3STXA

Crystal structure of tomato methylketone synthase i h243a variant complexed with beta-ketoheptanoate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDAVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylketone synthase 1
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
total genus 85
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stxA00
5FUMA 4ZREA 1K5PA 4DMFA 1IZ7A 1GQRA 4U2BA 2OAEA 3I2IA 4KYVA 2DCMA 2XUPA 4GHWA 1SCKA 4H77A 3RKSA 2G4LA 3VJLA 4IH9A 3R40A 1HPLA 3HLKA 4B80A 4Y2XA 2XT0A 1GPKA 2WJ4A 2XMSA 3K9BA 4HRYA 4A5SA 3KDAA 1XZHA 4RPCA 4LYDA 1ZI6A 3A70A 5C8VA 5AKLA 3O4IA 1K4YA 2DHDA 4AO6A 1EINA 5AKJA 2XUGA 3V1MA 1VE7A 3WLAA 1EX9A 5CMLA 5HKAA 1JU4A 3CN9A 3HZOA 5EHNA 3ILSA 3C6BA 3IUNA 1AX9A 3E1GA 2AJCA 1EVQA 4AX4A 4W1QA 4J0JA 2VJBA 2RI6A 4J3JA 4C01A 1CPYA 4DGQA 1MNAA 1EB9A 4UBJA 3WKBA 1Y7IA 4OCZA 3AZOA 3FNBA 4X00A 1UKCA 2WG2A 1KEZA 4IH4A 3V48A 1J1IA 2XLCA 5HK9A 3BIWA 5E4YA 1QJ4A 5ALEA 1JT2A 4QE3A 1UT6A 2VT6A 1CUJA 1ZGCA 1HDEA 5AM3A 3BL8A 1QIGA 4C89A 5LP1A 1O6FA 4X3CA 4J0HA 1MO2A 4UHEA 4FNMA 4W9RA 3IURA 5JD6A 1R4ZA 1QGED 4ZI5A 5A7FA 1FJ2A 1XZCA 4MWSA 2O2HA 2ORYA 4AO8A 2VT7A 4EB0A 1HL7A 3T4UA 2HA6A 4Q05A 2B9VA 5C8ZA 3BWXA 5D6OA 1L7QA 4HXEB 4XX1A 3OG9A 1G42A 2WIJA 2H9YA 3WIOA 3H0CA 3A2NA 2WFLB 2XQKA 1U4NA 1EK1A 2YASA 1THGA 4CIBA 4DTCA 3DKRA 4YX9A 3QITA 5AKHA 3UUEA 1ZI8A 1XZDA 5HK8A 2IITA 5IH7A 1N1MA 4G9GA 5AHXA 3IB3A 2DR0A 5CT5A 4L0CA 3D2BA 1FFDA 1SOMA 3AJAA 1MX9A 4LIPD 3I1YA 4F5ZA 5A62A 4U2CA 1Q0RA 3PI6A 2HRQA 2I3ZA 4OB6A 4UFNA 1W6RA 2R11A 4KAAA 5FKJA 4WFJA 4V2IA 4FHZA 1UK9A 3LIPA 2V97A 1CUWA 2W22A 4PSDA 1GPNA 4HXFB 1LGYA 1PJAA 1QLWA 1CUCA 2H7YA 4CFSA 3D2AA 4ROTA 3LCRA 3C6ZA 3ICWA 2GZRA 3STTA 4EY4A 3I2GA 5AI0A 3QH4A 1T4MA 2V96A 2PSHA 1QIMA 1XRQA 3I2HA 3PF8A 5HF5A 2IIVA 3G9ZA 2H1IA 1DWOA 1UKBA 3H2JA 3ZPXA 3WK6A 3AILA 1NU8A 4Y2TA 2VAXA 4UUQA 2PUHA 3VJKA 5K3EA 1KU6A 3WIBA 5AKKA 3C6YA 5E4JA 3O95A 3K6KA 2HM7A 2NW6A 3HC7A 1WOMA 3FWHA 4U2GA 1FFBA 4INZA 1XRLA 5ALXA 4Y2JA 5DNUA 3ZLTA 5AM5A 4QDOA 3TEJA 2ACEA 2H7XA 3DKKA 1ISPA 2JEYA 3UMJA 1LZKA 3H2KA 3ESAA 3R3VA 3TGLA 4W1PA 2BUBA 2VATA 3S8YA 5JAHA 4OSEA 4FFWA 4EY6A 4WY8A 5LLSA 1VA4A 3SX4A 4MXDA 2R8BA 5F4ZA 3QVMA 3ANSA 2WM2A 4WFIA 5DYWA 2XQIA 4WFKA 5A7HA 5E2IA 3NGMA 2PSFA 5LIPA 4FNGA 4UBIA 5K3FA 3DEAA 2C0PA 3HYSA 1SCIA 1SCQA 3WKDA 2WJ6A 3MGAA 4ETWA 3EF3A 3NWOA 4H7KA 3VDXA 4BATA 4B85A 1U65A 1QOZA 3WL6A 1QZ3A 1BN7A 3AZPA 1XFDA 3DCNA 1F8UA 4PW0A 2Z8ZA 3BDVA 1X2EA 2X8BA 3O9VA 4DNPA 3L1JA 4CCYB 2HFJA 2AJLI 3G7NA 3G9XA 3AIKA 5DNWA 3C43A 1AURA 1WB4A 4C6HA 2AJDA 4FBLA 2HU7A 1OILA 3AZQA 2XMDA 1BCRA 2OG1A 2ROQA 3PUHA 4ITVA 5CRIA 4BE9A 3ZLUA 3S2ZA 3TJMA 1J06A 1VZ2A 4PSUA 4Q3OA 4B6GA 5A6VA 2FJPA 4Y2RA 1P0IA 1P0MA 1NU6A 1DT5A 2CJPA 3OPMA 4H7JA 3WKCA 4Q34A 5ALZA 2HFKA 3WJ2A 3I6MA 2Z8XA 4BTLA 4B9AA 1X2BA 4GLBA 3DD5A 2DHEA 3R3YA 3R3UA 4KE6A 1QO9A 1QTRA 1KU0A 4BP8A 4UHFA 2RGUA 3JW8A 1MT3A 4IHAA 4UBKA 4MJ3A 2QUBA 1WHTA 1UWCA 4HTAA 1CRLA 1CQWA 5SYMA 3STYA 2WHPB 4LXHA 1G66A 4WY5A 4E11A 4PQEA 1TRHA 1N5MA 2ZYIA 3ZI7A 2WQZA 3K2IA 4F0JA 5IKXA 4PNZA 1ACJA 3FYUB 3PFBA 1EB8A 1CUUA 4DYHA 1LLFA 3H19A 5CURA 5ALUA 2WG1A 3H1AA 5T4EA 3I6YA 3QPCA 2QM0A 2QUAA 3QMVA 2JGEA 1QIFA 3WMRA 1ETHA 1ZD5A 2OCKA 2BAGA 1XZEA 5ALNA 2PBLA 1TAHA 3PICA 2EDCA 4N5HX 4QLAA 2HRRA 5CH3A 4W1SA 1WM1A 1UOPA 1QO7A 3D2CA 3MUOA 4Y2SA 4AN0A 1BRTA 2JGMA 2OXEA 5JZ9A 2V9ZA 3WI7A 2XUJA 3X3HA 4BDTA 2XUQA 3ESDA 4S0XA 4B81A 5ALVA 5BWCA 1YAJA 1DX4A 5AK6A 3Q8WA 1XQVA 2XQGA 1L7AA 4H35A 4UPDA 5DTIA 1H2XA 1MTZA 1A88A 5ALIA 5ALFA 5AH0A 1LPNA 2XQFA 1VKHA 1JJFA 3I1IA 2PX6A 3R3WA 2V98A 3BF7A 1XZMA 1C7JA 2OCLA 1ODTC 1XZBA 2I3DA 3ZV7A 4LHEA 4QDTA 1LBTA 2WFMA 3C87A 2ZJ6A 3DL7A 3D3NA 2GBIA 3CCCA 2PL5A 3FOBA 3C5WP 3DOIA 3IULA 3FBWA 1EHYA 1AMNA 4ZRDA 3C6XA 4P9NA 2C5FA 5CT8A 3FYTA 4BVLA 1EA5A 5EHZA 3AINA 1TCCA 5JANA 1C4XA 2DQYA 4ZV7A 1YB6A 2D0DA 4WCVA 1QIKA 2DHCA 3CXUA 2AJ8A 4RNCA 4X85A 1THTA 2OCIA 2JGJA 4ZXFA 4AMYA 1LPPA 4RE6A 1YASA 4UHDA 1JJIA 4L9AA 3F67A 2BJHA 1H2YA 5AICA 3BE8A 2QMQA 1CLEA 2LIPA 3WZLA 1RP1A 5JZSA 3AIOA 2QRUA 2HDWA 3H17A 4IQ4A 5JIBA 1GKKA 5ALGA 1YS1X 2B4KA 5I7UA 4H7DA 5HQ3B 4K5QA 4X97A 2WILA 3AIMA 4G4IA 4X6XA 1JI3A 1X70A 3IUJA 1F0NA 1A8UA 2PKYX 1DU4A 2ECFA 1HKHA 3F97A 3M82A 3WK7A 4OU5A 3IIIA 4DSZA 1ODSA 2WUFA 1O6GA 5ALMA 1CIJA 2QKYA 4I19A 3FVTA 2CBGA 2VEOA 2Y2VA 1JU3A 4DMHA 5CXUA 1DWQA 1VE6A 3E3AA 5AKZA 4KRYA 2ACKA 4J0GA 2ZYHA 4BVKA 2O7VA 2I03A 2B61A 4Q1VA 6YASA 1CUYA 3QYJA 5BV7A 5AKYA 5T4BA 2WU4A 1E8NA 5JAPA 3D5EA 4OYLA 4AN1A 1EVEA 2D5LA 4L72A 5JAOA 3DJYA 4KAFA 2VJCA 4N5IX 3VVLA 5FOQA 2HA2A 4OD0A 2XUFA 4XWGA 3WK8A 3OM8A 1DTEA 3MVEA 5AKGA 5JARA 3GELA 3H2HA 2FJ0A 5HFAA 3G0CA 5EFZA 2PUJA 1JMKC 3B12A 4KAJA 2CEKA 1I6WA 5E4TA 3F8SA 5EHXA 1FFEA 2OGSA 4X6YA 1UXOA 4Y2YA 5DYYA 5I8PA 2XLBA 2VJDA 5ALDA 1IVYA 1AUOA 4N8EA 2CMFA 1CEXA 1VLQA 2XDWA 1EDDA 1CUBA 1FSSA 3C8DA 5IVKA 1XQYA 5H3HA 4KEAA 1QIJA 5IVIA 2VJAA 5LZ4A 2HA7A 1PFQA 4GW3A 2DFPA 1R1DA 1GQSA 5AI9A 2HADA 3MUNA 4GECA 4GI1A 2PSDA 1Q0ZA 2OPHA 1QIDA 1ACLA 1E3QA 1H2ZA 