3QM1A

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with ethylferulate, form ii
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl esterase
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
source organism Lactobacillus johnsonii
molecule tags Hydrolase
total genus 91
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qm1A00
5CBKA 3WK6A 5AH0A 1P0IA 3WJ1A 4U2FA 4IH1A 2XQGA 4CFSA 2CBGA 4K5QA 3UUFA 4WJLA 1SFRA 4AQDA 3VVLA 1ISPA 1RWQA 2IIVA 4G5XA 1LNSA 2WTMA 5AOBA 1K6EA 2V97A 3VJMA 2X76A 1CUFA 5FUMA 2BGRA 4UHCA 5I7UA 2XLCA 1J2EA 2JGJA 3F97A 1BCRA 4LYDA 3VJKA 4H7JA 2QOEA 3PF9A 4G4JA 1JU3A 2HA5A 5EGNA 4A5SA 4FHZA 5CH5A 5FRDA 2B9VA 4UBOA 2G5PA 3AILA 3C5WP 4ETWA 2HADA 1O6FA 1VZ2A 3WWEA 2BCEA 5JD5A 2HL6A 2LIPA 2WIGA 1E89A 1QE3A 2OGTA 4HVTA 4W1RA 1WB4A 1DT5A 3OPMA 4GW3A 1S8OA 5ALTA 1Q0RA 4FBLA 5ALQA 1GXSA 3HZOA 1IUOA 1CUHA 4X95A 4V2IA 3AIMA 1QGED 4B9AA 2PSFA 3AUKA 1QIFA 5JASA 4JUIA 1EDDA 5HF8A 1AGYA 1XLVA 5EHZA 1JFRA 5AI4A 3DLTA 1IUNA 3ZPXA 5H3HA 2DQZA 5DNUA 5LZ8A 5LZ4A 2OQVA 2ES4A 1GKLA 3WJ2A 3C8HA 2VAVA 1XQVA 2WILA 4BYMA 1CUCA 3I2KA 1CQWA 3T4UA 3IUQA 1EB8A 4C4YA 1CUZA 1ACLA 4Y2YA 5IH7A 1DX6A 2ORYA 5J3JA 3G02A 1UOOA 4CIBA 1ODSA 5HZGA 2WUDA 2HM7A 3DOIA 3DYIA 4PV7A 3C43A 4TGLA 4U2BA 5JZ9A 2AJ8A 4Y2UA 1TCAA 1AZWA 2WFLB 3BL8A 3FNBA 2XQIA 1R3DA 3STTA 4Q3OA 4Q3LA 5FP0A 3QVMA 2PU7A 5ALXA 1WHSA 4M0MA 3O9VA 2AXEA 3WIBA 3LS2A 4H35A 4G8CA 4WDQA 1CUVA 1G42A 1FFCA 3U1TA 4MWSA 4Z49A 4B7ZA 1GKKA 1PFQA 4H18A 1EX9A 5BOVA 1MX5A 3OTQA 5BWBA 2DHEA 1TRHA 2V9ZA 3R3ZA 1K5PA 3A2NA 4Q1VA 1X70A 1BROA 1B6GA 4C4XA 1L7RA 1CUYA 2VA9A 4EHBA 4BTVA 4J0DA 1H23A 3WKAA 5DLPA 4Q82A 5JZSA 1GPKA 4XIIA 5AI5A 2DFPA 5D3KA 5DTJA 4BTLA 3NWOA 3LLCA 1CUIA 3E3AA 1TCBA 2WSLA 5ALRA 5EHXA 4WY5A 3HLKA 4FLFA 2XMCA 2X8BA 1J07A 1QIKA 2FX5A 2H7XA 4U2DA 4KYVA 4B84A 1LZKA 1CUDA 4ZGBA 3VVMA 2XE4A 3DYVA 3D2AA 4W63A 4BVKA 2RIPA 2PUHA 1XZIA 5C8ZA 3IUJA 3MUOA 3R41A 2K2QB 4DMKA 4XJVA 1XQYA 5HQ3A 5ALDA 4H7IA 3QMMA 3R40A 4BVJA 1QIMA 3HI4A 2XMZA 2VATA 3I2GA 1H22A 4B9EA 4FBMA 3I6MA 5AKJA 2DCMA 3F98A 3DL7A 1LZLA 3G9ZA 1CIJA 2ECFA 1DQZA 3G0CA 1C4XA 4BC1A 1O6GA 4WFIA 1THGA 1DWPA 3D2BA 4FNGA 3WK7A 1QIJA 2VT6A 5LKRA 3QITA 3WKEA 2GBIA 5BWCA 5AM4A 4KEAA 2WHPB 2WIKA 1MO2A 4KE7A 3TRDA 4DSAA 1KU6A 2QM0A 2WJ4A 4MEBA 1CVLA 2J3DA 3STWA 1THTA 5F4ZA 3IUMA 4BDTA 4ZWNA 5ALSA 4G4IA 1HPLA 2I03A 1H2ZA 4PSUA 5E4TA 1EA5A 1EINA 1LPPA 3ESBA 3KWFA 3G7NA 3MGAA 4O08A 1L7AA 1ZI8A 1F8UA 3I1IA 4IH4A 3FYTA 1LPBB 4DM7A 1Z68A 3DCNA 3BXPA 1BN7A 3GZJA 4FMPA 2RONA 3JW8A 4QNNA 3I2FA 5JD4A 1R4ZA 4RNCA 3ZWQA 4U2GA 5ALMA 1R1DA 3FLAA 2QS9A 5A7HA 4F60A 4F5ZA 3IA2A 1JT2A 4X92A 1XLWA 4X00A 2VQ6A 4OUKX 5LP1A 4UFOA 1YS1X 4PSCA 2GZSA 4H7FA 1QIIA 5HKAA 3G0GA 4DIUA 4E15A 3IIIA 4FFVA 4W1PA 3ZLUA 1G5FA 4L3WA 4YASA 4EY5A 2D5LA 3AIOA 4C6HA 1TKRA 1XZGA 4B82A 4H0CA 3H19A 4GEGA 2PSHA 4P08A 1OILA 2WM2A 4RGYA 2BKLA 5FLKA 2PPLA 1XKLA 4DNPA 2HA6A 5K3BA 4EZIA 1A8QA 1HL7A 3X3HA 5CT5A 3WLAA 4FDMA 3C45A 5LKAA 2J4FA 4KRXA 2PSJA 1IMJA 4Y2JA 2Y6UA 4RE5A 4RPCA 3DDUA 3QPCA 4X93A 4OYYA 2G63A 2OG1A 4QDUA 2JGFA 4DNQA 1DWQA 5K5EA 4BCCA 4A16A 2OLEA 1T2NA 2WG1A 1LPAB 5AK4A 1EH5A 3W9UA 3E0XA 3H18A 4IHAA 4QDTA 1VA5A 1W1IA 1E5TA 2QRUA 2B61A 4ZRDA 1EHYA 1BE0A 2XMDA 1VOTA 2C58A 1EXWA 1WB6A 3ESAA 4B0OA 1XFDA 3U0VA 1CPYA 3LIPA 2HRRA 1VZ3A 4G4GA 1T4MA 2BGNA 2ROQA 2QUBA 2ZJ7A 1GZ7A 1KEZA 1G66A 3EF3A 4BVLA 1XZLA 2XDWA 1R9NA 1MTZA 2QXTA 1CUAA 4EY7A 3M3DA 4QDXA 1BU8A 3QPDA 3WZLA 2VF2A 1CV2A 5ALLA 1UKBA 1FJ2A 2GYUA 5AKXA 3V1LA 3HEAA 3ESCA 3BDVA 5IKXA 3FCXA 2CZQA 1TQHA 2OCGA 1FFDA 4D9JA 3T52A 2WJ6A 3WWOA 2HA4A 5ALNA 4KE6A 3WL5A 3KOOA 3NGMA 3C6ZA 3GA7A 3BF8A 3WKBA 1ZD4A 5HF5A 1CUWA 2HA0A 1QTRA 5CTAA 3AZOA 1Q84A 1ZIXA 2NW6A 1N5RA 4LHEA 4X71A 4X85A 4BCDA 4J0CA 2WHQA 5LZ7A 4UUQA 4BC0A 3LP5A 3DD5A 1WPRA 5CT4A 1LPOA 1ODTC 3IUNA 5AKEA 1JMKC 2JGKA 3ED1A 1UKCA 2WU4A 1BCSA 1YS2X 4Y2XA 4ZV9A 4DMCA 2QMQA 4QA9A 3IDAA 3VISA 1XZEA 4HS9A 4UBLA 4IQ4A 1HKHA 2BUCA 3PUHA 1QIGA 3PFCA 3KWJA 4CI9A 2W6CX 3I6YA 5A62A 3IVMA 3EQ7A 3CN9A 2CKMA 3KSRA 5HKBA 2FJPA 4HRYA 4BAZA 3SWWA 5ISMA 5D3ZA 3YASA 1ORVA 5I9IA 5JADA 1XRLA 4P93A 2J4CA 3E4DA 1HQDA 1WM1A 5T4FA 3AJAA 2PL5A 3FCYA 2WKWA 1MN6A 3WYNA 3QBJA 1A8SA 1BS9A 5ALWA 1UK7A 4UBJA 5CXUA 3IB3A 2Z5GA 4DSZA 4CG1A 2YXPX 2WIDA 2HDWA 3PICA 1XZDA 3TGLA 3D2CA 1K8QA 2HA3A 2X5XA 3I2JA 2XMRA 4UHDA 4QEKA 5ALGA 2WG0A 4DYHA 2DR0A 3F8SA 4K6GA 5CT8A 1CEXA 1YA4A 1LLFA 5A7GA 5T4BA 4OU5A 4H7HA 3I2IA 2GYVA 3C8DA 1XKTA 5E4YA 2JEZA 1GGVA 1MX1A 5BV7A 4KACA 1E66A 3WKCA 4JYPA 1CLEA 3BWXA 2B4KA 4XVCA 3PDCA 1CUXA 2FUKA 3WKDA 5T4EA 2H7YA 2UZ0A 2R8BA 3H2IA 3H17A 2ACEA 5SYNA 1YAHA 3W04A 5A7FA 5I8PA 3FSGA 5FV4A 3VKFA 5LZ2A 1U8EA 2HA7A 3O4IA 4ZI5A 3R3YA 4FFWA 4BE9A 1N5MA 1AURA 1UOQA 4N8DA 1YB6A 3D0KA 5FDFA 5ALHA 3HSSA 4OB6A 4EBBA 4K6KA 5DYTA 4HXEB 4X97A 2WUGA 1EK1A 5HF9A 2ZYIA 2VJCA 2XUKA 1ZOIA 3K9BA 4ARAA 3VJLA 4U2EA 1LBSA 2Z8XA 3C87A 4QWMA 4EA6A 3HXKA 1ZICA 5A6VA 2P8SA 4LYEA 2HU7A 1E3QA 2Y2VA 3M81A 2B20A 1CUBA 2VSQA 2O7VA 1GQSA 1NU6A 4C4ZA 1TIBA 5JAPA 4P92A 