 1Y3DE 2J3MA 4DNFA 1U31A 2NSHA 4ACBA 3W1WA 4ZARA 1SY7A 1MUUA 1QRRA 3L41A 3IILA 3LPCA 4GMFA 5TMBA 2WIKA 4C7OB 1YQXA 3R3XA 1G8GA 1CQXA 4ZQHA 1RWKA 4QPDA 4WW0A 1FZTA 1F38A 3AR9A 2B36A 2H9YA 2IDZA 3ZE8A 2Q46A 4H17A 1CVRA 1E2IA 2EL7A 2VT2A 4EG4A 1TYBE 3COYA 1GPBA 4E15A 4R54A 1NMZA 4JJZA 1YCGA 3NW9A 3ZU4A 2WDPA 5J2UA 2WHPA 1IK6A 3BIXA 1B3BA 1KYQA 1T9CA 5EPOA 1T9GR 3PIDA 4BKRA 1KVSA 1CUZA 1V8DA 3NEAA 1SOVA 4I1VA 4W9NA 4DMMA 3GCWA 2QW1A 2D5CA 1SO8A 1YHYA 3DBRB 4PLZA 4CLRB 5AKZA 4RTQA 1AF7A 5G53C 3N8HA 1JMKC 1GT6A 3W5DA 4MIEA 5INTA 1ZWKA 5IZCA 4OYLA 5DK4A 1RCFA 4DHWA 3CGGA 4UHKA 3FYTA 3U4MA 2QQGA 5BWBA 1L4KA 3WLRA 1ZOSA 5T4EA 3UAXA 3GVHA 3IUNA 4IVQA 4NSNA 3WJ1A 2WTBA 1RLJA 2ZKLA 2VR1A 4ZVLA 2JGRA 5GY7A 5B55A 4DA6A 5ERXA 4LV5B 4JXJA 1JRLA 4FXOA 4KR9A 5HPYB 1N9ZA 3HEBA 1MVOA 1O6GA 2C2OA 2VYFA 1HK7A 4IM7A 3AF2A 1CSEE 2IQIA 1P4GA 2ERCA 4KR2A 4ANFA 4UHBA 1L5ZA 1SA0A 3R0IA 5IDYA 1N2BA 5EKSA 3B2NA 4ZIRA 1ZI8A 5AW3A 3A4YA 1TC1A 3LCCA 1DG3A 2J9ZB 1J6UA 3NDIA 5EI5A 3UHPA 4X91A 3JQEA 4FFBA 1BNCA 3HS3A 4JEUA 3MAJA 3P9NA 4RVNA 3QUBA 3UB4A 3MINB 4KIUA 3OIWA 4E07A 4V1CB 1CXZA 2XXAA 2JCXA 3G9QA 2Z0MA 2RFLA 1SK8A 1T8PA 4I66A 4NMMA 3K9GA 4OGLA 4ZN6A 4C0KA 4MJ3A 2ZZNA 5LNK1 4TM7A 4FPXA 1J24A 1RQ7A 2E89A 4WXHA 1SXPA 3GZTB 1Y9ZA 1TF2A 2VH2A 3P97A 5C7YA 5CA1F 1RJ9B 1Z0KA 1AKNA 5HKKD 2I3DA 3B1JA 3H6KA 2OV6A 3EVTA 3ZBQA 2Y99A 1BE8A 3KC2A 1HE8B 4M0LA 2D0DA 5JEEA 2E1PA 2HLHA 5CNMA 3BDAA 4NBSA 2KBEA 3O8OA 1D0SA 1FTGA 1X7ZA 5TX7A 4KDEA 3Q98A 5DOZA 3AEQB 1G5FA 1R5NA 4G6ZA 3HCBA 4IOLA 4UNQA 5EL0A 2YVAA 5CT9A 4WCFC 3E9DA 5CT6A 3ERCA 4JI8B 1Y33E 3S2ZA 1GAXA 1SB9A 4TQ9A 1NOIA 5DT2A 4CIAA 1Q20A 2ZROA 1YOVB 1Z7EA 2POCA 4FDMA 1FLVA 2WJVA 4KFSA 1ZUIA 2FSVA 4KWEA 4QU0A 3RBZA 4NOKA 1NR5A 1FPQA 1XMPA 4LCJA 4OH7A 1W5FA 2C1EA 5C4GB 5C8YA 3WB1A 4BZZA 3I2GA 2XMDA 3N2KB 4C6HA 1H4QA 1AKTA 3GCDA 2D06A 3OU6A 2B4TO 4FSXA 4BC1A 2J5XA 5CLGA 4N41A 1MOSA 2X76A 5LUAA 2Y4NA 2YS7A 4PTYA 1X1DA 1KK2A 3WGLA 5J5VA 2EFJA 2ZRFA 3WWZA 3ZE9A 4ZVOA 4ZRDA 1NUPA 1TO6A 3QH4A 5F73A 4CR7A 1LVUA 3AERB 3NIBA 4G9EA 2R8BA 1I80A 