2PU7A 4Q3KA 1EH5A 2VF2A 4YK7A 3G0GA 5FPQA 1DT3A 3L1IA 4DIUA 4FDMA 4H7HA 3PUIA 3W9BA 1A8SA 4BCCA 2GBGA 3VKFA 3WK5A 2XUAA 2BCEA 5AJHA 1OXMA 4W1RA 1WPXA 4X90A 5IVHA 3WL7A 3I2KA 3H04A 1CUAA 1CUVA 1VXOA 4B0PA 1A8QA 4E15A 4FLEA 3R0VA 2Y1KA 3WWCA 5K5EA 4OPMA 2QZPA 4HVTA 5AI6A 3ZWQA 4G9EA 4KE7A 4OUKX 1R9MA 4TPKA 2QVBA 2ES4A 3V1NA 2JEZA 1B41A 4BRZA 1AZWA 3IUMA 1HQDA 3B3QA 3BJRA 4KACA 4QNNA 4G4JA 3GZJA 5CTAA 3D4LA 3WKEA 4ZWNA 1D07A 4BP9A 4M0FA 3KWJA 3G02A 1ZJ5A 4UHBA 5LZ5A 2ZVDA 3HI4A 4B84A 2VA9A 1MX1A 1YR2A 1GT6A 1CUXA 4MEBA 2XQJA 1AGYA 2HHAA 2CKMA 2HIHA 5EIAA 4BCBA 3IA2A 3QZUA 1AQLA 4A23A 4AO7A 4CI9A 5AK4A 1UOQA 5A7GA 2EDAA 3IVMA 4F21A 5AOAA 2WIDA 3H1BA 1LPBB 2Z3WA 1G5FA 2X76A 3GFFA 4AQDA 1W1IA 1L7RA 5AKIA 3DYVA 1RWQA 2ZJFA 1BEEA 1Y7HA 1Q84A 5AI4A 4QDUA 4J7AA 4JH0A 1K6EA 5HCUA 3WWOA 4DSAA 4UBLA 1ZGBA 4PV7A 1R9NA 2AXEA 4HS9A 3CCBA 2CB9A 1UZAA 2ZSHA 1CVLA 1BE0A 5EI5A 3UUFA 3OURA 2VAVA 4FTWA 4Y9SA 1CQZA 4LXIA 1LZLA 3DQZA 1XLWA 4HAIA 1ZD3A 2HL6A 5AIAA 3BF8A 5AM2A 4I4CA 3U0VA 4NZZA 4OU4A 1XZKA 5LYYA 4PSCA 1E89A 3OOSA 4Y7DA 5AKXA 5J3JA 4BAZA 1VA5A 3DL4A 5CBKA 2FUKA 3WK4A 4YPVA 2XUIA 1B6GA 1IUOA 3FSGD 5BWBA 3A2LA 4OB7A 3G8YA 4GXNA 4BRSA 3JWEA 5LZ8A 5ALOA 4X71A 1EI9A 3FLEA 4MQLA 3R3ZA 4WDQA 2Y6VA 2WKWA 2BGRA 2H7CA 3DS8A 3EQ8A 5CT4A 4UBOA 2GZSA 4BBZA 4CG3A 4HZGA 5ESRA 2WLSA 1XZFA 2QR5A 1CUZA 1LPAB 2B20A 1BU8A 5K3FB 3V9AA 4X7BA 5EHQA 1C7IA 4BVJA 3FLBA 5ALSA 3OC0A 3C45A 3LS2A 2O2IA 3KXPA 3HXKA 1EK2A 4H0CA 2C7BA 4N8SA 3STVA 4BCDA 4FLMA 4GEGA 3VJMA 5T4FA 2J4FA 1MAHA 2XB6A 1VOTA 2PVSA 4EY5A 1P0PA 1YCDA 4J0KA 4FBMA 4Y2VA 4Q3LA 2WHRA 3AUKA 3STWA 4EY8A 5DJ5A 2XUOA 2W6CX 1U2EA 4KR0A 3WA6A 3VXKA 2DSNA 5FXMA 1TK3A 3ZLVA 3EQ9A 2XMCA 1QFSA 4JEIA 5IVDA 2C5GA 3KOOA 1Y37A 1E5TA 1JFRA 1XRPA 4QDXA 1TIBA 2GYUA 3NUZA 2RHWA 3GUUA 2RAUA 5D3KA 4DLNA 3M83A 5AM0A 3KWFA 2Z3ZA 2ZYRA 1ZIYA 3NOXA 5CXXA 3G9TA 4UBNA 2G5TA 4G4GA 2WG0A 4BAGA 2YXPX 3N2ZB 3HACA 3M81A 5LZ7A 4KE9A 4P08A 1MN6A 4X92A 4K6HA 2Y6UA 4ZV9A 5YASA 3O0DA 4U2EA 5AOBA 4BZZA 2QXUA 2HU5A 3T52A 1UFOA 5DYTA 4D9JA 4J0CA 5I9IA 1ZICA 2GBCA 2HU8A 4C4YA 5CT6A 1XZIA 5EGNA 1XKLA 5D3ZA 3EQ7A 1UKAA 3O4JA 5AKEA 3LLCA 5HFNA 1WCYA 5JZBA 4IH1A 4UBMA 3FAKA 4K6GA 1M33A 3HEAA 3WL5A 3WKAA 2OAGA 2YYSA 4C4ZA 1TCAA 2VSQA 3DDUA 4QEKA 5T4HA 1CUGA 5DTJA 4QWWA 4M0MA 4TGLA 5JASA 2VTVA 3W9UA 2BUCA 1AKNA 2OGTA 3GBSA 3OTQA 1R88A 4FOLA 1GGVA 1DX6A 2IX9A 5AK3A 2PSEA 4UHHA 4DNQA 3BJMA 3QPAA 4EBBA 5FDFA 3IDAA 4XIIA 5HF6A 2WU3A 3FCYA 3H2GA 1ZIXA 3JYHA 5CH8A 3RLIA 2FX5A 3O4HA 4FKBA 3BIXA 2WFLA 5AI5A 1BCSA 5ALTA 4J03A 5DLPA 1YB7A 4DM7A 3C8HA 1QE3A 2I78A 4GWLA 3DLTA 5C7YA 2XUHA 5CW2A 2K2QB 2OCGA 4H7IA 1Z68A 2JF0A 4BYMA 2CZQA 2G5PA 1ORWA 4DMCA 4EA6A 4DMKA 4X6UA 1BROA 2XMZA 4EZIA 2ONCA 2WHQA 1WB5A 4BDSA 1BEZA 1W75A 1QIHA 3G0BA 4P93A 2EEPA 2WUGA 3L1HA 1QTIA 3EIOA 4OYYA 3DYIA 3E4DA 1E8MA 3ESBA 5EIEA 1N8SA 5D7BA 4M0EA 2ZYSA 1WPRA 5A71A 3QBJA 4BC0A 1MU0A 2YH2A 4CCWA 4DNOA 2O2GA 1U8EA 2WIFA 4AMZA 3QPDA 3B5EA 1WHSA 2G63A 1XRRA 5ALQA 4G8BA 1JKMA 3QMMA 2WSLA 4QLOA 1XQXA 4CG1A 1AC5A 5EIHA 5KBYA 4X95A 3KSRA 2WUEA 3C5VA 4I3FA 2HA0A 4A16A 1CUIA 5HF9A 4C87A 3VISA 3EBLA 2QS9A 5ALRA 1VJ5A 2UZ0A 2GBFA 2X5XA 3HABA 2HA3A 3V1LA 3LIIA 4X94A 2WTNA 2PSJA 3C70A 4H18A 3FVRA 3STXA 2PPLA 1MAAA 4CG2A 4FMPA 4CIAA 2VQ6A 4OB8A 1QONA 3R41A 5CT9A 2WIKA 5JATA 2E3JA 2C0QA 3PE6A 3O4GA 5JALA 4FWBA 1WB6A 1XLVA 5AI8A 5LZ2A 2DQZA 5A2GA 1FFCA 3HJUA 4N8DA 1ZD2P 4EHBA 3F98A 4P92A 2QJRA 1EXWA 1TKRA 1GPLA 3GROA 3BDIA 1IUPA 3ANTA 5DNVA 4MEAA 3KD2A 3A6ZA 1XZJA 4UHCA 1HBJA 4QWMA 1XROA 1LBSA 4L3WA 4Z49A 5ALYA 2BFNA 4GBGA 2QOEA 1MX5A 4HRXA 2AJBA 5AM4A 3TRDA 1UK6A 3Q0TA 4NS4A 5K3BA 4C4XA 3WYDA 2XMGA 1QFMA 5AIBA 1JMYA 2RIPA 5CH5A 1H2WA 3G0IA 4XVCA 1G4HA 2OQIA 1CUHA 4RGYA 5JAUA 3IUQA 1USWA 1CFJA 2RONA 2BGNA 1MJ5A 1ZI9A 5ALWA 4CCYA 1ZOIA 3YASA 1XRNA 3PDCA 3W05A 1LNSA 4O08A 4E14A 4MQMA 2J4CA 3WJ1A 3FLAA 4UFPA 1N5RA 2O7RA 2Q0XA 2RHTA 5HKBA 1MNQA 5AO9A 4G8CA 3WL8A 1W52X 1XZGA 2GYVA 4QDZA 3RARA 3D7RA 1IZ8A 2PU5A 3WWPA 2XI4A 3E0XA 5BOVA 1RYYA 2JGLA 1A7UA 2XUKA 4AXBA 2CUTA 3W2TA 4Y2UA 3R3XA 3DNMA 3QMWA 4DNFA 1QIEA 2QXTA 3U1TA 5AK5A 4MYDA 4WDRA 3AFIA 3N0TA 2BUAA 5ALJA 1JJBA 4FLFA 4BE4A 5JD5A 5K3AA 3ICVA 2JGFA 3WA7A 1J07A 4TVKA 4AZ3A 4J0IA 5FLKA 5C8XA 1F6WA 1W76A 4B7ZA 2WJ3A 1R50A 2XMQA 1CUSA 2OQVA 3IBTA 4QZVA 4KE8A 2OLEA 2PM8A 2P8SA 1XLUA 2WHPA 4JNCA 4PO3X 1VXRA 4NMWA 4FFVA 5ISMA 4F60A 5C81A 2WUDA 4ZGBA 1XZAA 3FYUA 3SWWA 1ZD4A 1Q83A 4G8DA 5HZGA 1ODCA 2HA5A 5AOCA 2ZJ7A 4ARAA 1K63A 2WIGA 1MPXA 4EUSA 5KWJA 5ALPA 1BS9A 3G0DA 5KWIA 3PFCA 4B83A 4X93A 1QIIA 1CUEA 2ZSIA 3I6ZA 5K3CA 4W63A 1LPMA 4KRXA 2QT9A 3QM1A 4BAUA 4Y2QA 1DQZA 3D59A 4U2FA 1CV2A 1ORVA 3A2MA 1CUFA 2BKLA 3BXPA 3I2JA 4NVRA 4ARBA 3GA7A 1EDEA 4YASA 2HA4A 3CN7A 4K6KA 4U2DA 1GKLA 2J3QA 1H22A 3WWDA 5SYNA 4B82A 1UK8A 1OCEA 3SK0A 1GXSA 4LKOA 3G9UA 1F0PA 3FSGA 3H2IA 3WQHA 1W4LA 3I2FA 4UFOA 2Y2UA 4EY7A 4HXGA 1HLGA 4LYEA 1IMJA 4C88A 3LP5A 4BZWA 1YA8A 3SC2A 4H7FA 5FPPA 1J2EA 2XE4A 4XJVA 3H18A 3DOHA 2C58A 2Z5GA 2WFZA 4E46A 3WK9A 2GYWA 5LKRA 