2ACKA 2XMGA 5K3CA 3FYUA 1QIHA 3JYHA 5EHNA 3FWHA 1CUEA 3QH4A 4S0XA 5ALFA 3OG9A 1QFMA 1JJIA 4H7EA 5LLSA 5K3FA 1ZGCA 5AKLA 4M0EA 4GI1A 5DNWA 1VKHA 3FVTA 3DJYA 2O2HA 4EY6A 5FKJA 5K3DA 3GFFA 5JZBA 2XUOA 1C7JA 1J1IA 5AKZA 4GECA 5DNVA 2HHAA 3IURA 2Z8ZA 4X90A 1GQRA 2WQZA 4OU4A 2C5FA 3H0CA 1XROA 2D0DA 5JYCA 2XUHA 4AO6A 5AM2A 2PM8A 2RHWA 1EVQA 1EB9A 2XUQA 2PSDA 2RI6A 2V96A 3M82A 1X2EA 5C7YA 4C89A 1NX9A 1M33A 5EFZA 1ZI9A 1I6WA 4BRSA 4X6UA 3DKKA 2XUFA 1XZBA 2C5GA 4E46A 1ZI6A 4X6YA 2Q0XA 2CB9A 1B41A 1XRMA 4Y2TA 4PQEA 2DHDA 4BRZA 1C7IA 1CR6A 3ICWA 3PE6A 2HU5A 1KU0A 5AKGA 3WZMA 7YASA 5JATA 4ZV7A 3RK4A 4NMWA 5DJ5A 3O4GA 4JEIA 1WCYA 5LYYA 3R3VA 2XT0A 4X7BA 3MVEA 2HFJA 2XQJA 3W2TA 3DOHA 3WA7A 3RM3A 3WL7A 2AJLI 3D7RA 2JBWA 3CN7A 2BUBA 2VEOA 1JJFA 6YASA 2GZRA 4JNCA 4J0KA 1MT3A 2XB6A 3C6BA 2C0QA 3C70A 1XRQA 4WCVA 3V1KA 4CCYA 2JF0A 3F9CA 1U65A 2XQFA 1L7QA 3LIIA 1XZCA 1USWA 3IULA 5DTIA 5LZ9A 1SCKA 5ALJA 4Q3KA 5FPPA 3RKSA 3B5EA 5HK9A 2PBLA 2QUAA 4AN0A 2PVSA 4NS4A 1MJ5A 4GXNA 3R3WA 2W22A 3S2ZA 5K3EA 2Z3WA 4BDSA 1N1MA 5K3FB 4J3JA 1XQWA 4WY8A 3GUUA 1DWOA 4U2CA 3EQ8A 4TPKA 4N5IX 4IH9A 1XRPA 2FJ0A 1SCQA 2Y6VA 1DTEA 4Y2SA 5CW2A 4MQMA 1FFAA 4YK7A 4DMFA 2HU8A 2OCLA 3AFIA 1H2WA 4HZGA 4HAIA 1AKNA 4OB8A 1EVEA 3DEAA 1AC5A 3G0BA 1UK8A 1IUPA 2WLSA 3H04A 1VXOA 4W9RA 1DU4A 2ZVDA 5EI5A 5HQ3B 4YPVA 3WIOA 5KWJA 3A2LA 3WA6A 3STXA 2CMFA 5AIAA 1ZD2P 4BP9A 1A88A 3WK4A 2VAXA 2XLBA 4GHWA 4KAFA 3HABA 3BJMA 1JI3A 2RAUA 3Q0TA 3G9UA 5CT9A 5AIBA 2CJPA 3VDXA 5KREA 1GT6A 3E1GA 3WWDA 2GBFA 5CMLA 4BATA 1U4NA 2DHCA 4AO8A 4X94A 1JMYA 2OCIA 5FOQA 3OC0A 1AUOA 4L72A 1XQXA 4CCWA 2ZSHA 4UBNA 4MYDA 4B80A 3L1HA 5IVDA 4LXHA 1YA8A 4A23A 5AKYA 2I3ZA 2IX9A 4XWGA 4K2AA 2VJAA 1ODCA 4WFKA 5JD6A 1A8UA 3H1AA 1FFEA 5AM1A 1P0QA 2DSNA 4I3FA 4UFNA 1E8NA 4HTAA 4CG2A 4WDRA 1XZHA 5ALEA 5AI6A 1ZJ5A 3G0IA 5FXMA 2I3DA 2CUTA 5C8XA 4KE9A 5IVIA 3EQ9A 1XZKA 5HFAA 3ZI7A 3QYJA 4I19A 3WMRA 3FBWA 4KR0A 3PFBA 4UHBA 4LKOA 5C81A 3G9XA 1W6RA 1DQYA 1ACJA 1G4HA 3WL8A 1MPXA 4YX9A 5CXXA 3H2HA 2HIHA 5AO9A 2PU5A 1UOPA 2OQIA 1YB7A 1ZIYA 3BF7A 1W76A 4Y7DA 1LPNA 1PV1A 4OPMA 4C01A 1K4YA 1UXOA 2PX6A 5AM0A 4K6HA 2EEPA 3DL4A 2WFLA 2WTNA 4G8DA 4KE8A 1D07A 2WHRA 4UFPA 4BBZA 5JIBA 4GDMA 4B85A 5SYMA 1MNAA 4TVKA 3O95A 5JARA 4PSDA 5AM3A 5AM5A 3QPAA 3ZV7A 1LPMA 2VJBA 4BZZA 3GELA 3STUA 2C4HA 5CRIA 4KAJA 4HRXA 1HDEA 1Y7IA 3V1MA 1AMNA 2GBGA 3L1IA 5ALYA 2QJRA 1E8DA 5AI0A 1WPXA 1SCIA 3ZLVA 3WK5A 3WWPA 5LZ5A 4DGQA 3ANSA 5E4JA 4FNMA 2XMQA 3K2IA 2XQKA 3FSGD 4J0JA 2V98A 2AJCA 2WIFA 4PW0A 2EDCA 5AKKA 4MYSA 3TEJA 4IO0A 5DYWA 2JGLA 2PKYX 3DQZA 3KD2A 3I1YA 2WJ3A 1VJ5A 2Z3ZA 2OXEA 4BAUA 1W75A 1XZFA 2E3JA 3W06A 1GPNA 4NZZA 2YASA 3FLBA 2HFKA 2AJDA 1OCEA 1YAJA 2XUJA 4L9AA 2JGMA 1W52X 3O4HA 4OYLA 2VT7A 5JAHA 3RLIA 4BZWA 1P0PA 5D7BA 3R3UA 4H77A 1BEZA 4Y2PA 3L1JA 1WHTA 2OAEA 1CRLA 4OSEA 5EIAA 1FSSA 3DS8A 4Q05A 4F21A 3EIOA 3I28A 1F6WA 5JANA 3H1BA 2ZJFA 3BIWA 3D4LA 5K3AA 1A7UA 3QZUA 1YASA 3FOBA 2VTVA 5DYYA 1PJAA 4QWWA 1HBJA 5CT6A 4F0JA 3DNMA 4MEAA 3TJMA 1F0PA 1ZD3A 4M0FA 1Q0ZA 1DINA 3UUEA 1LGYA 2XUAA 2R11A 3N0TA 2WUEA 2WHPA 5T4HA 5A2GA 4ARBA 3SK0A 1R50A 3HYSA 3NOXA 1E8MA 5JALA 2QKYA 4KRYA 4FLMA 3R3XA 3BE8A 5EHQA 2ZYSA 3HJUA 1QIDA 5ALPA 4H7DA 2ZYHA 1Y7HA 1R9MA 2OPHA 2EDAA 5HF6A 3EBLA 4J0HA 1F0NA 3G0DA 3V1NA 1H2YA 1RYYA 4MQLA 1CUJA 3AINA 2OGZA 3F96A 3OOSA 3WK9A 4Y2VA 3QMVA 1JU4A 4GLBA 3F67A 4C88A 2RGUA 3KXPA 3QMWA 5AKHA 3BIXA 4AX4A 2XUDA 4GWLA 3FVRA 2QR5A 4Y9SA 1TAHA 1QTIA 3AZPA 2WIJA 1ETHA 2CEKA 2JGIA 4AZ0A 1UZAA 2HRQA 5AKIA 4BAGA 1IZ7A 1MNQA 3G8YA 1CUGA 1AQLA 1BEEA 2JGEA 1HLGA 4G8BA 4AMZA 3C5VA 4OCZA 1QO9A 2O7RA 1AX9A 4AB1A 3HRHA 3RARA 2BUAA 3OM8A 3STVA 4EY4A 4AXBA 4UHEA 4MWTA 4LXGA 1EDEA 3D59A 5IVKA 2PUJA 3WYDA 1RP1A 1R88A 3AZQA 3ESDA 1CQZA 3DKRA 1QZ3A 2QVBA 2RHTA 1ZGBA 2Y1KA 3BJRA 2XMSA 1Q83A 4CIAA 3GBSA 4UPDA 1UT6A 1VE6A 2BJHA 5HK8A 4J0IA 5FPQA 1ORWA 5AI9A 2QT9A 4FTWA 5YASA 2YYSA 4FOLA 2QTBA 5HFNA 1MU0A 3QM1A 4N8EA 3BDIA 4J03A 1UKAA 4KAAA 2WFMA 4LIPD 5EIEA 4G9EA 1XZAA 4WFJA 1XZMA 1FFBA 5DWDA 5ALKA 1ZD5A 2G4LA 3M83A 1MAHA 2WU3A 3V48A 4EUSA 2ONCA 2ZJ6A 4PNZA 4Q34A 2WFZA 3PF8A 4JYMA 5AP9A 1EI9A 1UK6A 2JIDA 5AK6A 4DLNA 3PUIA 4UBMA 5CURA 1K63A 2H9YA 4J0GA 1QJ4A 4G1FA 4X6XA 4QZVA 5KBYA 4QDZA 3H2GA 2GYWA 1QFSA 4ROTA 4DNOA 3H2KA 2XUGA 2ZSIA 1GPLA 4NVRA 3B12A 5AICA 1ZJ4A 4OD0A 3G9TA 4DNFA 2GBCA 5JAOA 3WQHA 4JH0A 3JWEA 3ICVA 4MJ3A 1VA4A 3ZLTA 4ZREA 5KWIA 1BN6A 1U2EA 1JJBA 1XZJA 4C87A 3CCBA 3WI7A 1EK2A 2OGSA 1UFOA 2XI4A 4Y2RA 4FLEA 5AJHA 5JAUA 2H7CA 4N8SA 1WOMA 1IVYA 4BE4A 1TK3A 2BFNA 3CXUA 1YCDA 1VXRA 3C6YA 3B3QA 2XMBA 3FYUB 2G5TA 3D3NA 1NU8A 3O9MA 1UK9A 2PSEA 4LXIA 2Y2UA 3K6KA 2I78A 4PO3X 5ALVA 3HACA 2OCKA 1J06A 4EY8A 1VLQA 1W4LA 4E11A 5IVHA 3SC2A 3LCRA 3P2MA 5ALUA 4B6GA 5AK3A 4BB0A 2VJDA 1EDBA 4AN1A 4RE6A 3WWCA 4AMYA 2DQYA 4G9GA 3FYUC 3W05A 5LIPA 1YSCA 1LBTA 1DX4A 4UHFA 5C8VA 4OB7A 4DTCA 5CH3A 3ILSA 5HCUA 5ALZA 4B0PA 3I6ZA 3FLEA 3N2ZB 3A6ZA 1LPSA 2QZPA 5D6OA 1IZ8A 5ESRA 1DT3A 4HXGA 5CH8A 2C0PA 1CFJA 4J7AA 5AI8A 3A2MA 2O2IA 4X3CA 1QOZA 3PI6A 4L0CA 4MXDA 2ZYRA 3C6XA 2JEYA 4QLAA 3R0VA 3FAKA 5AOAA 5A71A 4HXFB 4BP8A 5EIHA 5E2IA 1MAAA 2C7BA 4AZ3A 3STYA 1QO7A 4QLOA 4I4CA 1H2XA 1TCCA 3V9AA 2WUFA 2QJWA 4ITVA 3SX4A 3S8YA 4B83A 1CUSA 1WB5A 4GBGA 1QIEA 4W1QA 5AK5A 4FWBA 4PF1A 4CG3A 1QONA 3HC7A 1X2BA 2IITA 4DMHA 2XUPA 3WK8A 5AHXA 5ALOA 2O2GA 2QXUA 2OAGA 1SOMA 4N5HX 3O4JA 4XX1A 2HA2A 4H7KA 3MUNA 3GROA 1MX9A 1QLWA 4AO7A 4FKBA 4BCBA 1OXMA 2AJBA 3NUZA 1N8SA 4CCYB 2YH2A 1SC9A 4QE3A 3WL6A 3AIKA 5ALIA 1XRRA 2XUIA 3OURA 3IBTA 4P9NA 4UBKA 1P0MA 4EB0A 3H2JA 3CCCA 3KDAA 3ANTA 4X91A 3O0DA 2BAGA 1UWCA 3Q8WA 2WG2A 1BRTA 3A70A 2J3QA 1XLUA 3UMJA 4E14A 4Y2QA 4ZXFA 1JKMA 2H1IA 1Y37A 3VXKA 3W9BA 4UBIA 4INZA 4B81A 4QDOA 1YR2A 4KJXA 1XRNA 3I2HA 5AOCA 3D5EA 4UHHA 4W1SA 1VE7A 1CUUA
