1SCIA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 98
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sciA00
2QKYA 1W75A 4ETWA 2PU5A 4K5QA 4AXBA 3ANSA 5JD4A 4QWWA 2XMDA 4UBKA 1CUYA 2HA4A 2WHPB 1EXWA 2JIDA 1CUJA 3FLBA 4UFPA 3QMVA 4PSUA 1J1IA 2DCMA 2OQIA 4GXNA 3H0CA 3W9BA 1DINA 5BWBA 4DSAA 5CT9A 1XKLA 2QJRA 1XZEA 3WK8A 4W1SA 5CRIA 5JAPA 5DTIA 4FNMA 1QE3A 1QFMA 2R8BA 5JALA 4FWBA 4H77A 1D07A 2C5GA 4WFJA 1UK6A 1SC9A 4W1RA 4UBIA 2EEPA 2V98A 3DKKA 2PX6A 2H1IA 4EZIA 3STUA 1QTIA 3RKSA 4UBJA 5AKIA 5FKJA 2PKYX 4UBMA 4Q3LA 2JF0A 1HBJA 5KWIA 4U2GA 5FPQA 4Q05A 1CUWA 5AH0A 1ODSA 2WUGA 1QGED 3L1HA 4FBLA 3G0DA 2WHRA 2WLSA 3SX4A 2Y6UA 4RGYA 3TRDA 3DL7A 5AKYA 3G9XA 1HQDA 3FWHA 1SCKA 4HRYA 4S0XA 1MPXA 1WPRA 1P0QA 2I3ZA 1CUHA 3D4LA 1MX1A 5H3HA 4QDXA 4J03A 5EIAA 4G9EA 1UOPA 1L7AA 3FYTA 3R3WA 2PUHA 1H23A 4IQ4A 4BDTA 3ESBA 1ZJ5A 1Q0ZA 2WIGA 4X97A 4LXIA 4QDUA 1IZ8A 3LCRA 5ALLA 4JYPA 5LZ4A 1USWA 2J3QA 2XUKA 5ALSA 1XZHA 4B82A 4GEGA 3VJLA 2BGNA 4P93A 5AM4A 4KR0A 4RE5A 5HKBA 3WL7A 4BDSA 1FFDA 3BL8A 2HRQA 4OPMA 5JADA 4N8EA 3RARA 5FDFA 3O4GA 2QMQA 1GQRA 3WK4A 1QIEA 4BP9A 1ACJA 4MQLA 1WB4A 4XVCA 2BJHA 3ILSA 3N2ZB 5LLSA 3DYIA 5D6OA 2D5LA 1EHYA 4AX4A 1A8UA 5I7UA 3UUEA 1Z68A 3I1IA 5DLPA 5AM2A 4FLEA 5ALKA 4AZ0A 1DU4A 4YPVA 5HQ3A 4HXEB 2HA0A 3AIOA 1AUOA 5CT5A 5AICA 3AIMA 4UHFA 5IVHA 1CEXA 5EGNA 1TRHA 4C88A 2CKMA 3KWFA 5EHNA 3H1AA 1R50A 5EIEA 3WWDA 4JH0A 3WI7A 1DQYA 5YASA 2RAUA 4H7KA 4AO8A 2CMFA 3QBJA 4H7DA 5CH3A 2XMRA 5IH7A 1ZJ4A 1A7UA 2W6CX 4BCDA 5KBYA 5AJHA 1MO2A 2H7CA 5AHXA 4FFWA 4DYHA 3OC0A 4H35A 5FUMA 1UZAA 4L72A 5AKXA 3V9AA 1BS9A 2CJPA 2XMZA 3R3ZA 2WJ6A 3UMJA 4QWMA 4ZGBA 1GT6A 2RHTA 4RPCA 5DNUA 3QVMA 3LP5A 1NU6A 4PO3X 2GYUA 2PBLA 5CH5A 2JEYA 2CUTA 2RI6A 1Y7HA 3K9BA 2Y2VA 5FV4A 1XZMA 1TAHA 1LNSA 2WIDA 4LXHA 4FNGA 2AJCA 3QH4A 3QPAA 5EIHA 2G5PA 4EA6A 1CUEA 4OYLA 1TCBA 1XQWA 2IX9A 5KREA 1K63A 1LGYA 3QM1A 3DLTA 1WCYA 1O6FA 4X94A 4H7JA 3HI4A 5AM5A 2ZSHA 3H17A 5ALDA 1CUDA 3ESDA 4RNCA 1XFDA 4EBBA 4G5XA 1N5MA 4CG2A 4G1FA 4B7ZA 2C0PA 2QRUA 4JUIA 1ZD5A 1ZI6A 5C81A 4Y2RA 2XUAA 3EF3A 4W1PA 5AKKA 5HF5A 4F0JA 4B84A 5A7HA 1L7RA 4NS4A 2C7BA 5C8VA 5LZ5A 4UHBA 4MXDA 3O4HA 4FMPA 5ALJA 4QDZA 3M81A 2XMQA 3ESAA 1QJ4A 1J2EA 3PFCA 3AZOA 4XIIA 3D0KA 1XLWA 4WFKA 3QITA 5A7GA 1FFCA 1K4YA 3QMWA 2OAEA 2V97A 3O95A 5ALNA 2R11A 3I2GA 1UK8A 3R3UA 3JYHA 4B0OA 2HL6A 4AN1A 3S8YA 3E3AA 4K2AA 3ZLTA 4IH1A 4B83A 3G7NA 1ZD2P 3WL5A 4K6GA 5I8PA 3D2AA 4I4CA 1EK1A 3AINA 5EHZA 1EB9A 1TQHA 4J3JA 2BUAA 2XMBA 3G02A 2Z8XA 2J3DA 4BVKA 4OCZA 3KXPA 1N1MA 1Q83A 1LBTA 3K2IA 5FP0A 2XUPA 2WUEA 3D2CA 5ALOA 2XDWA 1GKKA 1FJ2A 3O4JA 1EK2A 1E89A 1R3DA 3U1TA 4HZGA 4M0EA 4PQEA 1CVLA 2XT0A 1RP1A 5BWCA 4N8SA 4UBOA 4FBMA 4JEIA 2OGZA 1HKHA 2JBWA 2XMSA 5JATA 3GBSA 2GBIA 4MEBA 3BJRA 4I19A 1N8SA 3IUMA 5LZ9A 1LPAB 1MNAA 2ACEA 4F60A 5LKAA 3QPCA 3HEAA 1W4LA 5C8ZA 1GQSA 4G8DA 4KEAA 1Q84A 4UUQA 1MX5A 3CN9A 1XZLA 2WTMA 2Z5GA 3ZWQA 1DWQA 1HLGA 1UOQA 4Y2YA 3OG9A 4P9NA 1VLQA 1YA4A 3K6KA 2GYVA 3OURA 4BYMA 5HK9A 4P92A 4BRZA 1MX9A 1XZFA 2PUJA 1YR2A 4GHWA 4BZWA 3GELA 1WB5A 4QNNA 4KRXA 1BU8A 1VZ3A 1XRLA 5DWDA 3AZQA 2CBGA 2Z3WA 3FLEA 3WL8A 1CUBA 1CIJA 1QO7A 4N8DA 2WUFA 3DKRA 3KOOA 1IMJA 2XUDA 1IVYA 3G0CA 4MYDA 1C7JA 1QIJA 1XZGA 2YH2A 2XQFA 1WB6A 2WIKA 5JIBA 4UFOA 2ZYRA 5AI9A 1EDDA 2OXEA 4DLNA 4ZV7A 4Y2QA 2H7XA 5JASA 3H19A 1UKAA 2FJ0A 2OLEA 3PUIA 1BEEA 1OILA 3UUFA 5AM3A 5LP1A 1T4MA 4J0DA 3STVA 5JARA 4BZZA 2PSHA 5CT8A 4X91A 1PJAA 3KWJA 3ZPXA 4J0HA 4EUSA 3QMMA 1UK9A 1W1IA 7YASA 3PUHA 1XZJA 5T4HA 2ZSIA 3DOHA 3EQ9A 3GZJA 4FLMA 4U2CA 2CEKA 2XQKA 3H18A 4JYMA 5A7FA 3IVMA 4WY8A 1JJIA 1FFBA 4OB6A 3CCCA 5T4FA 3T4UA 5ISMA 4X6YA 4IO0A 4UFNA 2BKLA 1QIFA 4DMFA 3BDVA 5LZ8A 1E5TA 2YYSA 2DR0A 2WQZA 4G8CA 5DYTA 4JNCA 5CXUA 1GPNA 1MJ5A 4CIAA 3GFFA 2RGUA 3OTQA 3FVTA 3H2JA 5SYMA 4L0CA 3M82A 2CB9A 1JJBA 4BCCA 4E14A 5FOQA 4WDRA 4XJVA 5AKJA 4Y2XA 4EY8A 1YASA 2V9ZA 4X85A 3WWCA 3C5WP 4N5HX 3D3NA 3QPDA 3C8DA 5HQ3B 1SOMA 5LYYA 1E8NA 3WKCA 1KEZA 2JEZA 4H7EA 1AURA 1A88A 1H2YA 1XZDA 3U0VA 2VT6A 3WKBA 4QLAA 1WM1A 2QS9A 5KWJA 3G9UA 1H2WA 1CUZA 1QIIA 1XROA 3V1MA 5DNVA 3HXKA 2BUBA 5ALQA 4C87A 5E4YA 5LZ2A 1ZICA 1P0MA 3R3YA 1TCCA 2XUQA 4ROTA 2O2HA 1QO9A 2BCEA 1UT6A 1LZLA 2X8BA 4Y2PA 2CZQA 3BXPA 4KE8A 3STTA 5ALFA 1DX6A 4OB8A 1ZD3A 1TIBA 4UHHA 3DOIA 5FPPA 2HM7A 1CV2A 4OUKX 5CURA 1DX4A 5JZBA 3B3QA 1IUOA 3WQHA 4DMCA 2WFMA 4H18A 3FYUA 5E4JA 4L9AA 2B61A 4K6HA 4U2DA 2VAVA 1BN6A 4INZA 3A70A 4U2EA 4J0KA 1EVQA 4GBGA 2DSNA 4XX1A 3NGMA 4UHDA 5A2GA 1XLUA 4EY6A 1FFAA 2VJBA 4B81A 4DMKA 1MNQA 5CMLA 1H2XA 2G5TA 4J0GA 1CPYA 2BFNA 3WKAA 4BTVA 3A2NA 2ONCA 2PSDA 3O0DA 3FBWA 1XZIA 3R3VA 1FSSA 1L7QA 5IVKA 2ORYA 1LPOA 4Y2TA 2EDAA 4CCYA 1MT3A 2XQIA 2EDCA 4WJLA 4ZWNA 2HA7A 2HHAA 2PSEA 3O4IA 5CH8A 4BVLA 1F0NA 1N5RA 2OG1A 3D5EA 4ARAA 5AIAA 3DL4A 1PFQA 2JGJA 1TCAA 4AO6A 2Z8ZA 5AK4A 4DIUA 1I6WA 3F96A 4KJXA 5ALRA 1QIHA 4KYVA 4HVTA 4C01A 3HYSA 4PF1A 2QUBA 4AN0A 4X6XA 3WYDA 4K6KA 2PSFA 3WJ2A 5JANA 3KD2A 1R88A 3FLAA 1VE7A 4EY5A 1WPXA 2J4FA 3LS2A 3HC7A 