3OY2A

Crystal structure of a putative glycosyltransferase from paramecium bursaria chlorella virus ny2a
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
392
structure length
392
Chain Sequence
MKLIIVGAHSSVPSGYGRVMRAIVPRISKAHEVIVFGIHAFGRSVHANIEEFDAQTAEHVRGLNEQGFYYSGLSEFIDVHKPDIVMIYNDPIVIGNYLLAMGKCSHRTKIVLYVDLVSKNIRENLWWIFSHPKVVGVMAMSKCWISDICNYGCKVPINIVSHFVDTKTIYDARKLVGLSEYNDDVLFLNMNRNTARKRLDIYVLAAARFISKYPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAEGAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAFTFFKDEKNRKEYGKRVQDFVKTKPTWDDISSDIIDFFNSLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyltransferase B736L
publication title Crystal structure of a virus-encoded putative glycosyltransferase
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus ny2a
molecule tags Viral protein,transferase
total genus 137
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3oy2A02
3.40.50.11930 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oy2A01
3CUWA 3L79A 4EL0A 1HLFA 3H4IA 3NCHA 3DDWA 2G9RA 1NOKA 3G2NA 3MBOA 1UQTA 2BFWA 4M60A 2BISA 2QN8A 4MI3A 3HBJA 5I45A 3CUVA 2QRHA 3IA7A 1FTQA 4M7PA 1WW2A 1Z8DA 9GPBA 2ACVA 3MSCA 4LDPA 2SKDA 4CDRA 1JIUA 3C4VA 3CUUA 1E1YA 3NP9A 1GFZA 2WTXA 2R68A 1NLMA 4EL5A 2AZDA 5TVGA 2ATIA 3E3NA 1GG8A 3IAAA 4WACA 1NOJA 1FA9A 4NESA 4BQEA 2F3UA 1WV0A 2ZB2A 1XOIA 1Y8ZA 1J39A 2R4UA 4RIIA 2XA1A 4X7MA 1VGVA 4MI9A 2VG8A 3MQFA 3NPAA 2GJ4A 4YUAA 1WV1A 3BD8A 1JIXA 2OFFA 4FZRA 3Q3IA 5GPBA 1SXPA 4REMA 3MT8A 3ZCTA 3MRTA 1L5WA 2XCUA 1NZDA 3RSZA 1JG6A 3PE3A 4AN4A 1Y6GA 2QNBA 5LQDA 1LWOA 1O6CA 4BFCA 3D0RA 2ASVA 3MT7A 3G2LA 3Q3EA 1UZUA 3G2HA 4M83A 3BCSA 1GGNA 2IYFA 4GZ3A 2F3PA 3DZCA 2C9ZA 1C8KA 3NB0A 2F3SA 3CV3A 1FC0A 1YGPA 2JZCA 6GPBA 3T3GA 3D1JA 2X0EA 3QKWA 1IXYA 3TOVA 2PRIA 1RZUA 2C4MA 4Z5XA 4X7PA 1YA6A 1QKJA 5TMDA 2O6LA 3OY7A 1K08A 1P4JA 4NEQA 4EKEA 1NVKA 4L22A 2QN9A 2IEGA 3S2UA 4WHMA 1P2GA 2G9VA 2XMPA 2Q6VA 1XL0A 2GEJA 1P2BA 2GT1A 1LWNA 4F96A 2IUYA 4RIHA 2SKEA 5DLDA 4AMBA 4N39A 2YJNA 2X6QA 4NC9A 4KQMA 3CX4A 1ABBA 4CTNA 3E3OA 3BCRA 2ACWA 1FTYA 1FU7A 4W6QA 2F9FA 2PRJA 1XL1A 3EBOA 3COPA 1QM5A 2JJMA 2QZSA 5DU2A 2XA2A 2QN1A 3BEOA 2PYIA 1L5RA 3NAZA 8GPBA 1XV5A 3T3IA 5TMBA 1EXVA 2QLMA 5IKOA 3SYRA 5JTUA 3VDMA 1IIRA 1P4HA 4RIEA 1H5UA 3G2IA 1XKXA 3L7DA 2QN2A 3BCUA 3G2JA 5DXFA 2QLLA 4F9FA 3EBPA 3CEHA 2ECPA 3SYMA 3HBFA 3OKAA 3BD6A 1K06A 3OTHA 1L5VA 2FFRA 4XI9A 4YI5A 5HXAA 3VUFA 4X6LA 4BQFA 4PQGA 3BDAA 4F97A 3ZCPA 2VSYA 3MRXA 1L5QA 5C1DA 2GPBA 3T5TA 4KQ1A 4GZ6A 2BGTA 3ZCSA 4KQ2A 2XGSA 3RHZA 2VSNA 2IYAA 1C8LA 3GUHA 3DDSA 3AMVA 2GEKA 1B4DA 1C50A 2QN3A 3T3DA 4MI6A 3MS4A 4EJ2A 2QLNA 1RRVA 1WUTA 3CUTA 2R66A 1P29A 2GPNA 2X0DA 3CUYA 2IEIA 4RELA 3QHPA 1FS4A 2AV6A 1FU8A 4AY5A 1KTIA 3MTAA 4AMGA 2X6RA 2G9QA 1NOIA 3OTGA 2PQ6A 3MS2A 4GYYA 3S0JA 2QRMA 3OKCA 2AW3A 4MRAA 1Z6QA 3O3CA 1JEJA 3VUEA 4MHOA 3HBMA 2FF5A 3L7BA 3MRVA 3CEJA 4MICA 1M5RA 1AXRA 3PE4A 1WUYA 1P2DA 2P6PA 2AMVA 1L7XA 3G2KA 5ENZA 3T7DA 3VDNB 3MTBA 1PYGA 1NZFA 4N3AA 1FU4A 1UQUA 3OY2A 1XC7A 2FETA 1L5SA 3WC4A 3ZCUA 1GPAA 1V4VA 2C1XA 3L7CA 4GYWA 3MS7A 2X0FA 2H1HA 2H1FA 1F6DA 2IW1A 3S28A 3TSAA 4AY6A 3L01A 4N3BA 3CEMA 3UYKA 1BX3A 1GPBA 3WAGA 3Q3HA 1F0KA 2IV7A 3T3EA 3H4TA 3S27A 1AHPA 3ZCVA 1L6IA 3E3LA 1E4OA 4RIFA 2C1ZA 2R4TA 3FROA 4HLNA 2XA9A 3WADA 1WW3A 3C4QA 3BD7A 4N9WA 2XGOA 4LEIA 4RENA 3L7AA 1A8IA 2QRQA 3S29A 1JG7A 2XCIA 1PN3A 2GM9A 3NC4A 1GZ5A 1JIVA 3OTIA 4FKZA 3MT9A 3ZCRA 5D00A 4G2TA 4X7RA 1RZVA 2R60A 2XGMA 2JLBA 3RSCA 5JTTA 5BNWA 2QRPA 1Y6FA 1GPYA 3HBNA 4CTMA 3NP7A 4BQIA 3DD1A 1Z6PA 4RIGA 3D0QA 2F3QA 3UYLA 4RBNA 2PYDA 7GPBA 1SXQA 4CTOA 2VCHA 5D01A 2IV3A 4WADA 2HY7A 4GPBA 1PNVA 4XIFA 1C3JA 2G9UA 5TMEA 4EKYA 2BGUA 2VCEA 4GZ5A 1EM6A 3OKPA 4MHSA 4HWGA 2KS6A 5IKPA 2SKCA 3T3HA 1P4GA 2GPAA 1PSWA 2QRGA 3GPBA 3TAXA 1Z62A 4YI3A 3OT5A 3ZCQA 4QLBA 2QN7A 3MTDA 3C48A 4N3CA 1FTWA 3RT1A
chains in the Genus database with same CATH superfamily
1Y8RB 2R44A 4K7JA 4MS1B 1H1TA 2QZJA 3BPSA 4TMTA 3AUTA 1TTPB 1XMVA 2PGIA 5C8DA 1Y0BA 3BCHA 3COYA 4ID9A 3D6HA 5C7YA 1GUZA 2ZUFA 1T91A 3DBLA 1NF2A 4IG4A 2VR1A 5IAGA 3RUIA 3AVQA 2X15A 1DIBA 4L16A 2FR8A 2ZSKA 3FNEA 5FEMA 1I7QB 3GQBA 2Q5CA 3N87A 4TMVA 5B2ZA 3GWZA 4ZQBA 1SC6A 3TQTA 2VQEB 2D0DA 4FGUA 4JB8A 3OOWA 1SIUA 5ECGC 4HG2A 3CVVA 3IHWA 3IKLA 1R88A 1RRMA 3FWPA 3HVHA 3TXAA 1LI7A 1S1CA 3IQWA 3BA1A 3IR7A 4LDPA 2YXPX 4J90A 4OY3A 5FUVA 2G88A 4JVSB 4RZSA 3ZLTA 4OIFA 4CLDA 3HXPA 5TB5A 1ELOA 4UUPA 5KVSA 1N1GA 2X5NA 3LXRA 2OYCA 4L8FA 3RS0A 5K7SA 1SG6A 5IZCA 1G2OA 2JAWA 3KAKA 2AOTB 4BJ5A 3E22A 3ZZ1A 1KQOA 4H7FA 2C5LA 2G82A 4PGHA 4C0JA 1K8QA 5ELXA 1TCUA 1L1RA 5H16A 2ZAIA 4L3VA 1NSYA 4ED9A 1OAKA 2FMUA 1P7WA 2GRJA 4Z4IA 4BEWA 2X0JA 4MVJM 2OZLB 3UUFA 3ZJYA 5EFOA 1F51E 2V54A 2AD1A 3TD9A 2X14A 4HSEA 1V3VA 1UPTA 5EHNA 3NV9A 1SBYA 2A0UA 4R54A 4RHFA 5L3ZA 4HVCA 1J39A 4JXJA 2Q4EA 3FZNA 3TZLA 2QX9A 1E0DA 2A86A 5ENDA 3PSHA 1ONOA 1S01A 3TSCA 2PUCA 3SSMA 3KUCA 2RAPA 1EVEA 1JNXX 3G85A 3SZMA 4Z4GA 1FDOA 2J7PD 3N86A 1O97C 3TLMA 3Q0EA 2GZMA 2CVZA 3DXZA 3HJAA 3USES 5KWJA 1JFRA 1YU9A 2VJPA 1XA3A 3STYA 2Q7OE 5CIQA 1GIAA 2J5KA 2XNKA 