1SCIA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 98
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sciA00
4FNGA 4AB1A 4ARAA 4C89A 1A88A 5CH5A 2QR5A 1VKHA 5FPPA 5EGNA 1WHSA 3K2IA 5ALRA 5BV7A 1SC9A 1JU4A 1F6WA 1EX9A 1ORVA 2BUCA 3W9UA 3FYTA 1XRRA 1E66A 2VQ6A 1MU0A 3TEJA 2OPHA 4H7FA 5HFAA 1DWPA 1S8OA 2WG1A 5K3FA 2GBFA 1UK7A 3E3AA 3D59A 4U2DA 3CN7A 1A8UA 3ANSA 2HA6A 2J3QA 3JWEA 3FOBA 5HFNA 1ODTC 4HS9A 2RGUA 3G9XA 1ODCA 5JZBA 1XQVA 1A8SA 5AHXA 1XZKA 5FP0A 1QO7A 2GZSA 2G63A 3FVRA 2XMGA 3TJMA 4QE3A 1H2YA 2ZJ7A 2I3ZA 4G8CA 4LIPD 1ETHA 2FUKA 2JEYA 5CT4A 4OCZA 5E4YA 3O0DA 3L1IA 5J3JA 1QONA 4X94A 2WTMA 1CLEA 5HF9A 2WSLA 3ZLUA 1RWQA 3VJLA 3A2MA 3STTA 5ALWA 5A62A 4KE9A 1LPAB 2XUGA 2O2IA 1XROA 5DYTA 5FUMA 1MNQA 1LLFA 3STYA 4Y2PA 4HXEB 4UHCA 3BIXA 4JYMA 3FWHA 1W75A 3SK0A 3R0VA 1SOMA 2WHQA 3QPCA 5DYYA 3V1NA 4LXIA 1FSSA 2WFLA 4Z49A 1OCEA 5AKZA 1QFMA 2VTVA 4NMWA 4ZRDA 5CT8A 4BAGA 1E8DA 1VA4A 3AZPA 4UBMA 1JJIA 4ETWA 4JYPA 4BAZA 5CXXA 3DL7A 2XUAA 4AO6A 4Q34A 2WIGA 4AMYA 1TAHA 1H22A 5FKJA 3OG9A 4E15A 4G9EA 3WLAA 1OILA 4MQLA 1L7RA 1VZ2A 5D3ZA 5ESRA 4ZREA 4B85A 1JJFA 3K9BA 1UFOA 3WL8A 1BN6A 2OCGA 3IBTA 3T4UA 2OAGA 5T4BA 4KAJA 4MQMA 4IH4A 4W1PA 2HDWA 5AKEA 4B84A 1ZI8A 1UOOA 2E3JA 2XMCA 4AQDA 1HL7A 1VOTA 2ZYSA 2CBGA 5ALPA 3VXKA 1QE3A 2QS9A 5FDFA 2HFKA 4EY8A 5JAHA 3BDVA 3UMJA 4GXNA 5A7HA 3SC2A 3DLTA 1B41A 4HAIA 1ZI9A 5DNUA 3I6ZA 3UUFA 4QWMA 4B6GA 2PUHA 4KRXA 5DYWA 4DYHA 5A2GA 2Y6UA 3CCBA 1C7JA 1U65A 1LPPA 3D2CA 3QMVA 2G4LA 3ZI7A 3JW8A 5ALXA 3ESBA 2WKWA 4WY5A 4DMHA 1B6GA 5HZGA 2V97A 2VT6A 4OSEA 2VATA 4GBGA 1EA5A 5AIAA 4E14A 4PNZA 1H2ZA 2WLSA 5K3BA 2Y2VA 5HKAA 1E8NA 3HYSA 4LKOA 5ISMA 3U1TA 1A7UA 3H2HA 5A7GA 1TKRA 3ESDA 4N8DA 3WK6A 1CV2A 3BIWA 4FWBA 1DQZA 3D2AA 2ZYIA 3WKCA 1G42A 2HA3A 1K5PA 3KDAA 1J1IA 4WDRA 2DQYA 4UBOA 3I6MA 4PO3X 5C81A 4IHAA 4DMKA 3G8YA 3X3HA 4BDTA 1P0PA 3IA2A 6YASA 4A5SA 5IVIA 1YB7A 2AJDA 3I2FA 3F67A 4ROTA 1EHYA 4PQEA 4BATA 4B9AA 5JYCA 5AKGA 3H2JA 2XLBA 4J0CA 5LZ5A 1R9MA 5I7UA 1GPLA 4ZWNA 3D5EA 2Y6VA 3GROA 1RYYA 1ZD2P 3M3DA 1ZOIA 5LZ8A 2BKLA 2C7BA 5I8PA 3C6XA 3V1LA 3WZLA 5ALMA 1YB6A 1ZICA 5JATA 4AX4A 3Q8WA 4B83A 1QOZA 2VJCA 2CB9A 5AH0A 1Q0RA 1LPSA 1PJAA 3BWXA 2ZYRA 2Z8XA 3FSGD 1QGED 3BJMA 4H7JA 1QFSA 2C5FA 2WHPB 2XUFA 4J0HA 1GKLA 1HLGA 3DJYA 4RE6A 2VF2A 2YH2A 3T52A 4BVKA 5AKLA 3AILA 1CUGA 4N5IX 1DU4A 1DINA 5CXUA 4Y2RA 2XUOA 1T4MA 5DNVA 2WJ4A 3OC0A 2EEPA 1JKMA 1CUSA 3D3NA 3VJMA 1U4NA 1ODSA 3A2LA 3RLIA 3QZUA 3M83A 4Q05A 2HU8A 3M82A 3PUIA 1TCBA 2C58A 2Q0XA 4OB8A 2XUIA 3RM3A 4MEBA 3ZLVA 3H0CA 2UZ0A 3I1YA 4J0IA 3PF8A 5AOAA 1DQYA 1HKHA 3BL8A 1QLWA 4BRZA 5AM0A 3AZOA 2PU5A 1QIKA 2ZSHA 2WIKA 1BEEA 1WHTA 3C8HA 1P0QA 1XZAA 2AJBA 1W4LA 3I2IA 1XLUA 1AURA 4ITVA 4H7EA 4F60A 3VVLA 4X71A 3ICWA 4MXDA 3CN9A 4EHBA 1BE0A 5AM1A 4KACA 3R3VA 1DT5A 1ZD5A 2B20A 5EHZA 1UT6A 4W9RA 2QKYA 2VJBA 1FFDA 5DTIA 4JH0A 5JALA 3R3WA 2OAEA 3IIIA 1ZJ5A 2XMZA 4UBNA 5AK3A 4L0CA 5AOCA 3ILSA 1U8EA 3W04A 1CRLA 5CH8A 1EINA 3ANTA 3GA7A 2I3DA 3JYHA 4YASA 2PSJA 4BZWA 2ZYHA 4W1QA 4BRSA 4DIUA 4CI9A 5ALGA 4KRYA 2QM0A 4J3JA 2DR0A 4DLNA 5EHXA 4X95A 1GPKA 4OU5A 1UKAA 1IUPA 1BEZA 5AKXA 3W2TA 2C0QA 2EDAA 3FLEA 3KWJA 5HQ3B 2H1IA 3QYJA 1R4ZA 3KXPA 3TGLA 1R1DA 4WJLA 4H35A 2XMDA 5BWCA 4UHEA 1E3QA 3PUHA 1QIFA 5HF5A 4K2AA 4BE9A 4UFNA 1JI3A 2HRQA 3PFCA 4ARBA 2WG2A 5K3FB 5A71A 4B7ZA 1R3DA 3DS8A 5ALYA 3NGMA 3BF8A 3PDCA 3QMMA 1PV1A 1W52X 3R3XA 5JD4A 3L1HA 2QVBA 4C6HA 1DTEA 5HQ3A 1DX6A 1JFRA 1LPNA 4OYLA 3WYDA 2XI4A 2RI6A 1UK6A 2XQJA 1LPMA 3LS2A 1HBJA 3HXKA 4H7IA 5AI6A 3LCRA 4G5XA 4AN1A 2Z3ZA 3IURA 4B80A 3WIOA 2WJ6A 3V1MA 2NW6A 3G0CA 4C87A 1FFBA 1N8SA 2V9ZA 4DNOA 2J4CA 5K3AA 3A6ZA 3KWFA 3G9TA 1CUHA 1UKCA 4AN0A 4U2BA 1U2EA 3STVA 2B61A 2B4KA 2EDCA 1MPXA 2WM2A 1CUIA 5K5EA 1AC5A 2VSQA 3I2KA 3O4IA 1CUAA 4DNFA 1EXWA 4INZA 1LBSA 4W1SA 4WCVA 1WPRA 4F21A 1CIJA 3W9BA 5ALZA 4AO7A 2BAGA 1ZIYA 3I1IA 1F8UA 2XT0A 3O95A 4WFKA 4MWSA 5AKIA 5EIAA 3BDIA 4FFWA 4QDOA 1AKNA 2OXEA 2ONCA 3AIKA 3QM1A 5AJHA 4H7DA 4J03A 4V2IA 4B0PA 4KYVA 3PI6A 3O9VA 7YASA 1XRQA 4EZIA 1F0PA 4HRYA 5JD6A 2QUBA 4CCYB 4PSDA 1EVEA 3WKBA 2WTNA 5ALEA 5ALDA 3HSSA 2WUFA 4QNNA 1R9NA 1CUEA 5AI8A 1XZLA 4U2GA 1ACJA 1UZAA 3WK5A 2LIPA 3WIBA 3G0BA 2XUJA 1MAAA 3F97A 1CVLA 1YAJA 3DKRA 1WB5A 1MX5A 1LZKA 2HADA 2XUDA 2QMQA 2ORYA 4GECA 4HRXA 4QDUA 1XRNA 4MYSA 5AP9A 4YX9A 3W06A 3DEAA 1F0NA 3C6BA 4GI1A 5AI4A 3WJ2A 4BC0A 4ZI5A 1JT2A 4F0JA 1K8QA 1J06A 2GYUA 2O2GA 3N2ZB 2DHCA 1ORWA 1AGYA 2BGRA 4EY4A 3ZWQA 1XZDA 1P0MA 1BS9A 1XQXA 1XZEA 3A2NA 1UXOA 4ZV7A 1UK9A 2BCEA 1NU6A 4MWTA 1GPNA 3BF7A 1ZIXA 5ALSA 4CCYA 1THGA 4WY8A 1SFRA 2HA2A 3HACA 3IDAA 5FOQA 4KE8A 1X2EA 3R3YA 4KE6A 4OPMA 4XJVA 3H2GA 3E1GA 3AUKA 2WFZA 5HKBA 4Q82A 4Q3KA 5ALIA 5JD5A 1THTA 2XMRA 1R88A 1Z68A 1SCKA 2IX9A 4FMPA 5C8VA 5ALQA 4ZXFA 1XZGA 3HJUA 2W22A 1GKKA 4ZGBA 2XUPA 3H04A 3G0DA 2HU7A 3OTQA 2WIDA 1Q84A 5LZ7A 1GGVA 1CUWA 4TPKA 1Q0ZA 4X7BA 3ESAA 4CCWA 2XE4A 1USWA 5AIBA 5LKRA 4XIIA 2JGJA 2R11A 4XVCA 3C6YA 2CMFA 5EHQA 1KU0A 1TCAA 4IH1A 5DTJA 4UHHA 2JIDA 