1XZPA 1N5DA 1WMEA 2ONKA 4EPWA 1PK8A 5E9QA 2IY9A 3E3MA 4L6CA 2VCYA 3DE3X 3FVTA 3IAM6 3OPNA 2ZSBA 1XYGA 5JOQA 5BYKA 3TZLA 4ZDJA 1VJ1A 5C8XA 3R4VA 3A9UA 2RGWA 2BY4A 3T06B 3QFHA 2EFYA 1JG7A 1JXAA 4IJKA 4RPHA 3QUQA 3NHSA 3F0TA 4PICA 3HLTA 4HLDA 3AUJB 4XX0B 2IY7A 2GDZA 5AWFC 3L8DA 3R5JA 1XWFA 3R76A 4LC1A 4QXPA 4ZALA 2ZJ6A 3I2FA 3SDBA 2HMUA 4QG3A 3H0KA 1HDGO 3BDIA 4YJ2B 3WK7A 3F4LA 1HQCA 5JCJD 1J90A 3VSBA 2D7JA 3WGMA 2FP3A 4ZGGA 4HNAA 1UDCA 1N78A 1GYQA 1PR3A 1XU9A 1U2ZA 3X44A 1L6RA 4BGUA 1OWLA 3FZEA 1UAYA 1D6NA 5AXAA 4DQLA 3CJRA 4GVPA 4HDMA 4L50A 4Z9FA 2Q6VA 4NDNE 3BKXA 1EHIA 3WGJA 1IBCA 3T9BA 1N2CB 1VJGA 1XDZA 2KHZA 2FEPA 4WA7A 5E3JA 3IJEB 4P93A 4HDKB 3W2HA 1EDOA 1HE5A 2PIAA 1U3UA 4LYGA 2YWFA 1OZ0A 4HDOB 2BBOA 2OLJA 1JYFA 3DUFA 3HBNA 3S2UA 3F1KA 4G0UA 1KYWA 3KQVA 1BO6A 1U2QA 3EARA 4MVJD 4DRZA 5AK5A 3CZ9A 1LBTA 1OPRA 2FSGA 1BDJA 2PKQP 5AIAA 2HTEA 3P0EA 4Y8VA 2E6UX 3O7WA 4LG1A 5I8ZA 2IUYA 3OAAD 1YMQA 4Y1RA 1A1SA 1HLFA 1WVGA 4R8RA 4QD3A 4LHYA 4ZDWA 4AQDA 1YQEA 1PVDA 4YHHB 1X7XA 2IXFA 2Z4RA 3KWMA 5DN6D 1DV1A 2QU8A 1KQNA 2HZ7A 2JH3A 4UCFA 3OZUA 4XYLA 5CEEA 3QE4A 2P9CA 4PR3A 5CRIA 3HRHA 1CD5A 1I14A 1PVOA 2Q2VA 3G2OA 4MCIA 3FUWA 4N8SA 3UB3A 4HLUA 4KXWA 1POXA 3A04A 3Q3GE 5A7HA 4NYJQ 2O3JA 4FC6A 5FHQA 2JFPA 4XYGA 3BKWA 3L93A 4YCBA 2RGNA 4A8JC 1ZJJA 4WJKB 2EKQA 3M3PA 5A5DA 1FMCA 4IH9A 2PFSA 1E2MA 5SZHB 4RTLA 1MC4A 4ZOEA 3W6UA 4ND5A 4RTJA 2P7HA 3DMHA 1DIAA 4YJGA 2OGZA 4KDRA 3VHLB 3KALA 1JS1X 4Q9NA 3KQWA 3FKJA 4KLNA 5DGHA 2ZCJA 4N12A 5D87A 2JB9A 3Q85A 3OPXA 1O08A 3FTCA 3L6RA 2OCXA 3NATA 5EUBA 1V5WA 1CZKA 2I8LA 1LLFA 3AR8A 2GPTA 1RI1A 3PL1A 3TR6A 3CBGA 1KO5A 4DLAA 2ANCA 4HDCA 4WL0A 5JUWA 2GCOB 4QWWA 1GCIA 3SYLA 1Q6ZA 1S2IA 2NV2B 3SJ7A 4ALLA 2O2JA 1Z62A 4HHEA 2IHBA 4TWBA 3EZXA 3T3HA 5TT1A 3A4MA 5KS2A 5C5EA 5AIBA 2V6IA 2CJWB 4GUAA 2Y66A 1Z7WA 3ISVA 1J2TA 3UMFA 1LRJA 1V1JA 4L3WA 2B8WA 2KPOA 5AH0A 2ID4A 2BZ1A 5FV7A 1JH9A 1ORDA 4GOMD 2PY6A 2Q7DA 4WKPA 5JNUA 4NK4A 1KGSA 1XVIA 2HCJB 4YS6A 3QPCA 1CUBA 1DVRA 2H7YA 4W99A 1JFVA 3ROFA 5JDCC 1NAIA 4CBVA 4L27A 2PXXA 1X0XA 5HIJA 3O4RA 