3KUUA

Structure of the pure phosphoribosylaminoimidazole carboxylase catalytic subunit from yersinia pestis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
b'NSAYAAGVKIAIVMGSKSDWATMQFAADVLTTLNVPFHVEVVSAHRTPDRLFSFAEQAEANGLHVIIAGNGGAAHLPGMLAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILALHDTELAGRLAHWRQSQTDDVLDNPDPREEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase catalytic subunit P
publication title Structure of the PurE Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Lyase
total genus 49
structure length 169
sequence length 169
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2009-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 3kuuA00
3OOWA 2H31A 1D7AA 2NSLA 3TRHA 1XMPA 4B4KA 5CTJA 5CLGA 2FWBA 4ZK2A 2ATEA 4Z7JA 2FW6A 5CLIA 5CVTA 3OPQA 2FWAA 5BOSA 5CLJA 3KUUA 3LP6A 2FWIA 4JA0A 1QCZA 2FW9A 4YCDA 3ORSA 2FWJA 2FW8A 3RGGA 2NSJA 4YCJA 4GRDA 1O4VA 2FWPA 5CLHA 4AY3A 2NSHA 4AY4A 5BORA 2FW7A 4YCBA 4ZMBA 5CLFA 2YWXA 4ZJYA 4YCCA 1U11A 2FW1A 5BOSB 5C5DA 4ZC8A 3RG8A
chains in the Genus database with same CATH superfamily
4QHYA 1E1QA 3RANA 2JAPA 1AUQA 3EPRA 5A2QA 4IDEA 4M1ZA 7ABPA 1ZVKA 4X6UA 1Q95A 2J5BA 3AWIA 3AIKA 1DL5A 1CY8A 1XTQA 3A1FA 2GRJA 3ZDAA 2Q8QA 5CEJA 3RVKA 1BX0A 3KJFA 4CCSA 2Q4TA 2GCOB 1G3UA 3ET4A 1SC4A 4J16C 1TA4A 5H5JA 5C4IA 3T3OA 2YX1A 2EW8A 4ZN6A 4OG2A 2XB6A 1I33A 1U3CA 1XK7A 2REBA 5WRFA 1Y3HA 2PZ8A 1U28A 2HHLA 3VOAA 3TQOA 3LX5A 4RORA 3P32A 4XUCA 2G36A 3NVKI 3LT1A 4L6CA 2VDQB 2JLYA 3WTCA 2C77A 2V7WA 1J7KA 4EG8A 1RXIA 5JADA 1TTTA 2WYIA 3HJCA 1D7OA 2PVPA 4YRJA 1L9XA 3ETHA 4XIFA 4EB6B 4K9RA 1T8TA 5KYUB 5TEWA 1R9JA 3HCPA 2FAXA 3NDRA 1LH0A 1OBFO 1TYCA 3TRFA 4DCSA 5U4XA 1MOSA 4K05A 4BMCA 3HDHA 1Z7GA 1E6KA 5A9SA 3LVRE 2ZK7A 1N9ZA 2R6DA 5DN6D 4MEAA 3ROGA 4UFOA 3K31A 1FP7A 4MW6A 4Y18A 1M33A 1Z15A 1SQ5A 1CETA 3LVBA 3E18A 1KXJA 4U5XA 4UTZA 2DT5A 3GFFA 4V0NA 1DFGA 4FNAA 3LDFA 2DBYA 4NAVA 1TUGA 4CLRA 1SZPA 4G89A 3NUGA 3UKOA 3F6BX 3KWMA 3S55A 1E0DA 3L7IA 4WBNA 3U17A 4PHTA 3OP4A 4FEYA 1T0JB 4OCZA 4AZWA 2JCBA 3L7OA 3LZ6A 1FFHA 1QIIA 3BQ9A 3WE7A 4JR1A 4E1BA 5F64A 1AUVA 2VJAA 1G21B 4GMDA 2XX3A 4DW8A 4DSZA 1ORVA 2XTAA 3PEFA 2QTVB 3IDZA 2ZTLA 4ND6A 3V7YA 2XWPA 3W7VA 3R3UA 4I5IA 3U1VA 4DSNA 5JOQA 3B8EA 2QVZX 1Q1GA 2VQDA 4ALKA 4L8WB 3HUTA 5F5NA 5DK6A 3UAVA 3HU3A 1T2VA 1PQ4A 1G0NA 3H5AA 1Q15A 4HX2A 4PAOA 2ADFA 3DOUA 3G88A 1EVLA 2OGTA 3KCNA 3HY4A 3KYDA 1SUAA 3QFSA 2QL9A 3LUBA 3WLJA 4V0RA 1UT6A 3CX4A 2OYRA 5EQFA 1YR2A 1Y3AA 1G291 2CMKA 2QMHA 2OCIA 3K71B 2EV9A 2WG2A 3DMNA 3HCCA 1XXHA 2P1ZA 2I67A 1TZJA 4I5DA 4TUYF 5AK0A 4FINA 2NXJA 2ZXFA 4D3ZA 4QPZA 4RYLA 1OV6A 6REQA 2ID9A 1IPHA 1QB8A 3BXFA 3GGJA 4INZA 4OYHA 4R8KA 1P6XA 3U4DA 4MGIR 2G0AA 3ZU4A 1C3VA 4Y2SA 3EVDA 1FC0A 4BRWA 1QVVA 1IBMB 1A50B 4GMHA 4A0GA 3OTOB 1PJAA 4UOQA 4IDFA 1A04A 2ISSD 3O9MA 1Z0DA 1FB5A 3VMMA 5B5SA 2VJOA 1QYDA 4XLZA 3X1ZA 5H9WA 2DWPA 1JFVA 3IR6A 1VDZA 1SQGA 2PCLA 2XE7A 4YP9A 4M1YA 4MUYA 2JPDA 1X2BA 1XRSB 4MR7A 2OSVA 1L5SA 1RWOA 4OMDA 1EUQA 2WP0A 1MG0A 4NMXB 4XPIA 3X2FA 2XNDA 4FHDA 3JWHA 4K0KB 2ZPTX 2O8NA 1R5OA 2J9FA 4E14A 4PFQA 2OAQ1 1FX0B 2GMWA 1L5VA 3ORFA 4MZXA 4X8HA 3UWMA 4CN8A 2NXWA 1VMEA 2QZSA 4MUMA 1JG4A 4G37A 3RC9A 2WM2A 2GF2A 2P2SA 3AUAA 4PZPA 5AI6A 1WP4A 5FTWA 1W4RA 3OTWA 2F6RA 2XNJA 4DSOA 2VPIA 1CC1S 4C7OB 3AKDA 1MB3A 3JQAB 4Q3NA 4A0RA 1GADO 4DDUA 1DX6A 2ZT8A 1YQQA 3ZWBA 3UBMA 1R6XA 1PR9A 5IXJA 1RXYA 3FHTA 5B4UA 5BWOA 3MA0A 1SBIA 3KZNA 2Y71A 4KR7A 4MQEA 4XOUA 3GN2A 3S0JA 1YV9A 4QRIA 4U2BA 5CTAA 3C5EA 4A27A 3VPXA 3B5JA 2FZ4A 2VO1A 3L0IB 2OE2A 3LYHA 4IVRA 4AP9A 3NAZA 3MTBA 1KJJA 1QPBA 3DGFC 1J70A 1ZA2A 1A7KA 3AINA 2HKIA 3OWXA 4FR2A 4K2HA 4XRRA 2B61A 5T57A 5FDFA 2YVUA 3QVTA 2CDNA 5JPDA 3VKGA 3GB9A 1K27A 1D4OA 1JT9A 1MCZA 2RONA 4QYSA 4ZI7B 3UH1A 1A7AA 3IOBA 5K3FB 2XYVA 5AI0A 5I9MA 1OROA 1SU8A 3A1VA 1G1MA 4AKEA 5FI5A 2IPOA 2WNHA 3K15A 1GM5A 3TK1A 2FPWA 3GP5A 3RFUA 3WIDA 1LLDA 5K2OA 5COQA 3R44A 4DNQA 1BMDA 1VJ5A 2HMAA 3CNEA 5CDFA 3ZOKA 4IR7A 4CF4A 3RT9A 5CAEB 4HNTA 2DUJA 2FQ1A 1FMJA 3HZHA 1M2OA 3AR3A 4N0QA 3ZXUB 1O7JA 3FKQA 3OQMA 4GLLA 4BZXA 1F2UB 2Q45A 2QRUA 3FYTA 1Q22A 4N3CA 4LRQA 1UOQA 2OXTA 1D8TA 4QDTA 4J2OA 3O84A 5CRIA 4F21A 2R48A 4I3GA 4KN6A 4OFBA 2QRPA 4M83A 4QXQA 3WXBA 3K0SA 1IMOA 1UFKA 3HJHA 4UUBA 5AOCA 5HQ3A 1JNXX 2XKJE 1GFSA 4GEGA 3F78A 3HACA 4JMLA 1O5OA 4RVSA 5CIYA 4AJJA 1GGNA 5SICE 5CVDA 4L3WA 4O4HF 3ZXIA 2ODEA 5ED4A 2DBZA 1GZ5A 3IEUA 3K8YA 3BTVA 3QX8A 5DSZA 1PT9A 3ZV7A 5CDTA 3ROFA 3IO3A 2ZU6A 1HT2E 3PQFA 1N78A 1SXJB 3AFHA 3L7DA 5HILA 1AQJA 2VLIA 4IKOA 4O2LA 3T9EA 2NLOA 1BKSB 2H0QA 5I6DA 2A88A 2KBEA 4P7KA 1I32A 4HNVA 2OQIA 1ODTC 5EPEA 4AMYA 2XUGA 3W5SA 2K6GA 3SN6A 3HBFA 2JFZA 4Y2RA 4K6MA 1XKTA 2C5LA 2VAMA 3NPMA 3HKEB 1LNQA 4RHFA 3NHJA 2L69A 4XM2A 5DJ5A 5JSKA 3CVXA 1TI7A 4LSMA 1LBEA 4RACA 1ZOSA 2II6A 2WNIA 4TL6A 3OZXA 2F43A 3FCCA 3JQ9C 3TLXA 3WFZA 4BGUA 1YQTA 1RWMA 2GEBA 3RVRA 4AY2A 2QORA 4LK3A 1JBQA 5DF1A 1RWNA 3JRWA 2LWIA 2FMHA 2P68A 3ETGA 2C8LA 1MAWA 2A3NA 3LBYA 3OQJA 4DUGD 3SYTA 1BXRA 4TMZA 4AK9A 2ID4A 2A30A 3IAEA 4LK2A 3VZCA 1QYRA 2VYVA 5B3KA 