5D7BA 3WLAA 4J0JA 1CR6A 1Y7IA 1F8UA 4LKOA 3PFBA 2D0DA 4EY7A 2WU4A 3M83A 3WWEA 5AI8A 2OAGA 5HFNA 1XRMA 2O2IA 3W04A 4BTLA 1DTEA 1IUPA 5AK6A 5EHQA 3JW8A 5AIBA 2VQ6A 1VXOA 1M33A 2VTVA 3WK7A 3F67A 4BAZA 4UHEA 4CFSA 1CRLA 4WCVA 4KAFA 5AOAA 1LBSA 3AIKA 1DT5A 5ALGA 4GWLA 4OSEA 1ZI9A 4ZRDA 1UWCA 3W06A 1B6GA 4B9AA 4Q82A 2OCKA 2WILA 2QOEA 2XLCA 2OQVA 5HK8A 2C5FA 3BJMA 3C43A 3V1NA 2Y1KA 2GBFA 2B9VA 4X6UA 5K3FA 2FJPA 1UXOA 4DNQA 3F98A 3HSSA 3C6ZA 5HZGA 5AOBA 4BCBA 1S8OA 3W05A 3IBTA 4QDOA 1XZBA 1QZ3A 3F9CA 5ALXA 3QZUA 1P0PA 2OPHA 1A8QA 3L1IA 3IIIA 1UOOA 2QXUA 2WU3A 3GA7A 4YASA 4EHBA 1GXSA 3ZI7A 5K3AA 1EVEA 3SK0A 4X71A 2XQGA 1GPKA 1EH5A 1RWQA 3F97A 4DNPA 1VOTA 2QJWA 2OCLA 3C6YA 3E0XA 1TK3A 3I2KA 2OCIA 3ANTA 5CT6A 3ICVA 5AKGA 3FCYA 2ZVDA 1T2NA 1CUCA 4B80A 5ALMA 3X3HA 2XUHA 2I78A 1THTA 3R0VA 3DJYA 3IULA 2RONA 3I2HA 3I6ZA 3F8SA 3I28A 1J06A 4LXGA 4U2BA 1ZGCA 4MWSA 4AO7A 4W63A 4BAGA 4MQMA 3DCNA 5FXMA 2PM8A 3BF8A 1K6EA 1IUNA 5AI5A 1LZKA 1G42A 3DDUA 5SYNA 5AK5A 1E8DA 4BAUA 4W9RA 5DNWA 2HU5A 2QZPA 4TGLA 5LZ7A 4NVRA 3FCXA 4B9EA 4A5SA 4DMHA 5IVDA 2VJAA 3N0TA 4ZREA 1ISPA 3VVLA 1YA8A 2J4CA 2H7YA 4QDTA 3WYNA 3HACA 2GBCA 1R4ZA 5AK3A 5JZSA 4G4GA 4Q3OA 4XWGA 3D7RA 1EA5A 3NUZA 1XZAA 2I03A 4Y2VA 3HZOA 3OPMA 4Y9SA 1YSCA 4MJ3A 2ZYSA 1YAHA 2JGKA 4B0PA 4C4XA 3ZV7A 4Y2SA 4FHZA 1ZIXA 2H9YA 5AKHA 2WUDA 4X3CA 3I6MA 1WOMA 2JGFA 4X92A 1G66A 1E3QA 1MU0A 1AKNA 2XE4A 3DD5A 1CUVA 4C4ZA 2VJCA 3AUKA 3STXA 5ALHA 4TPKA 3LLCA 4H0CA 4A16A 2YASA 1QIMA 4BC0A 5HFAA 1H2ZA 1EB8A 4GECA 4FDMA 1K5PA 2K2QB 4CI9A 2O7VA 3D59A 3IUNA 4FKBA 1SCIA 3I6YA 4ITVA 2NW6A 4KRYA 5K3EA 3H2HA 2XMGA 2ZYIA 4P08A 1X2EA 2X76A 2VATA 2VJDA 3WJ1A 3JWEA 1G4HA 5ALYA 4C89A 4PNZA 5JYCA 2Z3ZA 4YX9A 3VDXA 1TKRA 2ZYHA 1CQWA 3PF9A 4Q1VA 1LPMA 5E4TA 2ECFA 5ALPA 2FUKA 1R9MA 3BE8A 1LPPA 5ALWA 2QXTA 3PDCA 1C4XA 3BIWA 3PICA 4H7IA 1HL7A 1UK7A 5DYWA 4OB7A 2ROQA 5ALUA 2C4HA 3FYUB 4C6HA 1BE0A 3P2MA 2O2GA 3STWA 5AKEA 1XQVA 5JAUA 1DWPA 3G9TA 4AMYA 4GDMA 4M0MA 3IURA 4KAJA 4PSDA 4QA9A 1QIKA 4Z49A 4BBZA 1CUIA 4H7HA 3WWOA 1GGVA 2HFKA 4M0FA 4BE4A 5K3BA 3VVMA 4LYDA 4Q3KA 1MAHA 6YASA 1IZ7A 4WY5A 1AQLA 4CG3A 4B6GA 3FYUC 2JGMA 3C8HA 1F6WA 3E1GA 3H2IA 3C70A 1KU0A 1W76A 5HF8A 1A8SA 2WM2A 4CCYB 4X7BA 2XI4A 5ALVA 4KE7A 3IB3A 3C87A 3C45A 2WFLB 3R3XA 4UBNA 4A23A 3BIXA 3NOXA 2UZ0A 4WDQA 2W22A 4RE6A 2DFPA 2IITA 1XRQA 3WIBA 3FOBA 1U8EA 4HS9A 4IH4A 1VJ5A 3PE6A 1ORWA 2XUFA 3H2GA 4BB0A 2HA3A 5K5EA 1NX9A 5JZ9A 2OGTA 4WFIA 3OOSA 4PW0A 5LIPA 1BN7A 5FLKA 2HADA 5DJ5A 3YASA 5A71A 1KU6A 5IKXA 4V2IA 1ZOIA 2PSJA 4G4IA 4GLBA 4BATA 3WL6A 5AKLA 2ZJFA 2QM0A 1JFRA 5ALZA 2P8SA 2JGIA 3WZMA 1CUAA 3O9MA 4DSZA 2BUCA 1JKMA 1XRPA 3O9VA 4HXFB 3L1JA 5CT4A 4OU5A 4N5IX 2XMCA 3KDAA 3C5VA 1J07A 1EX9A 4TVKA 3HABA 1ETHA 4KACA 4NMWA 1XLVA 2LIPA 3WKDA 3KSRA 4BVJA 1NU8A 2BGRA 5A62A 4UPDA 2WG0A 4HRXA 2JGLA 5C7YA 2IIVA 2I3DA 3V1KA 2VF2A 1YCDA 2XUJA 5JAOA 3G8YA 1AMNA 2WHPA 1WHSA 2GYWA 2WIFA 2WSLA 3AZPA 1VE6A 4X90A 1JI3A 3MUOA 5AO9A 3WK6A 3ZLVA 1U65A 4GI1A 1JU3A 3FAKA 3MGAA 2WFLA 3R40A 4DNFA 3Q8WA 3V48A 4ZV9A 4U2FA 4HTAA 5AP9A 1ACLA 4FFVA 2X5XA 2PVSA 4AB1A 3EIOA 2QVBA 1X2BA 2VSQA 5FRDA 3AFIA 5D3ZA 3RLIA 3EQ8A 5K3CA 2HU8A 3WK5A 3G0IA 1QOZA 1ZGBA 3IUJA 2WJ4A 4KE9A 5AM0A 1JU4A 3A2LA 5K3FB 3WKEA 1VXRA 1U4NA 2WFZA 1OCEA 2ACKA 1UKCA 3WA6A 3R41A 1W52X 4H7FA 2FX5A 2HU7A 5AI4A 1VZ2A 1X70A 4UBLA 4QLOA 2RHWA 3IUQA 3OM8A 5EHXA 4J7AA 1XRNA 4DTCA 4Q34A 1DWOA 2ES4A 4PSCA 3PI6A 4NZZA 3TEJA 3H2KA 3BWXA 2HA5A 3DQZA 2AJ8A 1CUSA 1UFOA 1YB6A 3HRHA 4MWTA 4DNOA 2AXEA 3W2TA 1QIGA 1YB7A 3Q0TA 5EI5A 3CN7A 4DGQA 4X95A 1E66A 1GPLA 5ALEA 4UHCA 1THGA 5ESRA 4KAAA 4EY4A 3DS8A 3TGLA 3HLKA 3E4DA 3FSGD 1CUGA 4OD0A 3WK9A 4F5ZA 2GBGA 5ALTA 5HKAA 1DT3A 3CCBA 1O6GA 1C7IA 3DEAA 4D9JA 2V96A 1RYYA 1SFRA 1ZI8A 2WIJA 5D3KA 1MTZA 3B5EA 3IDAA 2B4KA 4I3FA 3ICWA 4LYEA 5T4EA 1DQZA 3D2BA 5JD6A 3C6BA 3RK4A 4E11A 3I2IA 1GZ7A 1CLEA 1MAAA 1JJFA 1E8MA 3VISA 5C8XA 4QZVA 4OYYA 2G4LA 2XUGA 4QE3A 1XQXA 4C4YA 1XZKA 1XKTA 4ZI5A 1PV1A 5E2IA 5AI6A 2QTBA 1CUXA 2ZJ6A 3LIIA 5CW2A 1FFEA 1XZCA 2WHQA 3EQ7A 5I9IA 2PPLA 3SC2A 2QT9A 2XQJA 2Y2UA 4ZXFA 5AOCA 1QLWA 3WMRA 4FTWA 2DHEA 4G4JA 4W1QA 1LPSA 2XUIA 2VEOA 1UKBA 1R1DA 2VA9A 3SWWA 3CXUA 1QTRA 4Y7DA 4J0IA 3I2FA 1CUUA 4CIBA 5EFZA 1Q0RA 4LHEA 4Y2JA 1VA4A 1HDEA 2HA6A 2XB6A 4B85A 2HFJA 3G0GA 4ARBA 3FSGA 3BDIA 4GW3A 2QR5A 4EB0A 4BRSA 3GUUA 3DYVA 3ZLUA 1ODTC 2ZJ7A 2QUAA 2WTNA 3G9ZA 4KE6A 3MVEA 4CG1A 3LIPA 2DQZA 3WIOA 5K3DA 3A2MA 2DHDA 1WHTA 4G9GA 1B41A 1R9NA 1CQZA 2C0QA 1W6RA 2PL5A 2HDWA 4DM7A 4CCWA 4E15A 1QIDA 3C6XA 5JD5A 1SCQA 3G0BA 3V1LA 1Y37A 1EINA 1LPBB 3T52A 2G63A 1LLFA 5A6VA 1AGYA 1JMKC 3H1BA 2GZSA 1JMYA 3FNBA 4FOLA 3WWPA 2WG1A 4YK7A 1F0PA 3AJAA 4QEKA 3RM3A 4IH9A 1OXMA 5HCUA 1CFJA 1XRRA 3QYJA 5T4BA 2YXPX 4MYSA 4BC1A 2DHCA 1BROA 5BV7A 4IHAA 4HXGA 5LKRA 2OCGA 1HPLA 2Y6VA 3BF7A 5IVIA 5CBKA 5CTAA 1JT2A 5F4ZA 5BOVA 3FVRA 2JGEA 3IA2A 1VKHA 1YAJA 1U2EA 5DTJA 1BCRA 1ORVA 1AX9A 3I2JA 5AKZA 3B12A 2VAXA 4AZ3A 2WKWA 3H04A 1P0IA 2DQYA 1BRTA 2HRRA 2VT7A 3ESCA 2B20A 1ZIYA 1LPNA 5CXXA 3S2ZA 5HF9A 3WZLA 2AJLI 4X93A 3ED1A 5ALIA 4J0CA 3A6ZA 3EBLA 3VJKA 3VXKA 4FLFA 1EDEA 1AC5A 5AI0A 2BAGA 5AM1A 3M3DA 2O7RA 4F21A 1QFSA 1BEZA 2HIHA 2AJDA 4E46A 4PV7A 3TJMA 4BE9A 2RIPA 4X00A 1H22A 5JAHA 2XUOA 1ODCA 1MN6A 3VJMA 3AILA 1ZD4A 3PF8A 2WJ3A 2GZRA 4HAIA 1VA5A 3W9UA 3WA7A 2Q0XA 4AQDA 4AMZA 3MUNA 4MEAA 1CUFA 3I1YA 2OGSA 2WG2A 4L3WA 2E3JA 3DNMA 1AZWA 3VKFA 1EI9A 1YS2X 2PU7A 4O08A 5DYYA 2C58A 2XLBA 3GROA 4Y2UA 2HA2A 1QONA 4G8BA 5HF6A 3NWOA 4LIPD 3STYA 1XQYA 4OU4A 2AJBA 1BCSA 1GKLA 1G5FA 1EDBA 1YS1X 1K8QA 5J3JA 3HJUA 4BP8A
