3QM1A

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with ethylferulate, form ii
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cinnamoyl esterase
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
source organism Lactobacillus johnsonii
total genus 91
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qm1A00
1UK6A 3MVEA 2WSLA 1ZI9A 4GWLA 3I2GA 4W1RA 3G8YA 2PU5A 5C81A 2QUBA 5JYCA 3NOXA 1AURA 2X76A 1YS1X 5CT5A 4CIBA 3ILSA 3S2ZA 1SCIA 3EBLA 1VE6A 2QT9A 3C6ZA 4BDSA 4QDTA 1E89A 3ZWQA 3GFFA 1Q0ZA 3STTA 4INZA 2DQZA 3QVMA 5AK5A 4G4GA 2VATA 3H2GA 1QOZA 4NVRA 3C5VA 4H35A 3LCRA 1DWQA 5J3JA 2DFPA 3WL5A 2BFNA 3B3QA 1ZD5A 1QJ4A 1P0IA 5C7YA 2K2QB 2XQJA 2HA2A 1J07A 5HK9A 2C4HA 3IB3A 2ZYIA 1JMKC 3ZPXA 4Y2SA 4RNCA 4MEBA 1VZ2A 2HU5A 2WUDA 1QLWA 1BE0A 4KE9A 5AKXA 4L9AA 1Q0RA 7YASA 4X91A 1CLEA 4E11A 1HQDA 2B20A 4NMWA 3HABA 4L3WA 4QNNA 1AZWA 3KWFA 5HQ3A 3D4LA 2RONA 1EDBA 2JGIA 1LBSA 3PF8A 4CFSA 2GBIA 2RI6A 1WHSA 4KE6A 1Q83A 1UKCA 4BP8A 4FFVA 2JF0A 5DTIA 4JUIA 1L7QA 3VJLA 3LLCA 5ALOA 3GA7A 3UUEA 1CRLA 2XB6A 3BF8A 1LLFA 3R3WA 5JAOA 2VT7A 2ZYSA 3LP5A 1TIBA 4TGLA 1ZIXA 1ZIYA 2R11A 2ACKA 5LZ2A 4UHDA 4C4XA 2XUJA 1DU4A 4H7EA 5K3BA 3D59A 3V1KA 3LS2A 2JBWA 3CXUA 3H2JA 2V96A 1H22A 2DSNA 4Y2QA 2FJPA 5EIHA 1UOPA 2I3ZA 4EBBA 4OB6A 1L7RA 1XZEA 1P0PA 1THGA 1W52X 2GZRA 1YSCA 3DOHA 3H18A 1R50A 2WHQA 1VA4A 3HYSA 1HKHA 3EQ8A 4Q82A 4IHAA 2XMGA 2BGNA 1PFQA 5FP0A 2G5TA 1LZLA 1TCCA 2W22A 4DNOA 1MTZA 2DR0A 2XMRA 4C4YA 1K6EA 4BRZA 5ALTA 4X6YA 5AKYA 1SOMA 2LIPA 2J3DA 5IVHA 3FBWA 4PV7A 4BBZA 1GT6A 3EQ9A 4BCBA 3VXKA 5EHZA 1XRLA 4H0CA 2C7BA 3FLEA 4EY6A 2XUHA 3A2NA 4G1FA 3PICA 1UKAA 3WK7A 2ZSIA 4U2DA 4M0FA 5JANA 3OTQA 4B7ZA 3H0CA 3ICVA 4K6GA 1G4HA 2H7XA 3H1AA 1N5MA 3STYA 1KU6A 3H2IA 1FFEA 2I03A 4X90A 4HS9A 1TQHA 2WM2A 3VVMA 2HHAA 4X85A 5D7BA 2VJDA 3FYUB 4FFWA 5SYNA 3K6KA 1VLQA 1A8UA 3BE8A 1DINA 2Y6UA 3O4HA 5JALA 4ARAA 3P2MA 5AJHA 2QUAA 2I3DA 2WG1A 2FX5A 3DDUA 4KRYA 5C8VA 3RARA 2XDWA 4WDRA 3ZLTA 4IQ4A 4WFJA 1RYYA 5ALUA 1CUCA 5E2IA 1K4YA 4ITVA 1TCAA 1VZ3A 4DSAA 2HRQA 1KU0A 2Z3ZA 3MUOA 5T4HA 3D2BA 2E3JA 4PO3X 5EFZA 2WIGA 1NU8A 4B85A 2DQYA 4H7KA 2CKMA 1UFOA 2ZVDA 3ESDA 3VISA 3A6ZA 3ESCA 4J0GA 3WA7A 4DMFA 5SYMA 2B61A 3NWOA 1EDDA 3PUHA 4W1SA 1EK1A 5IVKA 4G8DA 4BP9A 5FXMA 5LLSA 5IVDA 4Q3LA 1UK8A 2YYSA 1MNAA 4ZI5A 1N8SA 5AI0A 3RK4A 3W05A 3AINA 3GUUA 4BCDA 1QIDA 5LKAA 3WZLA 3ED1A 4PSDA 4ZREA 4KYVA 1VOTA 4LYDA 1CUWA 3IUJA 1YA8A 4DMKA 2OCLA 4HRYA 1OXMA 3SC2A 5AM5A 4F5ZA 4BATA 1ORVA 1ZI6A 1NU6A 4QDXA 3WWCA 5CT6A 3ZI7A 2O2IA 2RGUA 3KD2A 3KWJA 4P93A 1JJBA 3Q8WA 4XJVA 1GXSA 3WA6A 3IDAA 1B41A 3L1IA 2PSJA 3BWXA 4MWSA 1YASA 1P0QA 3FAKA 3HC7A 4N8SA 3G9TA 4Y2PA 4XX1A 3ANSA 1UOQA 1MN6A 5HFAA 4BTVA 1TKRA 3IIIA 5CH3A 2AJBA 5HZGA 1XKLA 4Y2TA 1XZJA 3AZQA 4ETWA 3UUFA 4BRSA 3WKDA 2WIKA 1X70A 2WU3A 1CUFA 1W4LA 3TJMA 1M33A 1YB6A 3C6BA 3F8SA 2PSEA 1EX9A 4OPMA 5CXUA 3FOBA 2PU7A 5HF6A 2QM0A 3JYHA 5CH5A 4DSZA 5EGNA 2GYVA 3DOIA 3DNMA 3L1HA 3I2IA 2Z3WA 1IVYA 4HVTA 2HL6A 3O4GA 5JATA 4DNPA 3QPAA 4P08A 1G66A 2XQIA 1JJFA 3IULA 5H3HA 3A2MA 3M3DA 3BF7A 1E8NA 3U0VA 4H18A 5LZ5A 4B9AA 2RHWA 5EIAA 4OB7A 2P8SA 5ISMA 4UBMA 1XROA 5DNUA 3WK5A 3H2HA 4GBGA 4XVCA 4NS4A 4J03A 3R3ZA 3R3UA 1C7JA 5LP1A 4KJXA 5JADA 1Y37A 2Z8ZA 1QIJA 5CMLA 3ZLUA 2WUGA 2HU7A 5HQ3B 1CUZA 3G0IA 3R3XA 2G4LA 1CUSA 3HI4A 1QIGA 2ZJFA 3C45A 4EHBA 4BAZA 3FWHA 2Z8XA 4X6UA 3SK0A 1W6RA 1RP1A 5ALLA 4IH9A 4W1PA 4KAFA 2XLBA 3BJRA 5HCUA 4X7BA 1GPKA 1HDEA 5DJ5A 5FDFA 1GQRA 2I78A 2D5LA 4UUQA 3M82A 4FNGA 2AJLI 5JD5A 5K3EA 2OCKA 5JIBA 3KXPA 2VJCA 1F8UA 2R8BA 5A62A 4Q05A 3DLTA 1F6WA 2XT0A 4EB0A 1EB8A 1A7UA 4PNZA 3IUNA 3QPDA 4RE6A 3F97A 4RPCA 2GYWA 1DQZA 2XQKA 5IKXA 4BC1A 4KAJA 3WYDA 2EEPA 1LZKA 5D6OA 4E15A 4C4ZA 1XRNA 2HDWA 2WHPA 2VSQA 3BDVA 2JGFA 4GEGA 2XUOA 1E3QA 5AKGA 4HXEB 5AIAA 4CG2A 4Y2VA 2ORYA 3I2HA 4WY8A 2HA0A 5ALKA 1AUOA 3WK9A 4KRXA 3EF3A 1WB4A 4QDOA 3RLIA 1ZGCA 2BGRA 1JT2A 3QMWA 2YH2A 2OQVA 5LKRA 1CFJA 1EI9A 3FSGA 5EHXA 1ODSA 1JMYA 2ROQA 5AKEA 4C87A 1ZD4A 2O7RA 1R88A 3QYJA 4DLNA 4WDQA 1BN6A 1G5FA 5A71A 4BCCA 4Q3KA 2Y6VA 2OAEA 5T4BA 1ZI8A 5CH8A 2XMCA 5FUMA 1SC9A 3KOOA 2WFMA 3G0CA 1UOOA 4WJLA 3H04A 4CCYA 2QVBA 1CUDA 5ALYA 1MU0A 4UBKA 4YK7A 4HTAA 5AKIA 1EH5A 2GBFA 1O6FA 1MT3A 3ZV7A 3AZPA 3CCCA 1AKNA 4W9RA 2XMQA 2CZQA 3QPCA 4EA6A 5LZ8A 4Y2YA 1XQYA 1YR2A 4DNFA 2PSDA 3C6YA 2BAGA 5ALXA 3GROA 4BDTA 2CJPA 5AM3A 4UPDA 2PVSA 4IH4A 4CIAA 3AIKA 1GGVA 4B84A 3ZLVA 4G8CA 1QTRA 5EHNA 5AO9A 4OYLA 4MQMA 3BXPA 4G8BA 3SX4A 4CI9A 5BV7A 2WLSA 3H1BA 1XKTA 3WWEA 4AN1A 1S8OA 3O4JA 3WL7A 1J06A 2CMFA 5F4ZA 2Z5GA 2G5PA 5JD6A 4QEKA 1CUGA 4UHHA 2WJ4A 3CN9A 2V97A 5DTJA 1LPSA 2ES4A 2O2HA 5JZBA 4EY4A 1OCEA 3BJMA 3PE6A 4F60A 2ZSHA 1OILA 1XQXA 4ZXFA 2HA4A 2IIVA 3V1NA 5KWJA 1DX6A 2GBCA 3L1JA 2OQIA 1ETHA 5ALZA 1BS9A 4UFPA 4FKBA 3T52A 1LPMA 4OYYA 4K6HA 1GKLA 2WILA 3F98A 3W04A 2D0DA 4FLMA 4K2AA 4MYSA 2J4CA 3WQHA 2OCGA 3TRDA 1DWOA 3F96A 4FLFA 2XUDA 1EINA 3VJMA 1BU8A 1MX9A 3M83A 1HL7A 1USWA 2PL5A 5K3AA 1GKKA 2WIDA 4H77A 4Y2JA 1XZHA 1UZAA 1MX1A 1H23A 5A7FA 4YX9A 