1ODLA 3T1YB 1W29A 2C20A 2ALJA 2NZUG 2C5SA 3F7NA 3ISTA 5J58A 4ZTUB 1UBUS 2YVQA 4FXPA 5KYXA 2XF2A 4BRWA 1XRRA 4ER3A 3B70A 2Y1LA 2WM9B 1XMPA 1JU3A 3BAFA 1CVIA 3UMCA 5A5EA 3GV0A 4JYAB 5EXSA 1OPXA 1OV6A 3QYPA 5U4QA 3UC9A 2JI7A 4LJLA 4BPRA 3C6YA 4TTQA 4XSGA 4LFBB 1HE5A 4WKCA 3FNQA 5SY4A 3WO1A 4E51A 3MAJA 5BOSB 4QNRA 2JK0A 2GEFA 4EB8A 3HNPA 4OD0A 3TM4A 5IN4A 3G2LA 1EHYA 1BO6A 3DZBA 3LLCA 2A5JA 4G36A 5AO9A 2BM1A 2JFHA 3S2FA 3THSA 3N9IA 3I1IA 3VH1A 4CWAA 1FZTA 1MAUA 2COKA 2WIKA 1JEYB 3IQIX 4FFDA 2IS6A 3ZLUA 1E59A 2MYNA 4J1TC 2NAPA 4BV9A 1I01A 2DM6A 3U4DA 1C4WA 2EIHA 1E2LA 3C3YA 2EL7A 1EZ4A 4N5IX 1L7PA 1D2NA 4A7PA 3CR3C 4LHVA 1F5SA 1FC0A 1YGPA 3FG9A 3RRXA 4E33A 4ES6A 4YC7A 5GV8A 4G0VA 3EEIA 1NXSA 4CG2A 1U2EA 4HDOB 3NUQA 1YFLA 3U16A 1IK4A 3BS4A 3BJRA 3WOHA 2KQUA 4FCVA 3IDSA 3QKWA 1M83A 5G40A 4PRLA 5KVVA 1SIOA 1IVYA 4IZIA 3LP8A 2JVJA 3ETHA 2XLBA 4ZAGA 3VHLB 4ZKDA 1MJGM 2OMKA 4FFNA 2BMVA 2BGJA 5IJAA 3NH9A 4J9UE 1EFPB 4EI8A 1A4UA 1TF7A 3T5DA 4NOMA 2H85A 3BZBA 3LT2A 2AOUB 2ZE7A 2IYRA 4IWYA 5FQNA 2FUG6 1NN3A 3GFFA 4O4IB 1YBMA 3KZMA 3QEJA 4MROA 1K68A 3K9BA 2NACA 2DPHA 4G5XA 2CBZA 4R9UC 4AQYB 1MW8X 1NRWA 2AC2A 4M8IA 4WA7A 1PJRA 2YY6A 3D3EA 3V8RA 3C5WP 1C3OA 4P3PA 1MDFA 5CEJA 2VCYA 3ET5A 3GNSA 4JA2A 1Q5PA 3M5PA 4JBLA 5EKDA 2F8MA 2BAGA 4XLZA 4OA5A 1XHEA 2O8BA 5K3EA 1KJJA 1OA1A 2XVMA 3AU9A 3C41J 4P83A 3WS7A 1T3TA 3QVJA 1CZUA 5LBUA 4ND2A 3OETA 4YCSA 2D06A 3LUDA 4FX5A 4KJZA 1WQ1R 4U0KA 2WFMA 4LRQA 4QQKA 4XYLA 3S1SA 4IO1A 4P31A 2UUPA 4XB1A 2QA5A 3U49A 1Z4QA 3GAMA 3ODGA 4IOLA 4KNYA 4U4AA 4U7DA 2NXEA 3O2NA 4WESB 4ZV4A 1A95A 4HL6A 1PK9A 4XWYA 2PGLA 3I58A 4RFSA 3R2JA 4UTZA 3R8CA 5NLLA 2PUHA 1R0BA 1U1EA 1DGQA 2JD0A 4A6DA 3BHMA 1CP2A 3W4IA 3COPA 3ONEA 5BSVA 4OJMX 3U40A 3AUXA 3KE8A 3BSSA 3Q7PA 3D8SA 4JL6A 4N54A 3WSWA 4R2KA 3R6DA 4OJNA 5B4UA 1XJWA 5ALPA 1FTSA 2W42A 5KPDA 3G9ZA 2PYIA 3DMNA 2Q5EA 3G68A 1G59A 1FB5A 2LVBA 2XNCA 5E6UA 2GBLA 1I7SB 1I32A 2IH4A 4O2AA 3ADCA 3A9WA 3BERA 2JI6A 2ZBEA 1X9IA 4Q4AB 4XDZA 1VXOA 4WOBA 5TMBA 1PX0A 3FWYA 3DO5A 3KEOA 1XTVA 3O47A 3AFHA 1JAZA 2QZZA 5EY5B 3E9NA 3GVPA 1X74A 5JNTA 1ODKA 3D2LA 1MIOA 3GMIA 4C7JA 2QLBA 3OT1A 1US8A 3NI2A 4K1LA 1XPRA 4RF5A 4NFHA 4YCAA 3D3KA 3HGQA 3ZDRA 3QELB 4I3GA 4QFCA 5AOAA 3FD8A 2XNJA 1HQYE 1HSZA 2CBXA 2C3UA 3QBTA 3WFIA 5L6LB 3MTGA 1DIGA 4ZZ3A 5EIHA 3X1MA 1NR7A 2ZI6A 3GCDA 1Y3HA 4KQIA 4L0MA 4M1SA 3WWDA 4QG7A 1BQ4A 2H8GA 2QMUA 3UOWA 2WSYB 1NVAA 1XR3A 2I3DA 1PL6A 1L7AA 5AOVA 2R5WA 3OTHA 4MAAA 4FPXA 5AHXA 1UKCA 5D1HA 1BEZA 2CNOA 2OCPA 3RKUA 3T3PB 1T9GR 3M6AA 5HCNA 1HMYA 3SFTA 4UARA 4PLWA 1KAQA 3EQ2A 3WZ2A 2IIQA 4Q3NA 1EFVB 5LWHA 5ANRB 5THQA 2IOHA 2W2OA 3UAXA 1Z0IA 1NU6A 3MRXA 4YRQA 5BV0A 3HB9A 1NMEA 1H2XA 4AFNA 3ZVMA 4EQZA 3LIPA 3VVLA 5CGZA 2NT4A 4YV7A 4ZXPA 1STOA 4MUHA 3V8MA 3CW2A 4PS1A 2BP7A 5AHKA 5BOVA 2C83A 2DF8A 3IAXA 1RDFA 2VP5A 4X1KA 3ZGLA 1HOTA 2IGTA 1KFEB 2OV4A 2PXAA 1ZQ9A 4K2HA 3QKIA 2PLNA 4FGJA 1ZVQA 1FYWA 3B3QA 4G4SO 5DI9A 1E1RD 2X9NA 1EHCA 5TT0A 4HEA1 3K0SA 1HDYA 1LY1A 3IERA 4MI6A 5BV8A 2OUKA 1G8MA 1I5EA 2PT9A 2RGNC 3VOBA 3EBLA 2PD6A 1C1YA 2JRLA 2ZDQA 3E4DA 3QUTA 1TPYA 4UU8A 4ZMSA 2QSUA 3E7PA 2ID7A 4QGGA 2O14A 4IX9A 4C2AA 1XRPA 3KTAB 3UKDA 2MSWA 2YOHA 4BNHA 1J56A 2H1IA 3D4BA 3W05A 2AMLA 3CLTD 3DDHA 4CG1A 4F1WA 1UEJA 3T1VA 1NBWB 1O9GA 3N39C 4DLWA 1YZTA 2N1BA 2I29A 1I1NA 1OXXK 4FI3F 4I3HA 6PFKA 5M04A 4IDCA 3ZY4A 1O89A 1E3TA 2IUEA 4XFJA 3PTZA 3ASZA 4A8HA 1U28A 5BMVF 3OTGA 2CJXA 2QTFA 2R6HA 2CFOA 1IL0A 3MFQA 3E7WA 3KC2A 4LYHA 4TS4A 1P1KA 1SZDA 3S0JA 4LFAB 4RA9B 1XQYA 5CU7A 4MO9A 2NSLA 2YC2C 4UEWA 3RHSA 3CZMA 4UNIA 1W94A 1BH6A 3HYTA 1VSVA 4QUIA 3WK6A 3P0IA 5GINE 4QL3A 4WN3A 4I2VA 2ROQA 1Q1EA 1Z5GA 5C4IA 1U6JA 3QTTA 2AA3A 2G0NA 3D6VA 2VYCA 3EG5A 2QL7A 3RBXA 1P2DA 3F5SA 3SYLA 1L5NA 3A4VA 1XF1A 1EFRA 4OGLA 5GAJA 2P6PA 1AVTA 2R6FA 1U2PA 4ZYLA 2OXCA 4FJ1A 1KK1A 2WIAA 4G9BA 5BP7A 3L9XA 4UZEA 3J81k 1Y5IA 3VM6A 4QC2A 5DZSA 2JG3A 3BMCB 5E1BA 1MOQA 1XC7A 4A0SA 5CAEA 1J5EB 1XNRB 2XYRA 1U2GA 1RWQA 3KDSE 1DWQA 1U4OA 1L8LA 3NQ41 3P2EA 1G7TA 1ZLXA 2E4ZA 5T41A 3ZZNA 4KP7A 4DREA 1YFKA 1TKCA 2JI4A 4NVRA 3KHUA 2WT8A 4K6MA 5T6BA 3HP7A 3LSYA 3JZIA 3ZVLA 4FONA 4GOOD 1FJGB 1W0CA 2J09A 4GM1A 1LX7A 1QYRA 2R9VA 2Y8EA 1DEHA 2X9VA 4F91B 2K7FA 2VK2A 3AI2A 4MA4A 1Z38A 4MINA 4QHTA 5G0TA 1BDBA 3CZRA 2A4MA 2IX9A 3HU2A 4TV8A 3QPDA 3PENA 3OLVA 2CVFA 4F6RB 4XJTA 3CUEF 5TC4A 4E31A 2G17A 3S28A 1SAYA 4EHNA 2JGLA 3KG2A 4B46A 4GE3A 5CLFA 4EJSA 1HPLA 5COBA 1ZR4A 1V43A 3ANLA 5DOZA 1VP3A 4UZFA 2GJSA 3UYKA 4YMGA 4O3MA 5DULA 3CJRA 4ONEA 2II6A 4G56A 4KO3S 3FCOA 1R5JA 3E81A 1K6EA 4CKBB 1WUJS 1H5QA 4AQDA 5KTKA 5GIPE 1DXYA 2G83A 4KZKA 3IHLA 1WPXA 2O52A 4YPFA 4JI1B 1OI7A 1L4HA 4OL9A 2FQ1A 6NULA 3OZDA 1X1QA 3ECCA 3LLMA 3ZV7A 2YW9A 1O7JA 2ZYUX 3R7AA 4DDTA 2VH5R 3BGIA 1J06A 4P54A 3UFXB 3AR7A 4DQUA 3IHTA 3KOOA 1UDCA 2YFQA 1EXWA 3SBXA 3FKSD 4Z4EA 1DO2A 1OFTA 5CH5A 1FQJA 3CTPA 3GOHA 3IJ5A 3AU8A 1KEUA 2IXGA 5JWRA 4L7QA 3AERA 1R0XA 4XVUA 5HZKA 4ZWNA 1AOXA 5C7OO 1TF5A 1C1XB 4M1MA 4RVDA 2AXQA 4XIGS 2Z8ZA 1IBSA 2E85A 3N7TA 1ZD8A 2FWMX 1IRIA 2X5KO 4Z49A 5AVQA 2JHPA 2JBAA 1QVZA 3F6YA 1OD6A 3UGQA 4WNAA 3EULA 5HVNA 