3OY2A

Crystal structure of a putative glycosyltransferase from paramecium bursaria chlorella virus ny2a
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
392
structure length
392
Chain Sequence
MKLIIVGAHSSVPSGYGRVMRAIVPRISKAHEVIVFGIHAFGRSVHANIEEFDAQTAEHVRGLNEQGFYYSGLSEFIDVHKPDIVMIYNDPIVIGNYLLAMGKCSHRTKIVLYVDLVSKNIRENLWWIFSHPKVVGVMAMSKCWISDICNYGCKVPINIVSHFVDTKTIYDARKLVGLSEYNDDVLFLNMNRNTARKRLDIYVLAAARFISKYPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAEGAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAFTFFKDEKNRKEYGKRVQDFVKTKPTWDDISSDIIDFFNSLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a virus-encoded putative glycosyltransferase
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus ny2a
molecule tags Viral protein,transferase
molecule keywords Glycosyltransferase B736L
total genus 137
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3oy2A02
3.40.50.11930 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oy2A01
1NZFA 2IEIA 4BQFA 4GPBA 2AZDA 4FKZA 2G9QA 4EJ2A 1UQUA 4MI6A 1Z6QA 1GPAA 1M5RA 4CTNA 4X7MA 3T7DA 3TOVA 5HXAA 2PRIA 3BCUA 3BD8A 4LDPA 3IAAA 2QN7A 2BISA 2H1FA 4MHOA 7GPBA 5LQDA 1NLMA 3CUWA 4N3BA 3WC4A 1WV1A 4NEQA 3MT7A 4M83A 4GYYA 4N3CA 2YJNA 3S27A 2PYDA 2X0DA 2R60A 2PYIA 3NPAA 4N9WA 1RRVA 1VGVA 3DZCA 3QHPA 3L79A 1C50A 3SYRA 1C8KA 3L01A 1L6IA 3OY7A 1L5QA 3ZCSA 1NVKA 1UZUA 3VDNB 1O6CA 3PE4A 2X0EA 1JG6A 3ZCQA 2Q6VA 3BCSA 1B4DA 2KS6A 1P2DA 3OTGA 2QRPA 2F9FA 4REMA 3T3EA 3EBOA 3DDWA 1PYGA 3CUTA 1WUYA 3S0JA 1XC7A 2VCHA 3OT5A 3TAXA 2PQ6A 1SXQA 5IKPA 2G9VA 4W6QA 3UYLA 3ZCPA 1HLFA 4MHSA 3EBPA 4RIHA 4Z5XA 3COPA 2OFFA 1J39A 2F3SA 2JZCA 2F3UA 1Y6GA 2C1ZA 4L22A 1XV5A 3MRTA 1C8LA 3DD1A 3OKCA 4EKEA 5TMDA 5I45A 1XOIA 3BCRA 2C4MA 6GPBA 3H4IA 3NB0A 4RIFA 3HBMA 4GZ3A 1QM5A 3G2JA 2XMPA 3MBOA 3MRXA 4G2TA 2XA9A 4RIGA 1NOIA 2C1XA 3H4TA 2ACVA 2IYAA 3TSAA 2BFWA 3BD6A 1FA9A 1L5SA 4YUAA 2AMVA 3FROA 4EL5A 1P2GA 1FC0A 2BGUA 2GJ4A 3MT8A 3MTDA 4XIFA 1F6DA 4MRAA 1L5VA 3IA7A 3MSCA 4BQEA 2QN2A 4CTOA 3CUVA 4AN4A 1FTQA 1AXRA 2XCIA 4CTMA 2SKDA 4CDRA 1JG7A 3BEOA 3RT1A 1GZ5A 3MTAA 2R4TA 3E3LA 3MRVA 3QKWA 2QZSA 3L7AA 4GZ6A 5C1DA 4M60A 3VUEA 1PSWA 3PE3A 4BFCA 2AV6A 1FU4A 1IXYA 4X6LA 4WHMA 3G2LA 2QRHA 3MT9A 4YI3A 3D0QA 3T3IA 4F97A 1FTYA 4GZ5A 3G2NA 3MTBA 1BX3A 1E1YA 1WW2A 2XA2A 5DXFA 1L7XA 1YA6A 2H1HA 4MICA 2ACWA 3VDMA 2FFRA 2QN1A 1Z6PA 9GPBA 3G2IA 3ZCTA 2HY7A 1IIRA 5TVGA 2QRGA 2BGTA 2ZB2A 2G9RA 1JIVA 1Y8ZA 3WADA 3RSZA 2X6RA 4EKYA 2AW3A 3OKPA 3ZCUA 1RZUA 3T3GA 2P6PA 1P2BA 3S28A 3RSCA 3CEHA 3MQFA 4EL0A 1FTWA 3E3NA 1SXPA 3C4QA 5TMBA 2G9UA 4RIEA 5ENZA 1Y6FA 1GGNA 2XGMA 4YI5A 3UYKA 3SYMA 3T5TA 1E4OA 3Q3HA 2QRMA 1UQTA 3HBFA 3NP9A 1QKJA 1NOKA 2VG8A 2QRQA 2C9ZA 2F3PA 2IUYA 4BQIA 4WADA 1F0KA 3CV3A 4RBNA 4AY6A 1GPYA 2R4UA 4N39A 2WTXA 3ZCVA 2FF5A 1EM6A 3G2KA 1Z62A 2GM9A 3L7BA 1NZDA 1V4VA 4KQ1A 4KQ2A 1JIUA 1XL0A 2GEKA 1JIXA 3HBNA 2X0FA 3CEMA 1LWNA 3MS7A 2VSNA 1AHPA 2XCUA 4XI9A 5TMEA 2O6LA 4WACA 3G2HA 2IV3A 3MS4A 4RIIA 3Q3EA 1H5UA 3AMVA 2XGSA 2R68A 1JEJA 2QN9A 1EXVA 2IYFA 5IKOA 3VUFA 5DLDA 3HBJA 3NCHA 4F96A 2ATIA 5JTUA 1YGPA 1P29A 2GPBA 4X7RA 3Q3IA 4KQMA 4NC9A 3CX4A 2QLNA 1ABBA 3C48A 5BNWA 2GEJA 4NESA 4MI9A 4MI3A 4F9FA 3OTIA 3T3HA 8GPBA 3C4VA 3D1JA 1PN3A 3E3OA 5D00A 2QLMA 2X6QA 3NAZA 1GFZA 1KTIA 4N3AA 4X7PA 3S29A 3L7DA 3GPBA 1GPBA 2F3QA 5JTTA 3RHZA 3ZCRA 2SKEA 4AY5A 1K08A 3WAGA 4FZRA 2GT1A 1LWOA 1XL1A 3OY2A 3NC4A 3GUHA 3BDAA 2VCEA 1WUTA 2QN3A 3L7CA 1L5RA 3CUUA 1GG8A 4QLBA 2GPAA 3S2UA 3CUYA 3O3CA 2IEGA 2XGOA 3BD7A 1FU8A 3CEJA 4AMGA 3DDSA 2IV7A 1P4JA 1RZVA 2QNBA 1WV0A 3OKAA 2JJMA 4AMBA 4GYWA 2QLLA 1XKXA 1P4GA 1WW3A 5D01A 5DU2A 2GPNA 2JLBA 4HLNA 1K06A 2FETA 4M7PA 3NP7A 1Z8DA 2ASVA 4PQGA 1FS4A 1C3JA 1NOJA 3D0RA 1P4HA 2ECPA 4HWGA 2VSYA 1FU7A 2R66A 2XA1A 4RELA 3MS2A 4LEIA 2SKCA 4RENA 1L5WA 2PRJA 2IW1A 2QN8A 1A8IA 1PNVA 5GPBA 3OTHA 3T3DA
chains in the Genus database with same CATH superfamily
4Q1BA 1FFXB 2O50A 5G02A 4EI2A 3BX1A 3BDVA 3H2YA 5LQSA 3D64A 2XDQB 1FS6A 2FN8A 3FY4A 3H5RA 3I64A 3LV8A 4KNYA 1WCWA 5AK4A 4U2CA 1YBFA 3BGVA 2D1YA 3KJXA 4PNZA 1D6JA 1UQUA 3UGQA 5L3QB 5LP6A 3UK6A 5CD1A 1HQCA 2NUBA 1VPWA 3D2LA 2QTAA 2O05A 5DW3A 4U9IS 4EJSB 4KXXA 4K9MA 5HBGA 5JAQA 3ZGNA 1BXRB 3JALA 3V7UA 3RSGA 3SHQA 1GL7A 5BNTA 6ABPA 2Q0XA 3MGBA 3GNQA 4RL4A 3EZXA 2P9QA 2XMDA 1FPQA 4LDPA 3W6PA 4DLWA 5CITA 4DKJA 1S2MA 2NPIA 5F7JA 2G8LA 1XQ6A 2FMKA 2RH9B 2VUSA 2ZJ6A 5F2KA 1QJ4A 1WO8A 1HDYA 1TRHA 3NHJA 3FUWA 3EEFA 1NMSA 4FYWA 4V0LA 5DGCA 4KQCA 5JMPA 1S3IA 2WC1A 4EATA 1GL6A 1R0YA 5KYWA 3PQ3A 3COYA 4D74A 4Y2UA 1JYSA 2LDBA 3ANXA 4UUQA 5A2QA 3KVOA 5DYWA 4ZJUA 4ZOEA 3MLAA 3K2IA 1YZHA 4DWOA 1PG0A 1RRVA 5IFLA 3PEVA 4MAFA 2C99A 2ZIWB 2ZAGA 4F71A 1DINA 3AUUA 4HTFB 3HI4A 2F1KA 2YQ4A 3UN1A 2Q3HA 4EI7A 4D96A 2H2HA 3FFTA 3LUBA 5EJEA 1F6WA 2IZZA 1X77A 1YUMA 2JJ2D 1DV1A 4IEIA 2ALJA 4C4PA 1K4MA 1HORA 2B37A 3FX2A 2Z0MA 3H11B 4JR2A 5ESWA 3ITDA 1XZDA 1XJ5A 3AF6A 4DMHA 1K8RA 3L0ZA 4J91A 4UC0A 2BHNA 2HGZA 2HKIA 4G65A 3W8FA 2GERA 4JC4A 1SBIA 2ECFA 2GD2A 1PR1A 2YY6A 1JHZA 3LBAA 4G8JA 5AHOA 4D3XA 2W4MA 1SQSA 1BKYA 1UINA 4BNXA 3EEOA 3SSMA 3BCSA 