2FJ0A 4GXNA 2WU4A 1JI3A 2QMQA 4J7AA 3PDCA 3WKAA 4C89A 3DQZA 3I1YA 4LIPD 1XZKA 1CVLA 5DLPA 4QWWA 1R4ZA 3WI7A 4WY5A 3FLAA 1GZ7A 4WFKA 1CR6A 1T4MA 1R1DA 3OM8A 1E8DA 3IA2A 1QGED 3CN7A 2IITA 1MPXA 1QO9A 1MJ5A 3O4IA 3WKEA 1IUPA 4Y2RA 3WKCA 1QZ3A 3WZMA 2J4FA 2XQGA 3R40A 5ALSA 3G9UA 3X3HA 1EK2A 3F9CA 2Y2UA 5HF8A 3AFIA 1ZD2P 1TAHA 2WFLA 3V1LA 5AI4A 3JW8A 1MAHA 2JGEA 2BUCA 3ANTA 4I19A 2Q0XA 3O9VA 4B82A 1B6GA 5AOAA 3CCBA 1N5RA 1Q84A 4I3FA 5FRDA 4PF1A 4UBOA 4QWMA 5LIPA 3FCYA 5A6VA 3WL6A 1U2EA 2WQZA 4AQDA 5ALHA 1J2EA 1ORWA 2VJAA 2OCIA 4H7JA 4J0JA 5FKJA 5LZ7A 3O9MA 3QITA 2QJRA 2AJCA 4X6XA 2WIFA 1X2EA 5CURA 4H7FA 2CUTA 1FFDA 4J0DA 4X97A 3LIIA 1QONA 1L7AA 4B0PA 2O2GA 2BJHA 4W1QA 4FMPA 4G9EA 3VKFA 5CRIA 1AGYA 5LYYA 4BYMA 3G0BA 3TEJA 5AICA 3ESAA 5AI8A 1WHTA 2ZYHA 5ALFA 4JNCA 3V48A 5ALMA 4KE7A 1LGYA 4UFOA 1QFSA 2XQFA 5I9IA 3KSRA 3FVRA 4AO6A 2VQ6A 3O0DA 2OAGA 3WL8A 1CUUA 2HA7A 1VA5A 4OU4A 1CUYA 2XUIA 2JIDA 3OURA 5ALVA 1WM1A 3C43A 3ESBA 5AKJA 1WCYA 2HA3A 3I2KA 1FJ2A 4UBLA 3FCXA 2OGSA 5ALNA 1AMNA 4AMYA 4B81A 2VEOA 4DIUA 4LXGA 2JGKA 4ZV9A 4IO0A 3D5EA 2C0QA 4BTLA 2QJWA 1EB9A 4QLAA 5CTAA 1LPAB 4HZGA 2WHPB 5AOBA 5AOCA 3WWDA 2C58A 2H1IA 1ZD3A 3O95A 2Y1KA 3G0DA 4G9GA 4WFIA 1ZJ5A 1XZDA 3FNBA 3B12A 1GPNA 3N0TA 4U2CA 5CT9A 2OGTA 3WMRA 4FBLA 4FLEA 1XZIA 1AX9A 1PV1A 4P9NA 2QRUA 3HLKA 1QIIA 2DCMA 5AK3A 4AZ0A 3I28A 3R0VA 1CQWA 3PF9A 2XUPA 3WYNA 1P0MA 1H2XA 1MO2A 3C5WP 3HXKA 1XRPA 3PFBA 3PFCA 4DMCA 2RHTA 3WIOA 1JFRA 4LHEA 3B5EA 3D0KA 4A5SA 3MGAA 4CCYB 3D2AA 2WJ6A 5ALGA 3HZOA 5A2GA 1BROA 1T2NA 4D9JA 4A23A 2EDCA 5DWDA 1CUEA 4CG1A 1HBJA 4X71A 1QFMA 1D07A 4OU5A 1R9MA 2VT6A 1ISPA 2WG2A 4Y2XA 4ARBA 1GPLA 2PKYX 1BN7A 3HSSA 1XLUA 3ICWA 4PSCA 3VVLA 2WKWA 4GI1A 4F0JA 5CT8A 1CV2A 3S8YA 3DCNA 4KACA 5JAHA 3BIWA 2CB9A 1JKMA 3IUMA 2ZYRA 3W9UA 3I6MA 1VJ5A 2XUGA 6YASA 3DS8A 4L0CA 5K3DA 2AXEA 4BVJA 4AB1A 4OCZA 5AK4A 3C6XA 5ALEA 2AJ8A 3QM1A 2WFZA 4HXFB 1PJAA 3U1TA 4DGQA 1IMJA 1KEZA 1THTA 4N8DA 4Y7DA 4ROTA 3AIOA 4L72A 5BWCA 4QZVA 3R3VA 4PW0A 4NZZA 1CUIA 3WJ1A 1K5PA 3FYTA 1J1IA 2WTMA 1HLGA 4B0OA 1BRTA 5JZ9A 4AN0A 3I6ZA 4OSEA 1XZMA 1W75A 1XZGA 4OUKX 5HF5A 4AZ3A 3I1IA 2DHEA 2XI4A 5ALQA 1VKHA 1H2YA 3GELA 4UBIA 3W9BA 5AH0A 3MUNA 2DHDA 1XRMA 2HFJA 2G63A 3D7RA 4ZGBA 1LPOA 1XZCA 3IBTA 3G7NA 1LPBB 4QDZA 1UT6A 1MNQA 4FHZA 1YAJA 1Y7HA 5IVIA 1SCKA 4KE8A 4X3CA 4UBJA 4UFNA 5EI5A 4H7HA 2QZPA 2DHCA 2WUFA 4J0IA 4EY7A 2VJBA 2QS9A 3STWA 2CEKA 1F0NA 1I6WA 5DYWA 3R41A 5AM0A 2EDAA 4KR0A 3BDIA 1DTEA 3GZJA 3G9ZA 2PSFA 3OPMA 2JGMA 1UK9A 5HFNA 3WK8A 5C8ZA 3NUZA 2ONCA 4WCVA 2WFLB 5YASA 2Y2VA 1YB7A 1LBTA 3Q0TA 4TVKA 4GDMA 2RAUA 5ALWA 1EVEA 5ALRA 2OPHA 3OOSA 4B6GA 1N1MA 4G5XA 3M81A 2WJ3A 3HEAA 1SCQA 2XLCA 3YASA 5ALDA 1W76A 1LPNA 2QR5A 2CBGA 4N8EA 2XUKA 2O7VA 1DQYA 1U8EA 1XZFA 3G9XA 2HRRA 5T4EA 1QE3A 4RE5A 3A70A 2XUFA 4CG3A 2WTNA 4DNQA 4BE9A 1FFCA 1XZLA 2J3QA 3EQ7A 4LXIA 3OG9A 1JU4A 1CUXA 1E66A 3WIBA 2C5FA 4EUSA 2YXPX 1DX4A 4TPKA 1CUAA 1LNSA 4H7DA 1FSSA 1DT5A 4GECA 2QOEA 1YCDA 4FNMA 5LZ9A 1JJIA 3IUQA 3R3YA 2BCEA 1MAAA 1VXOA 3FYUC 4C01A 4QA9A 3WK4A 2ACEA 3H19A 1LPPA 4BZZA 4F21A 3STVA 3DL4A 5AI5A 4XIIA 5AI9A 3NGMA 4C6HA 5A7GA 1GQSA 2QXUA 1ACLA 4MYDA 4E46A 2ZJ6A 1YS2X 3HACA 4X92A 3QZUA 2H7CA 4B9EA 5DYYA 3WLAA 5AM4A 4Y9SA 4DMHA 1XZAA 1XQWA 4X00A 3QMMA 2QKYA 4AO8A 1XLVA 5KREA 4FBMA 5EHQA 2C0PA 1CUHA 5K3FA 4BVKA 1BCRA 1VE7A 3WWPA 1TCBA 2WG0A 2XMBA 2PX6A 4X95A 5BOVA 3WWOA 5ALPA 2RIPA 4E14A 3IVMA 1IZ7A 5HF9A 2BUAA 3PUIA 5JAPA 3K9BA 4JEIA 1ZOIA 3F67A 2QTBA 1JU3A 1A8QA 5E4YA 4XWGA 2BUBA 5ALIA 5FLKA 1QIEA 4U2GA 1FFBA 2JGJA 2GZSA 1U4NA 3AIMA 4GLBA 2HIHA 4BB0A 3G0GA 5KBYA 2UZ0A 5A7HA 3DKKA 2X8BA 3FVTA 4HAIA 4UHCA 2V98A 5AK6A 3WKBA 2QXTA 1XRQA 1VXRA 5HKBA 1K8QA 1A8SA 4GW3A 2BKLA 2GBGA 5AM1A 1XZBA 1CUVA 5I8PA 3KDAA 4BE4A 5AIBA 1YA4A 1EHYA 4Q1VA 4MWTA 3IURA 2HM7A 4ZV7A 4K5QA 3I2FA 4G4IA 1CUJA 2VAVA 4ZRDA 4AX4A 4CCWA 1WB6A 5E4JA 2W6CX 4LKOA 3AZOA 5D3KA 2H9YA 4AMZA 1R3DA 2PUHA 1AQLA 5JAUA 1BEEA 3EIOA 3RKSA 1MX5A 2XMSA 4FTWA 4B83A 5I7UA 1CEXA 4W63A 3V9AA 2VF2A 3LIPA 1A88A 1YAHA 5AKKA 1EXWA 4X93A 4Z49A 3FSGD 5BWBA 1CPYA 5AKZA 2VAXA 4K6KA 2HA6A 1QO7A 1F0PA 3UMJA 3RM3A 1Y7IA 1AC5A 2XUQA 4U2BA 5FOQA 4Q3OA 2PM8A 3C70A 3GBSA 3E0XA 1FFAA 4A16A 3D2CA 5AHXA 5T4FA 5JD4A 4KEAA 2HFKA 5DYTA 4YASA 3AILA 1QIFA 2IX9A 4J0KA 3C8DA 3QH4A 3VJKA 5DNVA 5LZ4A 3G02A 5DNWA 3TGLA 3H17A 2C5GA 3W06A 3I6YA 3DYVA 4OB8A 1QIKA 3T4UA 5JZSA 4FDMA 1WOMA 5CW2A 5JASA 3DJYA 3N2ZB 4PQEA 4EY8A 4BC0A 2VA9A 2WHRA 3E3AA 3QBJA 2V9ZA 2JGLA 3BL8A 3I2JA 2OXEA 2WIJA 1NX9A 2XMZA 1QTIA 3JWEA 4M0MA 4Y2UA 4UBNA 1EVQA 2AJDA 4N5IX 1W1IA 1XFDA 2NW6A 2HA5A 3QMVA 4MQLA 4GHWA 3DEAA 1DT3A 2FUKA 2JEYA 1TK3A 3H2KA 1UK7A 1K63A 1IUOA 3SWWA 1C4XA 4X94A 3C87A 4IH1A 5AM2A 3VDXA 4AXBA 3W2TA 3DL7A 4KAAA 1UXOA 1XRRA 4JYPA 1ZGBA 1XLWA 3AJAA 4DM7A 5CT4A 2B9VA 4DTCA 1ZJ4A 2OLEA 2VTVA 4J0CA 4S0XA 5FPPA 1DWPA 4H7IA 1EDEA 1ACJA 1IUNA 2HU8A 4BVLA 4G4JA 5K3CA 1E5TA 2XUAA 2YASA 4N5HX 3OC0A 4QDUA 3FYUA 5HKAA 4LYEA 1BEZA 1WPRA 2ECFA 2X5XA 4YPVA 4OD0A 5IH7A 4LXHA 4C88A 2PSHA 5D3ZA 4Q34A 4BAUA 5ALJA 5CBKA 1EA5A 3STXA 4HRXA 3PI6A 3C8HA 4MXDA 1SFRA 4M0EA 1HPLA 1R9NA 4EY5A 1BCSA 2XMDA 1H2WA 1XQVA 3K2IA 5FV4A 5FPQA 4UHBA 5E4TA 1C7IA 2PPLA 5CXXA 5EIEA 4QE3A 1Z68A 4QLOA 5HK8A 1CUBA 2OGZA 4U2EA 2ZJ7A 4JH0A 1IZ8A 3D3NA 3WK6A 2JEZA 4J3JA 4FWBA 5K5EA 4EZIA 4P92A 3BIXA 4PSUA 1O6GA 1WB5A 4B80A 4J0HA 2H7YA 1ODTC 2B4KA 4UHEA 1U65A 3V1MA 2PBLA 4DYHA 3E1GA 4FOLA 4I4CA 5AKHA 3WJ2A 4BZWA 5AP9A 1UWCA 2PUJA 4RGYA 4BAGA 1X2BA 4O08A 1ODCA 1H2ZA 1RWQA 1CQZA 3STUA 4AO7A 5JARA 1CIJA 5KWIA 5K3FB 4JYMA 3FLBA 3A2LA 3DKRA 5AI6A 4MJ3A 4U2FA 5C8XA 1G42A 2XE4A 5AKLA 1E8MA 2WUEA 4UHFA 2OG1A 1WPXA 1TRHA 5ESRA 3DD5A 3HJUA 3HRHA 4ZWNA 1UKBA 3E4DA 3DYIA 2HADA 4HXGA 2GYUA 4V2IA 4MEAA 1QIHA 3AUKA 1QIMA 1ZICA
