4W7HA

Crystal structure of deh reductase a1-r mutant
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
249
Chain Sequence
MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase
publication title Structure-based Conversion of the Coenzyme Requirement of a Short-chain Dehydrogenase/Reductase Involved in Bacterial Alginate Metabolism.
pubmed doi rcsb
source organism Sphingomonas sp. a1
total genus 87
structure length 249
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4w7hA00
5I9LA 1GYRA 3AI1A 3LT1A 4B3JA 1BW9A 1LDNA 2NTVA 1R0KA 1DC6A 5B4VA 1U4OA 1MV8A 3B1KA 1PWZA 5IF3A 4HP8A 4F3YA 4NG5A 1C1DA 4ZU3A 4E32A 1KEWA 2I67A 1XQ6A 3OF2A 4KUHA 5TGDA 2CF6A 2A92A 3ZU3A 1R4NB 1DFHA 1YXMA 4E5KA 5FI5A 3GUYA 1GQ2A 3KM0A 4J4BA 1E1MA 4L76A 1HETA 1CETA 2HSDA 2X22A 4IQ0A 2BELA 3DTYA 3D1LA 3QWHA 4FPXA 3HQ4O 3IIEA 4IZHA 4J3FA 3WNVA 1ISMA 2A4KA 5ICMA 2O3SA 4RVFA 1I10A 4LVCA 1U8FO 2HU2A 1B16A 5A9TA 3Q0EA 1NAIA 4UVIA 1TI7A 1I33A 1C1DB 4ZRMA 2DQ4A 1YJQA 2P68A 3E18A 4O63O 1EK5A 2PZJA 5KJEA 2Q3EA 4BGIA 5U9CA 5T64A 7MDHA 3MWDB 2V6BA 1WDLA 3BHIA 4I8XA 4CPDA 4DYDA 1HDXA 1ZSVA 1KBZA 4CM1A 3WLFA 1EVIA 4Z9XA 4M55A 3UGKA 5DP1A 5F1OA 5F1KA 2EW2A 4Z0TA 4WLUA 1O6ZA 1QLJA 4S1VA 1JWAB 4KP7A 3QJ5A 1JQBA 2QG4A 1Z74A 2E48A 5DZSA 3UCEA 4R1UA 3BMOA 3IL2A 1NQAO 4BV9A 2LDBA 4XB1A 3UF0A 2Y05A 5JMPA 3F1LA 4BNGA 2GGSA 4R3WA 2X5KO 4W7HA 3ZWMA 3H65A 1H9AA 2O7QA 3GFGA 4W99A 2DBQA 1X0XA 2NQTA 4XYLA 5TIIA 2IXAA 2F1KA 3WBBA 3G1TA 3DDNA 4BNFA 3V2GA 2W2KB 4YEDA 4H15A 2J3KA 3MJEA 4FFNA 4UAGA 5EIOA 1MB4A 4TVBA 5JDIC 3WS7A 2FR1A 4IZIA 3ADPA 1T2AA 5A4DA 1QLHA 4IGEA 1R4MA 3LYLA 1PIWA 1P74A 2EJWA 4EDFA 4J90A 4OXYA 4CQMB 4OH1A 2D4AA 4RGBA 5F3RA 2DBVO 3TNLA 4R1TA 4RPHA 2Y66A 1BVUA 1F17A 3EHEA 4OMUA 1NHGA 3WX0A 3BMOB 1H2HA 2Y1GA 4UUOA 5G2OA 1N9GA 3GN2A 3VAZA 4A27A 4BO6A 2ZK7A 1T2DA 2ZKLA 4HFMA 2J5QA 1MGOA 2RH4A 4IQ8A 4HADA 3KEOA 3T7EA 4BO8A 2O2YA 4OXKA 5DP2A 4EW6A 2YW9A 3DB2A 5AXCA 2JFHA 3OIDA 5DT9A 3NTOA 1B3RA 3B1FA 2Q1TA 1P3DA 1R15A 3E6AA 4CM7A 2X5OA 2UUOA 1CF2O 3L6OO 4FC6A 4R5HA 2G17A 2X4GA 3ZWVA 3L0DA 3ZU5A 2X9NA 2NVUB 4BMSA 3TFQA 4MVJI 4FFRA 3I9OA 3DAFA 3H5RA 2VNSA 3QRWA 3WXBA 2GN6A 3A1NA 4NNJA 2EEZA 2DC1A 1NWHA 4HWKA 5ITVA 1N9GB 2VRBA 3NDIA 1ML3A 3W6UA 4Q39A 2O50A 1E3JA 1X7GA 5I7EA 5KKCA 4FFMA 5A04A 3KSUA 1M6HA 3HHPA 2QRKA 3WR5A 3WIDA 1ZK0A 4JP2A 2HJSA 2YQ4A 2VWQA 3RJ5A 3HSKA 3RUHA 3NGLA 3ZU2A 2Y1CA 4BKQA 5IDXA 3ZWCA 3NT2A 2G0TA 1FF9A 3W8EA 3F5QA 4O6VA 4CLHA 2AHRA 4AJNA 1U7HA 4AJLA 4PLPA 3C1OA 5CDUA 2X6TA 1B15A 3FHLA 4ID9A 4K6FA 2YYYA 1LRKA 3MJVA 2VHXA 4BQRA 2I76A 1YL7A 3U5TA 3ONEA 3GVCA 4EITA 4Y6RA 5IN5A 2PGDA 2FY8A 3I23A 3MJTA 3VZSA 2BGKA 2BD0A 4TKLA 3VZRA 1HLPA 4TZTA 5CDTA 3QSGA 1HE2A 4YTEA 1TEHA 3PWSA 3EVNA 4FBGA 3MZ0A 1MUUA 1UZNA 2NV6A 3DOCA 2CNBA 3OSUA 3GEMA 1T2CA 2WE7A 2DFVA 4DQVA 1FK8A 4RVHA 1ZEJA 4ND3A 4E2YA 4WCFA 4JJIA 4ALIA 4FB5A 3ANNA 3UFXA 1E7YA 4AJKA 4C7JA 4PLZA 3GEGA 3FF4A 4RPGA 1UXHA 4J7UA 1H6CA 1P31A 5TX7A 1HF3A 3WB9A 3DZIA 4RDHA 2GD1O 4UULA 1JKFA 3PHIA 1YB4A 4RL6A 2J5RA 1ZVMA 2C0CA 2X0RA 3FNHA 5T8KA 3VKVA 3CMMA 1ADFA 2DTXA 4IGFA 1A4UA 5A3VA 2O23A 3SJ7A 2P9GA 1PJTA 4D7AA 5C5IA 2XOXA 3S8MA 2CVQA 3UAGA 3ZWBA 3ZGYA 1O5IA 4YAJA 5G0SA 3PDUA 4J1NA 3R6DA 3UVEA 1LXCA 4B4OA 4CQLA 2QHXA 4J7CA 5GZ3A 4HNHA 1E6UA 1ZH8A 1GPDG 1HTBA 1QG6A 3F3SA 1E92A 1PJLA 2VRCA 5I7SA 4J91A 3UCFA 3BHMA 2R00A 3KUXA 5BSGA 4WLEA 1V8BA 2JCXA 3CH6A 3F4BA 4R41A 3RFTA 3TN7A 3PIDA 2C5AA 1LQUA 1UR5A 4DQUA 1IUKA 4PLCA 3IP1A 1L7EA 1ZK4A 1ZCJA 3E1KA 2UUPA 2D2IA 3K8ZA 3F6YA 2RBEA 4TKMA 5AVOA 4E5YA 3DZJA 4N5LA 3KSZO 3OA2A 1PQPA 1X0VA 1XIVA 3GR6A 4DUPA 3OICA 5L45A 3O03A 3O38A 4BO3A 4E5PA 1PR3A 4CQLB 1DC4A 2I6TA 1DRUA 4FJ1A 4JQCA 2EJVA 2OP1A 1ADCA 4Y67A 5K0ZA 1LNQA 3CPSA 3BTUA 5JSFA 4HNGA 3C85A 5EJ2A 4ZHSA 5JDCA 3DHNA 4YQZA 1E7QA 5ILOA 4J4HA 4TRMA 3LLSA 4OSOA 2JCYA 1LA2A 3U9LA 4GH5A 3NUGA 2P4QA 5JCJD 5KIAA 1ZMTA 3D0OA 4XCVA 5KVSA 3GNQA 1HWYA 3QVSA 2PD4A 5EN4A 3EC7A 4CM5A 3L9WA 5C7IO 3DBRA 2Y1DA 3HWRA 2YV1A 4XWYA 4D3DA 3WMWA 4GMGA 5GY7A 1A72A 2OBYA 1NQOA 1RM0A 4GAEA 4QSMA 4XGNA 4ZGWA 1NWCA 4D79A 3SVTA 3VPGA 5H82A 1XHLA 5EQDA 3WBFA 2GPTA 2QYSA 4CV3A 1PZFA 4RF3A 4WLOA 1LC3A 1Y1PA 4HX5A 1IULA 4L4SA 1YDEA 3GA0A 5F5LA 3IC5A 1M67A 1VJTA 2EHDA 1S7CA 1HZJA 4RVGA 3HJAA 1E5LA 5IDYA 3PK0A 1YDWA 1B3BA 1YH3A 2ZCUA 1DIAA 3H2SA 4ND4A 4CMIA 1JU9A 5HRUA 4EGFA 2CDAA 3HADA 2PKQO 4OKIA 3W1VA 4UUPA 3P2OA 5DCUA 3DBRB 2D3TA 4PG7A 2HRZA 4J4TA 4Z0HO 1VJ1A 3EYWA 3HFGA 2XAAA 3JTMA 1U28A 4Y6SA 2VHWA 1ZBQA 2H63A 1X1TA 1JAXA 1B2LA 1GR0A 3KTDA 2Y0DA 4MVJA 3JYNA 3KHUA 3Q9NA 4JBIA 3OQBA 4LW8A 1GUYA 1EUCA 5GZ6A 3JCZA 1PL7A 1YS4A 4BNMA 4D45A 3QQPA 1WVGA 2WJPA 5A5EA 3IQDB 2NM0A 2QIOA 2P2SA 2GN4A 4IDAA 4WECA 2HMTA 4ALLA 1U4SA 3NT4A 3KRTA 2Q45A 1R6DA 4CMIB 3GDFA 5T5QA 3HNPA 5CHEA 4BHTA 2B5WA 4GL4A 3BZUA 4FQ8A 4G65A 2AE1A 3DZHA 4KMSA 1OAAA 2VUSA 4ND1A 1EBUA 3E5RA 3T4EA 3U4DA 4CLEA 2O2SA 1PTJA 1QYWA 2Y1FA 3LT4A 4E31A 3D4OA 1GUFA 3IMFA 1H5QA 1D1TA 2UDPA 3H3FA 1G6KA 4J1TA 4M89A 4MVJM 3WLEA 4Z0PA 4CMCA 1D7OA 3O8QA 4DVJA 1W6UA 4E30A 4GWGA 1IB6A 