4B3JA 4WINA 3HO1A 2EFYA 2NSJA 1MV5A 3SEZA 1VKJA 1ZITA 4JLMA 3QITA 3U6KA 2PMEA 1EFPB 1T2CA 2F9FA 2R7AA 4KR2A 3WX0A 2PRZA 3EBOA 3P2MA 5AVOA 3SY8A 1L7BA 1VI5A 2JJ1A 4H60A 2ZR9A 3LU1A 3T9DA 3EVFA 3GXOA 3RROA 1YL5A 1AGXA 1GUBA 2BGWA 4Q7KA 2ZUEA 2AIRA 3OJEA 1AQ6A 2A9OA 4IDFA 4JENA 3AF1A 4FFNA 4FOLA 4HUQA 3OCXA 2E4ZA 2H6EA 2X23A 4LXUA 1OTHA 2HA0A 1MEEA 1V16B 1XEFA 1OLUA 1A9SA 1U3WA 1W46A 2XTMA 4M9UA 9LDBA 2WIGA 1M2FA 2JH3A 1DDGA 2AN4A 4B3RB 1GZ3A 4RWZA 1MOPA 4R84A 2A59A 5F3WB 2HUNA 2HBQA 4YQZA 2ZJ2A 1CVRA 1QFSA 1AHNA 3HFGA 1NNSA 3SYNA 2QRLA 2QWXA 1GDHA 1DBPA 4IJQA 4RM2A 4WZAE 1NP7A 3PKZA 4EY4A 1CZHA 2W4IA 3GGDA 5JSQA 2JK0A 2BIFA 2YUIA 5JU6A 1JXMA 3PCRB 1VG8A 1IBLB 1UXIA 4N3GA 1MAHA 3LMKA 4KV7A 1HXHA 3RG2A 4G1MB 3B36A 3ZDDA 1H65A 4MHTA 1CK4A 2Q2NA 1Y1SA 1U8ZA 3A04A 2YNMC 3J81k 2WIDA 4BWYA 2O1EA 3WRYA 1PJTA 2EOAA 2B1QA 1RE1A 2QLFA 2AR0A 4ESHA 3GDFA 3H4TA 4YYZA 2Z09A 2F9LA 3ROZA 4AZ3B 1KJYA 4F7DA 5LN1A 5EMLA 3H4MA 1CF9A 3RJTA 3IE0A 4NNOA 4OOFA 3TVTA 1BHO1 2I6UA 1EFDN 1KDVA 5CFLA 4QJ5A 2J5QA 2QROA 2H54A 2XV1A 3UQYS 3ILXA 4D8VA 5FA5A 1XVVA 2HU2A 1E94E 1RKBA 2PUWA 2QT1A 4Q3KA 3ZXUB 3QXSA 4IVNA 1KFBB 2A88A 2ZYRA 4N0DA 4C5AA 2H52A 3IAM1 3MGAA 3VOBA 2YBEA 3PHHA 4ZO7A 5FRDA 1E1MA 4KQXA 3UY4A 2FXVA 2IXGA 3LRPA 4GX1A 4QUKA 3T7EA 3UMGA 3UAWA 4W5TA 1ONBA 1JDTA 5B3JA 1BX1A 2F1RA 1OZHA 2C4UA 2QPTA 2NOAA 3A4IA 3EXAA 4ZQFA 1E3IA 1KEWA 2XOKD 4INOA 4R5HA 1ZGHA 4FFOA 4DR7B 3D6NB 2M6SA 4Y1FA 5BR4A 3X2SA 4C7MA 1MQSA 3SXUA 4GOND 1YS9A 4NBRA 4KQHA 5KJFA 4CTKA 2PX6A 3O82A 5BSHA 2Q2OA 1YZYA 3ZGXA 3BRCA 1CLEA 1DAEA 4HNHA 1SCJA 3AR6A 5LOVF 1W9MA 4F5ZA 2I0FA 2HO5A 2C5HA 4YN3A 3WOHA 4F45A 2VNKA 1MB9A 1CS4C 3BEOA 5D85A 5FA6A 2E7ZA 2R4TA 1DRWA 1EFPA 4Y30A 1JR3A 4M0DA 2RI0A 3D81A 4IVPA 3RVRA 1DB3A 5K1ZA 5J58A 2VZ0A 3QF7A 1ZRSA 2P68A 4XFKA 2G6BA 1L7MA 1ML3A 2M6RA 3NHLA 3Q0IA 4QYTA 1PFYA 5DNDA 1QTIA 1AZSC 3Q2KA 3FI0A 2AQKA 5G0VA 5WRFA 4AZTA 3OOYA 3UBTA 5JXWA 4L78A 3TBKA 4ZI7F 3PV0A 4YS6A 1Q92A 2PGOA 1U2QA 3A70A 3GR6A 3NHPA 2NUAB 1D0IA 5AXDA 3DB2A 4GZ5A 4IH9A 2ZRMA 3KKNA 4E5MA 2ID8A 3H2BA 1NI4A 1OIXA 1VL5A 2Q1SA 4YUWA 3VOSA 3CPEA 1YA6A 3IHTA 4O29A 3FTNA 3HA2A 3LUFA 3N2YA 3VPSA 3K70D 5JMOA 4NWIA 1KH3A 3KSZO 1DQSA 1YBAA 1T8RA 4EA7A 1NM5C 4EG3A 3ND5A 2W7TA 3ENKA 3D2BA 3BJIC 3U3JA 3JWHA 2VRWA 2H92A 3TAHA 1FVHA 5KTKA 3HYTA 1YR3A 2YNMD 1JHXA 3FFAA 3O21A 5JMWA 4JI0B 1DKPA 3M33A 3FTPA 5AW4A 3KKEA 4GX5A 2Z4SA 4ZT3A 1J9EA 1YV9A 4E5UA 2WTNA 5K6RA 1CY4A 4LTDA 2ZCJA 4PXYA 3WKAA 2I2BA 2AW3A 4DWWA 2JGAA 3NM5A 3SI7A 2EL7A 2NGRA 4LJAA 5FNVA 1SBTA 2G5GX 4BMCA 5KNDH 1WR8A 1A9QA 3R5TA 2OGZA 4BZZA 3TXXA 2G0NA 1MPTA 4E08A 3R5HA 4YP5A 2BSAA 3A25A 3L7JA 3PYXA 3GPLA 5CCEA 4N49A 2XHEA 4IKOA 3NFRA 1ZW6A 2WJ4A 2ZLBA 1JLRA 3AC0A 3BWCA 4TMZA 3OQPA 3HP1A 7YASA 1U0BB 1PS0A 2Q3LA 1M2VB 3SJZA 1QNLA 1Z7WA 4X64B 3KEMA 5K6AC 4OLAA 1J23A 1FTGA 2XDQA 4KLCA 6PFKA 3PTAA 3I01M 4ZVOA 3SQDA 3DMNA 4DA4A 3SOPA 2VZ8A 4NBUA 2REQA 3F3SA 3HXKA 1I3LA 3I23A 4UCXA 4PC3A 5DFAA 3U81A 4WKNA 4EMUA 4DPLA 5IT0A 2DM6A 4XARA 4IINA 3GD7A 3H99A 3H65A 4MO2A 3TRDA 3VSBA 1EUYA 1YHZA 3RBXA 1WCIA 1WCXA 3KEQA 3W7VA 3MMSA 3I5XA 4G85A 1L7PA 2VRCA 2WRZA 5ERGB 5FWDA 4AZ0B 2OZPA 1Z5NA 2DFKB 5KX5B 1QKJA 1ZVJA 2XUQA 4QBHA 1NE2A 5IAEA 3MCWA 3QI7A 2NU8B 3V8EA 1AN0A 3PCTA 4NEHB 4MKIA 1W47A 2WV9A 4BMZA 4ZT6A 2E4VA 4I4LA 1SB8A 2D5IA 4V1CA 1UWKA 5EJIA 1DJMA 5B1EA 1BROA 4BVJA 1D7AA 2FZKA 1EESA 1GP2A 5BSKA 1MKYA 3LQRA 1O97C 3O8CA 5AJTA 4TTVA 4DYHA 3LC1O 4LXTA 3B53X 1CIPA 4QPNA 5BSUA 4AFNA 5A5DA 3L1IA 1CE8A 4HFJA 2PUDA 1XTKA 2CJPA 3CV3A 3LDUA 5K3SA 3KVRA 5KWVA 4W9NA 4CM8B 4IG9A 4MVCA 2X5NA 5CB6A 1BCSB 2QKYA 4UE3S 3RR2A 1YQEA 1HSOA 1OFUX 3VYRB 1K6MA 4RHXA 4M8LA 4D8UA 4YMUA 1OX4B 2XH8A 1RQ7A 3B6JA 3HEBA 4BYMA 1OI4A 2HJRA 4MLCA 1D2MA 4RGYA 4MWEA 4YO7A 3AWIA 3MCUA 1WABA 5EWMB 2X4LA 3TOCA 2OHVA 3KAKA 2DX7A 5IDQA 4KV9A 4AWXA 3GWZA 1BA3A 3LP8A 2QUZA 4HQFA 3UCEA 1C8VB 2FXIA 6CHYA 1IBCA 4DDHA 3HTXA 1WMDA 4CLRB 1RI1A 1B3RA 2XVYA 3OLXA 4GE3A 1KY2A 1K6XA 3U31A 3F74A 1L5HA 4G5SA 5D3MB 5EYPA 3DBIA 2IYZA 1U63A 3G0HA 5FOVA 2W48A 5HZKA 3DAHA 1GIAA 2Z2KA 3JZDA 4ZP1A 1C7EA 4R9NA 4PN7A 5AUOB 1GV1A 2CMKA 5DLYA 1KI9A 3QSGA 4ZAGA 5C8ZA 1Y1KE 3WOVA 4L6IA 1WBBA 4DCMA 1EFVB 1NNLA 4QTZA 4RHYA 1NSFA 4G4GA 2UVDA 1ZRNA 3AK4A 4IDNA 4KRXA 3VNQA 2WNIA 1G4UR 1QKKA 1RWKA 3HKCA 3ZZNA 3EAQA 1R4NB 1WOYA 1XMJA 3NEJA 4AICA 1DI0A 3BBLA 2E3JA 2R62A 4KL8S 3E9RA 5JW6A 1GADO 3L82B 4L51A 1RKXA 3AKZA 3COWA 5BV0A 4DB4A 1FK8A 2QMYA 1KVSA 1D1TA 3KU4A 3UCXA 4LNHA 4NC9A 4H4DA 5EFOA 1JS1X 1IY2A 4BRZA 1C4XA 1NMQA 1UZAA 2C2GA 4BVLA 4IMRA 3V1KA 5A5FA 2VPYA 1CWUA 3OM0A 4BNDA 4CV3A 4PZZA 1J5XA 2YVUA 1KJNA 3P96A 4WOKA 2F67A 2FPLA 3R8FA 3MGKA 3TQSA 4ASUD 3GJZA 1UH5A 1E7WA 2HDOA 2RHRA 3PSHA 4BVFA 1NBAA 3OZXA 1DCMA 3UJ3X 3B1WA 1H0RA 1TAHA 1KGDA 2X6QA 3TFQA 3U1BA 3GLHB 1QAQA 4NRDA 2ID4A 2EU8A 1E58A 2Q27A 4E70A 4HAVA 5T4FA 5BSFA 5DTRA 5ICMA 2FGJA 4OAQA 2EL9A 4FK8A 1AQJA 3CJTA 1RPJA 2W6NA 1I4TD 4KK4A 4KGDA 1UBKS 2XE4A 2O2DA 2AE2A 2ZBVA 3S1AB 1LNSA 1QF9A 1USVA 2WFMA 2VSOA 3OOSA 1H05A 4PYLA 4RK6A 3REOA 4JIMA 2OAQ1 1NFFA 1WPGA 3PPYA 2NAPA 1XPRA 3WYAA 2ZTMA 5DMXA 3C6BA 1OHHA 