4UM8B 1RKUA 3CF6R 3RTDA 1T8WA 4EY3A 1VZ2A 2GO1A 1XEXB 5DHQA 1DKRA 1PDVA 3CRMA 3D81A 1TECE 2NXJA 3BMQA 1WMDA 4YRJA 4I08A 5DWVA 4BO0A 4B3GA 3AEUA 3FAKA 4C0BA 2HJSA 4TZ0A 1GVHA 2FPIB 5JVDA 3BFPA 2AZXA 3MMXA 1KL7A 2HSDA 1HG1A 4URUR 4IDDA 5TEVA 2VHQA 4IGKA 1M2NA 2HA5A 2HMUA 3BJZA 4ND1A 1GGJA 2C9OA 5EVCA 5EMLA 5JY6A 3AF0A 3SIRA 3EZ7A 2IC5A 4UAUA 5FTWA 2Q0XA 4DMLA 4OQZA 2OD7A 1NYQA 1UJ5A 1V0JA 2ZUCA 4RIGA 2ID9A 4X97A 4OKIA 1FP6A 2RK4A 1VLZA 3GJZA 3D2CA 2H31A 1N5LA 3NHWA 2D59A 1KJQA 1E3EA 4IGFA 4ILEA 3R74A 3NYWA 3B9QA 5DGHA 1U0RA 2EYQA 2ZSAA 3CONA 4A15A 1I6WA 2Y1OA 4J16A 3SHWA 2Z1DA 2VHYA 2PSDA 1TVKB 5ECWA 3QLEA 5A1JA 2OVBA 4HX5A 4ZT3A 4EHKA 1AUXA 4R8LA 1UBTS 1UDRA 2VDQB 4BMVA 4TTIA 1EM6A 2J3HA 1Y6JA 2K5UA 3F6SA 4E94A 1RMYA 2FQYA 3DLTA 3COWA 4MQLA 5BRJA 4CEJA 1UPUA 5IW8A 3M3DA 1YDFA 2FWPA 4M8NE 2AFHA 2WAAA 2PSSA 1YI8A 5TLSA 1C9KA 4MWDA 2O8DA 1E1DA 3AJ8A 2JLYA 2PLAA 3H99A 2O7RA 2OQRA 3LCVB 3GRRA 3GEIA 2RC5A 2VZ0A 1G4HA 1GN9A 1Z62A 4CLRA 1B6TA 1R50A 2JJ8A 3LPMA 4R7ZA 4YI3A 3WFJA 2BEVA 1JQ3A 3DKRA 3S4YA 1W8DA 4UKDA 4WX2B 2HGSA 2VQSA 3FYSA 3M4YA 4IQFA 3H2HA 4KNVA 3L6CA 5JPIA 4DJ5X 2O1XA 4LF5B 1EDBA 2AUNA 2FEWB 1HLFA 4M6WA 3NHKA 1X7ZB 1TA4A 2GARA 2ZJ0A 1MW9X 1A4XA 5KWVA 2WHQA 3K15A 4JEMA 4BQPA 1Q14A 4KN6A 4EHLA 1CR1A 2OM6A 3F4BA 5LFAA 3EZ6A 4BNFA 1JHUA 2PGJA 4XLTA 3TCKA 2YV2A 4YFYA 1RQ2A 2OESA 2OCKA 3O75A 5FXMA 2BFFB 3IA7A 2SCUA 2QVXX 2DXIA 1G17A 4J75A 2Q6OA 4PC7A 1Y63A 5A5GA 4LF7B 2YWXA 1VMDA 1YFJA 2AE1A 3VKGA 4OI0A 1EK6A 3HSYA 4XFKA 4O8CA 5A6VA 1ZD5A 3WL5A 2AJDA 3WGUA 1PGJA 5IAOA 3I5UA 1E1MA 1NP6A 5KJ1A 3WK9A 3K0CC 3DEYX 3LCMA 1Z12A 1LDNA 5J59A 3UIEA 1SZCA 3BRSA 1VKRA 4YT2A 2C2BA 4Y2GA 3C4VA 4L5YA 1WMBA 2C4KA 4GKVA 4NBTA 5BMVB 4A2WA 1CUYA 1TK9A 4U8HA 1DTWA 4H18A 1JZSA 1PQYA 2FMFA 4YMVA 3IKTA 2QAJA 4YT8A 4CU2A 3KKKA 2VF4X 5DJ5A 2NIPA 1YT5A 2YYSA 5FR1A 3N3AC 3ID6C 2WPDD 4HTAA 5KMGA 4EL5A 1AMUA 1GL9B 1NW9B 2GRAA 1DBIA 3B7GA 1RI2A 3E03A 3L1VA 4UDOA 5K9ZA 1KKMA 1TJ3A 5CDTA 2V1XA 3Q7QA 3S1AA 1KARA 3KFVA 1HWYA 4OH7A 4LYJA 4X85A 4DG9A 1KRXA 2XVXA 2XOKD 3GQVA 3BBLA 1V5EA 2V7EA 1GUBA 1VYTA 1T29A 3KXDA 2WY2D 4NXNB 3EUAA 1VPLA 1YRYE 5ALGA 1GHTA 4G09A 3JQCA 1N1MA 2DFLA 4RDXA 2OCLA 4LJ9A 3WSVA 1KJZA 3JQ6A 1G64A 3RUPA 1G5QA 3BSFA 4C7KA 4YDQA 2E89A 4HMQA 5PNTA 2YUTA 2X0NA 4GMXA 3FTFA 2P4QA 3L6BA 4FDUA 4R4JA 3DZJA 4BX8A 4HDKA 5CG1A 1RHKA 4PZCA 3EGEA 4PG6A 4R2HA 1H2RS 4TMYA 4Y6RA 4D0NA 1V3UA 5J2TA 5AFSA 3RVQA 3N0VA 2HHAA 2XCUA 4D8YA 1JL3A 4Q21A 1BRMA 3VYUB 4BKPA 1FNBA 3EZYA 3M5CA 4UNRA 1LWOA 3ES9A 3O94A 4C4RA 3N0TA 1F0NA 4HDRA 1D2GA 1L4LA 1E92A 1T3HA 4N18A 3SPXA 3KSZO 1JVSA 5TS3A 5LPNA 1E1LA 5K09A 5EOVA 1BVUA 1AT1A 2NU6A 4YIHA 5HZGA 5M3BA 3KZCA 4POAA 8ABPA 1N2HA 1E3DA 3IOCA 4BP1A 2OHVA 5DCYA 3WLKX 3WYEA 4ASUA 2ZKIA 1P1BA 3U2QA 5JQGF 1W36D 2OSVA 2Q5LA 1YB6A 1KTVA 4IJWA 4WSOA 1SCJA 2EX4A 4YV0A 3A6PC 5F9FA 3ANSA 5HF9A 2WU3A 1MGPA 2R6ZA 3QVWA 4C4AA 5CB8A 4GUDA 4M55A 4HWKA 2VUSA 2A5GA 3CKYA 3W0LB 4DA0A 1Z7YA 4ENUA 3WK4A 4PQFA 3UJAA 1J5XA 1ZC3A 4DCTA 2P9CA 3UT6A 1SBCA 1GTSA 1SHZA 2GN4A 1UBMS 1R9JA 1KPHA 1TM5E 1WF6A 3M6XA 4DMKA 3AC0A 4Y9DA 3QX3A 3QKRA 4K9QA 5LLSA 3CNOA 4RV5A 1SHLA 2OWDA 3ZEAA 4EGFA 3HCNA 4UHHA 4GVLA 2C2HA 1IE3A 2QORA 1JBQA 1JHXA 4IMJB 4HCJA 1R8QA 1IXYA 2PT7A 2QF7A 2EZ9A 1VJCA 3GZ4A 4IRUB 2OYRA 3HWSA 1NBAA 4Q4JA 3TPFA 4Z5XA 4DIDA 5AW1A 1KKUA 3PD0A 3EA5A 1ZNXA 4Z6KA 1E6KA 1OVMA 1PLJA 2AKYA 3ZD8A 1BDIA 1NKSA 1NUQA 1ZNYA 1Q50A 1WVMA 3BDVA 2GK4A 3SZ3A 1F9AA 2PKCA 4MWGA 2FSVA 3COZA 4QFBA 1XTSA 3P19A 2P2YA 2QN9A 2XKAA 2PA3A 1A71A 4A0QA 3DHWC 4BNGA 1TAUA 2VJBA 3EIQA 4RTRA 4QT0A 4Q00A 1H8EA 3AEQA 3TRJA 3O3MB 2VDNB 4PG5A 1L7NA 4MRMA 3H97A 2W71A 2GHQA 2ONKA 3QM1A 4J94A 1YL6A 3RU2A 1U9IA 3L8YA 3OT4A 2VDWB 2Q3EA 4I5DA 4OXKA 2P9BA 3TRFA 3W79A 5J5VA 4CCAA 3DYIA 1QVVA 2NU8B 5KYKA 1CE8B 1SVIA 2KE5A 2RHWA 3PXCX 1ABBA 1Z0FA 2X40A 3HHPA 3LYUA 3CRZA 3ZWNA 5E1OA 1CIPA 3BCRA 4PANA 5SYNA 3LQQA 1FU7A 4UU0A 4JI0B 2PX2A 2JGFA 2PZLA 1ENZA 3NALA 5IG2A 1QUEA 2DR3A 4JB3A 1ZXBA 2NZJA 3MCAA 1D9XA 3LYHA 1OT3A 4CIDA 4EHIA 2QKYA 1IZ0A 3K0BA 3NIGB 2D2FA 2EJBA 3CB2A 1V3TA 4G0QA 3JD0A 1KQNA 1KK3A 3W6NA 2J5XA 3SR0A 4F0JA 4ZYUA 2ODPA 2I1WA 4M89A 1YA4A 5B37A 3AVTA 4BO3A 5DU2A 4DCNA 1TT5A 4NATA 1WMFA 3GJYA 2FLVA 4RXMA 2HRQA 3U17A 1B6GA 3PX7A 3ODPA 2XODA 4C05A 3NIWA 4URFA 3VZRA 4OUDA 1QLWA 2CYBA 4JSRA 2CBGA 3EWSA 1NATA 5CFMA 3Q8LA 3DBIA 2XQGA 4K8OA 5TVKA 5E1DA 1CLEA 1YE3A 1P9RA 1W93A 2HF8A 1P5FA 3MYRA 5DNAA 3WK7A 5KSOA 1Y7PA 5LNK1 3D02A 2CJFA 1ODCA 3IUBA 3DO6A 1I5OA 3OICA 2WDPA 3DFMA 3Q7SA 5DISB 4FKMA 3C1AA 5DRTA 5ECDA 1M8JA 3VYWA 1DCKA 1VG0B 4FEAA 4B6GA 4D0GA 3HV0A 3UMMA 4EDHA 4PFKA 4M49A 1TK2A 3EOZA 1X1DA 3JTEA 2BKUA 3P26A 3GRYA 1T5LA 2C57A 2QN2A 4HEA6 3E61A 4IIDA 2QRKA 4W5HA 2P3OA 3T4UA 4B3FX 2BEKA 4WE3A 4G81A 2I1LA 1E4EB 5FTJA 3J80A 4X91A 3CH7A 5D7NA 2O2CA 2ZTSA 2XMDA 2P4EA 1Q44A 1FFWA 3SICE 1BXGB 1UJ6A 4Y2UA 4EPTA 3IPLA 5HXAA 5GGYA 3SR3A 2Q46A 2NU9A 2CLLB 3KYIB 4MJ3A 1GTRA 1RQGA 4Z4HA 4W5RA 1UT5A 3OHSX 2YIMA 5ITVA 2CK3D 4X44A 1KAGA 1NXOA 5P8WA 4EPRA 2QTVA 1G8PA 3K9GA 5IKXA 3OZCA 2I7CA 3IALA 5UKDA 1S8NA 4FC7A 4CKCB 2GF9A 2YJ6A 4MR8B 2ZRAA 