1SCIA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-acetone-cyanohydrin lyase
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 98
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sciA00
3BF8A 4UFNA 3IIIA 2DHEA 1CUUA 1CQZA 1EK2A 5JAOA 3PE6A 1MTZA 4H35A 5JADA 4FMPA 2GBGA 5LZ9A 4W9RA 4Y2RA 1IMJA 3H17A 3F98A 4INZA 3FYUC 1QZ3A 1VE6A 2WG0A 5EGNA 3OPMA 5AKYA 4QZVA 2BCEA 2OCLA 2W6CX 3V1NA 4LHEA 5A6VA 4G8CA 4DMHA 4B9EA 3ESBA 2OGSA 1MX1A 3R3ZA 3R3VA 3A2MA 2RHWA 5ALFA 4B82A 4LKOA 1MT3A 5LZ2A 3WA7A 2XDWA 4CCWA 2OXEA 1K6EA 3DS8A 4LXHA 3PI6A 3WLAA 1W75A 5CW2A 2HA6A 1A8UA 2XLCA 4EHBA 1QIKA 3ESDA 3Q8WA 1RWQA 3FLBA 5K3CA 4YX9A 1A8QA 1F8UA 3ZI7A 1G4HA 1ZD5A 4MWTA 1K63A 4EA6A 1VZ3A 4ZRDA 1EVQA 5IVIA 2Q0XA 5CT8A 2AJDA 4N8DA 3G9ZA 5BV7A 2H9YA 2J3QA 1RYYA 4RGYA 3UUEA 4CI9A 1O6GA 4OSEA 4FNMA 1P0QA 4K6HA 1UKCA 3AFIA 3TEJA 5ALSA 1W1IA 3G02A 5AKKA 3AZPA 3F97A 1R9MA 3BIWA 2B4KA 2C5GA 1XQXA 5HF6A 3U1TA 4UHBA 3B3QA 3O9MA 1BN7A 1XZKA 5JIBA 2XE4A 4EY7A 3DL7A 2PVSA 2DQZA 3OURA 1CEXA 4J0HA 3VKFA 4C4ZA 3TJMA 3SK0A 4BAZA 4AO7A 3ZLUA 3WKDA 2V98A 4P08A 4DTCA 4W1SA 4PV7A 2WG1A 4K5QA 3C45A 1L7RA 3C6BA 3QPDA 2GBFA 1UOOA 4X94A 1DX4A 3O4JA 3C6ZA 1E8DA 1CUVA 3NWOA 2XMGA 4P92A 2FUKA 1TCBA 4GI1A 5KREA 1QJ4A 5IH7A 3I1IA 2ZYHA 3L1IA 1OXMA 2I03A 3IDAA 1F6WA 3H2IA 5AKEA 3QMWA 3I2GA 2Y2UA 3TRDA 2I3ZA 3H2GA 4X91A 5LZ7A 3ICWA 3RK4A 4WFIA 3AINA 3BIXA 1QIDA 4I4CA 3WKEA 4CCYB 5I9IA 4B7ZA 2I3DA 1BROA 4Q82A 3STYA 5I8PA 1WHSA 2YYSA 4IHAA 2PUHA 3O9VA 5ALLA 2PL5A 3N0TA 2HA2A 5CT5A 5YASA 3QPAA 3ESCA 1IUPA 3I6YA 1VJ5A 2FX5A 2XQJA 1VOTA 5HKAA 3FLEA 3DYIA 3LIPA 4J0DA 2R8BA 4ZGBA 3WWPA 3RARA 1H2XA 3RM3A 3HSSA 3IURA 4UHDA 5AK4A 5AIBA 3H19A 3LIIA 1K4YA 1EX9A 3PDCA 2DCMA 4YASA 3F67A 3HEAA 1GGVA 1SCQA 4FNGA 4BDTA 2QTBA 5JD5A 3DNMA 4KRYA 2WHQA 1UZAA 1CUAA 1HLGA 1TK3A 1J1IA 2WIFA 5KWIA 1L7QA 5A7HA 4CG3A 4DMCA 4V2IA 4WY8A 5ALPA 4JYPA 1UK8A 4PSUA 1Y37A 3KSRA 1EI9A 1X70A 1GXSA 1N1MA 3QM1A 2K2QB 2JIDA 3RKSA 4G9EA 5E2IA 4QDUA 2J3DA 1XZBA 1JKMA 3N2ZB 2P8SA 2XT0A 3WK4A 2VF2A 2WJ6A 4A16A 5CH5A 5D6OA 3JW8A 1RP1A 4GBGA 4RNCA 5AICA 1CUBA 4HVTA 3BJMA 4NS4A 2DR0A 5J3JA 1DU4A 5LZ8A 1B6GA 2CB9A 2VSQA 1I6WA 3VDXA 3WJ1A 2O2GA 3SC2A 4BVJA 4BE9A 1E5TA 4ITVA 1LZLA 1AMNA 3WZMA 4Q3OA 2DQYA 3ANSA 2JGIA 4FDMA 4Y2UA 3FAKA 4X85A 3WKCA 4C89A 5AKHA 5K3FA 2RAUA 2WJ4A 3GUUA 1CRLA 4UBMA 5HZGA 3A6ZA 1LLFA 2WG2A 4M0MA 2VJDA 5JAHA 1DT3A 2QS9A 5EHZA 3O4GA 3WL5A 3W04A 2DFPA 4QWWA 1JJIA 3C6YA 5LKRA 1YA4A 4MXDA 2XUIA 4RE5A 4OYYA 2JGKA 2WFLA 3MUOA 1J06A 3WK8A 4DM7A 4BZZA 4EY4A 4TGLA 1XZMA 3R41A 3HXKA 3WL8A 2QUAA 5LYYA 4PF1A 4RE6A 3IUMA 3I28A 2RHTA 4C4YA 4XIIA 3FVRA 4BRZA 4MEAA 2PKYX 5ALQA 1GPNA 3R3UA 1CUFA 3FSGA 5JZBA 4G8BA 5ALWA 3C70A 4HS9A 1YCDA 5DNWA 2C4HA 3RLIA 4HRXA 1EDBA 3F96A 4QEKA 1ODCA 1GKKA 1TCAA 3S8YA 3E0XA 3ZLVA 2CJPA 3HZOA 4ARAA 2GZSA 5ALEA 5AOBA 5HF5A 3I6ZA 3DCNA 3WWCA 2WQZA 4B9AA 4E11A 2WM2A 3IA2A 1ZOIA 4UBIA 4MWSA 4TPKA 4YK7A 2O2HA 4UFPA 1CUJA 1QIEA 3CXUA 3FCXA 5FLKA 5ALHA 2JGEA 4B6GA 1AUOA 2RONA 2NW6A 3EF3A 4M0EA 4U2EA 4Y2TA 2QM0A 1ZICA 4B84A 1DQYA 5JARA 1E3QA 1QIJA 5DNVA 4NZZA 3W05A 4C4XA 1IUOA 2JGJA 5LP1A 1CFJA 1BCSA 5D3ZA 4W1PA 4C87A 2QZPA 4B80A 3B12A 2DHCA 2YXPX 5A2GA 1LZKA 4AO6A 1CPYA 1ZJ4A 1DTEA 3R3WA 1IUNA 2AJLI 4GHWA 2HA7A 5HCUA 1QO7A 1WPRA 4N8SA 3EQ9A 1XZLA 1ZGBA 3LP5A 5AM4A 2VQ6A 3D2AA 1FFEA 1WB4A 3QZUA 1ZD4A 2JGMA 3C5WP 3E1GA 2G5TA 4QLAA 4PNZA 3ED1A 2WTNA 4H7KA 1E66A 2HDWA 3QITA 1UOQA 4G8DA 1NU6A 1YA8A 2C58A 3DEAA 1CUSA 4JYMA 1XKLA 2BGNA 4X93A 1JMKC 1FFBA 3PFBA 4DNFA 1JI3A 1EINA 1XZJA 4MYSA 3STUA 1IVYA 1TAHA 4DSAA 4D9JA 5AO9A 1XZEA 4XVCA 2XMCA 4Y2SA 5H3HA 1B41A 1QFMA 4MQLA 2HHAA 4XJVA 3FBWA 2WFMA 1LGYA 3IBTA 2IITA 2PSEA 3BDIA 3STVA 2WSLA 5EFZA 2HU8A 4CIBA 4QDXA 2HA5A 2AXEA 4OCZA 2QXUA 1XRPA 1ZIYA 1P0PA 3C87A 1J07A 1XQVA 3G0CA 2EEPA 4GECA 5K5EA 1XRLA 3H2KA 4UFOA 4P9NA 2WJ3A 2OCGA 1C7JA 3PFCA 4X71A 1O6FA 4BAUA 3HI4A 3NUZA 5A7FA 1XRQA 1XQYA 5CTAA 3R40A 1W76A 4U2BA 3C43A 1MNQA 4IO0A 1QONA 5AJHA 2XMZA 1DT5A 1T2NA 3MVEA 3QMMA 5A7GA 3I2JA 3D4LA 1E8MA 1X2BA 3WKBA 3G9UA 5K3EA 3K9BA 3WA6A 3V1KA 2Y6UA 2WIGA 3WIBA 1CUCA 2JBWA 3M81A 4J0JA 3G8YA 2OAEA 5HF8A 4BTLA 4UPDA 5BWBA 2ACEA 5C8ZA 4JEIA 1XLWA 3VJMA 3DYVA 3VVLA 5DNUA 3VXKA 5CT9A 1ZI9A 4HXFB 4BCCA 2QR5A 4FBLA 1K8QA 3B5EA 4GEGA 4Y2XA 3O0DA 1QTIA 3DKKA 1S8OA 4OB8A 1XZAA 2EDCA 3IULA 4X6UA 2FJPA 1CLEA 4F5ZA 4OU5A 1YS2X 4QWMA 3NGMA 5FOQA 4AZ0A 4KACA 1HBJA 3QYJA 5AKGA 3CN7A 5ALNA 5FXMA 1TRHA 2Z5GA 4K6GA 3WZLA 2X8BA 5CRIA 5ALJA 1A8SA 5A62A 2GYUA 4FLEA 1A88A 4BC1A 1Q0RA 4BE4A 2XLBA 3FLAA 2C0QA 2XUKA 3ESAA 4WCVA 2D5LA 5AK5A 4UHEA 5SYMA 4DSZA 2QUBA 1X2EA 1YASA 3STXA 4BAGA 3A2LA 3WL7A 1EH5A 4K2AA 4BATA 1BU8A 2XUJA 1H2ZA 3GFFA 5ALRA 3AILA 4RPCA 1P0IA 4I19A 1CUEA 2WIJA 2WUEA 3DQZA 1A7UA 2WU4A 3HRHA 3AZQA 3H1BA 4G4GA 5DLPA 4YPVA 3ZLTA 3DLTA 5HKBA 5FRDA 3LLCA 4KR0A 2CBGA 1YSCA 4DNOA 4DYHA 4ETWA 2FJ0A 4HZGA 2PPLA 1YB6A 1FFDA 5CURA 4F0JA 3AIMA 3H1AA 2GYVA 1R88A 1TQHA 2LIPA 2BJHA 4JUIA 4TVKA 3BF7A 4N8EA 4HAIA 1W6RA 5C8XA 1G5FA 