1AD2A 1STOA 2Z4SA 1XV5A 2NXNA 2XD9A 1NDHA 2CGEA 2J9XB 4KNVA 3SEQA 3TRIA 3WLFA 1LTQA 3IDFA 4AKIA 2JL1A 2G5TA 2CL7X 2OV6A 3OZTA 4XGIA 4NSNA 3SE7A 1D4AA 1XZPA 4TZTA 4EHKA 4EX7A 1QAQA 2G76A 3A1CA 3WGYA 2V1UA 3TAXA 1V26A 4R3WA 4KWIA 3VDMA 1J8FA 4AN0A 4BVKA 4RL6A 3SS9X 4JLWA 2X6RA 3EQ2A 3I9LA 3P45A 2V54A 3VO1A 4H6PA 1QHFA 1W85A 4YQYA 2C2HA 4U6QA 4YCDA 4IYJA 4F9FA 3TQIA 5LJIA 3C3JA 4OLAA 1U2PA 2PS0A 2P40A 3MJ4A 1UPCA 1ZK4A 3M1YA 2MYPA 2ZTVA 3TVYA 1EHIA 1E2GA 5FL7A 5REQA 3U4HA 1LSUA 3MYYA 2W2TA 3GLIB 3CLVA 2OV1A 3V42A 1EBFA 2BGUA 1IUPA 2YXNA 1UWKA 4OFWA 3QXXA 2WV7A 1QQAA 3UB4A 5EMNA 5K03A 5JXIA 4JGBA 2JNWA 1ZXBA 3B8HA 3PA6A 3AKYA 3P9QA 2RB5A 2ZRMA 4LIPD 3L82B 1XCOA 5T8KA 1E64A 5L3SA 2ZQ5A 2A0YA 3VMFA 5KWIA 2PKCA 2WIGA 1X9GA 3GCWA 1BJTA 1FQWA 2V5UA 1MAAA 3Q3EA 4RUKA 4AFNA 3R0XA 4Y7DA 2R60A 4MZDA 1DTEA 1EDBA 4YCJA 2ZRPA 5BN3A 1Y6QA 2PT9A 4Q4HA 2P91A 3X3HA 1KS9A 5KPJA 1MC8A 3I2YX 4QEZA 1P80A 3QEBZ 3K2EA 4UASA 5TJ9A 1WXFA 4X7RA 3NYIA 3GLSA 1P1CA 5HDBB 2H5EA 4YJGB 2EJCA 5KNBA 3C3WA 3AI1A 1WXIA 3NWOA 1ZN2A 4LJ5A 2OXIA 4DRZA 5BW6B 3S8YA 3ESDA 3JQ6A 1WLSA 5FA5A 3H0KA 2QT9A 3DL2A 3UCEA 5TMDA 2FLVA 1KI9A 1E3IA 5EZYB 4RZSA 3SS8A 3USZA 2IXTA 3A1UA 1D2AA 4NI5A 3NH9A 1E32A 1C9YA 1MIOB 2WUEA 3NOVA 2O5VA 4UCXA 5HIIA 5IMSA 3MILA 4I1RA 1X2EA 4II2A 1L8QA 1NBEA 5C51B 1OBCA 2ECFA 5DGHA 1Y1SA 2PYIA 4NPCA 3C4QA 1V5GA 4ZV9A 4D82A 4WKOA 1VKNA 4KQJA 5D3QA 3R23A 1EGVB 2AZTA 3SZOA 3C0KA 4QLBA 5DNUA 5THXA 2PJZA 4AKGA 1U6IA 3GYBA 4D3FA 5DXFA 2B8JA 1TJNA 5IS2A 2HADA 1VIAA 4N82A 4TKZA 3N8GA 5IK2A 2G70A 2MJLA 2X0RA 4OL9A 4DXHA 3HSYA 2Q3MA 1KMNA 3V1MA 2AN1A 3DFKA 4JJIA 4K9PA 3TQFA 4DCOA 1U81A 2GRUA 5IEBA 2DF8A 1P0CA 5EOVA 3ZHQA 1V6AA 2X4DA 1CDOA 4DR6B 3JQQA 3LY5A 2QEQA 4HLDA 3R7SA 1QQBA 5G41A 5AVXA 4QLOA 1CRZA 3HN7A 4OHVA 3LLSA 3HWWA 2YVQA 4U5QA 5AJWA 5JH7F 1NVVR 2JLXA 1ML4A 4U02A 3COSA 4YWHA 2ZI4A 3R0ZA 3GFGA 2PZLA 5A0TA 3QXSA 4NXNB 2PEZA 3PZBA 2X0JA 3DM5A 3NHAA 4HWTA 5COBA 4ZI3A 3CEJA 1XDUA 3QPAA 4S0ZA 4ZZ3A 5A9SB 3G2OA 3OZGA 4UQOA 2HDWA 5JBQA 3OLYA 2DRIA 2BKAA 2VSOA 4KDRA 4N39A 5ERXA 1XDWA 3ZG6A 2CJYA 2Z3VA 3TCXB 1QS0A 3DULA 3S99A 1G5PA 5L3QA 4CLRB 2ZJ7A 4A16A 3I6MA 3R76A 4Q66C 1ADJA 4YMIA 1G21E 3TQSA 4WBNB 2DFNA 1E2DA 4UKDA 1JMKC 2P3OA 4EJMA 4MRAA 3A6PC 2KHZA 3UJ6A 4DIOA 2HJGA 3QXJA 2ZRJA 3ODPA 3GFBA 2WA1A 4X94A 4MULA 2EKLA 4QHTA 1PTKA 2QZ4A 1F3LA 3AR6A 3ORYA 3DE4X 2WSLA 4BMOB 4GGMX 4DY4A 2W7TA 4ZVVA 1B0UA 3FZQA 3KQYA 3KOXA 3L77A 2W93A 3PYLA 4JWTA 4DLKA 4OJNA 1J25A 2J3MA 3TGPA 4OXIA 4BAUA 1LDGA 3OEEA 3M6WA 1PF7E 2ZRAA 3A05A 4O0MA 1KDTA 4JVOA 5JS8A 3O2NA 3W6NA 1U65A 1PR1A 2WDZA 1H2BA 5B55A 3KYDB 4YRDA 2HLDD 3NTOA 5LDHA 1X77A 5LQJA 5LBTA 3R5KA 3RJMA 1NG1A 3PQ7A 4KR0A 4KPUB 1DI0A 2EBUA 4KWTA 1XXHB 2WF8A 3IR7A 1CUSA 4US2R 3DWIA 1OXKB 2JFOA 1BS2A 3N2GA 1E2HA 6REQB 1MXFA 4XEHA 1TC2A 2WFAA 1T2EA 4DVJA 1XMPA 3GRUA 1P1HA 3FE2A 4LYJA 1USIA 4MKIA 3FUCA 1MOQA 3JVUA 3E2MA 3M5CA 1BWRA 1J4AA 3TF5A 3FUUA 3LBHA 4RABA 4B3IA 4YECA 5IJXA 1RPTA 4ARBA 4MR7B 1H0SA 1YO6A 3UT0A 4EEXA 4W82A 4BBAA 2ZE6A 2Z8YM 4R01A 3AU8A 4EY5A 2VHCA 4XPIB 1LVGA 3E7FA 3LWZA 2EFEB 3MWJA 3CMCO 2FUNB 3LHKA 3S7ZA 1Z0FA 2J9FB 4P36A 3AR5A 1IN4A 1M6VA 3H2YA 3AG6A 2DYKA 4C6TA 2R8EA 2ZATA 3GBSA 4OKIA 5BRNA 2DLNA 4J2HA 4NYMQ 4RPKA 1GNLA 4HEJA 4N5LA 3PXXA 5E3IA 3T1NA 4CDGA 3H9QA 3NUQA 2HPVA 4ND5A 4PICA 5K5EA 3EB9A 2WG0A 3NYWA 5CTJA 5C1BA 3IBGA 1SKUA 7REQA 4WN3A 2H2DA 3KXKA 4J1TC 3HR7A 1Z82A 2X9LA 4LXHA 2JLCA 4UVGA 5ECGC 2XUJA 1FY2A 4YV0A 2EJUA 5BNIA 1N1MA 1K88A 2WUGA 4J75A 1K5PA 1UXJA 2F2TA 3QU7A 4MQEB 1NSYA 4RKQA 4TLAA 4AN1A 4YUWA 3N70A 5K4AA 4CMGA 1RCFA 2WU4A 3SKYA 4DNFA 3LWNA 4G5QA 1U7XA 4UXHA 2RHHA 1I3NA 5KTKA 3M6UA 1TJ3A 2XDWA 2V98A 4P4LA 1D04A 2UYQA 4OHBA 3NCHA 3IB6A 3N0RA 1U8ZA 3EEFA 2CK3D 5F21A 2C20A 1V2GA 5KKAA 1WLYA 1QKIA 2L17A 3Q9SA 1W96A 1ABFA 4I2NA 1SKQA 3GAAA 2VYQA 3ZQ4A 1I6MA 4FE4A 3QKTA 3ROQA 3REFA 4I50F 3PJEA 3FETA 1XQXA 2JEYA 1XTVA 1CD5A 5ES3A 3TLKA 5CB4A 1V4BA 5NLLA 3SSMA 2I6QA 4BB6A 4EPWA 2NXCA 3HV0A 3AL0C 5ITVA 1DEXA 5AT1A 1T1IA 4V03A 1Z2EA 1SEVA 1R0CA 1M2OB 1Y9ZA 2JI9A 3SEAA 1N5RA 1U1GA 4XX0A 1TFRA 2BGNA 3JZMA 1SXQA 4GMXA 1MNQA 4CTOA 4OHFA 3IKTA 2Z6AA 1FSGA 4RPLA 3RBAA 4X1OA 3WQBA 1VE7A 3O9ZA 5PNTA 3VZSA 1CX9B 2ZS7A 3MWDA 4MYUA 4PSVA 2K7FA 2E5WA 3K70D 5HQ3B 2B83A 2H06A 1CUYA 1TPZA 2GEDA 1UDRA 4FDUA 1Z34A 2XQVA 4DCGA 2Y9PB 3FPGA 3OI7A 2VA8A 2B8EA 2OSBA 4ID9A 3VISA 1XPJA 3DDHA 5IF9A 5KJ1A 4HUTA 5JS6A 5EKSA 1VZ2A 1C81A 2IITA 3DEHA 7YASA 1C9NA 3USCS 1E66A 1L4GA 5KOIA 5F1OA 1UOOA 2ATIA 2DP4E 3FHJA 4WCVA 1XZHA 1YS7A 4RTSA 1OZFA 1SBZA 2H9YA 4ER6A 1MX9A 2BSAA 1WPGA 2NSHA 1OH5A 2BUBA 4OI0A 3G8CA 2HPZA 3IP3A 4XDYA 1E7YA 3OQ6A 1P8JA 2HA7A 4AU1A 4D81A 2A6PA 2JKVA 3OE7D 1YTLA 4MB6A 2F43B 2CC2A 3CUKA 3EC2A 5AK5A 2YWHA 3AHGA 4ONEA 2X2OA 3ANXA 3QUQA 5KHOC 1XU4A 3PXDA 1IZ9A 3O38A 4K9DA 2IV2X 3ASUA 2J67A 1C7FA 2IJGX 3ZS9A 1PL7A 2WTMA 5FJIA 4UEJA 1BXRB 1PFGA 5F23A 3SR0A 3NIWA 4NVRA 4OTZA 3Q0TA 3WISA 1RZ3A 1R2QA 2JF0A 4HDKA 3ZD9A 2WABA 2FPMA 3IBSA 2HDNB 4U9HS 4JBGA 1QV9A 3S4YA 4J0FA 3OEWA 3QVSA 1HRKA 1L7RA 4J0KA 5CLHA 4BJ5A 1H0HA 2BLLA 4UHHA 