chains in the Genus database with same CATH superfamily
2NO7A 4ZYVA 1Z7WA 4DJJA 3BRCA 3QXXA 4KDRA 1W75A 4N6OA 5EKXA 2I33A 2JVKA 3DSRA 1W30A 2VHJA 1M1YB 3AKZA 4PIVA 4PANA 1XEWY 2B1JA 3U40A 4DDTA 4HDSA 4XUDA 1DAHA 4LN1A 1FU4A 3Q98A 4QWWA 1P4HA 3D6NB 4UBKA 3EAGA 4WNAB 1SIBE 1IXZA 5DE3A 1JTFA 2B8JA 1DEAA 5JLJA 4IPTA 5JW6A 1RHRA 2BEJA 2J9FA 4D5EA 4DV0B 2ZB2A 1M1NB 3O2QB 2D5IA 2JIDA 1J2YA 4N12A 2GUWA 3MMXA 3EFOB 3MEQA 3JVDA 4GRIA 3T9DA 4NU8X 3NUGA 4K9DA 4BJ5A 1HE5A 2W2MA 3R5HA 3TH5A 3WLKX 4B31A 4OHFA 3PYXA 3Q85A 4BB5A 4PSKA 4DIMA 3L49A 1Z2AA 3H0CA 4BQQA 2ZP1A 4YJDA 5JZOA 2F1OA 1C80A 4X41A 2VQ3A 3N75A 5ELLA 1ESCA 2AYXA 1JPJA 3LAWA 1FZQA 1I7NA 1GEEA 1W88A 5C1IA 4AZTA 2XBMA 3O9ZA 4IJWA 2PBZA 1XT6A 3VI3B 2O59A 5J40A 2F3SA 5M04A 1T2UA 1E9SA 3K6SA 3EVGA 1F06A 4CVNA 3GFPA 1P73A 4P86A 4KSBA 5ELXA 2IS6A 1ULHA 5JAPA 2L82A 4AKEA 4MUHA 3EFEA 1CJUC 2ZTLA 1YNOA 4AUMA 4FNMA 2RHCA 2Y66A 2JLVA 1RI3A 1VYUA 1QFMA 1DAFA 2ZE6A 1NMXA 1E7RA 2CLDX 4FWBA 4M8KA 1KRWA 1JSXA 5DMHA 1QOQB 4WFJA 1SC9A 1ENPA 4KLZA 3B9PA 1NQVA 3EXIA 1B2LA 4J1SA 1EK6A 3GH3A 5C3UA 2QBYB 1SCNE 2QRZA 2V98A 3PQ2A 3OQIA 1QQ5A 2ZSUA 3ONNA 1HZZC 1QB7A 3NASA 4HF7A 4O4JA 2B78A 3G1WA 4HSGA 1BMTA 1CR0A 1G0NA 1NOKA 1YQWA 2QLMA 3FGNA 4OTZA 3NBYC 2B8TA 4XCQA 2HLHA 4PAOA 2F43A 5AKIA 5LMNB 2FPPB 2FW0A 3MBOA 5LM3A 4KFRA 1OX6A 5C1PA 3QKSA 4YV1A 2BFFB 5FKJA 5JCJA 1NC3A 2CD7A 2O2CA 4DLRA 3NHBA 2QR2A 4Q3LA 4N39A 4BBJA 5BR8B 3AM3A 4U2GA 2FEOA 3O3CA 3UQZA 4F7DA 5KWIA 1KEVA 4YV2A 3RTGA 1Z37A 1YQDA 2GGSA 4TTIA 4BFVA 5D2CA 2PR7A 2DZDA 2KMLA 3GU3A 3R3HA 2CFTA 2D2IA 2FAXA 3IILA 1MOQA 2QRJA 4P3PA 4WADA 1ODSA 3U6BA 5EP3A 3PGVA 2QD1A 3KG2A 2OFXA 2PGXA 1EVLA 1V1RB 4K05A 4HQNA 1D2EA 3R5JA 1JFLA 1D04A 2WHRA 3UMYA 1F2VA 3ASYA 4Q16A 1RYNA 2Q0SA 1CWUA 3FWPA 1OI4A 3HVUA 4W8OA 3IOYA 4MNTA 1GFIA 1L9XA 1U2DC 3TPZA 5L53A 2QT1A 1LF0A 1X80B 1XWFA 4XARA 3SX4A 2IP2A 221PA 2AWOA 4F84A 3U19A 5JU6A 3CJQA 3H4TA 1N1DA 2GZMA 4PC1A 4W8GA 3TRDA 5AKYA 1CHDA 721PA 2IW3A 2YHBA 4JV5B 1T6BY 1F2DA 4Q66C 5ENVA 1QDEA 1E3SA 2GN1A 4MW0A 1KMIY 1NC1A 2PZ8A 3UH0A 2EQ5A 3I09A 4LRQA 3T7SA 5K4GA 2GM3A 3N53A 1P0QA 4U7GA 1ZXBA 2V0CA 4G0PA 1WKCA 5G2OA 1IHPA 1N33B 3VFDA 4IG9A 5H3HA 2AN1A 3QLVA 1R0WA 2ZSEA 1SHUX 3OTGA 4QDXA 2ZIWB 2YZGA 2B0JA 3OO0A 5EIAA 4HN4B 4MLPA 1MX3A 4CDNA 1QGDA 2IEAA 3PZRA 5H59A 1CEYA 3DEFA 3GRAA 4INPA 4WLUA 2PUHA 1VLHA 4RUKA 4BFWA 4H1TA 5A1JA 1ST2A 2IEYA 4ITRC 3P94A 4J91A 3ZHBA 4PTZA 3NVMB 4YRSA 1ZJ5A 1GM5A 3EVDA 1RRPA 2QJTA 4JJAA 2RJ3A 4X97A 5BP7A 2VTKA 4LXIA 4DMLA 2UYCA 4MS3A 2C97A 1T2EA 2H2HA 1XTTA 5KSPA 5KJ6A 1GKYA 4JYPA 5E6SB 3THXA 3TPFA 5F7OA 2CMKA 1USWA 3CEPB 3OZBA 2J3QA 3QKTA 4EHLA 3RWMB 4BNNA 2GARA 3Q10A 1YZVA 4GE0A 4RH0A 3HYNA 3C5EA 4GEGA 1DOZA 5CHYA 3VJLA 3WL4A 4B82A 3R9XB 4ALKA 1D3AA 2QVXX 3QXGA 2Q7XA 4P35A 3M6UA 3ZU5A 3CNHA 4BEBA 1HNZB 2D1RA 3ZGOA 4TXHA 1GZ6A 2KS6A 2RGDA 3VU8A 4BDSA 1WCV1 1GUAA 2VDLB 2HMTA 3VOAA 2BONA 3EC7A 2XWBF 1E7QA 1LDBA 3DV0A 5JSQA 3UUWA 1T9DA 3FYSA 5FYQA 4HXYA 2HRQA 2HRBA 4OPMA 5E95A 4E0BA 3K8QA 2IS1A 2JCGA 3ZZ0A 4N8EA 3OLVA 2G9VA 5KYYB 2VHQA 1Q7TA 5FDFA 4WH0A 2ZPUA 4RCZA 1PR1A 3OQNA 2QPAA 3OZFA 2C5HA 4KQFA 4LYJA 4RM2A 1GQRA 5FBRB 3WK4A 3UMGA 3JAMA 4RD4A 3WB0A 1L1FA 3ZDYB 1WB4A 5L6MB 4DSOA 3FMGA 2BJHA 1FMFA 3ITKA 5LQRA 3ILSA 1J9GA 5DB4A 3PBKA 5E1OA 3K5IA 3E22A 4XH9B 3L0OA 1EHYA 1JXMA 4F2HA 1SKBA 4MB2A 2OKGA 3KJGA 4NNOA 1A8UA 3DE5X 1I3KA 4CE6A 4RDIA 3I1IA 3QQ5A 5K3SA 2H11A 3K2EA 5EY5B 3EGWA 1XJCA 4J16A 1GUFA 3PE3A 5AM2A 4RENA 2GVDC 2C07A 4PFKA 5SY9A 3JD4A 2QG6A 1CS0A 4TYPA 4DF3A 2G8LA 4YPVA 5JXIA 1OB5A 3MYYA 4HXEB 4H3KB 2FW8A 2CJXA 2R85A 3AIMA 5LOVA 5CVUA 4E30A 3ZIUA 3FLMA 4XSVA 3U4HA 3IL2A 2YWXA 1BWSA 2P3SA 2H5IA 2PLAA 1OFUA 4Y0VA 2VZLA 2VTBA 2ORIA 2PQMA 3NORA 3B13B 3DDCA 4UMDA 1GYQA 1R8SA 3H9QA 5EHNA 4BNGA 1JR4A 2VJNA 3PX3A 1IOZA 4LJ7A 4EOGA 2A86A 2L18A 4U00A 2PLNA 4BE7B 1VJCA 5EN4A 2O8FB 3NAZA 3P9ZA 4JH0A 4P7JA 3WI7A 2I7DA 3S40A 3Q7PA 1ZVQA 2GXUA 3KQMA 4EYGA 1QFZA 1S1MA 2IC5A 3ZWPA 4BU0A 4H7KA 3Q2KA 1KIAA 3EXG2 4F6RA 5KVCA 1WDLA 3DT6A 3GB9A 1XO1A 4G1UC 3UKDA 5IXYA 1M34A 4MPRA 1SCBA 1YU9A 3IP5A 2EG5A 5E4FA 1VYTA 4BQPA 3UN1A 4N0EA 4H7DA 1JDVA 2WT4A 4QPJC 5LUAA 4KVFA 3J81A 3O7MA 3OSZA 2ST1A 2XMRA 4UNPA 1HL3A 3WISA 4X8LA 1CT9A 4BLRA 1O0SA 3EVAA 2ZEJA 1XF9A 1K4MA 2NZVG 3O94A 4KSYA 5JISA 3RAEC 4KRFA 3T99A 3BGVA 1Z2NX 3PQ5A 1RWMA 3JQEA 4IIUA 5G0SA 1IBSA 4FILA 3WOVA 4BCDA 4DDKA 5KBYA 4JSRA 1NKSA 1P31A 1HYQA 1GL9B 1V16A 