3LT2A 2CW5A 1ODIA 2PRSA 3ZQKA 3OH8A 4EFNA 4UEOA 3I9LA 1F60A 3GBVA 2IU4A 2PEYA 3DCIA 3W6OA 3GQBB 5HBRA 3K6JA 2J6CA 2J9GA 2E37A 2RGEA 2JZNA 3DMHA 4TSFA 3MWGA 4YRRA 3ONDA 4RMHA 2XMQA 1IG3A 1K27A 3O93A 4RZHA 1ZMOA 4ZJZA 3MUOA 1XJ0A 1RPTA 4YJGA 1QWOA 1GNQA 4E09A 3W5AA 1LD3A 1QF6A 3ZDBA 1VSQA 2KB0A 3ELWA 3UH1A 1U8CB 3AFGA 3E2MA 1FVFA 3L3BA 4UVGA 4B35A 3H05A 3EVCA 2MSLA 2WMDA 1JDSA 3PKJA 5DP2A 5AM0A 1GPH1 1Z29A 3CINA 4B3FX 5A9SA 1L5MA 4EG5A 1YJXA 2YN4A 1YZTA 3KZVA 3QMWA 3B9PA 3BSYA 2PUTA 3GFPA 4KB5A 4RANA 4YDHB 1P5HA 4G0MA 4F4JA 3WIBA 1MW8X 2WNSA 1Y3BE 4BO8A 1P4JA 3O75A 5EPUA 3VNVA 4DNXA 1S9HA 1RJDA 3K0FB 4TTJA 5C53B 1K7FB 4PBRA 1XVUA 4YV1A 2JI7A 3AINA 1HQKA 1QO0A 4YAOA 4Y2GA 4B85A 4MPDA 1A9PA 3V3KA 5C7OO 4Z4IA 1DJPA 4DR6B 4IUCS 1LDNA 1TAGA 4NZOA 4CEJA 2WAXA 1M6VB 3W0LB 1FFHA 4EGJA 4GQIA 1ZOIA 5ENVA 3DO6A 4GW3A 1TJNA 3RWOA 4ARZB 1JILA 2FW9A 5ALWA 3NMUF 1ZH6A 5KKNB 4HSGA 4AWAA 2B3DA 1D2EA 4NCKA 4JI6B 4UU0A 1XTIA 3EAFA 5CB4F 5CFOA 1OYWA 3IJPA 2H07A 3D4BA 4PU0A 5F7ZA 1GTRA 1QHHB 1BQ3A 3AUXA 4UPEA 1KH1A 3OSUA 5FULA 1UT8A 2VTBA 2XRZA 1HX7A 2C9CA 5FDFA 1QO9A 3NTUA 4MUYA 3TXYA 1U0NA 4FTWA 4RY8A 5T6BA 4NF2A 1K89A 2V3WA 3DZBA 4EB6B 2OO5C 1AU9A 3AB7A 3HB1A 4HWGA 4MVJE 2HW8A 1JFVA 4XPIB 3H2KA 2R66A 4GL4A 2BL4A 4HFNA 3RK0A 4JSRA 5CXUA 2C8LA 5CNJA 4PANA 5EERA 3B2EA 2SKCA 1E61A 3AUTA 1OZAA 3DZFA 2X9QA 4GI3A 2P0YA 4Q4JB 4XVRA 2WTUA 4MA0A 2CJWB 1YO6A 2CL7X 3EE6A 1J9GA 4FEAA 4N18A 4NJEA 4QREA 2JLAA 1KE2A 3OO1A 3F8WA 1RYDA 1NZFA 3WLTA 5B58C 2D2XA 4AJPA 2ZZKA 1XNGA 4BQFA 4MUBA 4NH4A 5L4SA 2E5FA 1SULA 3R7SA 1KRHA 3KZKA 5CD9A 4KK3A 1DBIA 1KAGA 4WOPA 5KHLB 3JZIA 1V5WA 3G85A 4P98A 2DECA 2YWJA 5E2BA 1HBJA 1QQ7A 2DWQA 3PXAA 3R8CA 4EJ2A 3GB9A 1U2EA 5ESDA 3F6YA 3KKZA 1BKDR 3FIUA 3FNRA 1KZHA 3VI4B 2GN0A 5JSZA 1Z4MA 2OENG 3RSSA 3HUEA 1DQRA 1QCCA 2X41A 5FF9A 3TIIA 4KXYA 4NOKA 4QDUA 4UM7A 1F0NA 4MHOA 2H1FA 3WRWA 5EJ5A 4C7JA 1DHTA 2VYQA 4WCFB 5F1OA 3CIOA 1G5IA 4TXLA 5EPOA 3QWHA 1R10A 2QZZA 5EKSA 5G0UA 4DJTA 3F5FA 4TZKA 3VSCA 4N03A 1CUDA 3U6BA 1PLJA 3CNEA 4F5EA 3STUA 1YKFA 4LRSB 3X43A 5E6UA 2Q6OA 3GCDA 5IXSA 4TWAA 5D87A 2WIKA 4GPZA 1XZKA 3KUDA 4NPHA 1YS6A 2OM6A 4P7JA 3L79A 2HBZA 3EMKA 3RHTA 4CCYA 4AJKA 2W6CX 3O84A 3PIIA 2H2IA 2WE8A 4LQCA 5AI9A 4QRDA 4C2UA 4YQFA 5LXTA 3B85A 1U0JA 5KJEA 4CMHA 1UK6A 5JRJA 1MHPA 2NO6A 4L57A 4RVDA 4XD7D 2YINC 1YHYA 3CZCA 4JHLA 3T1OA 3T5AA 1UZUA 4HAOA 5DYIA 3FOZA 2JGNA 5JPIA 5TPZA 4K28A 2VBGA 2HDWA 1M75A 4AF7A 4MV0A 4D46A 1QQAA 1DXHA 5ALOA 3TKYA 4BNLA 2X0EA 1ENZA 4XD2A 2XYHA 4GM0A 2PD3A 1F0PA 3QU5A 1H0SA 2WJ6A 2PA0A 4RADA 3L07A 1B4DA 3LO5A 2OORC 3W2GA 2FCAA 4IKEA 1DJNA 4WKPA 4H1HA 1N1EA 2UV8A 1YSCA 3CUTA 1U7ZA 2O5EA 4H15A 4DMCA 1S01A 1IC6A 4FS8A 4WFJA 4IJVA 1ZA1A 2P5YA 2VTVA 4AULA 2DUJA 4HDAA 4JB2A 4IMJB 4FFLA 1G6KA 2GEDA 3BE6A 4GWGA 3WYFA 4DIDA 3ICEA 1ODSA 3UYLA 1HLFA 2Q4TA 1LQUA 1RQXA 4MQFB 4PINA 3WV5A 1ZH8A 3Q7IA 4XVUA 2AKEA 2BR3A 2Q3JA 4UHJA 4RD1A 4B84A 3UJNA 3PKIA 3F98A 4RD2A 5DNAA 1N33B 2C1ZA 4P08A 2E1RA 3FGZA 4Y7CA 3ND8A 3ZNNA 1RLIA 3P5BA 1P9LA 4IWNA 4JX8A 5CVCA 3RRZA 1FTNA 1MH1A 3NOVA 4IFTA 1JWAB 5FI0B 3TW8A 2X9NA 3VV2A 1IZYA 4G5GA 4M4SA 3BCRA 2A4MA 4DJEC 4G5YA 1SXJB 3TVDA 2AYYA 3SM9A 1JHRA 3IPLA 1ZJ6A 4RYLA 3PLNA 4QU9A 1A7JA 3CPJB 4RZ3A 5IABA 2X0KA 1NVAA 4UXJA 4JB0A 1MC1A 4KDFA 4EHDA 1MD9A 3WI7A 3C8ZA 3ENZA 8MHTA 2PCLA 2X8WA 3BXEA 1L7OA 1LTQA 1JHPA 4MKFA 1GQRA 3LPAA 3GVCA 4XGRA 3TNYA 3KQHA 1U2PA 5ALHA 3RDPA 4M1QA 5H1YA 2WG2A 1SURA 5DRYA 2FFAA 4MV3A 4ZTBA 5HKLA 2FQXA 5E2AA 5L3ZA 2YUTA 4BP9A 5LQNA 2BP7A 1W59A 5GGXA 1XZPA 1TMYA 2V7VA 4INAA 4I19A 4MYSA 5C8YF 1Y5IA 1GTZA 1Y63A 5CP8A 1TMKA 2P3SA 4M0FA 2YXEA 3FGNA 4A2CA 1NBEA 3FTCA 3QHQA 5J1TB 1YFKA 2IA5A 4F12A 2HCBA 4OM8A 3FWNA 4GP6A 2HO4A 2GARA 3PJDA 3EMVA 3P9ZA 3AHJA 1E7QA 1LPMA 6YASA 4HEQA 3C2QA 1KEUA 2VL7A 1QIFA 3CTPA 2IPLA 2WI8A 3H84A 4NNPA 3DM9B 3ODGA 3T1YB 2OHJA 2BM8A 4PCUA 3E9ZA 2RHOA 1TCBA 3IVGA 3M5WA 2H06A 2RGXA 2Q5EA 3RPEA 1KAOA 4I1VA 2X3YA 5BSTA 3DOEA 5ALEA 1Q0PA 4DLKA 3E81A 1EFRD 1MB2A 3BIXA 3V1UA 3Q6NA 2BFOA 3ZWWA 5I7HA 2BZGA 3KNZA 1FDTA 1PNRA 2JARA 4Q3AA 1DPFA 3FMFA 4G1CA 3CH7A 3NDRA 4BIIA 1CY0A 5LIRA 3QBJA 2UKDA 1BMFD 1ENPA 2D2IA 3TXAA 3W3AD 2RGDA 3RT1A 1GZ5A 4BO4A 1VDMA 1NBOA 4AM8A 4B7XA 3F7MA 2XXAA 3OKFA 1K7CA 5SYNA 3U3XA 1QCYA 4Z4EA 2IHKA 1IY8A 2JGJA 3W7BA 1Z26A 4LYHA 3KQOA 1C9YA 5CNKA 4C6HA 1AKMA 3WV4A 1NQXA 2HAEA 3UAZA 1BDHA 2R25B 3CNNA 2YMPA 3H9CA 4RY9A 3VZPA 1FTYA 1EM8B 1WLYA 2LBPA 3EB9A 3TJMA 1WKCA 3BTSA 5JI3E 5DYNA 1TYEB 3VTZA 4GOXA 4RUKA 3W6ZA 3JQGB 1R6UA 1W8IA 4N76A 1VIYA 2H1HA 3A3PA 4BFZA 5IVHA 3SK0A 1WUKS 4E30A 4UQOA 1Q1AA 3TTYA 2IP1A 4EG1A 3ZHYA 4EGAA 4FMDB 1XMSA 3BC1A 4AN0A 1KSJA 2DFNA 3HB0A 4CHTA 1XU4A 1XU9A 1YE8A 3DTVA 4BQPA 1AC5A 2DRIA 2QUIA 4N3NA 2FF7A 4M6WB 1NG9A 3NHRA 5KHAA 4ZGBA 4BKRA 2DC1A 5TVGA 1PQ4A 5JATA 2QRGA 5H5JA 3FLMA 3Q8XB 1DXYA 3K9QO 3ZJ4A 2VJAA 2PX2A 1T4GA 2DHDA 2QTZA 4UTPA 4GRIA 4J16C 1NMXA 4J2TA 3V2UA 5IT9A 2IYVA 3SEQA 1RLMA 1AKVA 4FFBB 4MB0A 1JZSA 4OYLA 3OTWA 4REOA 4UQPA 4EM6A 2Q50A 1PNOA 1SVMA 4EZIA 1AGYA 3QLEA 2K6GA 4NQRA 3RQIA 3I4FA 3E9MA 5JD3A 4DEXA 1IEVA 4E03A 4WXPA 2JIRA 5LU9A 2GN8A 