2AOXA 4RLHA 1SHKA 1E3MA 3QVTA 1TZ2A 5AWFC 4ZJUA 2GN8A 4E6EA 1XTZA 5F52A 1Y7IA 3UA3A 5K6AA 3LHDA 3LBAA 4JQOA 1BFDA 1WW8A 3UMFA 1CQZA 2MYUA 4LTDA 1L7BA 2IYAA 3C97A 3L4BA 3KEFA 2PNJA 3VNSA 3MWLA 1M0TA 1YTLA 3L8DA 2V7WA 4X6UA 1B8OA 3PXDA 1ICIA 3GZNA 4TVKA 4AIIA 2ZUBA 1SB9A 3AJ9A 1XU7A 2NO5A 1G3IA 1K8XB 4EW2A 4X24A 4BO7A 4EABA 2PVSA 3FWZA 4BGVA 1R4MB 1VA4A 3TTXA 2ZYTX 4Z3OA 5KQPA 3C5HA 2HDOA 2HIHA 2WD7A 3WZMA 2VYQA 4H1WA 5A6SA 1KFCB 1M2OA 1NWCA 2AS0A 2CDNA 4GLOA 3A11A 1UP7A 3H75A 4MJLA 4WLEA 3TFQA 1HDEA 1TLFA 1IJFA 2RDMA 4GE0A 1KH1A 1QP7A 4QDTA 3K7EA 3HMKA 2G09A 1UBNA 3QWAA 4QIHA 1UXIA 1NF3A 3FRJA 1W85B 5K0LA 2OAP1 2SNIE 3RCBA 4TYQA 4UBOA 5L7TA 1BIFA 2G70A 2W98A 1J0AA 1CS0B 1E7QA 3EVCA 4RCVA 3WP0A 1K88A 1ORDA 3INNA 3R76A 3ROXA 1RZ3A 4DS3A 5JO0A 2J9GA 1VC2A 3A2NA 2CSXA 2IYUA 4KLAA 2PQ6A 2GH1A 4AY3A 2EKLA 2C7QA 2R1TA 4M88A 3W9BA 1DKOA 4LTMA 1PFKA 4MRMB 2O4CA 5KU7A 2QG6A 2A7XA 3CZCA 3A3YA 4FINA 4KWCA 4L50A 3LCJA 4QBFA 3BXPA 1CQIB 4R0MA 3CEPB 1J8VA 3EDOA 4BOYA 1L3BA 3PKJA 2ZUWA 4D2IA 3OTWA 4FE4A 4BBJA 1EINA 2BKXA 3QG1A 3PE4A 2CVOA 2YXLA 3E1KA 1RRPA 4UCXA 2M6KA 1EHIA 3SJ7A 4HZIA 4MR7B 5JQGB 1XYYA 4QQ8A 3TXXA 3VR6H 1D2HA 1T2CA 3N8HA 1Z7BA 4MUJA 5JRJA 2FPRA 5DLPA 4N0PA 1V5WA 2BSXA 4A27A 4NJEA 5DN6D 4B7UA 2O59A 1MJHA 2Q6KA 1E9FA 2FR8C 3TO5A 3I92A 3NPMA 3TRDA 3JAWB 2ZYHA 4NARA 4V39A 1GU7A 4UUBA 4RUKA 3S8YA 1WZEA 1JFVA 1TUBB 4CNQA 1KYWA 1XQ9A 1VCMA 3EVBA 2YJ4A 1M7HA 1OHHA 3PHHA 4OG2A 3GU3A 4B2LA 2HH9A 3N0RA 1D09A 3U7GA 1ZPDA 4C3UA 1XZIA 3L7IA 1S3GA 1HRKA 4TKUB 4X6YA 2XITA 1QE3A 4GC5A 5IM4A 1W4ZA 3V8PA 4IXMA 2OE2A 5DBFA 4PSVA 221PA 2JGAA 2XIQA 3C85A 4OI2A 1B0AA 2Q3LA 4Y9SA 4B74A 4N8EA 3TSAA 3VH2A 4K9RA 5DT2A 1JTFA 2W2PA 3K05A 1WXWA 2JAPA 4YJFB 4JXXA 5FYQA 1AKTA 2XWBF 1Q0UA 4TLAA 1LBHA 3F8WA 3HCWA 4E2YA 3P9YA 5FWXB 1XAGA 2VRWA 2GEDA 3I3OA 2ZT7A 4YLGA 3WNCA 5KYTA 3NMUF 4MWBA 4YRBA 2IV7A 2I8AA 1V35A 3EY4A 4XVCA 3GF4A 4NQZA 4OGFA 3BT7A 2YVLA 1DDIA 3S27A 4RYDA 2J0QA 4IICA 1X80B 1CZLA 5DYNA 1QAMA 2YN4A 4Q3BA 4ZVQA 2XNHA 3EVDA 4G5QA 4PRZA 4RTKA 3KT6A 1V4BA 4KV9A 1Q7EA 1TCVA 3FKQA 4AZSA 4DRXA 1AHPA 1E20A 2JAOA 1UXGA 3I9V6 3LFTA 4HUQA 4YPVA 4AJLA 3KJXA 2X8JA 1SXJE 1MB4A 2UVPA 3AHHA 3C6BA 3OKFA 3JCZA 4FGWA 4L3WA 4MV6A 3REQA 3VDRA 1YOBA 2VZ8A 4J76A 4P53A 3UWPA 4E46A 2WAMA 5IARA 4X45A 4N8DA 1QO7A 3IHKA 4RKWA 1R4NB 1X7YB 4CM4A 3DGFC 3B9BA 1ZDMA 4QSMA 2DFTA 3FCYA 5T4BA 1QHEA 2NYVA 2O2EA 3DEKA 4D4IA 2OECA 5CHEA 3DMTA 2HLDD 3FVQA 4Q1BA 3S29A 4D1YA 4KH1A 4FNOA 5HUHA 1ADGA 3A4LA 4C3ZA 2IUUA 1ZUIA 2VNHA 5BORA 2H16A 3EVGA 3ACCA 1U3CA 3U81A 1ADJA 3G6WA 2Y66A 3PQ5A 2EWWA 4KGXA 5D00A 2C5FA 4R41A 4X7RA 4ZT4A 3SDBA 2V7XA 1USVA 1KGSA 1GZSA 1GZ3A 2VHWA 3KQTA 4FNGA 2QVYX 5FF9A 3H65A 5HIKA 6ABPA 1QMPA 4YCBA 2IZ6A 2I78A 2XADA 4RVUA 5CBPA 1EVLA 1GZ4A 1XZKA 5MFPA 1T9HA 3PEVA 1E2HA 4QEZA 4BQIA 5A6SB 4D4KA 4MYUA 4UCWA 2NQ2C 4D5EA 1DC4A 4NLLA 1O57A 1KEEA 1D2EA 1KO1A 1Q1NA 3KJGA 3EPLA 1M1NB 3GGDA 2AMJA 4LYAA 5AM5A 8ADHA 1UDXA 4IP0A 5KKNB 1DZIA 1SXJD 3ESRA 2ADOA 2WVAA 2HA4A 5E8RA 4GDMA 1T1EA 1A04A 1PNVA 3E23A 4RD3A 2NO1A 1ZXXA 3W8NA 2G9UA 2V5AA 3CVOA 1QS0A 3B6JA 4P7BA 3LX5A 4K9OA 2YFYA 5KOHB 3W90A 1PV4A 5DGDA 2P3SA 3G6KA 1RRKA 2VRCD 3GJ3A 2IHYA 2FW8A 4CUKA 2B4AA 3MFYA 1VJ5A 4Y6QA 5BSEA 2Z9CA 1YGYA 2YMLA 2WB2A 1XDGA 5C7LO 5CH8A 1D2RA 3ZBPA 4H08A 1BRTA 5G1PA 1QGED 2WK1A 1SU7A 3BL8A 1I4TD 3T5AA 1G6HA 3KZ1E 4E7OA 2YOGA 2E3JA 5D3KA 1LNQA 3OE5A 5KX5F 1VE3A 2AHOA 2WM2A 4JT9A 3T1QA 3QBJA 2A0YA 2VT3A 4Q12A 4XGIA 5EKUA 5B64A 5LKAA 3G0BA 1IUKA 3EUWA 4PLGA 1V6CA 2XE8A 5KC8A 4FOPA 4MDEA 4FGZA 4LK2A 1Z5OA 2SBTA 3TR5A 4HZUA 4WUTA 5CJ2A 5I7AA 3RFFA 6Q21A 3EGXB 1CR0A 4PHGA 5AOCA 3TIIA 3VU0A 5DRYA 1NJ2A 2AFIE 2FKNA 2QT9A 2HIMA 2R8BA 5FBWB 4CDNA 1ILWA 2J3QA 1GA4A 1LFAA 2VJDA 3JWGA 1ZJ6A 3WLRA 3PXXA 1ZHOA 3G2NA 3PWSA 3UHAA 4W5TA 2CXSA 4JUIA 4K9NA 3BWBA 3OIVA 1JR4A 2CJYA 2BISA 2Z2YA 3S2EA 1UBCA 4CEIB 3TZCA 1Q2XA 4IOMA 3LA6A 2AC7A 2KSQA 3PNBA 4LVUA 1X39A 1U7DA 1JIJA 2ICAA 3UK7A 3SG0A 1Y1SA 3DWIA 4E5VA 2N3ZA 3EGCA 4ZVUA 4D57A 4XVHA 1MH9A 2MU1A 2OLEA 4A8JC 1RBYA 3NTXA 1N0VC 1K4YA 1KOFA 2WHYA 1V26A 4PAQA 1GA6A 1H23A 3DEFA 1LI4A 1WQ4A 4TXLA 1XK7A 1MJFA 1PV2A 1SUPA 2ENUA 2VDKB 1DL5A 3AEXA 3D0OA 4K5QA 4F2PA 3ROKA 2WHPA 2E4XA 2D13A 1M5UA 1Z6XA 2VBFA 3U3DA 3UEOA 3WLOA 2YKGA 1KF0A 5A4JA 1ZHFA 1QGAA 5K05A 4XE5A 2I99A 4NYMR 1K6XA 4M37A 1RCTE 1Z75A 2I03A 2E4YA 3GDWA 2G3YA 1XJ5A 2ZCUA 1FQOA 3OJCA 1VRWA 3KP1A 4UEKA 2DPMA 5E2BA 5TVGA 3G5UA 3ZWMA 4EW1A 1K9SA 5FNZA 4FUQA 5AUNB 1UZNA 1LNZA 1XVAA 2Z95A 3CT6A 5L9AA 3SOPA 1P2UA 4F9TA 3E9CA 3QOXA 1HYGA 4KQFA 4CL2A 4EHDA 4LXQA 3Q1LA 4PO8A 5EJ5A 1N9ZA 3RVPA 2MJLA 2NO6A 1ZVJA 4DWJA 3HYCA 3QPWA 5FPHA 4BLVA 1ZH8A 3FRIA 1H1DA 2EW1A 4AG6A 1G55A 4CU5A 2XCRB 5HTKA 4JHXA 3BIXA 2NTNA 1LJLA 2BM0A 4GBJA 1PT6A 2Y2UA 5TGDA 1NJGA 1PW5A 2OHOA 4GI5A 2EATA 4BXOA 1MP0A 1AJEA 1N2GA 1ZD2P 3FCEA 1TEVA 4CM7A 2PWYA 4NFLA 2XDQB 5CFLA 3DLBA 1MA3A 2A5DA 1D1SA 3RFTA 3LBIA 4V03A 4Q9LA 4EX6A 3NS7A 2EJCA 3F71A 1P7ZA 1B2LA 5EIOA 3W8RA 1R0RE 2YMQA 1UAGA 3ITDA 1G0NA 4RD4A 1N6IA 3RHFA 1KGDA 4BLQA 2WB4A 1IB0A 3CLVA 4JYPA 4QWMA 1TVMA 5CDSA 1E2FA 4RZHA 4FCWA 1UFVA 