3ACCA

Crystal structure of hypoxanthine-guanine phosphoribosyltransferase with gmp from thermus thermophilus hb8
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
177
structure length
166
Chain Sequence
GMFTPGNGPVQISAEAIKKRVEELGGEIARDYQGKTPHLICVLNGAFIFMADLVRAIPLPLTMDFIAISSYLLKDLRLPIHGRDVIVVEDIVDTGLTLSYLLDYLEARKPASVRVAALLSKPSRRQVEVPIHYLGFEIEDAYVYGYGLDRAQFDRNLPFITSIRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Structures of hypoxanthine-guanine phosphoribosyltransferase (TTHA0220) from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 50
structure length 166
sequence length 177
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2009-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3accA00
1ECJA 1WD5A 1U9YA 2JBHA 5JSQA 3LRTA 5HIAA 1STOA 4RHTA 4P83A 2YZKA 5BQPA 2P1ZA 1G9TA 1HGXA 2DY0A 1ZN8A 2E55A 4P82A 2EHJA 4RANA 2AEEA 2WNSA 1AO0A 3QW4B 5BSKA 1JLRA 2VFAA 1A96A 5ESWA 1LH0A 3ACCA 3G6WA 1ECFA 3ACDA 5IAOA 1DKUA 1Z7GA 1OPRA 2GEBA 3S5JA 1GRVA 1G2QA 1JLSA 1HMPA 1L1RA 3GGJA 1I13A 4F8EA 1U9ZA 3ACBA 3GGCA 4P80A 4RHYA 1OROA 4RAQA 1W30A 5BRNA 3O7MA 4P81A 4S2UA 5K51A 1BZYA 5JV5A 4PAWA 3MBIA 4Z1OA 5IPFA 2FXVA 3LPNA 4RQAA 3NAGA 1A3CA 1P18A 4IJQA 4M0UA 1G9SA 4PFQA 1I5EA 5E38A 1ECBA 1J7JA 1VSTA 1YFZA 1XTUA 4JLSA 1UPUA 4TWBA 4QRIA 2H06A 1A98A 3OHPA 4JITA 1G2PA 1XZ8A 4FYMA 1QCDA 1DKRA 5ESXA 4ZFNA 1PZMA 4RABA 1ZN9A 4P84A 4WMLA 4M0PA 2PRYA 2C4KA 4RHXA 1QB8A 1A97A 4RADA 4X45A 4P3KA 1D6NA 1QB7A 5BQOA 3MJDA 4WN3A 1BD4A 1DBRA 1TC2A 1QK4A 3HVUA 1BD3A 1UPFA 1A95A 1R3UA 3GEPA 4RAOA 2IGBA 1QK5A 1VDMA 1ZN7A 3DEZA 4QYIA 1I0IA 2H08A 1IBSA 2XBUA 1GPH1 4LZOA 1O57A 2HCRA 1QCCA 2H07A 1P19A 5EUCA 1OREA 2JI4A 1A4XA 3H83A 1I14A 1V9SA 4P86A 1TC1A 1CJBA 2PS1A 4RHUA 2PRZA 1Y0BA 5KAPA 3DMPA 4M0KA 1XTTA 1XTVA 4MB6A 1DQNA 3KB8A 1MZVA 2JKZA 1QK3A 3DAHA 4RQBA 4LYYA 2JKYA 4RACA 4LYGA 1I0LA 1P17A 3OZFA 1NULA 4RV4A 5KAMA 1O5OA 3OZGA 1ECGA 1DQPA 1NONA 4OHCA 5HKLA 4X44A 3EFHA 4LZAA 4QYIB 1VCHA 1UFRA 1XZNA 3N2LA 1L1QA 3M3HA 1FSGA 4KN6A 4LZNA 1P4AA 1ECCA
chains in the Genus database with same CATH superfamily
3RSZA 1PBTA 2NACA 2JBHA 4M36A 4DR7B 1T3GA 4MV9A 3U49A 4PPFA 2YZKA 3PFFA 3IDSA 1NUHA 4M9SA 4LSGA 3AF1A 3H1GA 3HKBA 3WJAA 5I9IA 4GSLA 2A5YB 3K6SB 2RBEA 3SEAA 3R5XA 4DR1B 1RI3A 3AH8A 1TRKA 1ECFA 1EG7A 1WXDA 2R6FA 4KB5A 2HRRA 4FJ1A 4ND2A 4ZCRA 4P92A 4V1CA 3IEIA 1Z7EA 1T9GR 3FB1A 4YR7A 4OGKA 3HH8A 5D6NA 2CVPA 1IYZA 3UAVA 2CZCA 2ZYAA 3U0BA 3OIFA 1ESEA 4PTLA 4URHA 5DRTA 3RFFA 3WDSA 5TQVA 1QOZA 4L8YA 3G0IA 4NPAA 4U8GA 2O14A 2P9CA 1I4OA 3UC9A 4CF5A 4RAQA 1ZD2P 5COQA 4CM8A 4F97A 3C97A 2W4IA 4TMFA 1AKQA 1R9NA 4PQYA 4QGSA 1ZRSA 2VJQA 2XUDA 3MJVA 2HK9A 2EFHB 1J2JA 1LNSA 5A1TA 2E4ZA 2OXFA 3Q87B 1L5SA 3LPNA 3DBHB 1NE7A 3L7OA 3QNUA 5B57C 5JZ9A 2BBSA 4PFQA 3FNIA 4QJ4A 1RJFA 3PRYA 3CR3C 2XA2A 1V3TA 1YR8A 3TW8B 4EHIA 5CTAA 2MSKA 1TK9A 4XPIA 5CX1A 3X43A 1NBME 1N1GA 1L9XA 2O05A 2W2LD 1ZUHA 2EEZA 1UDWA 2PAAA 1U5BB 4KIFA 3HN7A 4NEHB 4C2TA 2BMVA 3N9IA 5IBQA 4F91B 2YINC 3M1AA 3OUUA 1TM7E 3EXHB 2AOTA 3E9ZA 3MCVA 2CVZA 2RB4A 3PC4A 4LS3A 3HCNA 1A97A 4RADA 1XN1A 4AUKA 4JQYA 2XUQA 4AJLA 5IZ4A 1R0SA 4LK3A 2V7VA 2WJVA 3DYVA 3PDUA 4ND4A 5DBHX 2INGX 4FKZA 3L84A 1CUGA 3ESXA 2BGUA 3O8QB 4I5IA 3RFUA 4QXPA 5JRDS 1GDTA 1WDKA 1YQEA 5IBRA 3HMKA 2OA0A 3NS7A 3I42A 4TLDA 1YGPA 2YW2A 2C78A 3VQTA 4AJPA 2XKKA 1R16A 1K2WA 1Z5NA 2GJ8A 721PA 3BXZA 5EUBA 5L4NA 2AL7A 3ZQ4A 1CY1A 4CLOB 2X3YA 1W36D 5LN1A 3HO6A 1WRBA 3P2KA 4IDAA 4IIYA 3CZRA 1TC1A 2I55A 3OOWA 3VC2A 2O6HA 5HK8A 3AR7A 3HP7A 1D1PA 5BT9A 1TMYA 3VR4D 4EPWA 1QVZA 1YS7A 5B7NA 3EF3A 3BHIA 2TS1A 2EKLA 1QZUA 4HFNA 4KGZA 2D1YA 4Y6OA 2WY2D 3SSOA 1DSSG 3DEAA 3WHLA 3TGPA 1SVOA 1KNXA 2W2XA 2FUG1 2OSVA 3IELA 3HDJA 5TRTA 5GIOE 1MF7A 1WUKS 1XCBA 1YDEA 3D7RA 5EG5A 4F93B 3HCDA 1L5RA 2Q5JA 4CKYA 1DG3A 1K4YA 2V6GA 2ZU0C 1XZQA 1Z4JA 2HLPA 1CQJA 4A6EA 1TYZA 2HAEA 2HIHA 5DM60 1FSPA 4U9IS 3ORSA 2A67A 3L6CA 3OCCA 3NHWA 2NU7B 2MSNA 1TRHA 3EY4A 1NIJA 3PL1A 3IEKA 1G21E 3OCZA 4G5RA 1FP4B 2JK1A 4UVEA 4QXMA 3D0QA 4IL5A 2E0IA 4FMDB 5DX0A 3DMDA 4G23A 4ZVTA 3VO1A 5IVKA 1E63A 2ECFA 1AD2A 1V95A 1GQSA 2QD3A 1IY1A 1YC2A 4G3XA 4X9XA 1U8YA 3OCXA 4OHPA 3AWDA 4JUAA 3ZV3A 5BN4A 3GRZA 1ZCZA 1BEEA 2J9FB 1VMIA 1UOPA 5B53A 2DQ4A 2Q1XA 1P8AA 4W1PA 3VTKA 3C1AA 3ZBQA 2GB4A 2HJ9A 1FUEA 1VPVA 2GZRA 4GM4A 3AV0B 4OXRA 4RF4A 2YWFA 3ZWOA 1TAGA 4Q7JB 1L4KA 2HO4A 2QVCA 3C1UA 4H6VA 1IEVA 4H7FA 4QC2A 1AF7A 1VYHA 3LX6A 3QE2A 4U2KA 4C3ZA 2QS9A 4IX1A 3S2SA 3H1PA 4A1FA 1PD1A 1LLQA 2OHHA 2CLEB 1ONPA 2VZEA 2Y0EA 3CRZA 3LXXA 3E53A 4QTZA 1O54A 4AG6A 5A3JA 2GFHA 3P2MA 4IO1A 1EFRD 1A9OA 1HDRA 1UJNA 1ORIA 2JHCA 2LZ0A 2VH5R 3CV3A 3KPUA 4MVJP 3W6PA 4AX8A 1EX9A 4AZ0B 3MC1A 4RKWA 4JUBA 4GC9A 2Y1CA 2V7WA 4GGMX 2IS2A 2YUTA 1I5EA 2H4ZA 4BNIA 221PA 3IDZA 2EJTA 5KINB 4A36A 1LWNA 3A6KA 2AJDA 4OI2A 4REOA 3PKIA 1NURA 2R8RA 2Z57A 2ZRGA 2JIRA 3R20A 3A36A 1ZC4A 2G07A 1B8VA 4IHJA 1JXOA 2JA1A 3CUSA 3CX6A 2GO1A 1EDOA 1B3RA 4ZARA 4YCMA 1T0JB 1XZ8A 3Q7TA 4JQCA 4YHHB 4ND5A 1JIQA 2C2BA 4W9NC 3QXHA 1TT5B 4YJ2F 3Q41A 3UF0A 1LLUA 2IHTA 3LOPA 4ILKA 4LDJA 5KOJA 4M0PA 