5E9JA 1DKUA 5GJVC 4N01A 3T7TA 1RJEA 4C07A 2R84A 3UWKA 4MUKA 5JEDA 5CTAA 2ZZNA 1H4SA 4RF2A 3F1KA 4Q24A 4LGCA 4OHKA 4TV8B 3E84A 5JH7F 1FNSA 1AF4A 2IUFA 1COWA 2VNSA 2ZJYA 2JI9A 3CVOA 3GPCA 4IV5A 4Y2XA 4CKCB 4BO5A 2A5LA 3RUAA 3RC8A 1WTCA 2II6A 1GDDA 1FP1D 2XGMA 3HJTA 4RTNA 1XEXB 4H7KA 3UW1A 1KVQA 3LJKA 5L6MB 2D0PB 1L7VC 3HJGA 1Y9ZA 1CVIA 1ESNA 1Z6YA 5DHAA 4WNAB 1GTJ1 5EP2A 2JD0A 2PWZA 3FCUB 3I1YA 5BXQC 1KEEA 1SC6A 3K9LA 2AE1A 1XD9A 1BGVA 2BZ1A 3VKHA 3GUUA 3MJSA 2H4WA 1WS6A 2DY0A 1FE8A 4RK4A 5FPKA 5K0EA 3HN6A 3OMLA 4IYRA 4O2AA 4LYFA 4RL6A 2ZQYA 2PG3A 3NP9A 3QYAA 5FHRA 1E0KA 3DHVA 2OGWA 3AUKA 3L8DA 1TK3A 2CBGA 2FZEA 3Q7PA 2WHRA 2QTVB 1DRKA 3OWXA 1L5LA 4C4AA 2QENA 1FDUA 1ICIA 2W11A 2ZI5A 3TEJA 4HPXB 4M0CA 4X41A 1YDWA 3AF0A 5C81A 4C7KA 5D3KA 1W0CA 3F5DA 3UUWA 4F8JA 5LKAA 4HGOA 3AIKA 3L4BC 1VRWA 3NIDB 5D2CA 3ESYA 1RTTA 5ALMA 2QJRA 5FJJA 5FXMA 1HYEA 5A5GA 4PV7A 1AMNA 1A9ZA 4XUEA 3WKCA 1QJCA 2O2EA 3WO0A 5I7UA 4D02A 1BVRA 3AVOA 1Q2UA 3B2QA 3OCWA 2C9DA 5EIXA 3GJXC 1CUEA 4MS4B 4X63A 5DCLA 5EQDA 5JALA 1W96A 4YAUA 2Q99A 1U8EA 3U4IA 2PL1A 2BDTA 4G8CA 5ALQA 2BCEA 4ARVA 2AC7A 3CWCA 2YXNA 4O4HA 1KMCA 1I1QB 3A0UA 1VLJA 1XTJA 1I7LA 4KQGA 3T9FA 1ORVA 1QYXA 1MAVA 3KHUA 4ZCLA 4JFAA 4MPTA 1KI8A 5IVDA 2VPWA 2D3TA 1TYBE 2G72A 2PQMA 3AV3A 4PRKA 4RZIA 1N5JA 2VSQA 4ZYXA 3ILVA 5KYWB 1NYLA 3TFOA 3GA0A 3D3NA 1YRWA 1NP6A 4QUBA 4PLCA 1E96A 4Z1MD 4PZCA 3ROQA 1W4AA 1X14A 1F2TA 4OOEA 4Z99A 5ALDA 2Q7OE 3V2GA 1BDJA 1V47A 5T7BA 5L3SB 1Z0DA 1IK6A 4G26A 1OKKD 4YXWD 1EXNA 3N8NA 4GM4A 4CDNA 2J6IA 3QF4A 4NFHA 4EQ6A 1SC1A 1ZI6A 2QTHA 3AT1A 3JQRA 3CNLA 4MWSA 1E98A 4LDRA 1CULC 3Q6MA 4PONA 2I3AA 5J2TF 4KNVA 1XTBA 3AQ4A 3QMVA 2ZIZA 4JLVA 4B9AA 2IEZA 4FBMA 3BB3A 3R3UA 3S68A 4A0GA 1XD8A 2OO3A 2VDOB 4MRRA 4KX5A 1Y8QB 2GEJA 4NESA 2RBEA 2GMWA 3L6CA 4KQ9A 5ALZA 4MI3A 1XF1A 3SSNA 3OTIA 3PVCA 3TQTA 5MN6A 2C8JA 1MOQA 3VNRA 4F3CA 3DV9A 2WAMA 4AMVA 4O5OA 4J1NA 3JD1A 3KDAA 1E7YA 1PN3A 3LIPA 4FEYA 4QRHA 4D8TA 4DBLE 5AW9A 3SHFA 2PUBA 3BTUA 2FX3A 4HEHA 3R23A 1U8UA 3JU3A 3RGGA 1U5BB 2AEJA 5KVCA 4Z8YA 5DK4A 2Q62A 1JG3A 1WPQA 2BWJA 5K05A 3IC5A 3UJPA 1G4HA 1GPBA 1WBJB 3QX7A 3C97A 3DVAA 3TW0A 5D7NA 2F3QA 3U19A 2IPAB 1KXJA 1ZIXA 2ZT8A 2BVNA 2JGDB 3IBCA 4JK3A 2QRNA 2WAAA 4TLCA 1F5NA 3OZAA 3N6XA 4TL7A 3MEQA 4BQQA 1L4MA 1RE0A 3KKMA 1RKQA 3WGUA 4E5KA 2IF2A 2I76A 2Y05A 1FMTA 2XCOA 5DXJA 3HVIA 1D4ZA 2GR9A 1E2KA 2IXBA 4I1YA 4UAGA 1FRNA 4WPGA 4YMVA 1PDWA 3CONA 4FE3A 3EVNA 3JQAA 4BO6A 3PICA 4K9NA 3U7JA 4MUNA 3CUSA 3CO5A 3PWSA 2DSNA 1A1VA 2EF0A 2RIRA 3T5BA 2EQ5A 2JLVA 1RBMA 2JI8A 3FUVA 1XU7A 2QYHA 1DAHA 1LUAA 2P2NA 2V6IA 2PKYX 1TQ2A 3Q41A 4LJ8A 5DGIA 5TGZA 2PKXA 2AN1A 2XB4A 3D4OA 2XQGA 3LZ6A 3SFVA 2ORYA 3TR0A 1HRKA 4Q47A 4YCSA 5CBPA 2HCFA 5BUCA 4OSPA 5AI6A 1QZXA 1ZDMA 5ECGC 2H1IA 2XNHA 2IEGA 4FCVA 4J7UA 5F64A 3IIKA 2F64A 4ZQBA 4ICIA 4EG7A 1NU8A 2AR7A 2HJ9A 3NHBA 3L84A 1RYNA 3RNLA 1TMOA 1T43A 1W19A 3QTBA 2ORED 1GPKA 5JQGB 2VUTA 1J1IA 2GS9A 2JJMA 5DRTA 1M34B 3PA6A 5ILQA 1YONA 3HMKA 3CPHA 4QTYA 2XUPA 4HP8A 1X1BA 3HV2A 1XDBA 3ET5A 1EDZA 4DANA 1FQOA 1M8JA 2YIJA 3AR9A 3P9RA 3IXQA 3ZJUA 5DHRA 4YJ3A 2YJGA 1IM5A 2XKJE 2YFKA 3V7YA 2BM9A 4EB8A 3PRKE 4HLNA 2JATA 1RXUA 4RE6A 4EGQA 1ZL2A 2VK8A 2YV3A 1DIBA 1HYHA 4D0GA 2VJCA 2DFPA 4AMZA 1K97A 2V4MA 3KQLA 1G8GA 4U39A 4KQEA 3KR1A 1JLMA 2J3EA 3UKJA 5AVSA 4QPCA 2MOKA 1VG0B 1Z8DA 2HPHA 2YVQA 2WKPA 3GD5A 4CM5A 2WTEA 2JFUA 2HRBA 2ANCA 3AR5A 3DHNA 3F49S 3I83A 4KVAA 4FMDF 1PEKE 2YWDA 4MVYA 4PQGA 4WWHA 3G9ZA 2EKZA 3AKYA 3MT0A 1TM1E 1V96A 2P1RA 1YJ8A 4YJ2B 1D03A 1AZLA 3ZUGA 5CLJA 5AVZA 1B0PA 4JVNA 2JKYA 5GZ3A 4ZHQF 1YQXA 5HDQA 4W9MC 3QVVA 4FGWA 3QVXA 2ZB7A 3IXMA 3OLWA 4HI0E 5TXGA 3WYEA 3EPKA 4I8XA 3NC1C 2Y66A 1N0HA 1JJVA 3VU9A 2CXXA 3CRZA 4HMOA 2W6MA 3C5HA 1UCFA 3C6XA 4GNRA 4RENA 4WCFC 2UYHA 1UPXA 3WIDA 4PFSA 2KE5A 5E4JA 1Z13A 3R0ZA 2H51A 3BWEA 3WMRA 2LDXA 1QRAA 1SHLA 4ROSA 4YXFA 4ZOQI 4DUZB 3CW9A 4PG4A 3REGA 2RHLA 5BY2A 1SVLA 3AJRA 1N0VC 4GMHA 9ABPA 5HKAA 1KK0A 4PYKA 2F1HA 4YCNA 3JQ8A 3PDCA 4C0SA 1M66A 1PNTA 2GHRA 2R6CA 4OMDA 3ZDXB 3QSYA 4F2HA 5JH7B 1XTPA 4MI6A 1PR2A 1LF5A 3DDUA 4GLJA 4MP6A 4O2BA 5LZ8A 4HDNB 2V7XA 4XIJA 3RK4A 1M5RA 5JROA 3PXDA 1JDBC 4JH0A 4LMBA 3G2OA 3SCZA 2FX2A 4GQBA 2BI4A 5LQAA 3CLUC 3L0CA 1SA0B 4X6UA 1NQOA 3G8CA 3BCUA 3WZMA 3JAWA 2WT4A 3BDIA 5CM8B 4I55A 4YECA 3IAUA 3MWEA 2R1UA 3BXXA 2OMEA 4LJ5A 1KR2A 1M1UA 2G88A 1LVGA 2NO0A 4IUDS 4MJXA 3GF4A 4HRYA 2XRFA 4NEQA 4WCVA 4YK7A 5F7OA 3LI2A 1JMYA 1IXRC 3HRIA 3QLUA 1IB6A 5DBOA 1W85B 1AKTA 1ULTA 2OHOA 2X0IA 3AHCA 3F7OA 3IUSA 4Y2JA 1C9DB 4P82A 1U1IA 3P9NA 3P0HA 1M73E 3NBYC 3M34A 2BEWB 1KF0A 2XJ9A 1T4BA 2MSKA 1GLVA 1C7JA 2QMUA 3CVUA 2JA2A 3EGVA 1GUFA 4R2XA 1OWPA 5FCDA 3HJBA 4CEHA 4BCBA 2UXBB 2FPWA 4ESVA 4JYBA 2QUAA 5CB8A 4F11A 3B1FA 4FOPA 3DMTA 1YMVA 2ZWOA 1VKOA 3LYLA 1OREA 1ZI8A 3OSZA 5HNKA 2QUJA 1XBTA 2BKVA 2IVZA 4FSHA 3C3AA 4D92A 1TZCA 5B36A 3AM4A 1YAHA 2HMSA 4Z7OB 2J0QA 1LA2A 5K6AA 1GCIA 1CR2A 3CNBA 3EPPA 3IAEA 3NT4A 5IVPA 4J0QA 4F91B 4XWYA 3KZNA 5FPPA 4LDNA 1IOWA 5K09A 1E4YA 3ITEA 5EIBD 1KQGA 1KO1A 2FZGA 3E70C 4MQ5A 1B8OA 1N77A 1EQAA 4ND5A 4R3WA 2EKPA 1T2UA 2OT3B 3G5TA 