chains in the Genus database with same CATH superfamily
2R9VA 3WK6A 2ZRLA 3LKZA 5AH0A 4EB6B 4DV3B 1M0WA 2A9KA 1D04A 3NV7A 2GVNA 4OVKA 5JCZA 1R15A 3IP8A 1M2NA 2CBGA 1EFCA 3PZBA 4K5QA 3S4YA 1UADA 4HTFB 4MWBA 3EZ9A 5F9MA 1U0BB 2CNKA 2QVXX 2WJZB 1EZ1A 1GRRA 4WJLA 4AQDA 2FR0A 3QTBA 3N7UA 5KTTA 2QW8A 1LQTA 1RWQA 4G5XA 4XKJA 5KAPA 1U1IA 3Q8MA 1RLTA 3GEEA 4IILA 3FI9A 3N58A 2G06A 2IV2X 3TF5A 5AOBA 1ZCAA 3ORFA 4XLTA 2BWJA 4MA4A 3GLHE 1FXSA 2HT1A 3VNSA 1EUQA 1XEXA 2BGRA 3NYIA 4PXYA 4UHCA 5BRAA 4I9UA 1Q74A 1P17A 1MJGA 2B83A 2ILVA 3VDRA 4RUKA 5C51B 1ES9A 4GD3Q 1E1QA 3A1UA 1QQTA 3TLKA 4F2GA 4DIOA 2H2DA 1NVWQ 2FN3A 4HWSA 4BNDA 5IG2A 3EXEB 2HCJB 3DT8A 1OFVA 4G4JA 3DWFA 1B0AA 1L5HA 3M5DA 4P0QB 1DIHA 4FQ8A 3P2EA 4AJIA 4OX9Y 2RAPA 2P3OA 3OFNA 5EGNA 3T3DA 2ZI9A 4FHZA 5BVHB 3THYB 3LO8A 5FRDA 3KU1A 2B9VA 4M37A 2NSJA 2V65A 4ETWA 4BNHA 3NEAA 4LWZA 2WPDA 4XD2A 3CZQA 1O6FA 4UTVA 1NI5A 1YH3A 4I81A 2C61A 1QDUA 1BMFA 3WWEA 1QK5A 5IYZB 4YRGA 2W48A 4C76A 1JTVA 1HQYE 1OBCA 4K6CA 1KJZA 3AEKB 5A6SB 3DLHA 1UUFA 1QE3A 4L5BA 4PLCA 2I9KA 1MH9A 4GOMD 5C8DA 3BVPA 1DT5A 3ZLBA 2RJOA 4MYTA 4OXIA 1TTHA 1N3YA 3ELYA 1S8OA 3GQBB 1Z0DA 2ZRKA 3KIPA 1UAGA 2QD4A 3OE7A 4FBLA 3HZOA 4PZPA 3SQLA 1CUHA 3OCZA 4S1WA 4D3ZA 4V2IA 4WESA 1AIPA 3EB9A 5TQVA 1YDEA 2EWWA 1QGED 2J7PD 3TUJC 2IDZA 4B9AA 5C7IO 1K7XB 2PSFA 3BKWA 3WLRA 2CDRA 3GFVA 4PYMA 4YCAA 1T5LA 2X6RA 3OJEA 4MUMA 2ZSBA 1NC1A 5BPFA 5THQA 3BM5A 5EHZA 2G28A 4JIMA 3LRPA 4HBGA 6REQB 3TOCA 4JSYA 9ATCA 4LNAA 3GN2A 2C5EA 3FYHA 1XMSA 4RFVA 4YP6A 1CEEA 1IN1A 1S01A 2K7ZA 2NNLD 1YUNA 4EYEA 1N6LA 5AHWA 4FINA 1IY0A 2AUTA 1GV0A 1FY2A 3LVRE 1FUUA 4XRGA 1SCUB 5ANRB 2CNOA 5DNUA 3F3YA 4CXMA 4KQFA 4YLEA 3ANYB 5LU9A 2ES4A 3M4YA 4RHTA 4A27A 2P4HX 3IX7A 3ORRA 1HE2A 1QJCA 5ENZA 1RJFA 4O3FA 4FFSA 3Q8LA 2DEUA 4GKAA 3V6MA 3KSZO 1YFKA 2MT9A 4RKQA 4UEWA 3TLGB 5K01A 1A72A 4BYMA 3FNIA 3I2KA 4KXNA 3OU2A 1ZX1A 3D54D 3HR4A 3ASYA 4GGMX 2FB9A 4PYRA 3MINB 2DY0A 5P8WA 3IO5A 5D5PA 4JJZA 2C5BA 4WADA 3B7PA 5TJHA 4K05A 4DA0A 5JYDA 1ZM4A 1YZLA 2WF7A 3FNEA 1O57A 2PMWB 2ZYGA 4EZBA 4G0VA 1KS2A 2JAOA 5BORA 5IH7A 1RWPA 5IN5A 1DX6A 1E2HA 2I3GA 5B2FA 4UCQA 4LV6A 2UUBB 1Z5VA 4C5CA 1LS1A 2HLHA 3E5MA 1BE8A 3AHDA 1G8KA 3PSAA 1A1VA 5FBVB 3KJFA 3IMEA 1K7CA 1E3EA 3LKDA 4EHAA 1U2TA 3E2IA 2EX0A 2NUAA 3NBMA 5HZGA 1SKMA 4NABA 1O6BA 4W4TA 1T2VA 2FWAA 1N6KA 4X3PA 3HFGA 3S2UA 2NTNA 3M6XA 1LC0A 3P9NA 4B3FX 4IHJA 3FFAA 1IHPA 1EE9A 3C43A 3PDHA 1V43A 4PV7A 4ZAFA 1NJFA 4U2BA 4FFBB 2ZP1A 1R6VA 4ZT3A 3JQ7A 3TLMA 5AVYA 5JZ9A 4IINA 4RPIA 4UHKA 2PKEA 4V1CA 4AKGA 3PXEA 2LUOA 4G1MB 3ACCA 1KZ4A 2B0JA 4X3OA 4YP7A 4DV7B 2A7XA 1I4WA 1P9RA 4E2XA 4CUZA 4DWVA 2UDPA 2WFLB 1ZH6A 2PCJA 2HT6A 2GERA 3FNBA 3R4VA 4EJMA 1QNFA 3AOEC 3LPLA 4A4DA 3MFQA 1NBMA 1A82A 3I23A 3LL7A 5FL7D 1FB5A 4B2IA 3QVMA 2VWHA 2VSFA 1WHSA 2W2LD 1AV7A 1Z75A 3H9EO 4RENA 2PWYA 1Z2CA 4MW1A 3HCAA 3ZE0B 3DZGA 2NVOA 3VR1A 4HZUA 3JD4A 3T4PA 5F76A 3QPVA 3VPDA 4Z4GA 1YI8A 3LDHA 3W3AA 2KSQA 4RJ2A 1WUHS 2GPWA 3QBEA 1ZMRA 1CUVA 4CM3A 4NULA 3UBTA 3UCEA 3V4RA 2QAGA 4MWSA 3Q1KA 1VP9A 3NI2A 3UAWA 4AZWA 2J7PA 3JVDA 3IAS1 5E7JA 5FA8A 2RGEA 3N8DA 5DMHA 1KZHA 3G8CA 4EI8A 1KRWA 2C98A 1II9A 3MWLA 1PFQA 1XVVA 2QL9A 4H18A 4RHCA 3WRYA 1EX9A 1K88A 2B4TO 2K4MA 4WSOA 5BOVA 5HOEA 1APBA 1FMCA 1MGPA 5BWBA 2EBWA 4DRXA 4RMNA 2B8WA 4URXR 5C5IA 1KPHA 3DW1X 3DPUA 3CXRA 4IIBA 5DM70 4DPLA 5JCPA 1T4DA 1JQLB 2QLFA 2R3SA 2I7VA 2NVUB 3JQBC 4KTVE 4ID3A 1P5FA 3K73O 2ZCUA 4HDKA 1YR3A 1X13A 3H1EA 5CG1A 1AUXA 1MO3A 3MWFA 3HN2A 2FUCA 2XBUA 3VPGA 3T3PB 4ZOQI 1W85A 5L7TA 3RAFC 1HV8A 13PKA 5BUCA 1L7RA 1HLPA 4IOLA 1CUYA 2BISA 2VA9A 3BXOA 2FFRA 1KI6B 1PJ2A 3M6AA 3OZCA 3QU4A 1OE0A 2ZRCA 3Q40A 3JWGA 3HYNA 4RPHA 3UG6A 1JH9A 5TIIA 3ER8A 4F1JA 4Q82A 3NXKA 5JZSA 1O4WA 3TQSA 3FYCA 5LDHA 4ITRC 1DAIA 2FPIA 1MB4A 2X4GA 4NAVA 4RHFA 4HEQA 1XEXB 4XIIA 2DFPA 2HNBA 4HATA 4J7UA 5CCEA 1VE5A 3PC3A 3WHLA 3NWOA 5BQ3A 5C34B 3OCCA 2PX8A 2HX1A 4GSYA 3E3AA 4CMKA 5LQNA 3VAZA 4XD7A 5FOUA 3BTVA 2M6SA 2J5RA 1U02A 1Q1QA 1ZCZA 4FC6A 3TKLA 2XMCA 2E55A 1W88A 3R6DA 2IDJA 3KYDA 4RJKA 3PYXA 5G0WA 3P8ZA 5EPEA 1J0CA 3L4BC 4WN9B 2I76A 2QRMA 4BVBA 2JAUA 1P19A 3RG2A 3WRXC 4RWZA 4UUMA 1ZKDA 4GPEA 2J9FA 1N2CE 3BK7A 1CHDA 3F6RA 3R5JA 4D0NA 3IAEA 3E5RA 1W4ZA 3WNCA 4M9RA 4BVKA 1E0KA 2PUHA 1U2PA 4MWEA 4LTDA 4ZCPA 3ROGA 