3OY2A

Crystal structure of a putative glycosyltransferase from paramecium bursaria chlorella virus ny2a
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
392
structure length
392
Chain Sequence
MKLIIVGAHSSVPSGYGRVMRAIVPRISKAHEVIVFGIHAFGRSVHANIEEFDAQTAEHVRGLNEQGFYYSGLSEFIDVHKPDIVMIYNDPIVIGNYLLAMGKCSHRTKIVLYVDLVSKNIRENLWWIFSHPKVVGVMAMSKCWISDICNYGCKVPINIVSHFVDTKTIYDARKLVGLSEYNDDVLFLNMNRNTARKRLDIYVLAAARFISKYPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAEGAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAFTFFKDEKNRKEYGKRVQDFVKTKPTWDDISSDIIDFFNSLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a virus-encoded putative glycosyltransferase
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus ny2a
molecule tags Viral protein,transferase
molecule keywords Glycosyltransferase B736L
total genus 137
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3oy2A02
3.40.50.11930 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oy2A01
3VDMA 1WW2A 1JG6A 2VSNA 3G2JA 2XCUA 3DD1A 4CTOA 1C8LA 1J39A 2O6LA 1Z6PA 4WACA 3MRVA 4LEIA 1WUTA 3T5TA 2BFWA 3OKCA 2ACWA 2GM9A 1FU7A 1NLMA 3HBFA 3RT1A 4GZ6A 3PE3A 3NCHA 2G9QA 1JG7A 2FF5A 3E3OA 2QN1A 4HWGA 3RSZA 3D0RA 1PYGA 4EKEA 1L6IA 2QRHA 1GPAA 4X7MA 1E1YA 3IA7A 1P2DA 3L79A 4N3CA 4GZ3A 4RIHA 2AV6A 4BQIA 4LDPA 3S0JA 3D0QA 4WADA 3ZCPA 1XL1A 4MI9A 1L5RA 1Y8ZA 5D00A 4M83A 3MSCA 4F96A 5DXFA 3BD8A 3UYKA 2VG8A 1GPYA 3SYMA 2BGUA 9GPBA 4RELA 2GPBA 1XOIA 3T3IA 2F3UA 3EBPA 3UYLA 1EXVA 2C9ZA 4KQMA 2XCIA 2Q6VA 2QN2A 4BQFA 1P4HA 4GYWA 2X0DA 3MRXA 2QZSA 1C3JA 3CUYA 1P4JA 2FETA 2ATIA 3RSCA 4KQ1A 4N3AA 3T3HA 2QLNA 1JIXA 1BX3A 4CDRA 1XL0A 3OTIA 1PSWA 3T3DA 4AN4A 1WW3A 3ZCRA 2R4TA 4N39A 4RBNA 1PN3A 7GPBA 3VUFA 5IKPA 3MTBA 3MT9A 3SYRA 4Z5XA 3DZCA 1A8IA 3MS4A 3T7DA 1P29A 3CV3A 2QN9A 3BCRA 3Q3HA 3IAAA 4RIFA 2H1FA 5TVGA 2P6PA 2X6RA 2PRIA 3H4IA 4YUAA 2IW1A 3TAXA 4RIIA 3BCSA 2XMPA 4M7PA 1JIVA 3MTDA 1NZFA 2GJ4A 2XA1A 3OKAA 1V4VA 3NAZA 3WADA 1ABBA 3L01A 2F9FA 2XGMA 1L5SA 4X6LA 2SKCA 3MS7A 2IUYA 2ACVA 4AY6A 3WC4A 1C8KA 3L7CA 1EM6A 2IEGA 3OTHA 2GPNA 1RZUA 3S29A 2AZDA 2F3QA 1HLFA 2IEIA 1UQTA 3BCUA 2XGOA 5HXAA 1SXQA 3NB0A 2QN7A 3L7DA 3MT8A 2GT1A 3CUWA 2SKDA 2ASVA 2QN3A 2QN8A 2YJNA 1Y6GA 3ZCUA 3HBNA 4NC9A 1KTIA 5GPBA 4GYYA 5TMDA 3VUEA 3ZCTA 4XIFA 4MICA 1QKJA 4QLBA 1K06A 3L7AA 2F3PA 2VCEA 2IV7A 3E3NA 5TMBA 1JIUA 3EBOA 3CUVA 3GUHA 5LQDA 1FTWA 1FU8A 4NESA 3QHPA 4M60A 3RHZA 4X7RA 2C1ZA 2PYIA 1WV0A 3TSAA 2X0FA 2GEJA 1GGNA 2R60A 1FS4A 1UQUA 3O3CA 3Q3EA 1QM5A 2C4MA 2R68A 2IV3A 2G9VA 5ENZA 1F0KA 1C50A 1AHPA 3OY7A 4MI3A 1WUYA 3NPAA 4AMBA 1GG8A 2R66A 2G9UA 1VGVA 2AW3A 1Z8DA 3C4VA 3G2IA 4EL0A 4GZ5A 3S27A 1L5VA 1B4DA 2X0EA 1XV5A 3MBOA 1FTQA 4W6QA 4X7PA 3NC4A 1FU4A 2QRGA 3G2KA 3OKPA 2BISA 1L5WA 2KS6A 1IIRA 2F3SA 3WAGA 2IYFA 3HBJA 1K08A 4L22A 2VCHA 2QLMA 2OFFA 1GFZA 2QLLA 3D1JA 3T3EA 1L5QA 3C4QA 4G2TA 2XGSA 4EL5A 1NZDA 4EJ2A 2PRJA 3OT5A 3G2HA 3S28A 1GZ5A 4RIEA 3CEHA 5C1DA 3H4TA 2BGTA 2FFRA 1NOIA 1Y6FA 1FA9A 3BDAA 3CEJA 8GPBA 4CTNA 3S2UA 3BD7A 1YGPA 2QNBA 2G9RA 2H1HA 1GPBA 5DLDA 5JTUA 2XA9A 4GPBA 4YI5A 3HBMA 1NVKA 4MHOA 3COPA 1P2GA 1PNVA 2C1XA 3DDWA 4AY5A 4RIGA 1AXRA 3L7BA 3Q3IA 3CUTA 1Z6QA 1YA6A 4YI3A 1H5UA 1P2BA 1NOJA 2JZCA 4REMA 3BEOA 4NEQA 2QRMA 3MRTA 2QRPA 5TMEA 3MTAA 4XI9A 4MI6A 1RZVA 4WHMA 3GPBA 1UZUA 2XA2A 1O6CA 2AMVA 3G2NA 1Z62A 2QRQA 3E3LA 3ZCVA 4PQGA 1FC0A 3CUUA 4KQ2A 1P4GA 5BNWA 3CEMA 3DDSA 1IXYA 1SXPA 2JLBA 3MS2A 2WTXA 3NP9A 5I45A 4FZRA 1XKXA 2ZB2A 1JEJA 2ECPA 4FKZA 4EKYA 2HY7A 5IKOA 1E4OA 2PQ6A 1LWOA 5DU2A 2VSYA 1L7XA 3OY2A 3ZCQA 1WV1A 2X6QA 3QKWA 4MHSA 2IYAA 2GPAA 1LWNA 2GEKA 2R4UA 3MT7A 4RENA 3VDNB 1F6DA 3G2LA 4MRAA 3BD6A 3T3GA 4N3BA 3NP7A 3PE4A 5JTTA 2JJMA 5D01A 1FTYA 1NOKA 2PYDA 4AMGA 3FROA 4N9WA 2SKEA 1M5RA 4BQEA 4F97A 4CTMA 6GPBA 1XC7A 4HLNA 3MQFA 3OTGA 3AMVA 3ZCSA 1RRVA 3C48A 4BFCA 4F9FA 3CX4A 3TOVA
chains in the Genus database with same CATH superfamily
1KC1A 3RC3A 5BW6B 4ACBA 2CV0A 4CQMD 3LY9A 3BL8A 2AI2A 3CZRA 3NNNA 4W5RA 2DWOA 2Z5VA 3JQFA 1HR0B 1G7SA 1ATIA 3CO5A 3M4NA 3MCUA 2H1SA 1G3UA 1XK6A 4DA6A 3EHDA 1CWUA 3L07A 3GVHA 3L9XA 4K1XA 1Q0LA 3A05A 4ATNA 4B34A 2W93A 1I6MA 4WZ6A 2RK3A 2Q1TA 2YN4A 3CR7A 3IELA 5K8UA 1HNZB 1ZVKA 4XYMA 4ILEA 3L8MA 1Y7LA 2HCBA 2P9GA 3G8AA 3NT5A 3UK1A 2Z8ZA 2BFWA 4IG9A 5HNKA 3PCXA 1M7GA 5AI4A 2CLDX 1Z6ZA 5AVXA 1ORRA 3F9CA 3K0EA 5DT9A 2MYUA 4E12A 5EPEA 3MMSA 4MUJA 2J6IA 1AQJA 1Q6ZA 3EY9A 1TCVA 3NCHA 4AZVA 5CAEA 3ML1A 1I2BA 2OYRA 3F98A 4XUDA 1Q0TA 1VPVA 2AVNA 3BGSA 3OWOA 4RABA 1HH4A 5EXDA 1F4VA 1POXA 4PLHA 1ESMA 3NWOA 3CKKA 2IU4A 3KE9A 4ND7A 3KB1A 4HFMA 4WY2A 2JAPA 2HGSA 3DB2A 4JBNA 3UKDA 2ZRBA 1JA9A 1U63A 4IINA 3FMVA 3LW8A 1UDCA 1PGQA 1RI1A 4PXSA 2HU5A 1CUUA 4FMCF 5IUKC 4LDPA 2D7DA 1F38A 2ZYGA 2XMSA 2Y3IA 3JATB 4OPMA 4CLRA 1L4HA 2WFAA 2ZSBA 3EVFA 1DTSA 1V8PA 3U3RA 3VR1A 5IMSA 2O2YA 4GDMA 3GOQA 1EMDA 1VI2A 1PZGA 2VDWB 2YDXA 3MEQA 2XODA 3W5SA 4OFBA 2VJYA 3WJ2A 1RYFA 3BRWD 2XUHA 2VATA 4E32A 2O6HA 3QTBA 2XOXA 4HL6A 3O8CA 1E9VA 2I99A 4K6CA 4R7GA 1Y8AA 5CU7A 4MRMA 4D92A 3BFXA 2VZ9A 5JDIC 3DGEC 1UXGA 4MI1A 1AB6A 4K9DA 3MWKA 4NATA 2R8RA 4PW0A 