3OY2A

Crystal structure of a putative glycosyltransferase from paramecium bursaria chlorella virus ny2a
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
392
structure length
392
Chain Sequence
MKLIIVGAHSSVPSGYGRVMRAIVPRISKAHEVIVFGIHAFGRSVHANIEEFDAQTAEHVRGLNEQGFYYSGLSEFIDVHKPDIVMIYNDPIVIGNYLLAMGKCSHRTKIVLYVDLVSKNIRENLWWIFSHPKVVGVMAMSKCWISDICNYGCKVPINIVSHFVDTKTIYDARKLVGLSEYNDDVLFLNMNRNTARKRLDIYVLAAARFISKYPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAEGAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAFTFFKDEKNRKEYGKRVQDFVKTKPTWDDISSDIIDFFNSLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein,transferase
molecule keywords Glycosyltransferase B736L
publication title Crystal structure of a virus-encoded putative glycosyltransferase
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus ny2a
total genus 137
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3oy2A02
3.40.50.11930 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oy2A01
4MI9A 3CUYA 3VDMA 4Z5XA 3MSCA 1WUYA 2XMPA 1GFZA 4BFCA 3TOVA 1FTYA 4X6LA 1RRVA 1F6DA 4L22A 3COPA 3C4QA 3D0QA 3S27A 3L7DA 3S29A 2AW3A 2BFWA 3D1JA 3IAAA 4GZ5A 3S2UA 3MTAA 4WACA 1KTIA 3OKPA 2SKEA 3UYLA 3MRXA 3BD6A 9GPBA 4RENA 3L7BA 1A8IA 3HBJA 5DXFA 1P2GA 2WTXA 2XGOA 2SKCA 2QRQA 1WW2A 1FU8A 3S0JA 2YJNA 1JG7A 3Q3EA 4GZ3A 3T3IA 2AV6A 2F3PA 3BD7A 4MHOA 1YA6A 4BQIA 1K08A 3C4VA 1FS4A 4M83A 2XGSA 3OT5A 3ZCPA 1XC7A 1J39A 4NEQA 2QN8A 1P4JA 2VSYA 1GZ5A 2PQ6A 1JIXA 3T3EA 3G2KA 4MICA 4YI3A 3GUHA 4AMBA 5JTUA 3VUEA 4HLNA 3SYRA 5HXAA 2QN2A 3GPBA 4W6QA 1FA9A 3E3NA 3RT1A 3Q3IA 3ZCUA 4GPBA 3CX4A 3NPAA 2QRPA 2ASVA 4F9FA 1LWOA 3O3CA 4WHMA 3DDSA 3CEMA 4LDPA 2BGUA 4X7MA 3BCSA 1EM6A 3OKAA 2GEKA 1Z6PA 3T3HA 3WAGA 3CV3A 1XKXA 3G2NA 2IEIA 5DLDA 2IV3A 1C3JA 3ZCQA 4EL5A 1GPYA 1JIVA 2XGMA 3VDNB 2IW1A 2C1XA 3G2LA 1NLMA 2QLNA 3OTIA 4X7PA 4NC9A 3E3OA 3IA7A 4XIFA 4EJ2A 1GG8A 3BCUA 5TMBA 3T7DA 2QN9A 1SXQA 3L7CA 4EKYA 3MRTA 4F96A 1L5QA 2XCUA 4WADA 2R4TA 3EBPA 4F97A 1FC0A 2FFRA 1FTWA 2VCEA 4FZRA 1L5VA 2GPAA 4GZ6A 1BX3A 5LQDA 1NVKA 2Q6VA 3MS7A 2P6PA 2PYIA 4QLBA 4REMA 4RELA 4GYYA 1Z6QA 1RZUA 4AMGA 2X6RA 3MTDA 1Y6GA 3NC4A 2XA1A 5DU2A 1UQTA 1NOKA 3MTBA 5BNWA 2AZDA 3BEOA 2OFFA 1NOIA 2R60A 1PNVA 1Z8DA 1ABBA 2R4UA 2ACVA 3CEJA 1JIUA 1UQUA 3SYMA 3VUFA 1L5RA 1IXYA 3BCRA 5IKPA 4MI6A 3RSCA 2JZCA 2C9ZA 3OY7A 4MI3A 2JLBA 3TSAA 3CEHA 2GPNA 3RSZA 1K06A 2X0EA 1Y8ZA 1AHPA 1IIRA 1YGPA 3PE4A 5TMEA 1PN3A 3DD1A 5IKOA 1V4VA 3H4IA 3OTGA 2VSNA 3MQFA 5TMDA 2QLMA 3HBFA 3WADA 3WC4A 4RBNA 2F9FA 1JEJA 4M7PA 4RIIA 1JG6A 2ECPA 5D01A 3MT7A 4N3CA 3NAZA 3RHZA 2GJ4A 3FROA 2G9QA 3NB0A 2QN1A 1H5UA 5ENZA 4N3BA 2IUYA 4G2TA 2X6QA 4KQ1A 2PYDA 5TVGA 4RIEA 2QRHA 2H1FA 4CDRA 4MHSA 5JTTA 2R66A 2H1HA 2QN3A 5C1DA 3EBOA 3MRVA 4HWGA 4LEIA 3CUVA 5I45A 4KQ2A 4CTOA 1GPAA 3MBOA 2XA9A 3CUTA 1WUTA 3AMVA 2QNBA 2FF5A 3TAXA 3L7AA 3MS4A 4RIHA 1E1YA 1Y6FA 4EL0A 1PYGA 2ZB2A 2AMVA 4N39A 2GEJA 1P2BA 1C50A 3T3GA 3QHPA 1PSWA 2GT1A 3DZCA 3E3LA 3CUWA 3UYKA 2KS6A 1UZUA 3G2IA 1RZVA 1GPBA 2GPBA 3CUUA 2QRMA 3L01A 4N3AA 3BDAA 8GPBA 1SXPA 2ACWA 2JJMA 3S28A 3T3DA 1LWNA 2X0DA 1NZFA 3OKCA 2F3QA 3NP9A 3HBNA 1C8KA 4BQFA 1P2DA 1L7XA 1WV0A 2F3UA 1VGVA 4AY6A 1FTQA 2FETA 4N9WA 1HLFA 3HBMA 1E4OA 3ZCVA 5D00A 2SKDA 2C4MA 2G9UA 3PE3A 2BISA 3DDWA 3MS2A 4MRAA 1FU7A 1WV1A 1NOJA 4CTNA 4M60A 6GPBA 1P4GA 2GM9A 2QLLA 1L5WA 7GPBA 1GGNA 2PRIA 3MT8A 1XL0A 1FU4A 3D0RA 3NP7A 2VCHA 3G2JA 2QRGA 1XV5A 2IYFA 2X0FA 1NZDA 2G9RA 1WW3A 1XOIA 3Q3HA 2C1ZA 1AXRA 4AN4A 4XI9A 3MT9A 3G2HA 2F3SA 4BQEA 5GPBA 4YI5A 4NESA 3T5TA 2XCIA 2IEGA 1EXVA 2HY7A 3H4TA 2R68A 3OY2A 1B4DA 3ZCRA 2O6LA 1L5SA 1C8LA 1QM5A 4RIFA 4YUAA 3BD8A 2BGTA 1M5RA 3ZCSA 4EKEA 1XL1A 4RIGA 3NCHA 4CTMA 1QKJA 2IV7A 1O6CA 4X7RA 1L6IA 2QN7A 4GYWA 1Z62A 2QZSA 4FKZA 3C48A 3OTHA 3ZCTA 4KQMA 2G9VA 2PRJA 2VG8A 3L79A 1P29A 1F0KA 4AY5A 2IYAA 3QKWA 2XA2A 1P4HA 4PQGA 2ATIA
chains in the Genus database with same CATH superfamily
2H48A 3B9QA 2DR0A 5SICE 2MINB 4LSWA 4RETA 4UBMA 4I9UA 1YOBA 5D5PA 3AVYA 5KDLA 4LCBA 3QF4A 4IIUA 2ZJ6A 2H4HA 1QB7A 4NBSA 2ZUTA 1I32A 3CU5A 3IV7A 2HREA 4PZPA 4B6QA 4IF4A 1DEKA 3T7EA 5HTKA 3ICVA 2FEPA 1SC9A 2CVFA 1ZI8A 3GAZA 3JZDA 3D0QA 3NT4A 1VQ1A 2GF0A 2WVHA 4Z9AA 3T7TA 5BMOA 2JK0A 1NF8A 3OZRA 4X1IB 3S2UA 3U4CA 1HK7A 1N2HA 4OHCA 1J1UA 2VP3A 4WJLA 2EJUA 4QD3A 4YDQA 2ZPAA 2AN9A 2WWFA 1M66A 2G06A 4U2FA 1GPDG 2HRBA 1WW8A 1EX7A 1FQJA 1FEZA 2GKOA 3KPVA 1A71A 1XPJA 2PD6A 1Y5RA 2GUWA 2HF2A 1DIAA 1PBTA 2AE2A 3IOEA 3MRXA 4XLTA 3WLQA 2RC6A 1UFOA 2BR4A 4BNUA 2Z2ZA 1DDOA 4R2HA 1PVVA 1T3TA 2C7GA 4OHOA 4A3SA 2CXHA 1OX4A 3IP5A 4GR5A 1XCJA 1DUSA 2E9SA 1WMSA 5TNXA 3TVTA 3OQPA 3WHKA 4D5EA 3DUFB 2JCVA 3FYUC 4HADA 2PZAA 1U8UA 3S0JA 4ZVRA 2ZT5A 4FXOA 2DBYA 3WYCA 3AV3A 4CQMA 4Z4HA 5JSQA 4DR3B 1JFTA 2O8CB 2AV6A 2ZUUA 1Q20A 1D04A 3DV0B 4PTYA 3LBIA 3REGA 1T5DX 5AJHA 3IKLA 4M0PA 2BGLA 1E5VA 3UOAB 4B09A 3A36A 4MVJA 3A0RB 1TK9A 2WQ6A 1TZBA 2OHHA 2PO5A 5KX5B 2I3ZA 4FZJA 1B8PA 2R8ZA 1VC2A 2PGXA 3LCMA 4XM1A 2BOVA 4Y2TA 5EXXA 2VZ9A 2ERCA 3G3EA 3HI6A 4US1R 5ENVA 2I6XA 1CS0A 3AL0C 3LLCA 1EWVA 1TAQA 1FMLA 1AB5A 2EP5A 4IVNA 2HLPA 4QRIA 