4KLCA 1KVTA 1E1RA 3CF2A 3T0IA 2CKMA 3H1FA 1II0A 3KXIA 5NULA 3L4JA 1QNLA 3RBVA 1UZUA 4MUAA 3ST7A 4AJ4A 3D59A 2FRXA 3ZI4A 4GL2A 1E5TA 2OCDA 3SKXA 3PD7A 2X0IA 3EVEA 1DI0A 4I9GA 5TQVA 3TLGA 4CM8B 4HAZA 3EYWA 5B4VA 3QJGA 3PNQA 3SQDA 3WHIA 1JLSA 4R8MA 2FPGB 1Z22A 1X2BA 3GL9A 1WB9A 3BM5A 1JS1X 4EIWA 1L1EA 1JHDA 2AEEA 4N5HX 3I28A 3SC2B 5K8JB 2HR1A 1IN1A 4D5GA 4BVLA 1B26A 3T9CA 1YZKA 4WERA 1ULBA 1E94E 5CITA 3UC5A 4BMZA 4CI0B 1INLA 3BFJA 2KM1A 3AUUA 4UTXA 1OIXA 3DONA 2X7HA 3DDOA 3L7YA 4H7DA 1I14A 1RAHA 1XZ8A 4GT1A 4YMWA 2ZBGA 3MXOA 3G7SA 3NAQA 3M83A 3C5EA 4QGBA 5MDHA 5DTIA 4GRDA 4EJ0A 5AVSA 1Z2CA 4KX5A 2XUIA 2D7JA 4CIYA 5HJ5A 2OB2A 5B7PA 4EENA 2A9JA 1NUPA 2R6GA 3IB3A 2Z6QA 2I1QA 4NE9A 3FUVA 1RHQA 3FYCA 1V6SA 3DKPA 2PWBA 1DMRA 2NXWA 3PGJA 4KEAA 2JGMA 3D5QA 2VJKA 1GUFA 4AM8A 4IG9A 4M1QA 3R3YA 4DYVA 4O2LA 2YWBA 1M2EA 1BWPA 1OA0A 3GCWA 4GZMA 1OB2A 1K5GA 3F46A 2X7XA 3HN6A 1HF3A 3HYLA 5ALDA 5DFAA 1FOEB 1G7SA 3EQZA 1HSOA 2NVBA 1CU1A 3U3RA 1TJ5A 1EUDA 3AR2A 2HA6A 4MCJA 3LGSA 5IJ0B 5LNK6 3VZBA 1EP1B 4MWEA 3N6RA 1OXVA 2PZFA 2ZIVB 3HDVA 3QWHA 4MYRA 2Q4OA 1GM5A 1M1YE 3BWVA 3CX4A 3LBNA 2QTBA 3JZFA 2NQ8A 3EHEA 3D4OA 2QK4A 4QGHA 3KQKA 2ZVJA 3AILA 1TTQB 3K31A 4KK3A 4LDNA 4RPIA 1MMFB 3EXG1 1G8GA 2QX8A 1UFKA 1BCRB 3NDRA 3PGMA 2Z2XA 3HVUA 4W9NC 2HK9A 4CV3A 3KCNA 4PVCA 4EQ6A 3LVFO 5KPJA 2ZDHA 1DHTA 2R7LA 3VKFA 2WYVA 3BHNA 2R8EA 2JJMA 1ZXLA 2DQSA 4RVNA 3K9WA 3KSDO 1W5BA 4B4OA 1L7OA 1RIFA 3SQLA 2Y6VA 3NIFB 4HN4B 4PHHA 2H3EA 5J23A 4A5SA 4P3NA 2QN1A 6AT1A 3HGMA 1YNOA 2Y68A 1ISFA 3H42B 5KBYA 3V1LA 3THXA 2R65A 1WR8A 3ANMA 4QPZA 5D6NA 5AVZA 3Q8MA 1ZD9A 2GJ9A 1LCIA 1X7XB 2VJOA 2VSXA 4YJHB 1N2JA 2YFHA 3UHOA 4BWFB 4EJSC 1S8OA 5KX5B 2UU9B 2Y1EA 1N8SA 1FVHA 1CIVA 3ROPA 5BWNA 3ZDEA 4F3NA 4IIXA 4ZCIA 4REQA 2EWMA 5DLEA 1XCGB 1GNLA 3IBFA 1NRJB 1SHJA 3ESAA 3KIPA 3KVNA 3G82C 3LC0A 3NDIA 3GR6A 5AK5A 5KUTA 1VIAA 1UXOA 5BQOA 2ONCA 1ABEA 2IYWA 1U7XA 3WV5A 3LY5A 1HK7A 3BCUA 4MUYA 1H69A 5EZYA 3ZV4A 1U3UA 3NRBA 2EV9A 3ITNA 4YHHB 4PCLA 2F7SA 3IKMB 1Y4UA 1GLNA 5FUMA 4GMFA 4ZHSA 1WXXA 2ECPA 4MVXA 5DGXA 3WGQA 5K0BA 3ZXXA 1Z4KA 4W5QA 5L6MB 1CF2O 4E08A 2O3TA 1KO5A 4EF4A 3D3JA 4QUBA 2DKOA 4YI5A 4HYEA 1H3EA 1KP3A 3FPKA 3B1JA 3KYCA 5IFLA 1GTJ1 1LLUA 4CFSA 3SX4A 1KWGA 4F97A 3OVMA 3QVUA 4JA0A 3JQFC 1C3XA 3VMMA 4DRYA 1WETA 1YAJA 2W2MA 1Y1KE 4CMEA 1KDOA 4ENWA 1Y34E 4XUGB 2G9ZA 4NJMB 3RNLA 3RU9A 1R5OA 1SKYE 3NHJA 4A9AA 4E22A 1B76A 2Z09A 4R98A 3ZS9A 4LJ5A 2ZQYA 4CR8A 1RI4A 1WTAA 5DM2A 1SA0B 2VPTA 4BMYA 2DFKB 2IBSA 4NBSA 4OGGA 1PJ8A 1G5RA 3FDZA 2X13A 2ZIEA 5IASA 4FN5A 4IDPA 4ETMA 1UF9A 4G07A 4TT8A 1UIRA 1QIKA 3C7CB 2W2KA 3WB2A 4XCVA 3N6VA 3N76A 1MC1A 1EA7A 2XUJA 1V4NA 2GSDA 3RC3A 2ZSFA 2BD0A 5LZ8A 1IOWA 3C8MA 1NXVA 1U6IA 4QPCA 5KHOC 2R47A 3W04A 1UMDA 2H7CA 2BRUC 4V2UA 4YO8A 3NTQA 5JS2A 4AUEA 1TO1E 1IN7A 4Z4CA 2GPNA 1Z74A 1MC5A 5IT4A 1CQJB 1ST2A 1KJIA 2OC4A 3E9EA 4PZEA 4A6PA 2O8FB 1K7EB 4XJVA 2JCXA 3LD9A 4H6VA 1FS4A 2VYVD 4IIEA 5TF0A 1B43A 4DMCA 1OFVA 4X20A 5CB6A 2A35A 4DVJA 5H3CA 3RC7A 3GJ4A 4EYQA 2CE2X 3HZHA 3FX2A 4D9KA 4MW7A 1DRWA 1KBQA 4C22A 2VYND 2G36A 4DUGA 2GEVA 2MIIA 1ES9A 2IPNA 3MS2A 4CQMD 4XXHA 3H1PA 1TIKA 1PTJA 2YBDA 4B44A 3A1NA 4HV4A 2GERA 1WUHS 2QRUA 1OJLA 4MRAA 1KDZA 4DC1A 3IPCA 5F12A 5DSZA 1CFZA 3I9OA 4TTRA 2LP4Y 3KELA 1YJQA 1EG7A 4JDPA 1E63A 3BIWA 3Q7EA 1PU2A 4WJZA 1UCFA 4F5ZA 4LYYA 1P7PA 3COVA 3EXEA 3OQIB 4Y0AA 3V1TC 1C4XA 4UNNA 3EXIA 4OMDA 3Q9SA 1T4CA 3URKA 4D9NA 2O07A 4CHGA 1MUUA 4R1SA 2Q6TA 1PD1A 4JMPA 5ES4B 2HT6A 5I7OA 4ZQEA 2HW8A 5F2OA 3DQZA 4LMBA 1WDKA 2ZKLA 2H2DA 4MPDA 2GXSA 1OGIA 2HCFA 4JJIA 2C94A 4OK5A 1O4VA 3UJDA 2AX3A 2Q6IA 1UR5A 1YZ3A 2X4DA 2C4UA 2UYGA 3U7QA 4R71A 2Q8QA 5FOUA 3TJMA 3KLPX 3GPLA 3Q8KA 1KIAA 3IURA 1XAJA 4AJNA 1KIMA 2XSZD 2XQKA 4B5KA 1YCFA 2QQ5A 2AI1A 1BU5A 1M6NA 1QANA 3ETDA 1LPAB 3JWIA 4IH9A 5ALSA 4EFNA 2IKQA 1E58A 1VJRA 5J9FA 3PDIA 1I4EB 1JDJA 2HJGA 3WGGA 2P78A 2ZYRA 3X0DA 4F7DA 3C3MA 2JJ2D 4BECA 4IDOA 3R3JA 2HBZA 5LD2B 1VIVA 1XLWA 3D7KA 3ICOA 1CBUA 5EVJA 2XOKA 3C1UA 1RBMA 3RV3A 5HQ3B 4K40A 2ZSIA 4IEEA 3W6UA 1NVUQ 2XYQA 4XWAA 1A9QA 3QVGB 1A7UA 4TMXA 2PGOA 2H4WA 3BGOS 3HKCA 3O7MA 5EIAA 5LDGA 3EY9A 1DAMA 4BJ6A 4F5DA 3WAGA 5KSZA 1NI4A 1S9HA 2EZUA 1S7GA 2DJIA 3ZK8A 3LI2A 1WDWB 3FDIA 2HT1A 4J07A 1MB2A 1ZMTA 1SC3A 1BQ3A 3BJIC 1JG3A 3DNFA 1T0JB 2YRWA 3K30A 1LSOA 3QKUA 4Q9NA 1FNCA 1JEOA 3SXJA 1FVXA 2W6PA 2VL7A 5JCZA 2Q5OA 2FZWA 4OHFA 2QDXA 4NBNA 2E9SA 3OFJA 3ZCVA 2V8BA 4EVSA 5IJ9B 2J0UA 2VVTA 4IPTA 3WMFA 2OZEA 1F6WA 1TCCA 2QTRA 2BHTA 2DWCA 1J2TA 1UADA 2F9MA 2G5CA 4FHFA 1C9YA 2B0JA 1XNJA 5CNKA 4KG7A 2YUIA 2JCGA 4HYTA 1E2UA 4ETWA 2AF3C 3IPRA 2QS9A 4MCAA 4HLQB 4LEIA 1L0BA 1PG0A 3ZHUA 1R6UA 5PGMA 4D9EA 4DNPA 5LZ4A 1A8IA 2O3UA 1GNQA 5KJCA 3WIDA 4RTPA 1T4DA 3M70A 2Z83A 4G5RA 3PR2B 2OAEA 1G98A 4QBIA 5BUCA 3CR7A 2YRXA 1CXZA 2H57A 4V1CA 2HQOA 4WLOA 2BTQB 1NP7A 1PJ3A 4RQTA 2IUFA 5JU6A 2PY6A 3HM9A 1A5TA 3A9CA 1C2YA 1X8KA 2REQB 4HPJB 4R2MA 1NJ6A 5C35A 2MR5A 4G5FA 2B82A 2ZR7A 4MQ4A 5EIBC 4EO4A 2EYUA 3H5VA 1PFVA 2B9VA 5LP6A 3TGPA 1RAGA 1KZGB 3HG7A 1OIVA 1RACA 4HWRA 3RR2A 5AW0A 1J0CA 1V71A 2H7YA 5AI0A 1NUHA 4YCLA 3CBQA 4LRTB 4OYYA 