chains in the Genus database with same CATH superfamily
1IEXA 1TUEA 1UXJA 4JSTA 3LHSA 4ZDWA 3KXIA 3MVEA 2QUZA 1NBME 1X74A 1U31A 2Q6KA 2NGRA 2OZLA 4GWLA 3SE7A 5JUWA 2XYQA 1JBEA 2PCLA 2AVDA 4DCGA 1QO0D 5KAPA 2E7ZA 4N3AA 1UPAA 2QUBA 4YI3A 2AXPA 1KYVA 3ONEA 4JFRA 3TRFA 1QKKA 1AURA 1PZEA 4P6VF 4CMIB 5AW1A 5IXJA 1XNRB 3HCBA 2J0UA 1VJ0A 2XR1A 1B0AA 1WMBA 2YRFA 1OXBB 1YS1X 1HYHA 3AI1A 4MWGA 5SY6A 3VR5H 5CT5A 3WRXA 3ZE9A 2P9TA 3DVSX 2FWMX 1YZYA 2R66A 3Q3VA 3NTLA 3TAHA 3USCS 2FV8A 4FK8A 2DH6A 3DOOA 3EC7A 4C0AC 4Q1AA 4IIJF 3MUEA 3H7IA 1BWQA 2RAVA 1U8CB 4IJMA 4P4GA 4L50A 3EXFA 5AVKA 4ARIA 2EQ5A 4F3NA 1C41A 4Y0VA 4BDSA 2G28A 5M7EA 5JNRA 1C29B 4JB3A 2RBGA 3WOHA 3UHAA 1E89A 1O6CA 3ZWQA 3GFFA 4KR9A 1Q0ZA 1OBFO 4LYJA 3STTA 1B8PA 4TUYA 4LJKA 4Q4JA 1DJMA 1H3FA 4PLWA 4Z4HA 2H06A 1PHPA 2Z04A 3ROFA 2ZSDA 4YYEA 3H2GA 1QOZA 3R7DA 1C4WA 5EWLA 2WW8A 5BV8A 4H35A 4ZJZA 1NW9B 3VA7A 3B3QA 1U1EA 1AZLA 2CMKA 1ZH4A 4E5PA 5B5SA 4PBSA 2VQDA 2AW5A 4X3OA 4D56A 1XG5A 3A1EA 4LHXA 5CG1A 2AZXA 5FBKA 4KXFB 4EENA 4B76A 3C48A 2HA2A 4ML3A 4GMKA 1JNYA 1DO2A 1PL7A 1LU9A 1HGXA 3LLMA 3O94A 1EXMA 2NIPA 5H3LA 4HXYA 1D2NA 1SUCA 3DB2A 1Y8RB 1W0CA 2LCIA 4IHJF 2R2GA 5HKOA 2AD5A 3FDXA 4F6LA 1KS9A 1USKA 5FI0B 2R2AA 1VIMA 4PYMA 4TKZA 4D26A 3EPPA 1CDEA 4MEBA 1BXRB 3JZFA 3BIFA 4ARSA 4S24A 5HDQA 1PFKA 2JVJA 1PRYA 1R64A 2D59A 3RS9A 2WUDA 1QLWA 1XEWY 3RHZA 3QPBA 2NPIA 1E3EA 1WQ3A 4IDEA 4EW3A 4G5FA 3N6XA 3FZYA 1Z82A 2A3RA 3GJTA 1VCOA 4IXDA 2AMFA 1Z4IA 2NU8B 4E11A 3B36A 3A36A 3D6MA 4ZT4A 4O3MA 4BMOB 5C2JB 4QNNA 4YCLA 1T1RA 4GLLA 5DX0A 1PNVA 4J49A 1SCUA 4JGBA 4XD7D 2GZ1A 5HQ3A 3L02A 1KJZA 2BTQB 5FD8A 3ZC3A 1S9HA 2J45A 1RBZA 3PF8A 1LBSA 4G65A 4TMXA 4UDXX 4CFSA 1G8MA 3O4RA 2AI3A 4AKIA 1T3TA 5A3VA 2MYNA 1N7HA 3I9FA 3KZ1E 5K99A 4F8JA 4U6QA 1PBNA 1PZGA 3BT7A 4DY6A 2YY6A 1UKCA 2ADMA 3WRVA 1G5IA 1EAMA 1XMVA 4BX8A 4RTSA 3LM8A 1NMYA 5ICFA 4E2YA 1HR0B 1J0EA 2EG9A 4M1OA 1BJKA 3VJLA 5KVVA 3AWIA 4M0UA 1AHNA 4ZCMA 1D4OA 1SRRA 3LLCA 5AW2A 3IP5A 1IN8A 1WXGA 4TYMA 5KVAA 1Q0UA 3PGJA 3KR0A 1KYYA 1P1JA 4XWOA 1GQ2A 2WV9A 2A9RA 4KQEA 1ENOA 5IKMA 1E2QA 3PTLA 1Q19A 1E3MA 4Y9DA 1JFVA 1GARA 1I3MA 3LXMA 3OLXA 2PUCA 1G20B 1TIBA 4HO1X 3T7JA 2O2CA 1YUBA 3L6CA 4R1NA 5D1HA 5B6JA 3AP3A 2CXNA 1XK6A 4XR9A 1V3QE 2ZRGA 1EFPB 2RJ3A 2XB8A 5ITSA 4C4XA 2XUJA 2HV8A 3ZOZA 3MJVA 4H7EA 2X8JA 4LSMA 2OGWA 3LC2O 3OM0A 3M4XA 3CBQA 4TV8A 3RPEA 5EJ6A 5AJWA 4PIMA 2XWBF 3LS2A 3ADCA 4CTKA 1FDWA 3NDIA 2Y0PA 3BRWA 4ARUA 3T5PA 1LI4A 5JPCA 1Z4MA 5BMOA 1MORA 1RCTE 2Y76A 3EE6A 2A0KA 1SD1A 3EY9A 4OLBA 4Q4AA 2V7VA 3DJFA 1RQLA 2X14A 1NYLA 3ISJA 4MA4A 5EWMB 1H22A 1V41E 4Y2QA 5EPUA 3NT4A 5AHKA 1NW7A 3GEBA 4MRRA 1QGUA 1UOPA 4EBBA 4LYAA 5KOJA 4LGMA 5KNDA 3ZNOA 1GPYA 2BE7A 3S1AB 3ZWCA 2PANA 1ADJA 1THGA 3R9KA 1W52X 2GZRA 3SP1A 1BS1A 3DOHA 1JAIA 3H18A 2N42A 2BKXA 1M8FA 3HYSA 4OEHA 3PXBA 5IRCD 4EP1A 4FQ8A 3B1FA 3GY0A 4HMOA 4IHAA 2Q5FA 1E4VA 1SHZA 3QKWA 4A10A 4BU0A 5K7SA 2VRCD 2WVAA 4L0DA 4B4OA 4BFCA 1G17A 1Q0SA 1JDVA 4QBIA 1UJ5A 2H11A 2PUBA 3H5TA 4ROSA 4A7PA 1UT5A 5TARA 4C2TA 4R2IA 5AJXA 2O1XA 3NHMA 5EXPA 1U7DA 4DLYA 3FMVA 3W0LB 1H5UA 3ORYA 4YMSA 2YDYA 1TUGA 4LVNA 2JGNA 5INTA 3PEWA 3KC2A 4XAQA 2WJWA 1MVNA 1RPTA 2KSQA 4L07A 5IN4A 5JV5A 2LIPA 2EFYA 1WEKA 1KMQA 4NZ9A 2MSLA 5KINB 5IVHA 2F9LA 4QUAA 2OQ2A 1U7HA 4EELA 1GGKA 2BFWA 4NDNE 3T3EA 1BG6A 4BBZA 5FBZA 2ZWMA 4XIYA 3VXKA 5EHZA 1CNEA 5DNDA 4C5AA 1U2QA 1CY8A 1FPMA 4H0CA 3AUJB 1NZFA 4HH4A 4DV7B 4R7ZA 3M5DA 3BTOA 4NBKA 2C7BA 4S1WA 4AJ4A 1NP7A 4AROA 5FFNA 4GI2A 2ZTUA 3B9RA 1ICIA 5F4BA 3RVNA 4EPYA 5IULC 3PNMA 1DS6A 3TNLA 1BX0A 3LQ2A 1DBWA 5FL7D 5JSKA 3CF2A 2H2WA 3D0OA 4FJ0A 3SM3A 1IQ0A 1UXGA 4O0LA 1TVMA 1UKAA 1X80B 2LTAA 1IHPA 3IP8A 3N8GA 4G36A 4IG4A 2I6QA 5EYPA 5JANA 4NK4A 2Y0CA 3AY3A 3E8XA 3K0BA 1VGVA 2VXBA 2QU8A 3PT5A 1P2SA 3ICVA 3JQRA 4K6GA 1G4HA 4LF5B 3O8OA 2KJQA 4AZVA 2G7ZA 5IJZA 5FPSA 4FFRA 4U7PB 5FQOA 3W2GA 4CT5A 4KZPA 2J30A 3L4SO 3CH6A 4TTVA 2WJJA 3A6FA 3EC1A 3QELB 3O31A 4PZUA 2ODNA 4X90A 3WXBA 5JY6A 2OY0A 3GR6A 3IIEA 1FQWA 4V38A 5CIQA 4GVXA 1MT0A 3Q2IA 2QU7A 2XB9A 4TWJA 4UOZA 1DCKA 3V3KA 3LGAA 1NOKA 2IK8A 4XKJA 4P3YA 1FFGA 2JHGA 1R66A 1Y81A 1YJAA 2VJDA 2PMKA 3D64A 4MRMA 4TKVA 2XUZA 2GHTA 1K92A 4TZ0A 2YXBA 3K6KA 2UZIR 4E12A 4XJXA 5BORA 1VLQA 4G0OA 4LY0A 3RU7A 3UJ7A 4IKPA 3NALA 1DINA 4FYWA 1LLUA 