1THGA 1MU0A 1DX6A 2ZJ6A 3VJLA 4J7AA 1R50A 2GBCA 1LPMA 4B83A 1MX5A 2JGLA 2HADA 2XMQA 1BN6A 4MJ3A 4AQDA 1ODTC 1AGYA 1BS9A 4GWLA 1M33A 1MNAA 5SYNA 4B0PA 3WK9A 4FOLA 3G7NA 3SWWA 4AZ3A 1QIGA 2HRRA 4AMYA 1ACJA 1LBTA 1BCRA 3QPCA 4MQMA 2GZRA 4E15A 2CEKA 4QDTA 3DKRA 4U2CA 2WLSA 1GPKA 1CUHA 4UUQA 5HQ3A 2QMQA 3M3DA 3E4DA 4G1FA 1CUXA 4UBNA 2XMSA 1HKHA 4Y2JA 4QLOA 5ALYA 1MX9A 3CCBA 3H2JA 2OGTA 1VXRA 2G63A 5ALKA 2Z8ZA 4JH0A 1UK9A 3VJKA 2ZVDA 3HABA 5DJ5A 4J3JA 5FKJA 4L3WA 1WCYA 5AI8A 5DYYA 2X5XA 2DSNA 4QDZA 1UK7A 4BC0A 4NMWA 2CMFA 1GPLA 3PICA 5D3KA 1EXWA 3FWHA 4BYMA 1XLVA 4H7HA 4PSDA 3QMVA 5K3BA 1QO9A 4FHZA 2V97A 4DMFA 3FVTA 3EIOA 2AJ8A 2JF0A 1LPSA 2XI4A 4BP8A 3OTQA 2BFNA 4PQEA 1GQRA 3FCYA 1UK6A 4E14A 4MYDA 2WILA 4G4IA 5EI5A 1PFQA 1MJ5A 2Z3ZA 3WWDA 3W9UA 5HF9A 1BRTA 1LPNA 5JATA 5JD6A 3UMJA 1AQLA 3CCCA 4WY5A 2GYWA 5K3FB 2B20A 5ALZA 3WWEA 1ACLA 1XZHA 3HYSA 3DL4A 1EB8A 5DYWA 1BEEA 4O08A 2X76A 2QOEA 1YAJA 1XZDA 5ALMA 4B85A 5KBYA 5E4JA 1ZJ5A 4Q1VA 1R3DA 2PSJA 3P2MA 5C81A 1GKLA 3G0IA 4A5SA 5FUMA 3MUNA 5EIEA 1ISPA 1CQWA 4M0FA 4ARBA 2WFLB 2ES4A 3WKAA 5C7YA 1AKNA 1N5RA 1H2YA 3G0BA 4Q3LA 3HLKA 5A71A 2O7VA 2ZSHA 2XQKA 4XX1A 1FFCA 1K5PA 3OOSA 1BE0A 5CH3A 4AO8A 1MAAA 1MAHA 5AK3A 4LXGA 1LBSA 2XMRA 2WU3A 4Q3KA 3D2BA 3DOIA 1JJFA 4FWBA 4OB7A 1YS1X 2YASA 2XMDA 5ISMA 2QJWA 1THTA 1QIIA 1CUGA 4X90A 1WB6A 2Y1KA 5DWDA 1EA5A 2OPHA 4PSCA 2ROQA 2HA3A 4LIPD 1R1DA 2PSFA 3V1LA 3A70A 1J2EA 3EBLA 2ZYSA 1WOMA 1ORVA 4J0IA 4J03A 2HIHA 1FSSA 5CMLA 1Q0ZA 1HPLA 4H7IA 1QIMA 2V9ZA 4H0CA 3G0DA 3ZPXA 1SCIA 5AH0A 2WIKA 3K6KA 2G5PA 4QDOA 2RGUA 4X95A 2HU7A 3LS2A 5AI6A 4X3CA 2WUFA 2VJBA 2B9VA 3BJRA 5AKZA 2ZJ7A 4FFWA 3KXPA 4IH4A 1CR6A 2RIPA 3CN9A 1SCKA 1EK1A 3GZJA 4X00A 3X3HA 5KWJA 3T52A 3C8HA 4OB6A 2PM8A 1FFAA 5JD4A 5C8VA 2RI6A 1VLQA 2ACKA 4W63A 3G0GA 1UKBA 5HK9A 3Q0TA 1WM1A 4H7DA 1PV1A 2VATA 4UBJA 4CFSA 4P93A 5I7UA 2WIDA 3D5EA 2HM7A 4DNPA 1SOMA 3YASA 4KE6A 3JWEA 2ZYRA 1XROA 3KDAA 2VJAA 1Q84A 3C5VA 5LIPA 3BE8A 5ESRA 4N5IX 2J4FA 3SX4A 2QJRA 2EDAA 5F4ZA 3L1JA 3BXPA 5EHNA 5AIAA 4N5HX 2OG1A 2ZSIA 4G4JA 3E3AA 2O2IA 2HA4A 4PO3X 4FBMA 3AIOA 4OUKX 3R3XA 2HFKA 3TGLA 4ZWNA 4A23A 4MEBA 4OPMA 4B81A 1DQZA 1ZD3A 3STWA 1QTRA 3V1MA 1XZCA 2XB6A 2HL6A 3I2KA 4CG1A 3R3YA 1YB7A 1WPXA 5D7BA 3F8SA 4CG2A 2OQIA 2XUHA 3H0CA 1CUWA 4BCBA 1CV2A 1IZ8A 3PUHA 1YR2A 2D0DA 5T4BA 2BGRA 2WTMA 1U65A 3IB3A 1QIFA 2IX9A 5HK8A 1VZ2A 5BWCA 3STTA 1AX9A 1KEZA 1Z68A 4UHHA 4AN0A 5JALA 3WYDA 3I6MA 2VJCA 4BP9A 1OILA 3PUIA 1R4ZA 4Q05A 2JEYA 3IUQA 2C7BA 2GBIA 4BVLA 2UZ0A 4BB0A 4H18A 1N8SA 2CKMA 5AKIA 5AI0A 5CBKA 1Q83A 5AOAA 4X6XA 2JEZA 4Y2PA 3FOBA 1EDDA 3O95A 5E4TA 1GT6A 4L0CA 5ALIA 1MO2A 2QT9A 4UBKA 1C4XA 5CT4A 2PSHA 5AM0A 2AJCA 2HA0A 1ORWA 4ZXFA 4WFJA 2HU5A 5FPQA 4DIUA 2XMBA 1VKHA 4AMZA 3WYNA 2YH2A 3A2NA 1JT2A 2I78A 3G9TA 4CCYA 3LCRA 1CUDA 4ZI5A 4LYEA 3K2IA 1XZGA 4U2FA 1WB5A 2VAXA 3D2CA 5JAPA 2ZYIA 4NVRA 1QOZA 3FYUA 1MPXA 4HXGA 1UWCA 2H7YA 1QLWA 1IZ7A 2W22A 4KAAA 1DWQA 5CXUA 4CIAA 1ZGCA 3GROA 4JNCA 4EUSA 3HC7A 3I2HA 4BCDA 5CH8A 4X7BA 3QBJA 1NU8A 4Q34A 1KU0A 1AC5A 4EZIA 3ICVA 2WUGA 4HXEB 4L9AA 5DYTA 3S2ZA 4FKBA 2OLEA 4GXNA 3G9XA 5LLSA 5K3DA 2HFJA 5CT6A 3R0VA 4KAFA 1JFRA 1HQDA 3WJ2A 2VA9A 3JYHA 4E46A 3WWOA 1T4MA 4F60A 1CUIA 3KWFA 1USWA 4W1RA 2OAGA 1LPBB 1D07A 5LKAA 3OG9A 3KWJA 2H7XA 3BL8A 3FYUB 3U0VA 2WHRA 1XLUA 1ZI6A 1TIBA 2VEOA 4J0CA 3PF9A 4W1QA 5EIHA 4AB1A 1AZWA 2WHPA 3WL6A 3M82A 2H1IA 4G5XA 1E8NA 3I2FA 4KEAA 2BUCA 1P0MA 5IVDA 2C0PA 5AM1A 5AKXA 3QH4A 4C88A 5AKLA 1CUZA 5AM3A 5AI4A 3H18A 4DGQA 2PX6A 3AUKA 2C5FA 4J0GA 5LZ5A 4AN1A 2VT7A 3WK6A 3L1HA 4QE3A 2XUQA 2VT6A 3EQ8A 2DHDA 2XQGA 2CZQA 4UBOA 3H2HA 2H7CA 4K6KA 1DWPA 1GQSA 2J4CA 4C6HA 4FTWA 4EY8A 5FDFA 4HTAA 1YAHA 4IH9A 4U2DA 1G42A 4I3FA 3OM8A 4BBZA 3AZOA 2PBLA 5CXXA 1U8EA 4ZV7A 1QE3A 6YASA 2XUPA 3O4HA 4UHFA 1SFRA 4OU4A 4H7JA 2OGZA 4QNNA 1TKRA 1CUYA 4U2GA 5AHXA 3V48A 3QVMA 1U4NA 4BZWA 3C6XA 2WHPB 2XQFA 5ALOA 5JAUA 1ZIXA 5AM2A 1CVLA 5IVKA 1VA4A 1LPAB 1F0NA 1ZD2P 4DMKA 3OC0A 2BUAA 1HL7A 4AX4A 5T4HA 3VISA 2ORYA 2ONCA 3GELA 1VA5A 4BDSA 4WJLA 3ZWQA 4WDQA 4EB0A 5IKXA 1WHTA 4HRYA 4WFKA 4X92A 5FP0A 5ALGA 3DOHA 5IVHA 1XQWA 2OCIA 4G9GA 2OQVA 4ZV9A 2V96A 4WDRA 4KE7A 5EHXA 2IIVA 4GW3A 3HJUA 1QGED 3IUJA 5HQ3B 4F21A 5AKJA 3KD2A 4X6YA 3AJAA 3IVMA 2G4LA 3I1YA 3DJYA 1MN6A 1C7IA 1XKTA 2PU5A 4KYVA 3EQ7A 4C01A 4UBLA 1NX9A 4OD0A 4FLMA 2CUTA 5JASA 1EVEA 4DLNA 5HFAA 1EDEA 4GLBA 4EY6A 4KAJA 2QKYA 4FFVA 4H7FA 4H77A 3WK7A 2WUDA 1N5MA 5K3AA 3H04A 5JZ9A 2VAVA 1EB9A 3BDVA 2Z8XA 4IH1A 3D3NA 1ETHA 3HACA 3DD5A 5JZSA 3AIKA 1UT6A 3ANTA 3VVMA 5JYCA 1W52X 4Y2VA 3C8DA 1EHYA 4KE8A 2WKWA 5AOCA 1E89A 4LXIA 2HRQA 4Y7DA 1DINA 3KOOA 2Y2VA 4ROTA 1QFSA 4S0XA 2Z3WA 1DWOA 2PU7A 3WIOA 3GA7A 3T4UA 4UHCA 5E4YA 5EIAA 3D7RA 2XUGA 3M83A 1XRNA 3W9BA 1L7AA 4GDMA 4OYLA 3D59A 3WK5A 4Z49A 1UXOA 5ALUA 1G66A 3ZV7A 4BTVA 2Y6VA 5LZ4A 2OCKA 1JJBA 2BUBA 1R9NA 4XWGA 2XUDA 1QIHA 4X97A 3IUNA 5DTJA 3DDUA 3W06A 4Y9SA 2B61A 2XUOA 4ZREA 3UUFA 1HDEA 2QRUA 1OCEA 7YASA 1UKAA 1JU4A 1FJ2A 3WQHA 5FV4A 3D0KA 3PF8A 1Y7IA 5ALVA 3F9CA 5ALDA 4DNQA 1PJAA 1KU6A 1BEZA 2BAGA 5AI5A 2WFZA 3FYTA 5ALTA 3V9AA 2XQIA 3NOXA 5FPPA 1AURA 1H22A 1LPOA 1TCCA 1XRMA 5DTIA 4H7EA 1F0PA 1GZ7A 1XZIA 1LPPA 1UOPA 5BOVA 5T4EA 3I2IA 4EBBA 2E3JA 5JANA 2QVBA 3FNBA 4Y2YA 3MGAA 1XRRA 2QXTA 2ZJFA 5AK6A 5T4FA 5AM5A 1UFOA 5EHQA 4AXBA 1ZI8A 2AJBA 1JU3A 1LNSA 3W2TA 4BRSA 4KRXA 4PW0A 2VTVA 5ALXA 5HFNA 1Y7HA 2BKLA 2PUJA 1XZFA 1CIJA 4KE9A 1VXOA 4B0OA 4KJXA 4L72A 1XFDA 1JMYA 1ODSA 2XUAA 2JGFA 2PSDA 4QA9A 3O4IA 1SC9A 3BWXA 1H23A 2R11A 3GBSA 5AI9A 3WI7A 4LYDA 4BVKA 2ECFA 5AP9A 3FSGD 4FLFA 1W4LA 2XUFA 3ILSA 4J0KA 4EY5A 1H2WA 1U2EA 1VE7A 4IQ4A 2O7RA 3WMRA 4Y2QA