3C3EA 5C35A 5AM5A 3W5VA 3ZXYA 5JQGA 5KWIA 2A35A 4TSKA 4A3SA 2Q6OA 9LDTA 1JNYA 2QUJA 4WUVA 2XYVA 4PSKA 2OG2A 3KT3A 5HIAA 1RC0A 1TT7A 1NX9A 2JBAA 4HDAA 5HJEA 1A5AB 3T7RA 1PTKA 2D1SA 1HDZA 3GGJA 4ZI3A 4IEFB 2GWRA 4BB0A 3L8GA 2HK7A 2ZS7A 3V8RA 4QHTA 2QQ0A 4DXAA 1E2NA 3A4VA 2QNBA 3CLUD 5KJEA 3SGLA 2ZP1A 1QF9A 3K9CA 4FIDA 4RSMA 4TL9A 3SYNA 4DV6B 2IZ7A 1TQ6A 4CUKA 1T3ZA 3SKYA 1EK0A 2EVWX 3BXZA 1WUIS 4BQSA 4E13A 3G5MA 3B9RA 4XM0A 2C9OA 2BUBA 2ZSIA 4HEJA 4R4JA 3T5CA 5KYXB 1V5FA 4QO8A 3BWDD 1L7MA 3RM3A 3V1LA 3QFRA 3VGPA 4DFDA 3RUDA 4AY6A 3R9IA 2FZLA 3WYGA 2A0YA 1Y1RA 2I65A 2JJ2A 2GNAA 3IQDB 3RAPR 4U6QA 4BMZA 3IQWA 1N3YA 1A9OA 1FX1A 2DULA 2VUIB 3IDSA 1XLVA 3EEYA 4PZ9A 4V0OA 5AHWA 3DP7A 1YZHA 4C30A 3TSZA 3VDMA 2FGKA 4PBRA 5CX1B 1B0PA 2WJGA 3AOEA 3V1NA 1X74A 2QW8A 1XHLA 4FR5A 2QR5A 3Q9LA 4W8OA 1HLDA 3KQLA 1SWVA 1Q1EA 1D7AA 1Y6QA 3QLVA 4MS3B 4TKUB 4ZO7A 1X8XA 5KAMA 4JIGA 3S1AA 2C7OA 3CRMA 3UJ3X 2W42A 1FL9A 2YV1A 4QT0A 5CTJA 1X42A 2XAUA 4LISA 2PNFA 4IF4A 3RPEA 2Z04A 3O8RA 1T9BA 3O95A 1I4OA 5ENVA 3QBEA 1ZGAA 4O8ZA 3U7JA 3CW8X 4QTZA 2PSSA 1C9DB 1NU6A 4L0MA 3DAFA 2IH5A 3KKOA 1ZLYA 1E7MA 2B35A 3EPLA 4Q7QA 3G23A 2OV4A 4WV3A 1LDEA 4J3FA 5EA2A 3SEFA 4KO3S 2XUOA 1Z7GA 4X20A 2R6R1 1GQRA 4K6GA 4H4CA 5TB5A 2BI8A 1DIRA 1NI4A 2VA8A 2UZ1B 3KZKA 4AJNA 4DWJA 4TZ0A 3MWYW 2W43A 1DJQA 1T8SA 1QDUA 1XTJA 2WNHA 1D2CA 3UXYA 1FTQA 2H18A 4XRGA 1YF3A 2C2YA 5AOAA 5EERA 1ZAYA 2P75A 3G9ZA 1Y1LA 3BILA 3FAZA 1N5IA 2BFDB 3QE2A 1TJPB 5HGXA 3X1YA 3P2JA 4FHEA 3KJXA 3QFTA 3G8AA 2HLNA 4GKJB 1J70A 1LS1A 2ILVA 2OC9A 4YRLA 3K5WA 4D45A 4CFYA 2JEZA 4MRNA 3TQHA 3BEDA 4KN6A 5IULC 1F12A 1GRRA 3FNHA 4UM8B 3UUGA 3MOIA 5LBIA 2C97A 3GUYA 4GGOA 3EULA 2GLUA 1E7SA 1N3BA 3Q4GA 4HDSB 1A71A 2NSJA 1FRNA 1OWMA 1ZOOA 1X1RA 2BUCA 1MN6A 2VCHA 2J32A 1ONOA 1V4VA 2Q1UA 2N0SA 3KV3O 1QC5B 4G41A 5DE3A 1QU3A 1AZSC 2CJYA 2QZZA 2Q2OA 4L72A 3X1DA 4AF8A 2I9PA 3RIEA 3B5IA 3R3UA 3L0CA 1LCIA 3DDHA 2XUFA 1G20A 3C6YA 4EUNA 3CLUC 3KUXA 1DCTA 3AY3A 1Q44A 5EXEA 1UBEA 4C4RA 4EB6A 3FVVA 3PR1A 1WQ3A 3WNQA 1S3IA 4ROSA 2H2HA 3LP6A 4Q4JA 3DKVA 1DC8A 