4Q1BA 3SN6A 2B1JA 5I51A 3UPTA 2V3VA 2FG7C 5TE9A 1B2LA 1KMQA 1OLUA 4D6PA 4O0LA 2WAYA 3AEKB 3DE7X 2B21A 1RQRA 4DSTA 1FYEA 1MIHA 3D7NA 3R3VA 4LNUA 1P5HA 2FEMA 1UKCA 4A5OA 4E5UA 4IV0A 3FYUA 3NHFA 5HKKA 2WAXA 5T6MA 4UEWA 3B82A 4QSMA 3DOCA 1JPNA 2PUGA 5D3KA 3T7SA 1PP4A 1KTVA 1E9RA 3W9BA 1FLNA 1IPFA 4TM8A 9MHTA 2NO0A 4YJDA 2WWFA 5A6SA 4AKGA 1R4ZA 1HF3A 1H22A 2HCFA 3CLSC 3CZPA 3I52A 1U2EA 3EZFA 3OLQA 3TWOA 1E3JA 2PJUA 4KWHA 3NM4A 5B6PA 3AR2A 1M0EA 1Y4SA 4KN6A 3OZXA 1M34B 1CY8A 5FYQA 1N6OA 5LVAA 4AF6A 2FWJA 3L04A 1GQYA 3NJRA 3DJFA 3SJBA 2I7DA 3SHTA 1RI3A 4CDRA 1XDWA 2A88A 4MS4A 4Z9AA 1PWHA 2B92A 2ZT6A 4H6PA 4Z3DA 3N6VA 3ZY2A 3OC6A 1CX9B 3E84A 1VI5A 1LD3A 1DO8A 4OG2A 2EP7A 2DFNA 1QPZA 4HB4A 2H7CA 4OM7A 3T9FA 2Q7DA 3T4UA 2K5UA 1ML3A 2IDJA 4LYFA 4PZEA 4FHFA 1XYVA 1M83A 2DU8A 1GLVA 2NYAA 5LZ4A 2I2XB 2WFLB 2ZJ8A 3WA6A 3FYSA 4BC1A 4PHHA 1OTXA 1ZCFA 1TOAA 2XZTA 2BKEA 3L7MA 1AZWA 5AH0A 1WQ3A 5BWOA 3DHYA 3MW8A 3DFFA 3E05A 4JI1B 4PC1A 3R3SA 5JATA 1HE4A 2OB2A 2OK7A 4EY4A 1N2XA 2XKAA 2C9DA 3DEHA 3KUUA 5AKYA 4EHDA 1MIOB 1X2BA 2XVMA 3DXZA 3E8XA 4K28A 1SHUX 3JAWA 1VRCA 4YP7A 3RJZA 3U2QA 5A06A 5IAEA 1DOZA 3QU5A 1UC5B 4DLXA 5LD2B 3EA5A 2CNBA 3COWA 1JBEA 4UUMA 3UK7A 4GFDA 3IRUA 4TM7A 4NCJA 5LP6C 1Z13A 1V4VA 1ZDMA 4WY8A 3IQFA 1ZK0A 3R7WB 1H8HD 1Y82A 5ALSA 2OPHA 3UFXA 3JPYA 3OX2A 1JNXX 2EEPA 3HO8A 4N7JA 3VNSA 4DA7A 1SUBA 5B4TA 3N2NA 1VLVA 3WRWA 4JSYA 1N0VC 521PA 1AKUA 3H16A 1FZQA 1T4DA 2M1ZA 3DXYA 3QVXA 5CXQA 2RGBA 2HT6A 2RH4A 1FPMA 3CBGA 3QPWA 3ZDRA 5A2QA 1NF9A 3RC7A 4ZYLA 4TLCA 4MKHA 1FQJA 1QUFA 4ER5A 5CDFA 2QU8A 3S29A 2DX7A 1EVKA 2CZGA 1PK7A 1HT0A 1YVDA 3NBMA 4AKTA 1VL2A 3L0CA 1LF0A 1MB9A 1NWCA 2FN9A 2C61A 2P41A 3CNQS 1ZJWA 3B53X 4PV7A 1KJNA 1CE8B 4OQPA 3OA2A 2GILA 4KO3S 2PZGA 2E87A 1XRSB 4CFSA 1EEXB 1J33A 5T4FA 4TKUB 5DTQA 2FPGA 1JXOA 2QQEA 2QN3A 4LPSA 4TUYB 2VH1A 4WJLA 4ZV7A 4URFA 4DLPA 4XVCA 4K9LA 1VE7A 4XD7D 3GLFA 1E77A 4HNSA 1KU0A 1IWPB 5DBEX 1XTJA 4TWRA 3I34X 3K9CA 3L0BA 4RCYA 3U3KA 4BMYA 1OXXK 3L7JA 2C95A 2IXBA 2B34A 1W9HA 2LCQA 1KI6B 4PY2A 1MO3A 2FX2A 2R7AA 1Y1RA 2IHKA 4HXYA 1HX7A 1E92A 3MWDA 1XVVA 2FSIA 2JASA 2QAGC 4Q1AA 5A4JA 2BYTA 4F12A 2GTIA 2I3GA 4KYVA 1K27A 4WNCA 2PL9A 5GJVC 4BKUA 5IASA 3KETA 3BD9A 5EY5B 1DIRA 1G4HA 2ZJ5A 3TDKA 1H6BA 1S1CA 2YWFA 4CETA 5FWNA 2PH5A 4BO2A 1KFKB 5B3AA 5EJIA 1V43A 5E9JA 1JIUA 4NENA 3I0NA 5IJ0A 1VBNA 2O0KA 2P2NA 1FU8A 4HAVA 3EXEB 3PUKA 3MHTA 2GS9A 2FMUA 3ANYB 4HQOA 2NUPB 1Z68A 3MOIA 4IV5A 1LK7A 3QEMB 3SS7X 2YC4C 2A86A 4MO2A 5JVDA 2P4SA 4ZI7B 2ZRAA 4HQ6A 1FUIA 4OK3A 4KRGA 4ZYVA 4CHGA 3QKSB 3WB1A 5B2ZA 1EGHA 1R0ZA 2PZKA 3OQJA 4FD3A 4EQZA 3G88A 3HA3A 3M3DA 2I6XA 2WJYA 3QENA 4FB5A 2JGNA 1HFJA 3IYLW 2EDCA 3O21A 3KUXA 4LSMA 3BC1A 3RYTC 1A8IA 4FN4A 3ERCA 3IFSA 4UAGA 4YECA 5KYNA 4M6WA 2B83A 4X97A 4PSDA 2DKOA 5LU8A 1S2OA 1Z45A 4PG8A 4ZQBA 1QJ4A 2IV3A 1EH5A 4L76A 2A7XA 4W82A 4AO6A 2YVUA 1ANKA 1HA3A 2HF2A 2PAAA 2WU8A 4MI3A 5TQ0B 2OV2A 3RFXA 1AV7A 6ADHA 3TIVA 5IARA 2A5YB 3SXUA 5HQ3B 5EP1A 5SYMA 1YQGA 1T5HX 3GFOA 4MVJE 3P2IA 3E4CA 1WULS 4FW9A 1LQ2A 1TA0A 4OQNA 5KAPA 2AG5A 3TI9A 5EVCA 3VH2A 4Q3LA 2MSLA 4ALLA 4TGLA 2IZ0A 4JB2A 3C4VA 2O3UA 4YAFA 4OTZA 3P0EA 3G2IA 4QPCA 4NFYA 4EG3A 4YRGA 5KB3A 3A28A 5IRCD 4KXXA 3AIOA 3I9NA 4QATA 4KGDA 3HFSA 2Y9PB 3PGKA 4MV7A 4QFMA 1DXOA 3S40A 2OV8A 4UBIA 5L4LA 3MBOA 2NXCA 3QPCA 3GZNA 2JLWA 5ALNA 4LYHA 2EGHA 4KITB 3R8FA 3NC4A 4LF4B 3BXHA 5CH3A 2OK8A 4AMYA 2B1RA 3PK0A 3EISA 4RQUA 1VMEA 3AETB 1CR4A 3E03A 2GKSA 3LBFA 2VDOB 3RRZA 3OKPA 1DIHA 2RHOA 3WLPA 2ADMA 2VYCA 3GFSA 3P9XA 1Y8QB 4G5QA 1DUSA 2WWGA 3CNEA 1A97A 1PK8A 2GGSA 4LWQA 3R7LA 1U80A 4D3SA 4W7IA 3UNXA 4BAUA 2HIMA 3FVQA 3I5AA 5AI9A 2XV1A 4Q47A 1YJ8A 2NLOA 1Z4IA 1JLLA 1KBOA 1CRZA 4J9VA 5JXJA 1A8QA 3DTVB 1QYIA 1J5EB 3BFVA 1NQTA 1VHQA 3JYHA 2Q5EA 4FXOA 3BG5A 1HDCA 4MLPA 1Z8NA 1MORA 4C7XA 4ZVQA 1K5DA 3LJKA 3DLBA 1E3IA 2UUCB 3AG5A 1GVHA 1IG0A 3WLSA 1N2JA 2ZIEA 1NM5C 1XP8A 1C3LA 2JRLA 3M6XA 5C1DA 3F3SA 2YJGA 5M29A 1W46A 1D04A 4PAOA 5KCZA 1KPIA 4AUEA 4NP6A 2CHVA 3EB9A 2HHJA 3UMSA 2X3FA 5IFKA 3SQXA 2Q3HA 2GF9A 3TLZA 8GPBA 3D3WA 3SOPA 3OIFA 5DMHA 3RFTA 4CTNA 1F0PA 5TIIA 5DGCA 4HBZA 1MP0A 2VHJA 5BSKA 1E4EA 2WA2A 2QNBA 3O4VA 3IIKA 4MYSA 2HMAA 4QD3A 1T0BA 2DERA 2RHWA 2R7LA 4GGOA 1ORVA 1XK7A 4JOBA 4KLRA 3ODGA 4UMEA 4DCNA 2VTBA 1VL5A 5CM9C 3X1DA 2EQ5A 1KZ4A 4OX9Y 2XAUA 1NONA 4R71A 3ILSA 3INYA 3IODA 5FD8A 4PZZA 1Y98A 3VAAA 2YW9A 3USES 1TM2A 5JC1A 5I48A 4Q3DA 3V1UA 1NQ5A 3WLKX 2XCQA 4EDFA 4QXMA 4RIGA 1YD7A 4C4RA 4HT3B 3PNBA 1AXRA 3CRQA 1M73E 3RADC 2QP9X 4MA5A 1CR2A 4ROSA 2QPOA 3A3KA 5IVHA 3NH6A 4NU0A 3QY9A 4G25A 1Y34E 2PKQP 5HF5A 1YA6A 1KZGB 3IBFA 3IUJA 4L6CA 5CMLA 1QFZA 2ZRMA 5C1BA 2X8BA 4NU5A 4QA9A 5JY6A 4PLWA 1NJFA 2WB2A 3OFVA 1GG5A 3M9WA 4CODB 1AURA 2OXRA 1YJQA 3T3MB 1PW7A 4EB0A 4DWOA 5K0EA 3EPRA 1NOJA 5DNVA 1KE2A 1HDIA 3AR6A 2G7MC 3A0RB 5E6SA 3T5BA 2Z3VA 4KPEC 4L7VA 2OECA 1XAJA 1KZ7B 4LAFA 1TUBA 4G07A 2C97A 5CB0A 3HN2A 1S8AA 2IYYA 2ZTVA 4NZMA 5CLHA 4G0MA 5HZKA 4XI9A 1KYYA 4MQEB 4OJNA 4ZRNA 2BI7A 3FNFA 1XELA 3RS7A 1VSTA 3D6FA 2XQIA 1O6CA 4DCVA 1W0JA 2AMVA 1G6HA 1Z62A 1T8WA 4BL5A 5DE3A 1E2DA 1QUEA 3DTNA 1IBCA 