chains in the Genus database with same CATH superfamily
1ZCBA 4JX9A 1TYCA 2HJGA 2CGEA 1FFWA 1E7QA 3EIXA 3MWDB 2AUMA 1C0PA 4KYIB 1SCBA 1K8YB 2JD1A 2OCYC 3ZIAA 2JAPA 1EG2A 1B1CA 4LF4B 3IPAA 4JXKA 2ADOA 4RGQA 2XGOA 1CQZA 3EVZA 2IT1A 2PWBA 3OWHA 2HSEA 4PRKA 4Q4AA 1ND5A 2COEA 3BMXA 3RGWS 3PE6A 3LA6A 4AJEA 2HQ1A 4RTRA 4I7EA 4Z4FA 1RXEA 2IYWA 1T8RA 3HI6A 1CVRA 4YJ2F 3FPKA 1V7QA 1WCXA 5KTSA 2VPPA 5ITVA 2GBGA 2H85A 4MR9A 5DE3A 4CLXA 3M9LA 4LC1A 4CIVA 4HN2A 3F98A 4INZA 3IPCA 1ZOOA 2ZBRA 1M34B 5I7RA 1K6JA 1Z5WA 2Z95A 4G37A 3TIVA 5FWDA 2HNKA 2FVYA 3OETA 3QUQA 4GC5A 4BRUA 3OFND 3U9LA 2FEWB 4I8DA 4JP1A 3GCWA 2V3VA 5F2OA 3WLJA 1U0EA 2HIMA 4E2FA 3A10A 1K6IA 2W6CX 2YY7A 4N01A 2ZPAA 1ZUWA 4YIKA 3UT5A 4I1RA 5J40A 4W7IA 5LMCA 4BQQA 4L85A 4DIFA 4B9EA 3ESBA 1B2LA 4HAZA 5LXTB 1MX1A 2G8LA 3G2QA 2R00A 3R3ZA 4S1PA 3FHOA 1EFCA 3KC2A 4Y18A 5EVCA 5AUQA 4B82A 3N3AC 5ALFA 1EK5A 3HR4A 3THSA 1RPTA 3FFAA 1N3IA 3C39A 3H13A 1ZNYA 2Q6LA 4IM7A 5AOVA 1FVFA 1HL3A 5F4BA 4EG6A 3WA7A 2F2TA 3K73O 4ZC8A 1QV6A 2FSUA 1WCV1 2EJVA 2F55A 3H6GA 1ZNXA 1KYYA 1QGOA 2PPVA 3DS8A 1W75A 1PL0A 3HGQA 3O2JA 2DT5A 1A8UA 4EWLA 4KPUA 1CY1A 1R6XA 3QFCA 3ODPA 1PX2A 1RJFA 3T9CA 3FUWA 4ZAXA 4C43A 3ZCUA 2N9UA 1NUQA 1W36D 1RYHA 3LKDA 3PHBE 1KQPA 1C7RA 3P9CA 3OQNA 3LBYA 3SQNA 4MVJM 2QVLA 2Q6KA 2QD4A 1GN9A 3TR5A 3ESDA 1C3OA 3EXIA 1PBTA 2VYNA 1R6DA 3ZCQA 4N7RA 3KAPA 4YACA 3N28A 3VKGA 1X1EA 3IODA 1OTHA 3CJQA 1CZLA 1XALA 1Y1KE 3ZI7A 4Q37A 2Z30A 1S8NA 1T8PA 4CQLA 3OTOB 3NHPA 2R5NA 4A8JB 4JFAA 4MA4A 4Q4AB 3EQ2A 1WG8A 1FRFS 3N0WA 1T4GA 4RTLA 2PKEA 1KI9A 1A98A 1BX1A 4MULA 3VYSB 2P2ZA 3ZR4B 4EA6A 1NIPA 3RKRA 4WKGA 4FM9A 2C7PA 1VKJA 2E6UX 3R20A 1C41A 1GZ6A 1P4SA 4JI6B 3NVKI 1COZA 3DOCA 1H5UA 3G1TA 1R6BX 3NYIA 5IVIA 2WQ6A 2AF3C 5CT8A 1SBHA 2Q1YA 3BH6A 3V7NA 2AJDA 3RUAA 1PI3A 3RG2A 4AWAA 3OVMA 3DE1X 2QG6A 4D4JA 3OAAA 3AHCA 2B36A 5EMMA 1P44A 2J3QA 1FXSA 5EOVA 4URWR 3UAOA 3E5MA 5DB4A 3LY5A 3QOXA 3VNUA 4CI9A 8AT1A 2NZXA 1O6GA 3NOQA 1LI5A 1PT8A 3UT5B 2CCKA 3ICPA 4KBGA 4AG6A 5AFSA 1NF3A 1T1IA 1SUWA 1QHEA 4LRXA 3A0UA 3FNQA 4PLFA 1NI4A 1ZRHA 1P4JA 5FHRA 1W9MA 3P45A 4HH1A 1NFQA 3UJCA 3PWZA 4M37A 5EP2A 3TAHA 4MV8A 4QOGA 4Y1RB 5C5IA 2DQKA 3U6KA 1YR7A 2I99A 3P0EA 3ZNNA 4US2R 4AECA 4QOJA 5C52B 2FPUA 2GXSA 2DUJA 3GRCA 4AYXA 5EJ7A 3LW7A 2MR5A 2PH7A 1B7GO 2RBGA 2ZRGA 3DMFA 4LWZA 4TN5A 1MG5A 4DQDA 4N5MA 5GM2A 1UDXA 1UJMA 2P11A 1K86A 3V46A 1CZRA 5HF6A 1WQ1R 3U1TA 4IF6A 3WV5A 4CMAA 3EXEA 2I2XB 3MOGA 3B3QA 3O9MA 3OY2A 3R5KA 5LD2C 4BE7B 1C3OB 4GOMD 2OBBA 4PYLA 1PJLA 3JALA 4PZPA 4CZ2A 5IN4A 4LMAA 4YMSA 1Z36A 1W8DA 3K2BA 3N05A 4HQFA 4R1LA 4EY7A 1IH8A 4QQNA 4RD1A 1GU1A 5LJLA 1UDWA 3K3PA 3A6KA 4U63A 3VKFA 3R4CA 4MZXA 1QH1A 5HTOA 4Z9YA 3NHMA 4Z7NB 4C4ZA 1CR1A 4DA6A 1YZVA 3KBBA 3DZFA 4LHYA 3SK0A 3ZLUA 3K6RA 4AO7A 5CPFA 4Y1GA 3WKDA 2V98A 5LYJF 3UXHA 5EZ6B 4QVKA 5FR1A 2IC5A 1LB1B 1LNQA 3R77A 4NBTA 2V4MA 4ZO6A 3RG8A 4TYYA 1PZMA 2ZI7A 4MRVA 1Y9DA 2D1QA 4AZWA 3C6BA 3LT4A 2XYRA 2X1MA 1NPTO 2LKDA 3CEJA 2OLJA 4ZT4A 2A9PA 1RI4A 2WUWE 1UOOA 2YZ7A 1QVVA 3OTHA 4M1YA 1IN1A 2DWCA 2GCOA 4E32A 2X42A 1I6KA 4G25A 4YJ2B 4UASA 3EIHA 1UF9A 1J97A 1YS9A 2P2NA 1TK2A 3HCAA 4H2DA 4IPTA 4DLWA 4Q1DA 2ZUSA 3ZVNA 4LF5B 2JPDA 4TL8A 2DPGA 5TMBA 2FUKA 1NI4B 2DHRA 1BC5A 1P9RA 2IU3A 4GI1A 3IO5A 1JHXA 3ROPA 4BGIA 2CXTA 5KREA 4M1TA 1QJ4A 2BI4A 3ANXA 2IGBA 4QD3A 3V5NA 3PDWA 1I01A 4GZMA 4GC9A 4PX5A 3S6JA 1DC3A 2QBYB 3B9QA 3ZGVA 4JJ4A 1TO6A 1IN7A 3I76A 4D74A 2I4IA 1XDZA 1Q95A 2O2ZA 4LOJA 3W5SA 2PUVA 3ZE1B 5F52A 1HY3A 3DE3X 4C5CA 4MWBA 1Z3CA 3FOCA 1JHMA 1I7DA 3DP9A 3R3SA 1IZYA 3MAAC 1YRYE 2Y2UA 3ANMA 4WW0A 2I76A 3D3EA 5KX5F 1JHDA 1KQ3A 3CB4A 5DBFA 3OCYA 3RK4A 1E60A 2N46A 2CVPA 3EXEB 3RUDA 3O8CA 2JIOA 2J6CA 4NWIA 4RKYA 3KCQA 3AINA 4WNYA 5CYOA 4QYTA 3JALB 3V8MA 3NDRA 1NRWA 4CDNA 1L7PA 1Z17A 3EBOA 4CCYB 5AW8A 1OWLA 4GI2A 3B53X 1Z56C 2VVTA 4B7ZA 5AVZA 3GUHA 3WLKX 1BROA 1ABBA 3FTCA 2O54A 3AP1A 1HYBA 1P7VA 1VRWA 2WLTA 3PFFA 4NEHB 1DZ3A 1DV2A 1QH1B 3O9VA 3NS7A 4IHAA 3VU0A 5E1DA 3HKEB 2CEAA 1LLDA 3RKUA 4TZTA 1PRYA 1PT6A 5CT5A 4XUCA 3IPRA 3QPAA 4BV3A 5F12A 2CFRA 3ERCA 3ESCA 3TLJA 3KSMA 3EZ9A 1SKYB 5ESXA 1F4PA 1ZA2A 1GA4A 1RQRA 3HXMA 1I7QB 4IOLA 1ZO8A 3HDYA 4JKIA 2JCBA 1HFJA 2P75A 4R81A 3A6FA 5ADVA 2CV0A 1VOTA 4JEMA 1GDHA 1Z6ZA 3SEQA 1VIAA 4TXLA 4WZAE 2EG9A 4HNUA 1EFRA 1Z4KA 3VR6A 2FUG6 4UD2A 5CUQA 4LYJA 4M98A 2DPXA 1TM7E 4MP6A 3WWPA 1YO6A 3HA7A 1H3EA 