3KUUA

Structure of the pure phosphoribosylaminoimidazole carboxylase catalytic subunit from yersinia pestis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
NSAYAAGVKIAIVMGSKSDWATMQFAADVLTTLNVPFHVEVVSAHRTPDRLFSFAEQAEANGLHVIIAGNGGAAHLPGMLAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILALHDTELAGRLAHWRQSQTDDVLDNPDPREEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase catalytic subunit P
publication title Structure of the PurE Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Lyase
total genus 49
structure length 169
sequence length 169
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2009-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 3kuuA00
3TRHA 1U11A 2FW8A 4GRDA 2FW9A 2FWIA 4ZK2A 4YCJA 2NSHA 3OOWA 5BORA 3KUUA 3ORSA 4ZJYA 4AY4A 5C5DA 5CLJA 1D7AA 5CLGA 2FW1A 4YCBA 2FWAA 2NSJA 5CVTA 1XMPA 4B4KA 4YCCA 4ZMBA 2FWPA 4JA0A 5BOSB 2FWBA 4Z7JA 2NSLA 5BOSA 2ATEA 2FWJA 5CTJA 3RG8A 2YWXA 5CLFA 4YCDA 2H31A 1QCZA 5CLHA 1O4VA 2FW7A 3OPQA 5CLIA 4ZC8A 3RGGA 2FW6A 3LP6A 4AY3A
chains in the Genus database with same CATH superfamily
5G0SA 2GN2A 1OAOA 1TU0A 2VBCA 2ILTA 2ZVPX 3MFYA 4GLLA 3LX4A 4KOEC 4YJHB 4DKXA 2VJNA 2BFPA 1VCIA 3IV7A 1T8SA 2NXCA 3F6BX 4IDQA 1BCSA 4N3BA 3D7MA 3N86A 4GYKA 4QOEA 3W4KA 3ABQB 2BTQA 5ALVA 3FMVA 5JCXA 2F48A 3A3PA 1HTTA 3RVRA 1U1GA 4RKWA 4MP8A 4OHBA 3RAGA 1UOOA 1JMYA 1PL6A 1X38A 1YVEI 1IZ7A 1ZVMA 2OCIA 4IKPA 4DNFA 3QU7A 2QRZA 3SQMA 4P2GA 3ETEA 2FRVA 3BORA 3N75A 4J0JA 1Q7TA 4PC3A 4R2XA 3USZA 1CDZA 3WR5A 4L9SA 3BFJA 4HDMA 1Y82A 3TLYA 2FAXA 1YR7A 1SUIA 2M6RA 5BRAA 2J0EA 1NPDA 5CDUA 4KWIA 4B84A 4KK3A 1INLA 3FWZA 3GFOA 1N0HA 2O7QA 4LVOA 1VKOA 2GHTA 5TXGA 1XCBA 1U3WA 4KWEA 4Y0AA 1W2HA 5AM1A 3U4QA 2LIVA 1IY8A 4V24A 3PEYA 2QMEA 2EFEB 5K0FA 3ADDA 1U28C 4ZVRA 1E6UA 1XU7A 4KQ6A 4YP6A 1O9BA 4LVNA 3ZHZA 2XWBF 3RKSA 2QMOA 1VPLA 2KJQA 1DLIA 4JASB 3S5UA 3E70C 1EK0A 1ODLA 1A9YA 3WV4A 2VWPA 4AZ0B 3FYCA 4B4VA 1XMOB 1UEJA 2HF9A 4HNGA 4KX3A 3SEZA 2JFHA 2PT6A 2GNPA 4PG5A 5ALWA 3UOWA 2R5WA 2GD0A 5LPNA 2ZJ3A 4QHSA 4E5NA 3ZHSA 3LL4A 1L7QA 1XDZA 4IZ6A 1ZR2A 3BWBA 3F9CA 3GGGA 1QHNA 1D7AA 1Z5OA 4FFMA 4QATA 4TXHA 3VR0A 1WETA 3E22B 1V47A 5EJEA 4UPEA 2ZG6A 3LFTA 2G0TA 4BFXA 1EAMA 2HADA 3IRUA 1DMRA 3LSTA 3NEYA 4EZEA 4YREA 3GFRA 1SQ0A 4YGYA 5IN5A 2GRJA 4JR2A 4CQMD 3EPLA 4CCYB 5CFOA 2WIGA 2OKCA 2XXAA 1A5BB 1UINA 3V42A 4DF3A 2FW6A 2F8TA 2X8AA 1EDOA 2IF2A 3VKHA 4HLNA 2I9KA 3KFXA 3U7RA 4Q3BA 2E4VA 3HKDB 3E7FA 3MCWA 4BVEA 1PUIA 4ZZ3A 2V8OA 3QU5A 1Q22A 5EFOA 1C7EA 4AUMA 1TAHA 4POAA 2EGHA 3I04M 4UUQA 2X0DA 1Q16A 2VT2A 3WGHA 2ZT5A 2DUJA 4G5QA 4MWOA 2WAXA 1TA9A 3LRXA 2E4AA 4OKNA 1FVFA 4O63O 4B87A 1DG9A 3PWTA 3ZR4B 2JGNA 4WEOA 5ECDA 1YZVA 4C88A 1OX5A 4KXNA 1QWOA 4ZI3A 1KEVA 2E18A 2ZXEA 2Z3VA 1BOFA 2Y99A 5KSOA 4MJLA 1WHTA 4G1BA 1B6SA 2JHPA 3FCYA 1H8EA 4EHBA 4Q66C 1P4AA 4G0YA 4ENRA 4Z49A 1C7RA 5KNBA 3PPVA 2AJDA 2C4KA 2HJWA 1MH9A 2NW6A 1IEXA 1RI3A 4N47A 2FMKA 2GSDA 4UUAA 1SQGA 1GN9A 2YJGA 3V46A 2CGEA 3FKJA 2B8EA 4JK3A 2OQRA 5LP6A 3IPAA 1OFTA 1G7TA 1YB4A 4GM0A 4KPYA 3ETNA 2NXNA 3WLLA 2H7YA 4F9EA 4QECA 3C5VA 3LBAA 5F1YA 4BU0A 2VVTA 1UWVA 2IZOA 2GQ0A 2X14A 3GVCA 1LD3A 2P9TA 3C3MA 3D4IA 3FSGA 3H18A 3RS5A 5HUHA 4OXYA 4R9UC 4IIYA 1P17A 3ABOB 4JBNA 3FVQA 3AY7A 3LKDA 4ZAWA 3C3YA 1BA2A 4K9KA 3DL0A 4O0MA 5A7GA 4E46A 1E8MA 3TKYA 1HKHA 3TXXA 3HJFA 2R79A 1T6BY 1WZEA 2QUHA 2WIFA 1PK9A 1T2FA 3EG9A 4MW0A 5JQGA 1W36C 1HZJA 3WSVA 1FYDA 3NTXA 3AF4A 1XVAA 3DZCA 4KMSA 5JBNA 3R3ZA 3HSYA 4JC4A 3L9WA 1JILA 3QLVC 3M6UA 4NS1A 3U1BA 4G5XA 2JIQA 2ERXA 2JIOA 2RMKA 1A69A 3AUAA 1F6BA 2NZWA 4O02B 4HLUA 2OYRA 3RFTA 2NSJA 1GZ3A 4NV1A 5JSUA 1OHHA 3IB6A 3LOUA 5K01A 1MJGA 2QRHA 5DBFA 4DS3A 2Q4TA 4XWYA 4FGSA 3QEKA 5FUVA 1HLGA 3IE0A 1P0FA 2I54A 3T34A 3PXXA 3IVGA 1HE4A 3BEDA 3RM3A 1GV1A 4MIYA 4IVQA 4HEJA 5F9MA 3WDKA 1XLUA 2ICAA 1XIVA 1OC2A 2JIDA 4S1PA 4PS1A 3UKOA 3EXEB 2LR0A 2JVJA 3HEMA 2R1VA 2W2PA 2FN9A 2A1UA 2CL6X 2IH4A 4TGLA 5ENZA 4KN5A 4BP9A 1GZSA 1LPPA 2X6QA 4HBZA 1PNQA 4LKRA 3TI9A 2OO5A 2BHNA 4FB4A 1IG0A 1NXXA 1Y8QB 1JHDA 1OZ0A 1LBQA 2D3TA 2FWBA 1J5PA 2C58A 1Z26A 2JD0A 4I99A 3ENKA 3EVCA 4ZV9A 2XUOA 3FWNA 2V3WA 5K4HA 1C3EA 1E4OA 1Z3IX 2VIIA 2YQZA 3B6JA 4E12A 4I50B 2DUMA 1JKJB 5KSPA 3ANTA 2O59A 2B2XA 2PKXA 4DLYA 4EATA 5JD6A 