3QM1A

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with ethylferulate, form ii
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
b'NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl esterase
molecule tags Hydrolase
source organism Lactobacillus johnsonii
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
total genus 91
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qm1A00
2ECFA 2OLEA 5ALIA 1XZHA 5AO9A 1K8QA 4UBIA 4FWBA 2QS9A 3KD2A 4W1QA 4EZIA 2G5PA 2I3ZA 3G0CA 1QFMA 5KWJA 3RKSA 3C70A 3ZLVA 5HCUA 1VJ5A 3SK0A 1LPSA 2XMCA 3S8YA 5AICA 4O08A 2I3DA 2WSLA 1CUCA 1C7JA 3TJMA 1JMKC 1XRLA 2WFMA 1UK8A 4DLNA 1OXMA 2OCLA 4N5HX 1WHTA 3QM1A 5K3DA 5ALVA 3H19A 4FLEA 4AXBA 2JGJA 4B9EA 2WHRA 4C4XA 1SFRA 1QIHA 4ZV9A 2WILA 4X00A 4EA6A 2GYWA 2ZVDA 4EUSA 5AP9A 4ZXFA 3VISA 2CBGA 2GBFA 4PSDA 1UT6A 2D0DA 4KE8A 2WTNA 1H2YA 3K6KA 3QVMA 3WJ1A 1B41A 1UKBA 4X3CA 1CPYA 4DNQA 4Y9SA 4QE3A 2XT0A 1KEZA 1XZEA 2HRQA 3G0IA 1EB8A 1XZLA 2QJRA 5D6OA 4P9NA 1CUGA 4QLAA 3STXA 5DTIA 2LIPA 3WWPA 1QIJA 3HLKA 1N1MA 4A23A 5AKHA 1ZJ4A 5I7UA 2EEPA 2J3DA 1QIIA 4FOLA 1T2NA 2XUGA 1R88A 1PFQA 3ZV7A 3STUA 1XFDA 3STYA 2XUQA 1ZI6A 3E3AA 2QVBA 5CXUA 1XZAA 4WCVA 2RHTA 5DWDA 3IUNA 5EFZA 5C8ZA 3O4JA 1YSCA 3LCRA 1YS2X 1X2EA 4M0EA 5KWIA 4KR0A 5JZSA 5AI8A 2CB9A 5LKAA 4GEGA 1LBSA 2OAGA 1EB9A 5ALUA 3AILA 2WG0A 3DOHA 1H2ZA 2HM7A 1N5RA 3DL4A 2ZYRA 3E1GA 4C87A 3BIWA 3M3DA 4J0DA 1W4LA 4H7IA 3N0TA 1ZGCA 4CG2A 1USWA 4CI9A 4CG3A 3SWWA 4UBNA 4QWWA 1TCBA 2RONA 1IZ8A 2DSNA 4D9JA 4UFNA 3NWOA 5AI6A 2QZPA 3ED1A 1BROA 3OG9A 1W76A 1CUHA 2I78A 1JJFA 3HI4A 4GDMA 2Z5GA 2VQ6A 2PX6A 4GXNA 3D59A 2C7BA 3AFIA 4Z49A 4HAIA 1SOMA 3VJMA 4N8SA 1YR2A 3I2FA 5AKKA 3C6ZA 5BWBA 3HACA 4HXFB 1ORVA 3NUZA 4G1FA 3G7NA 2PSJA 1N5MA 4Y2YA 5AIAA 4MQMA 4X90A 3DYVA 4UBOA 2Y2UA 5E4YA 1XRRA 5DNVA 2FJPA 4N8DA 2HA5A 4FNGA 5BV7A 1A8SA 1SCKA 4FBMA 5EIEA 4ROTA 2JGKA 4KRXA 1XZDA 4GWLA 2JF0A 5IKXA 5JAHA 2YYSA 4XX1A 3C43A 1DINA 1LLFA 1XZFA 2RI6A 3F96A 5CH8A 4P93A 4E15A 5AKXA 4BCCA 3PICA 1ISPA 2WIKA 2PL5A 4MWTA 1GPKA 1XRPA 2AJ8A 4U2GA 1JJBA 2I03A 5ALJA 3A2LA 1YCDA 4X85A 2HFKA 2OQIA 4EBBA 3D5EA 3HXKA 5FPPA 1LGYA 3BF7A 4UPDA 4OB7A 1HL7A 2QM0A 1L7RA 1G4HA 3PI6A 3RK4A 3GA7A 1CEXA 1EDBA 3SC2A 2P8SA 5ALZA 4BBZA 2BGNA 3SX4A 2DQYA 4U2BA 3FVRA 1R1DA 5ALOA 3HC7A 3OPMA 4Q82A 1QONA 4Q05A 4AO7A 4Y2VA 2JBWA 1UOQA 5ALEA 3ZPXA 4LXGA 2GBGA 2B20A 2XMRA 2Z3ZA 4H7DA 3Q8WA 4LYDA 2XUPA 4XIIA 3VVLA 4UBJA 3EQ7A 1Q83A 1ZD4A 2PSDA 1AGYA 3KDAA 3WKEA 3R40A 1W75A 2ZYSA 3LP5A 5HKBA 1FJ2A 4M0FA 1ORWA 3M81A 4W1SA 1CIJA 3R3WA 1XRMA 4DIUA 5FPQA 4GLBA 3W04A 2AJLI 3O0DA 5AKJA 3IBTA 5AOCA 2CUTA 5CBKA 3O4GA 3WKAA 1MX5A 1EH5A 4N5IX 4AO6A 3CN9A 3DJYA 1P0PA 3HEAA 4BZZA 3F67A 4B84A 2VT7A 3K2IA 4BRSA 2XQIA 3BIXA 2DHEA 2Q0XA 1T4MA 5FOQA 3LS2A 2QR5A 4QDXA 3WL7A 5E4TA 1YA8A 4WY8A 1FFCA 4Y2RA 1WM1A 7YASA 3DS8A 4H7JA 1C7IA 1VLQA 1PV1A 4MWSA 4W1RA 1QTRA 2WJ6A 4QNNA 1R3DA 3WK4A 2WU4A 3VDXA 3ANTA 4GHWA 3C6XA 3KSRA 4ARAA 4EY7A 1AX9A 4H7FA 3QPAA 4XJVA 1GT6A 3PFBA 2O2IA 3A2MA 1BCSA 4BVJA 1BU8A 3V1MA 2RAUA 4B81A 5ESRA 3G9ZA 1DX6A 1YB6A 5BOVA 2WUFA 2HDWA 3ZWQA 3QMVA 4JYPA 2WUDA 4I19A 5BWCA 4FNMA 1EINA 4OYLA 1BN7A 2WJ3A 2WFLA 5SYNA 4ZGBA 3NGMA 5IVKA 4PSUA 4J7AA 1R4ZA 1U65A 3A70A 2QT9A 2DQZA 4DMCA 5CXXA 4LXIA 3OC0A 5EHXA 2O2GA 3AINA 5JARA 5SYMA 3PUIA 3CXUA 4DSAA 1Y7HA 5A7GA 3I2GA 1YASA 4OU4A 4EHBA 5J3JA 2CJPA 1B6GA 5T4FA 2RHWA 4J0JA 1NX9A 4L9AA 1UFOA 4Y2PA 2HA3A 2XMQA 5CT9A 4DTCA 5A62A 3G8YA 3FNBA 2OAEA 4G4GA 4UBLA 4OB6A 4G8CA 5AI9A 2XUJA 4K6HA 1MPXA 1EDDA 1A8UA 3H1AA 1UK6A 4JH0A 4IH9A 5CT6A 5AKYA 1EA5A 2XUDA 2BAGA 1QIDA 1ODSA 3IA2A 2WLSA 4J03A 4BE4A 5FV4A 5LZ9A 1XKTA 2BUAA 5JZ9A 5HFNA 2CKMA 1AURA 2PKYX 3FYUB 3I6MA 1DWQA 2VSQA 4IQ4A 1TRHA 3B5EA 2XQJA 1MU0A 3VJLA 5ALNA 2EDAA 1XZGA 2V9ZA 3K9BA 2VEOA 3GROA 3HZOA 4KAAA 3VJKA 1DU4A 3WMRA 5HK9A 3CN7A 3O9MA 3WZLA 4YASA 5FDFA 5HF9A 1HQDA 3WIBA 3BJMA 4NS4A 3V48A 1FFDA 2CZQA 3WWOA 2BUCA 2Y6UA 3FLBA 1Q0ZA 1A8QA 5DYTA 1K5PA 1EK2A 2XDWA 1XROA 1H22A 2WTMA 4HTAA 3KXPA 3WK6A 3C45A 4B6GA 3IURA 4RGYA 4ZRDA 4LIPD 5CH5A 4B83A 2DR0A 3OURA 4FBLA 5JAOA 1G5FA 4FTWA 2WQZA 4IHAA 2WG1A 4KRYA 3WA7A 3OOSA 2O7VA 3I1IA 4J0IA 4B0OA 4YK7A 1BE0A 1QZ3A 3FLEA 1HLGA 1BCRA 3H2JA 4H18A 2VT6A 2ZJ6A 4WJLA 3QZUA 4Q3OA 5HK8A 1DX4A 1JU4A 1RYYA 3IIIA 5AK4A 4C4YA 5E2IA 1IZ7A 1WHSA 2J4CA 3G9UA 5ALXA 3I6YA 2RGUA 5D3KA 1AKNA 5EIAA 1RWQA 4Q3LA 4GECA 3BDIA 3BF8A 3FSGD 3D7RA 5DNUA 5HZGA 2B61A 1XZKA 4L72A 3WIOA 4AZ3A 1KU6A 1J2EA 1Y37A 2DHCA 3LIIA 3UUEA 3S2ZA 4KYVA 2WUGA 5A7HA 2J3QA 5LZ5A 3STTA 3B12A 4K2AA 2ORYA 1ZI9A 2ROQA 2WU3A 2Y1KA 3WWCA 3HRHA 4ETWA 1GKKA 4UHFA 1UK7A 1YS1X 4M0MA 4LXHA 3STWA 3W05A 3WI7A 5JIBA 3EQ8A 3I28A 3I2IA 4FFVA 4WFKA 5JAPA 3LLCA 3DKKA 5K3FB 3V9AA 1R9NA 5DLPA 1SCIA 4HS9A 1FFEA 4EY6A 1JT2A 1LPPA 1FSSA 4FMPA 4QEKA 5DTJA 2OXEA 4UHDA 3G02A 2WM2A 3DLTA 1IUOA 4MYDA 4OD0A 4DGQA 4BAZA 2OGZA 2OCGA 4B7ZA 2PSFA 1Q84A 3I2HA 4X7BA 4TGLA 2XUHA 5CRIA 1WB6A 5ALTA 4H77A 2WFLB 1GPLA 1DT5A 2XI4A 2D5LA 4YX9A 1DQZA 4FFWA 2ZYIA 4BAUA 1HDEA 3D3NA 2C0QA 4ARBA 3B3QA 