1A8PA 2WYUA 5BT9A 2I6XA 5C8ZA 4HX2A 2AMLA 4PC2A 1Q92A 3KKMA 4M8NE 4IF6A 4O63O 1A9ZA 3CX3A 1BWPA 1HO3A 4DZTA 3BCHA 1H4TA 1WHTB 1VL2A 2CBZA 3AUUA 5FI1B 1GPBA 4FYYA 4U6NA 3FR8A 5HYVA 5JEEA 4DW8A 3TW8B 2MDTA 2IU0A 2VDLB 3NWJA 4G97A 1SJ9A 3QLUC 2G1PA 1P75A 5E95A 5JXWA 3CZPA 1IIBA 1LEHA 1JSXA 4CUKA 1JQ5A 2GXAA 3BE4A 3AG6A 1IY9A 3X1ZA 1PD0A 2O8DB 4DIDA 1N6PA 3HI4A 4IIHA 3RTCA 4C7VA 1ZOOA 3CCFA 3MN1A 3SOZA 4EYGA 3QGMA 5DXJA 1LC3A 1T0BA 3I2GA 4TLCA 1NBWB 3HGMA 3COWA 3AEXA 3V1UA 2AFIE 3O9ZA 2V7BA 4B9EA 1Z2EA 1UBUS 1L5YA 2AWNA 4UDXX 1KAHA 4ETMA 1KMIY 4TV8F 4QTYA 1RSZA 2AEEA 3KOWA 5AKJA 2DCMA 1UEXC 3DL7A 2LNDA 3EG5A 1BGVA 1T36B 4MUIA 1S4QA 5K0GA 3OQIB 2FMXA 2ECFA 4R69A 3HL4A 2WICA 5D86A 1DQZA 3DDWA 3RC7A 2I62A 4HAOA 4LX8A 1YE8A 4UOEA 2HF9A 2YOHA 3OP1A 1UBKS 1HK7A 1U8YA 1WCIA 1VRVA 3G0CA 4B3RB 2QTGA 4TTQA 4TTVA 3IUSA 4AFNA 1THGA 2ZEJA 5EQJB 5CA1F 2QR3A 3D2BA 4LCBA 2E82A 3AQ4A 4B74A 4CM4B 4Q4HB 3ND5A 4ZVKA 1SVKA 3WKEA 5LKRA 2YRFA 4JBGA 1YIAA 4YIKA 1ENZA 3LXMA 3LXRA 4LGYA 2A9JA 3DL2A 2WHPB 4RTOA 1KAGA 3P71T 1X0XA 2V7WA 3ESQA 3H3JA 3OIWA 5JFTA 2QM0A 1SBHA 1USVA 4L0QA 1Z5UA 1CVLA 5I4CA 1Y80A 1Z8HA 5JNUA 3OI7A 3STWA 3GIWA 4BNMA 2Y1OA 2Y1CA 3NIWA 3Q10A 4H3HB 1GZ5A 4RVDA 3RUHA 3ZGXA 5EMNA 3IUMA 3IT0A 4RK5A 4BQNA 1XRJA 1RC8A 2B1RA 3CEPB 5ALSA 4IIFA 1Z34A 3L7IA 2EWVA 2BFBB 3MCVA 4MVJG 2I03A 2Z1NA 3H4MA 1OBHA 1TA0A 3I9V6 1LF0A 4QQFA 5E4TA 1EINA 4DWJA 1M9NA 1WE2A 3AF4A 4TQUS 5TR9A 1ZOLA 3VR0A 1NVUQ 4A0GA 4DUPA 4W5QA 1KAOA 3G7NA 3CH7A 4MS1A 3BHJA 4LC0A 1PR0A 4YJFB 5AVJA 4MQBA 1T3SA 1P1HA 4B75A 5BSMA 4BV8A 2X58A 3MZ0A 4UVGA 3AESB 1KYWA 4D74A 1KYXA 3P94A 3KUUA 4KBGA 5BXYA 3GAZA 1N2CB 3D8BA 1DLJA 3OJLA 1PVDA 1ZR2A 3QI2A 1LPBB 3TYXA 1FTQA 4PS1A 5CA0F 5EIWA 4NFLA 4OI4A 2FFAA 1PT6A 4PEVA 4V3CA 4JQOA 4BLQA 4PFJA 1E5QA 2Q9BA 2Q0SA 2HC9A 3AUJB 2RMKA 4AMBA 4YJGA 5EC8A 4BWGA 2WY2D 4WJKB 4HZUB 4TYWA 4WKNA 3LNCA 2J09A 4YMIA 1OY1A 3ZWQA 4GQIA 1KOFA 3I8XA 3I01A 1GTJ1 2PGJA 3EEBA 4PLFA 2AKYA 4BB6A 5C7OO 2KBEA 4R81A 1NVVR 4GPBA 1RWBA 4ZZ2A 4EVSA 5JH7A 5LC1A 4ER5A 3FLAA 1FRZA 1DX9A 4PHTA 4RU1A 4CNBA 5K2OA 2ZPAA 4RZXA 5A7HA 4F60A 3QSYA 2BONA 1CXZA 2FEKA 1EM6A 1H3FA 1OYWA 2IXBA 2V9PA 3LLMA 3ZCTA 3UTDA 1UKYA 3EGWA 4AZ0B 1IUKA 3O2QB 5F7ZA 1J9ZA 2Y8EA 3N8HA 5JNSA 2PQ6A 2WAOA 4JT8A 4KOEC 3I5MA 1XPRA 1XLWA 2POCA 1K5GA 4JLVA 2PS9A 3WJAA 5B30A 2WEKA 3D6NB 4HXYA 1GUBA 2LV8A 3S8EA 2GZSA 3C1TA 3I92A 4H7FA 4N5NA 3W9YA 1EFPB 4GI2A 3M9WA 5GJWC 5AD1A 4DG5A 4QYWA 4MUNA 2IE8A 5KYYB 2C7VA 4QGAA 4DIUA 1PK8A 2PH1A 4FFVA 3EEIA 4N0PA 2ZM5A 3ZCXA 5BV1A 1NLYA 3CJRA 4HNRA 4I1UA 4RV4A 1DOAA 1DRVA 4EHHA 1Q0TA 2MSLA 3F5MA 4JGBA 1W1UA 3AIOA 4WNAB 1Z22A 1Z4QA 5FPHA 1A9PA 3ZWAA 3PS9A 2VP6A 3NB0A 2TMGA 2Q9CA 2XCSB 1MCZA 4J1NA 3PA8A 2MU1A 3I9MA 3OY7A 1LDEA 4FEGA 3L05A 5FBRB 3SS9X 1YRHA 3L8HA 3QKRB 4RQUA 2JIPA 1DC4A 1QFXA 2W2QA 3OO0A 4NH4A 1NXPA 3HB4X 4MR9B 4OIFA 4RGYA 4TV8A 1EKXA 4GWKA 5FLKA 4WN3A 4D8UA 4F38A 3P4YA 1M1YA 1WSWA 3D6AA 3H5VA 1A8QA 1NKVA 4Q1AA 5CR9A 4A0SA 1GPDG 1M8JA 1XEWY 2AEJA 3NV9A 3K8ZA 1PF7E 3KYCB 1DAHA 4FDMA 2WV9A 3HXOA 4WEOA 1EK5A 1ZS9A 3DAYA 1SOAA 5TVKA 3NVKI 1UBMS 2PSJA 4Y2JA 4AYWA 3E9MA 2Y6UA 4EUKA 1G3MA 2IQIA 2RHDA 2G7ZA 3CYFA 4YMSA 3RIYA 3USZA 5CA1A 3DFKA 3AJRA 3HWWA 3EN0A 3K8QA 1S02A 2BFDA 1OXBB 3C3PA 2YFYA 1I5RA 2BM8A 2IC5A 3NKVA 3P0HA 2Q1YA 3Q9UA 5FBZA 1J5XA 1SBZA 2A9RA 2JI4A 1R4NB 2QT1A 1L5VA 3EUEA 4HAVA 2B78A 5A04A 5LLDA 3BE5A 1SXIA 1ILEA 2OG1A 2AZ4A 3CNQS 1LSSA 3PDUA 1FFGA 4QDUA 4RVCA 4BJHB 2YN0A 1JYEA 2E18A 3TZLA 5K5EA 1RQGA 1DJQA 1W0CA 3K0HA 2A92A 2FW1A 4GLFA 2JVJA 4Z4HA 3PNLA 5EJ7A 3WP0A 3ETCA 1NRJB 4JODA 4PO1A 4Y7CA 5K0TA 1JR3E 5EZYF 3E0XA 1IY2A 5E9JA 3RROA 1T24A 4D8XA 1YS4A 4JUAA 4HQFA 2YOFA 4QDTA 3UWKA 1AXRA 1VPDA 4RHXA 1G6HA 2JFOA 1JHUA 2QRUA 2GNAA 3MRTA 4W5RA 3L9WA 4D92A 3MW8A 5AW5A 3OJOA 4LC9A 1E79D 4H1WA 1IFXA 5GJVC 2H48A 2QTVB 1OGIA 2QLBA 3CVUA 1CF9A 1E2FA 5FA5A 4JU9A 4GOND 5FA6A 1HFEL 3T7RA 1EXWA 4I1SA 1RXYA 2O7QA 5CA0A 1JDZA 4BUCA 1YE3A 1C29B 1TEHA 2WJPA 3GPBA 2HHHB 2XZTA 5A5DA 1WCXA 4MRRA 2F6RA 3F6BX 2WSBA 4Z7NB 4TMTA 4JN6B 1N2HA 4GZ3A 2FNAA 5IVKA 2HF7A 2N1MA 1MB3A 3FWYA 4NPHA 4YMLA 2SKCA 2DETA 1M5TA 1B93A 3OKPA 1BS1A 2Q29A 1FNBA 1ZRSA 1R0WA 2AWOA 2Q2NA 1U6IA 2GN0A 2AOTA 2BIFA 3AF3A 1SK9A 1T4MA 1YWGO 1E7SA 1Z6YA 3DKVA 1X7XB 4OTZA 4TXLA 4UU7A 3VSCA 4D99A 4KUGA 2X9LA 3GEMA 1AK2A 1KEZA 2DPMA 1YQGA 3EF3A 3LDFA 1TFUA 3AL2A 1CWUA 4BVLA 1VIMA 1DG3A 4CKCB 1XZLA 3WYEA 3NR2A 1R9NA 5JASA 1OGYA 4KZKA 2I6SA 4RPKA 5KPJA 1CUAA 4LF5B 4URWR 3M3DA 1BU8A 3QPDA 3EF0A 3LRTA 3OZGA 4M2LA 4O2AB 1A71A 2VF2A 3O1HB 1CV2A 4MS1B 1XALA 5JXGA 2DF8A 4XGNA 1RWMA 5AVOA 3ELDA 1I36A 4J0FA 3RVKA 4JA2A 2YFKA 4QJIA 4RULA 4N5LA 2OZVA 2QN9A 2II6A 4IDDA 4R6WA 3RIHA 3V1LA 2X2OA 4X54A 5CPFA 4ZVQA 1YNSA 5EWJB 5IKXA 3FCXA 4KK4A 3LC2O 4M99A 1FFDA 2W9XA 4NBUA 3D43A 4D9JA 2VUTA 1KYQA 2XVMA 4M86A 3WWOA 5DBIA 1UKEA 3EFEA 2IHJA 2UUOA 4KE6A 4HGOA 4U5QA 4F4CA 3EODA 3NGMA 3U4QB 2ZZMA 4TMWA 2H2AA 3U6BA 1DHTA 2J9GA 2X9GA 4HR7A 1S9DA 3BF8A 5JH7B 3UG7A 2MSKA 2WD9A 4HQLA 3MJCA 2IW1A 3C5CA 4QPJC 