3D2BA 2JGKA 1D07A 4P92A 5K3DA 2WU4A 1H23A 4G8BA 4Y2VA 5ALVA 4KJXA 2QJWA 5HK8A 4J0DA 5EIHA 4IQ4A 4BC1A 1YS1X 2ZJ6A 2H7YA 3G7NA 4H0CA 4B9EA 4LXHA 4IH9A 1PFQA 4JEIA 4U2EA 4KR0A 4Q3OA 4BYMA 4QZVA 1TK3A 1EDDA 1G4HA 4WFJA 2Z5GA 5ALFA 3WA7A 1XLWA 5FV4A 4DMCA 2OG1A 5C8XA 4DMFA 4BE4A 1LZLA 1IZ7A 4EY6A 3AINA 5AI5A 1MJ5A 2AJLI 1QJ4A 2V96A 2HIHA 1XKLA 3C45A 4C4YA 2I03A 4DNPA 5H3HA 5AO9A 2GBCA 3GZJA 1YS2X 4MEAA 2WIFA 1AQLA 4L3WA 1IMJA 4WFIA 5LKAA 2G5PA 4RNCA 3OURA 1O6FA 1XZBA 4CIAA 2AJ8A 5ALHA 3DKKA 2B9VA 2XMQA 3MGAA 5AK6A 2JBWA 2OGSA 3WWPA 2JEZA 5ALUA 1G66A 5HF6A 3F96A 3LLCA 2WUGA 4EY7A 4N8EA 3WWEA 4OB6A 3STWA 2CJPA 4E46A 1CFJA 4Y2QA 2DSNA 2VT7A 4C4ZA 3GBSA 2PSEA 1NX9A 5CW2A 2OCLA 4FLFA 5FPQA 3WJ1A 3FNBA 5LP1A 3QH4A 4AZ3A 2J4FA 1UOQA 1CR6A 4Y2YA 1EK2A 4GHWA 3WL5A 5F4ZA 1WOMA 4AXBA 2PUJA 3HRHA 5AKJA 4U2CA 4FLMA 5JIBA 5SYMA 2VEOA 4UBLA 3H1AA 2FJ0A 4H7HA 2BJHA 3C5WP 3H19A 4W1RA 1QO9A 1IUNA 1OXMA 5FXMA 2GYWA 2HHAA 4HXFB 1XRLA 2JGLA 3D4LA 1LGYA 3EIOA 3H2KA 1DX4A 3H1BA 5BWBA 4QA9A 2QOEA 4QLOA 1UKBA 5LZ4A 5EI5A 3C43A 1YSCA 4GDMA 3I6YA 2BUBA 1GQSA 2XQKA 1EVQA 5ALTA 4QEKA 1KU6A 4UPDA 1BCRA 1E89A 1L7AA 2PBLA 5AICA 1ZJ4A 5LLSA 2GBGA 5HF8A 2I78A 2XQIA 1XZIA 4EY5A 3QITA 1H2XA 1XZCA 5DJ5A 4JUIA 4LXGA 4N5HX 2WQZA 4K5QA 3DOHA 2PPLA 4G9GA 4O08A 1FFCA 4QLAA 2XUKA 4X00A 2C0PA 1CQWA 3QMWA 2CKMA 2PU7A 4J7AA 3IUJA 5JARA 4L9AA 5LYYA 3I2GA 1LPOA 4BTLA 2QRUA 1CUYA 2C5GA 2RHTA 1WM1A 2GYVA 5A7FA 3FCXA 4EB0A 4YK7A 4C01A 4KEAA 4UHBA 3VVMA 2AJCA 3NOXA 5ALLA 1WB6A 3G0IA 2O7RA 3I2JA 4YPVA 2YXPX 1BCSA 1A8QA 4P93A 3R3ZA 5FLKA 4RPCA 4RE5A 3VJKA 4K6HA 2QXUA 4UBJA 5CH3A 3EQ8A 4BDSA 3WL6A 4C88A 3FCYA 2WHRA 3EQ9A 1N5MA 2DCMA 3F8SA 2ZSIA 1SCQA 2OCIA 5AM3A 5KWJA 4M0MA 5JAPA 4JNCA 2ACKA 3B3QA 5DWDA 3LP5A 1EDEA 2K2QB 4BCCA 1VXOA 2XDWA 4H77A 4BCBA 5I9IA 2DQZA 2Y2UA 4UUQA 4WDQA 1EB9A 5LZ9A 4J0GA 4X93A 5AKKA 2VA9A 2Y1KA 4TVKA 1E8MA 4C4XA 2X76A 1SCIA 1WB4A 1LNSA 2X5XA 4GEGA 1IUOA 2YASA 3EQ7A 2ZJFA 3G9UA 1EK1A 4KAAA 1J2EA 3P2MA 2WFLB 1QIGA 4K6KA 3M81A 4BVLA 1CUBA 3R40A 2Z3WA 3MUOA 1IZ8A 3R41A 1XQYA 1DWOA 3TRDA 1XRMA 2GBIA 1IVYA 5HK9A 4UHFA 2WUDA 1Q83A 3PE6A 2C4HA 1CEXA 2BGNA 1XZJA 2CEKA 1CUDA 5K3CA 4Y2JA 3V48A 2RIPA 4H7KA 4MJ3A 1VJ5A 2HFJA 2H7XA 3VDXA 2VAVA 1UK8A 3PF9A 5AKHA 2HU5A 4DTCA 1VE7A 3RK4A 3H2IA 4EBBA 1W1IA 4G1FA 3SWWA 1MO2A 1JU3A 2VJDA 1BRTA 2XMSA 5JZ9A 1NU8A 2PM8A 5CTAA 3O4GA 5D3KA 5AKYA 4I19A 4GLBA 1JJBA 3H17A 2PSFA 5IVDA 1I6WA 1MTZA 4NVRA 3EF3A 3WWDA 1XKTA 2WUEA 2HA7A 1T2NA 3FAKA 1ZD3A 1CUVA 1FJ2A 1G5FA 1FFAA 3PFBA 3WK7A 1E5TA 4K6GA 4W63A 4B81A 3O4JA 5JANA 2AXEA 3STXA 4BZZA 2WFMA 3MVEA 4Y2XA 4J0KA 3BE8A 3HI4A 5FRDA 1QTRA 5CT6A 1GXSA 2QJRA 3VKFA 1X70A 5CMLA 2WG0A 1BN7A 3U0VA 3WYNA 1EH5A 3KOOA 3D7RA 1CUZA 5AK4A 4PSUA 3DNMA 3OOSA 4QDTA 2QZPA 4Y7DA 1YA8A 5BOVA 3C70A 2PKYX 4Q3LA 1AMNA 5SYNA 4X6XA 4FDMA 4Y2TA 2FX5A 3DDUA 1BU8A 5E4TA 2OCKA 4BTVA 1RP1A 3NUZA 4AZ0A 3C8DA 4FTWA 2HM7A 1VA5A 1YASA 4FFVA 3WI7A 3FSGA 2OQVA 4DNQA 3S2ZA 3OPMA 4X91A 5A6VA 5IVHA 3BJRA 2PSHA 1TRHA 2RAUA 3WQHA 4Q1VA 4OUKX 4S0XA 4BAUA 3ICVA 1HDEA 2CUTA 3E0XA 2ECFA 3IUQA 1N1MA 1O6GA 1VXRA 4RGYA 5JASA 1JMKC 2PL5A 5DLPA 2CZQA 5AM5A 4UFPA 1GT6A 3LIPA 3NWOA 2HL6A 4Y2UA 2ZVDA 2DHDA 1BROA 2WU3A 2XB6A 5KREA 2ACEA 4HZGA 4IO0A 5T4FA 4N8SA 5CURA 1KEZA 4FOLA 3GELA 5HCUA 3PICA 3DQZA 4OB7A 1TIBA 4FHZA 1ZI6A 3DYIA 4FNMA 1X2BA 4FBMA 5ALJA 4FBLA 2IITA 5E2IA 2WHPA 4PSCA 1CPYA 5K3EA 2V98A 1DWQA 3WK9A 4BB0A 4FKBA 4BBZA 2OLEA 2JGFA 3RARA 2WJ3A 4EUSA 3WK8A 2BFNA 1CUFA 3S8YA 5ALNA 4P08A 3O4HA 2GZRA 1XZMA 3SX4A 4I3FA 3ZV7A 1ACLA 1MNAA 1QIJA 2XMBA 1LPBB 2J3DA 2DHEA 3FLAA 5D6OA 3V1KA 3N0TA 3GFFA 1CUXA 2VJAA 5CT9A 2XUQA 1XQWA 2RHWA 3RKSA 3B12A 5EIEA 4PF1A 4NS4A 4CIBA 1WPXA 1AZWA 5T4EA 4OU4A 2H9YA 5ALKA 4CG2A 4TGLA 5YASA 3IUNA 4PV7A 3DYVA 4X85A 4DSZA 1QTIA 3WA6A 2QXTA 4PW0A 1P0IA 1VE6A 1MX9A 1MX1A 5IKXA 4HVTA 3KSRA 4CG3A 1QIEA 2XLCA 3GUUA 3HLKA 2HA0A 1EDBA 5C7YA 1W76A 1EB8A 2PSDA 4A23A 3BXPA 4M0FA 3I28A 2YYSA 4QDZA 2OQIA 3R3UA 2PX6A 1Y7IA 4M0EA 1QIMA 3WK4A 3G02A 3QPDA 5KBYA 4X3CA 3MUNA 4J0JA 2D0DA 3AIMA 4DGQA 1DT3A 5IVKA 2OGTA 1XRPA 5AOBA 4GW3A 3I2HA 1XZFA 1GZ7A 4LYDA 3FYUC 4BP8A 4LYEA 4MYDA 5T4HA 4G4IA 2HA4A 5CT5A 3CXUA 4U2FA 2QUAA 5E4JA 4KE7A 1L7QA 2OGZA 5AK5A 1H2WA 1K63A 1YCDA 3CCCA 1ZGBA 4L72A 3AIOA 2P8SA 3V9AA 4CFSA 4LHEA 5JAOA 1Y37A 1UOPA 4QWWA 4ZV9A 1FFEA 1R50A 5CBKA 3HEAA 4G8DA 2JGMA 1W6RA 2FJPA 4KAFA 2HA5A 3ZLTA 5KWIA 1XZHA 2X8BA 3G9ZA 1AUOA 1YA4A 4UHDA 3IB3A 3WKAA 4X92A 2PVSA 1J07A 4HTAA 3WKDA 1TQHA 4BCDA 3C5VA 3B5EA 2G5TA 4X90A 3K6KA 5C8ZA 3H18A 1CQZA 3AZQA 1QIHA 3QBJA 3EBLA 2O7VA 2O2HA 3LIIA 3FBWA 4BVJA 2WILA 2XUHA 3HABA 5JAUA 1M33A 3IUMA 1HQDA 2JGEA 1CUUA 3FYUA 2D5LA 3WKEA 1QIDA 4AMZA 2DFPA 1QZ3A 3STUA 1XLVA 4DM7A 4UBIA 1ZGCA 1K4YA 1VLQA 4GWLA 4UFOA 3C87A 3OM8A 1GQRA 5IH7A 4P9NA 3AJAA 3AFIA 3DL4A 4DSAA 4AO8A 3E4DA 4E11A 3F9CA 4I4CA 3QVMA 2JF0A 4OYYA 2R8BA 3WZMA 3UUEA 4UBKA 4B0OA 3G0GA 1C7IA 1YR2A 1JMYA 3KD2A 1QIIA 2QT9A 5D7BA 4BP9A 1K6EA 3L1JA 4Y9SA 1HPLA 2RONA 1ISPA 3WWOA 4XX1A 2WIJA 4B82A 3FLBA 2W6CX 5EFZA 3WWCA 4FLEA 1Y7HA 3VISA 2QTBA 5ALOA 5AI9A 5EHNA 3FYUB 2HRRA 1ZD4A 2ES4A 2IIVA 1EI9A 3IULA 2BUAA 3DD5A 3ESCA 5LIPA 3WMRA 3IVMA 3WL7A 3HZOA 3DOIA 4A16A 1AX9A 3W05A 4OD0A 3FVTA 1CUJA 5AM4A 1MAHA 3F98A 4NZZA 4X97A 2Z8ZA 3O9MA 4G4GA 5AI0A 5CRIA 2JGIA 5JZSA 4CG1A 4X6UA 5LZ2A 1LBTA 1CUCA 4QDXA 3DCNA 1UWCA 4EA6A 5AM2A 4XWGA 4H18A 1XFDA 1VZ3A 1C4XA 4F5ZA 3ZPXA 1N5RA 1TCCA 4X6YA 1YAHA 3HC7A 2XQFA 3YASA 4D9JA 4G4JA 2VAXA 3ED1A 5JADA 1MN6A 3C6ZA 3D0KA 5DNWA 1WCYA 3QPAA 1MT3A 2XQGA 4Y2SA 3Q0TA 3A70A 2H7CA 2ROQA 4HXGA