2PGLA 1PSDA 2D5CA 5G4KA 1LRLA 4NIMA 2DLDA 3PWZA 3DEYX 5BT9A 4MVJF 1B8VA 3LF2A 5L53A 3ENNA 1PS9A 1P1IA 4FDAA 4DA9A 1NP3A 1OOEA 5AQ1A 1LSUA 2BI8A 1GEEA 3GUCA 2JHFA 4KUEA 2I9PA 4LK3A 1P44A 2JAPA 1DFIA 5KJ6A 2PKRA 1E77A 4R51A 5A9SA 4Z9YA 4BGEA 1PJ3A 1K6JA 1KC3A 5A1TA 4WCDA 2X1HA 1FDSA 5L3ZA 1DHRA 1LSOA 1Q0QA 4WGGA 3VH3A 3C3XA 2W98A 1KVQA 3GN1A 1MX3A 4U0JA 2HRBA 3E8XA 4JBGA 3QY9A 1A5ZA 1NPDA 3GRPA 3AUTA 4XA8A 1V6AA 1LTHR 4NBWA 1EDZA 5BNFA 1JKJA 5C37A 5CG2A 1T1SA 2H6EA 5G4KB 3RSHA 1DC5A 1J5PA 4ROSA 2BMAA 2OHXA 4IIUA 2VOEA 1RYEA 2X0JA 3QE3A 1HZZA 3MJ4A 5JBIA 4D44A 5EMHA 3LSYA 4DLAA 5TNXA 3AOEA 4J16A 3QVTA 4AJPA 5JS6A 3NGXA 5TJ9A 1I3NA 3DZKA 1E3WA 2I5PO 3S2EA 5B12A 5A9SB 3LC2O 5EPOA 3KLPX 2HUNA 3PPIA 3TQHA 1DIHA 1DJQA 2X9GA 4GKBA 4MP6A 4J6FA 5JAQA 1N1GA 2EXXA 4ZQHA 1IPFA 1Q2XA 4KTTE 1U1IA 5KVQA 1EFLA 4J0FA 1U2GA 3RKUA 2BI7A 3PYXA 3JV7A 5G0WA 2X5JO 4G5HA 4AJ1A 1VRWA 1HRDA 1BXKA 2BLLA 3LC7O 3PZRA 3D64A 3O9ZA 4CR7A 1AXEA 2C54A 1GADO 2EGGA 1Y8QA 3MJCA 4R69A 3RIHA 1DXYA 1LBEA 3MJSA 1JTVA 4AJJA 1CWUA 4E6PA 4ND2A 4OOEA 1E1NA 1UDCA 4ZQFA 1IZ9A 4B7CA 5FI3A 2VWPA 3HUDA 4AJIA 5JC1A 1E3WB 4JX8A 3PHGA 4TRRA 2GO1A 1PJSA 1ZNQO 2FSSA 4B8ZA 1EZ4A 3JYLA 4NPCA 5JLAA 4M86A 1ZK1A 3WSWA 5HWSA 1X7HA 5JY6A 1PEDA 5TT1A 5ADHA 5JE8A 3D3EA 3VHRA 3GY0A 4ZQGA 4NMHA 4IDCA 3WQRA 2J3HA 1J49A 3S55A 4Q3NA 3AI3A 1BXZA 3KV3O 4A5OA 2CUKA 3DL2A 4CMEA 3GZNB 4IXTA 1Y8QB 3ZZNA 3PJGA 1LQTA 3WYCA 1W4ZA 4WPGA 4O59O 3H8VA 4DIOA 4CM4A 2OBNA 1LDEA 1AN9A 1O0SA 1E3IA 4BO1A 2QRLA 2G82A 2W4QA 4GLOA 4PZCA 1A4IA 2W8ZA 1A9ZA 2CDBA 1NFQA 3ZNOA 5DDIP 1YQGA 1AXGA 3GK3A 4KZPA 4LMRA 4E0BA 2Y1OA 4JNKA 4PFJA 4BKRA 4KDEA 3OMLA 2NVWA 4WJZA 2OZPA 1GUZA 4YQYA 3A14A 1ZUD1 4J9UE 2B35A 4R68A 3GHYA 3U4IA 2JFFA 2GERA 2GLXA 4YJFA 5EINA 4YAIA 5KJFA 4ZVVA 4PZEA 1ENPA 1P1RA 1SPXA 5IZCA 1M6WA 1BRMA 3FR8A 4ZRNA 1DIGA 3AM3A 3B20A 5G4LA 2J3IA 4XR4A 1KVSA 3RC2A 2IYPA 1PX0A 1BGVA 2ZB8A 1AHHA 5DBIA 4DBZA 1XGKA 1N8KA 4I5DA 3P2YA 3HB5X 4BS9A 3C8MA 1VL6A 1F8GA 1B0AA 1NFRA 4Q3CA 4BNJA 1EE2A 1SC6A 2O3UA 1NPTO 2NSDA 4RQTA 1ARZA 4LCEA 4GX1A 5HBRA 2NACA 3SLGA 3W4KA 5L4SA 1L7DA 1H6DA 4WCFC 3COSA 1BHSA 3ORFA 4QFCA 3EY4A 5JYDA 1TT5A 4YJFB 1JW9B 3ITKA 5TS3A 4YRBA 3AK4A 4CL8A 3VDQA 1MC5A 4P4NA 3O26A 1PJ4A 1EVZA 4Y8VA 2BHLA 1RWBA 5JMWA 1GYPA 3VC7A 4CLOB 1HDYA 1ULSA 3PIIA 1PGPA 3GMDA 5A03A 5B37A 2QYTA 2CD9A 2ZJ0A 3ETEA 2VZ0A 1U7TA 5AXAA 2DUWA 1FJHA 4DIBA 5IFLA 2R6JA 1WLYA 1LX6A 2GUGA 2VOJA 1O94A 4J49A 4FD3A 4TQGA 5KVVA 1ZIDA 4BKUA 3Q6IA 3GHHA 2OL4A 4DC0A 1ADGA 3WYEA 3AUAA 1NM5A 4BB5A 1TT5B 2P9EA 3KB6A 1KY4A 4PLFA 4R4JA 1WWKA 3WGTA 2X9VA 5A05A 2E49A 4CMKA 1KETA 3MTJA 2R00C 5DOVA 3OQ6A 3OEYA 3UUWA 3ZV5A 1Q0LA 5JCJA 2VTDA 2BGMA 3BTSA 4R9SA 1JN0A 2PD3A 1YOVA 4BNYA 4FR5A 3GGOA 3JQAD 9LDTA 5CP8A 3EDMA 4D41A 1ZJYA 3T4XA 1I36A 2CMDA 2O3QA 3JQFA 4WUVA 3VVBA 1M2WA 4BNIA 2IZZA 5CAEA 1VL0A 2BKAA 1ZZEA 5CFZA 4BO5A 4ONEA 3H5AA 2ZCVA 1BDMA 4PLWA 4GX5A 3GOHA 4YRAA 3IJPA 3P19A 2ZB7A 5JDCC 1VI2A 2W2KA 3VPSA 5KWEA 2PR2A 1EUZA 2Y68A 1TXGA 4XYBA 5HS4A 1Y5RA 2FN7A 4XIYA 3OIGA 3NX4A 3ZN2A 1PGNA 2NLOA 4I5EA 4CQMA 4QXMA 5I9MA 3D4PA 1KEVA 4YRDA 1YOVB 5L9AA 3LK7A 3OEWA 4U0KA 1HYHA 1PR9A 1U2DA 1U3VA 2E37A 1HDRA 1PZEA 2JJYA 1C1XA 2WYUA 3FWNA 4BO9A 2NWQA 4YVFA 3UHAA 4Q9NA 3C7DB 1GCOA 1UAYA 1X13A 1PWXA 4MJLA 1T2EA 2PZMA 2O3JA 1OZAA 3QP9A 3TRIA 4MOWA 4NJMA 4EEZA 4AFNA 1C14A 3RFXA 3FD8A 2ZQYA 1QYXA 5CPBA 4CV0A 3LLVA 5A06A 1XSEA 4L8VA 4W4TA 1GD1O 1Y9AA 5L7TA 2PWZA 3H9GA 3D3WA 3Q2KA 1RM5A 4OSPA 1NQTA 4P38A 2VQ3A 3GG2A 3WFJA 4OJNA 1ZMOA 3A28A 3M1AA 1E6WA 3KSDO 5ER6A 4KQWA 1PS0A 3E9QA 3GT0A 3ZW9A 1XCBA 3BMQB 5ER9A 3WG9A 2FP4A 5U4QA 3H9QA 4KOAA 4MVJG 3HDHA 1HLDA 2NVUA 2P4HX 5LDGA 3RUEA 1C1XB 2PZKA 1VL8A 4GQAA 3AUUA 2HO5A 3ROKA 4J1SA 5IAAA 1DHTA 3VH4A 1JLLA 2ZYAA 1TA4A 1XU9A 4LSWA 4AJEA 4CV2A 2QW8A 4E2XA 3UICA 4NJMB 4OO3A 3DBHA 4B4VA 2PY6A 1I3MA 4NDNE 1IHYA 2X58A 3R3JA 1LSJA 1B26A 1RM3A 4RF2A 4GLLA 4CLRB 3D3WB 5JFOA 1K89A 2ZTUA 5K9ZA 3F4LA 3V5NA 3D5QA 2DFDA 2BFOA 3S2FA 3ZI0A 1H9BA 2VN8A 3VZPA 2NTNA 4XZ3A 5ES3A 2ZJ1A 5C7LO 2NTJA 3SX2A 4GGPA 5DBGA 1ZO8A 1J0XO 1NNUA 4CUJA 1AHIA 4E3ZA 4O5OA 1PJ2A 1SMKA 1GV0A 3ICCA 3FTPA 4RLHA 4DPMA 2Y67A 3FR7A 1DBVO 3TZKA 3DBLA 2EKPA 3DBHB 1QSGA 2B4TO 2D0IA 1ENOA 4RZIA 1Q7BA 2GCGA 3GAZA 1ISGA 4IY1A 3FI9A 2PV7A 2Y93A 3JQBA 1YQXA 5COQA 5JXWA 2GDZA 4MKRA 1EBFA 5FF9A 3GG9A 3PLRA 5T6BA 4IDEA 2CFCA 2DT5A 3LDHA 2Q1SA 4H16A 1DAOA 2HDHA 4FSHA 2XXBA 1SB8A 3BYZA 5JYEA 1ZXLA 5TSDA 2UYYA 4P4LA 4J43A 1P77A 1Z73A 3RVDA 2EWMA 3U3XA 1N92A 4W6ZA 2Q1WA 3H2ZA 4YT5A 4XQGA 1V3TA 4GGOA 1HDCA 4MINA 3KO8A 4CM9D 4MIYA 3ZHBA 1LI4A 5JO9A 3F46A 4YT4A 3JYQA 2PNFA 3ROQA 4A0SA 1HSZA 1Q0HA 3DBLB 1ADBA 1SEPA 5KCZA 4D0SA 1P9LA 4QO7A 4CODB 1ISIA 1QMGA 4MIEA 2GYYA 3DHEA 1G1AA 2C07A 1GQYA 4WLNA 3L77A 1XLTA 5EL0A 1JWBB 2Z5LA 4DMLA 1GZ3A 2A94A 2OORA 2WM3A 4FGSA 1ID1A 2FWMX 4UUNA 2QZ9A 1HSOA 3V2HA 3RI3A 3VPFA 3QWFA 4BOYA 1NVGA 2FOIA 5TF4A 3ZCXA 4DREA 1J4AA 3G0OA 4IMPA 3AOEC 3HB4X 1NQ5A 4RV9A 1DPGA 2GZ1A 1B8PA 3BXXA 5ICSA 3GVHA 1KS9A 1CQIA 4FS3A 4ZD6A 1KEUA 3TZQA 2HJRA 3RC9A 