4XM2A 4QM7A 4KRGA 3GCDA 4R1OA 4YCJA 3TVDA 3UBTA 2OK7A 1K9SA 3JQBA 3KVRA 1XQ1A 1FS4A 3NEYA 4KH1A 4XWAA 4AFNA 2CCJA 4AS1A 3HEBA 5JFGA 3W7BA 4XZ3A 2J8ZA 1C30A 1WNFA 1Y9ZA 1KIFA 3HDGA 4RIFA 3G2IA 4ICIA 1DARA 1W25A 2JIMA 5AFSA 5IAJA 3H4MA 4BO3A 4C1NA 5MHTA 4R8LA 3DBLA 4WBSA 2JJMA 1RM4A 1C9YA 1E96A 3AHHA 3KTAA 5TEVA 3TLJA 2GYUA 1TA4A 2E21A 2PBLA 1PTJC 1O89A 3BH0A 4A82A 3QW2A 2JEYA 4U9HS 2RI6A 3GRZA 1ZCFA 2O2EA 3P0RA 5CXSA 3WQQA 4TZKA 5FQNA 1XD2B 4V03A 4LXHA 1WHTB 4C3VA 3KAJA 2DC1A 3C4JA 2P79A 3BXGA 3QPAA 5EIHA 2GDZA 2M32A 5A0VA 2KPOA 2LIVA 4UZSA 4NIMA 3TLBA 1YZLA 4BFSA 1SVWA 4B3MB 1T5BA 1TQ4A 4AU1A 3HI6A 4JAVC 4S1TA 1R74A 3VDQA 4Y0AA 3K5WA 1QH1A 3UO8B 1CQPA 4FS3A 2IX9A 4HRAA 4CMGA 5KREA 4D43A 3KSAC 1UDWA 4IRUB 2YV1A 1K63A 1HE4A 2OV1A 5EHIA 4ZQHA 4G1BA 3G0OA 5DBFA 3VKVA 5KDOA 3PDIA 4N76A 1NBEA 2P4SA 1ZVMA 1O6FA 3F5MA 1XDSA 3QENA 4X94A 3HI4A 5C1BA 1IY8A 5AM5A 2DGDA 5K4HA 3I4CA 3PXXA 1D2CA 4A0QA 1AK1A 5IDXA 1E9EA 4D0SA 1CJKC 1ZO8A 3LC2O 3LQYA 2G72A 2QN6A 4YP5A 4Z1MA 2G1PA 1F8XA 1GGNA 1MBZA 4ZHQB 4K1XA 1J2RA 1T9CA 3PX7A 4G5XA 3K15A 1RQRA 4EB3A 4QTYA 4MGIR 4M99A 4CG2A 1OBOA 2MINB 2C0PA 3CNLA 1KWKA 2QRUA 1GV0A 3SBDA 1HE2A 4ERXA 1HRKA 3NHKA 3KPUA 3NTUA 3GHHA 3CLTD 2BSXA 4RVHA 5KKCA 2J3LA 1OMOA 4K9NA 1KP2A 5TRTA 3LECA 3R7WA 3DHEA 3M6IA 4IQ8A 3HJAA 3AB3A 1SCUA 2CNLA 2XD4A 4JODA 4YRLA 2B2CA 1LJLA 5U4QA 4F0JA 2IXBA 2ZPTX 1QG6A 1A9TA 1UM9A 3BD9A 3LHSA 4QPZA 1AS3A 2XV1A 5KYKA 1BRMA 4QRHA 4CU5A 1G9XA 2QTGA 1N6OA 3DOOA 4HLCA 5C8VA 1XNQB 1H9BA 3KSDO 4I5GA 3KLBA 2JFQA 1UZNA 3D2LA 1DP4A 1MB2A 3LKDA 1D6JA 4ZHQF 1ANKA 1E1QA 1OD6A 1GP2A 2REQB 2VDOB 2W2OA 2X4DA 1LLQA 2QTZA 1EFPB 1HLDA 2E4VA 4NU5A 4M1OA 4XX0B 4EUHA 3ZNOA 3D3KA 1RPAA 4R6XA 3TZBA 5IXSA 1OHHA 1U1EA 2W8BB 3E7WA 4FMPA 5IMSA 2GM4A 1MORA 2AFIA 2XNKA 3ZH9B 3ESAA 4X8MA 1QJ4A 1DCFA 4F8YA 1SXJE 3THYB 5I9BA 1DSSG 2YJTD 3WRXA 2FSIA 3WJAA 1QM5A 3ZCPA 4JI1B 5FWDA 4MVJM 1M2VB 4LXUA 1JE0A 1XQ9A 3MLAA 4I5EA 4PLWA 3CPEA 5CK5A 3X44A 3QITA 2VCYA 3W5HA 4ZAVA 2WJYA 1DTWA 4OH7A 4F3KA 1P2UA 1L5OA 2C0CA 3KNZA 3LWBA 4ILKA 4AZ3B 1X38A 2V97A 4CMIA 3O95A 4ZZIA 1OH8A 1DBVO 2BEVB 4MRRA 3RLFA 4BMVA 3BXXA 4R2KA 1KDRA 4Q4HB 1AHNA 5FIUA 1QZTA 4XEHA 1WD7A 2BC9A 2G3YA 2ZDGA 1RIFA 2HL6A 5LP6C 1H8HA 5GOTA 1ULAA 4KYIB 4JD5A 4CIWA 2CFRA 3BBPA 4AVYA 4DC1A 2ADMA 2G80A 4Q1AA 4B83A 1JHVA 4AZVA 3E9CA 1FQOA 4QREA 4UCQA 1EZ1A 1CEEA 1ZHOA 1Y6QA 3MSXA 3WL5A 2FPRA 1VRVA 4N03A 4I4CA 3AK4A 3CRZA 3AINA 4GZ5A 1KARA 2C3PA 3K53A 1EB9A 4WXPA 1JA9A 4DCVA 2IUYA 1HZJA 3DDHA 4EVIA 1UBFA 3DXFA 1TQHA 3O3OB 2GFHA 2Y1GA 2NSDA 3CS3A 4Z86A 5AYVA 1SVLA 4NXNB 1F0YA 1GDDA 1KXZA 1M3SA 2IZOA 3ZWVA 1ZHHA 5B58C 5DNDA 5A3SA 1LW7A 2XRMA 2OUKA 3KXPA 5J4VA 1YRHA 5ICFA 1LBTA 1A9XB 3BRQA 3I72A 1EJ2A 3B53X 4EJSB 2PAFA 2YJ6A 3AW9A 5EJ6A 4ZCIA 3RFXA 2WUEA 5C5EA 1LX6A 3CEMA 4MW2A 4KQ9A 1JSLA 3TD2A 4YRMA 1XMQB 1H2AS 3P71T 4N0PA 3SF8A 3A05A 1TVEA 2P2NA 5LQCA 4LQLA 3U2QA 4XVUA 1HMYA 3GY0A 1WULS 2I8AA 2VHZA 4AJOA 1OI3A 3DLPX 4PPNA 3H8WA 3U1TA 3B3GA 4CDRA 4HZGA 2IJGX 4EATA 5B4UA 1FB5A 2WSSD 4PQEA 2Z08A 2Q2OA 3I6IA 3RYHA 3DMFA 2ATCA 2XT0A 3KTDA 3W6UA 2IU3A 5DGDA 5K2MA 3FOEC 4HWTA 4MP3A 2V7GA 3EMVA 5EXDA 1G8YA 5KWVA 3DUFA 3JAWB 1NMQA 2X3YA 3ER6A 4EY3A 2X0RA 2QROA 4D9GA 2RGGA 2ONJA 1JH8A 2X9LA 4JEIA 4NJEA 4RZSA 4TTTS 2O8DB 4LCJA 4UQPA 5EXEA 3TZ6A 2ZZNA 1G5QA 1PJCA 4RJJA 4YUVA 4Q47A 5AW3A 4WK4B 2MIIA 3NIGB 4RNDB 4FD2A 5HVNA 3NETA 2GBIA 4BGUA 2GETA 4MUIA 5LNK6 3BJRA 1NSTA 5JWRA 2O8VA 1FTSA 4RETA 4E2WA 4FDLA 1HX7A 1N8SA 1X3SA 3P8ZA 4Q3NA 1XU7A 2ODPA 1NUUA 1Z5ZA 1Z7YA 2BIFA 1KR2A 1RRCA 1HV8A 2A3RA 2ACEA 1ES9A 2AL7A 2H16A 3KR1A 4DL9A 1IVSA 3NCTA 3W5BA 2X7JA 1AUVA 3F8TA 1D1TA 3R7LA 3AU9A 3AKYA 1G20E 2YIVX 1Q84A 4KEAA 4D98A 1B8PA 3EZNA 4WMLA 5K8UA 4NOJA 1CBUA 3SMVA 2RBGA 3BB3A 1WW8A 2QM8A 3DWIA 1XZLA 4UMVA 4Q6BA 3C4QA 2WTMA 3JQGB 1HTTA 6REQA 3AR3A 3CGGA 4BU1A 5F23A 5I5EA 1E2KA 2G07A 3NTOA 3OE7D 4NKRA 5J4YA 1DWQA 3WRWA 2JAUA 4II7A 1DUVG 1HLGA 1RLIA 1NPTO 1R0LA 1YS6A 1P9OA 3JWIA 3Q9UA 4RANA 2OBBA 4Y2YA 4YJ2F 4HV4A 1VLQA 3FBTA 2A0XA 2O5EA 2J6IA 3W5UA 2GYVA 4NE9A 4CGYA 3OURA 5HRCA 1HDYA 2WVJA 1SPXA 2QW0X 3NRCA 4RPLA 2MMCA 4PZ9A 1W59A 5FUQA 2GTHA 1UH5A 4HEQA 1XZFA 4V2UA 2PUJA 1YR2A 3IPAA 4BZWA 5DP1A 4KRXA 1BU8A 4MMYB 5K3OA 3BSSA 3OZRA 1VZ3A 1NNEA 1AN0A 1NVVQ 2CBGA 3OCWA 4TMZA 3I9JA 3I52A 4BNTA 1Z6XA 5LPNA 2HCJB 1HQKA 1RXVA 1E18A 1N7JA 5A4MS 4B3XA 2PUDA 4JXXA 5NLLA 4Q9NA 2Z5VA 2GPJA 3UMVA 9ABPA 4O1IA 1NW9B 3SFZA 4DBLC 4AY6A 4NQRA 1ACMA 3AC0A 3SIRA 2GZ2A 1Q3HA 2XOEA 1F38A 3NIBA 4OQEA 2HX1A 3ELDA 3W8DA 5IM5A 4BNDA 1SELA 1PT5A 4CEJB 1U0OC 2ZKLA 4DWJA 1IMJA 2XUDA 1DQPA 4KN9S 4OLBA 3PWTA 4YT5A 4QTZA 3KJNA 4CLRB 1FSPA 1E6MA 3TUIC 3ZE9A 5FBQB 3WMXA 5K6AC 2R5NA 1O9HA 2QRHA 4TLLB 2FUCA 3WHKA 5KNBA 1EWQA 3LC0A 3F9IA 3I32A 4N0DA 5DM2A 1C7JA 1QQ7A 1XZGA 1LBEA 1ZM9A 2D3TA 3DAHA 2YH2A 3OF3A 4G85A 4OFWA 4XQEA 1UAAA 2WIKA 3Q7EA 3PZBA 3R75A 3Q8LA 4EIWA 4JC5A 2ID4A 3IE0A 4BNVA 4FONA 4LRTB 2BBSA 5BN1A 2RGBA 1YZGA 1YS9A 2WYVA 3H97A 1PJRA 4UREA 5EWJA 3ROXA 4RVSA 