4X9XA 3LH5A 5JALA 3KS9A 3NIDB 3BFVA 3CEPB 3DR5A 2Y9MB 4IIDA 3FKSD 1ADGA 4I1YA 3MJEA 3IOCA 4FIZA 5L3SB 3AK4A 1PS0A 3RARA 5JXWA 3CR7A 3UJ9A 1NI4A 1WNFA 1ZM7A 3NBYC 2FG5A 4JJ8A 4WDRA 3NVAA 3UB3A 3TD6A 5JWHA 4KQKA 4ZCPA 2CUNA 3T7EA 3E7XA 1RYYA 2X77A 3WAJA 3LKDA 4LV8B 5E2IA 2VBFA 3R7FA 3ZQKA 4ZJUA 1KFKB 2TECE 5D01A 2ENWA 1D2GA 3N7TA 1G3UA 1DC3A 2CF6A 2KPOA 1LV8A 3LWBA 3DMTC 1KU0A 4JEUA 2AQIA 5J2TF 3HKEA 4MUEA 5P8WA 4BWFB 5HS6A 3DONA 3SYMA 3D2BA 3D6AA 3F78A 5L9AA 1O1YA 1REQB 4PO3X 3KU1A 3NV9A 5E38A 5EFZA 2IX3A 3RF6A 4KLRA 3GVXA 4H4CA 3B53X 5HIIA 5LOVF 1GCAA 5ER9A 2X9VA 5H82A 5TF0A 4DR7B 4Z4EA 4H7KA 2A9KA 4U3JB 3WNVA 3DE5X 2CW5A 3PFKA 4XUDA 4YJFB 1Z74A 4R6WA 1YRLA 3REOA 4JHXA 3A6ZA 1NN0A 2NUAA 5DNEA 4Z86A 2Q2OA 3KLBA 1L1QA 3FYSA 2O57A 5C8XA 5AVWA 1ZCJA 3A0RB 4GF5A 4US2R 5KOHA 3OJ0A 4DTIA 2ZVJA 2UYYA 4DMFA 5SYMA 1SCAA 3NWOA 4K8RB 4EFNA 1EDDA 5BNZA 5H5JA 3GFPA 1PQPA 1BFDA 2HLPA 2VP6A 3JX9A 4RPJA 1XZ8A 5FYDA 1JPNA 2INGX 5DX8A 1Q1EA 1LC3A 2D8AA 4JOSA 1XPUA 4GPZA 1IXZA 1HEIA 4P7KA 4TXNA 2GM9A 2J6IA 4R1UA 4XWKA 4NE2A 3UJ8A 3AHJA 4MV3A 1PFYA 3VR1A 5K0CA 2CVFA 1EVJA 4I1VA 3B2EA 4Q3LA 3T95A 4CEHB 1JQAA 3PC8A 1X3LA 3ND7A 1MNAA 2DPGA 1N8SA 3M5PA 4UTXA 5AI0A 2DWQA 2HMUA 3W05A 3TW0A 4D4LA 4FDUA 4BBAA 1AM4D 1J0AA 3OIFA 4Q48A 3KQNA 4BCDA 1XK7A 4LDZA 3U3JA 1TZBA 3UB4A 4MLCA 5HE9A 1FQKA 5LKAA 3ZDBA 3ED1A 4PSDA 3NH9A 2UYCA 4DKJA 3BQNB 1BMTA 4ZREA 2ZTLA 1VOTA 5KYTA 1CUWA 2E6KA 5EVCA 3IVAA 3IUJA 2BKVA 4Q4LA 3RS2A 1ZP6A 3ERCA 1N0WA 1NMEA 1GYRA 2OCLA 3FRJA 3KR2A 3KV3O 4NAVA 1K2VN 1DPGA 1OXMA 2J46A 4PQGA 2VDPB 3W9YA 4ED9A 5AVZA 3SC2A 2QW0X 4XRGA 1MZPA 4FGWA 1DTSA 1Y3DE 4GAEA 5EP3A 4ER5A 4Y30A 3QKSB 4LZPA 1TTQB 1JEYA 1CJMA 4BQOA 2GMWA 1NU6A 1DFIA 4BGIA 1E7SA 1RHRA 4N4AA 3VHXA 3LPLA 1OAKA 1LF0A 1KVTA 7ABPA 5E2AA 4DG8A 1UXHA 3EG9A 3W5BA 4M6WA 1R0XA 3PNQA 4KDFA 4YJ2F 4Z6KA 3VNAA 2CYBA 4EI9A 5IYZA 1ORRA 5AUOB 5K05A 2E48A 1DBSA 2K87A 2P9ZA 2AR7A 1I3CA 3Q8WA 4KNWA 1Q14A 3G2IA 1RZUA 4FHFA 2DZDA 1TAQA 2WWXA 5CU7A 4MRAA 3O8QA 3NTVA 5FNVB 2UZ1B 1GXSA 221PA 3MAAC 1XQ9A 1A98A 2C4MA 3P9XA 4HWTA 4XWAA 2YWXA 3L1IA 1JHDA 2PSJA 1ZVJA 2JNWA 1J42A 2QG9A 5IAKA 1W49A 3BWXA 4A0HA 1N0UA 1YASA 1ZK3A 3JV7A 3FAKA 3RRFA 3IAS6 5KWEA 1LBEA 4WLNA 1SQGA 3KB6A 2BGLA 1BDIA 1ZSYA 1YK0A 4Z0HO 5KNBD 1H2EA 2QP3A 2J9FA 2WSBA 3RU3A 2F7SA 2QRQA 4J2TA 3TF5A 4ES6A 4QVGA 1Q2XA 5KAMA 5BN3B 2GETA 1F12A 5JW6A 1SVOA 2P7HA 3OCVA 4K2HA 3VX3A 2L19A 4CUJA 4BLRA 2ZIAA 5KYXB 3IIIA 5L3VA 3AY7A 3FPHA 4DJ5X 1N5OX 1CF2O 4V1CI 4YEDA 4BBPA 3DZCA 3SYKA 3JAMA 1TB4A 2VK8A 2WINI 4TVOA 5CW1A 3AUFA 1NBHA 4FHGA 4Y2TA 1XZJA 5CA0A 3AZQA 3JAWA 4BRSA 3WKDA 4MVJP 3ACCA 4MA0A 2WPDD 1DEHA 2R1VA 1X1QA 4N7RA 5ELMA 1NVFA 3U3XA 3VC7A 2WU3A 1MXFA 2Z6QA 4CEJA 2EP5A 2J0UB 3CNBA 4LOHA 1BKDR 4L5AA 4O2BA 4XSVA 1HEUA 2IS6A 1U1FA 3B6KA 4DLZA 5JNSA 3F8SA 2WSSD 2PSEA 3ETNA 3IXQA 4OP1A 1CD5A 1KI9A 2Y92A 1D2HA 3I0ZA 3VBEA 5CH5A 3WHPA 3FSRA 2HJSA 3DOIA 3DNMA 3WDMA 4LC1A 1KEUA 1UQUA 1IVYA 3LMKA 1H93A 3D7KA 2QD3A 3LY9A 4Q3BA 5IF3A 4IVQA 3VHQA 5CDSA 5JATA 4ZT3A 2EIHA 4Q4JB 1G6OA 2POQX 4BKPA 5KNDH 3VV3A 3VU8A 4WXEA 1JJFA 4BB6A 3IULA 1N1EA 3A2KA 3Q7QA 5H3HA 2HPVA 3M3DA 1GRQA 3LCUA 5EWLB 5IKEA 5EMNA 2W4QA 4K6MA 5MGNA 1E8NA 2YTZA 4YMWA 1M10A 3DMNA 4XX0A 4XIJA 3A28A 3DEHA 2YWGA 3EBPA 3IPCA 3WBBA 2OORC 3EHDA 5K0ZA 4LC0A 2Z1NA 1JG4A 2BFEA 2H0RA 4H18A 3N07A 4RF3A 4ASUD 4B9AA 4I1OA 1A27A 2E1RA 3AFMA 3WGTA 9ATCA 1TLFA 2PLFA 2YC2C 3G6KA 3QE3A 1I2BA 2VAPA 2WJZB 3O7MA 4GBJA 1DOAA 4V03A 4ZN6A 4NBRA 5CDFA 4MWDA 1J2YA 5K8JB 4C0QC 2AHOA 5FH9A 4TLMB 4GGMX 2C88A 4CM8A 2JFFA 4KV9A 5ISMA 2HCRA 4EIWA 2FFJA 3HNPA 1O95A 4JV5B 1XROA 3F8WA 3L6BA 1JKIA 5DNUA 3HU5A 3JVUA 5J63A 4XVCA 1EHIA 1NSFA 2HBZA 2Q3BA 2BSAA 3F74A 4MTCA 3B1KA 4F9GA 5I7RA 1OZ0A 2FLVA 1CRWG 4RJLA 2IYNA 2D2FA 2P3LA 3LK6A 3F3SA 4M9ZA 3PENA 3FFWA 3RASA 3FRIA 1TDJA 5I3ZA 3OQ6A 4L3OA 4G0YA 4DV1B 1QIJA 1J5XA 2GWRA 1RHKA 3WMGA 3AUUA 3ZE1B 1GTG1 3W5UA 5HJ5A 2A0FA 2HN9A 3HXPA 4WEQA 4ZVVA 1SCUB 5HQ3B 4R0MA 5ERYA 1VC2A 3R3XA 3BC1A 3PEFA 3ZGNA 1CUSA 2PQ6A 4OL0A 3PX2A 1UBEA 3HI4A 4NDZA 5FAKA 3C8MA 1L4LA 4JCOA 4B09A 2CUKA 5CX1A 4YRQA 3C45A 4EHBA 1XU7A 1UP4A 1NN3A 1RQRA 1MKYA 3SF8B 3MMNA 2VLIA 3CH7A 4H3KB 2BELA 3BMOA 3FI0A 4OHFA 4X6UA 4LTNA 3CBGA 4OQEA 3ADOA 4V0SA 4E88A 3KQLA 2RD2A 3FF4A 1CIPA 2IODA 3M4YA 3OLZA 4K40A 3LLVA 1DRUA 4K87A 4P3KA 4ZQBA 2XLBA 4BFZA 5KHOC 1J8FA 1VI5A 1B1CA 1HDEA 3WLNA 5THKA 2X41A 2ATCA 5E4JA 5A5EA 2BM0A 5K20A 1A04A 2FWIA 1VL2A 4IFIA 4UREA 1U9ZA 1HV8A 1U1DA 3KK0A 4X61A 3VOBA 2B34A 3WYAA 4Z4GA 1BKYA 3UGTA 4EG5A 1YJQA 4ITUA 1C50A 1DSSG 4J0FA 4Y6LA 1B43A 1VKZA 2X8JB 4TV8B 2QNRA 5JIBA 2NUBA 5FTMA 1ZN7A 4EGCB 2EERA 2G70A 2WHEA 5IM4A 2C84A 4NNJA 3X1MA 1L4HA 2R8BA 4YRDA 2A9OA 3GJ4A 1NXQA 1F6WA 3TMYA 1ZS9A 2OHVA 2QRPA 2FRDC 1P2DA 2C9DA 1A9TA 1BH2A 3AB3A 2W2TA 1J4AA 3V97A 3WGGA 5IZ4A 3AI3A 1N6LA 4Q4AB 5K3OA 4PNZA 1EUYA 2OZKA 1Z8HA 2QJFA 3B9PA 3NHUA 3PC4A 4MSUA 4QTZA 1DAPA 4O4HA 1RZRA 4PSVA 5K0BA 1KI2A 1Q1ZA 2ZU6A 4RJTA 1DQZA 4GPIB 4BY9E 4BL5A 4KAJA 5I4CA 3CE9A 4IIGA 4QL3A 1PJ3A 2YW2A 