3ZNQA 3AY7A 4LRSB 2OOSA 5CEEA 2AA3A 2E82A 2EGHA 4XQEA 3Q9UA 4ZJUA 1LLQA 2HK8A 2OFPA 4EEXA 3RC7A 4MP8A 2HKIA 4L4XA 2Q49A 3RBVA 4R1SA 3VOSA 3PEFA 2DBRA 1TLTA 2YZ7A 4YA6A 4I9UA 2GN8A 3KZVA 4JIGA 4PVCA 1IY8A 3S2GA 5BR7A 4YBZA 1K0UA 1LU9A 2AEFA 1HE3A 3WGOA 4NK4A 5AXDA 5TJHA 2VT3A 4L0QA 4YAEA 1F14A 2FZEA 3FNGA 1WXDA 2R2GA 4EZBA 1XKQA 1ULUA 1MG5A 3L6EA 2CVOA 2CVZA 4Q3AA 5KNLA 3EAGA 3ZWAA 1GU7A 1NTOA 1GQQA 1P1HA 3EGOA 3I9KA 2X0IA 1PQUA 3NTRA 3VPXA 3AW9A 3HFSA 3KEQA 1XEAA 1N7HA 3DC2A 2VYNA 3MOIA 5JAMA 5KJ1A 1QR6A 2P9CA 3GVPA 4RPLA 3DZFA 3PJFA 1LLDA 3BMNA 3SLKA 2JFGA 3ZWPA 4MKZA 1XELA 3NRCA 4URFA 4QFDA 2D59A 1V0JA 3EMKA 3ZV4A 1DIBA 1W0CA 5B4TA 1NVTA 4KWHA 3U4HA 4FOSA 4RVUA 4BNLA 3WJAA 3OJOA 4QEDA 2O4CA 1I2BA 3ICPA 2W2LD 4QUKA 1KVTA 1PL8A 4IBOA 1UP6A 1LEHA 1K2WA 2AEJA 4K9DA 1ORRA 3WTBA 2HK9A 4OM8A 4NZ9A 1NFFA 2C29D 4PGFA 3M6IA 4II3A 3RAJA 4Y9DA 5JAZA 1JA9A 2Q1UA 2EF1A 3H9EO 3WWYA 1ZK3A 3BA1A 8LDHA 2YUTA 1NAHA 3BMNB 2HQ1A 4C4OA 3EUWA 4CR6A 1F06A 1ZKMA 4R9RA 1NVMB 2BFPA 2E4AA 5EESA 1RJWA 5IZCC 3M1LA 4TMFA 1P0FA 4E2ZA 3DMTC 3ZWYA 2HLPA 2GN9A 4XEHA 4E12A 5H81A 3CKYA 4BMNA 1F0YA 3U0BA 3SEFA 2EIHA 3NTQA 2FSVA 4BNNA 5L4NA 1KERA 4Q3EA 3I4CA 3U49A 4P8RA 3FNEA 1CDOA 5CDYA 1LDBA 4NBTA 3W4IA 3L6DA 5CPFA 5FFFA 4J2OA 1GY8A 4IDFA 4CR8A 1EMDA 3CXRA 3GC6A 3PJDA 2F00A 2ZYGA 4EJ0A 4XX0A 2X8LA 3TL3A 1UDBA 2SCUA 1AE1A 1WZIA 4BMVA 5JY1A 3JYOA 2EP7A 2NU7A 1EFKA 2ILTA 3I52A 4BO7A 5ENVA 5A3JA 3AU8A 5JO0A 3PXXA 4N54A 3K92A 4ESOA 3RU7A 5CDGA 2FZWA 3JQAA 1E1LA 4A73A 2BFMA 3TFOA 4BO2A 3GZ4A 3DZGA 3EZLA 3OM9A 3PJEA 1IHXA 4IJVA 4F6LA 4B3HA 2C2XA 1PU2A 1JVBA 3RD5A 2POQX 3ZDFA 4OQZA 1EVJA 3ZNNA 2DM6A 1DB3A 3HDYA 2B37A 3ENKA 4HFJA 1I01A 1QORA 3MOGA 4GX2A 5FEUA 3OJ0A 7ADHA 2OGUA 2P5YA 3GFBA 2YJZA 5CEJA 1A71A 3E48A 3VH1A 2RIRA 4I5FA 4XIJA 4F46A 3L4SO 1NASA 1RKXA 2BRUA 2PKQP 3AU9A 3GNTA 3JD2A 3JSAA 3RASA 4IS2A 3JD0A 1KVUA 3MWEB 4RQUA 5K6AA 3RWBA 4AG3A 4EJ6A 2PZLA 3SBOA 2ZIZA 2BH9A 3L4BA 4NU5A 1SB9A 3GRKA 3RBZA 3TOXA 3ZWOA 4N5MA 3JQAB 4AJ4A 5AOVA 2QX7A 3BMCA 1LDGA 4GBJA 1EQUA 2TMDA 4Z9FA 3AI2A 1X7DA 4KWIA 4E5MA 3NKLA 1C0LA 1WDMA 1U3TA 4W82A 3JQFC 1HYEA 5BSFA 4WNIA 4JJFA 3K9QO 3WQSB 4M49A 4JBHA 4ZICA 1I3KA 3B6ZA 3ONDA 3Q2IA 3NAQA 4RZHA 5FWNA 3NYWA 3F47A 2HMVA 3N58A 1BVRA 2AE2A 4EBFA 1T25A 3QVOA 4A2CA 4OQYA 3JQ6A 4DYVA 1VKOA 1YJ8A 1N2SA 4U6SA 3OQ1A 1I2CA 1C0KA 1L1FA 3UW3A 2FPPA 3NJ4A 4GSKA 1SAYA 3H9JA 3LU1A 1WMAA 1Y6JA 2FRDA 4Y98A 3NDRA 1NXQA 4KDFA 3BMCB 1UH5A 3JQ9A 4LCJA 1MC4A 4FFPA 1P1JA 3ZHYA 1EVYA 5TT0A 2JHGA 4GVXA 1ISFA 3KYDB 1Y8RA 3PQDA 1SEVA 5T57A 3A9WA 5THKA 4PLHA 1PZGA 4WK6A 4ZQEA 5B1YA 2AG8A 3H7AA 3IOYA 4IDBA 4NFSA 1P33A 3PVZA 4BGUA 3AM5A 2D8AA 1B7GO 5BNTA 1QV7A 5JNLA 3ITDA 3FBGA 2DPGA 5JC8A 2VNAA 1B14A 3STHA 3FSRA 4M87A 4CMAA 1I3LA 1ONPA 5DBFA 2WD7A 1UDAA 3FPCA 4PVDA 3DONA 1O89A 1G0NA 2NUAA 1WPQA 5AYVA 1Y8RB 2C5EA 1JDJA 3AY3A 3GZNA 2JAHA 1YB1A 4JP3A 4L75A 1I8TA 1MFPA 1YWGO 2VTEA 4EUHA 5A5FA 1U3UA 3ETDA 1YBVA 4NFYA 1X14A 4GWKA 3C1TA 4EJMA 3S1LA 2V65A 3DOJA 3AFNA 4F45A 5ILGA 4JN6B 5KVCA 2C82A 4OXNA 1T1RA 1V35A 2VT2A 2ZQZA 4FW8A 3W4JA 3AY6A 3RUDA 3SJUA 1JVSA 1PGOA 3AUSA 2C20A 3SC6A 3TSCA 3ABIA 4QQRA 1NX6A 3CE6A 2YDXA 3GGPA 1DLJA 4HBGA 4XQCA 3GPDG 4EYEA 3I1JA 1EUDA 4IUYA 4G81A 2EP5A 1PJQA 2WD7B 4UVEA 4XJTA 4CM9A 1E0DA 4ZN6A 2ZYDA 2Q99A 1MG0A 3DAPA 4W7IA 5KKAA 2XXJA 3SXPA 3AOGA 3BHJA 3KYBA 3Q1LA 1BXGA 2RAFA 2JD1A 2FHSA 4FN4A 4UVHA 4D42A 2EKLA 3KYCB 3B1JA 4N18A 4DQXA 2XF8A 3ASUA 3DFUA 3AFMA 4ITUA 1IOLA 4ILKA 4LRTB 2OXIA 3RJ9A 4IDDA 4BQPA 3I9JA 3ZWNA 4CUZA 1VSUA 3E9MA 4GSLA 4RORA 2NNLD 1Z7EA 1NBOA 3K96A 1Y9EA 2H9IA 3QV1A 3RQSA 5L51A 3GF4A 5DF1A 3FCOA 4E5NA 2ZTLA 4OGWA 4NK5A 4Y6PA 1CQJA 4PG8A 1NR1A 1LLCA 1JKIA 1I24A 4YWJA 3E82A 2IE0A 1EK6A 2JCVA 1R0SA 3QLJA 4UREA 3RUAA 4BO0A 4WEOA 4IMRA 1BXGB 2IODA 2VRCD 1A7KA 5L95A 4UVGA 4CLOA 3TF5A 3OP4A 2I66A 2GR9A 2WD8A 5CG1A 5IXYA 3WIEA 5KJCA 1HKUA 4A10A 3WGIA 3WJ7A 4M8SA 3GQVA 5FYDA 1XA0A 4GPD1 4B7XA 2HCTA 4BIIA 3OJFA 1FDUA 4RVDA 2IZ0A 3GNSA 3OH8A 4EI2A 2I3AA 4U7WA 1T24A 5HS6A 1Z82A 4LGVA 2B83A 4B3IA 3PDJA 2B4RO 2NU9A 2RHRA 4UEJA 3ZV3A 1EEHA 4YPOA 1OC4A 1YRLA 3PQEA 4FGWA 4PG5A 2AQKA 4OOFA 2VHZA 3F1KA 4HFNA 4JJGA 4R3NA 3TOZA 1H94A 1HE4A 4HKTA 1C0IA 2VWGA 4LMPA 1D1SA 5T8KC 4D3FA 3IKVA 5DULA 4BKOA 1GDHA 5I9NA 4LSMA 5C3MA 3I9MA 2X86A 5F5NA 1HDZA 2AQIA 2HAEA 4BL5A 4DBVO 2O3RA 5MDHA 1LJ8A 1P1KA 2NU6A 4OIMA 1ZSNA 4QO8A 4NFHA 3LC1O 4II2A 4AJHA 1VSVA 3S2IA 4I1IA 4FJ0A 1UP4A 1RM4A 4W9NA 2ZATA 1DAPA 2DVMA 1BDBA 2CDCA 1GTMA 3GLQA 1UXJA 2QRJA 1E3SA 3OHSX 3N74A 1AUPA 3EZYA 1UZLA 1GEGA 4PLGA 4Z3KA 3TPCA 2VHVA 3UOGA 1MXHA 3B70A 3WGZA 4ALJA 5F1PA 1E7RA 1V3UA 3NJ8A 1VPDA 4R01A 2NADA 1ZJZA 4I5GA 4PRKA 5IZ4A 5A02A 1HEUA 3KETA 1QV6A 3UCXA 2DTEA 2VZ8A 1CERA 2PFGA 4D0RA 2YY7A 3I3OA 3UH1A 4JCOA 2CSUA 1I5RA 3TL2A 1YE3A 2UAGA 3QWAA 5G0TA 1G0OA 1QYVA 2VYVD 5U1PA 3I9NA 1SZJG 5COBA 3BTVA 4Q3BA 3BAZA 1BG6A 1IE3A 3HN7A 1LDMA 4S3MA 3ZH2A 4H3VA 5C7OO 4MVJD 4U5QA 1Q7GA 2C7VA 3BIOA 6ADHA 3JQGA 4TRJA 1YL6A 2CY0A 4R54A 5T67A 3BMQA 1BW9B 4CJXA 4CUKA 4IXWA 2AMFA 