5AHOA 5FXMA 5B6IA 1AKVA 1RIFA 3RU2A 3ISTA 4ECAA 2IHNA 4ZOLF 4LYGA 3QBJA 4MUFA 2OYCA 2FW8A 3ORHA 1GNQA 3V2HA 3AUTA 5CDUA 5KQGA 5IM4A 3LOPA 2DCMA 5P21A 5FTNA 3F6EX 5THKA 4EI7A 3O4HA 4Z7NB 2OORC 3QZUA 4B1FA 2W4QA 1LDGA 3NP9A 4QXQA 1Z0KA 1ZLYA 3R5SA 2V98A 1RCUA 1XMJA 2GAAA 5CB4A 2J3QA 4L78A 2REQB 3P9SA 2HI0A 4IOKA 1HOTA 2PGJA 3HVRA 3S1SA 2I4TA 2B8WA 2Y0DA 4P7GA 2QVZX 3ZX5A 3A2KA 2HSWA 4JB8A 5HZMA 4AZ0A 5AKKA 1ORWA 4FM9A 2VPPA 4JOQA 2P3OA 3N59A 1H9BA 1KQNA 1MR3F 5AK3A 4CMCA 1S3FA 3DM5A 2UV8A 2GPAA 1ZOSA 4MVJH 5BW5A 4IMRA 3FSRA 3AF5A 4FDLA 4AO7A 3GA5A 2B5OA 2PX0A 4B3XA 3H5AA 2PA0A 3AUJB 3PIDA 3UKOA 1N2CE 2FA9A 1R15A 2B6HA 3EASA 3VJLA 1CJCA 2AEMA 1Z28A 1LFDB 1MABA 4MRAA 4RCZA 2N1MA 3IMEA 4L0QA 1U0NA 4FKBA 2C88A 4H4CA 4KQEA 5H3LA 4AQYB 2GCEA 2H54A 5F2NA 2VQDA 2GSWA 1S2GA 2QAGB 1OKKA 1QLWA 1COWD 1T0UA 3IHKA 2A58A 2XUAA 3NP7A 4RA9B 4TKVB 1PT5A 1I30A 1CJTC 1MG5A 1R12A 2Q6TA 4PQRA 2G1UA 5D1HA 2DTDA 2AXQA 2WHPB 5A03A 1T8SA 1IM8A 2JJMA 4NSNA 4PN3A 3AL0C 4KPGA 2YHAA 5AKIA 3M6MD 4HLUA 4ZHQF 5L6LB 2QAGA 3OQMA 1N3LA 4B3JA 4WJZA 1TK3A 4TLMB 3QKRA 1H2FA 5DN6D 3BL5A 2FPRA 4Q9HA 1QTQA 1XC7A 4TTQA 1QF7A 1FX0B 2B6NA 4RQAA 1T9GS 3BMQB 5L3SA 2EQBA 2HK9A 3RAGA 1GTL1 3RC9A 1THTA 3PV0A 2DHQA 4Y6PA 1W5SA 3L1JA 4BFCA 4UQLA 5EJ7A 3HCPA 3R6LA 5EGNA 3X44A 2PZBA 1GADO 1EQUA 4KKVA 4WBXC 1X1AA 1NRWA 1JR2A 3M6LA 2JLVA 1C30A 2FN8A 1NSYA 1KXJA 2BGKA 4OHXA 4LA4A 4YJGA 1PZMA 3UHPA 4MS3A 1RXCA 2O8CA 4I19A 4MP3A 1BKSB 3M2PA 1TVCA 3OCVA 3DW1X 3IVXA 4OVKA 2O6LA 1NNLA 4P83A 2PYZA 2BW0A 4H1TA 3FSGD 3NOXA 2O8CB 5JQWA 2CVZA 5G1OA 4A8JC 5IXYA 3WK5A 1XMOB 1A8PA 5C5DA 3JS5A 3QLVC 4FI3F 1GGHA 3B9QA 3H18A 2IK8A 3AM3A 1U99A 1YR6A 5DHTA 3CE6A 3H2KA 3O2JA 4X1KA 4XLZA 1PQ4A 4KNWA 2OR3A 1Y3DE 3IV9A 4I4TF 1LVUA 1HQDA 2YQZA 4JBHA 3FDXA 1C1DB 2B0JA 3FDJA 1OX4A 4OUDB 1U02A 3TAHA 2FDRA 2QRVB 4ZT3A 2O2CA 1W2HA 4P1ZA 3FCUB 1A82A 1BA2A 1PYGA 3ADKA 2XWJI 3UH1A 1DO2A 3EVTA 4P0TA 3EPPA 4U9IS 3VZDA 3WAKA 5CT9A 1F6WA 1N9GB 4PRYA 4AK9A 5DNAA 1DT5A 3CZAA 5IW8A 3DZIA 2GB4A 2UZ3A 4RE6A 4Z2YA 1GLGA 1T9BA 4WCFC 5FUMA 4US2R 4EP1A 3N07A 4C6RA 1NN1A 1OD6A 1F9EA 1RPTA 2WWXA 3ETLA 3L40A 3NNSA 3ZD9A 4BBJA 4DHWA 1XZIA 2Q6IA 3IERA 3QIAA 5K7SA 5KMGB 2EZ8A 2YJ4A 2HT1A 1U04A 3UJ9A 3G7NA 1UJ5A 1K7CA 1H0HA 1KJWA 3N2ZB 5DOZA 3PYXA 3DDCA 4QPNA 3SKVA 3RLIA 4KR3A 3BWCA 2OSBA 4RY2A 5BMVA 2IPOA 3CKMA 1AN9A 4FTWA 2D2VA 2EP5A 3QGMA 4CQMB 3GUVA 1NMYA 3E9QA 4C0KA 1UBGA 1KYQA 3L2OB 4LGVA 1U8XX 2QA5A 4F8JA 3WYCA 1LBIA 5T8KC 4HFRA 3W5UA 3VNUA 3HVUA 4M2LA 1T26A 5F7OA 5K0ZA 5KSZA 3FSJX 2F3UA 1ONSA 5DN6A 2GM3A 3OPYA 4E21A 2PUEA 3ND9A 4FMDB 1LLCA 1N3IA 1OZHA 4QU9A 1J99A 1RQPA 2CE7A 1OSNA 3CX8A 3N2EA 5TVKA 2Z2KA 3K15A 3ORQA 3GLKA 4FVTA 1ZD1A 3V48A 4P80A 3OWHA 4ZDIA 5J47A 1VSVA 3EJ6A 4DKXA 1U65A 1RABA 4MDHA 4N6GA 1B1CA 1B16A 1CETA 2JGJA 2W2MA 1KAQA 5FIUA 2XD9A 2XUGA 3W7VA 3B2EA 1OVMA 4G6ZA 2ODNA 3DHNA 1WM1A 1ENOA 3B3QA 4GSKA 5ERXA 2RD2A 5HW0A 2JIRA 5LFAA 4RTOA 3WKBA 2LP4Y 4BN5A 3JQBC 2C2ZA 1HE3A 5DK4A 1OMOA 4PZDA 3UMGA 3PJDA 5TQJA 4ZCMA 4Y2JA 2C07A 1V4BA 5HF8A 1MQ9A 1E9BA 4LJ6A 4IIHA 3C7KA 3CEPB 2ECOA 1IY0A 4KQHA 1XL0A 1ZNYA 3BAZA 3LC0A 2P7HA 5IN4A 5JZSA 2O8DA 2NNLD 3MTJA 5DF1A 2R4TA 1RAHA 2Z98A 4CIXA 3EOAI 3FOZA 1B7GO 1RYEA 2VRCD 2ZAIA 4QBGB 5E3HA 7GPBA 2P5YA 3TLYA 1N8NA 4AX8A 3T94A 3IQGX 1XA4A 3ZNOA 1KMHA 2ACEA 3RRFA 4AULA 2R44A 2FZVA 4BMOB 2QXYA 3B7WA 2E5FA 3DDNA 1M1NA 1MJ5A 1DTEA 3IAFA 2V8OA 3KKQA 4N3NA 1TNDA 2ZJOA 1OLSA 3EAQA 3C5CA 5JNLA 2EKQA 3HO6A 1HGXA 3GAMA 4X94A 1MAWA 1XTVA 2WM8A 1M2EA 3H6GA 3N5CA 1R6VA 2WOOA 1ZMOA 3JWPA 4MPJA 4XB1A 4A0RA 4E0BA 1AKMA 3B38A 3MWJA 4EJSC 2C9OA 5J4KA 4RTMA 1R5OA 3EEIA 4IDGA 4R40A 2G70A 4NJEB 2PRIA 4PS0A 2B1GA 3W79A 1ZM4A 2XVZA 4ND2A 4KIWA 1JFFA 1PEAA 1ZLXA 2J3LA 1Y48E 4HXEB 3RRMA 1JIIA 2GNAA 4QDJA 1KH3A 2X2EA 4M0FA 1X7XB 1TTHA 5LR6A 3FVWA 2A4MA 1L4MA 1G8HA 2AXNA 2Z2JA 4YACA 1R6TA 2EFHB 2FP3A 3GY0A 1RBZA 2Y1LA 1L6RA 2HEIA 1E2FA 1Z4PX 3DV2A 3EIQA 4JUFA 1GUYA 4MUGA 3VI4B 1R6AA 1O97C 3KC2A 1ADBA 3EWSA 1L4GA 2O48X 1V45E 3QYJA 1WTAA 2A8YA 2YOFA 2XGMA 4UFPA 1TA4A 2TMKA 4X6LA 5HOEA 1WWKA 2JK0A 4J0QA 3CRW1 4MR7A 2K6GA 1STOA 4UD2A 3E53A 1JTVA 1RVDA 3DL0A 2P1DA 2FPWA 2WWTA 4Q1FA 5H4GA 1Z0AA 1SRQA 2DBVO 2JK1A 3ICPA 5KOIA 3B48A 2QZZA 4JROA 4MWOA 2D1YA 2G0AA 4NE2A 5JSKA 3P4XA 2AZDA 2F3QA 4B6QA 3ZXXA 2WYUA 4V0OA 2IEIA 3HKBB 2YICA 1WXDA 2CMGA 2X6TA 2NO5A 1HDRA 5A9SA 1SEPA 4BYMA 1BG6A 4XTCS 1VHDA 4E5SA 4HN2A 2BMAA 4TROA 1UBJS 3GJ4A 5KJFA 3UJNA 1TKAA 4GPD1 5HG0A 1PR4A 1QHGA 2YJNA 2NXJA 4DQLA 1J8MF 1JEQA 3VR6H 3N28A 3C5EA 2H0QA 5IYZA 4RJKA 3Q7RA 4FHEA 3FX2A 4H77A 4KFUA 1BE0A 4LF8B 2LW7A 1KDRA 2Z5GA 4OI1A 2QMYA 3FFTA 3TQOA 2A9OA 2IZ1A 3BXPA 3B6ZA 4NMXB 2ZR0A 3G17A 1LNSA 3HJAA 5DM70 3FN4A 3C8DA 1QMPA 2OHHA 2PEYA 4MCHA 1M6EX 1FMLA 3VTKA 2Q3MA 1R10A 4Z86A 1FFWA 2X9LA 3DKPA 3U39A 2E3JA 3NHWA 1BX1A 3C7AA 2OM2A 5HIKA 3NM5A 1A1VA 2OKGA 2YNMC 2CCJA 2AXPA 2PSSA 2Q7XA 3GLHB 1QYRA 1U2SA 5LQDA 4NBUA 3H8JA 4QBIA 4X41A 1DINA 1O6FA 2M6SA 1MCZA 3CVOA 2X0RA 3GZ4A 1ZW6A 1SUPA 1BZYA 2AN4A 3BMNA 3JQFC 3RKUA 4IIGA 1Y9AA 1EP2B 3PWZA 4Y9TA 4D2IA 2UYOA 2Q2OA 3KHSA 5TJHA 1OFVA 3CINA 4ID9A 2QSUA 