3X1XA 3VHRA 5FAKA 3FH0A 1DLIA 1G38A 2C5GA 2Z2KA 5A06A 1E64A 3OOSA 2VJYA 2VWGA 1P1CA 4G3XA 4XGQA 2NPIA 3HZOA 5FPKA 1D7AA 4ITVA 3P9ZA 1IBLB 2C82A 1N5MA 3RGGA 1L7EA 5JZ9A 3HLYA 2X3YA 3NRJA 3KPJA 1CY7A 3L8ZA 1Q3KA 3LM8A 5C1IA 4Q1VA 4PCUA 4O2BF 5E4JA 4RLSA 4EUFA 4L9RA 5K51A 3KETA 2WWWA 3JQ9C 1DKLA 1ND5A 4WNCA 1MX5A 2M2IA 2HF9A 2J9ZB 3UENA 4PYJA 3K70C 2IA5A 2Q29A 3OFND 4Y6OA 1YTUA 4D0SA 4WZBE 3OKPA 4NU0A 3KBBA 3N0XA 4GYJA 4NYJR 2LRHA 2EDCA 1PT5A 4YBRA 4NS1A 4UEOA 4DIUA 5EQFA 3DOEA 5AESA 5JPCA 3OPVA 2OBXA 3VA7A 2BTEA 1VQ1A 1VJDA 5CCXA 3ZQUA 1IHXA 5WRFA 4X8LA 5FOVA 4U3JB 3SBDA 5JRDS 1C7EA 3N2KA 5E7QA 3FMOB 1G5TA 3V55A 1N8TA 3JARB 4OBWA 3R6LA 4B75A 5DNUA 3BE4A 3OT5A 4LDRA 4KYTA 3ROZA 3O93A 1K6JA 3ADOA 2GD0A 4J0FA 1WB5A 1UBSB 1YDHA 5HFJA 4LQLA 4G25A 4K9SA 1K27A 4RZ3A 2J41A 4HNAA 1F3LA 2RHRA 2ZWMA 4NPAA 4P3KA 2B99A 4C3OB 2I4TA 1Z6ZA 3ESZA 3DDWA 3LFUA 2ZLBA 3TJRA 5EMHA 1NN5A 3UKJA 4V02A 1VHQA 4JJ7A 4QUAA 1VCHA 4WLVA 4ALJA 4B8YA 5BUZA 1ZK2A 1WCV1 2GNAA 2X8AA 3P94A 4J4HA 5AOBA 1ZY2A 4MS4A 2QU8A 2MINA 3TRKA 5HIIA 4KQ6A 4V0OA 2PUDA 2Z3WA 2V6MA 4FZ5A 4URWR 3AR4A 3H8SA 1V5FA 4WOKA 4E5SA 3S70A 2AEFA 1SPXA 1A88A 3CX8A 5T4FA 1PE0A 3FFXA 1E8DA 4BP3A 1G42A 1A9ZA 5JYDA 2ZJ3A 2ZRNA 4PYNA 1IRXA 1MPTA 2AXEA 4YRFA 4HLUC 1IG3A 4JOBA 3UV7A 4PQEA 2MSLA 4UNSA 1RQXA 5DIFA 1YJXA 1X8LA 3AHJA 1O1YA 4JVNA 1BJTA 2P8JA 1LRKA 4AO8A 5CNJA 4RPLA 1Q0QA 1K3FA 1XELA 2C9MA 1U99A 2JJYA 3FUXA 4IR7A 4OQYA 3W5SA 5HKOA 4MVJE 4V3CA 5LA6A 3UWOA 2C07A 1A69A 2N47A 1JLRA 1NJSA 3Q0TA 2XMCA 5JMWA 1M66A 2Q1SA 2B3TA 2WP8J 4DKXA 4LF6B 2GAFA 3I6QA 3H8WA 5U9CA 2Z04A 1KO7A 1ESDA 4JL5A 3V7FA 4FOSA 1N2CE 1U2TA 2J6BA 1A0OA 3GJ5A 4AG5A 1YVRA 2WF6A 3QP9A 1RRGA 3E3NA 2BEWB 3VRHA 4R3WA 4AYWA 3F96A 2XGGA 3MWFA 4CMHA 3C3EA 4U2FA 4R81A 5KYYA 5DHSA 1K89A 4XJXA 1G291 3U44A 1PKEA 4HR7A 1XOIA 4DMGA 1Y8ZA 1OI4A 4FCCA 1E89A 3VOSA 1VHJA 2O0KA 2HWXA 2JEYA 3EMBA 4DRZA 2TMKA 1G20B 5DHPA 3AETB 1JALA 1E5XA 4NONA 4CEHA 2F59A 3CR8A 3C3AA 1Z35A 3JASA 1XVTA 2NO7A 2VG8A 2YNMA 3A1UA 3N7AA 2FUCA 2GJ4A 4TTTS 2G1JA 2WG2A 4V38A 1ZYUA 5AM4A 5FHQA 2PA0A 5DYYA 5F78A 5ELLA 4BLUA 1LW6E 3EZ9A 5FB3A 5EJEA 3V1NA 3DXYA 2FMIA 3OZXA 2AVNA 4REMA 1GXSB 3MT8A 4TYPA 3S68A 4YJ2F 3UJ3X 4DAEA 4CCYA 3ADPA 4HTFA 3RNOA 1T1SA 3I0MA 3HBLA 3AQ4A 4L57A 3TQHA 2UXCB 5KVAA 3RQSA 4MVJD 1U2DC 2LNDA 5I7WA 5CK4A 1GN8A 3K0KA 3DTVB 4JITA 1AS2A 1LV7A 4XR4A 3S2IA 3OO1A 4PHTA 5IN5A 4MTLA 4Q4LA 5CT4A 3B78A 4BNDA 3AZOA 4TT3D 2W70A 5B4TA 1QQ7A 3QOFA 5I7SA 4A5OA 4E32A 1PQWA 1JWAB 4MUXA 3KQWA 3JWJA 4Q9AA 1JPVA 1ID8A 3ZY6A 1WZCA 2ISCA 2ARKA 1A7JA 2C9ZA 4NNPA 4OYLA 1EX6A 1MXFA 2C9CA 4PO9A 3T0FA 1R0YA 2L0XA 2Z5FA 3B5IA 4O4LA 1F3OA 1HC7A 2PKEA 3NEPX 4GOXA 4Z2AA 4YY3B 2WHEA 1K6MA 1Z45A 2BGMA 3IV6A 2EP5A 3LRTA 2VJQA 3AHIA 2O3RA 3P2OA 2E2WA 2WOOA 3HFRA 2X0RA 4N0DA 1L5KA 4DT1B 4OYHA 2YC4C 4IHAA 1KH3A 3C4JA 4HGPA 4UJ5A 2OC9A 3C5VA 4JNCA 4Q1CA 4RESA 3KQHA 1I2CA 4PXSA 2X0EA 1A1VA 4QRDA 3E27A 1ZJJA 1UIMA 3HCEA 4C06A 4X1IA 3QV1A 2X23A 4US0R 3PEYA 3OHPA 5KC9A 3FYHA 4POOA 4JXZA 1J1UA 3A0RB 1NONA 1M73E 2Q1TA 3FPAA 5TMDA 1YU6A 4FGSA 5CR9A 3HXQA 2ZRFA 2LWIA 4QNMA 4WZAE 4M22A 1B15A 2YL2A 3UWDA 4BBZA 5LN1A 5FBQB 1ZZEA 4IIJF 3UV6A 2F43A 3NWEA 1N0UA 3BC1A 3OQBA 4UMEA 4A6XA 4RS4A 5JDIA 4BL5A 3LTEA 1X7WB 1E6CA 2PKXA 4MEAA 3U4IA 5KWIA 1EFKA 3DP9A 1II9A 2RKOA 4EY6A 4FFSA 1WULS 1MC8A 2WMNB 4KAAA 5AVJA 4CFYA 4CLXA 5KS2A 4MKHA 4A8JB 3FCXA 2W8BA 2IUYA 3PFBA 4MRPA 3UMJA 2BT4A 1TO6A 3ZJ5A 2F3RA 5FBRB 1NAIA 1CY2A 4MI1A 3O74A 2XD4A 1H5NA 5DHUA 4YXWD 4D26A 1CUXA 5BNTA 1M2KA 3ED1A 1RKQA 4AF8A 5HK9A 1EQ2A 2G40A 2VPYA 3JY6A 3EOBI 1JI0A 2Q28A 4OP1A 5AK0A 1W4CA 3OWOA 4CTNA 2HWKA 2V0NA 3ROTA 2X77A 2QD4A 1QP4A 3KQUA 2ORIA 3KLMX 3OTQA 2YDXA 2PQ2A 5KYWA 2D8AA 1USUA 1XRJA 3H9EO 4O2BB 1BJKA 4KRYA 1RAIA 1M10A 2A9VA 2NOAA 3CQ9A 3ZWCA 4FUTA 3LV8A 4OV6B 2VDRB 1T5HX 4OO3A 4N49A 1O94D 3ZJ4A 5KYNA 1BX1A 1WHTA 5C8XA 2D2VA 1CFJA 4NV0A 4MQFB 2QJWA 2QZSA 2ERCA 3G0CA 2GFHA 1KZ9A 4LYGA 3DMRA 4XOIA 2ZE6A 1KI8A 4RZUA 5EP1A 3WGTA 3AVOA 1TT7A 3UWSA 2P5SA 3E4CA 5JSFA 3MB8A 3PUWA 1UZLA 1J9GA 4LXUA 3GVXA 3FGOA 4YR7A 1L5RA 1TYEB 1YR1A 2IDKA 2P69A 2W6ZA 1GR0A 1PWEA 3P71T 4X95A 1GPLA 4XSVA 4YFVA 3QE4A 2WZDA 5E2IA 3K9FC 4PIPA 1VA5A 1W25A 4BKRA 1W30A 3TE6A 2D5CA 5HKBA 1YCGA 2XRMA 1J2RA 3WBFA 1M9NA 3BGSA 4WCFB 4BB6A 1KEPA 4D46A 3MGBA 4YT4A 3G0HA 1WHSB 1BHQ1 4H2DA 4W9RA 2FG5A 1I24A 1V41E 5DP2A 5FPTA 3SC6A 1EDDA 4RIEA 1EK1A 4E1VA 4LF8B 1V7CA 4GM0A 4WECA 1E3QA 1CYDA 3BMOA 3C8DA 2F62A 3GCGA 3PNPA 4HRAA 5DXFA 1E0SA 3NBMA 3CIOA 3VV2A 3WKCA 3CLRD 2ODTX 4X8OA 2HLDA 4DA9A 4KOAA 3TZEA 4EA6A 5CA1F 2QUHA 2XUKA 3S7ZA 3HADA 5DLYA 1P7VA 4BYGA 1LB1B 4ALIA 4B3BA 3I0NA 4EKIA 2CUTA 4HEQA 1RYBA 2P91A 3U6KA 1M2VA 4I8IA 1ZUD1 3B51X 4BIIA 3JQ7B 3N2LA 3N2EA 4C5BA 1A82A 3EG9B 1MO3A 5E9AA 2FQQA 1GQFA 3FCCA 4TXNA 1JDBB 3V4FA 5CDYA 1C30A 4KGVA 3N2ZB 4EMBA 3WGVA 2VBIA 2PZEA 5HFNA 4FM9A 3P20A 4IJKA 5TPZA 1IG0A 2FCAA 4RHYA 4PG8A 4ZCMA 5CX1B 3BMXA 5LC1A 3QUBA 1SC9A 2X5OA 4CMAA 4CGYA 1SH7A 2QXTA 5FA5A 1ENYA 3ICWA 5JS6A 2XGSA 4GX0A 2H07A 4YHBA 1GL6A 4PSKA 2DR2A 3LLUA 5JBIA 2B3DA 3RVKA 2FU5C 1U2SA 2AR7A 1F6BA 3GUHA 4RVOA 