3VAAA 4BCBA 4IOMA 4B7UA 1LQTA 4RDIA 1CRLA 3FKSA 2M6RA 2RFLA 2VHVA 3P2OA 3KOZA 3OMLA 4KKXB 2PWBA 3T61A 3MN1A 3UENA 4NQRA 3KKZA 3OD5A 1DCMA 4JX9A 1USUA 1W85B 2J6HA 3GLIE 4Y6PA 3PQ4A 5E3JA 5U1PA 3KLNA 5JXGA 1H4TA 4FGKA 5B58T 4HWSA 4LXQA 3RAGA 3MWYW 2PUEA 1GO2A 1V35A 4JR2A 3OC0A 4YK7A 5REQB 1F5SA 4QNMA 2ZRGA 1JHYA 1WY5A 4HEA1 3JWJA 3KOWA 3EVGA 3LTEA 2X40A 1U2GC 2HF2A 1D2RA 2R25B 2TECE 4YJFA 4JK3A 2GTIA 5FR2A 3NHZA 2PDAA 4PU0A 5F73A 4IGKA 3RYHA 2HCFA 3CBQA 4BMSA 4EB0A 1C50A 1K4MA 2VQ6A 3KL2A 3T3IA 5LPNA 3L46A 4ITUA 2O59A 4N54A 3GA7A 4AIIA 1KEUA 4NLLA 2FGKA 4J1NA 5L3SB 2GD0A 2HYIC 2K2WA 2EHDA 4PR0A 2IYFA 1FUKA 4ALJA 1SBTA 5B7GA 1Y8CA 1PE0A 1GITA 2WTBA 2VIIA 3B9QA 5H80A 1JAXA 5BN3B 2MSEB 4Q4HB 3G49A 1CR4A 3EIUA 5E2AA 3WYEA 1N25A 4Q7QA 1Z47A 4B4VA 4B7XA 4BVJA 2OWEA 1A2OA 1DJPA 3A14A 5LP6C 4AJPA 4CM3A 1O08A 1Q21A 3OP1A 4KOAA 4P3NA 4URUR 3X2EA 3EEOA 1UKZA 1YDMA 2P9BA 3H42B 3EIQA 3ZNPA 3PGMA 1FUUA 4MPJA 3SHQA 1D8AA 3TOZA 3ADBA 2O8DA 1YRBA 2WE7A 4TTJA 3PNQA 2NTVA 1KEEA 1LPNA 1MORA 3M4YA 2P0EA 1DQPA 4RJIA 1T13A 3DC7A 4OLHA 1LI7A 1FUYB 2ZR7A 3MS4A 3I8XA 4C43A 4CM5A 1H2FA 3IAFA 3EFHA 4YRIA 4MWCA 2YV1A 5TF4A 2AB0A 4EJ6A 1V1JA 5I8WA 1HF3A 2JA1A 4JLBA 4IDPA 1NUQA 3V4PB 4UCQA 3VZDA 3KDAA 2GEVA 3PUZA 4XWYA 5DI3A 3QJGA 3T38A 4Q47A 1BEZA 1Y4SA 2V9ZA 2QI9F 4UNNA 1QFXA 5I7VA 4TTTS 1PNRA 2QSUA 4DDMA 1IVSA 2MSNA 4KEAA 4GMGA 1AT1A 3FNFA 4JP1A 2CVZA 1JF8A 4GWLA 5DB4A 5CG1A 4YAOA 3ER9A 3FVQA 3MBIA 3UYLA 4PLWA 1Z08A 2BR3A 3FSJX 5CEEA 4FD3A 3IIIA 1K8ZB 1MFZA 4WI1A 1QFYA 1V71A 2XEXA 4JI6B 2EJBA 3U7RA 2P7HA 5ICEA 4XE5A 5A3JA 3Q9LA 1C4OA 4AAYA 1SGWA 4O63O 1OBVA 4S2UA 4L7QA 5A5GA 1LRKA 4HVAA 3R5TA 4IEEA 5KOHA 1WAMA 2WK1A 2W0SA 1YQEA 4ZKDA 2PZMA 4F12A 3TSYA 1I6LA 3ZCXA 3INTA 3LVQE 5TMEA 1CB7A 2BZSA 4MGEA 1ZP6A 3BRQA 2OO5A 1ZIDA 2Y0PA 2ZSIA 3QV1A 5FWAA 1PL6A 2EZUA 3COJA 3C97A 4TTVA 3KKNA 1N4AA 2DCUA 3VNSA 2O4UX 4EO7A 1XQWA 2IP4A 1H9AA 4M99A 4YWJA 4DM4A 2ADMA 4JODA 3H84A 2R8XA 4XVCA 2ZRDA 4KQXA 1QS0B 4IRXA 1EGQA 4K0RA 5L3QB 4LBWA 5FKJA 3QEMA 3DF7A 4L9RA 1G2IA 1XZJA 1U0SY 5D86A 4MLDA 3VH2A 3S8EA 3PHBE 3AB8A 3IRUA 1GDDA 4RZQA 4E03A 5KPDA 4MAAA 1VL6A 2R8PA 4DAEA 3R40A 3DAYA 2PMEA 4FQ8A 2RJOA 3RSQA 2WMOB 4UBLA 1E6CA 4EY3A 3QI2A 5JASA 1X39A 5ILOA 2YRWA 4D96A 3TKAA 3F1KA 4PNZA 4OU4A 3UGQA 4AW9A 3G0DA 4P0PB 4Q24A 5B3JC 1U8FO 1G38A 3ENZA 3ZD8A 3GPCA 1QZUA 5L7TA 5CH5A 3SVTA 3SYNA 2HW8A 5CX4A 2GPWA 4DT1A 3L1IA 4P35A 1AZSC 2WJVA 2QMZA 2NP6A 2YR0A 3HJBA 2JKYA 5KYYA 1EIZA 4BQOA 3Q3IA 4MVCA 1JP7A 1Z5ZA 4CMAA 1ZCFA 3EPHA 2M1XA 1A8PA 3TMKA 2GT1A 4CG0A 3REQB 1OLSA 3ZDDA 1JDVA 4PGFA 5HF6A 1XDDA 1BHO1 4DLYA 4BX8A 2Z6QA 4LZAA 4INJA 1USWA 3PCRB 5EZQA 3N2GB 3PFCA 3OBBA 2X8WA 1BWPA 4ARSA 4DNPA 1Q0PA 4IIYA 2VYVD 3VZBA 3OOEA 3OPYA 2W0MA 1XTKA 1AU9A 1KZ9A 2NVUA 2P6MA 3EG5A 3LP8A 4JUDX 2HK8A 2RGNA 5IHXA 5CT6A 3SNHA 3IKJA 3DM9B 1V9SA 3CEPB 3ZDBA 1Q0LA 1RP1A 3HFSA 2VRCA 3AM5A 3NWEA 4XJXA 4OQMA 3HYTA 4LGYA 1CUAA 3OPYI 1FDTA 5K05A 1DHTA 1FP1D 1TAGA 3SHFA 3Q72A 4CRWB 3DXXA 1QF7A 4ZVOA 5HM6A 3AXTA 2HQRA 4I81A 5KVCA 4H60A 3F3YA 3P4YA 1ZA1A 3EVAA 1NLUA 3F6YA 2H92A 4DB2A 1GQFA 1M6VB 1OB2A 1C3LA 2GX6A 4C6TB 2HA5A 2AG0A 5A04A 4RE6A 3H5IA 2PRIA 2Q3HA 3ABSB 1N5JA 3GH3A 3KFLA 1Y33E 2QPTA 4I9GA 1QZTA 4K9SA 3WGQA 1TM1E 4E5DA 1GKLA 1T9BA 5IASA 1SFRA 5FFNA 4Z1MA 3DDZX 1N77A 4UTRA 3WGKA 3CIOA 2L18A 5LMCA 7REQB 1YZUA 2P77A 3KOMA 4Q37A 5A62A 3GT4A 1ISHA 2CWDA 3DPSA 5EHIA 3D02A 5GV8A 1U98A 4P0QB 2Q5EA 4BLSA 2BP7A 1XZEA 3Q5EA 2A5DA 3LQKA 4DAOA 1Y5IA 3ECCA 1UEIA 4IJ6A 3L01A 1T5TA 3ZW8A 2YIMA 5B2EA 1ZR4A 1ZM7A 1KWKA 2JBHA 5IDWA 3SGLA 3WB9A 1T8SA 4YMWA 1FSZA 1FU8A 2BEUA 3A3PA 4KN8A 3UAXA 2BMAA 2A57A 2QTCA 3JRXA 1DAMA 3A26A 4OYYA 1YDEA 1J20A 4QOHA 1XEAA 5KX5A 4EFLA 1P72A 1YB1A 1ZAKA 5EJ4A 1G66A 3E9CA 1JR6A 4GMKA 1PDVA 2R4UA 2OAGA 1TM4E 3B7PA 4P1ZA 3SDBA 4XB2A 1KAQA 3EOZA 3WIBA 1P7PA 1RWXA 1TM2A 3PRHA 3OY2A 4HAXA 4ML3A 2RAUA 4NYIQ 2ZVJA 4XX0B 3UOWA 3O21A 1U4OA 3S6JA 2R8ZA 2X0DA 3MJTA 3M49A 5FLEX 1KQNA 2YY7A 4FSDA 1JU9A 1L1QA 4F1WA 1LLUA 4HXYA 3R24A 1RAIA 3KPUA 3MWDB 5E1MA 3AVTA 3OAAA 2EP8A 1ZEMA 5HKLA 5BSVA 4ZEMA 3FYUA 3MUFA 3MINB 4ZI5A 3ZCTA 1X86B 4X41A 1I9CA 1A8HA 3D4NA 1JYEA 3S2YA 3B1KA 4X1KA 5EZ6B 2QLMA 2BN4A 3UMJA 5A6VA 5IK2D 2Y4NA 1OV4A 2QTGA 1HDGO 1UKYA 4KSCA 1K66A 1JPNA 2XD4A 3E6AA 4ZZ2A 4JLUA 5LZ4A 3HWX1 1MW9X 3H5OA 2XQKA 5E3HA 3DUFA 1XNJA 2A84A 2OV2A 5E38A 3UGTA 4XKJA 2J0VA 4GBMA 4TV8A 1CZHA 4C4RA 2QUKA 4J76A 4WGGA 4RXMA 2WLTA 1Y3FE 3L8MA 3QPVA 2X13A 3VR6A 4L08A 1VE3A 3II6X 4CL8A 1NQUA 5ITZA 1QANA 2DFPA 1EMDA 1V45E 3EMDA 1T4DA 3R7DA 3A36A 3WKDA 1CRWG 2UUOA 3PQ8A 3X0DA 1G18A 3U61B 1FLVA 3OZUA 5ALXA 5TVGA 1GTG1 2PMCA 1QP8A 3DUWA 1G6HA 1PL8A 4OP2A 5KYGA 4BLUA 1E5XA 2W6MA 3GJSA 1HQCA 4JIGA 4LMBA 2PM8A 3RVDA 1KK1A 4C0WA 3TECE 4HDKB 4Q9DA 2XV1A 4MK4A 2QAIA 3DB1A 2BM0A 1MMFB 1K7SN 2OCPA 2VG8A 2JAXA 4D0LB 4ZYLA 3GGSA 3CNHA 1W1IA 2R751 4RTMA 2H08A 4CHGA 1BH2A 2XQGA 2ZIWB 1XRJA 4QICA 3P9NA 5EWMA 5FR1A 3RSLA 3CW8X 8ABPA 5HPYB 3G0GA 3FBTA 1ZVMA 2RGXA 4OJYA 5BWLA 1F0YA 2X19A 4GXQA 3WS7A 3ZI0A 2FX2A 1HXHA 4DYHA 3TKYA 2BW0A 3OE1A 5DM0A 4DNOA 