3FCAA 2EEPA 3NNSA 3BKXA 3M6IA 4BQQA 1DXQA 5THQA 5D6OA 3SEFA 3TLMA 1L5ZA 4M0KA 1ILEA 2Y77A 3EZYA 1QHFA 1XRNA 3J80A 2PMFA 4XQ0A 2GF0A 3K9QO 3KUKA 4BJ3A 3KJIA 4OA8A 4I3GA 2JGFA 2ZR9A 3QI7A 4P4NA 1YBFA 2XUOA 1E3QA 3LFTA 4DVGA 2X0FA 5F1PA 2EKPA 5AIAA 1L5HA 1HZZA 2DFLA 4IBOA 2PO5A 3SSAA 2VO1A 3A9VA 4M1WA 3K6SA 3IDFA 3LOUA 1COWA 1JZSA 2ORYA 4WXMA 2KMLA 4NZNA 4OAOA 1Y3CE 2WABA 1DC5A 3USES 4AMGA 3P1JA 1KVSA 1CSEE 4F2HA 5CFNA 5HE8A 3CX8A 3WC4A 5IZCA 3OCZA 1OA0A 3E8MA 1KSFX 2J9GA 4OXIA 2EWVA 5I7VA 2BF4A 3SKXA 1VG9B 2GPNA 2BGRA 1ZQ1A 4LECA 2JHPA 4HADA 1ML3A 2NU6A 2YH2A 1PP4A 4LMPA 4BO6A 2LR0A 4R8SA 4ZXPA 2XITA 2YJNA 1CFJA 2V0CA 3C8ZA 1A5ZA 2I71A 1SOVA 3JZMA 4IGEA 4OKSA 4R84A 4ZVKA 3RJTA 5H68A 1KOGA 3CRRA 1KJYA 1ZA2A 5CB0A 3T5DA 5I7EA 4QXQA 3LTEA 2C2HA 1XJQA 3SBOA 4B7UA 3IEMA 1V39A 2IZ6A 1M8PA 3ZWAA 4LV5B 3IXLA 4MPJA 2QN9A 4WDQA 5A71A 5EXDA 1JAZA 3PHHA 4YONB 1JG1A 2OAEA 3OMLA 4PZZA 3T1OA 2JJ2D 3OTHA 5FUVA 5EYPB 4DADA 3WAGA 2Q41A 3FFXA 4H31A 1DKOA 2VF5X 2XF8A 2XMCA 2HJWA 3QTTA 1VGRA 1HT2E 1PS9A 3KOOA 1SPBS 2FF7A 1N5KA 4MKXA 1TZKA 3CR8A 3RADC 2RAFA 1P74A 1V8BA 2QVBA 3ANXA 3H75A 3MMZA 3LQRA 4PPQA 3U44A 1CUDA 1XTBA 1UBMS 1ODKA 1DL5A 4L16A 5ALYA 5K0EA 1OH7A 4MYHA 3FW1A 2BZSA 3P9KA 4YK7A 4HTAA 4ATNA 2PUDA 4AF6A 1XIVA 4KQHA 3BWBA 1MH1A 5CJPA 4KK4A 2X9QA 2GBFA 1O6FA 4MIOA 1G7CA 4MRMB 4TKVB 5SZIA 4JUDX 4KZKA 3VKUA 4IIEA 4NCBA 1XCBA 1QX4A 4PQYA 5EJAA 1V43A 2NZVG 5JXIA 1D4AA 1NQUA 2WIBA 3EGDA 4GI3A 1T8YA 3ZDCA 1YQUA 4LFAB 2ZI9A 3W4JA 2P3OA 2CZQA 1I3OA 4JEMA 4IOMA 3T5BA 5CDUA 1CY6A 3WY9A 3P0EA 5LZ8A 5KU1A 1RMTA 1NI4B 5I6DA 1JQLB 4IRUB 1ZX1A 2QY6A 4DNFA 1BTOA 3DLAA 3HMKA 4UNQA 1RI5A 5IBRA 4J75A 2GUWA 2II6A 1KNXA 3IP9A 1QH9A 4WNCA 4D6YA 3RS4A 1Y5LA 1JQDA 2RGAA 3IAEA 4PLHA 1SBZA 1KRXA 4GE0A 4BFVA 2C31A 4M0CA 5ALXA 4F3TA 2JHCA 3UPUA 3VSDA 3HKEB 1MB0A 1FU7A 3W2IA 1QH1A 1S6YA 2WA1A 3H11A 3E5RA 3GNTA 1YJBA 4RD6A 2HXYA 5TF4A 3RIHA 2QLLA 4EQ6A 4IH4A 3K4QA 3LUCA 3MJDA 4CIAA 2NSDA 1GGVA 1MQ8B 1JJVA 2Z6VA 3OO1A 1T2FA 1QTRA 5LBTA 1J0BA 1P17A 4NOJA 2Q5IA 2ZUUA 5EC8A 4J6EA 4NCXA 3OZCA 2ZUVA 3PC3A 4MQMA 3BXPA 4H16A 2C83A 3ED5A 2NUAB 3A4VA 4CI9A 4H59A 5BV7A 3BXZA 1A4RA 1HDCA 1WPQA 1X39A 5B1IA 3RUEA 2Y8EA 1XKTA 3Q15C 2NTNA 4POAA 3B8HA 4P54A 3I9V1 4F72A 5I9BA 4ZZIA 3VRHA 5AVYA 5LU9A 2X1MA 3T1VA 2G5PA 2QW8A 2J3EA 5ETJA 4GP7A 4O1MA 2TS1A 1M6EX 2HLDD 2I6TA 1GU1A 2IZ7A 3CX3A 4UHHA 2YFHA 5B37A 5TSDA 2WTBA 4B1FA 3FCSB 4ZI7A 3MMXA 1XPRA 4FB4A 1OF1A 2P4HX 3LTNC 3EDRA 2C2XA 1D4ZA 1DLJA 4BJ1A 1W5EA 4DV6B 5DXFA 4F4HA 2DUMA 2VG8A 2NAFA 4OJTA 1XJ0A 2HLNA 2DM6A 4HGQA 1U0RA 5TMEA 4F3RA 3J81k 3UBTA 2OGUA 4LY9A 4RV9A 3ZU6A 3O73A 4TXMA 4EY4A 5HOQA 3NBKA 4YHHB 1EA7A 5KVSA 2ZSHA 2P2GA 4C3OB 2IIVA 1GQQA 3N5CA 4NJMA 3H5IA 2QNBA 2O2DA 2ZS8A 4C1NA 3AVPA 3PD0A 4LCEA 2IBSA 1M1ZA 3TIFA 1ETHA 3AKZA 3V4FA 4HGYA 1AQYA 3IAHA 4ZCSA 3ZU4A 1R12A 2IEBA 4JA0A 5A5FA 4S04A 3A05A 3OA0A 3SC2B 2RKWA 4FB5A 4BU1A 1GUFA 2X2PA 3HB7A 4E1BA 3W2HA 1WCV1 3SOZA 4LMBA 3T15A 1LKZA 2IIPA 3IAFA 1UZMA 4RHTA 3D8NA 3BH7A 3OHPA 3OOEA 3VOAA 1T13A 2C98A 2PGNA 1Y1LA 4PZ0A 3VHXB 5KSWB 5DNCA 1XFAA 2YWBA 2PMEA 2D0DA 4C7JA 3EG9B 3LQFA 1OHHA 1V25A 1E9SA 3KUDA 1T2CA 3QK7A 4BLQA 1TEVA 2QRGA 4K9KA 2HY7A 1QGZA 2M1ZA 2PA0A 1DWOA 3H9JA 3TRDA 5IYZB 4CJXA 3K9NA 2AXNA 2JEOA 3F96A 4E08A 1IWBB 2VCYA 2ZTSA 1S2MA 3KE9A 4FLFA 3VV2A 1HYQA 2GLUA 3O8QB 1GXSB 5CLFA 5FLEX 1GFIA 3D3JA 3M83A 2XWPA 1V71A 1THMA 3HVUA 3OIDA 5DGIA 3ZV4A 4RTMA 3V7YA 2VDWA 1T9AA 1W7AA 4K88A 1Y98A 1ZESA 3Q7RA 4QREA 1UAAA 4N3GA 4JOCA 4C0HA 4H77A 3TAUA 4EPRA 1CVIA 3B1WA 4MIKA 4Q7EA 1JDPA 1YCHA 1DELA 2BIFA 1H23A 2J85A 4JJKA 3L41A 2VDQB 4YX9A 5LQDA 1IOLA 2FJ0A 1ZVKA 3IAS1 1P72A 1KF0A 3A9SA 4REQA 3RIEA 1WG8A 3WGQA 2B8JA 4NATA 2WPNA 3NU1A 3DQZA 5EJMA 2C04A 2D1QA 3I1YA 3KAKA 4IJQA 3OU7A 4WE3A 3QNMA 2QYOA 2GK6A 4IO1A 5DXJA 5LP6C 3A6EA 1VLZA 2BEVA 3LPAA 4ND7A 4YPFA 1U3FA 2AN9A 3GZ4A 1WSBA 4FW9A 5B4VA 3IBSA 1CR6A 2OHFA 5EJ2A 3FPCA 4NY1A 1RD4A 5KCMA 5KTSA 4IGFA 3VZRA 1R1DA 3JAWB 1IQRA 4V0QA 4HP8A 3IDQA 2FZKA 3IA2A 2BVNA 2R1VB 4I5EA 1U9IC 1YJ5A 4QNRA 2QSZA 5EESA 5HR5A 3FMPB 3DLCA 3H4TA 3JASA 3VR3D 1BX1A 1DBVO 3N6RA 4CEJB 1ODFA 3A31A 3EN0A 5FWNA 2OCAA 2XY4A 5U4XA 1MPXA 2I4MA 3CLTD 3N8IA 1Y3BE 3O82A 3EXEA 2V3VA 4O2BB 1V8FA 1XZNA 2V6GA 1UL1X 1Y63A 3M1LA 3EAGA 3QUQA 2JIQA 4QG7A 3WS7A 1NR7A 3WGHA 1M5RA 3A9UA 2J67A 1IN5A 2VNKA 1QZ3A 2WF7A 2Y66A 4FQ5A 4D25A 1G20E 3WZMA 1OWNA 3S7ZA 5C1DA 4YECA 3ASUA 1AMOA 3HVKA 5HJ7A 2ZI4A 3WNQA 4RTPA 1PR2A 3LSYA 2O8CB 3SQXA 3PS9A 4KTTE 3V42A 1RVV1 4ZYXA 1C2TA 2C3MA 1OXKB 2H2IA 1DRKA 4OJNA 4CKCB 3ZD7A 4CI0B 3EDOA 1ND5A 1UBUS 3OQMA 5BSEA 4Z54A 3G9UA 3ANNA 3TNJA 3X3HA 1EK2A 1GJRA 4K03A 3ZUGA 2DBQA 4EWLA 1Y1SA 3GDWA 2EF1A 4WXRA 1GDDA 3ESZA 3AJDA 4HBZA 3BCUA 3HXMA 4XX0B 4XWTA 2IEDA 2XNJA 1D9ZA 3CF0A 1V5GA 5BR8B 5FBWB 3V2HA 2QK4A 2BFEB 3IT1A 2BHLA 1DAIA 1BVUA 2BUCA 4P36A 2Q0XA 5FL3A 1EWYA 5C1IA 3RQSA 1P2UA 4IX9A 5AOAA 3ETHA 3UK6A 2CXUA 2WICA 4BJ6A 3M5CA 5AJVB 4EM6A 1S3IA 4JVMA 1LDBA 3KWMA 4I3FA 1I9CA 2P65A 4QWMA 5JTTA 1IULA 2HSZA 3FCYA 1IQUA 