1SCIA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 98
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sciA00
1QJ4A 3AIMA 5E4YA 2XLCA 1RWQA 5AHXA 4ZWNA 4UBMA 1XZBA 5CURA 1RP1A 2XQKA 4K6HA 3Q8WA 4W1QA 5DNUA 4JEIA 3FYUC 1FFAA 2ZSHA 4AMYA 5A62A 4DYHA 4X85A 4X00A 1CR6A 2JF0A 5CBKA 2WHQA 1QIDA 4P9NA 3D0KA 2HU8A 2O2HA 3UUFA 4UHBA 2WUFA 4KAFA 2DQYA 1UOOA 5DJ5A 3SC2A 4Y2JA 1THTA 4J0KA 2EEPA 4U2CA 5AK4A 5CT9A 3WMRA 3OOSA 2H7XA 4A23A 5CXXA 2WSLA 3WL7A 3FSGA 5HCUA 2R11A 3HJUA 3IUJA 2RIPA 1CLEA 3F8SA 3O4JA 1ISPA 2JEYA 2VAXA 4OU4A 3KWJA 4KE7A 5YASA 1F6WA 1LNSA 3RARA 4K6KA 5AKYA 3F9CA 3CCBA 2FUKA 3BJRA 3I1YA 3WKEA 1Y7HA 2XUAA 5LKRA 4BATA 3T4UA 4BBZA 3D59A 4AZ3A 4AMZA 3IULA 4XVCA 4LYEA 4BVJA 5AKKA 1J07A 1U65A 3DD5A 3U0VA 2WG1A 4GDMA 4C01A 3A2NA 4Q05A 4KACA 5ISMA 5IH7A 4KE8A 3K6KA 3BF8A 2WHRA 3D4LA 5EIEA 1J2EA 1EVEA 4G4IA 4PF1A 1BN7A 3DKKA 4BCCA 3FBWA 2QOEA 4C89A 2B20A 2Y6UA 4FBLA 2PSHA 1JJIA 1DQZA 4H0CA 4BRZA 1VE6A 1MT3A 1WPRA 1IUNA 4BAUA 1MNQA 1XKTA 5HFAA 4CI9A 4FOLA 1W52X 4PO3X 3LLCA 1SCQA 4WFKA 2ZYRA 3FYUB 3BL8A 1L7AA 1C4XA 4HRYA 3O4IA 3H17A 3WK6A 2ROQA 2FJPA 4OU5A 2VA9A 1TAHA 4H7EA 2BGRA 3E3AA 4UHHA 4UFOA 4H7JA 2HDWA 4U2DA 3T52A 7YASA 1CVLA 3G0BA 1QIJA 4KJXA 3PI6A 4QDTA 4BCBA 3E4DA 3VVMA 1QGED 2OLEA 2O7RA 4QA9A 4NVRA 3WK7A 1U2EA 5EI5A 4Q1VA 2BUCA 2QTBA 1VXRA 5EHZA 2JBWA 5ESRA 2ZJ7A 1CRLA 3M83A 3DYIA 5JIBA 3AIKA 4B0OA 1DT3A 4DNQA 1VXOA 2Z8XA 3V1MA 4X71A 1ODSA 2GZSA 4X91A 2D5LA 1D07A 3HSSA 2WHPB 4E15A 2V98A 2XUPA 3WWOA 3L1HA 1MX5A 1XQXA 2ZJ6A 4X6YA 5AKLA 1GPLA 1NU6A 1AURA 2PU5A 1CUVA 3IUQA 4Y2VA 2GYVA 3R3XA 3EF3A 5EIHA 5A6VA 1CUXA 5AI6A 2B61A 1YAHA 1VOTA 5EFZA 4DSAA 4QWWA 2PKYX 4GECA 4H7KA 2Y2VA 3G0IA 2WLSA 5LP1A 3WK4A 3TRDA 3X3HA 4HXGA 4GW3A 4HTAA 1WHSA 3IA2A 1XRNA 2XI4A 4RE5A 3WKBA 3BE8A 3O9MA 1FFEA 5HF9A 4FLEA 3R3ZA 5E2IA 1CUJA 1R3DA 2H7YA 3OM8A 1E5TA 1QO9A 2V9ZA 2QKYA 3STWA 3WWPA 1XZMA 2G63A 1ZIXA 4A5SA 1CUAA 1YA4A 4X97A 5FPQA 1K63A 4UHEA 4FNMA 5D6OA 5AKIA 2Y6VA 1XFDA 4G9GA 1XZJA 4P92A 2OCKA 4K2AA 4WDRA 1UK6A 3IBTA 4KAAA 2PSDA 5CT6A 3KSRA 4CCYA 4M0MA 3BDVA 3H2GA 5DTJA 2WUDA 1O6FA 4J0GA 4CCYB 2DHCA 1UFOA 1CV2A 3HYSA 5K3FB 3DNMA 1XKLA 4WFJA 4BDSA 1MO2A 5A7HA 1ETHA 1CFJA 4Y2SA 5JAOA 3PF8A 1YAJA 2DFPA 3I2FA 1K8QA 1XRRA 1QIGA 1A8UA 5KBYA 3WZMA 3CXUA 1I6WA 2QZPA 3NGMA 4BRSA 3I28A 3HI4A 1H2YA 5T4FA 1CIJA 2XB6A 5CXUA 2R8BA 5EHNA 4DMCA 1DWPA 1YA8A 4Q3KA 1EI9A 1UK7A 2AJLI 4XIIA 3WA6A 2WJ4A 2PSJA 1OILA 3D3NA 3PE6A 2ZSIA 3C70A 5JAUA 1CUBA 4WCVA 3KDAA 2XUQA 5AP9A 2B9VA 1XQYA 4GXNA 4OSEA 3MUOA 3PDCA 5EIAA 3G9ZA 4EZIA 1EINA 1ORVA 5JANA 2C58A 4KAJA 3STXA 3DCNA 3UUEA 3ED1A 4QDZA 3MVEA 5ALDA 5SYNA 2ZYSA 2ACEA 3M81A 4AN1A 2VAVA 4AO7A 2WHPA 1VZ2A 1CUYA 5LZ9A 2PVSA 1JI3A 1EDDA 5J3JA 1SC9A 3IVMA 3AUKA 2YYSA 5ALEA 1THGA 4X90A 1EB9A 3R41A 2OCIA 1YSCA 3C6ZA 1Y37A 4GHWA 5AI8A 4CG1A 3GELA 4BP8A 4CFSA 2UZ0A 4Y2PA 2CUTA 3H18A 1GZ7A 3C8DA 5JADA 1XZAA 1QO7A 1R9NA 5AI5A 5IVHA 5K3CA 4FTWA 1UT6A 1NX9A 5I9IA 1OCEA 1N8SA 1QFSA 5ALNA 3FOBA 3KXPA 3I1IA 2XQIA 4B80A 2QJWA 1KEZA 4C88A 1XZHA 1RYYA 3F67A 4MQLA 4LKOA 4UBJA 1TRHA 4BE4A 1XZEA 1K6EA 5BOVA 5AM3A 2PM8A 3PFBA 2WU4A 4HRXA 4PQEA 1W4LA 2VT6A 5ALMA 2X8BA 4E14A 1XZKA 4J0HA 2ES4A 3AJAA 2H1IA 2XT0A 4UBOA 3IUNA 3QMMA 1VJ5A 2W6CX 4FWBA 1ACLA 5ALOA 3D2CA 1DX4A 3QBJA 1R9MA 1T4MA 4QDOA 3QH4A 2QR5A 3HC7A 5KWIA 2XUHA 1CUDA 5JD4A 2WTMA 1R50A 2WIGA 3WL8A 3P2MA 5AKJA 2EDCA 4B9EA 2FX5A 3HLKA 4M0EA 1CUCA 1TKRA 5AKZA 5AKHA 3ZI7A 1R1DA 3WWDA 2QM0A 1ZD5A 2XMRA 4MWSA 1PFQA 1CQWA 1UKBA 4B7ZA 2BKLA 1BS9A 4QWMA 5IKXA 2VQ6A 3AZPA 3R3WA 2P8SA 1XZLA 4LYDA 2X5XA 4WJLA 5I8PA 3W9BA 3LIPA 2WIJA 1GQRA 2CMFA 2OAGA 1E8NA 3IIIA 4GBGA 4EBBA 2RI6A 2PX6A 2DHEA 5AOBA 3I6MA 5LZ5A 5A2GA 1L7QA 5LZ2A 2ZYHA 2WIFA 2OCGA 1LLFA 1ODCA 1YB6A 1UKCA 3IURA 4UBNA 4QDUA 3C6XA 5JALA 2ACKA 2QT9A 3B5EA 1MPXA 4BTVA 4HXEB 1QONA 3FSGD 4PSUA 1LGYA 1DX6A 1LZLA 2CB9A 1ZI9A 4BTLA 1U4NA 3KWFA 4CG3A 4KE9A 3CN9A 1QIHA 3EQ7A 2WFZA 3PUHA 1SFRA 1VE7A 4EUSA 2EDAA 5AI9A 1XZGA 1LZKA 3DL7A 3H0CA 1H22A 1QIFA 1A88A 1XROA 3STUA 1U8EA 1M33A 4G8CA 5CH8A 3G0GA 4YX9A 4G4JA 4I19A 5AOAA 5FXMA 2WJ6A 4P08A 2WG0A 3QM1A 1W76A 3DL4A 2BAGA 1N5MA 3M3DA 4EY6A 2QJRA 2AJ8A 1W6RA 3JYHA 2IX9A 3F98A 4MEAA 3EQ8A 5JASA 3BXPA 4G5XA 4MXDA 4YPVA 5DYYA 1MAAA 2HFKA 1N5RA 1X2BA 1WHTA 3VVLA 1XRLA 1JT2A 1S8OA 3QZUA 3OC0A 1UWCA 2WU3A 1MJ5A 3DKRA 5EHQA 1EVQA 3WJ2A 3OURA 3H1BA 4BAZA 1LPSA 4HS9A 3WL5A 1HQDA 2HIHA 2G4LA 2QRUA 4H7DA 3AZOA 3YASA 3TGLA 1KU0A 5AM4A 4DNFA 3D2BA 5AI4A 3OTQA 3BIXA 1Q84A 5CH3A 1EHYA 1HPLA 3SWWA 4AQDA 5JZBA 4H7IA 3FLAA 2HA3A 4ZREA 1L7RA 2C0PA 2GBIA 3KOOA 1GQSA 1WPXA 5CTAA 3WWEA 1UK8A 3QVMA 1QTRA 5FLKA 3DQZA 3NWOA 3IUMA 4KE6A 4JYMA 4UPDA 2C0QA 4JNCA 3C45A 4BE9A 4IH9A 5D7BA 5DTIA 1ZIYA 4ITVA 2DQZA 1TQHA 2ZVDA 2I78A 3DOIA 1Z68A 2OAEA 3V1LA 4V2IA 3FLEA 2WM2A 5K3AA 2GBCA 3BDIA 2C5FA 1DTEA 5HKAA 4DIUA 5DLPA 4W1PA 4JYPA 1TIBA 1F0NA 4RE6A 4DMKA 3NOXA 3I6YA 5D3ZA 3I2HA 4G4GA 3WJ1A 1WCYA 4RPCA 1XRQA 3VJMA 3R3VA 4G8DA 4OCZA 3FCXA 4BYMA 3H2KA 2WFLB 1FFBA 