chains in the Genus database with same CATH superfamily
3LD9A 1T1GA 2VNKA 4FNGA 1Y1QA 5FI1B 1KHHA 3QIAA 1OWMA 1I7SB 5DWQA 2GF0A 2QR5A 1IXRC 1VKHA 3KLNA 3P2IA 2IU4A 3BCHA 3PNBA 1B15A 3TCXB 3SJ7A 4JZYA 5A4DA 5BV7A 1JI0A 4DIOA 4ZGGA 1EX9A 5GOZA 4AROA 3N8NA 1FXUA 3EMVA 4I6JA 4DCUA 3W9UA 1GYPA 3T7RA 2FPPA 1K9SA 4EMBA 3QBDA 3ROEA 2A35A 1DJPA 2CMKA 3A1SA 3KVYA 3AHIA 1JW9B 2H4WA 4IGKA 2OPHA 3TEJA 2QT1A 1HDCA 4UXJA 5HFAA 1RD4A 3TQTA 4RDCA 5BN4A 1PJLA 4DV2B 2GEJA 4PAOA 4PIVA 4IHKA 4DYDA 5IZ4A 3CW9A 1A50B 3E3AA 3VTKA 3CLKA 2OQ2A 3REFA 4PRKA 3F3KA 4FM9A 5EJIA 1RZRA 4QUJA 3V1TC 3ANSA 2HSGA 3AMVA 4DJFC 4BFTA 2W37A 4DKXA 4IV5A 1EE1A 2Y0PA 3FOBA 3KOMA 4QAQA 5HFNA 3HJHA 1ODTC 3QFSA 3EK2A 2BKAA 4KNVA 3X1ZA 3I62A 2D00A 2Q4OA 1NFFA 1OZFA 1J97A 3EAGA 2OENG 3EW9A 3K73O 5IBPA 4J94A 1YV9A 1GNSA 3ZBUA 3PNOA 3KXLA 4HP8A 2KE5A 3E70C 4M7RA 4PLZA 5AHXA 3ZJYA 2GZDA 4H0FA 3LPNA 1GHTA 1WUHS 1J2JA 2DH6A 2G63A 2Q2WA 3L02A 2BP7B 1DRUA 3Q2KA 1W85A 4I8DA 1C9YA 1SG9A 1H8EA 3OJ0A 2QRMA 1EUYA 4N0EA 2NO4A 1AK2A 1NMSA 4QE3A 3JYLA 1A9SA 3QKSB 3S2GA 3MYRA 1NFQA 2JFNA 5ITZA 4XD2A 1FEZA 1N3LA 2V6MA 1HDXA 4LIPD 1EXVA 1KJZA 3GD5A 2MSEB 3RC8A 2J7PD 2JEYA 4E0BA 1VJGA 1GZHB 4UNSA 2FPSA 4L51A 3P4XA 1WMAA 1SIBE 2D3WA 4R9NA 1WVMA 1BWQA 1ZR2A 2AMFA 5CYPA 3ZS9A 3FJYA 3USCS 1RAFA 3QVGB 1Z2DA 1LWNA 2ZM6B 1L7MA 3T3DA 5J3JA 1UPXA 4CM4A 1D6JA 2JKVA 4X94A 5FPTA 3U44B 1WDLA 2A1IA 1XAGA 4HDKB 2DPHA 1QGAA 4MYRA 4HX5A 1QYVA 1H0KA 1JMVA 1RTTA 3VDMA 5JQGB 4H4DA 5FORA 1JNYA 1RWQA 3EYWA 4EECA 4QIHA 3JV7A 5DSTA 1ISGA 2OSBA 2O1EA 4CN9A 2QZ4A 4F2PA 3NRCA 3PYXA 1KDPA 1XQ9A 2ODAA 5FFFA 5AUNB 3LFHA 1GG8A 2WTEA 3T5CA 3OIWA 4E5DA 1F7VA 3CMMA 4TWBA 3W9SA 5DMHA 5E38A 1GXSB 3CLRC 4CV2A 4H15A 1V7CA 4GX5A 3STYA 2WSSA 1Z8FA 3BVPA 2PE5A 4HXEB 4UHCA 3BIXA 1GTJ1 4PGGA 2HHJA 4U39A 4K3UA 4PN7A 3ZDAA 4UAVA 1SXHA 1W2GA 5DHTA 1S3IA 2GFHA 1XMOB 1W75A 3LOQA 4I2NA 4WXEA 1GZ4A 1SOMA 2VQFB 2FWNA 2NO6A 3NGLA 521PA 2AZ4A 1R8YA 3AI2A 4LXIA 1BWPA 5TPZD 4KYTA 3N76A 5LMUB 2EX0A 3DT9A 1Z15A 1G1MA 1GGEA 1GL9B 2P1RA 3HR8A 4ZQGA 1NVVR 4NPHA 3O1JC 1MOPA 4ZRDA 4ZEWA 3DTVD 4P53A 3RR2A 4GE0A 10MHA 2H9IA 3RT1A 2XVMA 4IHJF 4LQLA 3A04A 1NXQA 3ZI4A 1E8DA 1O0SA 4NCXA 2QAGC 4TRNA 4MTLA 4ZVRA 3C3DA 4RL4A 3NJ4A 1YO6A 2HMSA 2VZEA 3DL7A 4GC9A 3PUWA 3TQSA 4CE6A 5JNWA 2F9MA 2ZWPA 1SJ9A 3NTUA 3WB1A 1DELA 1PG5A 4Q34A 1ZH8A 2PQ0A 3EPPA 4AMYA 3G88A 1TAHA 4JI3B 4JC0A 1OB2A 4GYWA 3OG9A 1W4ZA 2FZVA 1G5IA 2ZSAA 3T5GA 4CMBA 1L7OA 1X80A 2UUOA 5H02A 3UAVA 4CDRA 1I13A 3QE9Y 2QTHA 4DUYB 3LHFA 1A4XA 3ILHA 4FUQA 3BUSA 1Y4UA 1BO6A 2A5YB 4MQLA 3Q15C 4Q02A 5CK5A 4R4JA 3KKNA 1CF2O 3DUFA 2D13A 5D3ZA 4DXDA 3C1OA 4K6CA 4B7AA 3MWKA 1R8SA 1JJFA 5JS7A 2OCGA 1GTMA 4FZJA 1UUFA 1O8BA 3QTBA 1BGVA 1WG8A 2Z98A 3NKFA 3QOYA 5FO0A 1JQLB 3CB2A 3D6VA 5K8JB 4PIPA 1G98A 4WBNF 5BMOA 3X2SA 2H08A 1PEKE 9GPBA 1E9CA 3S8EA 4AJJA 1I5OA 4DIDA 3T5MA 2AYYA 2GN1A 1EYZA 1LLQA 3RGWS 4JI8B 2RJ3A 4MVJP 5F33A 3LX4A 1J9GA 1HL7A 1VOTA 1NVXQ 4OBWA 1QMPA 2CBGA 2ZRCA 3VXKA 4V0MA 4D97A 1P2BA 1QE3A 4L8VA 1NRXA 1CJVC 5CA1A 2QS9A 1ZWLA 1KDOA 3QPWA 1SGWA 4D8VA 1Y3CE 4GOMD 3BJEA 5C3UA 4DF3A 4QM7A 1HSOA 3VNQA 1WRBA 2EJBA 3GZNB 3L7NA 1QQ6A 3W8RA 4IIXA 4Z99A 2BFFB 1R4NA 2HFKA 2UZ1B 221PA 4BNYA 2HRCA 2EZUA 4PG7A 4DQVA 3W4KA 4WSOA 3KXIA 4MCHA 3AF5A 3JALB 1CR1A 4MCAA 3EGEA 5B57C 2FJUA 3BDVA 3LPMA 1AUQA 1RXCA 2CNWD 4MWGA 1PVOA 5KWVA 3DLTA 3KZNA 4FIDA 1CZOA 2I9KA 3T12A 4NS1A 1CDZA 2NV0A 4MINA 1JXOA 3EWAA 3LM8A 4PFSA 2RHGB 4Q3DA 4Z0HO 2YYZA 1NOKA 3VZDA 4I4IA 1ZRSA 2HDHA 2GN9A 1EX1A 1WCIA 4AMGA 4IQ8A 3CO0S 3VGPA 1XVAA 2FHPA 1OXXK 3HDVA 4L4YA 1DCTA 4D5EA 2YJ6A 4DSTA 1XNGA 1ZC3A 2J3EA 2Z9CA 2FR8A 2ZTSA 4G1VA 4MAFA 1I5RA 2IYQA 3CUWA 1JEYB 1TVEA 4JN6B 5SZIA 3CCBA 4DLSA 3ZJUA 1M7GA 2ZYAA 4KBFA 4ZAVA 1KQFA 3VYTB 5ERGB 1UXJA 1MZPA 2BFBB 3II6X 1G8PA 3PXEA 4C20A 1DV2A 2X15A 1D2HA 3GCWA 2J31A 3AF3A 3G17A 3QMVA 4EDFA 3ITKA 5ECWA 3DVAA 5JSQA 5ALXA 3W6OA 4BXOA 5CVCA 1D2EA 3A1DA 2GXQA 1M2VA 3L6EA 5DF1A 4XDYA 1IQUA 1NOIA 2BMDA 1B6GA 3CH5A 1JVNA 1UBEA 2EZ9A 3Q0EA 4UHJA 5LU9A 4OSEA 1UBUS 2HGSA 2O9JA 3AJ9A 2VATA 4YRKA 1HT1E 1RR6A 3BD7A 3O8OA 4RD0A 1JZTA 2C96A 2Y71A 3TNDA 3KAJA 3L8ZA 4RPJA 1VLHA 5JAMA 5KMGB 2GTHA 4PNZA 3MTJA 5KSPA 5KYTA 4N12A 1H2ZA 1VHDA 2OHVA 5KVSA 2WLSA 2PY6A 2CSUA 1T5TA 3E9CA 2H3EA 4W8HA 1V39A 2FGJA 4O33A 4UXIA 4F1WA 5B3LA 1VPVA 1J0CA 1E79D 1I3MA 3JX9A 3HYSA 2D1RA 1I3CA 2V8BA 4KIWA 2VA8A 2DYKA 3ISTA 3LVBA 3H2HA 3MGBA 1JEAA 3ZCTA 1DGQA 