1Z2AA 5CEEA 5A6VA 4CM8B 1GDHA 1VRCA 3WL6A 3FPJA 1BAPA 4AWBA 1L4MA 2CCGA 1U2EA 4AVYA 5HKKA 5ICSA 1Q1BA 2WQZA 4WOPA 1DKNA 1MEJA 3GT4A 4XASA 1UOEA 3AR6A 4PFQA 1J2EA 3IV6A 3R7WA 3LKVA 4CNBA 3FTFA 4JJIA 5FKJA 3O9MA 4JBXA 4IDNA 2ZT8A 3PGKA 2B94A 1YRYE 2PUWA 1ZMTA 3S0JA 1A2KC 3G2LA 2F48A 3UK7A 1JNXX 2R8EA 4H7FA 4R68A 4D0SA 2Z98A 4FYYA 2IBTA 1FFDA 1V5IA 1AK9A 3PJEA 3Q9UA 4J0DA 3FWNA 4RW0A 4XDGA 3FKJA 4DPLA 1Z4QA 2Y05A 1L7AA 1Y5IA 3VOSA 1XHFA 3AIIA 5SY4A 2I99A 2IXEA 5J4LA 4YRNA 4NMHA 3O93A 4KQXA 5DI3A 5CRIA 2GXUA 1T4BA 2I1WA 3C39A 1AGYA 1D2MA 1JDSA 2JANA 3CXRA 4PPFA 5CX1B 4DNXA 4BYMA 1QO0A 1Q22A 1BO6A 2F00A 3TEJA 3ABZA 3FCOA 3FE2A 3NWEA 1RYEA 4KMRA 3PQ8A 4N65A 5AI8A 4MGIR 4WD3A 5IJAA 1NQVA 4QQFA 2OMEA 3I64A 3PQ4A 1TF5A 5FWAA 3QU9A 4L4XA 3NHBA 4HLDA 3IILA 3V48A 4W6QA 5ALMA 2QAJA 4CT4B 2VJMA 3L0IB 1ZDMA 4MQ6A 3FHLA 2CNKA 2OESA 5DPMA 3OEYA 5CCXA 4L8YA 3AJRA 1HFWA 1CJTC 2ZBEA 3HYCA 4MTLA 5DDIP 2O2YA 5FORA 3HBJA 3IQIX 2H5JA 3IO5A 2XE8A 2OAGA 3JVEA 4IIVA 4BKRA 2P9BA 3BCRA 4Y1GA 3I09A 3FG9A 5JDCC 2FZ4A 3TOXA 2B3TA 2EXXA 4OU4A 4UULA 5A9TA 4ECAA 4CETA 1OZGA 1CUYA 1DXYA 4L5YA 1MIHA 3Q1KA 1N1GA 1L7DA 1RE0A 5D5QA 5EQJB 2FCRA 3MXTA 3IXMA 4IYRA 5KKAA 4D9KA 5JQGA 1U3UA 3ANLA 1EBUA 1OAOC 2BGJA 2P2NA 3K5WA 4FSDA 4M7OA 5TMBA 3GP8A 3C43A 1OXSC 2JHAA 3N70A 4R5MA 1MVOA 1OKKD 4R8LA 1GY8A 5B7GA 4F5EA 1XWIA 5AKJA 1KQPA 2E55A 3EVBA 5BPFA 1OX5A 2ZW9A 3VNQA 3TXXA 2P6UA 2XAUA 4X41A 4QICA 3SBDA 2OGSA 3LHKA 3TXAA 3IR7A 1E94E 1JVSA 2J5QA 4YP1A 4L57A 3QWAA 3ND5A 1V37A 4HNSA 4NP6A 1WO8A 2RGXA 4V2UA 2V6IA 3BGIA 1OFTA 3ZHZA 2XV1A 5B3JA 4BTLA 3DC7A 4CMGA 5KIAA 4KWHA 4RABA 3PFNA 3C74A 4QLAA 3UK1A 2CEAA 2GFHA 4HZGA 5KX5A 1MVLA 4IFEA 4LE1A 5AOBA 2CLDX 1PF7E 1JKXA 3O95A 3W8RA 1C9NA 2Y1KA 2YVQA 3G0DA 1L5HB 4MA5A 2GN2A 3ANMA 3B12A 5K4HA 1GPNA 3JYPA 4CM9A 4OI4A 3K6SB 1U81A 2N3ZA 2HNBA 2JCVA 3KT0A 2Q9AA 2I2BA 1TYAE 1XYVA 1Y7TA 4RWEA 4MI9A 5C8YA 4YAKA 4ILKA 3RG8A 4NK5A 4JBWA 2OWEA 4HNHA 2YVLA 1AQJA 5ARCA 1QRSA 4EAQA 3UHFA 4BKOA 5CIYA 1FQJA 4DDUA 3RAJA 2VBCA 1T3LA 4U0JA 1T34A 1RJ9A 3OZUA 4FLEA 1ZEJA 4XD7A 4QPZA 3F0TA 1AOXA 1XZIA 3II6X 4RZ2A 5EUBA 1TM7E 1YT5A 4Z7OB 5JXHA 1KSJA 2NU6B 3HHPA 3HO8A 4ZOBA 1EKXA 3VZPA 2QRVA 4WOKA 5DEIA 4ZYUA 1U2PA 4I2VA 1NBWB 3T5TA 4YRFA 5EXSA 3SIXA 1QIIA 4RKQA 1T2DA 1Z6TA 1TQ2A 3MCWA 3CKYA 3KUCA 2G3YA 2O3TA 1T91A 2YZ7A 3IQEA 4RHFA 3UHPA 4LA4A 1ST3A 3I28A 4XUCA 1D7AA 4J07A 5BSUA 1QYIA 1Y3IA 2ZXUA 3RK1A 1YOBA 4L02A 1ABBA 1FNSA 5A4FS 3UK0A 3ONVA 1FTWA 5JYDA 5COQA 1T2VA 3VR0A 4PN7A 3ECCA 5DT9A 1ZKMA 2ZI6A 3C7KA 4ND5A 4AJOA 4D0GA 4XYMA 4B3JA 4NV0A 4RJKA 1FFYA 4YJ3A 3QVGA 3WLRA 1IBKB 1JF8A 2ZRHA 1KAGA 1Z4NA 3D0KA 2P6PA 3PA8A 4B7CA 3AGQA 4NCAA 3AG5A 2QL7A 3R75A 4PIPA 1Q15A 4CZ2A 1H9CA 3VYSB 1T8SA 3NYIA 5F64A 2NO6A 1UWVA 2VHVA 4TZKA 1JXAA 1DFHA 3OZSA 1BROA 1T2NA 3V2IA 2A9JA 4D8YA 3FUCA 2HJVA 3L7JA 1VSBA 3DT6A 4UATA 3SU8A 3MMPA 1DEAA 2EHJA 3R5FA 3N5KA 3ZZMA 3MT9A 4P5DA 4LFCB 2LV8A 4LWQA 4PSAA 1P91A 3SHFA 1M5UA 1ARZA 4CG1A 1MV5A 3I5AA 5AR1A 4BFYA 1B8VA 1C0IA 3HB9A 4ZQEA 4X71A 4ZOLA 3R44A 3L6UA 3EGDB 5K8VA 1D6NA 3FHTA 1KMIY 2QTFA 4N9QA 1E77A 1R9MA 2PFGA 2VT6A 2CL0X 2WG2A 1EGAA 4MVJE 1GPLA 4PONA 4S35A 3SLRA 3HSSA 4EMUA 1W9HA 4RGQA 4TYNA 1KVRA 2AFVA 2VDUE 1XLUA 3VVLA 1D3AA 4PSCA 3ICEA 1M3SA 2IXGA 1SVWA 1I4EB 1VSVA 2WKWA 4FFMA 1F7VA 4DN6A 4W5RA 2BFDA 1QR6A 3QF7A 4UXIA 1XCLA 2VRCA 4TT3D 5CT8A 2ZSFA 2WP0A 4MO2A 2Q3JA 4D8XA 2CK3D 3S8YA 1L5WA 2TRSB 1KEWA 1X9IA 2GLXA 4LGCA 1UM9B 4Q21A 1DKRA 1W0KD 1M2VA 1PBTA 1Q3HA 4MUGA 7ADHA 2Q46A 3SZMA 3ZCXA 3GV0A 1PJQA 1KBQA 3BIWA 3NASA 4CQMA 2NMVA 1M67A 2ZSKA 3ONNA 2UZAA 3H11B 4DUPA 3E9MA 4EQ6B 5A0VA 1U3GA 1R6AA 4MP8A 5IDXA 5BSMA 4RX1A 1LK5A 3CF6R 3O8LA 4LJLA 3AKDA 3UGQA 2ECKA 2OMKA 2VXCA 3IMGA 3EEQA 3U09A 2R47A 4L76A 3CR3C 4EGFA 1SEVA 1EVIA 4DJFC 1QB8A 4RKWA 2V55B 2W6JD 4HYEA 3K72B 1QG6A 2NQ2C 5AHOA 1ZK2A 2AXEA 2ZXFA 4L4ZA 4BVJA 4AB1A 3IODA 3CG4A 2VPQA 4QXPA 3C6XA 4Z2YA 4U4AA 4CV0A 3FB4A 4L4YA 1Z06A 3FNQA 2W2NA 1YZFA 3QM1A 4S3MA 1TJYA 3R6WA 2K6GA 1CEYA 5CDGA 2I1QA 3RK0A 4HXFB 1PJAA 1F1BA 3UAZA 4DRXA 3WIEA 5SYAA 1OGYA 3AG6A 4BLUA 3G5TA 4W9MC 2LVBA 1SULA 4DGQA 4ZI7B 5IG2A 2QVYX 3Q2OA 2YN2A 4Q01A 4B71A 3GT7A 3HDVA 4FINA 1THTA 1O5TA 3KOZA 4L5CA 4LX8A 4PYLA 2G83A 4ROTA 621PA 2DLDA 3GLFA 3P9SA 4YRRA 3ORFA 5BWCA 2QTLA 2ARKA 2CSXA 1XQ6A 3MTEA 4BMXA 1AUQA 1PE0A 2YJ4A 4DF3A 5K4GA 3ZYZA 4DDKA 4EGQA 4PW0A 2H9AA 2PA3A 3TVYA 2C7OA 3JR7A 4OTZA 1T10A 4LDQA 4NJMB 3AEXA 1TT5A 3WJ1A 1ZJ6A 3I6IA 3M8KA 3GCGA 3Q3GE 3PPYA 1OMOA 4BEBA 5C80A 1KO4A 1HLGA 3AI2A 2PRZA 4QRDA 5C7LO 5JZ9A 2C77A 3HCEA 3KL4A 2YJ5A 2R8YA 4RBNA 4TV9F 5DW3A 4AG3A 4NPHA 4C0LA 4QPPA 5BQOA 5JVDF 3UAYA 4ENUA 5LDGA 3KOXA 3DCJA 1BOOA 3K6RA 4AN0A 2W48A 1SNYA 1YRQA 2JAOA 3A4IA 2HYDA 1G8HA 3A26A 1PCXA 3V80A 4ZI2A 3EGVA 1P7VA 2QZSA 4M86A 2F6RA 3LQ1A 1I2ZA 3GMTA 1F8GA 1JKJA 4RTLA 4AURA 3FKSA 2MCFA 2V5UA 3CLHA 5HYVA 3ND8A 1GTJ1 4RF2A 4IFBA 2ZDHA 2Q5EA 3GDGA 5ECDA 1CEEA 5B6IA 4LWZA 4JY7A 4J4HA 3C16C 4JLSA 3M6UA 1EWVA 2BV3A 4H7PA 3IELA 1BA3A 2Q6IA 2G7MC 3L1KA 2YWEA 4ZC8A 2G9ZA 