4F3TA 3KQLA 1AURA 1GJRA 2ZBEA 4S1VA 1T5OA 3G2QA 4PGGA 2JGNA 2IU0A 1I36A 5INTA 4FUTA 3SR3A 2B25A 3HEMA 4DLBA 2HCRA 3HXTA 4HI0E 3ZU6A 2HBRA 4F2DA 3UVEA 3GEDA 4DYDA 4ZT7A 1AGYA 1BU5A 1U0JA 4YJFB 4BGIA 3RYHB 4CR7A 3MTGA 4KGDA 1A82A 4YLGA 3D5TA 3CUEF 2IHNA 5CA0A 1C0KA 3S8MA 3DMRA 3ND6A 2WMNB 1I1OA 2HJSA 1S8AA 4NU6A 5HIJA 5I3CA 3A04A 5K1ZA 3T7CA 2Z8YA 3IP1A 1NY5A 3WMFA 3D8NA 1BXKA 2O8EA 3ZXSA 2G8LA 2IYEA 1Q0ZA 1DBVO 3L8HA 5C5EA 2Z1NA 2F67A 4U7DA 2C7RA 1C3JA 4I1OA 3T9DA 4NPAA 1W2GA 2G4VA 4LX0A 7MHTA 1CW2B 2PX5A 1JX6A 4P4TA 1XMVA 2GYYA 3C6MA 3PWZA 5HHTA 1XIVA 3DKKA 4UU8A 5JZOA 4Z4FA 2QNRA 3R8CA 2ATEA 1EE9A 2WTAA 3EODA 3MAJA 4QDOA 4OXXA 2NU7A 3QWHA 3DB2A 2O8DB 2HX1A 3T3MB 4Q9HA 3KQSA 3UMRA 1THGA 2ECQA 4LJ8A 1AV6A 3X1JA 1YDFA 3RWBA 1EK0A 3BIXA 4UMDA 2CNKA 4IZHA 4FOTA 2WEKA 1HORA 2SNIE 3RHFA 5KMGA 1YZNA 1Y89A 4JWKA 3W5DA 1LXCA 3DNPA 5EE0A 1TE2A 2BLNA 1PKXA 1ZVQA 4OQEA 4PN7A 2XNCA 3QPDA 4FNOA 2BELA 4L07A 1SUIA 1BJKA 4XPZA 5DI3B 5IUKC 4D0SA 4P5DA 5J2UF 3BN3A 1T6NA 1TGVA 1RKXA 1UFQA 5MF6A 1ZONA 2UYOA 2O48X 3U4IA 5C1OA 3KYJB 3PC2A 1XROA 3ICPA 3NDPA 4NYMR 4UUNA 4AB1A 1YULA 5C35A 1DG1G 5JBIA 3I2IA 1FXSA 1Z8DA 3GAFA 4FJ2A 4OAQA 3JYHA 2ZTUA 1R7RA 2XWSA 3GROA 4MR9A 1MG5A 3KKPA 1J0CA 4KI7A 1R27A 2CUTA 3DGEC 4ILKA 5LQMA 1BWQA 2IE0A 1UJNA 3HU5A 4CT5A 4F3KA 4MVJG 4Q5IA 2I6UA 3AEKA 1KJIA 2JFFA 5T6BA 3TR6A 3VDQA 4R9SA 4RPJA 2F90A 3B48A 5KOHB 3SC2A 4XAQA 5DEOA 1NSTA 1B2RA 1U7OA 3AUTA 3I0MA 1T6BY 3OIYA 5DLYA 4UUOA 4MQ6A 5LZ7A 2GOYA 4AY5A 3GRFA 2FX3A 4KQEA 3UJDA 3EWIA 3OQIA 5T7BA 4RVDA 1R66A 2IYRA 1RBYA 2MSCB 1GPWB 4Y6GB 1SQSA 5FJJA 1SJ9A 3TLMA 4CI9A 1SXGA 4Q4AA 1GL6A 4C3VA 5FIUA 3ZV6A 4JXJA 8OHMA 2EKQA 3D43A 5AW3A 3C7AA 3LBFA 1IBLB 2JZOA 4EYEA 5A4FS 1TEVA 3DE1X 5IJ0A 3E3LA 4TKUA 3HYNA 3QEMB 4KTVE 4M7OA 3D6VA 5DRYA 2FNAA 1N8TA 3BFPA 3AR9A 3WRYC 5AQ1A 3F6PA 3EQ8A 4OREX 3SF8A 3VOBA 2QTFA 3QBVA 5GONF 4W5TA 1QDEA 1CS0A 3Q85A 4DIBA 1JFLA 2I55A 4M2LA 2NSDA 1I3MA 2VNKA 5ARDA 3AT1A 3OIUA 3LOPA 4P4NA 2CFIA 1X1SA 3ZU2A 2QB5A 3AEZA 3I64A 2H2FA 4EKEA 4KQHA 2QJFA 2JS7A 1F0KA 2P62A 1ZM9A 1MU0A 1V8OA 2WHYA 3FMIA 4IV8A 4QXMA 1EUDA 1HTTA 2QGZA 3KLOA 1B8OA 4LOAA 4KNYA 3RTGA 1ATZA 3CMMA 3DOCA 3H83A 1PX2A 4GKAA 2BE9A 4KQWA 4JBYA 3ZDXB 1IHUA 1C5KA 2OXEA 4R5HA 4WN9A 4CWAA 2V4UA 4HC4A 4PO9A 3VR0A 3ZY6A 4DT1B 5I3ZA 2GPNA 3LCJA 3AVVA 3OVMA 5CYOA 5KVVA 5KYYB 4KYUA 2DC1A 1PQPA 1ZRMA 4UDXX 4BLPA 2FP4A 5BWMA 3F4LA 1YKFA 4ZYVA 2CVOA 1OLSB 3AHFA 4QOIA 2B1JA 2ZUVA 3AQIA 4NU5A 4KFSA 1KYZA 4DA8A 4DCVA 2WWGA 3CLUD 4DPMA 4F85A 1LJLA 4N9WA 4RTJA 4KXVA 4BQQA 2QM8A 4ZHQF 3VSCA 5CFQA 1PWZA 2QLLA 4I1PA 2EWVA 3OPYB 4Q3AA 1MR3F 4RETA 5AMXA 2NVUB 1Z35A 1NYRA 4GXTA 3VDXA 3VPHA 3VV3A 1SVUA 3AUYA 2CNWA 1V48A 2IUTA 3NBKA 4G8DA 4M0MA 3ZV4A 2R7MA 2GNPA 4X97A 4BJHB 4JH0A 1VA5A 1Y4AE 1CJBA 2QHXA 1QIFA 2XUZA 5CD1A 4GRDA 3ZIDA 4FOPA 4KUGA 4JI5B 4Q9AA 2ZUSA 4B84A 4RE5A 1E7SA 3GT0A 5I8ZA 3ZCSA 5D8DA 3WSVA 1I7PA 3I9FA 1AA9A 1QE3A 3I34X 1R4AA 2ZSDA 2X8LA 2VAPA 3QE9Y 4G4JA 2FEAA 3V33A 1NFFA 1VYUA 2OEPA 2W58A 1O9GA 3LC7O 4JJ7A 3KR2A 4EG6A 3ZWYA 2CSXA 2NO4A 4S1WA 4CF3A 1YJCA 4BFVA 1L5RA 3IOEA 3TNJA 3K9LA 3ZTYA 3ZW9A 2Q2QA 2WM9B 5H0IA 4L8LA 3T5GA 3JAWA 3ETJA 2C99A 4UHBA 3AR4A 3PF8A 1QTQA 5FO1A 2YXPX 4NK4A 4AUKA 3GN1A 2P35A 2NX2A 4H9GA 5TB5A 2XVZA 4D4MA 3GUUA 2NAPA 4QDXA 2ZTMA 3WAJA 4LE1A 5I9IA 2BP7B 1E3QA 4V38A 4BFCA 1Z37A 5IFKA 5GOZA 1THTA 1EWVA 1KS2A 1Y7HA 2PQMA 3CVJA 1DLJA 2LRHA 3KAPA 4JL6A 3O1JC 1GG2A 1XMXA 3RYTC 4E51A 2ONKA 1NUUA 4FFLA 4FYKA 3L6UA 4ZVKA 3EH1A 5BWNA 1PVDA 1TA0A 3ESCA 2VZ9A 2XT0A 1DAHA 4IO1A 4PPYA 5EPOA 4KFUA 5BV1A 1GFWA 2D1YA 1LPMA 3O0TA 4PYNA 4ZCIA 2BEUB 4TOIA 1XE3A 5CLGA 2ZLBA 1P5HA 1L7PA 2DJIA 4EZBA 3AV3A 5KX5B 4BLOA 2H59A 4BGVA 3LH5A 3E4DA 2B5WA 2VUSA 1YRHA 3RVJA 4CLDA 4HX9A 1EVJA 1JDSA 2HXSA 2PKRA 1LK0A 3KXLA 2EF0A 3SP1A 1LS6A 4FYIA 3LCRA 4CG1A 4UUPA 4X8OA 5BSKA 1W94A 3MPUA 5IH7A 2B78A 4C14A 4DMUB 5L8VA 2CB0A 5AI8A 4MQ4A 3GNQA 2X4IA 4JT8A 5F5LA 3P96A 4G5OA 2OXCA 5AI4A 4QGBA 4ZAZA 3L8GA 1OWOA 3VJLA 4CKZA 2F00A 3OCJA 4HH4A 2EDAA 1E2UA 1EUCA 4WKCA 1RXUA 2DULA 3AKEA 4PIVA 2CFTA 3UB3A 3KRTA 3FYUB 2PUWA 4KIJA 2C1XA 2ZB2A 1NRJB 1WXQA 3AP3A 4MV5A 2GYUA 2LGJA 3D6UA 3IPCA 4X1KB 4G1CA 3RQIA 4ESVA 4LQ4A 3LI2A 4GPZA 4AO7A 3RIHA 1CVIA 1DAOA 2R79A 1CY6A 2XOKA 4C2UA 4RJKA 1OFGA 2BFCA 1R64A 3HL4A 1T4CA 4HY3A 4C0AC 1KMHA 1W4ZA 2OQ2A 2G5PA 3DUFB 3IX7A 3AWDA 3PZRA 5F3RA 2Q9BA 2QZJA 2IZ1A 1LX6A 2B4QA 1OHHD 2V8BA 3A1TA 2C96A 3PC3A 4X5OA 4D0NA 4LF8B 4TV8B 1H2ZA 1A2KC 2GVDC 4RIFA 4IHKA 1BXZA 2D8AA 3I9JA 3FOEC 5C3UA 2X6TA 3V8RA 1EGMB 3ZHZA 2B4TO 5ITZB 2WG1A 4BVLA 2B1IA 3UUFA 3AESA 3UJHA 4YUAA 4HLNA 3DAPA 3QOWA 1N33B 1DVRA 1QDUA 1QE0A 4QFDA 1E9AA 3W4KA 2B4YA 3RS5A 3QITA 4IXMA 2J9YB 3FYSA 1G4UR 3PKJA 3ZVKA 4PX5A 3GDOA 2H7XA 4CGYA 3E1SA 1GZVA 1U2TA 2FMFA 2GFHA 4DQDA 4PQEA 2RGWA 3VU1A 3MUEA 2FETA 2WVGA 4DCPA 2AWOA 2ZETA 1B8VA 1FTNA 1QDLB 1WZUA 2DPGA 2R6HA 3F7OA 3MJRA 1GV0A 2HF8A 2WHXA 2DHDA 1YD7A 1W34A 5EWMB 4A36A 3F3MA 1PR5A 3AR8A 2ZYGA 3F5SA 4RS4A 1TAHA 3RUFA 1RE0A 1ZW6A 1NRXA 2R1ZA 2Z8XA 1M6YA 3GNSA 3TVTA 3LCCA 3LQFA 3TEFA 3ZR4B 2FY8A 2JC3A 