5E38A

Structural basis of mapping the spontaneous mutations with 5-flourouracil in uracil phosphoribosyltransferase from mycobacterium tuberculosis
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
209
Chain Sequence
GVAFQGQVHVVDHPLAAARLTTLRDERTDNAGFRAALRELTLLLIYEATRDAPCEPVPIRTPLAETVGSRLTKPPLLVPVLRAGLGMVDEAHAALPEAHVGFVGVARDEQTHQPVPYLDSLPDDLTDVPVMVLDPMVATGGSMTHTLGLLISRGAADITVLCVVAAPEGIAALQKAAPNVRLFTAAIDEGLNEVAYIVPGLGDAGDRQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of mapping the spontaneous mutations with 5-flurouracil in uracil phosphoribosyltransferase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
molecule keywords Uracil phosphoribosyltransferase
total genus 48
structure length 209
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5e38A00
1QCDA 4JLSA 4P84A 4P83A 3HVUA 3DAHA 3OZFA 4KN6A 4RAQA 1QB7A 3G6WA 5E38A 1VCHA 4M0PA 1Y0BA 1GRVA 1ZN9A 1A97A 1XZNA 1BD4A 1FSGA 2H07A 4RQBA 4RHUA 3H83A 2PRYA 1P18A 1JLRA 1NULA 2JKZA 4JITA 4RV4A 1TC1A 2C4KA 3MJDA 1ZN8A 2JI4A 4RABA 4TWBA 3ACDA 1D6NA 1A95A 1I0IA 1P4AA 4PFQA 1XZ8A 1ECFA 4P81A 4M0KA 2FXVA 5EUCA 1DQNA 3GEPA 4Z1OA 5IAOA 3N2LA 1CJBA 1U9ZA 4OHCA 1BZYA 1G9SA 4X44A 3S5JA 4M0UA 2PS1A 1A98A 1UPFA 4RADA 1GPH1 4QRIA 5BQOA 2P1ZA 3MBIA 1WD5A 2H06A 3OHPA 4X45A 1U9YA 1DBRA 1LH0A 1QB8A 4FYMA 1L1RA 4LYYA 4RHYA 3ACBA 2EHJA 1UPUA 1A4XA 4PAWA 2VFAA 1DQPA 1JLSA 1PZMA 1O5OA 5BRNA 1HMPA 2XBUA 4LZNA 4P3KA 1ECCA 1I5EA 2IGBA 4LYGA 3OZGA 4P82A 2E55A 1IBSA 4MB6A 1ECGA 4WN3A 4IJQA 1ZN7A 1W30A 1R3UA 3DMPA 3GGJA 5JSQA 3M3HA 3KB8A 4ZFNA 5HIAA 4RAOA 4RACA 1I13A 2HCRA 3DEZA 2YZKA 1XTUA 2WNSA 4QYIB 1G9TA 1ECBA 3LRTA 1MZVA 1P19A 5ESXA 4RQAA 5IPFA 1P17A 1A3CA 4WMLA 2AEEA 1G2PA 1QK4A 3ACCA 4S2UA 4QYIA 1VDMA 1OPRA 2JBHA 4RANA 4LZAA 5K51A 2PRZA 1UFRA 3QW4B 1AO0A 1DKRA 4F8EA 5BQPA 2H08A 3LPNA 1OROA 4RHTA 4RHXA 5HKLA 1OREA 1O57A 4P86A 1XTTA 1YFZA 2DY0A 1TC2A 5KAPA 3GGCA 1DKUA 5ESWA 2JKYA 1I14A 1V9SA 1G2QA 5KAMA 3NAGA 4P80A 1Z7GA 1A96A 3O7MA 1NONA 5JV5A 1J7JA 1BD3A 1QK5A 1ECJA 1QCCA 3EFHA 1I0LA 2GEBA 1STOA 1XTVA 1QK3A 1VSTA 4LZOA 1HGXA 5BSKA 1L1QA
chains in the Genus database with same CATH superfamily
3CVVA 1JR6A 2G83A 2IEYA 1HO3A 4UARA 2BC9A 4PYNA 2QMEA 5GPBA 3MJHA 4I5EA 1WS6A 4OIMA 4X8LA 1GPLA 3QE4A 4JNCA 3UKOA 1IE3A 3IPAA 3OZCA 1N9GA 1QIEA 2J3HA 3T1QA 5FH9A 3ESZA 1ULTA 1U0HC 3TWOA 2ZRPA 4F9EA 4AZVA 4N5IX 1E62A 1Z4OA 3COSA 2BEVA 3A0RB 4Y2QA 2GLTA 3T12A 1ZICA 5CP8A 3D6UA 4U7PB 1DT3A 1GSIA 5FTWA 4TMWA 3IQWA 4WN9A 2A59A 2ISSD 1KOLA 5J4VA 2VSNA 4Q1EA 3UB3A 4CUKA 2PLNA 3QYJA 4P35A 5LXTB 1AKQA 1QX3A 2GQ0A 4KIWA 2VRBA 3TL6A 2IC5A 4JLWA 1HETA 1SELA 3IAS6 5LQCA 2WHPA 2BOVA 2JIZD 4PTYA 3T99A 2VNSA 2UVPB 3SQNA 1SBIA 1E98A 1RWOA 4WDQA 1DBRA 1OYVA 1G6KA 1Z5VA 4LYYA 3ZWAA 2BTQB 3ERCA 2CHGA 2QMYA 3LHFA 3NHLA 4H6PA 4WZAA 4BNDB 2QGZA 3LLVA 5AW9A 2VPWA 4PC2A 3SZRA 2WMDA 1UR5A 2ADMA 3BIOA 3CZCA 1LLUA 1JDJA 2B7BA 2BHRA 2NV0A 3BDVA 3M7IA 4LRYA 4BMYA 5K3SA 2WSYB 2FEXA 1Z4KA 4ILEA 1EP2B 4TMXA 3O92A 1E9EA 2HMTA 1S8AA 2L0XA 2QV0A 5HR5A 2PUWA 5EKUA 3RVSA 5G0WA 5JSQA 3CZPA 1NBIA 1ZGCA 2YN2A 5JROA 2EZ8A 5U1PA 4MDYA 3IP6A 4INPA 3TOXA 3ABOB 3IO5A 4URXR 3Q11A 5AXBA 2RI1A 4Q39A 3WWOA 1Q12A 3PG5A 5DHFA 1SCKA 3DOIA 4RK6A 5ESRA 2NAPA 2RGGA 1BFKA 1RFGE 1V25A 2DPYA 3HB5X 3IP9A 3N86A 5TQVA 4ARSA 2E37A 4DGSA 4WN9B 4GKBA 1V5GA 2DBVO 4TZTA 3VO9A 1ZHHA 2OV4A 2DG2A 3I6BA 4Q3DA 5EHZA 4B7AA 4BLQA 4XVCA 1FLDA 4L73A 4S1PA 5EE1A 3L5KA 3G2NA 3I45A 4NDAA 4N7MA 1NW6A 4M1QA 1WV1A 4REQA 5IT4A 4B85A 4RJ2A 3ET4A 4CG2A 4R1LA 2F17A 3KVRA 3ZQJA 4PYJA 2ZUBA 4OP3A 4R71A 5CVDA 4QPDA 5AW0A 4MIYA 5AT1A 4ZV9A 3PEYA 2OPHA 3ANMA 2ZRFA 4N49A 4LBZA 4M89A 5IT9A 2FSHA 1FEZA 1CDZA 4KFTA 3C7CB 5ALGA 4UU7A 4DCCA 4DQ0A 4WESA 2EKBA 2PT7A 2O2IA 1VPWA 4LSZA 4KK3A 1E6EA 3DBOB 2WWVD 1HX7A 1Y3DE 5DX0A 5CLQA 3TLZA 2UUBB 4PG7A 4QRDA 5BNZA 3QXHA 5BWMA 4MO2A 3QJYA 2I7DA 2L17A 4WTOA 4E03A 3DHVA 5F2KA 3TZHA 4FNMA 2A1TS 4O2AB 4N47A 4FM9A 3F3SA 4X41A 1W85A 1M10A 2R5NA 4DM7A 1WMFA 3UGJA 4KR3A 1R10A 3EGEA 3IILA 3CVUA 5KNBA 2XUJA 5KWEA 3DAFA 3QSGA 4GXNA 1CNEA 1CZKA 3V33A 2EARA 1VJGA 1G8HA 4MRRA 2BF4A 2PUGA 5B1IA 1HDYA 3SYLA 2VT7A 3TQSA 4B3IA 4DPKA 1FY2A 2NPIA 1WY7A 2Q07A 5F33A 3I1FA 2ZCJA 3N8NA 4JT2A 3OX4A 1GUYA 1NW4A 4M38A 3TG8A 1RFLA 3ZGOA 5DN6A 3OLZA 3Q4GA 3MWDA 2QTNA 4DG8A 1AK1A 1USGA 4J1QA 4BJHB 1ZCZA 1H5UA 4IDHA 4DXAA 2V7QA 2COEA 3QWFA 3RT9A 3R8FA 3NAZA 1Z35A 2AW3A 4A0QA 1JFFB 4E2YA 4HD8A 2FSPA 1F6WA 1HDCA 3IUQA 3OBIA 4OJMX 2HQ1A 3UV7A 2YY6A 3NS7A 4E2WA 3KEOA 1EGMB 5E2AA 3SF0A 2IS6A 1CFZA 1KFJB 1AGRA 4REQB 1NDUA 2MSWA 4DSZA 4C0QC 4BCCA 1QLHA 3B2QA 1ECLA 2W6PA 2PSEA 1N7IA 1J24A 2FWBA 2R6JA 3EYWA 3H5NA 4HB3A 2WHXA 4D4LA 5J4HA 1J8YF 3RF6A 4FYMA 3EF0A 1SUWA 2GN9A 4OMCA 4PNZA 5EIXA 2AA3A 4J49A 2PZLA 5ELLA 3X2SA 4TMFA 4RTMA 5F4BA 2YHAA 4C4OA 1I7DA 3OFKA 3D2LA 1ML3A 2Z3VA 3H17A 5FO1A 1JQKA 1CG6A 2EFDB 2CLIB 1OWMA 4EMSA 5KX5A 4N6OA 2XGOA 4FIZA 1PR4A 1EM8B 3QFHA 5DYWA 1Z4MA 2V9CA 2ZE7A 3V4OA 4OL0A 3IJEB 3ROPA 1RMQA 1P4SA 1YMQA 3OPMA 2XR1A 5DNWA 3SLRA 4B3TB 4QJ5A 3I76A 4NYMR 4YJGB 4MYDA 2M9MA 4AK9A 3P96A 3ZH9B 3WRWA 