3PGA1 3K70C 3I0ZA 3I9OA 1RAEA 4JNKA 4EGCB 4XCVA 5FHRA 1W1IA 4DSZA 1YE5A 2H57A 4FE3A 4DDTA 4OPMA 1K75A 4KXFB 1C3OB 1UDBA 3UKJA 3AJ8A 1ZK1A 1QH1A 4J29A 4AB1A 3W9BA 4HNHA 1XR3A 4FCWA 4QYXA 3N8IA 4ZEMA 1PG5A 4KDRA 3TLZA 1XMJA 4UD6A 3F90A 3GV0A 5FO0A 4EHKA 1JHZA 2ODEA 2FN7A 4G8DA 4HNAB 3A1DA 3VH1A 4A8HA 4A15A 1PFKA 5AKLA 3ZBTA 4NPCA 4BATA 3R0XA 3NOOA 1WD7A 4Y1GA 2IX9A 4IS2A 3V1LA 4H7JA 5TVGA 3LLUA 3T5DA 3DG9A 2AJTA 3AU8A 1ANKA 2NMVA 2VQDA 1J8MF 1ZN2A 4AJEA 4QUJA 3QJYA 1UANA 4EYSA 5DI3A 3CCCA 5KKAA 3OE4A 5LIPA 2ZJ6A 1TLTA 4RK0A 4UBKA 2NV0A 5LP6F 3GH1A 1L3IA 1P4SA 3ICQB 3HK2A 4MVJG 1PL8A 3GOQA 3KEFA 1P3Y1 4M60A 5JY1A 3T7SA 4CQNA 3GJ7A 4JP5A 3BKWA 4BBZA 1TCAA 1F2UB 3T95A 5LXTB 5FBWB 3SZGA 1SOVA 2O7NA 4WXEA 4CKXA 2IELA 3H13A 4CUZA 1SEPA 3V97A 3B9QA 1Y3AA 4NYMQ 3I2HA 4WEQA 3WGUA 4Q9KA 4ZYXA 2I3DA 3WB2A 3COWA 3F8TA 2ZS8A 4EQ6B 4CIXA 4LDQA 3IV9A 3GJSA 3KSRA 4XJSA 5REQA 5KU7A 4YY3B 3RRNA 4DA9A 1QUEA 1U1DA 2UYQA 4WN3A 4XLTA 3V1KA 3WNVA 2VSYA 4EGSA 1G1AA 3CEPB 1AS2A 1SC6A 3ZY6A 3U16A 3UJBA 4RMJA 4YS6A 2ZZKA 4BU1A 2QP3A 1A9ZA 5BUZA 1VBMA 1D0IA 3I04A 1V8ZA 1S6YA 1P2VA 4ZVUA 4LQDA 3ROZA 5B3KA 1PV1A 2B5VA 2X7HA 4NBNA 2W11A 1LS6A 3MWDA 2HW8A 3CH4B 3H04A 2GBCA 5CHYA 5JS1A 4J6EA 2JJ1D 1GUDA 4LI3X 4O3FA 1B93A 3TTTA 1TJYA 4F12A 1WXIA 1GR1A 1TADA 4YV2A 2W6JD 3T3MB 3I9KA 2BPOA 4JXJA 4LKOA 1W29A 3MTIA 5DBOA 3H99A 3USES 4IF6A 4KXVA 4PN3A 1I7LA 4MTCA 3MC1A 1CVIA 2C5LA 3CSUA 3F6PA 3AO0B 3G0CA 4GBMA 3GBPA 3AEYA 2NU9B 5GZ1A 3BSSA 2PRIA 2ZJAA 1M6YA 3T7CA 4IFTA 3EA0A 2LCQA 3TLJA 2OO5C 1JWLA 3HUDA 4Z2YA 2QPLA 2EYQA 1YUNA 4IHAA 1UMDB 2P4QA 2ZYRA 1QHIA 1ONPA 2G6TA 4HJRA 1UZLA 3AFMA 2Y1LA 3KQYA 3VO8A 4DPLA 5I51A 5IMSA 1OF1A 3OPYA 5LNK1 1AKYA 3AB8A 3IESA 3LV8A 4A3SA 2HPAA 1RI5A 3LI2A 4JB8A 1SULA 4I4IA 2QRJA 2VDOB 2BBSA 2Q2OA 4GZ3A 2RGUA 4R9VA 4E3ZA 4XSHA 3FRJA 1C7FA 1VE9A 2JFYA 2OLEA 4XQGA 2FPIB 1RNLA 1Y48E 4RENA 1GT6A 4WKPA 3ZD9A 1SXHA 4EA8A 4B7AA 2FR8A 4GPEA 1JSLA 1E8DA 4BNTA 5KKCA 3U7FB 1JHYA 1E4EA 2K7ZA 3KZXA 4RK6A 1N8SA 4H08A 4JBXA 2F62A 4YFVA 3U3DA 4EJMA 4O5OA 4B3IA 4WLOA 2LDBA 3G7SA 2BC9A 1TUBB 3VR5H 1N2OA 4EMBA 1YL7A 2X4IA 3E5HA 1PJ3A 2C2MA 3VYSB 4GX5A 3SS8A 2ZVJA 5KCZA 4ZC8A 3W8FA 1CUWA 4JYPA 4LYEA 4MVJD 2PKEA 4OXQA 1ULTA 3IT3A 3G79A 1AXEA 4DPKA 1XKTA 4GPAA 3JPYA 1J8QA 2ZB3A 2FF5A 3A8TA 3I05A 3K6JA 2JKVA 2J30A 1Q7RA 3LO5A 3PCRB 5SY6A 3RJ9A 4BO8A 4AY2A 4MR7B 1GAXA 1M66A 3PFBA 5CXXA 3DZBA 4E2WA 2ZJYA 2ODNA 2M1ZA 2B69A 1N33B 4XGRA 3W79A 5DBIA 1OFHA 1GTG1 1UBCA 3FBTA 3IKLA 2TMGA 9ABPA 3Q8MA 2A5GA 3DGFC 4TLLB 3GQBA 1YQEA 4V1CB 3CRNA 3SQXA 1J0BA 2XPCA 4G4SP 1OYOA 1PGPA 2IITA 3A1FA 1U3GA 2GN9A 2QIPA 2WVHA 3OIWA 2I1QA 3ADKA 4HMPA 3C5WP 2PR7A 5AI5A 4HDSA 1QRDA 4CM7A 3DT9A 5B37A 3WMGA 3PUVA 4JJEA 3ZQJA 3T4UA 2C9CA 2H29A 2Y4NA 4ONEA 4YCJA 1XMSA 2V7UA 3HDVA 2A5LA 3LA8A 4DMKA 2WNIA 1KEUA 3EZNA 1C2TA 3FVVA 2J7PA 4MV5A 3W3AA 1C7IA 2GN1A 2IIVA 1TGYA 3IMKA 1E7RA 1PGOA 2REBA 3CN9A 4L6CA 1DIOB 1DZ3A 3CWQA 3RUIA 2WUEA 3T4XA 5ESWA 2UYOA 1OXBB 2L19A 3W2HA 2J3DA 3O83A 3TZHA 4DOMA 2XDWA 2XUFA 1H05A 2VAPA 4TTQA 1N3IA 4OMUA 1M67A 1FNSA 1G19A 1VSBA 2BEWB 3KTAA 1QK4A 1GDDA 4HTFB 3ZQUA 1XPUA 2Q29A 1T5BA 3KKZA 2WWYA 2OFPA 5C9ZA 1WUYA 4KPEC 3X1MA 2XNJA 5GQSA 2IS1A 1R66A 1VJ0A 2YVAA 5I7WA 4D0LB 2YZ2A 3BTUA 1E2HA 3E9EA 2CL0X 4RD4A 4U39A 2FHSA 4KR7A 5J2UB 3EZFA 2YR0A 3KWFA 1RHUA 4FFBB 2VRWA 4BE4A 5JS8A 1AF7A 3K1AB 3S1SA 1Q7CA 3TB6A 5HKBA 1UAAA 3TFWA 5KSZA 3BWMA 4FMDF 3L0DA 4J90A 1Z5GA 4R3NA 5K3DA 3GD5A 3EGEA 2B7BA 1TFUA 3A9TA 3OX3A 1T4CA 2FR8C 3VMFA 4WLVA 4C4TA 3UJ3X 3OFKA 1NOKA 4PG4A 1SZCA 2IPMA 4II3A 1P6QA 1RBQA 3JASA 521PA 3TAHA 2WF5A 3ILXA 4D4JA 4CEJA 4RJTA 4G2TA 1AVTA 4KRGA 1EFKA 3T54A 5GVRA 1OWPA 1DTSA 3PHJA 1W0KA 1MDFA 1X1QA 1W4BA 5GJVC 4U02A 2HV8A 5E0OA 4QM7A 2V5UA 4KTVE 1DC8A 3FOWA 3FPGA 1PUJA 2CUZA 2AMYA 1FQOA 1OI2A 2FY8A 3DDSA 4MGKR 1HQCA 3I45A 4QU9A 1XEFA 2XNKA 4RABA 3HFSA 3HNOA 3R3VA 3S2IA 4QO7A 1TA0A 3QMVA 1HT2E 1Z39A 1XYGA 2W98A 4HH1A 2HL6A 2NLOA 4C1BA 1EUCA 1FJHA 1YIOA 4OK5A 3W04A 4IDEA 5DVZA 3T4EA 4DCNA 2YDXA 4I6EA 4J2TA 4DYHA 5JH7B 4H3SA 1E2JA 4D3XA 3JD0A 3HG7A 4TWBA 1P1BA 4P54A 3V8NA 4YQFA 2PL1A 2VXCA 4OSPA 1F1JA 1W9MA 5CEJA 3OZUA 2WBLC 4OHOA 4NE2A 1Z5VA 1Q1ZA 2PRJA 3WC4A 1SIWA 5FEMA 3S4YA 3ZI4A 1W2WB 1FP2A 1EZ4A 4F72A 