4W7HA

Crystal structure of deh reductase a1-r mutant
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
249
Chain Sequence
MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based Conversion of the Coenzyme Requirement of a Short-chain Dehydrogenase/Reductase Involved in Bacterial Alginate Metabolism.
pubmed doi rcsb
source organism Sphingomonas sp. a1
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase
total genus 87
structure length 249
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4w7hA00
1ZEJA 5L4LA 2CY0A 1PS0A 4DLAA 3LK7A 1EK5A 1F8GA 3CMCO 2O3RA 2J3JA 5IDQA 1RYDA 3CTMA 3U49A 3ZNPA 3PJFA 3DBRB 2DPGA 5BSEA 3VH2A 1ZSNA 4R3NA 2WMDA 1XGKA 3DL2A 1RYEA 3I9NA 4PZEA 5G0WA 4JXKA 4XGKA 3L6OO 1IULA 1K89A 2B37A 2P4QA 3D3WA 4FW8A 4PVCA 3U4CA 1F12A 1FDVA 4E5YA 2YV1A 1PJCA 1PZGA 3E9MA 2NTNA 2R00A 2DM6A 4EJ6A 5DF1A 3UVEA 3QV1A 5GZ6A 4R1UA 4CMEA 2NACA 1U1IA 3DTTA 4LSMA 2EGGA 4YJGB 1OAAA 1GR0A 2VHYA 1Y8RB 3GGOA 2OXIA 3SEFA 1B14A 4A2CA 1E3JA 2ZB8A 3OJ0A 4E5KA 1BRMA 3AY6A 5ER9A 4IZHA 1OOEA 3DZHA 4WCFA 1LXCA 3K73O 3RUEA 3ZV5A 1TT7A 4BQRA 1VSVA 3NDJA 3GDOA 2YHIB 1ISGA 1M6WA 2ZIZA 3EGOA 3PEFA 3DZGA 1E6EA 1ZMOA 3BMQA 1A4IA 4OGWA 4KMSA 2Q50A 3ETEA 1IZ0A 5B1YA 4MVJD 1E1MA 3D5TA 4TQGA 4YVFA 1XR3A 3F5QA 1W4ZA 3E18A 1HE3A 1KBZA 3BMCA 3EZYA 3OF2A 3VZSA 4XGIA 1P1FA 3SJ7A 1ARZA 1X7DA 5TF4A 1SB8A 6LDHA 5MDHA 3AU9A 4X54A 1I32A 4FJ0A 4BHTA 2I3AA 2Q2QA 2BFPA 1ADFA 2G76A 3GN2A 4RVSA 5MGBA 3C7AA 3L9WA 2YHIA 2Y99A 4ZRMA 2W4QA 1ZO8A 4NBTA 4EZBA 3MOGA 1O8CA 1YJQA 1PGJA 5JDCA 3WIEA 1H0KA 1H94A 3INGA 4GQAA 3NTQA 3JQFC 4I1IA 1A7KA 1S6YA 4ZU3A 3TZCA 4TROA 1PJ3A 4U6SA 1SEPA 1UR5A 3JYOA 3KYCB 3ZWOA 4FCCA 3ANLA 4W9NA 4Z0HO 4GGPA 1R37A 2YFHA 5TC4A 4JBGA 2GYYA 4OYRA 2I65A 2FMUA 2BI7A 4IDEA 1JLLA 2CVZA 4GVLA 1NPYA 3WFJA 4BNJA 5IZCC 4XA8A 1N8KA 1GFSA 2X58A 3JQFA 3GN1A 1TT5B 3AI1A 4W4TA 3ZWPA 3DBLA 2I66A 3NT2A 4E5PA 1LC0A 4OM8A 2J3IA 4K28A 2VRCD 3JQ7A 2OZPA 4NK5A 3DOOA 5CG2A 3R1IA 3PLRA 1C14A 1DBVO 1CJCA 1YO6A 4RDHA 1DOHA 5JS6A 1IY8A 3FRJA 3PHGA 4NBVA 3NGLA 1EE2A 3M6IA 1HRDA 4M8SA 2HUNA 1EDOA 5A06A 4J90A 4RO0A 3ZWCA 1NPTO 4DC1A 3U4HA 2PLAA 5ILGA 4E21A 4RF3A 2J3KA 4FFNA 3H9JA 1B15A 2AQHA 5JC1A 5BNFA 4B4VA 1V3UA 3DOCA 3ANMA 2E4AA 4RDIA 1A71A 3WMXA 2D3TA 4O0LA 2WTBA 4N5MA 3WDSA 4AL4A 1C1XA 1ONNA 3ROPA 3I6QA 1DIRA 4PFJA 4E12A 3L77A 1YWGO 4MIEA 1IPFA 4HNGA 4B4UA 1GADO 2IEBA 1E3IA 3DHEA 3FTNA 4FSHA 4I5EA 4IZIA 4NJMA 3RQSA 1KS9A 4D41A 1PJ2A 1T26A 1PWXA 2HRBA 4II2A 2NQ8A 1C0PA 4BMVA 5EESA 5CEEA 4PIVA 4XKJA 4YJHA 4D3SA 4DXHA 2PD6A 5ENDA 2EP7A 2OFPA 4XQ9A 4RF4A 4BO5A 3VPFA 1B2LA 1K5HA 1GUZA 3H65A 3ZU5A 3QWAA 3WGGA 5FI5A 3A28A 5DCYA 2QW8A 3HN2A 5C7LO 2AQIA 4Y8VA 2AW5A 3P7MA 3ZU4A 2CZCA 1Q0QA 5JDIC 3I5MA 1KIFA 5EERA 2Y1FA 3UCFA 2EJWA 4I5DA 5I8ZA 5IXSA 2IXBA 3PXXA 1OC2A 4AVYA 3JQ6A 5K9ZA 1UH5A 4D3DA 3FCOA 2FR1A 1MG5A 1R16A 4L8VA 2VWPA 1HZJA 1PZFA 2PKQO 3PJGA 5I7SA 3RD5A 2CDBA 3LT0A 5T6BA 3VTZA 1HYGA 4CL8A 1JDJA 1ISJA 3WYEA 4CM1A 5K6AC 1R0KA 4C7JA 5DDIP 1NXQA 4A73A 4F3YA 1G1AA 1I24A 1U4OA 1I33A 1EDZA 1Q0LA 2ZQZA 3P2OA 1JKFA 4PG7A 4JP2A 4Y67A 5HBRA 4OXNA 2Q46A 2Z5LA 3QVXA 1E3WB 4AJPA 4DPLA 5L53A 2HK7A 3DZIA 2DUUA 4HUJA 5AOVA 1GEEA 1IHXA 1N9GB 3F5SA 3H7AA 2D5AA 1R4NB 3MTGA 4GGOA 3JSAA 2GSDA 1P9LA 4YAJA 2IODA 3L07A 5ES3A 3GFGA 3DEYX 1KVUA 4IY1A 3QLJA 3JYNA 3P2YA 2EWMA 3JD4A 3LYLA 2TMGA 3H3JA 1DIAA 1SC6A 1G6KA 1HLDA 2G82A 3OEWA 3U4IA 1YOVA 5F1KA 2PZKA 5G4KA 1P74A 4DUPA 2CD9A 4YAKA 5H81A 3GH3A 4EUHA 1DAOA 3LDHA 3N58A 1YL7A 4FIZA 1CF2O 2EW8A 2C7GA 3DHYA 3LC2O 2VUUA 2HO5A 2GR9A 4ALIA 4ZQHA 4DLBA 1EQUA 3OBBA 2WWRA 5CHEA 3VZPA 4BGIA 4DBVO 1WP4A 1U8XX 5CFZA 4N7RA 5U9CA 2BD0A 1IYZA 5A4DA 3PWSA 1YDWA 2FPPA 3OICA 4BNVA 1NBOA 2UDPA 4AJIA 3PFFA 1DHRA 3TL3A 4RVFA 4XQCA 1H5QA 1LRJA 5KJ6A 4CMBA 3W4JA 3RKUA 2B0JA 1YBAA 4DC0A 5I7EA 3G1UA 5KWEA 2QRKA 3FI9A 1ZXBA 4NFYA 5HA5A 3WNVA 3SBOA 3JQ8B 4MVJM 1DRWA 1PR3A 3ZHBA 3JCZA 3OJEA 3WTCA 1I8TA 2Y0DA 1ZZEA 2PD4A 4GH5A 2BFAA 3GAZA 3WQSB 4Z3KA 1QYXA 1YQDA 4BB6A 1TVEA 3ZU3A 2ZTLA 4EEXA 1LC3A 3I9LA 5IF3A 3DOJA 3QVWA 3ZDFA 2Y66A 4O63O 4P22A 4R16A 3LLSA 3UKOA 3VPXA 2FWMX 2EKQA 3TL2A 3WWYA 4R69A 1Z73A 2E37A 5B4UA 1T2CA 3HFGA 1CYDA 9LDTA 4YT5A 3PQDA 1NVTA 4HNHA 3LU1A 1MX3A 4IINA 3LQFA 1TEHA 1LJ8A 2CSUA 3GUCA 5G0VA 4BV9A 1NWCA 3TOZA 1E7YA 3HB5X 4R54A 2EF1A 2JD2A 3I9JA 1ZW1A 3RBVA 2C54A 1M67A 1P1HA 3LC7O 2XXBA 3H9QA 4PLYA 5JCXA 2WD7B 4YB8A 1YBMA 1YGYA 3H5RA 4FGSA 1DO8A 4ND1A 1E7QA 3D3WB 4JQCA 1B8VA 1P1KA 1ZK1A 3WOHA 1Q0HA 1N2SA 3CPSA 1H9BA 3DR3A 4CMGA 3VHRA 4BO1A 3GZNB 4J0FA 4NBRA 4RJTA 2PZLA 4B7XA 4BO8A 1RM3A 4MVJG 2IZ0A 3QSGA 1V0JA 2V6FA 1X14A 1A4UA 4Y6PA 3PRJA 1D7OA 1U7HA 3E9NA 2D8AA 3MOIA 3RI3A 3UGKA 1Z75A 4D46A 5TJ9A 5TIIA 2FSVA 4FS3A 3SVTA 3ICPA 4FPXA 4E13A 1PSDA 4KWIA 5HTOA 3IL2A 1ZK0A 1I3KA 1O9BA 2VUSA 3ONFA 3KVOA 5K6AA 1P33A 2YW9A 3F1KA 4LRTB 4B7CA 3JD3A 4GBJA 1E3WA 1UAYA 2QG4A 4WJZA 1ENPA 4J7CA 1XEAA 3I4CA 3OJLA 4RVDA 3UHAA 2P68A 8LDHA 3P19A 3RROA 5AVOA 3AJRA 3RC7A 3IKTA 3JQAB 4YAEA 3RCBA 1WAMA 5C3MA 4EJMA 3NDIA 4J7UA 1XLTA 4P38A 1KC1A 5T8KC 