3G3EA 3I6IA 3V8BA 1LRJA 2Q4BA 4PLVA 5GZ1A 4BNWA 1ZXBA 1RPNA 2Q50A 6LDHA 3PP8A 4N5NA 3PWKA 4NBUA 4TZKA 4RF4A 4MPDA 1LDYA 4CV1A 4MVJP 1QXSA 3GEDA 2X0NA 3U09A 1KC1A 2I3GA 3QWBA 3SC4A 4CLRA 4YDRA 1MA0A 3WGGA 1U8XX 3LT0A 3NV9A 2BFAA 1X1EA 4PG6A 5J23A 1OFGA 1E7MA 3PFWO 3LVFO 4GI2A 3E9NA 3JQGB 1E3EA 1A9YA 1VM6A 4WASA 3TJRA 1P0CA 4BNZA 3I6QA 1F8FA 1FXSA 2HK7A 4B4UA 1TT7A 4ZQBA 1YO6A 1WW8A 4A7PA 4BKPA 3VTFA 3RU9A 2Q46A 4NBRA 4GKVA 1HYGA 3CSDA 1CEQA 1KVRA 3IJRA 5ITWA 5DN9A 1DIRA 4A03A 2WSBA 4XGKA 3A06A 2FPGA 3K73O 1TB4A 3AM4A 2IRWA 4E21A 4PLTA 2D5AA 1BWSA 1MXFA 1FDVA 1U9JA 2ZB3A 4R16A 4NI5A 4B79A 3R1IA 5TLSA 3OBBA 5THQA 1UXKA 1DRVA 2PH5A 4UEOA 3JQ8A 4YT2A 4RDIA 2Z95A 3ZWWA 4NJOA 3PHJA 1N1EA 1LC0A 3ROMA 1DEHA 4NQZA 4XRGA 3D5TA 4BNXA 2NU8A 1KEPA 4QECA 2O4UX 2PLAA 1N7GA 1R66A 1XYGA 3K5PA 5K6AC 3E03A 1V3VA 1Z7BA 1HDOA 4WE3A 2FR0A 2LDXA 1OMOA 4R1NA 3L4BC 2RHCA 1EE9A 2YQ5A 4PRLA 1DFGA 1R4MB 5ENDA 3LQFA 3O4RA 2YV2A 3H5NA 1ZSYA 1HDGO 1DJNA 4DPKA 3V1TC 4U6QA 3JQ8B 3WOHA 4CM6A 1R12A 2C7GA 3I5MA 4ALKA 2AEMA 1GAEO 1BTOA 3WQQA 4WKGA 1YONA 4RO0A 4TSKA 3TWOA 3HN2A 4PZDA 3WSVA 2PGJA 2BGLA 4L74A 2GASA 1U3WA 4JLWA 1XWFA 1H0KA 2ET6A 2O48X 3OJEA 4XD2A 5IDWA 2J6IA 3K31A 1PJCA 4UEKA 3ON5A 4XR9A 1DC3A 4CLDA 3DR3A 5JCXA 3KVOA 4N7RA 4YAGA 2ZTMA 4ZA2A 3WWZA 4BB6A 2QZZA 2DTDA 1KYQA 4RCVA 4TRNA 2IYOA 4O1MA 3ASVA 3JQ9C 5A9RA 1UP7A 4K26A 3JQDA 1PGJA 2DAPA 4JXKA 1M76A 4D43A 1HE5A 1E6EA 3IP3A 4IPTA 1C0PA 4P22A 3U4CA 3IKTA 2WTBA 2G1UA 4UVDA 3VVCA 1C3VA 3OECA 1S6YA 2WYVA 4IQGA 4IS3A 4NHEA 3CIFA 3Q11A 4FC7A 4YB8A 3LF1A 4RLSA 4CMGA 5GMOA 2C59A 3WICA 1H6AA 3OA0A 4J0EA 4B8WA 5H83A 1VJ0A 2JD2A 4NU6A 3ADOA 5CEFA 3NEPX 4LN1A 2PD6A 4NBVA 4AVYA 2EG9A 3VH2A 1GZ6A 1K3TA 1DSSG 2EV9A 1UAGA 2A35A 2WEKA 1VKNA 4XRRA 4C7KA 5I7FA 4AJ2A 1YBAA 3FRJA 1ZW1A 2JD0A 1CYDA 4E33A 1Z45A 2AG5A 3QIVA 1UXGA 3LZ6A 2H5LA 4B7UA 3EW7A 1SCUA 3EVTA 3N7UA 3RFVA 3OIFA 1YB5A 1R16A 3RC1A 4MO2A 4HFRA 1Z75A 4MDHA 1H93A 1N5DA 2P91A 4CMJA 4MVJH 4YAKA 4TWRA 5BQFA 4AICA 4ALMA 4YACA 1GZ4A 2D1YA 3M2TA 5B4UA 2V6FA 1QYCA 1V9LA 2YDYA 2HMSA 3I83A 3INTA 3ONFA 3K2BA 3WNQA 3WFIA 3D4NA 1ISHA 4WCFB 4ND5A 4IM7A 3ROPA 1ISJA 2JL1A 4CMEC 3RUFA 4Z6KA 2WWRA 1B8UA 9LDBA 3TZ6A 1SBYA 2YFQA 1M75A 1RYDA 3OETA 3P7MA 3PFFA 3GH3A 4RVSA 4XJSA 4K1LA 2B4QA 3E5MA 1IPEA 4WNCA 2GZ2A 1EDOA 3UXYA 3DBVO 2PA3A 1AGNA 1ZFNA 1VC2A 3PZBA 4PLYA 3HDJA 1I32A 2DU8A 1YQDA 3L07A 3WGYA 3G49A 4R5MA 1EQ2A 3WMXA 1I30A 1KY5A 2WMDA 4WEQA 2Q2VA 3PYMA 3CINA 1WDKA 4IJWA 3VTZA 1A7AA 4Q3DA 5L7WA 1I0ZA 5I8WA 4MKXA 3TZCA 1P1FA 3KOUA 4DC1A 2VUTA 3WTCA 1DOHA 4OYRA 2X7HA 3H9UA 4RPJA 4HV4A 3MEQA 4I08A 2RH8A 1XDWA 2FMUA 4P4GA 2VUUA 3DAGA 3R0IA 2Y0CA 2GRAA 2V7PA 3NT5A 3RUCA 4E4YA 5IXSA 4X54A 4D46A 3AWDA 4M1QA 1NR7A 4K28A 1CRWG 3BTOA 3PTZA 1O9BA 3FBTA 3NDJA 3CTMA 3OJLA 2IEDA 2V6MA 1WMBA 3ANLA 3GVXA 1HXHA 4QT0A 2HMUA 3TZHA 1NPYA 1P45A 2GF2A 1FDTA 1QYDA 2I99A 1XQ1A 2IZ1A 3OFSA 2G76A 3CUKA 4IDGA 3ZU4A 3U62A 2CZCA 2J3JA 3M2PA 3DO5A 4WOKA 2YFHA 3GDGA 4L4RA 2A9FA 5DCYA 5TRTA 5L4LA 1ZK2A 1T4BA 4J9VA 1LSSA 3PGXA 1O8CA 1WP4A 3LT2A 3RBXA 1F12A 2J5KA 4YXFA 3FWZA 5JDIA 1D3AA 4JGBA 4CLXA 1K5HA 2Q4EA 1DLIA 4RPKA 1O95A 4RF5A 2OP0A 3C24A 3ZW8A 1SOVA 2AXQA 4NH4A 5LDHA 4CQMD 1ONOA 2Y1EA 1YVEI 3QW2A 4INAA 2DKNA 2DPHA 4DLBA 4M54A 4IJKA 3MTGA 1JAYA 3DWFA 3GPIA 5G0UA 1D8AA 3CZRA 4FJ2A 4O0LA 4E13A 4RJTA 1BMDA 2B69A 1XG5A 2PTGA 2VYVA 4CM8A 2NQ8A 3ANMA 2QQ5A 3WGQA 1XR3A 4OAQA 1IYZA 4IIVA 4H7PA 1KIFA 2ZB4A 4W9NC 1YL5A 4B4WA 4J2HA 2C2YA 3ZHXA 4IJUA 1Y5MA 3RCBA 3ST7A 2VWHA 3RUIA 1OBFO 4XYEA 4XKJA 5IJZA 3DXFA 4DL9A 4FFOA 1CJCA 1PQWA 3FNFA 2Y99A 4U8GA 1VE9A 4BNUA 1W8DA 5JW6A 2OO5A 4CM3A 3KYDA 2UVDA 1PS8A 3QWIA 1K6IA 4K6CA 5DNAA 4OHUA 5IDQA 5AXBA 2B5VA 1H2BA 3K2EA 3VPHA 2NVBA 1W73A 3D7LA 3W8FA 3HDQA 3V2UA 4I9NA 4CM8B 1ZEMA 2Z1MA 1I2ZA 5JPIA 3C7CB 5I8ZA 4CL3A 3PHLA 3H4VA 1FMCA 3IUPA 1Q1NA 1HT0A 5JAIA 2O3TA 3T7CA 2OMEA 3F5SA 3ETGA 2VHYA 3VKUA 1UZMA 2B36A 3GVIA 1QKIA 1LLUA 1WAMA 1YGYA 3JQEA 4YT8A 3UN1A 4E2WA 1KOLA 2V6GA 1M66A 2IXBA 1T26A 3JQCA 4YJGA 3PRJA 4XB2A 1K6XA 1PL6A 3K6JA 3RKRA 4UUMA 2P5UA 4KTVE 3ZWXA 1E7SA 1PGQA 3HG7A 4WLFA 2WYWA 5MGBA 4XYGA 4A26A 3R3SA 1Y7TA 3W8DA 3GAFA 4GMFA 3X2EA 1SNYA 4LVUA 1WNTA 3IDSA 3IUSA 1ENZA 3CMCO 4DMMA 4MIOA 3DFZA 1GV1A 2PH3A 1ENYA 1Q7CA 5LC1A 4HY3A 3RROA 4F6CA 1QRRA 3DHYA 2I65A 4YYZA 2GZ3A 4YCAA 3O8QB 1UUFA 3HE3A 4WOJA 1TVEA 1E1KA 3H3JA 3JD1A 4YJGB 4NR0A 5KTKA 3AJRA 4BNHA 4MVJE 4QX6A 3VZQA 5EERA 4BVAA 1IL0A 2BF7A 3HZZA 4BV8A 1GFSA 1FDWA 2Y0EA 1H6BA 2GNAA 4FOOA 2X23A 3KYCA 3G79A 3DOOA 5BSHA 4G2NA 3KBOA 3VDRA 2UV8A 4PIVA 3V1YA 3DZBA 1PJBA 2GSDA 4YJHA 2Q2WA 2AQHA 1OC2A 1BSVA 3A4VA 3DMYA 3H6KA 4DWVA 4ALNA 2FR8A 4XQ9A 2JKVA 2Q2QA 4J7XA 1MFZA 5HA5A 1XU7A 3JQ7A 1DO8A 3DTTA 4PN3A 3PI7A 3PQFA 1T2FA 2AQ8A 4OKNA 4WLVA 4D3SA 2G5CA 3G17A 4YR9A 1U5AA 4I9HA 3K30A 2EERA 4DIFA 1DRWA 3IS3A 2ZTVA 2VZ9A 1GYQA 4JK3A 3INGA 2DUUA 1GL3A 3I9LA 5LCXA 1J6UA 1CIVA 8ADHA 3ULKA 3KXDA 4XDZA 2EW8A 2RCYA 3EK2A 4KQXA 4AJOA 3JQBC 1YKFA 1IZ0A 1E3LA 4LISA 1ONNA 4YJHB 4J1QA 3TDKA 3FTNA 1WZEA 4CMHA 1GPJA 1HL3A 