4OYYA 5LZ4A 5HF6A 1YAJA 5AOAA 4AZ0A 4AB1A 4BVKA 4UUQA 4HRYA 1GKLA 3C8DA 3WK9A 1VZ2A 1XZBA 3ESBA 1E3QA 1EX9A 1HBJA 1CUUA 1WPRA 4JEIA 1P0MA 3C6BA 1EDEA 4X6XA 5AH0A 4BRZA 2PUJA 3U1TA 4B80A 1EVQA 3PE6A 4RNCA 4LYEA 4QZVA 2WHQA 4J0KA 4UHEA 4X6YA 5AHXA 3FSGA 5AI0A 4XVCA 4DMKA 5HQ3B 4V2IA 4FLFA 5JAUA 1E8MA 1MAHA 1LNSA 2WUEA 4OPMA 4KACA 2C0PA 3EBLA 3C5WP 2XUKA 4XWGA 3WQHA 1O6FA 2VJBA 3WYNA 5A71A 1Q0RA 3FVTA 1GXSA 5LIPA 1H2XA 5ALFA 1S8OA 2Z8XA 5JANA 4FKBA 5CMLA 2W22A 3H0CA 5F4ZA 1XZJA 4G4JA 4UBMA 1QLWA 1JMYA 1CUWA 3PDCA 2QKYA 4RPCA 4BATA 5ALWA 1U8EA 1IUNA 5D7BA 3DOIA 3QBJA 2HL6A 1CUIA 3D2AA 3EQ9A 1TIBA 2WIDA 2VAVA 5KREA 2HA2A 3DD5A 1F6WA 3OM8A 3YASA 1BEZA 4C4ZA 1EK1A 4UHBA 3N2ZB 5DYYA 1CVLA 3UUFA 1DTEA 1VXRA 1DWOA 2DFPA 6YASA 3WK7A 2Z3WA 4FDMA 5I9IA 1J06A 3BL8A 4F21A 5JASA 4NZZA 4I3FA 1EI9A 3QMMA 2VJDA 1XZIA 5AK3A 3HSSA 5DYWA 2Y6VA 1UOOA 2HA7A 4K6KA 2IX9A 4E46A 4X95A 5ALGA 4C01A 3HJUA 3WKCA 4J0HA 2PU7A 1K4YA 3BE8A 3HYSA 4BP8A 3GBSA 1CQWA 3WYDA 3C6YA 3GFFA 2VTVA 1XKLA 2WHPB 5ALPA 2JGMA 2PSHA 2WIJA 2R8BA 2O7RA 4YPVA 2HU7A 3H18A 1LPMA 2QXTA 3VVMA 4AMZA 4FLMA 2V97A 4PO3X 2EDCA 3D4LA 4QDTA 1ZD3A 3IULA 4DSZA 2QJWA 3D2BA 1XLVA 1WPXA 4HXEB 1XLUA 4KEAA 5T4BA 3QMWA 4PQEA 1W1IA 3L1HA 4QLOA 2JEYA 4BP9A 2WIGA 4W1PA 4I4CA 4L3WA 1CUXA 3IDAA 3R3XA 4CFSA 4HZGA 5LKRA 1NU8A 5FRDA 4CG1A 5AOBA 4Y2UA 3H1BA 3WZMA 5IH7A 4PSCA 2GZRA 1AC5A 2FX5A 2XLCA 5KBYA 2HA0A 2XLBA 3QPCA 4H7EA 1ZI8A 1CV2A 1JU3A 1WCYA 4BC1A 3H2GA 1F0PA 5AM0A 5JZBA 3NOXA 2X5XA 1YB7A 5CW2A 5E4JA 5HKAA 3IUJA 2X76A 2J4FA 3R0VA 1EHYA 3ZLUA 4IH4A 2G63A 1TAHA 2JEZA 1ODTC 4X94A 3L1JA 5EHNA 2CMFA 5AIBA 3P2MA 3T4UA 4WFJA 1CFJA 4UFPA 2ZJFA 1QGED 4Y2XA 1QIMA 1QFSA 3V1LA 5LZ2A 5CTAA 3GELA 1ZD2P 3PF9A 1MAAA 1TCAA 4LKOA 3ESDA 5K3FA 3FBWA 2QTBA 2HA4A 1OCEA 5ALLA 2PVSA 4X93A 5JALA 5EIHA 2H7XA 3AUKA 2OGTA 1H23A 2HRRA 5JATA 1SCQA 5LYYA 3H17A 3WA6A 1XRNA 1IVYA 2ZJ7A 4AN0A 2WFZA 5C81A 5EHZA 1Z68A 4JUIA 3DNMA 2PBLA 4B82A 4BC0A 1CUDA 1UWCA 1CUFA 4CCYA 1CUEA 4Q1VA 5LP1A 3DKRA 4KAJA 3UMJA 3RLIA 2OCIA 4BVLA 5CT5A 3A2NA 1IUPA 3WWDA 4KE7A 1HKHA 4J0CA 2VF2A 2HA6A 3I6ZA 1ZD5A 3ICWA 2WG2A 4GI1A 4EY4A 1K63A 5AKZA 2AJDA 2IITA 3W2TA 2ZSIA 5CT4A 3AZPA 3F8SA 1CUJA 3GZJA 4Q3KA 1AQLA 4BCDA 1NU6A 1ZIYA 5DJ5A 1QIGA 1LPBB 4AMYA 4BTLA 4BE9A 4S0XA 3H04A 5ALMA 2ACEA 2GBIA 5FXMA 4ZI5A 4U2FA 5AI4A 4BB0A 5K3EA 5HQ3A 1FFBA 1UXOA 4P92A 3F98A 4BYMA 1XQYA 4MXDA 5C8VA 1MO2A 3C5VA 1YAHA 4G8DA 2HADA 2BGRA 1VA4A 1QJ4A 1VZ3A 2NW6A 1ZICA 3A6ZA 2O2HA 4UBKA 1ODCA 1MN6A 4J0GA 3Q0TA 3BXPA 1GGVA 5AM4A 3BWXA 5HFAA 2XE4A 3H2KA 4DMHA 5DNWA 5K3BA 3PF8A 2AXEA 4WDQA 2BKLA 3H2HA 1P0QA 1XQVA 2OPHA 4EY5A 2PSEA 2OCKA 4IH1A 1L7QA 3FYUA 1VOTA 2C4HA 3MVEA 4AQDA 5JYCA 5ALSA 2H1IA 2HU8A 3O4IA 5AM2A 1E66A 1UKCA 4AX4A 4BAGA 4F0JA 5HF8A 1WB5A 3G9XA 4CIBA 3BJRA 1QO7A 4MJ3A 4KE9A 4KAFA 2ONCA 1E8DA 2JGFA 1CRLA 4G9EA 1IMJA 1QO9A 1R50A 5CH3A 4OU5A 1DQYA 3V1KA 3R3YA 4A16A 4PF1A 1WOMA 2WKWA 1O6GA 2GBCA 4JNCA 5AKIA 4RE5A 4BCBA 3WKBA 1W52X 3OTQA 4MEAA 3G0DA 3W9UA 3ESAA 2GZSA 2QXUA 5AJHA 5AK5A 5LZ7A 2XMGA 3R3ZA 4H0CA 5LZ8A 2R11A 4C88A 4U2CA 1A7UA 1ZOIA 2ES4A 3AIKA 4G8BA 3IUQA 2HIHA 1VXOA 3FOBA 3DYIA 4MYSA 4C89A 3WL6A 1QIKA 5A2GA 5AI5A 2QOEA 1EXWA 3IUMA 2XUIA 1QIFA 5ALQA 1J1IA 3T52A 2C58A 4HRXA 1BN6A 5C7YA 3IB3A 2ACKA 5CURA 4WDRA 4GBGA 1TK3A 5AM1A 1FFAA 2B9VA 4CIAA 1EVEA 5K3CA 4LHEA 1XLWA 1ZGBA 2K2QB 5ALDA 3M82A 1VA5A 2BUBA 3WK5A 1Y7IA 1OILA 3QH4A 4G9GA 4UFOA 5AKLA 3O9VA 2YH2A 3GUUA 3PUHA 3ZI7A 3IVMA 3HABA 2FUKA 3QPDA 5IVIA 1X2BA 4DYHA 2G5TA 2PPLA 1F8UA 4HVTA 4KJXA 3ANSA 1UOPA 5ALKA 3CCCA 1LPOA 3O95A 3H2IA 3WJ2A 1VKHA 4NVRA 3I1YA 2VAXA 5EHQA 1XQXA 2JGIA 5LLSA 4B85A 4OCZA 3AZQA 2IIVA 4BDTA 3AIOA 4FHZA 2YXPX 4H7HA 4PW0A 3W06A 1UKAA 5IVHA 3WWEA 1U4NA 5HF5A 1BRTA 1CQZA 4E14A 1BS9A 3C87A 1CUBA 5FUMA 4W9RA 5D3ZA 5AKEA 2E3JA 4B0PA 3R3VA 1LZKA 3F97A 3FCXA 3MUOA 3QYJA 4H35A 2H9YA 4PV7A 3ICVA 4MEBA 3O4HA 5YASA 4EB0A 5K5EA 4E11A 1CUYA 4JYMA 1PJAA 4HXGA 4K6GA 3AJAA 5A6VA 3WK8A 2QUAA 4UHCA 3DCNA 3CCBA 2WIFA 3FAKA 3WL8A 2XMZA 2H7YA 2AJBA 1MX1A 3M83A 4INZA 1GQRA 1JJIA 4Y2SA 1JI3A 5T4HA 4DNOA 1ACJA 2Z8ZA 5JD6A 5ALHA 1UZAA 5T4EA 4OSEA 4A5SA 5FKJA 1MT3A 1AZWA 1G66A 4IO0A 5K3AA 3WLAA 2PU5A 2WJ4A 3ESCA 3RM3A 4QDZA 4K5QA 2G4LA 2UZ0A 3KOOA 3FCYA 1N8SA 4MQLA 2VATA 1CUAA 1VE6A 2JGLA 3G0BA 3MUNA 4Y7DA 5FP0A 1I6WA 5JD4A 5EGNA 2H7CA 1K6EA 4DNPA 2XQFA 1XRQA 2ZYHA 4G4IA 1GZ7A 5EI5A 1CLEA 3LIPA 1D07A 4L0CA 4U2DA 1E5TA 5AM5A 1CUSA 4F60A 3L1IA 2C5GA 3DEAA 2AJCA 2XB6A 5IVDA 3E4DA 4WFIA 2W6CX 1G42A 2QMQA 3TEJA 4TVKA 2DHDA 4Y2QA 4H7KA 3G9TA 4C6HA 2BCEA 1H2WA 2C5FA 4ZWNA 1AUOA 4BZWA 4AO8A 4G5XA 1GPNA 1C4XA 3I2KA 3VXKA 4DNFA 1QIEA 4BDSA 4B9AA 3FYUC 3TRDA 2YASA 1CUVA 4TPKA 1THGA 2GYVA 4QDUA 1VE7A 3E0XA 3JW8A 2Y2VA 4PNZA 2VA9A 2OGSA 2PUHA 1THTA 1BEEA 2JIDA 2V98A 2XQGA 1F0NA 1RP1A 3X3HA 1XZCA 1P0IA 1KU0A 2BJHA 3R41A 3G0GA 1M33A 1ACLA 2OQVA 4X6UA 1CUZA 2PM8A 1LZLA 3RARA 3FYTA 1TKRA 2WHPA 2ZSHA 4GW3A 1JKMA 1LPAB 1J07A 3I2JA 3DL7A 1ZIXA 3R3UA 2QUBA 1MX9A 2XMDA 4X71A 5AKGA 3FLAA 1TCCA 1QE3A 4X92A 2QRUA 3D0KA 