1XEXB 1JQBA 3QHQA 2ZDGA 3V8RA 2G9RA 2ZS7A 121PA 3K0BA 4Q93A 2RH5A 4AS3A 4F71A 3KZCA 4G4IA 4WK2B 1PSWA 2IHNA 4JH0A 2FPUA 4L9RA 4P4UA 3R23A 3DHYA 2XD4A 1S01A 3DL4A 3FTPA 1YZFA 1U0SY 3HYLA 3NONA 1OAKA 4ZCPA 1ZVJA 4RANA 2CDRA 4F3CA 5L9AA 1LNQA 4PYRA 3D31A 2GLXA 3HH8A 4UVEA 2AW5A 3CMCO 3F74A 5HTOA 4ECEA 3L7MA 2GS9A 1PD1A 4II7A 4X63A 3HUEA 2J32A 1M9NA 2VTKA 3FD8A 3DDCA 1JEDA 1LA2A 1OROA 4AY3A 1JA0A 4YP6A 2ZTVA 2VDWB 2XTZA 5IJWA 2VXCA 3CZ5A 1IEWA 1PBTA 4ZALA 1MA3A 3OM0A 1KFEB 4S04A 1DUVG 2GXSA 1NWCA 3G9ZA 1VCOA 5AI4A 2WY2D 5AOVA 3PNQA 4AJEA 4OA5A 1GY8A 5JDCA 3CRRA 2PCLA 5T3YA 1YDEA 4Q7QA 2OCBA 4FKZA 5ICGA 2HK7A 2ZS9A 2F1IA 3BB4A 4FS3A 1QFYA 2B8EA 5KPDA 1FFAA 1S6YA 4COOA 2EWVA 3QKSB 3Q8XB 5L40A 5CFNA 3P9XA 2Y2UA 4FR0A 3RRBA 3GLGA 5E1OA 1C7FA 3DNFA 5T5QA 4RFSB 4BO8A 2RGRA 4XQCA 3QA9A 2IU0A 1QB7A 4H08A 2FPSA 1J2TA 1I24A 4AP5A 1WB6A 2EKLA 5DHRA 5FBRB 5GADl 1XZNA 3KPVA 1YL5A 1BRMA 1JQ5A 4XCVA 3I2JA 3Q2OA 3E9RA 3UIEA 2D59A 3WO1A 3CLSC 3TDNA 5JS7A 2SICE 1BDHA 1VJCA 4WWHA 2QQGA 4XARA 2A6PA 2VJYA 3QKTA 2GYYA 1EEXB 2WM9B 3SHOA 3LBIA 4EBBA 4WEQA 4CMEA 5C7IO 3A6KA 3PVSA 1T1SA 1J8MF 1OIXA 4RGYA 2D2VA 3ZUGA 4OMUA 2RE8A 2PBRA 3B82A 3VO8A 2B69A 2YV3A 3LX8A 3DHWC 3ZBPA 5ALUA 1VRVA 2FXVA 2O48X 2O0JA 3Q12A 4RD0A 3QVGA 2VUTA 1O9BA 3D4NA 4B6SA 2PS1A 1BS9A 1KOFA 4DR4B 1GPJA 5AICA 1MH9A 5ECGC 4QJ3A 1PGQA 3LX5A 4GWLA 3BICA 2PUBA 3OU6A 2I76A 1TVCA 1UEIA 3MTEA 4IIUA 2QAGB 4RF2A 2HK6A 4NRDA 1GQOA 1HR0B 2GO1A 4IXTA 5F35A 2QRKA 4RCYA 1JJVA 3RYTC 5JISA 1ZD8A 1QG4A 2VXBA 4LX8A 1CULC 4FS8A 3U31A 2BTQA 2Y6UA 5LU9A 2AVNA 3AM4A 1DHTA 2IY7A 4GOXA 4RLFA 5F5XA 2MU1A 4ND8B 2XWSA 4Y18A 2QUIA 1ST2A 2JI7A 2QAIA 1QKJA 3DXFA 2EJVA 3ESXA 1FLNA 3E5NA 3CN7A 3N0VA 4ZARA 2XBLA 3IPYA 3MJEA 4Y3UA 3QY0A 3R44A 4IOJA 4BGIA 1NXTA 3FCAA 4UTZA 1DRWA 4IG9A 5DLPA 4C0SA 1PT5A 1QVRA 3PUKA 5THXA 4B7CA 1YS4A 3AP2A 3K5PA 4QYIB 4EZIA 2HGSA 1P6QA 2JLSA 2BRUC 2WV9A 5KSYA 2E6KA 3OCZA 3PJRA 1OC4A 2CLHB 2WD9A 4DVGA 5REQA 1E0SA 2OE2A 5DBOA 4AVYA 3C6KA 2OCKA 4EJFA 2QQ5A 3N2KB 1J23A 1NR7A 5BVGA 1ZYUA 3F90A 5IHPA 3U60B 4ZMBA 5KTSA 3BWYA 1U0FA 5CT5A 3AR6A 3OM8A 4U2CA 1I94B 4NMHA 5FTMA 1QIIA 4X6YA 3NT5A 5KTNA 2FG6C 1XQ9A 2PD4A 3RBAA 1QRSA 2QGNA 3DBHB 5AVJA 1CLEA 1KHHA 3MB8A 1A7AA 1OA0A 4G09A 5DRYA 3M1AA 3RVOA 3TSWA 2Q6TA 3R6LA 3SNKA 2VQ3A 3A7EA 3GEDA 4TM8A 5D6OA 4BJ5A 4C4PA 1SEVA 2DUNA 3IEVA 1RBYA 2OBMA 3N2GB 4H7IA 5CK5A 4C0XA 4QPPA 3VH2A 4RE6A 3OY2A 1J4AA 4P3XA 3P0RA 4G26A 3LUHA 2I6XA 2QN3A 4Q0MA 4GLJA 1V41E 1CRQA 1RBZA 3D4LA 5FI5A 3ZGXA 2J6IA 3K92A 3BDIA 1SCAA 2PJZA 2XDYA 2CXQA 3EIWA 3D6NB 5BWLA 1P91A 1QS0A 4I46A 3SQXA 4KRFA 1ENZA 3G88A 4D6YA 2WJPA 1Z13A 2BFMA 1PTJC 1ULHA 1G2OA 1VA4A 4MWDA 4XJTA 4BDSA 3TTUA 3CTPA 4CEJB 3NIGB 1II8B 1U3WA 3SU8A 4FBLA 3CLSD 2GUWA 3OIFA 5TJ9A 4Z51A 4MH0R 4ZAGA 4BTLA 2CDCA 3KLOA 2X15A 3PHLA 4A1FA 1Q7TA 5CJPA 3RROA 1ZGHA 4RVDA 3MPOA 4ZVQA 3MFQA 1TEXA 5KYVA 3TLKA 4CKWB 1I2ZA 3SMQA 3GJTA 4KQEA 3SOZA 4EUFA 5BORA 1XD9A 4ZJZA 5AK3A 4OA8A 2AR9A 3OSUA 4WZBE 3MWKA 6NULA 5K8JB 4FOLA 2O8CA 1RMTA 1T8WA 5ALYA 3T3OA 1JHVA 3WJ7A 5F3WB 5JCPA 2ZU6A 3IO3A 1CY4A 1QHYA 1ICIA 1RR6A 5KJFA 1DAPA 4TYYA 1CR2A 1WV0A 3OIYA 1T4GA 4DSNA 4L75A 5BXYA 3LXUX 3IT1A 4FNOA 2R60A 1PIWA 2AN5A 2C84A 1T6ZA 3DFMA 1DKPA 4OUDB 4LGVA 3RSHA 3TK1A 4QRIA 1I9GA 1XT6A 1V37A 3I72A 2H06A 1ZD9A 1UDCA 4P4NA 2R8PA 1CQPA 3UA3A 3VHRA 4AAYA 2XGJA 1K1EA 3EHDA 1SCNE 3P7MA 1ZAYA 4YCDA 5FNVA 4KCGA 4BS9A 1EUYA 1AUVA 4R05A 2O1WA 1U4SA 2P3LA 2XE6A 3C5HA 3WFJA 5EHXA 5HCIA 3KZ1E 4A16A 1SCUB 3Q3EA 2Q7OE 1WEHA 2IEIA 4FD3A 3G2IA 1SULA 4G85A 2X5OA 2G63A 4OLFA 5IG2A 1JR4A 5L7YA 3SBDA 3WMEA 3NHMA 3M4ZA 5C31A 5ARCA 3REQB 4O4LA 1MOPA 2X13A 3UMCA 4AICA 2VA9A 3V80A 4YX9A 1IEQA 4QIHA 1QJ4A 1S96A 2FOXA 4L95C 3F5MA 4LMBA 5HFAA 3NRCA 1H2YA 3AEZA 2P4EA 4EKNB 3L7JA 3H04A 3TLMA 3ABQB 2F59A 5AM5A 2ZREA 5CFQA 3AEKA 1EXVA 3EGOA 1Z73A 3EWNA 4KREA 1QGYA 5DT9A 3UOAB 4W5JA 2FA9A 3JWHA 5LB2A 1J2RA 3QVLA 4Q3NA 4B3SB 1E61A 3QENA 4GPZA 3B2EA 1QMGA 2FZLA 4IIDA 4BJ1A 5I5GA 3RS5A 2DHEA 3I4FA 3LUCA 5K51A 1ZI6A 4U00A 3CVJA 1Y9EA 2W0SA 3M9XA 1OGJA 1EX9A 4YK7A 1JAYA 2G28A 4QICA 5KCZA 1YCHA 1GQSA 1FS5A 1XDDA 1U1CA 2BM0A 1VECA 3NT4A 4PZYA 3TGLA 5LD2C 3BVPA 1MUUA 3AESA 3IELA 1XMJA 4OFXA 1LF0A 1RQGA 3EY4A 1YZTA 3R09A 2NTVA 4HV4A 1FDUA 4CCYA 4BWFB 3HCNA 2YMLA 1OH7A 1G2QA 3K0EA 4JS0A 2WKQA 5DASA 2QS9A 3BHNA 1ZGAA 2CUTA 4CVNA 1AKVA 4PFSA 3R20A 1P9RA 3LCUA 1GTJ1 4P4SA 4MR8A 1E79A 2WJZB 5AKEA 2G1UA 4OHMA 4PYOA 1VSBA 1LV8A 2ZCVA 4DJDC 3K8ZA 5FBLB 3EQ9A 4HG2A 4OYRA 4N3GA 1O6FA 3L7CA 3V00A 1H2XA 4INZA 4YONB 3JQEA 2A5JA 1JPNA 1Y1SA 4DHWA 3G5AA 1JTEA 4P84A 2OCXA 4N5DA 3Q3GE 3JAKA 4OH7A 2ZE5A 1MC8A 5D87A 1AQJA 2E0IA 2RI6A 1E7WA 2ANCA 4AZ3B 1RYYA 3JXEA 4CLXA 1NP7A 2B1QA 4WOKA 4L9WA 5C8YB 3CPSA 3CVOA 3AVYA 4P31A 2XBMA 1SXJC 2VPQA 2C8VA 4RABA 3INGA 1QKIA 3ZZNA 1BH6A 1XZDA 1ZJ5A 3GFRA 1C2YA 4EQ6B 1XLWA 2AKAB 2CLSA 2ZYUX 1DFGA 4F3RA 2HYDA 4BKQA 1ZNYA 1OFIA 1D2AA 1JFFA 3ISTA 4PSVA 4MQEA 3Q5DA 4QYSA 5EP4A 5JPDA 3KSRA 2G9UA 3OF2A 2ERCA 2YXEA 1JV2B 4ZEOA 1C0EA 2IUYA 4LRTB 3KT0A 4PLHA 3AI2A 3HP7A 3MWJA 3FDIA 4Q7KA 2WEKA 5KC8A 