3Q0IA 3AOGA 3AHCA 2HJRA 1GGJA 2I4LA 2V97A 3O7MA 1Y1PA 2UZ0A 2RH4A 3AKEA 3PZRA 4J7CA 3R8CA 5KTOA 4KIWA 3QKRB 1KE1A 4BNMA 1YB5A 2XAAA 2VPWA 3DE0X 1ECLA 1U0SY 3E9NA 3QITA 1UBMS 4KYVA 2X2EA 3D5EA 4FB4A 4YONB 3LT1A 5ALXA 3HJRA 3M4YA 3LOPA 1Z2OX 5DLQC 4X44A 4QYIB 3DFKA 4PLVA 1L5KA 5A2GA 2XADA 4G2NA 1M34A 5BOSA 2CL0X 5G40A 3DV0B 4X54A 4NQZA 5HTKA 4MQBA 5I9TA 2XYQA 4C4ZA 1QYCA 4URUR 5F21A 1KEEA 4AD8A 4F8YA 3IBSA 3FDXA 4MVJH 1FVXA 2RC5A 2E7ZA 3KM0A 3QNWA 2D1FA 4QREA 4RD6A 4CIYA 3HDTA 2DHRA 4OO3A 2IIQA 4DW8A 4GYJA 1QR2A 1F3LA 4ZVQA 3T4EA 1SHUX 4G63A 4GPIB 1UQUA 4CNQA 1Y8RA 1N9GA 2CBGA 4FD2A 1EUDB 4J1NA 3KXIA 3IT2A 3MF4A 3VYSB 1S01A 4KXNA 2GAIA 4BB6A 1I4LD 4NH0A 5KCMA 3ZGYA 3S8MA 1LS6A 2XIJA 1JQ5A 4R7TA 3LVFO 3GCGA 2DT5A 2XKAA 4Y7CA 1OXBB 2O2SA 3L4EA 1WLYA 5DGIA 4CWAA 4Z7JA 3NM5A 3U61B 5AQEA 3FNFA 1KEKA 1K4MA 3VZPA 2YVQA 4NI5A 2VJAA 2X1MA 2CUNA 1WQ1R 4B80A 1HOTA 2CNNA 2ILTA 2NZ2A 4CMAA 2P5TB 1N92A 5JVDB 2C0CA 3C6BA 3U6BA 1NZDA 2Z2IA 5CLFA 4HADA 4XD7D 4FR0A 1ZUNB 4H27A 4TMTA 1BMTA 5BMVB 1N6RA 2Y1LA 1WB6A 3SSMA 3WL8A 4WEQA 2PVSA 4MGHA 4R0VA 4G01B 1P9WA 5E7MA 5LLSA 1CIJA 1W1IA 5CTAA 5K3FA 5TQ0B 1Z18A 2X58A 1OFVA 5KNCA 4AU1A 4RPGA 1MJGA 4I4TB 1CY6A 3NIGB 3B1ZA 3IQZA 2VP5A 2QL7A 1SCQA 2FUCA 1WVIA 4UNNA 2P4SA 3OFNA 4FKBA 4QUHA 2WR8A 4HUQA 1BYUA 1TYEB 2W5UA 3AWDA 3II6X 4NZYA 4ZQFA 1ULSA 3JZAA 4UVIA 4J0JA 1VI6A 4MULA 3TI7A 3UJ6A 3ZGLA 5IYZB 5CFOA 4CFSA 2QTBA 3GMDA 5D3QA 3QVLA 5HFNA 1OGIA 1VKJA 2C3UA 3G9XA 3K1TA 3DVSX 1MFPA 4JB8A 1GPWB 2Q1TA 4PYNA 5AKKA 1ZN7A 4B6PA 4DADA 3IPCA 3V7WA 1K4YA 3T9FA 1G8AA 1PGNA 4YUVA 4E5PA 5L95A 4AN1A 3TLKA 3H9EO 1WHTB 1PX2A 4MRRA 1IZ8A 5KNDD 4ZGBA 3G8BA 2I6UA 4BBAA 1P61B 1RXVA 4LKOA 4LVNA 5KC9A 1GILA 3GLIA 3QWAA 2PS9A 1T8TA 3MJTA 3QX9A 4UMVA 4CU2A 1IZ0A 5DF1A 3GRAA 5AK0A 3TSWA 5BQFA 4FEEA 1ZVKA 4XD2A 4HAXA 4WKBA 1P1BA 3UKJA 1E9DA 3OTQA 1H6AA 2ZVJA 3VU8A 3RS8A 1G55A 2IYAA 1ZIXA 4GI2A 4JL5A 4KFRA 2J46A 4LDAA 4DMHA 1R6UA 2Z5GA 4YNBA 1DDGA 2VOJA 4XPIB 1UKAA 3A6PC 1CS0A 3Q11A 1PLKA 4UM7A 4IIXA 5K99A 1U3TA 1U65A 2QZPA 3NORA 2PLFA 4I50B 4ZAVA 