1MZPA 2CZQA 3KD2A 1DFHA 3IR7A 4YRIA 1L5YA 2I2WA 3KV1A 3E2IA 3PHGA 4ZQHA 4R7ZA 3S99A 1GKUB 1YJAA 3STYA 1W0JA 4B7ZA 3PFHA 1SXQA 4NE9A 1J90A 5K01A 4TPKA 4S0ZA 2V55B 4LZJA 1BD4A 1YQ9A 2OAGA 2Y9PB 4CIYA 1GT91 3C3MA 3CF6R 3CW8X 2XUOA 3T5MA 1RAIA 3TLKA 5BUSA 1UPUA 5HIAA 2EWVA 1PTJC 3F67A 4XWGA 1WKBA 4FYXA 1XV5A 1NYRA 3E9YA 1AQNA 1Y1QA 2YN0A 2O4UX 2JHPA 3SDSA 4JVSB 4GI1A 2YBDA 1RZRD 1PL8A 2X6TA 1SGWA 2D8AA 5DTMA 1J0AA 3EZGA 5IBQA 4CKEB 2O1SA 1FLDA 1DCKA 3MLBA 4WI1A 1QVVA 1TCAA 2OESA 2X4DA 5DI9A 2PMKA 3WJ2A 1ABEA 5KQSA 4TKUA 3IT0A 1SUEA 4R68A 1F20A 4U00A 1B42A 1OT3A 3KB1A 4XQEA 4CR6A 5FOTA 2A5JA 3QKTA 3GMTA 3QQ5A 3R5KA 3IOEA 1I3OA 2VT2A 3RHSA 3UO8B 5B5SA 4EARA 4UUMA 3RS8A 2I71A 1GNTA 2C5EA 4DXHA 2IDMA 4D97A 3ERCA 3MCVA 4EG0A 4KSCA 1GG9A 3D8NA 2BFWA 4CMCA 2VHWA 4FHGA 1V1MB 2B8TA 4YALA 4JL6A 4ZARA 4BNWA 5IWCA 3M81A 5KUTA 1UBFA 4HEA6 1ZW1A 2NADA 3S6JA 3CLUD 5EJ8A 5IJ0A 4TLEA 2EP8A 1E6WA 3D9QX 4DM7A 2PBZA 4MINA 2XUAA 2JLUA 3IUMA 1QVWA 2AF4C 2WPDD 4HFMA 3RIMA 1RRKA 1JDVA 3QLUC 4MGZR 5GV8A 3VU1A 4EL5A 3L4KA 1USUA 1FC0A 1N6LA 3T9CA 3HB5X 5CLIA 5KB3A 2AJCA 2V98A 4GLBA 4LVNA 2L17A 3RQSA 2JGFA 4Q03A 1R66A 5BV2P 1YCGA 1PHRA 2KYRA 2ZUUA 3QG5A 1VXRA 4FDMA 4JOBA 1KDRA 3K8ZA 5FTWA 5FYDA 3N53A 3S2EA 3GIWA 4BJ6A 2WICA 2FE4A 4V0MA 1QFJA 4R5MA 4RK7A 1E6KA 1W5EA 1M7GA 4FFRA 3WAJA 2CBXA 2G7MC 2COEA 1WZEA 4L02A 2X3UA 4L1KA 1ZJYA 3VOTA 3L6EA 3A7EA 4CQJA 2BMJA 2CV2A 1TYAE 1UK9A 3HSSA 3LHDA 3ADBA 1JG7A 2QMQA 4JB8A 3NT2A 3RTCA 3RUFA 3WL4A 4B3HA 1QRSA 3STVA 2Y27A 3F5MA 3GGGA 3QVWA 4EHNA 1Y4DE 3MRVA 3UMVA 2I6TA 1XZEA 3IDAA 2HV9A 3VC7A 4CBVA 1UMBA 2BFDB 1FSZA 2I2XB 2XNDA 4IOKA 1XLVA 2WOOA 4PICA 1QQ6A 4X1KB 3NWOA 3TBFA 3VAAA 2PX4A 2PXXA 1ADCA 2FZ4A 3JRNA 3VMFA 2UZ1B 2XD9A 3PQ8A 5KIAA 3QXCA 1RWBA 2RHDA 2VI5A 5CPBA 1UBHS 4Q4DA 3QX9A 2FPRA 4F97A 1YRBA 1R9MA 4KYVA 3RIYA 3V2IA 2J3KA 3DDHA 4EUHA 1ORWA 1T10A 1G41A 1XPJA 1WW2A 2ILTA 2P9YA 4HAZA 4IHAA 4I6GA 3GOHA 1AGNA 4YP7A 2NQ2C 2XLCA 2GZSA 3FSEA 3H5TA 1JHDA 5CM2Z 4XYEA 3IQFA 2GLUA 5C7IO 4L76A 2DQYA 5KC9A 4DR2B 1P74A 3ZE7A 1KK3A 2O2XA 3JD4A 4QEDA 2XMRA 2L82A 3Q88A 2YZMA 3H1GA 3G8AA 3AERA 4R71A 2R5NA 4FZJA 4JT2A 5EWJA 1O7JA 2HSDA 3PGVA 5JJLA 2C97A 2RBGA 3DE3X 4LJYA 1BOOA 2Q46A 5ILGA 3PPIA 4KVFA 2GK6A 3FWZA 3K0EA 5EXDA 4O8ZA 4OQZA 2G80A 4HAUA 1MX1A 3ZEIA 5JVDA 4HH0A 3PDUA 4DEVA 2J3MA 2P41A 3GUZA 4IFBA 1AUPA 1Z4IA 3FVRA 4P36A 3RTEA 2AL7A 4YPFA 4WXHA 5EJ9A 4LTNA 4DDMA 1D3AA 1KVUA 2E21A 2PJDA 3F9RA 3FFBA 4XW2A 1WL8A 1XXLA 4L07A 3ZWOA 1E2JA 2JIPA 3KSUA 3Q4GA 5C34B 3H17A 4J7AA 4MXDA 1T25A 3CH5A 1FX0A 3EVEA 3GJTA 4Q1VA 3LQKA 2NSDA 4KQ6A 3KIPA 4Y8VA 1K68A 2J9YB 4JQSA 4LBVA 1KJ8A 2HCJB 4QQ8A 4EX7A 5HFNA 1WF3A 1OBHA 3UZUA 5LJIA 1KMHB 3GFTA 2A8YA 4I2VA 2JJ2A 3EPRA 1V8DA 2LGJA 3O8OA 1CQZA 1ONPA 2Q2VA 5AYVA 3HNRA 5DVZA 2RBKA 2XE8A 1M2GA 2ZT5A 5I6DA 2OTCA 3IAHA 5K0CA 1CKEA 2G9ZA 3DGFC 4UZSA 3I76A 3M4YA 4C9BA 4U7JA 4F6LA 3Q1KA 2FSHA 4G4SP 3GDOA 1MOSA 4MITA 2XQVA 3G6KA 4K9LA 4TKUB 3S55A 1PWZA 2XDAA 1QOPB 3P0EA 4X93A 5JBNA 5JAMA 3PG5A 3VTKA 5CFMA 3LUKA 1BH2A 4M1OA 2YYZA 4YRGA 3IEKA 1Z7YA 1ZRMA 2JJ1D 3L6UA 4QBIA 2PK3A 2QAIA 2XCLA 3IP7A 4QU8A 1N2CB 4NV3A 2GGSA 5EZQA 4GLFA 1VE3A 2SECE 2V7GA 2XVMA 4ZXFA 1I3CA 4NJEB 4FN4A 5BW4A 1SRQA 4QX6A 3IUEA 4Z0TA 3RYIA 1J56A 4MROA 2VEDA 1P44A 1WEHA 3OZBA 3TZHA 1UBCA 4KPFC 2X86A 2G63A 3PA8A 1VG1A 4C0HA 3STXA 1GPYA 4OHBA 4MQLA 3OU6A 4PG6A 1Y42X 1J24A 1EM6A 3THXA 4XIIA 3G2KA 4CQMA 3DBHB 5LP6C 2XNCA 4UKDA 1P31A 1GARA 1C1YA 5F2EA 4INJA 1E1RA 1FQKA 1TXGA 4K2HA 3KJEA 3NH6A 4KQWA 3ZYZA 3RF7A 1ZH2A 5BN4A 3DLBA 4IJ5A 4NEGA 2VDJA 5JD4A 2WE7A 2YWHA 1KYVA 2GXUA 1E59A 1TVMA 2FEKA 3Q11A 4G23A 1X8JA 3LVQE 4CR8A 4G0QA 1YVPA 3FVWA 3VR5H 1QLHA 3TSYA 1S2IA 2H4YA 2XZDA 4QHTA 1M6VA 4O1MA 3GJRA 3ASYA 5T64A 4D4MA 2HK8A 2WDZA 4KXUA 4FLMA 1DCFA 2FJ0A 1Y37A 3WSVA 2FPOA 3FYDA 2WD7A 3QK7A 3AR7A 1CNFA 1G3IA 1YOVB 1AX9A 1FYVA 1O94C 2WG0A 3DTTA 1HMYA 2HMYB 2ACEA 1J2UA 3TBHA 2EKLA 3PNLA 2O3UA 4DUGD 1N6IA 3P9PA 4QXPA 5EUBA 3IP3A 3Q15C 1ZGBA 1USKA 3DF9A 2F7SA 4JJAA 3E61A 2HMUA 4PAOA 1O6BA 1ZCAA 3C43A 4KQFA 1SBYA 4LQ4A 5IAOA 4S3MA 4BFXA 3IDQA 4WN3A 5HRCA 3BN3A 4EDHA 1COWD 2E4UA 2WEKA 3AI1A 4FEGA 3UJAA 3GNSA 2QX8A 3FPSA 1N5OX 1R4ZA 3DO5A 3SQNA 4R7TA 3WKEA 2UZ4A 2DWPA 2ODAA 4JELA 1SU6A 2DWOA 3M70A 5IKEA 1Y89A 3VU9B 4FXPA 4MGIR 5BOSA 4I4TF 1XZ8A 2C7VA 4G86A 4M86A 2OAEA 5G41A 3COSA 1H2XA 2BZ0A 621PA 2WW8A 2H29A 2I1LA 3B78A 1L8XA 3DVSX 3IALA 4M1WA 3U4CA 2ZDHA 3RC2A 5JAHA 1MIOA 2OLEA 2MWMA 3PI7A 2VK2A 1YR1A 4KFTA 4PNPA 3NTVA 3ROXA 4LZNA 3W6UA 1QFYA 5LNK6 2HMAA 1LSJA 3QA9A 4JYCA 2YWGA 7REQB 2P69A 1S2NA 1W7AA 2O48X 3EG5A 1NQ5A 1C9NA 4W7SA 4YJDA 5K4HA 3KXPA 2GAAA 3A4YA 5FBLB 4MH0R 4FWBA 4G6ZA 2CD7A 1E3DA 4IDBA 4OHMA 4RE5A 4R05A 3UB3A 4LHSA 1G6HA 4QJBA 1B76A 2YWXA 4RPLA 4JT9A 1E1CB 1U7TA 1X7YA 2R751 5JD5A 1O0BA 1I14A 3KXIA 3U5ZB 5JAPA 4BWVA 4KQKA 3IJRA 1RC8A 1CR1A 4ZHSA 3AGQA 4FHCA 4DT1B 4O02B 4MOWA 2OV6A 2C7QA 4YRKA 2QK4A 2DPYA 3T4UA 2OYCA 1N5RA 1V9LA 2ST1A 1RWXA 2PH7A 2RCYA 5A3JA 1P1BA 4ZZ1A 3Q3CA 3VFDA 1LY1A 3D3KA 2WSSA 1N4DA 3DFIA 4NMXB 4U8HA 3W8NA 1AURA 4HWRA 4RHCA 2QG9A 4CM9D 5KYXA 1K4YA 1RZVA 2GPSA 