4N76A 1BE6A 4O8CA 2OQVA 2WAXA 1SG0A 4F4UA 3GHHA 3U0BA 1MT3A 5MGNA 1QB8A 4KFSA 4BNVA 3MT0A 3AOEC 2YBDA 3B48A 3BMXA 1NT4A 4J3NA 2R97A 4IG4A 1YBFA 2CHEA 2Q0SA 3P9KA 5IJZA 5IYZF 4YVFA 2OHFA 4G0XA 2H2AA 3JQGA 4TWZA 4UBMA 1O03A 4D79A 3I5XA 4YAJA 3CWCA 2BE7A 2ZAOA 5E1DA 2JC3A 2NAFA 1ECPA 3GYBA 1YZKA 4HADA 4N39A 3ZDYB 1Z4NA 2VP6A 4C5BA 2RK4A 4ZMSA 3ESYA 1DIGA 3NWEA 4NZ9A 5BYKA 4PLWA 1U8EA 1Q0SA 3VTFA 3UHAA 5C5EA 1BC5A 2CV0A 1RLJA 1DEHA 3P2IA 5IJ0A 3RTEA 3U7IA 4DC9A 2WE8A 1O9HA 2H57A 4PYLA 1ZAKA 4NCBA 1ZJ6A 2ATEA 2WM8A 4R0VA 4CR7A 2C2KA 5ED0A 4IFTA 1WL8A 1Y4DE 1NRIA 1Y34E 1XZQA 1NQTA 1PL8A 1U28A 1V8OA 1FLAA 4O2RA 1RU3A 2I6QA 4MS3A 2BFWA 1CF4A 3LUFA 4L57A 1JTVA 4A82A 1AUQA 2C82A 2EFHB 3RRZA 1QRUA 4WPGA 1HQCA 2ZRKA 5IASA 1ZN2A 3BL8A 2QPAA 3K09C 4BLOA 3Q6MA 5BNFA 5E3HA 4JI7B 3ML1A 3MA0A 2IYWA 1SUBA 4O29A 3C4QA 4YJFB 3WNZA 1A5ZA 2G17A 4BOYA 4EI9A 2C4NA 2A94A 4RS3A 5BRJA 4LJ5A 5JS8A 2WUVA 3RC2A 2HCFA 1L5LA 4OFWA 2VDMB 5ITZB 1YCFA 1T3ZA 2JZNA 1CS0A 5DGIA 3UMSA 1J8VA 4JBYA 3G1TA 3DFZA 3BIFA 3OZWA 1ZUIA 2WJJA 3HA5A 3M5DA 5MGBA 2Z3ZA 5ENZA 3R6DA 3QVWA 4Q00A 2CXHA 2CVPA 3TTTA 4DGQA 1TVKB 3OQNA 3E3NA 1TECE 3NM5A 3GT4A 1GPBA 3NI2A 4YH1A 3WTCA 2GF2A 4EO4A 1M6HA 2P4HX 5AP9A 5ITVA 3WSWA 3IDSA 2VHXA 5FIUA 1L1QA 2VDWA 1AKEA 4YRIA 3USZA 3FWNA 1VHJA 4B3BA 2CLFB 2E4XA 4RAQA 2B92A 1NL3A 1C41A 2BUBA 2HN9A 3DB2A 3L18A 4KAJA 2PAFA 4Y9SA 1CJKC 4RL6A 1MO2A 1C3OB 1XLTC 3KBOA 4CODB 3IESA 1EU1A 5C37A 4L9SA 3I01M 2QU7A 1JQLB 5I9TA 1W76A 2RGEA 2JASA 4GMXA 1BXKA 4HDKB 1NYRA 3I23A 4B8YA 4O4HA 1ULSA 4C08A 1R7RA 2XQKA 3TNDA 2NIPA 3U7JA 2JHGA 2DXIA 2NXEA 3FSEA 5KDLA 3CFYA 4HRXA 3AUYA 1P1IA 2P9CA 5FBKA 2HMSA 2I03A 2IFTA 2Q3FA 3JQ8B 4JVNA 4CTJA 3PFKA 1U5AA 5C7LO 3AUKA 1ABFA 4B74A 4HYTA 1WBJB 1R0LA 2AQ8A 5LNK1 1H6BA 1CB0A 4IGEA 3PHHA 4KACA 4OJYA 3Q0EA 4XDHA 3C24A 4EGAA 1QR6A 1LLDA 4TLLB 5C34B 4DNFA 4BO5A 3P9ZA 5JD5A 1L5KA 1JR3D 3SR0A 2VP0A 1J1IA 1U0NA 2XWJI 1F9EA 2FRXA 1Q5PA 3NBKA 1N9ZA 4K5QA 4PZ0A 4RSMA 4AJPA 3ILSA 1G9XA 1JSRA 3N8GA 4MYSA 4RSRA 4YJ3B 3HDHA 2C96A 3GLVA 4OCZA 4DBVO 2AMFA 2R86A 4CKBA 4IIYA 3QVTA 2J3QA 4C76A 2ZQ5A 2AC2A 1LWOA 5AVKA 3ZHUA 1V35A 2GEFA 3BXFA 3MWGA 1JR3E 1U0EA 4MZDA 5J40A 4POAA 4CM3A 2ZR7A 2FZCA 3RADC 1XTBA 3I4LA 3Q3HA 3STVA 2O19A 2Q6IA 3AUTA 3TBFA 5C1DA 3PLAE 1DO2A 4D2IA 1N0HA 1FPMA 2LXNA 1MO6A 2G70A 2XOEA 3CH6A 5DT2A 3RV3A 3GZNB 4BVBA 2Q50A 2GTPA 3HI6A 4TMKA 2QSZA 5CDGA 3RSOA 1YVPA 1QHHA 3HC7A 1K8XB 5EMHA 1XCOA 2N3ZA 4DXHA 4P3OA 4JP5A 1QCYA 1NBAA 2YYZA 3Q1KA 3RIYA 5A6VA 1E9RA 1RD4A 2XADA 1T8TA 3IXQA 1HNWB 2I9PA 4MV0A 3SZUA 4ZRMA 2YW2A 4NBLA 2PTGA 4JX8A 1SPXA 2DJ5A 4OI4A 2XA1A 2VQ6A 3NHWA 4MA0A 4BLRA 1CUWA 1K5DA 3IR5A 3RHFA 4TV8A 1TT7A 4EJ0A 3E22A 2XH8A 3BDAA 3OP4A 3Q2KA 4KE9A 2VTEA 3O6VA 2MSNA 4P0TA 2ACVA 4UTNA 3AGPA 1W4RA 3L4EA 4TN1A 1N9GB 2HMAA 5T4BA 1D2MA 1WULS 1ZUNB 2W2VA 2XOXA 3ELWA 4PGMA 2R5FA 4M1MA 5ESDA 4US2R 3AX6A 5M7EA 1CD5A 4J4BA 3U7HB 4C0WA 3MRVA 4DVJA 2C9OA 2VK4A 1FW8A 1OFUX 3UGKA 1HTTA 1VKZA 2DOKA 1KBQA 2XCIA 4HNGA 3F5QA 3ROZA 5JANA 4D4JA 4H7PA 1RLUA 3TI7A 4D97A 3K70C 2WSMA 4DQLA 3F9RA 4UMDA 3N39C 2VAPA 5DK6A 4M1EA 3HGMA 3WSVA 4EFMA 1U8YA 2TMDA 3G2QA 4ZCIA 1T6BY 1QHFA 3SJUA 3C1OA 1ZCAA 2XDQB 1CQXA 2QN7A 1IVSA 1PZEA 5HRAA 2HV8A 1G3MA 3QI7A 4RXUA 4GVLA 4P83A 4R5MA 4ZAWA 5IJ0B 3DM9B 3CSUA 1P5HA 1Y80A 5J1TB 1F0PA 4R6WA 3IP8A 5CUQA 5EP1A 3RW9A 4U7DA 3HDVA 1TJPB 1OD6A 3UYKA 2VI5A 3HRHA 4N5HX 1CY2A 4A27A 1PJCA 2ZBDA 1ODJA 3B6ZA 4H7EA 4R9VA 4MJ3A 4RX1A 9GPBA 2GBGA 1IUNA 1U2GA 3HDYA 3SHTA 1OVMA 2D5IA 2XXJA 4C87A 2DMRA 1E3EA 2OXEA 3C3JA 4OBWA 2HCBA 4TTVA 2DFNA 2E4AA 3QITA 2DPGA 2OORC 3LWBA 3OCXA 4XSGA 5LYJA 1HSZA 2FN7A 2QMOA 3EXEA 5ISMA 5BWNA 3SHVA 1O77A 3KJGA 1T3TA 1UT6A 1E2BA 3N58A 4ZYTA 4QTTB 4LDQA 2SCUB 3NALA 3F9CA 4A8JB 2APJA 1FVOA 2ZRIA 3ESCA 3INNA 4X45A 1W0JD 3N3AC 1CP3A 1RRPA 3QKRB 4G1FA 4MJLA 3UJPA 5FUQA 1ISGA 2ZKLA 3ZWVA 3EPPA 2AE1A 3KQSA 3ZWBA 1U0OC 5LQAA 3Q7TA 2FPXA 1MQ8B 1BGWA 3I53A 2Y99A 3GI1A 2VP3A 5CM2Z 3GAAA 5KKCA 3MWEA 2CF5A 2XXAA 1KMMA 4D6PA 3TTXA 3OQIA 2W4IA 3BE6A 2ZI4A 5AYVA 3CRZA 4YRZA 1KDRA 1Z12A 3NIFB 5E7JA 3DO8A 1U8XX 4H1WA 5JXWA 4DCSA 2UVPA 4ARAA 3C0KA 2ZJ1A 2WHPB 2ZIEA 3DT8A 4K9QA 5ALEA 1U5CA 5LNK6 3CVYA 4G67A 1U98A 2ZRBA 4ZT3A 3E2IA 2XZOA 1V3VA 3KV3O 2H5LA 1E89A 1H8HD 1X87A 3E0QA 4Q6BA 1GM5A 2FPMA 3DDNA 1JSXA 4L3VA 1HFKA 1B3BA 2EIHA 2C2HA 3W6ZA 4DBLE 2I1LA 2FR8C 4UQPA 3AHJA 4Z3KA 4YJ2B 1D1QA 4LXUA 4YCJA 1E1RA 4Z9AA 1J09A 2V0NA 5JALA 2WSSD 2NTNA 5E9WA 3R0QA 5JY6A 3VZQA 1Y4SA 1BVYF 3UXYA 5I8PA 5JNTA 5DI3A 4IV8A 1KL7A 4P38A 4WBSA 5C3UA 3ZHQA 5LA6A 4CQNA 1IONA 1L7NA 1N8KA 1LBTA 1A9RA 3GD5A 1SG6A 3KSUA 5HOQA 1F2UB 1FP7A 2X6TA 4LOHA 1YOVA 3OE5A 3QKIA 5CFOA 5HDQA 3U7RA 4NYIQ 1NPTO 1KARA 3HBFA 5ALKA 1WLYA 4PIVA 3WNDA 4L0CA 5CA1F 5IZCA 5A05A 2NGRA 1LC0A 1SXJB 2YOGA 1XNJA 2OA0A 1LQTA 3NFYA 1P3Y1 1SCQA 4FQ5A 3NAGA 1SXJA 5B1DA 1OZHA 1V6AA 4I9NA 4Z2YA 2V74B 5DIZA 4LHEA 2IWHA 1FJXA 2X7HA 4NMLA 3IEXA 3VNVA 3W77A 1QCCA 1R4MB 4TV9A 1QC5A 4LC9A 4LXXA 1ISIA 3DBRB 5BMVB 1OI2A 3ANTA 5TRTA 5HKBA 1RBMA 1GPMA 2YIDA 3OJEA 5GV7A 1S7GA 5DNUA 3C14C 1BN7A 4JLSA 4HQRA 3N5KA 