1YSCA 2JBWA 3VVMA 4G5XA 5JYCA 1DINA 4RE5A 5KREA 1FFAA 1SFRA 4Q82A 2XUDA 5FP0A 1XKTA 1BN6A 2WTMA 2C4HA 3F9CA 4QA9A 4MWTA 1E8DA 1DQYA 4AZ0A 4BC1A 3P2MA 2JGIA 1XQWA 5LKAA 5ALKA 5ALLA 3FYUC 2OGZA 3RK4A 7YASA 1LPOA 1K8QA 4B9EA 1GZ7A 5FV4A 5FRDA 5DWDA 5ALHA 3RM3A 1YA4A 4MYSA 3W04A 1VZ3A 1IUNA 3M3DA 5HQ3A 1PV1A 2QJWA 3W06A 3HRHA 1TQHA 3FCXA 3O9MA 4Y2PA 5AP9A 5JD4A 4JYPA 1NX9A 2J3DA 3WYNA 4IO0A 5LZ9A 5K3DA 3STUA 4AB1A 1P0QA 2JIDA 1EDBA 4KJXA 4JYMA 3WZMA 4B0OA 2XMBA 1CUDA 1TCBA 3HSSA 4WJLA 1S8OA 3PF9A 1E66A 1XRMA 4J0DA 5JADA 1CR6A 1LPSA 4G1FA 3ED1A 4JUIA 3I28A 1R3DA 1H23A 3V1KA 2JGKA 3F96A 1UK7A 1UOOA 4BB0A 2XMRA 4PF1A 4LXGA 4BTVA 1SC9A 1T2NA 1YS2X 4GDMA 1YAHA 5AM1A 3WWEA 4X91A 4K2AA 3ESCA 1XZLA 2QTBA 5HF8A 3D0KA 1ZJ4A 1DWPA 4H7EA
chains in the Genus database with same CATH superfamily
3E70C 4Y67A 3NWPA 2I9PA 4AJHA 4P4SA 5F12A 1Z4MA 4WLFA 3WLLA 1WX1A 3CNHA 1N1EA 1TKBA 1MO5A 3FM9A 3OZRA 4H7PA 4PHCA 4U7PB 3WX0A 1FUUA 1Z17A 5G0WA 1AN0A 1MC1A 1AQIA 2QTNA 5P8WA 4DIDA 1H85A 3CG4A 2Q27A 5E7QA 2OAEA 3RAEC 2J30A 2ZI7A 3C3WA 4KYVA 2DCMA 4IIHA 4X54A 5AYVA 1OT3A 4C7KA 2Z6VA 2EIHA 4CQJA 1P2BA 4I8XA 1G8PA 3GCDA 1J22A 3LUAA 5FCDA 5H9VA 3OQOA 1U31A 3VJLA 2OV6A 3VPFA 2GXUA 2QPAA 4WK2B 2IC5A 4E0BA 5L3VA 4BNFA 3N86A 2C03A 1PL0A 4OBXA 4B80A 4ER3A 5BP7A 1L3BA 2WNSA 1EJ2A 3C7CB 5H70A 4Y2XA 2CY0A 3RSQA 3D4IA 3U4MA 2WJ4A 2B98A 2C7VA 2JS7A 2OBNA 4HRYA 4A5SA 4ZGWA 2ZRCA 4C7OB 1WP9A 1JR3D 3NVDA 3GVHA 4YV2A 4RPCA 4K0KB 1FU7A 1BDHA 4LYDA 3T5TA 2DP4E 3RNLA 2PUAA 2BGGA 1VB3A 4CMJA 1ZWLA 3FNRA 4RPIA 4XE5A 4UARA 4EA8A 1O97D 4ZO7A 1JLHA 4DDUA 1V4NA 5IKEA 2GZMA 1RZRA 4O3FA 4UU1A 3OEWA 2VK2A 4GLOA 5HYVA 3HH8A 5LQAA 3V1MA 5FIUA 3KSAC 2PJDA 3T0FA 5KC9A 3ZD6A 3T1OA 1PGNA 1FDUA 4GQIA 4TZKA 6PFKA 3S70A 3O38A 1IQ0A 1MQAA 1SBTA 1ZRMA 2VH1A 3RO7A 2OV1A 5IXSA 3HVJA 3GEBA 3P9CA 4L2IA 3OHPA 2V4ZA 4EKIA 3ODGA 3O3CA 1ZUHA 2E6KA 2DF8A 2YRXA 3S27A 5HQTA 5BMVF 3DL2A 4M37A 3LPDA 1I4WA 2VHXA 3CH6A 1XVAA 4R5MA 4KMMA 4NCAA 2OCYC 3PJDA 1ECFA 5G0TA 3LLUA 1XEXB 2C20A 1OF1A 3QE2A 3N39C 1WXDA 2ZE7A 5FUWA 1T91A 1MNAA 4QASA 1Q0LA 4I4TB 3GLQA 1X9GA 1OH7A 1RHUA 3IYLW 2VPXA 3KCQA 3GT3A 3F6YA 4GR4A 4J9UE 4JHLA 1TD9A 3UV7A 1VL1A 5BUCA 2VP2A 4O4HB 5FADA 3M5PA 3WSTA 4CKBA 4XDZA 1DO8A 3VVCA 4KR3A 5A9SB 4MW9A 1C1YA 5KNDD 4LOJA 2P2CA 2WG2A 2WB4A 1GZ6A 3S2EA 3W2IA 3B48A 4Q24A 2ENUA 4Y9DA 2JLBA 4HXYA 4HDAA 1J1IA 2Z3VA 4TL7A 4EYOA 2OXFA 4ZHQF 4E2WA 1S9DA 2CC2A 2QX8A 1Y1PA 3KHSA 4YRDA 5D6NA 1EU1A 3IEIA 3W0LB 3GP3A 2BFOA 3PPWA 1QJ4A 1YMVA 1CZHA 1N0WA 1RRVA 2R87A 1M0TA 3BVPA 1QO0D 3SDZA 3ZK8A 3G68A 2YR0A 3SJUA 1X94A 2CEAA 3SHWA 1EESA 1IJBA 2V7XA 3RYTC 3OE7A 4R41A 2J1LA 4OH1A 3BL8A 3IS3A 1YVUA 2DRIA 3SX0A 1H9BA 2IZ1A 4C89A 5CHYA 8MHTA 3A3KA 4C78A 3ZHOA 3K0CA 2QPOA 5DM1A 5EIBC 3KEGA 3NYIA 1A1SA 4IUDS 4TKVA 1PGQA 2CHUA 3D0OA 2WTEA 3LI2A 3QOYA 4ZYVA 1A2KC 4UM9D 3CKKA 4JKIA 1O5OA 3I39X 4BNDB 3ML1A 4DA6A 4W9RA 2COEA 2QM7A 3TAHA 1DKRA 1VI5A 4OMFG 5E0KB 1SGWA 1PZGA 3SICE 3UMRA 1KDOA 3UTDA 3ND6A 3WSVA 3ZD7A 1TQ6A 5L7WA 3RUCA 3SZUA 3BWMA 5T57A 5K2OA 1MO4A 5LMZA 2O2HA 4HD8A 2C8JA 1N6OA 3K73O 5KYYA 2J5BA 2PVPA 2ACWA 3OJFA 4XTRA 4YJ2F 5CVUA 2GA9A 4Z7OB 4KITB 4DJ5X 5JY6A 2CVQA 3NALA 4ALNA 3LJKA 4XZ3A 4NNJA 4AO8A 4QRHA 2VH5R 1EVKA 2BFFA 1WETA 1JT9A 2AB0A 3MTGA 3NV7A 3OCUA 2YQ4A 4HWSA 4N47A 2GJ8A 3ESZA 2BWJA 2XWQA 2ZJOA 4UCXA 1U63A 2BM1A 2EKZA 3HP1A 5D6OA 2C1ZA 5EJEA 5M29A 1WUHS 2JJ1A 1SKYE 2QPTA 3CPSA 4HXEB 4R9UC 3AX6A 3CUVA 3ONVA 3CUUA 1E7MA 3IE1A 4O2LA 1MP0A 3OJXA 4JBIA 4JLSA 4AP6A 1JG2A 1I5OA 4ZARA 1OXVA 3WHKA 5I3CA 4CM9A 3IAHA 1P5HA 1G42A 3VO8A 1DIBA 2W98A 4Q9NA 2A7XA 3I9KA 1AJEA 4UEKA 5BVHB 1J2RA 1SCAA 3IQFA 1DOAA 2G0AA 3WP1B 1ZGHA 4UDYX 3B9QA 4TT3A 4WBSA 3RSCA 1HG0A 4OQZA 1T3ZA 3WIOA 3P5SA 4M0PA 3A2NA 4WTOA 2C98A 1MRZA 2A94A 1U98A 3QVTA 4L2IB 4LA4A 4F4DA 3MWDB 4FFBA 1XTRA 1AXEA 3A11A 3DHNA 1SM4A 5AHOA 5D5PA 3A9TA 4BBPA 5CFOA 1L7OA 2XQKA 3EGEA 4MUJA 2BLLA 4GF5A 1MJGA 1TUBB 3DTVB 4QD3A 1QV7A 3G7SA 5L3SA 5JCXA 1THGA 5C5IA 1YUBA 1C3OB 4ZMBA 1AK2A 1FYFA 1NLYA 1R5NA 1NM5A 1QLHA 3V55A 2INGX 2JHFA 1E1QA 1U8TA 4Q0MA 4RLQA 2HPZA 3PWTA 3F7TA 1XZDA 1MVLA 1ZCJA 2IITA 4LYFA 4MQUA 4OY3A 1N1MA 2PDAA 1N5JA 4Q9IA 4CKBB 2GPSA 2PH3A 1U2DA 1FFSA 2QT1A 4D45A 5IU6A 5CCXA 2XB8A 3I3SR 1ZKMA 4KKVA 3D2BA 1FB5A 2ZAYA 2HCTA 3I92A 1DZ3A 4NCJA 1X3LA 1PBTA 4M0UA 3AJAA 3VKGA 1MX9A 1ZXXA 4BNNA 1ABFA 4NZOA 2ODWA 3L7JA 3QNMA 3M1AA 3NQ41 1RQPA 5FL3A 2UZ4A 3DMPA 2QGFA 5LYJA 2IDJA 2J0VA 4IHKA 1R7RA 3EVDA 4RHUA 4LF8B 3PI6A 3U3MA 7REQA 2I3ZA 5F7JA 5H3LA 2BI8A 2O0MA 3KAQA 4M8IA 2AYXA 1NRIA 3Q7QA 2R11A 4J9VA 2QENA 1K97A 2WM9B 3WDMA 4K9MA 2BZ0A 1YMUA 4ZIRA 4LF6B 3P7MA 2V97A 1XX6A 2OBYA 3FDXA 1CUWA 1IRXA 4CUZA 1P74A 3HUFA 3KYBA 3ZV5A 1KI8A 2CDAA 4BKRA 5K8TA 3B6MA 1W6UA 4KDFA 1QLWA 2ASEA 4TKVB 3TIFA 1TZ2A 3P9SA 2JCVA 4ESOA 3OQHA 4G4SO 5E2AA 3C6ZA 3ICWA 4BNTA 3STTA 4EY4A 3K0CC 5BQ5A 3I2GA 2ODPA 1IHOA 1WHSB 4XW2A 5CNIA 3HBMA 2OZEA 3NM5A 3I62A 1L5MA 3KG2A 3JAWB 2Y77A 1QIMA 4HEJA 3ZE8A 3J81A 1XRQA 3TCKA 4LISA 2HSJA 4PC2A 3GCXA 5UKDA 1PIWA 1CJTC 3IT2A 