3N0XA 1BMQA 2BR3A 2XHEA 5K4HA 2IU4A 2BR5A 2B25A 4ZCRA 4ZI5A 4MWZA 5GADl 1W5BA 2WJ4A 4E3ZA 3E9EA 4IRXA 4M0MA 1N0HA 2R751 3E7FA 2XD9A 3KXDA 4UD6A 2EJUA 3LA8A 1WXFA 3CLHA 4U2CA 2QD3A 3OA2A 1I0LA 4EYQA 4PNPA 5GV7A 1CY1A 2J9FA 2GTIA 2IXEA 5T8KC 1SU8A 2AF3C 2J9RA 2PMCA 2ZSKA 2YC4C 3WK6A 1Q95A 4YJ3F 2YY6A 3OTOB 1H0RA 3N5KA 2QRKA 3JS5A 3NH9A 3E5HA 4EMSA 2FOIA 3OFJA 1HV8A 3A6HA 2JIMA 4MLDA 4OMCA 2VJOA 4N3NA 4TWAA 5D3MB 1C9MA 1MB9A 1Z17A 2PQ2A 3B38A 4LRTB 3W8NA 4CKYA 1WUKS 5K8LA 2NPFA 2OP1A 2VYVA 3SZRA 1SHKA 5CDFE 4WBNB 1OAOA 1E9VA 4MAFA 1XPOA 1D2AA 1NAHA 2AJTA 2P90A 2EU8A 2H2FA 1KDVA 4ZYYA 2V54A 3GQVA 1Z0JA 2OILA 3EG9A 3V8VA 3ZWYA 3ZZTA 4D8YA 4YT4A 5SY9A 5JROA 1AXGA 3OH8A 2CB0A 1T5BA 3MWGA 2PMEA 2FMKA 3W05A 5DYYA 4TMWA 4NU6A 3SR4A 1I3CA 1QOPB 4B5KA 2ASEA 2IF2A 2VDKB 3DFMA 2QD5A 3L4KA 5LQUA 5GWXA 3FYUB 1TAGA 2QYOA 4TKLA 1VYUA 4EKIA 3FDZA 2FPGB 1E0JA 5C1OA 5IJZA 3TMYA 2F8SA 4DB2A 4OI0A 2AFIA 2P6NA 3G9TA 2NT4A 2YN4A 1L5HB 3AR7A 1X92A 2BVNA 1Q1GA 4PYMA 5KQPA 5FWDA 3EZGA 3PU6A 3T7TA 4PR0A 1JLHA 3OTGA 1I9GA 2NTYC 3LK7A 3WOVA 1KBZA 4ZU3A 4CHGA 5LJIA 3FYUC 1JDSA 1VE9A 1ZSNA 3THRA 4URHA 4NJMB 5EJ4A 3DCNA 3DL2A 3PNMA 2AC2A 3KAJA 3PUZA 3UTDA 5JXGA 4NH4A 2DFKB 2I2DA 2ASVA 4GO1A 2HY7A 4BX8A 3PDJA 3AINA 4OJQA 3PYMA 4PO8A 3G6WA 3GOHA 2FEOA 4G0XA 5DULA 4DCOA 3UK6A 1VE3A 4W5RA 1Q7EA 2JIPA 3ZN2A 2BMEA 1VP3A 1ZU5A 2DKFA 1T3TA 3I04M 4Q05A 3SC2A 5C3MA 2Z1DA 2PRKA 4RJKA 2WRZA 5I9LA 2L42A 2FEKA 3I0MA 4L4XA 3VOSA 5I7VA 3NH6A 5FUBA 3M6WA 3VYVA 4GSKA 3DHNA 2QZ4A 1A8SA 4BWFB 1MG5A 4L0DA 3DEYX 2JVKA 4N65A 1KP3A 4DIEA 1C1XA 1PV1A 2QQFA 2R1VB 3K8ZA 4LXYA 4DMCA 2LZ0A 1JR3A 3UT5B 2JPDA 4MKHA 1FQOA 4LRYA 2OPBA 2XKKA 5K0LA 8ABPA 1KMMA 2ERYA 3UV3A 4L76A 4KCGA 2IOHA 3ENQA 3RO7A 2PE5A 4QGSA 1OIXA 1P9LA 2RHGB 3P45A 4TV8A 3K0CA 3N9IA 5E6UA 4Q4HA 1LTHR 1NULA 5LYJA 2BZ0A 4RLFA 4G0PA 2VQDA 5EZYF 3K6SA 1TVKB 2DR2A 4US0R 1UWCA 4J0CA 3JCZA 1M2OA 4ZT6A 2HHHB 4UM5A 4Q7KA 4L16A 3A2LA 1Y9EA 3DHVA 4MARA 6GPBA 2ZIVB 5AICA 2ECPA 2CZCA 1A9SA 3MJDA 4G9GA 2DB3A 5B4VA 1MPTA 2AKAB 3L05A 3K6RA 3A0UA 3PXGA 3WKEA 1WCIA 