4M9UA 3WYCA 3S8EA 4B85A 4UM9B 1U8XX 3HY3A 2GN6A 2YRWA 1AHHA 4MINA 4N82A 2WJ4A 3CF0A 3FPEA 4P92A 1WX1A 2Z9CA 3WFJA 4D6YA 4ETNA 1TEHA 1H2ZA 1EJ6A 3RTAA 1QFJA 2ERCA 3KJXA 2XZLA 3BIWA 4DLPA 4N0EA 2ZUDA 1N0UA 1KQ3A 1VDZA 4NCNA 2DUNA 3Q98A 1MIOB 3V80A 1C50A 2G7ZA 2H2AA 1IZYA 1XTRA 2QQGA 2ZIXA 3GJ4A 1V1RB 1VA4A 4CW7A 4F2GA 4ZEOA 3ESBA 1EFRA 2H4WA 1SCQA 4MV7A 1G6OA 3GR6A 3PK0A 3RUCA 3RC3A 5KINB 4P4NA 5HM6A 1J99A 2MDTA 4UHFA 4U8GA 1HPLA 5FXMA 5LNK6 1OXKB 2ES4A 1GADO 1YQ9A 2FR0A 4QELA 4F71A 3TFOA 3KB2A 4H3HB 2C54A 1TZJA 3E0QA 5FA6A 3WYEA 1L4BA 4IHKA 2DR0A 4KLNA 2IDKA 2G9VA 1DKMA 2QRLA 1QVWA 4Q1BA 5HZHA 1EE2A 3EZ7A 1M8KA 3REFA 3PHBE 1QTQA 2BE9A 4IVRA 1NVKA 2CVPA 2AB0A 4YX9A 1YRWA 5BSWA 1QQAA 4QSHA 3G23A 1XEXB 3DLTA 2E82A 1EEHA 2V1XA 2YL2A 4FZVA 4KP7A 3QLJA 4ZQCB 5E6RA 2CDNA 2CUNA 3B8HA 3ZWXA 4COKA 4PYMA 4D8UA 4DCVA 4M0CA 10MHA 3D54D 1QCDA 4NBWA 4D3DA 1WZCA 5EHNA 2VUTA 2RAPA 4M0LA 1SC1A 3QMMA 4RTMA 1X3SA 1NZDA 3AETA 3LKZA 1AMNA 4O3MA 4DLKA 1YS6A 3VNAA 1H8HA 2R6R1 5I9SA 4L75A 2BFFB 3FA2A 3U3XA 3PVSA 5IHPA 2ZRBA 3PXUA 1NP7A 1C1YA 1L5SA 1YZLA 1ZRSA 2JARA 1CVLA 3Q3JB 2C7VA 3SN6A 3T5CA 1B3BA 2OV4A 2ZR9A 3GMDA 3OUZA 3VU0A 1XU4A 2V9CA 2XB9A 3QKUA 2XVYA 1AKMA 4KSCA 5WRFA 4X66B 4OQYA 3L7OA 3R3SA 2FEWB 4DY4A 5FBVB 2VHUA 4JEUA 1LSSA 2X2PA 3QYAA 1QVZA 1TMGE 3V6LA 1GRCA 3KWLA 4KGVA 4GMGA 4UNSA 3V4RA 1OLUB 4JITA 3TFQA 5E9QA 1E8NA 2X8JB 2BKVA 3K5IA 4N39A 2GVZC 4ZCMA 1G3RA 4DJAA 2C82A 1HE5A 3WE7A 2V74B 1F9EA 4GHWA 4C0LA 1GU0A 3IP8A 3NVKI 3JQEA 3GK3A 4QHTA 1ELOA 3LSYA 3NO4A 1OFUX 1SHLA 1JEYA 4C3UA 1L6IA 1HORA 1G60A 1NF3A 4IQ8A 1BW9B 1E2NA 5HJ2A 1P7CA 3T12A 4RTQA 3DC7A 5AW1A 1UJMA 1VMAA 4IXTA 3AVOA 3HXOA 4N01A 1W0JA 3ANLA 4HMOA 3NGMA 4UEQA 4XVCA 1QK5A 3QVSA 5EMMA 3SLRA 2MYNA 1GLNA 5EMJA 5BN1A 3QTLA 4QGGA 2BLLA 2F3TA 1II9A 5LD2B 2EBHX 2P41A 5KVSA 1JIUA 3BFKA 3UWKA 3HUUA 1DV1A 1NQXA 4EGAA 3GRKA 3H83A 2AMLA 3ZLBA 4FFOA 3LLCA 4HZUA 3R7WA 1D6MA 4EHHA 1QYCA 4ER3A 2KWIA 3PQ2A 3NFRA 4QPZA 2VSFA 7REQA 2XKJE 1JU9A 5KNLA 1RWKA 1DWPA 1R0XA 5DM2A 3ZWWA 4XKJA 1CJUC 3V2UA 2PMEA 4U7PB 3QSGA 3BXXA 2M2IA 1R6UA 2EJTA 3LUCA 1WW2A 1WMBA 4X62B 4N0QA 4YMTA 3GW8A 1F2TB 4U7DA 4PHGA 5JZ9A 1JAIA 1CEXA 3PWZA 4RM3A 4QREA 3EAFA 4FMPA 1F51E 2REQB 5I3ZA 3GNQA 3AM1A 1M6HA 5DTEA 3IUQA 4ROSA 3TPFA 2FDXA 4AP6A 1L7EA 3OPMA 4EF5A 3LPMA 4QT4A 2V97A 1U80A 5TS3A 4MW9A 5DE3A 3BMCA 4DB2A 4ZQEA 2H11A 4EPXA 1W4AA 4NYJQ 3KQUA 2VPWA 1CJCA 1VJDA 2HA3A 1TK3A 2XADA 3MOIA 5DJ5A 5AO9A 2JS7A 3SZ3A 4BMCA 2CLEB 1T9HA 3HSKA 3TK1A 1GQOA 2FQWA 1SXJC 1IEWA 3O74A 5HFAA 2L69A 4NBVA 1IXRC 4ZEXA 1EBBA 2ZJ0A 2O7RA 4NOMA 1G291 1H6DA 3DDWA 1JQJC 3O4VA 4F7WA 5EE3A 1Z0SA 3CVYA 4FC7A 1XA0A 1W49A 4HEQA 4OBBA 1ZS9A 5DWDA 4AUNA 4BRZA 5IKPA 4F5WA 3LKVA 5A4IS 2KS6A 3HP7A 4IG4A 4MAMA 5DYNA 4AJIA 5AFSA 1GAQA 3QELA 4AJ9A 1LNSA 1F2VA 5IC6A 2CB0A 5AXCA 1H4TA 2HTEA 3WJ1A 3BL5A 4R1SA 4CM6A 1Q21A 4BAZA 1TIBA 3D3JA 3QKSA 1T0IA 5DM4A 1QYXA 2C4TA 5A3VA 4DRYA 1X8JA 2BFDA 2VDQB 3PRKE 4CDMA 3D7KA 4HOYA 2A88A 1JXAA 2C61A 2JEYA 4O25A 5CLQA 1KAOA 2GFIA 3AHFA 1HNWB 1G18A 3E23A 4UARA 3H2BA 1G8YA 4J4BA 1JI3A 3JAWB 4LZLA 5IDYA 1BJRE 3CT6A 3F78A 2D2XA 2PUCA 4DMGA 3ABIA 3VNSA 4OGWA 3RGGA 2QNIA 2QD4A 3H7IA 1ZJZA 1Z0UA 4PC2A 4Q7EA 2HQSA 4FT2A 4RMNA 1IBRA 3BHJA 4AWAA 3DBRB 2PEZA 1JFFA 3UWOA 5BV7A 2N9UA 3Q2KA 4HD8A 3MELA 3G2LA 1YQXA 1IM8A 4HEA1 4JJ6A 2HQ1A 4BLTA 1QBKC 3QE3A 4TTTS 2XUPA 4UUNA 2BEKA 1UPCA 1UJ4A 4WZBB 3V00A 4DBLE 5ED4A 4MNTA 3HA5A 4AKTA 4DNPA 2VKTA 1NC3A 1SM4A 2CHVA 3JTEA 5JBQA 2BDUA 1D7OA 3R3WA 4ZICA 5KYVA 5TMBA 2Q5FA 1XROA 4IV8A 3V8VA 4HFMA 3HVRA 1S1MA 5BNIA 2WPDD 2JFBA 3QKRB 4P6VF 3VYRB 4X44A 1RBZA 3K6KA 5L4LA 1H9BA 1I5RA 5AK6A 4ASUD 1B8UA 1ZN8A 4MDYA 1GD1O 1Z12A 1ZGBA 1E1DA 4D4KA 4V0SA 1SHKA 1YRYE 4G09A 1CZLA 2HBZA 3BERA 1M74A 5BQOA 1JZSA 3DV0A 2HX1A 3B1WA 1WHSB 2JVIA 2ISSD 2SNIE 1NTRA 3OZDA 4W1QA 3MIZA 3F1LA 3JQ7A 3NAGA 1GO2A 4NXNB 1UMBB 4JUAA 4I55B 4TZTA 3W5IA 4BX2A 3LBIA 2QXTA 1USVA 4V2UA 3OTOB 1YQTA 4NENB 1NASA 1TC2A 2FWPA 1TQ4A 4DIEA 2CDBA 1UPTA 3I8OA 1YR3A 3RFFA 4ZDJA 5LQAA 2UZ3A 5ITZB 2NPFA 1ULBA 2Q5EA 3B1ZA 4DCGA 1E6LA 1LH0A 1FTNA 1TVKA 1MJNA 1XZ8A 1WE2A 1IYZA 3CN7A 1L5NA 4Z1OA 1MX5A 3K53A 4ZN6A 4MYDA 3K1ZA 4ARZA 4BGIA 2O3JA 3RKRA 5K4GA 5G53C 1NVXQ 4WLEA 4AO7A 3TMYA 3K16A 2HRQA 4HHEA 