1LDEA 1ZXLA 3E9DA 3JX9A 4DFDA 2XKJE 4M1ZA 2UU9B 1CXZA 1OI2A 4CG0A 1RYZA 2OGWA 2IY7A 2P9GA 4H7JA 5LQKA 4WNCA 3GJ0A 2OAGA 3IP7A 2X1MA 3G7NA 4TVKA 2TMKA 5KDDA 1DG3A 1XXHE 1ZQ9A 2NZVG 2O7NA 2QUAA 3O2QB 1OWMA 2GKSA 5DIFA 2ZYHA 5FWAA 3CLUD 2QNRA 4D8WA 4OX9Y 2FK7A 5JTUA 2OAEA 5U9CA 1R5NA 3G5TA 3E03A 5CDYA 1OH7A 5ALRA 5G0SA 4ARVA 1V0JA 4ZU6X 4UZSA 1NV8A 4AUKA 3FPSA 1NVMB 1J2TA 1DEOA 3R41A 2O0KA 1HG0A 3LPNA 5AW9A 1P0QA 4YCNA 5HS4A 2D2EA 5E6SA 3RT1A 3H2KA 4N65A 4EKNB 3CCFA 3NPAA 4J2TA 4OFZA 4PAGA 5DGDA 4CT4B 3FNBA 4WFKA 3CVOA 1GTMA 1NR5A 1YACA 2H08A 3FI0A 1V5EA 2IL1A 1W48A 1KMHB 4LDAA 1ZZGA 1G8JA 1L1EA 2B1GA 5AO9A 3STYA 4RK5A 3N53A 1G8HA 2A0FA 3C24A 1NNSA 4PO3X 1DKLA 5CT9A 4RYDA 5TEVA 1WPRA 1EM6A 2XE6A 1Y0BA 2I99A 2YN4A 5DXAA 2FUG1 1UXHA 5ES3A 1V8DA 5SZKB 3RS3A 3Q85A 3JQAB 3WRYA 4GH5A 4A9AA 5BVHA 5GZ3A 3KEQA 5CCBA 4MS3A 2OEPA 1F4LA 4LECA 1JT2A 1EE9A 2X8BA 2GVNA 5GM2A 3C8UA 1C3VA 3SHQA 2HCRA 4YQEA 1AF7A 4HI0E 2QT0A 2VP9A 3IUBA 4FHCA 2PL3A 4HDRB 4AULA 3ZCQA 1ULBA 1JHAA 3EA4A 1IPHA 2EGUA 3G89A 4NE2A 4QJIA 5JH7B 2ODNA 2ODEA 2HF8A 4WOKA 3K70B 3G2QA 3RV4A 4DJTA 4F12A 5GZ1A 3SN6A 4LKOA 5TIIA 1UT6A 5HFAA 3SZUA 5KYUB 3GMIA 2IW1A 4OHPA 2C1XA 4D3SA 1QO7A 4MRMB 3JWGA 3I8XA 4UOEA 3B12A 1BEEA 4MLCA 2W93A 5C8VA 2O3TA 4IUBS 2EYUA 3LNCA 1MTZA 2P9ZA 1EDOA 3LPCA 3MWYW 1NYRA 3PGKA 4GC5A 4RA9B 4U7JA 2NP7A 4ZRMA 2IXFA 1KI9A 2IEDA 5B6PA 4XM0A 4ZCTA 1TUIA 4CEHB 2A7QA 3GRAA 1W46A 1QV9A 4V0NA 4GIBA 3FGZA 3M6UA 3K0AA 2FCRA 3WNZA 7MDHA 3FTFA 3KZMA 3RCBA 4HAOA 1LK5A 1GG5A 1Y8QA 2WG1A 4MUGA 2XMRA 4KLZA 1JBEA 1HFWA 4ZMBA 1XK7A 1IIBA 3WMEA 2CXUA 4RK6A 1NVVR 1XHLA 3E5MA 3PD1A 5JAIA 3ST7A 1L5GB 1SQ5A 1H0KA 2YV4A 5CDFE 3NALA 1PUIA 2H65A 2BVNA 3D5QA 5FLKA 2XVAA 2EW2A 1AN9A 1WUIS 2ADFA 5AOAA 3FZNA 3KYDB 4D79A 5L6MB 1U8AA 2G5TA 3A6KA 3G49A 3O3NB 1QDEA 4HK4A 4Q3DA 3V8PA 2CNNA 1P80A 3DFKA 4CMEC 1JLRA 1GZUA 2ODWA 3DYBA 5LP6C 4UDYX 3UWSA 4E07A 2P0YA 1KMQA 1RZUA 1YFZA 1U9IC 4FEEA 2X6RA 2LTAA 4A23A 5KKNB 1XTRA 1Z4LA 4DVGA 3WI7A 4BMOB 4QBGB 4NECA 4KFCA 3EVCA 5BVGB 3COJA 1QC5A 4ZQHA 3UTCA 2GCOA 3WRWA 3ZLTA 4DJAA 1NOKA 1CY0A 4TS9A 3AGPA 5K0FA 2Y1KA 3BUSA 1YQQA 2ZREA 3SNHA 1UKCA 4G0PA 5C46F 5ECGC 4Y9DA 1FQKA 3I1YA 1ATZA 2AKEA 1QFYA 2I4MA 5AJXA 5ALTA 3JVEA 4LHZA 1BFKA 1DZ3A 3GDWA 5BN5B 2JD2A 3HCDA 4B85A 5M2QA 1GUYA 1RWMA 2ZU6A 3BCRA 2V7TA 3PC6A 1HMPA 1U0FA 2DM6A 4HRVA 4LJYA 3ZBPA 4EGAA 5D86A 5BURA 3DA8A 3EMDA 2Z3WA 1MRSA 3CNBA 2HBQA 2E4AA 5BT9A 3W4IA 3O31A 5FR2A 1J22A 3OX1A 1PWZA 3MIIA 4WN9B 1R18A 1HWYA 2ZETA 3QNUA 5I7SA 3IAFA 3TQFA 3IE1A 4U2GA 2J3HA 4N7BA 2I67A 2RHMA 2PSJA 1IOLA 3OCYA 4I3GA 1BFDA 2OCKA 5EXPA 2R6HA 4CLEA 3FF4A 3AJDA 3KFLA 4YQYA 1E9VA 2BSAA 2V6JA 4NV0A 2EZTA 1BVUA 2VJDA 3W05A 5JS7A 1VFNA 5EYPA 1ZVJA 5FUBA 2A84A 1QYRA 1XVLA 1Y1RA 5BUCA 4RE5A 3IO5A 4QG7A 1CJCA 3OPXA 3KEMA 3FAKA 2XDYA 3UJ6A 5FORA 4F8JA 1ZJJA 3L7NA 3T99A 2H6EA 4MA0A 1RXCA 1F6BA 2ZDGA 3K0FB 3NTLA 2QRLA 3H1EA 3ITNA 4NAVA 1FFBA 4Q9NA 1RXVA 2HIMA 2H0AA 4OJQA 4LXUA 5IDYA 1P74A 4Q4HB 1SUAA 4HFRA 2XF8A 2G7ZA 2ZUFA 2QYOA 3U4AA 9LDBA 5P8WA 4B3XA 5HOEA 3EH1A 3RIHA 4H7PA 4F2GA 1T6XA 2ZJBA 4XVRA 4AF6A 1ZN2A 2EKDA 2H1FA 4IGEA 3QUAA 4ECEA 3LRXA 2OCDA 4WX2B 5EEGA 2ROQA 1H5QA 1SELA 3U80A 1UKYA 1GU0A 1T8UA 3RJTA 3WIVA 4BNIA 1WCYA 3W3AD 2GZAA 3AR5A 4V0QA 3EBOA 2FPUA 3UK7A 4HWGA 4GZMA 3LXUX 3U1BA 3PKZA 4DMGA 4DLZA 4DZZA 4KDEA 3DGEC 1GDDA 1UJMA 1IQPA 2ADMA 1OBCA 3PDUA 1DQRA 4FQ5A 3NEYA 5M3BA 2X4DA 1EUDA 3N05A 4URFA 4OU5A 4YLYA 5DHRA 4LBVA 1XDSA 2CMHA 1ACLA 1E1CB 4KO3S 2R6CA 1IZ9A 3I6IA 4X20A 3NATA 3LA8A 1C9MA 1OIWA 2IYVA 1F9EA 1NX6A 2QNBA 3ASUA 3DOCA 3P0JA 4HWTA 5TJHA 2CL6X 5BMVB 1DXOA 3FGNA 1F6WA 2QMOA 5G3YA 5LL6P 3Q6IA 2F8LA 1II8B 5CITA 3LZCA 2BGJA 5SZIA 1Z3CA 1D4ZA 4QT4A 1H93A 1IN8A 4BZXA 4NARA 2DPHA 1FSPA 1X77A 1E2FA 1AUVA 2PEYA 3GNQA 4PPQA 4TLCA 2YQ5A 4LTDA 5KNDA 2R5WA 3DVLA 1G41A 3O1HB 1L4UA 1P44A 4NYJQ 4TQUS 5CIWA 4R1MA 1DUIA 1XTBA 1NVBA 1R10A 2D62A 5HP4A 2B2CA 1OZAA 4Z0NA 3MGKA 1Y4UA 1K8RA 2QLJA 2DPLA 4RE6A 2D2IA 3OM1A 1A7JA 2PXHA 3G2IA 3T3OA 3OT4A 1BHJA 2ZYGA 4MYDA 5K4AA 2B99A 2H2FA 3L01A 4U00A 5C31A 3RASA 3U13A 5FI0B 1E5LA 1N78A 2DKNA 1OLUA 1YR3A 1AURA 4FSXA 1GVNB 3P5SA 4RL6A 1GN8A 2C7PA 5K0LA 1TT7A 2RK4A 4Q1AA 4U8GA 3T3DA 2WAAA 3WL7A 1RXUA 4B7ZA 5ITWA 4FJ2A 4WKOA 3O83A 3FPLA 4H3SA 2Z4TA 1ZRHA 4NZ9A 3ODPA 2JRCA 5GV8A 1L7XA 1VKOA 2VTEA 1ZU5A 2VWQA 5DCLA 4AI6A 4ASUA 1G7TA 2XZOA 1NR7A 1UXGA 4F56A 5AVTA 3O4HA 2VJMA 2P3QA 8MHTA 3LXXA 1ADFA 4F3YA 2PGJA 2P6RA 2ZWOA 1TM7E 5TT0A 3IXLA 1MJHA 4ZMSA 3WO1A 1Q84A 4FKBA 1P2SA 4OUKX 4OLBA 3P19A 4JC4A 4IV8A 3UH0A 3CEPB 1C0IA 3L3BA 4JC8A 3GPDG 4YRDA 3WRYC 2QVXX 4N8SA 4PTZA 1FDSA 1FUIA 3OU6A 3KZOA 4HS4A 3FKJA 4NCAA 3C3AA 4ZO9A 4EGQA 4KACA 3B7WA 2ZIXA 4F7WA 2XRMA 4M0CA 1EB8A 4RLFA 5JJ5A 2FW9A 2JIOA 1UPTA 2GNPA 1GCUA 1KVUA 3CR7A 3HR7A 4MQMA 1K6JA 4X71A 2I9PA 4G4GA 4QTZA 2FEMA 5EUMA 2QMHA 2IOHA 4ONEA 1XA3A 4G65A 3C7KA 3VR3A 4ER7A 5JPDA 3EARA 1M67A 2NU7B 1LBIA 2PZFA 3AERB 4G8BA 1Z4QA 2V5UA 3UTDA 4YPVA 3FAZA 2PEZA 3RWMB 1EXWA 3BIXA 5LU9A 1VKZA 5ALDA 3LDFA 4ISBA 3RVLA 4DPMA 1ZXBA 1TJ4A 5E7QA 1DAPA 2Q2QA 3KELA 4GO1A 1P17A 1S9HA 2X41A 1DTWA 1E32A 