1OLSB 2ZANA 2IZ6A 4AIIA 4CM6A 1SCJA 5L6LB 3KLNA 4QNMA 2WWHA 5CLHA 4DLNA 4X62B 4ZV7A 1S8FA 1GDHA 1LXCA 3MC1A 3V8VA 3ABZA 1W7AA 4L2IA 4B6RA 2FJ0A 2ZRIA 1KMMA 1KJIA 2D1TA 2QAGA 5I9SA 1BEEA 1ISIA 3HP7A 4BNHA 2YYAA 4D57A 4EGSA 3BL6A 5F5NA 1A69A 2Q9UA 3AEQA 4XI9A 3RS5A 2MYTA 2I4OA 4WKGA 4WLOA 1SRRA 3CNNA 4X7RA 2FX2A 3W34A 1F4LA 2W90A 4L9SA 4M9SA 1Z4IA 4ND5A 2FWIA 2YV2A 1OBCA 3DDOA 4CV3A 4US1R 2BGWA 2X14A 3HCOA 2H4ZA 1AK9A 1R5NA 3GLHE 4OHKA 4X91A 4ALNA 4I55F 4ID9A 4TT8A 2ISSD 1I9CA 4H3VA 2CKDA 4HYTA 4KKXB 1GWNA 4LXXA 4WZBB 1TAQA 1ZRHA 2YOGA 1TU3A 2AR7A 4WBXC 5TVKA 4EUSA 4TM7A 2VYNA 1Q6YA 1Y1SA 4M36A 5IEJA 3GVPA 3H6HA 3D8TA 1UK9A 2MYNA 1G17A 1R6XA 2N9UA 5K8LA 2X2FA 1YBHA 3A6LA 3GRFA 4IEEA 1RAHA 4IXMA 5T4HA 3OOHA 1MG0A 2B37A 4FLMA 4GOMD 2MJLA 5TY0A 3P0HA 3BH7A 4QECA 3DKPA 1PR4A 1V3QE 4BXOB 1NVUQ 3KKZA 5FWAA 5EA2A 1Z8HA 4R31A 1M6EX 5A5FA 3IVMA 4JYAB 1RJGA 3CZCA 3FZGA 1Q95A 1BJTA 3MJSA 3HKBA 4D9KA 2QRPA 4QTUB 3EGXB 4OB6A 2ZYDA 3AH8A 5K0ZA 4C6TA 1AHIA 2ZCVA 3RD5A 1W73A 3C15C 3LUPA 4RVDA 4YGXB 4DMRA 5ISMA 3ZWBA 4X6YA 3ADBA 3ZDAA 5EYPA 1WMDA 5SY6A 1YQ9A 1AQNA 3AFGA 3HA5A 3TX6A 2EZUA 4GMFA 2QAIA 1FUIA 4G24A 3T5DA 4Q1DA 4MQUA 1OQAA 2Q4EA 5CM8B 5TPZA 2WOOA 3MWYW 3IP9A 2FNAA 1OU4A 1VHQA 3PHHA 1K5HA 1G4AE 1R6UA 2EHDA 2WHEA 4LDPA 1KAGA 4RPJA 4U5QA 3TNFA 4ZJUA 3I5YA 5CR9A 2VBCA 1U7ZA 4E2ZA 4WOPA 2DQKA 3A6PC 4LQ4A 1PSDA 1KEUA 4WK6A 3ZE8A 4ZFNA 5CXUA 4Z9YA 1KYQA 4MVWA 3U3OA 4CIAA 2Q4TA 2P9FA 2E7ZA 1PG2A 2RGUA 3OTQA 1P91A 1P2DA 3M9XA 5SYMA 2CB9A 4DLUA 2ZTUA 1YE3A 2ECPA 4CUKA 4EHDA 2BHRA 2WV9A 4WDRA 1W9MA 3DLBA 4Y2XA 2YBEA 3CF6R 4OLJA 5HCIA 3BGOS 2IK8A 2HIMA 1YASA 5DF1A 4B5LA 5I7FA 3O2JA 3WWCA 3R7AA 5HZKA 1SIOA 2BGTA 1RABA 3D1VA 3UKJA 1KC3A 5ITZB 4GNKA 2X8JA 4L8VA 2XNJA 3C5WP 1YRWA 3D4BA 4JBNA 1AF7A 3KEFA 3M2TA 4FFNA 5B1HA 5TMBA 3IE2A 3NHRA 4F2GA 4HB4A 4RY9A 2YN4A 4A0FA 1TT5B 3IT1A 2K6GA 1EU1A 2EX1A 3DBVO 1AZTA 5LYYA 2ZBGA 1N77A 4Z9XA 3D0RA 4AC9A 1XZDA 4JT9A 1H2YA 2NOAA 4YMIA 3V4PB 1JEQB 5JROA 2IE0A 3CH5A 4TWAA 2W2QA 2XJ9A 2OBXA 5C80A 5EJ5A 1ABBA 5G4KB 2DH5A 2PYIA 3KKLA 3QVGB 4TSRA 2OZPA 1WS6A 2PV7A 1QIIA 1ZRNA 2Z2XA 1MXHA 4UJ5A 4GR4A 5BRAA 2JIQA 4C87A 1NFQA 1RJ9B 1VI2A 2DUMA 2EG9A 2XODA 3QBVA 4TKVA 1YRLA 5LZ2A 2XUQA 1U3WA 1ENYA 3NEJA 3BFXA 5BNIA 3GLGA 1A77A 3LRPA 4AJHA 3O38A 4ZOCA 3LY5A 3HGMA 4A7PA 5DNAA 1W4CA 1IRXA 3O93A 3HVHA 1MFZA 1UC4B 4F71A 3UAYA 3QXJA 2NVUA 5FFFA 4D9BA 1BHSA 4EB6B 4FX5A 2AI3A 1C2YA 3LBHA 5FBKA 5LBUA 2VJLA 3NTVA 1LK5A 3WGOA 1N34B 2IH2A 3ZCVA 2GXAA 5B2EA 1SG6A 1TIBA 4OLAA 2IODA 3B6EA 1G3IA 1QRAA 4BBPA 4LF7B 1QU3A 5FPPA 1P5ZB 4QL3A 1PD1A 1GQFA 3EDOA 4GSYA 1VJDA 1Z4LA 4MAFA 4ZTBA 1K7YA 1YJXA 3V97A 3O3NB 4N65A 4ER5A 3PEYA 2I7VA 4OUKX 1KOJA 3AWDA 1A1VA 1HEYA 1DX4A 1XE3A 2AOVA 2W2PA 3CMMA 4MKXA 2J07A 3IPRA 2WICA 3D6JA 3WQHA 4DS3A 4DMCA 3O1JC 4LJ4A 2YICA 2BTQB 4RZQA 2FP4A 4I4TB 5I8WA 3JQFA 4OMFG 1WSBA 4DLTA 3EC1A 3UXHA 4MV0A 5E4JA 5BSFA 1GAJA 5A5DA 4M0UA 1P1RA 3RHSA 2POQX 2P4UA 4JJKA 4L9AA 4K6HA 3AT1A 3EYAA 3B6JA 4U2DA 2GCIA 1QGUB 2ZKIA 1U8CB 2Q9AA 3GUYA 2OXIA 4XD7A 4FNOA 1CIVA 5IASA 2DSNA 2GCNA 3AHFA 3KHKA 4KXXA 2H5LA 3RS3A 2F3TA 3HM9A 1JDPA 4XYLA 3TOZA 1SAYA 1Y5NA 1ZGJA 1IBKB 3LRXA 1S5PA 4RKQA 3RSZA 5EE5B 1SN7A 4MAAA 1NVAA 2WNHA 3G2NA 3N7AA 1KEPA 5B3LA 4D3SA 1Z18A 5IN5A 5AVZA 3ICOA 4JK3A 1TPYA 4XASA 4EL5A 5JV5A 3E1KA 4TTRA 5CMLA 1H2XA 1R8YA 3BK2A 2JLRA 3DW3X 4J0GA 4J9VA 4LVUA 4RIEA 2ASVA 4AD8A 4EDFA 2ZYGA 2C2YA 5K8TA 1PT6A 1QU2A 2XB4A 3WNBA 5AW4A 5BUCA 2WIAA 4FW9A 4ZCPA 2LD4A 5IARA 2QRMA 2PUVA 4KUHA 3TIIA 4QOHA 2W0MA 3GUCA 1TYDE 1SKAA 2ONCA 1XD9A 4FGZA 1V48A 2ZWMA 3L7IA 4GLFA 4PNEA 1USIA 1V7ZA 2FH5B 4B34A 4B46A 4HHEA 1TKAA 2OUIA 5C52B 2Z3VA 5LQJA 3DAFA 5JJLA 4MWEA 4BLQA 3FRIA 2FW9A 3MJRA 3TBHA 1L7QA 4EF6A 1SBCA 3ZHYA 3A1VA 3CCFA 1T0IA 4JJGA 1LPOA 2LVBA 2PX0A 4YR9A 4IFEA 2P5YA 5HRUA 2FEAA 4CCYA 1O4VA 2VF7A 2FN9A 2DB3A 1G8GA 3RVNA 1DJQA 4M8NE 3M7IA 1WTCA 4ZWNA 2FOIA 2PVCA 3UM9A 4AK9A 4DMUB 1MB9A 2VLIA 3OE1A 2HHAA 3VZRA 2CDRA 4OLFA 2C7OA 3CFYA 2J1LA 1II8A 3OY7A 2JIRA 4JB8A 4WN9B 4MQFA 1XP5A 4ZEMA 1DEOA 3KIPA 4NOMA 2OG1A 1N5RA 2E4UA 3C3AA 1ZVJA 1EFLA 3UUGA 1HT1E 4IS3A 5DI3A 3RS9A 5L9AA 3ZE1B 5AIAA 2P67A 5IUJC 4TWBA 4IDOA 4TRMA 3ND9A 5KTPA 1PFQA 1WXIA 4IV0A 1GPYA 2OB2A 5CFOA 1B1AA 1VM6A 3F2IA 1QZZA 3IAS6 3RTDA 1YQUA 3NOVA 4JHXA 1W2GA 4W8HA 4BKMA 1Q22A 2R1ZA 3UJDA 2KE5A 4PO8A 1I6WA 5EE9A 1TGYA 1NIJA 2UVPA 3BMOB 4I7EA 1C3VA 1M6YA 4MKHA 3UAZA 4ZU6X 2O8BA 3EARA 3K16A 3QFTA 5TT0A 3AP2A 1YJAA 2BKAA 2IPNA 4C5BA 2ENUA 1MMFB 2P6PA 4KYVA 5DHRA 1P1BA 2C2BA 3RFCA 1Q1QA 2OSVA 1JIVA 2R7NA 4XPZA 4AZSA 3EISA 4ZAZA 4EF5A 1GKIA 3HYSA 4ND2A 4WNCA 2FSPA 2Q9CA 3A28A 4HOYA 2QUBA 1AMOA 2HNAA 4ON9A 3WLEA 5KHLB 1UF9A 3KQUA 2AG8A 2WSMA 4E94A 2ZXUA 2C2OA 2QP9X 2HREA 3I42A 2LWIA 2XNCA 1Z5NA 5D6NA 1QHSA 3KD2A 3WJ2A 3V1UA 3F3SA 3OTWA 4QFBA 5I48A 1R88A 4G5SA 1VE7A 3BS4A 5EPEA 3UMSA 1JHYA 1K2WA 1ZM7A 2VDUE 4P4UA 1GHTA 5BSWA 3ELBA 2BFEB 4JR2A 4Y0NA 2VRNA 2HPHA 3OJ0A 4HAWA 4NJOA 2PT7A 2R68A 2PCLA 1CR6A 1CE8B 2FLVA 1KC1A 