4FN5A 3M82A 5EXEA 3V1YA 4CQJA 1K86A 4NMHA 5JI3E 2HHAA 3JALA 4ZOLF 1U2ZA 4G23A 3ZLJA 1J42A 1ULZA 2P2NA 3HKBA 2NAFA 4L95C 2QYTA 1JR6A 3LCVB 4Q02A 1H9CA 2WMNB 4QBTA 4EY4A 5JFTA 4J0CA 3P0IA 5H3HA 5FUWA 1V11A 2ASVA 4R7TA 5JNSA 1ULSA 1YRLA 1Y5RA 2WY2D 5CVTA 3X1JA 4CF4A 2P3QA 2ILVA 1M8PA 2ZZNA 1HZZC 5BWMA 1PVVA 1B0UA 3DFUA 3CZRA 3DMTA 3QHPA 4JVOA 1RACA 5E2BA 5ICEA 4TTSA 3R3XA 3GA0A 1RHKA 5F2EA 3VR5D 3WLQA 2OUKA 3ZIAD 4GRIA 4K9DA 1WB6A 2O1XA 5CA0A 5DHTA 1YZKA 2XUHA 4OV6B 3NBUA 1IVSA 3MJRA 4GT1A 4KZKA 5DW3A 2QROA 1P2SA 5JIBA 2AKAB 1CWUA 2HGSA 4RPHA 4YAOA 4IHJB 3LTNC 2O8DB 1P1IA 1E5QA 3OQPA 4ND3A 3ZX5A 4UUBA 1A9XB 1UOPA 2B7CA 3C7TA 3FXAA 3WAJA 4HFJA 1G3UA 4DC0A 1RABA 3B6EA 4Q1AA 4WCFB 1A3CA 1P75A 1UC4B 2WJ6A 4KE8A 1CQWA 2AW5A 4RS3A 5BRJA 1K6EA 1DWUA 5KAMA 2OILA 2XQIA 3K9LA 1SCIA 3UO8B 1MB9A 3OKFA 2D0IA 1TQ2A 4WY5A 3G8BA 4OKSA 5FL3A 4CM9A 1ADCA 2G9RA 1J9GA 4GP7A 4N7MA 2XQGA 2O2YA 3AJDA 2Q0XA 1E9FA 2YIVX 4RPJA 1WVMA 1AKUA 1DC6A 1YBHA 2PIAA 2H07A 2G17A 4KAAA 3W0LB 3P94A 3ZZTA 1DHTA 4D99A 2VRBA 5C81A 1BXZA 2LIPA 4ENPA 2ZAYA 4IIUA 1G66A 1BMQA 2W2OA 3AXSA 1M8FA 3GDGA 4JXZA 1UIRA 1KRWA 3RS0A 3RSCA 4JI5B 1MB4A 3PUZA 4P2BA 5F78A 3L46A 1EUYA 3TIFA 2W6PA 2VYFA 4B09A 4XM1A 4MYTA 4IEIA 2I4NA 4PSDA 4W5JA 3L02A 1KZ4A 1XA3A 3G85A 4PSKA 4RD1A 3JYNA 1MX9A 5AKIA 3ZHCA 5JXHA 5CT6A 3WNQA 2V7GA 1PJRA 5AJWA 1JIJA 1I7NA 4F60A 1HE3A 5AICA 1Q0SA 4KXUA 4EGQA 2OT3B 3LW7A 2NV2B 2DUUA 1IBLB 2CXOA 3UCXA 4O4LB 4B75A 1ZFNA 4ND8A 5CFQA 1CUZA 2J3QA 4ITUA 1QHYA 3UB3A 1ADBA 2C5FA 1VE3A 2BJVA 2W2LA 2PZLA 3FETA 4FFPA 1SBQA 2Z5LA 3Q5DA 3O73A 1OILA 2VAWA 1JI0A 1FRZA 1QQTA 2V4ZA 4LJ6A 4RSHA 4DDVA 3D6UA 3RK0A 2WD7A 1NSTA 1YVUA 4KUHA 2G71A 2QDKA 2H1HA 2NYRA 2MSNA 1M1NA 1TF5A 1I24A 3PV0A 3LBHA 5IT4A 3KSBC 3N74A 1YA6A 1WZUA 4LMPA 4DTCA 3BJMA 1T36B 5KOIA 2C4WA 2W2XA 4B48A 3N28A 3OZBA 4NULA 3CC8A 5DX0A 4B3RB 3DUWA 4K9MA 4QUDA 4P3PA 3IOBA 4YECA 2O2SA 2R68A 3EA5A 2NUPA 3EVNA 4Y9UA 2ZRMA 1ZXXA 3CF2A 4HRVA 4P36A 1UBHS 4OQDA 3HDTA 5FTJA 3GCDA 4X84A 1IM2A 3CPHA 2YWCA 2R25B 3C2QA 3EISA 3RIEA 3Q1KA 3DMTC 3KTFA 3MCUA 1UC8A 2IU3A 1G8HA 2O5RA 2LD4A 1YBVA 3G8YA 3KV1A 4Q4LA 4AMGA 2R86A 1IQUA 4TYYA 1GOTA 3TLAA 2X5NA 2H63A 4LQ4A 4A92A 5DNEA 2GBIA 1UJ6A 4R81A 2JAQA 3CNNA 3RHTA 2UYCA 4AXXA 2Y3IA 2QS9A 3V2IA 4EA7A 3TZKA 5IKMA 2QQEA 1V6SA 1BJKA 1WQ4A 2KBEA 3F3KA 4A0GA 4BLOA 1N5JA 3JYOA 3B6ZA 5DEOA 4X3CA 3PX7A 4ZYWA 2Q3CA 1UFOA 2C8KA 3REQA 5EJ2A 3OEHD 4IDGA 3AL2A 4YO7A 1Z83A 3AEZA 2FX3A 1XX6A 1N6NA 3QVUA 5F2KA 4BQRA 2QAIA 1XD2B 3D8TA 1P0IA 2WVAA 4MAAA 3SR0A 4OAQA 1V8BA 3PLRA 4LTMA 4AMYA 1DZIA 2JGIA 1EEXB 4HEA6 4JGBA 5CB4F 3I5YA 2HA5A 4LZNA 2GCOB 1M1YE 2OCXA 3INRA 4K3UA 4K26A 5CJPA 2VO1A 5CTAA 2UZ1A 2HMSA 2HH9A 5JTTA 4GZ5A 2Z6QA 4IDBA 4ZVPA 5FWXB 2PVCA 4TKVB 1XE3A 2WI8A 2XCQA 2F1OA 2Z5GA 2YV5A 2QR3A 1LB1B 2P2DA 4RA6B 3T7IA 3NDBB 2ZJ2A 4O0LA 3RRYA 1QOQB 2XGMA 1B43A 4NCXA 1YNSA 4E94A 2AFRA 3WADA 5EWJB 1POXA 3DXXA 4OM8A 4QFCA 4C9BA 5EJGA 1TXGA 3GVXA 3VGPA 4D4LA 3P2JA 5CH5A 1ZC4A 2QKYA 4KODA 2BBTA 2AZMA 3RYTC 1M9NA 1Q0ZA 4L3OA 4TM8A 5AH0A 5ECWA 3V4FA 3F1KA 2QQ5A 4ZAVA 4JBYA 3H3JA 2GPYA 3NWEA 4JQOA 4Z7NB 2PZEA 3A3YA 2BZGA 4DSOA 4NFHA 1IJBA 1MTOA 4ZAZA 1Y63A 3R7DA 4ZCPA 4Q37A 3LZ6A 4TOIA 1ZNXA 1C0LA 4TQAA 5E3HA 4TYNA 4Q9DA 4EMUA 4EUNA 1YU9A 1MGPA 4RZXA 1CUUA 1N2IA 1ZN7A 4MQEB 1R5JA 4IOLA 1H2YA 3GN1A 4J1SA 5JJCA 3RF6A 1CE8A 4RTOA 5JHGB 1BX3A 1A9PA 4NZOA 4ZPXA 3OLZA 1M2FA 3EVBA 3G2QA 1PFYA 3NRJA 4ALJA 4WFQA 3AVTA 2GOYA 1CEQA 4KJZA 5FTMA 3RHZA 4KQXA 2ARKA 2IHJA 2R8ZA 4KKXB 2XR1A 3KJIA 2R8XA 3MTDA 4B34A 2UV8A 1E92A 3ZH2A 1XMXA 2KM1A 1YZGA 3HR7A 4MLZA 1FL9A 3HY6A 1NNUA 2A4MA 5B7GA 1VPEA 3IAUA 3OZEA 5E9AA 5JISA 4XX0B 1T4GA 3X43A 1DBQA 3ZNPA 1MZPA 1L9XA 1P1KA 2C94A 1RKBA 5FNVB 2ZRGA 5IZCA 1SXPA 1C9YA 2IP2A 3INYA 4FFSA 3CR7A 4RF2A 1GCIA 5G41A 1AT1A 1PE0A 1QYIA 5DXAA 2PBRA 3RO7A 2HZBA 1V6AA 4BWYA 5ICSA 4TSFD 1F3OA 1UDAA 5CR9A 1YL5A 5H1YA 1QVAA 1ZH8A 1E6EA 3O8BA 4JT4A 5CYOA 3ZJTA 1AV6A 3UK6A 3C85A 4UNIA 4C7BA 5F23A 3FNGA 1Q83A 1U9IC 3F67A 1R6BX 2YMMA 3U3JA 1V8DA 1TOAA 1KYWA 1JQAA 1ZIYA 3OI7A 4FFNA 5BV1A 1U6KA 3ZZMA 2YY6A 2JK1A 2Y0DA 1Y6ZA 2FX2A 2NU6B 3SS9X 1LF0A 3OE7D 6REQA 1ZI9A 2PT9A 4DB4A 1GGVA 5BR4A 1HNZB 2NT3A 1TO2E 2JFGA 1LVHA 4ZQHA 5BYKA 1K5GA 1NVWQ 1KYIA 3WL4A 