4M0FA 3ESDA 4U2GA 3PF9A 3L1JA 3WK5A 3V1NA 4ARBA 1BEEA 2Z3WA 2XMGA 2WIKA 2VEOA 4G8BA 3H19A 4DNOA 3AINA 4H18A 3VDXA 5ALRA 3DS8A 4CG2A 4EY8A 4X92A 1HKHA 1EA5A 1CUFA 1GKLA 1FFCA 1A8QA 4NMWA 4E11A 4UHCA 3F97A 2RONA 3EIOA 4AO8A 3W9UA 5LZ4A 1ACJA 5ALFA 3ZWQA 3ZLUA 4DTCA 4Y2YA 3ANSA 3Q0TA 2Z3ZA 3WKAA 4X94A 1DQYA 1EDBA 3SX4A 3VXKA 5FUMA 5A7FA 1LBSA 2WTNA 4ZRDA 3GBSA 4NS4A 4X7BA 5ALHA 4OPMA 2CKMA 4ZV9A 2XUJA 3ILSA 4GLBA 3WYNA 2VT7A 4QZVA 1JFRA 3WA7A 5C8VA 2VF2A 3FLBA 3G7NA 2JGLA 4L72A 1VZ3A 1P0PA 3H1AA 3I2KA 1N1MA 5CT5A 2XUFA 1UXOA 3RK4A 3VJLA 5T4EA 4XJVA 3FYTA 1MN6A 1ORWA 4DNPA 4FLFA 5BV7A 2QMQA 1Q0ZA 4B85A 3E0XA 1OXMA 1BROA 1CUHA 3O95A 5DNVA 1H23A 2AJDA 3MUNA 1K5PA 4DSZA 2ONCA 2Z5GA 2PU7A 2VJBA 3D7RA 4XWGA 2C5GA 1P0MA 3VKFA 1CQZA 1CUUA 5ALIA 6YASA 2HL6A 2JGEA 1X70A 1G42A 1HDEA 3O0DA 2PSFA 2NW6A 1VLQA 2XLBA 1HL7A 5ALTA 3R0VA 5LYYA 1LPMA 1FJ2A 2AJCA 2XMCA 1O6GA 1AKNA 2HA5A 1EX9A 5C7YA 2O2GA 3DEAA 2XMBA 4N5IX 3WKCA 5ALVA 2HRRA 5K3BA 2I3ZA 1YASA 4N5HX 4S0XA 5DNWA 1IMJA 3W04A 2PL5A 5BWBA 5AIBA 3B3QA 4PNZA 5AK5A 5C8XA 3O9VA 1AGYA 2CEKA 3GZJA 5IVKA 3WIOA 4MYDA 3R40A 2XE4A 1EK1A 4UBIA 2K2QB 1WB5A 3E1GA 3QYJA 4W63A 3WWCA 4BZWA 4LHEA 3H2IA 2ZJFA 1KU6A 3HEAA 5JD6A 1IUOA 3VJKA 5JZ9A 3I2GA 2GBGA 1LPBB 5CT8A 2RHWA 3G9UA 2HHAA 3BJMA 2RAUA 1Q0RA 2OGSA 3H04A 1SCKA 4OB8A 1E8MA 1W1IA 5CMLA 5HZGA 1IZ8A 5K3FA 1F8UA 2WFMA 3G0CA 2OGZA 4HVTA 1EXWA 2LIPA 2VSQA 3QPCA 4L0CA 1YS2X 3DOHA 3B12A 1ZJ5A 2HA0A 5LZ8A 4MEBA 1MX9A 1GPNA 1JMKC 2HU5A 2C4HA 1LBTA 1P0QA 4I3FA 4E46A 2DSNA 2VJCA 4J3JA 5HQ3B 3C87A 1AUOA 1XLWA 3RM3A 4FFVA 2WUGA 2ORYA 2YH2A 2WJ3A 4BC1A 4F60A 2J3QA 5A71A 4C4ZA 3A70A 1XZDA 4J0JA 1E8DA 5EHXA 5HK9A 1HBJA 3STYA 3GA7A 1E89A 5AICA 2Z8ZA 4H77A 3A2LA 2G5PA 1JMYA 3DYVA 2OQVA 1ZICA 4I4CA 3N0TA 4Y2UA 4X3CA 1PV1A 5AK6A 2I3DA 4BP9A 5JAPA 2VATA 1EDEA 4QLAA 1C7IA 4KRYA 1DU4A 2OCLA 2BJHA 1PJAA 5JAHA 5FRDA 1CUIA 2XUGA 3GFFA 3JWEA 2XUKA 5DYWA 2WKWA 2AJBA 2HA6A 4AO6A 1YS1X 4B83A 3ANTA 3AZQA 4W1SA 2CZQA 2C7BA 3FVTA 2BGNA 2WUEA 4Z49A 4HAIA 1ZGCA 4PW0A 2AXEA 3OPMA 3F96A 3A2MA 1UOQA 2JGJA 1IVYA 3PICA 1TCBA 5I7UA 3S2ZA 2VTVA 5IVIA 1MU0A 1Q83A 1W75A 4RNCA 4Q82A 4CCWA 3G0DA 3BIWA 4LXIA 4QDXA 4EY5A 1LPOA 2JGKA 1AMNA 2JGIA 3V48A 4NZZA 1EK2A 1VA5A 2GBFA 1BU8A 4N8SA 2J3DA 4ZGBA 2PUJA 4BVLA 5ALSA 4Y2QA 1IUPA 4DM7A 5D3KA 2CJPA 4PV7A 4MJ3A 3ZV7A 5JD5A 3ZLTA 5FOQA 1AZWA 2RGUA 3G9TA 2FJ0A 4F21A 5LKAA 3LP5A 5JZSA 4FFWA 4YK7A 4BVKA 1ZI8A 1P0IA 4BZZA 2W22A 5ALYA 5AKGA 2BUAA 1DWQA 2PBLA 5H3HA 2DHDA 1UK9A 3OG9A 4WDQA 4B82A 1CUGA 2OGTA 3STVA 4CIAA 5ALUA 4EY7A 4PSDA 4Y2TA 4AZ0A 2XMSA 4INZA 4BC0A 3FYUA 4Q3OA 2QUAA 3O4HA 1A8SA 2HA7A 4FLMA 4X93A 3WIBA 1G5FA 3I2IA 3WI7A 1JJFA 5CW2A 4DLNA 4OB7A 2X76A 2O2IA 5HF5A 5AI0A 5ALLA 1QTIA 3K2IA 2JIDA 1CUZA 4AN0A 5K5EA 4MQMA 3PFCA 4GI1A 3MGAA 4FBMA 4J0DA 2HM7A 3ESAA 2OQIA 1BRTA 3LIIA 4FNGA 4H35A 3M82A 3QITA 4BB0A 5KREA 1VKHA 3GROA 1XZFA 4QLOA 1H2WA 5HFNA 5HF8A 2XQGA 2PPLA 3DLTA 3ZPXA 2XUOA 2J4CA 1BN6A 1XQVA 2E3JA 2RHTA 5ALJA 4LIPD 5DYTA 5E4JA 1SOMA 3FNBA 4FKBA 5ALKA 2QUBA 4ZI5A 3I2JA 2HU7A 2OXEA 3G8YA 2ZYIA 3D2AA 5LLSA 5CH5A 5KWJA 5HQ3A 3KD2A 1HLGA 1LPAB 1UKAA 3WZLA 3HRHA 3HABA 2Y2UA 3LS2A 3DJYA 3DDUA 1WOMA 4HZGA 1QIIA 3WK9A 2HA4A 3GUUA 3C6BA 1B41A 5C81A 1BCSA 4QEKA 1YR2A 4TGLA 1GKKA 3UMJA 2XUIA 5AM5A 5F4ZA 3IB3A 1FFDA 1CPYA 4HXFB 5AO9A 3SK0A 4DGQA 3WK8A 3CCCA 2HRQA 3EBLA 1UZAA 1K4YA 4BCDA 4BAGA 4OB6A 2D0DA 4KYVA 1WM1A 4ZV7A 1MAHA 5K3EA 1AC5A 3QMWA 1JU4A 5AOCA 4L9AA 1QOZA 3C43A 1QIMA 2J4FA 2XMDA 2V96A 1GT6A 4F5ZA 3ICWA 4Y2RA 2B4KA 2O7VA 4Q3LA 2OG1A 1FSSA 4OYLA 4U2FA 5ALPA 2IIVA 3TEJA 4UFPA 1MNAA 3AILA 4J0IA 4IH1A 3FWHA 2WIDA 4KRXA 2Q0XA 3RLIA 2GYWA 3CN7A 4YASA 4FDMA 4X6XA 1ODTC 2PUHA 3FCYA 2ECFA 3QMVA 1IZ7A 1EH5A 5ALQA 2JGMA 4PSCA 2V97A 4B0PA 5ALWA 1DT5A 1CEXA 2PSEA 1C7JA 2HFJA 1AX9A 4C4YA 3K9BA 1J06A 4ETWA 4UBKA 1XZCA 4GEGA 2XMQA 2VJDA 4F0JA 1B6GA 3W2TA 3WYDA 4B84A 5FV4A 3HXKA 4ROTA 1X2EA 1EB8A 5JATA 3LCRA 3TJMA 3BF7A 1SCIA 2GZRA 4LXHA 4C87A 1E66A 4KEAA 3WLAA 3VISA 5BWCA 3ESCA 1E3QA 2HADA 4J0CA 4B6GA 4X95A 1QLWA 4UHFA 1YCDA 4BDTA 2XUDA 4CIBA 1JJBA 3ESBA 1ZD2P 2WG2A 4U2BA 4KR0A 1WB4A 2BUBA 4N8DA 2I03A 2XDWA 3C8HA 2DCMA 4B9AA 1UOPA 3R3YA 4QNNA 4LXGA 5E4TA 3WQHA 5FPPA 1T2NA 4N8EA 4D9JA 2QS9A 2XMZA 3QPAA 4OYYA 1DWOA 4MWTA 1QE3A 5AK3A 5FDFA 5AM0A 3RKSA 4AB1A 5SYMA 5ALZA 5HKBA 3W06A 4UHDA 1XLUA 2GYUA 4H7HA 1DINA 3ICVA 5AM1A 5JYCA 3I6ZA 3C6YA 4TPKA 4Y9SA 3STTA 5ALGA 4G9EA 4U2EA 4J03A 4MYSA 5C8ZA 4C6HA 4EY4A 2H7CA 5T4BA 5A7GA 4UFNA 1LPNA 1GPKA 3EQ9A 3D5EA 1R4ZA 1JKMA 4K5QA 4DMFA 2VJAA 1H2ZA 3G9XA 4EA6A 4JUIA 4Y2XA 4QE3A 4H7FA 2BCEA 1TCAA 3HZOA 2WFLA 2QXTA 1A7UA 1ZJ4A 5DWDA 1NU8A 1QFMA 4ZXFA 3WKDA 3ZLVA 2JGFA 1AQLA 3WL6A 3S8YA 3HACA 4OD0A 1ZGBA 5AJHA 1ZI6A 3QPDA 5JARA 2XQFA 4JH0A 1ZOIA 1GXSA 1QIEA 1TCCA 4P93A 2Y1KA 3U1TA 1QIKA 4X6UA 1BCRA 5LIPA 1CUWA 3BWXA 5AKXA 1MTZA 4Q34A 1ZD4A 4EHBA 4B81A 5FKJA 5LZ7A 1Y7IA 3N2ZB 2JEZA 5ALXA 5CT4A 2YXPX 2YASA 4FMPA 4GWLA 3V9AA 1XZIA 1JU3A 3V1KA 4FHZA 3JW8A 4O08A 2IITA 4L3WA 1XQWA 1GGVA 1MX1A 3NUZA 4IHAA 1CUEA 4AX4A 4IH4A 3C5WP 4RGYA 5HK8A 5CRIA 1BEZA 1YB7A 3L1IA 3AFIA 1G66A 3H2HA 4C4XA 4J7AA 2G5TA 5AM2A 3FAKA 2OPHA 1BE0A 3A6ZA 5T4HA 1TK3A 1QZ3A 4UUQA 5HF6A 1CUSA 1R88A 3W05A 4IQ4A 4EB0A 4TVKA 4DMHA 1LPPA 5FP0A 2HA2A 3R3UA 2CBGA 2WILA 4XX1A 5IVDA 1H2XA 1G4HA 5AKEA 2QVBA 1ZD3A 3IDAA 4A16A 1XLVA 4WFIA 5AH0A 4ARAA 4W9RA 4IO0A 3FVRA 1F0PA 5AIAA 3C5VA 4W1RA 4AXBA 1J1IA 2WQZA 3H2JA 3O4GA 2BFNA 1VA4A 1XRPA 4WY8A 2DR0A 5K3DA 3G02A 4OUKX 4K6GA 3PUIA 1USWA 1WB6A 4UBLA 5EGNA 2H9YA 3AIOA 4G1FA 1XRMA 4Y7DA 2XQJA 4WY5A 2QXUA