5IM5A 1T8PA 1MRNA 3I73A 3WAJA 1T2NA 3B6MA 1E6KA 1ISRA 2IFTA 2RJNA 1ONSA 4QQNA 3V42A 2ZQZA 5FX2A 1VYVA 5EN4A 3PLNA 2H2AA 3ETDA 3DE1X 2DFLA 2O48X 3KZXA 4LYEA 2JD1A 3RUEA 3UB2A 3V8NA 2FQWA 4B6OA 1UKZA 2UAGA 4I2NA 4BE7B 5JALA 4PLGA 4IICA 2RGCA 1X1QA 3EHDA 3VFDA 1NXXA 3P27A 5LMNB 3TL2A 1JJFA 2Q5LA 2PH7A 2XMRA 3QPUA 1MAHA 4FTWA 4IX9A 1T8WA 2FSGA 3U40A 3CUVA 2FFBA 3PI7A 3JVVA 3B89A 3S55A 4MS1B 4IILA 4KACA 2V5AA 1KZGB 3GMDA 4OBWA 4L75A 3TFWA 3ZLTA 3ZX4A 4A8TA 5DGHA 3B9RA 3LCMA 4ESEA 5HE8A 2C31A 4IMIB 3QUCA 7MDHA 3F6RA 1GJRA 5C5CA 4BNDB 2ZWPA 1JFTA 3I2FA 1YRAA 3IOCA 2GM4A 1GFSA 2H16A 4YMLA 2IYWA 2GA8A 4OD0A 3RYFA 3FMIA 4M7WA 1ESMA 5AK3A 3GLIE 1OSNA 4JYAB 4NOMA 4B76A 1F60A 2CWWA 1CUCA 2XWSA 1UBLS 3QF4B 2W93A 4J90A 4R7TA 3VYUB 1MN6A 5KNBD 1SHTX 2DBZA 4PYJA 3L77A 2YV4A 3BGIA 4R81A 5AI9A 5JROA 4AD8A 4RH3A 4WDRA 2HA3A 1MOPA 3TQSA 4D9IA 3UWKA 1AGYA 2ZSIA 4GPAA 4C89A 1H23A 4KYTA 1XF1A 1RZVA 3A3NA 3E84A 1QVWA 1E1QD 4H7IA 3ANYB 4FM9A 1JSLA 3FR7A 1G42A 1PX2A 5DLQC 3WI7A 3RVMA 1NG1A 4NXMB 4D0SA 1N7JA 2DJIA 3OQ6A 2V9ZA 2ZJYA 3FB4A 3KHTA 5ALOA 5H3LA 4NU6A 2QLBA 3PR1A 2KJQA 4R2XA 5HDQA 3RSHA 3SF0A 1FVFA 2N0SA 3CPSA 3ZE6A 3KQQA 2PYIA 1HO3A 2VYNA 4YP5A 1EHCA 1H3EA 4EOGA 1OI7A 1TCAA 2ZYGA 5EP2A 5FPPA 3QFFA 3Q8LA 5KOYA 2YCBA 3EZLA 1MG5A 1XTPA 4LY3A 4JYBA 3VX3A 4URXR 5IWCA 1MENA 4M9ZA 3B7WA 1QRRA 4H1UA 4BFSA 4CNBA 1F0YA 1HKHA 1QHSA 4OV6B 3TLCA 1LSOA 4DA8A 1GKKA 1XYYA 1TF2A 5L40A 5IT0A 5FB3A 4KSCA 2WZBA 2XDWA 3THWB 3A31A 5AVVA 2P11A 2X9QA 4N12A 2IZ6A 1A3CA 2XX3A 2WMYA 4FR2A 1H6AA 3KSBC 3RHSA 3PUXA 4MEJA 5A71A 2X8LA 2HF2A 1Z33A 2BY4A 5BN5B 3OOHA 5FP0A 1P0CA 3G8CA 1KH2A 3ZGOA 1AN0A 4ZT6A 4P4TA 2OOSA 1WCYA 4JI5B 4OX9B 2WP0A 5F23A 4WFIA 5AM3A 2R5WA 2P9YA 5DF1A 4RK1A 3UK7A 1ULZA 1MO5A 3I3OA 3VO2A 4TSFD 3W2HA 2QVZX 5GP1A 2NAPA 4TXHA 2V1XA 2A9RA 4O1IA 5IKMA 2ZE7A 2HDNB 3EGEA 1BHSA 4MW0A 1R12A 3T38A 1SUIA 4MVJF 3IESA 3ZNOA 1PJTA 3NP9A 2K6GA 3PGA1 1J23A 3IBSA 3CQ9A 5LQKA 4MQLA 3BGSA 4LNUB 4C21A 2CYBA 4RH1A 2Q3MA 5L3VA 1Y6QA 2A9QA 4A27A 1QO0D 1VKOA 2YMPA 3D6AA 3LC2O 5DBGA 5F2KA 3DOOA 5CEEA 1Y1RA 4C4AA 1KVUA 1MB2A 1PR6A 1ZG3A 3FM9A 3RQSA 1Z6GA 1U5AA 2QAGB 4QRDA 2O3RA 1GG9A 2X0KA 2D59A 5GGXA 4Y67A 2JVJA 2FSHA 4PYOA 2ONZA 5JS7A 5JSZB 5ALYA 1TUIA 4GXTA 4OHVA 3I2HA 4O2BA 5FADA 1W4LA 4ZVVA 8ADHA 4ZO6A 1EP3B 2B1QA 2WHXA 5HP4A 5GAJA 2OKGA 1VE5A 3DV0A 1CZKA 3SC2B 5KNCH 4INPA 3K9WA 4JI6B 3V3KA 1OLSB 1D2GA 1OYVA 3NNSA 4RNCA 4BNGA 4BGDA 1ADGA 1T6BY 2H11A 3SEQA 1OFHA 4YLYA 4KWHA 4L4RA 3PF9A 1P4JA 4TM8A 2XUKA 2KLBA 1Y98A 3T3IA 2G1AA 2PRKA 2OCIA 3AUFA 3TJMA 4O4JF 1JH8A 4EGFA 1KE2A 3HKDB 1R66A 3U1VA 3ZDFA 2JJ1D 4KN6A 5CDFA 1H1DA 4MUKA 4OAQA 3LYHA 4NX2A 4UHJA 4JB2A 3I9NA 4Y6GB 3X2SA 2JGJA 2QR3A 1CCWA 2PWZA 3TEJA 4NMLA 5E7IA 3KVNA 1IPHA 3P20A 4N40A 5KWSA 1PYGA 3C85A 2NOAA 1IJBA 1XZJA 1W5SA 1F5NA 2AW5A 2Y6UA 3A6HA 1K6EA 5DHUA 3L04A 1AMOA 1DZ3A 2VO1A 1Y7HA 4DNQA 1XK6A 3SFVA 5JZVA 4IAOA 2CXHA 4P1ZA 1QH8A 4HLQB 1NSYA 5IJAA 4HEA6 3M2PA 1N0HA 1PIWA 4Y1EA 1S2MA 2D6FA 4TV8F 3WKDA 4O08A 4L72A 3MTBA 5DLDA 1EUDA 2XXAA 1BX1A 1EZZA 3LHKA 4H1WA 4L15A 2R7KA 2ODWA 1I94B 3GGJA 3U48A 3DCJA 4YJ3B 2PSDA 4CFSA 3IOBA 5HZKA 1A5TA 1AKRA 2FTKE 3BZUA 1LBHA 1XC7A 2P2GA 2QJOA 3N8IA 4P3XA 1W73A 3BK1A 5LVAA 3P45A 1BVHA 4CN8A 3RADC 5JD3A 5FNVF 2WIAA 4A10A 3CF4G 4G1MB 3R5FA 3KUDA 3N86A 4I3HA 5L9AA 5DJ5A 1L5ZA 4Z2YA 3C6MA 3A9UA 2XQFA 4LZZA 1SC4A 3GRFA 1NX9A 3RBXA 4K0KB 2DFPA 1KI7A 4FZVA 2FWNA 4ICIA 3SZ3A 3H0CA 1VHJA 3AZOA 5WRFA 4X3OA 1XA3A 2PKWA 1E3QA 1FMCA 5D87A 1E62A 4O4IB 2UUCB 1RLOA 3NP7A 4PQGA 2A9PA 2XCUA 4D4HA 4JEMA 4W5HA 2FMFA 2FH5B 1SR8A 2V0NA 2Q2OA 3W5UA 4BDSA 5HIIA 4XYEA 3C5HA 4F2WA 1CDZA 4KL8S 4B3JA 3PFKA 4GMKA 4UQLA 3SHVA 5DYGA 3WDMA 1EVYA 3E48A 3IP6A 3TXAA 5KCZA 4UOZA 5A6VA 1U2DC 1XTKA 2XGMA 4RPIA 1PR4A 3WGMA 1E79D 1L7OA 4PGMA 5C8YA 3NTOA 1JHXA 2BJWA 1BO6A 3SS9X 3GV0A 1U2EA 2JFHA 1EVJA 1WXEA 2CBZA 3P2JA 3NJRA 3WJ2A 2Z58A 3BIJA 4KAJA 4DKXA 4CE6A 1JEAA 3CFYA 4R1OA 3LKDA 4D6YA 5LQMA 3UWOA 2AXEA 2HCJB 3UW1A 3HFJA 1KETA 2IH5A 1CJMA 3AETB 5CLGA 1U0NA 5JNSA 1AJEA 2I9KA 3T3MB 3DOCA 4Y2JA 1CX9B 1VKRA 3PUWA 3FJOA 4LX8A 5AVTA 2NU9B 1UJBA 1E32A 1XAHA 3EIOA 1HETA 1NY6A 5EIFA 1TXGA 1P39A 1VE9A 1NVTA 3AG6A 3LY9A 1N2EA 3MMNA 4GKBA 1B8OA 1L5MA 1Z74A 2EAUA 5MN5A 3HP1A 4WKGA 2FF7A 2OORA 1X1DA 1CFJA 3MW8A 1P81A 1U0JA 4UE6A 4W5QA 2A5LA 4TLBA 1WPRA 3IIJA 3JATA 3UMFA 1W5EA 4QYMA 3V6LA 5IRCD 1E3SA 4U4AA 2PLAA 3V33A 1WNFA 4ZVQA 3AZQA 3D4PA 3L8MA 1KDVA 1EZ1A 2C57A 2GRJA 3V4ZA 3NZEA 3WMRA 1TVEA 2JI8A 2PX2A 4I14A 3IDOA 4CF6A 3EZ7A 3ASUA 3OJOA 1DC8A 1JFRA 2FEMA 4J2OA 1Z13A 4OI4A 4PPYA 1I5OA 1E2IA 4WESB 1B0AA 3OZCA 3ADCA 4K2AA 3NWEA 2EXXA 3W05A 5TJ9A 1A7KA 1TNDA 4DRZA 4XGKA 3B20A 1XZDA 3EISA 5U9CA 4FWBA 2F8SA 2FKNA 4TRNA 1XROA 4OQMA 3I8XA 5AKXA 4D46A 4JOBA 1BKSB 1RC1A 4YMWA 4EPXA 3GJ0A 3MIIA 2TSYB 4EA7A 3GMSA 4N5MA 3SSAA 4UNNA 1PZEA 1OKKD 5H81A 3AY6A 4J91A 3TLJA 3TZQA 5FPSA 1ZD1A 4YVFA 2BP7A 5KNDD 4BQNA 1GNQA 4EG5A 2DH6A 5FLEX 1DXQA 3ZDCA 3BE6A 4NYMQ 4OQFA 2AFRA 3EWSA 4CDGA 4R0MA 5BR1A 4HYQA 4B2PA 1DIAA 5EIBC 1R9GA 3ZU4A 2G9RA 3E9RA 5FI5A 5ALHA 1NGSA 