4W7HA

Crystal structure of deh reductase a1-r mutant
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
249
Chain Sequence
MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase
publication title Structure-based Conversion of the Coenzyme Requirement of a Short-chain Dehydrogenase/Reductase Involved in Bacterial Alginate Metabolism.
pubmed doi rcsb
source organism Sphingomonas sp. a1
molecule tags Oxidoreductase
total genus 87
structure length 249
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4w7hA00
1UP7A 3PDUA 4GL4A 3TJRA 3ICCA 3FNGA 3CMCO 1C1DA 3WB9A 3KBOA 1EQUA 2GN8A 5BNFA 4IGEA 5TT0A 4YJDA 3GPDG 1QKIA 4RDHA 4TRRA 1HL3A 4PG6A 1JU9A 1QMGA 2GYYA 4JROA 1LXCA 1S6YA 3C7CB 4LK3A 2B35A 2JD1A 3RASA 1U8XX 1T2EA 5LDHA 5JPIA 3Q9UA 1IHYA 4DBVO 1ZW1A 2DBZA 3QIVA 4MVJA 3AI3A 1LEHA 4L4RA 1HDRA 3CSDA 1TVEA 1GZ4A 1V9LA 1MXFA 3IDSA 3H4VA 5CDSA 1AXEA 1D1TA 3E6AA 5BSEA 3DFZA 1YH3A 1YWGO 5EL0A 4F6LA 2J5KA 5JLAA 2CY0A 4N5LA 3D4NA 5AXAA 1DJNA 4B3HA 3Q9NA 4Y6SA 4WCFC 2IZZA 5B37A 4ALMA 1R15A 3VC7A 2FSSA 3DO5A 2Y1OA 4CJXA 2CDAA 1EE2A 1U5AA 4F45A 5K9ZA 4ROSA 3DBHA 5DZSA 1Y8RA 1T2CA 3NTRA 4XIJA 2D59A 2GUGA 3HQ4O 2YV2A 2UAGA 3LLVA 1XU9A 3NUGA 4Z0PA 1Z6ZA 4J1QA 2ZATA 4J3FA 3RWBA 5KJFA 5L95A 4PLHA 2OFPA 2BGLA 5JDIA 4BO6A 4KQXA 1OOEA 4BNNA 3PHIA 4CLRB 3CXRA 1LBEA 2Y0CA 1LDGA 4Z9XA 3IL2A 4IPTA 3RC7A 1DIRA 1WAMA 2PLAA 3KSDO 2B36A 2P9GA 1WDKA 1HLPA 5I7VA 1HYEA 1YB4A 2Y68A 5G4LA 1UP4A 3SC6A 4DLLA 2C2XA 1NX6A 3IJPA 4DA9A 3C85A 5F21A 5ICMA 3PHHA 5HWSA 5TX7A 1E5LA 1U3VA 4NI5A 1U2GA 3GH3A 5IDQA 1WNTA 1ZH8A 1X0XA 4E5NA 3MJVA 1DFIA 2H6EA 3JD0A 1ARZA 4EDFA 2DTEA 4OOEA 3QVXA 3KM0A 1M75A 4LVUA 3OSUA 5ER6A 3UGKA 1QLJA 3JTMA 4GLLA 4NFYA 3JSAA 4OQZA 3H5RA 3DBVO 2ZTMA 1VC2A 4XCVA 1Z73A 3C24A 3KYDB 4PLWA 1PL8A 1A5ZA 3OQ6A 3OA2A 1H94A 3H5NA 4R1UA 3RFVA 1PZGA 5BQFA 3GNTA 2HRZA 1FMCA 3JQEA 4CLRA 5JAIA 2DBVO 2IXBA 4NZ9A 2I9PA 4F6CA 2DPGA 3LDHA 3SC4A 4IIVA 4BO2A 2WEKA 4BNZA 2NQ8A 5G0TA 3SLKA 3UHAA 4A0SA 4XQ9A 1BW9B 5JYEA 4JCOA 3W6ZA 4Q3BA 4W99A 2DLDA 1Y5MA 3QVTA 4BO1A 5CDYA 1QYCA 1OMOA 3DZJA 4H3VA 5JMPA 5JCJA 3RKUA 2B83A 1MP0A 3NDJA 1K6IA 2HK7A 5GMOA 2X9NA 3BTUA 1DC5A 3TPCA 1PWXA 5KKAA 1H5QA 2X6TA 4WGGA 3ZWYA 2B37A 2O3UA 1PQWA 2NU9A 1I10A 3QWBA 4OXYA 1RPNA 3FBTA 1B15A 1UJMA 4JLWA 4IM7A 4A10A 1V35A 4FR5A 1ZK3A 4GBJA 1ONPA 1UAYA 1LRJA 2GN9A 1PR9A 4WJZA 4XQGA 3WDSA 3S2IA 4CMJA 2JKVA 1P33A 2NUAA 5G2OA 1UZNA 1O95A 3JQAB 3U49A 1A7KA 2W8ZA 3H5AA 2YQ4A 1K6XA 1F8GA 4RVSA 1ZK0A 3AFMA 3KZVA 3WWZA 1GU7A 3OBBA 3OETA 1A7AA 2X1HA 1N9GB 4YT8A 1GYQA 1GPJA 2POQX 3ZNOA 1PZHA 9LDTA 1JTVA 1GR0A 1W73A 2IZ1A 1GDHA 3CINA 4GMGA 1GQ2A 2AG5A 3KOUA 1B0AA 4W4TA 4CUJA 1I2ZA 4XB1A 4W6ZA 4XDYA 4UUMA 4LRTB 3QV1A 3RUCA 4BIIA 1WDMA 4BNFA 3PK0A 5COAA 3ZW8A 4I9NA 1Q2XA 4B79A 5CG2A 1M6HA 1ZK1A 5TJHA 1IYZA 1M6WA 3INTA 1GV0A 4JNKA 1A72A 1E6EA 3VZPA 1EZ4A 3TDKA 3K73O 3WWYA 5BR7A 1KC1A 1NAIA 1OC2A 2AG8A 2JL1A 4J1TA 2H1SA 4GQAA 5L40A 2HUNA 1JQBA 1PZFA 5TC4A 3JQAA 1J0XO 4J4BA 5JE8A 1RYEA 4MVJG 3GGGA 3RSHA 2WD7B 3Q2KA 3UFXA 1WXDA 5FF9A 3A28A 3M2TA 4MVJE 2FZWA 3NT5A 1R0KA 1N9GA 1N1GA 2ZCUA 3DBLB 2TMGA 5TSDA 2VZ0A 1PEDA 1T2AA 2Y1EA 3ZNPA 1I01A 1Z75A 4PGFA 4MO2A 2WJPA 1MGOA 1U7HA 3B6ZA 4A2CA 3PGJA 2CUKA 3EVNA 3I3OA 2GGSA 1V8BA 3FTPA 3MWDB 4PZDA 5H81A 3E5RA 4NFHA 5U1PA 2Q50A 4BQPA 4TKMA 4PZCA 2RAFA 4TZTA 1VKOA 2EJWA 4D43A 4XYGA 2GERA 3QA9A 2VUUA 3JD3A 3ROQA 3L4SO 1UXGA 2C59A 4UEJA 1B14A 5FEUA 3RUDA 4BOYA 2X22A 3W4KA 4IIUA 4HBGA 1ZKMA 3WYEA 2X5KO 4AJPA 4PRLA 2J3HA 1FDVA 2PZMA 1B3BA 1I36A 3MCVA 4UULA 3EHEA 4AJIA 2ZKLA 2GR9A 5HM8A 3PIDA 3KEOA 5KNLA 3GEGA 4WPGA 2PH3A 2AEMA 5B12A 3PWZA 3WIEA 4FGSA 1G6KA 1YL5A 2NV6A 4FFNA 4LRSB 5HTOA 2AA3A 2HK9A 4IUYA 1QYWA 3WOHA 3L07A 1NFFA 3DBLA 2Q1UA 5DBGA 3OEYA 4RPLA 4AJLA 3ADOA 4FSHA 3NDIA 4H7PA 4II2A 5AXCA 2EGGA 4ZGWA 1T4BA 5K6AA 1D4FA 4RGBA 4J43A 4OM8A 3RFTA 5U4QA 3UOGA 3T7CA 4ZU3A 1BTOA 1LDMA 1SC6A 2YV3A 5ENDA 3L0DA 4TVBA 5L4SA 1H2HA 4MDHA 5JNLA 4U5QA 3V1UA 2XPCA 1FJHA 5JBIA 1YGYA 1LLDA 2BMAA 2YFHA 2PGDA 1DHTA 3OICA 2PWZA 1RYDA 4AJ4A 1DJQA 1LX6A 3P2YA 3SVTA 3VTZA 3TWOA 3JD1A 3GVCA 3FI9A 3DFUA 4YJHB 1VL6A 4I5FA 3G3EA 4QUKA 3WSWA 5DCUA 1DFGA 3K8ZA 1UDBA 1KVUA 2BFOA 4YXFA 2HMVA 3ZW9A 2WYVA 4P22A 1XCBA 2YY7A 4CM3A 5L4LA 2EWMA 1SOWA 2O2YA 2JHFA 3ZNQA 3W6UA 1A27A 4BGVA 4WLFA 2IXAA 4CUKA 3H9UA 3JQ8B 3G17A 1KVRA 5IDXA 4DIOA 5EERA 4EBFA 4EUEA 5GZ6A 3ROMA 2C7VA 3TZ6A 1HDZA 1AHIA 1HDXA 2C2YA 1Y9EA 3F5SA 4J2HA 1MX3A 3K31A 3AM5A 2NSDA 4NDNE 3PQEA 4RL6A 4Y6PA 2DU8A 2NU6A 3QSGA 5TJ9A 1KC3A 3GUYA 4MVJP 3L6DA 3WS7A 1QORA 4YJHA 3S8MA 1UXKA 1RJWA 1V3TA 3KSZO 3GN2A 3AUSA 4IINA 3NT2A 4BO9A 4BNYA 1VJ1A 3QW2A 2EXXA 1PJLA 2G1UA 5A9TA 3QVOA 1B16A 1PJBA 4EYEA 3D3EA 4BO0A 2HMWA 3TSCA 3OA0A 1DSSG 3PJDA 1GCOA 1BDMA 2PK3A 3RROA 2G5CA 2E82A 2JFGA 4R1TA 4ONEA 2NU7A 3MEQA 4CMHA 1YB5A 2ILTA 1C0LA 1CF2O 3ADPA 3JQ8A 4PLYA 3DQPA 4Y8VA 2B4QA 4WLEA 4CODB 2JFFA 3AOEA 2SCUA 1AN9A 3OIDA 4HWKA 1ORRA 4I5EA 3QY9A 2YDXA 3I9NA 4JP3A 4CV0A 4YPOA 5L7TA 1O9BA 1H6DA 1VI2A 3INGA 2VYVD 4BO5A 5JDIC 2RIRA 4JBGA 2C7GA 3RUAA 1VSUA 