2QWXA 2FN8A 3GJTA 1CQJA 3CT4A 5B4VA 3LQ1A 4LY9A 1FDIA 1ZVVA 1GRNA 4M8IA 2Q50A 5HIKA 1CDOA 1GU7A 3MELA 5FAKA 5A4KA 1CB7A 3WVNA 3KYDB 1DJPA 4GMHA 2CXTA 4RZXA 3TRHA 1A5TA 1T2VA 1Z6TA 2XKAA 4PZEA 4DIKA 5CCEA 2KWIA 4IDQA 2YKGA 1W44A 6ABPA 2PY6A 4PRZA 1A7AA 2G9UA 1V6CA 3RJ5A 2EBUA 5JYEA 4MWDA 2FFQA 1HG0A 3OEHA 4OFXA 3CR7A 4DZTA 4J9UE 4UUNA 3FMIA 5GIPE 5HFNA 5JRDS 1N5DA 4HAYA 5KHOC 1I5RA 3KOZA 1FVFA 1E9CA 3Q87B 2BM9A 2ODNA 2OESA 4BTLA 1DTEA 3RJ9A 1YULA 4HZUB 4MA4A 4OL9A 5DASA 1E61A 2B36A 2GX6A 2XZDA 3G5UA 2YWRA 3Q40A 5AK6A 1L7EA 3T7TA 2AVDA 3PGXA 4L8FA 4MRVA 1EJBA 2J9ZB 1HE1C 3EG5A 4P4LA 3HKEA 2NXNA 3OX3A 1X9GA 5AIBA 2VQ6A 5I01A 3OFVA 4O3FA 4PGAA 4WXEA 1K97A 1NYRA 3WNQA 4LMRA 5JMOA 1T8YA 3K5PA 3RK1A 2NO0A 4X64B 4V1CA 2A0YA 2CXHA 4X24A 5BR1A 1KO7A 4EKEA 4KIFA 4A6DA 4Z51A 4OI1A 5BV2P 4CFSA 1E6KA 2H4JA 2IYFA 1QXSA 1RXWA 4KQGA 2WE7A 3DCJA 1E0KA 1OAAA 2AOUA 4MKZA 1ZCBA 4ZMRA 2V4MA 3HQ4O 1NF9A 1IG0A 1BS2A 3K20A 1E64A 1XYVA 4DLSA 1RLOA 1AQ6A 2JBAA 2PFKA 3SLRA 1VE1A 5JC1A 1RWWA 3PWKA 4N1AA 3TZLA 4GZ6A 4GYWA 2JFNA 2W2LD 4ZJZA 1E2NA 1DIRA 2I2BA 4GWLA 1GR0A 3MINA 1XVTA 3AR4A 3CZAA 3RQSA 3FROA 4JP3A 5LR6A 4OMUA 3SDSA 3W06A 2TMGA 1B6GA 3NW9A 1LFAA 5LXTF 4RVFA 4ED9A 3K9NA 3OICA 5GP1A 4ZEOA 4BO0A 2DY0A 3E5HA 2PEZA 1UQTA 2WILA 1O96A 2XLCA 4ACAA 1U28C 2I91A 3WLPA 2WI8A 4DY6A 4UXIA 4GYJA 5A04A 3VKGA 1UP7A 2C9OA 2Y1KA 2G5GX 1M75A 3QIAA 3LCVB 3JQAD 3CLTC 3Q6MA 2JASA 4D26A 1E69A 3FF4A 2H48A 5K3FA 2EAUA 3K8YA 3JZFA 4GSLA 1I3NA 2H00A 2QR3A 3R74A 1P1JA 5DW3A 2O2XA 3RVKA 2PJDA 5HMLA 2POCA 1JNXX 4YXFA 1C1XA 1HFJA 1K27A 1LRKA 3C6ZA 3HSSA 3IEUA 3LX5A 4KBGA 2KYRA 3QUQA 3QVOA 4HQLA 4KQCA 4F5WA 1S8OA 3D64A 1NLZA 1V2HE 4L0QA 4F12A 1V4VA 1PHPA 1PL7A 3R5SA 4NQZA 3CBGA 4Q6WA 3G7SA 3J80A 3GUVA 4HGPA 3UAWA 4ALIA 1FBNA 4R2IA 1K3UB 3T1VA 1PS8A 1ZLYA 1IY0A 3TAXA 5B4TA 5K0GA 2FMIA 1UPTA 2R00A 1MH9A 2ZI6A 2PUCA 1VBNA 1BVRA 1YIOA 3TAHA 1KZ4A 1MVNA 3IALA 4RQBA 5B6JA 2PQ0A 2CLKB 5LP6F 1KKMA 3L7NA 3PC3A 4LZOA 1OREA 2OL4A 2J7PA 4YASA 4ZANA 1KL7A 2ATVA 2FQWA 3VV2A 3TKLA 1UMKA 2QSYA 3EXG1 1EGHA 1FRNA 1UMCA 2O2SA 3PJFA 4FGJA 4P4SB 4CLDA 7REQB 1DXHA 1ZNYA 1G2QA 2F1KA 4CIYA 5BUSA 3RH0A 4AJ4A 3H2YA 4ZYTA 5FULA 1JFFA 1EVEA 2D8AA 2GCOB 1JEYB 2R4TA 1GPKA 3NHWA 1LW6E 4A9AA 4QBFA 1WR8A 5EJ7A 2G06A 3DJFA 3L7CA 3A11A 4DNPA 1HEUA 2PGLA 1VOTA 1A2BA 3HN7A 4BFUA 4ZO8A 2QJWA 2C95A 4LSWA 1CY2A 2QX6A 2PH5A 4PG4A 1CJMA 4EHNA 3ANTA 4D9HA 1VCOA 4GI3A 1Q7GA 5CT6A 4MI9A 5AKGA 2RH9B 3IXMA 2J6CA 2C2ZA 4OI2A 2H08A 2ZJOA 3D9QX 5IM4F 3PX2A 2O07A 1CUCA 3A1WA 4ZVMA 1WB9A 3V46A 4L8GA 5TQ0B 3R0ZA 4EYOA 4UOEA 3R24A 4GR5A 1FLVA 2XUHA 3T9FA 3X3HA 2IEBA 2I78A 2W9XA 1WOYA 2XGSA 3B36A 3DEIA 3PXGA 4FINA 1EE2A 4FMDB 4C7OB 3DONA 4DGSA 1KI8A 5JNTA 3BZWA 3O8BA 2XEDA 4Y67A 1B6TA 3TI9A 2GK4A 2JHFA 2O3SA 3A2KA 1N3BA 1J06A 1QANA 2YNMA 1ZGCA 1GRVA 4LXGA 3KLPX 4U2BA 1Z5WA 3LFUA 2BFOA 3D7LA 3K0BA 4L16A 4ARSA 3T3DA 1PRYA 2BKVA 3RRZA 3DCNA 1Y0BA 1D4FA 3HLTA 1G63A 4JYCA 5DRYA 4I1PA 3H8SA 4U9UA 4R1MA 5IHPA 4TUYA 2HV8A 2XRFA 4G0MA 1VBFA 2VOJA 3KTOA 3TL3A 3EVZA 1E4EB 3GRPA 2D4HA 1XK6A 4YQFA 3PCXA 2C7VA 1A72A 3DDUA 1QPZA 4DHWA 3B9RA 1TMGE 2CVZA 1I10A 3AUSA 1E8DA 1C0EA 3FE2A 3HR7A 2FUG1 3CYFA 3FPSA 3E2PA 4FMDF 4BAUA 5JO9A 1RCFA 3VPBA 2IEDA 5DNWA 4DKJA 1SA0B 5G0TA 4LY0A 5BRJA 5CIQA 1PEAA 1EFRA 4EUEA 3CRMA 2YZKA 3FB1A 3GNSA 5BXYA 2QZPA 4TGLA 5ED0A 3TYXA 8GPBA 3ZV5A 3IPLA 2DTEA 4O4IF 3EEYA 3FZNA 5LZ7A 4LJKA 1T1GA 4L8YA 3ZK9A 1QH8A 3A6DA 1E9RA 1C7ZA 1J2UA 2BFBB 3D1LA 2B6NA 2HSEA 1P80A 3FJ1A 4MVJG 2R4UA 3N0TA 2AS0A 3HWWA 4P34A 1JAXA 5P8WA 3PA8A 2AJTA 3IAFA 4LG1A 4LI3X 3VVLA 2ZT6A 2J5RA 2VH1A 1QBKC 5DIFA 4BQEA 4D4IA 5A03A 4HDKB 3CZ4A 4QDTA 3WYNA 3AESB 3X1MA 1L8AA 1KEEA 4HDNB 3ZH2A 1TMYA 3DT9A 3OEYA 3U4AA 1E9VA 1REQB 3LSTA 3OCUA 1NT4A 1PSZA 4G4GA 5JZSA 1TZCA 2FPIB 2HQ1A 2JPDA 4EJ6A 6GPBA 3RSCA 4F9TA 4QUDA 3VUFA 4C4AA 1T2DA 1S3IA 4XSHA 1HURA 1F4VA 4E51A 1X7DA 4LZPA 4F2DA 2ABWA 3OLWA 2C99A 3OPMA 4Y9SA 4E3WA 1L3IA 1G6Q1 2QV7A 4MJ3A 1CSEE 2C2MA 3AL3A 3JWJA 2QGZA 2BR3A 1AM4D 1NIPA 2FGJA 1EGQA 2AFHA 1ULSA 4LAFA 3F7TA 3HKCB 3KPYA 1D1QA 2IYOA 1G8KA 2OBLA 2XNDA 3SBXA 4C4XA 3AEKA 3GCWA 1EWRA 1AIPA 3SYTA 2H9YA 1NJ1A 4RO0A 5AKHA 2WWFA 4WZAE 3TB4A 5K51A 1XF1A 2BZGA 2LRHA 2VT2A 3ZZNA 3ZZTA 4FGSA 1ZLXA 4B79A 1JHMA 1Y3BE 3JX9A 1ZU5A 3IQGX 2G9NA 5JRZA 2B9EA 3JYLA 4DHEA 3RS8A 1PNRA 4RAOA 3PJGA 3IC5A 3CH4B 2CYAA 2JHPA 1YCFA 3IBCA 5T3UA 1QWSA 1GGEA 4N3AA 1MO3A 1AKNA 1YONA 3DD5A 1DXQA 4LX8A 2CE7A 4DZZA 5GIOE 1NNSA 2D7DA 3AUKA 1WCXA 2WNIA 1KP9A 2CHFA 4JB0A 4K9MA 3ND7A 4TPKA 3LLCA 3LGXA 2DMRA 1MEJA 4FFDA 5G02A 1E0JA 3GPLA 2PANA 4YALA 1X19A 3ZY2A 1NQWA 1VRWA 1SOUA 1N4AA 1YZTA 3HCNA 3V9PA 3HN6A 2JLYA 5BUQA 5JR3A 1NVEA 4LZWA 1P7YA 3BRWA 5EINA 1JPNA 3IJEB 2HSDA 5FUBA 3LOUA 1B26A 2BSAA 1OLXA 4KDEA 2ZJ1A 5M29A 4RTQA 1C9KA 5LDGA 3U7HB 3R8CA 2CUNA 2K2QB 4OQYA 3GO4A 4TKMA 2HV9A 1XXLA 5LQUA 2O7VA 2R6DA 1YQXA 2HJWA 2ZT8A 5EKUA 5G0WA 3K0SA 1TMOA 3H2ZA 1OIXA 3SC4A 4NFSA 5COQA 4CM4B 4D4LA 4YJHA 2P68A 4KQHA 4MCJA 3I6YA 4BNUA 4EUKA 