3RVRA 4F46A 4MUGA 3O0TA 2ZSDA 3WBKA 2B1RA 3BIJA 2AMYA 4PXYA 4I5IA 3OZEA 4TLEA 3UMJA 2GF9A 3FHJA 1Z8DA 1ZISA 1A88A 2WR8A 3MXTA 3OMWA 4M8KA 2JHAA 5A5DA 2E82A 2XLCA 3O9VA 1U1IA 2YYAA 1TW2A 2XUHA 2VT3A 1ZSVA 3DZFA 3B78A 3SXJA 3WJ1A 3GLUA 4N54A 2CD9A 1H1LA 1JZSA 3A6DA 2X9LA 4CDMA 4F1KA 1W48A 4HGOA 4NYJQ 3T3PB 2P27A 5C8DA 4MWSA 2OORA 4MOWA 5FOUA 1Z63A 1VTKA 3R9IA 3RWOA 3KPWA 4JL6A 3LQKA 4OGLA 1N2HA 1R2QA 1SU7A 1FNNA 2VYND 2C5FA 4R2HA 3UG7A 4BNGA 1GYPA 4OTZA 3HVIA 3A26A 3G02A 3O95A 4K40A 2HRCA 1G0NA 4X90A 1DKOA 3SSAA 5JMOA 2G1PA 2RGNC 3H11A 4KO4S 4U2FA 1WEKA 1IOVA 1JDUA 1UZMA 1YCGA 3BILA 2AYZA 3H1FA 1NVVQ 1OLUA 4G63A 4M0LA 4UUQA 3ZCTA 2VPPA 1CY0A 1IXSB 3BWCA 3ND5A 3IVRA 1R50A 2HU7A 2X8LA 2SKEA 3QG5A 3Q0IA 5B6JA 4MTLA 1C9DB 4CMJA 1F8FA 5FBWB 2JB9A 3G59A 2HHAA 1N6RA 3O8OB 5BSFA 5CYGA 1HRDA 4PG6A 3I6IA 4NU8X 4FUQA 1AMOA 5CX1A 1MX3A 2IZZA 4U9UA 4LVCA 1HNNA 1NE2A 2C77A 4I99A 2OYRA 4P4SB 2VNHA 2DBRA 2I1QA 1KE2A 3VSEA 1K66A 2ICAA 3QMVA 5ALJA 1SXQA 1U3FA 2MYUA 4ZTZB 1UT8A 3CGGA 1L6RA 1TEHA 2NUAA 3NV7A 2ONJA 3WMRA 5H1YA 1KBOA 4EI8A 1HXHA 1OYWA 2HJGA 1MW9X 3P4UA 2XHEA 2OBNA 1PWYE 3QBTA 1DAOA 4JX9A 3VBEA 2Y1KA 3WXMA 4EHAA 2MSDB 4H3SA 2FFQA 4GEKA 3U7FB 5BV7A 4UTOA 2EU8A 2QTVA 3F78A 4ML3A 1ZH0A 3WGIA 4WLOA 3FNRA 2Z2XA 4UBJA 2XRZA 3DV0A 3FVRA 1NLYA 2Q3CA 3VAZA 2C2GA 4UDNA 5FI3A 4GM4A 5KNCD 3L9XA 3DFKA 5B1YA 4FIDA 4RA6B 1WXHA 2RCNA 3D3WA 2QXYA 1XJQA 3F1KA 2P0EA 5C52B 1X74A 5LQMA 1OA1A 4XASA 4HP8A 1TCBA 4AT1A 1T25A 1BWQA 1YS9A 2O3QA 3X1KA 1IHUA 1ZKMA 3AFGA 1UBGA 3L8HA 1AKUA 2BZ0A 4IF6A 4YRAA 4MQ6A 1C3EA 2JH8A 5IM4F 3VNBA 5E2IA 5KNCH 4JUAA 4DLAA 2PHZA 4MDEA 4CLRA 2FJUA 4DLNA 2UYGA 1F0KA 2BONA 1DELA 4PGFA 1G20B 3DVRX 4TMVA 5M5BA 3TR6A 3VKWA 4POOA 1A96A 3G8CA 4FKBA 1VRCA 3SEFA 2FPIA 1ZJ4A 1G18A 2V8OA 4MUHA 5FPKA 1WMEA 3GJ7A 4DMHA 5F98A 4N7BA 3ZKWB 4D9BA 2QRQA 1BXZA 1FJHA 2GEBA 1EFLA 1HH4A 3RYHA 1EK1A 1KJNA 3RYCB 2HR1A 4NV1A 3AETB 2X0IA 1U3VA 3CCCA 1GVHA 3GBSA 4HLUA 3RV4A 5KYGA 1MX1A 4LVUA 3CF4G 4Q12A 3SFZA 1VMKA 4MUIA 1Y3FE 5EAIA 1IPEA 3QWHA 1U8AA 4PRZA 3ZC3A 4HKTA 5EEGA 3ZK7A 5IDQA 1SUCA 1KE1A 1DTEA 1IYZA 3H83A 3HLTA 4BBJA 1SCJA 4N3CA 2DPHA 1GV1A 1JKIA 1QS0B 2YWFA 3D02A 3U7GA 3EY9A 4X92A 4RMHA 1PFWA 2BSXA 4GPTA 5CNIA 4MITA 4BNXA 2GLUA 3BXEA 3CEAA 3ETLA 3FYSA 1T9BA 3K20A 5G0TA 2HHHB 4MMZB 5T3UA 5E6SB 1P4AA 1UJ2A 5E7MA 1K5HA 4QTXA 4AN4A 1R0ZA 4C6TA 1PGNA 3DLTA 4IJKA 1AGXA 2BFFA 1CXZA 1Z0KA 3RS3A 4HN9A 1SK9A 4JXXA 4PONA 3ZD8A 5KSPA 5MN4A 5FT9A 1H85A 4E6EA 1Z18A 4QULA 4TXNA 1XA4A 4GYWA 2BHNA 2I6FA 2ILVA 4MEJA 3SFVA 1UUFA 2NADA 4CFZA 1LRLA 1C4KA 3RANA 1D4AA 1L1RA 1LPPA 2OQ2A 4DLYA 5BUCA 3JD1A 3TMKA 1X7DA 1XRNA 1IZ9A 1NAHA 2ID8A 2Z5GA 4F2DA 3BH6A 4E2XA 1DJOA 1LBQA 5DTQA 1DPFA 1IU9A 3LDUA 3OJXA 1WCV1 1M72A 2O2ZA 3EFEA 3CX3A 1PG5A 4HRAA 3HY3A 1NVKA 2CNDA 2OP1A 4N18A 2JEZA 2FMIA 3Q9LA 5KS2A 1EFRD 3FXAA 1KI6B 5EIFA 3UWSA 1T3GA 1WXIA 3DFUA 4R1SA 5AUNB 3PL1A 5BN4B 4BBPA 2BI8A 2JEOA 5D2CA 3UWDA 5EZ5A 1JQJC 5L7TA 2QQFA 2EC5A 4RKWA 4UVHA 4F93B 3TZBA 1IZ7A 1IMOA 2ZWOA 3ABRB 1YMVA 1VJ0A 4TKUA 4DCOA 5G1NA 3CV3A 5I7WA 1JT2A 3COJA 2FLVA 3O75A 2GN8A 3OFND 2J3KA 4JHLA 4TL9A 2B35A 1B42A 3L7LA 5KINB 3O5AA 1UXIA 1LNZA 2FWPA 4TUYF 2VF2A 4DHEA 1XLUA 4E30A 2B4TO 1ZM7A 4HPWA 3VR6H 2IYPA 2IGTA 1THMA 3RUAA 2A0WA 4WGGA 5AH0A 2OAP1 3KPJA 1Y5RA 3OKPA 1KEUA 2VG8A 4URZR 4KXVA 3ZU6A 2YXLA 1OUMA 5DTJA 4BZPA 4EHFA 1WHTA 2QTFA 2B37A 1OIVA 3VXKA 3HXOA 5DBEX 3VPSA 4B3HA 2GO7A 5J63A 1EGQA 1M8JA 3KTFA 2H5EA 4IGFA 3G5TA 4TMYA 3B1ZA 1DE0A 3ABIA 2OESA 5REQB 4BX0A 1KQ3A 4RVFA 3BTVA 2ZSJA 2DY0A 5C5IA 5IH7A 1R88A 3FDJA 5ELXA 4TS3A 3H5AA 3OHMA 3LO8A 1T9HA 3V2IA 3MUOA 1KKUA 4S3MA 4D5EA 4DC1A 4J0HA 5CR9A 1EWQA 4ZV7A 3SS8A 4OB8A 1YR1A 4H18A 4PZCA 1YIAA 1XL0A 5ES3A 2PT5A 2PO5A 2JLBA 5BR8B 2XUFA 3PFFA 1LRJA 2B8WA 5JNUA 1QQTA 4JFRA 2Q28A 3HVKA 4K9PA 4C3UA 4K2AA 1HKUA 2FU5C 3KB6A 5T8KA 3I8SA 2W00A 1IBRA 4INAA 2Y27A 4H7DA 3U39A 5KQRA 3M6VA 1MKYA 2RGUA 3SC2B 1KC1A 3ELYA 1Q77A 3NTUA 1UT5A 2Q5JA 3R7SA 2IODA 5JJ5A 5LOVF 4LK3A 4PN7A 1B8OA 2IHJA 2VUUA 4LC0A 1GG5A 2BISA 2TMYA 2V3VA 3BQNB 4HQKA 4LPKA 5F7JA 1ABBA 1RRCA 2FETA 2FLKA 1I5RA 3KR2A 3HWSA 3AUJB 4B33A 4AIRA 2HH9A 4GR9A 5IFLA 1KC3A 1VB5A 1P2GA 3AJ8A 1L5YA 4FMBB 3URKA 4DLTA 3PQ5A 2PMCA 3ITEA 4LE1A 5A9TA 2Z04A 2JFWA 1QVZA 2VJOA 1H4TA 3WL7A 1S02A 2A9QA 2IHVA 5GZ3A 3IHKA 2RB4A 4D81A 2W6OA 5JU6A 1U9ZA 1OLUB 5F52A 3V32A 3QEMA 3VKVA 1D0SA 3EDYA 4IYRA 3Q3JB 1JEAA 4D6XA 5J43A 2MYNA 4ZOAA 4BNDA 1J90A 3NAQA 4WBNA 5ERXA 1BXGA 1OW3B 1WB5A 2IV7A 1EVLA 1HYEA 4G1VA 4F5EA 4ZDKA 4HDSA 2H7XA 5F7ZA 4A8JA 4ZTBA 1Q2UA 3O26A 1LSUA 3PI6A 3U4GA 4NXMB 2H1CA 3M33A 1L8AA 3UKJA 2FPGB 2EERA 3O73A 5C4GB 2ZB8A 4BYGA 1A72A 2G4CA 4HXFB 1CJSA 5DU2A 3LKZA 3ZV4A 3CEHA 4TKLA 1N8NA 2V54A 4KKXB 2IYNA 3T5TA 1DKQA 5IWCA 3ER6A 2D06A 4MARA 1Z6YA 2EF1A 1TF7A 4H35A 1MABA 5DEIA 1WA5A 3HKDB 4RUKA 2X9QA 5CXUA 3PX2A 2G1JA 2AFRA 3FCYA 5DM0A 1JA9A 4CZ2A 3A4MA 4ETNA 3FUWA 4EB6A 4BTEA 4ND7A 4II2A 5JYEA 3CRQA 4IWYA 5K3FB 1ACLA 5CCBA 1V48A 1CUVA 1O2DA 3G1WA 3RVKA 1ZOSA 3COPA 3MIZA 4NHOA 4FFRA 1OQAA 2NQ2C 3PSHA 2UUOA 1LZKA 4GQAA 2IYYA 2WFLA 