1HPLA 4Y2TA 1X70A 2XQKA 3JWEA 4NMWA 2HU5A 3DQZA 1A88A 2CEKA 3WKDA 4X97A 5ISMA 2V96A 2HFJA 2OG1A 2DCMA 4WY5A 1MNQA 2XUFA 2X8BA 3U0VA 4U2EA 3WL5A 2XUOA 4OUKX 2VJCA 2B4KA 4J3JA 5ALYA 2XUAA 3BDVA 4X91A 4UHHA 3D2CA 5H3HA 1QTIA 4ITVA 1W6RA 5I8PA 1MJ5A 5CT8A 2JGEA 1QOZA 2VJAA 5JADA 4F5ZA 2FJ0A 4W63A 5JD5A 4ZREA 3ILSA 3PFCA 5AK6A 2HHAA 4RE6A 2RIPA 3DDUA 3KWJA 1GQSA 3VKFA 1SC9A 3MGAA 3AZOA 4QA9A 2XMBA 3EIOA 3KWFA 1ZJ5A 1E8NA 5AM3A 1WB4A 1MNAA 2XMSA 1YA4A 4ZV7A 4QDOA 5C8XA 3W9BA 1LPNA 4N8EA 4Q34A 1TQHA 4AN1A 4BTVA 3JYHA 4QWMA 1XZMA 4P08A 4OB8A 1CR6A 5ALRA 4Y2JA 1XQWA 5FLKA 1LBTA 2GYUA 1DT3A 1R9MA 4DMFA 1DWPA 1MTZA 4DM7A 1E89A 1ETHA 1U2EA 2BFNA 1AMNA 3AIMA 3QITA 1UK9A 4KE6A 3F9CA 3ZLTA 1L7AA 3STVA 3C8HA 3V1NA 5A7FA 3EF3A 1JFRA 4CCWA 3FWHA 4EY8A 3TGLA 4CCYB
chains in the Genus database with same CATH superfamily
1AKWA 4MQFA 4PCAA 5ALIA 3EW7A 1RBMA 3O8QA 1XZHA 4O4JB 5ER6A 4MV4A 2VDWB 1K8QA 2ZIXA 5B58C 4FWBA 1L4YA 1Z29A 2G7ZA 1U9IA 2I7TA 3N2LA 2C4NA 1HUQA 2W8BB 3GEGA 1KP3A 3DC2A 4LCJA 2P9QA 1E3EA 4CEJA 2I3ZA 2C84A 3TINA 3TQHA 3G0CA 5IF3A 1L8QA 2XZOA 2B7CA 1BQ4A 1CY2A 2JBHA 2ST1A 4UULA 3EIWA 1O57A 3HDJA 1Z5NA 3RKSA 5L3QA 4DJ5X 2ZXFA 2Q9AA 4R54A 2W90A 1CWUA 3EZFA 1YB1A 4QNMA 4M9UA 1CS0B 1IEVA 3SK0A 1R6XA 1BRMA 1PL8A 3KDSE 1N5JA 4LK2A 3E27A 1LB1B 2EBHX 1XHFA 2I4MA 2PS1A 3DAHA 4OOFA 5AICA 5FI0B 5FQOA 1S9HA 5HUHA 3RYCA 2I3DA 4X1IA 3NI2A 4JL5A 1FSGA 1T2EA 3AF2A 5JMOA 1F12A 2I4TA 1RIIA 3GPIA 2GTIA 2OR3A 1XRLA 4NY1A 3RVKA 3TXAA 1XEXA 3A10A 3D6MA 4KPYA 2G9ZA 5K4GA 1EE9A 2OCLA 4I4LA 2EX4A 2L18A 4PG4A 1SRRA 1GSAA 1LBQA 1R5JA 4PEVA 1WHTA 1FC0A 2J46A 2LE0A 3FW1A 1ZJZA 1XR3A 3E9QA 1M2WA 3KV1A 4NYIQ 1G291 2UUCB 2I1QA 1Q11A 1G4UR 1AJEA 3OZEA 2IS4A 3B1VA 2DGDA 5DH9A 3H19A 2JI8A 3FMOB 1L7XA 3B2QA 4X7RA 3ICQB 3GJ0A 4L76A 2P5TB 2WZQA 1Z75A 3FA2A 4L5AA 1ZMOA 4B9EA 3OPYB 2V1UA 4ASUD 3VR3A 4HNVA 1DXYA 5D7NA 2AW3A 3KFLA 3RH0A 1V3VA 1H6DA 4LNUB 2HU2A 4TS3A 3IOEA 1Q7CA 1HDRA 1XZ8A 5G1OA 1DPFA 1GTL1 1NC1A 2CBGA 3EXIA 3PFKA 1Y1RA 3GP5A 2FE4A 1LSUA 3HL0A 4PSDA 3DZHA 1GA4A 2A0YA 4Y6RA 2D0DA 2VF7A 4RJKA 2H16A 4NIMA 4G0MA 1TZJA 4M7PA 1GPUA 1OZGA 1LX6A 3IXMA 3R5FA 3I45A 13PKA 1G8JA 3K1ZA 3PFNA 1K6XA 2QMOA 2XXBA 3IUSA 4IQFA 4LA4A 7AT1A 4DPLA 5HBRA 5HDBB 3UGJA 3DPIA 4NHEA 4P83A 3CUYA 1OWNA 1XA0A 3KT0A 2PQ6A 2IVZA 1UKBA 4ZQFA 1M66A 4D9EA 1RWMA 4H2DA 3KEQA 4GM0A 3GOQA 5C8YB 2UXCB 1RRFA 1XRSB 4JK3A 5T7BA 3IDSA 3ZK8A 3LHDA 4XEHA 6ADHA 4LYAA 2CNBA 5DRYA 2H3EA 2EWMA 5B1HA 2QTVA 4P7JA 1ND6A 1WMDA 2BI7A 2IV2X 4JBHA 5F23A 4QE3A 5KTRA 2AFIE 2VDMB 3LQRA 1B3BA 4KRGA 1RYNA 4RZIA 1QHHB 3K73O 5IS2A 3AY6A 4DCOA 1EB8A 1UMDB 4FSXA 2OHFA 2YN0A 4KN8A 2A1UB 3FUXA 5AHRA 3UG6A 4PZPA 5IZ4A 4GRIA 1E2JA 1KJYA 4Q9LA 4JQCA 3O2NA 3M6LA 3DFKA 2LIPA 1RRKA 1DOZA 1UP4A 2WMYA 2WMNB 4DQXA 3LQ1A 1ZM7A 2WW8A 1CX9B 3F4BA 4IY1A 3PUJA 4LZJA 4PYOA 5U4QA 3D8NA 4LN1A 5IK2D 2IYNA 3DLAA 3JPYA 3OLQA 5BNFA 2J3DA 3LXUX 1H69A 5HNKA 1MOQA 3PVSA 4LSWA 5TVGA 3SZOA 4HGRA 3QX3A 2P5UA 5ADUS 2Y67A 1T1IA 1TPZA 1TE2A 3HJAA 4FOLA 5B4TA 2Q07A 1T2NA 3H1GA 1R4MB 2PT9A 2PYDA 1PFQA 3EDMA 2A78A 3TQQA 3STUA 3ZV7A 1QPZA 3EGVA 4U39A 4YYEA 3STYA 1X13A 1ULHA 1PTJA 2Q4TA 1YONA 3QSGA 2VKQA 1DG1G 2WA1A 1L5HA 4OXYA 4WKBA 4ENQA 1S2NA 1EIZA 2N46A 3HJRA 3RUCA 4ZAVA 3JD1A 3MM4A 1KK2A 3G2IA 2ZFUA 3E0QA 3EMVA 4IRMA 4YECA 1O94C 3LPCA 4KQ9A 2WJYA 4YJ2F 4UEQA 4X8LA 4EZBA 4RZHA 5CXQA 1SCAA 3O2QB 2R6HA 4HGQA 1PV2A 2C97A 2P9TA 4QL3A 1E7QA 5GV7A 1X2EA 4Q7MB 4TTPA 2EFGA 4FWIB 3GT7A 1ZW1A 2JAHA 4IWYA 4NJEA 1N2EA 4XQGA 4KR0A 4F04A 3HSKA 3SF8A 2BZSA 3U7HB 1Q3KA 3LF1A 2ZAOA 1T29A 4MPDA 2XBLA 4Q9IA 4ZDWA 2O14A 1L8LA 4HN9A 4WKGA 1P29A 3T3PB 1FFWA 2QIPA 2D00A 4DGSA 5IT5A 1VSQA 1EB9A 3AFGA 4ZD6A 4Q4HA 5H8WA 3AILA 4PFSA 5KQGA 5ARDA 2YHIB 1GEEA 3C3YA 4YIKA 3ZD9A 3DFUA 2FDXA 5DM4A 1OTYA 4U0JA 1RBZA 1PJ3A 4C87A 4UTRA 1XDZA 1HGXA 1W4LA 4N0DA 1G8YA 1V35A 3GJXC 3HGTA 4H7IA 2AD1A 2I62A 2KWIA 2QTLA 4QPDA 5LXTF 5HRUA 4FFOA 1P7ZA 1BJRE 1U99A 2QT1A 2J5BA 4DC9A 1KPIA 1ZGCA 4Z86A 3ZHOA 4MO9A 3RRZA 4GX1A 3RK1A 4CG2A 1CJBA 1N7JA 2FRVA 1P4GA 1PIWA 2JIPA 2YCLA 2ZXEA 3COVA 3EWAA 4FD2A 4QJ4A 1BDJA 2XAAA 5EJAA 1BFUA 2R44A 2GARA 3L82B 4FYJA 4IPTA 1SVKA 1Y1PA 4WOCA 3ZS8A 2C7GA 4D9HA 4LDAA 4CG3A 2EZ8A 1DFHA 4OM8A 5E8JA 1XALA 4PLHA 3U17A 4EEZA 3CKYA 4BJHB 4GLFA 4FB5A 1ENOA 2RONA 5L7TA 4J16A 4Q24A 4FVTA 4JYAB 3MWLA 1OLOA 4RHYA 2BJWA 3Q3CA 1NMSA 4XX0A 1LY1A 4WFQA 4WXMA 4UFNA 4LNAA 3PQ5A 4Z3OA 4TKUB 2R79A 2NG1A 3ZGVA 1WLSA 1XUOA 2BEVB 3N05A 1KJ8A 1CJVC 1QF7A 2A57A 2RE8A 4MYTA 1BROA 4QXPA 3N2KA 1I2MA 1FNNA 3N0WA 2GK6A 4HNRA 1MKYA 4JU8A 2ZQ5A 1JH9A 1JVBA 4DA4A 3EXG2 1PO7A 1NBHA 5HIAA 1ZISA 3OHSX 4C7MA 1YZHA 2XHEA 4O1HA 4W5RA 3TVDA 3ZCUA 2CD7A 3EVZA 2J0QA 3FVQA 2X6TA 2XCLA 2UZ1A 3FAZA 3EA5A 4PNPA 3ZJVA 2PX6A 2UZAA 4GXNA 3FRHA 5DMHA 1PRYA 5C4MA 4URYR 2IU3A 3FYDA 4I5DA 1P6QA 1PQPA 2QLTA 3A4LA 3DO5A 5BSUA 3SEZA 1PJSA 1QWSA 2PG3A 2PZKA 3AWDA 3HA7A 4RY8A 1KAOA 2GTPA 3D8SA 2IYFA 3EZ6A 4N8SA 1LTHR 4HAOA 5ECDA 2MR6A 1YR2A 1ZITA 4D74A 4QVIA 1OZAA 2NUBA 4RFSB 2C2GA 1UBKS 3Q5DA 2BGIA 4RK7A 1KQNA 