1NL3A 1P9WA 4XW2A 4JKYA 4UKDA 2GEDA 3DLAA 2ZQYA 1XHLA 1MVLA 4I55B 2JLYA 3LQ1A 5AXDA 1GGJA 3M6XA 4M9UA 1UDXA 3KKEA 2ODPA 2FFHA 1DAFA 1ZKDA 4KXXA 4PZPA 5EAIA 5CNIA 4OHPA 3TKLA 3DVRX 3LG2A 4OQDA 3N8DA 4AJ4A 1FXWF 2HA3A 2QJTA 3GLRA 4QRHA 1ZM3A 1C3OB 3DQPA 2ZRKA 2IUFA 3MCWA 4HLUA 2WT8A 4G9BA 2AHRA 3B52X 4W5WA 4YJFA 2FWRA 2FSFA 3UW1A 5HNKA 1AKQA 1F9EA 4PO3X 4I5DA 4IHAA 5FOTA 2WP8J 1TUGA 2JI8A 3NHLA 3O8OB 4Z0NA 5BR1A 5IJ9A 1P0PA 4TWJA 3DMNA 4ZOLF 3MWEB 1UCFA 4WGGA 4M6WB 3MJEA 3OF2A 5MHTA 4KITB 5KVCA 1IM8A 1DUIA 4OHZA 3RUCA 1TYDE 1W8DA 5EYPA 4HFJA 1U63A 4QVKA 2XODA 2ZIZA 3MOSA 4LXXA 2V0NA 1NQWA 4ROTA 1UFRA 1AZSC 2CLEB 1E2HA 3KAKA 3K1AA 3D8SA 4BWYA 1M2EA 4B9AA 4UQPA 2PZKA 2RDMA 5JYCA 2ZI5A 2Z08A 4R81A 1PJBA 2IP4A 3CWQA 4DJDC 1R37A 2B37A 1Y80A 3H2JA 4URWR 2XLBA 8OHMA 2B4RO 1I3NA 1G5QA 1R9MA 5TVGA 1LVHA 2OCXA 2Q2VA 4GYKA 2DQ4A 2TSYB 4DJ5X 3FHJA 1SUDA 2XITA 1PQUA 3E7PA 5BQ5A 4MI9A 1JQ5A 3W2FA 3MZ0A 4J16A 2TYSB 3BRWD 4NR0A 1SG6A 2GNOA 4KUEA 4RDIA 4ZT5A 2D8AA 5EJ8A 4XXHA 3M3DA 2WSMA 4G0QA 1GUYA 2Q1SA 4ZHQB 2CVQA 4HB3A 4A0SA 4II2A 4BLOA 1HNWB 1X15A 5A3RA 4GOKA 2I7TA 3LBAA 5E4FA 1PSWA 3U3JA 2C7BA 3L8FA 3DV2A 3FZNA 1SZJG 1K8YB 2V4MA 1PJZA 5EMMA 5I8PA 2GJ9A 4M0PA 5CXSA 4MROA 4CUKA 5JATA 2JAOA 1KFCB 4B83A 4AX4A 3V00A 3FMVA 5I5GA 3EISA 3TAUA 2XCUA 4PXAA 3NYQA 3U7RA 2MR5A 3DOUA 3OY7A 3SDSA 1QOZA 3CURA 1ZCFA 5SY4A 4AVYA 4DMLA 4EJFA 4RANA 1JBEA 1GFIA 1P1BA 1ZMRA 2Z0MA 2G7MC 3KEOA 4MA0A 2I55A 5IAJA 2JGRA 2WRZA 1PYGA 2NO7A 3CNHA 5FEMA 1QFSA 2XUFA 2YDXA 1KQNA 4D82A 5EP4A 1FMJA 2R1ZA 4YECA 4DMRA 1T3SA 1C8VB 4BJ3A 1YOBA 1B6SA 3K5IA 5B12A 5CFLA 4RLQA 4CJXA 1QZXA 4F56A 2HT1A 1SVWA 3ADOA 3BXFA 1GLGA 2QDXA 4CM8A 3J81A 1FIUA 3KJGA 4F4DA 2QL7A 3QWFA 3KZMA 4Q4LA 4LK2A 4XB1A 1HYQA 3BCUA 1E5DA 3T52A 4BX0A 3U16A 1H8HA 3W3ZB 2BFMA 3WV5A 1X0VA 3MB8A 3S2FA 2JZCA 1FRFS 1JTEA 2NX2A 1FNNA 4GKBA 4XTCS 2HLDA 2DRIA 1BMQA 4Y9RA 2NPFA 2O2YA 1V37A 1NVWQ 1XYVA 4D8UA 1X14A 2ZBEA 3CGWA 3GP8A 1DMRA 2RHLA 3JD0A 5SY9A 4FSXA 5M7EA 4HUJA 1CUSA 1TU3A 2RMKA 3M1AA 4Z1MD 3MOIA 2J0QA 3VJMA 4JCOA 5KOYA 2I66A 3FETA 2Y99A 1ODSA 3L1KA 3TBHA 4IWYA 3TK1A 4G0OA 3QZUA 2HXGA 1PI3A 2RH8A 4KWIA 3M82A 4N3NA 4Q05A 3RU9A 4PS0A 3PUIA 2B35A 2EERA 4OFZA 3JS5A 3T7IA 1BFDA 4RULA 1GUAA 4HN2A 2VLBA 2Q0XA 2W2VA 3Q7QA 4OB8A 2XUIA 2W2NA 5ANRB 1WO8A 3ZLVA 4YDQA 1YK0A 4JI5B 4J0IA 5JCJA 5K0LA 3LF2A 3PF8A 4HDNB 2HO5A 1DQYA 3CEAA 4MQFB 4RVNA 1B1CA 5ULLA 1S0UA 3M4NA 4BRZA 2VQ3A 2FW8A 2JFBA 5T57A 3QXGA 2O0MA 2PU5A 3IP8A 2QAGB 3B9BA 5AHWA 2I7CA 2VUIB 4HDCA 3DEFA 2WIKA 1Q0SA 1P1CA 4MVCA 1WHTA 4XRRA 1KC3A 4EHIA 1CZLA 1SA0A 2VXBA 3UYKA 1J39A 1V8PA 5E8RA 2MYNA 3ILYA 1I80A 1TYAE 2Q3DA 2I7VA 2QG4A 3OFVA 3LDGA 3PBKA 4GH5A 4LSWA 1B0ZA 2YMPA 4QQRA 3TG2A 3FPSA 1EJBA 4HQKA 3A7DA 3UA4A 4HDQB 5L51A 1RHKA 1KL7A 3ICWA 1UKYA 4LCEA 4MXDA 3ZXIA 4EFMA 3BFKA 1W581 3CN9A 2DEUA 1RPZA 4MDEA 1P8JA 1M0TA 4L9WA 4NECA 4XCQA 5KPJA 1T9DA 2ZSFA 1DT5A 1IN6A 3QBVA 4ZO4A 4JBWA 1PG0A 3ROPA 4E6EA 1ONBA 4COOA 3LT1A 5EHZA 1HE2A 1UT6A 3I9KA 4JP3A 5DP2A 4HFNA 3MW8A 1YR9A 2VJBA 1KJ8A 4TL7A 4ML3A 4JH0A 3KAPA 2I7XA 3E84A 2NZYA 3AYXB 1K2WA 1WULS 4TTRA 4YALA 1SVOA 2R4TA 4IFIA 1MDBA 3SQWA 4M83A 1KKLA 1WDTA 4A1OA 5CHYA 2IHNA 1ZJ5A 2NO9A 3EIEA 3PGJA 4G97A 1E2DA 3MA0A 3MJHA 2QZSA 3S5JA 4XH9B 1WQ4A 3ILSA 2OCYC 4U02A 5FL7A 4RELA 2VWGA 5EEHA 3UENA 5FTJA 3ISJA 5ERYA 4C0KA 4DM4A 3WGIA 4KI0A 2JFPA 1HMPA 2ZI7A 1NI3A 4LX8A 1WOYA 2FEKA 4MYHA 1QVWA 5HMMA 4BZWA 1ATIA 1C81A 2R84A 2XRMA 4GF5A 3D4IA 3EODA 4R0VA 3RIMA 4KXNA 1EFVB 3GH1A 3N6RA 2ZYHA 1VBMA 3GRVA 3SJZA 4QO8A 2VYCA 1KORA 3RSZA 3MILA 4BRSA 5PGMA 3R9XA 3CF2A 4OBBA 2M1XA 1H0SA 1VPEA 2G1AA 3PKZA 1SUCA 1MQSA 5IM4F 4LF8B 4YACA 1CW2B 3S28A 4F4CA 2AR7A 3I04M 4HQLA 4PQYA 2QWXA 3HKBB 2QM0A 3LRTA 4K9OA 4NMMA 3EZLA 3OU2A 3UAGA 3KUCA 4OQMA 5FWNA 1LDMA 5HR5A 5EKSA 3D6FA 3JPYA 1DDOA 4QTXA 3I52A 1ZVVA 4J3JA 1DG1G 4DLNA 3U7JA 2QLJA 4MR8A 2YWGA 3O8RA 3K92A 3VHRA 1IUPA 1BEZA 1JAZA 1W93A 2IVFA 2E85A 1DTSA 3H5IA 1FQJA 4X54A 1DPGA 1P5JA 4YGYA 4PGAA 2VKTA 5IJ0B 1EFAA 1ZGHA 4Z9FA 4DDWA 4HPXB 4EX7A 5HQ3B 1EGAA 2BFPA 1MENA 3PFNA 4J2HA 3OOWA 2WM8A 2DF8A 2HIMA 4UQLA 4XGIA 3TGLA 2LE0A 3KKMA 4WCDA 3BBPA 3IT1A 5JISA 2H1HA 2ZB2A 3FCAA 4H35A 4HH3C 5FPSA 3BGOS 4UHEA 1XRSB 2H5IA 3WOVA 1SWVA 1G41A 1P9OA 3RVRA 2KHZA 4FE7A 2C7QA 2V1UA 2K2WA 2OILA 2WYHA 2EKZA 3CLSC 1RXUA 3W8FA 4AU1A 2CNDA 4A6EA 1A76A 1JTFA 4RY2A 3ZDFA 1YJBA 2ZRPA 2C57A 3F5SA 3ACBA 3L1VA 4HB2A 3RSHA 4CYMA 1P19A 3E81A 5AW1A 1T1EA 1H94A 5F5NA 4URUR 2R3SA 4ZVNA 5TE9A 2BZ0A 2ATXA 1QHSA 4EI8A 4OJMX 1X13A 1OE0A 1DAMA 5L53A 4PVCA 4WCFB 1SBYA 4BGIA 1R3DA 1Q7CA 2XCRB 3LF1A 3LQFA 2QD3A 2YZMA 1NUTA 2MMGA 3GLIA 3ODPA 3S1AA 1S7GA 2B8EA 4NTZA 4YLEA 4A2WA 4CDNA 2C7VA 1GITA 3U3OA 1KXZA 5M04A 2Q5LA 3SF0A 1LJLA 3LP8A 4JXJA 3NM6B 1YT5A 5EPOA 4HPWA 3MJSA 3FOEC 5DHUA 2AE2A 3Q3JB 1GU0A 4ZKDA 2H2GA 1MG0A 3NNNA 3R3XA 4RGQA 4O4LF 2AOUB 4GUAA 2IS6A 2NXEA 5HZMA 2BELA 4MV0A 1WXIA 3MBOA 1GYQA 1T35A 3B1JA 5HQ3A 2VPIA 2RGEA 1SHTX 1M3SA 1GPUA 3F1LA 4ZCQA 1AIPA 1QHFA 4EMUA 