1JHPA 4UU8A 3S2YA 2FPSA 2XADA 2Y4NA 4N03A 2QL7A 3HSSA 2RAPA 4UHDA 1IB6A 4R2LA 3KLBA 1PZEA 4WASA 3OJFA 5JDCC 2VRWA 1Y5LA 1XCPA 4M76B 3DAFA 1DI0A 3FE2A 4MJLA 1W1WA 1GJRA 2PJDA 3MS2A 5DEIA 3KLPX 3WMGA 4KWEA 4DDWA 1BJRE 1XNJA 1Y5MA 3ELBA 3ENNA 3VPFA 3EG9B 5FBRB 3U48A 4EJMA 3G88A 3HJRA 4QSMA 4ASUA 4YASA 1AGNA 3W9YA 4BO3A 2I54A 5FCDA 3GPIA 1U8ZA 3L7MA 4HWRA 1YMUA 2CYBA 4DHWA 1GGVA 1S7CA 2FFAA 4G0QA 1U9IC 4FGKA 3MF4A 3QSGA 2H2AA 2XEDA 1SCQA 2NX2A 4FNGA 3KBOA 5D3MA 3U49A 1KTVA 2ENWA 1TA0A 1AKUA 1H69A 5TLSA 1HLDA 1P8JA 1IIBA 3EFHA 4BJ6A 3TW4A 1D6MA 3ZYCA 3D8UA 5B1SA 3VU9A 2YNMD 5B30A 1HEIA 3CEAA 2MTBA 3FUXA 4GX2A 4F9FA 4G0VA 3O73A 4OGWA 5KJEA 1YV9A 5KWIA 1ESDA 1FW6A 2VF5X 2WAXA 1L7QA 5A7HA 1D7OA 3EF1A 2JG3A 2FKNA 3KZCA 2WAMA 3EZ7A 4WY8A 5CFQA 3P2KA 2AG5A 4JYPA 2ONJA 4QGSA 4L78A 2PZEA 4WD3A 1Y37A 3AO0B 2J1LA 2Y1GA 1EI9A 1X70A 2Z04A 3KKKA 5K6AC 1GXSA 1D8TA 4FE4A 1Q6ZA 1FLAA 1GNRA 2FZEA 1IHYA 4WXHA 3LT5A 5CCDA 3F5FA 1M1NA 5CJPA 3UY4A 3ZJ4A 2JIDA 4G9EA 3FRIA 5E2IA 5KYXA 2J3DA 4HF7A 1XZBA 5FOVA 3A3OA 2QYSA 3ENVA 5LYJB 4HUTA 2DLNA 2VYCA 1JLSA 3WK4A 3UK1A 5B4TA 2ZSUA 1X42A 1SC1A 1TMKA 3S40A 1XJCA 2EU8A 4D8WA 3JW8A 1IPFA 2PV0A 2CNWA 1WXXA 3MPUA 4E5NA 2RG1A 3D8BA 2IL1A 3C7KA 3LW8A 2O8FA 3IH5A 4JT2A 4IDFA 1R8XA 3GH3A 1T3GA 3KYJB 4MUEA 2Q1WA 3C6KA 1FDRA 2HGZA 3FRJA 3KIPA 5CVCA 3PB3A 1DRUA 1QANA 2V6GA 3THOA 3U39A 3UG6A 2PS0A 2C5HA 2XODA 1JPVA 3Q0IA 2ONZA 1LV7A 1SBTA 2H1FA 2J6HA 1YQ9A 1JQ3A 3CWZA 3DL2A 3NWEA 3BJMA 4G4SO 3GDFA 4IDEA 3E5NA 3CVJA 5FPHA 2HX1A 3A1DA 3AU9A 1PUIA 1MRSA 3EGXA 3EUFA 3QWBA 5LZ8A 4BNDA 1B6GA 4FYKA 4EO7A 4KQMA 1RKUA 2VSQA 3DBHA 4NBKA 4P2GA 2XNCA 5DX0A 4KQ1A 5B3JA 3PXGA 1P7YA 3JZMA 3W1VA 5J5AA 3RADC 4URUR 3SC2A 3J7AC 1YZUA 2B7BA 3SVLA 4BVJA 4CNBA 1J22A 1G9SA 1HE5A 3O7MA 1GEEA 4E5DA 3OE7D 3EGDA 2GDZA 2JAHA 4X8MA 5E9QA 4KMSA 1AMNA 2VJQA 1AMOA 1NV8A 2Q5EA 4Q3OA 4DV3B 1K2WA 1RKQA 4JJAA 3VU9B 1G59A 1TZ2A 1OFHA 3JAKA 3BBPA 1MW8X 2F3UA 1K9SA 4Y2UA 3HMKA 3V8EA 1D0IA 4IQ0A 1UAAA 4X85A 4H1TA 1OXKB 2J3KA 5KX5B 5K3FA 2CXUA 1A7AA 3DEKA 3H8SA 3WV4A 1GGKA 4ZC1A 3CUSA 2VAWA 5KNDD 3B51X 1E0AA 1DT3A 3HPQA 1MB0A 2HK7A 2VHEA 5EHZA 5TR9A 5JHHB 4RZHA 1GXSB 9ATCA 3M6FA 3QVSA 5CLIA 2XA2A 2C9YA 3KL2A 4YS6A 5CEEA 2E5LB 1GZHB 2TECE 5A4IS 4OHVA 3RVKA 4RIFA 2ZAYA 3LU1A 3C6YA 4KQ9A 5I51A 1DMSA 3OU6A 1ICEA 4QU9A 3JSXA 3N8HA 1AT1A 2XUIA 3IIKA 1G8PA 3LCUA 4UVIA 4OYYA 1N36B 4MKIA 2FCRA 1TC1A 1A0OA 3PNKA 4FGZA 3D5QA 1KI4A 2YJGA 4DM7A 4WKNA 3VO9A 3LOUA 3VPHA 4YRIA 4G0WA 2W58A 1X92A 3BFKA 2ZWPA 3GFOA 2Q3FA 4H60A 2GXAA 1BTOA 4GQBA 2JFBA 1I3MA 4L6IA 3VBCA 3H7IA 2XT9A 2QORA 3WGOA 1VCIA 1YMQA 5LYYA 4GLFA 1FY2A 2IPNA 2VO1A 3GK3A 2AV6A 3IUMA 4KQ2A 1Y6QA 4MV6A 4BNDB 4PHTA 5EIBC 4BU1A 2IYQA 1T3ZA 2WNHA 5IWAB 1XRSB 3S28A 3SS7X 1CS4C 3FVRA 4MEAA 1MCZA 2BM9A 3VR1A 4RTJA 3F4KA 1ADCA 2HBYA 3GVIA 5C46F 5K0BA 1XNGA 4PRZA 4QYIB 3R3UA 5CFLA 1CUFA 2B5WA 3H42B 3CF2A 4YRPA 4LY9A 2DBZA 1UL1X 2BFMA 4G8BA 4D3ZA 3AM5A 3H4TA 3IUEA 1XTSA 3DLAA 4Q66C 4F5DA 4DCOA 2FMKA 2X0KA 3L8ZA 3USCS 2VL7A 4IFTA 5EQJB 2O59A 1NFFA 4HS4A 4HS9A 4GRDA 4CN9A 4DLRA 2H17A 3WGLA 4ARZB 2CN1A 4GR9A 2GDJA 2QRHA 3DDWA 1EEXB 4PGMA 4PZEA 2R7MA 4RVSA 1CY4A 1JT9A 1ZC4A 5DNWA 5FTNA 2QIPA 4FI3C 1NMEA 1CDOA 1ODCA 2RGEA 3F96A 3N7TA 5BPFA 4Q3EA 1QP0A 1KYQA 3HO6A 4GM1A 4RL4A 1R0YA 1W2GA 3UB3A 2PZKA 2JFHA 2YRXA 1KMHB 1L0BA 3E0XA 3M89A 4D8XA 4HNTA 5IM5A 1TPZA 2VHXA 1Z7EA 3WNDA 3K8YA 3MAGA 1NBME 4YJFA 2QRVA 4LDRA 4EW6A 4B48A 3G79A 4A2CA 4DQKA 2EL9A 2GZSA 5ALEA 2UAGA 1KDVA 5LWHA 3W4IA 2NZ8A 1BJTA 1VBKA 3NLLA 1RBMA 2HRZA 3OZVA 4E11A 2C3PA 5IT4A 1ENOA 3BERA 5DBEX 5B1HA 2H5LA 4A6XA 1IOVA 2V6JA 1L5YA 3OPNA 3N70A 5ITZA 1CZKA 4S04A 2WWYA 2G83A 1T0JB 2WK1A 2XNHA 4ND8B 4DB4A 4DIBA 1NY5A 1XO1A 3KD3A 5AVKA 3DOFA 1Z0ZA 1UJCA 1WMAA 2HF2A 4O2LA 3C7AA 3PHJA 5E6UB 3CKKA 2C92A 4A0SA 4HB3A 3L6RA 4J43A 2IBSA 3CXUA 3O2SB 4NZOA 5JXIA 5JAQA 2ZYAA 2HK8A 4EI8A 3WGYA 4Z9XA 2WM9B 1PEAA 3HB9A 5B1EA 3CSDA 5HFJA 4R8LA 4MV9A 2PSSA 1AKYA 1O95A 3X1KA 4S1WA 2PGJA 2HT6A 4B6GA 4DQ0A 1PSZA 1AUOA 3FCAA 3QU5A 3LUGA 2RONA 1TVEA 1H6BA 3IBCA 2WPDA 3UBMA 5DW0A 3ROFA 4M0EA 3UWDA 2C98A 3NV7A 3NPMA 3QEMA 1PN3A 3L0ZA 2PRKA 1WCIB 3KVOA 4E0BA 4Y2TA 5CFOA 2V55B 4N49A 2HHCA 4B84A 4BMZA 2FZ4A 4Q9KA 1DQYA 1O9GA 4LJSA 4BQOA 1OLUB 3SYMA 4ANFA 5DTRA 4EHIA 3BCUA 4LBWA 5DM2A 2DM6A 3AHGA 4XDZA 3KT6A 5AXAA 4DA9A 2QQEA 1NKSA 2I55A 1JR4A 5BRNA 1QIJA 1J2TA 2GBLC 4DA0A 1JVSA 3ZGOA 3W05A 1BWPA 1GV0A 1T0IA 4BNYA 2QZJA 3AERA 3OZ7A 4MVYA 4JVNA 2PUEA 3BGDA 4GPIB 5D3ZA 2FUEA 1RZRD 2ECPA 4GF5A 4PTZA 3HFGA 3Q3IA 3R5SA 2QW1A 1E2EA 3NNSA 4B80A 1DIOB 1KFEB 1ZKMA 1F1JA 1JQBA 1HLFA 4KUHA 2DHCA 2P4QA 3H9QA 4MV1A 1F1BA 1N2JA 5HUQA 5IF3A 2JLUA 2M6LA 1R9JA 3A6HA 5ENVA 1LZKA 1E3DA 2I65A 4BV2A 2FLKA 4A2PA 1U81A 1NUAA 1UP4A 3H5RA 5CPBA 3ZOZA 4DQVA 1RZVA 1XVIA 4JB3A 4HFMA 5SZHB 2W5UA 2BSAA 4B4VA 2A0KA 3R3WA 4TX1A 4YAFA 3A4VA 1UZLA 1ZIPA 3AI1A 3C1OA 3S70A 3RQSA 1N34B 1PBNA 2WWHA 4HUJA 2EFHB 3KCNA 1LUAA 1K0FA 4PPYA 2P5TB 4ZD6A 2JK0A 3A9WA 4DV1B 3IQEA 1JECA 3LP5A 3W1WA 