5AW8A 3OEED 3VOTA 4JUAA 2VSXA 4CKZA 1O0BA 1NC1A 2NSYA 2PX3A 3HJCA 1YHNA 3NEJA 3ZHZA 3G0GA 3OX3A 1T5SA 3GCXA 1JAXA 3W5CA 2GBGA 2FSHA 2QTMA 1LPPA 1V7PC 1NTRA 2P9BA 5IT0A 1Q95A 3TNLA 3Q3EA 5CA1B 4M9ZA 1QP4A 2AXEA 2TS1A 2AZXA 1R5NA 5JVDF 2OXIA 1W4LA 1YDMA 3PYMA 5A5FA 1FP4A 1T6XA 3I04A 4FFSA 1M1XB 1CJKC 4HDKB 3I6BA 4KLAA 1AHPA 5CAEB 3NPAA 2QI9C 2H0AA 3C1UA 2AUTA 4D99A 4IVNA 3CISA 4IEFB 4MCIA 5CIYA 1GAEO 1T5DX 4OP1A 2CF5A 2FH5B 3G59A 1TC2A 2EW2A 2I4NA 1JAYA 2VQ3A 3M1IA 4LX0A 3SFZA 5FUWA 4CF4A 4RAOA 4E51A 3ZDXB 3PXEA 3W6PA 3VVLA 1ODLA 2JF0A 3AOGA 3E1GA 2ZYAA 2AUNA 1Q83A 4PBRA 5AJVB 4IWXA 1XXHA 1GXSB 2ZXEA 3WLLA 1SQ6A 1NRIA 3EEFA 4HGYA 1HE5A 2A78A 3H2ZA 3W9SA 2YYSA 3U62A 4ZI5A 5M5BA 1WDWB 1YE8A 1TYEB 4CE6A 3EIUA 3OHMA 2JI4A 1LI4A 2CZQA 3KFVA 2NSHA 2C2BA 1J49A 2JAOA 4MKRA 2WJPA 1QTRA 3HXMA 3DLCA 1L5FA 3LQ2A 4JH0A 4Z9FA 1BS1A 4PNEA 3Q6MA 1J25A 5ESRA 2YZMA 3HGMA 3OOEA 1QP0A 4C7OA 5EE1A 1NW5A 4UULA 4AQ7A 1JEYA 2CNNA 1U2PA 3PVZA 3W1VA 3I9OA 1WZ2A 2X8AA 4TPKA 5KWVA 3NBKA 1HRDA 1MB4A 3G1WA 5ED4A 2NVUA 2H4WA 3V8MA 4ZMBA 4DLWA 2PUWA 3T3EA 4K5QA 1FMJA 3ECCA 4LWZA 4OQEA 1TUEA 1OLOA 2VF2A 2UUOA 3LL7A 3M6IA 4GWGA 4J0FA 4EHNA 3T1TA 1JEYB 4JC0A 3O4GA 4CMEC 3DE1X 4MW4A 4TZ6A 4D3FA 3H99A 2XGJA 3PDCA 4QUIA 2NYUA 2OHFA 3MVEA 2OCKA 4HG2A 3N8DA 3AW9A 1ZMBA 1PVOA 1MC5A 2FFRA 1ZVMA 2ZEJA 2VJPA 3H6KA 2ZDGA 3TM5A 3X0DA 2WIDA 3V4RA 5SY4A 1KGDA 1RAGA 3RS3A 4KVZA 4TV8F 2AFHB 2ZVDA 4UQPA 5FWDA 2Y93A 3NHBA 3V1YA 1NJ8A 1QX3A 1DXHA 3ZWDA 4YT4A 2HX1A 1E63A 4EW1A 3VPCA 1AT1A 1TMKA 1QVVA 2BFDA 4S1VA 4RTKA 2RKWA 1U9IA 2QTAA 1GL9B 2C82A 2FPUA 2JCVA 4JU8A 2AA3A 2C31A 3ORYA 1LS1A 1WOMA 4EYQA 4X1IB 4ZK2A 1PZFA 4BEWA 4RD1A 3TTTA 1N7IA 3C3JA 3GBVA 1NASA 2BFDB 2VBIA 1G16A 4PZ0A 5HTOA 5A62A 3K9HA 2JFOA 4YJKA 2D06A 1X8XA 2P0EA 1JMVA 1PJQA 3GLSA 5K3EA 2N42A 1CERA 3FFXA 4PG7A 4XKJA 2QX8A 2YMQA 5KWEA 2QM8A 4WW0A 1PWEA 3IALA 4DM7A 3LUAA 5BWBA 3PPWA 5CJPA 4D8WA 2NM0A 3D02A 4D57A 5A9SB 1QKIA 3L43A 4FDTA 2Z95A 2PQ2A 2Y0PA 2WZQA 1GZ7A 3PZRA 1KOFA 4MJLA 4DCCA 2GCOA 1AXGA 1N5OX 1YE3A 2FX5A 2GBIA 2JZCA 3DOHA 3OPYB 4G0ZA 3UJ3X 4A23A 4R1UA 4UE3S 1VCNA 5LQKA 4FYKA 4BCDA 3O9MA 5KYXB 1B2RA 3CPJB 2DJIA 3MTAA 1RVV1 1TB4A 4OYYA 4QHYA 2IY9A 16PKA 4ZO8A 4WHMA 3ZIUA 3PCRB 3ETDA 5F3WB 1VG8A 2L2QA 3JRXA 5FBZA 1DS6A 3REGA 4RY9A 4Z4FA 5JAMA 3I8OA 1NDUA 2MR6A 3IQDB 3LC7O 3CHYA 1ECPA 1RM0A 1U3FA 2EARA 1HDOA 3V8NA 4DL9A 4V1CA 1WP9A 3URMA 2I4IA 3MJCA 2CNLA 4LFCB 5HM8A 2XBLA 5SZKB 3P9ZA 4FCVA 1RM4A 4QUDA 3S5JA 1VXOA 4OU4A 4CEHA 1OWNA 3K94A 2PSHA 3X43A 1XDDA 2VA8A 4A8HA 4POOA 3KXPA 3WLEA 4ZO4A 3ES9A 4UNIA 3O8BA 1FUUA 1ESDA 1S96A 2Q0XA 2Q3DA 3O93A 4OMCA 3SEFA 1KOGA 4D0NA 3E9RA 4I5FA 4TMYA 1ZAKA 4KREA 2HCRA 2EDAA 3BXFA 3IVGA 4GBJA 5T3YA 3QNWA 4ISCA 1NQUA 3IIIA 5SV2A 3SHFA 2PR7A 4CL0A 1DAIA 2DR2A 2FPPB 2LCIA 3PIRA 2BE7A 3W5JA 4F4HA 2CJWB 3F6CA 3PRHA 1D3AA 1NJGA 2I6UA 4NNJA 1I33A 3OFND 1DEKA 4OHOA 1J00A 3AB7A 3RIEA 3L4EA 4I0WB 2CDAA 4BVLA 2BFOA 3ST7A 1NVEA 1WHSA 3PNQA 5FUYA 5L7YA 3MMNA 2R6HA 1S4MA 1UEXC 3JQ7B 2PUBA 4ETNA 4AMUA 3QLTA 3AJAA 1JI3A 3PE4A 1A9QA 4UPDA 4CWAA 4DMKA 4GRAA 4OQZA 1R88A 3CZ4A 3FPCA 4FLMA 4NDNE 4DLYA 3E2PA 3TW8B 1G2PA 2C92A 4YRSA 3GJ5A 3O1HB 4MR7B 1S01A 4BP1A 2JPDA 4TWBA 4BZQA 2HHCA 5BNFA 4YUYA 3NBYC 1U5BB 2GNOA 2UKDA 2XUFA 4Q4AA 3S2FA 2VKQA 3D5EA 4I4IA 1KI7A 2VKTA 4TLAA 3UUFA 1NVMB 1F8YA 1ZZEA 3NIGB 5F78A 1PJ2A 1WEKA 4MRRA 1SBHA 5EIBC 3CU5A 1DT3A 3TFQA 3TRKA 3TFWA 5D5PA 4JBLA 2DQZA 1AX9A 3AMVA 4KOEC 1UANA 3FWZA 1P3DA 3PA8A 3TLAA 2OFOA 1LXCA 4FYXA 1JR6A 5EHXA 3AZPA 1YJCA 2XIJA 4L75A 3EPKA 3U3OA 4HRAA 1H05A 4DM4A 4ZHQA 2NV0A 2NXEA 2VF8A 3VU8A 1JG6A 3SE0A 2DSNA 2CVHA 3ZU3A 2OSVA 4JLJA 5GZ6A 3GNQA 5CVJA 3VVMA 5E4YA 1JEEA 4IQ0A 2UAGA 4DYHA 2QY9A 3QVGA 2OC9A 3ZDBA 1RT9A 4NCKA 5D3QA 5AHWA 5IJXA 4M9XA 3HVJA 3IBTA 4M46A 4MB6A 2O7RA 1PVDA 1U8TA 1KY2A 2XEXA 1N33B 4HVCA 4F93B 5LWHA 2YZ7A 1T2EA 4GEKA 2YVAA 4AYXA 4DIEA 1JPJA 3I9FA 2R0QC 1E0JA 2EF1A 3F7OA 2IHTA 1NLMA 2Z4RA 4N49A 3FBTA 4JYBA 4HVTA 1UXOA 1ZH2A 2Y1FA 4RVSA 3W8DA 4HUTA 5JI3E 4DUZB 1ZUHA 1CDZA 4UHDA 4E7OA 5KYWB 4II3A 1DG1G 1R6XA 4N7RA 3PZBA 3HXKA 3BL6A 4DMFA 3HRIA 2FF5A 4EENA 1UDAA 4BFLA 5CTJA 2A9VA 2JGIA 4UVHA 4D43A 4CIYA 5IULC 4CIVA 1KWKA 4QVKA 4BLQA 4R2LA 3D7RA 2P1RA 3F47A 2RHCA 2V9ZA 1Y37A 3DEKA 4ZT4A 3WZMA 5FI0B 1SELA 2YN0A 1E1YA 4IPTA 4WBNF 1P2DA 1KEZA 3UAOA 3NASA 3DO5A 4BQIA 2JCGA 5HOQA 1Z56C 2PGAA 1TT7A 3H5NA 3ZD7A 1OI2A 3D0QA 2D1FA 2V0NA 3OE1A 5EVJA 4IOJA 5EQFA 1SQFA 4WKOA 3RHSA 1QQTA 4WOJA 3FPAA 1NYTA 3TTSA 2GD6A 3MOGA 3ZCPA 5LN1A 1D2AA 4FC7A 3RG8A 2XR1A 3QEAZ 1P61B 4S0ZA 4NE9A 5F76A 1UJNA 3HRKA 4HFJA 3ESQA 2O0JA 1ZU4A 5ALWA 2X4GA 1VSUA 3KT6A 1RQ7A 3BFJA 4TYYA 4OKIA 4J2TA 4RS3A 1MXHA 3FTQA 3KYIB 3QJYA 1FVOA 4RYDA 1WB4A 5T4HA 3BWDD 3WQHA 1KY4A 1QHEA 1NXSA 1R2QA 2QRZA 2ZRDA 4BLWA 3QEBZ 3AB8A 3I61A 4FKMA 3W4KA 4LCBA 4DZZA 1MX5A 1UFOA 3VO9A 1T10A 4RMGA 5CB8A 5IF9A 4JJIA 3AI2A 5HMLA 5JXHA 2YJ5A 4QUKA 1ENPA 4RANA 3VBEA 1GPYA 1NLFA 2QM7A 3X3HA 2REBA 1WA5A 1OY1A 5FUQA 1CJMA 2IPXA 3HJTA 4F4IA 3BYZA 1XRPA 4C4AA 2IXTA 4PX9A 1S2LA 1M6YA 4Y9SA 4KNYA 3KSAC 5F21A 1L7AA 3WIUA 3BHJA 1L5OA 2FY8A 2RBGA 