5CGZA 5HIIA 1OGYA 5ED0A 1RWNA 2B6HA 3FFTA 3HWWA 3V5NA 1GGHA 2XQJA 2CLSA 4JLJA 2WJPA 1QR6A 5LP6A 1IIBA 3CEPB 1VGRA 2WWRA 3HXKA 4H7IA 5AI6A 1IXKA 4B3BA 3DLPX 1JXQA 3PRKE 2X7XA 2PYDA 2Z3ZA 3IURA 3PC8C 4B80A 2WJ6A 5LQCA 4LTDA 3PQ5A 4C87A 1G3MA 3GBPA 1U0NA 2FXVA 1FFBA 3VAYA 1ZY2A 3GH3A 4JQCA 5THQA 4IUBS 2V9ZA 3QKRB 4IO1A 4O2AA 4BECA 5CB0A 2ZI6A 3AR5A 5K3AA 4QOGA 1J42A 3M5WA 2VHYA 4RZIA 1PGQA 2ODQA 3UANA 2W6QA 5H7XA 4JENA 3AOEC 5FTMA 3U1BA 3U60B 1KETA 3KJFA 4FT4A 3HO6A 2WF9A 4E03A 1ITZA 3F5DA 3FNFA 4OHKA 4PCLA 3PTLA 2B61A 3BDAA 3V4PB 1FMTA 2VTBA 1MPXA 2WM2A 1W85B 3ELUA 5JCPA 1TK2A 3OZUA 5CYOA 1OH5A 2GUGA 1JHRA 3OD1A 4FI3C 4PTZA 3I2KA 3VC1A 4CMEC 3HJFA 4BLPA 1KARA 2NTJA 2C4UA 2ZSDA 4DNFA 3FDZB 5LB2A 4NU6A 4N01A 2CE7A 4UAGA 4ZT4A 4REOA 2YVUA 2O8FA 1QH1B 4W1SA 3BTUA 4WCVA 5L7TA 3IESA 1L4NA 3NJ8A 4M49A 2ZATA 4F21A 3U56A 1MFZA 3ZR4B 3NANA 2R9VA 3UQYS 1SBNE 5IANA 3ZYCA 3KS9A 5JJ5A 1SEPA 4JLUA 1JVBA 5ALZA 5IUNC 4AO7A 1HI9A 2PVCA 4CTOA 2PX4A 3I1IA 2Z5FA 1J49A 2VK1A 4RWZA 3O95A 3REQA 4CKBB 3KKLA 5F2KA 2PUCA 5AKIA 3HXOA 1YQWA 4LOJA 4CLRA 3WGOA 3OIDA 3OX1A 4IYJA 4ZAYA 4D0SA 4QUHA 3HSKA 2NP6A 3ZXXA 1ZQ9A 4RAQA 1DAOA 2UVPB 3OIFA 4XVQA 1P4RA 5TMBA 4OSOA 1AKNA 2KW5A 3JYOA 2YYAA 3SI7A 1QHNA 3S1SA 2HIGA 2QI9F 2JAWA 1EGMB 3NKVA 3PLAE 1C1DA 5C2JB 2C7PA 5AJHA 2F43B 1NNEA 3LCVB 3MS2A 3OZGA 1YHNA 5EN4A 1KPGA 1WNTA 1VHLA 1T6BY 3H8SA 3DZJA 4KYVA 3OE5A 3PI6A 4D8WA 1QPZA 1NW7A 1XRQA 3AWIA 1U5BB 3B38A 4N6NA 5KYUB 1NONA 1S4QA 2XX3A 3VOSA 4TUYA 3GUHA 4HRYA 4JVMA 3TZKA 1FU4A 3VOAA 2MHCA 3ZW7A 4ALJA 1RC8A 1WBDA 4F7DA 3L92A 2OMKA 4POAA 4CCYB 3OT1A 3PFFA 3W5VA 3ZY5A 3WYGA 3GMTA 1ADBA 1Y33E 5FWXA 3THYB 3VZQA 5DXJA 5ALEA 5FBWB 1AB6A 1JDNA 2ZBGA 2R86A 2VJLA 3EA0A 4ESVA 4I1RA 4EGAA 4Q1DA 4LWPA 3QVOA 2NQ8A 4J7XA 4P7KA 1R9NA 1E2PA 3SHOA 1CUEA 2HRBA 4V0ME 4D9EA 1OD6A 5JVDF 4Z4CA 1VPWA 4UU0A 1O57A 2B5VA 3RS7A 4H1VA 3GQVA 1RYNA 1UZAA 4D3ZA 2LIPA 1ZA2A 2IYFA 2RHMA 2H11A 3AKCA 3P9PA 2QAIA 4KLAA 5G0VA 2IHBA 2UYOA 5KTOA 1SR8A 2J9XB 4JVOA 4XD7A 1WS6A 4LOHA 1NVDA 1JIVA 2IXBA 3I8XA 4C4PA 1WB5A 5ETJA 2KWIA 4CMIB 1PQPA 4YV0A 4ZHQF 3VKHA 1G20E 4KTTE 1N6IA 2HADA 5BT8A 3K09C 2E87A 2W7TA 2QMQA 3NWEA 2HPHA 4KN9S 4ILEA 4EB6A 1U7WA 2ZU6A 5AP9A 1TF7A 2HJ9A 2C4NA 2Q6TA 4GZLA 5AESA 4QUBA 2A5LA 3W06A 4CQMB 1F0NA 4ZTBA 3C6BA 4GI1A 3WJ2A 1NSFA 2ODBA 1GL3A 3N6XA 2PL9A 3W1WA 4J29A 2FDXA 4BC0A 4EKDA 1JT2A 1SKQA 2ZRDA 1K8QA 3C2QA 4F0JA 1OBOA 3ILXA 1QPBA 4KFUA 3P1JA 4RCZA 1I2DA 2QVGA 6LDHA 3NFRA 1XI2A 3EDMA 4ZQFA 2BGRA 5EVJA 4YCMA 4CM9A 1RRGA 1ZL2A 4E88A 5EJ9A 6ADHA 3I6BA 1KRXA 1WAMA 3SXUB 1P0MA 1DC6A 3A8TA 4EY7A 3N2YA 1XZEA 1G5RA 2AF4C 3E9DA 3KPJA 4W8GA 2ANBA 1T34A 2VRBA 4A8JB 4BN5A 4JB3A 1NLYA 2NZVG 3FNIA 3GEMA 1BE6A 5LBTA 4WVFA 3PC6A 4ZXPA 4LMAA 3IQDB 4O6VA 4WOJA 1NU6A 3RJ9A 1SHLA 1MABA 3EFOB 1GPNA 4ESEA 1NP7A 5L4LA 2V7BA 1E3MA 3K30A 4RV5A 2FW7A 1GGFA 2OC4A 4KIJA 5E9AA 4P7FA 2XA9A 3A2KA 4C2BA 1GFWA 1Y9EA 1TTPB 5JEEA 4TMVA 3S2IA 3E61A 5EHGA 5LLDA 3IDAA 2MCFA 3NVMB 4R9VA 1XALA 1PW5A 1X80B 4JVSB 5DLDA 5LFAA 2F43A 1YWGO 3JD4A 3CMCO 4WERA 2QD4A 3TW6A 2W2QA 3X44A 4UNRA 4O2BF 2R62A 5JD5A 3HYCA 4AN4A 3UZUA 1NTRA 4ZMRA 3JATB 1R88A 4QXAA 1SCKA 3AL3A 3FPEA 4FMPA 3WLSA 2H92A 3ZQKA 1GSOA 1Z63A 1DKNA 2X2OA 4DUZB 2G1UA 1XZGA 3HJUA 1WMSA 3UMVA 2VYQA 1EEXB 1ORRA 2D5AA 2ORIA 3CFYA 3JZAA 3HKEB 4RPGA 5NLLA 3SHWA 4U3JA 2DWQA 3R5KA 3U0BA 1TAQA 4GPZA 4F96A 3Q72A 3CRNA 3H04A 4ZGBA 4DR6B 4HWOA 3G0DA 1L0BA 3BXGA 3OTQA 1N6RA 4P54A 1GGVA 2ECQA 1TJ3A 3KB6A 4JIMA 3DF9A 2Y9MB 4TPKA 3W3AD 2ZOSA 1GZUA 2C2HA 1WUKS 1QTQA 3SY8A 4PG6A 4E12A 3R74A 2OTCA 3SMQA 3T9DA 4DIEA 5CFQA 4X7BA 1SCUB 2O06A 5TGZA 4O1MA 1Z37A 1USWA 2PRKA 5DHAA 1NJ5A 5AIBA 2B1JA 5AW3A 1VG1A 1Z0JA 4ZJYA 5CA1B 3MTBA 4PO9A 4D02A 2JPDA 1Q0HA 3EPRA 4XVCA 5AMXA 3PGKA 5DDIP 5BUCA 1RJEA 5GONB 3RK1A 4R1SA 3VTAA 821PA 5JNVA 1FDSA 2PQ6A 4IH1A 4KIUA 1E0KA 1SVUA 2JAQA 3D2BA 5AD1A 1D07A 4IIEA 4TV9A 3TOCA 5A9SA 4P92A 4FEYA 5KMGA 1OB5A 1G5HA 3FTNA 3KVOA 4AZ0B 2G0AA 4F2DA 4MCIA 2AMYA 1U5AA 4MVJG 1GZ5A 4TTSA 1OIXA 2OM6A 3CT6A 4Z9YA 4CTMA 3UOGA 4FDTA 5DNYB 4EUHA 4WK2B 4X1YB 2OECA 4RV4A 4TYYA 2ZDQA 4FGJA 3RVNA 4EYOA 3D0OA 3IQXA 3QNWA 4C4RA 4EHFA 1QKIA 2ZWAA 1SZCA 3EBOA 5LC1A 1E1RA 1P72A 1Y82A 4TYNA 1LQUA 2IF0A 1VIAA 2VNAA 3AY6A 1H9AA 1J8VA 2DFDA 1X8KA 5JG7A 4WZAA 3TQOA 2GR9A 1NV9A 1SU6A 2GSDA 4IQ4A 3DAPA 4FDAA 4NPAA 5C1IA 1YS1X 4QXMA 4BC1A 3RKUA 4F3RA 1PKXA 3KPYA 1RHMA 4O59O 2QMOA 1W46A 3M7IA 5D00A 3UY4A 3GUYA 4PNPA 1PFQA 2CBZA 3IRVA 3FIJA 5CTJA 1PJ3A 1ZN9A 2VDMB 3S2UA 4E09A 2I22A 1W36D 3AL0C 1L3BA 3IAFA 2BGJA 1TK3A 2FMIA 1V5EA 4M60A 1G4HA 4JJ6A 4IDPA 2P9BA 2YHSA 2Z5GA 4M1ZA 2A1TR 3INYA 2R751 3FHCB 5FV4A 4UMVA 4DMCA 5CHEA 4FQ5A 1NYQA 1YU6A 2N0SA 1R0SA 4R0NA 3QSGA 1PJRA 1T8UA 4RSMA 3MT9A 1UBJS 2Q5QA 3HJAA 4ER6A 3RAEC 3KE9A 1IZ7A 1WKVA 3FWYA 3GEHA 4OO3A 1AB5A 1L4KA 1ZA1A 2PXAA 5JAQA 3OPYI 1DKRA 2XW6A 4PCAA 3SDZA 4R1MA 3RW9A 4US2R 4OI0A 2R4UA 3SJAA 4F12A 5E9WA 1Q1ZA 1E7YA 1D4AA 1FSPA 2HJGA 1DX9A 1QHYA 3F6CA 2V74B 5HE9A 4UHKA 1XVTA 1Y1SA 