2VDWB 1T9CA 4QU8A 3U60B 2JFVA 4AZ3A 5J5CA 2CE7A 4IL5A 5D5HA 1FS5A 4QHYA 1NJ6A 2H5IA 1GRRA 2DHEA 4DGSA 4U5QA 2DG2A 3ZX4A 3GELA 1H2YA 3AV3A 4W6ZA 5EWJA 2ABWA 4RQUA 2C20A 3N28A 1RKXA 1EMDA 4REQB 3ZWOA 2FLKA 5FTJA 3C98A 1K06A 2GESA 2D0PB 1R6TA 3D7RA 3OZEA 5TPZA 3V6MA 3G7SA 1XZCA 4QGBA 2DFDA 4FMCB 4G2NA 3IBTA 3Q0EA 3G1TA 3S8EA 5MHTA 2G0AA 1U9CA 2BEVB 4LXTA 4QDZA 2OB1A 5DNAA 1UT6A 3SC3A 2IKQA 2FRVA 2HYIC 2JLVA 1YRBA 4QPDA 3DO8A 4IX1A 4WASA 1G21A 3ASZA 1XGKA 4D6XA 4KH1A 5ECYA 2XCOA 4LZAA 5JSYA 5IVIA 1XI2A 3EULA 4A0GA 1MRSA 3F6CA 1KYXA 3DAGA 3JASB 4YI5A 1AH2A 3C1UA 2V3CC 5G4KA 2DERA 1VRWA 5EI5A 2H7VA 3DWFA 4DUYB 3N0WA 3EXEB 5BVGB 4F9FA 4PYIA 4IFTA 2IGBA 3DD1A 3JQFA 1N8NA 2WUFA 1ZD8A 1OLOA 1QP8A 1AGNA 3O8DA 3BBLA 3H2BA 3NEJA 4EY7A 4YFYA 5LQJA 2BI4A 2H1HA 2ZULA 4FN5A 3OE7A 4RY8A 3P32A 4RA9B 5EL0A 4ZEOA 4C0WA 3SVTA 3B70A 3UMCA 2NU9B 3LRXA 1GPJA 4EITA 1T35A 5DISB 4RLQA 2J3MA 1U0SY 4JLKA 5LIRA 3IL2A 1YRWA 1EXNA 2PSFA 2XRYA 3O2NA 2KYRA 3OPMA 4JDUA 4K26A 2QYSA 4PNHA 1QCCA 2WWGA 1UK9A 2I67A 2WZCA 3R0XA 1AMUA 3N7UA 3IFSA 5GOTA 4HWPA 4UE2A 4MV5A 4GSLA 5GM1A 4WCVA 4JVOA 1FVFA 3CCFA 4TN5A 1QNLA 3PEYA 5I4IA 1SKBA 3GVHA 3MC1A 4GZLA 3CW2A 2LRHA 4OSPA 1SK8A 4YRCA 3E9ZA 5SZHB 4EB3A 1DPFA 1TEHA 2PL1A 2EAUA 3WBJA 5BRAA 4UOEA 3GFBA 3ACBA 2ATEA 2PS1A 2YJ6A 1PG0A 4ND1A 4WNYA 1IZZA 2CC2A 2V58A 2W0SA 3IBCA 3MGGA 5EJIA 2OO5C 3TI7A 4X44A 4DEVA 2VSXA 1S2OA 4B6GA 5TGZA 4JBIA 3FDJA 1FW8A 1JSZA 2AQ8A 1Z6PA 3PIIA 1WDKA 2YJ3A 3LD9A 4D2IA 1XCOA 4LVUA 1BNCA 4HAXA 1QE5A 1I5OA 1AV7A 2C9OA 1M1UA 4FYHA 2BBOA 4G5XA 3R7WB 1SHTX 4XQEA 4OQYA 2B4RO 4CKXA 1LSOA 3OETA 2JJ1A 4PX3A 2PRJA 4P86A 2E5LB 3O8NA 2W8ZA 5KNBA 2VJPA 4UTPA 1W85A 4XYBA 5BP7A 2TYSB 1W76A 2FFHA 4G3XA 4AMVA 2WTUA 4JBLA 3HKDB 4RZIA 2HEGA 4RENA 3RROA 2QTHA 4S12A 5B2ZA 3DPSA 4DLPA 5A1TA 2FFQA 3ST7A 1OW3B 3HFSA 4KK3A 4R2JA 1QE3A 3JQCA 4UEQA 4J4TA 3UJBA 2G1AA 1WB9A 1P1RA 2B4AA 2VDOB 1Z28A 1TM1E 1SZPA 4HK4A 2XUFA 5DYIA 1I01A 1PGNA 3JARB 2PTHA 3IQWA 1S3GA 2WTNA 3COPA 5DI3B 3WNCA 4YCCA 1I7QB 1WBBA 1PGQA 1X15A 2XDYA 1N2ZA 2A1TS 2WMDA 3RJ9A 1P5ZB 4EHHA 3OG9A 3U16A 3E3OA 2X2OA 3LL4A 3V8QA 1CUXA 2CFTA 3DOCA 2WPDA 1E66A 3H4VA 3HO6A 3LVRE 4NYIQ 1Q0HA 3L8GA 4UZFA 4YQYA 2FVYA 1XTKA 2EBHX 4WOJA 4DIKA 1JN0A 1GKUB 4B48A 4H7DA 3AGPA 3D1LA 1HTWA 2ZITA 5CLHA 2VJMB 3Q0IA 4E5KA 2CJWA 2QOEA 1NVEA 1YCDA 3TBHA 4IXWA 1VP9A 3RFFA 1T4CA 2VHWA 4G5OA 5BYAA 5LZ9A 3PHCA 4TL9A 3GBPA 5E9JA 5G40A 3U2QA 1V35A 3DZGA 4OLHA 2ZJZA 2WD7A 4O2AA 2FZCA 2VYVD 2ZYUX 1JJIA 3IUQA 3OM1A 2QORA 3ZS9A 4D02A 5F52A 4EF6A 3ADDA 1MAAA 2GA9A 3WBFA 5KQSA 4EPVA 2WKPA 1VJDA 2P9CA 5JQGB 2XOKD 4QA9A 1PEKE 3V8BA 2O7NA 3F4BA 1XUOA 2ACEA 2AN1A 3WK4A 4DA4A 2JAXA 2G9VA 3A37A 2ODBA 4KX5A 4TYPA 3REFA 1LPPA 1WDLA 2CLIB 4D8VA 3X1DA 3NYWA 2V65A 3CZRA 4JODA 1ZC4A 5TB5A 1GTSA 2FHPA 3DBIA 1YRHA 3QTLA 4M1EA 2QQGA 1DC8A 2JAHA 3ZGOA 1FY2A 2OBFA 2X19A 2AG8A 1U0TA 3BK2A 1O89A 3DL4A 3OUZA 3K0HA 3OAAD 4G1EB 4PG6A 3NPMA 2BRUC 4HATA 4XIIA 5AI9A 1S4QA 5DLQC 3N0VA 5EE5B 5A7GA 3L8HA 3AR3A 4DLRA 1WXDA 3ZOKA 3ZCSA 1WZIA 1Z08A 2R8ZA 3EZGA 3U1BA 2IP1A 2AUMA 3EXHC 3KKEA 1O95C 4LUCA 3NHLA 4MYDA 4OJKA 2NT4A 2YIJA 4UNNA 1H0SA 1YS2X 4FCCA 2O19A 3HACA 4UCQA 2FN9A 1NVTA 2GN4A 2H7CA 1ZD9A 4L74A 5DYYA 5KX5B 3RUDA 4E2XA 1ZM3A 3SEZA 3WLAA 2AJTA 2OHGA 3A4MA 5IUJC 4DMHA 2XT6A 4ZYYA 2JJYA 5IJWA 1PJLA 1V3VA 4K9DA 3QMMA 1Z45A 1DCFA 1FFSA 1A97A 1DBIA 1MGPA 3ILXA 3E48A 4ZFNA 1XLVA 3IMKA 5KREA 1DAKA 5C8YB 2AOUA 4FHCA 3CISA 4XARA 5A6SA 4LF4B 4X84A 4GOKA 3JQ6A 4M88A 3G0OA 1R8XA 2IPMA 4JLWA 2FW9A 4J16A 2G8LA 4H15A 3EPHA 2O3QA 1FU8A 1HLPA 4RK6A 1OLXA 5SZKB 2G9QA 1DIGA 1Z0IA 1MAUA 4X95A 5LBUA 1P1HA 4IXNA 3QVUA 2RIPA 1ZVQA 2BWJA 3KKKA 5HA5A 2WYWA 4V0LA 5LA6A 1T1EA 3PUIA 2ZIXA 3AVOA 1H8ED 2XYVA 5JAPA 1V4NA 2NO5A 2H5EA 1XYGA 3K9BA 2QMZA 1MD9A 1SD2A 1TOAA 1T36A 1SXHA 2VDMB 3VO9A 3NRJA 2X5JO 3F67A 4Y1FA 3HBNA 2F2TA 1Q50A 5EEGA 4CE6A 1JE0A 1GUAA 3GU3A 3OCWA 2ZJ0A 3F3YA 5L7YA 3RRMA 3B1XA 4BNWA 3NZEA 3CNNA 1ID8A 1KQNA 4P0QB 2V1XA 3ZJ4A 4LQ4A 4O63O 4WKPA 4N48A 4YJ3B 4CMKA 3QVGB 3HKBB 1VE1A 2YIVX 4LY6A 1UPTA 1JA1A 2HZ7A 2ZQYA 3L6EA 3Q5DA 1FFBA 4GGPA 4IW3B 4Q3NA 2FZEA 4D4GA 1YL5A 3C5CA 4RZXA 1AGRA 4I99A 5LP6F 1T5HX 3ZH2A 4BB0A 1W88A 2SHKA 1K7EB 1L7VC 3K3PA 3H0EA 4JVNA 2EIXA 4XIGS 1N6OA 1U4SA 3MCTA 1I3NA 3O3CA 2RHRA 2ZUBA 2X22A 3VJRA 4ZK6A 3A27A 4N7MA 1ZOPA 2N75A 5CPFA 1L5MA 3HPRA 3QVXA 2QMYA 3E58A 2PK3A 4P7BA 3ZNPA 1FXWF 4TXJA 3PKIA 4ZOLB 1DXHA 2CLEB 1IJKA 2QXTA 2ZIEA 5L3RA 3VMFA 3PNSA 2PXAA 4IJ5A 2HX1A 1K8QA 1HZZC 3H4IA 1A8SA 4MUMA 2Y1OA 4MR9A 1KDTA 1GIAA 1K7FB 2H16A 2BFDB 1I2CA 2G76A 4JLUA 2GBGA 3DEFA 1E9BA 2BL4A 3AEKA 2PKRA 3HQ4O 3RD5A 2QN8A 4BNDA 5J4VA 4L7VA 2Z9CA 5IZCC 2Q1XA 3EASA 4BE4A 1M2VB 3N2LA 2AUTA 4I6EA 4A82A 2REQB 4CQMB 3F2IA 1N9GA 4K7JA 5BMVF 4C7OA 3I5UA 3H9EO 3QLTA 3SLGA 4Q1VA 2NYVA 4D96A 4OMFG 3TD2A 3CVXA 4KXWA 4MQUA 4E5DA 1XNHA 3NCTA 2C3OA 5J4YA 3HR8A 1QZXA 3RIYA 2C8JA 3HDQA 3PSHA 4KVGA 5EJ7A 1OVGA 3NT5A 4K5QA 3G79A 5CYFA 4F96A 5JT1A 5JFOA 1W0JD 4M8IA 3PWKA 2JKVA 1NF9A 1L3IA 3MIIA 4OKNA 4MMYB 