3VGJA 3BXPA 4K40A 1W6UA 1LC0A 4TTPA 1V35A 1G5IA 2GAJA 5EVCA 5E6RA 4EKEA 5KX5F 1QRDA 1IZZA 2CYBA 1KEUA 3CXUA 5DEOA 1E2BA 1EWKA 2RAPA 1AH2A 2IBTA 1C4WA 3W04A 3PQ7A 3D7MA 1U4SA 1RQNA 3HB7A 5A3RA 5K6RA 3LTNC 1RZRD 4YHBA 2RKOA 4KQIA 1B6RA 1MX9A 4DDMA 3S8EA 3MERA 1U2DC 2IYSA 4AM8A 4EY7A 2C9YA 5FWXA 3C8HA 1E3IA 1O5IA 3GN2A 3H11A 1XO1A 4FK8A 3L8CA 4HNRA 4RH3A 4ZVTA 1J2JA 4WT7A 3TOVA 2C2BA 2J67A 2CFCA 3AHHA 3N8DA 1NKVA 1QV6A 3A6ZA 5AXDA 4BVFA 4DA4A 3EOAI 1XKTA 1XDBA 3GYBA 1N2JA 2B69A 3OQVA 2CDBA 4ZCQA 5IAJA 4QFBA 1KBQA 3EK2A 3PC4A 3KSDO 2JA2A 4IJ5A 2AYZA 3OEED 3KL4A 3KWJA 3TNDA 3BWVA 5KVAA 2A0UA 1F0NA 3HKDA 4LZPA 1XWIA 3WRVA 4HMPA 3RSSA 5JS7A 2QSZA 4PX2A 2V55B 4EJ2A 5ELXA 4X1IB 3FPKA 2XOKD 1PTJC 2AQ8A 3LJKA 1JQ3A 3E8XA 4OBEA 4PINA 4D26A 1L8AA 1VYTA 4D4MA 1AT1A 4F2DA 3ZD7A 2GN9A 4Y2PA 3T7EA 1GO2A 1KJQA 1ZJ6A 4KAJA 2HQBA 1C3OB 5HDQA 4M0FA 4XJSA 1GSAA 1K06A 3JWGA 3QFFA 2OTCA 3OICA 4W5NA 2QA5A 3D02A 3WLEA 2HD4A 2Z9BA 1P2BA 4X85A 1XJ0A 2AE1A 2WFMA 3DL7A 2OUIA 4Y6QA 2CNDA 4ZYXA 1NZFA 4E0BA 1DTEA 1SZDA 1HMYA 4XKJA 3FRIA 1H2HA 2PBRA 4N8DA 3RABA 1E66A 4J3NA 5JJKA 4DLBA 3U9LA 5DK6A 5E3IA 5KMGB 2A1TS 4G56A 2J4CA 1U4NA 4JP3A 4YASA 5LIPA 4HT3B 1N9KA 4AZ0A 3W3AD 1AUVA 2IIVA 1Q0PA 1PWXA 1KI4A 2BCGY 2P9JA 2RGDA 3PTZA 4H7EA 4PXAA 4MDYA 5BVHA 4WLFA 2HFJA 2P9BA 3PXXA 1VKZA 2PLWA 3A3PA 5JT1A 2XOEA 1UWLA 3F5MA 3R3JA 4FI3F 4ZWNA 2FU5C 1M54A 2ODEA 2JFYA 4O8CA 3ZXSA 4ND6A 4ARAA 4BN5A 2WTMA 3V1TC 1ESMA 2GCEA 3T9CA 5F64A 3OIGA 3Q2IA 4LJAA 3T7CA 3TSOA 4DQ0A 1XNGA 1YJBA 2QUAA 4IIEA 1AK2A 4U2FA 1S02A 1ZDMA 2PGIA 3H0CA 3WSVA 2C98A 3O0DA 2ZGVA 1AQYA 3B1XA 2H0QA 1TYZA 2J0UB 3HBLA 1F2UB 4J76A 2J3DA 2O2GA 4YV7A 1UADA 2GZRA 1KQOA 2HDNB 3MB8A 1QK3A 1UKVY 1XVLA 3Q8XB 3WADA 4C9BA 1XAHA 3LD9A 3QEBZ 2DVMA 4F5WA 1M6YA 1WCWA 3C5VA 4ER5A 5DX1A 1VXOA 5DSZA 4RVOA 3LBAA 1JG1A 3VO9A 2JFBA 3G8YA 2R8PA 2F4NA 2XT9A 4ZJUA 1M2GA 1XEFA 3V8QA 2V9CA 3QVTA 2BFPA 3R77A 1AV6A 3OM1A 4EFLA 2ECOA 3AH8A 4PGGA 2Z1NA 3EIEA 1UFKA 1D7OA 4RKQA 6REQB 2C4HA 3O94A 2ZSDA 2WNIA 5ECGC 1LNSA 5FNVF 2PBLA 4E12A 4NAHA 3SJCA 3A1WA 1J0XO 