5I7VA 3DQPA 3QA9A 2J8ZA 3JQ7B 5COAA 5KOIA 4JROA 4OL9A 3PYLA 4BNKA 2HMWA 4DGSA 4CMBA 4XDYA 3JYPA 5L7YA 1Y81A 2O7SA 4FIZA 4BO4A 3ZNPA 3I4FA 2W90A 4XGIA 3W6ZA 3CZMA 1NHWA 2CF5A 3WYBA 3P5SA 1A27A 1Z6ZA 2EKQA 4BUCA 5IN4A 3X2FA 3IAHA 3QVWA 1DDOA 2YV3A 3MCVA 2YHIA 1UJMA 5DCWA 4DXHA 5TQVA 4EUFA 4TVOA 2XPCA 2VYND 3FPLA 1OI7A 1QP8A 5BNIA 4EUEA 1R0LA 3WGHA 3QHAA 2B0JA 3PLNA 4HXYA 1YBMA 5DOZA 5TC4A 2WDZA 4KUGA 5CDSA 4TROA 5HTOA 3L9XA 2IDZA 3DMTA 4GVLA 1E5QA 5BSEA 5G0VA 5L40A 4CM4B 1UXIA 4BGVA 3JD4A 4FFLA 2AW5A 4IINA 1E7WA 1U5CA 2VCYA 4PCVA 3F9IA 4Z3DA 4BNTA 4XYMA 1LUAA 5EQFA 1NYTA 1MP0A 4DLLA 4BNVA 4DTIA 3PGJA 4PG4A 1SOWA 5F21A 4L9RA 1T4DA 2YHIB 3V1UA 4QTZA 3PHHA 1GCUA 5IG2A 1PZHA 2E6UX 4FCCA 2TMGA 3INRA 2IEBA 1MLDA 2YHUA 4DPLA 4L73A 3ZHZA 2Z1NA 3C1AA 3QVXA 4MP3A 2H1SA 1D4FA 1X15A 3GMSA 1R4NA 2FPIA 2WE8A 4YJDA 2PK3A 3C7AA 2W2LA 3CEAA 3GDOA 3UKOA 3ZV6A 1SO8A 5HM8A 3WDSA 4DRYA 2DBZA 2OUIA 1VLLA 3KLMX 3GGGA 3G1UA 3Q3CA 4GX0A 4AL4A 4HUJA 3JD3A 3FN4A 1R37A
chains in the Genus database with same CATH superfamily
5I9LA 2HLDA 2FPXA 3AI1A 2PU5A 3NBAA 4H31A 5HDQA 5SYNA 4YRGA 4R2MA 3NVMB 3GP8A 4B3JA 1YRYE 1LDNA 1R0KA 2B1RA 5C80A 3F5DA 3W5JA 3L82B 4BGDA 1VMAA 5B4VA 3B1KA 1U63A 4TTAA 3QYJA 3HKCA 5GOZA 3WLPA 3WXMA 4MA5A 4CR6A 4OGFA 4FWTA 3TSWA 2FDCA 1ODIA 5HRAA 3G0CA 1JR4A 4DNOA 4IEEA 4R1PA 3T5PA 1HORA 1R4NB 3TE7A 4E3WA 1UBNA 2WJ4A 3K5IA 5EWMB 1H4QA 3GUYA 1GQ2A 3JATB 3VR2D 4LX8A 1U7ZA 4J4BA 5EQJB 1E1MA 2XMPA 4L76A 5ALZA 1CETA 1BCRB 4X84A 3W2IA 3E1SA 3KT0A 3HQ4O 4IZHA 1JIQA 4J3FA 4DXDA 3CUVA 1ISMA 4OD0A 3X1KA 1TE2A 3G9XA 2MMGA 2C3OA 4W6QA 4LVCA 1FYDA 5HZGA 3IOCA 3O6VA 4KQ2A 1NMYA 2ODWA 1E4OA 5B5SA 2XA2A 3Q0EA 4M53A 4XXHA 5CBPA 2XNDD 5AH0A 5JWOA 2GF9A 3E7XA 3M4XA 2CXRA 4R3UC 1JA1A 2PQ2A 3BIJA 4DMHA 1E20A 2XMGA 3FCXA 1UBJS 5AYVA 3E18A 3IBSA 3IOBA 3KUUA 2YOHA 5KJEA 2QMEA 3HVRA 2OFWA 3OZEA 5A5VA 1T9GS 3BQ9A 4S1TA 4QQKA 3W3AD 3V7NA 3N0TA 5GJBA 4I8XA 2LTAA 4CPDA 2FMKA 1R3DA 2GWHA 4ZVLA 4CM1A 2I1VB 4GKJB 1G7SA 2PVCA 1RYFA 3WLFA 4E1VA 2G8LA 3BEOA 2R65A 4D8YA 3PJRA 2EW2A 2JFWA 1XQ9A 1WSDA 4M99A 2JIDA 4S1VA 1JWAB 3QJ5A 5ALIA 1JQBA 1SU6A 1Z74A 2FVYA 5DZSA 2QB5A 3FAKA 2H0QA 1AK1A 4R1UA 2HQSA 3IL2A 2LDBA 2BFDB 2CMFA 4XB1A 1OPRA 1J25A 2D5BA 3EIFA 5JMPA 2XZDA 5CBPB 4RD6A 1W581 4LXHA 1XDSA 4R3WA 2X5KO 4W7HA 3COVA 3GAAA 1I51A 1Z22A 1FDRA 2P9JA 4DANA 4JYCA 4KXNA 1T1JA 5JD3A 1R4AA 2IXAA 3P4YA 4D9GA 1GARA 1D6JA 2EAUA 1HKHA 2W2KB 3DDNA 4H15A 5CH3A 4YEDA 1EP9A 4JLSA 3V2GA 3Q0IA 4JWKA 3WS7A 1GL6A 1Z26A 2FR1A 5LLSA 4Z4CA 5KHLB 3PDCA 1OAOA 4PYNA 3C98A 3KKZA 5A4DA 4IGEA 1O95C 4Q4DA 2EJWA 5JXHA 4NCAA 1S2NA 4J90A 3JASA 1JLMA 3A1EA 4NPHA 4OH1A 2D4AA 5JQWA 3G2HA 1WUIS 1NVUQ 2HRRA 4K0RA 1NQVA 1NN3A 1ZN9A 4P1ZA 5FFMA 4IX1A 4HRVA 2OHGA 2RSLA 3EHEA 1BQ4A 4F92B 2WNSA 3A10A 1RE0A 4F4HA 2NO0A 3ELBA 1IXKA 1C5KA 1N9GA 4LA4A 1NJ5A 1ZJ5A 2RK6A 1GQSA 4A27A 1GZDA 1N2CE 4J0IA 1T2DA 2ZKLA 1J24A 2QP4A 4IQ8A 4G5GA 2OKCA 1V7PC 2BEUA 1RRGA 2R1TA 3KEOA 4HDMA 5CVVA 1COWA 3DE7X 4HF7A 2C4MA 2D8MA 2HF9A 1JPJA 1ZG3A 1VLZA 5DP2A 3LVBA 4FYMA 2Y3IA 3GEBA 2I62A 4MRAA 4BAGA 5I3CA 1UADA 5AXCA 3UB3A 3LDAA 3DBOB 1B3RA 2IVZA 3HCPA 2WJGA 4B76A 3P8ZA 4OH7A 1ECGA 1N7JA 4CM7A 1P4JA 5A6VA 1E79D 3L6OO 4QNRA 5B7NA 4OU5A 3ZWVA 1F7UA 3JASB 1UWKA 3L0DA 3PNOA 3HU1A 4MV5A 1GZHB 5DKFA 3WZMA 4ZYLA 3H87A 4MVJI 3HBFA 4FOPA 2OCGA 3E2MA 4FTWA 3ZY6A 4JENA 1X39A 2YN2A 3I9OA 2RAPA 3IAEA 3V7UA 3TLEA 4IX9A 3WLNA 4B85A 3L0BA 4C0WA 4H7KA 2GN6A 2OHJA 3F8TA 3UW1A 1JLLB 2EEZA 4HWKA 1NWHA 2CVPA 2DJIA 2QOEA 1I6WA 1N9GB 3C2QA 1HV8A 1ML3A 5ITVA 5J3JA 1XZDA 2B2NA 4K03A 2OEPA 4F86A 4I5IA 3HWX1 2ZUDA 3B13B 2BEUB 2R1TB 2NO4A 4HDMB 1SG0A 5LZ7A 2OHVA 1M0WA 3U3KA 3CX6A 3HHPA 3KZNA 2ZVDA 5JJ5A 3MWLA 1ZK0A 3RJ5A 2HC9A 3HSKA 1Y3BE 2CDRA 4UBJA 1EGQA 2NAPA 2VP4A 1Y3HA 1P1BA 3JQRA 5AJHA 2EDCA 5FUVA 1W88B 2FW8A 1TZJA 3NT2A 2PL1A 1AVTA 4OBEA 3SHTA 3VYTB 1NDQA 1RXVA 2H85A 4BC1A 3M49A 3DE4X 4PV7A 2TSYB 4Q1EA 3C1OA 3CRNA 3G8BA 3MF4A 4OP3A 4ID9A 2WSLA 3L92A 1L4MA 3MJVA 1Z39A 2VHXA 3U19A 1EGHA 4QTYA 2BZGA 3AZPA 3EY9A 3LJKA 1ZLXA 2VEOA 3AJDA 4FNAA 4GRDA 4OFXA 2I6GA 1Y3FE 2FY8A 3I23A 2WICA 3MJTA 5DMHA 3WJ2A 4QBKA 4TKLA 4G37A 4H77A 2QUZA 2RFLA 3QPUA 2FE4A 3C3PA 4MEJA 3TI9A 3UK1A 1TEHA 2VO1A 3II6X 2ISSD 2VJPA 1AB5A 3EVNA 4FBGA 4KRGA 1IM2A 5BSMA 3QSYA 1UZNA 2NV6A 5ADHA 2GN2A 4CKEB 1EJ0A 6ABPA 1CRZA 2XRMA 4HPXB 1QK3A 2EATA 2JARA 1BGXT 4D9NA 4DQVA 2ZYHA 4BJ3A 1XVUA 3GUUA 1E32A 4ND3A 1LZKA 4QZVA 3BB1A 2DQZA 4JJIA 4ALIA 3FVWA 4PZYA 3ANNA 1DDIA 1JQKA 4PLZA 5MN5A 1SVKA 2PLFA 5FBRB 2JLCA 4OHVA 4GOMD 4LRWA 1P31A 5TX7A 1QU3A 1Q1GA 1Z56C 5KNCD 3EA5A 1C2YA 2V6IA 2GD1O 3ET4A 1OWOA 4RDHA 5AJVB 2AFHB 3L8HA 5FUWA 2E7ZA 5T4EA 2J5RA 3WSTA 1ECJA 2C0CA 2X0RA 3FNHA 2RHHA 3DVLA 2RBGA 3VKVA 4BQFA 2DTXA 2WF8A 2H4HA 2WKRA 1CS0B 2HNBA 4JR1A 4RZXA 3FHJA 4TV8F 2P9GA 2FR8C 2J5BA 2G8NA 3HJNA 4KQ6A 3V6MA 4EL5A 1HDEA 4K8OA 3S8MA 5IAKA 2WK1A 2B99A 1QIJA 3GFRA 4Q34A 2E4UA 1MO3A 1R0WA 1EWYA 5M7EA 1PNRA 3VKHA 2WZQA 3UMJA 2XDWA 1QGUA 4C4XA 3FVTA 4LWQA 4B4OA 2YMQA 1MZVA 3GBVA 4NV0A 1I80A 1DOZA 4K7JA 4Y2XA 