4NJMB 4AG3A 3L6OO 1MB4A 1D3AA 1ZFNA 2VYVA 4EJ0A 3KYBA 2P5UA 3OJFA 4RVDA 1K6JA 4E13A 3GRKA 1I30A 1E3WB 3OJEA 4GVXA 4U7WA 2WMDA 3ROKA 1PJ2A 4GKVA 3MWEB 3Q0EA 4IXWA 4IQ0A 2YV1A 1GEGA 3DHNA 4Z3KA 3AFNA 3DZBA 2Y1GA 2Z95A 1C0KA 2WD8A 1E0DA 1HSZA 2NACA 2JD0A 4MJLA 3RAJA 1NBOA 2X7HA 4K26A 4DRYA 4Y98A 1F17A 1XLTA 3M2PA 2B5VA 4OJNA 3TOXA 4BKRA 1A4IA 3C7AA 4INAA 4GX5A 3D4PA 3PP8A 2D2IA 1OAAA 3TN7A 1XR3A 1I5RA 5BSGA 1K89A 3BMNB 1H6AA 4ZJUA 2B4RO 4QO7A 3RU7A 1Y9AA 5JDCA 1PTJA 4A26A 1N2SA 3K96A 1ADBA 2GZ3A 1OI7A 2J5RA 2D5CA 2PKQO 3WFJA 5JFOA 4NJMA 2DUUA 1LSSA 3RBZA 4JJIA 3GPIA 3HJAA 3PHGA 4M49A 1T4DA 4O1MA 3GG2A 4J91A 1T2FA 3ZWPA 2PD6A 3CPSA 1E3WA 5BNIA 3ZHZA 3VPGA 4E21A 1E7WA 4J4HA 4UAGA 3LT1A 3F1LA 5I9LA 1NAHA 2B69A 4M54A 3BTSA 4MVJM 1VL8A 3HHPA 3B1KA 2CD9A 3RBXA 3WGYA 1T25A 3TL3A 2O7SA 3GT0A 4HADA 5COQA 1CWUA 3KHUA 4XGNA 4BMSA 4NBRA 4GX2A 5ITWA 3IMFA 5KKCA 1YDEA 3OH8A 3R1IA 2Q2VA 5EESA 2DAPA 5CHEA 2GZ1A 3FN4A 4CUZA 1MG5A 2ZTUA 1UZMA 4UUNA 3ETGA 5AQ1A 3M1AA 5GZ1A 2O3SA 3PHLA 2BKAA 3RQSA 3PHJA 3WNVA 2XF8A 3Q6IA 1L1FA 4FFMA 3BMNA 1YO6A 5ICSA 2I99A 2VZ8A 1PGPA 5F3RA 1H2BA 2NVWA 1SMKA 4BNHA 1JKFA 1LSJA 2UYYA 1AE1A 2PZKA 3EYWA 4LW8A 3RCBA 2J5QA 1SBYA 4JXKA 3U62A 3ZWMA 2BHLA 1DPGA 4PVDA 4FCCA 3F4LA 2RHCA 4MP3A 2ZB4A 3N58A 2NVUB 1PJQA 4NK4A 4U6QA 4BVAA 3VH2A 1MV8A 4OAQA 1JN0A 2DTXA 1LNQA 1JAYA 1TT5B 3I83A 1ENPA 2G82A 5B4VA 3KYCB 4J4TA 4BQRA 1V3UA 3VPSA 1ONNA 1EUCA 3S1LA 1SAYA 2OORA 4Y9DA 1KEWA 4QECA 1ISIA 2JD2A 3WYCA 4GLOA 2F1KA 2VUTA 3BTOA 4BNLA 1LLUA 5KVVA 1MC5A 5CP8A 3RVDA 3UKOA 3V8BA 1BXZA 4KTVE 5KWEA 4ZRNA 1ZJZA 3BMOB 3H3JA 2CMDA 4Y67A 3F47A 4Q3EA 4CLEA 1IY8A 3SLGA 3DAPA 4DYVA 2ET6A 4EGFA 4JJGA 3L9WA 5JY6A 4JQCA 5AXDA 4OSPA 3PFFA 1VE9A 1LC0A 4I08A 2VN8A 4YDRA 3ULKA 3WICA 3PDJA 2H63A 4XWYA 1C14A 3BHMA 3KV3O 1GD1O 3U09A 1NFRA 1TLTA 3ETDA 2O50A 4RVUA 4C7KA 4BNUA 5AVOA 3CIFA 2NVUA 3H2ZA 1EE9A 2D0IA 3SJUA 4PG5A 1QR6A 4LCEA 2H5LA 4M89A 4PN3A 5DULA 4I9UA 4OOFA 1TT5A 3E48A 3JYOA 1E3LA 1HE3A 4YAJA 1D7OA 2C0CA 2OUIA 3KYCA 1TB4A 2QRKA 1JWBB 1WPQA 3FWZA 4ND5A 4E0BA 3DR3A 5KJEA 5JO9A 3O26A 5B4UA 4G5HA 3GMDA 4RF2A 4XQCA 2VOJA 1OC4A 4K28A 4R16A 1YL6A 4J49A 3WXBA 3WTBA 4E5MA 3ZU5A 2W2LA 3GF4A 1HXHA 2X58A 2OP1A 3BMOA 4IY1A 2WYWA 1NWHA 2EERA 4UREA 1BMDA 5DN9A 1DB3A 3FTNA 2I5PO 1YJ8A 1EVJA 3DL2A 1NWCA 5B4TA 2RCYA 2RH4A 1JAXA 1H6BA 3F5QA 3PZBA 4IJVA 5HS4A 3VVBA 1ADFA 5DP2A 1CJCA 2GSDA 4MVJD 4TMFA 1BVUA 4J7UA 4BNJA 5BT9A 4BO4A 1EEHA 5DBIA 5A3VA 5I8ZA 3TZCA 3AWDA 1FDUA 1ZSVA 3Q1LA 2ZTVA 2F00A 2E37A 1UH5A 4CLHA 2CVZA 1HT0A 1Z7EA 3OHSX 3ONFA 4PG7A 5JSFA 2X4GA 4BS9A 3EZLA 1UR5A 2BFMA 3V2GA 1RKXA 4XYEA 1LRLA 5DCYA 5LCXA 1QYVA 2PZLA 4QO8A 3NT4A 3IOYA 4D79A 5K6AC 1IUKA 1D1SA 1DC6A 3KRTA 1ZO8A 1DOHA 1YE3A 2CSUA 4UVGA 2P2SA 1N8KA 4FW8A 4B3JA 2ZB3A 2OL4A 2PKQP 1ONOA 4R68A 3EGOA 5TQVA 1Z74A 4PZEA 1B8PA 4CLDA 4E6PA 5CDTA 1LQTA 4TRMA 3EMKA 4IS2A 2IDZA 3K92A 3I9MA 4FOSA 1GV1A 3WLEA 4HV4A 1YONA 5KJ6A 1U1IA 3CZMA 4BO7A 4NJOA 2AE1A 4YB8A 3LF2A 5TGDA 1IHXA 4FQ8A 1EDOA 2AEJA 2Z1NA 1HDCA 1QXSA 4WK6A 4CMGA 1R6DA 3K5PA 4ZVVA 3U5TA 2IZ0A 2Q1WA 1WZEA 3ST7A 1HETA 3I9LA 4CM9A 1KETA 2VHYA 3LF1A 1KY5A 3LYLA 3P2OA 4Q3CA 1GUFA 2JAPA 4DPMA 1U2DA 3F1KA 1ZK4A 1NR7A 1EK6A 4UEOA 3DC2A 3S2FA 3OECA 4IDEA 4BNGA 1MA0A 1DLJA 3VDRA 1X1EA 1NFQA 1Q0QA 4O0LA 1EVYA 2FZEA 4RVFA 4DVJA 1IPFA 1Q0HA 4BHTA 1U9JA 3DOCA 1CQJA 2VHXA 3GGPA 3ENKA 4DQUA 4XYBA 2AQHA 2EG9A 1B2LA 4DXHA 1U4OA 1EVIA 4XJSA 3IS3A 1U3WA 3D1LA 1PR3A 1LDNA 4DLBA 1P1JA 3VVCA 1WLYA 5CPBA 3QWAA 3FSRA 4M8SA 3D5QA 2HU2A 3ZZNA 2BI7A 3FNHA 3SJ7A 1EVZA 2I3AA 1IPEA 1I2BA 1NP3A 3AUTA 1H93A 1I32A 1M2WA 3LC2O 4B3IA 2ZJ1A 3QE3A 1AGNA 1HKUA 2CVQA 3EZYA 1L7DA 3JCZA 3HE3A 1E6UA 3ZHXA 4MIEA 4GGOA 3A4VA 5HBRA 3QRWA 2NM0A 2GO1A 1XU7A 4LISA 1F0YA 3LT4A 3VZQA 4BMNA 3ASVA 5JCJD 2B5WA 1IULA 3OIGA 4CR7A 4W7HA 3UCXA 2C82A 2QZZA 1WP4A 4RLHA 3EDMA 1N5DA 1HZZA 4BKQA 1JDJA 1P45A 1UUFA 1O94A 4NHEA 3U4DA 2Q3EA 1BXKA 2W98A 1JKJA 5ADHA 2Z1MA 4D41A 1BVRA 4MINA 8ADHA 3QHAA 3FBGA 4JBIA 2RHRA 3H2SA 1DIHA 4CMIB 2X0RA 4RQTA 3AOEC 3V2UA 5THQA 4KP7A 3KYDA 2FR8A 1O6ZA 3D0OA 2HSDA 4WE3A 4XRRA 1LLCA 1P31A 3WG9A 1ADGA 2IEDA 2J3IA 1O8CA 1AXGA 3VTFA 1SB8A 3A1NA 3I1JA 4J7CA 7MDHA 2AEFA 4UUPA 1TEHA 4KTTE 3RUHA 1LDYA 2BH9A 4EITA 1NVTA 3VHRA 2B0JA 4EEZA 4L74A 1UP6A 1NASA 3ZI0A 4BGUA 2EKLA 3D3WB 4ALNA 1X15A 2WE8A 1YS4A 1BW9A 3DXFA 3WLFA 1GYRA 4J90A 1B7GO 4W7IA 3ZWAA 4DC1A 5C3MA 2EKQA 3NTOA 4AICA 4CQMB 3GMSA 2NNLD 2Y67A 2BGKA 5I9NA 3GR6A 1UXJA 4OL9A 3HZZA 4N7RA 1EUZA 1GY8A 2X86A 3B20A 1BRMA 4GKBA 3PFWO 4XZ3A 1Y8QB 2P9CA 3ZV3A 3LU1A 2D5AA 1Z7BA 4FOOA 1DAOA 1PJ4A 3MZ0A 4IGFA 4CPDA 1ZXBA 4AJNA 4CMIA 1ZMTA 2E6UX 3VZSA 4CM5A 3KB6A 1Z45A 1HZJA 3E82A 3FPLA 1K5HA 2WE7A 1A9ZA 2DQ4A 1O5IA 1O0SA 4OQYA 4NBUA 2PV7A 5JDCC 1PS0A 4ZQGA 2NADA 2PH5A 3JQAD 3LC7O 3NJ8A 5JAMA 2Y93A 4IDAA 2E49A 3D5TA 3HWRA 1I3LA 5A06A 3TFQA 5IXSA 4NIMA 1HDYA 4HNHA 4OH1A 3X2FA 2VCYA 4B7XA 3D3WA 3HDHA 3W4IA 1T26A 2PD4A 4LVCA 4KUHA 4XD2A 2UV8A 4DLAA 3VKVA 4WECA 2PGJA 2I3GA 3VPHA 3HADA 4CM6A 1DRUA 2E48A 4CQMA 3ZWVA 4L4SA 1A9YA 4E32A 