1W0JA 3AVUA 2VSOA 2QX9A 1RHJA 1ZM7A 1AUPA 2ESRA 2PX6A 3HFGA 3K6JA 4HAVA 2BSQA 3IIEA 3FOEC 1REQA 2IYUA 3H16A 4GOJA 4CV3A 1DPGA 2ZVDA 2QXUA 4AAYA 1D1SA 6ABPA 3ZGOA 4EVRA 5A71A 3E27A 3GPDG 1JHUA 1DOZA 1YS9A 4WHMA 4DAOA 4IV8A 3EDYA 3A1EA 2O1XA 3UUFA 4UTZA 4C2AA 1V4NA 3DDCA 5B7PA 2QVLA 1E61A 1F48A 1SIWA 2M9MA 2GJ4A 5THKA 3RVSA 4DCSA 3L0YA 2NO1A 3OC6A 1NVGA 5E1DA 4WK2B 1N2CE 4XFDA 3TJRA 3QMMA 1EJBA 3SHVA 4MINA 5KYUB 1UBOS 3AZPA 4BVEA 2Z56A 1BZYA 4RF2A 2MYTA 2BKXA 3F7MA 4LYYA 1SUEA 4D97A 1FFHA 1T8YA 1NM5C 4NC9A 4MVWA 1JWBB 2W6JD 2C2HA 2BCJQ 2BM1A 1ZJ4A 1W5EA 2BM8A 4QEKA 2H9AA 1VE6A 5E6SB 1H66A 2W22A 4F11A 4LBVA 3BIWA 4LJLA 1GVHA 5KBYA 1WDWB 2J0EA 1PSDA 2JJYA 1ZPDA 4G5XA 3ZY5A 1MVLA 3A1SA 1KAOA 1B8NA 4B3IA 2CEAA 1UFRA 1JHXA 1OI2A 2BMVA 1LSJA 3FNEA 4KEAA 4Y6LA 1VRCA 4ZHQF 1QQ5A 3O47A 1HE4A 1JEDA 4IQFA 4J2HA 2VJNA 2C0PA 1E9FA 1KC1A 3WMRA 3H4IA 1PNTA 1XD2B 3U44A 3EEQA 2HF2A 3FMGA 3AEXA 2GHTA 1SCDA 3D59A 2Y0BA 2X77A 3F6CA 1C2YA 5CYPA 2WUEA 4OGGA 5HG0A 3WBKA 3OPQA 2QYHA 1FS5A 1QIJA 4UEQA 4ZJZA 3NOQA 3OJXA 2I3ZA 4MTCA 3BFJA 5BUZA 3SICE 1Z4QA 3FCEA 3BHNA 4BNYA 4YAWA 4EG3A 3D8UA 1T1SA 2AJCA 3C7TA 1OBCA 1W93A 4Q24A 1H1LA 3FFBA 4RK4A 1WZCA 4MV0A 5KYWA 4Z3OA 4DF3A 3ZHOA 4PCUA 5JWHA 4F6RA 1TCBA 3SSOA 3H1FA 4GXTA 1A1VA 3RYHA 3Q8KA 1SXJD 3N2GB 1EFCA 3QXCA 3G8CA 3OA0A 3RV3A 3FOBA 3REQB 3EXHC 2GVNA 3QFSA 4QL3A 5HJ2A 2W6ID 4CKZA 2EYQA 1XJ5A 4RHEA 5AR1A 3JWPA 4QBKA 1P8AA 4CT5A 1FW8A 2AV6A 3DNMA 4OAOA 3IUQA 2WG2A 3AIMA 3GEBA 3N2IA 1XMXA 5K0JA 1GPH1 3T0FA 2W2OA 4MUKA 3W5AA 3ZLJA 3GA5A 1RXUA 2GJKA 5CA0F 3TR5A 3RRZA 1DBIA 2IYQA 4YREA 3KQQA 2Q7XA 1SIUA 5TEWA 3AVXA 4F4UA 1G1MA 3UT0A 5CFMA 1GUZA 1NKTA 1TIBA 2CNWD 4BNNA 4MVJE 4BLRA 2JI4A 3EZNA 3OWOA 4R1SA 3MILA 4ZO6A 5EFOA 3R09A 3KHTA 2Y4OA 3TE6A 1ZCJA 2V7WA 1ZUHA 4YO7A 2DSTA 2QTGA 3SYKA 1X80B 2GM5A 3UMSA 3CMCO 2KLBA 1HZZA 2LR0A 1U28A 2N1BA 3KOYA 1VGQA 1RYFA 4IKPA 4KODA 4QEZA 3H84A 4EPXA 1Z0AA 1ZIPA 1S1MA 5EJ8A 3C3JA 2I6FA 3EJWA 4BP8A 3TMKA 1BXRB 1LLUA 2L0XA 3A6EA 3I9JA 4DT1A 1S7CA 2E5FA 1TF7A 1Y7PA 1HKUA 2ZCUA 5FPTA 3HM2A 3QSYA 