2IZ6A 1L5ZA 2RGNC 3I8XA 3WIEA 3BRQA 3HJNA 4GZ5A 5KNCH 2J31A 4K3VA 4J2TA 4HXFB 1BGXT 2DTDA 3NBQA 2PSJA 1N5MA 3B48A 5AIAA 4UDOA 2CYAA 4ZVOA 9LDBA 5D5HA 4MQMA 1FMCA 2CLHB 3CUTA 1JIQA 3DYVA 2R7KA 1ZNZA 3W5CA 1G8SA 2IYUA 3EIXA 1H4VB 1XRRA 1KZ4A 3HU2A 5DNVA 3OEEA 4GZMA 1XN1A 3EMKA 3C8MA 4HVAA 4G2TA 4N8DA 3W9SA 4IFBA 1QFYA 3BILA 4M1YA 3OTWA 5BV7A 2H1HA 3HDTA 4FSDA 1ZK1A 1A8SA 1K7CA 2PRZA 5DXAA 5CB4B 4HUTA 4NV0A 4GYYA 4DAEA 4HUJA 4IHJB 3OPQA 2CVFA 1MQ8B 5HCIA 3LXXA 5J5CA 3I04M 5F9HA 4QOSA 4HNTA 3HJCA 4FDTA 3UHFA 2B8TA 5GPBA 3QU9A 5IKXA 4P2BA 1YT5A 1GTSA 1N6PA 1TB4A 1G9XA 2YYSA 1BAPA 4PZYA 4IAOA 3V7UA 1HKUA 3MRVA 1E9VA 4HQFA 4AL4A 1NSYA 1PNRA 1WUTA 1ZKDA 1Z28A 1RVDA 1G5QA 2HOQA 1KC3A 5LQMA 2WIKA 3KTAB 3A4IA 4GI3A 5JNSA 4M6WA 5DHRA 5TPZD 1R4AA 2WSSD 4ALJA 1XMSA 3D7LA 4LS3A 4NBWA 4KPGA 4F2WA 2VK4A 3PGMA 5CB4A 3TCXB 4UM9D 3L4SO 4P4UA 4YAIA 3PPIA 2AJ8A 4HJXA 4U2GA 4YQEA 2B3TA 3KWMA 4F2HA 4JBGA 3T38A 5ALJA 4A0FA 6ABPA 5E95A 1NWCA 2ZTLA 2AVDA 4KOAA 3PP8A 4UD6A 3DL2A 4R81A 1C9KA 3UWPA 4WXYB 5EOVA 4FDLA 2HFKA 2MIIA 4TVBA 2OQIA 1DAOA 3KS9A 3O8OA 3ZBPA 4IV0A 4E08A 4FGKA 1Y4SA 2H18A 2FW6A 1TXGA 3HB0A 5I4IA 3RSZA 1I0IA 1Q22A 5C1DA 2JKZA 4LYGA 4MQFB 3AY7A 3MWFA 3GEIA 5TRTA 3WWZA 3NEAA 2VDWA 4LV8B 2QM0A 3BQMB 2O4CA 3VSAA 2ATCA 5F3WB 4CVNA 4BFYA 2IODA 3BSFA 5CIYA 4YLEA 1NRXA 2ZIWB 5KHAA 1JUDA 1N2CE 3SC2A 2F1JA 4IDBA 5E1BA 5E6SB 4DWOA 5ALZA 2PAAA 1XCLA 3I9KA 2BDUA 1KP2A 5FORA 5FV4A 4B47A 4WKPA 4LF5B 1EBFA 2ZUSA 4U2BA 5DVZA 3G1TA 2FR0A 5F51A 3QWAA 1R1DA 3OPMA 4D8TA 1X7WB 1QF9A 4MX8A 3ZHTA 4JV5B 2B1RA 2CYBA 4IIUA 1A7JA 4Q9NA 1N57A 2JBWA 3IBGA 3ZPXA 3PUKA 4LXGA 4ZT2A 1RXWA 2W48A 1BCRB 1ETUA 5GGXA 4Z9FA 5SYAA 1RQ2A 1LLQA 3EEIA 2BLLA 4FT4A 5TS2A 4Q7QA 4QXQA 1RXVA 1QVRA 2B20A 4A6DA 2OHXA 3GFSA 4D41A 2Z3ZA 3PD0A 4BNGA 3LBHA 1C3VA 1ZVKA 1KE1A 2INGX 3ND7A 5HWSA 2ABWA 4QDKA 2MMGA 4QECA 5HMMA 2QVYX 2ZRGA 4ZP1A 3WGMA 2DPLA 1UXGA 2WYUA 4ML3A 1V6CA 1FW6A 1PEAA 5HUJA 3C3KA 4HJRA 1Q83A 2ZRJA 2VWQA 1TMOA 1H0RA 4ERNA 2VA8A 3WKEA 1GN8A 1W75A 2A0UA 2ZYSA 4BBJA 4ZDKA 1SVSA 1B93A 2Y1OA 4M0FA 3OOHA 3O3MB 2C07A 3I3SR 2R6JA 1ORWA 3GIWA 5IUNC 2WWWA 3U4DA 3OPYA 2JDIA 1GSIA 1CE8A 3QWIA 1HOXA 1FDRA 2B30A 4S3MA 1FJGB 5AXAA 1GPAA 5I7EA 3C24A 3AJEA 4JLBA 2KI5A 4XGKA 5H68A 1EGHA 1U7UA 4NU8X 3HDQA 3DNFA 4MAMA 1FDWA 3IDZA 4E03A 3OD5A 1CDZA 5KVAA 1M1UA 1BHQ1 2DOKA 3IP6A 3ZHBA 2G04A 3KYBA 4IYRA 1Y9DA 3CEAA 2JPDA 1BXGB 3O4GA 3GJRA 1DJPA 4JC4A 5LQRA 1JHAA 4OUDB 1K1EA 3A1VA 3TZLA 1T5BA 4RHFA 2HLPA 3P9ZA 2ODNA 4CUKA 5CBPA 4DV3B 4BLUA 4ZI3A 2C61A 4BNYA 1LWNA 1PGPA 1G5IA 2XNDA 1ZR2A 1H0HA 3UQYS 3BFXA 4Z9BA 4MUXA 3DJYA 1M3SA 3HUEA 1X8JA 3F67A 3MW8A 5G3YA 1F9AA 2H6EA 1YBFA 1JQDA 4JI6B 5L40A 2WLTA 1WZEA 1ZCFA 1L1FA 4IOLA 1S7GA 1SWVA 3HO6A 4AJ9A 3WSTA 3GQBA 4K9MA 4QKQA 5MN6A 2DHEA 4HYEA 1H9CA 1YR3A 4ZOBA 4E09A 3WLFA 3K1AB 3ELUA 4G2NA 2PZGA 3CKMA 2IXGA 3WL7A 1P45A 1N2GA 5H02A 2ID4A 4BO3A 4WY8A 1FFCA 4XYGA 2QTMA 2H11A 4XM2A 1YRHA 1D4OA 2AN9A 1TJYA 3DS8A 5FT9A 1S8AA 2BEWB 2ZR8A 3FFXA 4IS2A 2V0GA 1QTRA 2ZBEA 4DCNA 1DHRA 3SYNA 1GT91 1K06A 3W6UA 4YO7A 3QV1A 5HJ2A 4WXHA 1MO3A 2A9PA 3HLTA 3LLVA 4LVNA 4R2JA 4YO8A 2YQ4A 5I8ZA 3BWBA 3VDXA 3ANTA 1Z6XA 3PPYA 4GHWA 3MWJA 2O9JA 3C6XA 4H4DA 4LHXA 3E22A 4D8WA 3KSRA 3CB2A 4ARAA 2FKNA 4H7FA 4I8XA 1ZUWA 3GCWA 1YZUA 1LK0A 4Z0NA 1O8CA 4XJVA 4BMOB 4BV3A 4IXNA 2V9PA 1W9HA 4HDKA 2O2IA 4D3DA 4ZMSA 3OQMA 1JDNA 2EAUA 2XX3A 2RAUA 4EATA 3NXSA 2D13A 1V5IA 3INTA 4PRYA 3MTDA 1QPBA 5JDIA 3T7SA 2EKLA 2YXBA 2DPMA 4CGYA 3ZHCA 1CG6A 1NAHA 2FWJA 3R5HA 1UPTA 1YVRA 4HLDA 4MMZB 4KYUA 2PUEA 1H85A 1BKYA 3ETNA 2VYVD 3CC8A 4CWAA 2XYQA 2Q7XA 3CPHA 3QIVA 4LV5B 5KYXA 2EGHA 4FNMA 2W00A 1NBWB 4LJRA 1IYZA 1QGUA 2RKOA 2QN1A 2AV6A 3BK2A 4WI1A 4BWFB 2J85A 4M0KA 2P69A 1FQOA 3JWJA 1HEYA 3ELBA 4INAA 3I76A 1USUA 2BTOA 1YQWA 3WIUA 4F3RA 4Y67A 4KR7A 1EGAA 1N5OX 4LY0A 2H4HA 2PUBA 3W3AH 3NGMA 3DV0A 3WGJA 4Q4HB 2ZRPA 5T5QA 2X0NA 3ZWPA 3QG5A 2V8BA 2XB2A 2GYYA 4WY2A 1R4ZA 1U65A 4HGPA 1HQKA 4MCAA 4MKIA 5CTJA 1ZEJA 2ZI3A 4KWEA 1U02A 2NUAB 3F46A 5AHOA 2IHTA 4URHA 5PNTA 5K6AC 3JATA 3C3CA 1GFWA 1WU8A 2X5KO 1M34E 1HXHA 3MTGA 2TMGA 5SYMA 4EJSA 1OGIA 1H3NA 3CXUA 4HTFB 4JJ8A 3BAZA 2B2CA 3RNOA 2AR0A 3DXYA 2PXHA 4KMOA 1L5MA 3TLXA 2C8LA 4KZKA 1F4VA 2E4AA 2VSFA 2YWHA 4WBNB 4N0MA 5J3JA 2YVKA 4IVNA 2AZ4A 4Y0VA 1I7SB 1SKUA 3B3AA 3EZYA 3KSBC 4H3HB 3BE6A 2JGDA 3WQRA 3N6RA 1DSSG 4CKWB 4EI9A 4CMAA 1KI6B 4KYTA 5GIPE 4D79A 1FCJA 1UAYA 1JHDA 3EDCA 1GG8A 1XTKA 3BGWA 3GMDA 4NNPA 2AEFA 4ZVTA 3S1SA 2OUKA 1J0AA 1EVJA 2E82A 2HJRA 3JQQA 4A15A 1N0VC 2HA3A 4EG1A 4MGZR 1FYDA 1DB3A 1Q2XA 3I05A 3PQ6A 1Q14A 2HY7A 3FPBA 3GC6A 4FN5A 5CT9A 3TG8A 4D8UA 4MDHA 4QG3A 3VZDA 1N33B 5CFZA 1FVOA 4FYHA 5JD3A 3EJ6A 2WTEA 4HSEA 3NATA 9LDTA 3T61A 3PJRA 3RC3A 3H86A 3G8YA 2VF5X 2ZSFA 3EPPA 2YMMA 3BHMA 1O97C 1KJJA 3FNBA 2I34A 4WK4B 1NULA 2M6SA 3NHWA 3LWDA 2O8BB 3IRUA 4ZO4A 1WQ1R 4OB6A 2JI6A 3IAFA 3QBDA 2ID7A 3S28A 2HH9A 3URKA 7GPBA 4G8CA 3TMKA 3UB3A 5AI9A 3IPAA 2YJ6A 4JEMA 4K6HA 4RIHA 1EDDA 1YWGO 4Q4JA 1M2FA 4PHFA 2NNWB 4IH9A 1W0KA 5F12A 3CIFA 3P2IA 