2XF2A 3VU8A 2Y67A 4TV8A 4A2QA 1XRQA 3I9FA 4I9NA 1ZL0A 4ZCPA 5BUQA 4RQAA 5FI0B 1ZK4A 4MROA 5LJIA 2JGDA 3DE3X 4KGVA 3T3PB 3U44A 1PJBA 5REQB 1BTOA 1Y3CE 2VC2B 2WNHA 4MQEB 1VG9B 2GN2A 4KVFA 3R7WA 5EE1A 4LI3X 3T5MA 5A5VA 2WWYA 1AQ6A 2GR9A 1ULAA 4KLZA 3UQYS 2OAEA 5FNVA 3KAKA 2YY5A 3MJTA 1V8FA 2W4MA 5F7OA 1AM4D 1ZX1A 4QWMA 4F4DA 1BN6A 2NGRA 3TOVA 2HT1A 1WZ2A 3P71T 1MH1A 4UEQA 1T25A 3ENKA 2ZI3A 5K6RA 5BPFA 5E0OA 4D26A 3Q12A 4JA0A 3FDZA 4RLFA 3DLTA 4HQOA 1T2CA 1SXJC 3GDFA 3H2SA 4JU8A 4KLRA 1QBGA 2X9GA 4QQRA 3OQJA 4TTQA 4BOYA 4X6XA 1JIKA 4RYDA 2B82A 2WI8A 2Z9BA 2G1PA 3OTGA 2A57A 3HVUA 1USGA 3ECCA 3TIVA 1GGNA 2F1IA 4UAUA 4F1KA 3CUUA 5ERXA 4P5EA 3BN3A 4ZV4A 1SXJA 3C5CA 5AM0A 3B3FA 2H1VA 2GAJA 5L3RA 1YQUA 5EUCA 3TTSA 1P74A 1CR2A 2FSVC 4IYRA 3WY9A 2DF8A 1E3LA 3G79A 4J2HA 1MHPA 2H00A 4YXWA 1IUOA 821PA 2J4FA 4ARVA 1MW9X 3S2GA 1EVEA 1RWBA 1KPIA 1X7WB 1LD3A 3HA5A 3LS2A 2EFJA 1IRIA 5KYNA 3DOHA 2FSVA 1KOLA 2R86A 2V58A 3B3AA 4ND1A 2M6RA 2XA1A 4R1TA 3RAGA 5LOVB 5F98A 3PIDA 4EYOA 2JH8A 1G3QA 2X8WA 2C1ZA 2VK2A 3LPMA 3VV2A 3UOGA 3PR3A 4BB9A 1Y6GA 1YWGO 4HDMA 2SHKA 1G21B 2QNRA 2PKQO 2ZWAA 1JZQA 1KRWA 4KQMA 3TOZA 3HFRA 2DG2A 4IUCS 5DM0A 3OTOB 4Z4GA 4EMTA 2QSZA 2RMKA 5JHGB 3DWFA 5CFLA 3TVTA 3I6YA 5FTWA 4BO7A 1LSUA 4AJ1A 3E3AA 2VUTA 1SBTA 1YS2X 2AFHA 2GBLC 3KE9A 4LWZA 4Y9SA 3EZYA 4JUDX 4JN6B 3W6UA 2UZ4A 1YB1A 1PD0A 5FTJA 2HHLA 2C61A 5ALJA 3V1KA 3OZRA 5COAA 3JWHA 3VYTB 1HV8A 4DA0A 3WLEA 3AEUB 1H9CA 3G59A 5L95A 1OBVA 1TI7A 2YVQA 4N03A 3DWGA 2GRAA 2O1EA 2HKIA 1Z2OX 2J0EA 4G5FA 3KQHA 3PDCA 4RY9A 4P31A 3SHFA 1XLUA 3O8DA 2GBLA 2HB6A 1CS0B 1E59A 3HGQA 3Q9LA 4MKZA 3IOMA 2IIQA 3IUNA 1Z29A 4S24A 1E60A 4B9AA 4CM1A 4ER7A 4HLUA 4LDZA 1E6MA 2Y1DA 2Z5VA 3WKAA 1NVWQ 4QXRA 4UC0A 1NM5A 3A3PA 3ESCA 5IUJC 5FLXA 2XVZA 1GWNA 1TD1A 4WLEA 5KOHB 4JJ4A 3NHPA 1UFKA 2IYPA 1SXIA 2W2NA 4NQRA 3PFWO 2QRQA 1FBTA 1ENOA 4JLBA 3N7UA 1IB0A 3A2NA 4G1FA 4UULA 4Y8VA 2M1ZA 2JJMA 4XUDA 1L5HA 3WK5A 4B6SA 1CIJA 4UARA 2I1LA 1ZGZA 1FYWA 5EMKA 2CDCA 4RX1A 1LZLA 1SRQA 3AI3A 3HFGA 3JS5A 1WE2A 2NVUA 4BB5A 4ETIA 2XRZA 2CHFA 2NN3C 2R11A 4ZVSA 1Z5ZA 3R7BA 3WYCA 1XNHA 2VNIA 1RCTE 1VHDA 4Z7NB 1IDN1 4IQFA 5ICFA 1WBBA 3NBAA 4AMVA 3PA8A 1PO7A 4OIFA 4RD3A 4XIJA 1HRKA 3U62A 4C0SA 2F55A 1DFIA 2XGOA 4WZAE 3N2NA 1MEJA 3LCUA 3UXHA 2FJUA 4R2KA 3IUYA 5DN9A 4GPEA 2HJGA 4R84A 4CMHA 1NG9A 3DXXA 5I7VA 1MTOA 4IOLA 4DLXA 3OJXA 3G3EA 1XJ5A 1RLUA 1XLTC 4DV6B 3R23A 4BGVA 2R5FA 2AMYA 4LVOA 2FZCA 2J5BA 5D00A 4EG7A 3QTTA 5K99A 1J24A 2JAPA 4OAPA 1TJ3A 3IPRA 1A2KC 3EA0A 2NADA 3BD7A 4H0FA 5EPOA 3VNAA 4HAZA 3VZQA 5FRDA 4ASUD 1RC8A 5JQWA 4XCXA 1DUIA 2HLNA 1OV6A 1XLTA 1NY5A 1CFZA 1BDJA 1GNRA 3HBMA 4AKTA 5A0VA 1J8VA 3FYUC 4GZLA 2O8DB 3P0FA 4US1R 4ZYWA 5BNZA 4LNHA 4LXQA 2HMAA 3LRPA 2LKDA 3CNOA 2ZRIA 3N0XA 3NWBA 4R3UC 3VNSA 1QHYA 2AK2A 2XGSA 3OEWA 4C3OB 1FFXB 4YPVA 5CLFA 4M9XA 5CBPA 1C9MA 1C9EA 3W1VA 2G9UA 2YQ5A 1PUXA 4X7BA 2NM0A 4C6TB 1BS1A 3PK0A 4FSDA 3I04A 5K8JB 4PCVA 1NRXA 2ZULA 4RACA 4PIMA 1K5PA 1TUBA 1C1XA 1SXQA 1V8BA 4PFKA 2BWJA 3L79A 1NONA 1XR3A 2OECA 2VNKA 1OF1A 4H77A 4J03A 4QUEA 2PUHA 1TPZA 2QP9X 1BS9A 3MWDB 5FI3A 2F6RA 4CCYB 4Q4CA 1YCGA 3GEGA 5CH5A 1AQJA 1QOQB 2XKAA 5B6JA 2EWMA 1RPTA 2GN6A 2OZKA 3CZ5A 3SR4A 4UDNA 1ZIXA 2DLCX 4P4UA 1LDYA 1D4OA 2WKRA 4PCLA 3I8OA 3MFYA 4DRYA 1PK7A 1SBZA 3PEFA 2W2VA 2BUCA 5CVDA 2I4OA 3LGAA 5BQPA 1VRVA 4OEHA 1CK4A 3DTNA 3UOAB 3LP6A 3NM5A 3BGOS 2GCPA 4Q00A 5L4SA 1KZ1A 1JEQA 3B85A 3I1IA 4ZCMA 5ELXA 3MJ4A 3RF6A 3PQDA 3PUZA 4IG9A 2Y1EA 1EFVA 3GUVA 1JHVA 1NQVA 2CL0X 5JIBA 3PPVA 4CM9A 2IHNA 4FOOA 3L1IA 1N57A 3U7HB 1YK1A 3E5NA 2HJWA 2WU0A 2BKXA 2VWHA 5EHNA 5BP7A 4RWEA 2EEPA 2O57A 3QKIA 1N3BA 4GXRA 4WBXC 4RM2A 3C45A 3GRUA 1QF9A 2HA4A 4XSVA 2Z3WA 3ZGLA 2NP6A 1GZUA 3AEKA 5BVHB 1RP7A 1GTL1 3UUEA 5A62A 5L3ZA 3VZCA 1V5WA 4IZ6A 2P3LA 2H17A 1HWYA 2GEJA 1M6WA 1MIOA 2A0XA 5JUWA 2WE8A 3EIWA 1IHYA 3WADA 1GL6A 1ZIPA 5H82A 4EI8A 2NUTA 4MS4A 2WHEA 1KDZA 3CUTA 5KMGB 2IPXA 2NAFA 2BR4A 2WTBA 2BELA 1RI5A 3V2IA 1DOAA 3C7DB 4H7DA 1NATA 3K2BA 3BMOB 4UBKA 3PCXA 3R1IA 3EC1A 4G0MA 3QEOA 5EPEA 4QUIA 2F67A 1LSJA 1XD2A 8MHTA 2YRXA 3HRIA 5FBHA 4A3SA 1Z75A 4X8OA 5JD4A 2FRDA 4M7PA 1JFFA 1SPXA 5BVGA 4E7PA 4MKIA 4C78A 3EBPA 3E82A 1LDMA 2V3WA 4AWAA 2VYFA 4BX3A 3NUGA 1KSHA 2C42A 1ETUA 3I5MA 4D98A 2WKWA 2XCOA 3FDFA 2O2CA 4MYHA 3AFNA 4Y98A 4CG2A 3H9JA 3PA6A 5FFFA 5AW5A 1ADFA 3FYDA 3I37X 4JJ8A 4OXYA 1XJQA 2AQIA 2GCIA 2QHXA 1WQ3A 3ZPXA 1WPQA 3K4QA 2ZT7A 4HZUB 5E9JA 4CDMA 1A82A 3DFZA 3KXDA 1JU3A 1J00A 1WU8A 2F4VB 1NKVA 2R8BA 3LUGA 2LGJA 4XCQA 2QUZA 4PVCA 3CEJA 4X1KB 1H2EA 3AR5A 4WOKA 1QTRA 3GRYA 4HQKA 4KQKA 4E5PA 2H92A 2JJQA 2VDPB 2WC1A 2C29D 4LEIA 4FR0A 5LQCA 1SCQA 1U94A 1VI6A 4HQNA 3HNPA 3IDAA 3RAEC 4YCBA 3COVA 4JP8A 3BF8A 1Y1LA 3G23A 3KM0A 1DKMA 4WVLA 3TD9A 3DLIA 3ESBA 4MHOA 1GL3A 3F9RA 3NT5A 1CF2O 2A14A 2P3SA 2Q6TA 3B5EA 4ON9A 4A9AA 1O96A 5AOVA 3KKOA 2HC9A 2ZR7A 1N6HA 2ZIFA 1GTJ1 4RJ2A 1Z4IA 2YV5A 2D5IA 4DCSA 5A03A 2XEDA 3LDAA 4G41A 4C5AA 3MQ2A 4RCVA 4RXUA 2CZGA 1N1MA 2NUAA 2GAOA 2CB0A 2O3UA 1Y1QA 3UHAA 3WGOA 3B52X 2A9KA 4FS8A 4BE9A 4E33A 4E5MA 2WTNA 3LBFA 5CJ2A 4AG5A 