1JZSA 4KK4A 1IY1A 4I2NA 1DMRA 4M87A 1GNLA 3WR5A 1QNFA 2W2LA 1FFEA 3A31A 3JZIA 1EDZA 4XVHA 3GFTA 1Q6YA 2Y1WA 4R6XA 1DIRA 4O0MA 2GFHA 1JLRA 3A37A 2XEXA 5KJ6A 3SOPA 1Q0PA 1BE8A 1A2OA 4EDHA 4GH5A 3GIDA 4QLAA 3FOEC 1N7GA 2OBLA 3U4GA 3QU2A 1OBFO 1H0RA 2WTNA 2XDQA 4H7KA 1B0UA 2Z2XA 1FYWA 2HDWA 2FQYA 2X5KO 1OI3A 1ZUD1 2H4JA 3WSVA 2ZTHA 4F86A 2O57A 1NU6A 1YA8A 2C88A 2O8NA 4PFSA 1T5SA 2ZJ3A 4J1NA 1PGQA 1XKLA 1Z33A 2NOAA 3A4NA 4JC5A 4KXWA 3K94A 4LUCA 1HK7A 1IQ0A 1LS1A 3IIMA 3QTTA 4GMFA 3OCCA 4JL8A 3REGA 3TCXB 4IGFA 4WNIA 1EAYA 4ZQBA 2XF2A 4ARVA 2W90A 4B4UA 2PS9A 3TLKA 1IHDA 3AERB 3PYMA 1D1TA 3NNNA 5B57C 5B1YA 3QF4A 1IVYA 2H8GA 2IOHA 2O7SA 2J9FA 4DY6A 3F71A 4OMDA 1DKQA 4DSAA 5TQ2A 4ZCTA 5KHOC 1IZZA 4D9JA 3PGXA 4M21A 3H97A 1MDBA 1PL8A 2IP4A 3BMOA 4NE2A 4B8WA 3DDSA 3AFGA 2X3YA 2QLMA 3D4PA 1YQXA 1A5BB 4LGYA 4AFNA 3L0DA 3C3KA 3E7PA 1UT8A 3QOFA 2GAFA 3GBPA 2Q3LA 1RLMA 4CR6A 5EC8A 4KFUA 4RGVA 4TV9A 3IDFA 2IZZA 1QPGA 4DC0A 1XMOB 3STVA 5DGXA 1QF6A 2WSLA 3BRQA 3LQYA 4V0NA 1ZQ9A 1A27A 1TQ6A 2X9QA 2Q0QA 5I5EA 3H05A 4H3KB 4C0SA 2Q9UA 3V4VB 1II0A 3EZYA 4IIVA 1XDSA 4ZT7A 4C3ZA 4BEWA 4F3NA 4C0LA 5JFGA 4B6EA 9LDBA 4JC4A 5FO1A 1OX4A 4RANA 4W5OA 1ZCJA 3BMQB 3UJPA 2PXXA 1I1HA 4G09A 2BLNA 2CE2X 1YMVA 1J1UA 1ZIYA 3QPUA 2WYWA 1M76A 1Q74A 5EA2A 3TLEA 3CNLA 2HK6A 5H70A 2ZE5A 2SKDA 1JDZA 2O0MA 1ZXBA 3G0CA 3N6RA 2EEPA 3CF6R 5SZIA 4YRNA 4R5HA 3LFUA 4X61A 1FYFA 4KO8A 5LL6P 1T8UA 2QR2A 4BWYA 4JB8A 5MFPA 1TUEA 1Q21A 2BW0A 1B6RA 1N6KA 1SBZA 5ECWA 4YPFA 2WJVA 4GI5A 1D04A 3EUEA 4B32A 4HDKB 1NHWA 4RQBA 5GPBA 1NYTA 3PGJA 2YWCA 2B92A 3KLNA 2OCGA 4LDNA 2DT8A 5JJ5A 1E2MA 2PMDA 3T9DA 1Y4SA 3EXAA 1XT6A 2ECOA 4LJ6A 1A2QA 1CJCA 5JTUA 3LUDA 2AI3A 3LCJA 4BAUA 2WMYA 4XUEA 4AY2A 1OLXB 3NUZA 2WPDD 4JLKA 4OJYA 5A7FA 5BPHA 2J9FB 5CB4A 4JUFA 5TQ2B 1ACMA 4QYWA 3AETA 1PW7A 3BMOB 4MHOA 1BAPA 1XQYA 3BGSA 1N1DA 3K4PA 3KJQA 4LNHA 1NN5A 4TWBA 4TYMA 5ER6A 4RK0A 2IYNA 2WWVD 1P0CA 1ESEA 3AR5A 2VHTA 3VAZA 4ZO8A 3E6AA 4TZ0A 3UN1A 3M8KA 4DBLC 1XB2A 4IO0A 3CLRD 1QONA 4DG8A 1GADO 2QPAA 4EB8A 1X3LA 3IJRA 4ZVRA 4Q4LA 3F7MA 1UANA 3MVEA 3PA8A 2C2XA 2IW1A 3Q5EA 2IUEA 4Y6OA 3VZDA 4QXAA 3D4LA 3REFA 1RAEA 2Y0EA 4KYUA 1J2UA 3I6IA 3HWRA 1JAIA 1G9XA 3TQRA 4JT9A 4J3NA 1AA6A 2NVWA 3G9UA 4PAMA 5TXGA 3K0CC 3KP1A 2UZIR 3KUDA 4F84A 5DX8A 2Y6UA 3PZRA 2WIGA 3B36A 1OX4B 1N2SA 1YDEA 3BRWA 3HU1A 2BFPA 3KL4A 1CUCA 1ZA1A 1USVA 3WIBA 5HRUA 5IJWA 5FADA 4IXMA 4TQUS 5FTKA 4MPPA 4P5EA 1GWNA 4J7UA 5FUBA 3QBEA 5BSTA 3RW9A 5A5DA 2FJUA 4R1MA 3FMOB 4HDQB 1LSUA 4UPDA 5BWBA 1VDMA 5EE5B 2ACEA 3ZI4A 2OEPA 3VJRA 3R76A 3VR6H 1DAMA 1G8KA 3DYVA 3KFVA 3VVLA 1U3TA 3T15A 2FMHA 2X9NA 3ROEA 5DNUA 5JC1A 1CDZA 1U1EA 1VL6A 1V5GA 3VXKA 2H31A 3LNTA 2CMGA 2GPNA 3F6SA 2EJTA 4JIMA 5J5CA 2HSGA 3U4DA 1PG0A 1JNXX 4HR7A 3PUVA 1BGXT 1M0WA 4J07A 2B1GA 1OKKA 4GYJA 5I9TA 5DK6A 1I51A 4HWPA 5K6TA 5MDHA 3W8DA 3QVXA 4HZUA 3CRW1 2ICAA 3LRXA 4DANA 1GSAA 1Y8CA 3QHPA 4BCCA 1K8QA 3G85A 2ZZNA 1DZIA 2EWWA 2WJIA 4U4AA 1IHXA 4EYEA 4Y2XA 4BNJA 1QTIA 5BSFA 1T5BA 3ILVA 4I99A 3NDIA 5IZCC 1KI1A 2XHZA 3I5YA 1RVDA 2EQBA 2F9LA 4U6QA 4JI1B 2QVYX 4IDQA 2EL7A 2HWYA 3NAQA 3AHHA 3L7JA 4LSWA 1U7DA 4BVBA 3HBJA 5BV2P 1YIAA 2JW5A 2IYEA 2XKKA 1XJ5A 3N6XA 4KGVA 1RRMA 4F5ZA 1KORA 4OSOA 1CDDA 5BWLA 3ADDA 2GZHA 2J07A 1JXOA 2HXGA 3NGMA 2VTDA 1E3WA 4H4CA 4L5CA 3V3KA 4YXFA 4YXWD 5JMTA 4NFSA 5CX1A 1GKYA 4AWBA 2HKIA 2P9GA 3TFQA 2ZRKA 1HBJA 2A9QA 4WZBE 3PLAE 1YZGA 4J91A 4E5YA 5K0NA 1TRHA 1X8XA 4PLCA 3COYA 3T95A 4MR8B 4AJNA 5DFAA 4H3VA 1BKSB 5B2FA 1JNYA 1ZEMA 1EUZA 5F76A 3OIFA 2OVBA 4M1OA 5CRIA 4K0KB 2RKWA 1SHUX 3OIGA 3ACCA 3GJZA 1X13A 3KOWA 2W98A 4J16C 1PS9A 4FFMA 4M1KA 2JJ2A 5EE3A 4Z7OB 1PNTA 4D0RA 3AP2A 3CWCA 1C8VB 3IQZA 4L02A 5A62A 2GYUA 1ODIA 4FLEA 4QQ8A 3CIOA 1TT5A 1UKVY 3L82B 3V2HA 4QL3A 4KQGA 5CR9A 4YEDA 3VDRA 1E4OA 1B14A 1V11A 1GILA 2O6HA 2W6IA 2WJZB 2XLBA 3FLAA 1GQFA 4PYIA 3GT7A 4WCVA 5EINA 5HKLA 4HT3B 3GVCA 2I2AA 2OBXA 1XF1A 4IJ6A 2NG1A 4PLTA 1FMTA 5SYMA 2ZWOA 1G21E 2QUBA 2JI8A 3ZD8A 4L95C 4DUGD 4BAGA 4HZUB 3WL7A 1R6UA 4Q4HB 4HRVA 8ABPA 4K2AA 4AF7A 3GRRA 5DI9A 2PE5A 4PYRA 1V5EA 4HHEA 1H2ZA 2QN6A 2DYKA 4PQFA 4BO7A 1M34E 5D5QA 3FSRA 2G7MC 4K6CA 5ALRA 4BMOB 3AILA 4AUKA 4RPCA 1NVVQ 1P0IA 1NBAA 1RYZA 2WU0A 3LQ1A 4TM7A 1QR2A 4QPNA 4X3OA 5FL7D 2WUEA 2WB2A 1D4FA 1FE8A 3PWKA 1S2DA 5TMPA 4YLGA 3FYHA 1BW9A 4UNNA 4H4DA 2BKAA 5HKKA 2OB2A 1R0RE 1WY5A 4H1HA 5I6DA 5KMGA 4ICIA 1A7UA 4TMKA 3H1BA 3P71T 1KY5A 1WAMA 1RBQA 6CHYA 3KAQA 5DLPA 4B46A 2Q3JA 4GR5A 1QF9A 3E27A 4L4UA 1ITZA 3T3PB 2X2OA 3F7NA 1E3WB 2OHFA 1PK7A 2I62A 1G60A 4RMJA 5HKBA 1QK4A 3O6VA 3BGOS 1ORTA 1WKVA 2Q2NA 4UCXA 3PS9A 2IEYA 3EC7A 1YSCA 2OORC 1XX6A 3C1AA 4NDZA 4ZO4A 4EB6B 5KOJB 1DOAA 4KLAA 2FJ0A 5FWXB 2HJSA 1FDOA 1Y3AA 4P36A 4RPHA 3ZU5A 2ODEA 4F3RA 2VWQA 2Z43A 5DPMA 4P53A 5KAMA 3RU7A 4MQFA 4ND1A 4RMGA 4F0JA 5B53A 1FDVA 3EZXA 1HQYE 1IK6A 4KB5A 3UJAA 3H1AA 3U44A 1E5VA 1DDIA 1WF6A 2GYVA 2R6CA 1LC3A 2YRWA 3NYQA 1ZHFA 1T1JA 1TT5B 5CDGA 2ZYGA 3CB2A 2Q6VA 3FPCA 4Z51A 1E9EA 1Y5NA 4FCWA 4OHKA 2JANA 1GN8A 1S3IA 4TVKA 