8ABPA 4Q3DA 3AI2A 1ZGZA 1QBGA 5F73A 4B6JA 2RAUA 5K0BA 1E69A 3AIMA 5I5GA 1PZGA 1U0TA 2GEUA 2Y9MB 1WCXA 3RS9A 2GJ9A 5I4KA 3WB0A 1P2BA 1EHIA 3DDZX 3QVWA 4PZDA 1EQ2A 4FR2A 1GHTA 4TSRA 1WDTA 4IY1A 4NCHA 4RTPA 2X2OA 3JQAB 3AB3A 5BPHA 1AV7A 5DHFA 2W90A 3OAAD 1D2RA 2VSNA 5LC1A 2QTRA 3MT9A 1DRJA 1WCIA 4ID9A 2JFVA 2VT7A 1T4MA 1YZTA 2NTEA 3JWPA 3STVA 3X2FA 4EG6A 5JWRA 4Y2UA 5IWAB 1R3DA 1CFJA 4MV6A 3EHDA 1Q15A 3L1JA 1XALA 3CWCA 5DHPA 3VPGA 4RK5A 5KQLA 1YHZA 4CE6A 1QOPB 1Y4DE 1H5NA 1Z0KA 5AK3A 4Z3KA 3VTKA 2AEEA 1XP5A 2ADOA 2PZKA 3CU5A 4LJ9A 2IHUA 1US8A 1QG2A 1XJ5A 3KPJA 3OETA 3VAZA 5KYWB 4E5YA 5HCUA 5AD1A 3U37A 4FZRA 3H6HA 1JFRA 2GWRA 1YS4A 1GTJ1 2IPAB 4MKRA 1RMQA 3QX9A 1GSAA 1TO6A 1ORHA 2MSKA 2WSMA 2AC7A 3ENQA 3U7QB 4AYTA 3MS2A 1ESNA 4DBZA 1XQWA 1XQ9A 1EFDN 4UNQA 4DNXA 3OZSA 1HLFA 4FMBB 2WJHA 2R2AA 1PS9A 1UBKS 3MA0A 2BEVA 1KI3A 3B6IA 2IYAA 2VF2A 1JAHA 1KJNA 1ORWA 3NHKA 4MV8A 3VTAA 5KQPA 1AQ6A 1B3RA 1KAGA 1BHO1 2KPOA 2POQX 1FFAA 4UBLA 3U4GA 2CD9A 5EI5A 3AL3A 3EIFA 3ZV7A 3L8DA 1ZOIA 1D1PA 4RBNA 4C4XA 1E59A 3K0KA 5LWHA 3BCSA 2J3KA 2AUTA 5H16A 1NQWA 2WAAA 5HMMA 1BCSB 3KU1A 4PC6A 4E1BA 4BJHB 5G3ZA 5MF6A 3ESAA 2HDHA 2ZUSA 3M0EA 2BTQB 3PNQA 3V7YA 5HMLA 4PLYA 4MCIA 1U9YA 1PZNA 1FMTA 3KKOA 1EM6A 2I1WA 3LHKA 3IVMA 1Z07A 2H52A 4GR5A 4EKIA 4W5QA 3A3OA 3DH0A 3LD9A 4QBHA 1CW2B 2ZYGA 3TM4A 5L7WA 3IPCA 4N0DA 4FYYA 4EX6A 3UGKA 3VPBA 2I6GA 4HDMB 4B6OA 3T0IA 2BMEA 4NK4A 1DU4A 3KU4A 1P33A 2LTAA 2YH2A 3A37A 1QLWA 2ZEJA 2VCYA 2O52A 4F9FA 5I47A 5L9AA 2CDAA 1GZ6A 2PQ0A 3ZDZB 2C9YA 3J80A 2HV9A 4W9RA 1ZRHA 1S2LA 3H8VA 4FFLA 4INJA 4NL4H 4QTYA 1RQNA 2P7HA 2B78A 5CLJA 3U4QB 2NTNA 4RKFA 1ZGGA 3NAMA 3OIGA 4LSZA 1T1RA 5F5XA 4EO7A 1G2QA 1XWFA 4HP8A 1DJPA 4JR1A 3WICA 5EA2A 2FLKA 2V54A 5KCMA 3Q6NA 4AK9A 2H2HA 4GQAA 5AM5A 1LSUA 1V0JA 4GS5A 1G8AA 3N5KA 4FIZA 3B51X 1A8QA 1NI4A 2JB9A 4JL8A 4Q6BA 4WOPA 1C0IA 2PXHA 5CTJA 4BP3A 4NMMA 4PGAA 4G5GA 4BEJA 4UAVA 2WQZA 3V4OA 1H2BA 3G6WA 4ZVVA 3S2SA 3ZWNA 2DCUA 3FJYA 2GN8A 4WZBE 1YH3A 5IAEA 5D7BA 4B74A 1U3VA 2DTEA 3MTAA 4ENQA 1TU3A 4OVKA 4FKBA 4ER0A 1PJ8A 2F9FA 3KFVA 2UUCB 4R98A 4FOLA 1ECCA 3LDFA 1ZWLA 1LJLA 2J8ZA 1N2CA 3E4CA 5ALRA 3G5UA 4MVJM 3BB3A 2AR9A 5FJJA 5JLAA 3ZEIA 3E9DA 2R8PA 3VKGA 4UJ3A 4BJ1A 1RWXA 2Q5HA 1G9TA 3MGAA 3CX4A 4W5HA 5F7XA 3G82C 4YCLA 3DZHA 3LRPA 4PWZA 1PCXA 3RBZA 4G8BA 1USGA 3DAYA 3R9KA 2B98A 3C6ZA 3NYIA 4IEEA 3EIWA 3Q11A 3ZWYA 4ECEA 2XXAB 3QUQA 4QU5A 2O20A 2BM9A 3D8RA 4PO9A 3TVTA 3VNUA 3B3JA 3DKKA 2RB5A 4GX0A 4OXNA 3H1AA 4K0KB 3B2QA 1Z22A 4AKEA 1QHXA 4MRNA 3P9IA 4IWNA 2GXQA 5JRDS 2PZAA 5TT1A 1VP9A 4CLDA 4FCTA 4PO8A 3K2IA 2RH8A 4S1WA 1H94A 4OP3A 1SBTA 5K8LA 4K6HA 4ND4A 1PJAA 2ACVA 2HSWA 2ZSAA 2A5YB 2I7DA 1KAQA 2C7GA 1JBEA 3FTNA 3RVBA 2P35A 3K70B 1HF3A 1X8LA 2EFGA 4YP1A 4ZAYA 3HJCA 3C3CA 3HCAA 4N6GA 1HRKA 4N18A 4FINA 4V2IA 1CHDA 2WT8A 4JI6B 3M6VA 3WHPA 5BOSA 4H1TA 5F1OA 4ZD6A 3RYCB 1WHTB 3BN3A 2OYSA 3F7TA 3S2UA 3ZW8A 4IW3B 4TXJA 1D0SA 1ZINA 3S5JA 1PQ4A 1RPJA 1YI8A 3DWFA 5IUKC 1Z2AA 3UNXA 5IJAA 2XTMA 1OH5A 3TTSA 3G8AA 4URUR 2HBYA 4BP1A 4E70A 1NNI1 4ZJUA 2FSPA 3L4EA 5LP6B 4B80A 3PDHA 3H0KA 2AXQA 5L45A 1N3BA 4HGYA 2G63A 2ZYHA 1A1SA 1Y33E 2W48A 4OK6A 3I5MA 4WK6A 3ZH9B 5ITVA 1PV4A 2ZAIA 2WU4A 8ATCA 2XUIA 1PWZA 1CQJA 1X13A 2EVWX 3H75A 3T3DA 4BKMA 3PRHA 3A2KA 3JQRA 3L6CA 4KDCA 4D8TA 1Y6QA 4CMAA 3RFUA 3WLSA 1ZMOA 4DUGD 2HDOA 1P74A 5CGQB 5JS7A 1VMDA 1D8TA 1KI8A 1WRBA 2JIZD 3FUUA 1CR0A 2I8AA 1NHGA 1ZRNA 3EG9B 4W8HA 5JQGB 2QX7A 5IAGA 4YCNA 4G4IA 3EIUA 2WKWA 1M72A 3A28A 3QEJA 1Z37A 3AR3A 1IJFA 1T2EA 3H87A 1S8AA 1N8NA 3EFHA 2XBMA 1PHPA 3CGWA 2O9JA 4BQEA 5FRDA 1T3SA 2WJPA 3D3NA 1OCEA 2IYLD 4PAGA 1DPGA 4FU0A 1V2HE 2ZQZA 4AN4A 3WFIA 4J8PA 3TLKA 5DBHX 4WKCA 3VKWA 4NCAA 4RQAA 2AV6A 1HSOA 2JJ1A 1UKAA 3DW3X 2ADFA 3M4XA 2OFFA 5JSHA 3W3ZB 4NU5A 2BHLA 3MCTA 5ALKA 3MMZA 3L6RA 2Z1NA 3KUCA 2JCSA 2P1DA 2QRQA 3HYTA 5B3JC 1NPYA 1S3GA 4RL6A 1ECPA 2VWGA 4Z1MA 3U3RA 4W9NA 2FYTA 3Q6MA 3IUPA 3NHYA 1ODKA 3P9SA 1L4FA 1MJHA 2A14A 2P6MA 2R1VB 1G21A 1M3SA 3PG5A 5G0TA 2G4LA 2A1UB 1E1YA 3I4FA 3SOPA 1DBIA 2AIRA 3TZCA 1QANA 4S12A 1Q0QA 3CUWA 3WRWA 1ONOA 2VUSA 1G5PA 2X19A 3CW9A 1Z0DA 5CB6A 2R44A 1XAHA 4BY9E 1NBAA 3EC7A 4F96A 1VHQA 3F97A 2QORA 5LZ4A 2FQ1A 5ELXA 3COJA 1RHQA 2JA2A 2WFZA 4WD3A 4B6SA 3MNFA 4DAEA 