4S3MA 3VDRA 4AJLA 1MA0A 2V6BA 1HF3A 3FWZA 4E4YA 2GN4A 5L45A 3M2TA 5G4KB 5JYDA 1CDOA 3H5NA 3UN1A 4CR7A 4PG4A 3KSUA 1ZKMA 3PTZA 4AJ4A 2OGUA 3MJ4A 2ZKLA 3ZNOA 5JXWA 1WDKA 4OO3A 4YYZA 3I83A 2RBEA 2FN7A 3GT0A 4CMJA 1LRKA 2GASA 1SO8A 1PS9A 1GV1A 3SXPA 4XWYA 3RKRA 4QSMA 1HTBA 3NV9A 4J0EA 4R01A 5JE8A 5KNLA 1OI7A 4YBZA 4I9NA 1SOWA 4UVIA 2C82A 3WYCA 4U8GA 5H83A 1ZXLA 1KEUA 4GL4A 4G81A 1KVTA 1N1EA 4R68A 2C29D 4YJGA 2HCTA 3BYZA 3OA0A 4FN4A 4CV0A 1DC4A 1FXSA 1KVQA 3BMOB 4DPKA 3VH1A 2DBZA 3U62A 1NVMB 4JJFA 1EFLA 1EMDA 2X0RA 4IQ0A 1PJLA 4KUHA 2R6JA 5DCUA 3OMLA 4F45A 4BUCA 1EBFA 1YB5A 4RQUA 2C20A 1GZ3A 1NM5A 6ADHA 5CPBA 3KB6A 3WICA 2V7PA 3IKVA 2OORA 3DXFA 4MVJE 1W8DA 4MO2A 1U2DA 3FNHA 4I08A 3Q2KA 3M1AA 3GG9A 1GL3A 1FDSA 4FDAA 3WNQA 4G65A 2B36A 2YV3A 2VOJA 4IMPA 4H15A 4R9SA 1IUKA 3H2SA 5JAQA 4PG6A 5ICMA 4HFJA 2HMVA 1WMAA 3DBLB 4ALNA 3JD0A 1N7GA 1KY5A 1VL8A 1BXZA 3ZWYA 3JQ7B 1Z74A 1UDCA 1YKFA 2GNAA 2GN9A 4RQTA 2B83A 3GF4A 4YJDA 4YRAA 1Q7CA 4IQGA 3P5SA 1DJQA 3QJ5A 3AFMA 2BH9A 1FK8A 3FNFA 3GG2A 1ZMTA 3E6AA 1NP3A 1RM4A 3HG7A 5L40A 4J2HA 3TSCA 3WIDA 2CVQA 1NYTA 2BGMA 3WBFA 2P9GA 3D7LA 2XPCA 3DONA 5EQDA 4DMMA 1GZ6A 5IDXA 5KIAA 3JQ9C 1SBYA 4CQLA 1B7GO 3W4KA 2ZB3A 2RHCA 4NK4A 2Y93A 1KVSA 5AYVA 4JBIA 3BMCB 2DT5A 2NSDA 3OETA 3C1OA 1PGPA 2VYVA 1XHLA 4TZTA 4EYEA 3PZBA 4TRNA 1VSUA 4BNLA 1UXJA 3IIEA 1ZK2A 3E03A 4IDGA 3ZWBA 4WUVA 1HDXA 3JQDA 5A3JA 4WE3A 4EUEA 1Y5MA 2D2IA 3LT4A 4WLUA 2RIRA 5A05A 1DDOA 3TDKA 5A9SB 1V35A 2VQ3A 1BWSA 3B70A 1L1FA 2D4AA 2J6IA 2HQ1A 4CQLB 5I9MA 4OSPA 2IRWA 4IXWA 4RPLA 2Y1GA 2DVMA 4PLZA 2X9GA 1X0XA 1ZSVA 4WGGA 3VPGA 1DHTA 4UREA 5DBGA 4BNXA 3C1TA 2D1YA 3WR5A 1BMDA 3N74A 1X7HA 3ZU2A 1HDGO 4XZ3A 5BT9A 3BHIA 4Z3DA 3DZJA 1T2FA 2VWQA 4JIGA 3HDYA 1UDAA 4RGBA 4ESOA 4Z6KA 4MKRA 1AGNA 1NFFA 2C5EA 3CMMA 3LF2A 4Q3BA 3IJRA 1T2DA 4WEQA 3SC4A 1NNUA 5COBA 1DSSG 2BMAA 3EAGA 3GPIA 4IIVA 4BMSA 2R2GA 3Q9NA 3GZ4A 3O03A 2J8ZA 2H9IA 3OHSX 1T24A 3GVIA 4MVJF 2J5RA 1NFRA 3BMNB 3GNTA 3JTMA 3NAQA 4J9UE 4KUEA 4L75A 1U7TA 2JCXA 4XIJA 3DWFA 3K92A 4DQUA 4WLOA 1P45A 1X1TA 5FF9A 4CM4A 2YV2A 4MDHA 3FBTA 3TN7A 3DBVO 4YRDA 2OHXA 5KVSA 2PGLA 2Q2VA 4LCJA 1LTHR 1ZJYA 3AM4A 4FQ8A 4NHEA 4PLTA 5IG2A 1DC5A 2X1HA 1R0SA 4XB2A 2P9EA 3GNSA 4J3FA 3ST7A 2EERA 4OH1A 3KEQA 3COSA 3VPSA 1E7SA 1LLQA 3HHPA 5IDYA 1QORA 1NFQA 4ZQGA 2NVWA 2AE2A 4M86A 3LC1O 3NJ4A 3BTUA 5AXAA 1ZNQO 5DT9A 1BDBA 1VKNA 4R51A 4LVCA 4UVGA 4WLVA 2IZZA 1R4NA 2FR8A 4GMFA 5J23A 3ZN2A 1P1JA 2W2KB 4I5GA 2GLXA 1MP0A 3O8QB 3ZV4A 3WBBA 3Q6IA 2OMEA 5I7VA 2O3TA 1Q1NA 2BKAA 1UXIA 2DTEA 3AY7A 3C7DB 4UVDA 3E5MA 4IGEA 4A26A 4OKNA 1DPGA 4XDZA 3U9LA 4IJVA 1H2BA 3OQ1A 1LUAA 2E49A 1KC3A 3CH6A 3PP8A 4J1QA 1PR9A 4BO4A 3UCEA 4OSOA 1XELA 1U3VA 4WLEA 4HBGA 1F06A 1U28A 3PYLA 1ML3A 3WG9A 3TPCA 3UXYA 3KM0A 4ZQBA 1M76A 1QG6A 2X6TA 5A9RA 1HDCA 1I3LA 1PU2A 1SZJG 4FBGA 3AW9A 3QIVA 4CMKA 1PTJA 4ND4A 5ILOA 2DC1A 4Z9YA 1E6UA 4RLSA 3C1AA 3VZQA 4CM6A 3WGQA 1P1RA 1Q7GA 3AWDA 3NDRA 4QECA 3HADA 3N7UA 3RU7A 4NFSA 3HUDA 2P2SA 1MFZA 1YE3A 2EHDA 4A03A 3ASVA 3FR7A 4CJXA 3RBXA 1HYEA 1MGOA 4B79A 3JYPA 1GD1O 3ZNNA 1E3EA 3ONEA 3PYMA 4A7PA 1BXGA 3JV7A 3DAPA 3S55A 2OOSA 1YVEI 4XRRA 2IYOA 3H4VA 5B37A 1ISHA 1K6XA 3GVHA 3DFUA 3L0DA 2CF6A 2VHZA 2YFQA 3OA2A 3TZQA 4U5QA 1I3NA 1OZAA 4UUMA 3S2FA 3T4EA 1J6UA 4EDFA 5KCZA 4IS3A 4R1TA 5JSFA 1ADBA 2FHSA 4EGFA 3H3FA 5F21A 4JP3A 3ETDA 3TRIA 1IZ9A 1WNTA 3GUYA 2PD3A 3GHYA 4HX5A 3M2PA 1LI4A 1GYPA 4D45A 1IOLA 1LDGA 2V6GA 1MXHA 2J5QA 5G0UA 4E6PA 1HT0A 3I52A 2PZMA 4FJ2A 2FR0A 4CV1A 5L95A 1U9JA 3EVTA 4AJNA 1WZEA 3CIFA 1H6DA 3OJFA 5JAIA 2DQ4A 1GYRA 1PJBA 1XWFA 4KWHA 3PYXA 1YL5A 1JU9A 2X5KO 1WDLA 1XIVA 1BXKA 3CINA 2W2LD 1V6AA 3DMYA 4NNJA 3ZWVA 1ISMA 2Y0CA 4CV3A 2QRJA 3WXBA 4LMPA 1D8AA 1LLCA 4E5MA 1YONA 1F14A 4OKIA 3I6IA 5JLAA 3W8DA 2G17A 4Q3EA 3FHLA 3T7EA 1L7EA 5IDWA 5IN4A 3R6DA 1XDWA 1WLYA 2JHFA 1DIGA 1YJ8A 2ZK7A 3GFBA 5L7WA 1AE1A 2BHLA 3QVTA 3H8VA 4WASA 4CM8A 1QYWA 2H1SA 1LSJA 1T2AA 2F1KA 3RC2A 1FF9A 4L76A 1PQPA 2FRDA 4ND2A 3WTBA 4CLRA 4IBOA 3KHUA 1B8PA 4IM7A 4L74A 4PLCA 5DBFA 2Y1OA 4MVJI 1VM6A 1Y9AA 2VRBA 4BNNA 4F46A 4DLLA 4AFNA 3TNLA 2NTJA 4YCAA 5THKA 2V6MA 3GRPA 4LSWA 4CMEC 1NVGA 4HWKA 4CLXA 3ONDA 3WSVA 2XXJA 1E0DA 3IP3A 4WNIA 2GERA 1K6JA 2I76A 2I5PO 1PQUA 4HXYA 3WGYA 5JAMA 3C7CB 1QV7A 5CDGA 5JBIA 3OSUA 4KTVE 1HL3A 3TZ6A 5A04A 1J5PA 2AG8A 4Y9DA 1E1NA 4WK6A 1GQQA 2YHUA 2C07A 3E5RA 1DAPA 1HXHA 1XKQA 2FSSA 4L0QA 3L9XA 4ITUA 4MINA 2O3UA 3QWHA 2FZEA 5A5FA 1VJ0A 4YJHB 1HWYA 1P1IA 2AHRA 3O38A 4ZICA 4XYGA 1UZMA 4OQZA 3Q11A 1GZ4A 1TI7A 4IUYA 5GZ1A 3WGTA 2E48A 4FJ1A 5KJCA 5L9AA 1HEUA 5DBIA 1D4FA 3MZ0A 4C4OA 4W82A 2Y68A 1V3TA 5HS6A 3HDJA 1C1DA 3VC7A 2WSBA 4R3WA 5L51A 1PGNA 2Q45A 4TRMA 2JCVA 2IDZA 1VI2A 2I3GA 1GQ2A 1AXGA 3ABIA 3ZWXA 3I9OA 3PDJA 3DQPA 4JJIA 3PLNA 4QTZA 3V5NA 3VKUA 5LDGA 3G17A 1NR7A 4LCEA 1T4DA 1M66A 1QRRA 1FDWA 3R0IA 3GLQA 5JAZA 5KVVA 5KTKA 3WLEA 4WNCA 1AXEA 1G0OA 1I01A 4BS9A 1Q2XA 3E9QA 3PDUA 5KJEA 1LSOA 4CR6A 4IDCA 1NASA 4GX2A 2P5UA 4FOOA 2Q99A 3FWNA 1CQJA 2VT2A 1XYGA 5F1OA 2Y1DA 4D3FA 2BLLA 2ZATA 1R12A 5JYEA 2GUGA 2HDHA 2PGDA 