2WSMA 3JALB 1J22A 1RYHA 3FNFA 1R5NA 2HXYA 1ZN8A 1SCDA 4TT8A 2QE7A 4WACA 4X97A 3R9KA 1SZPA 2RH5A 1VMKA 1U0RA 1YBFA 1RI4A 1NV9A 1TZMA 2ADOA 1OA0A 2JATA 2XMPA 3EQ7A 5E4YA 1XNJA 3WLQA 3TCXB 2BKUA 1GPBA 5JYBA 1VCIA 4YGYA 1SIUA 3OI7A 2UXDB 1KU6A 3ZIAA 2PMBA 2ODBA 1G5IA 1SKMA 1E7SA 2C2KA 1G1MA 1E6CA 1HE3A 4N18A 4ND8A 1NF2A 4Q9JA 3RC7A 3ZY5A 3CURA 1KAOA 2VOEA 3SU8A 4P7FA 1WA5A 4EQ6B 1O0CA 5ECGC 1GO2A 4NVRA 4DAOA 3DZJA 5AVZA 3P9PA 3QVVA 2Z9DA 3RFCA 2AGVA 2O0JA 4H6PA 4LJ5A 2IX9A 3QMVA 1V5EA 4WA7A 5K51A 2RH4A 3VU0A 2HGSA 2LCIA 3A14A 1BU8A 1SHKA 1QE5A 2ZBGA 5LYYA 1EIZA 3PKZA 4BS9A 3VH2A 3OU7A 1P18A 3K9CA 3D43A 3QGMA 1IUNA 4J1SA 2A59A 3KHSA 3EF1A 4TKZA 4GL2A 4NV0A 4QGFA 1DAGA 3CH5A 2QTFA 3OQPA 1NI3A 3SQXA 1NBIA 3Q2KA 3DA8A 4YLEA 2OD2A 5DYYA 3F9CA 4AQDA 3R40A 4B47A 2H06A 1A98A 5IXYA 2FN4A 1OI4A 4GNKA 4XGRA 5T8KA 4E1AA 1PZXA 4D0LB 2BFCA 3N74A 3R8CA 2H7VA 5T6MA 3JQBA 4WHMA 1KXJA 1TJ4A 3P9XA 5EAIA 5IKPA 1K88A 2C84A 1RKXA 5JXIA 1F2TA 4TMYA 2OD7A 1XQ9A 3JASB 3SC3A 4B79A 2ZRFA 4UUPA 1KFJB 3GRRA 4Z9YA 3MFQA 5JNTA 4QRHA 5CVCA 3T5CA 1SCNE 1FNBA 2OO7A 1RT9A 4FBMA 5IF9A 1MV8A 3MJRA 4WNYA 4ZDWA 3BAFA 4XFDA 3Q2IA 4BEBA 4AQYB 2WJJA 2GD1O 1R3UA 2HA5A 4KODA 5EHXA 4EGQA 3WQBA 2JLAA 4KYUA 4TS3A 4TZKA 3ZH2A 4LJYA 3RWMB 5FO0A 4F60A 3SE0A 1E1YA 1ISFA 1OU4A 3JW8A 1NT4A 1KGSA 2WJPA 4F96A 4MWCA 3ZKAA 5EJ9A 4M0KA 2GO7A 2CJYA 4FFBB 1OXSC 4YX9A 5LNK6 3ILSA 1U0LA 4M21A 2JAWA 1CUBA 3JQ9C 4X90A 3FGZA 3ZWPA 4CHGA 1N36B 1QPZA 4Y2SA 4G0UA 4JHXA 4MJ7A 3GNTA 3QUBA 1XZGA 2E82A 3QVWA 3MT0A 3NBUA 4AIIA 4BWGA 3G2OA 4TMWA 2XUZA 3BOSA 4ZJPA 1WMAA 2X76A 1REQB 4KFRA 3COSA 3LECA 1M2VA 3SNHA 3R5SA 4PONA 5CFOA 3PENA 4Y2UA 3JQ9A 4NK5A 3F9IA 4O4HF 5BQ3A 2O3JA 4I50A 2G82A 2IZZA 2R9VA 2OCYC 3Q1KA 1RVV1 4MHSA 4HP8A 4QU5A 3LYUA 4PPQA 4LHEA 3TBHA 2FZKA 2MR5A 4C29A 4DEYA 3LDGA 4BY9E 2WPNA 2F4NA 1JG6A 4TN1A 2Z1MA 3VX4A 1GRQA 3LPDA 4OOEA 4ENTA 5KWJA 3OHMA 3MWJA 3FA2A 3G9UA 2ZM5A 5A6SB 4R2MA 1TLTA 4UM9D 5AJHA 5IMSA 5SZJA 4BO4A 4CV0A 4RTJA 2O19A 3UJAA 3GI1A 1I01A 2QN6A 4KDEA 5F4ZA 4HDNB 3AFHA 2C20A 1KPGA 1SCUB 1Z0DA 3OFSA 5T64A 2Q3HA 2XT0A 3DW3X 1S89A 4GIBA 1CBUA 4HB2A 3SZUA 1SQ5A 1YRBA 5HG0A 4MIYA 4YP7A 1CKEA 4AF8A 3W6NA 1NVBA 1JPJA 2PUJA 5AXAA 3BL6A 2VYQA 1A9RA 2P2DA 5EWJB 1WVIA 1JAHA 4GW3A 3WL8A 4K1LA 5H5JA 2ODAA 3OTQA 5G1PA 1X14A 2NO7A 1N2IA 1W36B 2QNBA 1YMUA 4DLRA 1Y7TA 1PDOA 4ZT3A 2EZ9A 4IIJB 5JXHA 4RLHA 1TTTA 3K7EA 1X7ZB 1ZH8A 1E99A 3OJEA 3PVZA 4YAOA 4DIUA 10MHA 1NAHA 2CJWB 3GYGA 4YV2A 3WE7A 5CA1F 5KHOC 4BEWA 4KXMA 4BDTA 1ZLYA 1PFYA 1KMNA 1MC8A 1L8AA 3QFRA 1PNRA 2VAMA 4U1RA 3RVSA 1XU4A 4BFLA 3SD7A 3A1CA 4KMSA 4KGDA 1K27A 4ZICA 4KR0A 3WLMA 4FONA 4U8HA 4XIIA 4JEHA 2R62A 1QYVA 1C3LA 4K40A 4QYSA 1TFRA 2PZKA 3AM3A 3RANA 1Q22A 3TD6A 4C01A 1M5TA 4TTIA 4F86A 2PZLA 3EUFA 3IQWA 5J2TF 1BWSA 3STUA 4EDHA 3FCEA 4LSZA 5HFAA 2VNJA 4OPMA 4ZC1A 5DNWA 3PQ2A 2F17A 3M4NA 1SN7A 2O5VA 2QYHA 1M6VB 2WT8A 3DMFA 3PFBA 4IGKA 1LPAB 1BOFA 4DQKA 1R0YA 5J59A 1W35A 2PMKA 4NI5A 5FDFA 5J3JA 1QHEA 1EBUA 4MP6A 3COZA 3M6UA 5HKKD 5E4JA 1THZA 3I04M 5BSUA 1GAJA 3TZBA 5JVDF 4CCAA 1RXUA 3B38A 1DBWA 3JD2A 4L73A 1B0PA 2ILTA 1G38A 1RWVA 2ZB7A 4XA8A 2AUMA 2YKGA 1G8KA 5HOEA 1FU8A 1A9SA 1BE0A 1KYVA 1O2DA 1T5SA 2PGJA 2WHRA 3GQBB 3DDNA 2VPYA 4RZIA 1DRWA 2J85A 4QDJA 4R7GA 5TF4A 4AU1A 5DHSA 4LDAA 4DIEA 1MHTA 4A8PA 3DDOA 3OLXA 2P6OA 2PS1A 2NZ8A 1QFXA 4EHBA 4BO9A 2GEUA 3ONVA 5ED4A 5ALQA 1I2AA 1XTVA 3E8SA 5FYQA 4D92A 4RPJA 2FPGB 1ZVMA 4J9UE 3BB3A 1K5DA 5ARCA 3BTSA 1N3IA 2Q0HA 4J07A 1DKQA 2JKZA 4FMCB 1WTAA 4URVR 4WK0B 5FH9A 3LMKA 3OQIB 4B32A 1IM8A 1KKLA 1XQ1A 2HDOA 4C2UA 2BR5A 2P5SA 1E9BA 3BJMA 5FOXA 5KJEA 2KBFA 4KU4A 2C9OA 1J20A 2R4QA 5EXXA 2CNWD 3WR5A 4F2PA 4PN3A 3G9XA 4EUNA 5KKNB 4ZDKA 5DEOA 4B8YA 4F6RB 1KARA 3QEAZ 5ALMA 5CFNA 4TTAA 4KN8A 5LBIA 3A4NA 4Z0PA 1VLVA 5FF9A 1JTFA 2FEKA 3HCWA 1R0LA 2G8LA 2FJPA 4HNQA 4X7MA 3RCBA 2GEDA 4EEKA 4ENRA 5JSQA 4YMHA 3DMYA 2BGWA 3GELA 1ZYUA 1ZUNA 4IDEA 5DASA 1LTHR 1ENZA 1OI2A 2C8JA 2F3RA 3W2IA 3A26A 3ZNQA 3VNUA 1YRLA 5BSEA 4HAOA 4O4HA 4UFOA 2RE8A 1UAGA 4C7OA 2MYUA 2Z4SA 3S99A 5C18A 4GOJA 1P1JA 1M1UA 1JLRA 5CPBA 4WK2B 3RTEA 2WAOA 1RWXA 2Q41A 3THYB 3ESZA 3ZWQA 3EH2A 4DMMA 3PLRA 3OX3A 1JGTA 4EHLA 2YWBA 4ML3A 1ZJ4A 4RZHA 1W96A 2ORWA 4FZJA 3ROFA 1TU4A 4UEWA 4COOA 3IQEA 4EHAA 2C7BA 2YNMC 3C1TA 2YWJA 3F5FA 2J4DA 3OCVA 5HX7A 5KJFA 5KNCA 2G3YA 2DAPA 4MTCA 2J3IA 1X8XA 3X1YA 5JARA 1TLFA 4RFVA 3ZY2A 3CN9A 3SM3A 3OPXA 3D2CA 2B0JA 1UKYA 2FETA 5CAEB 3KELA 1Z6QA 4M88A 5ARDA 3D59A 5CIWA 2GKOA 4L6AA 3MYRA 3SQDA 1DE0A 2W98A 2AHRA 3E7XA 3CRQA 4FMBB 1ZAYA 1ULTA 2YNMA 3DT8A 3IQZA 3M5PA 4KN5A 2G5CA 4U00A 4YRPA 3ICEA 3MCZA 5JU6A 1Y7LA 3MELA 2JFOA 4C14A 4NH0A 1K6JA 4IH4A 1JEEA 1NVMB 1SCAA 3TN7A 3OKAA 3WTBA 4B8ZA 5ITSA 1S8OA 2VH1A 3DR3A 4KKXB 3U4QA 1ZGCA 4YRCA 4LF5B 1O8BA 4D56A 5EWLA 4IKEA 5IUNC 1Y37A 3VJLA 4DABA 2DTDA 4TL6A 3AHFA 3K1YA 3H97A 4CU5A 2LWIA 4K6GA 3H05A 4Z3OA 4CLEA 1KF0A 5CXXA 5K3FB 1VL5A 3WS7A 5DEIA 3ADKA 3MJCA 1HDCA 3R3WA 4US0R 1BMDA 1WLYA 3ORQA 3KJNA 1N4DA 4IXWA 2YQZA 4V0MA 4W1QA 1C2YA 5ENVA 2X0FA 5EXSA 2ZZMA 5CYPA 4WLOA 1L5NA 4AT1A 2ZRCA 3BE4A 