1Y1TA 5DX0A 4P0TA 3UV3A 3HN2A 4IGKA 1YRBA 3WSWA 4YRKA 4BFSA 1Y80A 4Q9AA 3IR6A 2JCYA 3EIFA 2AQKA 1YDWA 4I50A 4IPTA 5ITZA 2XE8A 4UAGA 4WDRA 1Z08A 1LC3A 3CEAA 3AI7A 3QBTA 2IEAA 2OY0A 1EWQA 1L4HA 1RMYA 3SK0A 2OO5C 4OJMX 3TZ6A 5JYEA 1HA3A 3KDSE 2JAOA 3SXUB 4RTMA 4U5QA 1KORA 1U98A 4H27A 3O8OA 5HEKA 4QKQA 4RQBA 3Q3HA 1YF3A 3OCXA 3C6MA 3UUFA 4ZVPA 4E5MA 1D3AA 4YT2A 2EKQA 2UZ4A 3C14C 3I45A 4RXTA 5ALGA 1Y63A 2ZYRA 3ETNA 3FVVA 3M3HA 4M99A 4NJMA 5FIUA 5H0IA 3AW9A 5LDGA 3LIIA 1KQNA 4GKKB 4NBWA 3KS9A 5IF9A 1P9NA 4UOZA 2OP1A 4MKFA 3G2OA 3M6LA 4UZFA 3ZOKA 1LKZA 1LGYA 1IBCA 2OFOA 3NM5A 3NVMB 2IUUA 3SBOA 4ETNA 4HF7A 4MCIA 5SYAA 1QO0D 3X3HA 2JLWA 4PYOA 5IANA 4K6CA 2C2ZA 3LBHA 1U8XX 1Z0UA 4N4AA 5JW6A 1L7EA 1PZNA 2PR7A 4MPPA 3WJ1A 4D80A 3WJ2A 3OQVA 3H2GA 1OU4A 4LXHA 4AXXA 1WEKA 1YDMA 1R16A 1JMYA 1VIYA 2QTLA 1M2NA 5TS3A 3ROZA 4DMCA 3EAGA 3NEAA 1NP7A 1L6IA 2QPOA 1IVYA 2CHUA 1JLLB 2VDUE 2WAXA 3EDMA 5DBHX 5IMSA 4CIAA 4M6WA 4ZPJA 4OREX 4BKUA 3FLMA 2BR3A 4DANA 1CEYA 2XCLA 2JFYA 3G0IA 4DZTA 5DNUA 1P39A 2HZBA 2PHZA 1N3YA 4LXQA 3ZBQA 3ASVA 1P6UA 4YMSA 4D9CA 1CY1A 2V7WA 2R11A 1FRQA 1ZG3A 3D7SA 4FFBB 2XA2A 1XX6A 2CD9A 4HDMA 3GEBA 3T35A 1NJSA 3MFQA 3CUYA 1ID8A 2CFIA 2FPIB 1L2TA 3P4YA 4L5JA 4PC6A 3TLAA 2C4KA 4JLNA 5TLSA 1I80A 5A71A 1LI7A 3FCUB 1MORA 2EX1A 4F6RB 5HUQA 4MJ3A 1N57A 1GD1O 1UBMS 4M9XA 1M8JA 3E5RA 4CU2A 5FH9A 2VP5A 3ZW7A 2JFGA 4YRNA 3WBFA 1ZCFA 2PX0A 1Z16A 4BB9A 3ED5A 3ETGA 4IKOA 3OZAA 3TLEA 1P75A 3FOEC 5F1OA 3UB2A 3VOAA 5HR5A 3R3ZA 4G1CA 1ATIA 1RZRA 1ZUNB 2MSEB 3VBCA 3A9TA 3S2ZA 1L4NA 4YRAA 3KVOA 3AR9A 3P5BA 1REQB 3F6CA 3GLSA 4PXAA 2H7CA 9GPBA 3ESRA 2WMYA 2PSSA 1NY6A 3RS5A 2A4KA 1R6VA 1Z7WA 3MCTA 4O1IA 3EUAA 5KNCD 3E8XA 3E7XA 3ES9A 5AKEA 1S3IA 2EKPA 3K2IA 1PK7A 4TTRA 2CJWB 2AG5A 4IKPA 4N5DA 4TTIA 2F43A 4U02A 2WWGA 4K9SA 2V58A 4LNAA 4K9PA 3P96A 3QVUA 1F14A 1NMZA 1S3GA 2C9DA 4YJFB 2FXVA 3TQRA 3G68A 1J99A 1GA4A 1YFKA 1K4MA 1GL6A 2KPOA 3R77A 4RS4A 5C7YA 1CR0A 1P7YA 3EVTA 2MU1A 2RHTA 3KR2A 4PO1A 1E7MA 4UUNA 4CMCA 4D6PA 4L4RA 2JI4A 3WGMA 4HX9A 1QVRA 4WXMA 1MX9A 2MYUA 2KB0A 3TEMA 3DW3X 3UMYA 4KRYA 1JNXX 3OZSA 4OBBA 4Q93A 4CCSA 2BTEA 1MOSA 3OJOA 1IONA 3L1UA 1DKRA 1VJTA 3LO5A 3T9BA 2UVPB 2VSFA 1IK4A 4OXKA 1NN1A 1F20A 3WKDA 6YASA 4KXXA 3LOPA 4Y2GA 2XQIA 1TYCA 1E1QD 3B7PA 1KVTA 3QU2A 4RHEA 4EYOA 1E2GA 4WUVA 2F1HA 2PMBA 3RUHA 1B8NA 2WNSA 3DMRA 4PYKA 3ZHTA 3U3XA 5LVAA 1C3LA 1RI5A 3LP8A 4MYCA 4UC0A 3R0ZA 5KIAA 4L07A 5G1OA 3WZ2A 2OXEA 4I55F 1T8SA 5IP5A 4W1RA 1B3RA 3DBVO 4TVOA 4YP5A 3PDWA 3SYKA 3LM8A 5HILA 1SHUX 3ODGA 4NAUA 4A4DA 5BORA 2AZXA 1YBAA 3EVFA 3OEYA 4HH3C 4IOLA 4R9VA 1JSXA 4XAQA 4ZANA 4PLWA 2CL7X 2EFGA 1E7YA 1OV4A 4MYTA 4D97A 4RTSA 3O8RA 3DLTA 3O84A 3TK1A 2LPMA 4LXTA 4BVEA 2UZ1B 5ICCA 3DUWA 3KV1A 2HB6A 5HF9A 2FQYA 4ZVOA 4RJIA 1GYRA 3L0IB 4EUFA 3THYA 4D25A 3UEOA 2M6LA 5H3LA 4UTRA 4GOND 4ILKA 3RJ5A 4RC9A 1ST2A 4TRRA 4M1MA 1YA8A 3VR6D 1T29A 3UWPA 4MKIA 2HIAA 1Y4AE 1J9EA 1UFKA 1XZDA 2PSHA 2WE7A 2QD5A 3RRYA 4BEWA 5DJ5A 3HA7A 1YZVA 2QX9A 1VJ1A 2HA2A 4UDOA 3AUJB 2I65A 4FS8A 4X6XA 1EUQA 3ZGZA 1UJCA 3JASB 4LS3A 3R7LA 1FBTA 1HYBA 2OBNA 3MCWA 3HLKA 5G0TA 3PXAA 4ENPA 1U3FA 1DBVO 1KTVA 1E9FA 4HGQA 1DAOA 5CGZA 1Y5IA 3JAKB 1O8CA 1SHKA 1VP9A 3PEYA 1ZD2P 2K7FA 4GICA 4UQLA 2X3FA 3C5WP 2V3CC 1P3Y1 2RHWA 3Q9SA 4FR5A 1Y9ZA 3KHSA 4GBED 1C2YA 1O4WA 1JIVA 5CW1A 2PY6A 1KDTA 2NTEA 5LD2B 1YDGA 3BWCA 3IBCA 4RM3A 1F5SA 3BK7A 4R2LA 2Q2OA 3T4UA 3P2IA 1Y3BE 3U16A 3QOYA 4AT1A 1FLAA 2BRUA 5KVQA 3JVDA 4LE0A 2ZULA 3NDBB 1JVSA 4UTZA 4OKNA 4PYQA 4EYQA 1QORA 1NASA 5CA0F 2Q8NA 1LD3A 1YT5A 3W1WA 2I80A 1YDEA 4CRWB 3UAGA 4OATA 3HL4A 3DTTA 4YGXB 3ZY2A 3NKVA 1T3HA 3GZTB 4EQ6B 4E7OA 3QZUA 2H2IA 3L0CA 4RDIA 1JDBB 3EPPA 5LYJA 3NMUF 2WR8A 1MX1A 1JWLA 4UE6A 1RI4A 1LZKA 2X2OA 1U94A 2XVXA 3I3SR 4Y6QA 2Q27A 4E46A 1VE5A 4F85A 1W0JA 3DONA 3QE9Y 2AOTB 4H35A 5C8YA 1FFHA 1RXSA 3O4VA 1HQYE 3S2IA 3T5GA 5HJ5A 4HAVA 1V4NA 2CGEA 2PMEA 3DJFA 4CKWA 3N3BC 4B2PA 5KWIA 3WNVA 2XNDD 2J5QA 3PWZA 1J90A 2Q9CA 3L4SO 3QEMA 4DRXB 1QQ6A 3F67A 5KYNA 1X6VA 3W6PA 3N2GB 1JXQA 4IV5A 3E7FA 3T06B 2R5FA 1SZCA 1ZEMA 2J9GA 2IF2A 2AOXA 3TSYA 4C4SA 1EDZA 1Y6GA 1FNMA 2XA1A 1U8EA 3RGGA 4FI3F 3DF9A 4BLRA 3GLTA 2GHRA 4TKUA 4N54A 5F4ZA 1R8JA 3RQSA 3TOZA 5EJ6A 1T5OA 3PIDA 4UUBA 1NU6A 4G8CA 3RVOA 3BICA 4TXMA 2QRZA 1AK2A 3TLCA 4D4JA 1G291 5KPJA 2YNMC 5TV2A 2JBWA 3FPBA 1T3LA 4ZCIA 3RYCB 5ESDA 4PG6A 4WY5A 3T9DA 4TUYA 1DBRA 1EB9A 1UIMA 1US8A 2I4LA 3EY4A 4JYMA 1JIUA 5B2ZA 3EXHB 1OYYA 2QW8A 1XRJA 3AVOA 4IHJF 4OHFA 5THXA 2AZTA 1TA0A 1IZZA 1JTEA 3N75A 1Q2UA 4H15A 3VMFA 4A2WA 2O3RA 3VUFA 3M49A 4BO3A 4F4UA 3CURA 3X1WA 1ZVVA 2NV6A 2V7QD 3G7UA 4RVHA 4MUXA 5EZQA 1NJ1A 2B35A 4BVGA 1XDGA 3DWIA 3NPMA 5FHRA 3DHYA 4EZBA 2O2HA 3R7SA 4BTVA 4EP1A 1DRWA 2B0CA 3LOQA 1PR5A 1XZQA 1H6DA 3NNNA 4ZEXA 2DHQA 4EG6A 2ZRDA 2ZYIA 3IS3A 4LNHA 1ZSNA 1GFSA 2FZEA 4JLBA 3RM3A 2D5IA 4I5IA 1QTRA 4J7XA 3WP0A 4EMUA 3EDRA 1HTBA 2A5FA 2PTGA 3VTFA 4RV4A 2FZ5A 3A4VA 3N8NA 3OTGA 1WB6A 4DV7B 5DSZA 3LXRA 5EJIA 4KB5A 1G8FA 4OF4A 4P2GA 4JV5B 2YDXA 5K03A 2QX4A 2KYRA 5HM8A 1C9JA 3MT7A 1MD9A 5BYBA 4B45A 2GJ4A 3TGLA 3ESBA 1XG5A 4MUEA 4BQOA 4AS1A 2GILA 1E8NA 