3E9RA 4FDAA 1XLUA 2IHYA 3L43A 4P4GA 3RODA 4PE5B 4BP9A 5B6PA 5J4VA 4ZEVA 3QVXA 2XITA 1DAKA 1ZK3A 3C6XA 1FFBA 3ZS8A 1L5GB 4A7PA 3PA8A 3W3AH 4KBGA 3FFBA 3QLVA 3EWSA 4ODIA 2VC2B 5LXTF 3T7JA 4R68A 1KQ3A 5JJIA 2JGDA 2N0SA 1OI7A 3GZNA 3T5PA 2O5CA 1ZW1A 4P93A 2X3UA 3A0UA 1L5HA 3W8DA 2EX1A 4TQGA 4EF6A 4A8JA 5CA0B 5K0FA 1N3YA 2IXGA 2I80A 2QL7A 1E2KA 3NANA 3RU9A 2Y66A 4YRCA 2VTVA 1XRMA 4CV3A 1DKRA 2ZUWA 1X1CA 3KJZA 3EIEA 3KZOA 2E9SA 5AHWA 4B3RB 2O8EB 1NW5A 1S2LA 5JE8A 2R2GA 3FR7A 3G2LA 3OOJA 4D9IA 3NNNA 2J5KA 2R65A 2B8WA 1FLDA 3KR9A 3PS9A 1JALA 3Q12A 2QE7D 2PVSA 3PHJA 3QFRA 4IIJF 2BSQA 3SIRA 2OHVA 3CQ9A 1VJRA 4F3CA 5LDGA 3W3AD 5FB3A 1DWOA 2VDLB 2EP5A 5AK3A 5T6MA 5I7OA 2HA4A 2RGCA 3VPDA 2LV8A 1N5KA 2NU7B 3TOVA 2YFQA 3PC7A 5F12A 1OBHA 2ALJA 4W5HA 4GGOA 4J2TA 3PDCA 1ZM4A 1SCIA 5KTPA 4F5YA 3R9KA 3LW8A 1TCCA 2MSLA 4OJKA 4OA8A 3WL8A 5KMGB 2Q1XA 4MI6A 3WC4A 3RLIA 2CZCA 4RHUA 4AJ4A 4C20A 1JJIA 1Q0QA 2HHJA 3CSDA 4EDHA 2GJ9A 2PUTA 4ZFNA 4RD2A 4BPRA 4WA7A 4UAVA 5HWSA 4HQKA 4O1MA 1XMOB 3DDSA 3UV7A 4L5YA 4AJ2A 1DG3A 4BQNA 2HTFA 3BL6A 2C0QA 1C9MA 1ST3A 1SUPA 1PQWA 2BDEA 4R8MA 5HZMA 2H11A 1GUZA 3PGLA 1ZZGA 2CLFB 4S0XA 2EZ9A 1EM6A 1TYBE 2NYVA 4MR9B 4ZOLF 4CN9A 2GHIA 4L27A 4X3OA 3NTRA 3H86A 5BSUA 4D9CA 3FPAA 1JR4A 2VQSA 3G8BA 1NX9A 2WR8A 3BFJA 2FPLA 5IDVA 1GQRA 2JGAA 3FSEA 3PFNA 1R5JA 3OCYA 3GLUA 2FPSA 4P3XA 2A9KA 2FEKA 1N6KA 2NUAA 4ZGGA 2DFTA 1T0HB 2YS7A 4JBWA 1PL0A 3ORHA 1IAVA 2OPHA 3SC2B 3MOSA 2OAP1 2A0KA 3KVOA 3VU0A 1W5EA 1X13A 3LPAA 3FCOA 1N2SA 4K6OA 4HQRA 1S4MA 5CLQA 4C21A 4RLHA 2GN0A 5KTYA 1EBUA 1S1MA 2WTEA 2VHWA 3ER6A 2NUPB 3OQIB 2DPMA 1MVOA 1JKIA 1TCAA 4CU5A 4DG9A 4ZMBA 1ZH2A 1VSBA 1BN7A 2OCDA 4K03A 4WWHA 4LWZA 1VI5A 5AVKA 3TDKA 5JVDF 4Q4AB 1CEYA 1ULZA 2PZAA 2BSXA 2PVCA 3I2KA 2YYAA 3MMNA 4OHRA 2GAFA 1KAGA 2QN7A 3JXEA 4BVAA 5IJ0B 4UM8B 4JUIA 2C5FA 1I24A 4TKUB 3K2QA 4D46A 3BK7A 3R9IA 5FAKA 2A1IA 1C1XA 1NXSA 4A5OA 1SHKA 2Q4DA 1IWPB 4NZ9A 2H9AA 3I28A 4FYXA 1PN3A 4HGNA 3SF8B 3DAHA 4NYIR 1J24A 2PCJA 1CS0B 3CR8A 4FFMA 4KR6A 4LN1A 4MKZA 5U4QA 1OT3A 4JBXA 4BFLA 1P2GA 4P7BA 1MQSA 5LCXA 2IYSA 5SY4A 4DEXA 1GLGA 4R2MA 4WV3A 4E08A 2IPLA 4INAA 4YYZA 4S1NA 1EUDB 3MWLA 5EIAA 4WAUA 3QUTA 1ZN8A 2A1UA 3D1LA 3CEMA 4IGEA 2WB2A 2VXBA 2W6OA 4TXLA 2FFQA 5E4FA 1QRAA 4FX2A 1RAHA 2ZYHA 4FQ5A 2C7QA 4MWOA 4R1QA 4WN9B 3VFDA 3CZ4A 2ZB3A 4OP3A 4JELA 5DGXA 1V9CA 3WWZA 3E5RA 1E7QA 4MR8A 1P7WA 1Z5UA 4KWEA 4BO9A 4F8JA 1WUJS 1FRNA 5LQDA 2XCUA 2FP4B 5IKXA 4EQZA 1TEXA 1Z88A 2HK7A 2P9GA 4BECA 4NABA 4DMCA 3FY4A 1I30A 3IR5A 2V74B 4U2EA 5ENZA 3SNKA 4LJLA 2CEKA 4AZVA 4YROA 3U3ZA 1BHQ1 2QP3A 1RJ9A 4RPCA 2YTZA 3R2JA 1WMEA 4MXDA 5ENDA 3RVOA 4DHEA 4YTEA 1W30A 1IUOA 3ULKA 3UPTA 4PW0A 1V9LA 3HXQA 4J0EA 3UAZA 4M9CA 3RS0A 1ZIOA 2OKCA 2VP9A 3BRWA 3CN7A 2ZYVX 5KCZA 5LP6F 1LK7A 3MUOA 4NDNE 4M9XA 1RYBA 2G1KA 4J03A 2AGVA 2PS1A 3F3SA 3WL5A 3OA0A 2Q0QA 2I2XB 2LDXA 1S8FA 4B4OA 2DUMA 1EXWA 4M9ZA 1D2EA 4XSHA 4JVMA 5DGDA 1L7AA 4RZ2A 1NQTA 1XSEA 3DZIA 3UCXA 5KYTA 4HK4A 4B09A 3VC1A 3MF4A 4IX1A 1SD1A 1TKAA 1RRCA 4CPDA 1YE3A 3IDQA 1UZNA 3PEVA 2PH5A 1M1XB 2OR3A 3JAWB 3CH4B 4EYGA 1RJGA 3WGUA 1M1YA 4D5EA 2WJHA 1XCGB 2NZ8A 3STWA 4H08A 5ALPA 3V1NA 1P6UA 2PGDA 1GDTA 1TO6A 2P2ZA 4Z9BA 5E9JA 1MV8A 3FTCA 2X6QA 3SJZA 5IC6A 4IV0A 3UB2A 1TJYA 3VKVA 1CF4A 1QYCA 3PQ5A 5HKAA 3EW9A 5TR9A 1LWNA 1Y3CE 2JI8A 4QU8A 1BAPA 1LFAA 2F1KA 2OV3A 4U0JA 1JJBA 1DAIA 1L7QA 2I9KA 3DXZA 4TL9A 4AM8A 4YR9A 2ZYSA 4R0MA 1WMFA 1N3BA 1SOWA 4BL5A 2HA3A 1Z39A 2LXNA 4CMIA 6CHYA 3DQQA 2NZJA 2E87A 5H3CA 2AQ8A 1ISRA 2WJZB 2ARKA 2XQJA 3BWVA 4PBRA 4ZRMA 3TOSA 2Y77A 3CLTD 1AX9A 1O4WA 4KBYA 3CZRA 4OQZA 4K9OA 5CH3A 5CT9A 2BJHA 4D6XA 4AQ7A 1CZOA 3L49A 3BTSA 2CMGA 3K0CA 1WCV1 4GX0A 1H69A 1OAOC 3BERA 4G24A 2CLMB 2C03A 4OQYA 1CT9A 4NNPA 3VTZA 2COEA 4DF3A 2Y2VA 3WYCA 4M0PA 4UOZA 3UJCA 1YFZA 1R8JA 1RRPA 3DZGA 4LRUA 4LV5B 2HJRA 4AECA 1FYEA 4K87A 1IWOA 4CI0B 3UBTA 1T0PA 1NI4A 3FTPA 1VSVA 3O8RA 1CUBA 1PHPA 2ZITA 1NUSA 3C41J 5EAIA 3TUJC 4KO2S 1EUCB 2I5PO 5EMKA 4A2PA 1NDUA 4B8ZA 4EL0A 1LDBA 3KB1A 4UARA 3T7DA 2FK7A 4B6OA 1E96A 5KSYA 2GFIA 2Y1XA 1JA0A 1EG2A 2Q8PA 3FTNA 4C29A 1Y81A 2ODPA 4O1IA 4A6XA 2PUFA 2F3PA 1CUWA 1U31A 2BFCB 1T4CB 4KRXA 3BM5A 1KMHB 2F1IA 1KORA 3QLUA 2I22A 4DREA 3EIFA 1FSFA 1QG0A 2X76A 1LC3A 1PJRA 2AMVA 3EVCA 4WZAA 4DV1B 2ZYWX 1AGPA 3HXPA 3O4GA 2J46A 3GRZA 5ENVA 1TD1A 3F97A 3FB1A 3EZLA 3TZ6A 2PUHA 3AESB 1N7GA 5FLXA 1SHLA 2E18A 2DBQA 3MPOA 1TGYA 1MJGM 5KU7A 3DE0X 1C2TA 4G36A 1ORTA 1U3FA 2PGLA 3N8DA 4JJEA 4OSPA 3S3TA 1LPPA 2YOHA 2QRHA 4TTPA 5DW0A 1QM5A 1BQ4A 4I3HA 3A6GA 2LR0A 2C2GA 1GZ7A 1WKVA 2W8ZA 2EATA 1LDMA 3DL4A 4GBJA 4JVSB 5KNDA 2JJ2A 3FIUA 4NJMA 1YC5A 3D8TA 2J7PD 5I9LA 1WB6A 1QIMA 1PJCA 3LE8A 1GOTA 1C9EA 4FMPA 4X8LA 1VYVA 5DT9A 4O3MA 1X94A 2XQFA 3QLEA 1DEAA 1ZGZA 2UYYA 4LOJA 4A26A 3LCMA 2UXDB 1Z3IX 1NVMB 2J3IA 3TD6A 5C5IA 3DKRA 1YQXA 3BHIA 3O8DA 3ZCRA 5E0KB 5IT0A 1U2DA 1XJ5A 1W5BA 4WOJA 4M1EA 1H5UA 1L6IA 2W6JA 4LOHA 4BNKA 5DT2A 4DUPA 4EL5A 1F51E 1P2UA 3PEEA 1ZQ1A 3N1UA 3MW8A 5ALTA 4MMXB 4I5GA 1E61A 2FPXA 1FDRA 4GI1A 4FZJA 4UE6A 2I2BA 1UC5B 4IF6A 4AG3A 3I4CA 3KHTA 5IT5A 