4YJGB 1BHJA 3FX2A 2FOIA 3KTAB 2HK8A 2WYIA 3PJEA 1QE3A 1L7QA 3C5EA 4IVNA 1GTRA 3H5TA 2Z95A 2VDUE 1M2FA 3S0JA 2QR5A 3W0LB 1ZITA 5EMHA 1BAPA 2PUCA 2PRZA 2R2AA 4CUKA 4ZT7A 1FW6A 4CT4B 3IB3A 1DCKA 1MC4A 3PC2A 1C7RA 1XMSA 2WJIA 3BMCB 3PQ8A 1T9BA 3K70C 1L7PA 2VJPA 3NTXA 3ROTA 1DLIA 2PCLA 1CWUA 1JF8A 3CVOA 1H6CA 5AVWA 5DT2A 4NU5A 1UIMA 2SECE 3Q4GA 5A4KA 3FYSA 2G77B 3O8NA 4GU5A 4BVLA 1A1VA 1DHTA 1NMXA 4XASA 5A2QA 2ENUA 3NHSA 1P5FA 2HR1A 4DWOA 3D31A 4CM9D 1NN1A 2X14A 5IC6A 1FQKA 2YVAA 3RHZA 2H1OA 4KIJA 2Q4TA 4U5XA 3N39C 3MWLA 2XY4A 2BMFA 4YUYA 1NW7A 3H87A 4DBLE 2IYLD 1YRHA 3AF4A 5FPTA 3TR0A 2CT8A 1UFQA 1KK2A 3GVIA 4YJFB 3IVGA 4XUEA 5AJXA 5DBOA 3SEFA 4QXAA 4TS4A 2DPMA 3M4ZA 1B2RA 2GOYA 3I9MA 4FEYA 5FL7A 2W8BB 2P1ZA 2P91A 4HDKA 2DECA 4ZAYA 1TVMA 2V45A 4OLAA 4NAVA 2NV2B 3GAFA 5L45A 3HNOA 1UMDA 5ALNA 4C6RA 1KKMA 1U4NA 4OQZA 4G4SP 5AMXA 2QYOA 4Z4CA 5J40A 2OBNA 1Z8FA 3HEBA 3EXEB 3NOVA 4HQRA 4H7JA 5EEGA 5JD6A 2ZE6A 1ZBDA 4PSAA 5EZYB 5TGZA 4BQFA 5HRAA 2QIOA 4JCOA 3T7EA 2V5UA 3VV3A 4ZDIA 3NVMB 4TZTA 3OECA 1KO8A 3ZWCA 2UZ1B 1SC1A 1Q2XA 4J49A 4N5LA 1F8GA 3RBZA 4LJRA 4HUQB 3JQ7A 5CDFE 4X6UA 1TD9A 3KB1A 1XWFA 4RZ2A 1Y34E 1PEYA 3F1KA 2RHWA 3ETLA 5H4HA 4AJIA 5BR8B 3H2IA 4C4TA 4LXHA 1S5PA 3H8WA 4B81A 2BHSA 3AV3A 1U8ZA 2EIHA 2WG0A 1C1DA 3OZDA 4KFSA 4Y2YA 4ZV7A 1A9YA 2P9HA 3BSYA 1VMDA 2XYHA 3ITKA 2IIVA 2XDAA 2IOHA 3VRHA 3TTVA 2BSQA 3W5HA 4MHTA 2J0SA 1E9CA 1QOPB 3LPLA 3IIIA 3BIWA 3EEIA 1OCEA 3S2ZA 2H1HA 4AY6A 2JFVA 4KEAA 1Q1GA 2Y6VA 3LTEA 3TI9A 1E5LA 1UH5A 1XCPA 3JAWA 5B1IA 4BP8A 1SCIA 4XIGS 4R8KA 1ZHHA 1LY1A 1GNSA 1U8FO 4CRWB 5JXWA 4E31A 3UGJA 1FPQA 3ZU2A 1SA0B 4LFCB 2FK8A 4LBYA 4D3XA 2ZSHA 1Z0FA 2XF8A 4U7GA 5JADA 1QIJA 4PZPA 3ESRA 2XTNA 3PXDA 4OQXA 3EA5A 3FHOA 4B6EA 4DSTA 4JXKA 1CJTC 1C0KA 3UPDA 5C51B 2BMAA 4IEFB 4XDYA 3OP1A 3VVLA 4CODB 1TKCA 2P4UA 2WJAA 3EZ2A 4DCVA 4ED9A 4HTAA 4ZI7F 1AKUA 1YV9A 5M29A 2RH9B 1VLLA 1E2PA 1C80A 5GTDA 1M2HA 1NVUQ 5EJ8A 3D6NB 4W82A 1Q77A 1BQ3A 4NBKA 4EFKA 5IM4F 2P69A 2A5JA 5FT9A 2MYPA 1RAAA 4QASA 3IDFA 3G2IA 3MCTA 2QE7D 3M9XA 3WMGA 1B1AA 5DXJA 3HEAA 3MJEA 3W5AA 2O07A 4RYLA 3I23A 1U8TA 4K2HA 5I7EA 1TKBA 4IVQA 1HE4A 3PGXA 3GLFA 4JBNA 1EHYA 1R0ZA 3ZIAD 2YRWA 3AESA 4KWTA 3I5YA 1TAQA 1Y1KE 4Q3LA 2ISSD 4AJKA 5K9ZA 2GZMA 3Q0TA 4C0KA 3CSUA 3LVRE 1WNTA 5K6AA 3E5HA 3C8HA 1CE8B 1PGPA 2CLSA 4NV3A 4P2BA 4NICA 4FDLA 2R65A 3O8OA 3INNA 3AINA 2JEZA 1EFPB 4HDSA 1PSDA 3F74A 5JWRA 1CIVA 1UBRS 2SCUA 5FHQA 3RU3A 4D80A 1U81A 3GLGA 4KRXA 3TI7A 3FSEA 1GZSA 3PFCA 3G5TA 1YL5A 1FJ2A 3HYSA 3UK6A 1NJFA 4FS3A 5CB4B 3DE7X 1YDWA 2YW9A 1J0AA 1L8LA 3CLSC 4KW7A 4NJMA 4NFLA 2BGNA 4UHEA 3KQKA 2HREA 2J46A 4LOLA 3NPMA 2PMCA 5J2UB 3P0IA 1DBVO 2IBSA 1U6KA 4KQCA 5ELLA 3RNLA 4PXYA 2QTLA 1GIAA 4ZYXA 4F3RA 1GEGA 1ZGHA 4CQLA 3PKJA 1N6IA 3NHLA 4ROTA 4BKOA 4YAUA 2V3CC 4P80A 4I8IA 5CLJA 2P9JA 1JXMA 2B6NA 3LF1A 5ALKA 1ABEA 1QLWA 1TCUA 3TBKA 2PX3A 4B31A 4KDCA 5B36A 4A03A 3ZOKA 2QL6A 1FQJA 4BVJA 1AA9A 3M34A 1RRKA 1S8AA 4EJ6A 3QXGA 1YA8A 2PMFA 1D2HA 3R6LA 5AKHA 1Y1PA 5L51A 1NC1A 1X1TA 4P3YA 4QLBA 1W8DA 4OO3A 4OHBA 3O2NA 5EVCA 1XCGB 1K5GA 2FP4A 1YDFA 3ZHZA 2X2PA 4JZYA 2Q7DA 1BW9B 2Q5CA 1M72A 5EKTA 3H6KA 4CQMD 5K8IA 3SE7A 1T1EA 1HA3A 2VDWB 2VXBA 3N1UA 3G68A 1MZPA 4CM8B 5KPJA 5EIXA 1ZEJA 3V1TC 4HXGA 3GDWA 3FOBA 5CITA 1QZZA 3FWHA 3GGPA 2J3LA 3KPWA 1T0HB 1HYGA 3FTEA 1EFCA 3S7TA 4N5HX 3VVBA 2J5RA 1Y5IA 3DEFA 4Q1BA 3WLFA 2VJDA 4CBVA 1IEXA 1RQPA 4GOKA 4K26A 5DTMA 3ND9A 4OHXA 1ZI9A 1UXHA 2VQ3A 4FVTA 1PR1A 5JJCA 1J1IA 2DWPA 1PR3A 4C1NA 3JZMA 1I0IA 1PLKA 2F1RA 2O7SA 3I64A 1G8MA 1ZA1A 2AS0A 5AH0A 3RROA 2QN7A 3FWYA 5TB5A 1MLDA 2O1WA 4HAYA 2BI8A 2JCSA 2C07A 4DZRA 1NXTA 1CY4A 2BGTA 3HDYA 1KYWA 4OTZA 2V7UA 1GR0A 2RBGA 1UBFA 1T36B 3LUFA 4GP7A 4TZ0A 1K1EA 1J0BA 5CHEA 5CDGA 5GVSA 4M54A 3L18A 5AW7A 3Q6IA 3K96A 1FTWA 3ZGZA 4RTMA 2QXYA 3I9V6 3FPHA 2PX5A 1SBQA 1ZM7A 1XZPA 1U8XX 2JKYA 1TUEA 1I0LA 3JAMA 2V4UA 3CZAA 3OZGA 1YHYA 3OTWA 4ZU6X 5A4DA 3WNCA 1T5OA 2PZMA 4ZXPA 4AXXA 1GPAA 2FWMX 1HNXB 4QOFA 2GBFA 3VPDA 3KAPA 1HYHA 1GXSA 4LFAB 2FPOA 4G0WA 4LOAA 3IIKA 3L2OB 4YV1A 1SXJE 3CVUA 2R8YA 2JA2A 4FEEA 2FRXA 4ZVMA 2R1TA 1M6NA 5LSAA 1QJCA 3LRTA 5FOVA 2J7PD 4V0OA 2NVOA 4PYNA 3V00A 1ZA2A 1NXQA 1RZRD 1PL8A 4YV0A 4MDYA 5C5DA 1KEEA 2FXIA 4BVEA 4JY7A 4MUAA 1TMOA 2AJBA 5EWMB 3VU1A 2KLHA 4WZZA 3T7DA 1R3DA 2PKEA 3NBYC 4YAJA 3OZEA 2HF8A 4WZBB 3TXXA 3WL5A 1U3UA 3KX2A 3G9TA 1RLIA 4R01A 2ZSAA 3NM6B 1Y3BE 2NTYC 2YWDA 2CXSA 2PEZA 3GEDA 4FN4A 1TGYA 3ECSA 3KQMA 4MO9A 3RSLA 3SI7A 5TSDA 2OC9A 2QY6A 2VXOA 5CM9C 2AIRA 2GN8A 2FOXA 1NX6A 1NJ2A 3CIFA 5J1TB 4XSGA 4FJ0A 1LTQA 3K0EA 5DHPA 1QQBA 1E4VA 3W04A 2F48A 5F33A 1WBDA 1GZVA 2P2LA 1QP8A 1ATIA 1JTEA 1UK8A 2VEOA 2ZAOA 1KORA 5DHTA 3ZV4A 3FPAA 1A7JA 2QQGA 3A6DA 4HY3A 4Q4HA 3OFND 1NW5A 3TSOA 2ZUDA 1YDMA 2XV1A 3V1MA 4F9FA 2CVQA 3MBIA 4HD8A 4IIUA 2PX6A 3TSCA 3DWEX 1GFWA 2UV8A 4GGOA 1R15A 1SOVA 2AFHE 1MJHA 3PQCA 5JNRA 1NVVR 3WV4A 5E38A 2OZLB 5KTOA 5FUYA 1HQKA 5LMCA 2CKDA 4K6KA 2ZBEA 1XMJA 4I4CA 2O2DA 1ISGA 1SCBA 2G8NA 3NONA 3BWEA 4OSEA 4FQ7A 4P53A 5JAQA 2OV2A 3UWPA 1VQ1A 3MWFA 4QGBA 2BF7A 1ZNZA 2OOKA 3IE1A 5H8WA 