3X2EA 5CFZA 2JD2A 1CUWA 2HA0A 4LHVA 4OHFA 3LQ2A 2P6RA 2J0SA 1U3FA 1MC4A 4OHVA 3KHTA 3JY6A 1TO6A 2W4QA 4HHEA 4WCFB 3L02A 4X85A 3SEQA 1M7HA 3SDZA 1A9XB 2WHQA 4R3WA 2FLKA 3SR3A 4EMSA 4LNUA 2H8GA 4UUQA 5FOSA 2X13A 3GEIA 4O4LF 3DD5A 1JS1X 4OK5A 1FYXA 1AQUA 3PJGA 1DC6A 4PYLA 4Z99A 3VTFA 3EXAA 4BFSA 4CE6A 1XZNA 4EPWA 1ZC4A 5EJ5A 3PTZA 3F49S 2SHKA 621PA 9ABPA 3GDHA 4GQAA 3U7GA 3I9V1 4IWNA 1J2RA 1OT5A 1R0SA 2C9DA 3IUNA 4PAQA 4PFQA 2GF2A 4AECA 2Z4RA 1SQFA 3X0DA 2H16A 4K9KA 3AR2A 1KI8A 1UL1X 4J16C 2JGKA 2JHPA 2OXFA 3ODPA 4WLOA 3ED1A 2AFVA 1XAGA 2GJ4A 3HR7A 4IF4A 4L1KA 4LZAA 3NH9A 2Z58A 3K20A 1T9BA 1CVRA 1YS2X 3FTQA 3MTBA 1MDFA 1C8VB 1V26A 3WP1B 5JC1A 3FMVA 1J5EB 1NXSA 1M2VA 1LVGA 4ZVMA 3LWNA 4GBED 1MUUA 4OGKA 4JX8A 2CL0X 1NN0A 4QA9A 1D7OA 3INNA 1SIOA 4ND6A 2A14A 2OAP1 1DPFA 3PR1A 3ZS9A 2Z43A 1QRTA 4LJYA 5EXTA 1SG6A 2NU6A 1NOIA 4P8RA 1PGQA 2X5JO 3L6UA 4F7DA 5KKAA 5HZHA 2FW7A 4IDHA 1L3BA 1TJYA 2ZJ3A 3NFRA 4WZAB 2BFEA 2WU1A 3RRFA 5DI3B 3NIBA 1QR6A 1X38A 4IQ4A 3EZNA 1EBUA 1HKHA 1U98A 2BUCA 3OZTA 4MI3A 5KNCH 2G1JA 4P7JA 3RODA 2GM4A 1EX6A 1C1DB 2G4CA 2O2SA 3HWSA 1PYGA 3MTDA 3PUHA 4E1VA 4F11A 3H2SA 3T1OA 2WTAA 2PRJA 3KWJA 1X19A 2Q2VA 4HWTA 4N3GA 1E58A 2R5FA 4TLEA 4DN6A 1A4IA 5I7AA 1IHDA 2VYNA 1VYVA 5A3RA 1PNOA 3CN9A 5LA6A 1LK0A 1OYVA 1Z6XA 1Z5OA 3PPXA 1RMQA 3F3KA 4MZDA 5HKBA 1E96A 4EATA 3N7AA 3UKJA 1OXTA 5I7VA 1QVWA 2PKCA 3K96A 1U4SA 1B0PA 3HBLA 3KXLA 3L2OB 1KXZA 4I08A 3O3OB 4OMCA 4XX0B 5DVZA 5LMCA 2BM0A 5TQ2A 5BWNA 3SWWA 2I2BA 5ISMA 4ED9A 1ZHOA 3CF0A 1ORVA 2GLXA 3L92A 5TF4A 1XRLA 3MGKA 3QPBA 1IXZA 1XD2B 1ZUHA 3A32A 3AR3A 1HQDA 4M6WA 4N40A 5F3RA 3HCOA 3ONFA 4TKUA 2IU4A 5L51A 5IC5A 2PG3A 2RK6A 1Q7TA 4NBRA 1NT4A 3LXUX 3RSQA 3RC1A 1SVSA 5TGDA 5DHRA 3WYNA 4GOLD 5IEJA 3T7CA 4OKSA 3NHFA 3LFUA 1TKAA 2YMMA 5UKDA 5CD9A 3OFSA 2QDKA 1G5PA 1RJ9B 3P5SA 4L9RA 3UJCA 2DXIA 1BS9A 3QXCA 1KQPA 5DNCA 5LP6C 4MV4A 4M21A 2K2WA 2QMHA 2WIDA 1YQDA 1PIWA 2IKSA 4AP6A 1YR1A 5KSWB 5FTKA 5JECA 3PICA 3SQMA 2XCQA 1XNJA 2GF0A 3GT0A 5L4SA 4KO1S 1BOOA 1OI2A 1URPA 2J9XB 1P1KA 1VCMA 2PAAA 3LVBA 3P5BA 3S2YA 2JFQA 3L6RA 3VMFA 4CT4B 3D2CA 5IZCA 1Z0FA 2YW2A 4XDYA 2UXBB 4JLAA 1UJBA 5DSTA 2H4YA 4XYEA 1F0YA 4K46A 3ZBQA 3QIAA 3AC0A 1RLIA 4QEKA 1NNSA 2COUA 5ALGA 2WG0A 4JI5B 1XBTA 4YJ2B 4DYHA 3R0XA 4R1SA 3L0OA 1OIVA 3MB8A 4P4SB 5FFFA 1H65A 5INTA 2RE8A 2FLWA 2ZIEA 4D80A 5KYTA 1WBDA 3VNRA 2BEWB 4EFKA 3VU0A 4NOMA 2HNAA 1T4CA 2Q4BA 2HQOA 2RHOA 5CJJA 1H3NA 1YA4A 3TLJA 4CKBA 3EEFA 3HUEA 2BHRA 3QLTA 3SYNA 4EUNA 1I7NA 5FIUA 4XCVA 1KBQA 3PXCX 3R6LA 5A7GA 4NC9A 2JIBA 3IE0A 2Q27A 4O4LA 3JTEA 1HT2E 3A1VA 4G4SP 2IPOA 4MITA 3DWGA 4FX5A 5CLIA 1USKA 3C8DA 5BV7A 1NRXA 7REQA 4ZYYA 1Y5LA 4F06A 1QQAA 1PWYE 3WKCA 3H5AA 2NU8A 2OOKA 3CLRC 4JYPA 1CLEA 3UN1A 3DOUA 1X74A 4QYIA 4Z9YA 2PS1A 2AC2A 2H0RA 1SC4A 4NBKA 2I7CA 4X24A 4ZA2A 1JHXA 5T4EA 2PKWA 3ZV4A 4F6RA 2GZ1A 2R8BA 3QVWA 3GJ5A 3EDYA 1YJAA 1Q7CA 3NIFB 2AN5A 3TJRA 5A03A 3O8LA 4OSOA 4ALKA 3N3BC 3ABIA 4IS3A 3T7KA 3VC7A 5IFKA 5IJWA 2I6QA 3UWSA 1A7KA 1Z6TA 1I5EA 2BGMA 1FQWA 2W83A 4FFMA 2GKOA 4GM0A 5A4AA 4KB5A 4V0QA 1Z45A 3CIFA 5B1IA 3SS7X 1AKRA 4ZDIA 3FSGA 3T1YB 4G0OA 4YRNA 3WHKA 5FV4A 1Z4NA 2JLSA 4PQFA 1H0SA 2WVAA 3X2FA 1LJLA 3R8XA 5KNDH 5DMXA 2PA0A 4TS1A 2PUCA 1MP0A 3EDRA 1FYEA 3RSLA 1N5MA 4RPGA 1J1ZA 2R1VB 3UW3A 4JBNA 2ATCA 4NCKA 4F96A 1GA1A 1POXA 5LQJA 1CULC 1NM5C 1YB6A 5G40A 1JH8A 1VB3A 3GP8A 5DKFA 4DQ0A 1P2FA 4DGSA 3A31A 1G8YA 4K6KA 5DYTA 1M6VA 4OXXA 2QYSA 1JUDA 5CYOA 4X97A 1IN4A 2PKRA 4FW8A 2WM9B 3L46A 4NBSA 3U7QB 5FPSA 3RI3A 1KC1A 5TF0A 4OKIA 1U31A 4L7VA 4BNTA 2ZBGA 1LDNA 4CM9D 2GPNA 3V5NA 1F6DA 5COQA 3ON5A 1LBSA 1UMCA 2P0EA 3KQWA 4I1RA 1TD1A 1Z9BA 5BW6B 2PWBA 2W4MA 1PJRA 1HM5A 3WMXA 3ZWWA 4RTRA 4C7JA 4KOAA 1IN6A 1SHZA 3C97A 1Z6AA 1AHHA 4Q4DA 3KSAC 5DGIA 2EX4A 1FZTA 2QX7A 2P8SA 2P9FA 3G7SA 2XZOA 1U7DA 3VH3A 5B55A 1BHSA 4KVFA 2XYRA 3M81A 4BGEA 2B20A 4YT5A 1VG0B 4WKPA 3S2SA 3EXG1 4WCDA 4Q9HA 3GEDA 2ZAIA 4M22A 5K6RA 4ENRA 1I6LA 2G9ZA 5CA1B 4BTEA 2O7VA 2NU6B 1GQSA 2B8JA 2JA1A 1WQ3A 1DSSG 2YMPA 2ZIUB 2Q1WA 2W58A 2Y99A 5DNAA 5JAPA 1Q6YA 2VAMA 1N2EA 3GBPA 1USUA 2ERYA 3QX9A 3UCXA 5JTUA 4KNWA 2JLWA 3FYUA 1QIHA 2HPHA 2X0FA 4YTEA 3N39C 2GESA 4RNDB 4ZEWA 5GOTA 4EA8A 1ULTA 3JQEA 3QH4A 1JJIA 2VH5R 4PZZA 2R8XA 4C6SA 1LDGA 3HYTA 5K3FA 4PC3A 5EIBD 4CTMA 3K6SA 4CLRB 1NPDA 2IXDA 4HDAA 4ENUA 2J32A 1LH0A 3A1DA 5G02A 3TTXA 2KPOA 2X1HA 3QF7A 4GI1A 4BO9A 2WTXA 3ZU5A 3IOYA 2EJUA 4LXYA 3BZWA 3R6TA 4G0NA 3QUAA 5DWQA 4MDEA 1NXOA 3DJYA 4M9UA 4RK1A 4BFTA 1YK1A 2P2NA 3AR7A 4K6OA 3ZXUB 4V0LA 4PNEA 4WBSA 5K6AC 3HA5A 3FIJA 2A67A 4URYR 1CZKA 2ASVA 4I5GA 1KEEA 5CB0A 3OKCA 4M6WB 2DUNA 4PQGA 4LF7B 3RT1A 3GPLA 4EPTA 1DELA 2QTFA 2FPSA 1BDIA 2HLPA 2NV2B 1P7WA 3B6ZA 1DVRA 3E2PA 2GK6A 2AF3C 3NX4A 1AV6A 2HHAA 4YRDA 3FNFA 2X4LA 4J2TA 5DCLA 1FS4A 2Z8ZA 4X90A 4L5CA 3SYRA 1SXPA 3M4XA 3PJRA 3UPTA 4TMYA 1NSFA 1SRRA 2F9LA 3KSDO 1ZVQA 1Q7BA 1RHJA 4OU4A 2VDRB 1MIHA 4OQXA 3G5LA 5T3UA 3KQHA 2XKKA 3OKAA 4X84A 2ZYAA 4OQFA 2XUHA 1GXSB 2BGJA 3LUHA 1NVTA 4DLWA 2O2XA 4GT1A 3BGIA 3C2QA 1TGVA 4Z54A 