3JXEA 2QRLA 5BWOA 4JI4B 3O8OB 3PUXA 1L5RA 2OILA 2OSVA 3IR6A 4N8EA 4RJIA 1P72A 5AHKA 3QKWA 4I50A 1ZH2A 3VDQA 4DY4A 1J0DA 3GJ6A 1JG3A 4MJXA 3ROMA 3ZBUA 3R2JA 1RIIA 2A9RA 1THGA 1Y4AE 2NO6A 2FEAA 2YQ4A 1Z12A 1F9AA 2ZETA 3KYIB 4LRUA 5H1YA 4C6TA 1MU0A 1DX6A 4JBIA 4R31A 4XD2A 3UT6A 4PZYA 2EP5A 2AWOA 2J67A 2GCIA 1IVNA 3GN2A 1HYHA 4TXJA 1D8AA 4G5RA 1F7UA 2GBCA 2FRXA 2AD1A 1LPMA 4KO4S 3I72A 1BW9B 3S1AA 4OH1A 2JGLA 3ULKA 2RGGA 1Q91A 3DAPA 2XMQA 3UJ8A 1BN6A 3SLKA 5KMGB 1A8IA 1T1SA 1QLHA 2GEKA 3MAJA 5FO0A 5LFAA 3MN1A 2AOVA 3BWYA 3RF7A 4ZPJA 1TE2A 5SYNA 4B0PA 4B7AA 4N3AA 4CR7A 3AXSA 2X9LA 3QVLA 5A3QA 5J4KA 5KHAA 2DFTA 3PGMA 2E89A 5KTPA 3KKMA 3D4BA 3DCYA 1KXJA 4H08A 2HRRA 4AVYA 3LZ6A 4AMYA 5JROA 2LGJA 1KI8A 1X3SA 3QPCA 2V6MA 1QTQA 1K1EA 2ZUTA 4MQMA 2GZRA 1G7TA 4E15A 4OTZA 1OI2A 2DBVO 2H6EA 4EVSA 4NJMA 4OL0A 1J24A 4KIWA 2CCJA 3GJQA 2HN9A 3OX3A 3UATA 1HFKA 5I9MA 2WLSA 3F74A 4M36A 4O1IA 1CUHA 1FB5A 2DUNA 3QJYA 5HQ3A 8ATCA 1KZGB 5DMXA 1CJSA 3OUUA 3TVTA 3N86A 1HNZB 1YZLA 3LDFA 2XVZA 1A96A 3U44B 4UBNA 4KDRA 1L5GB 1HKHA 2YS6A 1YC5A 4IJKA 2YXBA 2WSSA 3ZS8A 3AIIA 4BKMA 1YL7A 4Y0VA 1M6VA 2B82A 3WGNA 1UZUA 3OTIA 1KGSA 2QTFA 1VPDA 5P8WA 4B3SB 2AZTA 1M8GA 3EVBA 3G5AA 2R6DA 4MDHA 4YUXA 6ABPA 1ZBDA 4I1UA 3GO4A 4MLCA 4P84A 1J21A 2JLQA 3SXPA 2OGTA 4EECA 4ND6A 4TTTS 4PAGA 1HGXA 3AYZB 2R8EA 5T8KA 1CRWG 1UK9A 3AUYA 3RGGA 2J0UA 2ZVDA 3M3HA 1N1GA 4U6SA 1FNMA 2F3TA 4BEBA 3FPFA 1G20A 4J3JA 3OZAA 4RX1A 5DJ5A 3M33A 5FKJA 2J7PA 8OHMA 1ID8A 3IHWA 4K3UA 3SE7A 1Q17A 1WKCA 4BO1A 3NVMB 2Y0DA 4BLPA 1YU9A 3QFTA 1W36C 1C3JA 3CH7A 4WOCA 3NHFA 5K4GA 2DSNA 2QLLA 3MK31 1DTWA 3P1JA 4JLSA 4NMWA 3L77A 2QP9X 4PYNA 4DCCA 3TLCA 2NVUA 5CM9C 1EESA 1QWSA 4JC0A 1Z6AA 1GPLA 1LBIA 3PICA 1ZW1A 2CLHB 5C5EA 2OQRA 2VLIA 4IFBA 2NZWA 4FYWA 4KJZA 5D3KA 1EXWA 1L7MA 1WMBA 3DAHA 2J5BA 3O9ZA 1XAGA 4FDAA 4QECA 4WLOA 3ZVLA 1JDVA 2CJXA 4FXPA 2R0QC 3RVJA 4V0SA 3OIUA 1XLVA 4H7HA 1N5JA 1GUAA 4KNWA 4PSDA 4WGGA 2DX7A 4UHJA 2CF5A 1U8YA 2Y76A 3UHJA 2QF7A 3W2HA 3ZDRA 1V1JA 2J3JA 1W88B 1SURA 4FHZA 4AUEA 1U5CA 2ZYVX 1XK7A 4AZVA 3EIOA 1WBDA 1WZIA 5HIKA 2ZB7A 1T1GA 3N2YA 3B2EA 2JF0A 3EIFA 5C4GB 4AX8A 2RGXA 4Z9AA 1LPSA 2QG4A 2W2OA 1OB5A 3R75A 2ZS9A 1ZGZA 4MPRA 4CM6A 3X2FA 3MB5A 2ZVJA 5FI0B 3H3FA 1U2SA 1M6VB 2OK7A 5KAPA 4QPJC 4WESB 3NBXX 3D6NB 3FGNA 2BFEA 4M99A 1WEKA 1KDYA 4EO9A 1YQQA 3O91A 2VDVE 2UZAA 9MHTA 4LE1A 5JNRA 4Y9UA 3TR6A 1SM4A 4BFWA 3E4CA 1SKYE 5A05A 3DD1A 1Y80A 2PT5A 3WO1A 1BFUA 2WSIA 5A6SA 2ANCA 3R44A 2J0UB 4UEWA 3WWDA 3AGPA 3IVRA 3I5AA 3IDOA 2ERYA 2DLCX 1AQYA 3BIJA 3CRNA 3GPBA 4Z3DA 5JATA 1Y89A 2OWDA 3S5JA 2W4IA 3B7GA 5JD6A 5HXAA 1QAOA 1QPZA 4OBWA 3AUAA 3BE6A 3ND6A 1AQJA 1GYPA 2DEUA 1P6QA 3W2IA 2CNNA 3CCCA 4OX9Y 4WY5A 1DTWB 1REQB 4YRBA 2GYWA 3X1ZA 1TJ4A 2N75A 4QBTA 1SVNA 2ZTVA 3IQIX 5JOQA 1G5RA 2Q45A 1VIMA 3IHKA 1WP9A 2FPIB 4IVPA 3A3PA 3RRFA 2VG8A 1A5SB 1DRKA 1GAJA 2VAPA 2FWBA 1Y7TA 2R1ZA 4GRIA 4I1SA 5C5DA 4O8CA 1YI0A 3RS3A 5KBYA 3VU8A 3QVJA 1DLJA 3L4KA 1PGPA 1EWTA 1YI1A 4FFBA 3KZOA 1P2TA 1J2JA 3PPWA 2VUIB 1ISPA 2ENUA 2P90A 2F3QA 1JLLA 3V9PA 1NJ2A 4CMGA 4E09A 2JH8A 4LNUB 3AFNA 1YONA 5CBPA 4YFVA 1UDCA 4UZFA 2OGUA 4WH0A 2BMEA 3GRPA 3QOYA 3MHPA 3ADKA 5FFFA 2I7XA 4O25A 2JHAA 3G0BA 3PUJA 3A04A 1KJJA 1NR7A 3GLGA 3C3WA 4QVIA 5IKEA 1U0TA 2R6HA 2QN7A 2Q1XA 3LHDA 5HGXA 2ODQA 1FFCA 1B2RA 1A5TA 1AS3A 5BWNA 3TIFA 2QUJA 3VR2D 3V4SA 1Z4PX 1K5PA 2BFEB 3MRVA 1BE0A 3O75A 3QUAA 3CINA 4OL9A 1N33B 2NGRA 2I2FA 1MAAA 5FNVF 4F12A 1P45A 5C7LO 1MAHA 1F0YA 1YQWA 3Q0EA 3QX9A 4LKRA 5AJWA 2ECKA 4CRWB 1W35A 3KSBC 2A0XA 5A6SB 4DIKA 1ML4A 2XMRA 2WU3A 3NWJA 4BFZA 1G38A 1ZNQO 2ZYTX 1XE3A 3ITNA 5LIRA 3T5TA 1NNI1 2ZRFA 3UF0A 3FTDA 2HLDA 1UXJA 3D2BA 3DOIA 4Q3KA 4X64B 4BJHB 3DZBA 3C4VA 1YS1X 4FN5A 1W96A 1AF4A 1JQAA 2C8JA 3KK0A 1LJUA 3L7AA 3UTDA 1G5TA 4AMUA 4AP6A 5ISMA 1FMFA 1YDHA 3AHEA 3G2KA 2A0WA 1THTA 4US1R 3IERA 2JVJA 4M7WA 4X90A 5BSEA 3SS8A 2JIZD 3IQFA 1II8B 1B3RA 4RFSA 3TRHA 3DPSA 3L8MA 4OQFA 5MHTA 1SG9A 4O29A 3S2GA 4HQ6A 4M1EA 4O02B 3TTUA 4BX2A 1V4NA 5AW0A 1R1DA 4NXMB 2PSFA 4LFAB 3JQEA 4R9UC 4KX5A 5B7NA 3GJ3A 4BNHA 2J9YB 2PMKA 2PLAA 3I6QA 2R00C 1JDBB 3CUTA 1A7KA 1SU8A 3GP5A 1L4NA 2VDNB 1OJ7A 2ZJYA 2ZYSA 3MCVA 4HXYA 4W8OA 4G07A 1WOMA 3T7IA 2BJVA 3D0QA 1ORVA 1EGHA 2LRHA 1SU7A 3Q7RA 3C41J 3GEBA 3ZEIA 2XZLA 1D0VA 4MKHA 5JYBA 1I7PA 2QMZA 4CF7A 3GCXA 2HIHA 1Z6QA 1FSSA 4HDMB 3F6YA 1KBQA 3ICQB 2BRUA 3REOA 3TE7A 3DEZA 4KYTA 1FDIA 3RSCA 3E3OA 2EW2A 4AICA 1IOLA 4XX0B 3ZHZA 1HPLA 3ZI0A 1U02A 4LWPA 3CY6A 5TT0A 3QKSB 3ESYA 1XTTA 3FCOA 1K7CA 2CFSA 4S2EA 4UDOA 5EIOA 5I3CA 4F5WA 5CB8A 2V9ZA 5I48A 3SNKA 2EYUA 2GK4A 2PHZA 3G0DA 4IQ8A 3SN6A 1ZESA 5DM0A 3BSYA 2IDJA 4DR6B 3N6VA 4ZXPA 3LX4A 4HNGA 4HX2A 3TLGA 1RRFA 3K6KA 1OD6A 2G5PA 2O2XA 4IRUB 1NATA 4X95A 4L3OA 4XGIA 1TRKA 1DTSA 2EKQA 3GFQA 4MTLA 2QTNA 3H1FA 3N2LA 3Q7QA 5KDOA 3T1TA 2OCDA 3BKWA 1Z7GA 2X4GA 3B6KA 2Z6VA 2C9MA 4X3CA 5KCMA 2WUFA 5J43A 2VJBA 2B9VA 1IONA 4OMUA 1R5BA 2O1XA 2OAP1 3K9CA 4NOJA 4E30A 1L4KA 1OFGA 3CNNA 3KXPA 3U3MA 1CR6A 2RHBA 1VB5A 3FPLA 4BNTA 4NCNA 