1KP9A 2OZVA 2I7DA 1PS9A 3V4RA 4E22A 5HUJA 3Q7IA 2JGDB 4BV9A 3GZNB 3R5HA 2LTAA 3GNTA 4ABTA 2YXBA 2CXNA 5IMBA 1L5HB 3K0AA 3JQDA 5KSZA 2JLUA 5LQCA 4MV0A 2QRQA 5CLLA 1QRDA 1IEQA 5DULA 2HM7A 4M9SA 1ZD4A 3ANMA 5DRTA 4LWOA 3PK0A 5FPHA 1I8TA 1TW3A 2FDRA 1PG2A 2C00A 1FDOA 2BM1A 4E5VA 4JJ8A 5HQJA 2B2XA 2BDTA 2H2AA 3L1KA 3T1QA 4NOMA 2D0PB 4PTZA 1FMCA 1JDNA 4IMIB 4MVJI 1WMAA 2XCRB 1QRUA 1KYIA 1VL0A 1T29A 1PRYA 2IHBA 2WIDA 3FD8A 3N9IA 3NGXA 4DJEC 4TQUS 5H81A 4A3SA 1G5HA 1XELA 3HJNA 4FGJA 3N74A 2O3TA 4EG1A 4RMIA 3NHWA 3FLAA 4GX1A 4GVXA 2E5FA 2ODTX 2K4MA 1IHXA 1PYGA 4GRAA 3IXQA 1GU1A 2A1TR 4JHLA 1N75A 1OASA 1QFSA 4RK0A 4WK6A 1QGOA 1UBUS 3LL7A 4BUZA 3L7LA 3H16A 3OM1A 3R3WA 3RH0A 3N6XA 3MAGA 1G8PA 2ZE5A 2ZYTX 4UBNA 4ECAA 1SU4A 2AVDA 2ZWPA 5DTRA 5A6SA 2A78A 5CNMA 2H1VA 2AX3A 2JIPA 3P8ZA 2WIKA 4BRUA 4ALNA 3IKMB 1P17A 3NVMB 4FKZA 1IVYA 2B3DA 4HHEA 4B3SB 1C4KA 1RBQA 1T6ZA 3A2LA 2R5NA 5EERA 4J3NA 4C88A 4X6XA 1K6IA 2O07A 1GRNA 4DV0B 3AEYA 3D81A 2JAQA 2OCGA 2IP2A 4CDNA 3N7UA 5F2EA 5H3LA 3HCBA 2GR9A 5HF8A 3BKXA 2Z83A 3EXFA 1OVMA 1W29A 2DZDA 1PTJA 1Q84A 3M81A 3ON5A 4P5EA 1D5CA 5JNWA 1SQ6A 1RMTA 2OESA 3ZHYA 1ZM3A 1D6JA 3U0BA 4ZYTA 1TOAA 1NI3A 1THZA 1EG7A 4YS6A 5FOTA 4G5YA 1ZCJA 3AV0B 1T0UA 3EIXA 2R68A 1U3UA 1ZH6A 3U7EB 3VR5A 4DRXA 1SXPA 2NUAB 1W4AA 3RJ9A 1Y9EA 4Y2VA 1QVWA 3GLHA 3RU2A 2CDCA 2RB4A 4XQ9A 4JU9A 1XD2A 3EDOA 3NEYA 2X0NA 2QK4A 1XWIA 3IRVA 4FJ0A 5JH7A 2Q2OA 3TTXA 4F96A 1BD3A 4RD3A 1OFHA 3SR4A 1GU7A 3WB1A 4YXFA 1PZNA 4N47A 1Z5WA 1Y7LA 1IOZA 3WGGA 5CFPA 2ZAGA 1YVEI 2O2ZA 1VG1A 1EFRA 4JJAA 1C1XB 1YS9A 3SLKA 1T1JA 5CMLA 4X71A 4ZMRA 3KFXA 1JBEA 1DQRA 2AW3A 3UYKA 1Q44A 1Z4OA 3DDCA 3VYRB 4RQUA 1DO2A 4RPHA 3VOTA 2R00A 5I45A 3IA2A 1G7CA 1G8FA 5CPBA 1ZH8A 1KVUA 5B7QA 2E55A 5JALA 2QRJA 1UXKA 2RAPA 1GQOA 3A4YA 2O14A 2EJTA 5AWFC 3EJWA 4MS1A 5FUVA 1Y4UA 3N0TA 1AZLA 2A1UB 1ZUWA 1H1LA 4P7GA 2SHKA 2HUPA 3WXMA 5TPZD 2Z5LA 4G1MB 2F4VB 4C0HA 2A0WA 2D54A 2AD1A 3D1JA 2XTNA 3I9V1 5KDOA 4H1UA 1Z8NA 1TYDE 2A9PA 3Q11A 4WNCA 1P0IA 2WC1A 2X1VA 3I09A 5JZ9A 4MR8B 5ICGA 1QWOA 1U7HA 5AXBA 3RSHA 3GJ8A 4G81A 4LRSB 1QHSA 3G2MA 3EHEA 3QOFA 3U7QA 4PYQA 1GCOA 3F6RA 4QL3A 5AXDA 2C4KA 2WWYA 4MITA 2XZTA 2YVKA 2QYSA 2LP4Y 1RJ9B 4FW8A 5LUBA 3R5XA 3TQHA 4J1SA 2IHKA 4LCEA 4N9QA 3IO5A 5AJTA 3DT9A 5JO0A 2UUBB 4EB8A 1KARA 2GBLC 1U0TA 1RYFA 5SYAA 3I1FA 4P8RA 4YPVA 2IODA 4G6ZA 3TDMA 1IN6A 3U1TA 3WRXA 2DTXA 3GPDG 4QVIA 4R0NA 1MX1A 5ALDA 4MV9A 4OEHA 2JLAA 2GTHA 4K81B 1UXOA 3MGGA 3W5AA 1YONA 4MVYA 4BS9A 4L4SA 4FU0A 3WK9A 2A67A 3Q1KA 4AP6A 5CG2A 4KIWA 3GFQA 1WVGA 1NM5C 4KZPA 4TWJA 1VXRA 1W5FA 3GEPA 4TXJA 4B4WA 1CF9A 2BMFA 1C0IA 4GM1A 2G4LA 5CGZA 1N6PA 2AF3C 2VP3A 4RD4A 2ONZA 5E7QA 5JS2A 4CTNA 2R5FA 4KR9A 4YFYA 2HOQA 5HGXA 3GIDA 1HTBA 2YQ5A 3T5AA 1M1YB 2V58A 3BTUA 3ZDFA 4BIMA 4RLSA 1OIVA 5AKLA 2BKLA 2H0AA 4AD8A 1O6CA 4OGGA 3CUWA 4LGMA 4BNLA 4EHLA 5C8XA 1JHMA 1T0IA 1MPXA 2Y92A 4JIMA 4PQYA 5J3JA 3LNCA 3TAUA 2X9VA 4XM0A 1ESCA 2ZJ0A 3BD6A 3ZGLA 1CR0A 1XR3A 4REMA 5FA8A 1JILA 10MHA 4IFIA 1VLMA 3L7NA 3T1VA 1Y8RA 3I3SR 3NWBA 4CMIB 3EGVA 5DMHA 1ZPDA 2XMPA 3AJRA 1NBME 3F67A 4R6XA 4YNBA 2B0CA 2DHRA 3U3DA 1R9GA 4AJ9A 4E7PA 4M9RA 2D2FA 1JYFA 4L78A 4S1TA 3F98A 5AKHA 4KE8A 1N6NA 5DHAA 2QM0A 3IDOA 4Z9YA 3FIJA 1YFJA 1OY1A 4KR2A 1PG0A 1Q7EA 2Q3DA 3I4LA 3NGMA 2AOXA 2IYPA 2XIQA 2OGSA 4LPSA 4ON9A 2AVNA 4GC5A 4E3ZA 3N0VA 3R3XA 1T5SA 3ABZA 1MAUA 2YN0A 4QWMA 2Q3JA 3U7GA 4TSKA 4D79A 1PK9A 4ZI7F 4S3MA 2JHPA 3H13A 2RD2A 1J39A 4M8NE 4OLJA 2X8BA 1HDCA 1NI4B 3ZTWA 1TTQB 4YRTA 3TPZA 1CF2O 4AF7A 4ER0A 4L76A 1IYZA 2DPHA 3K1JA 5BYAA 2C42A 4ZD6A 3LDGA 1TAUA 1FQKA 2FQXA 4D0GA 3EQ9A 2CDRA 3IUEA 4UHEA 4V3BA 4Q9NA 5JNSA 1KYWA 5BY2A 1VG0B 1H6BA 1MH1A 3N2IA 5T67A 3SZMA 4XGRA 1P9RA 2C9BA 3U3MA 5K8CA 1FMLA 1KGSA 2AQHA 4WJKB 3UC5A 3J81k 2NZ2A 1Z2CA 1NOKA 1QOPB 4NL4H 3GFSA 1OC4A 5H4HA 4NCNA 3SQNA 2OENG 1CKEA 1DX9A 1U6JA 5G4KA 4W5OA 3FGPA 5C52B 4FZ3A 1QQ7A 3LG2A 2HSDA 2I2AA 3DOIA 3QELA 4R69A 4WZAB 2Y1OA 2IX3A 3FZYA 1XRNA 4G5HA 4AURA 2L42A 1FRFS 3EIOA 4MV3A 3KC2A 2G1AA 5AK6A 4AQYB 3OE5A 3RD5A 2RK6A 3MCUA 3Q8WA 4G4GA 4Y1RA 3X1XA 1GL7A 4DN6A 5IU6A 2IY9A 2H1HA 1T5BA 3B9PA 2EJVA 2VCYA 4GW3A 2OPBA 1CJTC 4INPA 2JW5A 2VDUE 3H5RA 3KUCA 4HAZA 3VJMA 1U7WA 4BE7B 1Q14A 1IOVA 2AG8A 1NKTA 4KJZA 1SXIA 4U0KA 4WX2B 1Q3TA 3FHLA 2XCQA 4B6SA 1XCJA 1KIAA 1XKXA 1KJQA 3O7MA 3OCZA 3R09A 4HP8A 4JJZA 4NJMB 4RZHA 1M2NA 1MB9A 5MFPA 1C0EA 3GEIA 4WKNA 1QH9A 1K68A 3C7TA 3FHOA 3DR5A 4NFHA 2CBXA 3OJCA 2IYTA 3AF2A 5D84A 3UY4A 3PL1A 3WNQA 1H93A 4EIWA 1KAMA 2Y1KA 3EMBA 3O8OA 3RC2A 5TE9A 3U48A 1L4EA 5J1TB 4MWBA 4BWGA 5LJLA 3LP5A 4FEAA 5F2NA 1IEWA 4Q1FA 1A72A 2BHTA 2YNMC 2ZPUA 4C30A 4NY1A 3L4EA 2YYSA 3WY9A 1W36D 4ZT6A 2N9UA 3AUJB 1O87A 4O3FA 3N59A 2ODNA 4A0FA 4DMGA 2AR9A 4LSGA 2O8FA 3VX3A 4FHGA 1OREA 3U56A 1OUMA 2X5KO 2ZT7A 4HS9A 3ADOA 3LK6A 3HZRA 1HI9A 1WY7A 3FCEA 1A2BA 1ULHA 2AOWA 3PWTA 1E7MA 1W75A 2B36A 2UVQA 1ZNZA 4A0HA 5LU8A 4CVNA 3CVWA 2CB9A 3K0AB 3PTZA 3KQUA 3EVFA 3T9CA 3VNVA 3G0CA 2ZUCA 1DB3A 1XCMA 3GH1A 1YMUA 1XN4A 1Z26A 4XGKA 4TZ0A 4ILEA 2CDBA 3B1JA 1QFZA 3ESBA 5K99A 1UIMA 2K87A 2IS4A 3CUYA 1ESEA 