1P31A 1W5BA 1K6EA 4HFNA 2TECE 4OHZA 3ZZ0A 3QXJA 1MTZA 3MXOA 3AVPA 4WJKB 1W85B 3L0YA 3DWFA 3NIDB 5ALNA 3TIXB 1FXSA 4HFRA 5HTKA 3D7SA 2RJOA 4K26A 2AMLA 4PNPA 4OJQA 1E7QA 2C5EA 4UNSA 2IYVA 3CLUC 3G8BA 1MA0A 3OQPA 2RGWA 3ZZMA 1XD2A 3V5NA 2G40A 3E4CA 4GMGA 1OZFA 4KQ6A 4YPVA 5J2UF 4RKEA 3DZHA 1YC5A 1RABA 2Y68A 1NN0A 3BPSA 1DIAA 3GUVA 5KTYA 2E6UX 1P7VA 1MMFB 2Z5FA 3K2IA 4ZJYA 2YN4A 3BKXA 1CP2A 4EQZA 2PUDA 1Z4PX 2BHSA 2H0QA 2XJ4A 4RYLA 3NFRA 2JKYA 3NC4A 1EFVB 4HNQA 3BOSA 1J49A 1M2OA 1VPVA 2ZG6A 4JJFA 1FTWA 1FYXA 1RVV1 1C7QA 2QY9A 3G17A 4JBXA 4KXQA 1L7OA 4DDHA 1XK7A 1YBVA 4O3FA 1BD3A 1EJ6A 3ELBA 4P53A 4L2IB 1YTUA 2JPDA 5L3RA 5F64A 2AI1A 4U6SA 1PJAA 1KMQA 4L4XA 5GZ1A 2NUPA 5A3VA 8OHMA 1P1RA 3L2OB 5CLHA 3L1IA 4C5AA 4PBTA 3U19A 2V5UA 5CBKA 5BUSA 4LNAA 4OQFA 2IH2A 2JJ2A 4G56A 3TRJA 1GG2A 3E1KA 1N4AA 4Z6KA 2BBOA 1GRVA 1RVDA 2QD3A 5BT8A 3FOEC 3EPLA 4CV3A 2ZE8A 3GP3A 1UEJA 1WIWA 2E3JA 3IRVA 4W4TA 2BKXA 3KUKA 1XZJA 4PANA 5F21A 3WYBA 2RKWA 1FP4B 4XEHA 3C7AA 3D0QA 2VXOA 3DCNA 4LOIA 3D7MA 1WUTA 3B7WA 3PHJA 3QUCA 4RWEA 4EYQA 4GSLA 1YRHA 3K94A 4XB1A 3DTVB 4B44A 1EFUA 1RWNA 1TJ3A 4YCCA 2GWHA 4BX8A 3RK4A 1YR2A 4DIEA 1A27A 3B53X 4KG7A 3WMXA 4AL4A 5DM2A 5JD4A 5KQLA 5CH8A 4KQ9A 2AJBA 4DNPA 4WOPA 1I4EB 2OV6A 1ZM3A 5I47A 1EWKA 2VOJA 3E70C 1M83A 1RRVA 4ZGGA 3BE8A 4YJHB 1X8XA 3V3KA 1IN7A 1UXHA 4ALMA 2OLKA 5TGZA 3VHXA 1EESA 4UHFA 4B4VA 3QV2A 2XAAA 4X7RA 4WBNB 4EW3A 4B3MB 3TR0A 1WRBA 4B9AA 1Q3KA 4GBGA 1Z22A 2PS0A 2A57A 1MO4A 2V9ZA 3GPIA 4FFBA 4FMDF 3ISJA 1AC5A 3EZLA 5AKIA 5C46F 1XGKA 1DZIA 3L84A 5IN5A 2AS0A 4EEZA 3NPAA 1RJEA 3EC7A 4A91A 2H0RA 4TTJA 4DABA 2Q1YA 4OHVA 3WKEA 4W6QA 3S27A 1VCNA 1O0BA 4FYVA 1TQ2A 2AJDA 2O1EA 2AG0A 5FWNA 3K70D 2VZLA 4AZSA 2WIAA 2HGZA 2GAAA 2F4VB 2Q9UA 2E18A 2FP4B 1N1MA 1XXHE 1XHFA 1O54A 4H7JA 2AOWA 1P3JA 1QYWA 1W35A 3DD5A 1A1VA 1OV6A 4MWTA 4E5KA 1J56A 2H65A 4K9DA 4GW3A 1YRBA 5ALHA 2CXRA 1L8XA 3R5JA 5LQDA 2AJCA 4MWGA 4DLZA 3EEFA 3B1KA 4M8LA 2PRJA 1LY1A 3Q40A 1IK4A 2R79A 5LLDA 3R0VA 4ZYUA 2XHZA 3Q6NA 1O94D 4XDGA 3DDSA 1D7AA 5ALTA 4J9VA 1ILWA 3LKDA 4GLFA 1BMDA 2YASA 4MUXA 3VR4A 1A50B 2V7XA 1UKZA 2R7AA 2ZSIA 4LQCA 4OXXA 3EZ2A 1M34A 2PWPA 4JUFA 2QSJA 3OQ6A 1L5OA 4MV7A 4FHEA 4IHQA 2BMWA 4QGSA 4LBYA 1KIMA 3LZCA 4BQEA 4ENWA 5F7OA 2PQMA 4G9EA 2C2BA 4HAYA 2I3GA 4KOEC 3PTAA 4AJOA 1CUZA 3H8VA 2ZUTA 1P9WA 4O25A 4AY5A 3KM0A 4RHFA 3TEJA 1LK7A 2BGIA 4EKGA 3KJNA 1CUUA 1SC1A 1ZW1A 3G9TA 4H0FA 1PDOA 1PGPA 4OD0A 4R9RA 4CFYA 5HKOA 3DTNA 2IS4A 2AE2A 2V0GA 3B3GA 4B84A 3PI7A 2GX6A 4WA8A 3KKMA 5F1KA 1G7RA 2QG9A 4NJMA 1R0YA 4EHKA 3SKVA 2H07A 4OH1A 4B2LA 3WGJA 5JMPA 1VHQA 1GNPA 2RGBA 4JKYA 1B43A 3N7TA 2FDXA 3OWOA 1VG8A 3ONVA 4BTVA 4R40A 1W4BA 1MF7A 2AVDA 3DG9A 5FNZA 3D6JA 4KR6A 4IY1A 2G6TA 2I8AA 1TQ6A 2C9ZA 3DD1A 2GZ1A 4YJ3A 2HBRA 1O4WA 3I9FA 1KO1A 1ZS9A 3MM4A 1HL7A 2B3TA 4TROA 1BE8A 1H42A 2K2QB 2LIVA 4B80A 3CUYA 2LP4Y 4QQKA 2CN1A 2AZ4A 3MJVA 2VN8A 3SJZA 5AJVB 1VL2A 1XFAA 4HAZA 3P1JA 4NESA 5EWMA 5JD3A 1QP7A 3M4JA 4CL3A 4WHMA 4E33A 2IDMA 3LQ2A 4MYTA 1J2JA 1Y3BE 3P2YA 1SZCA 4K6CA 3TPZA 4FDTA 1ZOOA 2C4TA 2ID7A 1CQWA 4U02A 1Y7HA 3Q2IA 1D6SA 3OH8A 4C06A 5JR3A 3LQRA 1TEZA 2PLRA 1GEEA 3RASA 3HFSA 3V1UA 3OOYA 5BOSA 1FU7A 4QD3A 3NCHA 1C3JA 4IIEA 2A14A 2CGEA 3AW9A 4YWJA 2HA6A 4MV9A 2X8AA 2R85A 3E7DA 1NOIA 2HIAA 2MSEB 3ADKA 2QVXX 3FOBA 4MV8A 1QWOA 4MIEA 4OHPA 4X7BA 3SLKA 4EY6A 5C8VA 3F67A 2DLCX 2I4OA 1CJTC 1DHRA 5TX7A 4E5VA 5FJJA 3SZGA 2QSUA 4NONA 4IIHA 4IH1A 3AILA 4M55A 4OO3A 5DYTA 1JBKA 4GG1A 2YDXA 3BCSA 1C3LA 3EFOA 3PGXA 2GB4A 4JXJA 3IIEA 4MLCA 4S35A 5B1EA 2EP8A 3E5RA 2FSVA 1Y6GA 2NTJA 2BY4A 4ERXA 1I5OA 1JKXA 3BMOB 4JU9A 4YAEA 3U9LA 2VDRB 1SXGA 1UBNA 3K70B 4NG4A 1QV6A 5HF6A 1QPBA 1IN8A 4FEAA 4YQZA 1B6SA 3FRIA 4Y2HA 5IVDA 1CY7A 4JQZA 1SHLA 3G3EA 4QECA 3NJ4A 4G07A 1XHEA 2YVUA 2IEDA 3L8CA 1MU0A 1TB4A 1O57A 1IY2A 2FUKA 2AOTB 5ALFA 1XX6A 1RM4A 1XVLA 2W5UA 3UTCA 3CZAA 2DR0A 2ZZNA 1GT6A 2Q0XA 3Q72A 2WWRA 4BECA 5CDSA 1ILEA 4TXHA 3HV0A 1L7BA 1QYDA 3WK4A 3GH1A 2IXGA 1Q1NA 1RI2A 4WCFA 1RPAA 4S1NA 1E3DA 3WQBA 3D1VA 3R5XA 4I81A 2W6MA 2BIFA 3KUUA 3D54D 1M1NB 1AXEA 5KVVA 5JV5A 1GDTA 4WUTA 4M3NA 1WD7A 3SE0A 1JDZA 4YRTA 2HB6A 2D5AA 1IG3A 2J3JA 3B3JA 5HGJA 2IJGX 1F7VA 2JGLA 1CYDA 2EFEB 2QSYA 1MZPA 2J6BA 2YYSA 3R40A 4LYFA 2TMKA 1PJ4A 2RH8A 3RVPA 4FR5A 4BO3A 3L7KA 1DAHA 2IEBA 1F12A 4KW7A 4D0SA 3PEWA 1G4UR 1K92A 3RTCA 1Z75A 3C48A 1PFQA 2FF7A 1R4NB 2BFDA 3IQIX 1UCFA 3UEOA 4B1FA 4DTCA 2QB5A 1VXOA 1H5QA 5CXQA 4BQPA 3ZJTA 5LP1A 4AF8A 1KEWA 4PZEA 2F2TA 2NSJA 3KXIA 3KUXA 2C78A 4UFNA 2OMEA 4RM3A 2EKPA 5J23A 3QVSA 2HW8A 2ANBA 1IHPA 1T0UA 3M70A 2ZPTX 4HY3A 2GN0A 2KMLA 4MAMA 2WM2A 5JDCC 5C1OA 3IP3A 4IDDA 3ZCRA 3CZRA 1R00A 1PR0A 4Y6OA 3D9QX 3TOVA 1SCDA 3ZDBA 5GQSA 4EA8A 3ZY6A 2JJMA 1QOPB 5C1IA 3VGJA 4LCBA 3NJ8A 3ILHA 2WI8A 4K7JA 2YL2A 1U3UA 4R8VA 4IMIB 4UM7A 4M21A 3L7OA 3R9KA 3W06A 4EHDA 4M36A 2JJYA 3CO0S 2Q27A 1M6VB 4X20B 5IKOA 1YULA 3GUHA 4LDZA 1XNQB 3OOJA 5AXAA 5CB6A 4F2PA 4OHFA 3TECE 1EVYA 4F04A 4ME6A 1XRJA 4GP9A 3JD2A 1VMEA 2ZXEA 4CMCA 5H9WA 4Q4HA 4B7XA 4JV5B 2F4NA 1UBFA 4NU6A 3L5OA 3STHA 4LOLA 1RYDA 2BGJA 4LFAB 4JP2A 1S3FA 