2VFAA 3PX3A 1EK1A 1KETA 3DOOA 3F78A 4F8YA 1W36B 4ME6A 2RK3A 3UPTA 2C4WA 2X41A 1YK1A 3C8HA 3QLEA 5J9FA 3R7AA 3V42A 3O2NA 3JWGA 3WQSB 4OB6A 4DABA 1KS2A 2PAFA 1NVEA 2YC2C 4RZXA 4JLVA 2UXBB 2G72A 2ZB2A 3JVEA 2EFEB 3K20A 1VB3A 4WLNA 5F1OA 5BSVA 5JSYA 2AOTB 2P9EA 4YMHA 2ACKA 4UE3S 1EGAA 3GMDA 2ATEA 3ZVRA 4BO8A 4I9GA 1T4DA 2JIMA 2R8ZA 4IJMA 5EP4A 1UKBA 1YULA 3H5LA 3OQPA 1NPYA 2YNMC 1J8QA 1TL7C 3CC8A 3GX1A 1VJ0A 1PV1A 4LYYA 2IQ5A 3QJGA 4AULA 1XHEA 2GTPA 3HFJA 1W581 2PGDA 2WIDA 4P98A 3RFUA 3L1VA 3SDBA 5BN4A 1DKLA 1TX4B 2F4NA 2X77A 4C7BA 5AVYA 1G18A 3QXXA 1D0SA 3YASA 3MGBA 1OYVA 1OVGA 1NW4A 3VV3A 2CLFB 1SHJA 1TTQB 3ABIA 1KAEA 3TW8A 4CM9D 1ZM7A 3K32A 3T3HA 3CE9A 4ZTZB 1R10A 1XROA 2B0CA 2BEWA 4YBZA 2KMLA 2DRIA 4GZ6A 1Y3HA 1FP7A 2OV6A 4Y1EA 3E61A 3Q2KA 4CU5A 3IV7A 5JNSA 5L3VA 4YAKA 1M6NA 3FPAA 1VGVA 1QFXA 3EVEA 3TLGB 1RAIA 5FWYA 3SVTA 1B00A 3PQDA 3HA5A 3C8MA 4TXHA 3T9BA 3B60A 3ETEA 1DSSG 2CKDA 2J4FA 3N2NA 1PL6A 3SX4A 2OK8A 2UYYA 3K0AB 5F4ZA 5JJBA 3X1YA 1Z4NA 4PS0A 3I05A 3SJCA 4IVNA 4ZRNA 5FNVB 5CD1A 1EFPA 2FW8A 2P3QA 4B7XA 1KIFA 3SG0A 1CZHA 1TJ5A 2IUTA 1HZZA 4LDZA 3VSEA 1D1QA 2EFGA 4GICA 1KDTA 2YWFA 4OP3A 4ZA2A 5IJXA 2RCYA 1CWUA 4UUAA 4QSHA 3ZWAA 5B2ZA 2ILTA 3DZHA 4Q93A 1QOPB 2J8ZA 1H0KA 2IU6A 3HDHA 3NV9A 5TS3A 5CB4B 4ZWNA 2CFTA 2IYYA 4MEBA 2D4AA 3BZWA 1GFZA 3Q4GA 4NYIR 3K53A 4EQZA 1A04A 1ZD3A 1QTRA 2FWPA 2AFHA 1KI3A 1UPFA 3V1MA 5BQOA 1V8BA 3F6EX 5K0FA 4LXXA 1PS0A 5GINE 3KZMA 3ZV5A 3I2KA 2H52A 4AZSA 1XHLA 3M4NA 5ES3A 2QX8A 4GZ5A 2FR8A 4L8VA 1L5NA 1OFUA 3VO1A 1SA0B 1WPXA 1OXTA 5D7BA 5EJ9A 2VDPB 3H5OA 2O0JA 4P4GA 1F12A 3W5UA 4C4PA 2XUHA 1PX0A 4YECA 3VR3D 4F7WA 1AQIA 1IZ8A 3BSFA 4B74A 1YR2A 4TZKA 1UC4B 1GAEO 1TM1E 5T4BA 3FMIA 2GYYA 1Y3FE 2GRAA 3WLLA 5DBIA 1FTYA 1Q7RA 4RD3A 5CVDA 5LBUA 3RS2A 4E6PA 1A9XA 1P33A 4M9SA 4AS3A 2IX9A 3N75A 3W2FA 5HK8A 1AKQA 2V7GA 4NZNA 4RJTA 4ZGGA 5IDWA 5IHPA 5JRJA 1FQKA 2JH9A 2UDPA 1N0IA 3IP9A 2GLUA 2XNDA 3NM4A 5EESA 3F6CA 3HVIA 4IWXA 4X7MA 2XCOA 1YVEI 4GXRA 4BJ5A 4ZHSA 7REQB 5BXYA 4ZIRA 2D5AA 4IHKA 2PL1A 1DCTA 1E9RA 1N2BA 2V54A 3MTIA 4FOPA 4J4TA 5TGTA 3RF6A 5B5SA 1ZR4A 1FP6A 4UE6A 4GAEA 2DH5A 1MENA 1X8JA 3B2NA 1Z68A 4PHGA 5FWYB 1NR5A 1A9SA 2JARA 4P3NA 2HUPA 4DEVA 4FX2A 3EYWA 1QRTA 3EE6A 3GXOA 3I6MA 1HKUA 1LTHR 4JEHA 4KQWA 3AOEA 1NJ6A 3KKEA 3INTA 4BMYA 2EX4A 2ZSEA 3IAS6 1OILA 3KJGA 4CF5A 4Z7QB 1EFPB 4MW6A 5BW4A 2NZJA 4X7RA 1FYVA 3OHMA 4RKRA 3PNQA 2FN9A 4MYHA 1T9CA 2JEYA 3K5PA 2HMVA 1I13A 2BGTA 3I9V6 1U8UA 1OVMA 2C7BA 2GBIA 3VAYA 4PYMA 1T24A 5CNKA 4HAOA 3JQDA 2UZ0A 1NY6A 1Q0HA 1YS4A 3COWA 1T2VA 1R66A 5JPCA 2FMFA 4G5QA 2GWRA 2Q9CA 3M7IA 3DBOB 1QDLB 3JQFA 3KTAB 2PD4A 3AHJA 1Z5PA 1PFYA 5AKIA 3P32A 3CUVA 1MRNA 2E87A 3HL0A 3IIJA 2C2HA 4MVJP 1Q83A 4QDKA 1Q5PA 4R0VA 4X6XA 1Z2EA 3FOBA 2A1TR 1NNSA 5F5NA 2FN8A 1GL6A 5E4TA 1GT6A 1LJLA 2FSPA 4INPA 4QTZA 2RC6A 1VSVA 1XIVA 2WMOB 1OV6A 2CDBA 3QU4A 1V6CA 3I4FA 4JBHA 5ENZA 3VZRA 2F1HA 4AKSA 4CF4A 3LXMA 1C4XA 2BM0A 4IW3B 4TT3A 4R7ZA 1SZPA 4OBXA 4RIEA 3Q3CA 1A9XB 5DIFA 1ZWKA 1L7BA 4KFSA 3QELA 2HA0A 2ZJBA 3H65A 1T2EA 4PWZA 4TROA 1RFGE 4H0NA 2NM0A 1SUEA 4YHBA 1P81A 5BQFA 4I6GA 5FPQA 1RKXA 1A76A 2HXSA 4DIUA 4ZIRB 5U1PA 2AOUA 4FKMA 2OHXA 2FOLA 2V0CA 5DMHA 5ADWA 1UBHS 1PFVA 3TINA 3FB4A 1QYCA 3T3IA 3I73A 3T1YB 5LA6A 3I01A 5JJIA 2YH2A 3M5WA 3PEEA 3CZ4A 2II6A 2MMCA 1XV5A 3HGTA 2QDKA 4MVJA 4UM7A 4WCFB 2I78A 4DLXA 2NT3A 2WKPA 3IPLA 4JP3A 3P20A 1TAUA 5GONF 4CMHA 2H4FA 2F1IA 1NTOA 1J20A 5KDDA 2WHEA 1E94E 4MPTA 1SQFA 3MD9A 4G0PA 4LECA 1AU9A 2PAAA 4U2FA 3S2UA 1ZXLA 5LOVF 3LMKA 1GUDA 4IYRA 2WOJA 4CFYA 2ZYIA 1QOZA 3L18A 5HG0A 2VDRB 3FPBA 1Y6FA 3DNFA 1RLUA 1UWCA 4OBEA 4DIOA 4FZRA 4YLYA 1GRRA 3KXIA 2N47A 4MGKR 4BFTA 4DLAA 1WA5A 3VH4A 2QYHA 4WECA 2A4KA 4KAAA 1DWQA 2RBEA 3LQ2A 4RFVA 5CXUA 1TUIA 3SQDA 3PPYA 1Q1GA 4CUKA 1ZUNB 1ANKA 2L42A 2VJMA 2I2WA 4JNCA 2IHTA 2F00A 3HC7A 5DBHX 3T4EA 4BCDA 4EUSA 4WVFA 5A5FA 1EUCA 1Z83A 2O4CA 1UIRA 4IMJB 4RHTA 4CT0A 3V4PB 4ALIA 4DBLE 1KFJB 4LEIA 1RS0A 3LDAA 1B8NA 1C4OA 1A4XA 3DFFA 4JBLA 2ZRIA 2RGDA 1J49A 1NU8A 3UGJA 4L6CA 3UGQA 1N8TA 3V8RA 5EXDA 4HLDA 2OBYA 2GA9A 2ZT6A 1TQ4A 2QE6A 1A97A 1OBCA 3PC3A 2Z6UA 4YRQA 3S2ZA 4MPJA 5B3JC 1QHHA 5DGHA 4UNSA 3Q2OA 4ZVVA 1SKMA 2O1WA 3Q9UA 3CZ5A 5H8WA 1SIUA 3QELB 3MJVA 2OO7A 3DLCA 3A6GA 1R0KA 5A03A 1QVRA 2CNOA 2ODAA 3FVVA 4FILA 7MDHA 5KJ1A 1G6KA 2HFJA 2PGLA 4B3JA 3FGOA 3VR4A 5JRDS 1OF1A 1OPRA 3R0VA 1VE5A 4KAFA 1PG5A 2A1IA 4MW9A 4K05A 3ADCA 1E3LA 4R69A 5ELMA 2BP7B 2B4YA 5FL3A 1IN6A 5ENDA 3I9KA 1L4EA 1KR2A 1RYDA 1SUBA 1QE0A 2HAEA 4BGDA 5JBNA 3FUTA 6AT1A 2BE9A 1C30A 1USWA 4PCVA 5I7HA 3RAEC 3T12A 1IG0A 4O59O 1G5PA 2P79A 3GCGA 3S2FA 4C0QC 3FGPA 4L5YA 3T5DA 4FSDA 1ZNWA 2FPRA 4XRGA 1GQOA 1SXJD 3O3MB 4MO2A 5LKAA 1AE1A 1K06A 1E6UA 1X0VA 1YT5A 2ERCA 3OFKA 2H7XA 1P6UA 4NV1A 3WLSA 1W5AA 2CJWB 3JQCA 1LS6A 1RI5A 2YICA 1SGWA 4IGKA 4UM8B 1H2EA 4NYJQ 1IAVA 1CJUC 1RSZA 1TIBA 1K7FB 4JGIA 5GONA 2EYQA 2VEOA 4TQGA 3LCCA 4URXR 2P1RA 2FFHA 3AEUA 4EF6A 3CZCA 3KYDB 5KO2A 2F43B 3TDNA 3L7KA 4TYWA 4Q1CA 2VJMB 4W1QA 2AG6A 2RAFA 