3Q3CA 1A9ZA 2OBYA 3GOHA 2Y1EA 3UFXA 4WEOA 1TT5A 1U4SA 2PV7A 5JO9A 1ZEMA 3JQAA 1R4MB 5I8WA 2I6TA 4J4TA 1CQIA 3I4FA 2AMFA 3U0BA 4LK3A 2NQTA 1A9YA 1PEDA 1M6HA 1U5CA 3T7CA 1P0FA 9LDBA 3JYLA 1H2HA 5C7OO 3PI7A 4BNIA 1O89A 3ITKA 1JTVA 4E2WA 1RM5A 1EUZA 3ITDA 5AQ1A 2X86A 1HETA 1NQTA 4NJOA 2O4CA 5F3RA 1ULUA 5AXCA 3D4OA 3INTA 2EIHA 3RBZA 4IJWA 1ENOA 1LQTA 3K31A 4MVJA 3HDQA 4Y6SA 3VKVA 2EG9A 4UUOA 3FN4A 4DA9A 2ZYGA 1E3LA 3ZNQA 3DB2A 1ZK4A 2X9NA 3NGXA 2OUIA 4TKMA 4GWGA 2PY6A 3L6EA 4ZD6A 4ZA2A 4RCVA 1RPNA 5CAEA 4ZHSA 4J16A 1JAYA 2O2SA 4PLVA 3PGXA 2AA3A 3OEYA 1SAYA 2GZ1A 1PGOA 3AM3A 4CPDA 3HSKA 2NU9A 4B7UA 4CLOB 2X5OA 1AUPA 4ZQFA 3MEQA 4LW8A 4LVUA 4YTEA 1B8UA 1QLJA 1YRLA 4J4HA 1MG0A 4YACA 4PLPA 5B4TA 3TZKA 1CIVA 3KBOA 1D1SA 1N1GA 4INAA 4ND3A 4E0BA 1U2GA 4DRYA 3GRKA 3WX0A 3VDQA 5LC1A 1LA2A 1F8FA 1O5IA 2GZ2A 3A06A 2EKLA 2WYWA 5LCXA 1YOVB 4DPMA 1K2WA 4FFLA 3ZWAA 3WWZA 2X23A 1DRUA 3KLPX 3PGJA 1J0XO 2V65A 4CUKA 4GLLA 2QZZA 3W8FA 2JL1A 2FPIA 3IUSA 1Z6ZA 3EHEA 1QMGA 3DFZA 2JD1A 2DLDA 3JQCA 1I30A 1AN9A 4IGFA 4XEHA 3JYQA 4HFRA 5EJ2A 2YY7A 3JQGB 2JFHA 1JWBB 2QYSA 3FTPA 2PNFA 3NTOA 5G0SA 1VKOA 4QXMA 4ZRNA 4DIOA 3L6DA 2PH3A 3WQRA 3HB4X 1DLJA 4IJUA 4YT2A 4XX0A 1O6ZA 3DZBA 2BF7A 2DTDA 4H3VA 2DFVA 3MWDB 3QHAA 4GAEA 5L3ZA 4YT8A 3CE6A 3U09A 3KYDA 3WGHA 1NHGA 1VE9A 1YB4A 1GPDG 1X0VA 1Q7BA 3SC6A 1F0YA 2AEFA 3B1KA 3KYCA 4KTTE 1DIHA 1JAXA 3Q2IA 3WSWA 3H5AA 4Q3AA 4CUZA 5KVQA 5CG1A 1ZSYA 1NPDA 1LU9A 3OQBA 1MUUA 3H6KA 2NU8A 1DXYA 1GU7A 3GAFA 3U3XA 2HMUA 2IXAA 3F6YA 4GWKA 4BNUA 1HYHA 2UVDA 4RPJA 3V2GA 4MP8A 2EJVA 2Y1CA 4TRJA 4E31A 2VOEA 2X8LA 3CZMA 2EXXA 3STHA 1UP6A 4U0KA 4CMIA 1GQYA 2JFGA 3V2UA 1PZHA 2JD0A 3BIOA 4XGNA 4C7KA 2JHGA 4MP6A 1NHWA 3ROMA 1UDBA 1QSGA 2A35A 1JA9A 2CNBA 2B4TO 3I9KA 4M55A 4BNWA 1EQ2A 2IE0A 8ADHA 4P8RA 2QIOA 3L4BC 4RLHA 2CVOA 4NFHA 2NTVA 2NADA 2RH8A 3F9IA 5A9TA 4A0SA 4ALLA 3Q0EA 2NVUA 2NVBA 3AUUA 2FZWA 5DNAA 4CM3A 4CV2A 3WGOA 2IEDA 2GGSA 2Q3EA 3LF1A 5ENVA 4JNKA 3DMTC 1IPEA 1Y5RA 2YDXA 4DREA 1KEVA 5ADHA 2GCGA 1X7GA 2Q1WA 4JN6B 4II3A 2H63A 4O5OA 1C0IA 3TFQA 3KXDA 1PIWA 3KUXA 4LISA 4YA6A 4FD3A 4BVAA 5KVCA 3BXXA 3OM9A 4ROSA 1IB6A 5IFLA 3GY0A 2HJSA 2VTEA 4UVEA 3NKLA 4P4NA 1P31A 3AUSA 3G1TA 1RM0A 4PZDA 3QWIA 1DC6A 4N5NA 1EE9A 3JQGA 4MIOA 1Y1PA 1DRVA 3FPCA 1ZBQA 3KV3O 4PGFA 5IZCA 1T1RA 1VJ1A 4KOAA 4AJEA 1E7WA 3GVXA 1XA0A 5COQA 5TNXA 1VJTA 1JVSA 5I9NA 2XF8A 4YRBA 2B4QA 3RC9A 1HE2A 1P3DA 3ORFA 3C85A 2X22A 1LSUA 1SPXA 3ZHYA 2XOXA 1QV6A 2PR2A 4KZPA 3F46A 1R0LA 4BKPA 3DAFA 3BHJA 3FNEA 4NZ9A 3H9GA 2H6EA 1L7DA 5FI3A 2O4UX 3ULKA 1ISIA 3ROQA 2NLOA 3KYDB 3O26A 3HN7A 1ZH8A 3W1VA 3AOEC 1RKXA 4RORA 1C0KA 4R41A 5ITVA 4Z0TA 1T4BA 1D3AA 4EUFA 3KEOA 1EFKA 2HMWA 4OMUA 4M87A 4HADA 3EMKA 1P77A 3ZHZA 2Z1NA 3NEPX 3GGGA 1W6UA 4DYDA 5TT0A 3E48A 3O4RA 3LLVA 4L4XA 4NMHA 4WECA 2NU6A 1C0LA 3LSYA 3VTFA 3E1KA 4L4RA 1UXKA 3H9EO 3S2EA 2DTXA 3EW7A 1WW8A 3ROKA 1U3UA 4IXTA 2WEKA 3BMNA 1T2EA 2Q1SA 4GVXA 3H9UA 2Q4EA 2O23A 1LDEA 3CXRA 1HDOA 4CM4B 3DBRA 2HK8A 3C8MA 4DVJA 3FPLA 4FFOA 3IQDB 2P5YA 3RUCA 4BO6A 3M1LA 2A92A 4K9DA 4EJ0A 3TZHA 4Z9FA 2EV9A 3A1NA 4UUNA 2VZ0A 3CUKA 1KERA 2TMDA 4UEKA 2ZTMA 4K26A 4YT4A 1RWBA 1Y8RA 3PWZA 1H6CA 4J4BA 2ZJ0A 5HS4A 5HWSA 1CRWG 5JDIA 1AHHA 2BGLA 3A4VA 4B3HA 5F1PA 1HE5A 4JX8A 5JCJD 5B12A 1EVZA 4WOJA 3QP9A 3WJAA 5DULA 1IE3A 3ZZNA 1OC4A 2ZJ1A 3QA9A 3DZFA 3MWEB 1GPJA 4D42A 3GEMA 1LLDA 1QYDA 4WLNA 3AM5A 2CFCA 1Z7BA 3S2GA 5HM8A 1XU9A 3Q1LA 4RPHA 4XCVA 2DBRA 1WXDA 3AU8A 2AG5A 3B1FA 4JLWA 4ALKA 3K8ZA 3VZRA 5F5LA 2B5VA 4CMIB 1LDMA 2HLPA 3C24A 1CERA 3KSZO 4RZHA 4OL9A 3NUGA 4NBUA 3EVNA 4CM9D 4XYBA 3FD8A 3BHMA 4HFNA 2VT3A 2C7VA 1QR6A 3I1JA 4D0RA 2JCYA 5DZSA 4XYEA 4BGUA 2EEZA 4IDFA 1UJMA 2PFGA 2VN8A 3DTYA 4XYMA 2ILTA 4XR4A 1JVBA 3ZWNA 1E92A 4IDDA 3EUWA 4OHUA 4NU5A 4M49A 3RAJA 1E1KA 1YB1A 4MJLA 5AXBA 1GUFA 1KY4A 3IAHA 4BO3A 4YR9A 4QUKA 4PLGA 2UAGA 4NI5A 1LDBA 4GI2A 4OAQA 1K0UA 4NU6A 5L7YA 1DB3A 4MOWA 4ALMA 3JQ9A 3H2ZA 4CM9A 3PPIA 2YQ5A 2DFDA 2X0NA 5FEUA 1T25A 4P4GA 3QWFA 3IUPA 4A5OA 5A9SA 4E33A 2X5JO 2SCUA 3AUAA 5DP1A 1LX6A 1CWUA 2DU8A 2ZB4A 5GMOA 3OJOA 4NIMA 1PS8A 2PTGA 4XJTA 4W7HA 4AJ1A 1EEHA 4YAIA 1BSVA 1X15A 1ULSA 1EVIA 4J2OA 1GV0A 1PJQA 2GPTA 2ET6A 1QP8A 4BL5A 4HP8A 2DUWA 4AJJA 1UXHA 4XD2A 2YJZA 2WDZA 4ILKA 3L4SO 1I0ZA 1Z82A 1OFGA 4ZGWA 3KLMX 2AE1A 1EK6A 4U7WA 3E82A 3L4BA 3K6JA 3MJTA 4IQ8A 1QYCA 2HSDA 3GGPA 4K1LA 4PG5A 4WCDA 4Y6RA 1DEHA 3O8QA 1VPDA 1O0SA 5THQA 4J1NA 1NTOA 2QQ5A 3JQ8A 4YDRA 1RJWA 4AJOA 2PKQP 1A5ZA 2X4GA 4IMRA 1H6BA 3W4IA 2QYTA 2GZ3A 1YQGA 4NR0A 1MV8A 3GMDA 3INRA 1SOVA 2C5AA 3PWKA 2C0CA 1C1XB 3D3EA 3GEDA 1Y6JA 2CF5A 4RVUA 3NX4A 1FDTA 3VAZA 1E3SA 3KRTA 1XU7A 1LQUA 1ID1A 3VH3A 4DIBA 2B35A 4XYLA 2WD8A 1PL6A 1ZUD1 5CDUA 2NVUB 4E5NA 2B4RO 2O48X 3GC6A 4GSLA 4HFMA 4IDBA 1ORRA 2NU7A 3RFXA 3WMWA 1BGVA 1JKIA 2VHXA 2ZCUA 1Y8QB 4IS2A 2Y0EA 5TSDA 3D4NA 2YZ7A 2UV8A 1HZZA 4GX5A 5H82A 2O3QA 1P0CA 3GNQA 2WYUA 2GN6A 5JY1A 2PK3A 2WJPA 4JK3A 1MC5A 2JAPA 5IZ4A 3GMSA 3I9MA 1YBVA 4FFMA 4I9HA 1JW9B 2GDZA 4BGVA 5BNTA 3UCXA 3CEAA 5JC8A 3WQQA 2W8ZA 4CM5A 3HWRA 2EKPA 1HDYA 