3DZGA 2F1HA 4AO7A 2JAUA 3PCTA 2G1UA 4BBZA 1TJYA 1IHDA 1R8SA 1DO0A 1QIGA 2WABA 3BRWA 4P3KA 2W6PA 3U39A 4HHEA 1TEHA 4EB0A 5D2CA 3HB1A 2P9BA 4PZCA 2QRKA 3E2PA 4AWBA 2YXBA 2E1PA 2C3YA 4MAMA 4D5EA 3WGNA 5GADl 1LTKA 4RD1A 2PNJA 2YZ7A 1CW2B 2LV8A 4LWOA 2JCBA 1O77A 3O91A 1EE1A 3P7MA 3TXYA 5BSWA 4IS2A 2QP3A 4C4PA 2BGIA 3HCFA 4MA0A 4CM3A 1IATA 1RYYA 2V97A 1C3EA 2Z30A 4IPTA 4M1TA 5FBVB 3B6ZA 1FVXA 4QFBA 1U0GA 5F5NA 2VSNA 5TX7A 1AG9A 2VDRB 3F2VA 2HMYB 1O87A 3QOYA 2IPAB 3NH9A 1FX0B 2R7NA 3ME5A 3RC8A 1P9NA 3KO8A 2KM1A 3QHPA 1YASA 3U3JA 2Y92A 3K2QA 4R16A 4B3DA 2OR3A 2P4EA 4XM1A 3RVJA 1RSZA 4ZHQB 4QTYA 1J09A 4WBNF 5CJJA 2CF5A 4ND6A 8OHMA 2V9CA 4Y3UA 2QZ4A 3MUOA 2XNSA 3FBGA 2C2GA 4F4FA 5LBUA 5SZHB 4QM6A 1JEYA 1JDJA 3WZLA 3ZNPA 2R8ZA 4B5LA 4G56A 4Z4HA 3B70A 1ZO8A 2FUEA 4GOMD 4OHWA 3OF2A 1FOEB 3EFEA 1JQEA 5FPYA 3HJUA 1LRJA 4QPCA 2G5TA 4R2WA 5U4XA 4KAFA 4MKHA 3HHEA 3PX3A 4MP8A 2Y68A 1MC5A 2QVXX 1J0XO 3WHIA 3LAWA 5CA0F 2XMZA 2EDCA 1UMKA 1YFKA 1UOOA 1D8AA 2PUBA 3RYFB 3GLUA 3E0XA 3LLVA 1DGQA 1DTWB 3QBEA 4LRTB 4F2DA 4OHOA 1VXOA 4UD2A 2A1IA 3D3KA 3EVFA 2OAGA 5HVNA 4QNMA 4B3IA 5IDQA 5KYYA 2OZEA 2XCLA 3ZXUB 4A15A 2AOUA 4GD3Q 5K7SA 3VJRA 2E6KA 4LRWA 4GWLA 5JBNA 3G2MA 2D7DA 1LBQA 4DE5A 8ATCA 1C8LA 1E6LA 3DW1X 3W1EA 4ZAWA 2O06A 4BX9A 3GGCA 1Y3HA 2ZEJA 4MW1A 1MX5A 1ODTC 1W30A 3C6KA 3EDOA 4G24A 1ISHA 1RQ2A 4WQMA 3TLKA 3ZQ6A 5LPNA 1R74A 1W9HA 1ORRA 2WIGA 3EHEA 1SZCA 2CCJA 3KC2A 1N8KA 3NVDA 2YV3A 3KYCA 3QOXA 2XTMA 4TTSA 3WYNA 5IJ9A 3C8DA 1UWLA 1Z0IA 1KGDA 3TLGA 2AC4A 2FZWA 2WUGA 1OB2A 3N8GA 4C07A 3TX6A 1N4AA 3ROXA 4K8OA 4BTVA 2E87A 2FKAA 1FRNA 4ZVUA 3JD0A 2JD0A 2XKJE 3RS2A 3EZFA 3UB3A 1Z4KA 2HNKA 2PK3A 3EGXA 2I91A 4N82A 5KJCA 3NPAA 4UD6A 3SHOA 3JCZA 3TNJA 3W3AH 1ANKA 2IHBA 3ABOB 3I2IA 4IH1A 4XGQA 4YHBA 5ENZA 1JG1A 3C2QA 4TKMA 3HJAA 4JSTA 3TGWA 1V25A 3FUVA 1FFAA 5EGSA 1SXHA 2WE7A 4WVFA 1AXGA 1PFQA 2GJAA 4CKBB 5GIPE 3CM0A 3PZBA 1UBNA 1WZIA 3IMEA 3ILVA 4OXKA 4TV9B 4CT5A 3TRJA 2VNAA 5D01A 1YTLA 5KJ6A 3O4IA 3QE3A 9MHTA 1EJ6A 1HZZA 1P5JA 5E1DA 4DLTA 4CYMA 1IBCA 2HN9A 5JI3E 1Q1QA 2Y66A 3ADBA 2XCTB 1YJCA 1YZ3A 3BXEA 5H9VA 1NVAA 4JVSB 1QRTA 4EFLA 4O1HA 2KX7A 4O63O 4D1YA 2JGMA 1N3LA 3HJHA 3NBMA 4L07A 4DMFA 2H07A 3U4IA 4PS0A 4HBGA 2HIMA 2CNLA 4BP1A 4QJ5A 1K7FB 3LCVB 1UWKA 5J4LA 3TUJC 2DPHA 1YVUA 5FL7D 2ZBUA 2QN8A 3DFFA 3AERA 1Y9EA 1TOAA 2JH9A 4CZ2A 2WJ6A 3DEYX 1L5YA 4LHWA 1V6CA 1JG7A 3C3DA 3WKEA 4IIFA 5JS2A 4F6LA 2SKDA 3EULA 2C7RA 1K3UB 5KYWB 4PLFA 3T4XA 5KAMA 1RNLA 1OWNA 3MERA 3DZ8A 5JJLA 3IXLA 2YJ3A 3SDSA 4QXOA 1N5IA 4EHKA 3DBRA 5PNTA 1YU9A 2Q2WA 3DO8A 3PJRA 2Q3LA 5BQXA 1J0EA 3JR7A 4U7HA 3JRNA 3OOYA 5JCJD 4LZNA 2FGJA 3PV0A 2IXBA 3IQXA 4WLFA 4J3FA 1XAJA 2J32A 1WD5A 1T8UA 1GZ5A 2B3TA 3HKEB 4HC4A 3DULA 4NCIA 4ZDJA 5IHPA 3O8CA 4JV5B 1D6SA 3GLTA 3NHKA 3DM5A 3DV0B 4MR8B 5KWIA 3Q0EA 1QQTA 3ZHSA 1QPBA 1G4HA 2QUAA 5CDSA 1U2RA 4ZYYA 3UK2A 1VJGA 4EGAA 1AO0A 5IKEA 2H18A 4DSUA 2CNNA 4I6GA 4CV1A 3HUFA 1M8JA 1Z37A 2I3BA 1ZSVA 3ONEA 4L22A 4H2DA 4MWBA 5DYWA 2NTNA 2VG8A 3AI1A 3T61A 4KHPB 4OU5A 3L43A 2OP1A 3DT9A 2FPIA 4FZRA 5JMPA 1N6KA 2B1RA 3SY8A 1U3TA 1XTZA 2C59A 3JWPA 4B6JA 5K8VA 2O2EA 2QMOA 3UPTA 1EQ2A 1YOVB 4YRFA 5IBCA 2ZBVA 5CT9A 4HYEA 4EW6A 1EWVA 5E7JA 1M2GA 2I99A 2QLNA 3HXKA 4UJ3A 4R1MA 1NI4A 4TL9A 4XR9A 2FB9A 3H9CA 4I7EA 2COEA 3WRYC 4AULA 4QDKA 1EEXB 3QXCA 2C83A 3KQNA 1BZYA 3D02A 2X8AA 3HR7A 4LOIA 5BXYA 3EARA 3D81A 5EESA 4WUVA 3TFQA 3QPBA 3U7JA 1M33A 3ON5A 5DVZA 1KZ9A 3AQIA 4RSGA 3C8MA 4US2R 2ZFUA 2NU8A 1QH8B 3ED5A 4GM0A 4R1NA 4RXTA 4DNFA 1S4QA 5CCBA 1KOGA 2L69A 3TMAA 4RV5A 4TKUA 1BCRA 3WRYA 3Q3GE 3DV2A 3U3MA 3DP9A 5KHAA 1F2VA 1H85A 2Q5QA 2XXAB 4RKYA 1UWCA 3NWOA 4IHKA 2UZ3A 5T6BA 2XUHA 1DDGA 3L1VA 3MINA 4G2TA 2D5AA 5CTJA 3SYKA 2G17A 4NNJA 2WLSA 3MB8A 4D45A 1Q1ZA 1X38A 3K2IA 4O0MA 5EQDA 1I8TA 1C9JA 1FYXA 1H66A 2B9EA 1LBTA 1ZIDA 2FDRA 1BGXT 1M1NA 4GLJA 2Q4RA 3LLMA 4QT4A 3ZK8A 1H0RA 3SZGA 1SURA 1YZUA 3VTFA 1GAQA 3H5AA 5BV0A 5LUAA 1GTSA 5IANA 3B7PA 4NBNA 1IN4A 2WSIA 2PUFA 3EZGA 2A0YA 5KTNA 1Q84A 1AX9A 4I9FA 1Z5PA 2BEJA 2F9LA 4LRYA 2PL3A 2GN4A 4HWGA 3KOUA 2EJWA 3QEMB 3KKMA 3CG4A 2XBUA 4JR0A 4JJZA 4UDYX 4GS5A 4WCFA 1T26A 5AVJA 1S1MA 1AT1A 1JALA 1Z56C 3TOXA 2H29A 4DSNA 2CMGA 4RTOA 1WULS 4L1KA 5J23A 3R6DA 3UJDA 1ZIYA 1H4QA 5AXBA 3ORYA 3Q5DA 2Y0CA 4PAOA 1E9FA 3A7DA 2ONKA 1F4PA 1DHRA 2PZFA 4HTFA 3QNMA 4XVRA 5SZKB 5H9WA 3REFA 4IOKA 1E5TA 1GHTA 2PIDA 2Z5FA 4YAGA 3KETA 4CM7A 4J16A 3KS9A 4II3A 1IQ0A 3KWLA 4B0OA 1OXTA 1W85B 4CVNA 2Y0DA 3BVPA 2G4CA 3QHAA 5F1PA 5JCXA 3RYTC 3HU1A 3WGHA 1N5KA 3N7AA 4UPDA 1NBOA 3NRCA 3FLMA 4C22A 4Q7QA 1X13A 1GGEA 1GTVA 3DTVB 1DAEA 1X7GA 3LW8A 4Y0NA 4Q02A 5D3KA 1ZMXA 3B1VA 3C39A 5CFQA 5JQGB 1QCZA 3ODGA 1ONBA 2XOKA 1SKBA 1Q20A 3ZG6A 1VJ1A 4FX5A 5J4HA 1J2TA 3BMNB 5AFSA 2IXTA 1CUUA 3GWGA 2WSLA 3PQ6A 1EMDA 3HFSA 3KYBA 1AH2A 3ZDXB 1WVGA 1AHNA 3DO5A 1MEEA 2XUGA 3JATB 4WASA 1W4AA 1IBKB 2IYFA 1GYQA 2CXPA 2W70A 1PT7A 4QFDA 4JC4A 2QKYA 1QFZA 4EKEA 4Q4JA 2LR0A 4EY4A 1A4UA 2C2MA 4JDPA 3OBIA 4OYLA 1WIWA 4U3JA 1WUIS 2YYYA 3ETGA 3SS7X 5K0CA 3FMFA 3K73O 5C8ZA 1UC8A 2GPTA 4NYJQ 2IV3A 1GR1A 4TKVB 3BL5A 