3AOGA 1I8TA 2VNAA 1PJCA 1E7RA 2GPTA 3GK3A 3O38A 1Q7BA 2YHIB 1CYDA 4NK5A 1Y8QA 2J3KA 3GZ4A 2FHSA 1W8DA 1IB6A 4R3NA 1RM3A 4W82A 3V5NA 2FR1A 4DGSA 2PY6A 3LK7A 4DL9A 3WFIA 1GQQA 1ZNQO 1ZSNA 2AQKA 2QX7A 4ZQEA 4KDEA 3L77A 5A9SB 2DT5A 3WGIA 2Y1CA 4PLFA 1Y1PA 5DF1A 1NQTA 5T8KA 7ADHA 3TZKA 1U3UA 3DZKA 1XDWA 1C3VA 1P1HA 1E1NA 4EJ6A 1DBVO 4IZHA 1NVMB 1U7TA 1LI4A 3OJLA 3NKLA 4JBHA 4NBVA 4BNIA 5JO0A 1E3EA 1TT7A 1GUZA 1E7YA 5ITVA 4YRBA 4R54A 2NTVA 3ANMA 2OP0A 2WD7A 3QWHA 3JYQA 2D3TA 4E5KA 2HJSA 4DUPA 3H6KA 2O7QA 4R9SA 3RUIA 3DTTA 4BL5A 3NJ4A 3RC9A 4Z9YA 4B4WA 5C7IO 4OIMA 1HDGO 3JQGB 4G65A 3WBBA 3UW3A 2IYPA 4Z6KA 3V1TC 3P5SA 2HLPA 4II3A 3WGTA 2YHIA 4ND3A 4RPHA 4Q39A 4URFA 4PIVA 1GCUA 1P0FA 3I23A 4NMHA 4XJTA 2BRUA 2HJRA 3GG9A 1LSUA 1MG0A 3DZFA 4CM7A 1MUUA 4KMSA 2PD3A 5A9SA 1HSOA 4Z0TA 4EUHA 3KETA 3R3SA 4E5PA 2DBQA 4YAIA 1R66A 2W90A 3DDNA 5K0ZA 1P3DA 4RCVA 1X7DA 3NGLA 2OMEA 3SBOA 3STHA 3GFGA 2WSBA 4ZQFA 3G0OA 3UXYA 1X7HA 3BZUA 1P77A 4NU6A 5U9CA 4A73A 1VSVA 4A03A 4EW6A 3GEDA 4KUEA 1YKFA 3QJ5A 2V6MA 3TQHA 1MFZA 3BA1A 4CMCA 4UVHA 4BMVA 3WMWA 1CRWG 2R2GA 2Y99A 4NBTA 5IG2A 1OZAA 1I33A 3JQGA 4WEQA 3E5MA 4XKJA 5CPFA 4CMKA 4H16A 1QYDA 2Y05A 3H9JA 1V0JA 3L6EA 1W0CA 2NLOA 3DBRB 5AOVA 1DIGA 2QHXA 1NXQA 2O3RA 2VOEA 4ID9A 4J16A 4AL4A 1FDWA 2VTDA 3RIHA 4AJHA 1O89A 1VJ0A 1PJ3A 1PSDA 3W4JA 4ZHSA 5I8WA 3HB5X 2JHGA 1HDOA 4UEKA 3E1KA 1ZZEA 3ABIA 1XSEA 3HDQA 3WJAA 4CR8A 2Z5LA 3F6YA 4N54A 2ZYDA 1R0LA 4ALKA 2Y1DA 2C20A 1EBUA 1I24A 5A5EA 4Z0HO 3W8EA 5A9RA 4DWVA 2D8AA 3BTVA 4B7UA 1DRWA 4YJFB 1ID1A 3HB4X 1KEPA 1SO8A 2A35A 2ZQZA 4IDBA 3PXXA 4TROA 1DFHA 3L9XA 2Q4BA 2Q49A 1XA0A 4LCJA 2C29D 2QRLA 3BHIA 4ZN6A 5DBFA 4BO3A 4IXTA 1R12A 3Q3CA 3AK4A 2PTGA 4MOWA 1DAPA 1KS9A 1U28A 3DB2A 2QRJA 3C1TA 4XDZA 3DBRA 1P1FA 3VPFA 3I52A 2Q1SA 5AYVA 5ILGA 5FWNA 1YQXA 2ZYGA 4RQUA 1XG5A 2EV9A 3WBFA 2CFCA 4OXNA 3R6DA 1EBFA 1K2WA 3AW9A 2HAEA 1R4MB 3E18A 4N5NA 2G17A 3PLRA 3QQPA 1LU9A 3H8VA 5G0SA 5JW6A 4ZICA 1N1EA 4CR6A 5B1YA 2AW5A 2YDYA 5EIOA 1DXYA 1KEVA 4NPCA 5KJ1A 4BKUA 3BXXA 3P19A 4WOKA 1F14A 5IDYA 4BNMA 4R4JA 4D42A 3I6IA 1QG6A 4IDFA 4K9DA 1NPTO 2VHVA 4YJFA 4QEDA 3CKYA 3JQ6A 5ES3A 2X0JA 1PQUA 3WSVA 1PJSA 2P4HX 2NWQA 3LC1O 3I4CA 4KOAA 3H65A 4YRAA 2HMSA 2X9VA 1J49A 3ICPA 1XIVA 4E2WA 3I9OA 3RUEA 3CUKA 1E1MA 3P7MA 4G2NA 5L7WA 4CLOB 1XKQA 4FBGA 1DIBA 4W9NA 2CDBA 2NTNA 3I9JA 1LDBA 4QTZA 4AFNA 3CH6A 1NQAO 1P1KA 3OJOA 4CV3A 2XOXA 1KVQA 3FWNA 4YAGA 4XEHA 1Y7TA 2HRBA 4EUFA 4CLXA 1JVSA 4E12A 3WX0A 3KSUA 5DCWA 4P4GA 1R4MA 4O6VA 5BSHA 2X5JO 3IJRA 1WW8A 4DREA 4OKNA 1LRKA 3DONA 4RPJA 1NHWA 4R51A 1DIAA 1QRRA 4D0SA 2FWMX 2AQIA 2VT2A 4OKIA 5KOIA 1I0ZA 3OMLA 4PG8A 3V1YA 3ZWBA 4ND1A 4BNVA 5CDGA 2OHXA 1P44A 4NNJA 5A1TA 1C1XB 2QG4A 4DPLA 2DBRA 2FR0A 4CM1A 4L0QA 3DOJA 5CEEA 3MOIA 3QLJA 4LMRA 1ZIDA 3IUPA 4CLOA 2D4AA 1HE2A 4ND4A 4HFRA 3DAGA 2ZIZA 3GAFA 2GASA 2I65A 3VH1A 3K2BA 1PGJA 3GVIA 3OP4A 3DEYX 4IZIA 3GHHA 1YOVB 3F4BA 4J1SA 4D3DA 4OHUA 1E1LA 2Q2QA 4UVIA 4WASA 5T5QA 4E33A 4A5OA 1SZJG 1J5PA 4CV2A 2YUTA 1R16A 1G0NA 1BDBA 2G76A 4I1IA 5H83A 5F5LA 5A3JA 2JCXA 4S3MA 4XIYA 2P4QA 1I2CA 3B1JA 1CETA 4YT4A 4J2OA 5T57A 1Q7GA 4WLNA 2O48X 1MLDA 2PR2A 1SEPA 1A71A 3N74A 4NU5A 1CIVA 2AMFA 1UDCA 1LSOA 3K2EA 1DLIA 2Y0EA 3MTGA 5G0VA 3FR8A 3HUDA 5KVQA 2WM3A 3D4OA 2GF2A 2CF6A 4E2YA 4TQGA 4JIGA 2R00A 3IQDB 1LLQA 1VM6A 2GN4A 1C1XA 1E77A 4R3WA 3PYXA 3GVXA 1YB1A 5A5FA 4IBOA 4BB6A 4BB5A 2V6FA 5DP1A 4CMAA 3BIOA 4Q3NA 3NGXA 2Q1TA 5C5IA 2OOSA 2OBNA 3GEMA 1YOVA 3OEWA 4CM8B 5F1OA 4RF4A 2UUOA 1ML3A 1GFSA 3HN7A 4WNCA 1DC3A 1EUDA 2DKNA 3R3JA 3BMCB 1XHLA 2X0IA 3RI3A 2BF7A 3D64A 4FIZA 2WDZA 2X8LA 1ZJYA 3B1FA 4YJGB 3ETEA 2R6JA 2O3QA 4HUJA 4MIOA 4IMRA 3ZV4A 2HDHA 1YRLA 4PRKA 4R5HA 5IN4A 3I5MA 2P9EA 1SPXA 3VOSA 1KERA 1I3NA 4OSOA 1NPDA 2EP7A 1WZIA 4JK3A 4OO3A 1GAEO 3D7LA 1IOLA 3W8DA 4PVCA 4IQ8A 1H9BA 3ZU2A 1QYXA 1VKNA 1BSVA 1E3IA 2FY8A 4OYRA 3FCOA 1PIWA 4FJ1A 4K6FA 3ITDA 4QSMA 2RH8A 3M6IA 3JQ9A 3QVWA 2C5AA 4P4LA 4TKLA 3U3XA 2EEZA 4KDFA 2W2LD 2YJZA 2WWRA 3NX4A 1F06A 2J8ZA 4IJUA 4BKPA 5L53A 3ZDFA 4ND2A 1CEQA 1H0KA 2VHWA 4QX6A 1NYTA 2A4KA 4XB2A 4IJWA 4ESOA 4U6SA 3GN1A 4PLVA 4I9HA 3KLPX 4AJEA 4BNTA 4MVJI 1XEAA 2Y0DA 3ZHYA 4AVYA 3RUFA 4WLUA 2O4CA 2X9GA 5T8KC 3BMCA 1H9AA 2A92A 3MOGA 1Y81A 4GMFA 4TRJA 1OFGA 3OIFA 1HWYA 4YJGA 1EFKA 1M76A 3ZV5A 1J4AA 4JN6B 4E2ZA 4ZQHA 5EQFA 4PCVA 1JWAB 3GZNB 2PFGA 5DNAA 5IZ4A 1XELA 4D3FA 4U0KA 5HA5A 5DOVA 2E4AA 3DMYA 4UVDA 3JQBA 4DIFA 1ZEJA 4YVFA 4JGBA 5FFFA 4IDDA 3JQFA 4DQVA 3PJEA 1P74A 2GDZA 1JVBA 1GADO 4GSKA 3U4CA 4WUVA 5IJZA 3GNSA 1X7GA 1G0OA 2JFHA 2UDPA 3T4EA 2V65A 3PWKA 3ZWCA 1KY4A 3U4IA 5C37A 4XR4A 3GFBA 4M87A 3RKRA 1B3RA 1D8AA 5T6BA 1DHRA 1C0IA 8LDHA 4YQZA 1FDSA 4DYDA 3TOZA 3KTDA 2VZ9A 4EJMA 1FDTA 3H9EO 4CM9D 3KXDA 3S55A 4CMEA 1M67A 2QW8A 4Y6RA 3WTCA 1NQ5A 1XYGA 3KLMX 2IYOA 2BFAA 5HS6A 3WGGA 4BO8A 4RF3A 3JQCA 4YT2A 5CFZA 1GEEA 3HN2A 3GZNA 4FS3A 1PU2A 3F46A 4P8RA 4XGIA 2DPHA 3O9ZA 1W6UA 3OJ0A 4R5MA 4YWJA 2JCYA 4IS3A 2OBYA 4K1LA 4AJOA 3ZNNA 1QV6A 3DMTA 4P4NA 2O23A 3ANNA 2VWPA 4DPKA 2I6TA 1I3KA 1UDAA 4PLGA 3R0IA 5JY1A 4CL8A 