4JVLA 5CVVA 1QFXA 4TL8A 3GMTA 4FYJA 2PMBA 4EI7A 4BMDA 4B87A 1DXOA 4KODA 3ZN2A 1ZMRA 3OJCA 4G37A 4FMCB 1OLOA 1WUIS 3DB2A 3A36A 1CY1A 2A84A 3ZUPA 2WSBA 1QYVA 4BNFA 1GNLA 4FXPA 1TEVA 1UDAA 3NYWA 4OGFA 2EV9A 3D8RA 3L0PA 5JJBA 2XCRB 2GO1A 3QRWA 4FZ5A 4TLEA 3JWEA 1RWXA 4GGMX 5TF4A 4DWVA 3V4VB 3HHEA 3HADA 4PNZA 5GOZA 1TO6A 1KS2A 4CQNA 4X1KA 4FCCA 3RSHA 5LWHA 3N86A 3O8NA 1AUXA 2RH8A 4KH0A 3ABSB 4DWWA 5HHTA 5I9LA 1IVNA 4WGGA 1WTAA 2ZAGA 1NLUA 3GIWA 4QXRA 3OH8A 4TX1A 2AG0A 3K31A 3OA2A 3WGUA 1D8AA 4RKYA 4P5PA 3BE8A 1Z0AA 1HC7A 3WYGA 1Y5RA 4HDMB 3LTEA 4PHGA 5ALWA 4F4HA 2QXTA 4Q4JB 4FMCF 3JYQA 4IHJF 4X6LA 4O2LA 2YVLA 3IA7A 3QOWA 4HX5A 1YFZA 1E2IA 1F17A 1C7FA 1ZESA 2DU8A 3N2YA 5FL7D 1UJ2A 2GVZC 1I3LA 3BMCB 5C5CA 2FU5C 1THMA 3DMHA 4QQKA 3OQ1A 4PBTA 3M4XA 2ZBQA 2I62A 5ALUA 3EXFB 3TIGA 2HF9A 4QIHA 1U0BB 2B6HA 4DMGA 1LJUA 2VUHB 4XYEA 3DPIA 1KK0A 1Z6YA 2QF7A 4QTXA 5JY6A 2ZSDA 3RFTA 3QEMB 3STWA 1LWNA 4EQ6A 3EWSA 2RK4A 4HTFA 5ES4B 4F2WA 3KPVA 1DWPA 3NTLA 1DKPA 1E2LA 1QZUA 1DAGA 4MINA 2UYOA 3S2IA 3TNYA 4YJ2A 1IOLA 3FHOA 1K0FA 5CA1A 1DEHA 1FX0A 4GMGA 5ARBA 1ECJA 4QA9A 2EHJA 4Z49A 1JQEA 1VECA 1VL6A 1CUIA 2FZEA 2B34A 2OGUA 1TUBB 1GLGA 3WWOA 1YK0A 1TW2A 2EYQA 2J87A 4BN4A 4UUPA 1KZ1A 4BE4A 3P9IA 3DZHA 2QIOA 5AXCA 1WRBA 4W4TA 4P7BA 4I50F 3LUCA 4GF5A 2ZCUA 4PZPA 4UEJA 5IX8A 1F1JA 4I9UA 1HMPA 3QW4B 3LBAA 2QENA 3MZ0A 4QYIB 3IOEA 3ADPA 4J07A 3UMFA 3VH2A 3FNQA 2Q5LA 3ENWA 1XQ6A 2RI0A 4RF4A 1EFUA 4JLDA 3DBRA 4V3BA 2X9VA 2B92A 3W6PA 4B6JA 4YRZA 3LFTA 1G8PA 1YC2A 4W82A 2E1PA 3GJ7A 3A6JA 3AJRA 3FYUC 3C8HA 3ZIAD 4ZVTA 3OLZA 1JHDA 4BO8A 3U3XA 3FUWA 4RFSB 4PEVA 2NU9A 3ETEA 1OYYA 3H2IA 4KO3S 2OORA 1TKBA 3C70A 4JI5B 2CJFA 2AQKA 2BCJQ 1A8SA 2NTVA 5TGZA 4ZVUA 3RC1A 1H3FA 4BO5A 1GNRA 4PHFA 1XA4A 4MP8A 5I9NA 1PLKA 3HUEA 2OP1A 2FUEA 5HXAA 3C45A 4E88A 1P3JA 2BPOA 3VR3A 3R3XA 4UBNA 4A23A 4YMWA 3F0TA 1HLFA 3OJXA 1M76A 1KDPA 2ACVA 2PMEA 3BIXA 5JSKA 4IMIB 4PQYA 1E1CB 1SBTA 2QG4A 4PCLA 4Q9HA 1FW8A 3VOBA 5COAA 2P9JA 2QYTA 2ZYAA 2IDJA 1T36A 3DTYA 3H65A 3NOXA 1VJRA 4I8IA 5KYGA 1QK3A 4S04A 5EJ9A 1Z62A 3REQA 2IITA 2EF0A 1XRQA 3DMRA 3KAQA 4UZEA 4F56A 2I1WA 1BHQ1 2H4YA 1Q12A 2V8OA 2LKCA 4NS1A 3ZUGA 4JU8A 4BPBA 1VJ5A 1GOTA 2NX2A 2MHCA 1RKXA 1PK9A 1E1YA 4TKUB 3LXRA 3KZVA 4B2IA 3ZWNA 1TJ5A 2PZLA 4X20B 4K40A 2ZFUA 3L8FA 4BB0A 4RXUA 2VLBA 3AERB 2FB9A 4X84A 5I7RA 2O50A 4LC9A 1RBYA 1JQKA 4UQOA 3QPWA 2FWRA 1XX6A 2F8MA 1NX9A 2NO6A 2WJHA 1DDOA 2GOYA 3CW2A 2HK8A 4MYRA 5DWQA 1RVV1 3GAZA 4URVR 1T34A 4JWTA 4PW0A 4LOIA 1BN7A 1PJBA 4Q01A 2WBLC 2B98A 1ISHA 1JR2A 4COOA 1TVMA 1G7TA 1Q0PA 3PQCA 1DAEA 2IYUA 1GCIA 1R4MA 1Q7BA 4P32A 3GUZA 1JQDA 4MRMA 3B5JA 4R0MA 4IWXA 3AXSA 4BATA 4HQRA 3UG6A 3PC7A 3SQWA 2QM0A 2NU8B 2NPFA 5ALZA 3NHAA 2C78A 3JTMA 2A5DA 3HMQA 3JQQA 5F77A 4HFNA 1M2FA 3G1TA 1DKLA 3WZMA 1ARZA 1QHEA 3FMVA 4AP5A 3VGJA 3UKOA 4IDBA 4UTVA 5KQMA 4RCVA 3LNCA 1M7GA 2AOWA 4C7XA 2ANBA 3AB7A 4G2TA 1YE5A 4B09A 5JAZA 5KPDA 1ZOPA 3QNUA 1JKMA 1T9AA 3JALB 1IZYA 2FKNA 1Y42X 4HXFB 3VNUA 3QVTA 5EWLB 1GPUA 3NJRA 5ILOA 2ZIXA 1I1QB 2WUWE 4F4JA 3A9TA 3OPYA 1EQ2A 4DQ0A 1QYRA 4ER6A 4ABTA 3GP3A 4OVKA 4I99A 2X8WA 4MPTA 1JG3A 2DR2A 2PWBA 1CD5A 3D6UA 2MSCB 3K4PA 3KYCA 5DLYA 1OLUA 3C5VA 2BP7B 1CYEA 1CHNA 2IGTA 4LYHA 5TF0A 1GIAA 3B20A 1EX9A 3F78A 3AB8A 3S7TA 5CCXA 3TW8A 5AVQA 2C96A 3HABA 3PP8A 4DRYA 2JNWA 3RU3A 1TE2A 4FYMA 4HNGA 4DPMA 5CYOA 1PWYE 1NU8A 3M6VA 3DZCA 1A4RA 1N0HA 2ATXA 2I9PA 3OM9A 1ND6A 1P39A 4Q24A 3W78A 1TLTA 5AVWA 3JPYA 2WG0A 2DPHA 2NUAA 4RL6A 2YWCA 1XZPA 2RFLA 4MR9B 4HRXA 4Y1EA 2JGLA 5DULA 1ESZA 1DAMA 4C3OB 1SXJA 3FBGA 2IIVA 3HU3A 4TQAA 4AX8A 5TB5A 1Y8RB 2A9QA 1TF2A 5BRNA 1Z34A 4LC1A 2FLWA 5TMDA 3WO0A 1VL2A 1W85A 2F3QA 3HBFA 4M1TA 1QWOA 3ST7A 4KXFB 4EGFA 1YKFA 3CPSA 1JLSA 4UDXX 1QBGA 1EAMA 2X1LA 4G63A 3G8YA 3TK1A 2FSVC 2QK4A 4OG2A 1RU3A 4RZHA 5JSZA 3M34A 4HZIA 1WZNA 2GAJA 1VCHA 3COSA 3S1AB 1ZGZA 3H11A 3V4ZA 4WGFA 3TUJC 1HZZA 4TKZA 4QJ3A 2CHEA 4N18A 2E82A 1UBHS 4P4NA 1JI3A 1L5SA 5KQSA 2CVHA 3P0FA 3AONB 3HUFA 3KUXA 4G5RA 4A91A 4TS1A 4X45A 3N2IA 5AO9A 1G41A 3WK6A 1M2WA 3M6XA 2V54A 4KB5A 3VDMA 1LX7A 4NYIR 1VIAA 1KBQA 5FPKA 2A59A 1U65A 3ECSA 3Q6NA 3FAKA 4GI1A 3MGAA 2B99A 3B2QA 3X2EA 3K96A 3T35A 4YT4A 4JASB 3VH3A 1GYRA 4HMPA 3SHQA 4PO9A 5EZ5A 2ISQA 2QTWB 5AP9A 2HJ9A 4G8JA 1ACLA 2FOXA 1M2NA 3JQ8B 3PWZA 3VC1A 1XG5A 2PVSA 3U5ZB 1J8QA 4AKSA 4IJUA 5H3CA 1FTGA 4AB1A 2LDBA 4MJLA 3EIOA 4JL8A 2D2FA 4RVUA 2FCAA 2KJQA 4HWGA 4GKKB 4LEIA 5FRDA 4CIXA 3AFIA 3W8NA 3UVEA 2YYYA 4PQRA 5K3CA 3ENQA 3ELYA 3L8GA 1GYPA 1Z45A 3LXUX 3BMQA 1QO0A 4HAUA 3VM6A 3H84A 2NU7A 4C7MA 4JP2A 2HT6A 4E6EA 1U2DA 1T43A 1LDGA 2WF8A 2YN0A 2WJPA 4F96A 5AUNB 4JKOA 3LX8A 1JU4A 3MB8A 4GQIA 3E9EA 4WOJA 1VPTA 3OU7A 3I39X 4DUGD 1Y8ZA 2HIAA 4KREA 1U4NA 1GPWB 1D09A 3PU6A 1KJQA 3KP1A 4QUBA 3DXXA 2WFZA 4DR2B 3QXHA 1QYWA 3MD9A 5BYKA 4ARZA 5FV7A 2O6HA 1UKCA 3PB3A 4M21A 3SI7A 5CB4B 5J43A 3TLXA 1V5IA 4YMGA 3TQOA 3AR9A 3R41A 4CUJA 4OFZA 5T67A 2ESRA 2HPAA 3AIIA 2F1IA 2FX5A 3BGSA 3GA5A 1KYXA 1WZCA 2MMGA 3K4QA 3GAFA 4BKPA 5AI4A 1W36B 