2DCUA 2Q1WA 4IDAA 4K0RA 4YT2A 3GA0A 5HX7A 2BV3A 2G1PA 3CC8A 4O5AA 2W9XA 3G17A 5CIQA 4NFLA 3ACDA 5E2BA 1A82A 2G0NA 2PRJA 3KKEA 3R3WA 1AO3A 2FZ4A 5YASA 4AUMA 4KK4A 4C6TA 3WLJA 2JVJA 1KMIY 1PX0A 5K03A 1UM8A 1MQSA 1UMBA 4YRTA 1RM3A 3WJAA 1ORRA 1KDOA 3HPQA 3G1TA 3A6FA 4N0EA 3TSAA 4DMKA 5B2FA 4C22A 1YBAA 1G7SA 2A1TR 5JJCA 1PQPA 1TQHA 2NNLD 2PKXA 3GA7A 3C3DA 3D3KA 4Y0VA 1VLJA 3ZVNA 1OH7A 3K2QA 4ZVSA 2REXB 3M3HA 1N5MA 3A32A 1V45E 4OK3A 3COSA 4X45A 5F4BA 4QT4A 3KSAC 3RSHA 1JJAA 1NVUQ 3RS2A 3I0NA 3KJQA 2BP7A 4GVXA 3UV7A 1KARA 2YQ4A 4QELA 1T5DX 3ICCA 4QSHA 5EJAA 3JRNA 1P5JA 3ZOKA 1T6XA 3MUEA 4HR7A 1SIOA 3VMFA 1J9GA 3C7CB 4HP8A 4AQ7A 2ZIAA 4UD2A 5E9WA 3NBKA 1S89A 4L73A 2ISCA 4RFSB 5EJ9A 4X7RA 1J33A 4JH0A 3W3AH 3BMXA 4XYMA 3RIYA 3ICQB 1DC4A 2PEYA 2G06A 2YQZA 3DEHA 4TL7A 1SXJC 1O87A 1A9YA 4GE3A 1L7PA 3ANNA 4JLUA 1JZQA 4J9UE 1PW7A 2DG2A 1Y48E 3IULA 1IBLB 3HVRA 5JNLA 1TFUA 1U7WA 3WXMA 2IP4A 3AUUA 3FUVA 5BRJA 4FZ5A 3PWZA 5HQ3A 4BYMA 5CB6A 8AT1A 3RYCB 4HBZA 1DADA 1MRNA 1QHGA 4DARA 2M1ZA 2HN9A 1N6OA 4K5QA 1EK5A 2C84A 3TL2A 4DZRA 1E94E 1QCCA 2I99A 4GPBA 3RSQA 3H3FA 2QY9A 1RVV1 2A0KA 3NV9A 3TNJA 4BUJA 5A4KA 4KLZA 1I6MA 2Q3BA 1T4CB 3IFSA 1IQRA 4LHSA 3X0DA 4C3ZA 3IEVA 1K3FA 2QX7A 2FRDA 3ZWKA 2VBIA 3C6XA 3U1BA 1ENZA 4IIHA 2JGIA 2PZJA 3OURA 1R3UA 4E46A 4I8XA 4Z9BA 4KUHA 2WJ3A 5C1BA 1ID8A 5EGSA 1MIHA 2FPOA 4B83A 1Q1ZA 3WLOA 3EASA 3RRNA 2CT8A 4LJRA 2ZAGA 2HTFA 3TFOA 1DAIA 4BASA 1DKRA 5CYFA 2GM9A 5WRFA 4JSRA 1BFKA 1XEWY 4ZVUA 3ZKAA 4HDNB 5IRCD 3ZTYA 3KELA 3KHSA 1XQVA 4LVUA 3PC8A 3ER8A 1X2BA 5FWYA 3ZCSA 5KDDA 4DILA 3UAYA 4HNTA 1EA5A 3TYXA 2ROQA 3SHFA 5KOJB 1OFHA 4QJ3A 2DTEA 1YFJA 1U63A 2JJ1D 4GW3A 1PV2A 3K72B 2JIZA 5IT4A 5IDQA 4DLPA 4EJSA 1TGYA 1U1CA 4UHFA 2ZTSA 3ADKA 4BTLA 1EHCA 5JTUA 3N70A 1Z0IA 4N6OA 4PLCA 5JCOA 1M8PA 3ZWCA 2VPQA 2F3TA 2ZU6A 5HVNA 3L0PA 3G2LA 3P2IA 3FF4A 1FYFA 4Q3KA 4LE0A 4BUZA 2X2FA 2NU6B 3IH5A 1I6WA 4OSEA 1IMJA 3H1AA 2CV1A 3D5QA 2EF1A 2GF9A 2IV7A 1ZFNA 2Q5CA 4NCIA 4RF5A 1P7WA 1ZMBA 1MEJA 2F9LA 4JX8A 4BO1A 4C5AA 4R98A 2VK2A 2YASA 5DSTA 1XDGA 2ZBRA 1ZM3A 3PJFA