1RYMA 3VJMA 4DKXA 2K87A 1ZN7A 3ETEA 2GI4A 3T6KA 4L3WA 1BVHA 2QZJA 3U7JA 4ZVQA 2GAOA 1FTNA 4G2TA 1E5XA 4ZOLA 1V47A 5HBRA 4YREA 3LT0A 3MJDA 4F9GA 1UC5B 3ACCA 3D7MA 2E3JA 2PYDA 2VPIA 3VVBA 2UZAA 1DPFA 3AF4A 4MQLA 4DILA 2YVKA 2I0FA 1EX1A 2QN6A 3LCRA 3KJXA 5EOVA 1RJ9B 1JT9A 1FNBA 1XAGA 4DA0A 4XYLA 1JU3A 2JH9A 2WM8A 3PD0A 4IMRA 5EIHA 3TW8B 2HMVA 3OAAA 4C2BA 1RE1A 2O50A 3I01M 2P5SA 1OFUX 3EVGA 1A27A 3TL6A 2C59A 1WBBA 4KQ2A 4FTWA 1W0KD 2DPYA 1YB5A 1YZKA 1W36B 3H2JA 3R20A 4Q37A 2Z04A 4H7IA 4AJOA 5D6NA 1JQAA 2K6GA 2XIJA 4KXMA 4EVQA 2B4YA 3KT0A 4BFTA 5D5QA 1MB0A 2H0RA 1QYIA 1II0A 4LVUA 4W5NA 3L7AA 2ZI5A 4HG2A 2C2XA 4RHFA 3PK0A 5EERA 1O95C 5EHNA 1E60A 3T4PA 2QV0A 5HM6A 2WJGA 5FO1A 4LAFA 3CVXA 1Y6FA 3R40A 4JCCA 4UPVA 3DLAA 3CHYA 4HLQB 2IKQA 3HC7A 4IM7A 3WJAA 3HN7A 2YXBA 2R7MA 3A7DA 3GHYA 3I01A 3BK2A 4NMLA 4N39A 3M4NA 1P0IA 3DCJA 1Q0ZA 1WY5A 1RI2A 1D2NA 4AX4A 2IPLA 1RZ3A 4GKVA 3G0BA 1AQJA 4REQA 3HK2A 3O38A 3SF8A 3C41J 5K20A 1D2MA 1QFZA 2GPTA 4IQ0A 4JUFA 3F8WA 1XLTA 1V25A 2XQGA 4G25A 5E2AA 4D4MA 4XOIA 2PIAA 3TCNA 1T34A 1YB2A 3H11B 1CUFA 3L93A 2GBLA 3G8AA 4DF3A 1X87A 5IC6A 1SXPA 2W6QA 3CW9A 3H04A 3PR3A 1T2EA 4XPZA 2AFIB 3VSEA 3LWZA 1XZPA 2ORWA 3HZHA 5A9TA 4AK9A 2WWYA 1W25A 1DAFA 4HLUA 2Q6KA 4B5LA 4WAUA 4I3HA 1U6JA 4FT2A 2XOEA 4DIEA 4KQKA 2F64A 2Z9DA 4J4TA 1C8KA 4P5DA 4BQFA 3THXA 1XP5A 4A26A 3NGMA 4HYYA 1EFLA 5FTLA 3ZVMA 3AY3A 2KJQA 1FIUA 3PJGA 3TZCA 4JI6B 3OEWA 3B36A 2W11A 1JQJC 1DJPA 2HRCA 2WIKA 2CLHB 4E2XA 3F3MA 4GGMX 4N9WA 1EFTA 1A2KC 1GCIA 3T1OA 4IIEA 1G8KA 2QUJA 3PHHA 2W2VA 3O26A 4YRIA 4XX1A 3O7MA 2HAEA 4A0HA 2WUDA 3OWXA 3BMQB 4UBOA 3IT2A 2EOAA 4Y9RA 3PUYA 4J16C 1EHIA 4BFVA 4RPIA 4PHTA 1KYYA 2GAIA 3AY0A 1TCCA 2JZNA 2Z8XA 4MRVA 3GH1A 3RNOA 3HKCB 1A82A 2I87A 2TYSB 3WICA 1GZSA 3TIGA 1TIBA 2VK1A 4MO9A 4KX5A 5FQOA 1KDVA 5B64A 4RTOA 4HQOA 6GPBA 2QLLA 1THMA 4DCUA 4OQFA 1CNMA 1E2QA 4WCFB 5K6RA 5LQAA 2E4XA 1T0JB 1UP7A 2GCIA 2UXBB 4S1VA 2QAGB 3MLBA 2Z57A 2X9QA 1YI8A 721PA 3JARA 3KJEA 1JWAB 3AINA 3LGXA 3QMWA 4I66A 4I3FA 4OCZA 2PZMA 3M5PA 3NKFA 4XDGA 5AJYA 3SLRA 5JPCA 1CYEA 3JYLA 1OLSB 3I37X 4R3NA 2FHPA 2WHPB 2Y1GA 3NP7A 3GMTA 4WBSA 1E79A 2PT6A 2ZB8A 4MQEB 3QK7A 5A3QA 2WT4A 1FLNA 2X86A 3NWEA 4X8MA 4BO7A 1N9GB 4LA4A 4KE8A 4P31A 3W2GA 2CDCA 4BRUA 3E81A 2QJFA 1U3CA 5JWOA 1V96A 3K32A 4CF3A 1LV7A 4ZI2A 4RPKA 4EBFA 1AQ6A 2G70A 4ZXPA 4INJA 3KTAB 1WWKA 3RLFA 2G0AA 2GO1A 1ZGJA 2FF7A 3DBLA 1Z39A 3G9XA 4IRXA 4RK0A 5JCJD 2HR1A 1XZFA 4YWHA 3RREA 2ZJ1A 3AEQA 3OU7A 1NXVA 1A04A 2DWQA 1KJWA 1OASA 2WU3A 3G2HA 1NJ8A 3FBTA 3O1LA 5DRYA 4D1YA 5GADl 5TSDA 4RTKA 2BGWA 3I6BA 1RQNA 1Y8RA 2DFDA 3HCAA 2YWHA 3W34A 2I7XA 3GGSA 4FDLA 4MA4A 3VSBA 2OGTA 1GFIA 3ZEIA 1YKSA 4DPKA 3EEQA 5JCOC 4ZHQA 5JVDA 1ODSA 2VYNA 4NL4H 3FPJA 3Q7PA 3ZS9A 2HA7A 1B2RA 1XRSB 3PDHA 5JY6A 2WUEA 4EKEA 5CHYA 1Z5GA 1XL1A 2B20A 2XMBA 3C3BA 1NURA 2OV1A 1R66A 2CF6A 2Q41A 5ADUS 1P4RA 3H3JA 3HNOA 3V2IA 1ZUD1 2PGDA 4QQKA 4WLNA 1KEUA 1DU4A 1NLZA 2WG0A 2FH5B 4LJRA 2JL1A 3DM9B 3SYLA 1NLUA 1L1FA 3SQNA 2VJAA 3K4HA 4G4SP 4QFDA 2L17A 3UJ9A 1K7SN 3IOYA 1WZCA 3MCUA 5F5LA 7ABPA 5B1IA 3A3PA 3LDGA 2DG2A 3QKWA 4Z1OA 4ZC1A 1FS5A 1RHMA 4NZMA 3QVVA 1PR4A 3RS0A 1A95A 3UMJA 1KO1A 4EELA 5BUSA 4WDQA 5IFKA 4OX9B 1QXSA 4KWCA 1J0AA 3VDMA 2Y77A 1Y1QA 1NG1A 5EP3A 2CVQA 4ESVA 3MTQA 1T10A 2QTAA 3AV0B 3UMGA 3NS7A 2P2DA 5K7SA 1E3LA 4L08A 3R3HA 2ET6A 3AR8A 5JRDS 3RAEC 1PD1A 4G67A 1Z25A 2ZJ4A 3BMOA 4WESB 2ZWIA 7AT1A 2B8EA 5AM5A 2BFFA 2EGGA 1DC4A 2VT3A 2FSSA 3C45A 3QXCA 3UXYA 1DC6A 3VR5D 5BN3A 5BSGA 1QPZA 1F3LA 2GSWA 1D5CA 4WZBA 1U7HA 3DE7X 4ZGWA 4NIMA 1MO4A 3D1JA 4JU8A 3GWGA 2WSSA 3BB4A 3MTAA 3U31A 5KYXA 5ICGA 2I1QA 1I0LA 4I1VA 1SXIA 3CCCA 3TIVA 4KUHA 2O0HA 1JLSA 3BD6A 3D8SA 3O2NA 4P3YA 3W5HA 4K40A 3WTBA 3AUTA 5JPIA 1Q1GA 1Y9AA 2I29A 3K5IA 5CJJA 4HOYA 3QX8A 1VLHA 2G1UA 5CD1A 1HRDA 1N2IA 2YQZA 4XDYA 2K2QB 4HB3A 1O58A 3WWYA 4BPBA 1KAHA 2H16A 1RHQA 3Q3EA 4QXAA 3ZZMA 3I5XA 5K0BA 3ZJ5A 4HQRA 5CM9C 2PJRA 1GU1A 4K8OA 1EGHA 2FMXA 2CFTA 3PQ7A 1P1BA 2JCSA 3AU9A 3LQ4A 5FQNA 5K3DA 1CE8A 2KM1A 5AKXA 1N6NA 1ORDA 1QX4A 2C83A 2HMSA 3V55A 3OFVA 5C53B 4NR0A 4JVSB 3SGLA 1R4ZA 2OESA 4L6IA 5CH3A 4KAAA 4ZDWA 3C3EA 5IT9A 2Y0DA 3QPVA 5DCWA 4L4SA 4L02A 3ZV3A 2O5EA 2OC4A 1Q16A 4IQFA 2O2GA 1AZLA 2O8DB 4CKYA 2AD5A 2IHNA 3NIGB 5BN4A 1Q12A 1B16A 4A73A 1NULA 1G8YA 2HRDA 4F4IA 1J0EA 2C5GA 3O21A 1FDWA 3F4KA 3INRA 1PDOA 5IEBA 3VPHA 4D57A 5CLQA 1B0UA 2QYSA 3PWTA 5JAMA 5REQB 1XWFA 3FUWA 1FTGA 3IXMA 2H2WA 2QA5A 1YGYA 4HGOA 4RPLA 4BASA 2O7QA 1R0ZA 3OHPA 4KNWA 1D4AA 4ARZB 5CDTA 3NRBA 2DB3A 2JAWA 4YCCA 1RRPA 3KUDA 4BUZA 1JDTA 1KEEB 1NRXA 3BTOA 4BFLA 5MN5A 3PNLA 4GPZA 2Z8ZA 2PKCA 2QU7A 3KVRA 1FA9A 3TNYA 2GRAA 1EDDA 5J40A 2QI9F 1WXDA 3IBSA 2FP4A 4GPBA 2HZ7A 4KV9A 3OMXA 1JJAA 2G9ZA 4IG9A 4Q48A 2J5KA 4P5PA 2BD0A 3PYXA 5DHAA 4TTJA 5KVCA 2HTEA 3V46A 1NWHA 2NU6B 1PFWA 3OQIA 4LDPA 4QDKA 4C3VA 2PT5A 1WHSB 3FJOA 4ZYZA 5EWLB 2NUTA 1RJGA 1VA4A 3FDIA 3V33A 2NV2B 5GMOA 4BO4A 3GDGA 2ZWVA 2EKZA 4YJ2F 2GARA 3ANLA 4FN4A 1G7SA 1HUQA 1OILA 5A4JA 5C8XA 3K0KA 4E1BA 1BDBA 2I2CA 1B0AA 2WVGA 3HHPA 1X39A 2A5DA 2WWHA 1BCSB 5C51B 1YOVA 1E5DA 1XKXA 2AUMA 2JI8A 3A4TA 