4IZIA 4MR7B 4FZ3A 2W58A 3LUGA 4R2XA 1KA9H 1QQ7A 4ENQA 4TKVA 2XYHA 3GG9A 1MH1A 3BHMA 4FFDA 4GZ3A 4HRYA 3ZJ5A 4FX2A 4V2IA 1D4ZA 1N6KA 3P0IA 4X71A 4ARUA 4LJKA 4CUJA 1ZBQA 1E2JA 3L01A 5GONF 1R9MA 4DADA 2Y2VA 3HWRA 4KKVA 2G71A 5C4IA 1ZU5A 3IR6A 3RC8A 1T2AA 4WKPA 2L82A 4DV6B 3F7NA 4D0GA 2WWIA 1L5FA 4RV9A 3IJ5A 3VU9A 1E2IA 2K6GA 4FK8A 4KQ1A 1FB5A 4TTQA 1TLFA 4XIYA 4ASUD 4C89A 4PINA 4DJFC 1H05A 1H69A 1N6LA 1SHKA 4HNUA 3F71A 4WKOA 1D04A 2FX2A 2ZRHA 4ZODA 5KHAA 1ARZA 1PWEA 2GYWA 1UPAA 4KPUB 5A06A 1AQIA 3FYDA 3BZUA 3N3BC 3MHTA 3JRNA 4YC7A 3TSOA 1BFDA 1LLQA 2NSHA 3KL2A 4HWGA 5E0OA 1XWWA 4BQIA 5AHKA 3E4DA 3KX2A 4WNYA 3G2LA 3LLMA 5TS2A 3OU2A 1P4HA 4V0KA 2P2YA 4I9GA 1PL0A 1XD8A 2NU7B 2GN1A 2FN8A 3LECA 4XLTA 4OQEA 2P5UA 2PYDA 3KYCA 4ARCA 1Y81A 4RD1A 5A71A 1JMKC 3CMMA 1DG3A 3NTXA 4PO9A 4ZAZA 5LYYA 3MMPA 5FOWA 2R4TA 4KWIA 3U13A 1NE7A 2VHQA 1C1YA 3BCHA 4HDRA 5BQ3A 3PEEA 3QUTA 5LZ9A 5IAGA 8MHTA 4KX3A 3IRUA 4GDFA 1W2WB 3JWGA 3PNLA 1HYHA 2PEYA 4NZNA 3ZJ4A 1Z6XA 4YJKA 4ENVA 2YOHA 4UJ5A 4E08A 4BZZA 4GPIB 2IVZA 1D0IA 3DE3X 5FF9A 4MTCA 1T5TA 2V3WA 3VVBA 1ONBA 3B6MA 4Z49A 2R6AA 1SVMA 4I4IA 4G0NA 4N6GA 1CJCA 1X86B 5J2TB 1EE9A 4ER5A 5TVGA 1R64A 1E2KA 1IOLA 4LV8B 3JQBC 5C3MA 3L92A 5LOVB 2I4LA 2OTCA 3GEPA 1IB6A 3GUUA 2EVWX 2JNWA 4H0NA 2RGCA 4R31A 4OHKA 1GKLA 1SIUA 4IJ6A 4XQ0A 3A1FA 1J25A 4Y0AA 2R8YA 2OBXA 3IBTA 2R8EA 2Y0PA 1QOZA 3BB1A 3FZQA 5BN5A 2IV2X 1XYYA 1DQYA 4URYR 4YDRA 3WL4A 2O2JA 3D7LA 1UPUA 2PWAA 3G8DA 3P0JA 5L3QA 4PLTA 3KOZA 5CW2A 4DA9A 4FBMA 1MG0A 5FWXA 4E5UA 2ODQA 4CLRB 1B7GO 3ZZTA 2AKYA 2D1YA 3DVLA 2W8ZA 4M46A 4E0BA 5HKAA 3B7PA 5IULC 3ANYB 1FP6A 1X9GA 2UZ3A 3VOBA 2HJHA 4KBGA 2P2LA 3JQDA 4MVYA 2Y66A 2QUBA 1GG8A 3G0CA 3IMKA 4KRXA 4QPJC 2NVOA 3KEGA 2WSSA 4PFKA 5EXXA 4PAOA 5FAKA 5KNLA 3FZYA 5G02A 2XMPA 1ZFNA 2ZQZA 3N53A 3C6MA 5AOAA 4BMZA 4CEIA 2PH1A 1X70A 5IDYA 3GJ6A 2VDVE 2HA7A 5K0TA 4GI2A 4Z4CA 4J90A 4P5DA 4NV0A 4DWWA 1D0VA 1HTBA 4HQ0A 1CK4A 5BNIA 2WVGA 1RE1A 4ZANA 1CY1A 3BSYA 4I8DA 3CYFA 2HRDA 4BNTA 4PPNA 1QGDA 2WUWE 1YVRA 1D07A 4Z0TA 2NVUB 2J9ZB 4ONEA 1DKLA 1FTNA 2WU4A 4DYVA 1R9GA 2X2PA 4OQPA 1ZUD1 2EF0A 2YNMD 3DKIA 3OZRA 1LFAA 1FBTA 1A77A 1U3DA 5SY6A 4B6EA 3O7WA 3FWPA 3W5IA 4XM1A 3N2GA 3P2MA 3ZCSA 5KX5B 3GMDA 2WB2A 2Q9AA 3R5HA 1QAOA 4QXAA 2B1IA 2O05A 2YVKA 1FUIA 3GC6A 3I6YA 4KEAA 5D3QA 1ISMA 3INTA 3DJYA 1P80A 4TL6A 3X1MA 1FYFA 1AU9A 3KR9A 3RVNA 4C03A 1I30A 1KDOA 1HRKA 5C7YA 2FSVC 3UT6A 1N2CB 1XOIA 3D3NA 5KCMA 3EEIA 1XEWY 3OTQA 3DE6X 3GZ4A 4Z4QA 1O58A 1IUOA 1W9MA 3FPHA 4OEHA 4RTPA 2H4FA 3K9QO 1CIJA 4FI3C 2PXHA 2J5QA 4MW1A 2XX3A 4DPMA 1IY9A 4AFNA 3ZWYA 2ZUFA 1ADCA 2GA9A 4PS1A 4E94A 1YS7A 3VHXB 2A2ZA 3ADPA 3U7QA 1EB9A 4MV6A 3QELA 1EK0A 5LMZA 2QUHA 3QRWA 3A4TA 3TCKA 3Q85A 4JLNA 4Q4LA 3FDXA 13PKA 3GGGA 1W36C 2WZBA 4KFRA 5IC6A 5C5DA 4LCEA 3IP1A 1FF9A 1ZMBA 2R44A 2R7LA 3PQFA 2BGNA 2YZ2A 4A6PA 3WWDA 4YAGA 2D3WA 1B0UA 3BQMB 3OE7A 3LUBA 2XT6A 4GPD1 4WXYB 4A6XA 4C21A 1YNOA 2ZXFA 3DOJA 1UDRA 4CMHA 2HA0A 1Y5LA 5CXSA 1CDDA 3SVTA 1EHIA 3A04A 2N1MA 3B8EA 4CIBA 4ND3A 2XCSB 3ZCPA 4IXNA 4A5OA 3T0FA 1DRJA 1R5BA 2CNWA 1JN0A 1OGIA 1L9XA 2DWPA 2PFKA 2A30A 2MOKA 1EAMA 3NRJA 5CK4A 2Z5LA 3OA2A 2X0JA 4YAOA 3TAHA 1GKUB 4GBMA 5TPZD 3E9CA 5BV0A 4QKQA 1FDIA 2AZXA 3WY9A 1M2JA 1WW2A 3LXRA 1USKA 4Q9IA 5FKJA 1TVMA 2PYZA 2B25A 1BTOA 2O7QA 2WJWA 1CUXA 1AHPA 3EEQA 1Z2DA 1I7PA 3RVLA 1Q50A 3ZY5A 3RAJA 3CVXA 2Q2QA 1RSZA 2ZAIA 3IXLA 1TM3E 5A5GA 3Q7EA 4KQJA 4HFMA 2ZBPA 4UE6A 4B3DA 1AS0A 3DB1A 3EQZA 1W5TA 3OEED 1ECCA 1UQRA 3QPBA 4IKOA 4P82A 1ODKA 1TL7C 2FPGA 4ITRC 3MJSA 4Z7QB 4HWOA 5JCZA 2HJRA 5TQ0A 3LCJA 2E89A 1IK6A 4NH4A 3O3OB 4OK5A 4CKCA 2CXOA 3KIPA 4UVGA 1S9DA 3GA5A 1FUEA 1EQUA 1TM5E 3IAUA 3N7AA 4GNKA 4RJJA 3TW0A 3UM9A 4AZWA 4FD2A 5C7OO 1QP4A 4NEQA 4LOJA 3SYMA 1AKRA 1XSEA 2C94A 1TYBE 1IPFA 2VAXA 3M6AA 5K0EA 5KJ1A 2VHCA 1WVMA 2FWAA 2WICA 1QK4A 1UMBB 3QLJA 3SDSA 5E3IA 3GLFA 3KV1A 2XCOA 3A6LA 3H9EO 3HBLA 4G4SP 2ON6A 3U40A 5IF3A 1NW3A 3MGAA 1L5NA 1I6WA 3CNEA 1X39A 2PKQO 2D1RA 2FVYA 3LHKA 3CRNA 3HDGA 4WCDA 5IAEA 2AQHA 4CR6A 1SC4A 4P2BA 3TW6A 4B83A 2V59A 2HNBA 1KI1A 1XDGA 2QRLA 5KBYA 4FJ2A 4G97A 1DG1G 4JJ4A 5EE5B 3FMPB 4ZVUA 3WAKA 1I3MA 2WIBA 2IH4A 2DQZA 1NURA 4OMFG 4Q1FA 3R7AA 3A27A 3DL2A 4BKMA 1U0JA 4Q19A 2OILA 3HBNA 3LZDA 5LSAA 1H2ZA 2INGX 5A9RA 4LJAA 5LVAA 3QY9A 4PVDA 4H6XA 1PJSA 2FK8A 2H4WA 3B1YA 3EQ6A 3HCBA 4LYAA 4I55F 4RWZA 4Y9TA 3UHJA 2VZ8A 3P0FA 3OC0A 2R8OA 1KYXA 4EY7A 4D8YA 2ZSHA 3RU2A 4H27A 4P92A 2M6SA 3DLAA 1YRQA 3SX4A 2PKWA 1TMYA 4NK4A 2IZOA 3DC2A 4OLJA 2C4MA 1CRWG 1XCGB 4M86A 4XLLA 1XV5A 4Y6LA 4DLRA 1I6KA 3TG2A 2H4XA 2X4LA 3EZ6A 1X0XA 3EEOA 1BGVA 1NI5A 4E1VA 2YYYA 3UFXA 1W7AA 1VSVA 2EEZA 3DHNA 4IVRA 4KHPB 2ZYWX 3DMGA 2C4WA 3AG5A 2GK6A 3B9QA 1GR0A 1BG6A 2PX3A 3UJ8A 4CKEA 4FDAA 4LXQA 3MRSA 2OBFA 4PLFA 2PGDA 4Q9NA 1N0UA 2ASVA 1V8DA 2R1TA 3AHEA 1KFBB 5AW6A 2IPNA 1XP8A 3RKUA 4C4TA 1Y8AA 3PVCA 4IH9A 3OURA 2VPXA 4TTPA 3AM3A 5DMXA 4HOYA 4TKZA 5A0VA 3JARA 3BCRA 3ET5A 3F3YA 4E1AA 2AN9A 1E69A 4Q18A 1KEKA 3RK1A 1KYYA 1RXYA 1RRGA 4EG0A 3T5DA 2A1UA 3WRYA 2PSDA 2JJ2D 4NNOA 3W8FA 1C9NA 3HKCA 1B14A 4DIDA 4FB4A 1A9OA 