3ZWKA 4R0VA 2AR7A 3OZXA 3BWVA 1NQUA 2IIVA 2D59A 3G9ZA 4FEEA 4XJXA 3UEOA 4YT5A 4CI0B 4OX9B 2H1IA 3K9CA 3ZBQA 1C0PA 1UKBA 3H2JA 1CY7A 8GPBA 1FX1A 1BWRA 1RI3A 1VI2A 1GLGA 5BQXA 3WK6A 3AILA 4A15A 4UM7A 3A25A 3GEGA 3KQWA 1QQ5A 4TXJA 1NU8A 3BFPA 421PA 1MC5A 2WRZA 4Y2TA 3OQJA 3SVZA 4JJKA 3VJKA 2FEXA 1GN9A 1GUBA 1TU4A 3D3WB 3WIBA 3PXGA 3PENA 4YUXA 4QXOA 2R60A 1AT1A 1K7FB 1TE2A 3W34A 2JIPA 4AJ9A 2ENWA 3B1VA 1E3WB 4AJNA 3GEEA 1NVUQ 3NBAA 3CVVA 3VYTB 1SXJE 3ONEA 1TZJA 5GIOE 1FP6A 3HJCA 4KNVA 4PVDA 4RNDB 1M2KA 3TCXB 2NW6A 4I9FA 2BVNA 4EG5A 1ESEA 3CO5A 2QL7A 3LFHA 1M5TA 1M7GA 5LOVF 3FWHA 2RKWA 3CR8A 1KQFA 3PHBE 1FA9A 1J00A 4RELA 3ZDEA 3ZUPA 1DKMA 2DFKB 4IKPA 2JIZA 4JWKA 3OPNA 5ALXA 1JKIA 5ITZA 2I62A 2HNKA 4Y2JA 3ONFA 3CKLA 2WF6A 3CWCA 4I4LA 4GR9A 3JSXA 3VPXA 1PUXA 1YU9A 2OUKA 3ADOA 1NQOA 1T6ZA 2QLLA 2J9GA 3EOZA 3VZRA 1HEUA 5DNEA 1GG8A 3X1DA 2GCOA 1TQDA 3H2KA 4NHOA 5B58T 3O7MA 1NWHA 4JN6B 3P9RA 2RKOA 1KVUA 3I6BA 4JWTA 1GU0A 3CVWA 1XP5A 2VATA 1C0KA 2X77A 2Y1XA 3AF3A 4J3NA 2P2SA 3MLEA 4CMCA 1YONA 3AFHA 1NM5C 4NK5A 5JAHA 2EZTA 2P9FA 4H08A 2FW0A 4QTTB 5GPBA 4MUFA 1EDOA 2O7NA 5LLSA 2JFVA 2ZAIA 1RW4A 4LZWA 5BW8A 4AECA 4TWJA 3B1KA 5DHUA 3K70B 3HPRA 1JSLA 5B53A 1G2IA 4HAZA 4DW8A 1N77A 1QRUA 2R8BA 3W5UA 1GNPA 2C29D 1U2DC 5HKOA 1P7PA 4G0ZA 1LBQA 4MULA 2IKSA 3ANSA 1X13A 2WM2A 5HQ3B 1MOQA 3L1KA 3EASA 5DYWA 3SXUA 1D9ZA 5A7HA 3VZCA 2CVOA 4XIFA 2EJBA 5E2IA 4UUPA 3ZE9A 5CVCA 4IF6A 1N4AA 5JAMA 5KSZA 2A1TR 5T5QA 3PLAE 4DJDC 2WAOA 4EL5A 3ZVRA 2FFRA 1T1GA 1WMBA 3QLUA 1JEJA 4FNGA 4UBIA 3GEMA 3DEAA 3SP1A 1W59A 3JZAA 3OFNA 3LM8A 3HYSA 3PVCA 4JEUA 1GPYA 4FR0A 2C7PA 1SCIA 5LP6A 1V7ZA 1NYTA 4MGEA 3D8HA 3EWAA 3F6SA 4JR1A 4EHAA 2WJ6A 3MGAA 4R1NA 2HLPA 1GO2A 1RHMA 2JZOA 3MQFA 4BMDA 4WBNA 5I47A 1I0IA 3FRJA 5BORA 1ZN2A 4B85A 1AXRA 4HK4A 1QOZA 4OGLA 5DKFA 4US2R 3NTLA 4LXUA 1G5TA 2ZIUB 5ER6A 1T3GA 1BN7A 3ZDAA 5TPWB 1KO1A 5CCDA 2ID8A 1IWBB 1BFDA 1N6NA 4MUGA 1NT4A 1G8KA 2PT5A 5EPOA 4O1IA 1EX7A 3A0UA 1XFDA 2IZZA 4W5HA 4AKTA 4DIKA 4ZYWA 3DCNA 3T7IA 3BXEA 3I9MA 2VCEA 4QIHA 2C2WA 2O06A 5B4UA 5LWHA 1GADO 1CC1S 3U39A 1DCMA 1CNMA 1OW3B 1P1CA 3G5UA 4UC0A 4UVGA 1GUYA 4QYIB 4RFSB 1BO6A 4OHZA 1TA4A 6REQB 4G5HA 1M34E 4GMKA 4MIOA 3L1JA 1IU9A 2OCAA 4CCYB 4OKSA 2Y05A 3EVZA 3D6NB 3WXMA 3JATA 4B2YA 5I4BA 5GM1A 2ZRHA 1VLZA 1ZM3A 2UVPB 3SC4A 1H93A 1P8JA 2AJLI 2C4TA 3FOAA 3G7NA 1LH0A 3HSYA 3IOMA 3Q6IA 3LHFA 3FRIA 3GFPA 4D44A 3D7MA 1L4GA 3AFNA 3IOEA 1V25A 2WJVA 3C43A 2FEOA 1LLCA 2J45A 1PU2A 2I65A 4ZZIA 1IOZA 1BU5A 1D1QA 4OAQA 4G9BA 3N8NA 2P1DA 4YP9A 3DAGA 4RMJA 3FCAA 2APJA 2D7DA 1LV8A 4ZD6A 1OILA 3UVEA 4MKXA 4CM1A 3K09A 1P1BA 2OL4A 1ZNXA 2B1QA 4JMPA 2DWOA 1HG1A 1Y8RB 2OG1A 2PUVA 4J16A 4Y0AA 5I9NA 1C9MA 5L4NA 3ZK9A 4PG6A 4I1UA 3PNQA 4CQMA 2QXYA 3ICQB 1VJRA 2J3HA 2O50A 3FWYA 4ITVA 4TV9A 121PA 3MFQA 2WAAA 4MA4A 4FPXA 5IARA 2DFNA 1AKYA 1LK7A 2P75A 3H84A 1N3LA 3NGLA 1L5OA 3KQPA 2BC9A 2GCOB 2O7SA 4HWKA 4X1YA 4BN4A 1LS1A 4EDHA 3RJTA 2IXEA 4LI0A 1T6BY 2X2FA 3EG5A 3I52A 5AW5A 4B6GA 4RMNA 3BERA 1J5XA 1TRKA 1R6UA 1XAHA 3ELUA 4KV7A 1BGWA 1P0MA 1TUIA 4K6MA 4ZAVA 1SZJG 2PGJA 2Y1LA 3BJEA 4FB4A 1DT5A 4PPFA 5LN1A 1X8XA 1XEWX 1DC4A 3KKEA 2IE0A 3DT6A 4YP5A 4KQHA 4H7JA 4MLPA 1QVAA 1GCAA 3S29A 2RGAA 4R0NA 4I3GA 3ZGYA 1TF2A 1I5RA 4S1TA 1VDZA 3WJ2A 1FYDA 5JVDF 4UUAA 5JXHA 1CJCA 3DC2A 3VDNB 1U7XA 1Z0DA 4GRIA 1X2BA 2FEAA 3HO8A 2Y1FA 2FF7A 1JW9B 3PGLA 4Q3EA 4TSRA 3WLFA 4ZJPA 5EJFA 3SXUB 4MS4A 3R3YA 4L74A 3TMKA 5KNDH 2ZKLA 3G6WA 1KI1A 621PA 5CM8B 5KDOA 2V3VA 5GIPE 2C9OA 3UJ3X 1KL7A 4R1MA 5FA5A 1JAZA 1SVIA 4ZJUA 3BILA 1SKAA 1QQAA 3A4NA 2PUWA 5DN6A 2RGUA 3ZCQA 1C7ZA 1DFHA 5MGBA 3W5IA 1IBLB 3I8OA 3JW8A 2ZRDA 1N2OA 1NE2A 3IDZA 1W88A 3QLUC 3R6LA 3AVYA 2QHXA 1E0AA 3ETNA 5AHWA 3G2IA 3RIYA 3B3JA 4J6EA 4DR4B 3QOFA 1X7YA 4G1UC 5LBIA 2GZHA 4XYGA 1QWOA 2FMKA 1CY0A 2VPWA 5G2OA 4NBWA 1SN7A 2C4UA 1WS6A 2NQ2C 4WVFA 4Z3KA 4WBNB 3OLQA 1VG9B 4NBUA 5LP6C 2WHPB 1ZOSA 4WY5A 3BZUA 1UMKA 1KDYA 3IKVA 1GCUA 3WZ2A 4HN4B 5KIAA 1RLIA 4G5SA 4CLXA 3L0DA 3F47A 3UM9A 2GF0A 1C3JA 2IUSA 3CH7A 3CW2A 2Y0PA 1YBFA 3ZI7A 4LRSB 3SNKA 4Q9JA 5IKXA 4N41A 4HNHA 1JXMA 1QNFA 3RHTA 3GAFA 2IH2A 4WK0B 4QQKA 3B89A 2JI7A 5DNYB 4KFTA 1CUUA 1A97A 2A9JA 2JJYA 1E79D 1H9AA 1FNBA 1ODKA 4HN2A 1J33A 5DX0A 3CR7A 4F3KA 1PFVA 1QJCA 5CURA 2EJWA 4LYAA 3ADKA 1MRSA 1RXSA 3H1AA 4G37A 2E0IA 4NMMA 1CZOA 3NKFA 1B0PA 1V8ZA 3IP6A 4GM1A 1BDMA 4IJ6A 3VR3D 3RRMA 4O59O 3BRQA 3JATB 4PS0A 3QY0A 3JD2A 5CBPA 4Z4IA 1DC7A 1HY3A 3A32A 4L75A 4NF2A 1AHPA 2HMYB 1TAHA 2NVUA 4K3VA 4RA9B 2IUYA 3RFUA 3SC6A 2EDCA 4QLAA 3M1IA 2AV6A 3TW6A 4DC9A 3CNNA 5CH3A 2A57A 4W1SA 1WM1A 4FDLA 2P6RA 3RPEA 1S8AA 1HE3A 1QO7A 5KPJA 4O4JF 2I4TA 3C4VA 2IYPA 2GPBA 2KYRA 4DDWA 3IBSA 2JK1A 1V48A 4HMPA 1XA0A 4MVJM 4D3XA 4Z6KA 4AKIA 1E3JA 1WU8A 1E99A 4JR2A 4WKOA 3RSOA 3T38A 3KR1A 1SPBS 4XD2A 5JZ9A 1P29A 5KVCA 1FDRA 4O8ZA 2N46A 3E9MA 3PGMA 3G6KA 3ROEA 3TJRA 2XUJA 3QSYA 1Z82A 3OM9A 4MYCA 5PGMA 4HUTA 2OK8A 3BCUA 2FGKA 3K09C 2ZRBA 4TV9B 3NVMB 4W82A 3X3HA 5BWCA 2EV9A 2PGOA 4J16C 1DX4A 5CFRA 3GF4A 3RSSA 2QJOA 1MO3A 3L84A 