4X8OA 3WLNA 4D9BA 2I03A 5CFPA 1VPTA 2PZEA 1GPAA 3EQ2A 5H3HA 4DWJA 4H7PA 4M1YA 2ZYVX 1PK9A 5BUQA 2GXUA 3RQSA 1JF8A 3NXSA 2M6LA 1ST3A 1AGPA 4IJMA 3TVYA 2YJ3A 1JR3E 1A5SB 3BGWA 3C6QA 1OV4A 3FWKA 3ITNA 3HFJA 1AQLA 1TADA 4BO4A 3N74A 2WHYA 4L3WA 4X0EA 4PHTA 1O97C 3BRQA 2F67A 4ENWA 4P35A 5JBQA 4WFIA 4DE5A 2SECE 3TW8B 2DM6A 4M8NE 2G5PA 2KS6A 5A5FA 4GMXA 3VR5D 4RETA 5ALHA 4MRMA 4GSYA 4C2UA 4EQ6B 1UF9A 2F6RA 2E18A 3FX2A 1VIYA 4IZOA 1H8ED 3NDPA 3UVEA 2B9VA 1AOXA 1P3JA 2QM8A 4LHZA 4EARA 5IEJA 4TLAA 3A6KA 1FDVA 3UMFA 1GRVA 1IG0A 2OBYA 2ZYUX 3HU2A 3PC4A 1T6NA 2NUAB 4MVJH 4E5SA 4O4IA 2CXTA 2C2WA 3FMPB 1H2EA 4U2KA 4WUTA 3TMKA 1DRKA 1E77A 2QRZA 3KFLA 3M4JA 2P9EA 1AQNA 1Z82A 2ZJAA 3MHPA 1JHYA 3ZWDA 2IK8A 4HKTA 3E9ZA 3LLCA 1ORTA 3KT8A 3O8QA 5H3CA 4DJTA 1H1TA 2XJ4A 3AERB 1NKVA 1AZLA 2QE7D 4ROSA 4RS4A 1YS7A 4UUBA 3TECE 5LCXA 3PRJA 1RWKA 3WWEA 4RF3A 2D4HA 4UVIA 3KYDB 3A4VA 3FPBA 2BGUA 2PUGA 3FOWA 2CJPA 2HSZA 4FJ0A 2YRXA 4E46A 1E1QA 4YCSA 1PQYA 3FGOA 3LK6A 2R8OA 3NM4A 5I48A 1GQOA 2G07A 3EUFA 4DTIA 2KB0A 2YN0A 4BQFA 2BTEA 4DR3B 4C4ZA 3PHGA 4DCPA 5K6RA 1DNPA 1F17A 1EVJA 1IG3A 2QVZX 1V1MB 1V11B 2OCLA 3WJ1A 3EG5A 3U4QB 4UNIA 2WF6A 1JWBB 1IPFA 1MIOB 4IX9A 4EJSC 4JOQA 1Z6QA 4GICA 4XGNA 3QH4A 2GHIA 3C7KA 3FYSA 1OI2A 3ASUA 4RBNA 4GHWA 1J6UA 5KYWB 4AY2A 1Q95A 1DP4A 1HE8B 4ZTZB 5K2OA 1NUHA 1ZR4A 1Y5RA 2Q5FA 4P3OA 5DM1A 4L6AA 1QWOA 3ZQUA 3X1MA 4FDUA 2PUJA 4OQEA 4YMWA 2Z2YA 3GFVA 5EJAA 3LT2A 3C3BA 1X1EA 4RZ3A 3WHKA 3QPVA 4JOSA 3SQXA 2QNRA 1DBQA 1YDGA 4X61A 2GI4A 2RHJA 2A8YA 1ZK4A 4EYGA 3AKEA 2A9RA 5KZMB 4UBLA 3X1JA 1KI6A 2BFCA 1O7JA 3C5WP 2L18A 1YIDA 3O8QB 3H19A 4H7HA 5TX7A 1LRJA 1DV1A 2BSQA 4NDZA 3GLIE 3QENA 4YUXA 4K87A 4V1CB 5HGJA 1Y8CA 3BE4A 3UG6A 4OA8A 4IDBA 1VKNA 1J7KA 3OZFA 2GYWA 2XBMA 2HHAA 2AQKA 1A9OA 4DNXA 5D84A 4DA8A 5L3VA 1DG9A 2GMWA 2XE8A 3A6HA 3K9GA 1K1EA 1TZJA 3U37A 1U3UA 1VYHA 3D4LA 3GLTA 1KNXA 1ST2A 1DX4A 1US8A 1YKSA 4L5JA 4CTNA 2P79A 3LC7O 1ZVKA 2DFKB 2VG8A 1NT2A 3GXOA 1OYYA 1GSHA 1ZSNA 2D4AA 4P98A 5ESDA 3BL6A 3U13A 1D6NA 3BJIC 5CCEA 2R65A 1GN9A 3G85A 4QLOA 1UKBA 4Z7NB 4PAGA 5EE5B 4Z4HA 5LZ4A 4JLPA 3FKSA 1YSCA 4RADA 2CT8A 1S8FA 4A36A 4EDHA 4EUKA 2OHIA 4FWIB 5KHLB 1YOVA 1EVQA 1PS0A 1NZFA 1CERA 2PKWA 3PD1A 4L5AA 4IDNA 5LVAA 3KPUA 1KU6A 1QH9A 1RZUA 3IP5A 3OZSA 5DX0A 1UP4A 3RQIA 4DRXA 1W48A 1NE2A 1S1MA 2FA9A 3ZNOA 5K0FA 4RTQA 4JJIA 2ZT8A 3J7AC 1SUWA 4G5GA 4D8YA 4ZMBA 4FKMA 5E7JA 1SHJA 3OQHA 4YCBA 4AZ3B 3P0HA 2NZJA 4MA4A 2A2ZA 4KWHA 3HGQA 4OVKA 5LA6F 4LX0A 4YAEA 5ECDA 5HF8A 3V2GA 1TUEA 3DSRA 1NW4A 2BFCB 3VC3A 1K7YA 1FCJA 4QPZA 2YV3A 3EGCA 4FE3A 2VTEA 1I4WA 2A3RA 4MS1A 4P4TA 5FD8A 4FFBA 3L7CA 3FE2A 4QG3A 5EZ5A 4EY5A 2BFEB 4WXYB 3UMYA 3QQPA 2WP0A 4NE7A 1E2KA 4MUYA 1SD1A 3NLLA 2F8SA 4B7CA 5IAAA 5BN3B 2PUEA 4B3DA 1FYXA 3FCOA 3AVYA 1M7BA 3OZ7A 1NVAA 3DE1X 4LXGA 4N5HX 5IK2D 4ND5A 1TA4A 4CEHA 4HNTA 3DOHA 5DGIA 3EMKA 3LYLA 4G85A 3H9UA 1Q1GA 1VGQA 1VCIA 2Z4RA 4GM0A 4HWSA 4RABA 4I1IA 2YX1A 4QLAA 4X1IA 1NJSA 3H6KA 5K6TA 4YRJA 4WUVA 4BO8A 1KI7A 2R6GA 2VO1A 1AA9A 4AX8A 3EIHA 4PEVA 1CQWA 3A6FA 4A8TA 2PU7A 1CY8A 3GFBA 4UE3S 2Q0QA 2P6RA 5D3MB 5HUHA 1EGVB 3IUJA 1NI4A 1GCAA 1O03A 4HBGA 4L9AA 4IV0A 4Q9JA 5C52B 1EFVA 3B6KA 3UTDA 2CD7A 2D0PB 3WWZA 3ZQ6A 4PHHA 1NPYA 4AJ2A 2Z2ZA 4HB0A 1FDUA 1G18A 2REOA 2FG5A 3GCZA 5F12A 3IBSA 2XH8A 2PH5A 3R0IA 4ITUA 4HYYA 3FBTA 4GOXA 4ID3A 4LI3X 1RJ9B 2G1KA 4XQGA 1YRHA 3QUQA 1E4OA 2QTFA 1T5OA 4AJNA 5IC4A 2GBLC 1H5UA 1VI2A 3I32A 1SN7A 4HOYA 2LXNA 1G0NA 5A7FA 2RHDA 2OV3A 3KL2A 1VL6A 3NO4A 3IGFA 3RU2A 3QV1A 3S40A 4CV0A 1QYIA 1GNPA 1PL6A 2BN4A 3DHEA 4KV9A 3FCSB 1DFHA 2PUAA 4JBGA 1HH4A 3BKWA 1RKVA 2C98A 1RI5A 2J5RA 4OP2A 3KV3O 1DDGA 2AQIA 2HNKA 2Y1OA 2GD6A 3IR6A 4LRUA 4B6EA 1OFTA 2AJCA 2QNBA 3NEJA 3HP4A 4DADA 4K8RB 2B8NA 5HILA 9ABPA 1WW3A 1Y3FE 1ZONA 3T95A 2A7XA 1II0A 2JHCA 5TR9A 3BWCA 3ZNQA 4DGSA 2VUHB 1V1JA 1MRNA 3HWSA 1WX1A 1NLZA 1P80A 2O7RA 3LL7A 1KS9A 1BCSA 2YXPX 2AW3A 2FW6A 3CRRA 3R3ZA 4K9PA 1K98A 1ESCA 2FPXA 1B8OA 1D8AA 3DAOA 3VJKA 1V4BA 4K6HA 2GGSA 3Q7RA 4Y2HA 2JHAA 2QXUA 4EGSA 1RWOA 1J23A 3EH1A 2JFWA 3GIWA 4D6YA 4YV7A 1VIMA 3OZCA 4B32A 1MB3A 3NIWA 2M6SA 4MWEA 4CF4A 2ZCUA 3UMGA 1R8XA 2Q50A 2OK7A 1Q7RA 3FCYA 3NBQA 5CYFA 3U4MA 3WLIA 2D06A 3LBFA 1G9TA 1GQFA 1KMHA 3F8SA 3IBGA 1UJ6A 3V8EA 1RZ3A 3PENA 4P7GA 5KDDA 4L3VA 1E9RA 4RM3A 5DKFA 3KSBC 4KWCA 5JY1A 4ND6A 3OBBA 4MX8A 4NYJQ 4JNCA 3OQNA 4FZRA 1G8YA 2ACKA 4BQRA 1E6UA 4JSYA 3QIVA 3F46A 4ZVSA 1JIKA 1KEEA 1TZ2A 2I3BA 4U63A 3AUYA 3L7BA 5G4KA 3DKVA 3T5AA 3V7FA 5DWDA 4KGZA 1KIAA 4A8PA 1WZIA 3FPLA 3LP5A 3E27A 1RXSA 2VPQA 4L8WB 3TBKA 3HCCA 1EDEA 4BCCA 1KAQA 1VXOA 3O73A 3RAFC 1QB7A 2EX4A 2V4UA 1HM5A 3O3NB 4LNAA 2O59A 3OCVA 2XAAA 1NIPA 4EUNA 3BK7A 5CFRA 3RRJA 2HR1A 2RK3A 1ONNA 5I9IA 2DQZA 3IV6A 3GLQA 3GLHA 4UUQA 4WDQA 3LNTA 5LZ9A 2AK3A 3FDFA 2EKPA 3DDZX 4J43A 1T9GR 2X41A 4NH0A 1L4YA 3GJ7A 3I4CA 3EVFA 1R74A 3TAHA 4X93A 1ZUWA 5AKKA 2VA9A 3CT4A 5IKMA 1TD9A 1O5IA 1KOGA 4OEHA 5C4GB 1ZVMA 2PT5A 4BLTA 1E2BA 3HG7A 3RT9A 3R7SA 1SCIA 2BZ1A 1WB4A 4QUDA 4Y9TA 