3EZLA 4FOSA 3VVCA 1MFPA 1M75A 4YEDA 1WVGA 3JQAD 4W7IA 3GDFA 2JKVA 5JMPA 1ZFNA 3G79A 3KOUA 4FR5A 1H93A 4JGBA 5A03A 4IDAA 1KEPA 1X1EA 4KDFA 5JPIA 1N9GA 4BNZA 2VYND 5KJFA 2AQKA 3VH4A 1A27A 2C2XA 2F00A 5EINA 4A10A 4BMNA 4DYVA 4NJMB 5JNLA 3F47A 3GVCA 1KOLA 4ND5A 5AXDA 1T1SA 1WWKA 4BB5A 1YH3A 4G5HA 3KZVA 4GX1A 4J1TA 3PHLA 4XQEA 3AUTA 1NR1A 3ZHXA 4IPTA 5ITWA 1YXMA 3JD1A 5BNIA 3IP1A 1VRWA 3GQVA 1SCUA 3ZH2A 4JBHA 5BSGA 4HY3A 1CETA 4N5LA 4ZJUA 5A3VA 3QRWA 3VOSA 1U8FO 4DQVA 2O2YA 3QQPA 3QW2A 3G49A 1DJNA 1VL6A 4J9VA 4XR9A 1Y81A 1X13A 1E5QA 4E3ZA 1U3TA 3D4PA 4NDNE 3AFNA 4ONEA 2OP0A 2YQ4A 3OP4A 4YPOA 4CLRB 1N5DA 3V2HA 1DC3A 1LEHA 1XG5A 1JQBA 4YWJA 4WCFB 2QX7A 1GTMA 1LLUA 2DPHA 1E7RA 1DFHA 4PVDA 3UH1A 5G0TA 3HE3A 2Z95A 2HK9A 4OOFA 1PQWA 3ENNA 2IZ1A 1ONPA 4TVOA 1F17A 2PWZA 4BKQA 4WPGA 2QRLA 2FOIA 1HE4A 4ALJA 3B1JA 5KOIA 1I2ZA 1PJSA 4I8XA 3TF5A 4BIIA 2AQ8A 3ANNA 4RVHA 5EIOA 4B8WA 2NNLD 1ZK3A 1K6IA 3ON5A 4FFPA 4CLDA 2ZQYA 4BNMA 1ENZA 4BKOA 2CMDA 1PX0A 4NG5A 4WKGA 4N54A 2HJRA 5TX7A 3KSDO 4RL6A 4BNFA 3FR8A 4M54A 3V1TC 1A72A 1J4AA 2HU2A 5B4VA 1BVUA 2VYNA 3JQBC 3GVPA 4Q9NA 1BTOA 4B4OA 4DIFA 5EQFA 4IIUA 4RV9A 2NWQA 1P44A 1DLIA 4PN3A 2X7HA 5F5NA 3AI3A 1TXGA 4BQPA 3UOGA 1HDRA 3QY9A 3W8EA 3PJDA 3B20A 3CZRA 3GA0A 5JMWA 1ZIDA 2EGHA 4JCOA 1DIBA 1V8BA 4UULA 5A1TA 1H9AA 4DGSA 4G2NA 4UAGA 5EPOA 2BRUA 4BO0A 3PHIA 4MKZA 5JY6A 2Q1UA 3HJAA 1YQXA 4TWRA 3DAGA 3F3SA 3KTDA 3RUFA 1LDNA 5CEFA 2QZ9A 2CUKA 2B69A 3BTOA 4TSKA 1E6WA 4ZN6A 4XIYA 2PH5A 2POQX 1EZ4A 2LDXA 4ZVVA 2AEMA 4P4LA 3SJUA 2QHXA 4PCVA 5JO0A 5CDTA 3A9WA 1BW9A 2P9CA 4AJKA 5IJZA 1I10A 3MTJA 4MVJH 4F6CA 5L4NA 4PLWA 4H16A 2C2YA 3ZGYA 3NT5A 4BNHA 1WMBA 2OO5A 4TZKA 4YQZA 4NH4A 4WCFC 3RJ5A 3BZUA 1JKJA 1HKUA 2PKRA 4E32A 4RPKA 2HRZA 3R3SA 4N18A 2BFMA 3K2EA 3OH8A 1H6AA 1M2WA 1NQOA 3D64A 5DOVA 3BTVA 3IOYA 2FY8A 3FSRA 1B3BA 1BW9B 3EC7A 3HZZA 3F1LA 4E2XA 4O59O 5COAA 1ADGA 4E2YA 1C1DB 1J49A 4CQMB 4CUJA 3MCVA 1NQAO 3UF0A 3EY4A 2XAAA 4U0JA 3S2IA 3G0OA 2RAFA 2WE7A 4L4SA 4E30A 4CMHA 4CL3A 2BGKA 2PA3A 3K2BA 4BO7A 4DWVA 4RVGA 4NBWA 1Z7EA 3RFTA 3F4LA 1B26A 5L7TA 4MP3A 3PIIA 3FBGA 1E1LA 3RJ9A 3RUHA 4JROA 1YS4A 1WPQA 1XCBA 5L4SA 3RU9A 2X9VA 1SMKA 3U5TA 4F6LA 2AXQA 5A5EA 2A94A 4XQGA 1IHYA 4ZQEA 4CODB 5BSHA 4EEZA 1KYQA 1UXGA 4GX0A 1ZCJA 5T5QA 4DTIA 2HAEA 1E5LA 2CDCA 3KETA 1FDUA 2EW2A 3BMQB 3PHHA 1ENYA 1PWZA 3DBHB 4O6VA 2E6UX 3DHNA 1MXFA 2IYPA 3K9QO 1U3WA 2BELA 5LDHA 3ASUA 4UUPA 3TJRA 1G0NA 2GO1A 1B3RA 3QWBA 3ZV6A 4BOYA 1Z45A 5DCWA 3AOEA 3W6UA 1TB4A 2BFOA 3K96A 2YUTA 5G2OA 3T4XA 2HMSA 4PLFA 5EMHA 5EL0A 1UP7A 3I3OA 4D0SA 3U4DA 2Q4BA 5FWNA 2JJYA 5BSFA 3X2FA 4D44A 4PZCA 5A02A 4MKXA 1UZNA 5C5IA 1E7MA 2PGJA 2Q49A 2I67A 4J91A 5CDYA 2G1UA 2ZCVA 3WJ7A 3ZW9A 2GRAA 3EYWA 1EUCA 4YAGA 1GEGA 3NYWA 5C7IO 3OQ6A 4BNTA 3RIHA 1U5AA 2CDAA 2ZYAA 4BO9A 2Y05A 4JJGA 2VCYA 3DBHA 2O50A 1UP4A 3ADPA 1PJTA 1S7CA 1WDMA 3HQ4O 3MJEA 1V3VA 3SX2A 4BNGA 4CQMD 4ID9A 3V1UA 4CMCA 4W6ZA 3ZWMA 2RCYA 5TGDA 3IMFA 4RPGA 3Q9UA 3PJEA 3RWBA 1EVJA 3X2EA 4QO7A 2EP5A 3RASA 1ADCA 1GDHA 4M89A 1MC4A 3AY3A 3DC2A 4D7AA 4B8ZA 1HLPA 4L9RA 4OOEA 1I2CA 2OL4A 4CM7A 4DL9A 4AJ2A 2A4KA 2NM0A 5TT1A 1N7HA 5TQVA 4BGEA 1PZEA 4M1QA 3QE3A 3O9ZA 5JCJA 3WYBA 3DO5A 1Y9EA 4QFCA 1GUYA 2YDYA 3SLGA 5KKAA 5ICSA 2DKNA 3DZKA 4L73A 2LDBA 3UUWA 4CQMA 1KETA 3ETGA 3JQBA 3EK2A 2PZJA 2VYVD 5T67A 1I3MA 4CR8A 1BHSA 2VRCA 2GD1O 3TFOA 4W99A 1EBUA 5KJ1A 3ZCXA 3DDNA 1R6DA 5JW6A 1UZLA 2J5KA 3R3JA 2OP1A 4J6FA 3IDSA 4QT0A 4XJSA 4KDEA 5CEJA 1D1TA 2G5CA 4GPD1 4PRKA 3IJPA 3DMTA 3HFSA 1PL7A 3ICCA 4KQXA 5TRTA 3KYBA 4EBFA 4BNYA 5FYDA 3B6ZA 5U1PA 1LSSA 2VNSA 5GY7A 3ZWWA 2A9FA 1WZIA 4EI2A 1HSZA 5IXYA 1GCOA 4J7XA 4FC6A 2O3SA 4QX6A 2ZYDA 4AICA 3AK4A 2C59A 4S1VA 1SNYA 4E2ZA 1NWHA 1VC2A 4NPCA 1DFIA 3WGZA 4R4JA 2WD7A 3S1LA 3SLKA 4KQWA 2Q2WA 1NAHA 3WGIA 4Q3CA 3PQEA 4I9UA 4Q39A 5IN5A 4J43A 2P91A 2VUTA 3AI2A 3VPHA 2R00C 3ENKA 4J49A 3RC1A 2HMTA 3JQEA 4R1SA 4UEOA 2VTDA 4OJNA 1B0AA 4YJFB 3HNPA 5BQFA 3LZ6A 2I9PA 4CLOA 3OECA 3BAZA 3EDMA 1SB9A 4GSKA 4LN1A 4A27A 2GF2A 3GK3A 5HRUA 1W73A 4CLEA 2DBVO 3RVDA 3WFIA 5I7FA 4Y98A 3PQFA 4FGWA 5T8KA 2I99A 3F4BA 3UICA 3GDGA 4QFDA 2WYVA 1NQ5A 2VHWA 3PVZA 4QO8A 2RH4A 4QQRA 4MIYA 2D59A 3BA1A 3CKYA 4R5MA 4KP7A 1W0CA 4J1SA 1XQ6A 2GN8A 3MJCA 3D5QA 2O7QA 5U4QA 4BO2A 5I9LA 3PHJA 4UEJA 4YQYA 4OXYA 3ZV3A 3NJ8A 4EITA 4GMGA 4PRLA 5TS3A 4CLHA 2D5CA 3PIDA 3D0OA 4WOKA 1FMCA 3IC5A 1NX6A 4BKUA 1ISFA 3TQHA 1HDZA 3IS3A 4CM8B 4MPDA 4OIMA 4DMLA 3NT4A 1QYVA 3W6ZA 1BXGB 3K5PA 3ADOA 2JFFA 3D1LA 2E82A 3AOGA 1GY8A 4K6CA 4R5HA 4R9RA 3MJVA 3WLFA 1AHIA 1TLTA 1JWAB 3GPDG 4OXKA 3UAGA 2OBNA 5BR7A 3RUIA 1PGQA 3PK0A 1B16A 2W2KA 3MJSA 4B3IA 4B4WA 3OIDA 2ZTUA 1JN0A 4D79A 3PZRA 3TOXA 4QEDA 1VL0A 1ZJZA 4Q3NA 1GYQA 5DOZA 2NV6A 2AEJA 3NRCA 2VNAA 4GKBA 1I5RA 3RUAA 5JFOA 4RF2A 1KVRA 3GEGA 2Q1TA 1A7AA 1QXSA 5T57A 4PLHA 4O1MA 3OIFA 2WM3A 5CP8A 1I36A 1IL0A 2X0JA 3GZNA 2JAHA 1MB4A 4BKRA 1GAEO 3WB9A 1XQ1A 1PJ4A 1NAIA 3OIGA 2J3HA 4GKVA 4LRSB 1ONOA 4D43A 1UUFA 2VWHA 2VZ9A 1O94A 2UUOA 2FP4A 1FJHA 4K6FA 4TMFA 2P4HX 2RHRA 4UVHA 3RSHA 4EW6A 2W2LA 3HDHA 4R1NA 