chains in the Genus database with same CATH superfamily
1WSDA 3AIMA 5C9ZA 3IVCA 1T2DA 4YCAA 2UVDA 4G07A 2LDXA 4M38A 5AHXA 3GPLA 2C5AA 2L18A 3COVA 1LF5A 1NM5A 5IM5A 2HO5A 4B34A 2P79A 2XQKA 1DAGA 1GADO 2H2AA 3LO5A 4IOLA 3TNDA 4EJSA 3Q8WA 5IZ4A 2H1CA 5F76A 3OO1A 4CIWA 1PUJA 4LC9A 4IIGA 1ITZA 1KERA 2IW3A 4JEIA 4II3A 4PGMA 4W1QA 4EJSC 5DNUA 3DZBA 1C7RA 2JGAA 3MRXA 2ZSHA 4YP6A 1JLLA 5E8RA 2V65A 3G8DA 1X7ZB 4ESEA 4R05A 3RIHA 2PN1A 2ZS9A 3ZUPA 2O2CA 2B3DA 4UNQA 1M8FA 3M70A 3KT0A 2WF9A 4J07A 4P34A 4E21A 1UC4B 4P9NA 4JI6B 2HU8A 4DZZA 3UCXA 4LXUA 1OX4A 4KQFA 1RQXA 2YC2C 3WGIA 2YYYA 1RPTA 3WQSB 1CC1S 1FTNA 2C9CA 2WUFA 3AX6A 3EMVA 2PXXA 5CGQB 2FW0A 3LWBA 1KR5A 1KFJB 5CVJA 4UCXA 4HNHA 2I2XB 4DJEC 3EGDA 4K7JA 5AK4A 5IX8A 5L3QA 3OOSA 2CMDA 3I4LA 1J0XO 2G7MC 3WHIA 4EKIA 1C81A 4PO9A 1C9DB 4HXYA 2C20A 5LYJF 2GJ8A 3V8EA 3AJ8A 4ZQBA 2ATCA 1I30A 1U5AA 5HCUA 4C6TB 2VYVA 2WK1A 2NNWB 1S2GA 1IHUA 1WWKA 2I5PO 2JAUA 3C3AA 1Q50A 1VHJA 1XYVA 2HMWA 2QXYA 5JAIA 2GNPA 2FE4A 3CWQA 3AU8A 1ISPA 2WWRA 4R2LA 3DL2A 4OU4A 3KWJA 4LPKA 5YASA 4YDQA 2GN8A 1TK2A 3JPWA 3ERCA 2UXDB 2XITA 5LOVB 2GPYA 1LNSA 1R0CA 5E6UA 5AKYA 1DJMA 4QUGA 2IY7A 4KRFA 2G5GX 2RFLA 2GRAA 2Z09A 3CCBA 3TM5A 1FDSA 1ZM2A 1C9EA 2XMPA 2CXPA 3BJRA 1QO0D 3I1YA 3L84A 2YL2A 3WGZA 4BFVA 4UPVA 5JQGA 5CYOA 1EX1A 4P33A 4P0QB 3SN6A 2NAFA 1LK7A 3CRVA 2B34A 3ZV4A 1SEPA 5BORA 1Q0PA 3IUEA 4C07A 1U8AA 1D04A 2XUAA 4FOSA 1SOAA 3AJ9A 3DM9B 4JOSA 3UKOA 1PZMA 3S3TA 2ADOA 4ZHSA 4FWIB 2C8KA 3FMGA 2HV9A 4DQUA 1PR4A 2VP5A 3LK7A 5C0OE 3IPCA 4KXNA 3AEKB 4F3NA 4LYEA 5D3QA 2E5LB 2JIZA 4RGVA 3EK2A 5AKKA 3THXA 4L6AA 3FYSA 3J81k 1CY8A 2IIBA 1Z28A 1E1CA 4WKPA 5KYUB 4Y3UA 3IT0A 2XGJA 1H8ED 3K0HA 4B48A 4MRRA 4BX3A 3MIZA 5ED0A 1YKGA 4Q05A 1XD8A 2WOJA 5JQWA 3CVVA 1NE2A 2NGRA 1XAGA 2JH8A 1V4BA 5ISMA 1FYFA 2OG2A 3BF8A 3F90A 2BY4A 2WHRA 3D4LA 1J2EA 4Q3NA 5SY9A 4OXYA 2O4UX 4AP5A 5BR8B 1YK1A 3DKKA 2IGTA 3DONA 3FBWA 2QBYB 1D5WA 3RYCB 3ZOZA 3PBKA 4EO7A 2YV2A 4I55F 2Y6UA 3N9IA 1P1KA 5ER6A 2V6BA 1UMCB 1MT3A 4HEHA 2Q29A 4JUAA 1NMZA 1TJ3A 1TLFA 1TUBB 2PMWB 4B6EA 1JQBA 4AQ7A 3P4XA 2ZZMA 3GLFA 3GWGA 5K0JA 1IUNA 3Q87B 3P27A 3PXGA 1GPAA 4IV5A 4NBNA 4JS0A 4LNUA 4NJMA 4GP7A 4P22A 5IAOA 4Y2GA 1ZUNB 2NU6A 3GJZA 5HFAA 4CI9A 4Z8XA 4ENQA 2C9BA 4YBRA 2FW6A 4UJ3A 3E7FA 1W52X 2D2EA 1TMGE 2P9FA 1TA4A 1KO4A 3GP3A 3RSOA 2G77B 1P19A 1HF3A 2X0RA 3QKUA 4W8GA 3LLCA 4HNTA 5JQGF 2J9GA 3BFJA 5LU8A 1SCQA 1XWWA 2V59A 4N54A 2AOTA 2Z6AA 2MYUA 2AN9A 2Y9MB 3IGFA 4ILKA 1ZUWA 3UJ8A 1L7AA 1H94A 1NXOA 3FWYA 1TJ4A 3OE7A 2B1GA 1M8GA 1OFUX 1OXTA 4UVGA 4Y6LA 1IULA 2ACVA 4F6CA 3KOZA 3E35A 1XCOA 1GRVA 5L51A 4HRYA 2MDTA 1R4AA 4P86A 2BFAA 1E96A 1J5EB 4HMOA 1Z0DA 2X8JB 1G0NA 4K9SA 2QTRA 3FR8A 4FZJA 4Q7MB 3AL2A 4NV1A 2WD9A 4RHCA 4ZQEA 3PWZA 4OU5A 1J90A 2CUZA 2BHLA 2EQ5A 4CF4A 2HCBA 4RL4A 3ZBPA 3FB4A 1J2TA 1ISGA 4ARZB 1KYQA 3DHNA 4G37A 4NYIR 5AQEA 3PGVA 2BGRA 4UTRA 5FL7A 2Z08A 3LWZA 4IOJA 4LMPA 2XZTA 1JHRA 2ZWMA 1C0LA 3GVIA 5TV2A 4B3IA 3GOHA 2WWYA 1O9HA 3MWEA 4F9TA 3ESQA 3DZHA 2JD2A 4I55A 1A7KA 1CVLA 4LZJA 1QIJA 3FZGA 1PQPA 3H4VA 4MS4A 3HB0A 1E2IA 2A1UA 2V9PA 2BCJQ 3C0KA 4YMWA 3SX0A 4RH3A 3V1YA 4LY6A 1Z4NA 2G9RA 1I2ZA 1ZM7A 4HFRA 2VTDA 4BCBA 5MGNA 3VVMA 3HUTA 3LWDA 1OI4A 5H8WA 1DAIA 1QGED 4LISA 2OLEA 2O7RA 3MXOA 2J59A 1U2EA 4FFBA 5EI5A 3WK7A 3KQKA 2IK8A 3AGPA 1NBME 3THSA 3SZUA 3ODPA 4QYTA 2FVXA 4V1CI 4Z7QB 1WMDA 1GRRA 1ZPDA 3K1YA 3GCGA 3BE6A 1JDTA 1ZK2A 3NDRA 3QF4A 2CFTA 3RQSA 3LFHA 2BGWA 2P67A 3M83A 1E4YA 2QD5A 4OKNA 5DLYA 5FULA 4QDJA 4CMIA 3U1BA 4GMGA 2GK6A 1IDN1 2I2DA 3GUYA 1DT3A 3USZA 4BN0A 1NJ1A 3CIFA 3E58A 4H4EA 4RA9A 4L9RA 5E2AA 3HKEA 3V1MA 3N76A 5KKAA 4UATA 1WMAA 5TPZD 1ODSA 2QV0A 3JVIA 4KMSA 1A5ZA 4EPTA 3EVDA 4N18A 3UH0A 3EPKA 4INOA 4BECA 4NYMQ 3Q11A 1JIJA 3NT2A 3FVVA 3HSSA 1N9GB 4RTPA 2I3BA 3K70C 6LDHA 4BO4A 2AFRA 1EFVA 2ZBDA 4K40A 3BRWD 4ZEWA 4AQYB 1G8KA 3PQ7A 1W5TA 2DAPA 4OBWA 3C4QA 4W7IA 4E5VA 1P1HA 4KO4S 4WWHA 5CA0F 2Z6QA 4X6YA 4DY4A 1GPLA 4QO8A 1DOZA 1UPTA 4F4UA 2DC1A 3FFAA 2Q9BA 1E9VA 4ZI7F 4G3XA 4MWZA 2X2EA 1H2EA 1FJXA 1D1QA 1NBMA 3KYCA 4S05A 3I64A 3QYPA 5D7NA 2GA8A 1H2HA 5J2UA 3ANNA 3GPBA 3P2OA 2AG0A 2K6GA 4LZZA 5FTMA 2V6JA 4G1BA 5B37A 1T5DX 1S9HA 3UGTA 1E1NA 2QY9A 4LSZA 3TSZA 5SICE 4RV4A 5DHFA 4TM7A 2IVFA 2E18A 3COWA 3MJRA 3A7EA 1M2KA 2VO1A 2W6OA 4IL5A 1E62A 2CCKA 2EZTA 4OQPA 2B61A 5JISA 3ZVRA 3FPFA 1QE0A 4EEKA 3H3XA 2VUSA 4DSAA 1AKYA 5TB5A 4AJKA 4PR3A 1L6RA 2W11A 4QWWA 5C5DA 3EEQA 4Z4CA 