3E4CA 1NUSA 3W77A 1GAEO 5B2FA 1KK0A 5L6LB 2QDKA 5SV2A 1BQ3A 3WFJA 4S24A 1Q0QA 2C2KA 2P1ZA 1V8OA 4HGRA 5JSZA 2X4GA 1C80A 3CBQA 4R84A 1M2GA 3THOA 3W90A 1ZMBA 4ACAA 1I3KA 4J1SA 1ZINA 4KODA 1YB4A 1TU0A 5ALEA 5EIBC 1DX6A 4Q6BA 5LU8A 1OT5A 4D6XA 3R6WA 1WKBA 4FCVA 2G25A 2P9BA 3DT8A 4RF4A 1JTFA 4F1WA 3PVSA 3FPAA 3L8CA 2QSZA 2VHTA 2ES4A 1NMXA 4FM9A 3ZU3A 1I4EB 4JITA 1KAMA 2QY6A 4R8MA 3EPHA 1OFHA 1PL0A 5IAJA 1CJMA 2HEIA 2QJTA 2EKLA 2WPDD 4KPUA 4NZPA 5EUCA 3ZVRA 4XASA 1UZLA 4PVCA 5DTEA 3O8DA 4XSHA 1CF9A 1K9SA 2BZSA 4KK3A 2R4TA 2BUBA 1X15A 1E77A 4EEXA 2J0VA 2XE7A 4CVNA 3NOQA 5FA6A 2FWIA 4X3OA 4UD6A 3M1AA 4KQXA 3OQHA 1RLOA 1VLJA 3ZDRA 3BYZA 2Q4DA 4G24A 1OZFA 3ZXUB 1XQXA 4LE1A 1Z28A 2PUTA 1QF9A 1HNZB 3PXXA 1BS9A 2JD0A 4D6YA 5JQWA 4HUTA 5LOVB 5FV4A 3D6FA 3I2FA 3TLMA 1R4MA 1JAHA 3W8RA 2ASEA 2EF1A 3N39C 3VC3A 2J33A 4DM7A 4Q16A 4RHCA 1JVBA 4B76A 5JBQA 1N3LA 3OT1A 3KOMA 2IXDA 2HX1A 4EX6A 2P30A 3M5CA 2W71A 1KZ6A 4RJTA 2UUAB 1Q92A 1FQOA 1CRQA 1S2IA 4MS1A 1SQGA 3DL2A 3ESZA 1LPMA 1U1FA 1Z8DA 2WFLA 1OT3A 2XOKD 4MUIA 5IAKA 3CLTD 1LQTA 1GKKA 1H1DA 1V8FA 3QMPA 4AZ3B 1KI6A 4O4LA 3PTAA 1JKFA 4E1AA 1C0LA 1I0IA 4WXYB 4RULA 3AB7A 4B3RB 3PDIA 1WDLA 2BHSA 2QTCA 1UDXA 2Q0QA 4OB6A 3RYFA 1C1XB 2Z09A 1X3LA 2WB4A 4GPAA 4DREA 2QVZX 1X0VA 1UEJA 2A5JA 3D54D 3ZWVA 1NTRA 2GWRA 3DB2A 3JVUA 4D9HA 1ESCA 1JHZA 3QF7A 4QT0A 4DNOA 5LWHA 1P18A 2OHGA 3L9XA 2KE5A 4Z7JA 4BE9A 5E1OA 2NPFA 1CUBA 4M0EA 1K06A 3U1VA 1W30A 2HHLA 3TINA 1QLHA 2RGEA 1V1RB 4JBWA 5CDGA 1XQWA 3Q5GA 3DLPX 3SQWA 1ZGAA 3BH7A 3VJLA 3AL3A 2QYHA 3MQFA 4G07A 1P0FA 3TW0A 2FJUA 4X66B 1YU9A 2P11A 3IPYA 4WRRA 5K3EA 1XAIA 2F1JA 2ZKLA 3O6VA 4FILA 3IIIA 4GX5A 4WMLA 2G67A 2A9KA 4GBMA 4L8GA 2O05A 2ZSHA 3C6QA 3LDHA 4J2OA 4ZARA 1BX1A 3HCCA 3CNLA 3S8MA 1GTJ1 3UK6A 3KOYA 1F8XA 1N5RA 3OZCA 3X2EA 5JCZA 2PX2A 4BP1A 4CMJA 2W6JA 2X0IA 1TQHA 4MGKR 3KXLA 5LQSA 3TWOA 2PG3A 4GD3Q 4Q4AA 5E38A 3TXXA 3EFBA 4DHWA 1TJYA 4EJSA 2GN4A 3NBZC 1Y42X 3P0HA 4HDAA 5JADA 4MWOA 3T0FA 3K94A 3KZKA 2XUGA 5KVSA 5J4KA 3AONB 4HNHA 1NN0A 4BX3A 4YV2A 1ORRA 5BUZA 1JR3D 2A0KA 3BFPA 5PNTA 4CDRA 2JFQA 3O92A 5C4IA 4UVHA 4CM9D 5I8WA 3P0FA 4XFKA 3TCKA 4BIIA 1V26A 2WF8A 2C20A 1OB5A 1RM0A 3MHPA 3VYWA 5T67A 2R7KA 1J2EA 1VCHA 3IH5A 5G4KB 1L3CA 5I45A 4M4SA 3FNIA 2XXAB 4EI9A 3EZGA 1MMFB 3EGDA 3LVQE 3PVCA 1PFGA 1ZM3A 3KKQA 1NRWA 2O1XA 1RKVA 3LPLA 1N3BA 3HO8A 3E7PA 1S3FA 1CR1A 3ABRB 1MC5A 4MV9A 3GD7A 2A5YB 3MJHA 4PGAA 2ZT8A 4O2BA 3RTCA 4E2FA 1DLJA 1T2FA 3IV9A 3INGA 3RYIA 2C7VA 1YULA 4RA6B 4BB6A 1OH8A 3QIVA 1O3YA 2ZSAA 1E1YA 2AXQA 3TZKA 2QAIA 4YY3B 3QPCA 2DMRA 3X1XA 3VNSA 5E6RB 4R8SA 4EL0A 1DFHA 3V9AA 4CV1A 5AW2A 2FQQA 4LJ8A 3IX7A 4PR0A 2E55A 2VJNA 4P36A 2E18A 1MA0A 4PC3A 1ES9A 2ECKA 2GEJA 1KSFX 2F3TA 2JNWA 5EE5B 4NZOA 3P9SA 4QGAA 4XPIA 4BQNA 2GYYA 3E9ZA 1ULZA 2HK9A 3HRKA 2IDMA 3W3AH 2Q1WA 2C7QA 4H7DA 2VCYA 3L7OA 3PHLA 4JT2A 2FPOA 4PM4A 2QRMA 4FFVA 1ZL0A 5DBGA 3VI3B 5HJEA 3R9XA 1F0YA 2VHUA 3N6XA 4JLUA 4W82A 3O1IC 3HMQA 4GC9A 4LWZA 1SCAA 1X74A 1L8XA 2ZTSA 5F1KA 5THKA 5I51A 4JB0A 2W2KB 3Q11A 3GF4A 1R6XA 2W0SA 2ECOA 2GYWA 2XTZA 3KT6A 3U7HB 2WA1A 2R6AA 5K3FB 3TTVA 3U9LA 3WBJA 4TXLA 1NI3A 3CRRA 1Z5OA 3UC9A 1ZHHA 1G2OA 2GZMA 4UDNA 2DULA 1BAPA 3KE9A 4M88A 1LUAA 4I5DA 1S01A 2BHTA 4H1HA 3TL2A 2GD1O 4WZAE 1EQ2A 1U65A 3BIWA 3QY9A 4CI0B 3RSQA 5CFMA 2ZOSA 1KSJA 3BGOS 4DIDA 4K2AA 2QJWA 1DDGA 5B36A 1T5TA 4GRDA 1SNYA 3FN4A 3HH8A 2ZYAA 2FETA 2Q2VA 5E6UA 4DSUA 5AXDA 2I2FA 2P0AA 5AJZA 1Z0SA 4TKLA 3JQFA 5CEJA 4UNQA 1JPVA 5K51A 3JZIA 3FPHA 4M21A 3X1MA 3O4JA 4I6EA 5PGMA 4L7QA 2C4MA 3L1VA 3NWBA 1M2OA 2GK6A 4MWGA 4B48A 1Y7PA 5FHQA 1COWD 2BP7B 5LUBA 3U5ZB 1MH1A 4HCJA 2GD0A 3IQFA 4O1MA 4A03A 1CIVA 3SE0A 1HM5A 4EKIA 4P86A 4F11A 3ICOA 4BNHA 2BKXA 3EZ6A 4QFBA 4RD1A 3L4KA 3HWRA 3GHHA 4OUDA 4M9CA 3Q8XB 5F7ZA 1PAUA 4CTNA 1DADA 3D8RA 4FNGA 3D2BA 3I9V6 1VBMA 4GLLA 4PGMA 4U9HS 1JLMA 3B48A 3FUXA 4XDZA 5JEEA 1PS0A 4GMXA 4H0NA 4A7PA 4E5DA 1RVV1 1QTIA 2HD4A 5HW0A 1NPYA 2UYQA 4CTJA 5M7EA 1QYDA 2PLFA 2SNIE 3AX6A 1U5BB 3D5EA 3FDFA 1M74A 2BJHA 2ODQA 3M33A 4WI1A 5NLLA 5B57C 4RVNA 3U3ZA 4BCDA 4PC7A 1ZSYA 1DHTA 1M1YB 1FQWA 1QK4A 3IOMA 1SXHA 2X22A 1I0ZA 4Z3DA 4EUHA 1Z29A 1XV5A 2PS9A 4GDMA 4PGHA 1NZDA 2Z1NA 4TTPA 2CKDA 1EFUA 2M6RA 4EEKA 1FX0A 1KZHA 3QUTA 5GP1A 1HOXA 5CHEA 3BMNA 1WKVA 4K1LA 2WHRA 3EJ6A 1QBKC 1N5LA 2EW1A 3UB3A 3U2QA 4P0PB 4LNUB 5EI5A 1U0LA 1UF9A 4N1AA 2ZCJA 1IZ8A 5E1MA 2VPZA 4FCTA 1E0JA 2SECE 2F6RA 4G86A 4XX0B 5CT6A 1BXRA 5DI3A 4ZD6A 1IULA 4PHCA 1PGPA 5FL7D 4E12A 2Y0PA 2Y1OA 4KSBA 1L5OA 1E9EA 3N2IA 2PN1A 1CF2O 4OQZA 3NHLA 3FTPA 1X1RA 2BJWA 2OSVA 3CISA 2XNSA 2B6NA 4DA4A 1ZICA 1UBOS 2XCQA 1C0PA 3O4FA 4TMVA 5JI3E 3IEMA 2IH4A 3CR3C 1KR5A 1KPGA 4FINA 4FX2A 1OREA 2ZT6A 5FPQA 4F2PA 2O20A 5K09A 5BW6B 3F9CA 2MYPA 1OXXK 2R68A 4ZQGA 3A6FA 3EIUA 4BGUA 3PPVA 1JQBA 3L1KA 3WLKX 3JQBC 3DMDA 2J46A 3ONWA 4IAOA 4I8XA 2GMWA 3UT5B 4WKPA 1LBQA 4D2IA 1AF4A 1WSAA 2XCOA 3RVPA 2IBTA 4WCDA 1FBNA 4FGUA 4EA8A 2P8JA 4I1SA 1IK6A 4KIUA 3ZCSA 3OJFA 5BR8B 4A0GA 1OXSC 4QYXA 3L8EA 2HK7A 3QVXA 2V98A 3H1GA 2W6MA 1N2CA 3GJTA 1KGDA 3S99A 2IPNA 1EXDA 5TPWA 1JKIA 4QJ5A 1SKYE 1Z62A 1X70A 3ENQA 4J76A 1NC1A 