2JLYA 3Q8WA 2BE9A 2GHQA 2XQGA 3GI1A 5EP1A 3LE8A 4BFSA 5HWSA 5JHHB 1U81A 4P5PA 1L7PA 1A5TA 1JLLA 1YNOA 4F2PA 3T7JA 3WBKA 1JG3A 4DQUA 3ZUGA 2W2VA 4KODA 1BSVA 4M60A 3HCPA 2XA9A 5G1OA 4AMVA 1A88A 3CQ9A 2VP5A 2VK8A 3MUEA 3GH3A 4A8JA 1JYSA 2GLUA 2I71A 1LPNA 1Z22A 2XQFA 1WIWA 2WTUA 2FFBA 1P0CA 2OB2A 2PX6A 2ZJ5A 3U60B 2G7MC 2V98A 3NBXX 4X97A 3ZXIA 1XZMA 1C7JA 4X1KB 3HEMA 2G9UA 2AW3A 1CQIA 4HDRA 2NZWA 4LHEA 1DL5A 1HK7A 1FFGA 1LBTA 2RCNA 2WFMA 2ZJ6A 3C87A 3DL7A 5K03A 4DBLC 2ZYDA 3BZBA 2FRXA 3PD0A 5GV8A 2GBIA 3CCCA 3ICPA 1RM3A 3IUSA 5IXYA 1LWNA 3HVIA 3HYLA 2WJJA 4BO4A 3U16A 3C5WP 4U6SA 3R23A 1DKOA 3UCFA 2CJYA 3ST7A 1ISMA 4JDUA 1N9KA 3GFBA 4KU4A 5FTJA 1AMNA 1YH3A 2FP4A 2VNAA 4FW8A 4C08A 2DBRA 2IRWA 2VLBA 5FBWB 5IULC 3CZ5A 5DLEA 3ULKA 2H2WA 1E60A 1CY1A 1W88B 2OKGA 4AFNA 2UZAA 4ZCTA 2C5FA 5F5XA 2P2LA 3FYTA 1OWPA 2ZE8A 4MUBA 5NULA 1X7YB 5LU8A 5JANA 1OH6A 1OH5A 3EUWA 2VRCD 4LCEA 4GS5A 1Y8AA 4I1OA 3HA7A 5A05A 1YB6A 1IN8A 4IXDA 1P4AA 1AM4D 1TEVA 2W48A 1GRQA 1NVBA 1RI5A 1DIGA 2V6FA 2WF9A 3I12A 3PC6A 3T9DA 3W7BA 3ZEIA 3N07A 4A2QA 1XLTA 3Q5GA 2V03A 3CXUA 5IJXA 2XNKA 2GPYA 4DOMA 4U5XA 2GHRA 1K8ZB 4M76B 2EFYA 2QIOA 5IDYA 3DE1X 4FINA 4JKOA 4PZZA 1THTA 3IQIX 4X85A 4RSRA 4ZOLB 2BW0A 1K7EB 3IDFA 1XMSA 3NP9A 4EG0A 3ROGA 2RAPA 2GFQA 1LPPA 1NW7A 1HDCA 1T4CA 3K0KA 5E1OA 2NOAA 5KDDA 1ZR4A 3PI7A 3IEKA 1JWAB 5J40A 4EPVA 1PI3A 5KJCA 1L0BA 3KZOA 3NHJA 1OFGA 4Q9KA 2IHYA 4P32A 4PXAA 4DJTA 5AICA 2YJZA 1RHRA 2D00A 4KXNA 2ACVA 5JEDA 4JEHA 2WZDA 2MTBA 2WMNB 2ZG6A 3THXB 2X7JA 5JZSA 3HXPA 5E6RB 1QDLB 1UJ5A 5H1YA 1GQQA 1M2VA 3N2KA 1MXHA 5E95A 4IQ4A 3TFWA 2O14A 1HOTA 2K7ZA 4NICA 3V1YA 3DFKA 2WJPA 3A8TA 1DXQA 1G3UA 2PGDA 1GNRA 5JIBA 4BWGA 5A04A 4PLFA 1Z6AA 3DXZA 3LECA 2I22A 2YYYA 2FMXA 1JIQA 1T0PA 4X6XA 3LC2O 3C3BA 1NMXA 2JCSA 2PAFA 3IUJA 1P2VA 2O3RA 3E9QA 4OHFA 4K88A 3KVRA 3UB2A 1SWVA 2CNLA 2P0YA 2H4ZA 1NI4A 3V2GA 1NJSA 1I9CA 1NVWQ 1PN3A 2I8CA 2H4WA 4JBHA 1HKHA 3WK7A 3IIIA 2Q2OA 4F9GA 2A9FA 4JP1A 3IRVA 2Q50A 5F73A 2ZW9A 3EUAA 4CV2A 4FYHA 4MV4A 2WWIA 2B5VA 2Y1CA 3C5EA 4MLCA 2V1UA 1YOVA 1KE1A 3H5OA 1P7ZA 4RDHA 1LDGA 1BE8A 2P35A 5C53B 4JLWA 5TEWA 2JFBA 3I2YX 5AVVA 1AF4A 1Z4OA 4KLCA 4URFA 4R8SA 3U0BA 2AC4A 1GGHA 4MB2A 3D7NA 4TKUA 2ZQZA 2XZPA 3P9KA 3IMGA 1Z0JA 3E1SA 1YC5A 3FVTA 4AMGA 1G9TA 2P9TA 4X5OA 2NNWB 4ZDWA 1U9CA 2C2BA 3EBPA 4A8JC 4C22A 5KC8A 5AW8A 1CQIB 2BSAA 5L6LB 5ADUS 1Z5VA 1DAHA 2RB4A 2XDAA 3GN1A 4WZBE 5IJ0B 1TQ2A 2JJMA 3EYAA 2EQBA 2VPQA 2BMDA 3AHJA 3TLEA 1MOSA 5TQJA 2QLTA 4MRMA 2Z2IA 5CXUA 3SD7A 2Z0MA 3L4KA 4IKOA 1OI2A 2G80A 1P9LA 2R2GA 1ILWA 2V8OA 2XHZA 3BGIA 5CK5A 5JT1A 4DV5B 2ACKA 4J0GA 5SZKB 4JV5B 1PRYA 1RC8A 1G6OA 3R6GA 1ZHOA 3U1BA 5IM4A 5L3ZA 4DV0B 3LBYA 3QYJA 3T7AA 4MRRA 3K1TA 3P4YA 5DP2A 5T4BA 5HNKA 5KMGA 1QOPB 1U0LA 3D5EA 3DT9A 4OYLA 4EFKA 5BVGB 1BKSB 4L6CA 4B76A 4AN1A 4B8ZA 1R4AA 3SM9A 2AE1A 4Z86A 4FR5A 2D5LA 3OQ1A 4I46A 3RAGA 3UJCA 5I01A 5JAOA 2ZS8A 3FFXA 2VJCA 5CAEB 1OROA 4N9WA 2AT1A 5KTRA 1TEXA 4J4BA 3D3EA 3MWEB 3ZXSA 4MIEA 1DTEA 5JARA 1J5EB 3PPYA 1XN4A 3H0KA 2KSQA 1M5UA 2R8RA 2RAFA 3X1MA 3PFIA 2D54A 4RQUA 1QFXA 2R8XA 3AWIA 3OVMA 2EATA 3L46A 3AUUA 5JYEA 3GQBA 2BGJA 1XLTC 1RRPA 2F9MA 1NQAO 3QSGA 5EHIA 3TKYA 5FOUA 1T4CB 3DZKA 3LPMA 3I9V1 2ZUSA 4U7HA 3GUCA 1G55A 2AG6A 2IT1A 4RACA 1TJPB 4PG4A 1ISHA 4Q7MB 2PH1A 4DIBA 2NLOA 1IAQA 4O4LA 1U7OA 1XMOB 3AW9A 2FEKA 2HHHB 1CU1A 4Y2YA 3HUDA 3LYLA 4ZXPA 1S8FA 3S2UA 4E13A 1KXZA 3U6BA 1WCWA 1NF3A 1NHWA 2VK4A 4HH1A 4IJ5A 1MZVA 4A8PA 1H2BA 3Q7EA 1NZJA 1YBAA 2F64A 3PQ2A 2RE8A 2VJDA 1F8XA 5ALDA 3QENA 3SMQA 3ZXUB 2OBFA 2ZUTA 3H5VA 4CDGA 3CEJA 3IVXA 2P2NA 2V45A 3RGWS 2UV8A 4IDPA 1G2QA 2VQSA 3MW8A 4XGRA 2QAIA 2X8WA 3AHEA 3LK6A 5KDLA 3ZHQA 1DFIA 1KKUA 1RWKA 1Y33E 3OU7A 4G0XA 2QJTA 3C8DA 4NYJQ 2QNIA 2VCHA 3KZ1E 4J0EA 1NV9A 1NI4B 2BGMA 1XEFA 3CCFA 4WNYA 5H3HA 4DIOA 5G41A 1QIJA 1YDWA 5IVIA 3TVTA 4ZT4A 4CJXA 1F2UB 4U6NA 3OCCA 2HMAA 2CFSA 5D1HA 4BMCA 3PITA 2XX3A 4DMMA 2V59A 3BZWA 4M98A 5EVJA 5BSHA 1O57A 4W99A 5BQOA 4ILEA 4C0XA 1B76A 5DLYA 3KJIA 4AJLA 3OTIA 1Z5NA 5HCIA 5JSKA 3DZFA 2DFPA 1CKEA 2BD0A 1Q1BA 4UPVA 3LY8A 3DVRX 3RUDA 2QMEA 3QBVA 1OXKB 5KO2A 3JD0A 4KN9S 1JQLB 2HK6A 4CCAA 5AI9A 5F3WB 1U0NA 1H2HA 1SKBA 3A9UA 3MUNA 4TKUB 5B5SA 3B1XA 5GQSA 3EEOA 2F00A 1AN9A 3TI7A 5J47A 2R1TA 5DIZA 4ID3A 2ALJA 1E2LA 2Z56A 1OSNA 1I0LA 3BMCA 3L7AA 2GCGA 5AESA 3QU5A 3QE3A 1LB1B 4LYYA 4Q3NA 4LGYA 1OLSA 1QIDA 5F2NA 1ACLA 1I2MA 3CUYA 1H2ZA 2IV3A 4FYJA 2RHLA 4HT3B 4TM8A 3NDRA 4QLBA 3P19A 4TV8B 2CDRA 3P0FA 1KAOA 4XLZA 1O03A 1CF2O 4MUKA 4MRMB 4BBAA 3D6UA 2C7RA 2DQ4A 1E4YA 3AONB 3E48A 3WLKX 3V4LA 2L2QA 2JD2A 3IODA 4LJAA 4FDMA 2JH9A 2Z98A 1Q0SA 4QTXA 4DIUA 1GP2A 1N5OX 1SO8A 3U7IA 3CLVA 2FPIA 2PG3A 3PFNA 4PZDA 5FLEX 4PTLA 1QPBA 1UKZA 4XVHA 2X1HA 4OQPA 3MRXA 2AQIA 2ZIXA 3GGCA 1Z2NX 4Q9HA 1N2ZA 2BCEA 4PONA 3ZHRA 4RQAA 5KMGB 4ES6A 4B3DA 3MJRA 4UTRA 3ZS8A 4DBZA 1FRVA 3E6AA 1CE8B 4GOOD 3X2FA 1RLUA 4BJ6A 1L4UA 1B73A 4BWFB 4E22A 3UMFA 3WJ7A 3IEMA 1VXOA 3I04M 3Q8LA 1X7DA 3K31A 4UE3S 3EXIB 4H17A 1HE8B 2C0CA 4Q9AA 4YRLA 2GCPA 4ZVRA 2ZRGA 3F5SA 