1SXJA 1Z06A 1A9SA 2X1HA 2YZNA 3K8ZA 4TX1A 3BF7A 1OI3A 2HA0A 1P3Y1 4PSCA 3TB6A 3T3DA 4ZO7A 4LF9B 3H13A 4ERNA 2RD2A 4HRXA 5DCLA 3OPYI 4IDGA 1JYSA 1T36A 2R7NA 3EH1A 4M7WA 1FZQA 2QM0A 3SE0A 1ZI6A 4K6KA 3MCUA 1GZUA 4QUEA 2B0CA 3I8XA 5ECYA 3RRJA 4FE3A 4ZMRA 2IZ7A 1LU9A 4EJ6A 4RTOA 4FMBB 4P1ZA 1NR5A 2LKDA 3DE7X 3PGKA 4JWTA 2V6IA 4L5CA 5SV2A 4D3DA 2ZVPX 1KFKB 1JT2A 3HO1A 4C7MA 4FBGA 1PZHA 4OLJA 3KSRA 4IEFB 4FEGA 3UXYA 1RJEA 2QX4A 3A1CA 4R2IA 5EWLA 4ZEVA 4NPCA 1R4ZA 4RE5A 4YJ2B 1Z13A 2VQ6A 3LOPA 3RIMA 5CFQA 3FNRA 1AQYA 5KCZA 5T6MA 3WGYA 3A31A 4I4IA 1LKZA 4WOJA 3I2HA 4BUJA 2ZJFA 4LK3A 5C8VA 5GV7A 1I6MA 2J5QA 5ELMA 3WGHA 3GLIB 2BFPA 3O3CA 1KZ6A 1IHOA 5DX0A 4O02B 3IVAA 3I39X 5FA8A 3A1DA 2JHCA 1ML3A 1B8PA 4M0CA 1B93A 1G3UA 2QMOA 2W6ID 5B53A 3K6RA 4XFDA 1MIHA 3C14C 2R3SA 2JIZA 3D5EA 4ZI7F 2RAVA 4N5DA 2B4YA 3GVHA 1O87A 1OU0A 4LJAA 4ER5A 3QWFA 4Q4HB 4BEVA 4UM5A 3RUFA 4P8RA 2ID8A 2PQ0A 5ENZA 5BVHB 1SQGA 4TTPA 1X14A 2Y92A 3ANTA 3B6IA 3N2GB 4Q03A 5F5NA 3X1WA 3B6ZA 3DOIA 4EFKA 4OL0A 3NUZA 5IF9A 2PLRA 4BB5A 3NHSA 4YRIA 2IPXA 1I10A 1O54A 2C2WA 4LJYA 3MOIA 4QXQA 4DF3A 2DB3A 1KJ8A 3MTIA 3KLBA 3TW8B 5CB4F 4KDCA 3S2GA 3EZNA 2XEDA 3VOTA 2GPTA 3IE0A 3U7FB 3N53A 1N5IA 1C81A 3Q4GA 3RE1A 3OPYB 2YHIB 2WP0A 4EG3A 1N6OA 2QW1A 4KSYA 4ACAA 2CEKA 5T5QA 1QCDA 2B6NA 5IRCD 4ZTZB 4IIJB 4LA4A 3JTMA 1SVLA 4PXAA 4V24A 4ZYZA 1KAOA 2R00A 1N33B 1E3WB 3L01A 4XYBA 4Q1EA 3CEMA 3EIOA 3TEFA 4MB0A 4PQYA 4JIGA 5TR9A 2ZJ4A 4G65A 3WQBA 1KI6B 1ZJZA 3CPSA 3JAKB 4G97A 4UUMA 3I04M 2HQ1A 4B3CA 1AK2A 5CCBA 1FUIA 4G0PA 3EH2A 4KPFC 5JZSA 2Q27A 3PC8A 1Z18A 3I23A 3GP8A 4BO6A 4EHJA 4B79A 1ZJYA 2W4QA 3CMMA 1JIQA 2O7NA 4R7TA 1MHTA 1OXTA 4N0QA 5MGBA 4ANFA 5ARBA 4GFDA 3RBAA 5MN4A 1F7VA 5CA0A 5JAHA 1N9GA 4FDLA 5FOSA 4U7JA 1M2VB 3RSLA 2CB9A 2GA8A 3UBMA 2VKTA 2PZ8A 4GL4A 4Y2XA 3V5NA 5HGJA 3WRVA 4KXWA 3ZHZA 4EOGA 1OZGA 3M2PA 2OGSA 3OAAD 4XLLA 1Q7RA 3H9CA 2HN9A 4HH4A 2BLNA 2FRDC 3L7AA 1MD9A 3DLPX 5BN4A 4U6SA 1GAQA 2IVZA 3LUBA 4GPIB 4HVAA 2BFEB 3N28A 4MYCA 4OK6A 4YCCA 4YASA 1V1RA 3TTVA 2HREA 4X3OA 3SQMA 1T8PA 1TZMA 3CLHA 3HUTA 3RVSA 2RONA 4ZMBA 4WKNA 4DHEA 3I37X 4KFTA 3R77A 3Q85A 4XX0B 5I9IA 1RHUA 2Y1CA 1I30A 3FTQA 3TAUA 2WT4A 3PXUA 3RYHB 3SZLA 4I14A 1WXQA 5FL7D 2JLBA 1MAAA 4HYQA 5EUBA 1IOZA 4OHOA 5A7HA 3VC2A 1QPZA 4F8YA 1CS4C 4XWGA 2WSSA 5B7GA 1FX0B 3O8OA 2VXCA 1T3ZA 3WJ2A 3TAHA 3WBKA 3CNNA 1TW3A 1U6KA 3FHJA 3U6BA 1U0LA 1GPYA 3PFGA 4N3NA 4NH4A 4A10A 2GK6A 1NTOA 2ZIXA 4I1IA 4TV9F 4CTMA 3U1VA 5K3FA 4GXRA 4YVFA 4AULA 4TM8A 4WMLA 1E69A 2OGTA 1LBQA 4U7GA 1QH8A 2BFMA 4YRPA 2ZYGA 4EWLA 2PO5A 4ZI5A 1DC6A 3EGOA 1I4WA 4HDMB 2QD5A 3B12A 3E7FA 3V42A 4PLFA 2JLQA 4NMXB 3THRA 2IQIA 3I2GA 2RI0A 4HN2A 2J6CA 3S40A 2MR6A 2AG8A 2IYVA 3G59A 2RKBA 1A5SB 3OEEA 4BWYA 1ZA2A 1TQDA 5K8LA 4XIFA 5LUAA 5CA1B 2Q3BA 4PW0A 3GD5A 2D1FA 4OQPA 2C84A 2NPFA 1O77A 3OCZA 3GMSA 1GKKA 3HDJA 3OH8A 4LV6A 4ZV7A 1Z88A 1K0UA 1UKYA 2CLFB 2WSBA 2QSJA 1KQGA 1YHZA 4R1UA 4F38A 5ICMA 1VTKA 4D6PA 4L8GA 1D0SA 4BZQA 2GM5A 2VOJA 4H7HA 2N75A 4Z1OA 1A8SA 1YRQA 5FOWA 1X77A 5L45A 2C77A 3AUSA 4RABA 1CZNA 1DC5A 3EWAA 2Y0CA 2XPCA 1C4OA 3ESDA 2AK3A 2PUAA 2WFLA 3HWRA 2WG1A 2JD1A 2Q49A 1XEWX 2FP4B 3UW3A 5H68A 3DMPA 2AOWA 1PRYA 3VH4A 3VPHA 1LH0A 2WD9A 1C4KA 2PO7A 4TLEA 4ZDWA 4F8EA 4W9MC 1EIWA 5EA2A 4KPUA 3BGWA 3I6YA 4LCEA 4BNXA 2ECFA 2J9XB 3G13A 3PJEA 1XPOA 4YAJA 4E5UA 5CVJA 4F1KA 3H9BA 1Y89A 2QDKA 3O82A 2ZRHA 4MUFA 5AK3A 3K20A 4OI1A 4BO2A 1CUWA 3MBOA 1P1RA 1UQTA 1MX3A 2JA2A 3WXBA 4J03A 4MI3A 1RTTA 4OK3A 4PWYA 1DEAA 3PGLA 3M0EA 1GFWA 3CUVA 5I47A 5I3CA 4GW3A 3NKVA 1L1FA 3U3KA 4MV4A 1FTQA 3JWHA 4KI0A 3Q1KA 4MMZB 3BK1A 2JLAA 2HYIC 3G0GA 1EBUA 1JSCA 3G2PA 2HRBA 3HSSA 1RZRD 3M4NA 4MYHA 4CYMA 1HT2E 3MSCA 2AFIB 3B1FA 2Q50A 3O84A 3PFHA 3MCTA 1RYEA 4DCGA 2BCJQ 3BB1A 1WAMA 1W0JD 5EP3A 3L6OO 2YXDA 2IHZA 4KVZA 5AT1A 3KB8A 3JQBA 2ZIWB 1AC5A 4U5QA 4UXJA 1P44A 3NT2A 1XU9A 3P8ZA 4FIZA 4H6WA 4LZNA 1ESZA 2UVQA 1NUTA 2UAGA 3GLHA 5A2GA 5ICGA 2B36A 3FUTA 3CH5A 1KJWA 4H9GA 3SHFA 3SC4A 1G4UR 4OKNA 5TV2A 1B8VA 1M1YA 1NLMA 4CF4A 1NVVQ 1P61B 2YV4A 4HUJA 1N9KA 1I3LA 1RWNA 3H04A 4S2EA 1I1HA 1KY5A 4S2UA 3M81A 1U9YA 1DDGA 1CW2B 1ZCZA 5GP1A 5B36A 3OZUA 1P77A 2EVWX 5BNZA 3ZUGA 2HJHA 4ZA2A 2AI3A 5K20A 1F9EA 4ZI7B 1UKAA 2ZWVA 4XPZA 4OP3A 2XE4A 4WDQA 2R4UA 3BOSA 5AK4A 1P75A 3C6QA 3DPUA 1T3GA 5HRCA 1IM2A 4UMFA 1JFSA 5FJJA 1P5RA 1S4QA 2FUKA 5CHYA 3B52X 4RMIA 3NPAA 5EIFA 3V7UA 4LHZA 2F17A 3OPXA 4AKEA 4M9QA 1NIPA 2EX1A 3OPNA 3P27A 3DTTA 4QODA 1VYUA 3W5AA 5HWSA 1NL3A 4FEYA 1QOZA 3NOQA 1U1IA 3QYJA 4LCBA 4D8TA 4ZK6A 1U8FO 4FWIB 5TPWA 2BGLA 3WGKA 5CB4B 7REQB 5GPBA 2NUPB 3WYNA 4AJ1A 3ZCTA 1XROA 1YVDA 1ZWKA 3PEFA 3P2KA 1T6YA 1ZP6A 3L2OB 5JSZA 3M1IA 1JG6A 3IPXA 4YJGB 2X3UA 1P7YA 1KDRA 5AM3A 5FNVA 3FY4A 4BTVA 4R9SA 4I4TA 1VRVA 2UUOA 3I83A 3MNFA 1PI3A 4L75A 3EEYA 1MFPA 2PT5A 2HBQA 5GONF 3IP7A 1ZH0A 5THKA 3HXKA 2VP6A 1D2AA 1IEWA 4HFJA 2ZIXB 4AKIA 1XG5A 5H7XA 2P2LA 3BXZA 2P2NA 1W96A 2H2WA 3H17A 3IEIA 2CUZA 4KB5A 2DHQA 5CT8A 3DUFB 1FBNA 2YHSA 3GO4A 1GGNA 4EFDA 2RHJA 5HK8A 2XUPA 3LKVA 4J2HA 2IP1A 4PYIA 1NSFA 3W34A 4PE5B 1N6HA 5IX8A 4L8LA 1U0SY 1LSUA 4LYFA 2FW7A 5IUKC 3URMA 