2Q5EA 5KNDH 4FGLA 3ZCTA 2CHGA 1GXSB 1NHGA 1O5TA 3Q6MA 1GTSA 1V9CA 4HFJA 4HB4A 3CTPA 1YWGO 2KI5A 1Z4NA 4GBGA 3KETA 5J5CA 1H6AA 4OAQA 4OLHA 3QFHA 1XDBA 3VKFA 4AMUA 1Q0PA 1QS0B 3ELDA 4PQGA 2YYYA 2ZTHA 2ATIA 5FBQB 2OCLA 4QEDA 3UWMA 2NX2A 3RK1A 2JGNA 1JDVA 1RJEA 1X92A 2IELA 4Q1CA 1L7MA 2HPVA 5FPTA 1I2BA 4FNOA 4RANA 4WLVA 4YCLA 3VO1A 3NBKA 4K86A 2GM4A 3FTDA 1X2BA 2LUOA 2XKAA 2JFVA 3JQDA 4RESA 1Q0TA 1PJAA 1NIJA 5LBIA 2WKRA 2J30A 3DZBA 4ROTA 4ZMRA 1J2UA 2RG1A 1DAHA 2J7PD 3COPA 3L4EA 4YNBA 5H3HA 3VHXA 5K01A 4ZN6A 4V38A 2ZZMA 2ID9A 3AP1A 1QZTA 1CUXA 1CEXA 1PKXA 2PSEA 4K8RB 3RUIA 4B73A 5IJWA 2D0PB 1PFYA 4ALKA 2VLIA 1PHPA 1HYGA 3U0VA 2BC9A 4EAAA 1PUJA 3NHRA 2JDIA 3OKPA 2B4RO 3D3QA 3EXEA 1WVIA 4WJKB 1M1NB 4LMPA 5JQGA 3URMA 2YYZA 2D7DA 2HI0A 1ZEJA 2H52A 2HBYA 2JBAB 3SDSA 4LQ4A 2WZCA 1JSLA 2YMQA 2E4VA 3NYIA 4OJTA 5ALQA 2VAWA 2VUHB 5COAA 2YXNA 3HVHA 2DTDA 1V5GA 4GLJA 2REQB 4MUJA 3VU9A 1AUXA 1JZTA 4P93A 4B4VA 5LYJF 1GRNA 2XBLA 3F3YA 2IZ0A 4F1JA 2SKCA 3IUYA 4KFRA 3QLJA 2UXDB 3OECA 5FAKA 3D6MA 1PO7A 1JHMA 5CT8A 1NLFA 3USZA 3P2JA 1GAXA 2A1TR 1YRLA 5DLYA 3DFUA 2K5UA 3UJBA 3ZR4B 2A57A 3ZVLA 4B9AA 5IM4A 1UBLS 4YAUA 1VOTA 3ABIA 1CX9B 1DXQA 3ELUA 2OCGA 2P2LA 1WMDA 3IDSA 1JHQA 4J03A 3VH4A 3PYMA 4QBKA 1QLJA 4QDZA 2QUHA 5DHTA 3ZWKA 4DUGA 3W5VA 1NT2A 2XCTB 3RVKA 2QQEA 3GOQA 2P69A 4L5BA 4O2AA 4YRFA 2VTBA 4U2DA 2QUBA 4Y8VA 1JLKA 1T9GS 5FOUA 4JEHA 3D6UA 1TF2A 5IF3A 2XZTA 1E6MA 1WPXA 4Q7LA 4J4BA 1P4JA 3YASA 1N5IA 2EZ4A 3LY7A 4TYNA 1TDJA 5KNCH 4ZOBA 5DDIP 1I4WA 3VDRA 2OT3B 4Q00A 1F8UA 1E64A 3BB1A 5JNLA 2ZRAA 3B1YA 4K9RA 2WQZA 2MCFA 2AFHA 3GUHA 4WN3A 4D02A 2QMEA 2PKYX 2Z2JA 4E13A 5JBNA 4TUYF 1P2TA 5HJ2A 3DE2X 2Y1XA 1GNPA 3LRTA 1XCMA 2F90A 4UXHA 3SZMA 3PU6A 5CH8A 3J7AC 2COUA 1VDZA 3K3PA 2C84A 4HBZA 4HLCA 3UB4A 4CUKA 1U4NA 2HCTA 2JH3A 2Z2YA 3AR3A 2FWMX 3QE0A 4QQ8A 3ZCUA 3KEOA 3OLQA 5TXGA 1YZGA 1GRCA 2VDWB 4TKZA 2C7RA 5AVJA 4II2A 2WTUA 1AY0A 4F9FA 4ALLA 2O8FB 1M5TA 1O96A 4NK5A 5A4FS 4WJZA 2HN9A 1EX9A 4MJLA 4WHMA 3S55A 3DDSA 1NRIA 2P79A 1SXJB 2BLNA 2YHSA 2JCBA 2R97A 4JWTA 3VFDA 5KDOA 1E1MA 3QE3A 1KH1A 4BB5A 3PQ5A 3V48A 3OKAA 1U0OC 3Q8WA 4QQNA 4PPFA 3KTFA 1IQUA 1NMSA 3N0WA 3H4MA 3KCNA 4H16A 2HV8A 2A4MA 1EK0A 2RH4A 3TQIA 4P34A 1ABEA 5LMZA 3EK2A 1TGVA 1L5MA 2PGOA 4FFNA 4WECA 5SY6A 3V4SA 4FWTA 2F8MA 4UXJA 3EA5A 1NYTA 2C3UA 2MINA 4ZU1X 3ZUPA 2UYCA 1ETUA 1QQBA 3AL2A 1JAIA 3U37A 4I9GA 4P35A 1C2TA 1T4MA 2H2DA 3CE6A 5DNWA 3SXPA 4EYEA 1FP4B 5HK9A 3L40A 2AXPA 2WWIA 3BGVA 1OC4A 1X7ZA 3CG4A 1E3DA 3FG9A 4FHZA 4X20B 1UM9B 3TGWA 1EEHA 3RNLA 2O5RA 4MR7B 1QNLA 4A16A 4CIDA 4JXZA 1I5EA 4MNTA 4C5BA 2NT4A 1RWVA 2F9MA 3EWAA 4GLOA 6CHYA 3BCUA 4OHBA 5DF1A 1EYZA 3RAPR 4FPXA 5KI6A 4X1IA 4N8EA 5T57A 2F55A 4CMAA 1AZSC 2JKYA 2H57A 4K6FA 4JJGA 4RCZA 1U2ZA 2G5CA 4IUDS 3ZI7A 2PRSA 5A04A 5F3WB 1JIQA 4X54A 3I3OA 4CL0A 1OCEA 1K6XA 1R3DA 2AHRA 2VIIA 3DCYA 3HY6A 4MUAA 4NV3A 1V2GA 1S2OA 3CTMA 4H1TA 3EBPA 4C6HA 2OLKA 3F6PA 4QOFA 1FC0A 4E09A 4W1SA 2VUTA 4A8JB 5B55A 1FFGA 4QREA 4XFJA 3GJ4A 2O23A 2V1UA 2E49A 3UV7A 4FOLA 3TYXA 3BULA 4D81A 4GGOA 1ML4A 1XQ9A 4LCJA 5DN6D 2QUZA 1GU7A 3DEAA 1IL0A 1BXGB 4F9EA 3JTMA 3JV7A 3MS7A 2O8CA 2IITA 3D6HA 1DC8A 3PB3A 3JYPA 5D85A 3U4IA 3GZNB 2W2LA 4O4IF 1JUDA 1E1LA 4Q3KA 4XWWA 4U2EA 4PXYA 5FYQA 4RF5A 3EISA 5KX5A 2EG5A 4C1NA 4DNXA 2PAFA 3ZNNA 1Y6JA 2WTBA 4G01B 2BYTA 3MEQA 1U3DA 1OXBB 1Z5PA 4MXDA 5DB4A 1WF3A 4ND2A 1ZAKA 1Z74A 4L2IB 2R60A 3HBLA 5ARCA 4D3XA 4EPWA 5K6AC 4TL9A 4KIFA 4URXR 1JU4A 1MAVA 1OXMA 5TS2A 2ACVA 1JA9A 1Z8FA 2NXCA 4HZGA 2CXOA 4MKHA 4EBBA 1YZHA 2VQFB 3IKTA 1N33B 2GPYA 4CHGA 1HZZC 4TYPA 4ZJZA 1ZW6A 4GOMD 3U4HA 1P5HA 3VOSA 1PFVA 3NAGA 4B32A 4C4YA 1I9GA 2A9QA 4CKEB 3PCXA 1IXYA 2PUVA 3K0CA 1RRFA 5C3MA 2QG9A 4ZOAA 4L85A 2WHQA 4WNAB 2QROA 2UZ0A 3JR7A 1LSUA 3DHWC 4FU0A 3GJ5A 2DHEA 1YBMA 5ITSA 1VCIA 4DCVA 2QUIA 2IYXA 2OO7A 3GGDA 4JI5B 5KJFA 1QYVA 1L4GA 3GGGA 2AFVA 1X80B 2FPPB 4QECA 3UGTA 1AUQA 1X8KA 4G0ZA 1XVTA 1Y8ZA 3PICA 1FYEA 2Z5GA 5JZBA 4Z4IA 4BNLA 1V8ZA 2QPLA 2XQKA 2XJ4A 5ALOA 4BX9A 4RTNA 1QG2A 4RUKA 3K73O 1FSSA 3Q0TA 3ZBTA 2BHRA 2O2EA 1XALA 3MMSA 4JLSA 4LX0A 2Q4OA 2HO4A 2MSCB 2F8SA 5LB4A 1LTHR 3HYNA 5J4VA 4E94A 2CLEB 4HGPA 3S81A 1HY3A 1C0KA 1GPUA 2PL5A 3PNKA 4DWOA 3GLIA 3JQAA 3KLNA 3X2FA 1ZN9A 5BWBA 1H5UA 2E5WA 2ORYA 4Y1RB 2HWUA 1JE1A 3T38A 3WWOA 1TFUA 2XUFA 3M3PA 4GKBA 4JP2A 2HA6A 2O9JA 3EPLA 5THQA 3UK2A 4KGVA 4FVTA 2DPMA 2IJGX 1YR7A 1U8TA 2Z43A 1GRQA 1XDWA 1ZWLA 3UCXA 3VO9A 5JH7A 3KVVA 2YWDA 3AOEA 1T9KA 5AICA 4H77A 4R0NA 1VKHA 1YZFA 3OUTA 1KMIY 5KYUA 4V1CB 4IIDA 3OEHD 1S4QA 1P61B 2GEFA 2JAHA 3OOWA 4JKYA 4MRMA 4XJXA 2EX0A 3BXHA 4IVRA 4ZVVA 4DJDC 2BFAA 5J4HA 4RA9A 3FUVA 2WUFA 5EE1A 5J5AA 3WL8A 1K5GA 3A06A 2R3SA 3GUUA 4B2YA 1G3UA 3NI2A 4WK4B 1JYFA 3KKMA 5FBVB 1IB6A 1ZH2A 4CEHA 2W70A 2G72A 3EULA 4FFLA 4OMFG 4RH0A 2J5BA 5L3QB 4PBSA 4NZNA 1AKMA 1Y5MA 1K27A 3BSFA 3OZXA 3VZRA 4FNMA 4YAIA 4R05A 4PTLA 1D0IA 4GMHA 4JQZA 1XJWA 6NULA 2OCBA 3LV8A 3N6VA 5DGTA 3G8CA 1ZA1A 4ZVTA 1OHHA 4RMGA 3JQCA 4BNTA 1WUHS 5B53A 4XOUA 4C08A 4RTQA 2QZPA 4KR0A 1CZNA 2RAVA 3QLVC 3SR4A 5F9FA 4Q5IA 5AM4A 1AZTA 4MVJE 5J2UB 2X7JA 4L3VA 3KYDA 4GVXA 4AP6A 