3K30A 4U6QA 1UAGA 4DQXA 2ZTVA 4XRGA 5C37A 5K0ZA 3PFWO 2ZB7A 3BMOA 5DN9A 1Y7TA 3VVBA 3V8BA 2NUAA 1R66A 4AJHA 3BTSA 7MDHA 5IAAA 5G4LA 4CMAA 7ADHA 1LRLA 4I5FA 1CEQA 1TA4A 1LBEA 3C3XA 4DBZA 5CPFA 1O95A 1BVRA 3FNGA 3ZW8A 4LMRA 3E8XA 3RUDA 1BG6A 2DAPA 1QKIA 4Z9XA 3OFSA 4HKTA 4XB1A 4OQYA 1YL6A 2Y67A 3I23A 3JD2A 5TLSA 4H7PA 3FF4A 2B5WA 1ZVMA 4Q3DA 1E77A 5FFFA 1OMOA 3V1YA 3RFVA 1I2BA 4W9NC 2YYYA 3LT1A 3NTRA 4LGVA 1C3VA 2O7SA 1SEVA 4Z0PA 5KKCA 3GR6A 4FC7A 5JDCC 1OBFO 2H5LA 4IJKA 4BNKA 2W90A 2O3JA 3QVSA 2WE8A 1YDEA 3UW3A 3ZI0A 1KEWA 5CDSA 1Y8QA 1XSEA 4AG3A 1PL8A 1GCUA 4FFRA 3GHHA 3TWOA 4WLFA 4TVBA 1DFGA 1R4MA 1MLDA 1K3TA 2VHVA 3LVFO 3G3EA 4RF5A 2UYYA 4GLOA 4BV8A 4XDYA 5ER6A 4FB5A 2VWGA 1V9LA 3LT2A 3A14A 4NQZA 1LNQA 1EUDA 4PG8A 5GZ3A 3WS7A 5EN4A 3CSDA 1EVYA 2BI8A 2DBQA 5TJHA 4HV4A 5T64A 2Z1MA 4MVJP 2G0TA 4YJFA 2HKIA 2W98A 1N92A 4TKLA 1R15A 4URFA 5DP2A 4B3JA 3S8MA 3KO8A 2VZ8A 4KUGA 1QLHA 1VLLA 2D0IA 3QVOA 2X0IA 1LDYA 1BDMA 1HSOA 4RZIA 4TRRA 4YXFA 2UUPA 2FPGA
chains in the Genus database with same CATH superfamily
2CY0A 5EZQA 1XLTC 4WL0A 3PUHA 3IALA 4FHCA 3R7DA 4DLAA 2Q21A 1AKYA 5IDQA 5C18A 2QUZA 2LVBA 5EJ4A 2NV0A 1ZONA 5DASA 4PTYA 3VNUA 1SKYE 1ZSNA 2YX1A 2VAWA 2Y27A 2ZOSA 1GGMA 4ND6A 5G0WA 4W8OA 4QOFA 4EGJA 4C3UA 5FWDA 1K89A 5AK4A 4NAVA 1AHNA 2OOKA 3ZVLA 3PEYA 1RJFA 4IDHA 4MYCA 3RG8A 1EXMA 1NMEA 3GMTA 3FSGD 1P2TA 3LW8A 4N7BA 3TM5A 1EHYA 2RKOA 3LP6A 4R8RA 4TYMA 5DF1A 1SKYB 2J32A 3DNFA 3QV1A 4CMEA 1JDUA 5FUWA 1U1IA 2AWOA 1FFEA 2QRUA 1FU7A 2WFLA 2WU1A 4G5RA 1DQZA 4HB4A 4M7RA 4OBBA 4RS4A 3IQFA 1VJDA 4AW9A 1G16A 5CHYA 4YJGB 4ZANA 3R09A 3GGOA 2VHYA 3OCZA 3I6YA 4WY5A 3ZS8A 1B0PA 3ND8A 3RRXA 3DT8A 5ER9A 1U2GC 1PLLA 1OOEA 3WVNA 4BQRA 3EGXA 4MWEA 3IODA 5ANRB 1UM8A 2B7CA 2HUPA 4H3HB 2H2FA 1J8YF 3DTVB 4JP1A 2PSHA 4FYPA 4K05A 2ONJA 5K3SA 4MRSA 5HUHA 1ISGA 3CXUA 4ZTZB 2ZIZA 3MT8A 3ORRA 3RM3A 3H8SA 3V1LA 3A4TA 3RYIB 3ZVKA 2XNKA 3G89A 2FJPA 1Y1SA 5DXAA 3V8VA 2VIIA 3RTCA 1NNI1 3CX8A 4KMSA 2Q50A 5ALDA 2IS4A 3VNAA 4U7JA 4CT0A 1Q84A 2DJIA 5EZ6B 1DI0A 4FYVA 4B4DA 3F5QA 5EIEA 3EZYA 3RYCA 2X8BA 4XGIA 4A36A 1RLIA 4ZHQB 1ARZA 2ATVA 2GB4A 3CE9A 4X92A 1SB8A 5TF4A 3SYNA 3AU9A 4EO9A 3EOAI 4X54A 5MDHA 2AFRA 4BHTA 4D96A 1V8ZA 4GDMA 2BFPA 3VA7A 4RVSA 2G72A 2XZLA 4ZCLA 3T1NA 1N2ZA 2Y99A 3FB1A 4EZBA 1ZO8A 3HA3A 3UJ8A 1O8CA 2JNWA 1TE2A 1I4DD 1XCGB 3Q5GA 1FYXA 1ZD1A 3C70A 2UVPA 3RUPA 3WIEA 4GQAA 3INGA 3AEXA 3TZCA 3JQFC 4B31A 1A7KA 1S6YA 3DT6A 1G3MA 4ZHQF 2DETA 4ALKA 4U6SA 4IW3B 3S40A 4YAOA 3RRZA 4UM9B 2CXUA 2Q4TA 5IHXA 4LF8B 2ZBVA 3KTOA 4RA6A 4F8EA 1Z2PX 2XGMA 3HR4A 3INYA 3O1HB 4L6CA 3AVTA 4D9FA 5D3MA 4DY4A 1GFSA 4EGAA 5LP1A 2L18A 3GN1A 3IB3A 3AF1A 2FUG6 2JATA 3RTDA 1JT2A 5HBGA 3STWA 1N34B 2D7DA 1Z0SA 3OIVA 1LPAB 2OQ2A 4O2BA 3ERCA 4D0NA 4K28A 4QGSA 2ZSFA 4L51A 3PLRA 4IXNA 5K3CA 2QQFA 5CA1F 1JBKA 4IIHA 4RDHA 1DINA 4NBSA 3ZHUA 3FRJA 1D2MA 1FTGA 4JUIA 5EI5A 2PMWB 4B4KA 4BWFB 2JGMA 2WQ7A 2I1QA 4ZOEA 5BORA 5KNBA 1MCZA 4Y18A 4GM0A 1TAQA 4YJ3B 5AKIA 1NPTO 2PLAA 1GZUA 4UCWA 2J3KA 5BV1A 3LXMA 1H1LA 1B15A 3H9JA 1CU1A 3WYGA 2WRZA 3HPQA 3PL1A 3QMWA 2QB5A 4V38A 4GOMD 3BL8A 1SR8A 4B4VA 3IHKA 4ZWNA 4RMIA 3DOCA 4BAZA 1LBSA 1QHNA 2E4AA 1A71A 1UBKS 3AEKB 1XTQA 1RP7A 3O9MA 2JRLA 2XE4A 2A9QA 1C1XA 5JV5A 1DIRA 5K0CA 4J3JA 1RADA 3A9VA 1QRDA 3PGKA 5GM1A 1KSHA 4HEA6 2PKCA 4HQNA 1GADO 2IEBA 1E3IA 1VJRA 5EIFA 3MUOA 3W2EA 1Z34A 3O8BA 3RQSA 4DT1A 3CO0S 2R0QC 2OR3A 2R7NA 4NBLA 2JCSA 4UQOA 4LF7B 1B76A 5AKJA 2HCRA 1C0PA 4V0MA 4Y1FA 5EESA 2ZSKA 2R7AA 2NPOA 3KC2A 4HEJA 4U2DA 2HWUA 3D6TB 2BCJQ 2PD6A 1XKTA 3A7EA 3CUYA 4JUDX 4Q21A 1GNSA 2P9YA 3RU2A 3K70D 1ZNXA 1U65A 2VPZA 4EHKA 1EVKA 3OX4A 4G0OA 2IEZA 3MLEA 4X71A 5HHTA 4BKMA 1GUZA 3H65A 2GHTA 3TE7A 2FR8C 3ZU5A 4QUIA 2CHEA 2PBLA 4WKBA 3I34X 3A7DA 2H2HA 5FI5A 3TAXA 4K6OA 2WLSA 4GZ5A 3CCCA 5C7LO 1JEOA 3QPBA 4ZZ1A 1E8MA 4DCTA 4RIFA 4DUZB 4Q02A 4YMWA 2AW5A 4Q4JA 3CVVA 1L4BA 3I04A 4FOTA 2KW5A 1KIFA 1XE3A 2QKYA 4CFSA 2Y1FA 3LH5A 3UCFA 2X3UA 4D5GA 1AF7A 4ZHQA 2I55A 1HNNA 2IXBA 3PXXA 3U1TA 2Q5FA 4RXTA 5LQDA 1Y37A 1P4GA 3PC7A 3PFKA 4EBBA 5FOQA 3B6KA 2IW3A 1ZAYA 3PGMA 5ICEA 2PKQO 3UWSA 4UHCA 2BFNA 4FOLA 1ZIXA 2HV8A 3VTZA 3LT0A 3WBJA 3L4JA 3ZQJA 1TFRA 1ISJA 2PLRA 3WYEA 2O8CB 4C7JA 3QKSB 5EOVA 4ZV4A 1Y5NA 3D3NA 5HBRA 4JP2A 3DDUA 3TRFA 1U3GA 4MYUA 2Q46A 1PFKA 5HZHA 5GONB 1E3WB 2MSEB 4DPLA 1ZESA 4LFAB 5FTWA 3EVEA 4NMXB 2HK7A 3OCUA 3DLPX 4GOKA 1CS0B 1B0ZA 5AOVA 1WXEA 1T1JA 1CR4A 2G4LA 3H7AA 4LECA 4UFPA 5CVUA 1ORVA 3VSCA 3IOBA 1R4NB 2FFHA 4FZRA 4DILA 2JLBA 2WT9A 3JSAA 1QVAA 3OOEA 1OCEA 5K8VA 3JQPA 1TADA 5AKLA 5K0JA 3FLMA 2H1FA 2B2CA 1DDIA 2BEUB 3BE8A 3L07A 3UMYA 4POAA 3BGWA 1KO5A 1X8JA 3CN9A 1WNFA 3NOQA 3MPOA 4F3TA 3P52A 1GPWB 3P2YA 3VZBA 2QAGB 1T43A 2EWMA 3JD4A 1Q92A 3I53A 4HDQB 2BM0A 2QN7A 1G6KA 3FMIA 1O5OA 4RACA 3OEWA 3TI7A 1YDGA 3M5WA 2FDRA 2YZGA 1PHPA 5CBPB 1W47A 3GH3A 2E3JA 3FUWA 2QM0A 2B78A 3HCOA 5DGCA 1JR3E 5B3JA 3FTDA 2J59A 1HT3A 3EARA 4Q6BA 1GRCA 2C7GA 3LC2O 4FDMA 5E8RA 1M8JA 3WRYC 2HO5A 2A6PA 1GA6A 5B30A 2I3BA 4WOPA 5A71A 4DLBA 1NBIA 1EQUA 1P0QA 5C8VA 2LWIA 1USGA 