3SDZA 1JLKA 1M2WA 3HC7A 1N9GA 2IXDA 2ONZA 3Q7PA 2BGLA 4FYHA 4Y6QA 2O8EA 4Z4GA 3KUXA 1GNVA 4P22A 2ZRDA 4HT3B 1Z36A 4ZGBA 2VJKA 2D1RA 2WLSA 1Y37A 4F56A 3GLTA 2I2FA 3VPXA 1TDJA 2Q9UA 1Z5WA 3PEFA 5LMZA 1KH1A 2AR0A 1QH1B 1DBSA 1ZEMA 1Y3FE 3CRRA 4YR7A 2QEQA 3RC2A 4KI0A 1IJEA 1XTVA 2WZDA 4J03A 3UHFA 2E55A 5I7OA 1X7WA 1KY3A 2FKAA 2FZWA 2OEPA 3DW1X 3K0HA 2C98A 3P0HA 3RBAA 1SBNE 4NBSA 1HI9A 5FI0B 3GCZA 1C30A 1T9DA 2CBXA 1M34A 1QPGA 1Z2NX 2J6BA 1JLLA 1G5RA 1DQRA 2ZYWX 2IJGX 3EE6A 5D1NA 1A8SA 3DYIA 3I0NA 1QF7A 2DAPA 1JNXX 1D4OA 2GYYA 4MP6A 3BZWA 5JAHA 4H4CA 5DGIA 2FQXA 3A1EA 4LDRA 2DTDA 2CN1A 4BWGA 4NCBA 1BU8A 3HU1A 4XM0A 3JRNA 1P4JA 5DI3B 5D3QA 1A4RA 1YQQA 4KMMA 4DG9A 1GUYA 3SZMA 4HWSA 2ZCUA 5SV2A 1YDEA 2I3GA 3NIBA 4MVJA 1NT2A 2WU0A 4Z6KA 1KA9H 1P1HA 4OHCA 3OT5A 4LRQA 4A2WA 3DXFA 2P75A 1I4DD 2Y1OA 3JATA 4NEGA 1NMZA 3WMWA 1RZUA 4BO5A 4AROA 1C1DA 2QJFA 4B3DA 3RSQA 3NPAA 2QYOA 2VQSA 2GF2A 3KR0A 3QMPA 5KJ1A 4AM8A 5REQB 2GT1A 2I6FA 3FR7A 1XMIA 3PI7A 3T61A 1CK4A 4OA5A 1IPHA 1PNTA 3UJHA 5FTLA 5EIOA 1DO0A 2UUPA 1RSZA 1UBRS 2GARA 3E1SA 3JYLA 4IIJF 4QNMA 1U63A 1U11A 3EN0A 4K9NA 1SOWA 5LUAA 2D54A 4E3WA 1I36A 4D02A 2YFQA 3MWDB 3SY8A 2BFNA 3PUJA 2H4FA 5C5DA 4OQPA 1XDGA 2C99A 2VP5A 2AQHA 3OIVA 3I4CA 4FGUA 4W9NC 4J9UE 3WQHA 4JYCA 5C8YA 4Z9XA 3NBFA 4LW8A 2ZIVB 4R8RA 4MKIA 4PCUA 4M53A 3A32A 4Y2VA 3WBKA 1DFGA 1PDWA 4XEHA 4B44A 2DP4E 5A3QA 1C3VA 3CG4A 4NK5A 3HLYA 1WNFA 3D5QA 2ZJ1A 4HKTA 3UUWA 1R8YA 3HCEA 3FNBA 3AIOA 3D4BA 3HGMA 3VU1A 1PQYA 1JAXA 1KP9A 2HNKA 2JRLA 2X2FA 1V8PA 1EB9A 1FDWA 1H1TA 1FXSA 2BFBB 2Z3WA 3C1UA 3O75A 4PFJA 4QUBA 5FP0A 2BJHA 4K6KA 4IIFA 1YSCA 5EMLA 2IEBA 2WMYA 4MA0A 3I2YX 4U2EA 1JJFA 5CDFA 3S8YA 2BR5A 1DP4A 5EXPA 1DVRA 3OPYB 4MVWA 1Z8DA 1K66A 2GWHA 3I6YA 1I0IA 5D7NA 3ETHA 3OCYA 1P80A 3R5SA 5GV7A 2D1FA 2JLUA 1MQSA 5EUMA 1XF9A 4GE3A 4LA4A 4CTNA 5IT9A 4KLAA 1OMOA 3VTFA 2WSIA 2NZJA 5JVDF 1BXKA 1H0RA 3H2JA 2H1RA 3GD7A 4NPAA 3E9MA 3K92A 3D6VA 4GAEA 2Y93A 4ZHQA 1ZJJA 4OXKA 4Q1EA 4UKDA 3AF1A 5DM60 1VTKA 1TQ8A 3WWPA 1TL7C 3GMTA 4ZWNA 1Z17A 1J9ZA 4D9CA 4W5RA 3AKZA 4PANA 3PD7A 2HMYB 1FMFA 1E4EB 3P5SA 4GI5A 4PHHA 2IZ0A 2Q4BA 4C0KA 5JT1A 1F0NA 4OFXA 3GJ3A 2BMDA 4M0FA 4BNDA 3GVHA 5KYNA 1T43A 3PGVA 1PDOA 2XA9A 4XE5A 4BQOA 3NVMB 2KYRA 4LCEA 3KK0A 4NAUA 3GEPA 3VSCA 4A16A 3G1TA 3FGNA 3NTOA 5B3JA 4HWPA 4K28A 3L2OB 4RIHA 3TOXA 5IZ4A 2LDXA 1U0GA 1R8QA 2O8CA 1FYVA 1M7GA 1WLYA 2IEAA 1MAUA 2CCJA 4XUCA 3ZHBA 2HO4A 3OZ7A 1RW4A 1UPBA 3FTEA 1V5WA 3GBSA 3GH3A 2VZLA 2FFJA 3NKFA 3I2JA 4RETA 1KGDA 2WF9A 1L7RA 4CGZA 5KQRA 2C4NA 3ITDA 1BXGA 2PXAA 4UQOA 4CMGA 1RBYA 2VNJA 1M73E 1UR5A 1WXGA 1UK9A 3DMRA 3I6QA 3PJDA 3IR7A 2QTZA 4BN4A 8GPBA 4I3HA 4HZGA 4IDFA 4EY8A 2B1RA 4LF8B 3QWHA 2GLUA 4N49A 2AGVA 4M3NA 4HDSB 1R9GA 1ATZA 5EN4A 4KGXA 5CNMA 4E14A 6NULA 1QC5A 1OIVA 2R87A 4W4TA 4IV0A 3ONDA 1EDEA 9GPBA 2ZPUA 3KNZA 2EX4A 4UDNA 1XPJA 4G07A 3BAZA 3JARA 1O9GA 4C04A 2OV3A 4HLQB 4PVDA 4IRUB 1XN4A 1BYIA 4RK7A 2N1BA 1L5HA 5C8YF 2ZYVX 2OG1A 4HWTA 1ZJYA 3Q5GA 2OM2A 3IKJA 3V5NA 2B30A 3Q0IA 1NMSA 4OF4A 4LX0A 4EG1A 2ZSHA 4AN0A 3V55A 4XVQA 1JB1A 1ZUHA 3L0CA 3PR2B 3D7SA 3O8QB 4M83A 5FJIA 3TGLA 2QJOA 1N2XA 4ZA2A 2G70A 1GRNA 2BYTA 4IQ0A 3ODGA 4D8XA 3KTAB 3DCIA 3DT8A 3DPUA 5BNZA 3A1WA 1JW9B 3VYUB 4E5UA 1U2TA 1JDBB 4J16C 5CG2A 4QBGB 4KC0A 2XRZA 5GTDA 3W6UA 5JSZA 2AJBA 5KQGA 2CJFA 4EFNA 4ON9A 4J7AA 1WY7A 1PQUA 2H8GA 1N36B 2VFAA 4L5CA 4BX8A 4AY5A 2JZNA 3AR5A 1N0VC 3O8LA 9LDTA 3E53A 1AKVA 3HB1A 4RESA 2XMCA 3O6VA 4Y2GA 4IMPA 1IAQA 3Q8KA 1FXWA 4B3FX 2YVUA 3I42A 3K96A 3WQBA 1VSUA 1LW6E 3D6NB 4XVRA 4A7PA 3CIFA 4WY8A 4QDTA 2O4CA 1XTZA 2HU5A 2OUIA 4FVTA 4RPCA 3UK7A 3V8QA 4BZXA 1U5BA 2WM3A 4XD7A 5HQ3A 1U2PA 1P18A 1T4CB 1AUVA 3NJ4A 3X1YA 4UBOA 3JASB 2H4XA 1LTHR 1SCUA 2OOKA 1TNDA 4O1HA 1NVDA 2GHIA 1T6XA 1X94A 3HMQA 4HDQB 2G4CA 3TR6A 2RGDA 4HAXA 5KEIA 3IH5A 4CEJB 1XTUA 4OMCA 5DP1A 5FCDA 3NR2A 3PDUA 2E5FA 4CEHA 4RKYA 2YIDA 2BGJA 2GXSA 1OW3B 2GNOA 2YHUA 4XYBA 4A4DA 3WA6A 2PN1A 5BSEA 3AP3A 3D3WA 4D45A 4EVRA 1JAZA 2HDNB 3DEJA 4C06A 3TZLA 1KF0A 1M6WA 2QUAA 1XTBA 2RKOA 3CS3A 3KOOA 3Q8WA 4S0ZA 1E9VA 2CXXA 5DFAA 3SYMA 3V4PB 1NW3A 1E2LA 1U8CB 4L9WA 5JOQA 1S2OA 4OBXA 4QODA 1JA1A 4DMHA 1K68A 1ZM2A 4NATA 5DMXA 3O4HA 1Z29A 3P0JA 4Y18A 4CMCA 3EZ2A 3M2TA 3T8YA 1EUCB 3CE6A 3H0CA 