1T24A 4AJJA 1HE5A 3X2EA 1LQUA 4LSWA 1X0VA 1U4SA 2YYYA 4J7XA 2VNSA 1HF3A 2OO5A 1KVSA 3FNFA 1ZBQA 3OF2A 2HQ1A 2NVBA 3C1AA 3DZGA 2ZB8A 1X14A 2H9IA 3KVOA 1ZXLA 1EQ2A 4E5YA 1IZ0A 4BUCA 4OGWA 1IL0A 1JA9A 2VHZA 5IZCA 2YFQA 3AI1A 4HNGA 3T7EA 2FSVA 1EDZA 1PL7A 3GHYA 3INRA 1Y6JA 2I67A 2XAAA 4FFLA 4P38A 1GPDG 1GYPA 1QSGA 3A14A 3PJGA 1EFLA 1ULUA 4QT0A 2DTDA 5TIIA 2ZK7A 3EAGA 1K3TA 1SB9A 2NU8A 3TZQA 4H15A 3IKTA 3DZIA 3AI2A 4PFJA 1YL7A 2A9FA 4Z9FA 1R4NB 4LMPA 1FXSA 3JD2A 2AE2A 3WNQA 1NR1A 1GL3A 5HRUA 4MP8A 2EF1A 3HNPA 3B70A 2BELA 1E7SA 2D1YA 3NV9A 4FJ0A 4Q9NA 5F5NA 5TNXA 1HTBA 3VZRA 3VAZA 1A4UA 2UUPA 5FI5A 4B4UA 2YW9A 2WTBA 4QFDA 3WR5A 4EZBA 4RF5A 2X5OA 4U0JA 1HRDA 3HDJA 3UAGA 3A9WA 1E3JA 4DC0A 3E9MA 3EC7A 4HKTA 3MJCA 5TF4A 1SNYA 1WVGA 3WGQA 3CE6A 1W4ZA 5F1PA 2QIOA 1I3MA 5A05A 4RVHA 5JC1A 2G0TA 3DHYA 1BWSA 2FN7A 3ZWNA 2P91A 1N7HA 3PIIA 1AHHA 3EW7A 2QYSA 4I8XA 1DRVA 5BNTA 2EKPA 2BD0A 3WGOA 1R4NA 2PNFA 5L3ZA 3PEFA 4TRNA 1RWBA 3TFOA 1ZUD1 2HCTA 2IODA 2O3JA 1PS8A 3PJFA 1G1AA 2J6IA 4BKOA 4RZIA 4R01A 1VJTA 3CEAA 3LZ6A 1YQGA 2EIHA 3GNQA 1NNUA 4J9VA 4W9NC 4J0FA 3H3FA 2Q45A 1HYHA 3WQQA 3GVPA 3RC1A 3UICA 1YBAA 1BG6A 4EEXA 3PPIA 4MKZA 1F8FA 5JAZA 3DOOA 5DOZA 4FGWA 3VKUA 5JC8A 2EP5A 4FD3A 1N7GA 4EI2A 2DM6A 1X13A 4MVJH 3EY4A 3GOHA 2BLLA 2XXJA 3IP3A 3ONEA 4XYLA 3DZHA 3E9QA 2VT3A 1ISFA 4CV1A 4I5GA 3MTJA 2FP4A 2OGUA 2FPGA 4OXKA 1IE3A 4DIBA 4CQMD 3ZCXA 3GRPA 3WYBA 2EHDA 3PQFA 3JQDA 4FFPA 3LLSA 5DDIP 2YHUA 2LDXA 1QV7A 1MXHA 1CERA 2Q2WA 2JAHA 3JQ7B 3TF5A 2CNBA 4AJ2A 4BNXA 2HKIA 3RJ5A 1ISJA 2X0NA 2ZYAA 3U9LA 1SCUA 3C3XA 4RORA 1IZ9A 2Y1FA 3KO8A 3PZRA 4B4VA 2OZPA 1LDEA 3E9NA 4XX0A 5THKA 3VDQA 5A04A 3AU9A 2WYUA 4CQLB 1Z82A 4TVOA 2FPIA 2GD1O 2I76A 3VH3A 3ZWWA 4IDCA 1LUAA 3DHEA 3BYZA 4TSKA 4GH5A 3NDRA 3WJ7A 5LDGA 4C7JA 4WKGA 4L8VA 4L4XA 3L4BA 6LDHA 3RC2A 3UVEA 3PRJA 4OMUA 1YDWA 3LVFO 3V2HA 4E3ZA 4QXMA 4WCFB 3FD8A 4GGPA 5BSFA 2BI8A 3C8MA 3COSA 2DVMA 5L7YA 1LC3A 3GA0A 1PJTA 1YVEI 1ZVMA 2DFVA 1E1KA 2VYND 5KTKA 4HFJA 1E5QA 4IQGA 4ZQBA 1JLLA 4AJ1A 3GDFA 1PS9A 3JQ7A 4YRDA 3H9GA 1NTOA 4M1QA 4RDIA 2VYNA 5I7SA 1TA4A 3FNEA 4NR0A 1GZ6A 3TZHA 2R00C 4XYMA 1J6UA 1VL0A 4NBWA 5ER9A 4DQXA 5IXYA 1CQIA 2GN6A 4JX8A 5F1KA 4AJKA 4FC7A 4CQLA 3QWFA 2FMUA 1PL6A 2J3JA 4B7CA 1U3TA 2HMUA 3DTYA 2EW8A 1B8VA 1ENYA 5EPOA 3H7AA 2V6BA 1K0UA 3HSKA 3BHJA 2UVDA 3EUWA 3HFSA 4MVJF 3JYNA 4PLZA 3G79A 3ZU3A 1ADCA 4GVLA 1M66A 3EVTA 5CAEA 4DMMA 2LDBA 4WCFA 4XQEA 2GRAA 2AHRA 3SX2A 5I7EA 1HE4A 4ALIA 2GLXA 4B4OA 4PLCA 4GX1A 3GDOA 3QP9A 2VRCD 3IKVA 4DTIA 4R9RA 2PA3A 5FI3A 2EGHA 5AXBA 1X1TA 1DEHA 4ILKA 3VH4A 3IP1A 4B8ZA 2VRCA 2VRBA 2IEBA 4ZRMA 3JQ9C 3FPCA 1DO8A 1KOLA 3WGHA 2QZ9A 4PG4A 2YQ5A 3RU9A 4YEDA 1T1SA 4GPD1 4ALLA 4YT5A 4RJTA 2DUWA 3RBVA 3JYPA 3GC6A 4ZD6A 1ZK2A 4MKRA 3WQSB 3M1LA 3AM4A 1NHGA 2B4TO 3UCFA 4QFCA 3WMXA 3JYLA 4L9RA 1FF9A 1R37A 4YYZA 4J0EA 2I66A 3UUWA 5DT9A 1E3SA 4BV9A 4YTEA 5EJ2A 5JYDA 1L7EA 1YBMA 2W2KB 3ZGYA 1P1IA 4MIYA 2O3TA 3ZH2A 3U4HA 1PZEA 1H6CA 1UAGA 3ON5A 1T2DA 3FHLA 3IIEA 5TRTA 3A06A 3O03A 3BMQB 3U0BA 6ADHA 5EINA 4XGKA 5JMWA 4L73A 2NTJA 1ISMA 3SEFA 3MJ4A 4RPGA 4ALJA 1NVGA 4J6FA 4ZA2A 5L51A 3ANLA 3JQBC 3S2GA 3SXPA 4LSMA 4C4OA 4G81A 4LN1A 5FYDA 5T67A 1R0SA 2DC1A 3H9QA 3JQFC 3PWSA 3QWIA 5G4KB 3OQ1A 1GUYA 4RZHA 1SOVA 3TNLA 5C7OO 2PZJA 4NG5A 3KUXA 4WLOA 5A03A 4YR9A 4N5MA 4GI2A 3ZU4A 3PVZA 4WEOA 4PLTA 3NTQA 3JV7A 4D44A 1VRWA 4WOJA 1YJQA 3AY3A 4RPKA 4FN4A 1E7MA 2ZJ0A 4NFSA 4X54A 1VPDA 2FRDA 1ENZA 4BV8A 4UVEA 1Q0LA 4GAEA 4RO0A 5EN4A 5JS6A 4R1SA 1RM0A 4Q3DA 2W2KA 1TXGA 2JJYA 4CMEC 3F9IA 5H82A 1P0CA 2QYTA 2CVOA 4FPXA 2IE0A 1ULSA 3BMQA 3LQFA 3T4XA 4BGEA 5G0WA 3UF0A 3ENNA 5LC1A 4A27A 3I4FA 5L45A 4D3SA 3G1UA 4KWHA 1EK5A 2O4UX 2RBEA 4KZPA 5KVSA 5JXWA 5GZ3A 3GUCA 5G4KA 4E30A 3DMTC 4XA8A 4HFMA 2BFPA 3O4RA 4YACA 3ONDA 3ZHBA 1UXIA 4L76A 1F12A 3S2EA 3PYLA 4CM4B 1MC4A 1KEUA 5KCZA 1U8FO 4E2XA 3IC5A 1YQDA 5MGBA 2Y66A 1BXGB 1UZLA 3GY0A 1TI7A 3IAHA 5EQDA 2TMDA 1P9LA 1PGOA 3JD4A 3EK2A 1PGNA 3GVHA 1QLHA 3FRJA 4FDAA 3C7DB 3OM9A 1WWKA 3E8XA 1MFPA 4GX0A 3HFGA 3LT0A 5J23A 3HG7A 2CF5A 4BNKA 4HXYA 5IZCC 5TLSA 3PI7A 3NEPX 4O63O 2A94A 3RFXA 1BHSA 3ZWXA 4Q3AA 1KYQA 3PTZA 1PQPA 1PWZA 4RV9A 1E92A 2AQ8A 3GDGA 4IMPA 4CL3A 2EJVA 4D45A 3G49A 1NM5A 2V7PA 4WLVA 2VWGA 4HY3A 4YBZA 2XXBA 3VPXA 4KUGA 1LTHR 1JW9B 1YBVA 4KQWA 5I9MA 4XRGA 1GTMA 2P68A 5IDWA 1N92A 4J9UE 4M86A 5JAQA 1SEVA 4NH4A 3I9KA 1KBZA 1DDOA 5G0UA 1OBFO 1NQOA 4CM4A 2HK8A 4LGVA 2OXIA 3WGZA 1HEUA 1PGQA 1FK8A 3C1OA 4R69A 4MP6A 1LA2A 2VWHA 4K6CA 2JCVA 4E31A 4FFOA 1BXGA 5L9AA 4J1NA 5IAAA 1UXHA 2DFDA 3WQRA 4DMLA 4YA6A 3RD5A 4F3YA 4TZKA 4BGIA 5A02A 4HFNA 3CZRA 5C7LO 1HLDA 2V6GA 3DWFA 4I5DA 1DC4A 3K6JA 4NQZA 3KEQA 4B8WA 3N7UA 1HYGA 2VUSA 3AM3A 5IN5A 5I7FA 2W4QA 3HDYA 1B26A 5CEFA 4YAKA 3K30A 1CDOA 3PYMA 4YAEA 1WMBA 3UH1A 2CZCA 3WIDA 3PQDA 1B8UA 1RM5A 3CMMA 5A4DA 1XGKA 2VTEA 3GGOA 2GCGA 1GQYA 4N18A 1V3VA 4L75A 4GWKA 2AXQA 2ZB7A 1Y5RA 3ZWOA 1VLLA 1NPYA 4M55A 4O59O 4CMBA 3AUAA 1ENOA 3ROPA 2VQ3A 3UN1A 5IFLA 5MDHA 2FOIA 5ILOA 5CDUA 2ZTLA 1ISGA 4DBZA 3QVSA 3PLNA 3F3SA 5ENVA 4YQYA 