1JAXA 1N3IA 4CIYA 3DLBA 4HYQA 3MLAA 2YASA 3UK6A 3RRFA 2XNCA 2OO7A 3VPGA 2A0FA 1EUQA 5CPFA 1WCWA 1Z7GA 2VK8A 3AVPA 4ITRC 5THXA 4RTKA 4LMRA 2XWSA 3CU5A 4KX5A 1ZIPA 3HADA 4MPPA 1EK1A 2QL9A 2XE6A 1I7LA 2VH2A 4Q21A 3IT2A 4YRRA 4BX9A 1MRSA 1T1JA 1M1YE 1MFPA 3DE4X 3T0GA 2WD7B 4R05A 5IZCC 4K6KA 1QB8A 2HB6A 2WTBA 4ZODA 3OAAD 2G72A 3REQB 1FX1A 4G3XA 4LRYA 1NBMD 1CUBA 1JEJA 1F9AA 4A6PA 1SVLA 4DCMA 1NBHA 1IHOA 4M0KA 3MF4A 5DK6A 5B3JA 1YL6A 4G5SA 4QHYA 2KBEA 4ASUA 2BKXA 2C1ZA 1UZNA 3DE6X 4Q1BA 2RHRA 1B8NA 4Q3CA 1D2NA 4N6OA 2GN0A 3TRDA 3IP3A 3CVWA 3ZWYA 5C1OA 2CGEA 4UPVA 1ZVJA 3GNSA 2GBIA 2FEMA 4JOBA 4GUDA 5THKA 2VWQA 4G1UC 2CB0A 2WJYA 4UHFA 1KXJA 5U4QA 3I5AA 3Q6IA 5IHXA 4DW8A 1CEXA 3CVOA 1RPTA 3L7KA 2CVOA 3O7WA 1BXGA 5KYUA 1M34A 5C7IO 2AN4A 4Q1FA 1CUDA 4R83A 1U6JA 4D9HA 4NFSA 2Q0HA 3GI1A 3BB1A 4RJ2A 3CGGA 4IDCA 4MVJF 1ZXBA 4R8SA 5JBNA 3A3OA 3LLUA 1R6AA 1XHFA 2JJMA 3EXHB 4KFSA 4B6OA 3V8NA 3U09A 5IJWA 1UK8A 2WW8A 4NBKA 4YI3A 5J63A 4F9FA 3IERA 4OATA 2QE6A 2FEOA 1ZN7A 1C1YA 4R8MA 3A1UA 3H2IA 1U81A 3I04A 5FBHA 4MLCA 3K0FA 4RVOA 5D3QA 3TQCA 4ZK6A 9ATCA 3E9EA 2FRDA 3LAWA 5LQAA 3SWWA 2I91A 2AW5A 2VJDA 1COZA 1BRTA 3HH8A 1P2SA 4PZCA 2B8WA 4LSMA 5JSYA 3RSSA 1XKQA 3SEFA 3T54A 2QQ5A 3HNPA 1J8DA 1T15A 1DXQA 2P6OA 3K6JA 2AV6A 4YC7A 2FCRA 4I5IA 5JZ9A 4JLWA 5BW5A 2BFAA 4MIYA 4HGRA 5CTAA 4KC0A 5BWLA 1MAUA 3LY8A 1YVEI 2I6QA 1POWA 2YIDA 4I19A 3PFHA 4BNMA 1NG9A 1FQOA 1GADO 3H4VA 3C16C 3WNVA 1T9CA 1E3WA 3BBLA 1L4GA 3SVLA 4NJOA 1IRIA 2EG9A 1VLLA 3H13A 5CX4A 3DLHA 4HY3A 3TIVA 4ALIA 1JQKA 3MWFA 1L1FA 3RANA 1JDPA 1F7UA 3DDCA 3QUAA 2R6JA 3WWDA 3O4RA 4LPSA 1WZUA 4MS3A 2ZT6A 4B35A 5J47A 1PHPA 5ES3A 1T2NA 1ZBDA 3UJ7A 2JCBA 2PWYA 3HGMA 2OYCA 2CXQA 1KVUA 2H1WA 3DB1A 3FAKA 1ZD3A 1VMKA 3KB8A 2BRUA 4MIOA 3U39A 4EHDA 4LXUA 5KOHA 4LYFA 2RBKA 1G5FA 1FFAA 2WMNB 1Z73A 3L5KA 1PT6A 3UJCA 1A71A 4BN4A 4D3FA 5LDDC 4OX9B 4E33A 2MOKA 4B2IA 2C20A 2P6UA 4Q4HA 5EE3A 3ODGA 4W63A 4FJ2A 1Q17A 3ROMA 2B82A 1E2NA 3U9LA 3WHLA 4BXOB 1JEQA 2F3UA 3O4JA 3Q5GA 5JANA 1TEZA 3SYKA 5EMNA 2GRJA 4BLQA 1OZGA 5BNWA 3CR7A 4H4CA 3V3TA 5E9QA 2A9PA 2EQ5A 3TI9A 1O95C 1Z08A 4L57A 4TN1A 3MQ4A 4NULA 2GK7A 4CLXA 4GO1A 1TQ8A 4UVDA 4Y2XA 2FN8A 3WLMA 1PJQA 3QRWA 5FOVA 1IWBB 2PXCA 2Y1FA 3BE8A 3LYHA 4KPEC 1CJTC 3HVHA 3WP1B 1W30A 1OQAA 3THSA 5JSZA 3PXBA 5FL3A 1WZ2A 1VQ1A 3JPWA 1FVFA 4DJAA 1HLFA 1CX9B 1GL6A 1TM4E 1GXSA 2J0VA 1XTTA 2QJRA 3A36A 3A4TA 3CLVA 4UEOA 5FWXB 4IFBA 2CY0A 5KI6A 2GLTA 5D8DA 2IEIA 4UTZA 2RC5A 3UWSA 5JCOC 3WYNA 1BN7A 3U0VA 3ZTTA 2R97A 3GL9A 1QV7A 2ZU0C 2GD2A 3D7RA 2AHOA 1CUZA 3JZDA 2PLNA 2RGYA 1OT3A 3DNMA 4EO7A 2F1JA 3PJRA 1SBZA 1A1VA 1WPGA 3TTYA 3UUGA 3KCQA 5IT0A 3HVUA 3UB4A 5BVHB 3RS0A 3QELB 1L8OA 5BOVA 4H2DA 2IL1A 4P5DA 3LQRA 4REMA 5TQVA 2LUOA 5CD1A 4QQNA 4X6XA 4BUZA 4FDMA 1AUXA 1JEQB 3PS9A 4XFKA 3WL3A 1B0PA 3DWIA 4WHMA 4DLTA 2BKUA 1UJNA 2V0GA 1BU8A 3LX5A 4W5HA 5E4TA 3L8MA 1KDTA 1GD1O 3HZRA 4IWXA 1M2JA 1ZW1A 4KXVA 4QXQA 3H5WA 1IEXA 5IF3A 3W5AA 3NVKI 3HZHA 1TI7A 1RP1A 3NUZA 1XN1A 1ISSA 2Q6OA 5EIOA 5BYJA 3TRFA 4AZ0A 3ZZUA 4MR9A 4CT4B 1NBEA 1NP6A 1VA5A 5KJ6A 1YASA 2PA0A 1CR4A 1E61A 4PG8A 3B8EA 3FSGA 2H1VA 4AJPA 1ODKA 3N1UA 4R41A 4RIIA 4X1YA 5DRYA 5EE9A 2HTFA 4X91A 5FULA 3PXXA 4EW6A 3QYFA 1P45A 5DO9A 1E9EA 3MAAC 2BONA 3GXBA 1FRQA 2ZS8A 3EXFB 4Q4JA 2YMQA 1GZDA 1S7CA 2WZDA 1KBZA 3MINB 3I05A 4JNKA 1DLJA 1UBFA 2RAUA 2QLMA 4L5CA 4YDRA 5GJWC 3VMMA 3N7TA 4KHPB 3HDHA 4U6SA 4WZAB 3HS3A 3M5DA 1GV0A 3JASA 4EGCB 4L15A 3HA2A 5JWOA 3R0XA 1XVLA 1QG0A 1TKBA 1UBTS 3TTUA 1KYYA 3RRYA 1UC5B 4PLCA 3HI6A 1Y5LA 1O6GA 2AOVA 1Q91A 2ZK7A 3BSWA 3HN7A 5GOTA 2G6TA 5JI3E 3FSRA 1G4UR 5EE0A 3CX6A 3GJTA 1VXRA 2IZ0A 3OZIA 4RGYA 3GT3A 5KYXA 5CA0A 4NDNE 1IZ9A 3CIOA 3SMVA 4NJEA 3FWZA 3LUDA 4Y1EA 4TKMA 2C3OA 4TV9B 3WNBA 5A9SB 2G36A 1GT6A 1AF4A 4IDAA 4NNJA 1KAGA 5CFOA 3LIPA 2HL6A 1C3JA 1GDTA 3ZDDA 4HO1X 3UGTA 4ES6A 3ER9A 3JVEA 2DVMA 2FW9A 2O3SA 4N0QA 2HPVA 2XB6A 1LBIA 1R6VA 2F2TA 3C24A 2ACEA 3AEQA 5EXEA 1LY1A 1OFUA 2OUIA 4JHLA 4JROA 1SH7A 1PW7A 3GN1A 3DW1X 4LYGA 4AJKA 3UWOA 4KO1S 1J2TA 1MV8A 4PIMA 2VH1A 5T4FA 1JKXA 1Z4KA 3SS7X 3ILVA 3WLPA 1UDRA 2PPVA 5HCUA 3SSAA 3C0KA 1C3VA 3BIFA 3DQZA 4OB7A 4WXRA 2Z6AA 3ND9A 2PUFA 3V4OA 1XXHA 3D3EA 4FBMA 3EZ7A 4H3SA 4MS4A 4ZQCB 4E4RA 5FUXA 1Y4DE 4BBAA 2H7VA 2QG6A 4FMBB 4JP2A 4LY6A 3SX2A 1DO2A 3HN6A 1XL1A 4MQBA 4MWZA 1HLPA 3JASB 4FBLA 5E2IA 1NF2A 3RVDA 5IFLA 3IQGX 4PSCA 4MMYB 5K3EA 5BN5A 1EWKA 2A0XA 2DPLA 3EZFA 3HGTA 3JARA 3MGGA 3P9XA 4RH0A 5BNIA 2HJWA 4FX2A 4A15A 1ZN2A 4C0HA 3ABZA 5BVHA 1VE9A 2C9YA 2EP7A 2GK3A 4NJMA 3VYVA 3S29A 5JNLA 1FK8A 2ZB8A 4FKBA 4YCCA 3CEJA 1WXWA 1ODLA 1I5EA 3K0HA 1UIRA 3LMKA 5DNDA 3UCEA 2W2XA 2EX1A 3F8WA 4I9NA 1CEQA 1UH5A 1HE4A 3FYDA 4ODIA 4A0GA 4A92A 2AYXA 1CNFA 1PR0A 2ODWA 3LKDA 4P08A 3VR4H 2OHFA 4Z3KA 3WGMA 3CZ4A 2F59A 5C1DA 4MGYR 1T5BA 3TR6A 1EK6A 3DPUA 1IQPA 5K0GA 4ZRNA 2HF9A 3H9CA 4PYLA 5AVKA 4YRNA 2ZPTX 2X1HA 1C3EA 2H54A 1CEEA 2W4IA 4BNWA 1YDHA 3ZX5A 2VRWA 2PZLA 4FIZA 3RF7A 1YIAA 3HV0A 3H65A 3LHKA 4OH7A 1D2AA 4JJZA 3VRHA 3G2KA 4RK6A 