1C50A 4JCCA 5DI3B 4Z4HA 2J3EA 3L9XA 3WWCA 1ZMXA 4BX9A 4Q4LA 3E35A 4C14A 2GCIA 2I4NA 4WESA 4OPMA 4J1QA 4GMDA 3FCEA 1VMKA 3VNAA 2QZPA 1JHOA 4RA6A 2Q0SA 1EGQA 1VQ1A 2BHNA 1NJFA 4MCHA 2NXNA 3ZDYB 3LWBA 3R20A 3KOZA 4UXJA 1GZVA 4IS3A 2IUUA 3OQ6A 5CLJA 1EM8B 1PHPA 5B3JA 3TB4A 1QRTA 1Q0PA 1X1RA 3QFFA 5ICSA 1L4HA 1JDBB 1FVFA 2LP4Y 2PQMA 5LBTA 4BNMA 1R18A 4ITRC 4O4LB 4PN7A 3CZAA 1JQ3A 1R9MA 1T2FA 1LDNA 2BFCA 5DOZA 3A04A 3DDHA 4MUMA 1DX9A 4QUJA 2FAXA 4ASUA 3ASZA 1JDBC 3LCJA 1EBUA 1PX2A 4BKMA 4YI5A 3IAAA 3CM0A 2VBGA 4X1IA 2JEZA 3RU9A 3MN1A 4UE6A 3IUMA 1EM6A 4Q4CA 2IIQA 2FZGA 1OFUX 1NV8A 5JBQA 3AFOA 4ZEVA 3DZCA 4I9HA 4E32A 1M72A 4ROSA 4QNNA 4ZZ2A 3O8OB 3ZCTA 1ETUA 2PX3A 3DCJA 3GCZA 4DMUB 1NONA 1TZCA 3PVSA 1YB5A 3GZJA 3KQSA 2IDZA 4ZTUB 2H16A 1E3EA 2VVTA 3ZV3A 1GSAA 1JYFA 1RJGA 1EFTA 3CRZA 3SSAA 1R64A 2HSZA 3OIGA 4GLJA 4IV0A 5EIFA 3TZ6A 4CTJA 3F6CA 5BOSA 4M8SA 2FU5C 4NIMA 2HWWA 2IHUA 4B1FA 2H0QA 1X1BA 4CEIA 5AUNB 4TTPA 3V1UA 2QMHA 2QRNA 3E27A 5KEIA 1M83A 4M9QA 4MROA 3RR2A 3OF5A 1KBOA 3ZCSA 2E18A 5IUNC 1A98A 1KJWA 2ECQA 2W58A 3QWHA 4A0SA 4BFVA 3PTAA 3UGJA 3EY9A 1W2WB 1MO6A 1P19A 3TUJC 2V7TA 5J5AA 1UBFA 2XV1A 1XAJA 4RCVA 1XDDA 4Q7LA 4GPEA 5ECYA 4MUNA 5JS1A 4YAGA 1OLSB 1HFWA 4G25A 4HQFA 3L7BA 2VDQB 1B7GO 4DG5A 2HIHA 3AVWA 2WA1A 3IA2A 4TTTS 3NT2A 1NZDA 1DMRA 3GLUA 3C1TA 4A23A 4XB2A 4CI9A 5AK4A 1ITZA 5A7GA 3GEHA 3HR7A 4UHJA 2PFSA 1DEHA 3AR9A 4ZQBA 1LDBA 3OOEA 2FPIB 2GARA 4MX8A 5DNCA 3DR5A 4MVWA 1FMTA 3JYLA 3KQOA 5DCWA 3LCVB 5TB5A 3SR4A 5A06A 1QAOA 2EHJA 1JJ7A 2ZIXB 1CXZA 2GAAA 3AXSA 5IJAA 3M6UA 5EJ6A 1G38A 2F3QA 1A5BB 1HYHA 2NVBA 2AD1A 3JRWA 3PSHA 3VSEA 4A10A 4AUNA 4FX5A 1YHNA 1WZUA 4POAA 1YTUA 3NFYA 4QEZA 4G0YA 4P2GA 3DBLA 1PQUA 3NBUA 4J1NA 3FAZA 4DLYA 4N1AA 3PE4A 4ATNA 1KTIA 1ELOA 2NACA 2QVZX 4FYMA 2ZI3A 2IGBA 3L7MA 2QUJA 4HB4A 1VG0B 4YRKA 1GWNA 3QKSB 3URMA 4R1UA 2I4OA 1RTTA 2PNFA 5DRTA 3CUSA 2OXIA 4OI2A 5HUJA 5HKLA 1DAKA 1KWKA 4AKHA 5HCUA 4WESB 3RU2A 4FZJA 2X9VA 3L79A 1BDJA 2XEDA 4RMGA 1A27A 5IX8A 1K3UB 4PV7A 2VHTA 1EFCA 4F06A 3IQZA 2R4QA 2M6KA 4Q4HA 2NZYA 1WZ2A 2R2AA 2C84A 4YUWA 3ZY6A 1UZAA 2WT4A 3BA1A 4QEDA 2D5CA 1NVAA 2NPOA 4ALIA 1BH2A 4QREA 3QE9Y 3HE3A 1CCWA 1NOJA 1QTNA 4HWRA 2TMYA 1T5TA 4GEKA 2V65A 4PGGA 4UUOA 1BE0A 1NXWA 2W0SA 3CS3A 2F3UA 3TFQA 2VP4A 2Z95A 1CY8A 1PNQA 2QG9A 4OJYA 1W5SA 2YJ3A 5EL0A 1TQ4A 2CVZA 5B3JC 1ONPA 1SEVA 3KVOA 1PWYE 1WL8A 1I4LD 2DUJA 5AM2A 4X1IB 1T5BA 3OFSA 1VSUA 2D5AA 1H8EA 5J1TB 1JTVA 1COZA 4FK8A 2F55A 4L5JA 2G0NA 1E1YA 3AU8A 4JGIA 4BTEA 3NTVA 1H4VB 1NI5A 5H3CA 1FP1D 4F11A 3AUTA 2ZTSA 1AHIA 3KQUA 1G41A 3O93A 2QN6A 4Q7KA 1JKJA 3FHTA 1W34A 3QV2A 3HUUA 1RKBA 4DEXA 3HHEA 1V8FA 4M53A 4RDIA 1SU7A 1SXJA 3TQQA 5BOSB 1U3VA 1YHYA 1VA5A 4ZT5A 2W6JD 4POOA 4IRUB 2ZU6A 2QLNA 2ZULA 4G26A 4UVIA 4CEIB 2W6OA 4YPVA 1KI2A 4JU9A 1R4NB 2XUIA 1OC4A 3WGVA 4KPYA 2XWSA 3H11A 3EC7A 3PQ8A 4EZEA 4G63A 1MGOA 4O63O 3EEQA 1HORA 1ZNYA 2QR3A 4KXFB 2DHQA 3ITDA 3TOVA 2PWYA 3M49A 3NONA 4JT8A 1O0SA 2P9HA 2ZBQA 3A1UA 2YZNA 4GXNA 2IHVA 3ZQKA 3SSOA 3JWEA 1JALA 4HTFB 3IT0A 3U48A 1CZUA 1M7BA 5MFPA 1PTJA 1UC8A 5JTTA 1YE8A 4X71A 1E4OA 1YFKA 4KQCA 3FLEA 5B4VA 2JBHA 2WJGA 4HDSA 4MQLA 3BOSA 3KZVA 2NUBA 3KZKA 3E7WA 1NNLA 4LXYA 4F6RB 2WKWA 4L6IA 6AT1A 4GKJB 2H7CA 3DS8A 2CLEB 3EQ8A 4MRNA 1P62B 2QGZA 1B3BA 2HMWA 1S1MA 3C1UA 4E5MA 1F38A 2QDXA 5I9LA 3MWKA 1JHDA 4IOKA 4JT4A 5B58C 1RC1A 2XJ9A 4C1NA 4LF5B 3M3PA 4HZGA 2FWIA 4CGYA 3H8SA 1GDHA 2CXXA 3JQBA 2J3IA 4BX8A 1RWOA 2VPYA 4D57A 1BU8A 5ICMA 1NY5A 2CXOA 3KTFA 3W2HA 3A1TA 3C97A 3V9AA 1YJAA 1NXQA 1QGUB 2TYSB 2O3SA 4PFKA 1C7IA 2GTPA 2VDVE 4GPAA 4MR9A 3SF0A 3ZYCA 2SKDA 4C07A 3PTLA 4QUAA 5K0TA 1IULA 1GN8A 1JQEA 1BWQA 1IN4A 3FLBA 3PUYA 2E6UX 1ZCAA 4FNOA 5ALSA 3CRNA 3WY9A 3F3MA 5E6SA 5BWLA 3N3BC 1TTPB 3ITEA 4YLEA 5GJCA 4HAXA 4RV5A 4BP3A 1FOEB 2PZKA 3L93A 4KWCA 2RG1A 5DK4A 5HCNA 1UC9A 4ALKA 1ZEMA 1U1IA 1ZQ1A 2FHSA 2KWIA 1ML4A 4J2HA 3JVDA 4EKNB 2P27A 4YMVA 1M75A 3STVA 4GOMD 3UMYA 2ZDHA 2WA2A 4O2BA 5AQEA 4BCDA 3E5NA 4HI0E 1G6Q1 5DLQC 5E7JA 5T4FA 4GL2A 3BMXA 1DJQA 1Q1EA 3ZW8A 3MELA 1FFYA 3KQQA 2IEBA 2J4FA 1MAHA 2PVSA 1VMDA 4OGKA 5LDHA 4QT4A 1YCDA 2PXXA 2EFGA 1STOA 2WU1A 1P2UA 3ESXA 4PYNA 3I23A 4JJAA 4Y2VA 4URYR 2PQ0A 4MAAA 1S02A 4C03A 1F4VA 3AR5A 1SUSA 4Z0HO 2XUOA 2W6CX 1IXKA 4B31A 4KHPB 1I7LA 3AY3A 1WAMA 1H65A 1K3TA 2X4LA 4BO8A 3N2YA 4BGEA 1RI2A 4C04A 1P31A 8AT1A 3GQVA 3V8BA 3VUFA 1AH2A 4GRDA 3L7NA 1NC3A 4LY6A 3SX2A 3ZR4B 2HLHA 4FB5A 2I7CA 3VR6A 1HUQA 3N7UA 4LAFA 4GKKB 5HQJA 1M34A 1B26A 3FFWA 3G5LA 4P35A 5IVDA 4PQFA 1QQ7A 2CUZA 2QN3A 1LRKA 2ZKIA 4F71A 2OYCA 1SQ6A 3GBVA 4AUEA 1II9A 2C5GA 1GT91 3M2PA 2OXCA 2PV0A 1JFRA 3T9CA 3TOSA 4YUVA 4AICA 5KTTA 2ZYGA 3LNTA 4V0RA 2YVKA 4QDXA 1QG0A 3W6OA 3PC8A 1JR3E 3IAUA 3P0HA 1ORHA 5HIAA 2ZM5A 4KSCA 3G2PA 1SXJC 2R6DA 1QORA 1TAUA 1I36A 4W5WA 4DEYA 4P5EA 3AM3A 3GRKA 5EINA 3U3OA 3FMOB 3BXOA 3W4IA 4DLNA 5KQGA 5AM0A 3KWFA 4R7TA 5FPTA 2QX7A 4AD8A 5KSPA 4KQXA 2AJTA 4MW7A 2BH9A 1Y1KE 1JAYA 4D79A 2QP3A 3S1AA 1PJTA 3F5QA 3LPAA 2MINB 4INOA 4XOUA 3OCVA 1L8XA 5JMTA 5BW5A 4HDSB 5JNLA 4QJIA 