3MJEA 3ZN2A 2HO5A 2YZ7A 5COBA 4FB5A 1XQ6A 1ZCJA 3NRCA 2NQTA 1RM4A 5TS3A 1Q1NA 3NAQA 1XQ1A 3G1TA 3AUUA 5EMHA 3O8QB 2C5EA 5CEJA 4WNIA 5TT1A 2GNAA 1LJ8A 4TWRA 1T1RA 4F46A 1EMDA 1QP8A 1P1RA 3FF4A 4XR9A 2FPPA 4RVGA 2Q46A 4IJKA 4KWIA 2BGMA 1ISHA 4S1VA 1WMAA 1KIFA 3AJRA 4JP2A 2VWQA 1GZ3A 3Q11A 4UUOA 3IUSA 3W8FA 4WCDA 3TL2A 1E7QA 4GWGA 4D46A 5KIAA 3LSYA 2Q4EA 4MKXA 1WDLA 2PGLA 4QQRA 4HP8A 3RJ9A 4HX5A 1ZEMA 3I6QA 1E6WA 1YXMA 4R41A 5JCXA 2ZQYA 1C1DB 4FC6A 3FR7A 2GZ2A 2ZCVA 3ITKA 2EW2A 3AY6A 3OFSA 4YCAA 2Q99A 3DAFA 4FJ2A 3ORFA 5CG1A 1XWFA 3GLQA 4E4YA 2O2SA 4R1NA 5IF3A 3GAZA 3E03A 2P5YA 2IRWA 1BGVA 3CTMA 3ASUA 4D7AA 1JKIA 4JJFA 4D0RA 3NYWA 4PLPA 3ZV6A 3O8QA 4CM8A 1ZSYA 1ZMOA 2PKRA 4ITUA 5KJCA 3K9QO 1PX0A 3OQBA 2CDCA 3W1VA 3L4BC 4MPDA 4GSLA 2C54A 3GQVA 4U8GA 3BAZA 4FFRA 4IDGA 4RLSA 5GY7A 4A7PA 5L4NA 2X23A 2HMTA 4O5OA 1U5CA 3DBHB 1Q7CA 5T64A 3UCEA 1AUPA 4Z3DA 1V6AA 1Y8RB 2QQ5A 3AY7A 3PGXA 3MJSA 3MJTA 3TRIA 5KVCA 3LT2A 3AU8A 3Q2IA 1KVTA 4BNWA 2C07A 9LDBA 1S7CA 1C0PA
chains in the Genus database with same CATH superfamily
1KI1A 1KR5A 1UP7A 3BF7A 3PDUA 5E6UA 4DCOA 1HTTA 1C1DA 1NI4B 1YI8A 1XDGA 5BNFA 2FN4A 4DB4A 4X71A 1O08A 2JATA 4WERA 4ZP1A 2ZU6A 1GTL1 1DAMA 1QKIA 1CS0B 3KJIA 4RDHA 4PG6A 5IAEA 1JU9A 3PGKA 1P4SA 1E0KA 3L2OB 1G4UR 3C7CB 2IX9A 3HRIA 3NNDA 1U8XX 3NWEA 4LK3A 1IDN1 3Q9UA 1IHYA 3D5EA 2A5GA 1R7RA 2CE7A 2AT1A 4E88A 2IYUA 3P2MA 1IJKA 4KDRA 4MVJA 4XXHA 1HTWA 4BVKA 3CSDA 4IP0A 4WXPA 1HKHA 3QHPA 1GZ4A 2JBAA 5PGMA 1MXFA 3IDSA 3JWEA 4PWYA 3VO1A 5CDSA 5A6SB 1QVVA 3FYUC 4UHBA 3DFZA 1YH3A 1C1HA 2VRNA 1VG1A 2W5UA 5EL0A 4RTLA 2Z6UA 4ZEVA 3LHIA 4EFLA 4EFNA 4D9NA 5AXAA 2VDNB 2ZITA 4N7BA 5B37A 1VIDA 3VC7A 3DMPA 3DO5A 4FKZA 5G53C 3HCAA 2DUNA 3IAFA 1U0OC 4YMGA 3MJFA 1H0SA 1MEEA 3IX7A 1C9EA 2B8EA 5DZSA 4UFNA 1Y8RA 2DZDA 4V03A 1P39A 1SRQA 3NTRA 3O8OA 1G5IA 1CY0A 4O2RA 3RIGA 4B5LA 2RE8A 4IFIA 1YVPA 1XU9A 3NIFB 3RWBA 5KJFA 4G0UA 2ZATA 3HI4A 3HLYA 2F17A 4N6OA 4G84A 4GDFA 3TPFA 3FE2A 5JDIA 1OOEA 3SOPA 2JJ1D 4BBAA 4WN3A 3CXRA 1NI4A 2YHAA 4G0VA 4EPXA 4IIYA 1CS0A 4KE6A 4BX2A 1DIRA 1V37A 3T06B 2PLAA 3E7DA 2P9GA 5A2QA 3T99A 3OX3A 1HLPA 2IJGX 1Y3AA 2Y68A 1YB4A 2Z4TA 4PSUA 1UP4A 1GQSA 1SCIA 3AH8A 5AQEA 1QJCA 5IT5A 4DLLA 4I9FA 2OYRA 3JWJA 5GWXA 2C2XA 4F9GA 4BRUA 1FMFA 1TYDE 3BH7A 3PC8A 1P2VA 1SG6A 3FWKA 2QN1A 1QRDA 3RRBA 2PGNA 1Z0AA 2WF5A 3PHHA 2GD0A 4KX3A 4MUMA 1TD1A 3UNXA 3BSSA 5TX7A 2A6PA 1GNTA 2UKDA 3IV7A 2YX1A 5DRYA 5JG7A 3FDFA 5H0IA 3OWHA 4LJ7A 3ZZ1A 4EO7A 5A6SA 5KS2A 4AY6A 1ZH8A 4XD7A 2M6LA 4JENA 3HXLA 3JD0A 3LVRE 4QWWA 2EZUA 1LPBB 2DTEA 2P6UA 3QVXA 5A6VA 1UAAA 3I12A 1NN0A 1M75A 4LVUA 5IKPA 2JGKA 3OSUA 3UGKA 3JTMA 1ZRSA 3M7IA 4NFYA 4OFBA 2H7VA 4LF6B 4J75A 2H2FA 2GF9A 4LAFA 3DBVO 2XI4A 2NU9B 2VPXA 1VC2A 3BWMA 1CKEA 3C24A 1IQUA 2DH6A 4UUAA 4CBVA 2DQZA 4DG5A 2GKOA 3OQ6A 1ZRMA 3H5NA 2SKDA 4KIWA 5BQFA 3KELA 4BFUA 1JIUA 5AM0A 1NVWQ 2CJPA 3JQEA 3CGWA 3BRCA 2Z8YA 4NNPA 2DBVO 3ZVLA 4F8JA 4NZ9A 3EPKA 5E4JA 3IMGA 2DPGA 4C0BA 3LDHA 1MDFA 4GQBA 3RIYA 3VYVA 2AIRA 4L4YA 4TTSA 1FSGA 3SLKA 5G0TA 3W06A 3UMFA 4XQ9A 3RBAA 4OP2A 5JYEA 3T0IA 4AZ0B 4KQKA 4F2HA 4M8KA 3LUJA 4DDUA 4ZANA 4PIMA 3T12A 5JUWA 1U1GA 5C1DA 7AT1A 1QIEA 3HLTA 1OMOA 4H3VA 1A82A 4FZRA 1ZNXA 1QWOA 4RULA 4WA7A 4MUBA 5JCJA 3RKUA 4FBMA 1UMBB 2HK7A 2EHJA 4D9GA 4A9AA 3TPCA 1YVUA 4S1NA 4EFDA 3IBGA 2B37A 3F90A 5ALNA 4DAEA 1SD1A 4EM6A 5BNZA 6Q21A 3JARB 1IQPA 4EYQA 2XE4A 2NU9A 4FWBA 3FLAA 3WAKA 4OXYA 1RPNA 3FBTA 4WZ6A 1UJMA 5B55A 4M8LA 3ZHUA 3HU1A 1ORTA 1LRJA 1D2EA 1VHQA 2PX6A 4JJKA 2Q5HA 4BY9E 1PR9A 4WJZA 1X42A 2IGBA 1CVLA 1TM2A 5EIHA 5SZIA 3ZI4A 3ZW7A 4JI3B 5JNVA 1DUIA 1KQGA 1FMJA 1URPA 1P33A 3EWAA 2ZVJA 1UZNA 4FYWA 3JQAB 5FBLB 2CHVA 1XQ9A 2ERCA 3B53X 1WOYA 3LFHA 2W4MA 3USES 3VX3A 1ZK0A 3OU6A 2W6CX 3AFMA 4C9BA 3HXQA 1Q0TA 2H29A 4O3FA 4AZ0A 3Q3IA 2NP6A 5F51A 3GA5A 3B6EA 1N9GB 3W5UA 1GYQA 4AWAA 1L6IA 1L4NA 4MLCA 4NYMQ 3PCXA 5K3SA 5AW4A 1GR0A 1W73A 2IZ1A 4RY0A 3LCJA 1X1SA 2YZNA 3A4YA 3UJCA 2FAXA 2C1ZA 8ABPA 1F6BA 1TJNA 4IR7A 4CUJA 2A0XA 2QPLA 1UMBA 4UUMA 3UUFA 4WA8A 2B3TA 2HQBA 5KWVA 2JIMA 1RMQA 2CL0X 1P5HA 3MXTA 1E60A 5COAA 1JSCA 4IOJA 3VFDA 2JEZA 3QPAA 3GJTA 3JARA 5CG2A 1ZK1A 5TJHA 4Q7LA 4WSOA 1Z8NA 2IDMA 1LV7A 1CUHA 4GP6A 4KB5A 1SHJA 1YZUA 4TN5A 4KQGA 3LDFA 5LZ5A 3H5IA 3K2QA 3K73O 2I2WA 1OC2A 2Q6IA 1J06A 1F51E 1SUCA 4LV5B 2AG8A 3O7WA 4AIRA 1CUUA 1U0HC 1Z36A 5L40A 5A0FA 2C9ZA 4R6WA 4PGAA 3BQNB 4R7GA 3PL5A 2XWSA 3H84A 4G56A 1PZFA 4QM6A 3JQAA 4J4BA 3PNOA 4BLUA 4BYGA 5JE8A 1N3LA 1RYEA 1DWPA 3WI7A 4TS3A 2C7BA 5FAXA 5CYPA 1TZJA 5ARCA 1YGPA 3W5HA 5J1SB 1EXVA 5FF9A 3M2TA 4MVJE 4JLNA 3W6OA 4M7PA 2BE9A 1R0KA 1N9GA 1Q91A 3RTGA 1EFAA 1N1GA 4LBYA 3OCXA 2ZCUA 1AK9A 3DBLB 1R9GA 3RV4A 3FYSA 1VLQA 4CCWA 2XBMA 4ZODA 3IRVA 1XDZA 2VZ0A 4F06A 1PEDA 1US8B 4YALA 1HE8B 1TQDA 2I6XA 2IP4A 2G83A 2BR3A 3KPVA 4R31A 1YVRA 4A2CA 2DP4E 2G5PA 4AS3A 3RU2A 3FPFA 4MLPA 4E1VA 1IEXA 3I3OA 1YZNA 2GGSA 3MWDB 4M99A 4OXIA 3WL4A 4BWGA 3E5RA 3J80A 3K71B 4R2JA 1FX1A 1KJQA 1CUAA 2V4UA 1HG0A 4TWJA 3RKSA 1V8FA 1VKOA 1Q17A 1MVOA 3E4CA 4HWPA 1OBCA 2VUUA 3JD3A 3WA7A 