3GEPA 4LHVA 4Z4QA 2I3AA 3AF1A 1UEJA 4QRHA 4ZQGA 1YU6A 2P3LA 4O4LF 1R5JA 2CLMB 3CH7A 1HYQA 4KQMA 4JT4A 4D46A 1KDYA 1XZMA 3AR9A 3V8BA 3NHUA 3WL4A 3DWIA 5ALRA 4Y9DA 5DM1A 5J2TB 1H2AS 1DQZA 4DWWA 3R7WA 3U0VA 3FGOA 1BMTA 3OJ0A 3TQTA 3VZSA 5B3KA 4NDZA 5LQJA 4Z4GA 1R4NA 1N9GA 3LX5A 5TGDA 3UMYA 1R0RE 2OXCA 4Q4JA 2OCGA 5M3BA 4B84A 3O4IA 4ZAVA 5HKOA 2SCUA 5CGZA 4MAFA 4GHWA 1WZCA 1XNGA 3WMWA 3NATA 2CXXA 2R8PA 5EERA 5IF3A 2Q9CA 1WW3A 2Y2UA 4HH1A 2PQ0A 5BWLA 1WQ1R 1QGYA 4FFWA 4EB6A 2C2WA 5J4LA 1KQGA 3RRXA 1XTIA 2QL7A 1Q1BA 1SNYA 2AX4A 1EJ0A 1YBHA 1FXSA 2QE7D 3OIWA 4BS9A 3HP7A 3D0OA 4FCWA 3P19A 4MWSA 5KYTA 3RK1A 1PJ8A 2XGGA 4KE9A 2ETXA 3WP0A 1OIVA 4U7HA 5FBWB 1P29A 3B36A 3ICOA 2D2FA 1N8TA 3VDQA 4BLSA 2IEZA 3ICEA 3P45A 1V3TA 1MJGA 1YQQA 5K0CA 3MLAA 4RIFA 1REQA 1Z5PA 5TC4A 3FZYA 2BM0A 5JDCA 1QV9A 1MEOA 2XB9A 4ZODA 4MK4A 1MGPA 3C3MA 4Q4HA 4BLRA 2GJSA 4HNAB 1E8DA 2JFWA 3SSOA 2IIPA 3N0TA 5KOJA 4RTJA 1I7SB 3RSGA 1V95A 3FY4A 3W2TA 3ZD6A 3GEMA 3KZVA 5GY7A 3ZY3A 3GELA 2FQYA 1TK2A 1TYZA 1D1QA 3EF0A 1RJ9A 1H2ZA 1RJWA 4YR7A 1BFDA 3R5FA 1RHMA 3MWYW 3E8SA 4JCOA 3CZ5A 3HK2A 2AQHA 3UN1A 1TUIA 4Z1OA 2W6CX 4RJJA 4OOEA 4CKBA 1SCDA 1FF9A 2QE7A 4BZXA 1BDMA 1X8JA 4J0GA 5DBHX 2BFAA 2ZQYA 2W6MA 4IKEA 4QJIA 1EFPB 3MS7A 2IUYA 4AY6A 4EO7A 3HB5X 2QVBA 1OC4A 2RAFA 2ZIZA 3L0IB 4YAWA 5IUJC 4ZTUB 2W2KA 2RIRA 1I13A 1IRXA 3FCXA 1OBVA 4KAXA 1BWRA 4D8XA 2GPNA 2EYUA 4YROA 3S4YA 2Y1DA 3RAEC 1HLFA 1MA0A 3MUOA 1HSOA 1Y5IA 2EWWA 4I9HA 4EVRA 2HFJA 1VJDA 3O92A 4P3KA 3KTAB 3PFWO 1USGA 1UL1X 1YZ3A 4JJAA 1SU8A 3L8YA 4GE0A 4M99A 4AZ0B 1CV2A 5J4YA 3KJNA 1G4AE 3M70A 1BJRE 4UAJA 4YQZA 2JIQA 2NQ8A 2XCLA 2ABWA 3PC2A 5F1KA 3H86A 4EEXA 1ICIA 3C5HA 3R0VA 3SP1A 4EHLA 4Q3CA 2IS4A 1YMVA 2Z58A 4P4TA 3RO7A 2HJGA 1VLHA 3PS9A 3WGUA 2KJQA 1XCBA 2O7VA 1R0SA 3F9RA 2WIJA 4NC9A 1KTIA 2QUBA 1PFWA 2AE1A 3ROXA 4DJEC 5LZ7A 1W30A 1W2WB 1E58A 1Z35A 2H2IA 5FTKA 4M7WA 4G36A 4KI0A 4ZKDA 4DC1A 3KEQA 4QOFA 1E1QD 1FFBA 1WXGA 3FW1A 1V8OA 2VYFA 1UPFA 3CN9A 5AR1A 1NVVR 2X0JA 4YJ2B 3A70A 5FPKA 5E38A 1A04A 4P2BA 3MD9A 1RRKA 2Y77A 3U7HB 1NW4A 1RC0A 1VG9B 2PHZA 1NR1A 3EE6A 3HBAA 2X40A 2I22A 2WW8A 3VX4A 3Q7TA 2NU7A 4Q9IA 1O77A 3L1IA 1ARZA 4RCVA 1FTNA 4E08A 4GOKA 1TJNA 3CCFA 5C31A 2C04A 4YRIA 4JEIA 3AQ4A 2V65A 2V7EA 3H3XA 3IEKA 3WDLA 4KXNA 5FV4A 5KQRA 4ZJUA 3K70B 4YC7A 2NU9A 4MQ6A 4B4DA 3ZE2B 5F77A 3ZHQA 1CZKA 5LXTF 1G8YA 1R9JA 4RFSA 4WESB 1Z0UA 2P2ZA 1U31A 1MVOA 4UDYX 3RHFA 3GEHA 2ZQ5A 3I4FA 4OK6A 3AFMA 1OILA 5BV0A 4ARBA 4F3RA 1KI6A 3MOSA 2VAVA 5CPBA 5ALDA 3WL8A 1V1JA 1O5IA 4EB3A 3EXHA 3TIGA 1IZ0A 3HA7A 3O8OA 4PYJA 2AOTA 1CCWA 4D3YA 1BCSB 3MFYA 2QXUA 1CRPA 4MV3A 4Q9JA 4KVGA 1DKRA 3ZV3A 4RV5A 3U49A 1VGVA 4U2DA 1TEVA 1AQ6A 1C4OA 3KV1A 2ZAMA 2ZI6A 1PR3A 3K1ZA 4NU8X 4P7FA 4WZZA 1J8QA 5CJJA 3RS2A 3BIOA 4JJZA 5JMWA 3N2GB 1JDBB 3P27A 4XCVA 1XNHA 1X15A 2FCRA 2B4YA 4LRWA 3S2YA 2AQKA 2TSYB 1JHZA 3FETA 4LUCA 2VDKB 3RUHA 4CLDA 2DLNA 2BVNA 1U2TA 1Z0JA 3I0MA 5IAJA 3RUEA 1WW8A 3ZJTA 5C1OA 4UU1A 2QORA 2WKRA 2B4KA 2X4IA 2GF2A 4CF6A 1KQFA 2QX9A 1NMZA 4QU0A 1DARA 4BVBA 3GLQA 3G2KA 1AN0A 1ODSA 3VJKA 4DUGD 1N25A 2KS6A 3ZV5A 4A36A 1JAZA 1T5OA 3FTFA 1D7OA 1DPGA 1GAQA 3EGIA 2VWPA 4R8VA 4AJPA 2QLLA 3HLYA 3TF5A 4BNTA 1IE3A 1OB2A 3ACBA 3QPVA 5LDDC 1N1MA 2ZU0C 1EGVB 3Q98A 5D1NA 5DHAA 3ZU6A 1LSUA 2B1IA 3EG9B 3UJDA 2A0KA 4NCHA 2XGSA 4YRQA 2OZPA 1MRSA 4DNXA 3O8RA 4J8PA 4LJ9A 1BU8A 1RXUA 2Z5LA 3H9EO 3NHAA 4HB0A 2ZRCA 1LFAA 1ZOLA 4BX3A 4JY7A 4ACAA 5JS6A 2F8MA 3H4TA 4DEXA 5AW5A 3TSZA 4PLGA 3Q6IA 2DWCA 5I9MA 4HNAA 4NCXA 4ZARA 3Q9NA 3CEJA 3ITEA 3ABZA 1OASA 4KV7A 5FPYA 4U6NA 3GQBA 2HEGA 4BQPA 1SRRA 3QV1A 4YT2A 3KKEA 4D3DA 4YAKA 1QPGA 4KE6A 5G0UA 5BWCA 5A4MS 1TQ4A 4BGEA 4X85A 3UMFA 4DCOA 3LIPA 1JZTA 4RK0A 2C29D 5F52A 5ICCA 3OI7A 4UATA 5DLDA 1JRLA 1VKNA 5ETJA 1SCAA 4HTFA 1M6VA 1H0SA 3NBQA 1JKJB 1O58A 3LOUA 4RK6A 5G02A 3R76A 1E1RA 1IZZA 4LYAA 3FMPB 4BB9A 2VBFA 3QWBA 3COPA 3B3JA 5I9SA 3MWEB 3FI0A 2GH1A 4CZ2A 3JQAD 1DKNA 1FX0A 4KO1S 1CZOA 1Z5NA 1KMMA 1WXFA 4IUDS 4ZT5A 3HN7A 4UNPA 3FF4A 4CV2A 4GH5A 1AGYA 4ENPA 4DLTA 1FRNA 4QODA 3AWDA 2P67A 4F85A 4F4FA 4FFBB 3GRUA 3R09A 1WSBA 3CRNA 2Z4SA 4QVIA 1E5XA 1ZL2A 1E7SA 3EFBA 2CXNA 3V1TC 4ZCIA 3EVGA 4KWIA 3GJ8A 2WLSA 4Q7LA 1EQ2A 2EJTA 4OHUA 1C7FA 1A4RA 3DHVA 4Q3OA 4M1ZA 4JNCA 1KK2A 2EHJA 3RJ9A 3G9XA 3W5BA 2OGWA 1LF5A 3RROA 2FSSA 4TLBA 1U3WA 1E2JA 3EVEA 1Y6RA 1OLUB 3LO5A 4W5QA 2PZ8A 5AKHA 2BCGY 3E5HA 2WMDA 4NR0A 3WWEA 4AY2A 4OJKA 1OZGA 1V1RB 1J9GA 3ORSA 1RZVA 1UMBB 2VJBA 3GCWA 4O2BA 2X2OA 2AUMA 3U5TA 3AOEA 4KQCA 4C3VA 3QEKA 1CQZA 1IUNA 2VHUA 2AFHA 4GI2A 4RVNA 4EK9A 1N78A 2A14A 2XMRA 4ZAGA 3ZJYA 1FC0A 3VHRA 2F43A 2Y9MB 4BFXA 4L8YA 2AKYA 2PMFA 2JLBA 4TSRA 3ZHVA 1SXPA 4R1PA 3JYQA 3DWGA 2WTXA 2GKOA 1IXSB 3UKJA 4MYCA 4TQ9A 1JHAA 2Q1XA 4FFOA 4H7FA 3VR2D 1NX6A 3TSCA 5JSHA 5EMHA 2ECPA 1OH7A 4LHSA 4EKYA 2GOYA 4MX8A 2HY7A 4N7BA 4YAIA 2B94A 1KJIA 2G82A 4QLAA 1GKYA 3CQ9A 1CNEA 3ONDA 4QSHA 2PQ6A 1UWLA 3HYTA 1USWA 4J1SA 3LTNC 2B4RO 1IJKA 1SXJB 1UPTA 2JHAA 3IVRA 2V58A 3LCUA 2HUNA 1NNI1 3NWBA 1C3VA 4JJEA 4TSFD 1NW9B 4DJAA 3ZVKA 3VPBA 2P4UA 5FO1A 3UGKA 4KRFA 3UMVA 1II8A 2BCJQ 3H7AA 1YKGA 4KMSA 3W8FA 