1RXEA 4KH0A 5HZKA 3G2JA 4TYPA 3S6JA 1XRSB 4DBVO 3I8SA 1U8XX 3WO1A 1E4VA 3DXXA 3IQXA 4IIBA 4PBRA 1XEXB 5F77A 5SY9A 2YJGA 1IG0A 4MQFA 3IHWA 3RK4A 1IYZA 1P19A 3MB5A 3NHLA 3H3XA 3V4SA 4EMUA 1ZR2A 4BXOA 1UKYA 5CT4A 1YDWA 1B6TA 4I1OA 1ECBA 3O7MA 3VNBA 4M36A 4C4PA 1NJFA 2UDPA 4KO8A 5CLQA 5TMDA 3QPUA 1DHRA 2BSXA 3RVJA 1OV4A 1Y63A 1X7XA 1CT9A 2VXCA 2JFOA 5K3DA 2XIQA 3R6GA 2OB2A 3GCGA 1CJKC 3RKUA 1T36A 3IPXA 5K20A 4NCIA 3NHZA 2W6QA 3FI9A 4JI3B 2UZ1B 1U7XA 3FDFA 4NFYA 4JLBA 4Q66C 5HA5A 2XDYA 3SR0A 2VTVA 3WNVA 3ZCQA 1ZOIA 4BYMA 4Z53A 3OJEA 3WTCA 1I8TA 1OYYA 4R6XA 5K4AA 1BN6A 3EUEA 1M0SA 3TE6A 4AAYA 2ICAA 3WQSB 3RS9A 4Z3KA 3PFBA 4O2AA 1FL9A 3KSAC 4FVTA 4BB6A 4XLLA 3ZU3A 1KDTA 2C84A 2IE8A 5DW0A 1MQAA 3A1VA 1LC3A 2E87A 2P9QA 2OHIA 4B47A 5AVRA 3A6DA 5IT4A 3UWMA 3WLAA 3ZDFA 1X80A 2YZ2A 3CBGA 4O63O 4P22A 4QTUB 2H1OA 2BP7A 2XTNA 3A2KA 5TARA 1ZH0A 4P3PA 5JH7B 3G2PA 3NPAA 4MRVA 4W7SA 1BYIA 2DKFA 4HUQA 4EGSA 3RYFA 4ZZ0A 4LE2A 1DKNA 4RHFA 3WAJA 9LDTA 5JEDA 3SQLA 4AYWA 3FOCA 4I1RA 1SZDA 1NKTA 1E9DA 3DDHA 4HNHA 2I9KA 3BN3A 3EXHB 1ZLYA 3H18A 3LQFA 1N0HA 3OLXA 1RJ9B 2AT1A 2W8BA 1BRTA 1CSEE 2CSUA 3GUCA 3LC0A 3UMCA 3V8EA 2JLWA 3K0SA 4RJIA 2I6QA 5EWMA 1JEAA 2EF1A 3CLTC 4JJ4A 5ELLA 2JD2A 5DBOA 2ZPTX 1M0TA 1ZW1A 5BSVA 1P1HA 3HBNA 2ZIGA 3L5OA 2V3WA 2IIQA 4PLYA 3FDZB 2OD9A 3AR5A 3PF9A 4RA9A 1NVEA 2C42A 1SELA 4YB8A 2GEBA 1EWTA 2IX3A 4UEQA 4FGSA 3HEAA 1ML4A 4YUWA 1E3MA 2PS9A 4ND1A 5EJGA 4TKUA 4MJXA 4JQCA 4ER5A 1RRFA 4QJBA 4ZYWA 4IDNA 2GPJA 3LDGA 3GLGE 3WOHA 3LFUA 1N2SA 1QDEA 4P93A 2OCGA 3P5BA 3SSMA 1KMIY 2RHMA 1CVRA 2WUGA 4B7XA 4HX9A 3REFA 1QU3A 1RM3A 1JLHA 2QRGA 3LAWA 4BX2A 2WC1A 2C4MA 4Q1AA 2GAJA 4DBLE 1X14A 4IILA 2ENUA 3PRJA 4BEBA 5DI3A 3OPYI 1D7OA 1U7HA 3B6MA 2D8AA 1Y33E 3UGKA 4ZGGA 4D6YA 3PA6A 3I8OA 5TJ9A 1TQHA 4URZR 3B9BA 3M6UA 3SDBA 1OAKA 4O2BB 2IP1A 1ZN8A 4F04A 5EXSA 3ICPA 3QFHA 1YZFA 2CDRA 2V7QD 2HRDA 3R7AA 5JNVA 1O0BA 5EIBD 4IL5A 5HTOA 4RK0A 1ZK0A 1O9BA 2VUSA 4XSHA 3ONFA 1D1QA 2RGCA 3FYDA 4JWKA 1LPSA 2I2DA 5INTA 4F9FA 5AICA 1WXFA 5KOHB 4MI3A 1GKYA 1MABB 4AWAA 5KU1A 1OWNA 1VJCA 4WJZA 5A2GA 4MEBA 3IEPA 4UHBA 4COOA 4Q47A 1ENPA 4I3GA 1EFAA 2FN4A 2NXNA 3IAM6 4G0UA 2ZT6A 1SUFA 2CL0X 4JLKA 1CHDA 4FXPA 4MRRA 4RADA 3UHAA 2QN1A 3DGFC 3HDTA 8LDHA 3RROA 2AI3A 1MN6A 2AC4A 3AJRA 1EBBA 5LKAA 3RC7A 4FFVA 3V4PB 3L92A 4YAEA 5CVCA 2GCEA 2J87A 3G68A 5C3MA 4FI3F 4IXDA 1XLTA 4BZPA 4P38A 2H5IA 4S1WA 3WGLA 4BX9A 1KC1A 4K03A 2QN6A 5T8KC 3L0CA 4S3MA 3VDRA 3O0DA 1EDBA 1GPYA 3TLBA 3IP7A 1IOWA 1A3CA 2A8YA 4BFTA 1HF3A 2L69A 2PO7A 2XHZA 3FWZA 3NIGB 3C3KA 4MA0A 5EKUA 3R9KA 4D02A 4B73A 2EDCA 5G4KB 5MN4A 3UN1A 4P7JA 3TD6A 4CKCB 4PG4A 1SWVA 4G8JA 1W34A 4QU5A 1BROA 1IZ7A 3RHTA 1WD5A 3BD8A 4PGAA 3ZNOA 5L3QB 1WDKA 4R7TA 2DBYA 4DJAA 4KAFA 2IT1A 4ENPA 4QARA 3CLVA 3IAUA 4CMJA 1KO4A 3KPVA 3WK7A 4NS1A 3K1AA 4HWTA 1ZDMA 4TXMA 1PS9A 3SHVA 2VK2A 1DKUA 1HTBA 3NV9A 2BL4A 1YZNA 4V0ME 5EHNA 3RKRA 3TBKA 4JSRA 2X41A 3AVPA 4YI5A 1OI7A 3TW4A 1TUBB 1Z47A 4YBZA 1UQUA 4I9NA 5HE8A 5CH8A 3U3RA 1Z68A 4C4TA 1PV4A 3WYCA 5H83A 1TEVA 4RSRA 2JLSA 3RT9A 1ZXLA 3HH8A 1WMFA 1KVTA 4LNUA 1N1EA 1YS1X 1OHHA 2ZI6A 3PKJA 4R68A 4KHPB 1SHUX 4YJGA 3OA0A 3BYZA 2APJA 4XCQA 3OCWA 2P2ZA 4WK4B 3BMOB 4M38A 2B8TA 4N3CA 1X7ZA 1NVMB 2FAXA 3WLOA 5KTRA 5TEVA 1SG6A 1X1QA 2EZTA 4IEFB 4IQ0A 3QF4B 4KUHA 2BYTA 1EGMB 3K9GA 3RVPA 3BICA 4KL8S 5B2EA 4BUCA 2O2JA 1EBFA 1OXVA 1CRPA 3T7AA 1YB5A 3QUTA 5ALWA 2XRZA 1NM5A 2A3NA 2JAOA 3STYA 1A5TA 1ZGJA 2AYZA 3EQ7A 3T7DA 2YWDA 1N2HA 3QX7A 3FCEA 2WVGA 1CZHA 1T3SA 4Q7JB 3ZJTA 2ZS8A 1W59A 4GKKB 4KYUA 2PBRA 2P9JA 4I08A 2ZU6A 1QIIA 1O5TA 1O6FA 2HHAA 4QIHA 4R9VA 3RRBA 4K9QA 4LI0A 1F4PA 4W63A 1W1WA 1ZM2A 2EWWA 3GG9A 3L7BA 3WNQA 3ZIAA 5JQGA 1OIXA 3HRHA 4X9XA 2B36A 2X9LA 2DMRA 2VOJA 2YV3A 4PNEA 1NOIA 4R9SA 3ZOKA 5BV2P 5TMPA 3CCFA 3G13A 2OHFA 4PG6A 1TCAA 2QT1A 4N6GA 5ICMA 4EEKA 2ZAOA 3Q2OA 1HUQA 3QNMA 5M04A 2O2IA 1WMAA 2FV8A 2W6CX 3FDXA 3HVIA 4OB8A 4X6XA 5MN6A 2HOQA 2BCGY 1JA0A 2G80A 4M60A 3RSZA 3U7QA 3DCJA 4WZ6A 4EUKA 1XZBA 1BXZA 1FUYB 3G8CA 3VU0A 1P72A 5IKXA 3MAJA 4LC1A 3M6AA 2B83A 2ORYA 1VZ3A 3LQQA 3WB1A 2ILVA 1FX0B 4YRAA 4IQGA 1M2GA 3BXPA 3CWCA 3LMKA 3H9BA 3QJ5A 1H8HA 1K97A 3AEZA 1Z3IX 4NABA 3T52A 4L5IA 4H7KA 3ED5A 4DNFA 3E6AA 2P27A 3FHTA 4MGZR 4RK7A 3HG7A 4H0FA 2HSWA 1C1YA 2I7VA 3AUFA 1KRHA 2P67A 1TU4A 1VE7A 3HV0A 4PSCA 1FSSA 2NV2B 1DBRA 4LPKA 3WBFA 2FMHA 4DMMA 2GBPA 5ARBA 1D03A 1LZLA 2PX8A 4Y6LA 3AR7A 4S0XA 2YWXA 1C4XA 2XTMA 4UU0A 1U04A 1IN4A 1Z63A 3ZDEA 1H2RS 2YJ3A 4BPRA 4HJXA 3DMFA 1B7GO 3KQPA 4ENSA 3OFND 1RS0A 1TL7C 4JBIA 2ZYUX 5AUNB 2R8OA 3DB1A 3ZGVA 5AOAA 4RMGA 4C7VA 3J80A 2PE5A 3ED1A 3SJBA 3RABA 1J7JA 1V16B 2A9OA 2VA8A 1J06A 2YTZA 5KC9A 1V25A 2MSNA 1DTEA 4BNLA 3QU9A 4RQAA 3N8DA 1YKSA 1GSIA 4YMIA 3SVZA 1CF4A 3IIEA 3LVBA 5KMGB 4LJ4A 3KOZA 3CF6R 5A3JA 2D2IA 3LT4A 4QELA 1N3IA 3N0RA 1D9XA 1CJBA 5CB4B 4WLUA 4XDGA 3FJOA 5A05A 3WHPA 5A9SB 3WA7A 4P34A 1V35A 4M1SA 1BWSA 4UTRA 4NXNB 4TSFD 3B70A 3E1GA 1UADA 2J6IA 2RG1A 4CQLB 1IN6A 3EZ7A 2QVYX 3SGLA 4UHFA 2DG2A 2WZBA 4S2EA 3ZTYA 4W5JA 3BXHA 3W5UA 2Y1GA 2DVMA 3JZAA 