3ZR4B 4E7OA 4JD5A 3LLVA 1VJDA 4NH0A 1KDYA 5H4HA 1G9SA 2EXXA 1EB9A 2XUQA 2YS6A 2GHQA 3OLYA 4DXDA 1EDZA 3V1YA 2AQKA 3W7AA 2RI6A 1OREA 4YRKA 1NQTA 2OVFA 4KXLA 3HVHA 1BA3A 3TDKA 1PK9A 4UASA 3GLUA 1X0VA 1ZNZA 1VYHA 1YHZA 3SXUA 5A4FS 1IRIA 1GZDA 2VBFA 1V8DA 1M33A 4XYBA 4A6EA 4M9ZA 1XN4A 4ZU3A 2VIIA 3BIOA 2DQ4A 2W6PA 4Q93A 3WNVA 3IR6A 2JVIA 3TQHA 2OCAA 2P1DA 3FA2A 1EGVB 1ZI9A 4EHDA 3CM0A 1RPTA 3U44A 4I6EA 2IP2A 4W9NA 1B00A 4E5DA 3CINA 1C9NA 1I6WA 5J4YA 3ETNA 2JIRA 121PA 4D1YA 3CSSA 3ERCA 3U4DA 4AUEA 4MW9A 3GEGA 1DB3A 1FRFS 3H7IA 5AVZA 3CB2A 3CIOA 3G8BA 4FJ1A 2XUFA 5D1NA 4U8GA 1G0OA 5E6RB 1G98A 5JY1A 3MG9A 4HLQB 4QPCA 2WMNB 5TGTA 1GZ3A 1Z5ZA 1BVYF 2I67A 3F6CA 2GVDC 2H52A 1ZI6A 1GFSA 3K9CA 1B2LA 1J97A 4BFYA 2C7RA 2DT5A 3CO5A 1XRMA 4ZO7A 2X0RA 3JAWA 5B1EA 4Y2TA 2B34A 5C2JB 3EZFA 4EYQA 4MR7B 1KDPA 3Q3CA 4M76B 4AVYA 3CBQA 2DHDA 4BRZA 1BJKA 2YDYA 1R6XA 1D2HA 1VDZA 3H11A 2J31A 3CISA 3SVLA 4KKXB 2RHGB 5JATA 1NL3A 5FBWB 4LYAA 4IJUA 3ICOA 5BQPA 5B57C 2J3MA 2PEZA 3KWLA 4HFNA 2ZWPA 3SFZA 2HTFA 2AH5A 1ST3A 1RIFA 2J3IA 2DYKA 3B52X 3B8HA 5LYYA 3Q12A 3V8QA 4KO8A 3TR5A 1FBNA 3VR3D 1II0A 3CW9A 3D6TB 2NXCA 4JI6B 1D2NA 3WNDA 1PGJA 4TL6A 3M3PA 5C37A 2HFJA 2IS6A 3NHJA 5IFLA 2V6BA 3CRZA 3IMFA 2PRIA 3LCVB 1N1EA 1MJHA 4Z2YA 2Z5LA 4MKHA 2B94A 4S35A 1L5GB 5HX7A 1EWRA 1ULHA 3TSYA 1UBEA 3G6WA 4PG5A 4DUGD 2QX6A 4R2KA 1G8JA 1U7PA 2D2IA 1WLSA 2B5WA 3A27A 4NEGA 4YFYA 1I2ZA 3COZA 4Z0PA 4QPNA 1DARA 1VL1A 4DKJA 3BOSA 1OFHA 2ZYTX 3ZGLA 1OH5A 1DJMA 16PKA 2VP0A 2ZB2A 3W5HA 2WWRA 3VU1A 1Z2AA 2P6UA 1GNVA 3EWNA 4Z9BA 2NPFA 2BUBA 2HSWA 4M3NA 1RC0A 2VEOA 1JJFA 3G88A 4NCJA 2GZRA 4OH7A 1Z2OX 3NUQA 2IHTA 2QHXA 4J0KA 4RA9B 2OCYC 3THWB 5D5QA 3PJEA 5IM4A 3BJIC 3WQHA 3BTUA 5BSVA 3IIKA 5J9FA 1GGJA 1YBFA 4ND7A 3VU3A 2J6BA 4L95C 1TYDE 4ZEXA 1KARA 4DB4A 4KMOA 3PJDA 2ZUWA 1XRQA 2VRCA 4LZNA 4NYJR 4WCVA 4CCYA 1RLOA 3BK2A 3CURA 4C0JA 2PZBA 1RAGA 1ZM3A 2BF7A 3KFLA 3AM3A 2DPXA 4ARZA 1DBSA 1Q11A 4D0GA 1FC0A 5JAQA 3GRFA 1S3SA 1SG9A 3QW2A 1T9CA 5IUKC 2A9OA 3HRKA 3KX2A 3TVTA 3A4IA 4MP3A 3X1WA 4IVNA 2W6OA 1GO2A 1TJ3A 3WNQA 1Y1RA 2GUGA 1Q3TA 3ISJA 3RABA 3Q85A 1THMA 3UW1A 3VR2A 1IQPA 1V9SA 2P4QA 3UGJA 4N3NA 5AXBA 5DTIA 2AG5A 1XTZA 5K1ZA 5KTPA 1SCKA 3GEBA 1F4PA 1GL7A 2BFAA 5ALJA 5EGSA 1B3BA 1J24A 3OCJA 3UUGA 1Y8ZA 3OETA 3NVDA 1QDEA 4NS4A 3LYUA 1MJ5A 4GXNA 4QKQA 2IYFA 1RPJA 2Z3WA 3HN6A 2EP5A 4MB2A 1UOEA 5LBIA 4D0LB 4PAMA 4L73A 5I6DA 4KRFA 4IEFB 5K3FB 3J7AC 5CCBA 1BDBA 3DP9A 4CLDA 3UMSA 1R8QA 3UB4A 2MJLA 1E7QA 2QRKA 4PTZA 3TIVA 1DWOA 2GVZC 1IYZA 1T0JB 3JYPA 4G24A 1QH9A 1ZN7A 5IDXA 1BOFA 4EX6A 4W8HA 4XWYA 5L40A 4FJ2A 2XD4A 1C1HA 2GXSA 1UC5B 2OC9A 4N5IX 4IH9A 3EWAA 1N0VC 2TMDA 1K68A 3Q9LA 2Y6VA 3KJQA 1XTJA 4Y2SA 3A1WA 3ZHBA 2HDOA 4MQMA 4TWJA 4J6FA 1XVAA 1P0FA 2Z30A 4TVBA 4DMFA 2HU8A 5DDIP 3EIUA 2VC2B 2Q3DA 1YO6A 4V0KA 1FW6A 2AVNA 1Y3DE 3N8KA 3K53A 3RUAA 4A10A 1EVEA 4NS1A 1N9ZA 3IBCA 5EP3A 2BGWA 1T8WA 1O94C 3AU8A 4FOPA 4GU5A 3REQA 2ZFUA 5IXJA 2RHRA 3PHJA 4NESA 1WCV1 4QUHA 3L6BA 1BVUA 1GAXA 3WRVA 3BSWA 3ROPA 3PQ3A 4IS2A 2Z5FA 3GA0A 3OU6A 4W6QA 2OXTA 3DNFA 2AX3A 1R74A 5EI5A 1KDOA 3RJ9A 1GQQA 1HI9A 2POQX 3IEPA 2OM6A 5GGYA 2AI2A 3PK0A 4QBGB 1L5OA 5JBQA 2C96A 3U4CA 3C4JA 4IL5A 4P83A 4ZCRA 2CUKA 1P91A 1CERA 3BH7A 1NJSA 1WU7A 3K1TA 4D9MA 3W1VA 1VCIA 2ZWIA 2FPOA 5B4VA 3OEHA 4DQXA 1YBMA 1NUAA 2CMFA 1ZD2P 3MIZA 1PL8A 3FBGA 4ZHQB 2XLBA 1RRPA 5HPYB 1MO5A 1UBOS 3R09A 4M1WA 4ACBA 1LJUA 1SU6A 2JRLA 2RAUA 1AF7A 2G83A 1XAHA 5GM1A 2VHTA 4JHLA 3BQ9A 5SZHB 2CJPA 1PLJA 3EFOB 1LV7A 2YINC 2HMSA 1GT6A 1HRKA 2PEYA 4ARUA 4ESEA 3DB2A 2O5RA 1IBLB 5I9BA 3PNKA 2VOJA 2WZQA 2P30A 2GJSA 5DWVA 1JDPA 3A3KA 3HA2A 4JUFA 5T8KC 4QUGA 4I9GA 1U4NA 4AO8A 1MTOA 2FEOA 1ZMXA 1W59A 4HDNA 3SE7A 4QICA 4ZAWA 1XK7A 4RM2A 3FY4A 2OHIA 3CEAA 4K0KB 2O2ZA 4F9GA 2NYRA 3T35A 2WYVA 3B9PA 2PMFA 3VR6D 4CCWA 3ZDRA 1ESZA 4M87A 1T3HA 2QBYA 1MHTA 4HNSA 4LXHA 4X45A 3NATA 4F1WA 1EJ0A 3OIYA 4DPMA 3F5SA 3DOOA 1M8PA 3KEOA 4IJKA 4NE7A 1UBSB 3NW9A 3QLEA 5E1OA 5C4GB 3FTCA 3INGA 1ODCA 2JJ2D 4CRWB 4F92B 4Z86A 4DNQA 1A8UA 2CWWA 3GRKA 2WT4A 2R87A 4MQFB 4ZAGA 5KWEA 3FUWA 3QI7A 4P22A 1PX2A 5DHSA 4ZVNA 4AF7A 1ZJYA 2FSHA 2FGKA 4ALNA 1MC8A 4PFSA 3QFRA 3BSFA 4P1ZA 4KHPB 1QPGA 1SKYE 1UJNA 4HTAA 3HKBA 4S24A 1A97A 2QPLA 4CG2A 1WQ1R 1RPZA 2NXJA 1Y7PA 5ALEA 3KTDA 3HA3A 2I3DA 3AERB 3IIEA 4RANA 4KE9A 3K09C 4LK3A 4BYGA 3OZ7A 2WZDA 3AEZA 2VDVE 4KV9A 3B1XA 3JD0A 3RB8A 1EQAA 1MRSA 2WQ7A 2XJ9A 3QE0A 5D5HA 3TW4A 3WGZA 1MOQA 2Q3FA 1XZKA 4QULA 1T2FA 2FFHA 3K5PA 4ZO9A 3ZI7A 4C4AA 5AUOB 5JBNA 3PTAA 4NXNB 3HRIA 3QYJA 4B2YA 4U7TB 5HIKA 3CLHA 2HZBA 3NOOA 3AOEA 3UT5B 3FBWA 3CUUA 3PFBA 3AP3A 3TMKA 3PITA 2H63A 1ZEJA 2F3PA 2JAPA 3A3OA 4PZCA 4XH9B 1OYOA 2VHXA 3AXTA 4EKEA 2UVDA 4N47A 3F6PA 4DANA 4G0UA 3TSCA 5C81A 2QRPA 1DFHA 3K35A 1W6RA 1CJVC 1XYGA 3GI1A 1FXWA 5MDHA 3P19A 2HMAA 4B73A 4KN8A 1T0PA 4O0MA 1T2AA 1OA0A 3ROMA 1NYTA 4PX3A 4TWZA 4DMMA 2ZOSA 4DWOA 4N3AA 1PAUA 3HK2A 4JBHA 3AFGA 5GAJA 2E48A 4KXVA 1IPEA 1KVSA 2PH7A 4EG7A 3H2HA 1DUIA 3HP1A 5AO9A 5F7JA 4LRSB 1MB9A 1DZIA 3CWQA 3OJFA 1T6ZA 