4B3JA 1IUKA 2MYNA 4W6ZA 3HKBA 3LD9A 4YMSA 1Z9BA 4F8EA 1GNSA 4FBGA 5DLDA 1JHAA 2Y2VA 4Z0HO 4PXAA 3EN0A 1GZ3A 1I4EB 1GL7A 3ENZA 1SCUA 5JI2E 1O2DA 3TNLA 4YUYA 1CY1A 1YMVA 1BWPA 3T5TA 1XU9A 4UU8A 3FNIA 1H4VB 1KOJA 4HTAA 4MUNA 5KSWB 5EG5A 3WGJA 1MO6A 3CEAA 4Z4IA 2Q5LA 2WJAA 3AUXA 3IAAA 3T41A 4RE5A 3UV6A 1YXMA 3WKBA 4A3SA 2L19A 1FFEA 1WQ3A 1C7FA 3CSUA 1XN4A 5IFLA 4ZU6X 1GR1A 4IW3B 3PQEA 4B6RA 2Q6VA 3GMTA 2OBBA 4BIIA 2A5JA 1R3DA 5DI3A 4YGYA 3OM8A 5IXYA 1PVVA 1E5TA 1HDRA 1PT7A 1QO9A 1U31A 2V9ZA 2WJWA 1AV7A 3KPYA 4LQDA 5HHTA 1EESA 4G0YA 2CUKA 1V11B 4NDZA 4TQAA 1RMQA 1CUAA 2HWKA 2DTDA 2OV3A 4NBLA 3EEYA 1ESNA 4X97A 4OI2A 5FPQA 1Z3CA 5A5GA 2CCJA 3GW8A 4UZSA 3HRKA 4A8HA 5E8JA 1E99A 3GJ7A 3L8HA 5SV2A 4TYMA 1XPUA 2YWRA 3RC8A 3GD7A 1RQPA 5D6OA 3Q9SA 1CXZA 1NOKA 1PL0A 2Y6VA 1OH7A 1PEDA 1GYRA 4X44A 2VBGA 4YV2A 2Y9PB 1Z62A 4G9GA 2XXAA 1KSJA 1YB4A 3BTOA 1UBMS 4K2AA 2Z2XA 4KIUA 1KYVA 3W78A 4O2BF 4WXYB 4BO5A 1TQ6A 1GSAA 1LDGA 3UJBA 1QP4A 3ICEA 2YHIA 3FKJA 1VQ1A 3IBTA 3I39X 1JBQA 1XA3A 4UQPA 3NTVA 5CT6A 3RJZA 4DG8A 2BSQA 4M0MA 1RVDA 5E1BA 4D4IA 1N2CB 4TWJA 3DBIA 2V5VA 2HT6A 2QUHA 3H2GA 4LJAA 1ZJWA 1WABA 1GFWA 3GLIB 3CR3C 4LHVA 1H9CA 1WS6A 2Q49A 2FQXA 1N2EA 4BBJA 4DR6B 1MB9A 2VR1A 1KI8A 1CV2A 2IQIA 2HBYA 3KP1A 1QXSA 4YACA 2JLBA 3HYSA 3NVKI 4DCMA 3L7AA 4E51A 2QR3A 2P2DA 1HFWA 1CNEA 1NHGA 3AW9A 4HSEA 4L95C 5JY1A 3RBZA 3NH6A 4YCJA 3ZW7A 4EGAA 4PLFA 1MO2A 2YJZA 3WNBA 5K8UA 4MPTA 1GAQA 3IQWA 1A9OA 3LUGA 4ZPXA 3OJOA 2E4VA 1CFJA 2F1JA 2IDKA 5GOTA 4PYIA 4UU0A 3VR5H 5JAOA 3C48A 4FOOA 1GJRA 2POQX 4H2DA 2DFPA 3O8RA 4INJA 4TMZA 3V4RA 3Q40A 4YTEA 2H1LA 1D6SA 2BBSA 4IYRA 2C4VA 2VHCA 3FYHA 3AHFA 3ONNA 3ZEAA 2QQ0A 3SZLA 1HDXA 4R7GA 5JSYA 3TIXB 4LK2A 5BY2A 3SJUA 1N6LA 2OYSA 2YIVX 1DAMA 1OZAA 2HMAA 3GLSA 4MOWA 3R9KA 5HKKD 1QDEA 3AF3A 3HI4A 4EUHA 1CCWA 4K88A 1A0OA 1EX6A 2H65A 1V5IA 3LF2A 1JG1A 4UCFA 5I51A 4OLJA 3QNMA 3NVAA 2O6HA 3FMOB 4TLAA 2CUNA 3CW2A 5EHNA 2YXBA 1PGQA 1L8AA 5JLAA 4AWBA 2BHSA 1DWPA 2QNBA 2ZRLA 4KQ1A 2AOWA 4RMNA 5JNUA 5KYYA 3WA6A 5JJLA 4LE2A 2PSJA 1H3NA 1T0UA 3DZFA 1QUEA 1N6PA 3T06B 2UZAA 3PE6A 1YVEI 3D7NA 3HKBB 3K0FA 3NORA 1NZJA 4EF5A 1PU2A 3FTNA 4PWZA 3P8ZA 2O2EA 4FYJA 1U2GC 4ZA2A 2WQ6A 2A0YA 3TLJA 2CVOA 3AI3A 2P9TA 3E9QA 1RXSA 4PQGA 1M9NA 1CUBA 2OB1A 4BN5A 4BVAA 1YDGA 2IU4A 4OJNA 1VLMA 2FMHA 4FJ1A 4WCVA 1IEWA 5KDLA 2O05A 4JR2A 3UAOA 3KDAA 4ZANA 3QEBZ 3AEZA 2B9VA 1ORDA 3HLTA 5ARCA 4HH4A 2OORC 3HYNA 1JR4A 1USIA 2C4KA 5BSWA 5CEEA 4D81A 3A4YA 3MUOA 3VVBA 4AX8A 3G9ZA 2CNNA 3LBIA 3TQHA 2P2GA 1DBIA 1U0EA 1YBMA 2C31A 5DWVA 2XF8A 5J2UB 4J1TC 3W79A 5JVDA 2QK4A 2VQSA 1N5IA 2Z8YA 2YXDA 5DM4A 4NMLA 1ZRSA 1E32A 3D81A 3RBVA 1M1YE 4F92B 1GGKA 1WPGA 4BMVA 2QM3A 3DHVA 1ZGAA 5DRYA 3REQB 3THOA 2A9PA 4NG5A 3QUAA 1J8DA 1EU1A 1UBHS 1M2VA 3E7DA 3KJQA 4M1YA 4UKDA 5BW6B 2QVCA 1H69A 3I04M 1I94B 2IE0A 1T9GS 1RYEA 1HYBA 3BAZA 3R7DA 3RUAA 2NUAA 2QLFA 2UUAB 3EGOA 2BPOA 3EAGA 1E0KA 2BN4A 1Q1BA 3ZS9A 2HQOA 1VLHA 1BOFA 1N8NA 2IODA 1PJQA 4JJZA 4AN1A 2WHPA 4ZGGA 4KQMA 4OOEA 4N40A 2YRFA 4UE6A 4WLNA 1M6VA 3WG9A 4ZGWA 2YINC 3M8KA 2PVSA 3HCBA 2NSJA 1P7YA 4ZCMA 5J3JA 3DBRA 1M1XB 3GP8A 1SC9A 3G88A 3IVMA 3MJDA 4US1R 5CCDA 3T5PA 2Z5VA 5ALEA 4EG4A 4HUJA 3NANA 1M7BA 3U26A 2OFOA 2BISA 2AV6A 1NUSA 2D7CA 3JPYA 1PNOA 5C5EA 2I66A 2JB9A 3CZAA 2IEYA 2CVHA 4R5HA 4NFYA 5UKDA 4EFNA 5BYAA 3MK31 5IWAB 1D1PA 4OHRA 4INAA 3JATA 4EKYA 3BC1A 4RFLA 3PXXA 3U5ZB 1ODJA 2P5SA 3LNCA 4EQZA 4CFSA 2X4DA 3H18A 1NVWQ 2W2PA 4RVNA 2VCEA 2OE2A 4DIBA 1Y8QA 1TGVA 3DFZA 3JALA 3QBDA 3M49A 5GJWC 2BF4A 3BE4A 4PHFA 2B7LA 2OESA 4S1PA 1AN9A 1U3GA 1VJ0A 2PKRA 3WLNA 1T2EA 3I58A 3P2EA 1WXGA 3RUFA 4FTWA 3WRXA 2UYHA 4TKUB 4UNIA 4JLMA 1UT6A 5EYPB 3RSLA 3BRQA 4E1BA 2OM6A 3R0XA 4KRGA 4MS4B 4QXMA 4AIIA 4CQJA 4DYVA 1UBUS 5BN5A 2BFOA 1YOBA 2OOKA 2C9MA 3FOBA 1GV1A 1W4RA 2QLJA 3I52A 1RVV1 3KXPA 3MWEB 5DISB 4E2XA 2A58A 4I3GA 1XBTA 2XQIA 4Q4DA 3DP9A 2Q4TA 4R0VA 1TUGA 3EVZA 4DW8A 2XPCA 3L7KA 3TBFA 1MB4A 2JVKA 1IEQA 5FTLA 3K05A 3ZTYA 1TRHA 2E37A 4R3WA 1O4WA 3L9XA 4EG0A 1AB5A 4AD8A 4BUJA 2K87A 1BA2A 1C9NA 1PVOA 3O1LA 5KHOC 2QRQA 5B7PA 5KNLA 1OXVA 2NYUA 2XSZA 2C9ZA 4ESVA 4EW6A 1R0ZA 2GWHA 5E7QA 4C4TA 4NZNA 1E6UA 1QAMA 3IAUA 3EXG2 3L46A 4LQ4A 3GJRA 3ABQB 4PQEA 3ANYB 3FBGA 1W4LA 4PFQA 4WCDA 1M7HA 4ND1A 1R4NB 1SBQA 1E79D 3H5IA 5WRFA 2OOSA 3M6UA 4RLSA 3EQZA 3PCTA 3VPAA 3PXDA 3SR4A 4UZFA 1QHHB 3EA0A 3GPCA 3UGKA 3ADBA 4E4YA 4M54A 2GHRA 2W6CX 3QMMA 2XKAA 4FWBA 4PQRA 3WC4A 1ACLA 4PC3A 2FU5C 3D2CA 1DX4A 1FUYB 3VAAA 1KDTA 5B36A 1R9MA 2P8JA 3QXGA 4QDOA 1WY5A 4B8YA 2QR5A 3AY0A 4D6XA 3QUCA 1IY2A 3E5HA 3S1AA 1KAMA 2B5OA 2EG5A 3DLIA 2WTMA 1R50A 2WIGA 2FP4A 4N3NA 2EYUA 1ZH4A 3II6X 3JYPA 4ZDKA 5JNWA 1T8UA 2LPMA 4B9EA 2EDCA 5JJIA 4O2LA 3NBMA 1EPUA 1N2IA 5THXA 3O3OB 4EIWA 4QXOA 4K3VA 5KX5B 3RWBA 3DZCA 3RYCA 3VNAA 3AL3A 1TKRA 1B0UA 1JQAA 5AKZA 3EGXB 5AKHA 4I9NA 1BXRA 1UBOS 4YVFA 5EWMA 1Z39A 1D09A 2EFEB 2HPZA 4JKIA 4TWZA 5BN4B 3BULA 1JEQA 3NIFB 3MGBA 3B9QA 4EKEA 4YFYA 1R1DA 1TCUA 2WSIA 3RD5A 5JE8A 5K3OA 2WPDA 4M1MA 3EH2A 