1N2OA 2X19A 4P81A 2QSUA 3O94A 2HZ7A 3AR9A 2DQYA 1B26A 1HG0A 1T9DA 1FRVA 1QFJA 2IXGA 3GU3A 2C95A 4FMDF 4LJ6A 1E20A 1I4DD 2FPPA 3DXFA 3DVQX 5KEIA 5HNKA 1WETA 1FFBA 1PWHA 1V39A 2PGIA 3L02A 3GNQA 4HX5A 4I55B 5DGCA 5THQA 4BV2A 4F4JA 1UUFA 2O5EA 4JWKA 1Q50A 1WWKA 2PD4A 3CWQA 1W4ZA 3KLBA 4IV5A 1QV6A 1UXGA 1W0KA 4HVLA 3NOOA 4ARZB 3IOYA 1Y3AA 2BP7B 4HZGA 3P19A 3LUHA 4IH9A 3M6LA 2HQRA 3O4RA 2A94A 4ZCSA 3B1KA 3P2IA 1HK7A 3QSGA 4YAKA 7YASA 4YRNA 1D0SA 1TGVA 3B51X 4GUDA 4JCCA 4XDZA 3LXRA 5JH7F 1J70A 1RHUA 3PQ3A 1YZTA 2AYXA 3OOEA 1BKDR 3UK0A 1IRXA 2QX7A 4UM9B 1WW8A 1JDSA 1RWPA 4HPXB 1VC2A 3K6SA 1SG9A 3TZHA 4C3UA 1KI4A 1U11A 2P7HA 3OT5A 1X1CA 4RE5A 2VRCD 1J8YF 3QVGA 2BSXA 3WP1B 3DEZA 3HYLA 3A3OA 1C3VA 2EF0A 1Y4DE 2JHFA 2HU8A 4I19A 3FOFC 1OB5A 2QD2A 2NPIA 1OW3B 2IDJA 3NCHA 4PLPA 3NJ4A 1MB0A 2FF5A 4WXRA 1O6BA 4D8XA 1A0OA 2CK3D 2JLRA 3UJBA 5KPDA 5A5FA 3AF6A 1J33A 4EBFA 4O3MA 4GNRA 4Y6RA 5FA8A 3DBHA 3AVOA 3WFZA 3HN2A 3QVXA 1GZ4A 1G41A 4H3VA 4Q0MA 5JDCC 2JLCA 7MHTA 1D4FA 3EXHC 3TW8A 4C7JA 5HRCA 3BH6A 4FJ2A 4G26A 1XAGA 2ZDGA 1SHZA 1YB4A 4OHZA 2JGAA 1AB6A 1R5BA 2XNCA 1JG2A 2WMNB 3BWYA 1QIFA 1K2VN 2VZ0A 1KOJA 1XELA 3NTLA 1O7JA 3RIGA 4E1VA 4RJKA 3EDRA 4U6QA 1K8ZB 5G02A 3UMVA 1APBA 1KEKA 1GRRA 4OH1A 2E4WA 5LFAA 5JDCA 1FLVA 4UE2A 3FUXA 3EXHA 1SC6A 3H1BA 1IJEA 2O0HA 2O0LA 4UTXA 1JQJC 2PJUA 3GBVA 4CM4B 2JIZD 2YMQA 3T5TA 5JAPA 1LPNA 2NQ2C 2PUGA 3ZCTA 2LVBA 3M9WA 2YIJA 4QDZA 3AIKA 1I51A 3O8QA 4YI5A 4Y1FA 2A7XA 2VFAA 3ONWA 1VCMA 2CFRA 2DR3A 2JBAA 3C5VA 1RW4A 2CUNA 3QW2A 2ZJFA 1Z7GA 2HSGA 2WWXA 3QOWA 4XFJA 1PFWA 3D7MA 3G0GA 4QGGA 1FX1A 3L3BA 4A5OA 1S2DA 4BV8A 3O7WA 5TC4A 2PT5A 5G53C 3VPXA 4X0EA 4TVSA 3C8ZA 1GZ6A 4KXUA 3CH4B 5IP5A 2J3JA 4LGVA 3ZXYA 3U81A 4MJ3A 1CJSA 1V7ZA 4GI5A 1U6IA 3BRWD 4I9HA 4UEOA 4HCJA 1HR0B 4PSVA 4JLPA 2AFHB 3U16A 1H4TA 1OHHD 3FPCA 5SY4A 1SOMA 4JLOA 1QAMA 2COUA 3FKJA 4Z1OA 2P0EA 2OXTA 3H17A 3OM0A 3RPEA 4FFWA 4UW9A 2IF0A 5KNLA 3FSJX 4QICA 1R9JA 3RC2A 2XVYA 3KQWA 1UZMA 4WFJA 3DMGA 1NNUA 3BILA 1PWZA 2J0VA 2WFLB 1YR7A 4FD2A 2G67A 4MB0A 4QWWA 1PFUA 1G2PA 4I66A 5H3CA 3RGWS 1WXHA 2EP5A 3OCUA 4KQGA 1LI7A 2NU7A 1K7CA 1D1SA 2NZJA 5FLYA 3RF7A 4RNDB 1FP4A 3H9EO 2EZUA 1VHTA 4PO8A 1R0BA 2NTEA 3ENNA 5KWEA 2BD0A 2AZMA 4HAIA 5DTQA 4R6XA 4AKEA 2OV3A 1RWMA 3K30A 2W8ZA 1CNFA 2OCAA 4JLMA 4OYHA 1XA4A 1OFGA 4Q82A 1L5HB 3N5CA 2I6SA 2P62A 5G0UA 2J9FA 3C3WA 5A04A 3E15A 3H5OA 3IPLA 2GETA 1FXUA 3CT4A 4Z4EA 2QI9F 4RVCA 4DLSA 3OZ7A 5EKSA 3FPGA 5CVTA 2X7JA 2FW0A 4CTJA 5B2ZA 2VQEB 2VA9A 4EI7A 3HYRA 3V4LA 3W06A 1DC7A 1KQFA 2UUPA 3DBLB 1N7IA 3H83A 4PW0A 5I4CA 5H83A 5JRZA 2VP5A 1LJUA 3C70A 3EQ6A 4RY2A 4ABYA 5KZMB 4UAGA 1IBLB 1IMJA 3OU6A 2H3EA 4L16A 1OR8A 2GZSA 1EE9A 1H0HA 1OH5A 1M2OB 3FUUA 5C8XA 3UTCA 3GB9A 2X8BA 4GM1A 1ZDMA 3KB8A 2GPNA 3AIOA 4XARA 4IJKA 1XG5A 2DCUA 4ZO8A 3O31A 3INYA 3V34A 3V2UA 5I9TA 5TNXA 3S6JA 4UNRA 3ZUPA 2QG4A 4MDFA 4CT0A 2HSZA 4ZU3A 1TECE 3L8FA 4QKQA 2AXPA 5EUMA 1FA9A 4V0ME 2JIOA 4DA7A 3TTTA 3AP3A 1M73E 1PZGA 3ICPA 3TOSA 2IW3A 2P67A 4AJOA 4J1NA 3OX4A 2PZ8A 4E4RA 2XMGA 4MVJG 1I6MA 4ZRDA 2J5XA 5SY9A 1TT5A 3I12A 5I51A 1SZDA 2F1JA 3C41J 1F7UA 5BYJA 4JSRA 3JXEA 1UDAA 1AXEA 2NO5A 5JSKA 3V7NA 1Z0UA 5F1KA 2JLVA 3PR2B 3LBIA 4C4SA 1P1HA 3F71A 5FWYB 2X4LA 5FV7A 1E9VA 2DR2A 4N48A 1H2FA 3J7AC 2QD5A 2Q9AA 4Z7QB 2LDBA 5K2OA 2R1UA 3HA2A 1V43A 2XYVA 5F7JA 1QORA 2A0FA 2VCEA 3ND8A 4GR5A 1RKQA 4V0NA 2RKWA 1Y9ZA 3HUTA 1NE2A 2X40A 3LLSA 3PQ5A 4LA4A 3RTCA 3VHLB 4V1CB 1CU1A 2WVHA 4B7UA 2QN2A 2IF2A 3RHFA 1V41E 1ETHA 1CUVA 4O6VA 4X64B 4DVGA 3QWHA 3WFJA 1XKQA 2NSHA 3MEQA 1KMCA 4M60A 4MS1A 1Q0TA 1Q19A 4DLPA 3TB6A 3X0DA 3WGZA 4H16A 3D8HA 4L8GA 4AW9A 1E7YA 5DBEX 2FU5C 3LL4A 4HRAA 5FEUA 4KNYA 1VGVA 1CUIA 4IQGA 3R77A 4BNDA 1FMTA 4FE4A 4KVAA 5IDVA 3BQMB 3N28A 3SKYA 2WD9A 2WMDA 4NMHA 5CVEA 2HQBA 3T8YA 4H6XA 5LL6P 1N6LA 2PY6A 3EOAI 1PG5A 2JEOA 5AJWA 4RTNA 4BUCA 2X1LA 1T91A 3FRJA 2H4XA 3LT0A 3AC0A 1C7JA 2ID7A 3LDUA 3QF4A 4YGXB 2W6IA 2YS7A 1B8NA 1M8FA 4I4TB 4HN2A 5M3BA 3W4IA 1MO3A 4FGSA 4IJMA 2C7GA 3O2SB 4D4LA 4QDTA 1MFZA 3AEYA 1SCKA 1SVMA 3BWCA 4UU7A 3WRWA 3UJCA 4NMMA 1C7IA 3RT1A 2OHFA 4DW8A 2D1QA 3O4VA 3G7UA 4GVLA 4RFSB 1P4HA 1VJ0A 3FIJA 4KIWA 3SM9A 4W8HA 1ICEA 3BMQB 3P2EA 4M0EA 2XB8A 3GDGA 1N0VC 3RT7A 1NU8A 1I10A 3IJ5A 3QVLA 4YJ3F 4ETNA 2DT5A 2QT1A 3DHWC 1O5IA 2VEDA 2GYWA 2W7TA 3DM9B 4IY1A 3BTUA 4L27A 1L4MA 3AR3A 3QP9A 4A82A 4R8VA 2Y3IA 5FWXA 1MABB 2RAUA 2QI9C 1PT8A 2PZEA 2ZTLA 4FILA 1B93A 3ELDA 3I30X 3UFXA 2WQ7A 1GQRA 1QLHA 3MOSA 1ILWA 2D2XA 4M7RA 2PPVA 4CF4A 2OAP1 4PZLA 3CMMA 3WHKA 3T9DA 5KHLB 1XN4A 4JQSA 3I5UA 1EDEA 3I76A 1XD2B 4IIBA 4O4IF 3TPZA 3X1MA 4C2AA 4CJXA 1J7KA 1G5HA 2QRHA 3KUUA 3Q3VA 4HDQB 1SK8A 2EWVA 3H5LA 1VRWA 3EQ9A 1HQCA 2VUUA 1EM6A 5BVGB 2MSLA 1YDHA 2FX5A 4QODA 5K0LA 3THWA 1KI6A 1EP2B 1X9IA 1NPYA 3HY4A 2C3OA 4FGLA 3KYDB 4LJ9A 4ZQBA 1O95C 3VHXB 2B36A 5AO9A 5IDXA 3ND7A 2IX3A 1UDRA 1WEKA 3JVDA 4XJVA 5BN5A 3WC4A 2WQ6A 1AKTA 3R74A 3NAQA 4OLHA 4S1PA 3KDPA 2YIMA 1UXKA 5EJFA 3UVEA 5ITZA 1J5EB 4PBSA 2F9FA 3L07A 5ESDA 4U6NA 2Q3FA 1SB9A 1ZZEA 3RJZA 2I4RA 4MDEA 4ZV9A 4EECA 3RKUA 1MAVA 4S04A 3HTXA 1KVQA 