2DERA 4L7QA 1RQXA 2XUDA 2VYFA 4WLEA 1Z0ZA 1U2SA 2CMKA 1QIDA 1ODSA 4BO2A 4EMTA 4MGEA 2B8WA 1B3RA 5DHUA 1T2VA 2G3YA 1XN4A 4PHTA 1F5SA 1W4CA 4HWPA 4EYQA 1MDFA 2Q6IA 1GA6A 1UC9A 2BUAA 5AXCA 3VMMA 1STOA 3WQQA 1WBBA 4QUHA 2JIQA 1G1MA 1WZUA 2HMSA 1X8LA 4KL8S 4DMGA 4DREA 1M6EX 4OYHA 2VNSA 2Z8YA 5CX1B 5G1NA 3RLFA 1USIA 1AURA 1KAQA 3QJYA 3LFUA 3WDLA 1TJ3A 1ZYUA 1R0KA 3SQWA 1LI5A 1P1IA 2J3JA 1SUWA 5G02A 1DWQA 2CKDA 4PFQA 4XQ0A 4KN5A 1FNMA 2FLWA 1SVUA 2P2GA 2GAOA 2ZBGA 3ECCA 4WNAB 2XNJA 5T67A 5JYEA 3QNMA 2IH5A 4YAOA 1C7ZA 1W5TA 3W7VA 2DH5A 4RS4A 2PZEA 2AE2A 1TU0A 3WGNA 4F12A 2ANCA 2AR7A 2EQBA 2EDAA 2KYRA 5E6RB 5EXTA 3TL3A 4KX3A 3WMWA 2D1FA 3NDBB 2QXYA 1E7YA 1XZGA 1ZMTA 2V9ZA 2WJPA 3A9WA 1Z2EA 1SN7A 3BFKA 1KZHA 3U3ZA 1FPQA 1FYVA 3ZWWA 3EPKA 1HG0A 1ATIA 1HDYA 2WP8J 3B53X 3HZOA 5A3RA 4JI0B 4Z9AA 4XUEA 1O2DA 5KKNB 3HM9A 3EW9A 3R5TA 1TUBA 1I8TA 1S3IA 3V6LA 3WLLA 1PZFA 3C85A 2XWBF 3O9MA 5B6JA 5FDFA 1LRKA 3ZWDA 3K8ZA 5HF9A 4TSKA 1JS1X 2C7OA 4Y30A 4KP7A 5CA1B 3V48A 4XIGS 3NNNA 3ZU2A 3EVCA 1U7WA 2OV4A 3PVZA 2DWPA 3E8XA 2CWDA 1WSDA 4LPSA 3R8FA 8ADHA 3KETA 5A4DA 2QEQA 5AW5A 4YMHA 1A72A 4G1CA 1XEFA 1Q1ZA 3LLUA 4A4DA 1PWHA 5L4LA 5DM70 1K5PA 3A28A 3SKVA 1C80A 1MB9A 1VKRA 1XROA 2QQ0A 2QX8A 3ITDA 5DGHA 3RR2A 1C4WA 1Y6ZA 5DTEA 3T7RA 3WB0A 2NU6A 2BKUA 4G1EB 2GK3A 1GR1A 5HKKD 2EBUA 4JXZA 1TVKB 3H11B 2QMUA 3D1VA 3CKLA 1YRLA 1I01A 2Q2WA 4HTAA 3O8BA 5ERXA 3GT4A 3M4XA 1UFKA 3WK6A 4B6GA 2QMZA 3IURA 2JHAA 3EDQA 2BH9A 3FNRA 4ZAXA 1Z0JA 1SU7A 1ADCA 5E6SA 4IJ5A 3WMFA 1EU1A 3CPSA 2YJ3A 4NXNB 3JYOA 5TMPA 5JAOA 3AEXA 3QUTA 5IJXA 2B98A 2X4GA 3K1TA 4NF2A 3H97A 4Z9XA 1BIFA 3VBCA 1WMFA 3L9XA 2PD6A 5I7WA 1RAGA 4KWCA 4YR9A 3K09C 3I01M 3L79A 3O74A 3CXRA 1Y48E 3C1TA 3KD3A 1QQ6A 3P4YA 1I6LA 3QFFA 2C4WA 3EVAA 4C2TA 4URUR 1THZA 4QJIA 2O7VA 1C0IA 3I1IA 4J0IA 4E5DA 1QZ3A 2HRCA 1TA9A 4FZ3A 4MKGA 2EZ9A 4DLXA 2H5IA 2HD4A 4XJSA 1EMDA 4E07A 2W2OA 2EIXA 2CF5A 1M7BA 2IOFA 4KLAA 2CLIB 1GLGA 2JFPA 3MTBA 3QXGA 3QYAA 4P7BA 1DX4A 1JU4A 4QM7A 4C7JA 4WN9B 1UP6A 4JQSA 4D4MA 1DBPA 2HB6A 4N6NA 3WWYA 1PVOA 5JCZA 1JX6A 3GRAA 4IV8A 2AC7A 2RGUA 5J4LA 2XBMA 1DAMA 5IC6A 5D3KA 3I5AA 5IF9A 4NICA 3WMXA 2JHCA 1AKNA 3ZG6A 4QGHA 1YDHA 2P4UA 3BTUA 3OU7A 5EXXA 5UKDA 1EFPB 1GRRA 3JX9A 5DM60 5IJWA 2VCEA 1L4FA 1RWQA 4CR6A 4Z4FA 3A9CA 2HCFA 1HQYE 1HDCA 3D8HA 4M8KA 2RHOA 4EO7A 1XFAA 2PY6A 2EOAA 4AJ2A 3WRVA 4DQVA 3EVDA 5ELMA 1OI3A 3QENA 4WZ6A 4B3DA 2O3QA 3FSGD 4KLRA 3D7RA 3FJYA 2B61A 4F45A 5JAMA 2WJHA 3RFCA 2JLUA 4L72A 4QGGA 3DL0A 3WIOA 5BURA 3S2UA 1Y37A 4I81A 5CVUA 2CL7X 3H5VA 4WSOA 1COWA 2D8MA 3WY9A 2VNKA 2KB0A 2JVKA 4YMUA 1FQKA 2QRKA 3Q3GE 3N2EA 4KYVA 1Y6RA 2RHLA 3DFFA 4MKZA 1DEHA 4C7XA 1D5CA 5CBPB 2J3QA 4JQYA 2VP6A 3STTA 4CXMA 5IJ9B 3AEQA 3MD9A 2NU8A 4LZAA 2CEAA 3KZVA 821PA 4HUQA 4L3OA 4O1MA 3HCBA 2ORYA 2BWJA 1FVXA 3ACBA 2ZBRA 2JD1A 2Z9DA 1NXVA 4HZIA 4EX7A 2PKRA 3UJ8A 2FF7A 3CISA 1DEOA 1VIDA 5CM8B 2V6IA 3N58A 1H5QA 1RCFA 1ZC4A 2Y1KA 4LJ7A 4Z4QA 5J4VA 3WWCA 2EG9A 1SB9A 1FTSA 1CULC 4ID3A 4PLVA 4C4RA 4ETWA 5I4CA 4JUCA 4UNSA 5KKCA 1YS1X 1ZHHA 4M0MA 2K87A 1MC8A 4NJMA 3WDMA 2ZS7A 4LXHA 4C03A 4H7PA 5FAKA 3SLRA 1DV2A 4P8RA 1HTWA 3G13A 3QNWA 3A6DA 2H29A 4UAJA 2BFCB 1FSPA 2EWVA 1HRKA 2JH3A 3MS7A 2JCXA 4I5IA 3VYRB 2FMUA 1G6OA 2C4KA 2H9AA 2VAWA 1ZOPA 2VBFA 3HB4X 3NHLA 4GBJA 5DGCA 5JAPA 2GJ4A 4R84A 3D31A 3EARA 1ZQ9A 5JUWA 2VP5A 3I9JA 1KJNA 1P73A 3HR4A 1II9A 5K3FB 1EWYA 2R85A 3V9AA 2O50A 3S1AA 3I62A 2V4UA 3PT5A 1T25A 5JH7F 3TSCA 2OHVA 1U2GC 2WSIA 2DM6A 1VL5A 4EY6A 5BNZA 5I9LA 1CR2A 1A4RA 1J5XA 5HJEA 1JT2A 2B35A 1OC4A 1VSTA 1ODIA 1SC3A 4E32A 3AEZA 3T4EA 1F8YA 2X41A 1LPPA 3F6PA 3GRVA 1I14A 3N75A 4W4TA 3HYLA 4YBZA 2H0AA 3ZE0B 3K9FC 3QEJA 3SHVA 1KIAA 1PX0A 4D45A 4EHHA 1U2RA 6LDHA 1G20B 1NQAO 1PJ2A 2CDRA 2JCVA 3OEHA 4OD0A 1SU4A 5CB6A 1Q7EA 3THYA 3NKVA 4BAZA 2OGZA 1CZOA 3JQDA 2A3RA 4XGIA 3VPGA 1XA3A 2PSFA 3WRWA 2PH5A 3S99A 1HYEA 1YVUA 3AR3A 4BN4A 4X63A 2RGNA 4X7BA 4TGLA 4MS4B 1AKVA 1WB6A 4MGHA 1GQYA 1DZIA 2CDCA 3IOCA 2D54A 5A1TA 1XJCA 1KO7A 4CKEB 1IL0A 1JKJA 2FPOA 2YMLA 3VDMA 5TDHA 3DV0B 4FIDA 5I51A 4LEIA 3KKMA 1G7SA 3KIPA 5CCBA 4YI3A 2J6IA 2JIZA 2O19A 4FR2A 2VRBA 4MUJA 4MUKA 1U8TA 1YC5A 2HNKA 3D6FA 3O5AA 3HBLA 4FYWA 4B3BA 1DJMA 5I9NA 5IG2A 4TS1A 4WT7A 1E1NA 2A1IA 2HQBA 3SE0A 2OENG 3UMCA 4EO9A 2C0QA 4QATA 1FFYA 5TMEA 2H4YA 1CZNA 2ZIFA 1H2BA 1A5TA 1IXKA 3DEKA 3IAUA 3HKCB 4OYYA 1KOFA 1HNNA 3UHOA 5HZHA 1LFDB 1NN3A 3U80A 2C9DA 1YAJA 4EJSB 3ZHVA 3OBIA 2WSBA 1NDQA 5AOAA 2BFDA 3JQCA 3HMQA 4IFTA 4MPJA 2ZQZA 3ZV5A 4L0DA 5LD2B 1NLMA 4OBEA 2OV3A 4UAVA 4PZUA 3FNHA 1QV9A 1X94A 1NY5A 1SU6A 1YZLA 4YQZA 5EEHA 5F73A 5THKA 3KBBA 1JL3A 2R86A 4QUEA 4EW6A 3T5CA 3C8DA 3WK9A 1EM6A 2MSWA 4Y6OA 3ESBA 5DHTA 3FZEA 2VP3A 3AWIA 4QUJA 2X3YA 5ADWA 3CVJA 4HNHA 1CUUA 3OIWA 1YDWA 1WV0A 2ATXA 3S4YA 3E2MA 3OUZA 2B5VA 2PT7A 2QD5A 3C6BA 4PBRA 3B9RA 5IRCD 5TJ9A 1EDEA 521PA 3A2KA 1O3YA 2DUMA 1XQ6A 4X8MA 1M8GA 2GPTA 4C4TA 1DDOA 4UEKA 2PUJA 2XPCA 4V0OA 3U1TA 1W2HA 4BRZA 2AMYA 5DGXA 4ZVLA 5LMZA 4O4HB 1MQSA 1AA6A 5AHXA 4ZA2A 3THXB 1HX7A 4RHCA 5AUQA 4C0KA 2HSGA 