2KHZA 1IOVA 4ZFNA 2AMJA 1IDOA 3N7UA 1I7DA 1VE3A 1H65A 1Q19A 2D1TA 5HTOA 5AIBA 3W79A 1DIGA 1H2FA 1KEKA 1Z0FA 4N12A 5K0CA 1NX9A 1O9HA 1ZR2A 2MMGA 1MF7A 2GX6A 3B52X 4HDKB 4NDZA 4P38A 4X84A 1CNFA 1DG1G 4GGPA 2JZOA 3A37A 4YMUA 5BVGA 1OBVA 4C0KA 1YAHA 2LRHA 2J87A 2VRCA 3FMFA 2RAPA 4KXYA 3A7EA 4H6XA 1RMTA 2JLVA 1PNRA 1I6LA 1TLFA 3P2OA 4E5KA 5BQ3A 4C3OB 1NZFA 2XYVA 3KSDO 2BT4A 1DE0A 1NW8A 4UUOA 3KLPX 2VAMA 3GA5A 2A7XA 3GNSA 4N7RA 5B3LA 1TEZA 2O3JA 1O7JA 2MDTA 2YC2C 2VH2A 1Z2EA 1TA9A 4TMKA 4MWCA 4AY6A 3F6EX 2G07A 5BN5A 3EB9A 3L07A 4YCBA 3D4IA 3G1TA 3HYTA 4IZIA 3LSYA 5F23A 1PFKA 1F3OA 3SJCA 1NI5A 2B0JA 3TRDA 4B4UA 4UNRA 2B4AA 4ZEOA 2C98A 2F1KA 3V6LA 2Q8PA 2WJYA 5DTMA 1ZISA 3WLFA 4ACBA 2AUNA 3EUWA 1Q11A 4WN9A 5JECA 1QZXA 3FWPA 4L8WB 5ALPA 4G0QA 1V6CA 2PZEA 3DDOA 5JD5A 2NYRA 2OC9A 3C5VA 4F04A 1QAQA 2ZAOA 4MUBA 1R6TA 2DFNA 3G1UA 5JLAA 4AJEA 3WP1B 2CY0A 2Q5HA 4R9RA 1FU7A 5ALLA 4Q03A 2C5EA 1JG1A 1XCOA 1WV1A 2YFYA 4PINA 4Y6RA 2AC2A 4YJGB 5GONF 1NW6A 2HHCA 2DX7A 2Y4NA 1SU4A 3T5AA 1YBFA 4RVFA 4J0JA 2A86A 1DINA 5CLLA 3QJYA 4CN9A 4A5SA 3FHTA 1M2KA 2A9RA 4JT9A 3ZD7A 3L7IA 2RJOA 4J7AA 3MGGA 1M6EX 3PBKA 5T8KA 821PA 1PYOA 3IQEA 2APJA 4S35A 4IUYA 2VZLA 1UXIA 3K0FA 5EJEA 2ZM5A 1X7HA 3DZ8A 1XKLA 1TYAE 4BO0A 1QC5B 3AUSA 2AJCA 2GCOB 1HEIA 5B1DA 1APBA 4Q4HA 2NO4A 4Z8XA 1P1FA 3B6EA 3EXFB 2JFFA 3D3NA 1J00A 3H99A 1P8JA 2ZSBA 4N40A 4XRRA 3WHLA 4AWBA 2QTNA 1HX7A 2ZSUA 1SOAA 2HC9A 4DSZA 4EQZA 3ZDAA 5DE3A 2B37A 1QZUA 2PZKA 3QITA 1S2LA 3FPCA 3Q3CA 1GOTA 3ZJ4A 2VA8A 4B4WA 4EG5A 2B1RA 4YXWA 2WM9B 5T5QA 3VPXA 4YRSA 3BDIA 4J1QA 3R3VA 5I5EA 3T1TA 5TGTA 4BLUA 2A1UB 1ORTA 1KO7A 3RRFA 2VPXA 3QH4A 4NI5A 3GJXC 3G17A 3OMLA 1FRZA 5GJCA 4B6OA 2DLCX 3LGAA 1EBBA 4KQCA 4X6UA 3IHLA 2JI6A 1KRWA 1U2EA 5AOVA 4ZYYA 4ZOEA 1SC6A 2Y76A 3L77A 3MW8A 1JSRA 3PHJA 4LJ4A 1E1CA 4NESA 1KBZA 3RVSA 1XF9A 3S5UA 1Z6XA 2YV3A 5FTWA 3ZG6A 3P0RA 4QA9A 3KSRA 4YJ2B 4FYVA 2W00A 3O0TA 1XVAA 4I4LA 3PNQA 1II8A 4ZA2A 5T7BA 2O6LA 1FW8A 4OYLA 4QBFA 1KDYA 3FCOA 3HXLA 4MS4B 3AGQA 13PKA 3IPAA 3T7KA 2QE7A 1TL7C 4J9UE 2AJLI 1OKKA 3KCQA 1PUXA 3TQCA 4DSTA 1YK0A 1GL9B 2X19A 4XGQA 3IPXA 4P98A 4OIMA 3RC1A 2PIDA 3D4OA 3NXKA 5I9SA 2XVYA 3VAAA 3VZDA 1VIDA 4IFBA 4E2ZA 1NW9B 4MAAA 3IAEA 4EVIA 3NHKA 1YCDA 1HEUA 2OAP1 1HO3A 4NPCA 5D51S 1VMDA 1T6NA 1J7JA 4PY2A 1TQ8A 4EPYA 1XAHA 4PYJA 5BXQC 2V8BA 3MWGA 4BNJA 4XWAA 1MGOA 5BSMA 1XTUA 2PFKA 4HZUB 4DCTA 1DQYA 1UMKA 3ANMA 3NQ41 4DUPA 5CEFA 1JDSA 2J45A 4AO6A 5D5HA 2C2YA 3OPNA 4J49A 4TRMA 2BTQB 4LI3X 4B84A 1S02A 4DN6A 1QIGA 5EGSA 3OQOA 1A7UA 4NYIR 4C7BA 1Z7GA 1KJQA 3AF0A 3GLQA 4OI4A 2GD6A 3JQEA 2JGEA 3HZZA 2HK8A 5BNFA 3OFND 2BL4A 2XX3A 4FX5A 4KZPA 3CLSC 4CLXA 1N5DA 1ICIA 2G5GX 3SCZA 3IEIA 1I3CA 1MVOA 1MV8A 1ZOOA 3PITA 3WIEA 1X1CA 3KKKA 4G1FA 3C3PA 3M6IA 4Z0HO 3USCS 4MJ7A 3AHGA 3SKYA 3LF2A 4FYJA 3HU5A 2BFWA 4ZCRA 5AVVA 4HTAA 3OTOB 3A14A 5ARBA 1T5BA 2R00A 3MAAC 1JW9B 3GLGA 3TLXA 3QXHA 3H5NA 4JT4A 3HZRA 4IDHA 3FTCA 3GB9A 3AERA 2NU7A 4WXEA 3WRXC 4LISA 5FWYB 5C8DA 3DKIA 2X1VA 4RLSA 3QFCA 4A0FA 4IIXA 1J5PA 5L3RA 2P27A 4FYMA 4ENUA 4IXTA 3ZIDA 2GXUA 2DQSA 1CQWA 2OHVA 4HB2A 1D2EA 1OX6A 1GRRA 2VXOA 3ITDA 3Q7SA 1GPJA 3OQJA 1OLUB 4L0CA 2IDKA 3N86A 3T3IA 2WMNB 3BM5A 1D2GA 4QG3A 2C4TA 1K3UB 2I34A 2JFXA 2ODAA 2I6TA 1OGJA 2N46A 3COZA 4Q0MA 2GTIA 3AUUA 5AVOA 2X7HA 2EEPA 4JUBA 2N0SA 1IZYA 5C32A 1RWWA 4J1NA 1C14A 1RS0A 4GYKA 3LY9A 4TX1A 2P9TA 2IZ6A 2JLSA 3HMKA 1WMEA 5BWLA 1CY4A 4HXGA 1TEHA 2YVQA 4X00A 3ZE2B 1ZNYA 3SXUA 2OENG 4DR7B 4KLAA 4BP9A 1E2LA 2DFTA 3B3FA 2WIFA 3CPHA 4MQBA 4ZO4A 1P6QA 3ETLA 1T1GA 4X1OA 3SBXA 1XAJA 2HNKA 2NW6A 3ROFA 3MAJA 5K8IA 3LUHA 3SIXA 1GA1A 4LIPD 5C5EA 1G8SA 5G2OA 1ZY2A 1GZ5A 3O2SB 2G76A 1F2DA 5KTSA 3WYDA 2K2WA 1HOTA 2P6NA 4X64B 1M2JA 3TR6A 4D7AA 3M89A 5LIRA 2R86A 1SEVA 4IHAA 1WU8A 2IV2X 5EZ6B 3SQOA 3ZDDA 1DJMA 2V7VA 3SU8A 4L15A 3VDQA 2CLKB 3V4VB 5AR1A 3D0OA 1SBTA 2ZPUA 4LZWA 1IAVA 1RSZA 1J09A 2JHCA 2RJ3A 3HTXA 3LQQA 4ZYWA 4WLOA 5AW1A 1VPWA 2V9ZA 4GMFA 4P0QB 2GFQA 1KBOA 1PX2A 2Q45A 4G26A 4D8YA 2UUCB 1AKVA 3A2KA 1EJ6A 4R2WA 5P21A 3ZHXA 4ZV7A 2ECQA 1O4VA 3PFBA 3PGXA 1A5BB 3HCFA 3ACDA 2QV7A 3CZMA 3CPEA 2I33A 3JQPA 3PPYA 3KUCA 2MMCA 2PMKA 3WSVA 2EFYA 2HOQA 2PVSA 2ZP1A 3ND7A 4NH0A 1JLLA 2AW5A 1OE0A 2ZRLA 1P1KA 3BWVA 4X7MA 4KDRA 4CHTA 2W6ID 1KP2A 1YRQA 3D2AA 1D1SA 3V7WA 3L0PA 1WQ1R 3DS8A 4JJKA 3EIWA 4NPAA 4TV9F 4MIEA 4N7JA 2X8AA 2L2QA 3GA7A 5CB8A 3R3WA 4FFBA 1LF0A 1NP3A 2IEIA 5DLDA 5T6BA 1TZMA 1A5SB 4NU6A 5E4FA 1C81A 4LV5B 4OGWA 1K88A 3LQKA 3Q0EA 1RRGA 4KWTA 4KR6A 2FPIA 1IWBB 2GXAA 3RADC 2F2TA 1BROA 2F62A 5WRFA 1MJFA 1ORIA 1JN0A 1POXA 2PCJA 3AFGA 3LL7A 1RYFA 3OH8A 4JDPA 2WDZA 3NDRA 1T91A 5I8ZA 3T0GA 4AURA 1Z6YA 4M76B 3KKZA 2JVKA 4LDQA 4XIFA 3LPMA 2NO0A 4OGKA 1JL3A 3A6DA 2Z3ZA 4ETIA 2TECE 4JLDA 4CF4A 2ZYVX 4EZIA 2NYVA 4MKXA 4XCVA 1E6WA 2I6UA 3SKXA 2OV2A 3HB5X 3D8TA 4ZZ3A 1GTRA 2GEUA 2WW8A 5AJUA 4URZR 1IZ7A 2C7BA 2JA1A 4TL6A 4B3GA 4V0SA 3HFRA 4RX1A 1REQA 4V02A 1YRYE 4G5SA 3ZVNA 1C8BA 1BO6A 3BE8A 1QGAA 1W52X 2ODTX 4HJRA 2PJDA 4FIDA 4KOEC 2ZSEA 4TYYA 5KTOA 2Y71A 4E88A 3LSTA 1X7WB 2CJWA 3K35A 4OH1A 3DFIA 3QU9A 1UXOA 5ES4B 2H31A 3RTEA 4C03A 3K6SB 