5DHRA 4PC1A 1EINA 4OK6A 4KQ6A 4UTOA 4E4YA 4F0JA 4J0IA 2QAGC 2CXOA 4GECA 3SJAA 3M9LA 4XWGA 3EODA 2QBYA 3CO5A 4O3FA 3AILA 2VDQB 1NJ1A 2WF9A 1K6MA 2NWQA 1PW7A 3F8WA 4M7OA 3L7YA 5C2JB 2DHEA 1D1TA 5KWVA 1V71A 5JWHA 5B37A 1E8NA 4OQPA 2CNDA 3O73A 4YDSA 4E6PA 1HEUA 3N53A 5DCWA 2JG3A 1FSZA 1E1CA 1S0UA 2QAGA 3NHUA 3KFXA 3K71B 1VCNA 3S68A 5LKAA 2GCGA 2B21A 2W6ZA 1TW2A 2ACVA 1PS8A 3UN1A 4ECEA 4HATA 5ADHA 4M99A 4DEVA 4Y6LA 1EDBA 2JLXA 4QG7A 1WF3A 1E2HA 2NUAB 1WL8A 1JFLA 3FCYA 4LYAA 4DADA 3BHMA 5F4BA 3TW4A 2R751 2C5EA 1JPUA 1VPDA 4PWZA 4RZXA 3R7AA 4FMPA 1WXGA 4BX8A 5K0SA 2WA2A 5CB6A 3QEJA 5LDGA 2CLKB 1OLSA 3EH1A 1C5KA 4XTRA 5DM1A 5BSHA 4AQ7A 1OH7A 2NLOA 3JR3A 3NHJA 4QE3A 4LHYA 4DRXA 2HYDA 2Q7XA 3A10A 1FVOA 1PNTA 1P6XA 1Y4UA 3EJ6A 1Z5VA 3SJCA 2I2FA 2R7LA 4LDNA 3J7TA 2VJAA 5CXSA 2CMHA 3AVQA 1F17A 1V5FA 1IULA 5K8UA 5JC8A 3HDTA 3JTMA 4UNPA 2PJDA 2REQB 3QI7A 4IRMA 5EEHA 4QEDA 3J80A 3CLHA 4KLNA 4BLWA 1GM5A 5KSPA 3GF4A 2NZYA 5KNBH 3INRA 3LLCA 3WBKA 2OXEA 4HWKA 4XRRA 1U8UA 1JT2A 2XOXA 4YUAA 2Q07A 5BR7A 3ASVA 5JAMA 1ZOIA 3A4LA 1KDPA 2VQDA 4LSWA 4IG4A 1Y6RA 5I7FA 3O8RA 1L7DA 1F8YA 1J39A 3AP2A 4KQHA 4WJLA 4WN9A 2IVZA 1RZUA 3CZ9A 4ZQCB 3AJ8A 5JFGA 1NHGA 3G2QA 3ZHRA 5CXUA 1G59A 2QVGA 3K20A 3VDMA 2QX6A 5BW8A 5L3SB 1J2RA 2APJA 1YRYE 2J48A 1ZCBA 1GP2A 1Q95A 3RUIA 2BOVA 2EKZA 3DKRA 3JYOA 4FFMA 1US8A 3BUSA 4BFYA 1C7EA 5IVHA 3WB0A 4OB7A 1UQTA 4AKIA 2HSEA 3KHKA 3ETNA 3S27A 3SF8A 4BKRA 4TMVA 3IA2A 1CVLA 2RB5A 2OV6A 2K2WA 3MAGA 3OWHA 4YJHB 3IVCA 5CXQA 4L5YA 2V4MA 2ON6A 3SHTA 3O2QB 4FDTA 4IVPA 4YRMA 3IUEA 3CKYA 4J1QA 4E7OA 2J5QA 2K87A 4TQ9A 1CZUA 1C8KA 3X1JA 3JZDA 3SVTA 3CVYA 3K8QA 2EW1A 2CFTA 4FP9A 5KVCA 2CVOA 4E08A 3FCOA 1XQYA 2FWBA 1AV7A 2YV1A 3PC7A 4KSYA 2I1QA 4QOEA 1ECGA 2FEOA 5HIJA 2PSSA 1OJ7A 2MTBA 1HLFA 2ERYA 2PLNA 3D3NA 3TVDA 1ADBA 1L7XA 2I5PO 4PR3A 4RJJA 4RLSA 3NHYA 3EXAA 4FX2A 5ILQA 4E2WA 4EM6A 3O92A 3VUEA 5JPCA 3DJFA 2QQ5A 3U26A 2WOOA 2FQXA 1DEHA 2MT9A 4JBHA 4NATA 4WNIA 4CQMB 2GD2A 5JO0A 3ZDQA 5KQSA 3NW9A 4UTNA 2REXB 3E1KA 4EGSA 4QJIA 1W94A 4P83A 3BERA 3L1UA 4MJXA 3O0TA 3MK31 1FLNA 4Z0TA 2LPMA 3JQAB 3RRMA 2FVXA 1PAUA 1Z12A 2BDTA 3MQ4A 4FNGA 5FULA 2ODPA 4CM5A 3EPHA 3IKJA 4G0YA 4LECA 1F0KA 1OAOA 3GXOA 5DI3A 1JHOA 2EG9A 3VKHA 3X1XA 1IY8A 2IZ1A 3DMNA 1ZD3A 1QYCA 2QLFA 4LBVA 4TT3A 3MGGA 3GRVA 1LQUA 4I50B 1VPTA 2O7QA 1E1MA 4B73A 3GK3A 4H6WA 3AETA 5LOVF 4I0WB 2EIXA 3IT0A 3MCWA 3T0IA 4DLWA 1PJRA 1M1YB 2H8GA 4Z7OB 1X0VA 2H3HA 2D8AA 3MSCA 1F1BA 1IHUA 4DCPA 2B37A 1BDHA 1UMBB 2VKTA 5C0OE 5JSHA 4E5NA 4B3RB 3EQ2A 5J43A 4KQ9A 1WOMA 2FDXA 3LUCA 4IJQA 1IEWA 2FN7A 4R3NA 5C7IO 2WWRA 3I1FA 4M1KA 4BNYA 1LS1A 1B0UA 2WF6A 1KI8A 1QIEA 4U39A 3TBFA 1EWRA 3NB0A 4RK5A 3S2YA 1QGAA 3RUFA 4QRIA 3DSRA 2P9EA 4LJAA 5E2AA 3L6EA 1YB7A 4I46A 5KBYA 1VYUA 2YTZA 3E7DA 2WW8A 4BC1A 5E1MA 3RUPA 5BMOA 2OMKA 5ESXA 4QO7A 1URPA 1IWBB 1VPEA 3L0YA 4HFRA 4HNUA 2J3EA 421PA 4C4RA 1UK7A 3ET4A 4WESA 2CHEA 4KBYA 3ISVA 2EGUA 3LO8A 3MTAA 3ZTYA 2J0QA 4KZKA 4BVGA 3OJ0A 3RYIB 3T54A 1LRKA 1PG0A 4O29A 3W2GA 3PWTA 2C7OA 3A6EA 1PT9A 3PFGA 2RGXA 5BYAA 4AECA 1KR5A 1QDEA 3TZKA 3G1WA 1JR3A 4D82A 3ZZ0A 1NXVA 1KYXA 1SZJG 4YY3B 3TTUA 4TQGA 3T1HB 2WKSA 5NLLA 4JIGA 1IZ7A 1DC3A 2YASA 3AJAA 3P32A 4N39A 5C7OO 1FP6A 2DHCA 5IULC 3RK4A 2H1CA 2RBKA 4E0BA 4HGYA 2IYTA 1PT5A 3ROKA 3AXTA 3GVCA 3L9WA 2YV2A 1MX9A 4B3TB 4E5SA 1UZLA 3RJMA 4BIIA 1XKXA 3KB6A 5IT5A 4FUTA 4R8MA 1N32B 3CB4A 2Z83A 4JLNA 4ZCTA 2JARA 5GM1A 1N5LA 3E8XA 3GFSA 4YBRA 2IU0A 1D4ZA 5TPWB 1YQTA 5REQA 3SIRA 2Y1FA 3DAOA 1GPDG 3W3AA 3HDQA 4BNVA 4MQEA 1Z8HA 5FO1A 2X0DA 2JFBA 3EW7A 2G36A 3K9QO 2BHTA 3JVUA 4Y1RA 1RPZA 2YXLA 4RH0A 4LHVA 2TYSB 2N1BA 4LIPD 4QBKA 1A72A 4A2PA 2VHYA 1UPCA 2BMWA 4DLLA 1NP3A 4KQWA 2WICA 1DI0A 2FPMA 3WGTA 3EE6A 3VSAA 2D0DA 3ETHA 4QECA 4WRRA 4OL9A 1ZCAA 3ZE8A 5AVSA 2ASVA 2BRUC 2REOA 1P9WA 4FDMA 2EHJA 3QG1A 2AEEA 2FUKA 2NYVA 1DCFA 1YDGA 5J5VA 2CL5A 1ODSA 4HXFB 1PV1A 1Y9AA 4GPBA 5BMVF 2R1VB 2WBLC 1JIXA 1G8HA 2WTAA 1P2BA 4U7TB 4M8SA 1YHNA 3WNBA 1MGPA 3B3GA 4ISBA 2QTRA 2VP9A 3BTOA 2XZDA 3DXZA 4GX1A 2EQBA 4HUJA 3D8TA 4W99A 4WTOA 2ZZKA 4MGHA 1DRJA 4A7PA 1Z8DA 3K5WA 1MORA 4K88A 4E3ZA 4EMBA 3T52A 4JI2B 1JSXA 2P75A 1OROA 3AFIA 1P33A 1ZUNB 2XUFA 4IZIA 4PS1A 1K68A 2B0CA 3Q9UA 4KH1A 4DQUA 5BWNA 5LM3A 5GJVC 1NW4A 3TKAA 5M04A 4I1PA 3BFVA 4EL5A 1N9ZA 3IC5A 3F49S 3H3XA 3RREA 1V7CA 3H42B 3KVOA 1U0HC 4CFZA 3DLAA 2H7YA 1UINA 2JHGA 1VJ5A 3B1XA 4ZQHA 1JILA 2HNAA 3MF4A 2BJHA 2PE5A 5TR9A 2GARA 3DAPA 3FMGA 1Z4NA 2FSSA 1YD7A 3B12A 3D8NA 3OX2A 3JRXA 3PXGA 5TT1A 1RBQA 4RJIA 5DT9A 1MV5A 1BVYF 1SQ0A 2AUTA 2D4AA 3M5DA 5AYVA 4K6CA 1JH9A 4JGBA 4P0PB 2C9DA 5DZSA 1X1SA 2VP2A 2QT9A 1HF3A 4NHOA 5DNCA 4YT8A 3KTFA 4EB6A 2Q5FA 4LF8B 3A9TA 4X45A 1Y63A 4BNFA 1JW9B 1SWWA 4A4DA 2FG5A 2POCA 5FR2A 5LYJB 1BG6A 2CLLB 3AEUA 3LU1A 3UG7A 2J0UB 4D57A 1J8MF 2C88A 1TCBA 4D9NA 3R5HA 3GFTA 3IRVA 9GPBA 4DV4B 2GJKA 3UANA 3KJIA 3NDRA 2W37A 2XYPA 2VRBA 3HLTA 5AI5A 1CS0A 4A8JB 4ZIRB 3OLVA 5B64A 2QNIA 2IWHA 2PU5A 3RRNA 2D74A 2WU1A 3QVMA 1V7PC 4JLAA 1YNSA 1YUMA 2IKQA 3KZOA 1AQNA 4J3JA 1H5NA 1R7RA 2JI4A 2QRZA 4CNQA 4EG6A 1H6DA 1XO1A 5LIPA