4WGGA 1X0XA 2REXB 1PL0A 2GHQA 1XXLA 3QYFA 5DBGA 3C1TA 4BNXA 1R0CA 3AINA 2JCBA 3MTAA 3GWGA 3OFNA 3ZU2A 1HDGO 4XZ3A 2NX2A 4RPIA 4PNHA 1JJAA 1U2EA 1T9CA 4LVNA 4ESOA 1ODSA 4XAQA 1AGNA 2FI1A 3TQOA 3TBHA 4A6EA 1SOAA 4WNAA 4Q3BA 4ER0A 3GJQA 3IJRA 2HBRA 2QRHA 3G6KA 4WEQA 3NVKI 1Z4MA 2BFBB 3HO6A 3OM8A 1OFTA 1QHGA 1W5TA 4IIVA 4YGYA 3LX8A 3Q9NA 4GFDA 1CUZA 5EHIA 2J8ZA 1P7WA 1T24A 2J5RA 4L75A 3GEPA 3JTMA 4BLVA 1U7TA 3C4JA 3W9SA 3KB8A 4ZVPA 1P45A 1X1TA 3JVDA 3IAM1 3VPCA 2PJUA 3H4MA 4CM4A 3TN7A 3V55A 3CPEA 3H5VA 4DV0B 3GPLA 2OHXA 3CGGA 4HL6A 2NSJA 2PGLA 1K6MA 4LCJA 2B4YA 4AN4A 4DR7B 4CNQA 1IBCA 4PLTA 3L46A 5IG2A 5JBNA 1DC5A 3ONWA 1M7HA 1R0SA 5ADVA 4R2LA 2EERA 1P2UA 4OH1A 4PSVA 5G1PA 4EPWA 4CRWB 2XHEA 2ZUWA 2A1TR 4L7VA 3QJGA 4HXGA 2AE2A 4MDYA 3WLHA 1QM5A 4M86A 4KRGA 1WXQA 2JANA 1N6IA 1BJRE 4O08A 5J5AA 2HF2A 4B6RA 5KDOA 1BFKA 1YOBA 3BTUA 2JDIA 4L4ZA 4YI3A 5DT9A 4C0JA 2G28A 4LVCA 2KHZA 7REQA 5JPDA 1FNNA 1BU8A 3EXIB 3TPFA 4LDZA 2W2KB 3BB3A 3NHKA 1IHOA 4I5GA 2XWPA 2I0FA 3ZV4A 3Q6IA 3QW4B 3NUQA 1L8OA 3HFJA 2BKAA 1C29B 2DTEA 2QRVA 2WU3A 4Z4CA 4UVDA 4G01B 4CU2A 1DAFA 1PFGA 1U1EA 4D0LB 4OKNA 5JJIA 5H3LA 4CI0B 2PT6A 4BWVA 4YWHA 3IVGA 1H2BA 2N3ZA 3LCJA 3OQ1A 4DS3A 1JA1A 1EXWA 2H4JA 4EL0A 4X1KB 3TR5A 2FFBA 5E2IA 1V1JA 3AC0A 4KI0A 4NOKA 1OY1A 2H1WA 4OSOA 1L5FA 3B48A 4C87A 2J6BA 1U3VA 3S70A 2BMFA 4BCDA 3Q3HA 2HM7A 2XDWA 4RWZA 3DM9B 3TPCA 4KR3A 5IVIA 3MINA 1TGYA 4ZQBA 3I2IA 1F2UA 2G63A 5CXXA 1IEQA 1W96A 3BIXA 2ZS9A 2ZGVA 3PPXA 4HMPA 4FCTA 5A9RA 1PU2A 5EY5B 4IVQA 3QIVA 4CMKA 1EEXB 1NQXA 4Z9YA 2R5FA 3VZQA 3C1AA 4B6GA 3NU1A 3WGQA 1TNDA 1EM8A 4RNDB 6ABPA 3N2GB 1QMPA 1GGEA 3QVJA 2FXVA 2QBYA 3C3MA 3NM4A 3KHKA 2AGVA 1KI7A 5D86A 2EHDA 3FF1A 4R2WA 5LBIA 1XEWX 2H1LA 1K63A 1MVLA 4K3UA 4A03A 2WI8A 2HTFA 2BR3A 2R84A 2G04A 2JHAA 1HYEA 1MGOA 1YU6A 2OECA 1VBKA 3KQVA 3WKEA 3JYPA 4NSNA 3ZK9A 4M9ZA 4DEXA 5JD6A 5K8UA 1E3EA 1P17A 3UFXB 3MAAC 4B2YA 1RI1A 1U99A 3D7MA 4US1R 3JV7A 2IOHA 3DAPA 3L1KA 3TD2A 5K0NA 1NI5A 4HPXB 3EG5A 1HKHA 1G2IA 1DC7A 4URYR 2C5FA 5ALPA 2M98A 4Z4GA 2CF6A 2IV3A 2FMXA 2QD1A 2JVJA 5F33A 4U5QA 1I3NA 5KCZA 1J6UA 4IS3A 4R1TA 2FHSA 4EGFA 3H3FA 2E4YA 3ETDA 3AUJB 3TRIA 1IZ9A 2V8OA 2O2ZA 1WNTA 1V8FA 1E32A 2PXAA 2Q8PA 4OJKA 2IYEA 1MAHA 2GAAA 4OMFG 3JALB 1IOLA 3W90A 4D25A 1BQ3A 2I03A 1YASA 1ZM9A 2J5QA 3T34A 3I52A 2Z56A 5DN6D 3PUKA 2XNCA 3MLAA 4KLAA 4ND8A 4AJNA 1M83A 4RHYA 1NBAA 2HC9A 3OJFA 5I7AA 5TR9A 1AK9A 3D0QA 2GVZC 1G3IA 3PNYA 1XMXA 2Z2IA 1Z9BA 2QRZA 3F3YA 3OZWA 4OU5A 1GGNA 1JU9A 1T5LA 4NP6A 4ZQCB 1TF7A 1R6TA 3CZ5A 1WDLA 2DPLA 3EOBI 5DWQA 3RSSA 3PNBA 5CLJA 1J8VA 2H17A 2I3ZA 3DMYA 3IB6A 2H1IA 5CA1A 1ISMA 1GL9B 4QXAA 3TSZA 1ZWKA 1K8ZB 4R2JA 3FNIA 3VJKA 4B71A 2GFIA 1D8AA 1LLCA 4E5MA 1JG2A 5JLAA 5FI1B 3W8DA 3D6MA 3I6ZA 3IFSA 3DE7X 4NF2A 4Q3EA 2H57A 4CI9A 4MA5A 1FRNA 2IGTA 4QG3A 2VA9A 1NW4A 1H42A 5A4JA 3LYHA 1WLYA 1R5JA 1XZKA 2HMAA 2VH1A 4CCYA 3L1UA 1YJ8A 3K8OE 3OFKA 3UT6A 4XWAA 3FUXA 5PGMA 3TAHA 5L7WA 1VFNA 4B2IA 1GDTA 1U3DA 2MTBA 3NCTA 4B0PA 4TS1A 3VU3A 1ZU4A 4Z7QB 5A0TA 3D8BA 1D07A 3RNLA 3JTEA 4M0DA 3S2ZA 4PM4A 3TEJA 4DKJA 3FUCA 1PQPA 2M6KA 2CBGA 5C52B 2RI1A 2NUAB 1SXJB 3M0EA 3MRSA 3R5HA 1WKBA 4ND2A 5J5VA 2DPMA 2HDOA 3BJRA 4NOLA 4RPCA 4QM6A 4IM7A 4L74A 4NJEB 5IP5A 5HIKA 5JJLA 2Y1OA 4RCYA 4MVJI 1Y9AA 2JFUA 3ZK8A 5JTUA 4F46A 4DLLA 4BGDA 3I6BA 3H86A 4DKXA 2RGBA 2ZDGA 2V74B 4JLSA 1C4WA 2OCKA 4QRHA 1G5IA 1YA6A 4XUDA 1ZD2P 3T9CA 2V6MA 3C6ZA 3K2QA 3GRPA 4WBNF 1Z7GA 5EE1A 4FMCF 3TZEA 2GERA 2I5PO 2QTCA 1FP7A 1PQUA 2RCNA 4HXYA 3OLVA 2J0UA 3I2HA 4FINA 2LE0A 4K6MA 4P3YA 5EJAA 1CUDA 3ZHTA 5EJ6A 3EZ2A 1Z0KA 5DK4A 3VOTA 5BRAA 3OSUA 1Z8HA 4G25A 4C08A 4KQFA 3TZ6A 3NBFA 1FTNA 5EUCA 1J5PA 4QJ3A 2VDJA 3UEOA 5AM2A 3A6JA 1L8QA 2M1XA 4XJXA 1NVAA 4F2PA 4PC2A 1HXHA 2DY1A 4L0QA 3MSXA 4ITUA 1SQGA 3KVNA 1KQGA 2WLTA 1KQ3A 4QFMA 4AZ0B 5LVAA 2ZIFA 4YJHB 3FMOB 1HWYA 5I51A 2XECA 3AIMA 2ZXUA 2ZRMA 3IQIX 4RK1A 1U6KA 3CLHA 3EZ9A 3Q11A 3IUJA 1RQPA 3AUYA 1PW7A 3B1XA 1M1XB 4JU8A 2VDKB 3COYA 1OSNA 3IO5A 2ANCA 2ATXA 5GZ1A 4DR3B 1T3GA 3TQSA 4LBYA 2A14A 1D4FA 4W82A 1QKJA 3O8LA 1V3TA 2GZSA 4UMFA 3TKLA 3L8FA 4MQFB 4FGZA 1NC1A 4OV6B 4MQEA 1K2VN 3NVAA 3AEQB 2WDPA 4TRMA 2ODBA 1AM4D 1ZI8A 4PYKA 3G2QA 5KSZA 3WGKA 1CR2A 2CUZA 9MHTA 2I3GA 1GQ2A 3ABIA 1ZKDA 5AHWA 3V5NA 3PLNA 1MO5A 1WB4A 3VKUA 3G17A 1D2HA 3PKZA 4B1FA 1YB7A 3M81A 4LJ5A 5EWLA 2ZFUA 2FPGB 5I7UA 4X1KA 1TGVA 3OI7A 3FTFA 2IIPA 1O0CA 3AVWA 3BZWA 3R0IA 2ZVQX 5JZVA 1XZ8A 1USUA 2WWTA 1LSOA 3GZJA 4INOA 4IDCA 4CR6A 4RHTA 1QGUB 4MMYB 3ROGA 1KO8A 1L3IA 1VECA 3HZHA 4P54A 1X2BA 3ZGNA 3DBOB 4FOOA 2Q99A 2QENA 2UYOA 4MYHA 2B61A 2D5BA 4NARA 1XYGA 2HWWA 4C7XA 5JYEA 4ZDWA 4OI4A 3KQYA 1H66A 2GUGA 2FEOA 1WUYA 4HXEB 4JSYA 5A62A 4GKJB 1MIOB 3TMYA 5J4HA 1LKZA 2VP6A 3LWDA 4OB6A 4WEOA 5C4GB 2K5UA 1XVTA 3SSOA 1E59A 1U4SA 2W6JA 3BBLA 1ZEMA 4Q4AA 4J4TA 3ZDAA 2OWDA 1FSPA 4R98A 1AX9A 3RS8A 2NQTA 1XDGA 4MEJA 1FVHA 5K01A 4JB8A 5K09A 1TM2A 2QX6A 5DBHX 2OCLA 3RIYA 3JYLA 1E9AA 3E3AA 4MK4A 3UYLA 2HT6A 3GJYA 1OV6A 4Z9AA 3ITKA 3V80A 1JTVA 3PI6A 3C6YA 1E2LA 4G67A 4AP5A 1AJEA 4DMUB 1IJKA 