4RDHA 2HT6A 1OBFO 4XWTA 3T95A 4O4HF 3NGXA 4AIIA 2QXUA 5HX7A 4HB0A 4X64B 3FNHA 1FJGB 5HQ3B 1TJNA 4BFTA 1IN6A 4IJWA 4FFMA 3DCJA 1Q7CA 4JQCA 2XT9A 4C2BA 2DFPA 1XZGA 2P3SA 5IJ9B 5JNSA 1XMQB 1AQLA 1K3TA 3EVEA 2IU3A 2M6KA 4GAEA 3SI7A 3WOVA 3SQWA 3UJBA 4IH4A 2G08A 4QWMA 1EA5A 2BJWA 5D3MA 5EIHA 2IX3A 3ZKAA 3U5TA 1VHTA 1SBZA 1NSFA 4MB6A 2AF3C 3LTEA 1M1YB 4EB8A 3C2QA 3WMGA 1TD9A 2WTBA 3V8EA 5CA0A 1XRPA 3RLIA 2ZIUB 1REQB 3AB7A 4QUHA 4O4IB 4HX9A 4N01A 5CNMA 3GXOA 2J5KA 4QBKA 1K8QA 1U2TA 2CSUA 3WP1B 2BF7A 1P0QA 4JKOA 1VLVA 1P73A 2I55A 2RHLA 4L8VA 3P9PA 3PGKA 2HYIC 5IU6A 1WMBA 3O1LA 1W0KD 1VMDA 1NF3A 1UF9A 1RM0A 1S9HA 5JAHA 2UXCB 3O8CA 4IP0A 2PQ0A 2YR0A 3F8SA 3MYRA 5MN5A 1M6WA 6PFKA 4Z0PA 3TLEA 3T94A 1H2EA 3GY0A 1B26A 2QVLA 3TRFA 1Y1QA 3GT0A 5C9ZA 1M7HA 3DZIA 4IHJA 4DS3A 1E3JA 1GQFA 1E2GA 4G5FA 3QFSA 4FEYA 2O14A 1JG2A 4O1HA 2HA2A 4E22A 5D6NA 4PRLA 2IPAB 1CBUA 4UD2A 2Z83A 4KVFA 1NI4B 3ZGLA 4TRMA 1RPTA 1Z68A 4WY2A 5B4TA 3BRSA 4RS4A 5IWAB 1F3LA 3N8DA 2VAMA 4IDAA 4NBRA 3PRJA 3B3QA 1T2NA 4X5OA 1QO9A 3LS2A 1AT1A 2YIJA 3F8TA 3M4YA 1KGSA 1GPWB 1ZESA 2O2DA 5ANRB 3ZEAA 5KTPA 3WB1A 5AVVA 1G8AA 2F6RA 4MVJI 4Y0NA 4EMUA 2R751 2FG5A 1J1UA 1PWHA 4BJ3A 5JAMA 2AXNA 3BZWA 3QBVA 4C4SA 2WIFA 1KOGA 3TRDA 2EQAA 1CQZA 1TZ2A 4R1MA 1PAUA 2AFHB 3WK5A 4Q4JB 4ZT7A 5L6LB 1U5BB 1O5TA 5AVWA 1GGHA 4G4JA 1YCDA 4W9NC 3ZWKA 2VPYA 1OASA 4OF4A 2DZDA 3WGTA 4L8YA 5K45A 3L1KA 1JL3A 4QGAA 5A9SB 4WCFC 1IN5A 1I1NA 5J59A 4AJNA 1ISJA 1NN3A 4CM5A 2K7ZA 1DJPA 3AHHA 3ENQA 3KR0A 1WUIS 3RJ5A 1FSGA 4RHUA 3R7LA 4DB2A 2QLMA 4RBNA 3IUSA 3DE2X 3F7TA 3CUKA 1ZCJA 1OZ0A 4LC1A 1A69A 4LQLA 3AY7A 4Q9JA 3DO6A 3RIGA 4CNBA 4ER0A 2B9EA 4AROA 1ZBDA 1X19A 3FZNA 1G8YA 4I50A 1VYTA 3FI9A 2JIBA 4JR2A 4E12A 3NOVA 1EX6A 3AGQA 2CNOA 1XQXA 5JPIA 3HVRA 1YS6A 3JVIA 4MYCA 4C14A 4M0DA 4KL8S 3CN9A 2IS2A 5AW4A 2REOA 3MTQA 4RC9A 2CT8A 1O96B 4KWCA 5LM3A 3L6BA 2P2GA 2ZPUA 3RKRA 5IT5A 1HMYA 3JZIA 4MS4A 1XTRA 4QFBA 1CKEA 1J97A 1IAQA 2J31A 1T10A 3BF7A 1WSWA 1NG1A 2FQQA 1USUA 2BM8A 3LY5A 4ER6A 1LH0A 1V7QA 1JIIA 1VJ1A 5KKNB 3KK0A 3L8EA 3MMXA 4D4GA 3U16A 3BB3A 3C3BA 1P6XA 1SHTX 1W2GA 3QVUA 1NKSA 4O8ZA 2WTAA 5ENVA 5K2OA 2UXDB 3H4TA 2WA1A 2ORED 4CE6A 2HSJA 4OUKX 1Z0AA 2E5WA 4UXJA 4WCVA 3W2IA 4DCPA 3AB8A 3QPCA 3ZVRA 2PUHA 3OA0A 3V1TC 3ADCA 2ZAYA 4YMSA 1FBNA 1J42A 2FSSA 1X9HA 2PM8A 4LJ4A 5HEKA 3TW8B 4B35A 1P7ZA 3EW9A 4HYQA 3VR5H 1PZFA 1G7SA 3L1HA 4L5CA 4S12A 2P11A 1C5KA 1SM4A 2HBYA 3EGDA 4FILA 4OM7A 5K3BA 4C7MA 4EF4A 5JW6A 3LX4A 2W2PA 1MJHA 2IXFA 3IDOA 4WD3A 2W6IA 1ZINA 5JQGA 1QPGA 1CERA 3AUXA 4JIMA 4RW0A 4IFIA 1JMYA 2OV2A 3DMDA 1GEGA 3R74A 3VTKA 1NMSA 1VQ1A 1JB9A 1CJUC 3VOSA 1RM5A 1Z0IA 3WNBA 1JECA 2X2OA 1QGZA 2XQJA 2OKCA 4ZHQA 2AR7A 1UBEA 1M33A 3FFWA 3PPVA 5BVHA 1ZKDA 5B2ZA 4YCNA 4NPCA 3VU9B 1R6XA 1JILA 2WB4A 1YI0A 5EIBD 3VKHA 3OPYB 2R84A 3PDHA 1KY5A 1PEDA 5DYNA 1QCZA 2HM7A 1ZY2A 2Z2KA 4XI9A 2EZ9A 5H68A 4BFZA 2RFLA 2Y0BA 2JFVA 4U5XA 2XVYA 4EJ6A 3T7AA 1CNMA 4Z3OA 3F3KA 2B4KA 2DQKA 2Q4BA 3ZWNA 3GLIB 1UDAA 2CV1A 5HF5A 1P7WA 5KMGA 2BCEA 2FN9A 2QE7A 3DE4X 1T2DA 3KAQA 3WQRA 4NABA 3RS4A 2PL1A 1SKYB 2PGLA 2ZUSA 3BMNA 1Y7LA 4ZYLA 2P6UA 1E64A 1KDZA 2PLFA 4ZYVA 1NUPA 3OFNA 5BSMA 3DBLB 2A67A 4Q1AA 2YJTD 1RJGA 4NICA 2BSQA 1HWYA 1UC5B 3BFPA 3IB6A 2DFTA 2PRSA 1G55A 1B8PA 4GX1A 4ITUA 2MT9A 3FHTA 1P0PA 2GZMA 3HS3A 2D7JA 4PRKA 2JG3A 2OLEA 3RABA 5F9MA 4P3YA 4UE3S 4XGKA 2YJNA 3UPUA 5BW6B 2VO1A 1GPKA 4LJRA 3GEIA 1XJWA 3VKUA 3WNQA 3D8SA 4BXOB 4YJDA 5DI3B 1V1JA 2ZVPX 4DMMA 4UNRA 1TCUA 4GI3A 4HZGA 5H3HA 2IT1A 2Y05A 4JOBA 2J59A 2SKCA 3X1DA 5BSGA 3D7KA 2SCUA 3P0EA 4DQKA 3EEYA 2VCYA 1EUCA 1XMIA 5CAEA 2P6RA 5HZGA 4H1TA 4XQGA 1GYQA 1SHUX 1UKVY 2HK9A 4NCHA 1VGVA 1A8UA 2F9FA 1P1BA 1QO7A 4BP1A 1B16A 1HORA 1VLLA 1JDNA 4ZICA 3C70A 3BWVA 3UHOA 2I6SA 4TWAA 1PS0A 1QO0D 4IO0A 4E15A 1WBDA 1ISRA 3CEMA 2A9RA 2Y6VA 3PA6A 1GFIA 4NQZA 3NOXA 4V3BA 1PN3A 3LU1A 4MGYR 4TWIA 5LR6A 1B15A 1Z56C 3ON5A 3CKMA 4NBNA 2YJ5A 5G1OA 3R3HA 1JRLA 4JI1B 3PJGA 1EWRA 2QNIA 2AV6A 3KB2A 2ZYTX 1RWQA 5F9FA 3NHKA 1JQAA 4EKEA 1DFHA 3K35A 2GFQA 1QNLA 3OO1A 4KE6A 3JQ7B 3PXCX 4CTNA 1XQWA 2EX1A 4HMOA 4MMXB 1QHEA 2G1KA 3V7FA 4HNAA 4B82A 5H8WA 1J0XO 1J20A 1T3LA 3ZV7A 1NJ1A 1X7ZB 4BMNA 2P79A 5ESXA 5BSEA 1OLSB 5EWJB 3S40A 1G2PA 3U1VA 3MLAA 4QDTA 3N59A 4NU0A 1GZ5A 1NZFA 1P5ZB 1UXGA 3HCEA 2G07A 1I2DA 2CSXA 4QPNA 3PFIA 2RHGB 4CT5A 3KHSA 2Q3HA 3TZKA 2UUPA 4XDYA 4XB2A 3TCNA 2DHCA 4ZCLA 3EBLA 1M2WA 3WQQA 3CURA 3F4KA 3I4CA 4KRYA 1SUAA 4LNHA 4LZWA 3CA8A 1FFSA 3QOXA 2X0RA 5ECDA 1SOWA 1SVSA 2YNMA 1QPZA 4A8HA 1EUQA 5AFSA 5CDTA 4OHRA 1MGPA 1RP1A 1A9PA 2PVPA 4XZ3A 4ZDWA 3KQQA 4PICA 1PZHA 2V55B 1EUCB 1XYVA 1Z34A 4OJTA 2GBIA 4YT5A 2B3DA 2BSAA 3IP7A 4YMLA 4AWBA 4M1SA 4V02A 1DX9A 2GSWA 3D8RA 4PBSA 2DTEA 3FCSB 4XVRA 4LF6B 4I4LA 1U9CA 2X6QA 1UP4A 3PD7A 2HPZA 4HLQB 5FV4A 5EMMA 2YFYA 2Q2OA 1HDZA 1CSEE 5H81A 2Q7DA 3SE7A 1TZKA 2ZUVA 3AI1A 3SHWA 1WQ3A 4BNYA 1UJMA 1N2ZA 2WAOA 3EXAA 4BAGA 3O9ZA 1XK6A 4P33A 2IU6A 1JT9A 4TT3A 3FOCA 4DIKA 3FJOA 3FYUB 1BHO1 2GK7A 4KTTE 2GEVA 5HRCA 2QQ0A 5IXSA 1Z17A 7ADHA 5LP6B 1YZQA 3OTWA 3K0KA 4ZRNA 1DIRA 2I65A 3OKCA 4RF3A 5KVCA 