1GKUB 1TC1A 2XMBA 1ESEA 1LPBB 2CHEA 2GM5A 2JA2A 3CKMA 2DWOA 3HUEA 1QV6A 4LZAA 3RUFA 5DHPA 1U3WA 3ETCA 4RAOA 4MKGA 2XUQA 3QXJA 1AN0A 3FZYA 2ECOA 2PS9A 4UZFA 3KRTA 4HGZA 4QGGA 1JB9A 2XWBF 3ZXSA 3NX4A 4I0WB 3CUTA 1AQJA 4NS4A 1HE1C 2WD9A 2ZUDA 4JEMA 1U0OC 4CEJB 3HCEA 4I5GA 2IZOA 1P5FA 2D62A 1X8JA 5ALKA 5HJEA 2G9VA 2HX1A 2BW0A 5KHOC 4X85A 1T8SA 5KYXB 4WK4B 1F2UB 2E4ZA 1KPHA 2BH2A 2RKWA 4ON9A 2RGDA 3PQEA 5EJFA 3VHLB 1N2CE 2OXIA 2B7CA 3P52A 1QNFA 5CNMA 3UJBA 1VE6A 1MX1A 1T5DX 2R8PA 4JD5A 1UXGA 4HVTA 4JGBA 4DMMA 2G9UA 2ENUA 4XQEA 5FTNA 3KSRA 2JLUA 3MXOA 4BX8A 1TMKA 1HTBA 3ZWMA 2LW7A 4KR9A 2PWAA 3KQSA 3OO0A 3RF6A 1VCOA 2XLCA 3R4VA 1SBTA 1Y6JA 1RPAA 5A4AA 3L6BA 3PL1A 4LJSA 5LDHA 1HE3A 5HRUA 4FFSA 2A6PA 5F7OA 4YFVA 3L0ZA 1DEOA 4EABA 3GUUA 1DCKA 3HLKA 4G0ZA 1J5XA 3VO8A 4NXNB 1XWFA 4L74A 3K0BA 3AJ8A 3IO5A 2AG1A 2G4VA 4K9DA 2W83A 3SBOA 1IN1A 1Q0TA 1EB8A 3OKPA 3AJDA 3P9RA 4BZPA 3QV2A 2HRDA 2I65A 5REQB 1N0IA 2ZE8A 4FZ5A 2XVXA 3IVXA 4TT3D 1K4KA 4U8HA 2QQGA 4MRMB 4QDZA 5IVPA 3NTVA 1ZG3A 1DEKA 1FY2A 1Y5NA 1UAAA 2PS3A 1HGXA 1E1NA 1LQ2A 3B1XA 4E5YA 4M0EA 1VKRA 1L8XA 2GNPA 3PQDA 3ZQ4A 3K3PA 3NTLA 5ICCA 1IOVA 2G09A 2PGJA 1PQWA 2PWPA 4P4UA 1EU1A 5DXFA 2ZB7A 2PWBA 4NEGA 3ULKA 1W0CA 3DLCA 4LSZA 4MKHA 2EC5A 1UP7A 1RI1A 5CNKA 5JVDB 1E98A 2V7VA 2WOOA 4GNKA 1U0HC 1OGJA 1V5GA 3OF3A 5DMXA 4BMDA 4DRXB 3THWB 5BQOA 2J3KA 3OIGA 2PRJA 1RYDA 1I2AA 1L1EA 3MN1A 1IJEA 1IK6A 2VI5A 2CWWA 4QJ5A 3RUPA 1U90A 2MSCB 3KYDA 3O8LA 5G0UA 5JSUA 1F51E 3JAWA 1N2SA 1EG2A 1P4AA 4EG3A 1QH8B 2YN4A 1Q20A 3BMOA 1GZ7A 4IS2A 4LYDA 2N9UA 2NYRA 4BVGA 1JFSA 1YJAA 3E8SA 1P9RA 4EVSA 2OZVA 3F6YA 2NAFA 5EZQA 4FMCF 5EQTA 4BP8A 4RXTA 4JL6A 2ZIUB 1E1LA 2JC3A 1XA3A 3FRIA 1X7WA 3I34X 3AUTA 1L5NA 3CXUA 3X1XA 2QUAA 3ZGVA 4E6PA 3L0YA 1J9ZA 4KSCA 5E4JA 4KE7A 1MIOA 3EVAA 1WXFA 4Y1GA 3NWJA 3ZD7A 1H2WA 2WZQA 3CCCA 3H4MA 1TYZA 4UCFA 4B5LA 4XAQA 4B47A 2DU8A 1QVRA 4ZV9A 4EVQA 2JI7A 3IDZA 1FFEA 1A2QA 1NZDA 1SIWA 3AP3A 4N82A 1J0DA 5CBKA 4HTFB 4B2YA 3C3CA 2FJPA 4ZDIA 1K6JA 5C8YA 3EVZA 1VCHA 3CH7A 1Z6PA 2J8ZA 4CIXA 3ZLTA 2AVDA 5ILGA 3A37A 2K7ZA 3E58A 3GPCA 5LBUA 5K0TA 2GPSA 2OC9A 2XEDA 4LVOA 2XUZA 2HXYA 1DRVA 3F4KA 1R5NA 4LSGA 4JR0A 3WKAA 4X92A 1N2BA 5CEJA 3ZJTA 2PVSA 3BK1A 2JLXA 4NEHB 2W48A 1H4QA 4HTAA 4OGGA 4QBGB 1HC7A 3UJAA 3TLMA 4V1CA 2Y93A 1JEEA 1I2CA 4B4OA 4EG4A 2EFGA 3NAGA 4B75A 2WWYA 5HW0A 1SC3A 2B6NA 4V02A 1YQ9A 4HNAB 4EHHA 5KQGA 1B23P 2XNKA 4HGPA 4KMRA 2CYAA 2FPRA 2PKXA 3GT7A 5GV8A 4DA9A 3QBJA 2I4OA 1T0IA 1W34A 1TMYA 2GQ0A 5LDGA 3K0EA 5B58T 4DABA 3EBLA 3TSAA 4WV3A 3WY9A 5HRAA 1WZEA 3BK2A 4DR2B 4C0BA 3A28A 5I9TA 5KTMA 3S1AB 1QUEA 5F7JA 5A9RA 5FLXA 1L1RA 3MMNA 3TW0A 3DCYA 3FBWA 3W5UA 4XB6B 4BVJA 1DHTA 2GILA 3GA0A 2Z1NA 4W6ZA 1B4DA 3AYZB 1DQNA 5HM6A 2WE7A 3RADC 3AR9A 2EHJA 4TSKA 5EKUA 3F2IA 2Z2JA 3N8GA 1LLCA 5F76A 3PE4A 5L3SB 1RKXA 2FN9A 1JUDA 2M6RA 3S27A 5H0IA 1YVPA 4DC1A 3K32A 1DBWA 2Q27A 3VZSA 3DGEC 1TT5B 3A6JA 4EFKA 2D5LA 4I9GA 4JJEA 4QTUB 5AUOB 1B73A 1T6ZA 1REQA 1ZRHA 1JDZA 2Q3CA 2ZIEA 4DM7A 5BWNA 5A5GA 3T35A 1NJGA 5HOQA 3DFZA 3OA0A 2BCGY 3OSZA 4GQIA 4JI1B 3ZBPA 3IIJA 4GWLA 3M1IA 1OOEA 3KR0A 4CNQA 5JNUA 2O3QA 4YRAA 1QFYA 1FZTA 3A1FA 3LTEA 4LRWA 4H6PA 4JV5B 4HAVA 1JFLA 3WFJA 3CLHA 4O2AB 1I6KA 1S9HA 2QT0A 5G4KB 3GJZA 4IFEA 5ECYA 1GQRA 2A7QA 1ZCJA 3IVRA 4FFMA 2P2DA 5IH7A 1U2GC 4YA6A 4GKVA 1XMSA 1OA1A 5ADHA 5I7SA 3A7EA 1TQ4A 3DL4A 4UNQA 3RYHB 4DSAA 2CCGA 4MV6A 3TDNA 4YMLA 4E11A 4PSVA 4CKZA 2BMJA 2AWOA 1YQEA 3QVMA 3COPA 5I8ZA 3QEKA 1RYZA 4FR2A 2XTNA 4E2XA 1RMTA 2XXBA 4YN3A 1AKYA 2YZ2A 4IIUA 4FK8A 1KFBB 1YR2A 4EG8A 2OL4A 3EQZA 3FGZA 2QRJA 3KD2A 4MKFA 4XCXA 2F64A 1QDUA 4QYTA 3ZD6A 3I1FA 2VAPA 3BB3A 2AN5A 1FUYB 5D7BA 2WY2D 4BP9A 3FOFC 2X0JA 4YJ3F 2NT4A 1N5DA 2QW8A 3PDUA 4QYIB 1XPUA 2RONA 2P3QA 3IUPA 4GAEA 2BDUA 4QGSA 5E9JA 2WEKA 4G65A 4C7XA 2FSHA 4DLYA 4RW0A 1GRRA 3H83A 2WIJA 4XLTA 2DLDA 1VG9B 5EFZA 2M2IA 3EJ6A 5LYJF 3MNFA 3PT9A 1RLMA 3NHSA 3NATA 1W5AA 3FY4A 3CC8A 1HYGA 3HB1A 2MSKA 4BKUA 2GN6A 1O9HA 2J6BA 3GEBA 3GC6A 3OZWA 2B1QA 3C15C 4R3WA 3AVTA 4FB5A 4V0SA 4BLWA 1DARA 1EI9A 1JILA 1U3GA 3IALA 4DV7B 3ML1A 3K9NA 1R16A 2BHNA 3WDMA 2ZWMA 1Q1AA 2X14A 3QVSA 4KVZA 1RM0A 3KJZA 3KQVA 3L82B 2JLRA 1N75A 1OR8A 1TECE 2AUNA 2G80A 1FXWA 3RVOA 1Y7PA 1KMCA 4TSFA 4U7GA 1TMOA 2XDQB 3BRWA 4BV8A 2H4HA 3KU4A 3NOVA 1D5WA 1AX9A 3P9NA 4OD0A 1X7ZB 3MAGA 2HK9A 3PGLA 1CUJA 2EOAA 1ES9A 1BSVA 3NHPA 2OHOA 3OT1B 4I81A 4XA8A 5DM4A 1BE8A 3ESRA 3U81A 4D92A 4AQ7A 4NFHA 5I47A 1D1PA 5CXQA 2DBRA 4NZZA 4TROA 4IW3B 4X97A 2QMHA 5F9MA 3A27A 1OVGA 1VE1A 5AJXA 3E5RA 4ZOEA 3WIUA 3HUUA 4R01A 4BFYA 1YZLA 2C78A 4URXR 2VNJA 4RSGA 3P0FA 3P45A 1J5PA 3ZX4A 2X9QA 2GZ2A 2B9EA 4L9SA 1RACA 2QRNA 4MVJD 5ICSA 4YJ2F 5JZSA 5TMDA 2R2GA 1BRMA 1W5EA 4GGMX 1BH2A 3LBNA 2GO7A 4X6UA 4ETMA 1ECGA 2NV2B 3CWCA 3RAJA 5LZ2A 5J2UF 4LGVA 3HWRA 1JYFA 1LS1A 4QDXA 2Y66A 4Z8YA 4EEZA 3ZWCA 2RHOA 4ER0A 4F3KA 1EA7A 4HX9A 1BVHA 3CSDA 5JYEA 1JSRA 4G0XA 5AM2A 3O38A 1NY5A 2Y76A 4P4SA 4NC9A 4H18A 1K7EB 1XFDA 1VZ3A 3I37X 4CMIA 3D9QX 4F45A 2FSUA