3VSCA 1Z26A 1P9OA 3GJQA 1C8KA 2FFHA 3FVVA 5FV7A 1EAYA 1GP2A 3FDJA 1CUDA 4ZO9A 4F4UA 4L27A 3FNFA 3FZQA 4LBYA 4M36A 1TM7E 3A2MA 1LDGA 3B2EA 4CTKA 3PQFA 1A9XB 1RAFA 1RYYA 2RGDA 5G0UA 2VYNA 4L5IA 3OM9A 3ICVA 3AZQA 4C29A 2QT0A 3AP1A 3H11A 1I3MA 4H4CA 2WILA 5AHRA 1EE1A 3F6EX 4N0EA 3TMAA 4OREX 4DGSA 1SKQA 4QTXA 2XDYA 4QHYA 2HU8A 3HTXA 5BT8A 2C4VA 3A1VA 2D1TA 3KWFA 2FW0A 2VHZA 3L7OA 1M67A 1U4NA 4CLOB 2IXAA 3PB3A 1MEEA 3NH6A 4EKEA 2CLCX 2G0TA 4R1MA 2YVKA 4G1VA 4F71A 4I8XA 2A1TS 3I2KA 1OLUB 4QULA 3QUSA 1E2MA 2Y93A 1JAYA 2P6MA 3FHLA 4D4LA 2HSZA 1U4SA 2CL6X 2XB8A 2H9AA 1U7HA 3OU2A 2WF8A 3E8XA 4QBKA 4XB6B 3CO5A 4MV5A 2KLHA 2CY0A 2HRCA 1WCYA 4IHKA 5E7JA 5BQ3A 3A6EA 4ZODA 4INJA 3FOEC 3I76A 2YDYA 1UMCB 4BNWA 4D3SA 4RK4A 4G0UA 4J0JA 2D6FA 2B8JA 5JANA 2JAXA 5KQGA 2FMXA 1NC3A 2SKEA 4TV9B 1KPIA 4U7WA 5JAMA 2HJRA 1JLKA 3IQGX 1X9HA 2F1OA 4QARA 3D2AA 2DTEA 2C4TA 3OE7D 2PYZA 2XSZA 5HBRA 5K8IA 5ISMA 2WYWA 1PBTA 3I4CA 3QNUA 1OGJA 1D1QA 3BUSA 4GI2A 1WCIA 2ZJAA 3EJ6A 1ECJA 1X1TA 2RGWA 1I2DA 10MHA 4BFYA 3M5DA 4R7GA 1FUEA 2CJWB 3VKVA 1BKDR 3TL3A 3D8BA 1DAHA 1PJ2A 2Y1XA 4P84A 1Z8HA 4UAJA 3ROQA 5EQJB 4EATA 5KTRA 1HGXA 4GKBA 5FUQA 4G1MB 1PBNA 4K9PA 5KNLA 5AKHA 5JSHA 5CDFE 3TSWA 2GDJA 3WIVA 2EGGA 4EA7A 1HQDA 1PR3A 1R16A 1Y8QB 3EAGA 3R7WA 4LDJA 2IU6A 1E98A 5H82A 3WMEA 1QZZA 5L8VA 3DSRA 5KOYA 1RAEA 2LGJA 1XDWA 4C7OB 4LF4B 2HV9A 4S12A 3IXQA 3PVSA 1FDWA 1G19A 1QVAA 4QWWA 5TX7A 4XYMA 4BU1A 1V45E 1U8CB 3CW8X 4FMDF 4MS3A 4V0NA 3STHA 1K98A 2SHKA 1GRVA 2PTHA 1MT3A 3HJGA 3D8RA 1A96A 2OD2A 2FMKA 5K3CA 1JWLA 1JPNA 4KMOA 1MTZA 4O0LA 4TL6A 3W2TA 5KQRA 3G2JA 1GTVA 1BFKA 4B3TB 2IIBA 1MO5A 3STWA 2R6JA 2V1UA 1D7OA 1N3IA 1Z29A 4RORA 4ECAA 4EZEA 4JGBA 4M1KA 4MR9B 5GJVC 1JDPA 1QH1B 3IDFA 3ABRB 5EZSA 3RK1A 3BD6A 4OU5A 1MX9A 3C7KA 1UZAA 2FFRA 2AXPA 3GUCA 4X1YA 4DXAA 3NCTA 1XZDA 3LY8A 1RKVA 2CXXA 4NZOA 2IZZA 3WL3A 4XM1A 3EDYA 1YB7A 4X6LA 3E1GA 4O4HA 4F4JA 2IIPA 3QGMA 1L5QA 4MO2A 4NYIR 2IYYA 3P0RA 3TW4A 3VISA 4R0NA 3VPGA 4YRZA 3FWHA 3BIOA 3RYCA 1WP4A 5BW6B 1QU2A 3RVNA 2NU7A 4N3GA 1MR3F 2BCEA 2H4FA 3ASVA 3IDQA 4E0BA 4N6NA 1U02A 1VHWA 3H9UA 4R1NA 3WG9A 3C7DB 4TKVA 3RAEC 1EM8A 1H2WA 2LD4A 3O8QA 1CG6A 4TRNA 3LRPA 1QPGA 4GPD1 1QHSA 3ER8A 1DFHA 1DRKA 3BMNA 2DX7A 1CX9B 1JHPA 4G85A 2A9OA 4G8DA 2R5FA 3IAEA 3KR9A 4QYIB 1J24A 1E79D 3NW9A 3IPAA 3BL5A 3R3ZA 4LSZA 3K53A 4EF5A 5SYMA 1XA4A 2BMWA 1OMOA 2FJUA 3NHRA 4ON9A 4TTJA 2ZULA 4N6OA 2Z6UA 3LBHA 2DOKA 2QLNA 1JVBA 3V00A 1S3FA 3QKSA 4CQMB 1FFSA 2EW8A 3LAWA 2YWCA 4TZKA 1Z4MA 3DFUA 3LWNA 4NOJA 3GFSA 3QFTA 3RVLA 3S99A 4JLUA 4MIKA 2R11A 3L8GA 1N92A 1T10A 2ATCA 4HJXA 4PFJA 4UEJA 3O8NA 1RXVA 3UMYA 3QHPA 4NNJA 5T64A 3OD1A 3ELDA 2AV6A 3MRSA 4NNOA 3H4MA 3WLHA 3B36A 3ELWA 1GZ7A 4XX1A 4AY5A 5LDDC 3KD2A 1RWXA 3FCAA 3LQKA 3R7NA 4CCWA 2RGRA 1P0IA 4ND8B 3RFXA 4OAOA 1IBKB 4CF5A 5DB4A 2D2XA 1WNTA 5L3VA 1XXHA 3TD2A 4DBVO 1MVLA 2C2MA 5GONB 2OHIA 4RM3A 4V0KA 1OBHA 1CUCA 3JQGB 1DJQA 1QG6A 1Z6QA 3WKBA 2L82A 4KXXA 3AJRA 3D0KA 1HRDA 4WOCA 4LRUA 5B2FA 1EVZA 1W46A 2WSIA 3EIEA 1M5RA 5DEOA 5IWAB 2A92A 4OMCA 4RQBA 4TWBA 2YWHA 3LE8A 3P4XA 5JNVA 2BPOA 3KEMA 1JR2A 5CUQA 1TC1A 3BYZA 4NULA 3WTBA 4QGSA 2YBEA 2DJ5A 1PFUA 1AGPA 2DPYA 2YWJA 3MTBA 4GPEA 4M0PA 2CNNA 3T7DA 2AE2A 1JI3A 2D5AA 2PS3A 4KVAA 2ZT5A 4Z99A 4M87A 2WJHA 1J2EA 2H1OA 3LWZA 4UTNA 2VNAA 1JIKA 3L4EA 3R20A 1YQQA 1PWYE 4L8YA 3KKMA 2XTJA 1TI7A 1V1MB 1O96A 1QF9A 5ULLA 1J0EA 1KXZA 1COWD 2P6NA 2CCKA 2GLTA 3H5AA 1OH8A 3OOEA 4FFLA 4KFUA 4NAUA 1RVDA 1QXSA 2Z5VA 4CFZA 2HNAA 2OBFA 4LBZA 2WUGA 5CRIA 1AUVA 3MS7A 3ZK9A 1QIJA 1YBVA 2WWGA 3H9JA 5EERA 4Q7QA 4NBVA 2H1HA 4D99A 4EY4A 3TEMA 4GD3Q 4E1AA 4PQRA 5FWYA 1JBKA 3BKWA 5TGTA 3K0HA 3RPEA 3W1EA 1NNUA 1FJHA 3JYNA 3VOAA 3QXSA 5DNDA 3U5ZB 2K2WA 5DTQA 4L73A 5E6RB 2VTKA 3R5KA 2OL4A 2ATXA 1H6BA 1N0WA 3C1OA 5DM4A 2ES4A 1BX3A 2H2IA 2OCYC 3DT8A 4L4SA 1DTSA 4L2IB 1GWNA 5EJAA 3VHXB 1N1EA 2HBYA 3TTYA 1ISPA 4M3NA 1EGHA 3JQAD 3AEKA 1NQWA 1SOVA 1T1JA 2ZR0A 3IQHX 1FS5A 4GO1A 1OXKB 3CBGA 2XHZA 3H4TA 2HFKA 3HFJA 4XVQA 4JP5A 2NUBA 5IC6A 3NVMB 3JVIA 1YC5A 3LQ1A 4IX1A 5AKLA 3ZBTA 1OYWA 2EZTA 2VS1A 4E2FA 1DXOA 4Q1FA 4LY0A 4RY8A 5LXTF 3K92A 2P30A 2XA9A 2YNMC 4PS0A 5BYJA 1B8UA 4FFBB 1IONA 4K05A 1QVWA 4MVJA 4OMUA 4UM7A 5TS2A 4AC9A 4DG5A 1S2OA 3I4FA 3GIWA 4N9WA 5H4GA 4A8JA 2MTBA 1SOUA 4JP3A 3HB0A 3NT4A 1FYFA 3GA5A 2G4CA 3JRXA 4QDZA 1Y3BE 3EXHB 1T1IA 4Q3KA 1KBOA 2V8OA 4WGGA 3HKBA 3V4ZA 3EPKA 5IUJC 4HNHA 4Q6WA 3AP3A 1N2CA 1UOEA 1YVEI 2V9CA 4Y2JA 3K4PA 5C1PA 5M2QA 3NC4A 1MT0A 5AW5A 4D9GA 1A77A 4HAUA 1PJ4A 2ECQA 2BH2A 2VJMB 4M38A 1DBRA 4OQMA 3ZV3A 4DCPA 4KR0A 2VJCA 2F00A 1QONA 3ENZA 1EX9A 2R60A 4JR0A 1NW8A 2HIGA 5G02A 3WDLA 2W00A 4MQUA 5JTTA 3A7EA 3ZXYA 1UBFA 4Q3DA 4CZ2A 1NBME 1DFGA 3FNHA 4DQXA 1CD5A 1NV8A 1C0EA 1HDRA 2ILTA 3MCZA 4L4ZA 4DPMA 1IAQA 2P79A 1K6IA 5IUNC 3V1YA 3FPGA 4J6EA 1T0UA 4FMDB 1KMQA 4FHDA 4IEIA 5IVDA 4TZTA 3WDKA 4DIOA 1H0KA 1BA2A 2VP2A 2NUTA 4DPKA 1MG5A 1CB7A 1FPMA 1NSTA 1IVNA 4Q34A 4HHEA 4NABA 1XMJA 3VTFA 4JXKA 3F7OA 4WVFA 4U0JA 2JCYA 3SX0A 5JH7F 1APBA 2C7VA 3IRVA 2FLKA 2QX6A 2YZ7A 3PQ4A 4GPBA 1MC4A 4LPKA 5DNVA 3MINB 3TLJA 1YUNA 4ZZ1A 4YALA 3W78A 3D6AA