1ZN8A 1OWNA 3V97A 3FOWA 1AKVA 3F5QA 4IGAA 4W82A 1CQWA 5CK5A 1ZNWA 3EXIA 3NC4A 3WXBA 3LVFO 2G9ZA 4YDRA 4B76A 3SXJA 4FT4A 4MVJA 5G53C 4D5EA 1RP7A 4BMDA 3DT8A 3A8TA 5U1PA 3DG9A 1V9LA 1YOVB 4ZQFA 3HJAA 2VYCA 4NFLA 1SUEA 3AKDA 1FXUA 2DVMA 2HIGA 3VKHA 2ZIAA 2VP4A 2CXUA 3Q7EA 4D57A 1SKMA 1IB0A 5K4AA 1U0SY 2ZEJA 1ESMA 2A30A 1EUCA 3IE2A 3R3WA 4LYYA 4DCOA 1GEGA 5JQGB 4EG3A 2R62A 1VHWA 3LLUA 3W9BA 3ZBUA 5FPHA 2WMOB 1CQPA 3I6IA 3AFOA 3PXCX 4H0NA 4HFMA 4M9RA 4PZDA 5HIMA 2PMEA 1E8NA 4MVJG 4YMTA 3SSAA 1VMEA 1QK5A 1KH3A 4FZ5A 1TD1A 4GP9A 3R7FA 3V7FA 5AOBA 1GNRA 1GTJ1 3KVYA 1HQCA 1Z4KA 4GOND 4MYTA 1WMFA 5LZ2A 3DBHB 1MJHA 3TZQA 1WZEA 4G26A 1ORIA 1XXLA 4YRRA 2UZ4A 1B14A 1IZZA 5AW2A 1KAEA 1NGSA 1JX6A 2WFAA 4UBNA 1HYGA 3TJRA 4QDUA 2IYQA 4EDFA 3NM6B 1LSUA 1SOWA 3DBLB 4JLUA 5E3JA 1OV4A 3GEDA 4NBKA 3VFDA 1X3SA 5K45A 4K9KA 1RI2A 4BTVA 3IPLA 1HZJA 4HXEB 4MJ7A 4C2TA 4OP3A 2PGJA 4XE5A 2ERYA 3L9WA 3SSMA 3CJRA 4Q5IA 4YV7A 1Q6ZA 2JASA 4DMRA 1DX6A 2PDAA 2RGEA 5DV9A 5TMPA 3GUCA 4MAAA 4ZT7A 1Z3IX 2N1MA 1YTUA 4G36A 1L7XA 3N05A 2YWBA 1U3VA 1JKFA 3EHEA 4HPWA 2R1VB 4KE9A 4LF4B 3CN9A 3ORFA 1QIHA 3JWHA 2JAOA 4JB0A 4YJGB 3NJ8A 4KL8S 1K7SN 1RM3A 3OTHA 4K0RA 4BJ5A 5CJPA 4BJ3A 3EDOA 4MW2A 3ENKA 2OP1A 1QPBA 2H31A 3BJEA 4OSPA 3PDJA 3LY9A 5LXTB 3BCUA 2P2NA 2O8EA 3EASA 1BH2A 1L2TA 2WB4A 3D4BA 1LZKA 3IQIX 3PPVA 2P27A 4D43A 2ZUFA 2LIVA 3O3NB 3K2QA 4GPTA 2FEAA 3H6HA 1XROA 4AP9A 1XR3A 4GOKA 2ZRCA 4RD6A 2JZCA 3LHFA 4CL2A 1ENOA 4GZ5A 3A9WA 2IH5A 2CFOA 2OFPA 3TSYA 4TL7A 2PLNA 3KQQA 4BLWA 4UCWA 1RAHA 1USKA 2D3TA 5BW4A 3R9WA 1QS0B 4U7DA 5CH8A 1SKBA 2QRZA 4UULA 4DMUB 1I7NA 1R4MB 3EC7A 1HZZA 4M8LA 4NU0A 4DWWA 5JH7F 1P72A 3IAM6 4G4JA 4RF2A 3JASA 4K03A 3HFSA 3ILVA 3K0CC 4DZTA 4J16A 4GC9A 4Z9FA 2FPPB 1YZTA 4RACA 5FXMA 1SHKA 2WJ6A 3EGCA 5ELMA 2BRUC 2FMXA 2Y0CA 5JT1A 1WUKS 3EVTA 1W76A 3DL4A 4Q12A 4QTZA 3V4ZA 2IXBA 2W6ID 2PE5A 5DK6A 1T6BY 3PJRA 3M0EA 1GTVA 3BMOB 4BEVA 1E2PA 1NDUA 2D1FA 3A10A 3NHBA 4O0MA 2OHVA 1VIAA 3U62A 1POWA 3G1UA 5I3CA 1X19A 2B7CA 1JQLB 2YZKA 3MPOA 4YUXA 1HNWB 4S1VA 4GWGA 1L5HA 2R7AA 2GM4A 3HCFA 3GOQA 1WLYA 2INGX 2IX9A 3CVOA 1HI9A 3U39A 3F98A 1YZVA 4JJKA 4ZRMA 3QNWA 1C1HA 1W0KA 4HATA 1N0IA 2DX7A 2WVJA 4FFMA 4MVJE 1G7RA 4FJ2A 2BFEB 3AR7A 1YZLA 5DYYA 1P45A 1ID1A 2CFIA 3AF0A 4B45A 5LYJB 2ZROA 4P5PA 2FPXA 1CW2B 4GRDA 3WWZA 1O94A 3RBXA 1WVMA 2F1RA 2VJMB 4YI5A 3IVAA 5D86A 1QB8A 3SF8B 2XKJE 3A31A 2PCLA 3D3WA 4DPKA 2GMWA 2AN1A 3DR5A 4DCSA 1RCUA 1VMDA 3DVAA 5KYGA 1MQAA 1S8OA 4Z4HA 4GWKA 1IK4A 4LYJA 3WLPA 3VZRA 5CU7A 1OYWA 4ZARA 1WHSB 1LQ2A 2FK7A 3D3WB 4WD3A 4KFCA 2HC9A 1TA9A 1TM3E 2O3SA 3ECCA 1B73A 3ONFA 4R1PA 3CRZA 1F7VA 1HLDA 3DKRA 4LPSA 5FX2A 3DE7X 5TQ2B 2YY7A 3MXTA 4RY9A 3KQVA 2CD7A 3GGCA 3ORRA 1R6BX 4IHJF 4FR0A 4M21A 3H1BA 4Y1RA 3WJ2A 1U2SA 2YWDA 5EEHA 3ZXXA 2OGUA 1ONOA 5I4CA 1R2QA 4MDHA 3IR5A 1FOEB 1C29B 2UKDA 1C30A 3I76A 3ASUA 3LT2A 3OTIA 4RZSA 3FF1A 4ZCQA 4IINA 4NBWA 5LN1A 5HR5A 2PX3A 1L4YA 1WTAA 2NADA 4PANA 5IJZA 1OD6A 1P2SA 2L42A 1N5LA 5JH7B 5DCLA 3W2HA 5JYCA 1Z83A 3CF6R 4U3JB 1JHDA 2QRUA 3AZOA 2GA9A 3NHZA 2N3ZA 4MV8A 4ZU1X 3ABSB 1AGPA 4HVCA 4TKVA 4QOFA 2XOXA 5AM4A 2D1RA 3WYEA 2DWPA 4BO8A 1Q2UA 3OTQA 3R2JA 4FGZA 2QX4A 2NOAA 5AI4A 2GUWA 3H3FA 3MT9A 1X8JA 2XXJA 3RTAA 2F43B 3BIXA 4P7BA 2J3JA 5EP4A 1Q84A 2XVAA 1B93A 3T1VA 5BN3B 5HM8A 4OA8A 2MTBA 1EHYA 5TMEA 3RGGA 1Z22A 2J41A 3MCAA 2VRCD 1SBCA 4WLFA 7ADHA 1Z5WA 5G4KB 5FOSA 5HIAA 2AZ4A 3V2HA 4AQDA 3HE3A 2VP2A 3RFCA 5IDWA 3UAWA 3DXYA 3FLAA 3GVHA 1L7RA 1BWQA 3OZCA 4LRXA 1NPYA 3B48A 5DRTA 5ICFA 1G6HA 2VOJA 2DM6A 2AL7A 4JMPA 4K9NA 4DJJA 3EX7C 4A15A 1XCLA 1RAAA 4DV7B 5TSDA 3ZCRA 2ZAIA 2FW9A 4DSUA 2G1UA 4ZCLA 1KY4A 1YZGA 3WWEA 5A5VA 1YQDA 3UB3A 4H1TA 1DKUA 5ADHA 3DQZA 2AE1A 1Y63A 3IUMA 5M2QA 5BXQC 3SR3A 4KE6A 4KQJA 1GARA 2P77A 3CGGA 3AVWA 1L5YA 3NKVA 3ZWBA 1DJLA 4L5IA 4UPDA 4ID9A 2C0QA 1JPUA 3LFUA 3LUKA 3P45A 4NEQA 1E3DA 4A10A 3CE6A 5DASA 4BE9A 2C2OA 4OHKA 3OFJA 4C20A 1Z0UA 2RC5A 1WG8A 2RH5A 3R4CA 4RVGA 2Q4RA 3TLZA 5AESA 1J56A 2D13A 1E6CA 1FU8A 3LUCA 2Z6VA 5LB4A 1WPQA 3PT5A 3G2IA 5H9WA 4F2HA 4PBRA 2CNDA 1Z68A 2KSQA 4JQZA 1FC0A 1XP5A 2G40A 2PYIA 3CT4A 1GYPA 2F90A 3GIWA 1X42A 2X19A 2GBCA 4YNBA 5DPMA 5DTQA 5K3AA 2C2YA 1SG6A 1I7QB 4R1LA 1XTVA 3O3MB 4C0KA 2YN0A 5CVVA 4TRRA 1F2UB 3MJVA 4CLEA 4V03A 4ZVPA 1G2IA 5DLPA 3Q88A 3M4NA 2QQEA 4OQYA 4W1PA 1E5VA 2M98A 3WQBA 3Q4GA 1LRKA 4JI2B 3F47A 4YAJA 3BD9A 1O0BA 1R5BA 3TN7A 3ZV3A 4H3KB 1J0AA 2IPXA 5EWJB 3ZQ6A 5EQFA 3Q12A 4MWDA 3UWPA 3AEUB 3LW8A 4K05A 4YAGA 2ADFA 2XRFA 4EARA 4JI0B 3C4JA 3GRUA 3IALA 3OPXA 2FPMA 3I2HA 3PJEA 3C97A 4AF7A 4FDVA 1KZ1A 2J9YB 5CHEA 4AWAA 4S1NA 3TMAA 3V3KA 1YI8A 1FP4A 1PZHA 1CS0B 5FNVF 5L3VA 1MAUA 3TBKA 3A9SA 4O1HA 1P5JA 3PUWA 4FMDF 5B1YA 3JQAB 5EQJB 1RR6A 3NCTA 4FN4A 4OCZA 5CNIA 1L5KA 1ISMA 4DDHA 4MVWA 2R8EA 2ENUA 1H8HA 1CQIB 5IC5A 4DHWA 4CEHB 1FFBA 1R0BA 4WOKA 2VP0A 4U2GA 3OJWA 3GRYA 4NZ9A 1JIXA 1NPTO 1J8YF 2Q07A 3B6JA 1P4SA 2IHUA 2IPNA 4G65A 3ICPA 8ABPA 2IBSA 4IFTA 2HT1A 4M9XA 4DS3A 4PE5B 5BQ3A 3RC3A 4ARBA 1VCHA 3DE3X 