2OQIA 2GLTA 4LXXA 1LW6E 1M0TA 1NSTA 1P3JA 2J1LA 2ABWA 3LHSA 4UTZA 5BURA 5I3CA 5HQJA 3BF7A 2P27A 4JLDA 4XSHA 1VSUA 4DCTA 5IASA 1OAOC 1KOJA 3KE9A 4Y7DA 1LPNA 4M7PA 2GFIA 1Z0ZA 5IUNC 4QXMA 1Q15A 4OHCA 5TT0A 3QLJA 3UC5A 2JGDB 3QSGA 4ZI7B 1UXOA 2W00A 4H3KB 4QX6A 3F4KA 4O2BF 2QUIA 3ONWA 2FR1A 2RJNA 3JQBA 4EK9A 1LA2A 4DCPA 3OTHA 5JHGB 1Y9AA 4QOEA 3MTQA 5DCUA 1U2RA 2ZDGA 3E81A 4IDGA 1N6RA 4NWIA 2J9RA 4G8DA 4PG7A 4HADA 3ICEA 3T61A 2WSSD 3X1XA 1KIMA 2ZTUA 3SZMA 1PKXA 2GCOA 3IQEA 4MPTA 1KKLA 1FE8A 2X23A 4ZCSA 4A7PA 4AJOA 2FZ4A 2V03A 1FUKA 3B20A 3LZ6A 4IFBA 1MB0A 1VHTA 3I53A 3OZEA 3GR6A 5HMLA 3GMDA 4H16A 3GNLA 3OZWA 4YQFA 1E3WA 2CFCA 1Y6RA 2XVAA 3LBAA 4MO2A 5AM3A 3DTTA 4RL4A 4D96A 1LXCA 1IJKA 4TV9F 1JA0A 4BNXA 2GSWA 5B1DA 2WYIA 2I4RA 5DK4A 5EKTA 1L7EA 2PVCA 4I2VA 1WF6A 2EEZA 3RC3A 2XEXA 4KAJA 4N6NA 1BW9B 3SN6A 2PZAA 1L9XA 1OKKD 5DM4A 2V74B 1Y7IA 3T15A 4TWBA 1KBOA 2R6JA 3JAKA 2WB2A 4C2TA 1X6VA 2QTWB 5EZQA 4UJ3A 2GBGA 2VRWA 5ALYA 1PZFA 2QJRA 2D2EA 5DN9A 4DOMA 7GPBA 1YTUA 2DAPA 4JJ8A 1AKVA 1S2IA 3TW6A 3VR4A 3Q7SA 3NJ4A 2V4MA 4E5UA 1NHGA 1Z7YA 1TLTA 1SBCA 1W73A 2H57A 3IVCA 1OOEA 5G0UA 3MHPA 2XGSA 3WK5A 2XGMA 4EO9A 5IAJA 2O14A 4QFMA 3VVCA 1ONPA 2BFCA 3BRSA 3KXDA 4IKEA 1FLVA 1RABA 3WWPA 5GIPE 2XEDA 3DLCA 4FNMA 1RCTE 1Y98A 2W70A 2XVZA 3R7NA 5C80A 3LBHA 3TE6A 1NASA 1ZK3A 3T1QA 4OMDA 4PW0A 1SUFA 2RC5A 3RVMA 2ZJOA 1KYIA 1EXDA 1F60A 3GDWA 1X7ZA 1ZJ6A 2IIPA 1NG9A 4BOYA 3WLHA 1YRQA 5DYWA 3CZMA 1JW9B 3QLUA 2GEJA 1MX3A 1ZK1A 2G40A 4YT4A 1I3MA 3DQZA 3KD2A 3LQYA 2AXNA 3I1YA 2ZIXA 2JLYA 1Z3CA 5F2OA 3ET5A 3GJYA 4YQYA 4D9HA 1PBTA 1WL8A 1KO8A 3H6KA 4BAUA 1U1EA 2ZSUA 4PLPA 1ZRMA 3I9LA 4FD3A 4NZZA 3QV2A 2YASA 3FLBA 4OO3A 3S1AB 4C43A 1ISJA 3FJ1A 1YVDA 2AJDA 2ZBDA 1YAJA 2ZI7A 1DP4A 1YR9A 2UKDA 1N2IA 1QVRA 3V3TA 5K8IA 4OYLA 1MW8X 5JFOA 1Z5GA 4FVTA 2NO4A 4BNZA 4RETA 1YZGA 4DV5B 1JG4A 2VT7A 2DPGA 5JAHA 4OYHA 3PQ4A 5HS6A 2A0WA 3RLIA 5I7WA 3FDZA 1CIVA 3PXXA 2QQEA 3KR9A 4F84A 3MELA 2WSYB 1BEZA 1VKNA 3W8EA 3AKCA 4IX1A 2OAEA 1GLGA 2QZZA 4XXHA 3SM3A 1WO8A 2GFQA 3R0QA 3ZBPA 1NC3A 1XDZA 3KC2A 2AZTA 1KY3A 2VZEA 5EL0A 1I6KA 2VG8A 3H1BA 3BIWA 5JANA 5LUAA 4ZZ1A 1W87A 1M2HA 2D5BA 4HDMB 2ZSFA 4G85A 3L0ZA 3AJEA 3NTVA 4MRAA 2O54A 2AEMA 1AN9A 4RTPA 3TQCA 3EULA 3X1KA 2VTBB 3QZUA 1KWKA 3TMYA 3FOBA 2VTVA 4NYMR 1II8A 4M83A 5KOIA 3FMIA 3LYLA 3T5AA 2JH8A 1OKKA 1FSGA 4O2BA 4PZLA 4E5YA 3T3IA 3A04A 2E6UX 5F3DA 5I7FA 3AKEA 2HEGA 4NTZA 3AEQA 3CX6A 1IBRA 1O58A 3PUVA 5K8TA 1GKUB 4MEAA 1WETA 2CV0A 3GJ4A 2G36A 1V5GA 3M6WA 2ERXA 4M0FA 4DL9A 3K1YA 3R8FA 1Q0ZA 1ZYUA 2CYCA 2XXBA 3I5UA 4ID9A 1NGSA 2PWAA 3AJ8A 4E7PA 1VLHA 1V4NA 2ODQA 4PNHA 1GQOA 3AHEA 1L4LA 2P2GA 4R1MA 1PS9A 4WH0A 3W6OA 4HDSA 1L6RA 3WLOA 1ZR4A 3QKSA 2FPPB 1Z0UA 3Q7EA 3WWZA 2WUEA 4MA5A 3D7MA 3HY6A 3PXAA 5JMPA 3DZBA 3BL6A 2V7QA 4ZJZA 1X9GA 3E0QA 4L3VA 4ENPA 2TRSB 1KKMA 2CLOB 2WIAA 3EGIA 4KV7A 4EPYA 3Q98A 2YCLA 5JSZA 4CEHB 1MW9X 5JXHA 1QVAA 3PHBE 3L7NA 1IDOA 2AZDA 1E8MA 4IDAA 4GKBA 4R9VA 4NZOA 1UM8A 5BN4B 3LMKA 2GYYA 5DEIA 3LUDA 1V25A 1IM8A 1CD5A 1XELA 1X87A 2YZNA 2ZYSA 4F6CA 1WXQA 5ALPA 2DBZA 4JJGA 4LDAA 5EJFA 4H7DA 2Q6TA 4C7XA 1AZLA 2P79A 2ZYHA 3R1IA 2YS7A 4JL6A 1CJUC 3BTSA 2OPHA 2OQRA 1MDBA 1PEAA 4KGZA 3ZTTA 4CZ2A 1BTOA 1SVLA 1IEWA 2HQBA 3PXBA 4RVUA 3TL6A 1I4LD 1Q3KA 4IV0A 1HDIA 3T1TA 4AJHA 2FPGB 3S8MA 4EHKA 1GSIA 3FFBA 4NMHA 2I2WA 3I12A 2DG2A 4PGHA 2XRFA 3F6YA 4MHTA 4YGYA 3O8OA 4DCNA 4MJLA 1QS0A 3I5YA 2HHJA 3U5ZB 1CY8A 4OHKA 2OGZA 3F96A 3T7AA 1XMIA 5I9TA 1CNFA 2ZIZA 2D1QA 2EKLA 1PBNA 2PA3A 3DVSX 4RDXA 5K8JB 5HRCA 3WRWA 3WK9A 4HYTA 2A59A 2X1VA 4DREA 5EJ6A 5KEIA 4Y2VA 1T9KA 4O4JB 1RXWA 4GLBA 1LNQA 4IFIA 4WFQA 1B76A 1QZUA 3DMRA 3F67A 4B33A 1SXJC 3L6CA 2OOSA 5KQRA 4BECA 2Z98A 2JLVA 4DLXA 4FGLA 1ZMOA 2JH3A 4AX4A 1D1SA 3GGDA 2COKA 1N4AA 4D9CA 3A6FA 2GAAA 1VBKA 4X1IB 3TCXB 4TYPA 5CITA 3F2VA 1E6MA 2NXNA 3UMRA 3K9FC 2BFWA 3GLVA 3JR7A 1TAHA 1V16B 2O8VA 1XCMA 1ZQ1A 2BMFA 3U4MA 4ZMBA 4MP6A 2JGIA 2JAHA 3QEKA 4LW8A 4GX1A 5DCYA 2WJJA 3QU2A 4CF6A 2J0UA 1SA0A 3DZDA 1YB4A 3TPZA 5IJZA 3RTGA 3QVOA 4A8JC 1BEEA 2OL4A 2V8BA 1OLXB 1J0AA 1EGMB 2AMVA 4C06A 3V55A 1Y3FE 3R4CA 1I24A 1XIVA 4MV1A 3WG9A 3QU9A 4EENA 4G8BA 2H4XA 3MTJA 5DX8A 3IE1A 4FZVA 4Q18A 4WV3A 5BSUA 1SN7A 2BEVA 3EK2A 1SKQA 2BBSA 4BVFA 1AX9A 1KGDA 2YWJA 3KLMX 4R9RA 3SEFA 4AB1A 2JKYA 5MGNA 2ECQA 1PVOA 4TTTS 2JPDA 4EJ0A 5K7SA 1ZUWA 3UJDA 4F5YA 3OIUA 1Z4OA 3EPPA 3BZUA 3N87A 1M76A 5TPZD 4DJFC 1I51A 2QT0A 4DTIA 1DKMA 2QLLA 2Q3MA 3VKVA 4B5KA 3EA0A 2P5SA 3FTNA 3H9JA 5J23A 1N77A 4MUAA 2PMKA 4AXBA 4UHEA 5EMMA 3OTIA 4MGIR 1U7OA 3UT6A 3W8RA 3GLFA 1TZCA 4RZHA 3ZHQA 3ZIAD 3JASB 1EEHA 4LHXA 4AJPA 2D8MA 2Y1LA 3FCAA 2FUNB 2OYSA 4NQZA 5ESXA 4GMXA 2C9ZA 1W8IA 2YVQA 4YMWA 1KFBB 1IH8A 4AKSA 5BVGA 1HDRA 1OFGA 3KFVA 4G2TA 1L1FA 1KNQA 1JJ7A 3WGUA 3IXMA 3LRXA 3JRWA 2BTOA 1ZWKA 2Y1KA 3TCKA 1GT91 5LWHA 1PNVA 2H00A 2XECA 2M32A 4FQ5A 2JFZA 1HC7A 1O54A 4AF8A 1QWSA 5LXTF 1Q83A 4U7WA 5CYPA 4GOOD 4ZYUA 4YMVA 1UT6A 5JUWA 3OPYA 1E2GA 2YV4A 3ZHUA 5BXQC 2IGTA 3VU9B 1AD2A 4B4WA 1RIIA 5EXPA 1JR2A 3ZHVA 2BTQB 4GIBA 