3VHQA 1NTOA 1LSUA 2F62A 2GAAA 3B8HA 1X70A 3IPXA 5AHWA 5AJUA 3TQTA 4UBLA 4LFCB 3STHA 4AN4A 1S4QA 5L95A 3DFZA 1D6NA 4ZN6A 2AE1A 4KVZA 2XTZA 2E55A 3ND5A 5EHXA 2JLZA 2VHCA 1PDWA 1FPQA 3AEYA 3BKWA 1UDCA 4L5IA 1GXSB 3A3YA 4B6OA 1XRNA 3A1CA 3FUXA 4YB8A 5IDWA 4BVFA 2IZ7A 4G0VA 5B5SA 4YRDA 3AFNA 1JVNA 1XCOA 3C3JA 1SKMA 1Z7EA 5JOQA 1Z28A 4G0WA 4PSCA 4BGEA 4C30A 3VPFA 1COZA 4GWKA 1E59A 3PUXA 1UXKA 3B38A 3QXSA 4I66A 2G5CA 1YUBA 4NZZA 3TEJA 3TE7A 4BGDA 3I9FA 1W36D 2DJ5A 3NYQA 3QUCA 3TSAA 2K87A 4FD3A 4YECA 1DFIA 1CUSA 4IIJF 1W0JD 1U90A 3K1JA 5KO2A 4H4CA 1YA6A 1DO0A 3PXCX 4FOSA 2CXPA 3GHYA 5KCMA 5F76A 5BN3B 4DJFC 2CV2A 2AXEA 1XTZA 1X3LA 2BZSA 5GAJA 1PNVA 1YB7A 4LV8B 4B8WA 4C21A 5FBWB 1CRQA 3UK2A 2VH2A 2O14A 2DLNA 1VL0A 3CN7A 1BNCA 3LHIA 4X5OA 5IN4A 4KR7A 2BR4A 2NUPA 1GPLA 1WVIA 3KO8A 3IV7A 821PA 3BXZA 5KPJA 3KYJB 1WLSA 1KOFA 5FB3A 1E2FA 3OD5A 1DTSA 4TMWA 4MVJI 2IEIA 2IHYA 3DS8A 1T0BA 3TGLA 2VP0A 4K9QA 4D7AA 4RHUA 1PE0A 1SVNA 3OUUA 4D0LB 2H6EA 5B6IA 1AD2A 5K0SA 2V1UA 5BVGA 5EIOA 4ZYWA 2JFOA 3DH0A 2PUFA 3B6IA 2ORVA 5FHQA 4DE5A 4Z3KA 3HCWA 4N4AA 1FDVA 4NCXA 4PFJA 1DT3A 1JG1A 4QAJA 3IAUA 5SICE 2O1WA 3BA1A 3FTFA 2GAIA 1M10A 1R9GA 2IF2A 2IUSA 5BV8A 5EJ4A 5IBCA 3GRKA 3F46A 1LBIA 4IHKA 4WE3A 5CG1A 3SKXA 1RYBA 2NTEA 3D43A 4HC4A 3GJ4A 2G8NA 3GDHA 4A03A 2D74A 4LYAA 1RM0A 4CR8A 3Q1KA 3BJIC 2EFHB 3W3AA 1MTZA 4LDAA 2R62A 2C5BA 5LQAA 4I3FA 4LYEA 4EI2A 1DQZA 4LXYA 3COJA 4MS4A 5DN6A 3RK4A 2CDCA 4AKIA 3I2IA 4HGOA 4JEMA 5AVKA 1FFHA 4B45A 4YUXA 1CLEA 3U4QA 4L07A 4H1WA 1IIBA 4WCFB 4R2XA 3E6AA 4UEQA 3IPCA 1ZOSA 2Z4SA 2VXOA 3L0IB 4HNAB 2I71A 2IWRA 3F5SA 2XUGA 3PNPA 4OYYA 3GQVA 3Q7RA 3BB4A 4Z5XA 3GN2A 4JLNA 4KKVA 4C4YA 3EA0A 4TMYA 5BWLA 3SAJA 1JECA 1O6ZA 2V7PA 4LZNA 3VU9A 2BE9A 2Q3FA 3RREA 3G2QA 5BUZA 1XKTA 5M34A 4DCGA 4LC0A 3CVWA 1KBZA 1O0CA 1PV1A 5E2IA 5AI6A 4QYMA 1JYFA 4QQ8A 1TU0A 2OV4A 1JEDA 2SNIE 2V7QD 3GARA 1IHDA 4MYTA 4RTOA 1RXIA 3VPGA 1DMRA 1N2SA 1XZCA 4O6VA 4ARUA 1ZH0A 1NLMA 1XPJA 2GHQA 3RYFB 621PA 1II9A 2PPLA 1L1RA 3E7XA 3HFSA 2Y0EA 5B30A 1D2NA 1GTL1 2IL1A 2RCYA 3T5CA 1EESA 3A31A 4IOLA 4EG3A 1QR6A 4NCAA 1HNNA 4HGQA 1U5BA 2OHFA 4ND1A 1RM5A 3U3JA 2ZRPA 4CM9D 3OZTA 3WLRA 3CVXA 3GMSA 1UDRA 2VDWB 3M49A 4NYMR 4ERNA 1ZMOA 1Z83A 1PTJA 1FLAA 4URYR 4ZO4A 2NPOA 3DCYA 2FTKE 2I2CA 2ZG6A 3B82A 2R8PA 3DZ8A 4LHYA 5CM2Z 5KYVA 4A92A 4RK5A 5CG2A 4I9GA 4IIFA 3C6QA 1JZSA 1UKBA 4OBWA 1UBUS 4UVGA 2E48A 1G16A 2QMUA 3VDRA 3OWXA 4K9OA 1RHMA 2VA9A 1D8TA 3IEPA 3GDFA 3L84A 5CD9A 1DX9A 2QTRA 2XF2A 3NBFA 4J0IA 4Y7DA 3JD3A 5B58T 4BV2A 5KNDH 1T15A 2I3AA 3FPCA 1UZLA 2VF8A 2Y3IA 1RLUA 4R2JA 2EGGA 3JSXA 1Z0DA 2K4MA 1NR7A 2EKBA 1Q0RA 1SKUA 1WDTA 2WVGA 3CLSD 5EFZA 4DJDC 4KR6A 1PX0A 1VA4A 1HDEA 2XB6A 3L6RA 1G6KA 2DY1A 2OPBA 1VPLA 1H6AA 3CRVA 3O2NA 4ARBA 1E2JA 1P62B 3PC4A 1YZNA 3EBOA 3HXLA 5ABPA 1TJYA 2A9PA 3U9LA 2XB2A 1KQPA 2QR5A 2I76A 2Q1YA 2O3QA 4HDRB 4EB0A 4YAKA 8AT1A 1WW3A 2XSZA 5MN5A 3GUUA 3UK7A 5G3YA 5L3SA 1PFYA 3G7UA 1SURA 5HE9A 2EWMA 4DLAA 4DXHA 1FQKA 3GNTA 3OE4A 4KE6A 4MUEA 2HXSA 3OWOA 4TTAA 1WZ2A 3MVEA 1KYIA 1KK3A 1F5NA 2YFKA 3WHIA 1X7HA 5KX5B 4WSOA 3WBKA 5F7XA 5JYBA 3AW8A 4ZDKA 1Z22A 3M3HA 4UAGA 4X1IB 1BC5A 3UNXA 2KI5A 2WJWA 4G9GA 5K3DA 4TTPA 4EFKA 2JDIA 4PM4A 3W6NA 1NW5A 1CQZA 2VBIA 1QPBA 3DTTA 1CEQA 2WT8A 4GZ3A 4Z1OA 2IELA 1Q7RA 2IY9A 3OMLA 4FR5A 4N7RA 1L8LA 5HEKA 4DR5B 3T1YB 3A1TA 5CHEA 3HUTA 4W6ZA 3GCXA 1OU0A 3D1JA 1QIDA 4KXLA 1MHTA 1HRDA 2QN9A 421PA 3C6XA 4LI0A 5L3RA 1WCIA 5LXTA 1M8GA 5F2NA 4HEJA 3E70C 1N3IA 1Q77A 4CV0A 2W11A 4DG5A 1BKSB 8ABPA 3NGLA 2A30A 4PG5A 1W2WB 2EKDA 3S27A 3T52A 4HUQB 5KX5F 4L9RA 2HMSA 3WLLA 1FLNA 2GK3A 2GZSA 3AQIA 3C4VA 2XE8A 3IO3A 1J1UA 3FNBA 4OQ4A 1A9QA 3B52X 2WK1A 2WC1A 1NMEA 1NSYA 2WG1A 3OSUA 5DYGA 3K1AA 4YK7A 2Q6TA 4LGMA 3AJAA 4GGPA 4JP5A 2ERCA 3RM3A 1BJKA 3JYOA 2X9QA 2WAAA 3F6YA 1E2UA 3RJMA 4E07A 3E9QA 3A37A 5HKKD 4ISBA 4MW9A 4RH3A 3F5DA 1V9CA 5JBQA 2E5WA 4QG7A 2ILVA 5LBTA 3QYJA 3RIGA 4F04A 3DTVB 3QU7A 3EZXA 4ROSA 1DJLA 1G64A 3L8EA 2VZ8A 1OSNA 4JMLA 4Y30A 3ZNNA 2DBVO 2FXVA 4UTPA 3K0AB 3NANA 5HM6A 1E3JA 5D1HA 5BV7A 1Q19A 2R1UA 1BA2A 3RJTA 4EUNA 4WWHA 1K4KA 1KH2A 1M0TA 1N6PA 1UWKA 3IMFA 1B8VA 4HXGA 5LP6A 2OCGA 1AKEA 1BXZA 2A5LA 4WA7A 4IGIA 3IP7A 2V9CA 4L4RA 5CJJA 5A9SA 4LW8A 3RBXA 3OFKA 4QXMA 4KLCA 1IJEA 2YIMA 4F86A 1NXOA 1G3UA 2ATEA 3B9BA 3GEDA 3ILHA 4R3UC 4WPGA 2RC6A 5CLGA 3SDZA 5KNCA 1RC8A 1OW3B 5HX7A 1PS9A 2V5VA 1US8A 2JFWA 3DTVD 3T0FA 5THXA 5L40A 4OP3A 1TI7A 2WEKA 3M5CA 1VKHA 3JZAA 5FYDA 4KIJA 1W93A 3BUSA 1BCRA 1H4TA 1UPXA 3E9RA 3QE2A 1LRLA 3DFIA 4FE3A 4GZMA 4KCGA 1BFKA 3C8MA 4FWIB 2Y27A 4I6EA 3T54A 3QEBZ 3MJHA 1I33A 5AKZA 5G0UA 4I9FA 1MOPA 3RSQA 5DGHA 5LYJA 1O0BA 1SM4A 4WKPA 1WXWA 3GYBA 2ZI5A 3S4YA 3SR0A 3HZZA 5DM1A 1P0IA 5DEIA 1BRTA 1XHEA 3FFXA 3FTEA 3OCVA 5ADUS 1EM6A 3ZU6A 3WZLA 2H17A 3I92A 4J0CA 2J09A 1SVOA 3OT5A 5KKAA 4AWBA 4YLYA 3MHPA 4KX3A 1CY7A 1ZYUA 2KBEA 4C05A 3A6ZA 4B3GA 1ML3A 2CHGA 1U2GC 3HCAA 4Q7KA 5KWEA 3QPVA 1T9GS 4ZT3A 5LDDC 4RGQA 1K6XA 1XJWA 4FLFA 3ZWCA 1I4DD 3FG9A 3K0FB 2H2DA