2P1ZA 1MW8X 3PKIA 1E6UA 1ZH8A 2PSSA 1QG6A 2JLZA 4RV5A 3U60B 3F3SA 4F5EA 1LNZA 1FBTA 1YC2A 1PJLA 3H1EA 4AYWA 3PNLA 4EITA 2DH6A 3UCFA 1JR3A 2R6R1 1X3LA 4OFWA 5BWOA 4YUWA 5BSGA 1GRQA 5GM2A 3I0MA 5C3UA 2V7WA 2C1EA 4LRUA 3AERB 3WMFA 1QC5B 3RFTA 4AUMA 5CMLA 2YS6A 3PIDA 3TN7A 4J8PA 3REQB 2QI9C 2QNIA 1IUKA 4PLCA 3TJZA 4EB6A 1Z2AA 1P2FA 4JOCA 3N2IA 1SD1A 2QQ0A 1L7EA 1ZCJA 1J90A 3E4DA 2UUPA 3I4LA 4JUBA 4KVFA 4DADA 4CI9A 2RBEA 2CXQA 3D1JA 1CRQA 5EMKA 4A6XA 4CF6A 1PQPA 3RF6A 1XIVA 3A04A 1QGUB 3IUBA 3QLTA 1M2VA 3SJZA 1HEIA 1NVAA 4QTUB 2QRUA 1PLJA 4YHBA 2A58A 1DC4A 5E2IA 3RB8A 2WU1A 4M8NE 5HTKA 1HYBA 2EZ4A 4KOEC 3K9FC 3BTUA 4BPRA 1UPCA 3OLQA 2ZBUA 1CUXA 2Z2ZA 2XYQA 1XD9A 1EINA 1KARA 1ZMBA 4JT2A 2R6CA 4YQZA 3IMEA 4WGFA 1FUKA 4J4HA 4TRMA 3LLSA 4KJZA 4LI0A 3P9SA 1KZGB 2PVPA 4GH5A 2GPYA 3NUGA 4OP2A 2P4QA 4OCZA 3DOIA 5C4MA 3EF1A 4AZTA 4A8TA 3D0OA 4XCVA 2WYOA 1VRVA 2P5SA 1D6MA 5LU9A 5M29A 4OREX 5EN4A 2I7CA 4G1MB 3W06A 3EC7A 1XJ5A 4C0JA 4UHEA 3T5TA 2H48A 2XHZA 4LBYA 3DBRA 2ZVPX 5J47A 2B3DA 2QS9A 2VG8A 1T5LA 5CH5A 3DM5A 1QFZA 1W7AA 1IWPB 3VNAA 4RY2A 4PTLA 4E1AA 3VPGA 5H82A 3HWWA 1SCQA 1F0PA 1XRLA 4DSAA 3F9CA 4H7JA 1U1GA 3IB6A 4B5KA 4RF3A 3UHFA 4OMDA 2HA0A 1IVNA 3G23A 3MJDA 4YROA 4W5JA 3CZ5A 2BHNA 2XTNA 5FH9A 2NPFA 2NTYC 1VJTA 2XW6A 5B1EA 1NU8A 1R0ZA 1IVYA 4RVGA 1J42A 4RHTA 1UWLA 2ZCUA 4YQFA 2ZQ5A 4BVJA 4R0MA 2VJNA 3ZG6A 5DNVA 4CEJA 4MV9A 3STVA 3G0HA 3DBRB 1JPNA 4WFQA 5FPSA 3CC8A 3VISA 1WD5A 3B5EA 1VJ1A 1OBOA 3HFGA 3D7KA 2XB4A 4R2LA 2PUFA 1I4DD 4X8HA 1C1YA 1ZBQA 1HYQA 1GHTA 1UMBB 2H63A 3PGA1 4N4AA 4U2KA 4CTMA 4V3CA 2BYTA 1JAXA 3GX1A 4P98A 5J59A 1F3OA 1IM8A 3A0UA 3KTDA 4WJLA 3SZLA 3Q9NA 4LW8A 3OQBA 1N5JA 1RVDA 1IHDA 1N6RA 1PNQA 2XMBA 4ZARA 5LBUA 1CR6A 4NAVA 2WJPA 1EP2B 1OLXA 1P3Y1 1WL8A 3IULA 3OLXA 2RGNA 3NXSA 4RQBA 1E6MA 4YI3A 5C81A 2DLNA 1L7AA 3MRVA 3OCUA 4RV4A 2REOA 1FMLA 5DPMA 5P8WA 5CYPA 5C0OE 1KAOA 3GDFA 5T5QA 4BHTA 1YAHA 4QYMA 4DMRA 3TMYA 4M9RA 1CB0A 1B6RA 4LYEA 3P52A 1ZR2A 3DWGA 4QIHA 2OZLA 1MB9A 3N2YA 2VBCA 3NI2A 1YFJA 2B1QA 4NESA 2F9FA 2LKDA 2J9ZB 1O5OA 5IARA 4EPXA 2HGZA 3U4DA 2O2SA 4L27A 4ZJYA 3SP1A 5EIBC 1E9FA 3EXHC 1QB8A 1JPVA 1H5QA 4KVGA 1N33B 3W90A 2Q5JA 4M89A 3WLEA 4FBMA 4KC0A 4BFSA 4CMCA 1D7OA 1E1DA 2WPNA 1PK8A 2PGLA 3BIWA 3HHEA 5EMLA 1DJLA 4BQEA 2Y77A 5F77A 1BMFA 4Q21A 1LRLA 4KLRA 4NIMA 2CHFA 3PWZA 4PTYA 6REQA 521PA 2PXAA 1IPHA 2IF2A 2R47A 2RHBA 3ENNA 3LF2A 3LQRA 2YC4C 5AP9A 5L53A 4FDAA 4DA9A 1SXIA 1RNLA 1LSUA 1UDWA 4FR2A 4TS3A 4DG5A 1I0LA 2WF5A 1QP0A 1ZXXA 3VTKA 1V37A 4W5NA 3NG1A 3TEJA 1DFIA 4X6XA 1M72A 3GIDA 2A78A 2IU3A 4RXUA 2OZLB 2IYTA 4BGEA 5A9SA 5G1OA 1NKVA 3DV0A 1EFUA 3ND7A 1XCOA 1Z4MA 3NDPA 5L3ZA 1RAIA 4BVEA 5BRNA 2EKBA 1A9OA 1ZRSA 2V7BA 2VA9A 4LV8B 1VE5A 2ZYSA 4RZSA 3HLTA 4HXEB 2F7SA 4UHKA 3TIXB 3E8XA 4MMZB 3HPQA 5K2MA 1OILA 3P2EA 1PVDA 4JBGA 3SZMA 4ZI7A 5LXTA 3FSGA 4YAUA 2XMRA 1L8AA 4G5FA 5BNFA 3QELA 4NBWA 1EDZA 4XUCA 5C37A 2A5FA 1DC5A 4UFOA 3GJQA 1JFRA 4IIUA 5FLXA 1JHRA 2HA6A 2DPMA 5IM5A 3A31A 3G88A 3KB1A 4MB0A 4D44A 4RVNA 1Y5NA 1J8DA 2M98A 5AI4A 3W0LB 2QW1A 3GAMA 4DLAA 1EVLA 5TNXA 5BRAA 4HZUA 3HM2A 4AWAA 2VP5A 4EZIA 2PANA 4LJLA 5C1DA 2O8EA 2IUTA 2QTCA 2X8BA 3DZKA 1E3WA 1N6HA 2I5PO 4OK6A 4RJJA 5FOXA 3VR1A 2SKCA 2B61A 3B1YA 5EPOA 4A8JA 4G07A 1T9GR 2HUNA 2R8ZA 2XX3A 3PPIA 3DV0B 3GLSA 3O9VA 1DJQA 4N7MA 1GA6A 3RVSA 4JYZA 4MDYA 2UYHA 3WWPA 1ECBA 2PRSA 4ZQHA 3RLFA 4BLOA 4P83A 1IPFA 2FMTA 3FPKA 4FM9A 3V32A 1U8UA 1EFLA 2QZJA 1U2GA 2YBDA 3NEYA 4IAOA 3RKUA 3CW2A 2BI7A 4AS1A 4ZI7B 2DQSA 2B94A 2EFGA 2YFKA 3DFKA 2BLLA 1BXKA 4LYGA 5KOHA 5HUJA 3O9ZA 1S9DA 3QELB 1OXTA 4MLPA 5D3MA 1CLUA 3CLHA 4KGXA 1QO9A 1BOOA 1S01A 4BLRA 1GADO 3MAAC 4RK6A 1GKYA 3QY0A 5DU2A 1Y1TA 1PWYE 3CURA 3MJSA 4H4EA 4TXLA 4AJJA 2V58A 4OMFG 1KMCA 2V45A 4ND2A 4K3VA 4KXQA 4OOEA 4Q93A 1V96A 1IZ9A 2C9MA 2QJOA 4QRHA 3BJIC 4B7CA 4AJIA 2VWPA 1P7YA 3HUDA 5JXJA 1AQNA 3QKSB 1E3WB 4JX8A 1Z25A 4DZZA 5AFSA 2CMGA 2XUJA 2QPLA 3BORA 1BKYA 2VKQA 1PJSA 2FSSA 4PQFA 4A8JB 4Q1FA 5FPHA 2A57A 5HK9A 4EF4A 4YRFA 3QTTA 3ZQJA 5K3FA 3F96A 1LX7A 3I01M 3GLHA 4MYTA 5HWSA 1KNQA 1L7PA 2CL6X 2J1LA 5TQ0A 2QX9A 4UBLA 1DIOB 3NEAA 3QFCA 3K4HA 4KFRA 1N0WA 4O08A 5ULLA 3D3EA 4TUYF 4WDRA 4I55A 4ZQGA 4C0QC 5KOHB 1UBKS 3WQRA 1QZ3A 3K94A 4EYGA 4LGYA 1J49A 2IDKA 5C1IA 3S55A 2Y6VA 4Q3NA 2DF8A 5D3MB 4LF7B 1OLUA 3KV3O 1TPZA 4CMEA 1JQLB 3QKUA 2FG7C 3ESCA 3ZLVA 3PJGA 1J56A 2PT6A 1W4CA 1W4ZA 3A37A 4FDLA 4MB2A 2C57A 3PIRA 1JV2B 1HE8B 2G36A 2N46A 2IZOA 3BD6A 3FVVA 1JEQA 2W4QA 3Q1KA 1Y4UA 5KHOC 3D02A 4WZBE 1TU3A 2CDBA 5EJMA 4EHDA 1EGAA 1JQAA 3W5SA 4WKOA 1AXGA 3GK3A 4KZPA 2V98A 4E0BA 1O7JA 2ZIVB 1M7GA 3IOMA 4LC1A 5H4HA 4C22A 4DV5B 2VHEA 1JLHA 3O8OB 1YC5A 4OGLA 1O6BA 2QVLA 5K3FB 4DMKA 2Z6QA 3GLHB 4WJZA 1QTNA 1RFGE 3ITEA 5TQ0B 1S9HA 1U0BB 3BBPA 3AR4A 3H97A 1D2CA 1TQ8A 3H5WA 2B35A 2HJ9A 2V4ZA 3U4IA 4R8MA 1G3RA 4R68A 2JFFA 2GLXA 4YJFA 1MD9A 1RW4A 1U6JA 1NZFA 3D0RA 4O2LA 5E3JA 2PSFA 5EINA 3V1NA 4NJEA 5KJFA 4MROA 3A6FA 4ZVVA 2CLDX 4QSHA 4PNEA 3VU9A 7AT1A 1OLUB 1M6WA 4JLNA 1BE6A 3I1FA 4K6HA 3PDIA 3UMCA 4PPQA 3B20A 1R6BX 