3R0QA 1A3CA 1OSNA 5HQ3B 2IY7A 4IHKA 1Y3DE 3WOVA 5JAUA 3NBFA 3WP0A 3BFVA 2BFWA 5F2KA 1A71A 2R48A 2WUEA 3D1LA 3TLGA 2PO7A 1E4VA 2IIQA 2M6RA 3I5UA 4IDCA 4IP0A 2CHQA 1XDUA 2GN2A 2RB5A 4JWKA 4KFSA 3SDBA 4YGYA 4MUYA 4QEDA 4YRIA 1M2EA 4N03A 2EKPA 1BMDA 1ZAYA 1OTXA 2ARKA 4O2BA 4OXRA 3RRXA 4G07A 3TNDA 3RFUA 1IXRC 3L07A 4MDYA 4D9BA 1Q0RA 1TYZA 1GXSA 3CNNA 2B78A 3FVTA 1XQ1A 4NTZA 4X64B 2VKTA 4OLJA 3JD3A 1H2XA 3KCQA 4HYQA 3M0EA 2UUPA 1IMOA 3WZ2A 4LCBA 2Z8XA 2QSZA 3L4BA 4NQZA 4D3XA 3K0SA 3NWBA 5CMLA 1XQ9A 3H0CA 3NIGB 1XZJA 1II8B 1EFTA 3FD8A 4XW2A 2H4XA 4HQ6A 1PK7A 2X1MA 3V4PB 1RBQA 1UANA 1QLWA 4OJKA 4M7OA 1PUXA 1NNUA 1R3UA 1CUWA 1Y3CE 2QLNA 4BATA 3HB9A 4P3OA 2PEYA 5ALWA 3TIGA 2ECKA 5D2CA 2Q3MA 4JI5B 2GHQA 2G1AA 1TU3A 1VKNA 4JP1A 1IOLA 4WA7A 5BMVA 1NJFA 1MPTA 3SAJA 1TECE 1CUIA 4DMLA 3EQ9A 1TIBA 2WIDA 2ZJ4A 3BD6A 4HEQA 4IG9A 4JJKA 5FNZA 1YJBA 1U7TA 2VAVA 2ZJBA 3EIQA 1AMOA 4TTAA 4DQLA 2VRCA 3GRFA 2CDBA 4L75A 3K20A 3TIFA 1VLMA 3R7BA 3EYAA 1DKNA 3WC4A 3A6GA 4W5QA 3ITEA 5JJCA 2PLAA 3AL0C 4I55B 1MUUA 2POCA 5BN5B 3N2ZB 2Q3CA 3BFJA 4WCFB 1P1JA 1E9CA 4JB0A 3DAFA 1HY3A 1DTEA 4NPHA 3H7AA 4IUDS 3N3AC 3T3DA 1R0RE 1X1SA 4M0CA 4DLTA 1ZUNB 1E1DA 3H3FA 4AWXA 2D5AA 1FRVA 4LBVA 2VTKA 1J06A 5ANRB 1IRXA 3BL8A 2QE7A 3U9SA 2DT5A 1CYDA 1KEPA 1T9AA 3A3OA 3BWDD 4F21A 3R6WA 1M8JA 5KJFA 1C7RA 2VJDA 3NRBA 2PN1A 5INTA 4CEHA 4KRFA 4Y3UA 3FUWA 2FW7A 4ODIA 4HPJB 3QYPA 3B6ZA 1Q0UA 4WQMA 5F2EA 4ENWA 4KSCA 2AKYA 3KYIB 5LN1A 2J9FB 2NWQA 3GG9A 2IX9A 4ENPA 4ME6A 3UFXB 4QU5A 4E46A 5C7IO 3L4KA 1V6SA 4GKJB 4X95A 4B45A 5IU6A 3HYTA 5D51S 4L8FA 4C01A 3ZXSA 2Y66A 1MBZA 2XT6A 2RARA 4J0HA 2A3NA 2H8KA 3HYSA 5HCNA 3N7TA 1M2VA 1VFNA 2AQIA 2OTCA 3VZBA 5B57C 1ABEA 1AB6A 1J7JA 3NALA 4I3GA 3MMSA 1MABB 5CNKA 1CQWA 2ZUDA 1YXMA 4FYKA 1L4MA 4IDNA 4PYLA 5FBQB 1SUPA 2RHCA 3CB4A 4OXKA 5LFAA 1E6UA 3UXEA 1ULBA 3BJIC 5ECGC 2IEBA 1S8FA 4GBMA 1PEDA 1T8RA 5ALPA 1L4HA 3H4TA 3AERB 3B6KA 2GPWA 5JSUA 4JYBA 1N8NA 3HU3A 2QZ4A 1NQWA 3O75A 3MSXA 4KQCA 5BYAA 1WB9A 1EFRA 2O7RA 1JDZA 1E1YA 2V0CA 4FEYA 4J16C 4YPVA 2XTNA 2RGDA 5CFMA 1AB5A 1SXQA 1SIBE 2HU7A 1WRBA 1LPMA 2EW1A 3EJWA 4DSNA 5FPTA 4R40A 5KSWB 5FNVB 4R9SA 4NK4A 1G21E 2WR8A 4BS9A 3FR7A 3FMFA 4UTOA 1D7AA 4FU0A 3WGZA 3M6IA 4BOYA 4R1NA 1ZD3A 3M1IA 4DADA 3DBHB 1RRCA 2PUVA 3DB1A 2HCJB 4FE7A 2NP7A 5ER9A 3MK31 4BMSA 3D2BA 3D6HA 3DKIA 3FCUB 4PS0A 1W2WB 4QO8A 4UUAA 3GPCA 2BF7A 1BD4A 2RBGA 3SZGA 3GGGA 4COOA 4G23A 4EA7A 2HIAA 2P11A 1Y9JA 5ICGA 1YFJA 1XLUA 5M34A 1P8AA 4YB8A 1E3DA 3KAKA 3TQSA 3AVTA 3A9UA 1NXSA 1L5KA 4JI8B 1GCAA 4KKVA 1PJRA 1W85A 3I6IA 3H1EA 3K4PA 3P8ZA 1GPYA 3S70A 1FP4B 5DSZA 1DBIA 3R7SA 1QAQA 1U3WA 1I30A 1VMKA 1IQPA 2BSAA 2CXRA 3KQMA 1URPA 2B4RO 3QKTA 4P98A 3JD4A 4OQNA 3VR5D 5TGTA 1JDTA 1RLIA 2X23A 4IKOA 2AUMA 1E79A 5JOQA 5JDIC 3EXAA 2WD9A 1M1NA 3HKBB 3I8SA 3RC7A 3RSSA 1T3LA 4UOZA 2NTNA 1V5GA 4X1KB 3DAPA 4EHDA 4D46A 2IY9A 1LUAA 1UBEA 1TKBA 2ERCA 2HF8A 1C8VB 2NUTA 1DEKA 1JPNA 3TR0A 3HK2A 1RJDA 3N2YA 4XTRA 1JTFA 2Y0BA 3QU4A 2XODA 2NZWA 2X3UA 3WLPA 3LT0A 2FMXA 3KCNA 3ZI0A 4DR7B 1LJ8A 2CK3A 2FX5A 4YP9A 3IMFA 4BNLA 4TL8A 4QULA 2EJUA 3PRJA 1D6SA 3QPCA 3K72B 2I3GA 3PJEA 3SHWA 1M75A 4L7VA 4EYSA 1PZNA 1CV2A 1SEPA 4YMVA 1JU3A 3C3JA 3CE9A 3H4MA 4JJZA 4UUBA 4EF6A 3ETCA 4Z1OA 1WCYA 2C88A 1MG0A 1J25A 2X8JB 3HCAA 3JCZA 1TM7E 5AM0A 4EX6A 3BORA 3KB8A 3QPVA 4EKGA 2OVBA 4AKGA 1PKEA 4C0JA 2AKAB 3BXZA 1QQ7A 4GPTA 4UNPA 2XAUA 2Y1LA 2IYAA 2CFRA 1YL5A 3TK1A 1FNDA 1E5LA 1DIHA 1SAYA 1YL6A 4QOFA 4B46A 4B6JA 3TTYA 5IFKA 2JEZA 5IJ0A 1UPUA 3DPUA 3WNZA 4CFYA 2VHVA 3F3MA 3PRYA 2CMFA 3T4UA 1F60A 4RTPA 4FI3F 1X15A 2E1RA 1ZGJA 2G1JA 1XMOB 1H4QA 3K9GA 1C3EA 1NT4A 4QAQA 1TD9A 1N9GB 4UFPA 3RQSA 3LWBA 4L6IA 3LW8A 2XVZA 5FWAA 4ZOAA 4NXMB 1HFKA 1QIMA 3HN6A 2YX1A 3HUTA 4PC7A 3JRNA 5LZ2A 4ZVKA 2BRUC 1ZD2P 2F8MA 3ZHYA 3H5LA 4WASA 4NYJQ 3CX3A 4F3YA 3FCCA 2A1TR 3QLUA 5CLIA 1RI3A 2OV1A 3P2OA 3PF9A 4CMKA 1MAAA 3SYRA 4YRBA 3ESDA 4E7PA 2JASA 2OVFA 1OCEA 4MR8B 5ALLA 5DGTA 3IPCA 2XCUA 3R7NA 1G64A 5DP2A 5C18A 5AFSA 1XIVA 2QG4A 4R9UC 5ENDA 3TIIA 1E61A 4HEJA 1J33A 4LXUA 4MWCA 1XZNA 2DVMA 2H7XA 2P68A 2Z1MA 2Z5FA 2BFPA 3AI2A 3DMFA 3FKSA 4H6XA 4J6FA 4M8LA 3VDRA 2FFBA 3ZBUA 4AICA 4CF7A 1SCQA 4GUDA 3U26A 1N2CA 5FCDA 3WA6A 1P7PA 1XRNA 3FCSB 4KGDA 1CRWG 3VR3D 3V8BA 1WXFA 1U1IA 2C1ZA 2YIDA 2WC1A 4XFDA 5TQ2B 5BW4A 5C53B 4AZVA 1GNTA 5EVCA 1SC1A 2QBYA 2FQYA 2PBLA 1XVUA 1R5NA 4B17A 2WNSA 4ND5A 5FOUA 3FDIA 3KYCB 3FTDA 4IDDA 2FF5A 1F9EA 5CJPA 4MS4A 2IYLD 5ILQA 2JCBA 3OO0A 1EESA 3ZCRA 4LF8B 2GGSA 1UWCA 4Q21A 1XKQA 3MAGA 4R3UC 2NXJA 2PLFA 1E7SA 3V8PA 2R9VA 1SPBS 3PGJA 3OZWA 2MTBA 3R9XA 3V3TA 4OHFA 1T9BA 1VHLA 1R9GA 4KIJA 2FEOA 1KY5A 1FPMA 4F4UA 2H52A 2V45A 4MAFA 4OKIA 4XOUA 1T2UA 3A2NA 4M4SA 3BM5A 3CR3C 3BTVA 3HJHA 2PGOA 1E3MA 1I6KA 4YT5A 2Q1SA 1U04A 4PG8A 4MRMA 1VC2A 2IWRA 1ADBA 1FU4A 2J6CA 2FUG1 2ZWOA 1J97A 4J4BA 1NE2A 3O83A 3R75A 1G6KA 4B2PA 3FCOA 1E9EA 1ZNYA 1B0ZA 4EY4A 5CYGA 2BFDB 2DLDA 2H00A 4R0NA 2IITA 5AKZA 2AF4C 2ZSIA 3BH0A 3KQTA 5BT9A 1CUJA 3I5XA 4MA5A 3GZJA 4OMFG 1V8FA 1XDBA 3GGCA 1GTG1 4I8DA 4CKBB 