4B6FA 4TN5A 3B9PA 3RFVA 3UWDA 1EWTA 3F5MA 3OF3A 5ALXA 2YY6A 3BXXA 1MH1A 4B2PA 1ZMTA 3ZCXA 2HRQA 5IJ9B 2ZANA 1PFVA 3GUCA 2VPQA 1Y0BA 5F5LA 5F64A 4EGAA 4EO4A 1I32A 2JFZA 4ZOBA 5JS2A 4G0QA 5BQOA 3UBMA 4G0WA 5GJWC 4BFWA 3KU1A 4MV1A 4C6TB 1OYYA 1RJ9B 3KKKA 2R8BA 4Y6RA 4NPAA 4S35A 5LYJA 2VYQA 3KAPA 4AZ3A 4E09A 2AZ4A 5CRIA 3VC2A 4DTCA 2J85A 4K2HA 5CX1A 3SNKA 2GCGA 3LCJA 4LYYA 4XYLA 4DV2B 4B43A 5IVIA 2BUAA 3CNLA 1ISGA 1ETHA 4K2AA 3SSAA 2PYDA 4MUKA 4LRSB 2Q4RA 4XIGS 3HNRA 1TPYA 3KCNA 3R4VA 3QTLA 2SKEA 2XVAA 2QTCA 3QH4A 1QQAA 1VG1A 1XQXA 3L4SO 2W9XA 4MIOA 3UK2A 2WF6A 3X2FA 3UQYS 2ZAGA 1FE8A 3MQFA 1I3KA 1B6GA 1EJBA 2G5CA 1K3UB 1M10A 2Y4OA 3NNDA 1NQWA 2NTVA 1DMSA 1G21A 3A10A 3LSTA 2FP4B 3H5VA 4MCAA 3IBSA 3LQ4A 2OORA 4MVJF 2WU1A 3ZD8A 4F9FA 4Z1MD 5H8WA 5FI5A 2ZAYA 1R0WA 4CDMA 3R6DA 3EIEA 2XRFA 2FSFA 1PAUA 1UP7A 1TVEA 1QG4A 4NZOA 4PSCA 5G2OA 5KYVA 3WRXC 3EMKA 4HK4A 2XIQA 3A0UA 2WVAA 1ZCZA 2WJ4A 4IBOA 2WBLC 3O4RA 4PPGA 2WRZA 1CBUA 3NBXX 1LS6A 2CNDA 4HGPA 1XQ1A 4BMVA 5JRDS 3P7MA 3G23A 1VLQA 2ZAOA 1QQ5A 4G65A 4F6CA 3BAFA 1QRDA 3BDIA 3K2IA 5I9LA 4O2RA 1G9XA 2O8VA 4PTYA 3S99A 3R3WA 1XQYA 4KKXB 1PT8A 1YZLA 4FFRA 3PC8A 2JHPA 4YFYA 1EK6A 4J91A 4RO0A 3A36A 1WTCA 2K2QB 5FYDA 4BO6A 2UXCB 2R6R1 4HJRA 1JL3A 4I9GA 4ND8A 4M37A 1KI8A 4BQSA 2C5LA 4R2XA 1VLMA 4C0WA 4ALNA 3KLOA 1JYEA 1X92A 3TJRA 4ZYYA 3IMFA 3AKYA 1KJ8A 3NEPX 2QV7A 4KO2S 2DFVA 3P5BA 3VHQA 2JA1A 4QFDA 5D5QA 1Y89A 2HFKA 1QRTA 2ZW9A 5DI3B 4MW6A 1EM8B 5DBFA 4AS2A 3Q7SA 4UOQA 3KEMA 4XPIA 2HJRA 2CCGA 1JIQA 1CUZA 2P2LA 3L79A 3P5SA 3SYKA 1ULZA 4OU5A 2GEUA 4Z8XA 3QF4B 2QW0X 2ZE6A 3OOHA 5ICGA 4MRSA 1EIZA 2Q8NA 4FK8A 4EUEA 5JALA 4RZQA 4QPZA 3QPAA 3SYLA 4WADA 1L2TA 1ZA1A 1NKTA 3KLMX 1CVIA 3LRTA 4BMPB 1NXXA 2FFJA 1TQ6A 1NP3A 3KEGA 3M89A 1XL1A 4KJZA 4US0R 4IJ6A 4LISA 5ALLA 3EWIA 3RU3A 5BNZA 4E11A 3FPLA 2AQIA 4TV9F 3AP1A 5DNWA 2JJQA 1T8YA 1ZISA 2I4OA 3GPCA 5H82A 3RVDA 2BM8A 4A9AA 3CB4A 3M3HA 4HZUA 4L15A 4BWFB 4JJFA 1QNFA 1P75A 2XAAA 1IZ9A 1WCXA 1WXIA 2HRRA 2JIDA 2XWBF 3PD1A 4IIJA 5DXFA 3N2KB 1M5UA 5JD6A 1DC6A 2ZP1A 4G01B 3EZLA 1DAGA 1UC9A 3JYLA 4TT3D 4YRFA 2X8JB 3SYMA 1ZVJA 3UXMA 4NZYA 3GJ7A 5IFLA 4E2YA 3ANSA 4R6XA 1R74A 5HCIA 3T3IA 5HTKA 2K7FA 3H4VA 3RUCA 2IDMA 3IJEB 3OQIA 1K9SA 3TXAA 2BGRA 4UXJA 3AH8A 3UXEA 5KNLA 1GGJA 3VNRA 4PZ9A 3CS3A 1ZSVA 3SFVA 2QN6A 3W5VA 1C9MA 1NW7A 1TU3A 3KYDA 2F1JA 3G0OA 4YJHA 1PI3A 5CP8A 1H66A 1WABA 4NS4A 4H1WA 2HQOA 3ANLA 3D2CA 1C3JA 1CUBA 2GYVA 4RUKA 2JFBA 2VXOA 1P80A 1RLOA 3WA7A 3R6TA 4OK5A 2BM1A 3GV0A 1P2UA 3ANNA 4G1EB 3CNNA 4HLQB 3Q4GA 4XASA 3ZZMA 4AZSA 4CM8B 4LOLA 1W5BA 4KGZA 4MKGA 3EG9A 3NV9A 4IKOA 5B7PA 3BHNA 4OBBA 5IEJA 2PL3A 3KSBC 5BSGA 4AG3A 1RPJA 2ZYSA 3FDIA 3OG9A 3DNPA 1V2HE 3I01M 1HKUA 1US8A 2M32A 3QBTA 4I4TA 2DEUA 2E82A 4ZDWA 2V7GA 2OGSA 2M2IA 3ZY4A 2R1VA 1XQVA 1C2YA 1TRHA 4IYJA 2OHIA 3DTVA 3R5TA 1NF8A 4HR7A 5CLIA 2JIPA 1NKVA 2FCAA 2QN9A 4BAGA 4AS1A 1KFJB 4HQNA 1SO8A 4FMBB 3PUWA 1FP4B 4FYVA 1Q77A 1TQ2A 3CG4A 2QRNA 2Z8YM 3JAWB 4XZ3A 2OXEA 2RGEA 1IBMB 1ADFA 2PGXA 3CLTC 3NXSA 1IRIA 1M76A 1MJNA 2ZR7A 3NCTA 3LHSA 3KCQA 1O87A 5C3UA 1GRNA 4UBKA 4DFDA 1QGDA 2BFEA 3KHUA 1MAVA 1A9SA 2FUG1 5L53A 1BMQA 5G4LA 4Q1EA 1AS0A 1ZGZA 1JDUA 3AP2A 3OPMA 4FT4A 4RIIA 3UCXA 4BNJA 4TWIA 3WHKA 3KTOA 4RGBA 3KYBA 4D9EA 1X86B 1ZD4A 3JD1A 4NYMQ 4OLBA 1TCAA 2BH2A 3E7PA 3KP1A 4FX2A 3U3DA 1XDSA 2GCPA 1DFGA 3RK4A 2BONA 2OENG 4BB5A 3BERA 1F8FA 3VYRB 4D80A 3IB3A 2E4VA 2GZRA 5HJ2A 1ZI8A 1L7NA 4EECA 1M2GA 3DMPA 2AVDA 1W2GA 4MYHA 1RSZA 4IILA 3W1WA 2BUBA 2NO4A 3D43A 3ID6C 4O4JF 1GPDG 1UWCA 3IT2A 3IAS6 3LG2A 2VP6A 4BN0A 2NU6B 3FYHA 3U3JA 5AVUA 1MUUA 1EUZA 5P8WA 4K8RB 1YZUA 1DAHA 4N40A 1KEEB 1GCAA 3OVMA 2GBLC 2MINA 1UOPA 4UHEA 4B0PA 3U9SA 5HXAA 1NQVA 1PR1A 5JMPA 1J0CA 2F8LA 1EUYA 3F90A 2QSYA 1JJ7A 4HLCA 3GWZA 2G0NA 1K7YA 5DV9A 3OQ1A 4UD6A 5AOVA 3AYZB 2YMPA 1NV8A 1CIJA 2XMGA 3EMVA 2MINB 4IS3A 4HVLA 4W5OA 4LK3A 2BMEA 3TXYA 2GJ8A 1WKCA 5GMOA 2YMMA 4TV9A 2GI4A 1U0RA 4Z0HO 2NXWA 2WYOA 1RP7A 4H60A 4UU7A 2B3DA 1KJYA 2E1PA 2KLBA 2Z1NA 2KHZA 4MLZA 2UUBB 5E7QA 2W2QA 2EC5A 3KFLA 3N7TA 4S24A 5TF4A 4GR4A 4P5PA 5D86A 1L5LA 4DY4A 3D6MA 3DLPX 1QKJA 5LLTA 5CDYA 1K06A 3MXTA 1SPBS 2P68A 3R75A 1DDIA 1GUAA 4NEGA 4AN1A 3LLMA 4CMEA 3N0XA 3G5UA 4QREA 4YMUA 4RXUA 1KOLA 3U09A 4PSUA 4RNCA 1TMGE 2CJFA 2HWKA 4TXLA 1EJ2A 3W78A 4TTIA 1IDOA 1MJFA 2ANCA 2X0KA 1BKDR 1P1KA 2K7ZA 4NESA 3RR2A 4P5EA 4KWEA 5JCOC 3EVNA 2WHXA 1XEWY 1EFCA 1ZNXA 5C8ZA 2E4YA 2QLJA 1EVYA 3QUTA 2IS1A 5D3MA 1CUGA 4MMXB 5EWLA 1TFRA 1JHQA 3HSKA 1EFVA 1V7QA 1DLJA 3G9UA 4QJ5A 3BFPA 4WFQA 3LY8A 4UCWA 1U9CA 2WKSA 5LNK6 4I5GA 2WYIA 5HK9A 3ZY5A 1Q91A 4Q3BA 3DEAA 2LRHA 4BO0A 3KHKA 4WLVA 5AHXA 4E3WA 4QQKA 3RVBA 1NMEA 1A9XA 2P9EA 2X2FA 5B7QA 1KRWA 2D0IA 4E6PA 2AH5A 2PGOA 1WUYA 2FFAA 3N6RA 4W9MC 3PTAA 4KLCA 1I6WA 2H4HA 3PI7A 3HB4X 4K87A 5H80A 4F1KA 3ZDZB 2E89A 4Q3AA 3F74A 2A94A 3GW8A 1PJRA 2N3ZA 1XFAA 4G84A 4GF5A 4JQYA 3HFRA 4WTOA 2WVHA 4C3UA 1RLTA 1VP9A 1O96A 4WLUA 1N2EA 4DDKA 4JJ8A 3BQ9A 4LC0A 2DLDA 4P38A 4TRJA 1YB7A 1E1KA 1YFZA 5A3VA 2OG1A 4QDOA 1LNQA 1Z0DA 4EL0A 3V1KA 3QVSA 4IFIA 4EF5A 2GSDA 3K6SA 1ITZA 3ITNA 2H3HA 3PX3A 5K6AA 4V1CB 