2VHJA 3BHJA 4G4GA 2Q0QA 3F5MA 4GXTA 4PC1A 4PPQA 2W70A 1B6RA 4BAGA 1PTJC 2YXPX 3KB8A 4IGIA 3H5IA 2GN0A 1PD1A 1AGXA 5KNBA 4MDEA 3M81A 2DXIA 2P6UA 1XIVA 1X1CA 4P08A 2PIAA 2YHBA 4UEWA 1DAOA 1JB9A 3NORA 4JBXA 1ZD9A 2IKQA 3E9CA 4K6HA 4LNUA 5CYFA 4CM6A 2BPOA 4ZV9A 2X1VA 1WO8A 4H1UA 4U2EA 3UHJA 3DXXA 4BZZA 4ZAYA 2I1QA 4C7MA 4C0BA 3D3JA 5CD1A 5DYTA 2IY9A 3ZDFA 4BU0A 3CUEF 2LZ0A 3P9YA 3HHPA 2YZ2A 1ZICA 1X3SA 2HU8A 3K16A 1DPFA 3JQBC 1EEHA 3HR8A 3SCZA 5BSVA 4JLMA 3SBEA 4AYXA 1EK0A 2P4UA 1T6XA 1J09A 1V3QE 1WHTB 3O7WA 4KAXA 1FZTA 2NN3C 1KVRA 1JA0A 3TNYA 1LJLA 4ENWA 3O4JA 3RFXA 1OFTA 3MMPA 3ND9A 3I64A 4MI1A 4KX5A 1N9ZA 2E4UA 4B45A 1O87A 4FCWA 3QMPA 2ZEJA 2G88A 5KCMA 1DFGA 3W4KA 1I3NA 4ER6A 1KJ9A 2X1MA 4UBMA 4I55A 4M0LA 3OQIA 4HGNA 4O2BB 1J99A 1FDWA 1SVOA 4KI7A 5DMHA 3ILHA 4JI8B 1KORA 1YRHA 4GBMA 3L8YA 3U7RA 1ND6A 1YC2A 4Q4JA 5KYUB 2EKQA 5DEIA 1QZUA 1JJAA 2OQ2A 4TS1A 1QRDA 1CWUA 1L5YA 2J48A 1TCAA 4FHGA 3HUTA 5A4DA 5D3MA 5DU2A 2GBLA 5FX2A 1RADA 2J7KA 2LCFA 4ILKA 4YRJA 4IQFA 1MJNA 3PR2B 3IH5A 2D2VA 3FPCA 4NTZA 4KUHA 3R9IA 1RZRD 1QYVA 3T4EA 5T4HA 4Q66C 2WTBA 1W581 1Z29A 3KFLA 4TMZA 3HTXA 2KMLA 4QXRA 1OZHA 3ER6A 1IWOA 1U7ZA 1UZNA 4HQ6A 4MI6A 4WZAE 3RG8A 3NHZA 1JE0A 1T3HA 1UMCB 1E96A 3HGMA 3Q15C 5C8YF 4LF9B 4NNOA 1WMFA 2W71A 4F84A 3DVAA 3OTQA 2I33A 3QF4B 1TJ5A 2Z43A 2FPOA 2V9CA 5L51A 1MQ8B 3IELA 4R40A 1SQ5A 1O4WA 3DTVD 1KSJA 4NE7A 3ZI0A 1SHKA 2CYBA 3E2IA 2F90A 3U6KA 1SUWA 2IX9A 1CS4C 4JLKA 4P3KA 4LQDA 1H1LA 4ZVLA 4CF6A 4BKUA 4DNQA 2VWHA 4DL9A 1PJ3A 1XI2A 2EGGA 2IXGA 1B3RA 3PL5A 5DW0A 4XIIA 3KJZA 2JFPA 4OXQA 4UDNA 3BM5A 5HF6A 4E5PA 4N76A 4YECA 1WUJS 2HT6A 2AI1A 2Q5LA 2JGAA 2RHBA 3PC8C 1N2GA 1PNTA 4L8YA 5E3JA 4CU2A 1G5QA 2VR1A 2NMVA 3KEOA 3CX8A 4EX7A 4EVRA 2DC1A 2G77B 2YWEA 1IHYA 1Z56C 3EFOA 3KZCA 4G07A 3ZWVA 1I4EB 1WMDA 5FTNA 3S1AB 2PY6A 3JS5A 2FX5A 3L0OA 3V7YA 5LQMA 2WFLA 3VNUA 1BCSA 1C4OA 3N2LA 4J03A 3GUVA 1RE1A 1PG0A 1UXHA 4EF6A 2DBZA 4GI7A 4ZN6A 2I78A 3SHQA 4TM7A 5LA6A 2JHPA 7MDHA 3FOWA 1KH3A 3GJ6A 3K5HA 5KNCA 3IL2A 4OM7A 1K86A 3BGVA 3FYCA 1AUQA 3LPLA 1O9GA 3OE7D 4IQ0A 1L5QA 5C7YA 1CYEA 4Q01A 2GF9A 4NZYA 4DKJA 3EMKA 3I9FA 2OCGA 2AOXA 2YVAA 3C4QA 3I83A 4BYMA 3STHA 1BH6A 2G5PA 3WNQA 4DMCA 2E87A 4DDMA 1IM2A 2VUTA 2A3RA 3O8NA 1W1UA 4FGUA 5M3BA 2FK7A 5CFZA 1GU7A 1WB5A 4E1AA 3SXJA 2MSWA 3NC4A 3IPCA 1G19A 1GPH1 2C3OA 2AQKA 3PUWA 1VIYA 3ESYA 5DXAA 3VV3A 3TDKA 5CVEA 4BPRA 4PR3A 2RGYA 1JAXA 2WUGA 3BICA 3FOCA 1QTIA 3L1HA 5DRYA 4IXMA 2IHJA 1H5NA 4U02A 4D92A 2IBTA 3FYDA 2A14A 1OBVA 1OWLA 5FL7D 1PK9A 2OWDA 3DW3X 3DYIA 3TPFA 3ESBA 1YQUA 2B2CA 4FONA 5LMCA 1GJRA 2F1OA 3TLZA 3X1WA 2OECA 4I55B 3ORSA 2QVXX 2ZTMA 2ORIA 3DBRB 4F97A 2QW8A 4AY2A 1F12A 1WLSA 1UJ6A 1OKKD 1V11B 2J0EA 1IQUA 4HB0A 4M0DA 3GLGE 4Q4JB 3NTUA 1BQ3A 4DNOA 3REQB 1Y1TA 3PYMA 3BG5A 4LWPA 5D3MB 4DLLA 3QPDA 2JJ1D 4X1OA 1UM9A 4JI6B 3GRVA 4OLBA 1KQOA 1OA1A 3T15A 3Q12A 4WLEA 3THYA 2JI6A 3IV6A 1XRRA 2JAWA 4MS1A 1X92A 3L5KA 4EFMA 4CLRA 4GR5A 1PFWA 1ESMA 3QJGA 5LU9A 4G8BA 4K9KA 4YRCA 1YQGA 1E4EA 5BSMA 5L7YA 3OZIA 2P9EA 1K89A 4JBWA 1RYDA 2JIQA 4HDNA 1VSVA 5FFNA 3PWKA 4FI3C 4GKVA 4UNRA 1PR1A 1XTQA 1ZU5A 3CJRA 3ZZUA 4RTRA 2PBFA 3OIWA 2AMVA 1FTQA 5TS3A 1AC5A 2CVPA 5KBYA 2D2IA 3T7CA 1P39A 4E4TA 4ZI7B 2A9KA 1V37A 2R96A 2XMPA 2NVWA 1U3CA 3DVAB 3FHOA 1PZEA 1E4VA 3KSRA 4I50F 3EB9A 4ND6A 3TRFA 3C5VA 3AOEA 2PGNA 4QHTA 3WMFA 3OZFA 1RI4A 4P80A 4YACA 3GG2A 1BJTA 1QHNA 3GLFE 4JYZA 2HA0A 1SHLA 4TUYA 3EBOA 1Y42X 5KTNA 2F8TA 1K98A 4O2AB 1QYRA 4WACA 2DOKA 1E1QD 3MTQA 5HF9A 5JO9A 1UIRA 4YRMA 5HS4A 2PWZA 4JSYA 2O6LA 3V4RA 2P4HX 4J0FA 4O5AA 3ZHXA 2C2KA 4D9GA 1NIJA 3R7LA 4MMXB 3WNVA 2IXAA 2BFPA 4BVHA 3IVAA 2HA3A 2FR0A 2GESA 1GR0A 2RHOA 2WTNA 4M99A 4U63A 3SIPA 4HF7A 3K70D 1PR9A 4MHTA 1HE5A 1ATIA 2JKZA 1X0VA 1MX3A 2BEUA 3MWLA 3RS7A 3SQNA 3EFOB 2A35A 1HTTA 2HF7A 3D8RA 4IIBA 5C1DA 3CX4A 2OB1A 4M6WB 3K72B 5ELXA 3NBMA 4FMPA 3AVTA 1K9VF 1YS6A 2VQ6A 3OZTA 4HAYA 5EZYA 3V00A 3WBFA 5MN4A 1D5CA 3BAFA 3L5OA 4OB8A 3F8WA 3R41A 3JPWA 4I2VA 4BYGA 1Y1SA 4K1LA 1T2CA 1Y89A 1REQA 3HS3A 5LA6B 3TTVA 5I51A 3PFWO 4YDQA 1Q6ZA 3F8TA 4KH0A 5TR9A 3UBTA 4XARA 1PK7A 3H83A 3PE6A 1YK0A 2WSMA 1S2MA 4RC9A 3HMQA 3INRA 1TYCA 2QLMA 4FWBA 1WB6A 1Z7YA 1IZYA 1E2DA 2YW2A 5KKCA 2PT6A 2Q3BA 1JP7A 1BHO1 3BXFA 2PTHA 1X7WA 3P0JA 5AI8A 3UH1A 1QH9A 2VP0A 4MVJD 4A0QA 4L5BA 4WZBA 4RK6A 4B34A 5G0VA 1SHJA 4C0QC 2BHSA 5AJUA 1LY1A 1ZD2P 1II0A 4YWHA 4EHBA 3F98A 1EXWA 4BFXA 1RRMA 1XCLA 3DFIA 3N0VA 2PZMA 3GLIB 3ZV4A 3B60A 1N2BA 2QTRA 5EMKA 2AYZA 2Q5FA 5JC8A 4NONA 1BHQ1 3QVSA 4CPDA 1TT5A 3QYPA 4ZZ0A 1T8YA 3O84A 1GITA 4IJMA 4NE9A 3ZZTA 1UC5B 1J1ZA 4QU9A 1FMFA 3A6ZA 4GD3Q 4UHCA 1HBJA 5JW6A 4FU0A 2I8AA 4ZOEA 1XROA 3AESB 3TMYA 4AWXA 3KJQA 4L4XA 4R81A 5FBQB 1ZUD1 3D4NA 4M8NE 4F5DA 2ZVQX 5FTLA 4L3WA 2M2IA 5E6UB 2ANCA 4EB3A 1QLJA 2QOEA 4G81A 3TZQA 4DUPA 1XB2A 2C07A 1KMIY 1TO2E 3W5BA 3V1TC 3ZV6A 5BWNA 1Z6YA 4H4EA 4U9UA 1FUYB 5LB2A 3ZZ1A 3S5JA 2RJOA 3CBQA 5E3IA 5F76A 4R71A 3THYB 5LB4A 4B46A 3E18A 1E7WA 1R5JA 3PIDA 4D0SA 2FN8A 5A3SA 1F20A 3AL2A 4GGOA 2Q3FA 4HPJB 4IZOA 5TC4A 