5TMPA 5EZYB 1SELA 1JR4A 4Q19A 1UXGA 2C59A 5DBEX 1RRGA 4C6SA 5AW8A 5FEUA 1DMSA 4QQNA 1XZLA 1GU0A 2X22A 2H65A 4WY5A 4IIUA 3DLIA 1ZKMA 4ZI7B 4YI5A 2J3HA 2WIFA 2PZMA 2YV4A 3EODA 3QV2A 4JB0A 4AJIA 5U4XA 3OT1B 5I9SA 2GR9A 1H1LB 2LKCA 3AL3A 4PS1A 4JQSA 3L8HA 1Q1BA 1E8NA 4YH1A 5EWMB 2UZ4A 3KEOA 1MAHA 1DKNA 4REOA 5JXJA 4D26A 2ZAMA 2ZKIA 3MWYW 4WZZA 1F4VA 1P6UA 4GP7A 4PQRA 4K2AA 1G6KA 4RJJA 4LRSB 4AX4A 3H13A 3GFSA 2DR0A 4KPFC 3DBLA 3P9SA 1ULHA 3CLUC 3LBAA 3OEYA 3L0ZA 5DBGA 3ICEA 1CEEA 4KLZA 4II2A 3OCZA 4Z4HA 1MO6A 4F4HA 3ZLTA 1US8A 4RGBA 3EVZA 3HBJA 4FX5A 2H07A 2QTGA 3DL7A 3G8AA 4GIBA 3KPUA 4HSGA 3V55A 3PXUA 1C41A 3ZH9B 8AT1A 1F38A 1BTOA 1D6MA 1SC6A 2XA9A 1UZAA 3MWDA 4TWAA 2VBGA 4U5QA 4WNAB 3FXAA 3AHGA 3QOXA 5EKUA 1L2TA 2P2YA 1ZVVA 3PUVA 1T5TA 4JXXA 2WHXA 2ZVDA 3L7YA 1Q57A 1Q14A 2W6QA 3OWXA 4KPGA 2JAWA 5EZYA 1C3EA 3SVTA 3VTZA 2CXNA 3JD1A 3FI9A 3JQRA 5FPSA 3K8YA 3VR0A 4F92B 1JILA 1PD1A 2PLFA 4ZI7A 4QUKA 2Q4RA 2LCIA 2CEKA 3HVHA 3HJRA 3OT1A 1OV6A 1H1LA 2EJUA 3VM6A 1G3UA 3I6ZA 2HMVA 4J29A 5EWMA 4YXFA 1T91A 3IBYA 2XCOA 3MQ2A 1VIMA 4RGYA 3CSUA 4P22A 1XCBA 4M46A 3IMCA 5IHPA 2RK3A 5LQCA 2EWMA 1SOWA 1UPCA 4GR5A 1AH2A 1DO2A 3RGWS 4OQNA 3ZS8A 3ZCTA 1TQ4A 4BGVA 2A0KA 2O2IA 4WLFA 2IXAA 4G5XA 4G9EA 3JQ8B 5HG0A 3CR3C 1C7FA 1D6JA 5M3BA 2J32A 1DBRA 1J7JA 4EUEA 4KKXB 2H57A 1QONA 3ROMA 3HHEA 3IB6A 3TZ6A 3UWOA 1RZ3A 1SY7A 1CP2A 1HDXA 1PZMA 1VGRA 2JHPA 2IV2X 3SNHA 2VDJA 5DLEA 3CVVA 3KYIB 5K2MA 1TMYA 4KXVA 3TX6A 3K4PA 4TLAA 4TV9B 1M1XB 5BWMA 3PQEA 1MJGM 2GTHA 1MZPA 5TF0A 5F35A 3A9CA 3CHYA 2FPRA 4C3OB 5ALFA 2HJHA 3SWWA 3QSGA 4RABA 5C8DA 2HMAA 1P73A 4AF7A 2ENWA 4D0NA 3WS7A 3SS7X 4K86A 1YE5A 2PFSA 1WCXA 2R5FA 1SUDA 3GARA 1YCFA 1M34E 3DE4X 3KSZO 4W5QA 2WZDA 4NF2A 3FUXA 1UDRA 1RKQA 1Y80A 1A9XB 3CW2A 4IINA 3MLEA 4YJ2F 1QFSA 3B3QA 1CHDA 3H5LA 3PC2A 3SDSA 4BNYA 1V1MB 1AXRA 4UTVA 2YN2A 3LO8A 2I6FA 3B7WA 3PKZA 4C88A 3G9QA 4EZIA 3I61A 3PD7A 2IVFA 4ZT2A 4TYNA 1NUAA 4EYEA 4UDXX 1PP4A 5CYFA 4BO0A 1QH9A 2CGEA 1DC8A 3EXAA 1Z2EA 3PJDA 4X8LA 4WZBB 1PV4A 3S3TA 2X2OA 4AK9A 3G2OA 3QZUA 4R1TA 1L1QA 2C95A 2TS1A 1F3OA 2XKJE 4CMHA 3YASA 1HX7A 5B3KA 1E9DA 5SZHB 4IIFA 4X7MA 3CRQA 1CF2O 2MSCB 2UVQA 3N8IA 5FUYA 3JQ8A 1OXSC 3DQPA 2IXGA 1RHJA 1R0YA 5JD5A 4B3TB 3UMVA 3RIEA 1QQ6A 3A3PA 3WSTA 3HTXA 1XRRA 3C5WP 3B52X 3LE8A 5TGZA 4LF8B 1CZRA 2EWVA 4HAXA 2YDXA 4PPQA 2VF4X 1AURA 1JQKA 3BL5A 4L8WB 3HJGA 4D4KA 1GTZA 4TV9A 4BEVA 1ABBA 3NO4A 2VHTA 1XD9A 4JBGA 1QF9A 4ZHQB 4W1QA 3MPOA 3U1TA 5AVQA 1TRKA 3GL9A 3IFSA 2H1IA 2XYHA 1G5PA 2VC2B 4AZ3B 2PUAA 3L6OO 1XROA 1DE0A 3QUAA 5T4EA 2XOEA 2OQIA 3LVBA 4JH0A 2J09A 2ORED 3H05A 3KYBA 4EJ0A 2IXFA 2P4SA 3M4YA 3GRKA 1BFDA 3KXKA 4FT4A 1A9XA 4U7WA 4FM9A 2WMDA 4C2TA 4F60A 1PJ2A 4GKVA 3LTNC 3TLYA 1V1MA 3GPBA 2MDTA 2B1IA 2MINB 1XCMA 2XZPA 1GEGA 3JAKB 4QATA 3RSQA 3U7JA 1DEKA 3MMSA 4KQIA 1WM1A 1KHHA 1TZ2A 3DZBA 4QBHA 2Y1GA 1U2GC 1XTRA 4NV1A 3ZDYB 1MEJA 2IYFA 5JFTA 4MJLA 1G9TA 1CRQA 1TU4A 2X7HA 4GM4A 4WZBA 4WX2B 2R6HA 3RAJA 5K8VA 1XLTA 1WA5A 1JLMA 3C7AA 4JY7A 3OD1A 4INAA 3RYFB 2GYVA 4RDCA 2DFNA 1C9JA 1ZD8A 2DPMA 4RCYA 2G36A 1CPYA 4RHCA 4JB3A 1T1JA 2FFHA 2GAOA 2OQRA 2FWNA 1Y5IA 4C0LA 1V11B 1BYIA 1L5HB 5EE3A 2PX8A 1I5RA 3TAHA 1K89A 3BMNB 3EGVA 4FP9A 4ZJUA 3OZAA 3K09A 2B4RO 3PUKA 3DKIA 1PKXA 2FFAA 2N1MA 3K96A 1YQTA 3LBIA 3PHCA 4LYEA 3CVUA 4ZHQA 2D5CA 3WFJA 4PXYA 2R7AA 3UJ9A 1P2TA 2Q5JA 2XMSA 2IELA 3MWLA 4H7EA 4J94A 1FFWA 1I4OA 5E1MA 4AZ3A 4C3ZA 2G72A 3F0TA 2FMXA 2G1KA 5BYJA 5CCXA 1RKUA 1P7VA 2P9JA 2YVAA 4Y1EA 2PD6A 3AIIA 1E79D 5BNIA 1U1EA 3ZHZA 5ALMA 1UIMA 5HJ7A 3A4MA 3AXSA 2MINA 3EH1A 3F1LA 1MC1A 2B69A 3JAKA 4M54A 3UAYA 2C2HA 1U3FA 3FUTA 3KVNA 4S0ZA 1Z4IA 1JSZA 2GRJA 3ZJ5A 4BTVA 2YCLA 3WGYA 3TL3A 2ONZA 1UOOA 1KZYC 1L4MA 3GQBB 1E9RA 1CWUA 3KHUA 4XGNA 1VIVA 4NBRA 2XTAA 4P4SB 3VPDA 2IYYA 4GX2A 4US0R 2O8DA 1EVQA 2C5BA 2IU6A 1YDEA 3EQ6A 3KUKA 2Q2VA 4HRVA 4IDPA 4UCWA 1X1QA 5EESA 4CUZA 4EY7A 3FN4A 4X91A 3N2GB 1POXA 3RYFA 5AQ1A 3M1AA 5C4IA 1ANKA 1YCDA 3R4CA 1MORA 3W3AA 4UAVA 1GDDA 3BK7A 2IU4A 3TD2A 1V11A 1MJGA 1L5HA 4MWZA 4D9FA 4FFMA 4YLGA 1RHKA 3BMNA 5B3AA 2I99A 2VZ8A 1PGPA 4L95C 4DLXA 1OJ7A 2IHTA 4BNHA 4JKIA 1JKFA 4Y2HA 5LZ4A 3EYWA 3NHPA 2WKQA 1HY3A 2ILVA 4JQOA 3O1HB 3NTLA 3I39X 3AP1A 2YJ6A 2HH9A 3MBIA 4D25A 1CY8A 1KEEB 1D4ZA 1KAGA 1CRPA 1O95C 1A1SA 4MP3A 4QTXA 3IE0A 3WNBA 3ELUA 3BXHA 4U6QA 2HTFA 3TIGA 1VBNA 2HSJA 4IILA 3T3MB 3AHFA 3G8CA 3SYTA 2YIVX 3DCYA 3I83A 3T6KA 4Y7DA 2JLCA 2G82A 5KPDA 4N8EA 5LBUA 2Q9AA 2D2FA 4G0QA 4LGCA 4UE6A 1TKCA 2G71A 2XGSA 2ZUVA 1GVHA 3VPSA 4XFDA 1WW3A 1SAYA 2OORA 2Q3DA 4Y9DA 5H16A 2IV7A 4C7MA 3DE1X 4TT8A 4EHKA 3D7RA 3GQBA 3I1FA 4PHGA 3SLRA 3LOUA 2CNKA 2A86A 1U0FA 3O95A 4HMOA 1WF3A 2F1KA 2OV2A 2YVQA 3CUTA 4P4SA 5J2TF 4BNLA 1MC5A 1OXTA 4PHHA 5L3SA 3RVDA 1VPWA 4V1CA 1I6KA 1QK3A 4ZRNA 1WZ2A 1W2HA 3N2GA 1Y98A 4JL6A 3TCKA 4TXJA 1H05A 1SQ5A 3K1YA 5I4KA 2FG6C 2MMCA 5DHSA 4CLEA 3KJGA 1IY8A 3DAYA 3IAM1 4FYHA 4KQ9A 1ZLXA 1AS2A 1MO2A 4YS6A 4DYVA 1XK7A 2QRMA 3EXIB 3L9WA 5JY6A 5AXDA 1A9QA 1TU0A 1K0FA 1LC0A 4OX9B 1N2IA 4YDRA 1J1ZA 3H83A 1GD1O 2XJ9A 3FCYA 3KFLA 5I7AA 