4FTWA 5BSKA 4JJKA 3AHIA 1W5EA 5JJ5A 2ECPA 4BMYA 1UPFA 1U9ZA 4FOLA 1T26A 3ZZUA 4NARA 4JVNA 3UMFA 4BFXA 5BUSA 3BDIA 1EUCB 4KAAA 3OVMA 4JGGA 4ZQBA 3HXPA 1Y3AA 5T7BA 1G60A 2EZ4A 2EF1A 3T3GA 2IHYA 1X9IA 3FXAA 1GNLA 5CB4F 4NLLA 4WFJA 2P2SA 1XZMA 4CQJA 4IQ8A 3MQ2A 5DGTA 1ZD5A 4ZKEA 1FMJA 3TH5A 1N36B 3RU3A 3EVBA 4C5BA 4DV4B 4TYMA 2LVBA 2WU3A 2WHXA 4FZ5A 4PPFA 1PGPA 3OJCA 1O5OA 4X44A 4CEJA 4WBNF 2EQBA 2BHNA 2ZJBA 4WLUA 1GTRA 2R79A 4FN5A 3V2HA 4B4OA 3IEKA 2UYCA 2WFZA 3TOXA 3WMEA 3R7WA 3L4EA 2JANA 3PF8A 2J07A 4B32A 5CG2A 1PUJA 2BBWA 3FTFA 3IOEA 2B9EA 4JYMA 4PLVA 4YRCA 5JSHA 5LP6F 1E5LA 2VHUA 4MCIA 3W2HA 3LI2A 6LDHA 2D0OB 4MSUA 2O8FB 3UNXA 2HIMA 1EI9A 4BU1A 1M7GA 1G21A 3WGIA 3HMQA 1WXDA 4DXHA 1H3EA 4DLNA 3PUIA 1RS0A 1S5PA 5TS3A 2C3MA 3PZRA 4HDSB 5ERYA 4EAAA 1KJ9A 2C7GA 1TVEA 3O3NB 4ER7A 3CKYA 2HRCA 2EG5A 3PPYA 4Q7LA 4QT4A 2ATEA 2Q8PA 3SJ7A 3I6BA 4X6XA 1WMAA 5KWVA 3CWZA 3S5JA 3KZKA 5KBYA 1UF9A 1NYQA 1ZC3A 3B1WA 3CFYA 3H2GA 3VDMA 2WDPA 2QRJA 2E4YA 4DBVO 2F1OA 1BQ3A 4X66B 3ZZ0A 2ONKA 5CEEA 3WYFA 5EMLA 2AIRA 5AICA 2PV0A 4IHQA 1SXHA 1JNYA 1BSVA 3GGCA 3OF3A 4KMRA 1PT7A 4MP8A 1ORTA 1QX3A 4EKGA 4UQLA 1T0UA 4CF4A 1KL7A 1X9HA 3RYFA 2GEUA 3TLBA 1BQEA 3LQKA 5KYUB 1W1WA 2FSVA 4KQ6A 1Y89A 3Q4GA 4TSRA 3UA4A 3B89A 4HWOA 4Q1FA 4Y9RA 5ES3A 5EWMA 2VPQA 3N05A 3IJ5A 2BM9A 4QUDA 2I9PA 4FHCA 1DBVO 4G41A 4Z7QB 1G8HA 1Q12A 1C9JA 2Z4SA 5JDCC 4ZREA 2DB3A 3SQWA 1BO6A 5EIOA 3TTUA 2CC2A 3KHKA 1E5VA 3JVUA 5KX5A 1Q5PA 3M8KA 4TKZA 1JL3A 4IR7A 3ZGNA 3CCBA 5J4KA 3K94A 1YBAA 4G0XA 3NONA 2OGSA 3F0TA 1UPUA 2WAXA 2ZRJA 5H9VA 4HLCA 4UJ5A 1XNGA 3SBXA 4B7AA 2LZ0A 1Y8QB 3DFZA 3PI7A 5H68A 4XSVA 4I1OA 2BKAA 3T99A 4JXXA 2V0NA 1NJGA 1PR2A 3TFWA 3LPCA 5HRUA 2B3TA 3ELUA 2VTKA 4B40A 3W1WA 3I4CA 2HLDA 1A9RA 1E6WA 3SM9A 5ICFA 1RAFA 3CRQA 3U60B 3KVRA 1TK3A 2O8CB 3CXUA 4AKIA 4LXUA 2HCBA 1G41A 2EJBA 3G5MA 1YCDA 3FCCA 4G63A 1VXRA 3QHQA 4UU8A 4OJYA 1AMOA 3V8NA 4M1TA 3PIRA 4IMIB 3NHAA 4ZKDA 2IDMA 3JX9A 4C6TB 1RWKA 2CUNA 3D3NA 2J0UB 1KYZA 3G2OA 1SNYA 3O9MA 5AJVB 1IULA 3IPRA 1X1BA 2BV3A 1QNLA 2OCXA 3HU2A 1VJGA 3QNUA 4Y1FA 2RIRA 1K8YB 4ECEA 3QJGA 1KKUA 5F12A 1DCMA 3RFVA 4XJSA 1BXZA 3SZUA 1Y8AA 1Q1EA 1TEXA 3VM6A 1EU1A 3DFFA 4HFMA 4MDHA 3V7NA 4L0DA 2FWMX 2R00C 4E2FA 4MARA 3GZNA 3KPJA 2VZLA 2PAFA 4H4DA 3SC3A 1U0FA 2XB9A 4FS3A 1D3AA 2NU9A 4U0KA 1E64A 2PX0A 4RF4A 4ZV4A 4ANFA 3V7WA 5C7LO 3GDGA 4GS5A 5IAEA 1AXEA 4FSHA 2IYVA 4JJIA 4TVSA 2ONYA 2VSXA 4PONA 5KMGA 1UJCA 2AOXA 3Q9SA 4XEHA 4ZXPA 1XDDA 3D1VA 3QVGA 1JHMA 1R6AA 3PNBA 2GRJA 3P2MA 2ZVPX 3D0RA 4O4HF 4XR9A 1MLDA 2EFJA 4C0KA 2B35A 4J3FA 1DNPA 1BXKA 1HMYA 2FN4A 4QNMA 1VMKA 1Y42X 5IU6A 4AYXA 5K0CA 2IELA 2QMZA 1O9GA 1X86B 2ZXEA 5E0KB 3JCZA 1ULSA 1XJ0A 2H9AA 4L8GA 4F3NA 4Q48A 4G9GA 4P2BA 3AL0C 1KETA 2PT7A 5TARA 1TZ2A 3ZDEA 1P4AA 4HZIA 4L8LA 3RK0A 4N49A 1Y4SA 1DX4A 1H4VB 1V1MA 3L79A 4UHFA 5LP6A 3ER9A 3HGQA 1XJWA 1LKZA 4MLPA 4WTOA 2AHRA 3SNKA 4CMCA 2PK3A 1YI1A 3VYTB 1PYOA 3RK1A 4FXOA 2XIJA 4DTCA 2A84A 3FZNA 1E7RA 2Q2OA 4HNAA 4RKFA 5HCUA 4A3SA 3D0QA 5PNTA 4TXNA 1US8A 4KQCA 2D4AA 5CPBA 4OP2A 4JUDX 3FLEA 3M9XA 5BSHA 1XWWA 3KHUA 4Q3BA 4YS6A 4JI1B 2QL7A 5JWRA 1BX0A 4OAOA 1FTNA 4IFEA 5FH9A 3T0GA 3FFTA 5H82A 1LTQA 2AK3A 1IBMB 2GD2A 4HXGA 4MV9A 4KMMA 1LU9A 4DEVA 1WV1A 3U31A 2CNNA 1NX6A 2WWHA 3KKZA 3NDJA 4WL0A 5EIFA 1E1MA 3ZK9A 4C3VA 3W5UA 5JU6A 2H5EA 1KI1A 1CFJA 4J7AA 3CT4A 3I4FA 4YPFA 4EL5A 4P6VF 2GSDA 2O2IA 3D81A 4FMBB 2WJVA 2ANBA 1G2IA 3PC4A 4R3UC 5B58T 1L5NA 4EJ6A 3S1SA 2Z2IA 4L0CA 4QXQA 1U2DC 3E27A 3K0KA 3MK31 2YVLA 4KWCA 2R4QA 1YOVA 2ZYRA 1FP1D 3C6XA 2JEYA 3OQVA 2BH9A 3FGZA 2JIZD 3ZW7A 2IPAB 2Y1EA 3ENVA 3RYCA 1GFWA 5DSXA 1V5IA 4KDEA 3RUEA 2GA9A 3NM6B 3RVPA 4PG8A 3WYBA 2NO9A 2NT4A 4MW6A 4BQIA 2EERA 2QVGA 1I3CA 3LK6A 3C3XA 3NP9A 2LBPA 3PQ8A 1JRLA 2HQSA 4KIGA 4YMTA 3STYA 2JBAB 2HRDA 4LRYA 2KM1A 1MXHA 2C3YA 3FKSD 3PDIB 1M1YE 2X3UA 2XNDA 5CLQA 1Z2PX 2VP3A 3ZK8A 3QTTA 3T5PA 2I4LA 2WE7A 3I04A 1M5RA 2WUFA 3OMXA 3KE8A 4Z8XA 3S8YA 5KYKA 2GK4A 3GRRA 3MJEA 4JB2A 3GFQA 3OOEA 3T94A 10MHA 5H9WA 1J0EA 1RQPA 3PHHA 1WVGA 2CXRA 5AYVA 1YR7A 4YDSA 2ADMA 4AJEA 5H7XA 1QIEA 2C04A 2IDKA 4KXFB 4KSCA 4II2A 4Y9DA 1GU7A 3ZTWA 1NN3A 5DOZA 2OESA 4DY4A 2HDNB 3ZDQA 1UQTA 2B0CA 5BMOA 2VPPA 1XVIA 2DFDA 1ESDA 3DBLB 4RELA 3OEYA 5JQWA 3WK8A 1ELOA 4R84A 3TLCA 1UEJA 2O23A 3FUXA 4LMBA 4W5WA 4BASA 1ORIA 1VLLA 1T6NA 5ALOA 5ELMA 2NAFA 3K0FA 2C7OA 4H1UA 1BJTA 1NM5A 2FN7A 3DOFA 3KVOA 1UWVA 4OAPA 5L7YA 2BEUA 2EV9A 4M1ZA 4A5OA 1X1EA 4DC0A 1J22A 2HJHA 4DLVA 3K0SA 2OAGA 1XAIA 2FFBA 2BELA 3LW8A 1MB2A 1BVRA 4E32A 3GLGB 5C8YA 3DH0A 4YMHA 1EFVA 4DV6B 1E0AA 3LPDA 3GGOA 1JF8A 5IJ0B 3KQUA 4CMJA 1HQKA 4N41A 5JS1A 5KX5B 2HCFA 3P9QA 1LSJA 1ONBA 1OXMA 1W4RA 2FMUA 1S2OA 3AXSA 4GR9A 1QU2A 2AJBA 1XQ6A 5EYPA 1OV6A 3E58A 4WVLA 3VKUA 2YHUA 1N8SA 1NF2A 1TIPA 1FRVA 4MS4A 4NCXA 1B23P 1O2DA 4QE3A 2SNIE 1JIKA 3R20A 2DQKA 3AIKA 3UQYS 1TK9A 1NVGA 4O4HA 3IDFA 3UICA 5LYJA 4KWTA 2FEXA 4M54A 4MDFA 1P5RA 2W4IA 4KBYA 4L3OA 2R6FA 3AI7A 2AOWA 1P0MA 1K98A 4OXKA 4E4TA 2OR3A 4MB0A 2FYTA 1UM9A 2A5LA 2B36A 1KZ9A 2QU8A 3ECC