4RPCA 1CQXA 5AK3A 3X3HA 1OLSA 3TOXA 3AH8A 5A1TA 4PAMA 2WF9A 3LKVA 1XRSB 1MO4A 3BE4A 1XZHA 3TRIA 5K0JA 1L5HB 2VHJA 5JVDF 1EMDA 5KKCA 1CEEA 4JGIA 1I0ZA 5JDCA 3WJ7A 1REQA 4GP9A 3H6HA 1PYDA 1WDTA 2NZYA 2ZP1A 4ZQIA 3VPGA 2RIPA 3TW6A 3DVAB 3A6PC 2AN3A 4R8SA 4PPYA 1X7HA 4NSNA 1PR9A 3NOOA 3NBKA 1Z15A 4IIVA 2IHYA 3EXIA 4U7WA 4IG4A 3KOYA 3JWPA 1Q1GA 5EJMA 4C7BA 4DVJA 1FW8A 2IOFA 3W04A 4TZ0A 3HXQA 2GTIA 4PTYA 5KSOA 4KREA 3AG5A 4KXLA 4IQGA 4ZOAA 1NRXA 1NIPA 1M1XB 4RSHA 1YH3A 4ZJPA 3QKUA 2ECKA 2PUFA 3R75A 3S7ZA 3F3YA 3PL5A 3ZU3A 4F3KA 4NVRA 2NPOA 1FFEA 4G3XA 3MS2A 1EHIA 4RKFA 4G89A 3O31A 4OHUA 3TEFA 4Q00A 4QPZA 2OOSA 4QFBA 2D1TA 5AXBA 3NZEA 3HEAA 4OXYA 1DC3A 1WB5A 1XA0A 5GPBA 5KYXB 2XE7A 2NSLA 4RA6A 4PYOA 2Z5LA 3T3DA 3K0AA 3K09A 1TA4A 2IEIA 3MTJA 521PA 1OLXA 1XWWA 3GLHE 5JSZB 1U0OC 1QK3A 3VHRA 3RH0A 5E6SA 3MWEB 2HJGA 1APBA 1FFYA 4QUJA 4A6PA 3KAQA 4B73A 4FZ3A 4PLFA 3VKVA 2LXNA 1E0AA 2QW8A 1CJBA 1P72A 2PQ0A 3IBGA 3OFKA 1DX6A 1O4VA 2BI7A 3HCOA 1L6RA 3PNOA 3EQ9A 3B89A 1XCLA 3DULA 3MMPA 1Z6QA 3IAS6 4CFZA 2Q0QA 2PAFA 5BWMA 5FBWB 2AWNA 4JEHA 4XDHA 3SC2B 1G291 1V2GA 4B6OA 1T0JB 3EF3A 3UG6A 5KNBA 4AG6A 3FCXA 4KNWA 4HH4A 1WF6A 3A6DA 2YHSA 1ZR2A 3NV7A 3TLZA 5CCDA 4OLHA 4WFIA 1JH9A 1AG9A 4IDDA 4HN2A 4NULA 1FFAA 4YLGA 3IP8A 3QHAA 3RIXA 2M9MA 1PCXA 1SWVA 1WE2A 4BL5A 1Y7TA 5JAUA 1PJLA 1ECFA 3CT6A 1SWWA 4IILA 4PQFA 1YULA 1GYQA 1E1NA 5HA5A 2DXIA 1NYQA 2B5OA 1KPHA 3BSFA 1Z0JA 3VR2A 1ADBA 3R5SA 2W4QA 4YRPA 3RVLA 3RVKA 1WLSA 4TT3A 5L4NA 3GP5A 4RWEA 4YRZA 1P18A 2O59A 5EE1A 3K2QA 1Z2DA 1TE2A 4Z7QB 1PW7A 4ZYYA 3BGIA 4E2FA 1C8KA 1PUJA 5AKEA 3IQGX 2P30A 5EFZA 4XSHA 1P2UA 3E82A 1DXQA 3OCZA 4Z9XA 2FB9A 2FN3A 4ZEWA 1YVUA 3D3JA 3GRZA 1NQUA 2BEJA 4HDSB 4AO6A 4FR5A 4M7WA 1E69A 3RIGA 4XVCA 2FR1A 1FFSA 4DLTA 5T4EA 2J3DA 2R44A 1RD4A 2Z3ZA 4OQMA 3EEIA 2IY7A 1D8AA 2ORIA 3BHIA 1E4EB 4HXGA 4OKIA 1V8BA 5F33A 2CXSA 3MOGA 1T2AA 4YCCA 3WGMA 5JI2E 4ERXA 1EFRA 3JVIA 1AK1A 1ISJA 1JG6A 4KE9A 4LVUA 5EA2A 5H70A 1S2LA 5CA0B 1RJGA 2INGX 1M6HA 3NIFB 3RVSA 1UMKA 5F35A 3R9KA 2QI9C 3ZV4A 1BH6A 4OXNA 3UPUA 4JYAB 1H9CA 3LUPA 4YJKA 2PO7A 3T9EA 3N0VA 5K0LA 4O2AB 2RARA 4QPDA 4AMUA 3DGEC 4FHDA 4MRVA 5M3BA 4D8YA 4US1R 4DC1A 3NV9A 1U6KA 2C3UA 2YN2A 4AT1A 3PX7A 2W00A 3C8UA 3RUDA 2P7HA 1T2EA 4NQZA 3TH5A 4C76A 1NUTA 5DMHA 2HPVA 2BBOA 2QQEA 3VX4A 4DZTA 1YACA 2K2QB 1M6YA 4CETA 2CKDA 3WG9A 3DTYA 5KDDA 4EZEA 2ODPA 4ESEA 1KIFA 3OT4A 4JLNA 2FZVA 3TPCA 1E9SA 3UWMA 4AP9A 1N34B 4D7AA 4TZ6A 2ZYTX 3EDCA 2KX7A 3BG5A 4XKJA 1FUIA 4OXXA 1H1LA 2AD1A 1IOVA 3QVMA 4E5SA 1C8LA 4G24A 4Y1RB 2Q3EA 3QVLA 4ED9A 3E9DA 4BY9E 4J7CA 2C4VA 4IICA 4W6ZA 1OHHD 2GRAA 3EVAA 1FIUA 2PEZA 1KBOA 4X3PA 1K86A 1ZJJA 2ZIAA 5E1MA 4AJHA 2DCUA 2R8XA 1PFGA 3RTGA 5C5DA 3A1WA 1RIFA 4Y6QA 1GV0A 4TTIA 4J3NA 2E49A 1R0RE 3T5DA 3G23A 3RW9A 3UFXA 2EYUA 5BRAA 3KOMA 4FWIB 4QGAA 1V3VA 2I9PA 2OBMA 2ZBPA 1XZQA 4FYKA 3DWEX 1QYDA 1ZAYA 4EPRA 2XTZA 3SM3A 4JYMA 1II8A 2WHXA 1HY3A 1U98A 3GFOA 3TMYA 5LD2B 1FJXA 3DTVB 3GZ4A 4CCSA 1TA0A 2ZJ7A 3N2GA 4WN9B 5FUMA 1JR4A 1ZNXA 2C0QA 2ZYDA 3A10A 1ZICA 5FLXA 1M1YE 3F7TA 3HP4A 3MTGA 3RYCA 3KU1A 2WB2A 5KYUA 3MCZA 4BVGA 4WBNF 2F48A 1VL1A 2GEVA 2GNAA 3D7KA 2GQ0A 1MENA 1H23A 4M0UA 4V24A 2PUHA 1KSGA 4ZYVA 3A1UA 3HXTA 4ZV7A 1VBMA 1A9RA 1GYRA 4MRNA 4KXQA 4TTQA 1ANKA 4YMTA 2GAIA 3T3OA 1EDDA 3A3OA 5AOCA 3EULA 4GKKB 2JAUA 4Y7DA 2GASA 3Q87B 3DLAA 2W6IA 3ENQA 4FCWA 4NAHA 4DV4B 2BR5A 5AM4A 4RVGA 1KJQA 4MRMA 4YO8A 4ZODA 3THWA 3QEAZ 1RS0A 4P53A 3N8HA 2BGLA 2ZUTA 3A6EA 4C0WA 1I36A 3M1YA 3P26A 3HC7A 1W5TA 4JD5A 4ZCRA 3IURA 3LX8A 3CRQA 4J2OA 5CCXA 4UXIA 3C3BA 3HZOA 2EX1A 3BICA 1IONA 1XF9A 3BMQA 4M76B 1ZK3A 1UBMS 4UEWA 2C2ZA 4X9XA 1IFXA 2AT1A 3SVZA 1P1RA 3QMPA 2JFQA 3LQQA 4UAUA 2PH3A 3A4LA 5EG5A 4BX0A 5CEJA 3E3LA 3LKZA 4JQZA 3QENA 1XHFA 3KLMX 1P62B 2CDRA 1QQTA 4HH1A 3GK3A 1H2AS 5MN5A 2Y1EA 1F2VA 4QOSA 3ORYA 4J1QA 1ZNZA 5CYPA 1UKVY 3IKMB 3DXFA 4HV4A 3ANNA 3O1JC 1AOXA 4I81A 4R8RA 4K6FA 5TQ0A 2YOHA 7AT1A 3PR2B 2JZOA 2OFOA 4CKWA 4LOIA 5K9ZA 3MAJA 2MJLA 4YONB 1YFJA 4BKQA 3QX3A 4NFLA 4WVFA 3KQMA 3TDKA 1F4VA 5B53A 1GT6A 2PY6A 1LZKA 4HAYA 3C7TA 1DC8A 4IZHA 4W8OA 4MICA 5HCNA 2R1TB 1B15A 2O8CA 1BMDA 4FXOA 1FMCA 1OXTA 5HF8A 4MS3A 2OD2A 1OAOA 3OX1A 3OD1A 1HURA 1QGZA 4H7FA 5F1PA 1NVMB 4XYGA 1G8HA 4DT1A 4E13A 4EKNB 2X2PA 3NTXA 1MJGA 4TT3D 3V1LA 1KTVA 1ACMA 3HXOA 1YB5A 3KQYA 1T15A 2D74A 4NAUA 2B34A 1OJ7A 4P7KA 1IN8A 2G9RA 2G1AA 3L6RA 2BFNA 1N1MA 4BAUA 4Y1GA 2FOXA 2P65A 3WSWA 5BVGA 4GVPA 1SPBS 5AKYA 1SKAA 3A36A 1UADA 4PYMA 4RNCA 3OLYA 4MLDA 2R5WA 4RTKA 4EJFA 4KLRA 3ZCUA 2YZGA 1CDOA 4XH9B 4K9RA 1U8TA 1J0EA 1JRLA 2CXQA 1YRYE 1E3WA 2DU8A 1E8NA 1P2BA 2WWTA 3CLTD 3TZKA 4KBFA 4K87A 3W34A 1Z8HA 1JKMA 1VHDA 3ZQUA 3OJWA 5KEIA 3L06A 4M7OA 1TUGA 2RKOA 1I01A 3EVBA 2V45A 5IJXA 1DMRA 1FJ2A 4RIEA 2Q5HA 2V5VA 5C5CA 1CZOA 4I2NA 1XAJA 4NFSA 4Y2TA 5CXQA 1PS8A 1SCIA 1OV6A 3ND9A 3EF1A 4II3A 5JSUA 3ELUA 1EG7A 2X4IA 3CRVA 1EWKA 1F1BA 4DSNA 1GRNA 3QOFA 4YI5A 3PS9A 2YIVX 1TLFA 1EVIA 4DRXA 2WD9A 4PTZA 4MVJD 3T5TA 3ZXSA 4A73A 1CEQA 2VBFA 4HLDA 2R6ZA 4YAJA 4M37A 5DF1A 1TGYA 3BD9A 2H1WA 4OGWA 3A4MA 4QNMA 4HAIA 1XQWA 1CT9A 3IUQA 3AXSA 3F8TA 3HBFA 