3RIMA 1XA4A 1G5QA 3JQBC 1W47A 3IPXA 5AUOB 2H1OA 3VI4B 2YV2A 4HY3A 4ISBA 4ZQGA 2VPPA 3UFBA 3VR4H 4DV2B 1YZUA 3PNYA 5CCBA 3HPRA 3VZSA 1E3EA 3TEMA 5EJFA 1ZJ6A 3GLRA 2C7RA 3T5AA 3LMKA 4CIAA 1RXSA 1DARA 1MHTA 2I66A 2GZ2A 4ILEA 1Z2DA 5HOQA 2HHJA 3B7GA 4RKQA 5HIIA 4KVFA 3RODA 2Y27A 1DDOA 1HEIA 1ISPA 1PNOA 3CT4A 3CZ5A 3I9V1 2WYVA 4IS3A 5FQOA 2B9VA 1UK8A 3N7UA 3Q7EA 2FG5A 3PPWA 3PIRA 3CPEA 3I9FA 3C3WA 2VK1A 5CPBA 4RD2A 4M8IA 4H60A 3CVVA 4AS1A 4ZOCA 2YZKA 5JWHA 3WLAA 1F4LA 1GKLA 4LRWA 1N34B 4HWRA 4DDMA 3H2GA 4QYIA 1PNVA 3CVXA 4KO3S 3Q41A 4LBZA 5EE1A 3SDBA 4Y2TA 2AJLI 1LI4A 1G2PA 4N03A 4ZVNA 4JLBA 2ZIXB 3PUYA 5E2IA 4FN4A 3C74A 4MAFA 1DKOA 3LHSA 2G82A 4YT2A 2XLCA 3L7KA 1EA7A 2QN9A 3A4TA 4MGHA 2PMWB 1IUNA 3A27A 1SMKA 4ML3A 4V1CI 3C48A 2WABA 3I5UA 1HQYE 4K6CA 1QH8A 1J8DA 3ND7A 4FKZA 4QTUB 3VOTA 4IGFA 2C88A 4XASA 3ZDYB 2X77A 2YVQA 4AJOA 4ETMA 4R1PA 3RVNA 2PSFA 4EPWA 4C5CA 2GK6A 1KC1A 3TW6A 1AGPA 2VP2A 4P4SA 3ROXA 3ZC3A 3OFJA 4GC9A 4FHEA 5KQMA 2O0MA 2I6UA 4BMDA 2E4ZA 1SVMA 2JCGA 2VI5A 4X95A 3I6ZA 1BNCA 4UASA 4TYWA 1PBNA 4D26A 2OFOA 5LB4A 3UXEA 3PP8A 3AUFA 5E6RB 1FXWF 4EY6A 5ERYA 2F1IA 4C0BA 5M29A 1C3JA 2CLDX 2PUHA 3I0MA 3OOSA 3QIAA 4IR7A 3O7WA 1G98A 1FZQA 2VYQA 2IUEA 1YR6A 4NBLA 4TL6A 3G17A 4BCDA 2YHSA 1THZA 2F1RA 2X7XA 3JVDA 4W7SA 2E1PA 1PSWA 2FFQA 2IRWA 3AETB 4YONB 5F98A 5JANA 2GSWA 1JIXA 2XJ9A 4JY7A 2AOWA 3I6IA 5H9WA 1CQXA 3P9KA 1U8EA 3S2FA 5LMCA 4AWXA 3FNFA 4I8XA 2ZVDA 3EF1A 2OZLA 2X5KO 1EVQA 5G1NA 4L9RA 2OBLA 4O2AA 1R6DA 3F46A 1EQUA 3B9PA 3O8CA 4Y98A 4A6EA 1Z63A 1JFVA 1WUHS 3U4IA 2QV0A 1RWNA 2DWQA 1RYFA 2R85A 2OCGA 3UUFA 2BI7A 2WRZA 3EYWA 3D2LA 4FFVA 4LTNA 4NX2A 3DBVO 3VO2A 1FSPA 3ECSA 3G5MA 3GJRA 1T4DA 2ZBQA 1IK4A 3QE9Y 1CYEA 4D5EA 4TTIA 3MHPA 4P4GA 4K87A 4BGDA 2I65A 5JZSA 2BAGA 1ZVKA 3ELYA 1UJNA 4CMKA 2XIJA 3WO0A 2ZAOA 5E6UA 5JZBA 4K9SA 1JEYB 3PFKA 5CCXA 1MQAA 2I67A 4MWDA 3VRHA 1OXVA 2Q2VA 1P9WA 3EDQA 1V9SA 1W1WA 4PYIA 5IAKA 4BDSA 2ATIA 2VTKA 3JCZA 3LFHA 3E7XA 2V98A 2ZTMA 5SY9A 3S7TA 3WL5A 3U4HA 1SD1A 1SZJG 1Y5NA 2H6EA 2JZCA 1U2GA 4LHZA 4PNZA 1WVGA 1VMKA 3CJQA 2ZIAA 3HNPA 2C04A 1T8TA 1M33A 5DK6A 1BKDR 2PO7A 3E9ZA 3EUFA 3JQPA 2XE6A 3FH0A 4YRCA 2D00A 3NI2A 3Q0EA 3L8EA 1HFJA 2ASEA 3OZIA 4P7KA 4PLZA 4BTLA 5AW0A 5J4YA 3RAFC 5AJTA 3RFXA 2AE2A 3J7TA 3FUXA 3OIFA 1J23A 2HZ7A 3I53A 4BIIA 5FF9A 3NC0C 4HZUB 2O8FA 1J2UA 3L8YA 1LC3A 4F85A 1A4XA 3RKUA 1BMFD 1JS1X 5BOVA 4HNSA 4NR0A 2J9ZB 2OHXA 3RRMA 1DQYA 3EEOA 2BLNA 3CLRD 4WLFA 3TLBA 3IQFA 4KXLA 1E5DA 1LK7A 3A4MA 4YAEA 1TVEA 2UZAA 4H1VA 1THMA 4MLDA 3T7KA 4DJJA 3F7OA 3T3IA 4M21A 2O2IA 2JCXA 3FMIA 3IO5A 1GFIA 2C92A 3ZDDA 1WQ3A 3IBFA 4FLMA 3CNEA 4IXDA 2Q1SA 2NNLD 2EKQA 1BO6A 4C4RA 1EHYA 2H3EA 3M3HA 2YOHA 1QX3A 1R3UA 2ZUCA 2OPHA 3BMCB 3PGXA 4U4AA 3B2NA 2FNAA 1KNQA 5DCUA 3WV5A 5C7YA 1UMKA 3IIIA 4FHZA 2HPVA 4LJAA 2POCA 4MRPA 1M1ZA 2BTEA 5FWNA 4CM1A 3GA7A 3KQWA 2VATA 2HNAA 4OFBA 4RVOA 5EPOA 2F64A 1MAWA 2VPQA 4R0VA 5AVSA 3W90A 4YRZA 5B7QA 4KFTA 2GK7A 1P77A 5JEEA 3VNRA 1WKVA 3K8ZA 1JL3A 2GD2A 4AI6A 3CUKA 3QELB 3A3KA 1GDTA 3UMVA 1X2BA 2M9MA 2VCHA 5I7HA 2Z43A 4LDPA 2JJQA 3B20A 1E2KA 3QKSB 4ND5A 1EVJA 3O21A 3C7DB 4KJXA 4MI3A 3CLTC 2H9IA 4ZMRA 6CHYA 2BFDB 2IDMA 5J2TA 3VAAA 3S1AA 2B2NA 2WILA 1QTNA 4KE6A 3RK4A 4LF6B 1IBSA 5AM2A 5ALQA 1YXMA 2DH5A 5IKOA 2Y66A 1E3MA 1E7YA 3NBAA 3BHIA 1U6JA 1ISFA 1BH2A 1D6JA 1SWWA 1WL8A 4KTTE 5D3MA 2XT6A 1XCOA 1IY2A 3RTCA 2WM8A 1QQ6A 2EU8A 1PG2A 3ZWDA 5DCLA 4N65A 3II6X 4XIIA 4EB6A 5M04A 4TS3A 1JFFB 3NWPA 4RH1A 2ZWOA 3UVEA 4ZK2A 1RP1A 3C7CB 5ERGB 2J0QA 1UXKA 1WOYA 2AKYA 2CW5A 4E5MA 2C7OA 3I9V6 1JJVA 3CG0A 3OU2A 3CRQA 1A71A 1H22A 1LBIA 4YV0A 2PGJA 4YAFA 1JDTA 1P0QA 5SYMA 4MZDA 4TV8A 5C7LO 3P0RA 2YJ3A 3V8MA 2UDPA 4AJ2A 4EEXA 2W93A 4MH0R 2V7XA 3L07A 4KRFA 1K3UB 2DYKA 3WWZA 2R66A 1SRQA 3S2YA 3ASZA 3EB9A 1DEHA 5T6BA 4D8WA 2JGAA 3LWBA 2EFJA 2HMTA 4M1SA 2C2BA 2RI1A 3WL8A 5AQEA 3A4LA 4CT0A 1MO5A 1Y4SA 2KB0A 3DV0B 3EGWA 1J6UA 3WGZA 5JPIA 4FMCB 3ZY3A 1NU6A 1STOA 2QD1A 3JQ7B 1IHDA 1JQ3A 1YRAA 4CG3A 4AX8A 2HQOA 1DOHA 4B33A 1GQRA 3QA9A 2ZR7A 3WGQA 2IXTA 5DBGA 4DLWA 2JJMA 4LCJA 1F48A 2AUNA 3D0QA 4ZDKA 1M54A 4GU5A 1Z2PX 2ZRPA 4HFRA 3AFIA 1PJ4A 1UF9A 3KWMA 4XLZA 1U9JA 1PRYA 3S6JA 2FN4A 4QDKA 4M86A 1A8UA 1NRIA 1QLHA 4RY8A 1XZGA 1TVKB 3L7BA 1OASA 2VYND 