4R9RA 2AYYA 4G8BA 4OMDA 2VCYA 1I2BA 2YV1A 3QVKA 4EGJA 4DB2A 2MSCB 3REGA 4OHFA 4P3XA 4PINA 2Z3VA 3QFTA 2R8YA 3DS8A 1HY3A 3T7AA 1T4GA 3WJ7A 3HDQA 2VLBA 1CUFA 2XDAA 3HWWA 3HEMA 4RTQA 3IV7A 4D3YA 4F7WA 4BFTA 4YDHB 2AQKA 2EBUA 1UDRA 2CXQA 3RRNA 5BUCA 3PUXA 1PNRA 1QKIA 4UHCA 3F97A 5FNVB 4IIYA 4WLOA 3Q8LA 4IM7A 5F7XA 3O4VA 2RONA 4FMDB 1NAIA 4JI5B 1JEJA 1JJ7A 1UADA 2ZI4A 1M5RA 3V6MA 1RYBA 1ACJA 1NF3A 2I2FA 3PHBE 2RHLA 2W43A 2PBFA 2VBFA 4X0EA 3BL6A 3D1VA 3H9JA 4CUZA 2A4MA 3GZTB 4EI2A 2QRPA 4DTCA 1MOZA 2DTXA 5HNKA 8GPBA 2Z8YM 5B2EA 4QICA 5I6DA 3SC6A 1T8PA 5IDXA 4ZC1A 5HX7A 5KOHB 3L6CA 2JLWA 2PXHA 5JI3E 2XTNA 3FHOA 4UFPA 1T2CA 3WKAA 1DQYA 3W4JA 1IY1A 3OHPA 5CBPA 1SUWA 4E6EA 1E79A 1LVHA 3HBJA 4XEUA 3SX4A 3VXKA 3CWZA 1QG2A 2EBFX 4HZUA 2I99A 4RL6A 5EWLB 2V0GA 4E32A 3E3LA 2NG1A 2PH5A 2CLSA 3EVNA 3FR7A 2Z83A 1BA3A 3CFYA 3HN7A 4IIXA 1CZOA 1BKDR 1SC6A 2ZPTX 2E1RA 4NS4A 4PAGA 4G2NA 4B87A 4X7BA 4XVRA 1LI5A 1XUOA 2B82A 2QTZA 2EF1A 5T5QA 5HXAA 2XZDA 3EDQA 2XUJA 2IP4A 4NOKA 3WYNA 2H3HA 1JFRA 3LC0A 5DIZA 3JD1A 2C2BA 4EKNB 3LRPA 5HKLA 4ADSG 3GJ6A 5G0UA 3B1WA 3K4PA 1X7WB 3FKSD 1EM8B 1UIMA 1Y9ZA 1SU4A 1Z8NA 1HE2A 2F62A 2PH1A 2VXCA 3JD2A 5DO9A 4YWHA 4LJYA 1N1MA 5CT5A 1VIDA 2NXWA 3LRTA 3PQ4A 1D4FA 1H6BA 1CZUA 1TDJA 2BEVA 2PYZA 3DMDA 3KZ1E 3RK4A 5T4EA 4EVSA 1TFUA 3HDJA 2JBAB 4KNWA 4HOYA 4I8DA 3DA8A 3DXFA 4FLFA 1VP9A 1FTSA 2XD4A 5F23A 4RTKA 3EPJA 4KVFA 3E0XA 3NNNA 4OXRA 1MVNA 1E2EA 2PZGA 4TXMA 2ZCUA 1HTWA 1G8SA 1PS9A 1K0FA 4ETNA 4J2OA 1PLJA 1CUHA 1UAAA 5DNVA 5ARDA 5F35A 1XA0A 1XVLA 4JJ7A 4BFWA 4TKUA 1R0WA 2AX4A 1TX4B 3KQTA 3UOAB 3E3MA 5DHUA 3ND8A 1P5RA 5M5BA 1ZBQA 3IT1A 2J5RA 1Y82A 5K0FA 1CUUA 1XCMA 3CUEF 3HR4A 5EIBD 3QPUA 5CCBA 2HJVA 1MC4A 4UAUA 2Y1OA 2UYQA 1X70A 3BZBA 4M1TA 1OA0A 4MUAA 3NHFA 1ZNYA 4BL5A 1DKRA 4TLMB 4K8OA 4HDQB 4BVBA 3MQ2A 1ZUIA 2NW6A 4D5GA 2JRCA 4OY3A 1BMFA 2Q1SA 4EI9A 2B6HA 2XLBA 4Y67A 2FDCA 1RWOA 1SBNE 1JWAB 2FY8A 3NBYC 4F3CA 5ALTA 1SAYA 2EJVA 2N42A 1QK3A 1YRBA 4RHFA 4XDYA 3EUFA 5KQGA 4O4IF 3ROFA 3WZ2A 4ZVNA 4HUQA 4YP0A 5E2BA 2Q27A 1QBGA 4B3BA 1OE0A 2IYLD 3ZDRA 3O8CA 4L15A 4C4PA 3ONDA 1M1NB 3H5OA 3RYHA 1B1CA 2YJ6A 4JJAA 3TWOA 1EX9A 1YBFA 2VDNB 1PEYA 3W77A 3BGDA 3P4UA 3TUZC 3HY4A 2DYKA 5CFZA 3Q8MA 1JHXA 5JCXA 3WKCA 3QUTA 1HE4A 2JLYA 1H1LA 5DBOA 4UW9A 3TUIC 3PEYA 1H4SA 1YASA 2P9CA 3B60A 2AUNA 1PJBA 1Z06A 4L5JA 9GPBA 1ZNZA 1M2WA 2R96A 4ZVVA 1Y6FA 2HYIC 3WGTA 3CLUD 4ND8B 4EG7A 2A1IA 4F6RB 1L5WA 3BGVA 5H4GA 3WIVA 3NYWA 4O33A 2PFKA 2JLCA 3B3QA 5AW4A 3NTXA 4MUBA 4P7KA 2JHAA 1FUUA 4OQQA 3VR4D 2AXPA 2CMHA 3DTTA 4PG6A 2C82A 5C8XA 1LLUA 2O5CA 3RHSA 1PN3A 1L5VA 2ZDQA 3DHYA 1AGYA 4H3HB 1W36D 2CBZA 3GZJA 1QF6A 4QOJA 5JU6A 5IVKA 1W9MA 1QV6A 1C3OB 5IPFA 4J7UA 4DC0A 2GKGA 5B2ZA 4AMUA 4R98A 1Z6AA 4FDLA 2WMDA 1R00A 3K0FB 3WK5A 4UBIA 5KOIA 3QKTA 2F1IA 4HLCA 1BXZA 4LBZA 2PPVA 1REQB 2ZTHA 3AETA 4KQGA 1A72A 4W63A 1UMDA 3I61A 3WWCA 4O4IA 3TSAA 3ETLA 3IVRA 5ABPA 3M6VA 4MROA 4WI1A 2ADMA 5JXGA 3ZDDA 1F8YA 3H65A 4IIVA 4POAA 4YRNA 1CTQA 1O94D 3B5IA 2IYWA 2GD2A 4JBNA 1KU6A 2VHEA 1PZGA 3HEAA 4EHIA 5IHPA 1U1IA 4FEGA 4EUNA 1ZC3A 1CYDA 5G40A 3F46A 2XCSB 1PSWA 4YJ2B 4G4SO 4I50A 2Y1XA 4Y0AA 3AKCA 5JZ9A 2WM9B 2IZZA 3HA5A 3SSOA 1NN0A 3I2GA 2X0DA 1JXMA 1J97A 2GBGA 3IA7A 3RKUA 4L27A 2ZB4A 3QTBA 5IW8A 2EFCB 2EZUA 1NSFA 3LHKA 1E4VA 1G20A 1G16A 2JIBA 2FXVA 4ZJZA 2EAUA 3EIHA 3KT6A 5IXJA 2VTBB 3KSMA 2P4SA 1GCOA 1O4VA 3KFVA 3GLTA 3IT2A 3ENWA 2YYAA 1DARA 3ABZA 4B6QA 4HDSB 4BNXA 1U28A 4PZ9A 5CEFA 2I80A 1V16A 2FCAA 4R7TA 1KAOA 4HGZA 3HS3A 5AVJA 3BJMA 2RAUA 1Q0RA 1SCKA 5HRAA 4MGZR 1LEHA 1PNVA 4X60A 1NV8A 3RODA 4BVFA 2YQ4A 3TD9A 1EJ2A 3LPDA 1SZPA 3DDCA 1CJTC 3ZDAA 1E8MA 2YIDA 5CMLA 3VVCA 1IZ8A 5CCEA 4OSOA 3LA8A 3ZKWB 1ZNQO 4A9AA 2CK3A 3G0CA 2PR7A 3ZXSA 2V1XA 1NUHA 4W5JA 4AVYA 1IHYA 1HDYA 1AQNA 3HBFA 3CLSC 3V55A 3TF5A 1P2BA 3QPCA 5HMMA 3T4EA 3NRJA 4IGEA 1YS2X 4CDNA 5IJ9A 3B12A 3EWSA 3WYCA 2PSSA 2YQZA 3KV3O 3OQIB 4GBJA 4LC1A 4WJKB 3IOYA 4URFA 5D8DA 5LZ8A 3R1IA 2GCNA 5FBQB 2JAWA 3K9HA 5EZ5A 3VNUA 3SE7A 3T3OA 2VJLA 4HLQB 2OXCA 3ND7A 3RFTA 1J7KA 4URWR 1XTUA 3O8BA 4MAFA 1GU7A 3L40A 4HN4B 4QBGB 1S3IA 4X1IA 1GAEO 2ZYTX 5T3UA 3ZH2A 2VJOA 1QDUA 3N1UA 4G63A 1LBTA 1RAEA 3TCNA 1TEHA 2KBFA 2FSVC 4ZAVA 4D2IA 3I01A 1RIIA 2IYOA 3IAM1 5HQ3B 1U0TA 3KOWA 3GB9A 3P5SA 1MIOA 2FSVA 1B0AA 3C87A 2XNDD 3N74A 4HAYA 1X7YB 4J90A 4Z4EA 2PH3A 1V1RA 3D6MA 3A4NA 3JAWA 2GETA 1T10A 1ZLYA 1K4KA 2QTLA 2ZATA 4CKEB 1G1AA 1TW3A 4JY7A 5DN9A 5DP1A 1ZCJA 3VPFA 1TFRA 1YB5A 4BMSA 1MEOA 1ZIOA 7ABPA 3KTOA 5IKEA 4LJ6A 2VP9A 1K6XA 4LDNA 4EUKA 1GCIA 1KDOA 3CGWA 4KFUA 4MP8A 5JSQA 1HBJA 5GVRA 2O0LA 1NBOA 2CXXA 3A1FA 2Q3HA 1K27A 1ZN7A 1CDEA 1XEAA 3CNQS 3PIIA 1U9IC 3A32A 3STYA 2CLLB 3GA7A 1IPFA 1LWNA 2Y71A 2JZOA 3A2LA 4KUEA 4Q7JB 2OQVA 4C0XA 1X92A 4RQBA 5BSGA 3AJDA 2A67A 4QT0A 5BMOA 2R00A 4LGVA 4XKJA 1JVBA 3CSDA 1PV1A 3HDHA 3DZKA 4MPDA 1NN5A 5AK6A 5C32A 5G1NA 1YB1A 3S2SA 3LHSA 1VBFA 1TZJA 4O4LA 4EMTA 1FJGB 1LNZA 1ZSVA 1W88A 2VPQA 1C7IA 4KRYA 4YIHA 4XX0A 4W4TA 4GVPA 5FI3A 5DB4A 3HJGA 5DNWA 