3OEYA 3SYNA 3D3JA 1AZWA 1DOHA 1WJGA 4C0BA 2QLFA 4RJKA 1W44A 4MW4A 4F5EA 1N4DA 4YAOA 3UICA 2BSXA 4BBPA 3BD9A 4DVJA 2FYTA 2PGIA 2BUCA 1P0MA 2D00A 4TLMB 3Q9NA 5IVDA 2XCLA 2C0PA 2WF5A 5C7OO 2VQSA 2YZNA 2RHJA 1BIFA 4NESA 4R7GA 3FMFA 2C95A 3URMA 2XTZA 5BR4A 3PHLA 2ZJAA 3QH4A 4TL6A 4C88A 5KINB 3HZZA 3DBVO 4UAJA 4D9HA 2JI7A 5AI4A 4PPGA 4DGQA 3T34A 2HMTA 2JA2A 2RGNA 4EKYA 4TSFD 4EHJA 4B3GA 5CX4A 1Z22A 4E2WA 3SQMA 2VT7A 4OHRA 5DVZA 3OQJA 3F8WA 2VK8A 1T9ZA 1O96A 3QUCA 3V7UA 4Q7JB 1YZFA 2OUKA 4G97A 4Q9HA 3TLMA 5BUSA 3MHTA 2XQGA 4F3TA 4UBOA 1T5LA 5IDXA 3FR8A 3HJNA 3QEKA 4KLCA 5DLDA 5FAXA 5JBIA 1JHZA 3DMRA 3EGEA 4G23A 2PR7A 3G9QA 1EA7A 1KP2A 1UJNA 2ZI5A 4I4LA 1DWPA 2J9XB 1E7RA 3GLHB 2OKCA 2RC5A 2F59A 2J4CA 2ST1A 3OU2A 4XE5A 3OCVA 5DCYA 2UXCB 1EGQA 3CMCO 4HTAA 1N5DA 2QLTA 4RPIA 2B5VA 3C3PA 4AKTA 3ONNA 4AS1A 4Z4EA 1M8KA 1NM5C 2UKDA 1O4VA 5K8JB 1G42A 1N0WA 1OIXA 1R6AA 3AF5A 3PC8A 3B1WA 4RY8A 3U4HA 2GASA 4BBJA 4BBZA 3GAMA 2VHCA 1R37A 3AZOA 1KMQA 1U8EA 2J3LA 1H1DA 1ES9A 1E2NA 3JZFA 1TTHA 4PFKA 1PK8A 3SFTA 5GONB 2P6MA 1DS6A 1L8LA 3B1VA 1LLUA 1TKRA 1PT7A 3QVMA 4MVJD 1GQQA 1PFWA 2O06A 3C7CB 4IXWA 3DNPA 5DIZA 5LOVB 1ZC3A 1T9DA 2XDAA 3C6XA 1OT5A 2XZTA 3CO0S 3CF4A 3E7FA 4YP6A 4DQUA 3FPSA 3G3EA 4FEAA 5G0TA 4BGUA 4MUYA 3BZUA 2FMXA 3LKBA 3PD0A 2XBUA 3U80A 2VUTA 3S2IA 1JTVA 1YJ8A 1ZIXA 1LSOA 2PK3A 2VI5A 5FPYA 2PY6A 3OZXA 1E58A 3H11B 4I1YA 1LQ2A 1RRKA 3IOCA 1K8ZB 4GMDA 5FYDA 4M9CA 4LJ4A 4YREA 5D3QA 3N3BC 4OHOA 1JDSA 4HNQA 4P3OA 5I4BA 5EJAA 2ZB4A 1USUA 4C5AA 1B23P 2FB9A 3RDPA 4UJ5A 1AQNA 3K0BA 4H17A 4GPZA 5T4HA 3LYUA 3HXTA 5FOSA 1VA5A 2IZ5A 2PEZA 3F6RA 1O95C 2VH1A 3GNSA 4R8KA 3AEKA 3WS7A 4BMVA 2W2KA 4EPWA 1OGIA 2LE0A 5I3ZA 5D85A 5ICMA 4EB0A 4V0KA 3KETA 5TVGA 1UKEA 3B89A 3L8FA 3EEFA 1RQNA 3G5MA 5IKXA 1WHTA 3PEWA 4M60A 3BRCA 4C78A 4P7GA 4X92A 1T2AA 1W5SA 1A9RA 3R5FA 4CV3A 2HK9A 4CKXA 3BTOA 3DOHA 4XKJA 3DB1A 5LP6F 1NE2A 1VBFA 4IG4A 3BSSA 1Z6GA 4R83A 2HWWA 2V96A 5JH7F 1ZGAA 4WDRA 5EHXA 2A4MA 5ECYA 2CZGA 2XOEA 3LLUA 4A9AA 3HJUA 3LXUX 5JPIA 2X1VA 1BS2A 2SHKA 2P41A 3IUJA 4EHAA 4CM3A 2ZRJA 3UAWA 5KVVA 2J0SA 1EGMB 2Z1MA 3J80A 4J4HA 5EMLA 3M6WA 1NX6A 4PG7A 4ETNA 4F21A 3WYGA 3AJAA 1GKIA 4BN0A 3I30X 3C6QA 3FNRA 3I1YA 3RU3A 2RBKA 1MN6A 4EELA 4DRYA 5BSGA 4LJAA 4U1RA 1YHNA 1C7IA 1LRKA 4RJ2A 5C1PA 3S0JA 5G1PA 1A5AB 5M04A 2MINA 3DEIA 3EQ7A 1HG0A 2E9SA 1FP4A 2I3BA 2JIQA 4Y6PA 5DXAA 2GM4A 1NRIA 2J45A 4IGIA 5H3CA 4IOJA 4YV2A 2UXDB 4FOTA 2VNAA 1QG0A 2CUTA 3NHUA 4UTZA 3WB9A 1O08A 4JVSB 1DC4A 1E9BA 3OQIA 5FJJA 4DXHA 3PHGA 4LWQA 4OFXA 1J0BA 4YMWA 4YA6A 5FEUA 3NCHA 4IIXA 1GEGA 1VG0B 4H77A 2H2HA 1PGOA 3O38A 5KSOA 4RY0A 4NCIA 1P75A 4ZK6A 1V2GA 1E1QA 3IAAA 4Q21A 4PR3A 4DV0B 1ZHHA 2R9VA 4M22A 5LLTA 3I45A 3D3NA 2O0HA 4KNVA 1MAVA 3CNBA 4Y67A 2O3JA 3TZHA 4LOHA 2BCJQ 4PYOA 2XRFA 1BHSA 4FE7A 2XYQA 5EKUA 4L4YA 5IBQA 1OU4A 3BXZA 3AIKA 3D6MA 3T7KA 1WHTB 4MV4A 3VVMA 2QSJA 5DRYA 5BT9A 4F3CA 4BUZA 5JYCA 2RHRA 3LI2A 2GPJA 2FOIA 4QBIA 3QNMA 5IDVA 2JAXA 3HXLA 3U5ZB 4KE8A 2V7WA 4F5YA 1SC3A 3AY3A 3RO7A 1KEUA 1JSLA 3NR2A 2EJBA 2Q41A 4PYJA 2HRQA 5H9WA 4Y7DA 3O3CA 1R00A 2C00A 1DINA 2W93A 3BULA 5J2UF 2P67A 1WE2A 2Q99A 1Y9EA 3AEQA 2KJQA 4CMBA 2IVFA 2PANA 5TMDA 2IHJA 2PRSA 5TSDA 4LDQA 3GLIA 2W6JA 3OOYA 4L08A 1DDGA 1YWGO 2C82A 2PU7A 2JHCA 5TV2A 5JUWA 2IUSA 5LP6A 4UHCA 1A8HA 3ROKA 3NVDA 4X5OA 1RRCA 3M6XA 2CL5A 1HV8A 1NMQA 3RRYA 3SR0A 5EIAA 1CZNA 5J2TF 2WU8A 3ZDDA 2NO4A 3ZNQA 3IXLA 1O3YA 3MRTA 1L3BA 4BB9A 1FP4B 5IBCA 4MLZA 3KZ1E 1M7BA 1NGSA 3HM9A 2HYIC 2RJOA 3DWEX 1PJZA 4GDMA 2BF4A 1HOXA 1ODFA 3I39X 4PO9A 4YRLA 2OFWA 3ZZ0A 4M49A 2GN2A 4DJJA 3NP7A 2C20A 2O2CA 3IQXA 1E4VA 1RXIA 4E51A 3OQIB 3CVUA 5NLLA 3KEFA 3L07A 4LTNA 1SD1A 4I1IA 3EAFA 4ITUA 4ECEA 3W34A 2QU7A 4UNQA 3VNQA 4BTVA 5IXSA 2XXAA 2Y6VA 4JJIA 2AHOA 2GKOA 5REQA 3HTXA 4HAYA 2OCKA 3I5UA 3PVCA 3R1IA 3PFKA 4JLUA 4A3SA 2Q1UA 1G6HA 2ZBEA 3FWNA 5MN4A 1WZEA 4RKFA 3IUNA 1WXQA 2WM3A 4II2A 5FJIA 5IDQA 1SCJA 2W4MA 4G0UA 3PFIA 4TVOA 4GP7A 3T5GA 1ZN8A 2G7ZA 2SICE 2PUFA 2EW1A 4DGSA 1YJXA 5HRCA 5B6IA 3FWKA 2QRUA 2YJ4A 4GKAA 3RTEA 7YASA 1UKAA 1DDOA 4RJLA 1FSFA 2CXQA 1XF9A 2O07A 2OESA 3HCDA 4MOWA 1P2BA 5KNLA 3EXHB 1DJQA 2Q8NA 3FLMA 3DVLA 1P4AA 5HM6A 1N6NA 3PF8A 1V45E 2VSNA 1V8PA 1Y7IA 3WFIA 5ALVA 2GPTA 1U7OA 3F7OA 4YJGB 1F9EA 4X1OA 3U5TA 3B78A 4L8GA 4XM1A 4Q9JA 2XCTB 3GLIB 4HL6A 3EZGA 1UBUS 2POCA 3ZE2B 3RSHA 1IN5A 2HPVA 2OO3A 3URKA 4BLTA 4RAQA 4WA8A 1QB8A 5LP6B 2IHZA 4NU8X 2ZEJA 2WFZA 4FDUA 4YIHA 1ZH8A 3FYTA 5JH7B 2O8EA 4PHHA 5C37A 5J2UA 1I1QB 1K92A 1XC7A 2WVJA 1LFAA 5THXA 1LPOA 1V37A 4GSLA 4BBAA 5F2KA 1YF3A 4JEUA 3OBIA 5B58C 5FTJA 4RF2A 2BFFA 2FN7A 1XZIA 4PZLA 5AUOB 1C8LA 1LPPA 1XNHA 3EFEA 3L2OB 1UOPA 4XJTA 5BOVA 2IUFA 5HZHA 2XXJA 4F1KA 3O5AA 4LJ5A 3FNIA 5J2TA 4JLAA 2YXLA 1U4SA 3KB8A 3P52A 3PC6A 1O0SA 4XRRA 3WVNA 1XDGA 2BZGA 3DFUA 3FNBA 3H3XA 4AL4A 3ZD6A 3HUEA 1PYDA 3B1KA 3LT1A 5LC1A 5A4KA 3KXKA 1FTGA 2GX6A 4R4JA 2P65A 3O47A 1JF8A 4RVHA 5T4FA 5BSHA 1E1CA 2WMNB 2RK6A 5EHQA 4HLUA 3WYBA 2M1XA 1FF9A 5JCOA 4BNKA 3DM5A 1MABA 1NMXA 2QL6A