1WLYA 3G6WA 1X7WB 3PFNA 4I1UA 3ZDEA 1SH7A 4RSMA 2V5UA 3GEDA 3G85A 1OAOC 1G4UR 1HXHA 1KNXA 1P5ZB 1RFGE 1AD2A 2J30A 2HPHA 2HRDA 3PPIA 4XJVA 3TRJA 4W1QA 3K0HA 1Z5OA 2CLEB 3R1IA 4IX1A 4H7EA 1MOZA 5AOAA 3FH0A 1VA4A 2DE0X 3PXCX 4JC5A 3V46A 4D4IA 4I66A 3NFRA 2YFQA 4U02A 4X6UA 1P7YA 5DCWA 3OLZA 4IL5A 3TZQA 5LDGA 4F91B 4G9GA 1KRXA 1YAJA 4KE8A 1DKUA 2P6UA 2IXFA 3CRMA 3FTNA 4HQFA 4TZ0A 5EWMA 1ENZA 4W1RA 4P34A 5TSDA 8ABPA 2WUFA 1ZI9A 3OKFA 2QGFA 3ZHXA 4CQLA 4RVUA 4D96A 3QVJA 5CB4F 5E2BA 4GQBA 3PGLA 4QGGA 1KETA 4LKRA 4Z99A 1BXRB 4CUJA 4IY1A 1E4YA 1XLVA 1OZ0A 2XUQA 4GGPA 4NS1A 3UPUA 1TYAE 3SJZA 2Y6VA 3TINA 1GQSA 4B3BA 1QMGA 1WXEA 2GN4A 1ZU5A 2UVPB 2XCOA 1VKJA 4ZREA 5C7LO 3GLGE 3KQPA 3QU2A 5LQCA 3B7PA 3KZXA 3ZQKA 1KO5A 4U9HS 2V6BA 1OU4A 4JL8A 3IMKA 4OQXA 4Y9UA 2E4UA 2EVWX 4OKSA 5EE0A 5HRAA 3TCNA 5HILA 4DQKA 3Q8LA 1DQYA 4EGJA 4O2BF 4WK0B 4OH1A 3ASYA 4HQLA 3VC1A 4IMJB 3ZOZA 4GPBA 4ANFA 1JHRA 3HBMA 3MSXA 1CPYA 1ZIOA 3A4IA 3KWFA 4IH1A 4PSKA 4YCLA 5JSFA 2YXDA 4I6JA 1KVTA 2RARA 1RZRA 1Q57A 4XM0A 1ISFA 2DRIA 5EXEA 4JC4A 4B3GA 4FEGA 5HK8A 3WMEA 2VI5A 1T0PA 4O08A 4IFEA 2RC5A 2A92A 3DOFA 2AX3A 3QY0A 4G67A 1OR8A 3UHOA 3J81A 2J3EA 2F1KA 4FNAA 4GXRA 3RIHA 3HEAA 5ITWA 4UZFA 1CYEA 3H1EA 4ZHQB 3RYHA 3JPWA 3E22A 4KRYA 5EP2A 4RK1A 3W3AD 4OHZA 4YI3A 1REQB 3D7KA 1K6IA 4FEYA 2Y1XA 4ZYTA 4J0HA 2FE1A 1VL0A 3TKLA 1GZHB 2BR5A 3FJYA 3C98A 4HEHA 4DS3A 5HF6A 4L8VA 3ZPXA 2J9RA 4J29A 4P4GA 4WLNA 4DXHA 2QRKA 5JADA 2D1TA 4NYJQ 5EQJB 3TNFA 1AA9A 2IYXA 3VSCA 2VUSA 3UUWA 2VTVA 2DFKB 4HNRA 2RKOA 4FLEA 1FMFA 2QRPA 1B43A 4MTLA 3BBLA 4G1MB 4E6EA 1WY5A 1X74A 4IRMA 4M38A 3UENA 2WIFA 3Q15C 4UCQA 1I5RA 5IU6A 5IDYA 3VC3A 2GHIA 1CEYA 1K63A 1PS9A 3BWXA 4A0GA 3G2NA 3I9KA 1F6BA 2QRQA 1FP2A 1XAGA 4N3GA 4MMYB 5T57A 2BY4A 2MSNA 3TLXA 3TZEA 5I7FA 2QTTA 3SX0A 2RFLA 2PFGA 1IN4A 2I2BA 1YZQA 2ZBVA 3RRJA 1CZUA 3TTUA 1DKMA 3IS3A 2JA2A 3EC2A 5EHZA 2ON6A 2HA6A 5CHYA 1RYHA 1IXYA 3ZDAA 1PLJA 1QONA 1YO6A 4OLJA 1E3WA 2IYOA 2YH2A 1SCJA 1XMVA 2P4QA 3TX2A 2IIQA 3KVVA 5C80A 4ZZ0A 2REXB 4CFZA 4EKNB 1SD5A 2OCYC 1YQEA 1YU9A 1YACA 1XXHE 2JLYA 3KXKA 5EE3A 3O84A 3CVJA 4AD8A 5JCXA 2HMUA 2QMOA 1YZTA 3HZOA 1O4WA 4HAZA 1XYGA 2O8DB 2V7TA 3NDRA 3TTYA 2IHYA 4IH9A 5CW1A 2RE8A 4PHTA 3QX7A 4F1WA 2WMOB 1KK1A 2V03A 1XNJA 2IVZA 3CTMA 2Y76A 4OM8A 1MQSA 1QRRA 4UCFA 4AF7A 1J20A 5BSHA 1X7DA 2PWYA 3V7NA 4JYZA 2WAMA 1YS2X 1QFMA 4PR3A 3THWB 1GNSA 2BFFA 1U6JA 1E5LA 3ZYCA 2DUNA 4CG1A 5K09A 2C4WA 2PH3A 3ED5A 3WKDA 4UUPA 5HDQA 5KTPA 3CVUA 2A2ZA 4ZQCB 5A5EA 3EA4A 3IULA 4UM8B 2B98A 3BD6A 4KUEA 2VR1A 2AW5A 2Z04A 1FDIA 1M2WA 1O8BA 1DC4A 4RHUA 1N1GA 1OFGA 5MN6A 3A4LA 3BIJA 4IIUA 1TYBE 3SQLA 4RULA 5EQTA 2JGFA 5EE5B 4B7UA 2EKBA 2PKWA 3LT2A 1AO0A 3F0TA 3GPIA 4ND1A 3WL7A 5A02A 1JFTA 4KHZA 2BGGA 2B4QA 2AHRA 1C9KA 1B3RA 1ZGHA 3QXJA 4LCJA 2P11A 1QE0A 4I3FA 2DETA 4HEA6 2VA9A 2AOWA 3C5WP 4CGYA 1HNWB 3EUFA 2GEFA 2ZJZA 1Z4NA 4UEJA 1YIAA 1PDWA 4OCZA 5FJIA 1IG3A 5KTMA 1OX5A 3E9MA 2ACKA 4IMPA 2G25A 1QC5B 3KSMA 5DCLA 1RWWA 1B0ZA 2IP2A 2DTXA 2XDAA 4WRRA 3HMQA 3KJQA 1QGZA 2A6PA 3IMGA 4LZOA 2CXHA 3BE8A 4MUHA 2NT3A 4H0FA 3ZCSA 1YF3A 2QRLA 1RRVA 3GT7A 4PYLA 4CEJB 2J7KA 4BJ1A 3WLRA 2D2IA 2DOKA 1TVKB 2X1VA 4H18A 1WKVA 2ID8A 1DL5A 3QI7A 3OT4A 1M2FA 3TW4A 4DLUA 2FPPA 4AXBA 4LGMA 1UBCA 3QMWA 5G0TA 2OZKA 1NJ1A 1RQLA 3BMQA 3HCCA 3EXHB 2RHMA 2G63A 4PCVA 4BQQA 4EZEA 3I23A 1GNVA 2QQ5A 1P77A 1FXWF 1SHKA 4YASA 3PNSA 4B8YA 1V25A 1B6RA 1R6BX 1J39A 1HTTA 1P4AA 2W2NA 3DKRA 4GBMA 3Q3JB 4XX0B 3R9IA 3TBKA 4CU5A 2WTUA 3WZLA 2JHFA 4M8LA 4A5SA 2C57A 4AY4A 2HDWA 2PEZA 3ABIA 3EEBA 4BC0A 4DYVA 1WUTA 3MQ2A 4BVKA 3MLEA 1C1DA 2Y1EA 3T5CA 4YTEA 4YMVA 3IUSA 1RWQA 4ZD6A 3R7FA 3RSLA 4B5KA 5ALTA 4KH1A 4YV2A 4RK7A 2ZBUA 3EQZA 2NVWA 4KPUB 4RVOA 2CWWA 3GJQA 4Q4HB 3GZJA 3ZQ6A 1J1UA 3PIIA 5KYGA 3ON5A 4GLJA 1FSGA 4TTSA 3JD3A 1AHHA 4IRUB 1T1JA 1ZXXA 3VHXA 4DIOA 2JLSA 4HWGA 2EFYA 2A84A 1Q14A 4MUAA 5F73A 3AR7A 3HH8A 4LHYA 3SVLA 2VP0A 3KQVA 1ZVVA 2H52A 3E5MA 1RC8A 1J22A 1UBLS 5CFMA 2HBYA 1T0JB 3A6PC 3LY5A 3UAYA 3JQEA 1IUOA 5CT5A 3WI7A 2WEKA 4RIHA 2NSDA 5CNMA 2EWVA 4D9HA 2HRBA 5FULA 1ULHA 4C03A 3RANA 2GPTA 1QRAA 5JDCC 3TR0A 4EDHA 2XT6A 3C14C 4FDUA 4PLFA 1RWNA 1AUVA 2YHIA 3VR6A 5FQOA 3PFIA 1GYRA 4FZ5A 3OWXA 4J1TC 3SZOA 1XA0A 4HZIA 3W4IA 1L5RA 2Q9UA 4NOMA 1NW6A 4DVJA 5KVSA 4IEIA 5D00A 1J09A 1SCIA 1T35A 2PKXA 1T2UA 3KJIA 4JLMA 4FWIB 1EWRA 4F4JA 3I2JA 3MSCA 1IY9A 5DRTA 2Q3FA 2ORWA 1WCIB 2D00A 2FVYA 3R20A 4KMMA 1BE8A 5BOSB 2GJ9A 1O96B 1HURA 2I7TA 1VPTA 2RJNA 1ULBA 3CN7A 5JLJA 3OEHA 4EMSA 3N6XA 1GGFA 4QTUB 2DBYA 2J09A 4EI9A 1RYNA 1XI2A 3QP9A 1Q16A 3UAZA 4DCJA 4EHAA 1WCIA 4QUJA 1KJ9A 5BW4A 1SZPA 2ONCA 2XMBA 5TARA 2IDZA 3R2JA 2RAVA 1X7GA 4GKKB 1MZVA 1YXMA 2OVBA 2J48A 4JLOA 2R2GA 1Y3IA 5E4JA 1DEAA 1Z0FA 3EUEA 3C8HA 4JGBA 5DW0A 3DBHA 1PF7E 2I3BA 1JHOA 2FQ1A 1M9NA 1IEXA 1YVUA 2JGLA 4I9FA 1IJFA 3WSTA 3O7MA 4EATA 1FQKA 1H6AA 4REOA 2ODTX 3KKZA 1E9EA 3MRXA 4RSGA 1Y8RB 3CUYA 1YR3A 2R6ZA 5FNVF 1XEFA 2QX4A 2ATIA 3OE7D 3B13B 3HDHA 2F55A 3QYPA 4MB2A 4JVLA 4K9QA 4M0EA 4B46A 2WZCA 4ZN6A 3PNVA 4CMGA 1OFIA 1W0KD 3OTIA 4S04A 2FWPA 4KVAA 5LU9A 4DDMA 2DXIA 4U7TB 1SBQA 3ZV6A 3OZUA 