4HPWA 4PLYA 1SBNE 1ZZGA 3K96A 2WLTA 3A4TA 3NYRA 2F8TA 2Q49A 1J0CA 2XZTA 4M0DA 5D84A 4KQ1A 4LKOA 3AZOA 1AU9A 2XWQA 3L3BA 3IYLW 1G38A 2VC2B 1T9DA 1SO8A 1Z7BA 2PGLA 3CNEA 5HMMA 4D4JA 2JLYA 2H9YA 1G64A 1ISGA 3ABIA 2GOYA 3FJ1A 3QYAA 4U7JA 4DRXB 4AI6A 3MWEA 1T4GA 4FXPA 4F46A 1Y80A 5JAUA 2O59A 5C1OA 2FMHA 4I4NA 1ZL0A 3O3NB 1SXJB 4YYZA 4TYYA 1WY7A 1P60A 3MF4A 3RKSA 3GLFB 4C3UA 2OZPA 3O1HB 1XO1A 8ABPA 4FTWA 4LRYA 3L4EA 1NI5A 3G8CA 4EMTA 2PX8A 5MFPA 3R77A 4DAEA 4DJDC 2WAYA 4UM8B 4F5DA 3TTUA 1A88A 1WVMA 2FEOA 3NAMA 3BZBA 2BCGY 4LPSA 4LJ9A 3DAFA 5FPYA 1TT5B 1MFZA 1JR4A 2DSTA 3D1VA 5T8KA 2JHFA 4IQGA 5H1YA 5JCPA 2CHEA 2GZMA 1T8RA 1E92A 2VAXA 2PT5A 2H2DA 3CMCO 3KTOA 4N3NA 4ND3A 4ZRNA 4CXMA 1QO7A 2EKLA 1NJ1A 4KFUA 4BJHB 5DMHA 3ZVLA 2BEUA 5HRCA 4NMWA 2W42A 1G7RA 3NVKI 4OHVA 2CLFB 2IH2A 2NTVA 4CU5A 3EAQA 2IXBA 5DIFA 1O6BA 1MX3A 1GILA 4ESOA 3N53A 4LYYA 2VT3A 3BQ9A 2CVZA 3AFGA 1JLLA 3C70A 1JKJB 1DC7A 2VUHB 3U26A 4BO3A 3AKYA 3AL2A 3D2CA 1Y33E 2V9PA 1FDSA 1A7AA 1TO2E 4RM2A 5CNKA 5BUZA 1XHEA 2VCEA 4IIJA 4BO8A 5CDFE 1A4XA 1O3YA 3R6TA 4Q9IA 2KI5A 2W6MA 5KNBH 1CY2A 3L9XA 5SV2A 8ADHA 4DRYA 4NX2A 1M2OA 4PBRA 2QRHA 2D1RA 4M8SA 1SKMA 4I55F 3L92A 4P98A 2JFXA 1PU2A 1RDFA 3BUSA 3RFCA 4E13A 3AILA 2JFHA 1BGXT 3H1GA 2HK8A 4AZ3B 3TZBA 2OHJA 1LTHR 3ENVA 1M2KA 3R74A 2AN3A 3QH4A 4BASA 2Q6TA 4BX0A 4MARA 1I0IA 5DNWA 3EY4A 4RK7A 2RI1A 2JLUA 3W06A 2Q62A 4TTJA 1X8KA 5A3RA 1N6KA 5E2BA 4FDMA 4RGVA 3HM9A 4ZT5A 2F8SA 1L3BA 1GAQA 3R5HA 4CR6A 5JASA 3I4FA 1IBRA 3MZ0A 3SS7X 3QBVA 4GBED 5F5NA 3OOWA 4BUCA 3DE4X 5A3QA 3H97A 4UTZA 2X9GA 3KQUA 2DUUA 4XE5A 5EMKA 4YMVA 1ZLYA 2QRZA 4OLJA 1EJ6A 1VMAA 2JGLA 3GJZA 4IHJA 5KHLB 2JW5A 5ERGB 3T5AA 4NZPA 4B3MB 4BN4A 1PW5A 2DT8A 4CKBB 2OXEA 4V3BA 3THXB 1NX9A 2HLDA 2YBDA 2IP4A 4R8MA 2HJGA 4QECA 1G7TA 3JWEA 5LQCA 5LUAA 5G4KB 4Y2UA 3OJXA 2YR0A 3PXXA 4OXQA 2ZTVA 4E15A 2XCTB 5PNTA 5TRTA 1LS6A 2E6UX 5C4GB 1E2KA 3FHJA 3L0OA 4JYZA 5DWVA 3HA2A 3BGWA 1FBTA 1JAHA 2RMKA 3AUAA 4EABA 4I8DA 1XFDA 2IA5A 1UFKA 4HOYA 4W8OA 2CLHB 1XTVA 3P9QA 3RREA 3VAAA 4YP9A 2PHZA 4F7WA 3FRHA 4DZTA 2Q50A 4GHWA 3WSWA 3DYBA 4JYBA 4KXUA 5CB8A 3CEJA 3K5PA 2P27A 1P7PA 1IB0A 4HAUA 2WSYB 2AB0A 4QNMA 2B21A 3H6KA 1TUIA 1W36C 3FIJA 4K9RA 1C4XA 3KJEA 2EC5A 4RY9A 5LBIA 3Q7EA 4DCPA 1Z7GA 4FYJA 4OY3A 5C37A 2BH2A 1KIFA 3IP1A 4WLEA 4G5RA 3UXHA 1KAOA 3H1TA 1DO8A 4LISA 4WH0A 3U7HB 1V6AA 1XEXB 1YMUA 5LQKA 3QEAZ 4XVQA 4N03A 3U7RA 3Q10A 2QM3A 4CMEC 3L7IA 3KZOA 1L7EA 3BFKA 4DTCA 2VTVA 3I8OA 2I7VA 2AFHA 2C07A 1G6Q1 4X64B 4J0CA 2DU8A 3TQSA 1U3CA 3IQFA 4FC6A 2L82A 2IIQA 2RHJA 5AJYA 3C3DA 4BMNA 3KZCA 1WF6A 4UAGA 1IDOA 1IXYA 5F1KA 5ITVA 1V0JA 3ZIAD 2J0QA 1AS2A 5AVOA 2HU8A 4BVLA 2YCLA 4JR1A 5K3CA 3KYJB 1X8JA 2YASA 2YYAA 3TQRA 3B7GA 3HRKA 4N5HX 5ENZA 3Q9NA 3LUHA 3E9CA 1Y4UA 1ZYUA 1JAXA 1GRVA 3NR2A 1T9GS 3AEYA 3BMQA 1GKIA 1HY3A 5FFFA 4ZZ2A 4DLXA 1HE5A 1JDUA 1W85B 4AF7A 4NFLA 4IIHA 3TBKA 3VDQA 3Q12A 3O8BA 4YPVA 1WP9A 3TLJA 1Z3IX 2C2GA 2H92A 1P1KA 3I58A 2Q7XA 2ECPA 4LXHA 4MKRA 4TMWA 4W99A 5IBPA 4CQJA 3LZDA 4Q34A 2OHHA 1AQUA 1KPGA 2PL9A 2YNMD 3KLPX 4WZBA 4BAUA 4FMDB 1LDYA 1RQGA 2C00A 3OA2A 5FB3A 3D7MA 1Y4ZA 5EXXA 4BYGA 2H4ZA 3RC9A 1C9DB 1NHWA 3DTVA 3SZRA 4NNOA 4XDHA 1F8YA 1EA5A 2DUNA 4DBLC 1ZM4A 4XWWA 3U56A 4TM8A 3U40A 1C7FA 5KYYA 1F7UA 4ARVA 5EP2A 3M9WA 2AG0A 3QXGA 4MW9A 2EBFX 3UEOA 1WCIB 1R7RA 2EARA 3I12A 4P80A 3TFOA 4JMLA 3UICA 3IR6A 2LW7A 1X19A 3EEIA 3F1LA 1QHGA 1R9NA 2QTZA 1PL6A 3E3MA 3JD0A 4U7FA 3ND6A 1UDAA 3CVOA 1BCSA 1U0FA 2DETA 1QHIA 3L6RA 2EZ4A 2CJWB 4KDRA 4QU0A 1PW7A 4ZTBA 1XAHA 4IMRA 4U9HS 3WLOA 3KB1A 5P21A 5EIEA 5LM3A 3N0RA 1UBSB 3CU5A 1GCUA 1A82A 4GI5A 4O2AB 4CIWA 1MJFA 4R69A 3TZCA 2FZWA 3FPGA 2RH8A 2GM5A 2YMLA 3R9XA 4XWYA 1Q1AA 2OGZA 2Q3FA 2BKAA 4HNQA 3EPKA 1XF1A 5MDHA 5BMVB 2HHLA 1PR4A 3HH8A 3CZQA 3D3NA 3MA0A 3QGMA 4M37A 4OXKA 1GUZA 3GXOA 3L6OO 3NIWA 4RJIA 4J6FA 4EG8A 1PDWA 4FWBA 5GGYA 3AOEC 5CVEA 1F2UA 1GG8A 3TR6A 2PIAA 2YFQA 5K5EA 1CZHA 4ND8A 5LMNB 8MHTA 4P92A 4PIVA 4BNNA 5DTMA 3CGGA 1YMVA 1F14A 1YI8A 2D1SA 2P3SA 3LL7A 1WSAA 2QUJA 5K9ZA 3WGYA 4BHTA 1XTRA 3MRTA 3NH6A 4ZO6A 5E4FA 4YRPA 3GLQA 2FAXA 2ZB7A 2LDBA 2G07A 2P0YA 2B1GA 2HBQA 4K8OA 1C1DB 4PO8A 4UHEA 1C9JA 1KSHA 1UJNA 1SA0A 3E1GA 3F9RA 2EGUA 2V7EA 3L5KA 1Z07A 1S2DA 2GN8A 3IV7A 1TCVA 3EDMA 4S1NA 4EKGA 3F6YA 3EB9A 5AKHA 2QJTA 1E59A 4GOJA 4C2BA 1O94D 5DASA 1L5RA 4GICA 5BRNA 3W3AD 1MH9A 3DBOB 2W2OA 3WJ2A 4BZWA 3KR9A 1UWCA 1VHJA 2CE2X 3BAZA 3D3KA 3NHZA 3RAEC 5F77A 3B7WA 1N3YA 4E3ZA 4K0KB 3DFZA 1JBQA 5I9LA 1JZTA 1DKLA 1MAWA 4RGYA 3HCOA 2IH5A 2VLBA 4BNFA 4MJ7A 3CSSA 3NM4A 3Q4GA 1H2ZA 4ZQIA 3WGOA 5E6SA 9ABPA 2AOUB 4AUMA 3STUA 2OCXA 3EH2A 3F6EX 2DJIA 2FOXA 1Q7EA 5A6SB 4EB6A 4F1JA 4DR4B 2FA9A 2HREA 3L82B 4LQCA 4AYWA 2EG5A 3PD7A 4LW8A 1SXGA 3VHLB 5IVPA 5LC1A 4B6OA 2ZCJA 3R7LA 3FLBA 3A2LA 3IKLA 3TPCA 3V2GA 3F1KA 3I1FA 3ESRA 1M0TA 3LXRA 1OLXB 5AI6A 2VBIA 2LXNA 1CVRA 2FQWA 4MJ3A 1JA9A 5HCNA 1RKQA 3TKLA 2N1MA 4C6TA 3EPJA 1JQBA 1E8MA 3PUVA 3ZHBA 2IY8A 4JX8A 3GO4A 2HRBA 2IWRA 3TINA 4OLFA 4EOGA 5FBVB 4N0EA 2IVZA 5LA6B 2IP2A 1G2OA 2V4UA