3MBKA 4M3NA 4MKZA 4D0NA 3QE3A 5JQWA 3ZV7A 4PHCA 4KPUA 2CHVA 1T36B 2VJLA 1WHSB 5AQEA 2Z56A 4REQA 4QAJA 1GQ2A 1N2XA 1ZH4A 1OAAA 2RDMA 2VAMA 4L8LA 5A05A 1OAKA 2DT8A 4LZAA 4E32A 1E6CA 2A30A 3AEKB 1WU8A 1YB6A 1LBTA 2O8NA 3GRFA 3G8YA 3GT4A 4RVCA 3ZXYA 4XWWA 4TMFA 3EZ9A 1VDZA 1JG4A 1T13A 4BBPA 1WCYA 4NBNA 2XE6A 4H7IA 3ADCA 1NVUQ 1T1JA 1V1RA 4PGAA 2GYUA 5EMMA 5TF4A 3VO8A 1MV8A 2PGJA 3JZAA 5LZ5A 4ATNA 5AIBA 2R00C 1M10A 1A9OA 4IXMA 3WL3A 4CI0B 3IT1A 4RJIA 4V0NA 5LZ7A 4BQRA 3VMMA 3OIFA 1SCAA 2JCYA 2RH8A 4LRYA 1CS0A 4QOGA 1L1FA 5DI3A 3UAYA 4CCYB 1XMOB 2V58A 1ZZGA 2LUOA 3FNHA 1R27A 3BCHA 2QZ4A 4WK4B 5ITSA 1Z74A 4NPCA 4MGHA 1N1GA 2RGNC 3FW1A 1R00A 1T29A 5HX7A 2B4YA 4Z0HO 1ZNYA 4L16A 5LUBA 5BNZA 4XI9A 3K0BA 1PGNA 1L8QA 1DQYA 1BTOA 2QMEA 2R48A 3MTIA 5FL7A 5HGJA 1QHYA 2ZS7A 1UMCA 4G8BA 1PQUA 1ZJWA 2AZXA 1M2JA 5EMKA 4Q9DA 4RLQA 5F52A 1T5IA 4MQ6A 5KCMA 1JLSA 2PZEA 4L75A 4RK0A 4DADA 4HFRA 1I7PA 3WYDA 1WD5A 5EXXA 1NUSA 4YT2A 3TLJA 2CNDA 2H5IA 4JSTA 3NCHA 1B0UA 4S2EA 2DBQA 3H16A 2ONYA 5F73A 4POOA 2NVUB 3RSLA 5TC4A 1PT6A 1X92A 1YGPA 4MQMA 2ZBQA 4JZYA 4XGQA 4DZZA 4HNVA 4GNKA 1K5HA 4CKEA 4DA7A 1RQGA 3G0IA 4EFMA 3AOEC 3OP1A 4M9CA 1Y81A 3IMCA 3VPXA 3WQRA 5CW2A 3NHWA 1PZXA 1M3SA 4C30A 5DWVA 2EDAA 3IMEA 1U31A 3IP9A 3CVYA 1M2OA 4X20A 1N7IA 1DX4A 2AG0A 4AI6A 1K2VN 2EGGA 4CXMA 2VK1A 2UUPA 1WQ3A 5E9AA 5BN3A 4DNOA 1PV4A 1QCDA 2QP4A 3DXXA 3EY4A 4U6NA 2RKBA 3HZZA 2ZRHA 1WUJS 3QLVC 3O8OB 4GMDA 4HQ6A 1OQAA 2DUWA 3LDGA 5J63A 3GWGA 3TNFA 2QLMA 1F4LA 3ODPA 3UJ8A 3UXHA 5FX2A 2ZSUA 1HWYA 3VO2A 4N3AA 4NU0A 1D4FA 1TLTA 1R4MB 2VH1A 3ICCA 1UMCB 1R2QA 3E0XA 1NPTO 2E4XA 1HRDA 3PBKA 4RZSA 5FBKA 3IKJA 5TRTA 3TUIC 1BD3A 3B60A 1X13A 5JANA 2XKKA 1S7GA 4MJ7A 1D07A 1ZCFA 4MV4A 4OMCA 1DIRA 4RS4A 2PL5A 2EJTA 1NC3A 1L5GB 3SR3A 4Q9AA 3T35A 5ETJA 4OM7A 2VRNA 3UC5A 1T0UA 1SD1A 3L6BA 1L0BA 2I78A 3WAGA 1BW9B 2HGSA 2GBPA 3GLKA 3KTAB 3V33A 4RTMA 1X7ZA 3LVRE 2JANA 2AK2A 2X8AA 1LWOA 1IWPB 2H18A 2CDCA 1KYYA 4NS4A 3OY2A 1C7IA 1ESMA 4OBXA 2QM7A 4DMUB 2I7DA 4WERA 2H4JA 4JGGA 3FYUB 3TZ6A 5IJ9B 3N8KA 3VR0A 1IBMB 1G20B 1KU6A 2ORWA 4LZPA 3KDPA 1GZ7A 3SF8A 4NYIR 3VZQA 5JH7A 3P20A 1OI2A 2OHIA 3AETB 3LC0A 2BEWA 2WG1A 5C8YA 3LDAA 4IEEA 3HFSA 3TL6A 4CMEA 1JJ7A 1TFUA 4V0KA 3AUSA 3GP3A 1D1SA 3I09A 5SYMA 2WMOB 4OSEA 3L1VA 3ROFA 1IUKA 2B2XA 2RK6A 1KYQA 3EA4A 4Q3OA 4ZJYA 3IEPA 3NJRA 2OOKA 2QTGA 5LBUA 2NUTB 1H2YA 4GYWA 4DDTA 1RRPA 2GZ1A 1BE6A 3KR9A 4D9FA 1DRUA 3UAVA 4UCWA 2QX9A 1GXSA 1NG1A 3EIEA 3PPXA 3VR3D 1CX9B 4FDLA 3ETNA 4UUBA 1ADGA 2VA8A 4I50A 3KQUA 4PX2A 3DYIA 3OECA 1XN4A 3DMYA 5FV4A 4JUFA 1RJ9A 2X40A 3QPCA 2W71A 1V6CA 3DLHA 1E2LA 2Y1XA 2B0JA 3BFVA 1D04A 4GC9A 1CDZA 4G0WA 2XQIA 2OFPA 3JATA 2FLWA 1AUQA 2GK3A 2PGNA 4QFDA 4ZAFA 1E79D 1SQ6A 3RS9A 3EGOA 1C1XA 4LOHA 4XWAA 3NM4A 1CJMA 1QK4A 5HZGA 1C3JA 3H8SA 1A71A 3B82A 4BX8A 5JS1A 2H0AA 1CY2A 3B70A 3MAAC 4M46A 4CMIA 4NG5A 1JSRA 3P9SA 2QU8A 4C4SA 4B4UA 1PJ4A 1YCHA 2QDXA 1LBQA 4NYMQ 5LM3A 1EE9A 1TUIA 3TJZA 1OFTA 4DN6A 2DLNA 5F5XA 4M1KA 3WWEA 3HYCA 5JC1A 1TRKA 3UBMA 4KWCA 3HHPA 5E7QA 4I46A 2IW1A 2Z1DA 2ZJ3A 4QDKA 3UHAA 3ID6C 4E3WA 2WMNB 3WISA 1KDOA 3PUXA 2MCFA 1HE4A 1NXQA 5A3RA 1PQYA 4LXHA 4QYWA 5L8VA 1RQ2A 3MMZA 3OTHA 2R11A 1IY9A 2VP6A 3C16C 1OX5A 1G21A 1NN1A 2IYWA 2YV2A 3BIJA 5EXTA 4A8JA 4BLPA 4HQ0A 4X97A 4CU5A 5AK6A 1DC6A 3LSYA 3OPVA 4WFKA 5KWIA 2PGXA 3DZGA 5C1IA 4CF7A 1AKYA 4URXR 2O20A 2QNRA 4O3MA 3V8PA 4CTNA 2GCOA 1C30A 2CF6A 4FW9A 2I54A 1H0HA 3SKVA 1Q16A 2OHGA 3S44A 5JS2A 2AXPA 2WHQA 4QWWA 1D8TA 1LQ2A 5B57C 3QM1A 3IESA 3DKKA 3ZC3A 4AJ1A 1A76A 1SXJC 2A84A 2I4MA 4YMIA 3F3KA 3T4EA 3G0OA 3UMJA 5K0ZA 1UK7A 1J99A 4JOSA 4FOSA 3GA7A 1KFKB 1C1DB 5TARA 3GZNB 1WV1A 3E18A 3NXKA 3Q7EA 2WSMA 1QHNA 2I9KA 1QG0A 2NUPB 4QO7A 4G0UA 4BO3A 3HGQA 2ZRJA 1YZVA 4EFKA 3B6IA 2L2QA 2X76A 3S27A 5CA1F 5J4KA 3DAYA 1ZHHA 2Y1WA 3HKCB 4LCBA 5I7WA 5JJBA 1YJQA 2QAJA 4RX1A 4IX1A 1AE1A 5EEGA 3NONA 4BNUA 1RYHA 4CV1A 1XRLA 5B3KA 3ENNA 2QQGA 3PQ5A 3I0MA 4TMXA 3ZDZB 1DKMA 3IRVA 1EFVA 3TD9A 1O5IA 1WY7A 3G8BA 2WABA 3ICQB 3GV0A 3EHEA 2F00A 3EOAI 3T8YA 5H3LA 3WGKA 4BOYA 3ABZA 2NO1A 1CUAA 3INGA 5DHFA 5CW1A 1DIGA 2W6ZA 5I8ZA 1J0DA 1ZKMA 1M8FA 2B8EA 3UFXB 4EBFA 2FDCA 3Q8WA 4XQ9A 3FDXA 4TT8A 4EYGA 3TOZA 2EHDA 2ZFUA 3P0IA 5J59A 3KJGA 1M2EA 3H83A 4IQ8A 1OLSB 1PJBA 1U2ZA 3FOCA 2Q5FA 2YR0A 4G9GA 3ZCQA 4IDPA 3GRVA 2KS6A 1DZIA 1HZZA 3BHNA 1N5KA 4TM7A 1QHFA 3RRXA 2W6JA 4PLYA 2NU8A 1UBEA 4OXQA 2QF7A 4MPPA 3BQNB 1SQ0A 2GO1A 4PFQA 1XDSA 3FB1A 1LK7A 3C6YA 3GVIA 3QI2A 1Z08A 3PD7A 2GXQA 2QEQA 2ZANA 3GL9A 4Y9RA 5CDTA 4KI0A 4X8LA 2OECA 3P52A 5T4HA 4M89A 1HZJA 3O0TA 1DLIA 4WT7A 3UUFA 3CUKA 2REOA 3RAJA 3UTDA 3SBDA 2IP2A 2DY1A 3M6AA 5JNLA 3SHWA 4RTRA 1W88A 1Q6YA 4FYHA 5JARA 3VSAA 3GFFA 2NW6A 2EHJA 3IB6A 3O83A 4IPTA 1Z8NA 3PXEA 5I5EA 2WM8A 3O1HB 2JA1A 3AEUA 1DXOA 4Q16A 1QX4A 5B6PA 4Z9FA 4D9BA 1WA5A 4I4NA 3LT0A 3M6UA 1C3VA 4HMQA 3R7FA 4O4HB 3KLNA 4O4HF 3GCGA 3DD1A 3ONVA 1JMVA 3V4ZA 1LNQA 5KVVA 1XOIA 1ARZA 5BYJA 5JFTA 3C7KA 4AYWA 4HQOA 4D4IA 3OG9A 1OU0A 1U02A 1GTMA 3RVMA 1ZH0A 4NPAA 3TX6A 2VDVE 3H4IA 3I37X 4PZEA 4RIFA 4BXOB 1WHTB 5HJ2A 4GZ3A 2XAAA 3NM6B 3DE1X 5K3BA 2Q8NA 3X0DA 