5HS6A 1RHKA 1SVOA 1NVKA 4X24A 4YJFA 4RS3A 1WKCA 2QENA 4YCDA 4N5IX 3ZY4A 4JB8A 4NYJR 2FOXA 3UAOA 3LCCA 5CPFA 1BHSA 2NZYA 3I39X 1NM5A 3A1NA 3ANNA 2OV4A 1IOWA 4K5QA 1ZZEA 5T3UA 4DEVA 1QH9A 3D1LA 3PNOA 1RKBA 3JQ9C 4GYYA 3W6OA 4W7HA 2ZE8A 2VP4A 3WGZA 1IJEA 1NQUA 1NUAA 2XI4A 1M34E 1O08A 3I5AA 3ROXA 4BO9A 5KPDA 4HDNB 3NC4A 4X91A 2JGMA 2XD4A 2WU8A 3MBKA 1QHEA 4BNVA 3O0DA 5L53A 2IFTA 4WKCA 5HKKD 2UVPA 1RXEA 2BTOA 4ZAVA 5BNWA 2WJPA 2OFFA 1NOIA 2YVLA 3HWX1 3BXXA 3ZLBA 2VJOA 3IDZA 4RKQA 3ZW8A 3VA7A 3D8UA 4KN8A 4LJ5A 3SHTA 4XUEA 1KIAA 4PS0A 4P32A 1E8MA 3G9TA 4XIIA 1KDRA 1KZ7B 1JS1X 1IYZA 4J0IA 4RFVA 3KXDA 4Z9XA 1U0EA 4Q7QA 1WMAA 3B5JA 3P45A 2K4MA 5JD4A 4EDFA 3L84A 3ZDYB 1FK8A 4MI6A 1P9RA 3H3FA 4EPTA 2UZ1A 2WAOA 1NUHA 2YJ3A 1RLUA 4UUPA 3RC8A 5LA6B 4ARCA 2V3VA 1FXSA 5A0TA 4GU5A 2P7HA 2NTYC 4ZCQA 1NY5A 2PBLA 5IKXA 1E3TA 1MGPA 4JHXA 4QDJA 2F43B 1MAUA 2OCIA 4NAHA 5ELXA 3U4MA 4HX5A 3I8SA 4NCHA 3SSMA 2P67A 1OAKA 3MWDB 3TL3A 2E21A 3OOJA 1LRJA 3VO2A 3TR0A 4C78A 4DIMA 2JG3A 5IKOA 4TXHA 3N74A 3E3AA 4R5MA 5HRUA 1BW9B 2PA0A 4K6HA 4KAFA 3GRVA 4LSMA 2GHTA 1MBZA 3OE7D 5G53C 3TQHA 3MQ4A 1STOA 3A6HA 1XHEA 3BB3A 3ME5A 4H18A 1VG0B 4AY2A 5ALSA 1PG5A 5IZCA 1WIWA 3KSAC 2O5VA 9LDTA 3AR2A 1XKTA 2YIVX 1CG6A 3SBDA 4R4JA 4M89A 2OTCA 3TSOA 3UHJA 3ETJA 3LVBA 1U3GA 4TLDA 5HZGA 4AUNA 1Z7YA 5IFLA 3B70A 3EG9B 2X0NA 1SOUA 1OI7A 2JKZA 5GY7A 1WABA 1DKUA 4D9MA 2R00C 1U4SA 3IUSA 4ERXA 5KWVA 4WFIA 4GFDA 4FE3A 4FYXA 4RHUA 5KTNA 2NNWB 2ZM6B 5AT1A 4OB8A 1YDHA 5KKCA 1QRSA 4G1BA 1TUBB 3AKCA 3TSZA 4NX2A 5IX8A 1Z56C 2JJ1D 4JYPA 1SKQA 1WZIA 2I1VB 5LUAA 4BGIA 2O2YA 2P91A 4DXDA 3IP9A 2OMEA 1DOHA 5C1DA 1N2ZA 5A1TA 1T9ZA 1GPNA 1CUIA 2WFZA 3FCXA 4LBWA 4RWZA 2YQ4A 4M1EA 4UU0A 5COBA 1G19A 4Z54A 4ZI3A 5IASA 3LQFA 3OPVA 5AD1A 3CS3A 3R5SA 1L5LA 1GTZA 4P3PA 1ZMXA 4DADA 3A26A 4EQ6A 2OORC 4CKZA 4Q7KA 4KSYA 2YX1A 1IPEA 3H2IA 3GGPA 2PGAA 2V6MA 4HSGA 5IU6A 3GD5A 3ICCA 4ZO8A 2IA5A 3JVVA 3T7JA 3W5UA 3E6AA 3AUFA 2DCMA 1BHQ1 1N92A 4O2LA 2O2CA 1YBVA 2W7TA 3BWEA 3ADOA 2V3WA 2X5XA 4H3KB 4RIHA 5DTJA 3VGJA 4MGYR 3WY9A 1Z36A 2AOTA 3WQQA 5BPHA 4Q9HA 2A35A 4EM6A 1PT6A 1DKOA 1RW4A 2PSFA 5C5IA 1ECCA 3F5QA 1KYXA 3KQLA 5FA5A 3U09A 1U2RA 3QEKA 2AB0A 2VKQA 1AHIA 1KY3A 3A6PC 1Y3IA 2OD9A 4IJWA 2FDRA 3MJ4A 1M73E 3OBIA 4M8NE 3GFOA 3LY8A 3WHIA 4HRAA 4JASB 1U0NA 4BUCA 2VPPA 1Q3HA 2ZJAA 4DRXA 5KQRA 2I3DA 1E20A 5ILGA 3N2GA 2FR8A 1X1QA 4ZT2A 4ZCPA 3S1AB 3FNEA 2B8JA 2FX3A 3U9TA 3V2UA 2V1XA 5A5FA 4G85A 4IICA 4P4LA 1KNQA 3H86A 1YV9A 3OF3A 4NABA 3AG6A 3PEWA 1CK4A 4EA7A 1YNOA 2C4VA 5BNTA 3VHQA 3VBEA 5B7QA 3MC1A 1K98A 3PUJA 1JFLA 3UAXA 3UATA 1KHHA 3H2HA 3QYPA 1SUCA 3DYIA 3OESA 3UICA 1JAXA 3HU1A 1DEAA 3AJ9A 3RYCA 4GKAA 2XDWA 2IPAB 4IZHA 4DBVO 2PRYA 3OHSX 1NAIA 2Y1LA 3S6JA 4QWMA 4FZ3A 2XKBA 4Q12A 1CZRA 1NATA 2IHJA 5BV8A 3EXHA 3N5KA 4EY3A 2UKDA 1GGJA 4C7VA 5KOJB 2W0MA 3A1VA 3KEGA 1S6YA 2RFLA 1EK1A 5CAEB 3ZJYA 1XU7A 2VNHA 1FTQA 1NKTA 1ZNXA 1A7AA 2WFMA 4G6ZA 5B3AA 4WKBA 3DTVD 4LG1A 1XLUA 2P35A 7MHTA 2C2OA 2F9LA 4FJ0A 4XB2A 1YC5A 2OBFA 5LYJB 3FOZA 2VYCA 1K89A 4X93A 3JRWA 1QGZA 4BNNA 4P8RA 4YRMA 1VCNA 2H4WA 2C4NA 2VEDA 4KXWA 5BW5A 2H4YA 3QKIA 4WY2A 5D00A 2PUFA 4F45A 1O9GA 2JIPA 1TNDA 3PQDA 1QFMA 5CRIA 3TQTA 3DVAB 4ZCMA 3FKSA 5IAOA 5JS6A 2DFVA 2GO7A 2G1AA 1EAYA 2OOKA 2V5VA 3BWYA 4ZVUA 4KO2S 3E2MA 5DMHA 5IXJA 3VPCA 1XN1A 2VF7A 3HWSA 2DY1A 2OVBA 1DJQA 5B5SA 4CKWB 4DV0B 2GK3A 1G6KA 1TVEA 3UAWA 3I4CA 2UZ3A 4ZRDA 2BKVA 2Y1CA 3RKUA 3HXOA 3MOIA 3N58A 4HYEA 3WQHA 5GIPE 2V74B 2BE9A 4TMWA 3KSBC 2FJPA 3LTEA 1ZVMA 1AGPA 4O63O 3W9BA 4H1WA 2ZI9A 1PR0A 1VRWA 1IEVA 1AX9A 3OEED 4PZAA 5DRTA 1UM8A 1CIPA 3H6HA 4P92A 5GIOE 2EXXA 4CQMD 4OQPA 3DOIA 1IXKA 1NN3A 2VYFA 3AK4A 3RUCA 1K8ZB 4M1WA 2X40A 4ZI5A 5JQGF 2WM3A 2BI4A 2EZ9A 3QXGA 4E5SA 3GNTA 1IHOA 4M3NA 4MVJD 5IARA 4DOMA 3NGLA 4EHDA 2ORIA 2G1PA 1L7OA 5U1PA 3H5WA 5CK5A 2W2TA 1ESZA 3INTA 3AUXA 4OLJA 4V3BA 2E1RA 5DYTA 4AB1A 1QE3A 1EZ4A 1H8HD 1X86B 4JHLA 3ND5A 4L75A 4M1YA 4V0MA 1KP3A 3FHJA 3RC7A 4AAYA 5EJGA 4N0EA 1JQKA 4KXUA 5JZ9A 1L5KA 5CVEA 3ZJTA 1YRWA 5CT4A 4DEYA 1JIIA 1RJ9A 3KE8A 2IZ7A 2KQUA 4UFNA 4Z9BA 4BJ1A 4HV4A 4BJHB 1T0IA 1P1HA 1NSYA 5HMMA 3VISA 3B1WA 1NMYA 2IS1A 1A8UA 1S7GA 1V5WA 4GHWA 4PHFA 5DV9A 1N4AA 3DZHA 16PKA 4J0GA 5HK8A 2DBZA 1E3QA 1ZOSA 3N2YA 4DA7A 1ISSA 3HEBA 3Q5EA 4IINA 3W5IA 4CR6A 4O2AF 5C35A 2EZUA 4IILA 2CFRA 2XHZA 3KLBA 5BSEA 1LF5A 1THGA 3ADPA 5IK2D 3V4PB 3I04M 2YWBA 4Y6OA 4O3MA 1K3TA 3KJFA 1KAOA 4LHXA 4ATNA 2GBIA 3AHFA 4UVGA 3AF1A 3CLTC 4OD0A 5TY0A 2QT9A 4YJKA 3TBHA 3GRKA 1UKEA 4KHPB 2Z4RA 1B41A 1Q0UA 2A9OA 4V0OA 1GG9A 1ZCBA 2PLWA 5G1NA 3Q2OA 5ALFA 3PKIA 3WL4A 3WWPA 4QATA 3B8EA 5L3VA 1QHYA 1LTQA 1QM5A 1UBNA 2OZKA 5ETJA 1M2VB 2RIPA 1ABFA 1RBYA 3GCWA 3GFSA 5DYIA 5D84A 4QAJA 1U80A 1Y37A 2O3SA 5AFSA 4MHTA 2CMKA 5IBCA 3AQ4A 5HJ7A 2FPGB 1MXFA 4L4ZA 4L4XA 4N3NA 4R6XA 4UCWA 4BV2A 4IP0A 2P65A 1MIHA 3I2IA 2MYNA 3BHJA 1TXGA 4BZWA 3C87A 3H11A 5HVNA 2FUEA 5LR6A 4FFPA 2BM8A 5JALA 1HE5A 5JDCC 2CL0X 1QDLB 3I73A 1Q6ZA 1MT0A 2AFIA 4G4IA 2ZR7A 5JXHA 1EGQA 5ALIA 5AH0A 3KKEA 5FAXA 2PUDA 1P2FA 1J1IA 5AK0A 1R4NB 1XD2B 3PC4A 1SUDA 3L41A 4FFWA 4CL3A 1EUCB 3KAJA 4J1TA 2OHIA