1OWOA 2CDNA 3ITDA 5K1ZA 3LD9A 3COJA 1AT1A 1VI6A 1NQTA 1Z08A 2XMZA 4QYXA 1ULUA 2UYQA 4C1NA 1J0BA 2G7MC 4PTZA 3T15A 4DQLA 2VAXA 3L6RA 1YVPA 2IOQA 3TMKA 3P9XA 1LQTA 4H7HA 5LZ2A 1L4EA 3MC1A 2WJIA 1S8FA 3F74A 1O6GA 3GLGA 4CL2A 4Y6SA 1DELA 2HBQA 3FN4A 1KJJA 1U5BA 2ONYA 1DCTA 1UANA 1FBTA 1OPRA 1QE0A 3AR6A 5FBHA 4BP9A 5JNSA 1J2JA 5IU6A 3M4NA 1ZX1A 2F1HA 2C78A 3BFPA 3NGXA 2OUIA 2QLBA 2ZXEA 3V48A 3UJ3X 2NU7B 5GGXA 1X7WB 1QAQA 2XUGA 1L1RA 3EJWA 4BQQA 1YDMA 3L6EA 3R4CA 2WHQA 2QSYA 2BFDB 2BKVA 5DW3A 4Z2AA 1E1QD 4GIBA 2G70A 5IK2D 3BCRA 3B5JA 4UTOA 4ZCQA 4MYRA 3DMNA 2O2SA 1FX0A 2QZJA 4PLVA 2BONA 3FW1A 3FOWA 3CRW1 3A3YA 4DMKA 5HKOA 4FYJA 5EHZA 3AM3A 1Z22A 4IGAA 1WCIB 1R9JA 1O6CA 3HSKA 2X5OA 3GPBA 1OB2A 4ZQFA 4LW8A 4KR7A 3Q0IA 2HRCA 5H80A 2HSEA 4N76A 1GA4A 3KVRA 3TSWA 4DCCA 3E22B 1P91A 4KQKA 4PLPA 1QFSA 4BMOB 2HPZA 3SBEA 2G6BA 3CTPA 1F20A 4F91B 2YICA 1AGYA 1RE0A 4ND3A 4FGKA 3R6TA 4DIEA 1YJ5A 2CLEB 3GRKA 4MW9A 1H05A 3VDQA 1ULZA 1C3OB 1F8FA 1LA2A 3J7TA 8OHMA 4TWJA 1Z0IA 4MCJA 1EG2A 2GA8A 5DLQC 5LCXA 1E0SA 3HL4A 4IG9A 3ILHA 4XUGB 1DRUA 1JLSA 4F06A 2HNAA 3SG0A 1GSOA 1YS9A 1AGRA 2FPIA 3HJGA 2QV0A 1QMGA 2DLDA 3OX2A 2CEKA 3JQCA 1WCYA 1I30A 2QEQA 3KPJA 3WL3A 4CBVA 1AN9A 2I62A 3SS8A 4DDWA 4JKYA 2VDVE 1OIWA 3NIFB 2YXPX 5LMNB 5IPFA 1W93A 2QYSA 2AWNA 3A6EA 3GL9A 2MJLA 2MMGA 1GAWA 4QXMA 4ZRNA 3ZGLA 4UNRA 4IDOA 1QVVA 2FSVC 2VP9A 3UJHA 4IJUA 3TNYA 4ENQA 1WHSB 2ZIXB 1ZD9A 4EGCB 3DZBA 4H1WA 2JIRA 5EXEA 1Z4KA 1PE0A 4FXOA 4NU0A 2VDWB 1Y1RA 4YT8A 2FXIA 2HGZA 3U09A 1KNXA 3D4BA 3OQHA 1QIJA 4RK6A 2CNKA 3K4PA 4DDMA 1J1ZA 3ELYA 3KZMA 1YHYA 2HBYA 3S4YA 4E07A 1H8ED 1W5EA 1MX1A 2I71A 4GP6A 2H16A 1AZLA 2EX4A 5DRTA 2YCLA 3FKJA 4KQ9A 1XL0A 4NG4A 1O8BA 1P39A 1UMBB 4PZ9A 2EBWA 3O75A 4GYWA 1ZSYA 1TFUA 1NPDA 1LU9A 2ZBQA 2VPYA 2ZBFA 1DMSA 3LQ1A 1DXYA 1E2NA 1RXUA 2ZI4A 3OZAA 4M8IA 4TMVA 1SCQA 1YC5A 2EJVA 4TRJA 5EPEA 1AC5A 2VOEA 2X8LA 1K5GA 1Y8CA 4AP9A 1H2FA 2Y9MB 4MV6A 2WHEA 1OVGA 1GQYA 3C7TA 3QF7A 4F97A 4NMWA 3WKBA 3HU3A 2RGRA 1RLOA 3QEKA 2B0CA 1FFAA 2X5NA 4FTWA 3V2UA 1PZHA 3BIOA 4C7KA 4G0WA 4MP6A 3QXXA 3SYMA 5J4KA 1JA9A 2VT7A 3SJAA 3I2JA 1P62B 1UOQA 1M2VB 4GD3Q 3NW9A 4BEVA 4LY3A 5BWMA 4YRKA 4RLHA 2XWQA 5EHGA 3RSFA 5HR5A 2RH8A 3SS7X 4TXHA 1GZ5A 1PFWA 5TMBA 4CV2A 3WB0A 3WGOA 4Q9IA 3KZCA 3N5KA 5ENVA 5ARDA 4H6WA 5K51A 2WABA 2Z2XA 3DMTC 4PHHA 5DX0A 1IPEA 2V7BA 5J3JA 1X6VA 1Y5RA 2X40A 4DREA 2QT0A 4JI0B 4L28A 1JQAA 4A8PA 2E21A 4DFDA 3D2LA 1JDSA 1HC7A 5E95A 5GV8A 4AX4A 3BH6A 4DLPA 3MMXA 2ZVDA 2H63A 4I46A 5HW0A 2PMEA 3E4CA 1E20A 1GGHA 1NRJB 1C0IA 1TKRA 2FMIA 2ZRBA 2ZYTX 3KWJA 4JASB 3ROTA 3DUFB 4CKXA 4FD3A 4DRXA 3I12A 3U2QA 3BXXA 3OM9A 2Q29A 3A4MA 3SP1A 2ASVA 2YYAA 3KTAA 3KQKA 2FH5B 3BH7A 2HJSA 1STOA 3AKCA 4X00A 1BYUA 3NKLA 4P4NA 5IFLA 2GJ4A 2XVZA 5LQMA 2BMVA 3K9NA 2G9ZA 4AMGA 3AIIA 2NXCA 4ER6A 3GOQA 1K3UB 5TY0A 2FK8A 1EE9A 1T3LA 1TJ3A 3JQGA 1N0WA 1FQKA 1Y1PA 2OKGA 3ONNA 4IOLA 4MIOA 4N0DA 2XIJA 1NMZA 1Q11A 2V4UA 1IVNA 1U7WA 1X7YA 1T1RA 1ZM3A 3KV3O 3QEJA 4IIJB 5IZCA 4KOAA 2PSDA 1E7WA 4C6TA 1EQAA 4MCHA 4UNSA 1QHXA 1VPTA 4LJLA 2BKEA 2COKA 2XF8A 2YVQA 3P4XA 4BRUA 3KQNA 2B4QA 4I81A 4ESHA 4JOBA 4I1PA 2IDJA 3C85A 2X22A 1LSUA 2YJNA 1QV6A 4KZPA 5KWJA 1O4WA 1R0LA 4V2UA 1QB8A 3I09A 5GWXA 1YFZA 3P45A 3MJRA 4WXEA 1X1AA 3TSOA 2DHQA 3AR8A 1EB9A 4F96A 1QH8A 1YI8A 3O26A 3W1VA 1GZVA 2YIMA 3QMVA 3IVXA 1C0KA 4R41A 1KAOA 2X2PA 4WZBE 2KB0A 4MV8A 1MZPA 1HFWA 3W5BA 3G1WA 1F4VA 1VTKA 4N0EA 1T5SA 2HHCA 3N53A 4KYTA 1JQ5A 3Q7QA 2NUPB 4E51A 2HMWA 4FK8A 3SR4A 2QTNA 5AJZA 3QSYA 2CYCA 2W6MA 4IFEA 3WLKX 1EM6A 4M87A 3BQMB 3EMKA 4U2GA 4YH1A 3WAKA 1UKBA 2MSDB 1FP1D 1W6UA 3LRXA 5AUOB 1UWVA 4HVTA 5JNWA 1QP4A 3E48A 1S2NA 3RVLA 4RM3A 3R2JA 2C4KA 3V7FA 2R8PA 1TJ4A 1QFMA 1C0LA 5D8DA 1GLNA 3QLUC 3M3DA 3VTFA 2C77A 1QZXA 1JDPA 5LYJF 3R9XB 2B3DA 1H65A 4JXZA 1QFXA 4ND8B 2O57A 1R0RE 4MUNA 3W9BA 1XPRA 5B3JC 4IXTA 5BSUA 1DARA 2C4HA 4E4YA 1ILEA 2XA1A 3KKZA 5F7JA 2OFOA 3H9UA 1UJNA 2Q4EA 1P1CA 5KINB 2O23A 4CM4B 1N2EA 1SD5A 3DBRA 2VKQA 3IQGX 4QEZA 1N3BA 3ZI4A 3KHSA 1TAGA 1V41E 5JNTA 3H5OA 3P27A 2P5YA 1A8UA 4IV0A 4OMCA 5IWCA 1FLVA 3M1LA 4BO6A 2Y76A 5FUMA 3G0HA 2QU7A 3BILA 3TZHA 4BZZA 2V7EA 4KHZA 4IO0A 4K9OA 4FNOA 4LHSA 4Z9FA 3REGA 3UMBA 4EG7A 4EUSA 4HDCA 3QLVA 1Z5ZA 1Y8ZA 3DMRA 3R5KA 3BRWA 4MQEB 1KERA 4HNUA 2PGXA 2R4UA 3CF2A 4P86A 5CB0A 4YT4A 3MD9A 3PWZA 1Y98A 3IXQA 4U2FA 3V8PA 2F9FA 1I7DA 5JDIA 4V0KA 1QK3A 4NNOA 1I1NA 3RJZA 3WC4A 1LGYA 1RWXA 3MPUA 2R2AA 3HWSA 3AL2A 4X6UA 5K0FA 3I9V1 1HQKA 1D2RA 3E5NA 4UU1A 3WQBA 5DULA 3VXKA 2WD9A 4M9QA 3ZWYA 1OC4A 4FFWA 1JR4A 1OFUX 3QA9A 3DZFA 5EC8A 4C0XA 5A1JA 2AJBA 1UWKA 3CLSC 1SA0A 4WLNA 5KQMA 1KFJB 5F52A 3NB0A 1BHJA 3EXHC 3ILYA 2WJ6A 4MW5A 1BO6A 2LZ0A 4ZARA 3EGVA 4YDQA 5KREA 4LWQA 4XCVA 2DBRA 1KYVA 1WXDA 1E98A 3OPYB 2ZRPA 3A31A 3DKRA 4GI3A 5F5LA 3QEOA 1WF3A 4TL8A 1ADYA 1WY5A 4MR7B 1N2CB 3C24A 2JLXA 1Q15A 4O8ZA 1JSCA 3BRCA 5LD2B 1U9IC 1M6EX 4HEQA 4MV9A 1F7VA 2CK3A 4C6RA 4ZEMA 1ORHA 2HY7A 1O97D 1CUXA 3LGXA 2YMLA 2I2WA 3Q98A 5TV2A 2J0UB 1VGQA 1YHNA 4UCQA 2OCYC 1EE1A 3DUWA 1LLFA 1Q0ZA 3F90A 3IKLA 1Z2AA 3A3OA