3TGPA 4MRPA 4KREA 2OCLA 4FCVA 1J1UA 1JKIA 1KZ4A 3LUAA 3EIXA 2G0TA 1TTPB 2OPBA 4R1MA 1EFPB 2FF5A 2J85A 1JLMA 4IJ5A 4ERXA 1SXJE 2CLHB 1MA3A 1SPXA 2BZ1A 2P62A 3CXRA 5A4JA 4AI6A 2ZJAA 3V2IA 2L2QA 1P7ZA 3JAMA 4M46A 4M1WA 4CDMA 5FO1A 2WABA 5M04A 1UDAA 1YJQA 3IH5A 4DIDA 4DIKA 3A1VA 4OHVA 3BT7A 4FE7A 5DYWA 4BWYA 1DMSA 1B74A 1WDMA 2WVGA 2AG1A 3N2IA 2W6QA 4EAAA 4DSTA 4P36A 1G21B 1N5OX 3MMSA 3OE5A 1P74A 3FOAA 3FOEC 4UUOA 2V45A 1N5DA 2GF9A 3I72A 3QUSA 3ZDQA 3ZLBA 2P68A 5FBKA 1FX1A 4J16C 3SJZA 3T9FA 1TD9A 5EPEA 2QW1A 4DXHA 3GAAA 4N03A 1GPUA 4ZO8A 1Y3DE 3QPVA 2QVYX 5DU2A 3U3KA 1CS4C 1OFTA 1RLJA 1ESDA 5TPZA 5DI9A 2OWEA 1J42A 4HAIA 5F1KA 4D1YA 3LQ1A 2PMFA 4E13A 2YWHA 3PIRA 2QU7A 4JDUA 5K09A 4E2FA 2IEIA 2QLLA 3CRMA 5TNXA 1A9TA 4Q1EA 4QPNA 1E5XA 2BGMA 5KYWA 3UHOA 1UOQA 3UWKA 1X1RA 2I6UA 2I6QA 4Q1DA 2G9NA 4HYQA 4UU1A 5FV7A 5IN5A 2VTVA 1EWTA 3ICOA 5IVIA 4ATNA 3OT4A 1Q83A 4UDYX 3UWOA 3OPVA 1Q3HA 1TAGA 4BNDA 5JWRA 3K32A 3CM0A 1GTRA 4A8TA 3LZ6A 1BEUB 4QG3A 1EM6A 3KJZA 4Q82A 4MW0A 3P9NA 4F1JA 3CNNA 3L79A 4DR1B 1SZJG 2IZ0A 1F14A 4EY5A 4QDXA 3QF4B 5U4XA 4KN6A 1Y1QA 2CYCA 3CUSA 4M0KA 2D0OB 1LDNA 1TM7E 4C6SA 2IRWA 4PNEA 5GZ6A 5JNSA 3CJTA 3RVBA 3JQCA 5CAEA 4E12A 1AMNA 3HA7A 1UJCA 1VA5A 2MIIA 4Y30A 4FFBB 4HEQA 4UJ5A 4RTNA 2WSYB 2PUJA 5TC4A 1L1FA 4CF5A 1EUZA 3CH4B 2GRUA 3EXFB 4GUDA 1WCIB 3UHFA 1TQ4A 4PS0A 1T4BA 4M7PA 4XIFA 4OIFA 1ZU4A 3NDJA 3VSCA 3ZV7A 4MJ3A 3ZDXB 1AZWA 2RGUA 1E5DA 1QAQA 1LC3A 2AK2A 4G4SP 2FJ0A 4UVEA 5HTKA 4YRGA 3ZLJA 2GPAA 4MI3A 3FRHA 3DPSA 4FZRA 5JZSA 1L7MA 3R7LA 1FVOA 1Y7PA 5NULA 5DW3A 1FYWA 4I5DA 5CG1A 4BZZA 4N49A 1KEWA 4ARZA 1UPAA 1ZL2A 3HY6A 1HM5A 1LNQA 3R44A 1W19A 4YP9A 5AKGA 3M1IA 4CL3A 8MHTA 2BUAA 1E1QD 2R7MA 3T3EA 3PIDA 5AUPB 4GI7A 2DHDA 3NIBA 2HRBA 4JGGA 3A9VA 3I9JA 3PB3A 1UK9A 1O97C 2X9GA 4TL8A 4B82A 2OGTA 5D3MB 4CIAA 3THRA 5ALUA 3ZEIA 5KKCA 4R54A 5B1IA 4INZA 1N3IA 2HIMA 4JJFA 4M89A 4KDFA 2YOFA 1VE1A 3CZ9A 5F3DA 4N7BA 1YV9A 1ZK0A 2F6RA 2YWCA 1PYDA 1QYIA 3ABOB 3G8CA 4IWYA 3TZHA 1I32A 4A0SA 2R85A 3PQDA 3DL0A 3GD5A 4J1QA 3JQ8B 5KDDA 1FU7A 3AYXB 4BP1A 1TVMA 2MR5A 3NB0A 2OUIA 3PUYA 1EFRD 2PUTA 4GLOA 1ZMRA 3AR2A 5C1IA 1FLVA 4DLNA 3U3MA 3UHPA 2X76A 3FPLA 2NU6B 1FLNA 1P2FA 2I2BA 4NK5A 5CTJA 3LBYA 3ZTWA 3NOVA 3VR4A 3D54D 1CKEA 3EZFA 1QTIA 2GKSA 2YZ7A 3LDFA 4GMKA 1SULA 3TJZA 1SIOA 4A91A 2ENWA 2CMKA 1Q77A 3AJRA 3AOEC 4YEDA 4URUR 4ZCPA 1JG6A 2G1AA 2ZI5A 4NPCA 2DPHA 4QUDA 2FWAA 5K03A 5K5EA 2VNHA 4MQMA 1KK0A 1SVLA 2Y8EA 4K3UA 4NBTA 2JAHA 3QX8A 5TVKA 5J58A 2XXBA 2QBYA 2HN9A 5CVUA 1W4AA 1W88B 2WBLC 2C2MA 2QP4A 3OKCA 5DW0A 4A36A 3ZXYA 2FSUA 1K88A 1OU4A 1IN4A 4O4LB 3TMKA 2NQTA 2DE0X 2HM7A 2H1WA 4C3UA 2JL1A 3OU7A 3VGPA 2OQIA 3LIIA 2JFGA 4RD4A 1ZZGA 1GG5A 2COKA 4H35A 1MFPA 4W8OA 1R5NA 2SECE 3DWGA 2V55B 3GMIA 2O3JA 2AEMA 4M4SA 4D3ZA 4A4DA 3PQ3A 1UM9A 1V8BA 3TL3A 3TQSA 1MH9A 2Q3FA 4BB0A 1SXQA 3DDZX 4FQ7A 2BCGY 1I3OA 2X9VA 5IAKA 3T3MB 2UXCB 1P18A 1XZFA 1K75A 1X8KA 1S4QA 4NCIA 2VHVA 1H2WA 2C96A 4QLOA 1GOTA 4QGBA 4I5FA 5HFNA 4A8PA 5L4NA 2PCJA 3U7FB 1V6AA 2FWMX 4WW0A 5KWEA 1OMOA 3COSA 3K9FC 2XUOA 4OEHA 4HD8A 3S0JA 2W00A 4UVHA 5AW1A 5JSZB 3GT3A 1MF7A 2XH8A 2HMSA 4M2LA 5ALJA 4DDMA 3DOUA 5DYTA 2WTUA 1LDEA 2VDKB 1M6EX 3VI3B 3UWDA 1E1RA 4G5HA 4CKEA 2HU7A 1W2GA 2FB9A 2QAGC 2GKOA 1ZCZA 4KHZA 4HWSA 3RC7A 1LC0A 2ATIA 3D2AA 4LJSA 1J9ZA 3HO8A 5BQOA 3VO8A 4BQPA 5KWJA 1FZTA 5A3RA 2VYVD 2H8KA 4U2KA 5HQ3A 1HLGA 1EFRA 1HEUA 2OEPA 1F06A 4O4LF 4WA7A 2NT3A 2X6QA 3A1NA 2I4OA 2CDAA 3UTDA 3EZ9A 2GPWA 4I1YA 1RQLA 3SZRA 1Y89A 4MNTA 2FN4A 4MVXA 3ZZ0A 3PITA 4L8YA 3NW9A 2X6TA 1NRWA 2ZJ2A 5I9LA 3DJYA 2G6BA 4ODIA 4PU0A 2J3LA 1L5OA 1WOMA 5JS2A 5B58T 1KVQA 2ZBEA 3M4ZA 4HFNA 4PZUA 2BHNA 2NXCA 2Z9DA 1QIIA 2ISCA 3EEOA 3TIIA 1L7DA 4A2PA 3NFRA 3EGDB 1US8B 1ONBA 1UKZA 2F9FA 2VSXA 4FX2A 3ZKWA 1KQOA 2UVPB 1W96A 2BEUB 3WX0A 3PXEA 1TKCA 5C81A 2B4RO 1BCSA 2G9QA 1U1FA 5DBFA 5E7JA 2D8MA 1NW9B 5JS8A 2QV7A 1BVHA 1M2NA 1QH1B 1OYOA 3ITEA 4JODA 2KMLA 4ER0A 3OHSX 4V39A 3ZQ4A 3OQNA 1E1KA 1KR2A 3L8EA 1NMEA 3Q3EA 3VPGA 4HQLA 1G8MA 4DOMA 5CFQA 1N25A 1Q19A 1QR2A 1FFDA 5KTRA 1CPYA 3JQ7A 1SCJA 1S02A 4HXFB 1CJBA 1BS1A 2Y77A 1K3UB 4N4AA 2AK3A 5AO9A 3RIXA 3BPSA 4WKNA 2D54A 3F8TA 3HCNA 5G4LA 3EODA 4J6FA 2VTBA 4O2BB 3ELWA 1VDMA 1L7OA 4YP1A 3DP7A 2NP6A 1JIIA 5CLLA 2ZOSA 3MJEA 4YCLA 1GTSA 4OXXA 4X1OA 3R5HA 4R9NA 1IBKB 1N3LA 2WAXA 1KTVA 2C5SA 2D0DA 3KQOA 3MRTA 4YJ2A 3MAJA 2EJUA 1MAHA 4FM9A 2CFRA 1AC5A 2CDBA 2Q7XA 2XVYA 1JU4A 1UBJS 2ZU6A 4W5TA 4L2IB 3RVJA 3RFVA 4IKEA 4B3XA 4YT8A 3W8FA 1QOZA 1O7JA 4O4IB 2YCBA 3COPA 2CCGA 4IV0A 1SO8A 1QZZA 4D4LA 4OP1A 4A82A 3IEMA 5K4GA 2QN1A 1UXGA 2UVQA 3KT3A 3WP0A 1U98A 2HWWA 1ULBA 1I4DD 3PZRA 2B21A 1ML4A 3ICWA 4G0UA 3C39A 2N1BA 2O7VA 2RGYA 3D6HA 2OFFA 4YAOA 4RMGA 1D9ZA 3IP3A 3MWYW 2ZFUA 3GIDA 1FLDA 2IS6A 3TLAA 4NZOA 4U2FA 4EPYA 3LY7A 5ALPA 1JNXX 2W2KA 2XEXA 2APJA 2A9VA 2Q3EA 1KK2A 3D0RA 1P3DA 3RIYA 4HNUA 1GFZA 2D2VA 3RHZA 2BYTA 3SHFA 1U3FA 3GY0A 1OHHD 4IJMA 4J0IA 4D02A 4FDAA 3ROQA 3SHTA 5C80A 4WINA 3INGA 4I4TA 4CKCA 1IBLB 3SBEA 2WPNA 1Z74A 