3NYQA 1Z16A 4MARA 1WZ2A 4BCDA 1NU6A 5DE3A 4MWEA 1W8IA 2RCNA 2Q29A 4M9ZA 3TIXB 3THWB 1ZK2A 4DCSA 2PUDA 3OKAA 4TRMA 4PC2A 4CT4B 4E4YA 1J9EA 4HG2A 4HRVA 2ZCUA 3GJ6A 1JEQA 5KSYA 3RRJA 2GRUA 1QPGA 3GRPA 2O0LA 4IIGA 2QP4A 1J23A 3H04A 2B1IA 4FMDB 1FDTA 1HOTA 1C7EA 4OV6B 4AMUA 1NMZA 3P19A 5ALMA 1C9MA 5FXMA 2RAPA 2L82A 1PR4A 1UM8A 3IVCA 4BX9A 3THXA 4CUJA 4C7OA 3X44A 1RAEA 2XOKA 5HQ3A 3NFYA 5CDFE 1VJGA 3WLJA 4CDNA 2HLDA 4FK8A 3DNPA 3GJ5A 2L42A 3HXPA 4DJJA 3MINA 1Z22A 2NSDA 4G8DA 3OTOB 3T9CA 5CDGA 1IWPB 1K0UA 2JARA 2OB1A 2ZRNA 4FFRA 4ECAA 4KYIB 1GGFA 1L9XA 4JI2B 1X7XB 3N6VA 4JVLA 1DPGA 1PLKA 4MVJD 3TSOA 1L5LA 3G85A 5H59A 2EFDB 3I52A 4ZCPA 1ZICA 4B74A 3GF4A 2WV7A 4LK3A 2H1SA 3PIDA 3VPDA 3OZTA 1K4KA 2N42A 5FFNA 3SM9A 4LF7B 2H8GA 2O2HA 2VQDA 3LPMA 1A2OA 2OXFA 3LUFA 4QQNA 1Q0SA 1JQ5A 3BUSA 4R2HA 1W4AA 1C1YA 5EP4A 3NDRA 4QBTA 3QKUA 3TAUA 3ZW8A 5K0ZA 2Y1DA 5FFFA 2IELA 3SOZA 5BQXA 3C7TA 3PNBA 5E0OA 5DXJA 4BEWA 3NEYA 2AUNA 4TMXA 1II8A 5IBPA 2A30A 2AI2A 2ZVQX 1AUVA 4AULA 2V7UA 3BWXA 2GEVA 4PQYA 5DNWA 5CUQA 4HCJA 1GCOA 3K35A 3ZZTA 3VGJA 3N8IA 1SKAA 5BMVB 4P81A 5J2UF 5EJ8A 2WPDD 1K4MA 5JRZA 1I0ZA 4MLZA 1X9IA 2BKLA 4X8HA 2CT8A 3BB3A 3LFHA 4QOIA 3BJEA 2P6PA 2ZDGA 3QEMA 2YS6A 3D64A 3SYLA 4EY5A 2CW5A 3GQVA 2OCKA 5TT1A 4F56A 4RD0A 3I6QA 4E5MA 3GY0A 1I36A 1VL0A 2RHJA 3QE2A 5G2OA 3MVEA 4R83A 4DWWA 4CR8A 5KSOA 3CT6A 2H1IA 4WXEA 2LZ0A 3AVXA 5ADVA 1O08A 1E66A 4MHOA 2J0SA 3OOYA 2Q1TA 4AX4A 3DLIA 1ULSA 4EGQA 3UCEA 5HF8A 2OKGA 1C7QA 3EXHC 2P0YA 2HR1A 3G8DA 4EHKA 2ZJ1A 3Q87B 1TDJA 4QICA 5JJBA 1FA9A 4DQKA 4KE9A 4BFZA 3EEOA 2YIJA 4NZOA 4DE5A 1O54A 4Q3DA 3SYMA 4L9SA 3NXKA 4N82A 4JR2A 1UKYA 1VBKA 3C1UA 4AD8A 4YCNA 1DP4A 1E8DA 2JGFA 2XZTA 1UQRA 2V74B 2GNAA 2B1GA 2ZIZA 3DP7A 3H0EA 4G9EA 2QW8A 4DLYA 1VCOA 3EXFB 4ZT3A 4ZU1X 4C76A 1J0BA 1UMKA 1O87A 4JLMA 3T1YB 1RPZA 3WLAA 2FPPA 4WMLA 4OU5A 1DQYA 1N7HA 5BQOA 3V1KA 2HW8A 1ZSNA 1F3LA 4YFVA 4ER3A 5FR1A 4BU1A 1HG1A 4R51A 1T34A 2NZYA 4ZGWA 1FJXA 4EUFA 3IUPA 5KYVA 5B2ZA 2XT9A 5LWQA 4POOA 3MT9A 2WKWA 2CSUA 5DFAA 1O6GA 2BMAA 2W0SA 3S44A 2HIMA 1MABA 2JJ1A 1CP3A 4JS0A 1DV1A 1DC3A 1HYGA 1G16A 1L5OA 3PHHA 4RD6A 1FX0B 3KVVA 5KX5A 5AKIA 2XYPA 3DVAB 4JASB 4ARVA 2XKAA 1JVSA 1U5AA 1GZDA 1CR4A 4BCBA 2Q3FA 2W4IA 3X1DA 2ZSDA 1ZBDA 3P9QA 3H4VA 4OA8A 5L4NA 1T0IA 5AW1A 2R6GA 3EEYA 4L08A 1C8BA 1BXRA 1GGKA 2PXXA 2GK7A 4DA0A 2Z98A 2GZSA 3FM9A 3H5NA 3L8ZA 2G82A 3TZHA 2CLFB 5JTUA 2HJWA 3G1UA 4JL8A 1UMCA 5ES4B 5E3IA 2I76A 5JPIA 3NYWA 3JYLA 5LZ7A 2EG5A 2J45A 3PC3A 4M1MA 2XMGA 5FNVA 3HWX1 5ICEA 5JJKA 4E5PA 4U2CA 1FLDA 2VDUE 1F8XA 1JHQA 3GLRA 1QR2A 1CQJA 4B48A 3C0KA 5KYTA 2C3UA 1BWRA 5MHTA 4FYIA 2Q5HA 1N9ZA 1A9XB 4JBXA 4MW2A 5BYJA 2JLQA 2YYZA 1UT5A 1W6UA 2IBMA 3DYIA 3EASA 2WTAA 3ML1A 4J90A 5IW8A 4WBNF 4C89A 2B7LA 1FVHA 1LK5A 1QIKA 3DFMA 2WJZB 1A98A 1PGJA 5JC8A 5AI5A 3KLMX 1CF9A 5JJ5A 2ALJA 3MWGA 4AQYB 1KEUA 3BRWA 4KHZA 2XUIA 4PX9A 5ARBA 4O3MA 4KLNA 2OORC 2EU8A 4TXHA 1Y6FA 3I42A 1NOJA 3V46A 3GDFA 1ZMXA 3KDPA 4JVSB 1BN6A 2C58A 4PBTA 1OH8A 3E6AA 4XWYA 4R6WA 1VP9A 5LBUA 1JPJA 4Z9YA 3F9RA 3E9DA 1KMMA 2WZBA 5DT2A 1JNYA 1FFAA 4MDFA 2BI8A 1GTMA 4WWHA 2OZPA 4CIAA 2HCRA 4P86A 1WL8A 4A92A 4CTNA 2PUTA 1NXQA 3IAS6 2K2QB 5GGYA 5EMMA 3M82A 3SNKA 1D2AA 2D4HA 2QYOA 3WK5A 1HE8B 4IDOA 2H4JA 1T2FA 4J6EA 1OILA 4G9GA 5AR1A 3V4RA 5MGNA 4FFBA 4X62B 1PK8A 3O9VA 1VBMA 2YH2A 1QQTA 3NHJA 4FNOA 2O0KA 4H15A 2FDCA 1W49A 2I5PO 2EF1A 2IUEA 4CCSA 2XZDA 1H94A 1P9NA 4UTNA 3TW4A 2PGLA 1FXWA 3HABA 2Y4OA 3IVMA 2D1QA 2FUKA 1ACMA 2IUTA 4I5GA 4TS4A 1SOVA 4U9IS 3PKZA 2QN9A 2G5TA 4JJ7A 4R1OA 2PKEA 4IIYA 1LCIA 3RTCA 1Q0PA 1DKPA 1IHUA 2WDZA 5A3JA 4MI1A 2AFVA 5FBWB 4FR0A 2AFHB 3OWHA 2HF7A 2G8NA 2UDPA 4BL5A 2BT4A 3L01A 4HR7A 3CCCA 5K0SA 5C51B 3FDJA 1S4MA 1DX9A 2R1UA 3KP1A 3L7CA 5CD1A 3N8GA 3C6MA 1NXOA 3EC1A 4WGFA 5JQGA 3QEBZ 2OKCA 4YPOA 4PNEA 1NRJB 3HB5X 4NVRA 3UC9A 4KQWA 5JNWA 2CJFA 2ETXA 5F7OA 1E1CB 1M0EA 2V7PA 2MCFA 1UBNA 1XQXA 2NYAA 2VUTA 5C5CA 5CIQA 10MHA 5ITVA 4K9SA 3CUKA 2NVUB 4D3ZA 5EZSA 1F06A 1TW2A 3T9AA 2BEKA 2AL7A 3R0IA 4P6VF 1N9GA 4XB6B 2O8EB 2F3UA 5EKXA 2IIVA 3ACDA 3AIOA 3N8NA 2D0IA 2IFTA 2NXCA 2WKSA 3GX1A 1MC4A 4D6YA 3IAM1 3GUVA 1IQ0A 2GCNA 4QVKA 3WWEA 1W5EA 1T8UA 2GS9A 2LTAA 3JQ9A 1BRTA 4NAUA 4CLXA 1HLPA 2F3PA 1JECA 2WF7A 2X7XA 3LJKA 4R9NA 4RKFA 4XDYA 1O0BA 3WFJA 3A6EA 4NDZA 3ZU6A 1GADO 2ENWA 1LF0A 1YZKA 3VU1A 3PTZA 4GUAA 3EUAA 4AF8A 5D00A 4YP1A 4CKZA 3SBDA 3PZRA 4E88A 3I5MA 1MOSA 1P31A 3FR8A 3QE3A 5EP1A 3ZGOA 3WNBA 4YH1A 5FUMA 4W9RA 1RMQA 3AXTA 5I9MA 3CTMA 3S55A 3WQBA 1KYQA 5AVTA 2ZLBA 1ODFA 3R3VA 1N2CB 4EJFA 3V9PA 3O3OB 2CNDA 5EMNA 3FCXA 1M2GA 4M87A 5IEJA 2O8CA 5K0CA 4RC9A 4EJ2A 4JSRA 2Z56A 3BG5A 1AVTA 2ZTHA 2JATA 2YWEA 4TWIA 1SXJE 2C92A 3ZWXA 3KYCA 2H9YA 1MHTA 3GAMA 4MEBA 4EKNB 1NJ8A 1UQTA 1B1AA 3K09A 1BHSA 3KPJA 2ENUA 4E11A 1NKSA 3D3WA 2O20A 3AW8A 2IHUA 3HV0A 3JASA 3PC7A 3FB1A 2QTHA 2XITA 1SC4A 2ZRAA 1Y5LA 2PAFA 4K6GA 4O4IB 4BQOA 2JLYA 4RDCA 4FYPA 3WDKA 1AGRA 1EJBA 2HEGA 2OC9A 2VSYA 3MRSA 3JTEA 3P0HA 4IFIA 5FL3A 4B3HA 1JBKA 1VG9B 1DARA 2H17A 2LDBA 4E13A 4ITUA 4B87A 