2PUHA 2BSXA 1YL7A 4GOOD 3TOSA 1SC4A 4UQOA 2FZLA 4I55B 3VKVA 1LBHA 1IBRA 1TJ4A 1IM5A 3VUFA 3TW0A 3WQQA 4DVGA 1NY6A 1XJQA 4ZANA 2BHNA 1C7EA 3EXFA 3OQPA 4J2OA 1DQNA 2BHLA 3MS4A 3W5AA 1OPRA 2A3RA 2WPDD 3KKPA 3C16C 2B2NA 1YB4A 3PC4A 4ARZA 2C9CA 3HUTA 2CNOA 1HDYA 3QUQA 4LHXA 2V9CA 3N0VA 2H11A 3JZMA 1GUBA 4I81A 5BXQC 2WUWE 5A5DA 1MA3A 1HZZC 3QKUA 3TG8A 2H1FA 3KVNA 3M3PA 3Q1LA 2AFIA 5IKEA 4NV0A 4ZRMA 2Q2WA 3VMMA 3RCBA 4JLNA 1SK8A 3WV4A 3GP8A 2ZPTX 2FRXA 3E7XA 4I8DA 4PIVA 2QPLA 1DIBA 5KTOA 5J23A 1E0AA 5AIBA 3P2MA 4R51A 4ZAYA 2XXAB 2G4LA 2IW1A 1P6QA 3K31A 3IDFA 4OI0A 2HIGA 3AR5A 4Q6WA 5LBIA 1CKEA 1QO0A 4A27A 3H04A 1VL6A 2X8LA 4RY8A 4MNTA 1WZUA 1ONBA 3EVDA 2GYYA 1ODTC 1Z6XA 3GX1A 5ALJA 1PX2A 2W2LA 1UMDA 2R8XA 1EB8A 1O3YA 1PZNA 3AVOA 3D54D 5ARCA 2KM1A 3QQPA 1A8SA 2OO5A 5KTYA 4EUKA 3V34A 2FOLA 1EEHA 3AU9A 5CBPB 4DABA 1GHTA 4G5YA 4PHCA 1HSZA 4C6HA 1ESEA 1W52X 4I55F 4E2FA 5JAIA 1GILA 3MQ4A 4LJLA 1W0JD 5EESA 1U8UA 1WCV1 3H0EA 3LKZA 3PDUA 5FUVA 4H6XA 3VPSA 1VHJA 4NONA 3W0LB 4PHFA 1C8VB 1HK7A 2OXTA 3RTBA 1AZSC 5JCPA 1PGJA 1Z38A 3OAAA 4DV6B 4H0CA 4RL6A 1WU8A 1YB6A 4JFRA 2RI0A 3DKIA 3N75A 3NR2A 3O9VA 4NEHB 5KDLA 4A2WA 4YXWD 4NCBA 3OO1A 4U7GA 3PQEA 2ZCVA 5ALYA 4DZRA 2TMGA 4R5MA 3KLPX 4XJXA 1WNTA 1I2AA 1Z83A 4EABA 4EJMA 4CEIB 1UIMA 2XF8A 3FHCB 2H85A 4A6PA 1DMRA 3LNTA 5A6VA 2HPAA 4QGAA 3OIGA 2J0EA 2XZLA 3BUSA 3A1EA 3CTPA 3O73A 4DV0B 4C22A 4ZA2A 3DH0A 2CV2A 5EE9A 3HBNA 3WGHA 5K99A 3ADCA 3SZMA 4MULA 3HV0A 3JZFA 4F71A 4ZC8A 1KERA 1N7JA 1WOYA 2J5RA 3B89A 4Z9BA 2V3WA 2GUWA 5ALZA 5FOVA 1WXWA 4MJ3A 1LA2A 3D3WB 4X44A 2AI1A 4M1OA 4WMLA 1M67A 2YWXA 5FA8A 5GPBA 1BW9A 3WHPA 3BRSA 2HA0A 5J4HA 5A0FA 3WBFA 1WHTB 1DRJA 4W1PA 2PIDA 3N7AA 1NM5A 4RZUA 4B2YA 2BMDA 2VZ8A 4EHIA 4GMHA 1ZHOA 4P2GA 3D2LA 2ZTHA 4G9EA 9LDBA 3CLVA 1BNCA 1Q0HA 1LH0A 2Z83A 1EFPA 2XB4A 3N39C 2XVXA 1GU7A 3FPBA 1G21B 2H48A 2VDMB 3FUCA 1XR3A 1L1EA 4NZNA 3E3NA 3HKEA 4K3UA 4M53A 4PE5B 1A5SB 3PX2A 1Z3IX 5KYUA 4N4AA 3BOSA 2GK4A 5JHHB 3A25A 3E3MA 4MV0A 5FHQA 5ULLA 1WUHS 3ZVNA 3QQ5A 4WK6A 2CE2X 3C3KA 3F96A 1SR8A 3V4LA 2ZWVA 3IHWA 5BV8A 5IX8A 1UM9A 3GH1A 3O9ZA 4EA7A 1QH1A 4EAAA 4LWOA 4DUGA 3PBKA 1WO8A 2ZZKA 3PQ8A 1PDOA 5B5SA 1KPGA 1EI9A 2PSFA 1CY7A 3GRYA 3ROFA 4AZTA 2LUOA 5KYUB 2IS6A 3EGVA 3VKUA 3QXXA 4MKIA 4V0RA 4L0DA 1T8UA 4NAHA 2PD3A 2XT9A 1QZTA 5CLQA 1QRSA 4DBVO 1Z2OX 4TXNA 1XMXA 4DJDC 3W06A 3EK2A 2YIMA 1QCDA 1N2CA 1RKVA 4Z0PA 4IJUA 1MXFA 1E7YA 1NXVA 1CQIB 2ZJ0A 1Z17A 4B4WA 2H5LA 4O8CA 5U9CA 1CHNA 3AKDA 4NBKA 4FOOA 3EPHA 4JV5B 4LVNA 1Q17A 4QO8A 5IHPA 2H7XA 3SZ3A 1N2CB 5HBRA 3BK2A 4FOPA 1VLJA 1W1IA 3WRYC 4HYTA 2X19A 3DHEA 4MJ7A 4NBNA 2ZREA 5AICA 3IEPA 1UKEA 3NV7A 4P93A 4B8ZA 4C1NA 2YWRA 2F8SA 3L46A 3WGZA 1YQDA 1DOAA 4S1NA 1PFGA 1WZIA 2NQ2C 4GZ5A 4HMOA 2OA0A 3WL3A 3E9EA 1HWYA 3FB1A 4KFCA 3LFHA 4KN9S 4Y67A 1NT2A 4ZAWA 4EJ6A 1YK0A 2KB0A 1JDNA 2GERA 4MR9A 5LOVF 5AUOB 4W6QA 2J45A 4RY0A 2JATA 4H7DA 1JWAB 3BGDA 3TVDA 3H17A 2JDID 1KIAA 3MTQA 3G7SA 4X71A 2J87A 3WGVA 1TO1E 4F86A 3PG5A 2VQEB 2FPIB 4EMBA 1WSDA 1AA6A 2XWSA 1SU7A 5FKJA 3TPFA 4KXLA 4ZTBA 4MRPA 1N6NA 2J9FA 4WERA 2W4MA 4AW9A 3ZQJA 4P98A 4BRZA 4QUBA 5UKDA 5AKGA 1DCTA 2HYIC 3L1UA 3ZWVA 4KI7A 3TDMA 2GPJA 4U3JA 2CBGA 2NT4A 3Q40A 5BYAA 2HDNB 3LT4A 3S5UA 5KQPA 1QOQB 4FYIA 2L82A 4OHFA 3HCRA 3BKWA 1O5OA 2OHGA 4N5MA 1A9OA 3K0CC 4G1UC 4BAZA 2V1UA 5FOSA 4BKMA 2DHRA 3UK0A 2OD9A 4OGGA 3PUZA 3FYUB 4G0NA 4WK2B 4CCWA 1KY5A 2L17A 3DVSX 2QGZA 2P6NA 1BD4A 3QKIA 4Q24A 5BP7A 3IPCA 1G66A 3OEWA 2IPNA 5L3QA 3OJOA 3PXAA 4P3NA 3ROKA 3U1TA 3HCWA 3VR5D 1J2TA 4K6OA 2XXAA 3BDAA 3FZEA 3ICWA 2MT9A 1W581 1VOTA 1FW6A 4C2AA 3G82C 5HWSA 1Z5VA 3LDFA 1EFTA 3OJFA 1C9NA 3C6ZA 3N2YA 4C14A 2C7VA 2Y1OA 2YV4A 2Z3ZA 4M1SA 3B12A 5FUBA 1P1BA 3LYLA 4N8EA 2C83A 4C4PA 4O4IB 1DRUA 2Z6UA 1D1PA 3EGEA 3KQQA 2H8KA 3OTWA 3VTFA 4CHTA 5K0FA 2ZRIA 1XLTA 5CG1A 1JKFA 1TMOA 2ZS9A 1SBYA 1RPAA 3F7TA 1VMKA 2JFUA 3KRTA 4R8LA 4GRDA 1GTRA 1VBFA 4QEZA 1F2DA 1VQ1A 5TQ2A 1ZMRA 1KO7A 3L9WA 3NC1C 1JH8A 1JHUA 4HGQA 4YGYA 2QZPA 2IC5A 3GMTA 4CDNA 1Z2PX 4R2WA 4V3BA 5I7AA 2VPXA 4PYNA 3WYDA 1OH8A 1QK3A 4ETWA 4R41A 2PZEA 5CG2A 3PNMA 2CXOA 3QX9A 2JFGA 3M6UA 4PFKA 1Z33A 3PICA 1DRKA 3C2QA 4CIDA 2ZXUA 2BI8A 1QZZA 2EGGA 1D6SA 3A1FA 3K9BA 3T7EA 2DUMA 2OBBA 3A6ZA 5AHRA 3T1QA 2DHDA 4C89A 4REMA 4ZQEA 4IJKA 3OLYA 3OFJA 2QRJA 3MTIA 4Z7OB 2DF8A 3GCGA 5KHOC 3DE5X 5HYVA 2R5FA 1NMSA 3S3TA 3RFFA 2ZGVA 4OI4A 3B3GA 5FV7A 3DTYA 1WP4A 4HZGA 1TM1E 1D5WA 1D2MA 4KQFA 3I45A 1XRJA 3THRA 3NHZA 3HJHA 5JUWA 2YRXA 4GKVA 1DG3A 5FPTA 4DR3B 2GEVA 4TYMA 3RSOA 4GSYA 3JQPA 4FN5A 3U7RA 1N3YA 1TKRA 2IQ5A 2B82A 4RHYA 4NBSA 3LPNA 3OZRA 1GRRA 4X92A 4ZT2A 4E2ZA 1EVIA 2R2AA 5JH7B 2PM8A 1JQ3A 3CEMA 3DDSA 4O0MA 4BNHA 5K8VA 4PINA 1J23A 3EQ6A 3MS2A 3P2EA 3ZHOA 3LZ6A 4AG6A 4DOMA 2W0MA 2WTNA 3JTEA 4FZRA 1PR0A 4GXQA 4WIAA 2VPWA 5HRUA 2O3TA 1V4NA 2JZNA 4OJMX 3T5MA 1LDYA 1O89A 1ZIXA 1KVQA 3DULA 4A91A 1GTVA 2J67A 5CYPA 4JXJA 5KTKA 1OVGA 1XF9A 2O8FA 1S3GA 4ZOQI 1PEKE 2RCNA 3ETNA 4IDNA 4Q66C 5KO2A 1UOEA 4INAA 4IZHA 4NDAA 4JI6B 1H8ED 2O2GA 5DP2A 5LP6F 1FYDA 2IUSA 4N8SA 5JBIA 1PUJA 1XVTA 1E69A 1XXLA 1USVA 2Q6KA 4HWKA 4MVJM 4LZNA 4N8DA 5E3IA