1UDWA 2WWFA 3GJXC 4XFJA 4EY8A 3NV9A 4PCUA 4DMMA 4ZQFA 1JHAA 3PUHA 2ZIUB 4HVLA 3EZ7A 4D9NA 5K0TA 2WJ6A 2JD0A 2Z04A 5KDDA 3C6QA 2X0IA 3NTXA 4XFKA 4IG4A 3W9BA 1XYGA 2C1EA 3OY7A 2A59A 3S40A 1QPZA 1R0RE 4DHWA 3EZ2A 3V48A 1XKLA 2JJYA 3MXOA 2ZIVB 3Q9NA 4Z7QB 1WXDA 4PO3X 1N7IA 1GPLA 3OUTA 5D85A 2BZ0A 1E94E 1QIJA 4QPNA 2ZUUA 1G6OA 1UDCA 3B3FA 2G80A 3S44A 3I5UA 3CISA 1JDUA 1IOLA 1IZZA 3D59A 5A4IS 1PEKE 4K9KA 3NJ8A 3CLHA 1F6BA 3HVIA 3AM1A 2GN1A 4RESA 5A6SB 4WIAA 1GGMA 4P84A 4O6VA 1EWRA 5CR9A 3FMGA 4O02B 3PNSA 1Z5VA 4MUJA 3BX1A 3EGWA 3JV7A 2DY0A 1QXSA 3QMPA 1E1MA 1URPA 3NR2A 3FKJA 3R4CA 4A9AA 4BBZA 4BMXA 1J90A 3ET5A 4KJXA 4HDNA 2C78A 2NO7A 4D9EA 1Y6JA 4H7FA 4RV4A 3SKXA 1JUDA 4UFNA 1VHTA 2BMDA 1YI0A 5EZYF 1WULS 3GZJA 5K3DA 3EXFB 1UJCA 3L6RA 3MIIA 3LRPA 1JTVA 3EXHC 3BZBA 3OJFA 4A15A 3HPQA 1CTQA 1QNLA 1GR1A 1EZ4A 2AN4A 1Q0SA 1ZGJA 2DAPA 2FSIA 2FP3A 2YWEA 1GAQA 4C7BA 1U63A 3TZCA 4YMVA 3DTNA 1P2BA 3KR1A 4IL5A 2VPZA 1NMEA 2WWIA 4DRXB 3BDVA 4GNKA 1TLLA 3GMIA 1WSAA 5CVVA 1FNDA 3BBPA 3TE6A 5JCPA 2CUNA 3GLHB 9LDBA 2XXAB 1XU9A 5TV2A 1IU9A 1E0KA 2VNHA 2PU7A 1FPQA 1XD2B 4GUDA 1I7DA 3KOYA 1T1GA 3G68A 1K7XB 2VDOB 3C8MA 3OUZA 4C6HA 2X5XA 5FPKA 1KA9H 5H3HA 3QHPA 1HT3A 1AHHA 1Z6TA 4DCJA 4F86A 5JH7B 1SRRA 2ET6A 3M34A 3ZOZA 5ISMA 2KYRA 3O75A 1C9JA 1NBWB 1RRGA 1U1FA 2PRSA 3BAFA 4DLXA 4E88A 3R6DA 3CPHA 4H6XA 4RIIA 1D2MA 1SM4A 1ZK2A 3R3SA 2F8SA 2OG1A 4GLFA 1HNWB 1FYWA 2H0RA 4FUQA 4BQRA 3PFGA 4KU4A 3C3KA 4XDGA 4DCMA 1SVSA 4F4DA 3MMPA 1JDTA 1KYQA 3K09C 121PA 3ZHUA 1GTRA 3ITDA 3E3MA 4IJVA 4NBUA 4R7ZA 5EHQA 4FWTA 1F4LA 3C7KA 1P3Y1 1T0BA 3V97A 5IZCA 2OXFA 3C3MA 3UC9A 1SA0A 1T2DA 1DIAA 2G1JA 5B4TA 3ST7A 1WO8A 3NTVA 1G3IA 1IIBA 1MJGA 1PW7A 1WPQA 2GRAA 2Y2UA 2YQZA 4CQMA 3MWEA 3PYXA 2ON6A 2ZXUA 3AJ9A 3DLAA 4MS1B 1H2YA 1NZJA 4RD6A 1H1LB 1E1RA 5C81A 3T1YB 2V8OA 4AMVA 1XEXA 4ESOA 5DW3A 1ESDA 4WCFC 1EX7A 4C08A 5G0SA 3LPDA 2QV0A 1MD9A 1EAMA 4CG3A 4DZRA 4WBNF 4LF4B 2PMDA 1DC4A 4HL6A 1U2SA 1QX4A 4KRFA 4R05A 4KVGA 1ELOA 1X1RA 3RFXA 4Y6OA 4R31A 4DPKA 3OCCA 4YCAA 4HEQA 4GR4A 5ADHA 3D31A 3BRSA 3U7QB 4E15A 5JFOA 2XCLA 3D9QX 2BFWA 4C03A 5CLFA 4DR2B 1ZS9A 3DBLA 5DSXA 3K0BA 1G9XA 2ZZKA 2FR8A 2QM7A 4BO8A 2P1RA 2AX4A 5FPTA 5IPFA 1N2BA 1CYEA 1GNRA 4UAJA 3D4IA 2YDXA 3KWLA 2VXCA 3ECSA 4LHVA 2OLKA 4GYKA 1Z0ZA 2I3ZA 1FS5A 2I2CA 1UAGA 2I9PA 2XOEA 3CT6A 3SQWA 4YIHA 2P79A 3ED1A 4DLPA 1OXXK 4LXXA 4MVJH 2BBOA 2Q3EA 4G56A 2FEPA 1RYDA 1G8YA 1N0WA 2CUZA 2HC9A 1BTOA 3A4MA 3JQBC 4HZGA 4JYMA 4PVCA 5AUOB 2P11A 1T43A 4C4XA 2WT4A 1XHEA 1HK7A 1SCAA 2HU8A 2W6JD 3H3FA 4IDQA 4D4HA 1FZQA 2CCKA 2J3HA 3PUXA 3O74A 1RW4A 3NEPX 3KQVA 4PM4A 4PZ9A 1HA3A 1LPAB 3BE8A 3H8SA 4YI5A 5LYJA 1FBNA 3DHEA 2JGMA 4RM2A 5J1SB 1SBNE 4PTLA 1EA7A 1VLZA 1TKBA 3G5LA 2J8ZA 2ZULA 2PR2A 3HWRA 4UEKA 1WJGA 4KREA 1OA1A 3NTQA 3S2UA 1WMBA 1UBMS 4XTRA 4MQMA 4OXKA 5I8PA 1IQPA 1TW2A 3PWKA 3G89A 4LAFA 4QQFA 1E1CA 3GDWA 4PRZA 1W6RA 3A3KA 4HZIA 3D0KA 5G2OA 1N1EA 1OZHA 5TEVA 4MKRA 1DDGA 3ANTA 2HYDA 2BR5A 4TYMA 3SIPA 2R8BA 1E5TA 4MVJD 5CJ2A 1JQ3A 1A0OA 2WINI 3I73A 1L5NA 4PS1A 2HY7A 3EF1A 1R88A 3F5DA 7GPBA 4NBVA 1PR2A 4J16A 3CY6A 2JFUA 5CW2A 2FFAA 3AC0A 3A9CA 3LUCA 2OP1A 3H2KA 4OQXA 1XG5A 4OM7A 5HMMA 1ZBDA 3CXUA 1Y8RB 2VDWA 2VH1A 4LQCA 1GZSA 1XVIA 1LC0A 3SXJA 4JQCA 2XGOA 3ZNOA 4DB4A 2RHWA 3W2FA 1YQ9A 3W90A 1KRWA 4U2FA 4WZ6A 3T5CA 2A9QA 2GLXA 5AUNB 1TQ8A 2NQ8A 1QORA 3CO5A 1QMGA 3NFYA 2Q62A 4J4BA 4US1R 5CCBA 3GEEA 3DO6A 3H1TA 4LYFA 3VDRA 2OCKA 2YIDA 4L0CA 3EK2A 4GE0A 4URZR 1HC7A 2IP1A 4I50B 3SQLA 2I6FA 4W5JA 4DEYA 1WBDA 5HSGA 1FJGB 3EYWA 1RQXA 3IFSA 3ITKA 1DSSG 1T9GR 5A05A 1FLNA 2PPVA 1FNNA 1X7HA 3PYMA 4QOFA 4YHBA 1OJ7A 1S2IA 3DE6X 2BKXA 3UUGA 2PUJA 4F2WA 5KU1A 2W00A 3TNYA 3GO4A 1TUBA 2OV4A 1XZLA 3DBRA 4Z3KA 3CLTC 2D1TA 5EUMA 4J9VA 4DA7A 1Z4QA 5JXHA 3PPWA 2OB1A 3PSHA 3QJYA 4LCJA 5CVCA 5AKIA 3F74A 3OX2A 1VSQA 2D5AA 3C43A 4FXPA 4Y2QA 3VR3D 1G17A 3V2HA 2B21A 1TX4B 4LHXA 2VN8A 1KAHA 2P78A 4HH0A 5FWYA 3JWGA 1VCMA 3D2AA 5FQOA 1S2GA 1PFVA 1Q6ZA 1QSGA 3AP1A 1TQ2A 2PAAA 3EHDA 1I51A 4NEQA 5G4KB 1PFKA 5CYPA 3R7FA 1V3TA 4R5MA 3DMTC 2D59A 3RCBA 1GN8A 3QELB 2X9NA 5AP9A 3AI7A 3LQQA 3U16A 4K3UA 5HNKA 4GPBA 4TTRA 1G8GA 3E3OA 4PINA 3UXHA 3AUUA 5EP2A 3T7TA 4AX8A 4OHYA 2O5EA 3N2KA 4Y1RB 5EUCA 3ZZMA 2Z2IA 1P91A 4YDRA 1LLQA 3A1WA 1A88A 2EKZA 3NP7A 4P2BA 3KQPA 4HCJA 4HG2A 1EBBA 4J94A 4MA0A 5TT0A 4QGSA 9ATCA 2RG1A 3N7AA 4EI2A 4D9BA 3QUAA 1BMTA 1VKZA 1KDVA 3U3KA 1ILWA 3FBGA 3NIDB 4B31A 1CUZA 5F7OA 3LZCA 4LHYA 3REGA 3RS7A 2IHJA 3HXKA 4AUEA 4CM4A 4E5SA 5LM3A 2BRUC 4PLZA 2W4QA 5LZ9A 2Z6VA 1ZI8A 5D6OA 3K9NA 4QLAA 5EP1A 3IT3A 1CY0A 4M1MA 4UHFA 1TTHA 1Z68A 3O8OB 4HRVA 3T7IA 2Q29A 2ZWIA 3E9NA 3PDJA 2PH1A 1JN0A 1IEVA 3Q3HA 3USES 4DBLE 4JNCA 2R96A 1TT7A 1MEJA 5C8ZA 3CZMA 2BV3A 3FCXA 3GMTA 2C4VA 2DPYA 5HFAA 1RSZA 1BDHA 3EAGA 2O2SA 5FA6A 5LBIA 4BQSA 3KM0A 4JI4B 2O8FB 5K3AA 5JARA 3KSDO 4K46A 3M5PA 4QFMA 3RRFA 4NQZA 2OGZA 2G17A 4NC9A 4QU5A 2GF9A 1JDBB 3U7JA 4EHAA 5DBOA 3CNBA 2Q5JA 4J91A 4QC2A 3OA2A 3EX7C 5BNZA 1JIUA 3TTUA 2AXQA 2PH3A 1VRCA 3K8ZA 2BKVA 3BSSA 1CUHA 4W8HA 1CPYA 3BMNA 3U4MA 4M8LA 1OOEA 4MIYA 3WFIA 