4BNMA 1BZYA 1JDZA 1P33A 2W2NA 4IIUA 4JL6A 3ZE8A 5DGHA 1WXXA 3C98A 4E07A 1DAOA 2Y92A 4TYQA 3LLVA 1C8VB 1TLLA 1DZ3A 4C5AA 3T1TA 3FCYA 4CQMD 3WL4A 3DW3X 3CS3A 4PSCA 2K7FA 2OMKA 2OZVA 3NIGB 1E0DA 1TZCA 5ALWA 2IXAA 3H8WA 2AN4A 4ZU3A 1VB5A 3U7JA 4NE7A 4CJXA 1S2NA 3ELUA 3H9QA 4V1CB 2CZGA 1YVRA 4F8JA 2K5UA 5BOSA 4KXQA 1Z0ZA 1XNHA 2C4WA 4RK1A 4RHEA 3UXEA 3HUDA 2WA2A 3RYHB 4CN8A 2HZ7A 3CUUA 3QA3E 4OREX 4N6NA 3VC2A 4DABA 1AX9A 3KKNA 1DO0A 1Z4QA 2NACA 1WUYA 4O1MA 3EZ6A 1GM5A 4WQMA 4B46A 4CU5A 4WKOA 5HPYB 1XVUA 3R24A 5AT1A 4X1YA 3K9NA 1UXHA 5GONF 3O9ZA 4GEGA 2QAIA 2XMQA 4CDGA 4G5QA 4FS3A 5I7HA 1I7LA 5EE1A 1NE7A 3SVLA 1Z2PX 1MZPA 2VFAA 2GUGA 4LF5B 1BVYF 1Y1LA 4WNCA 2ZVQX 4IJ6A 1KXZA 2Y1CA 2Z2IA 1JP7A 4B4OA 4JITA 3L06A 2VAWA 4NEGA 3H4IA 2Y3IA 1W94A 4BQRA 1EB8A 3OZEA 2QP9X 3HYCA 3E8XA 5DX1A 2CLKB 4BFCA 5A2QA 4TWRA 4RGQA 4AZVA 5ADUS 2H5EA 3EXHC 3S8MA 2FH5B 2GTIA 1G3MA 3KQMA 4DXDA 1FX0A 1N5JA 1AHNA 4KVAA 3UJAA 1RQRA 3VOTA 4A0FA 1XMPA 3B3AA 1ZAYA 1SCIA 3SEAA 4A8JB 1IRXA 1PJ3A 2GZDA 2RSLA 3B2EA 2Y0PA 3C3BA 3OUUA 4IIHA 4RF5A 1KPGA 2BGKA 2VDJA 3VISA 2GXAA 3TB6A 2GJKA 3MQFA 4MGHA 1EEXB 1IWOA 3FIJA 3KWMA 1DAEA 4LEIA 4UARA 1E3QA 3X1KA 2FZEA 2P0AA 4FVTA 1FNNA 3KZVA 4J0CA 1CP2A 2AG5A 4B6GA 1NTRA 1YCDA 1RZVA 2O20A 4BDTA 1JR6A 5FFNA 1AVTA 2PKQP 3WBBA 4CIBA 1I33A 1ZISA 2BMJA 3IUBA 4MVJI 4UD2A 4P3OA 2I8CA 4LE0A 2VN8A 2Z98A 3I0ZA 2QIPA 1V5GA 1DXHA 3CZ5A 1WB4A 1MAVA 3BS4A 3PRJA 3U7GA 3LAWA 4M76B 3LBFA 3SP1A 4MGIR 1I7SB 1KYXA 4OHOA 4YO8A 1WKCA 4N8DA 4M8KA 4G6ZA 4HDAA 4REQA 2PVPA 4DEYA 1Z45A 3R3YA 1HNZB 4I36A 4IQGA 4G56A 4UXJA 3PPYA 1TZ2A 4XSVA 1FXWA 3FSJX 5TQ0B 1T2UA 2FDXA 4MA0A 2DQKA 2WMYA 3D7MA 1WOYA 1ODFA 1DJQA 3V42A 3R9XB 1KQGA 1T2NA 1UDXA 1D7OA 3E9ZA 2P9HA 1MDFA 3O8NA 4LOIA 5ECDA 2R00C 3V6LA 2PWPA 4Q6BA 3CSSA 1UXIA 2JI6A 2HWXA 2BI7A 4JBWA 4XTCS 2BTQA 3LF1A 1NFQA 2ZUCA 2ZUBA 3B1XA 1RWVA 5G3YA 3QJYA 3UWMA 5JCJD 4OYYA 1ND5A 1Q1ZA 2R6JA 2VYNA 3GUVA 4KITB 3TR6A 2N9UA 2KE5A 3RRZA 3MWFA 1QVRA 1LWOA 4K26A 4KCGA 5JAQA 2FGKA 5A9TA 3VNBA 3AUUA 4L08A 4JLBA 2HBRA 3RUHA 3ICQB 5AK3A 5HMLA 5GIOE 5AM0A 5E6RA 3SKYA 1YMUA 4MDYA 1MO5A 4HO1X 4M3NA 3CC8A 1E98A 3VZSA 4BHTA 1CR4A 1Z73A 1K7FB 2O54A 5JR3A 3AYZB 3HXLA 3AR8A 1QSGA 2PFSA 2VK4A 1YIOA 4R9UC 3RT9A 4C1BA 1Y8CA 5A4KA 4OXNA 4JWTA 4DM3A 1DG1G 3OU2A 4E5UA 2GRJA 2XWPA 1Z4JA 2W7TA 3FTDA 2RAVA 4JDPA 4G9EA 3NHAA 4QELA 5DXFA 1DKLA 4DM4A 1ABFA 3U16A 2CL5A 4MYSA 1UBNA 4JUBA 2JAQA 1E9EA 1L4GA 2RGGA 1ENYA 5C8ZA 4WOPA 3ZHRA 2H7CA 5T4BA 3GCZA 3D5EA 1YULA 1JKMA 4G0QA 1KKUA 5I48A 2P9JA 2C7PA 1YUMA 4EA6A 3FCSB 4MKZA 1R6XA 2I3GA 2LRHA 4JUIA 4HI0E 3UMGA 5JEEA 1JDPA 1SU6A 1YRLA 4QE3A 4CMEC 1A97A 3G2QA 2PWAA 2HLNA 4AMVA 3L8CA 2X7JA 3N3BC 1Y8RA 1SJ9A 5B6JA 5CYFA 5B7NA 1F2TA 2R65A 1PSDA 5JRZA 2QMOA 1XDSA 4Q3CA 2G1PA 1PR5A 1H6CA 1A7UA 2G9UA 2GSDA 4WEOA 5DWDA 1NU8A 4FYXA 3WKDA 4CLOA 3EDYA 1RYFA 2II6A 4IILA 3BCRA 1NLYA 4TYPA 4BLTA 4C22A 1TTTA 1Z2NX 3GLFE 3WL6A 1FP4B 4Y0VA 4TXHA 4IRMA 1XMJA 1PJSA 3NHUA 3VDNB 1LQTA 2DU8A 1PFKA 1UODA 5LP6C 2J3HA 4DANA 1RDFA 3CEHA 4NCXA 1PZFA 4NV0A 5BRAA 1T5LA 2YYZA 3RBAA 4LF6B 1H0RA 5KAPA 2QLTA 2Y1EA 3K1ZA 4WNIA 3NHWA 1ZI6A 5DOVA 5TRTA 5U9CA 4MMXB 1O03A 1U2DC 3OLXA 4HKTA 2AHRA 4HMPA 5DFAA 3RVQA 1U2TA 3DDSA 1H5QA 1EFUA 3V2GA 3NALA 4WJZA 2HB6A 3TQQA 4BASA 4F6LA 4ZEVA 1SD5A 5DSZA 1SBZA 3UT5A 3I32A 4FFNA 1F3OA 2C2KA 5EEGA 4E6PA 4YPFA 2QPOA 2BI8A 4MVJH 2B30A 3TRJA 1NR7A 3IKVA 1I9CA 2J9XB 4M88A 4WOCA 4CG0A 4DWVA 4EFLA 4Q9LA 4X6UA 1LI7A 3ADCA 5LIPA 1P73A 2AXNA 3RFFA 3PJDA 4BO3A 3KLMX 5H02A 1DIGA 1CUWA 3BWXA 1T4CA 3MF4A 5DHPA 5AKXA 4Q34A 4BV3A 4LZOA 5CDFA 2GEUA 5ERGB 1JTVA 3E3OA 3BH6A 3PVZA 3ZY2A 1COWD 5CYGA 5FKJA 2YJGA 5J40A 5EJFA 5LZ7A 1FSPA 5E1DA 2VBCA 2QRMA 4CM7A 2O06A 1QQ7A 3RTEA 1P75A 5HS4A 1V26A 2R751 2WA1A 1YGYA 2YIMA 1S8FA 3ORQA 4QBIA 5CT4A 5ALXA 4AJNA 4D44A 5MF6A 2ODTX 4G85A 2JDIA 1YS9A 5EMLA 3LOUA 5AW9A 3GI1A 5CM8B 2UZ3A 1GWNA 2HLHA 1ADBA 1NL3A 3ZDZB 3A6FA 2R44A 4I1VA 2XBLA 4RVOA 3IIKA 3LDGA 1O5TA 4NKRA 5DEIA 2BGGA 3M6LA 2VJPA 3AM5A 3B1JA 1E2DA 2J31A 2MT9A 2IITA 3JYOA 4IF4A 3JQQA 3G6WA 2H2IA 2OBLA 2B4YA 4G25A 1ZK1A 3WYGA 4PPFA 4IEEA 3FZNA 3R5JA 1SPBS 4W5OA 3C1UA 2YJNA 4MV6A 5T57A 5BN3A 1CUEA 3NVMB 3RRMA 1IY0A 2H54A 4GVXA 1VE9A 1FVFA 4TX1A 3U4GA 3C8ZA 1ADJA 1FTGA 2ZRQA 2QSJA 4IH4A 3VDQA 2C92A 1JA0A 1P17A 1BXGA 4RD0A 2QZ4A 4EUEA 1S2IA 3BXZA 4FGJA 1NVEA 5KWSA 3LC7O 1Q7RA 1P6QA 2EFYA 3GDFA 3PHCA 4RX1A 3GJXC 2C83A 1A95A 1T0HB 2DFLA 3AFIA 2WAYA 3BKWA 1UT5A 1PWYE 3H2HA 3K0AB 3PHIA 2FQWA 4J7AA 4WLEA 4QKQA 4U3JA 2XYRA 1GRQA 1RRKA 1II0A 3I37X 1TLTA 4TSFD 4JI8B 1QF7A 1TK3A 5DCUA 2VWPA 4CKWB 1OA1A 3LUBA 5HF6A 2WE8A 3CNHA 1JG2A 1R88A 1YK0A 1Q0SA 4HJXA 1A1SA 1ZDMA 2AXQA 3FE2A 4KGDA 5JXHA 1PQUA 3QE0A 1N2HA 3A1EA 3BSFA 4IO1A 3LYHA 1CZLA 5L3RA 1KOFA 4EB0A 1RWMA 3RGWS 1ORRA 1II8B 1GTL1 3KJFA 2CBGA 3H9BA 5FTJA 5J5VA 2ORVA 1ZP6A 5TLSA 4QM6A 1PTJC 2IHKA 2WILA 4MJXA 2EX0A 1RZRA 5A3JA 2IIPA 2JH9A 5AKEA 4Q15A 5I9NA 1JRLA 1KVTA 3ZDEA 4IRUB 3ZJVA 1ML3A 4DLYA 4ANFA 2VJMA 1K86A 4NS1A 1L3CA