4M76B 4XR4A 3C0KA 3QHQA 3B3JA 3RC2A 4DMFA 2WT9A 3R0ZA 3P96A 1BGVA 4AMYA 1YSCA 1DKPA 1N8KA 1XGKA 2NX2A 4I5DA 2ZXEA 3P2YA 3HB5X 3M4ZA 4G0VA 3L40A 4ZEVA 2G63A 3DM9B 4EAAA 1F8GA 4BJ5A 1B0AA 2CFTA 3CZ4A 3HXPA 4PAWA 2FWBA 1VMDA 4Q3CA 1SC6A 2IGTA 3ELWA 4C30A 4MV3A 4BNJA 4J6EA 4RTJA 1NPTO 1QFXA 4RQTA 5KNDD 4DR5B 3R9IA 3D4LA 1CJTC 2NXNA 4TMVA 2FPUA 4B0OA 1E69A 1L7DA 3S2ZA 3F49S 3FYUA 4A0RA 4C21A 3LCJA 4FWBA 1TFRA 5HMMA 4DM3A 1BHSA 3ORFA 5AVSA 3HCNA 1MX1A 3K35A 4S1PA 2CDNA 2FLWA 4YJFB 5JYDA 4HUQA 1JW9B 1NI5A 2ZSJA 4KE9A 1I6MA 4JASB 1R6VA 4MYHA 4NJEB 5HKLA 3RGWS 3SC3A 3VDQA 4Q1CA 4UXJA 3VU9B 3WDMA 2DWOA 4AZVA 4R2KA 2IYRA 3BXFA 4AF8A 4M9CA 2QE7A 1PJ4A 2BHLA 5JMWA 1TJPB 5D8DA 2QNBA 3VC7A 2N1BA 1HDYA 1ULSA 4A1OA 1PGPA 4LXTA 1Q22A 3GMDA 2ZE7A 3RYIB 3LZCA 2QYTA 4K86A 3ETEA 1P72A 1UBCA 2QRPA 2GHTA 3KJIA 2DUWA 2G3YA 5AXAA 4DIBA 5CDFE 1JIKA 1WUHS 3KVNA 4TZ0A 3G5AA 3MMPA 2I2DA 2R6JA 3R40A 4FSXA 3L46A 3DP9A 1YQWA 1CJKC 4J49A 3OZBA 5LU8A 5DHRA 3OM8A 2BFBA 5B1IA 3E53A 2PPLA 5C4GB 1J2UA 2Q3DA 3DT6A 3FYUB 1ADGA 3NHJA 4HEHA 2G7MC 2XQKA 4N0EA 3AUAA 3MBKA 1MJNA 3WYEA 4BFTA 3R6LA 3TIGA 5C1BA 2BDUA 3ZDZB 5ESWA 1XD8A 2ARKA 2P9EA 3EH1A 4GP7A 2NSHA 3CNOA 3G5MA 2E49A 1GVHA 1L8XA 4RKWA 1Z08A 2MSCB 2YJNA 3AFHA 2ZUEA 2CL5A 1TCCA 2R00C 2HA7A 2GJ8A 1N5KA 2TMYA 4G1EB 1NDHA 3LMKA 3JWJA 2VTDA 3PPWA 2GAJA 1ODFA 4X97A 4CFZA 1DCKA 3K0CA 1IONA 4RFLA 1JN0A 1P4GA 1YOVA 1ZWKA 4ZT6A 3S5JA 1VIVA 3TVDA 2Y2VA 2C5SA 1VHJA 3AR8A 4FR5A 4WZAA 2PKXA 1MZPA 4RANA 4TVKA 9LDTA 4GBMA 1UT8A 3IKMB 3TZEA 5J4VA 3QTLA 1RCTE 4HAIA 2JDID 3HLKA 4AKTA 2OK7A 5AVRA 4G41A 1N3YA 1UT6A 1EXNA 1QANA 2O0MA 3AP1A 1P75A 2PLNA 4PZ9A 3T4XA 3W79A 2CMDA 5ALFA 4BN5A 1FPQA 1GUDA 3D3JA 4X1OA 3V55A 2PSDA 4OHWA 3BH6A 5ALKA 1YF3A 3FTEA 1ZZEA 2XTJA 1WB5A 4N3GA 5CFZA 3OEHA 4K87A 1NNI1 4OP1A 3T1QA 4DJFC 1GGEA 1EYZA 2YH2A 4RSMA 5FR2A 3TNDA 3NOOA 5TMPA 5LD2B 3IEVA 3OIUA 4QU5A 1ITZA 1EDDA 2X2EA 4LS3A 5JDCC 4JNCA 1KPIA 2RK4A 3KJZA 4Q9IA 3IAAA 2VBGA 5EE9A 3VPSA 2PR2A 4D81A 1TXGA 2AXPA 1WJGA 1JMKC 3PT5A 3DKIA 1V6CA 1T0BA 3OIGA 4J3NA 1V5GA 2EX1A 1Z06A 3EEOA 1E8DA 3PA6A 1YZQA 3ORSA 2PKYX 3PXDA 1YOVB 4KPUA 3LK7A 4U0KA 2QRQA 4Q1VA 1GTRA 4TT3D 2DUMA 5FBQB 4IWYA 4WZAB 2JJYA 3FWNA 4ZV7A 2W6QA 3D8TA 4GR5A 3IEKA 1TU0A 4EHLA 3IBGA 4R1QA 4XPIA 4GGMX 3A4LA 1E3DA 2C7PA 5BV2P 1SOAA 2O3JA 4EEZA 2C8LA 4LWOA 3ZIAD 4E07A 1L7RA 1B4DA 2D7JA 1WZCA 3BCRA 3D7NA 3FD8A 4AJ9A 1Q0ZA 3OZ7A 2CV2A 4URZR 2B7LA 5A06A 1N77A 1Z5VA 5GGYA 2G1PA 4W4TA 2JCBA 3BL5A 2PWZA 1KK2A 1YHNA 4OGKA 3ZD7A 2YS7A 3GG2A 2QMHA 2O2EA 1QKKA 3PNPA 4V0NA 4CVNA 3OY2A 3E9QA 5CB0A 2XUFA 2ZRMA 1XCBA 4XAQA 3BMQB 3KKQA 4YCLA 2QY6A 3H9QA 4DXAA 2MU1A 2VSQA 4KPUB 3EGWA 5E1MA 2P4HX 8GPBA 1U9YA 5LDGA 3OOWA 1CNFA 3O92A 4R31A 2ZJYA 4GQAA 4EDHA 4ZT2A 3FA2A 2B0CA 3OKFA 2WZBA 1PP4A 2FQWA 1QDLB 3HZOA 4TL6A 1QQ5A 5IAAA 1DHTA 4OUKX 1AMUA 1BA2A 1Z2CA 1IN7A 3BWVA 2NYAA 4LSWA 4RZ2A 4QHSA 5SYMA 3UICA 4P31A 5CA0B 2PY6A 1MO5A 3AHDA 4F2DA 2QVBA 3VC2A 1CZLA 1OZHA 3R3JA 4I0WB 4QWWA 5F7XA 3A9VA 1N5LA 4EMUA 4WBNA 1XMQB 4RD4A 5A71A 4CLRB 4ZVOA 2IL1A 5JZSA 4V1CB 2GJSA 4B75A 3GMIA 5K9ZA 2C83A 3F4LA 2CFIA 1JDVA 1KJ9A 2OFXA 3A1WA 5EWJA 9GPBA 1XWWA 2HSEA 2DFDA 2DR0A 1R9JA 2GCOA 3ZI0A 2F59A 1JIUA 2KE5A 2VN8A 5C32A 4HRYA 1C9JA 2ZJ1A 3FNBA 2NTJA 4RD2A 4GGPA 4ZDWA 5KWSA 2XLBA 1J0XO 3KWJA 1SMKA 3WB1A 2QA5A 4C06A 1TRHA 2PG3A 4BBAA 1BFDA 2SNIE 3FR7A 5BN4A 3PR1A 1J9EA 1YZNA 3ONNA 2B4TO 1DQNA 4PAOA 2D0IA 2PQMA 3FGOA 4YRRA 3TDMA 1SCIA 3QFFA 4AAYA 4UTPA 2GCGA 3IVCA 5DNDA 1P2VA 2HREA 2NXJA 2Y1WA 4B3FX 3JQBA 1GG9A 1YQXA 4DBLE 5BY2A 1C4XA 4YX9A 1ESCA 3A4YA 1VZ2A 3IVRA 3PLRA 4IDEA 2CFCA 3OQOA 3N5CA 5EWJB 5HP4A 2Q3JA 1DAOA 4AX4A 2C4UA 2XE7A 2MHCA 2FW9A 3BYZA 4N76A 2UYYA 1KRHA 5DGDA 2QX6A 1P77A 4LNUA 4Q16A 4ISCA 2IY8A 3CR7A 3M1YA 3AW8A 4PO3X 4Y2JA 1KGDA 1H1TA 4F6RA 3H2ZA 1NVEA 4YT5A 2BJWA 2Q2NA 4A1FA 4ETNA 1N5RA 2ZRKA 3Q2OA 3QEJA 1HDCA 3L0YA 3N2ZB 4MINA 3RODA 3L5KA 1C80A 1SXGA 3EEIA 4KKXB 1QWSA 4UTOA 1WEHA 4V24A 1LLFA 5BN4B 5F2NA 4G26A 3EBLA 5HQJA 3JYQA 5CXSA 4A0SA 4YT4A 1Q0HA 1BD3A 4KI7A 5KYWB 5EJ4A 1SEPA 2IXFA 4D0SA 5A4KA 3RSCA 1YMVA 3NCHA 4RVOA 3CWZA 5KYGA 3O2SB 3EYAA 1G1AA 1AUOA 1I6LA 1GQYA 1KS2A 4CEIA 4WLNA 4N3BA 1XLTA 5EL0A 3AEUA 4HTFB 2MT9A 4HDRA 3VC3A 3JALB 2OHOA 2ZJ4A 1LVHA 2QZ9A 3FROA 4OHOA 4TSFA 4OX9B 3V2HA 4EG5A 2QW0X 3QWFA 4BOYA 4O3MA 1NVGA 2FOIA 1JJFA 5H3CA 3QG1A 4JLKA 5TF4A 3SR3A 2LCFA 3CEJA 1P61B 3IBCA 4ZOAA 4F9GA 2AUMA 1Q7EA 3LUBA 4QPCA 3CVXA 3RAEC 4DREA 3VKUA 1PV4A 3AOEC 2DUNA 1RI3A 3HB4X 4KN5A 4RV9A 4BZZA 5ICSA 5K0SA 2JFUA 3GRYA 1H2RS 1KS9A 3K9GA 1YU6A 1X7YA 3ZNQA 3U6BA 4H6PA 1QQ7A 3L8MA 4KWCA 1PEAA 3V3KA 1WZ2A 5K0BA 2P6PA 4HDCA 3N0XA 2EWWA 3H8SA 4DWWA 1XF9A 4X8MA 2PBFA 1N3IA 4BV3A 5J58A 5KQMA 3VA7A 1SVIA 2HKIA 2PQ0A 4L4XA 4S1OA 2C1ZA 3E3AA 3U7EB 1QPZA 3K1YA 4L08A 1KOJA 2GN8A 2WA1A 2IYAA 4JIGA 3QE0A 5EOVA 5E7IA 3BFPA 3S2GA 2J45A 4EFLA 2WQ6A 2AEFA 2AJDA 1HE3A 3EMDA 3HDGA 1DMRA 4ZANA 5EE1A 2ZXUA 3ZH9B 5AXDA 5M3BA 2DWCA 1QZTA 3OQVA 4YAEA 4LJYA 5TJHA 1FY2A 1BJKA 2FZEA 2GNOA 2YV4A 3IXLA 4BFXA 2YCBA 1RWQA 1NXXA 2GBPA 