2XMZA 4DPLA 3I5XA 5FPSA 4H0FA 5JQGA 3SD7A 1VMAA 2FYTA 4IH9A 5HFNA 5L51A 4D43A 3PQ6A 1JG7A 1V5FA 2C9ZA 2GS9A 3B6EA 4HNQA 3CF4G 4LSWA 4WERA 2BISA 3H1EA 1WF6A 2PL9A 1GHTA 1QMPA 4IW3B 4B6FA 4EI9A 4BXOB 1ZUIA 5IJ9A 2BHNA 4UU7A 5H1YA 1O57A 3ROEA 5JZMA 2WZQA 5K0GA 4KPYA 4UMVA 4EOGA 1AHIA 4JBIA 4R16A 1XGKA 3VVMA 1PT8A 2ZI7A 1MVNA 3SS7X 2I3GA 2R84A 1RPJA 3OZEA 1FP4A 1OWNA 4LVOA 3OQ1A 4O4LF 4B46A 5ESXA 2I03A 2NO1A 1X7YA 3PTLA 1NVFA 5JXJA 3I30X 3BEOA 1YHZA 3IE0A 5DNWA 5KVQA 3V7NA 3HP7A 4M1OA 1OKKA 5HEKA 4OBXA 5D1HA 4EGFA 2B92A 2DLDA 4DMKA 4I9FA 4PX3A 1GZ6A 3ZHTA 4BNVA 3OU7A 3H5NA 3IDSA 3TIVA 4YRZA 1DRWA 4Q9LA 2ZIGA 4HKTA 1ZNQO 1A4RA 1NN1A 5E9AA 4CIVA 4BVBA 3V6LA 1S8OA 1EWQA 4OXYA 4YP0A 1LZLA 3U31A 3P27A 4C6SA 2B82A 3H19A 3HMQA 3HZOA 3VHQA 4HDNB 1ISJA 2IDMA 4M7RA 1T8YA 2GCNA 4RPGA 1MO6A 1UBCA 4MGZR 2WAAA 1DOZA 1NVEA 1FTSA 3BQNB 4EGAA 3MJSA 4JZKA 2FW7A 2XF2A 2XYPA 1QOZA 4FHCA 1TDJA 1QRTA 1IN1A 1UQUA 1XAHA 5LIRA 3QFCA 3PTAA 2QVLA 4K88A 3H1PA 1PLJA 3REOA 1WOMA 3M1LA 3CV3A 4MPTA 3NONA 2QXTA 3GI1A 4ZICA 1PGOA 2H4HA 4TQ9A 4CFZA 1RZRA 4B2PA 1CNFA 5AKJA 1CQJA 2D3TA 1EFPA 4MHTA 3L4JA 2FPUA 4CKWA 2FSFA 3OZ7A 1ZFNA 2ZJ4A 4YALA 3M8KA 5ALRA 1UBSB 3RC8A 1F2TA 2GZRA 2VP0A 3RWOA 2I34A 3W2HA 1ZKDA 3WGTA 2C82A 2IEZA 2QW0X 1IY2A 1GYQA 3QIAA 1QHHA 4JMPA 3THWA 1SG6A 1U0FA 3JQ9A 4L3OA 5DI9A 2Z5FA 3WZMA 3MK31 5C7YA 7MDHA 4TMKA 2R6FA 2FRXA 2ZFUA 4LCBA 4ZP1A 4B0PA 4BNFA 5CEFA 4KVZA 3CUTA 4TL7A 2J3LA 4HQLA 1B6RA 3W1VA 1S2MA 5H8WA 5JLAA 1AB6A 5DTQA 1X7ZA 3L4KA 2HMVA 3G02A 1CZNA 4BEBA 1UAYA 4NNOA 2IK8A 2V7QD 4NHOA 4JLPA 2FMKA 1QYXA 5AVUA 1HOXA 1SA0B 3JQ8A 1NWHA 2ZRKA 2CKMA 1GEGA 4CQMB 4CT0A 1SIUA 2HUNA 2DFLA 3AIMA 4CEHA 1KYXA 3MWEB 4I36A 4F1JA 1EK1A 1CUVA 1C0LA 2Z5VA 4ZDIA 1F8FA 2LKDA 3T5TA 2G7ZA 2QLTA 4XCQA 5GJCA 3T7SA 4Z4EA 1XEXB 2Q7XA 3C8UA 3BOSA 3GA0A 4Y2PA 4LMRA 4AS1A 3WL3A 1NVBA 3IV7A 1P9LA 1FW8A 1XZ8A 2FJUA 3O4VA 2P9JA 4JFRA 1Q74A 2KLBA 4PYKA 3U49A 3VQTA 2XUAA 2IPAB 4WZZA 1QGAA 4F38A 2I91A 5TLSA 4IICA 1RYZA 3QEJA 2PKXA 5HG0A 1Y6RA 4RV5A 3FMFA 3C98A 2XAAA 1UBEA 4HDMA 4ZQCB 4FSHA 1QJ4A 4YFVA 3BGOS 3W06A 3CCFA 3H4VA 4B3BA 5C53B 3DBLB 1TUIA 4QTZA 2CCGA 2XWBF 2DWQA 2VF5X 1JR2A 2YV2A 3CPSA 4EHBA 4EQ6B 1L3BA 2Q1TA 3WB0A 1AZTA 2B5OA 3B60A 2FFRA 3QKSA 3BFVA 3T35A 5A03A 1PEAA 4IVPA 1WU8A 5BV2P 4LDPA 4KPFC 4QUHA 2IIPA 5KCMA 4YRNA 2FZLA 1T2CA 4ZJYA 2WE8A 1ECFA 2GZ3A 3H5WA 3DZ8A 4M8IA 2WPNA 3B7WA 1MAHA 2AZ4A 3JALA 1TZ2A 5EVCA 3A0RB 4XLTA 2DH5A 4BFTA 5IAGA 1PZGA 1M10A 2BTEA 1GSAA 3Q1LA 4FR0A 4KODA 4TVKA 4G0ZA 2VTBB 2IOYA 3ISJA 4QBKA 4KH1A 3QMMA 3VDNB 1MDBA 3PUIA 3UKJA 1M72A 3I0ZA 2MR5A 4OHUA 5LYJB 5JC8A 2GD6A 2WUVA 4DWJA 2B8TA 2G9ZA 3W77A 4EABA 1M2GA 2GNAA 3H18A 4X3PA 5LFAA 4RK6A 4NDZA 4HN2A 3OFNA 3AFIA 3Q3CA 1ZOLA 2LBPA 1KR5A 2JJ1D 4LDZA 4QO7A 4JOQA 3RSFA 1UPXA 2XMDA 1U0OC 4E46A 1E1CB 3L40A 1KEVA 2I87A 2PL3A 1PGNA 1KQPA 3SYRA 3JZFA 4ZCSA 4UUQA 2WWWA 3TBHA 1WXEA 3RUHA 4A1FA 2HWKA 1NIJA 1T1RA 3Q3VA 2HSZA 2ODWA 3TRKA 3P94A 4A91A 2ZWOA 4OMUA 4KXYA 1DARA 1NULA 3MT9A 2GJ8A 2IGBA 1P4HA 2ISQA 2JVKA 4HGQA 2D4HA 1DMRA 4XUEA 3UUEA 5BW5A 3WGIA 4AI6A 3O1LA 5KHLB 2WM3A 2VHYA 4MV4A 2WKWA 2D0DA 2VDWB 4IRMA 4B43A 1NMXA 3MQFA 3A9TA 4U7PB 1NJ5A 3BL5A 3LUAA 4BVGA 1X7GA 1NR1A 5K8TA 2AL7A 2B7LA 4U2KA 4WXPA 3RIMA 1QG2A 2GCGA 1MENA 3WGVA 1UJMA 1VGVA 5J63A 2A94A 3S2EA 2JDID 3DEFA 3C1UA 1ZAYA 3JSXA 3A6KA 2D74A 3DHWC 3E9EA 4I1IA 2BFOA 1KVTA 1DIRA 1PNQA 1JWAB 4GRIA 4Q1CA 3G59A 4XD7D 1HE3A 1GZUA 2A2ZA 1TUBB 3DBRB 3A7DA 4Y0NA 2FMXA 1OFTA 2QSZA 1G8HA 2QGNA 3EAQA 4PCVA 2CLHB 5A5DA 4BMDA 5CB4F 1KI3A 2IUYA 3M4XA 1U8TA 4RH3A 1MAVA 4GBED 1H1DA 3DLPX 2H2HA 2DSTA 2EZ8A 2Q49A 1V6CA 2CJWA 2Z2KA 5FWYB 3KOUA 4F71A 3T3EA 1XXLA 2UYCA 3NT4A 4FQ7A 2MWMA 4I1YA 4PSDA 2PXHA 5E0OA 4B45A 5JSYA 2BGMA 4JJ6A 1B16A 2IV3A 3J7TA 1NXTA 1O6ZA 1Y1TA 1QYIA 3B82A 4YJHA 1Z22A 2WKPA 2IS1A 3DBVO 2COKA 4JFAA 3D8UA 5B1SA 1XZQA 5EC8A 4HWRA 4TLLB 3DO8A 2EKDA 3P9ZA 4GQBA 2Q3BA 3N2KB 2GAIA 1RNLA 1FXWA 1SQ0A 1GYRA 2ZXEA 4TSRA 3NNSA 4WDRA 3HTXA 5BUZA 1XO1A 4NE2A 1JYSA 2WZCA 3MTDA 1YB5A 2ZPAA 3RTCA 4P7JA 3A3YA 4L9WA 4LX8A 5JD6A 1NYQA 1KBOA 1G98A 3F49S 3DF9A 3M83A 5CFNA 3JD4A 2VPWA 1JH8A 3WTBA 2RE8A 1K3UB 4CM4B 3F3KA 3LXMA 4KTTE 1E1DA 4DGSA 1P39A 4G1UC 5F1KA 5BURA 1AM4D 2OOSA 1E8NA 1WR8A 4V0OA 5IC4A 5J58A 2G9UA 3L6CA 4DNXA 5JAOA 3IAUA 1WZNA 4TS4A 3M2PA 1ODIA 2MR6A 4MQFA 3MUNA 5AJUA 5DX8A 1UQTA 3KZVA 3ADDA 1XRRA 3ZKWA 4C5CA 1JL3A 2W2NA 4NYJQ 4ZGBA 2W6ID 3AUXA 1HH4A 4BASA 2EG9A 5A06A 2GBPA 3FDXA 2YHAA 5C34B 4OXQA 2FSVC 1KQOA 2O7VA 1E1RD 2BBTA 1MP0A 5FOQA 1FQOA 1T8WA 2RGGA 3HSSA 3I04M 1VL5A 5IUNC 2PKQP 1PDWA 3HGTA 2WSMA 4MYRA 1N9KA 1TJ4A 1G3MA 4P83A 1VCHA 3RAJA 4B17A 4QGAA 5L4NA 4PG5A 5HS6A 5BVHA 3N53A 4RQTA 2CLSA 5B1DA 1DAPA 1VB3A 1XZBA 2V6JA 2XUFA 3GQVA 1GZ4A 1U3GA 2X7JA 2IXDA 1N0IA 3BMNB 1TVMA 3ECAA 3EG9A 4R4JA 4YPOA 5JAZA 4WK2B 4HXEB 5LXTA 1TCVA 1CUGA 3G0OA 2GZDA 2ZCUA 4IGFA 5JSUA 3FPKA 3KAKA 5JQGB 3QU4A 3P0RA 3IUYA 1W36C 3F6CA 1LX7A 3FM9A 3PUJA 4V0MA 4MKXA 2HV9A 1QU3A 2JGFA 2WWXA 4UJ5A 3PXGA 3HBNA 1JJAA 1O96A 4G97A 5C5CA 4IVQA 1NDQA 2I76A 3MT7A 4LNUA 5LZ5A 4AJHA 5T4BA