4YAKA 3L0SA 4GI7A 2XNDD 4UE3S 1E3JA 3DGEC 3EUWA 3DCNA 4OBWA 1RKXA 2HMVA 3REFA 2ODQA 2JEOA 2Q5FA 5DBHX 3PDHA 1Z18A 4ARUA 1I7DA 5BNTA 1CJKC 3OX3A 4TL9A 2JAWA 4MVJP 3MJDA 4QYIB 2ETVA 3M83A 2G40A 1FTYA 5BT8A 4RUKA 3T06B 1N77A 2Q5OA 1GQRA 1MVOA 3D1JA 4MVJH 2MWMA 3ZHQA 2BM1A 2J9XB 2B21A 2FPWA 1C9EA 1RWPA 3QMPA 5JSHA 4DNOA 4GR9A 4LFCB 5GJWC 5KUTA 3NASA 4M21A 2C0CA 4RM3A 5EKTA 1JLSA 3GFOA 2Z8ZA 1Z26A 5BOSA 2QQFA 2WE8A 2V7WA 4V0RA 3IERA 3PXDA 3NVKI 3KV3O 2R8ZA 1QDLB 5CU7A 1WXWA 1O6CA 3RYCB 3FSEA 4V03A 3JWPA 3PIIA 5ULLA 4PCUA 3QX7A 1YJAA 2QTZA 1Z6TA 2I6UA 2RG1A 4J91A 4LY3A 4MV6A 3P4UA 2WF5A 2WIBA 5LOVF 2O2DA 2DBZA 4KNYA 5T6MA 1JWBB 1YOBA 3KT3A 1XEXB 4I66A 5DNAA 4A8PA 3KR2A 1XNHA 2OG2A 3ESCA 3NW9A 2XVAA 2IW3A 1U90A 2XR1A 4C7OB 4PQGA 3SFTA 4D3YA 3NBAA 2EKZA 2WT4A 2ZZKA 3RM3A 5KAMA 1C4KA 1KMHB 2P0AA 3IOYA 3O94A 2G4LA 2UZ0A 4U7JA 4CKCA 4F6RA 4HHEA 3ZDCA 3KOOA 1YR7A 4QAJA 3UOGA 3RO7A 1V1RA 4PN7A 3G0BA 1BVRA 5FP0A 4DCGA 5JD4A 2I4IA 1SY7A 5M2QA 2OCYC 5EJGA 2EHJA 3BBLA 4F6CA 4LNUA 1XRQA 2ERYA 5LNK6 3B7PA 5F9FA 3P9XA 2OBYA 1HYHA 2W0MA 3T41A 1NUQA 3L0ZA 3TLZA 2Z4SA 1WUJS 1NZFA 1QZXA 2VWHA 1WY5A 3ORSA 1GZ7A 1RI4A 1TYBE 2HC9A 4DIEA 2IXDA 1D07A 2I99A 2DFKB 3D9QX 2CFTA 1E58A 1A7AA 1JEDA 2V6BA 4W5OA 1ZN9A 1QVVA 4F8YA 1RYBA 5LJIA 3NKLA 1G5RA 2QZSA 2W2KA 3RHTA 3OQ1A 4KXQA 2M1XA 1RABA 3ENVA 3TDMA 4JUDX 5JY1A 1KXJA 2HBRA 3DEAA 4LX8A 4P33A 2B0JA 1HR0B 5TEWA 5B1SA 4DB4A 2E6KA 2PV7A 2AJCA 2Y68A 4URVR 3D8TA 5THQA 5FA8A 2BFAA 3FTCA 4MV0A 1ZWKA 1XPJA 2UUBB 4WFIA 1Z9BA 1DRKA 1WMSA 3W2HA 5KU7A 4TVKA 3OE7A 3RVPA 5BVHA 1E6EA 1BFDA 4ARSA 3OUUA 2QD3A 3OZ7A 3PC4A 2V58A 1UBMS 3JALB 3PDIB 4ZHSA 2Z4RA 4PYNA 4H7KA 3G9TA 1UMDA 4QSHA 4DEXA 5LM3A 4ZWNA 3BZBA 3VC7A 4BZXA 4OK5A 5IAAA 2E4XA 3PV0A 4G5XA 3WHKA 3VH4A 1C4XA 5HW0A 1NQ5A 1TIPA 4BKMA 4Z4EA 2JFWA 3CBQA 2WAXA 3HO1A 1JPUA 1R7RA 2ERXA 1U9YA 3GEMA 1TGVA 1JJVA 3QQPA 2GQ0A 1GV0A 3OLVA 4FEGA 4ICIA 4L8YA 4ERXA 4RTSA 1OXSC 1S8NA 1ARZA 1PYOA 4LVCA 4PNHA 1G3MA 2A8YA 1J8YF 1VCHA 2Q0HA 5EXPA 4EGJA 2CVPA 1LW7A 1VKZA 2YBDA 4QDUA 1ZDMA 3CLRD 3SHOA 2PNJA 2VUUA 3G6KA 4E4RA 1ULTA 4Q4DA 1WF6A 1PR3A 1ELOA 2F1OA 3NCHA 3ISTA 4PNZA 3I9LA 1YDGA 4IJUA 3RS4A 3SFZA 2OGSA 3RPEA 2WZDA 4R68A 1Z8NA 2Z83A 3BQNB 4LXXA 2JIDA 1UPFA 3IPXA 4S0ZA 1JDBB 2BFBA 4AYXA 1PS8A 1WTAA 1XZCA 1Z6GA 1AKUA 4BQRA 2AZTA 3NBYC 5TIIA 4RWEA 1IXSB 1ZM4A 2HSEA 3CLSC 3LWZA 3MRXA 2PJUA 1JU9A 1GUFA 1YDMA 2FPIB 1YRWA 4HX2A 4ETMA 3V1UA 4MWDA 2CXQA 3DKPA 1WLYA 3DVAA 1WXGA 1ACLA 2BZ1A 4NBRA 4HAYA 3ZV6A 4TXNA 2F8TA 3CSSA 2GHTA 5TQVA 5LOVA 1OI7A 2XRZA 1H66A 4GGMX 4X6UA 1ZA1A 2IDMA 3CZPA 4ZJZA 1BXRB 1JR6A 1LZLA 1R64A 3L8CA 1R6DA 3UCXA 3C8ZA 3LBFA 3R0XA 4XDHA 1TKRA 2PX8A 2O5EA 2PL9A 3A4MA 3AB8A 2HPAA 3L7YA 3KJFA 1ZSVA 2WHPA 4WESB 4YCMA 3ZWOA 5KOHB 3KR1A 2WD8A 4DUZB 4XJTA 5BW6B 1L5NA 2FWMX 1ZX1A 2QU8A 3NIDB 4IIJA 4WVFA 4YV2A 1LPAB 2ZT8A 3AUYA 4FOTA 5HA5A 4YDSA 4K9OA 1QDUA 4HDRB 3I2JA 4Z7NB 4NC9A 4Q5IA 3R3UA 1DHTA 4ND8B 1ZIDA 3TTTA 3DTTA 2XMDA 3JS5A 4TL7A 3ZE2B 2JG3A 3IEVA 5E9WA 4D8XA 4L28A 2UYYA 3KT6A 5AKGA 3FLAA 2BRUA 1TZ2A 3K16A 2J30A 2MOKA 3LCMA 2QRUA 3P2KA 3TM4A 5BY2A 1AGXA 3DWGA 4I08A 4Y2TA 5K2OA 3DLHA 2FPLA 2OSVA 1E0AA 1X70A 2XQKA 1GL3A 4ND6A 4NMWA 4EDFA 3DQZA 2CEKA 3WKDA 5K8LA 1I5EA 5TARA 5ISMA 4FD3A 4RCZA 4UCWA 3LAWA 5J59A 1RPJA 2DCMA 2OG1A 2UUOA 1ISGA 3HU1A 1LH0A 2X0JA 2EQAA 2GEDA 2PX5A 3PNQA 4FXPA 4Y6GB 3RU9A 4CI0B 16PKA 5ICFA 4GGPA 2BKAA 2VPZA 3X2EA 1BA2A 5F21A 2WM9B 1KJQA 2QGFA 5DHQA 1QYRA 2DEUA 3DSRA 2W7TA 3OEHD 3H42B 1Z0AA 1Y4AE 2B4KA 4A91A 1DLIA 3O21A 2GBPA 2QF7A 2Z2IA 4AP6A 2H2FA 3MERA 3WYCA 1OB2A 1OVMA 4UVDA 5ALYA 4EFMA 4YONB 1YHYA 4ZK6A 4C0AC 3FPLA 3IIKA 2KS6A 3BDVA 4X91A 5DM0A 2PFKA 1TAGA 3C74A 4HADA 2GUWA 3RVBA 1I7LA 4UHHA 5H3HA 3WB9A 2GB4A 2E5LB 3M70A 5KQMA 1E0JA 2NADA 1AKEA 4Q1DA 3USZA 2XA2A 3BCUA 1MJ5A 2ZBVA 1L4UA 1ZGHA 2WAMA 2QVLA 3I58A 4BRWA 5IDWA 1NR5A 1U0LA 1USGA 1P74A 1XHEA 2OBXA 4LVUA 2XDAA 3LTNC 3SQXA 1L5YA 2EP8A 4JVMA 3VPXA 4N76A 2ZM5A 1AY0A 2VT2A 2VJAA 3FNFA 5AJWA 3ZK9A 5BP7A 1WETA 3LF2A 4YFYA 5JADA 1C30A 4TTJA 2GX6A 5EE3A 2G71A 2VXCA 5M29A 4RIFA 3UJBA 4BQEA 3FCEA 3PT9A 4K8OA 5B3LA 1PFKA 2GN0A 3N86A 3L7AA 3UUWA 5BRNA 4UQLA 4JC8A 3Q40A 1H5NA 4OK6A 2G9RA 4ZREA 3FHJA 1E7WA 2JFFA 2XMPA 2JHFA 2I6XA 1PUJA 2A4MA 2NVUA 5BPFA 4K9RA 4BO7A 5C3MA 1GQSA 1QM5A 4NE2A 2IV3A 3Q8XB 2KM1A 2FW8A 3WHIA 3QBTA 4CM4A 3QXCA 4EWLA 2EZ4A 5HOQA 1MC5A 2D7JA 4TUYA 3SZLA 1L4BA 1RHJA 3DT9A 4BFLA 5SICE 3HKEA 4WXPA 4BN0A 5AM3A 1WB4A 1KPHA 3EE6A 1PJBA 4MTCA 4YJGB 1YA4A 2XWPA 1U9CA 4LJ8A 1QCCA 3SG0A 4D4JA 3GP3A 4R2XA 4EJSC 4KXNA 5C8XA 1KQ3A 3K9QO 3PFWO 2EBWA 1IB0A 3W9BA 3K8QA 4M54A 1LPNA 1U3DA 1QH9A 5FWXA 3COPA 1DAIA 2BCJQ 4BTVA 5JSFA 1PL7A 1R5BA 4KW7A 5K0LA 3LH5A 2ZI5A 1J56A 1U0GA 3GDGA 5FUWA 4TWAA 2BKVA 3WYBA 2ILVA 3NNSA 3WLEA 1BKDR 2VZ0A 2WWFA 5FLKA 4XPZA 2GERA 5C0OE 1GZ5A 4Z4IA 2GYUA 3ZDXB 2JLCA 4RKEA 1X9GA 4A8TA 4ZHQF 1WP9A 4DM7A 4BGIA 3COJA 1MB2A 5KYUA 1U2EA 4I2VA 1AMNA 3AIMA 3RYFA 4BE7B 1T36A 1QRUA 4RXUA 1UK9A 3ZLTA 3ZQKA 1ZU4A 2JDID 4Z8YA 3NBUA 2VWPA 4AXXA 2QTGA 5BQFA