2A1UB 3IEUA 4GUAA 3WRYC 1KEEA 4BNUA 1H85A 1PQYA 2VNHA 3A9SA 3V1LA 3U4GA 5KYTA 3CIFA 4ZO8A 1E69A 1E8DA 2WMOB 4UTZA 3I30X 3QEKA 4P81A 2QD5A 4TLMB 4RZ3A 5J2UB 5JS8A 4F4JA 4B32A 2JFOA 5DULA 4B87A 3CY6A 1VL2A 1NV9A 3E3AA 5AW7A 2QDXA 3HXMA 1E1RD 1T29A 2OUIA 1HQCA 2QRKA 2J0UB 2P5TB 5FV4A 2B8WA 1JYEA 3O84A 2EL7A 3ZJ4A 2GWHA 3RVQA 2G67A 5SY4A 5JD4A 4FR2A 5B4UA 3HACA 1JIJA 2FCAA 3MMNA 4GO1A 4MQUA 4RK1A 3RSZA 4DDMA 2GEUA 1OC4A 1E99A 2FOXA 2PSFA 4KREA 3IOMA 1T3TA 2A57A 2JFUA 3FDXA 2GLTA 1HXHA 2OP1A 2P6MA 3RHZA 2WYWA 3T9CA 5FTWA 5D1HA 5DN9A 4YCMA 3OIUA 4QGHA 2OZLB 4I3GA 4NV0A 3VYSB 1ILEA 5HCIA 1UT5A 1MJHA 3H9CA 3W1EA 2O6HA 2KJQA 3HJUA 1NWCA 2GPNA 3QPBA 2RCYA 2W6IA 3EXIA 2Q3CA 2GETA 4NHOA 5D87A 3R7FA 3DP9A 1YR7A 1YF3A 2ORWA 1ADFA 1U5BB 1CJCA 1NBWB 2GSDA 2H2GA 3IO5A 4ZDKA 1L4BA 1WZNA 2XDYA 2OZKA 1L1EA 1OFHA 2A1UA 2AZTA 4J7UA 4ZYZA 4QXPA 5I8ZA 2VK2A 2QB5A 4KAFA 4I6JA 1WCWA 2CXUA 2IXDA 3BE6A 3EEBA 5FWXB 1A2OA 3A9UA 3BJEA 3ZD7A 3BAFA 4H3HB 3AWDA 1EA7A 1S1MA 1T15A 2Z9BA 5G1NA 5JJCA 4F4UA 1SUBA 3Q1LA 1WR8A 1C1YA 1GCGA 3TZLA 5J2UA 1Y9JA 4CLHA 1RAEA 1UH5A 2AD5A 5IKOA 2A5JA 1VXRA 1HPLA 1YNSA 2G0AA 2CVZA 3TVDA 3DFMA 1HT0A 2XY4A 3KBBA 4EO9A 1JE1A 4QBTA 2WK1A 3ABRB 5JSFA 2X4GA 4BFTA 2J0UA 4D5GA 4BP8A 2Q41A 1RKXA 4Z99A 1E2KA 1LRLA 4O4JB 4NH0A 3WYGA 4R98A 3CEJA 4FGUA 5J5AA 3NAZA 2R3SA 4R0NA 2HB6A 2BZGA 4WZBE 2CMHA 1DC6A 2LVBA 5FOTA 3PV0A 3ZWKA 3MCWA 1HK7A 5IM5A 4UVGA 2P2SA 1ADYA 4KR9A 1XNGA 2BBOA 2XYRA 4OBBA 1ONOA 2ZWIA 4R68A 1JXQA 1XVAA 1B8PA 2HPAA 2YUIA 1LQTA 4GLBA 2OZLA 4DG9A 4GL2A 3ZDXB 2OD7A 1YONA 5K0SA 4EA8A 3JZIA 5TGDA 2XVZA 4MV3A 3G2PA 1KK2A 2BC9A 1HDCA 5CRIA 2V3CC 1U5BA 1JLRA 4WK6A 4CMGA 2MYUA 1G18A 3MAAC 4WKCA 2IZ0A 1XX6A 1JBEA 3ST7A 1HETA 5FWXA 2B7BA 3AR9A 4EGQA 3RSSA 3U19A 4Q3CA 4HH0A 2IYXA 1GUFA 1COZA 1KJ9A 2JAPA 3HJHA 3HV0A 1P62B 1BC5A 4COKA 4PGGA 2ZT6A 4KFTA 2AB0A 4LQLA 3NM6B 4LE0A 4QOSA 1VKJA 4YP7A 1II9A 1K27A 2JFPA 2CB0A 1YFLA 3CRW1 4UEOA 5K09A 2GF0A 4WFIA 1E98A 3OECA 5DIZA 1L5MA 3D0RA 1DLJA 3I6MA 4MB2A 1B6TA 1N6PA 1QV9A 1XZGA 2O52A 2RGNC 1Q0QA 1LPMA 5DW0A 3VUEA 5JMTA 5LQUA 4NBSA 2FZEA 2GFQA 3PC6A 4O4JA 2HCFA 1OI4A 1PN3A 4K81B 1IPFA 1GG2A 3EA4A 1F6WA 4NZNA 5DO9A 2Q3HA 2P0EA 2XT6A 4N0PA 4ECEA 4OLJA 2VAMA 3ENKA 4K9QA 1M6EX 2G63A 4KAJA 1IZYA 1X77A 4MH0R 1D0SA 2RAPA 2V54A 4FNMA 4JC0A 3MERA 1NUUA 1U3WA 2YCBA 4C0QC 4PX2A 2D0OB 1PR3A 3O2JA 1LDNA 3CLSC 2WV9A 1JDPA 4QL3A 4DLBA 1KJJA 5CT8A 3PUWA 1BS2A 3QWAA 3D5QA 2HU2A 5FCDA 1EVZA 1L7MA 2AZMA 2MSWA 2LRHA 2WW8A 3STYA 1VOTA 1U3CA 1Z4KA 3CCCA 3I76A 4FZ3A 3LC2O 2VP5A 4AY5A 4DLUA 1KQ3A 1XZKA 5K3EA 3QE3A 4RD2A 1FNMA 1SXIA 1CUIA 3X0DA 1JH9A 1E6UA 1S89A 1Z5VA 4GGOA 1UJBA 4M0DA 5HBRA 1FP2A 1EX6A 4KE7A 4YHHB 1Z26A 2LCQA 2GO1A 1PFVA 2WVGA 4P54A 2IPMA 2BISA 4BMNA 3VZQA 4MRRA 3ASVA 2AN4A 1XDUA 3LBNA 4ID3A 4EKYA 2BFEB 3FAZA 1Z4OA 4B45A 1WSAA 1ZC3A 4WNCA 3Q40A 2R1VB 3QKRB 3RTEA 1MR3F 3Q7EA 4C87A 1DELA 3EDMA 5SYAA 3T7JA 4BCBA 1V4NA 1JHVA 1JDJA 1UBNA 1QH0A 3U4DA 5KYXA 4CKBB 3KZMA 5ADHA 1VMDA 1BVRA 3R41A 8ADHA 2X5NA 1N8SA 4RQAA 1W4BA 3HK2A 1DIHA 3WOVA 4RZUA 3F6CA 3NU1A 4NZZA 1V9SA 5THQA 4IRUB 2NSHA 2C58A 2FR8A 3DDUA 1XALA 1A76A 1KMIY 2C77A 4HAIA 1P31A 2HJWA 2IEDA 1O8CA 1AXGA 2J7PD 1ONBA 2W22A 2QJRA 3EGDB 3I1JA 4FYMA 2ZIAA 5JVDF 3M1YA 4N3GA 4RFSB 4ZDJA 3FOEC 3GDWA 2J6HA 3W5IA 4UJ5A 2BH9A 4GRIA 4CCAA 3PWTA 3VHRA 2B0JA 3OZ7A 1BD4A 3H5TA 4M6WB 2ZW9A 4PFKA 4AS1A 4HDQB 3ZI0A 3OQPA 1FIUA 3W7VA 1MD9A 1T9AA 3D3WB 1CFJA 3Q7IA 5EHIA 2WE8A 4RYDA 4GXRA 3KE9A 1I7DA 2FSIA 1Y63A 1B7GO 1IG3A 2P62A 2PSEA 4MYUA 2VQDA 3C8DA 1FUIA 2O2ZA 3GMSA 2Y67A 4YONB 2BGKA 2A3RA 3GR6A 4QYMA 2BFEA 3HZZA 1OI3A 3FYHA 3PNVA 1EUZA 4DZZA 2IWRA 3QKRA 3LYAA 4JOSA 4BGDA 4WIAA 4Q9HA 5LYYA 3NHKA 3PPWA 4ZXPA 3LV8A 1ZN8A 2P9CA 5F4ZA 2GCEA 3H3XA 1XAGA 3E84A 5C7YA 4CKBA 1Z2AA 1DAFA 3MB8A 3R40A 2AS0A 1CUWA 4RM3A 4UOZA 2C5GA 4NZMA 2PM8A 2PRZA 2ZE5A 4AJNA 3IERA 1ZMTA 4CCSA 4GZ5A 3GEEA 3IGFA 3QH4A 4IX1A 2EDAA 3FPLA 2FJ0A 2D74A 2ZDHA 1V48A 1LTKA 1O5IA 2W0SA 3IR7A 4NBUA 3X1DA 5JDCC 3VR6D 4F2DA 2CEAA 1KYXA 3RRFA 3EGDA 1J00A 4RFSA 1K9SA 1VL1A 4H7KA 1P8AA 4REQB 4Q3LA 3THRA 1PWYE 3A1VA 4NIMA 2UXDB 1EFTA 4M6WA 4ROTA 4LV8B 2VQFB 4TL6A 5EE1A 2FWJA 1VMAA 4OYLA 2FQXA 3U16A 4X3CA 1VQ1A 3D3WA 3DDZX 3HDHA 1C7RA 2PD4A 2FSFA 4IHJF 1PJAA 3HCNA 3W4IA 4C4AA 2IHVA 4KXFB 4Q16A 1SOMA 2Y6UA 4XD2A 3SY8A 3UTDA 3ZK7A 5IVDA 2W0MA 5FBRB 4PNZA 3F78A 2ONKA 3DUWA 4GMXA 3AOGA 1I8TA 1JU4A 2HEGA 4EI7A 1QWSA 2VNAA 2ZJOA 3OLZA 1E7RA 1D9ZA 1UPBA 3OM1A 2V7TA 1Q7BA 1CYDA 4LDRA 5J4VA 3E3NA 1P19A 3FROA 4DDHA 4II7A 5LB4A 2YWBA 4R3NA 4DLTA 3C8ZA 4DGSA 1RQXA 1SM4A 1JS1X 1KZ9A 1GQQA 1ZSNA 4LHEA 4ZQEA 4K9PA 4WOPA 1Q3HA 2JHAA 3BRWA 2QRZA 3IHTA 4N8SA 3U17A 3ORYA 1Y1PA 3V9AA 4GOND 3QU5A 5AR1A 4GOKA 4ARBA 5BO5A 1U3UA 4AJ9A 1GVNB 2HMYB 3DZKA 3TO5A 1P1HA 2Y9MB 4YX9A 5CFQA 3MJDA 2OHVA 4RIGA 4UBMA 2X41A 1MVNA 2QX6A 4JVNA 5FLKA 3V80A 4PPFA 2ZJ4A 2C0PA 4HH1A 2CV1A 1YJXA 3PR3A 4X64B 5KYWB 4KX5A 5ITVA 2IS6A 4DNOA 3WIBA 4ZYYA 1BQ3A 4KITB 1KEZA 3QWHA 2JFBA 1T6XA 1N6LA 1CUGA 2BFNA 2YASA 2V58A 3H2GA 1UKCA 1KI3A 4Q00A 2QAGC 