4GUAA 2HU8A 3WGNA 1Y6FA 2EKZA 3RYHA 3BX1A 3UJ9A 2GPJA 2AR7A 4HGQA 3B6IA 1GU7A 1SXJB 5EKDA 3I9KA 2EZTA 3ZWDA 3LKVA 1PUJA 3FNQA 3HFSA 4OIFA 1XEAA 5JT1A 3MOIA 3OZCA 1Q1AA 4DR4B 5AI6A 2OWEA 4NFLA 1QR6A 2HSJA 2P9CA 1JFSA 2P2ZA 2WU0A 4RPLA 4DN6A 3M5PA 2FN3A 5TGZA 4V2IA 3BMNA 4NRDA 3EPPA 3P2IA 3BH0A 1X1RA 4HLUC 3CZAA 4KXLA 3WY9A 1HNXB 3IAM6 3SF8A 4RK0A 5AW2A 5AJYA 2D59A 3L8ZA 4B3SB 5B4TA 2RE8A 1XRMA 1JVNA 2VHJA 3ZIUA 4DDVA 3QUAA 4KWHA 3VJMA 2WFLB 1WY5A 2OZEA 4RVUA 1T43A 3WJAA 3KB2A 4QEDA 1KI9A 2D1FA 1I2BA 3GOQA 4C5AA 1LBHA 1KHHA 1A9SA 4R98A 1K8ZB 4WNYA 2AEJA 5FA8A 1S4MA 4ZYUA 2H5JA 2O8FA 4NBKA 4Z54A 3WTBA 2HK9A 4NATA 1NFFA 3R3ZA 5J1SB 4UBOA 3IDFA 3U7QA 4DLYA 3VYRB 3VOTA 3IESA 2WJIA 1E58A 4MS1A 5LNK6 4U7PB 1JX6A 3UUGA 4A5SA 1KAGA 1GDTA 3H2YA 2AHOA 2EF1A 2Q1UA 4R83A 1GXSA 2ZE5A 3RS8A 1CHNA 1UKZA 1QX4A 2YUTA 4RXTA 1S0UA 3BMNB 1UOEA 3KPWA 1CR4A 3EUWA 4FHEA 3IQHX 4LQCA 4P08A 1AQLA 4WBXC 5DBHX 4KRYA 3T5CA 2OFOA 3SF8B 4AMUA 4CDGA 4ZMBA 3I28A 1NVMB 2BFPA 2WT8A 1G66A 2NSYA 3HJTA 4RK1A 5IZCC 5H7XA 2I6SA 3DMPA 3I2GA 4YN3A 4ZQIA 3FWPA 1QRAA 1FFXA 3I34X 3PPYA 5H81A 1EVQA 1FVXA 5KO2A 2PV0A 2VP6A 3NBXX 1VG1A 3H2IA 3O1HB 2JZCA 1Z6TA 2HNKA 3IX7A 3L7BA 4GOXA 4MQMA 1Q74A 5A4FS 5L4NA 1KERA 1II0A 3CJTA 3LM8A 2HBYA 4EY7A 3L6BA 1RAAA 4NBTA 1A2OA 4ANFA 3PEEA 4MS1B 3L6DA 4KNWA 3UAVA 1GY8A 3A6EA 3PXUA 3UTCA 1R18A 2CLSA 3U5ZB 1GXSB 3O74A 2O2HA 1OJLA 2YWJA 3KEFA 1E1CA 2X8LA 1UDBA 1T0JB 1AE1A 2HJHA 4FGUA 1G5TA 1OLSB 5K3CA 2GJAA 3IQEA 1LK0A 1RHMA 2WFMA 3IEIA 3JYOA 4HZIA 1UBFA 1ZRNA 2NU7A 3I52A 4LK2A 5EZYA 4YXWD 5KWJA 1JP7A 5J4YA 1BX3A 5CFOA 3G82C 2F3PA 1OFTA 1OTHA 1FFXB 5K3EA 3OMXA 4ZAYA 3R9XA 1HO3A 1KTIA 1Q83A 3JQAA 4JC0A 2G7ZA 5DW0A 4A73A 2A9OA 2B2XA 2HZ7A 2I80A 3KUKA 3OFJA 4BO2A 3PJEA 4H3HB 1PKXA 1ATIA 2P6MA 4G1VA 5IW8A 3T7TA 2DB3A 5K6TA 1ILEA 4P54A 4OQZA 2XNDA 2C4NA 1ZLYA 1QIGA 3I42A 1SY7A 2YIVX 4FP9A 4HFJA 5H0IA 4C05A 1Z5UA 4CKWA 1CF9A 5FEUA 3OJ0A 3A4IA 1IH8A 1YE8A 1NM5C 4UMEA 5IK2A 2YNMD 1UBMS 4ICIA 3NNDA 1KDVA 4LDRA 1E1CB 2ORED 3K1JA 4D80A 5KNBD 1MO6A 2UYOA 1ZA2A 2PKQP 3AU9A 3CLKA 3GNTA 3PNKA 3RASA 4EPRA 3HK2A 4FGZA 3JD0A 3E3OA 2NU7B 4DJTA 2NYRA 3ZIDA 3EIHA 2HHLA 1Z3IX 5J5AA 4AG3A 3IBTA 1FYVA 2PZLA 1E1RD 2QN2A 2C8JA 2AJLI 2J5XA 1SB9A 3R9XB 1Q1BA 3GRKA 3RBZA 4N5MA 3JQAB 5DXAA 4AJ4A 1VA5A 2QX7A 4CIYA 3BMCA 2PGAA 1EQUA 2NO7A 3F2VA 2AK3A 4OI0A 4MVWA 1W5BA 2O1WA 3AZQA 5L3SA 4Y7CA 3M3PA 1FNMA 5KAMA 1NW6A 1MQ8B 3NKLA 3ICQB 1WDMA 1GGVA 3R7DA 1FTGA 4WNIA 3SU8A 2Q28A 4PBRA 3UM9A 4D6PA 1NRIA 2NZUG 2IYQA 4M49A 4EGQA 4YHHB 3I6MA 3ZGOA 2DH5A 2XCSB 1I3KA 3B6ZA 3CO5A 3ONDA 3NAQA 3S7ZA 3U4AA 5EIEA 3V8PA 3KOZA 3CRVA 3TK1A 4EABA 4M1WA 4EBFA 1TU4A 3UWPA 2FPWA 1G4HA 2B9VA 1VKOA 1QO7A 1G2PA 2AFIE 4FLFA 4U6SA 2C96A 2ES4A 3AONB 5KAPA 3THXB 4JMLA 3TTUA 3NJ4A 4GSKA 2HH9A 4Q4LA 4L6IA 5ALVA 5HKKD 1Y6JA 2JIOA 5CLQA 4KK3A 1SQFA 3FMPB 4DF3A 3BMCB 3DTVB 2WOOA 3JQ9A 1PW7A 5CM8B 2BR5A 3TTYA 1MC4A 1G6OA 3MC1A 4MWOA 4BFYA 1NBME 3DE2X 3WLAA 4POOA 1ISFA 1JMYA 4IO1A 4NONA 2B34A 3PXGA 1SIBE 3QXSA 4AMGA 4KYUA 1SK8A 3NC4A 4WXEA 3C6BA 3A9WA 4ZVRA 1MW9X 4BB0A 5LQAA 1PSWA 2J0UA 4Y2GA 3T7AA 2RCNA 5B1YA 3VR4H 2V0GA 3H7AA 3I2KA 4IDBA 3MLEA 1THTA 2QXTA 3HR8A 4ASUD 4KMRA 4GQBA 3BRQA 1QB7A 3I6BA 1V95A 1BGWA 1I7DA 2YWRA 4M36A 4AP5A 2X15A 5BNTA 3AKCA 5C5EA 1QV7A 4OU4A 5CBKA 5HYVA 5JNLA 2CD7A 1G5RA 4JBXA 1ISSA 2DPGA 3QF4B 5JSQA 4OHYA 5CU7A 4I9GA 1JEYA 3WLJA 2VNAA 1IY2A 2FEXA 3NHFA 4WZ6A 5DRYA 3JW8A 4DAEA 5FX2A 3NVKI 3FSRA 3HB9A 1I3LA 5DBFA 1YGPA 3P5BA 1CNEA 3JR7A 2XMZA 1UDAA 3PS9A 3R7BA 1N6KA 1O89A 2NUBA 4R05A 2X13A 2WSIA 1AD2A 1K5GA 1KI6A 6GPBA 4IMJB 3AY3A 1GCGA 1YB1A 2IC5A 4L75A 1UAAA 2TS1A 2IXEA 4MS4A 3QOYA 5JNVA 4FMDB 4E6EA 2QSUA 2J0UB 3GJYA 3MWJA 2J87A 3FOWA 1X14A 4NFYA 4JJ6A 1JG1A 4UHDA 5IKOA 3C1TA 3WKEA 4IHKA 4ZO7A 5AVVA 3LWNA 1C30B 4DJAA 2GH1A 5ILGA 1NYQA 2DERA 3MILA 3WYNA 2XUDA 4BN4A 1PFQA 3UANA 4FW8A 3RLIA 3EVBA 3RUDA 3QNMA 2GZRA 4X1IA 4NTZA 1VECA 5CR9A 4QQRA 3NMUF 4G0XA 4FEAA 2Z3VA 3CE6A 3EISA 1JEYB 4HGNA 1YV9A 4XQCA 2ECPA 2D1QA 3BWCA 4IUYA 4UVEA 2E3JA 5DOZA 4XJTA 2J9YB 3ZS8A 1KJZA 1SQGA 1E9DA 4GFDA 4CM9A 2ZRDA 1O9HA 5HPYB 1LPMA 1RXYA 1YZLA 3ANYB 1E2HA 1RYZA 4W7IA 5KKAA 4Q9DA 1KI6B 2WT4A 4I7EA 3ZJ4A 5CNKA 2CW5A 5K3AA 3BHJA 4P3XA 3Q1LA 3C3AA 1XBTA 4DLWA 2AN3A 3FHOA 3I8XA 5AKKA 4FN4A 4UVHA 1TCBA 2FHSA 2JD1A 2P67A 5KDOA 2ZYIA 3PBKA 5AW9A 5C8YB 4NXMB 4O8ZA 3B1JA 2ZJAA 4I1RA 4FKBA 2G80A 4R84A 2FRXA 4HDAA 2OXIA 2OPHA 2O0LA 4AECA 1KFCB 2BI4A 4IDDA 4UNSA 5AI9A 4BQPA 6CHYA 4ES6A 3EGDB 3B12A 3HJCA 1C29B 4OQDA 3ZWNA 2WF6A 4E11A 1RZRA 4CUZA 2YBEA 4KO8A 1KE2A 1VSUA 2FFJA 5SY9A 1NP7A 4RORA 1ZR4A 4X1IB 1DG3A 3VZCA 3I9FA 4I19A 5J5CA 3RQSA 3NZEA 4E46A 2IPNA 2J9XB 3NBYC 1JJBA 5DF1A 4KAFA 3FCOA 3I76A 2J48A 3Q8WA 2XZTA 3GJ3A 5K3SA 4PG8A 1CQJA 1NR1A 1CCWA 2GUWA 4M1MA 3UG6A 2QMQA 1JKIA 5EZSA 2OO3A 3E82A 5KNCA 1EK6A 1QIDA 2JCVA 5DGCA 1OH5A 1RADA 2R1VA 3NTUA 3UUEA 4MNTA 3DNFA 3GLVA 3LFUA 2IS1A 1ACMA 3V2IA 4DARA 3BWEA 2O52A 3JY6A 2YX1A 3GJZA 3LDUA 4MIKA 4UVGA 1U0SY 1Z33A 4C6TB 5EJ8A 3TF5A 4NOMA 2WD8A 2GR9A 4U7JA 5CG1A