2DMRA 2DERA 2BGNA 5AJHA 4HDNA 3ESCA 4R2IA 4DCGA 1P2VA 1ZKDA 1YQUA 1NI5A 4PGMA 4PYNA 4DMLA 4NHOA 5IX8A 1X1QA 2ZYHA 3SIRA 2IYAA 3TSAA 5K4GA 2JEOA 4CJXA 2FOIA 1M2VA 1IVYA 4LY0A 4EO7A 2EQBA 1XNQB 3GMDA 3O91A 3M89A 2O52A 1FS5A 3GW8A 2IPOA 4UZEA 1M7BA 3GEHA 5BSEA 3U7GA 2R6JA 2AMVA 2HNAA 2A1TS 2MSNA 3KE9A 1AXGA 1NDQA 3G0CA 5AVXA 1SELA 3LGXA 3OD5A 1NI4B 2BDUA 3ET4A 3SGLA 2E5WA 1U0LA 3A7DA 4JJFA 1AS3A 3LHSA 1R5OA 1TQDA 2XSZD 4BJ3A 3ADKA 3TSWA 1P6XA 1J1UA 1HFEL 4KRYA 2K87A 4E1AA 1Q19A 1OB5A 3M3HA 4IRUB 1JEAA 3U26A 2FUNB 4MVXA 4F5YA 1OTYA 3A6KA 3PUKA 1WIWA 1PWEA 3SJ7A 1W88B 2P6UA 3D6TB 4J03A 5D6OA 1OC4A 4A7PA 3NKVA 4IF6A 1XDGA 3SZRA 2RGCA 5A9RA 4LDQA 1KS2A 2XOEA 2L0XA 4OUDA 2J9ZB 1QOZA 3GFGA 5KQPA 1M8KA 4OP1A 1U5CA 5JXIA 2VQ3A 1EDOA 4OU5A 2NUTA 2QLTA 3TS1A 4P32A 2Q2QA 2Y77A 3DA8A 4KLAA 4B31A 3F0TA 2A5FA 5I7EA 3BHJA 3RRNA 1EX7A 3JQBA 3L7AA 1QH0A 3A28A 4GZ6A 3CWQA 4GXNA 1JHOA 4FB5A 1HEIA 1EP1B 4KVZA 2PV0A 3C15C 3C3PA 3EF0A 3K15A 4OKSA 3WL5A 4ZGWA 4ZTZB 4R40A 5H16A 5LCXA 3LOQA 4JFRA 7ABPA 1RHRA 5JZMA 3HK2A 2PZKA 1AO0A 1TQHA 3VJKA 3RC3A 1SO8A 3G7SA 5AOAA 3HB9A 1PJSA 1ZIDA 2L19A 2QHXA 3FPAA 2ZPUA 4OI0A 2XA2A 3FE2A 2X1VA 2V6FA 1ZS9A 2FQYA 2ZUVA 1E2PA 4PZ9A 4IJUA 5JNUA 4DUYB 2FPSA 1XMIA 3BVPA 3IODA 1JU3A 2I2FA 1NP3A 1PE0A 5LMZA 4UEKA 1OC2A 3MUEA 4NMMA 4Q1AA 3GLIA 2OBNA 2Y99A 2CVOA 2X5JO 3FUTA 1QO7A 3EDOA 1SKYB 1U7PA 2ZUDA 2JFOA 1XMVA 2D1FA 1U0EA 3KTAA 4L08A 4N1AA 8ADHA 4BFYA 1PI3A 3ZI0A 1HLPA 5EESA 3B8HA 5TIIA 3H3XA 3PC8A 2WYOA 1NBIA 2G7ZA 3OU7A 4PPNA 3CEAA 3IL2A 1YOBA 2BGTA 3TM5A 7ADHA 1KGSA 2F4NA 3IBFA 3OOEA 4WA7A 3TOSA 3EVDA 5A7FA 1GUDA 1L3CA 3NHZA 5C3UA 4P7FA 4Q9IA 3S2ZA 1GGEA 5JCOC 2PSJA 2YCBA 1LJ8A 4BQOA 3D43A 5KYTA 5JCOA 1YQQA 4MWDA 4PSUA 4RQUA 4IRMA 4ZDWA 4U2FA 5CX4A 2ZI3A 1F4PA 1O6ZA 4XX1A 1UAYA 1KEZA 3O95A 3C6QA 5AHRA 4P4NA 1V39A 4G63A 3TI9A 5KU1A 1Z17A 3OIUA 2X1MA 3GN2A 4PSVA 4EABA 5KHOC 2ZQZA 4MV5A 1AUVA 3EIOA 3B5EA 4N54A 3BA6A 2V1XA 4MK4A 3BH0A 2BRUC 2GM5A 3BF8A 5FWXA 3WR5A 2IHZA 4BPBA 1V37A 1SK9A 4DMFA 1E2FA 3GG9A 3GT7A 5C37A 4NFYA 3HDTA 2ZI7A 2VBCA 3N2KA 1T6BY 4OB7A 3QIVA 3JQGA 4JODA 2HSEA 4NOLA 1RAEA 4N8EA 3PFKA 3V8NA 1Q7GA 3ZZUA 2HSZA 1SAYA 1C1DA 4ZYZA 3T9AA 1ZM7A 5AI5A 4EUEA 4A5OA 1UDXA 3DH0A 1AB5A 3KQPA 3KKPA 2QX7A 2QRMA 3WMWA 4HDMB 1TUBB 2W0SA 4B6EA 3FYSA 4CM7A 2EGHA 3VR6D 5BWBA 2RHMA 5ICCA 2HTEA 4EHFA 2YOFA 5CX1A 1LJUA 4BWGA 5LYJB 3DMGA 1PQWA 1YTUA 3DLCA 2EFJA 4CMGA 5H7XA 1JH8A 4JA2A 5I7SA 1QORA 1JZQA 3IQXA 4D79A 3KTDA 4OO3A 3HP7A 4LIPD 2KJQA 2RMKA 2PGDA 4L15A 4ND3A 4IF4A 1JX6A 3K30A 3K7EA 4BE4A 2CLDX 4INZA 1LK0A 5GZ1A 2FKNA 3PNPA 5HF6A 3GIDA 4CM9A 3NVKI 2RHHA 3CSUA 1X7GA 4C7VA 1N8TA 4RQTA 4ZC8A 4OLJA 2RGRA 4RC9A 5C31A 1O94D 3FMVA 5ITWA 2J33A 1FYDA 3IERA 4KR9A 2JJYA 3K4QA 3FWYA 4I50B 3UEOA 5BWOA 4NARA 3C6MA 3KPVA 1OW3B 4WLOA 1ZXXA 4TYPA 4BO7A 2H5JA 4EMBA 2CMGA 1C3OA 3IVAA 3BMOB 3GLTA 1MR3F 1WU7A 3KT0A 2W98A 3Q0TA 4TWRA 2BKLA 4XYMA 4UNSA 2H0QA 3U7IA 4DY4A 4CLOA 3L93A 3K0SA 3OF3A 5DZSA 3KSAC 5FOSA 1ZIOA 2JAOA 2VJQA 3CEMA 3RK1A 5KNDA 3D7SA 1GRVA 2B2NA 1PEDA 1PLKA 3LQ4A 4CKBB 4CQLA 3L1HA 1XDWA 1OJLA 1Y4SA 3HB4X 4JUIA 2OLJA 1ISGA 2IDZA 4OQPA 4LQLA 4Y9SA 5C80A 2AB0A 4E33A 2O6LA 4CKZA 2VXBA 4ZT4A 3PEFA 1AHIA 4DLZA 3G2HA 1Y8RA 4JVLA 2BJWA 2IZ5A 3Q3EA 1E77A 1CZLA 1JDNA 2HU5A 2XX3A 4A9AA 2X1HA 2V54A 4UJ3A 1NUPA 3EXEA 1SY7A 2R7LA 1BVHA 4BZPA 3COVA 4GUAA 4WDQA 1JIQA 3EGWA 4MR9B 5KPJA 1SUBA 1Y80A 4D56A 4CM3A 4GXQA 3VHQA 4C2BA 2J7KA 4D3YA 4DREA 3RUCA 4LHWA 2TSYB 1S2DA 1K0UA 1RXEA 2C3MA 5A4JA 1MFPA 4B4DA 3ZE0B 1VRCA 5ALYA 1Q0HA 2Q3FA 2X0NA 4EAQA 3L9XA 2XAUA 1CUVA 2BPOA 2C2OA 4QOFA 2HHHB 3LNCA 1ZK0A 4D5EA 1P29A 3CC8A 4NZYA 1ELOA 2PBFA 1AK9A 3HCFA 1CHNA 4N0QA 1SHJA 3SZLA 4KR0A 3H5OA 3R0JA 4RNDB 5C3MA 4Y2SA 1N2JA 5TX7A 3KFLA 4PVCA 4D6YA 3L8ZA 3T6KA 1I4WA 2YXPX 3CX4A 5SV2A 2ERXA 5BRJA 5BNWA 1UDWA 2C2HA 3UH0A 1VB3A 4FGLA 1HTTA 8GPBA 4WNAA 3FHLA 2IS4A 1UBGA 1Y3FE 1WMFA 3URMA 1OCEA 1XD2B 3FYUA 5IEBA 2P0AA 4P84A 5HGXA 1G3QA 3FUUA 1YCFA 3KVNA 3C1AA 5KO2A 2CLIB 3B3QA 3EGDB 5KTMA 3NTOA 3BXFA 1D4AA 3BRWA 5AJZA 3SLKA 3W5IA 1Q57A 4UTNA 5LLTA 4KTVE 3WIUA 2X77A 1Z0KA 4II7A 3SPXA 1V3UA 3DWFA 3MXTA 5BW8A 3L8MA 1VJ0A 4RLSA 3G9TA 3Q7TA 3SBOA 4L8YA 2GM4A 1UOPA 3W5BA 1EZ4A 2A92A 3IMGA 1D0SA 2P27A 3N3AC 3EYWA 2H1SA 2PAAA 3BH7A 4LY3A 1NUQA 2ZYWX 4RAQA 3RFCA 3L0DA 1QDEA 1Q3TA 4H6WA 3R7WB 1MNQA 3HACA 2RHCA 4FZRA 1YKSA 4AC9A 2G67A 1Z75A 4RO0A 1A8QA 4MS3B 1VMAA 3THXB 3LPDA 4DEYA 1DG3A 2CMFA 3FIJA 1YDGA 3NDJA 2H1OA 4PLPA 4KFCA 2DR0A 2QN3A 2CGEA 2H1CA 3MWLA 5DH9A 1CJKC 4HWOA 5CFZA 4ZOBA 2EARA 2QUKA 1QU2A 4NOJA 2B30A 2H85A 4BC0A 1TD1A 2OUKA 1M34E 4BV2A 2AH5A 3SC6A 2G4CA 1P3DA 4F7WA 3H8VA 1BXKA 2ZJOA 3QPUA 1P4SA 1O6GA 3U7EB 3BGSA 4G56A 4GMGA 1L8LA 3U61B 1RHJA 2V74B 3WLOA 2I4NA 3O4JA 2QQFA 4LF8B 1JNYA 2P6RA 2W6OA 4PZDA 1GTVA 2LVBA 3HH8A 3L5KA 3NW9A 3V3TA 3U60B 1L9KA 4DDKA 3S81A 3M6VA 5CVEA 1POWA 2A9FA 3AI2A 5DM1A 4BNJA 4M1ZA 2PBLA 2JLCA 3DL4A 3I72A 1LDYA 3D8TA 4ZEXA 3MNFA 3WK6A 3AVYA 3AVXA 2H3HA 2FJPA 2IE8A 4EJSC 4JY7A 2YH2A 3HR7A 3ZWYA 3CX7A 3DOHA 4HUTA 1Q44A 1T5BA 4MWTA 5DIFA 1VYUA 2ZXFA 4YQEA 3ER9A 2DTEA 3QMMA 2GA9A 1BE0A