3WYDA 5EWJB 3K1JA 4D6XA 1TTQB 3N76A 1RM5A 3G13A 3K8ZA 1T1JA 2WWHA 3EXFA 2W2MA 4TLBA 5HGJA 5HMLA 1H2WA 1RWMA 3WDSA 3HDVA 1MFZA 3INTA 2P40A 3FTQA 2P9JA 2OQIA 4BB5A 3IB6A 3S2GA 1GU1A 2JPDA 1RPAA 4G67A 4WJZA 5I7OA 1E2FA 1QH8B 4Q5IA 3DNPA 1U3TA 3TR6A 2QD5A 4AY5A 1CFJA 1X1EA 3K3PA 4A3SA 1N7HA 2WNIA 3HB0A 5E2BA 3TRKA 2GD0A 4O25A 1MJ5A 3HN2A 4LFAB 1R8XA 1P5RA 2MYTA 3GUYA 3S1LA 4X8OA 4R84A 3FUXA 2VSFA 4PLGA 2BM0A 3KU4A 4R4JA 1EFDN 3HWWA 3YASA 3N8GA 4DZRA 4HQKA 3HWSA 1J1UA 4RLFA 1P1FA 1GIAA 3AOEC 3E9EA 4Y6OA 5CJPA 5DXJA 5BSUA 3UZUA 2F2TA 2ZRKA 1NUPA 2AKYA 3B8HA 4KK3A 4U7WA 4JBGA 5F4BA 5CXSA 3F0TA 5AJYA 2R48A 3EIWA 3EWNA 4B2IA 1AQNA 3H2SA 3BWBA 3DCYA 4MV8A 4A2WA 1E63A 1NSTA 4JSTA 2O7RA 3FDZA 3N5CA 3NEYA 2FNAA 2WJHA 1U2GA 2QX9A 4P0TA 1XDUA 2PTGA 1MNQA 3ZY2A 3WL8A 4WT7A 3PNKA 4PZLA 3KETA 3K0HA 4EL0A 1QF7A 1XZGA 2IEYA 4WA7A 4D3DA 1J56A 1MUUA 1RXEA 4QDZA 2D6FA 3MJHA 4RFVA 1U1FA 4Y1GA 4RHFA 4ZT3A 3HKCA 3MJ4A 3OD5A 2BM8A 5TF4A 1WABA 4QOSA 1REQB 3KSDO 4BP1A 2REBA 4QGHA 5F7OA 5BOVA 4QGAA 1Z6PA 2JGLA 2YFQA 4IUYA 4NMXB 1FNMA 1XDBA 2ZWAA 2ZCUA 3JTEA 4V1CB 1QFZA 3PEYA 4N12A 4Y2UA 4B3IA 3L4BA 2G72A 2P41A 2YL2A 1MHTA 2FEPA 4FSXA 1AQYA 1K7YA 2YWBA 3HL0A 3OFND 1VMIA 3TPCA 4EGCB 2F3RA 4W6ZA 3RWMB 4MRVA 2WICA 4NC9A 4A8HA 1FEZA 1KSFX 2JAQA 4KV9A 5AK5A 1JIKA 3TG8A 2Y3IA 1N32B 4WDRA 1FDIA 1ZISA 3WMXA 3AFIA 1HH4A 4JVLA 3LX6A 4PRYA 2BN4A 2C5BA 2OCXA 1P81A 4GBJA 4P58A 4TROA 3FOFC 1SIOA 1WKVA 1FX0A 4RKWA 2DBYA 4XSHA 3JU3A 4KLAA 1V5IA 3G8DA 5ALJA 2WM3A 2NPFA 3T1YB 4IYJA 4GNRA 3WISA 1Y9AA 3ZHBA 4O1HA 1U2QA 2DAPA 4Z99A 2PZ8A 5EN4A 3PLRA 1KZGB 3PHLA 2AN1A 3WVNA 1TI7A 3RBAA 5FUXA 2FY8A 2JGFA 1OX4B 3MS7A 4MWCA 2AWOA 4LHYA 4YO8A 3UW3A 2A4MA 4RVGA 4CEHB 4Y1RB 3UJ8A 5GAJA 1G3QA 2IYNA 2B0JA 4J0IA 4DA0A 5EKDA 2PX2A 4PRLA 3W2GA 4TS4A 5DTMA 1UXGA 2G07A 2WJ3A 4MR8A 3TRJA 4FDAA 4B6PA 3QF7A 2WY2D 4PCLA 1AHNA 1LS6A 3IBTA 2W2QA 4TWZA 1RAHA 4I1RA 4KE8A 2V7PA 3JQPA 2D62A 1FTNA 4UEOA 4NCKA 4BKOA 3FOEC 1CT9A 3LO8A 1QVVA 2OLEA 1HDOA 2PM8A 3ROFA 2FQQA 4JNCA 4EG3A 4LZOA 4JENA 4PO3X 4L1KA 1UQTA 1CZNA 5CPBA 2FDCA 1OAOA 5IWAB 3ORFA 3RB8A 2GYYA 4DEVA 3K8OE 4F8YA 1M8KA 3EMBA 4KUGA 3FJYA 4WHMA 3U3JA 3DFZA 3C2QA 4LOIA 3L77A 4H1TA 4RY0A 1ACMA 3IE0A 3FYUA 4ZPXA 3OJLA 5C35A 3OAAA 3EAQA 4GMFA 3DB2A 3H4VA 5HHTA 4O3MA 3U4CA 4YP7A 5HZGA 1ODCA 1Z16A 2A86A 2W90A 2EOAA 3WTBA 3A36A 2VQFB 3LBIA 1G60A 4ARAA 2REQA 4DT1A 4JI0B 4EUSA 4G0QA 3V8PA 1II8A 3LCUA 3CEPB 5AWFC 2I2AA 3JQ7A 2Z1MA 3E3NA 4FE4A 4MZDA 5JD3A 3EGWA 1KAEA 3C6MA 5J2UA 3DZJA 1H2FA 4MDYA 2IS2A 2MSCB 1V5EA 5T64A 3LF1A 1JEAA 3KKOA 1SBNE 4LV6A 1I6LA 1CUEA 1X42A 4FX2A 4BMOB 5EXPA 3I6ZA 1D1SA 3OTWA 3DM5A 1AXGA 4CIVA 2P5SA 5AW7A 2QT9A 1Z5WA 2XKJE 3FZGA 3NPMA 3A4VA 4PSAA 4Y2QA 5F5NA 3NRJA 3PDWA 4TT8A 2XDYA 2G1AA 1CV2A 1ORVA 4K6OA 3ZTYA 3S4YA 2BKLA 4ENQA 4EW2A 3CRW1 4PCVA 4CN8A 3GA7A 5JJIA 3JQRA 3FUUA 5HBGA 1AA6A 1M1NA 1NQTA 2C2OA 3QVVA 4GG1A 1BC5A 4LOLA 4M8KA 4MS3B 1C7QA 1L5WA 2IEAA 4U1RA 5BNZA 1U2GC 2QD3A 4R8VA 4WKNA 2C3UA 4BLPA 2AEFA 4L73A 3MAJA 2C4KA 1YZLA 5CFNA 2VPPA 1GFSA 2A88A 2Y68A 2Z8YA 2JVIA 1O95A 1XVUA 3BS4A 3OUZA 4JUDX 3P0EA 4RK4A 3TZCA 4B82A 4B44A 4EHJA 4G86A 1BOOA 1JHQA 5C34B 4CM4B 4YMLA 1OZ0A 1TUGA 4BWYA 1YKSA 3QPUA 4HFJA 4NX2A 5DN6D 3SK0A 2ZYVX 2B4QA 1GXSA 4KLZA 1Y3FE 1O6BA 2BMAA 3OKPA 4R1PA 5DWVA 3VKHA 1F0PA 5EZ5A 5BQFA 3U09A 4MI3A 4II3A 3EIQA 5EKSA 4UTXA 3GLHE 5KOJA 1R5BA 3W5SA 1W4LA 3JQQA 1R9JA 3GJXC 3KL4A 1LQTA 3L4BC 3D0QA 3ADPA 1EZZA 4UFOA 2HK7A 4UJ5A 1NVVR 2ZK7A 3ED5A 3GO4A 3NTQA 4HGYA 2EL7A 1JBQA 1U7UA 1LLUA 2FGJA 3F5FA 2UVQA 5IBPA 1HLDA 4LYEA 1R0ZA 3QPBA 5A4KA 1V9SA 3AHCA 3SC2A 4EHHA 1MBZA 2WVAA 3FPAA 5KYVA 5JNTA 3UA3A 1ADYA 3KPYA 2XE4A 3EVEA 1J0BA 4P4TA 1R9GA 1UUFA 2Q8PA 1P5JA 3H18A 1S6YA 2C8VA 2QTHA 2IYAA 4IQGA 2FVYA 4Z1MA 4E46A 5T41A 4EEXA 2UZIR 3DEHA 2JFQA 2A5FA 4I1IA 1XEWY 4URUR 1O5TA 4RVNA 5EE5B 2KE5A 2ZDQA 3L49A 4OFWA 2J9YB 1SC4A 2DBQA 3SFZA 4MPDA 1W4RA 3CE9A 1N6KA 1PJ4A 3DBIA 3WFZA 1SUAA 3Q8MA 3VPDA 4NI5A 1PDWA 4L02A 1IMOA 4PHTA 3H7IA 3B9RA 2OV3A 3OJ0A 4K9PA 4RE5A 3U2QA 1GFWA 1FFAA 1SFRA 3QLJA 2BKAA 1F4PA 2G71A 3X1XA 3Q7SA 3QFCA 5NLLA 3UAXA 3ZJ4A 4B3JA 4PIPA 1S2GA 2XCQA 3CUWA 3UJ6A 2XDQA 2GF2A 5I45A 3V4SA 4CL3A 4IAOA 5G02A 2Q3JA 3CONA 2O3UA 3G8AA 3Q72A 2H3EA 3I73A 1G1AA 2VSNA 4RWZA 1Q1AA 1C80A 5JEEA 4PYLA 1OAOC 1G6HA 3OIFA 3IPYA 2NIPA 2FUNB 1NURA 4QUKA 1SU6A 4GGPA 1ZD8A 1OXUA 4JQCA 2GEJA 4ND3A 4MQ5A 3DPIA 4NJMB 1UXKA 2CHVA 4P4NA 5SYAA 3QQPA 8LDHA 2QX4A 1K75A 4O4IB 2J6IA 4NFSA 2YUTA 1C1XB 3JVVA 4MVCA 2GAJA 2PEZA 4KC0A 1VCMA 4QOFA 2REQB 3FYUC 3IQDB 2R84A 1HC7A 3OY7A 5ALLA 4URXR 1II8B 2FPUA 4H3HB 4B8WA 4RCZA 3K9LA 1BKYA 3FMPB 4WNCA 2V7QA 1THMA 1Y6ZA 4RVHA 1K8QA 4N7MA 3HVUA 3WHPA 1J2UA 4HEA1 4NP6A 4PCAA 1XJQA 3F2IA 3COWA 1YXMA 5B2FA 1ZBQA 2CYCA 3WRVA 3RM3A 1DKQA 1QGAA 1YA4A 2HJ9A 3FN4A 3QG5A 1YL6A 1VZ3A 4X65B 3ON5A 3M3DA 1K0FA 2V4UA 3GPCA 2JASA 5D86A 2QJWA 4FMCB 4EVSA 5AQ1A 5FNVA 3FF1A 1GNVA 1TYBE 3FA2A 3RC2A 5ABPA 3MGCA 1LUAA 2QRPA 2VA8A 3IEUA 3PYLA 4RXUA 5JD4A 3JQEA 1KO8A 4A0RA 3P94A 1GAJA 3EX7C 3V4FA