2ZBVA 2EW1A 1FFCA 1U02A 2VDJA 1R3DA 3AJEA 1HPLA 3G0GA 3H13A 4RSHA 2FEOA 4XRRA 1RP7A 4UEKA 3UJAA 2IHBA 2Q2WA 4L08A 4QDZA 3T4UA 3VVMA 4YY3B 4P4LA 3A1CA 4QJ4A 2RGNA 4F5DA 5DWVA 2BH9A 5T67A 2QN2A 3PS9A 1KSGA 2F8MA 4N48A 3C3CA 3TD2A 3V8BA 4PHCA 4GC5A 4DLVA 2GMWA 3KALA 2BJVA 1K8RA 4BO6A 1N34B 2DBQA 3PWKA 3P2OA 1GGVA 1Q0TA 5BVHB 5BUZA 2Q49A 4LJYA 3FA2A 1E4EB 1RDFA 5HK8A 5CMLA 3PPWA 2QD5A 3UJ6A 3QIVA 4PC7A 2B9VA 1K8ZB 3E81A 1DQPA 2DLDA 2IEGA 4XWWA 3WLHA 1NVWQ 2PWBA 1U9JA 4AS1A 1GUFA 3GB9A 3IAAA 4DNOA 1RPNA 4ZAXA 4JJ6A 3PC7A 5K2MA 4FX5A 4DA7A 2HFKA 2IGBA 3UV6A 2N9UA 2HO4A 3HKCB 4LYGA 2E55A 4M0FA 3ZWXA 1E4VA 3NW9A 4BPRA 5C53B 2GDZA 3DAYA 3QUBA 4QDUA 4UREA 3I04M 4UDYX 4ZVTA 1SUPA 5DULA 1AKTA 3RS7A 3GP8A 2BM1A 3QU2A 2QPLA 2F43B 1FUYB 3R0IA 2BFBA 3ZEIA 1Y8CA 3HP1A 1MV5A 3ZX5A 1SBHA 3NEAA 4I9FA 4N6NA 2YWHA 3VOTA 1U3GA 5EWMB 5LQSA 3G8AA 1ONSA 3ORSA 4CMGA 4EYOA 3QKUA 4YUWA 1K6XA 4MVJP 2CLMB 1P17A 4S1VA 5IANA 3PWZA 2HMWA 3ASUA 3NUQA 5KVAA 3DZGA 1R8QA 2Y9MB 2WKPA 3FBGA 4HB2A 1RCUA 4JC4A 1A9ZA 2FW1A 2P3OA 3RUEA 621PA 1Q11A 3OTOB 1U7TA 3JASB 4YCSA 3A1VA 3D59A 3N6RA 6REQB 2LV8A 5B7GA 4CG3A 4JYBA 3TD9A 1U3TA 2QDXA 1E6KA 3JS5A 4AKEA 2WQ7A 5H82A 3WNCA 1WCIB 3RUIA 2PPLA 2RK6A 5AJZA 1I9CA 1TYZA 2Z9BA 3R7WA 2WAMA 1NXXA 1XDSA 4PZLA 2EIXA 5AESA 5BYJA 4Z4FA 1OFTA 2C9MA 4H0CA 4HZIA 4E31A 4JP3A 4X1YA 3FNBA 3OJOA 1GTMA 1IIBA 1DLIA 1PR9A 1RCTE 2XXAB 1U2SA 3GJRA 4DYDA 5IF9A 1R8JA 4KQWA 3OM1A 2HXSA 1DADA 2CUKA 4RZUA 2ECFA 4N0DA 2OYCA 4EJSC 4QAJA 5JH7B 1L4HA 1FVHA 3V4VB 3OP1A 3DCIA 4DUZB 3QKRA 3T0GA 1P6UA 3OCUA 4CU5A 1FP4A 2CZCA 3F6CA 4MKHA 3R4VA 4RKFA 4ZGBA 3FETA 1IQ0A 2R65A 4YHBA 4U63A 3SICE 3D7RA 4RORA 4FHCA 3GT7A 2ZYHA 1CWUA 2BT4A 3COZA 4QG7A 3RK0A 2CJPA 3ZOKA 2FN3A 3R9WA 5IAKA 4BLTA 5EPUA 2AXQA 1QGUB 3T5GA 3WDKA 4ZI2A 1YZVA 1WNTA 4FDVA 2IXBA 4AN1A 4EF5A 2EXXA 1LSSA 4D1YA 3KQLA 2VF4X 1OLOA 4YJFA 1NW8A 3UC5A 1YB6A 5E3JA 4M1WA 5C8YF 1W6RA 2JLQA 3PC6A 3AC0A 3BZBA 4BO2A 3ZV3A 1W36D 2VC2B 2LGJA 3K3PA 3TRHA 2KLHA 4NWIA 4ZVRA 4DCVA 3KU1A 1OFHA 2HWUA 3ZD6A 2TRSB 3IV9A 3I5MA 1UINA 1ND5A 3N74A 4M99A 4QLAA 4QQ8A 5TQ0B 5EFOA 1SUDA 1LZLA 2XSZD 4R16A 5LIPA 5G0SA 2GBCA 4Y1FA 3B12A 1MO5A 3K9HA 5EUBA 3RCBA 1JDPA 2FEPA 2QQEA 2R25B 1M2GA 1T29A 3HXKA 4J7UA 3FPLA 4GGOA 3F6RA 3MWLA 5J2UA 4X66B 2Q6OA 2V6IA 3UJ9A 4EVIA 1XCMA 4FWTA 1RAGA 2I3DA 3BFXA 3D6FA 1NJ8A 4FLMA 1NN5A 1R6VA 1P81A 1T26A 2XA2A 4GMFA 4NNJA 3SX0A 4AULA 4CL8A 3EPHA 4Q3LA 1NQVA 4KGXA 1B8UA 1Q6YA 3FUVA 3V9AA 3JQBA 3UAVA 5EERA 3I92A 4ZYXA 4CF7A 1KJQA 2V03A 3TYXA 2FQWA 3PTLA 5CVVA 3MAAC 2D6FA 1Z83A 1KETA 2NXNA 2ZB7A 3DLHA 1IOZA 5IH3A 2JK0A 2HLDA 4MVJH 1O94A 1PS9A 2JD0A 1PJ2A 3EVZA 2CDNA 2PX0A 4B6OA 3ANNA 4OGFA 2N0SA 4XR9A 3N87A 4MAAA 4PIMA 1ZOPA 4UKDA 1PDWA 2Q3JA 4ZT4A 4BNMA 1R5NA 3ENKA 3KQVA 3PF9A 4PZUA 3AF6A 4YLYA 2C99A 3KL4A 1L4BA 2BGGA 4PZDA 4XWYA 4MVJD 1L2TA 1W9HA 1KP2A 2B98A 2JI9A 2WU1A 3C3XA 1PFUA 3TTVA 5KSZA 4YMHA 3S2ZA 2J5XA 1Z8NA 3AFHA 4LJLA 1MIOA 3GRFA 2GM9A 1TK9A 1QF6A 2J3IA 3CNBA 1JA1A 4DUGA 4FYXA 3G68A 2NZUG 2FEKA 4FMPA 3OLXA 4J94A 3O0DA 4EUKA 4MS3B 2D5LA 5LP6A 4FC6A 3IHTA 1XEXA 1XZHA 3EOAI 1H1DA 3KJIA 2ZU0C 3VU0A 3AVUA 2CUNA 1T1IA 2OGUA 5CIWA 2Z6VA 3OZTA 1S2GA 2X42A 2WVJA 5EJMA 4CV1A 2BGKA 5JJKA 2C1ZA 1OX4B 2W37A 4H2DA 3W1WA 2YXBA 1R8YA 3JQFC 1JVNA 5CCXA 3NMUF 4Y2RA 1Z4IA 4OSOA 4PWZA 4FFSA 3MINB 1D8AA 2GGSA 4H7KA 4L16A 3M1YA 3ZE6A 1EI9A 3IA2A 5JI3E 1MPXA 4OVKA 4NCXA 2VBFA 2HQRA 4QATA 5I6DA 1HM5A 2A9PA 2GH1A 1DRKA 5BNTA 2Y8EA 4M83A 2WYIA 2QUJA 5JVDB 3LVQE 1SMKA 3OZAA 1UK7A 3EA4A 3PE6A 1TJYA 1WSBA 3OI7A 5IVKA 3UAOA 3MOGA 2J9FB 2EL7A 1AM4D 1LBEA 2QJFA 4R54A 4R1PA 1NI3A 2P6PA 3PJDA 2JCSA 2WZDA 1L4EA 4YP0A 4DKXA 3SZ3A 4AC9A 1QG0A 5I3CA 4OOEA 4LRSB 4BU0A 3TB6A 1YJAA 1YMUA 1PFKA 1X92A 1SVOA 3AMVA 5HF8A 3BEOA 1G6Q1 2PUEA 4XSVA 3CUEF 1DKMA 4WXRA 1MVOA 2COKA 3DA8A 4AZTA 2NACA 3N2ZB 3PSAA 1NVTA 1DJNA 5BQFA 4JC8A 2BYTA 1RZ3A 1HUQA 3A9RA 1P29A 1CR4A 1MJNA 3LY8A 4IM7A 2YWBA 3DOCA 2O6HA 4JCCA 2UZ0A 5AKKA 2CY0A 3VMMA 4BNKA 1UP6A 1JXQA 3C6YA 5KKAA 1OMOA 2BFCA 5IK2A 1EJ2A 2A1IA 3KT6A 1Y4UA 3UK0A 3U7QB 1ULUA 1MPTA 5A7HA 3CT6A 3EG9A 4MQ4A 4QHYA 3I2GA 1ADGA 1X7WB 2D1FA 1DEKA 4ZHQF 3PLNA 3FIUA 5A62A 4FN4A 1G5TA 1VKNA 3G79A 3L6DA 3CSDA 1SA0B 2E5LB 3LCVB 4XA8A 1QE0A 2D0PB 1FFHA 3Q3CA 5DCWA 4X44A 1W4AA 4UMEA 1JX6A 2CCGA 3D2AA 4Y6PA 4AYTA 1D5WA 1SKQA 3JPYA 5A4JA 4WGFA 1IBMB 4DA0A 1Q16A 3TLJA 2DU8A 2D0IA 4OXYA 2Y92A 2XKJE 5BSVA 1FA9A 2AD1A 4R5HA 3E8XA 4X0EA 3FLAA 2JDIA 2VRCA 4KQ2A 3R3JA 2W6CX 3QE0A 3T7IA 3O8QB 2B82A 4M49A 3ZE8A 3OUZA 4YUXA 1DTWA 3FI0A 3O47A 3PNVA 4LZJA 2Z6AA 4KXMA 2BEJA 1Q0ZA 2C7PA 3Q0TA 1SUIA 2NVWA 4DAOA 2QKYA 1JG6A 3OIWA 1M66A 1PK8A 3K0AA 3TDKA 2P4QA 1V96A 3LDFA 2C7VA 2FWJA 3ZNPA 2W22A 1NKTA 2E5FA 1KQGA 4PC1A 2DUJA 3GNQA 5K03A 1ZGBA 3JU3A 1GADO 5JMTA 1K7YA 4JLDA 1VPEA 1CUBA 4W8HA 5L3SA 5ALMA 5EGNA 1AKYA 4HPXB 3E1SA 4JMLA 4K9RA 1XTUA 3MGCA 4QXMA 4RD4A 1TTQB 3WL5A 1DWPA 1XMVA 2VTVA 4KMSA 3T1VA 3QEMB 1HZZC 3G23A 1S3IA 2BZ1A 1XXHA 1UC8A 2C0PA 2E4ZA 3EAFA 3EG9B 3L0ZA 3OTIA 3WLNA 5JRZA 3SBOA 5FA5A 1N1DA 2AN1A 4BKPA 5DGTA 4WSOA 4XWOA 4RO0A 2WVAA 3G2KA