4DUPA 1YNOA 4DCVA 2WF7A 3HZOA 3DTTA 3Q88A 4Z9YA 2H1LA 1L5FA 4B4WA 3LUKA 4K03A 1HDGO 1Z12A 3JQGB 2AW3A 2OXEA 3TSAA 1CVRA 4E08A 3EIUA 3N0RA 2AYXA 4UM5A 3V1TC 1GTRA 5F98A 2GVNA 3WLSA 4G4JA 4BE7B 1TO2E 1ZICA 4ND3A 4RPHA 2HADA 5IFKA 4XPIB 5B7QA 2FH5B 2CT8A 4G3XA 3IE2A 5HF6A 3HEAA 4B80A 3RG2A 1Z0JA 2V97A 1JAIA 3TGPA 3DZFA 4ZYXA 2OCIA 4OL0A 3SQWA 2CXQA 1WXGA 5DHUA 1KE2A 2PD3A 3FHOA 3KETA 3R3SA 4RM2A 1YMVA 4ACBA 5F7OA 4KRFA 1R66A 2E4VA 1H66A 2HBQA 3MD9A 4LHYA 4ZEOA 4RCVA 1E1CB 4BEWA 3R3ZA 1I1OA 3STHA 3H19A 1ECCA 2WTEA 3GFGA 4ZQFA 5K0BA 4BX0A 2H8GA 1HLGA 5K45A 1JHPA 4I5IA 3BIXA 3D6TB 4BMDA 1GPBA 3A4IA 4KAAA 2BV3A 1IZ8A 2BBSA 1PUXA 2ESRA 3LC0A 3WQBA 5U9CA 2YN4A 4HMQA 1VSVA 4A03A 4UXIA 2PA0A 3GEDA 1YCGA 3ER6A 1UBCA 5KYWA 3QJ5A 2O1WA 5ED0A 2FOLA 4K7JA 2V6MA 4L8FA 3GMTA 5CLIA 2FCRA 3LDUA 2G07A 3KJQA 2G77B 2E6KA 4XLTA 5ELMA 4K2HA 4M3NA 2UYHA 1R88A 4NV3A 1USWA 2R2GA 2QQFA 3E8SA 3A11A 4LJ8A 5AW5A 4XASA 4WEQA 3JQGA 1UANA 4RD1A 5CPFA 4CMKA 4H16A 1NYRA 2IF0A 1X87A 2Y05A 1RACA 1UOPA 3R5SA 4ARVA 5EWLB 1PT5A 3PPXA 1OYWA 2PL9A 3T5TA 4YMTA 2E4ZA 2GJ4A 3EAQA 4PFSA 3F7TA 4XPIA 1W0CA 2GPSA 3DBRB 3OJXA 3L4EA 2UYGA 2F1OA 1P5RA 2VOEA 1EHIA 4CCYB 3WGNA 4P33A 3SIXA 1O89A 1PSDA 3QK7A 2W83A 3JVUA 3TB6A 5K0JA 3HB5X 1VHJA 3M6UA 4LZAA 4FMPA 1HDOA 3G6WA 1XSEA 2Z5LA 3F6YA 4ALKA 1MQ8B 1BE1A 2Y1DA 3ABOB 3AHJA 1E1CA 3AYZB 3IDQA 3PGA1 4Y9SA 3TS1A 5KVAA 2C20A 1I24A 4PIPA 3E9RA 1NJ2A 1GFZA 3RC8A 4HO1X 1P4GA 1T5LA 1JR6A 1OJLA 1UEJA 2D8AA 1G42A 2VJMB 3VYUB 2GD2A 1YASA 1E2EA 1DRWA 1ORVA 4B35A 2NX2A 1G21B 2WWXA 1FFXB 1ID1A 1KY3A 2A35A 3H2BA 2PXCA 2ZQZA 2IYAA 4TWZA 1WOMA 4MDEA 1M2GA 1DFHA 5K8TA 1HFEL 2Q4BA 2ZT5A 3AJAA 5B36A 3K5WA 5JAOA 2OQ2A 1IUOA 1JL3A 4LXUA 1AGRA 3BHIA 3AV0B 4Z4IA 2WT4A 3CN9A 2RHLA 3KDAA 3I34X 3D4IA 3KXIA 1X1BA 3A1TA 3AK4A 5BQ5A 4L0CA 4U9IS 1KS9A 5EWLA 3H6HA 1I7LA 2QRJA 3C1TA 4PSKA 4UTOA 1NBEA 3DBRA 3WDKA 4CXMA 2YZGA 3UMMA 1MMFB 2HPHA 5AYVA 2VDMB 2VT7A 3FGOA 4CCYA 5FWNA 2JIZD 4ZCPA 1KSGA 1YQXA 5DTQA 2I8LA 2JIRA 4BV3A 2ZYGA 1VLMA 4OLFA 2PZAA 2EV9A 2QM8A 3CBGA 3RS3A 2CFCA 3WBFA 1NW4A 3TBHA 3AW9A 1CR2A 1R4MB 2O9JA 1H8HD 4K9MA 2QE6A 4H6PA 4MUAA 2G17A 3PLRA 2DRIA 4D4JA 4FOTA 4LXTA 4MVYA 2GPBA 1A88A 3MWGA 5HF5A 1SKQA 5HKBA 4CR6A 5B1YA 1J2RA 3SM9A 1KEVA 5FL7A 4NPCA 4LC1A 1UKVY 1UCFA 1HRKA 1PFUA 2ZRDA 1F14A 2VJMA 3KUDA 3OF5A 1GU1A 2ZEJA 4R4JA 4D42A 4I6GA 3OC0A 4OBXA 1G21A 2DHEA 4RZSA 1FFXA 4KXQA 5CB4B 1PQUA 2P4HX 3INYA 5ALKA 2B8NA 4LFBB 4AZSA 2VTKA 3DLCA 4U2DA 3FLBA 3H65A 1X8XA 2WAYA 4TTAA 2BVNA 2HMSA 3ICPA 4FUQA 1RAAA 3WO1A 3AP3A 4LOAA 3I9OA 4EO4A 2PS3A 1NUPA 1IM8A 1D2HA 2LP4Y 1YAJA 5B1SA 4YPFA 5L7WA 3H86A 1NY5A 4EYOA 2XYPA 4S1OA 3WLLA 4CIWA 3UBTA 1D4AA 4W9NA 5HFJA 5LA6B 1V26A 2CDBA 3BIFA 3I9JA 4LRUA 3N8KA 1NXOA 1PJZA 1RCFA 2P9BA 2QF7A 1Y1SA 4CV3A 4YAGA 3U3OA 4GNRA 5DMXA 2VK8A 4E11A 2WNIA 3TJZA 4EUFA 5HFAA 5KDLA 3U3KA 4CLXA 2YWGA 1PRYA 3KSUA 3OZEA 1R4MA 3ICQB 2NSLA 2HLHA 2ODPA 5TDHA 1WW8A 2FW6A 3R9WA 3BC1A 1FVHA 3PRYA 4N0EA 4DREA 4LTMA 1DADA 2F59A 5FOWA 2WM2A 2HSGA 3CJQA 3ZDRA 5I45A 1NHWA 1RYHA 2DHDA 1DIAA 2F67A 1QF7A 1XDDA 4J0IA 4BDTA 2W2OA 1M6VB 1NBHA 2AQIA 2Z8XA 5CB4A 2OILA 1BROA 3HVJA 4AIIA 1CDEA 1I0ZA 2SKCA 3FWHA 5KOIA 3UJNA 3V1YA 5DASA 1TAHA 2OHXA 1RPAA 1P44A 3KPYA 2J4DA 1KF0A 2QG4A 4KL8S 4XM2A 6ABPA 2ZULA 1JDZA 1TVCA 2R7NA 4IX9A 2J87A 3OHPA 2VNKA 1HZZC 4KQMA 4RTOA 2PZ8A 1TF7A 2D4AA 4FOPA 4EY4A 4ND4A 2QRUA 4HFRA 5KNDH 5LA6A 4NJEB 2O2DA 1LGYA 1XF9A 1G6HA 2I65A 4L15A 4S35A 3EEQA 5FAKA 4X65B 5SICE 4OHZA 2QTRA 3CNEA 4IZIA 2LGJA 4EUKA 1GPH1 1YOVB 2GO7A 2WWIA 3AYXB 4J1SA 4OHUA 4JJAA 2FF5A 4YRCA 3G8BA 4ZZ1A 4JYBA 2OAQ1 4KK3A 3AUFA 3GROA 3ZGXA 3IR6A 4E33A 4YYEA 3QU2A 2EVWX 4B6SA 4UM7A 3V00A 5HE8A 3W8RA 4CV2A 2YUTA 4NXNB 3OZFA 6YASA 1BDBA 2E18A 3WLHA 2KWIA 2BE7A 3PC4A 1B76A 3QHQA 3O8DA 1I2CA 4OJQA 4WXYB 3KJXA 3PFNA 5T57A 3VSAA 3QXJA 5JECA 1SEPA 1WY7A 3BORA 3DGFC 3N74A 2B34A 4GYWA 1BVHA 4DIKA 2AMFA 2XWJI 4M9CA 4K6GA 5ILQA 1I9CA 3PPYA 5K20A 2ZAYA 2Y0EA 1M6VA 2ZSHA 4NBNA 4X45A 5E7JA 2VCHA 4D9CA 4GBGA 1N75A 3HUDA 3VNQA 3WLRA 4N3CA 2LCFA 2WM3A 5DW3A 2F4VB 2GF2A 4FMBB 4KIUA 1AMOA 5DTRA 4B33A 2MTBA 3L8EA 3KKNA 5JRDS 1VM6A 2GN4A 2ZSIA 2E5LB 4KLNA 3LOQA 1O2DA 3C6KA 2DUMA 4F9EA 3Q2OA 1ORDA 1SHZA 3CH7A 1SCBA 2QX8A 5A5FA 5FO0A 3V4RA 2X0EA 1FOEB 4IBOA 4EMUA 3OZXA 4YCSA 5DP1A 3ZGLA 4UM9D 1VLZA 3ISVA 3LXMA 4NJEA 3DLPX 4UU1A 2C4MA 4YMLA 1GZ7A 3BJRA 5K0NA 4RJKA 1OXXK 2OOSA 1Q1EA 4FEGA 3OEWA 1YOVA 4JUIA 1CFZA 3TDMA 4C0HA 1CC1S 2G6BA 5IM4A 4DV2B 4HZIA 5A4FS 1GFSA 3VNUA 4HG2A 2FGKA 1BX0A 2OC9A 2DKNA 1KOGA 3FVVA 3R3JA 3BMCB 3KJNA 2YJTD 1PCXA 4GZLA 3K70B 3NXSA 2BF7A 4M53A 1W29A 4FIZA 2X8LA 4YJGB 1D4OA 3NANA 4BZQA 2YNMC 4ES6A 4IMRA 4MWOA 1ZJWA 1YRLA 3TLEA 3VJKA 3I5MA 5DXFA 3H5WA 1M1NB 1QZUA 4QPJC 1C7QA 2A9PA 5DBOA 1AQUA 2EP7A 5CVUA 1WZIA 1MJFA 1RZRD 1OUMA 1TUEA 2D1TA 3KSRA 3W8DA 1JHDA 4G6ZA 3WFZA 4EI8A 2JVJA 4ZCRA 1NJ6A 3GH1A 1WF6A 3QVWA 2H08A 3IHLA 4P4LA 2V45A 2ZBUA 4O0MA 2GEKA 1U8TA 4JJ6A 4KDFA 5TARA 3ZDQA 4AROA 1AO3A 3DCNA 4RWZA 5EZYF 3SX4A 1F06A 3S7TA 2JK1A 5MGNA 5L53A 3ZDFA 5ELXA 4ND2A