2RIPA 3W2EA 4IH9A 4TMTA 2O8NA 2DHQA 4X45A 4ARZB 4HB3A 4DLSA 1Q17A 1TCUA 2YZMA 2ZUTA 3SAJA 5JRZA 4KR2A 5K3SA 1I6KA 2I4RA 4FOTA 3JQ9A 2GJKA 4P32A 3W1WA 1ZNWA 1ZOOA 3ZCUA 3E8SA 3C4VA 1Q20A 5H0IA 3JALB 3A3NA 1W85A 1Z16A 2CFRA 3QW4B 4TRJA 3HKBB 1L7OA 4Q48A 3VPSA 4BKPA 4LI0A 4QFBA 3C15C 1P7VA 5T3YA 2IXFA 1V11B 4YJFA 1AA9A 1Y9AA 2WWRA 2JLRA 1EX1A 1W6UA 3FZQA 1M75A 3CHYA 1XLTA 4DAOA 1YKGA 2D5BA 3IUBA 3LKBA 4JJIA 3D6AA 2VDWB 3JRXA 4L9AA 5AIAA 3JZAA 2DFKB 3DTVD 4UUPA 1CY7A 3ANYB 3AGQA 1UCFA 3IIKA 5BP7A 3QHQA 5CA0B 3RT7A 2W00A 1EM8B 4K88A 4BZQA 1FFDA 1X0VA 4EFMA 5DHSA 4N7JA 5I7FA 1F38A 2EKPA 2MWMA 3KKMA 4B0OA 5IBPA 3RWMB 3WIEA 4ZQFA 3RNOA 4CR7A 2Q45A 3ASVA 2O05A 2BGUA 2D13A 1YQWA 2ZBUA 3E4DA 1J07A 2SECE 4MS3A 3RLIA 5CB4B 3DMGA 1FX0A 1JPJA 2QT9A 2BONA 2YXBA 1PT7A 4NZPA 3AEKA 4F93B 3KQOA 1AURA 2JD2A 2TECE 4X7MA 4EUKA 2XUZA 1PP4A 1CR6A 4NAVA 1V8FA 3KVVA 1U5AA 3E5NA 4JP8A 2DFTA 1MA3A 5CDGA 4CM3A 4XCQA 2JVKA 4BFWA 1SOUA 1T5LA 1SCKA 4A8TA 3UA3A 3L1KA 3LK6A 1KVRA 2DLNA 3H2KA 1AKQA 1CP2A 2O0LA 3MF4A 5CXUA 3FE2A 5JNVA 1RM4A 4X8LA 3EARA 3K1TA 1BSVA 4HAOA 5FPYA 1JKFA 2AZ4A 2WPNA 4BNWA 2OORA 1CT9A 1VM6A 3WDLA 3LHIA 2W2KA 2IUSA 3LTEA 4FE7A 4M9RA 4UUMA 2F90A 4ZT6A 3ZPXA 4LOKA 1WO8A 3NRCA 5BNFA 4WV3A 4C5AA 3G0GA 2Q1XA 3QPDA 4UDOA 1FFXA 3BSWA 4MPRA 1ZKMA 4Q01A 5LZ8A 4AG6A 3MWEA 3MGKA 5B2EA 3AY3A 1GGMA 3D8BA 2J0UB 4X20A 3CLKA 3ADCA 3H0EA 2GEDA 4NYIQ 1R2QA 1J09A 1KMMA 5IX8A 4KK4A 2CNKA 7MDHA 1HL3A 3KJFA 3NC1C 3A9WA 1T91A 3BD8A 4HCJA 2N42A 2OZPA 3C43A 2CXSA 3LUJA 1UBTS 4MWCA 4AKSA 5F52A 2V0GA 4ND8B 3R0JA 1BG6A 2HWUA 3OA2A 5EVCA 2G04A 5DNUA 1ZLXA 1U90A 4TQUS 4EYQA 4JEIA 1RKXA 3R6GA 2ZSUA 2AN9A 4QBKA 2SKDA 1SBHA 4PV7A 1NSYA 2E85A 1HMYA 3HJTA 1NLFA 3EPJA 1YJ5A 2ENUA 1R6AA 2WD7B 3OZGA 1RPNA 1K89A 1AQJA 5AKGA 1KYYA 3JQFA 5B58C 1IUKA 1G8GA 1ZU4A 1JWBB 1LCIA 1M1NB 2A84A 4JBLA 1E18A 4UD2A 4ARBA 2MYTA 5KNBH 1AKEA 3A6ZA 3KXDA 5BMVA 1F4VA 3ENZA 5T4EA 3SC6A 3JQ9C 5EGNA 1YTUA 4RJIA 4LN1A 1JLSA 2B34A 2HYDA 5K03A 3HACA 4HGZA 5IULC 2ATCA 5IXYA 2GS9A 2NUPB 3HUTA 2YICA 3E7PA 4OG2A 5HZGA 5HFNA 1VLMA 3GLVA 3EVFA 1BX1A 1TF7A 1XVLA 4JNCA 4KHZA 1Y4AE 1SNYA 4TSFA 5E95A 4YN3A 1OI7A 4B4UA 3NIWA 3P52A 3ECCA 3ZVRA 4KDEA 2XNSA 1NW5A 3LQFA 1BVUA 4IHQA 1H2EA 1K9VF 1QZZA 4Z0TA 4D46A 2YKGA 1GA1A 3OX1A 2EFHB 1C4OA 2GA8A 3WLIA 1MH1A 4GLOA 3TM5A 3AHIA 3T41A 4AAYA 1Q50A 2AG0A 2YQ4A 3PL5A 4OI0A 3ASUA 3HL0A 1CVRA 3OP4A 5MFPA 3KQLA 2RSLA 1E2MA 2J6IA 3KPYA 2J9XB 3LJKA 3UFXA 3PDIB 2IGBA 3IHWA 1R4AA 3AH8A 4N3NA 3R2JA 3REQB 3HKEA 2HAEA 1J2EA 1QUFA 2D0OB 3CZPA 1ZOLA 4F0JA 4AKIA 2PUDA 1Q3HA 3B2EA 3S2GA 3STXA 1JG7A 4G1CA 4H7HA 3RRBA 4RADA 4ABYA 5CD1A 3KS9A 4E30A 3VAYA 4LHWA 5FUBA 1I3KA 3SHVA 1J1ZA 3CZ9A 2WWFA 5EWLA 3RRZA 4Z7QB 1NURA 4ESHA 3OCZA 4L0MA 2PUWA 2ZSFA 4C3ZA 16PKA 1NXTA 4CKBA 4DRZA 4EEKA 2VJMA 3MJFA 5DP2A 2P67A 2JKZA 1LW7A 1I14A 3OAAA 5DPMA 3W5SA 1K97A 4U9UA 3BL8A 2FMXA 1CRQA 1FLAA 3DL2A 3WTCA 5C2JB 3FTPA 1RI1A 2B4TO 3GT0A 1KL7A 3FFWA 2AK2A 3FNIA 3NB0A 4IOJA 3UUGA 2CDRA 4OI4A 3TRDA 3VNBA 2CMGA 3EMDA 2HB6A 1MV5A 3D64A 4LE2A 2QX9A 1ZONA 4MRRA 1Z4MA 4A0HA 4C7JA 2YBDA 3QXXA 2UYYA 4Y2RA 1LV7A 3BWCA 4KXMA 4PYOA 2PWPA 2OL4A 1P5HA 2BKLA 1H69A 2O50A 2Q62A 4IL5A 4OHKA 4YDQA 2R84A 5GONA 1PYDA 5JHHB 2Z95A 4YPOA 1KK3A 3CRVA 2FU5C 4KRYA 4RGYA 4UAJA 2G83A 3Q2IA 5I45A 1EJBA 1CE8B 1V41E 2PL9A 1E20A 2GESA 4LWZA 2OGUA 1NYRA 2WUGA 1BGWA 1II8A 3JQFC 1EX6A 4MS1A 5EP4A 1ST2A 5EZ5A 5B3AA 5B57C 2XVXA 3HVJA 4ARIA 1UT6A 5KJ6A 1I7DA 3AX6A 1JE0A 1ILWA 3M4JA 4Y0NA 1JDNA 2NZXA 4GVXA 2XOEA 4O4IA 4DCMA 4OGFA 5DF1A 4X61A 4M0EA 4XA8A 5AOCA 2BDEA 5KIAA 5BMVF 1APBA 3BVPA 3TLXA 3PFNA 4CJXA 3GHYA 1T8RA 3QPUA 4P7BA 3UANA 5KX5A 3LT2A 5TMDA 2FZ4A 2Z6VA 4MQMA 4AN1A 4JJ8A 3GAMA 4Y0VA 4QJ3A 4D3FA 2JAPA 4FE4A 5AVZA 2NZYA 2JI4A 3LQ1A 4HJXA 4R1UA 4C0XA 1X1TA 2I76A 4BRSA 3MXTA 4TRRA 1IZZA 1MX3A 3C7KA 4LMRA 1RKQA 3JRWA 2IOQA 2YJNA 3AR9A 4MB2A 2VJCA 4UM7A 2NO7A 1Y7HA 1VKHA 1OB5A 4ZVMA 1T4BA 2OGWA 2VXYA 1H23A 1Y3DE 4HR7A 1MJ5A 3AHDA 4OYYA 4WPGA 5AYVA 1X9HA 1NY6A 1P39A 4WJKB 1NIJA 3ZY2A 4E88A 2WSBA 2XKBA 5U1PA 3O1HB 3DR3A 1C41A 2D2FA 4B3HA 4P0TA 6REQB 2CXPA 5JMWA 1FFEA 2RARA 2WJ3A 1A2QA 5J4HA 3R40A 2WIJA 1KDRA 3TNDA 5HZMA 3FCCA 3HVHA 4M7PA 1W30A 3A2MA 3FSJX 4QSMA 1V7ZA 2F4VB 3FX2A 4PZAA 3BRWD 3EF0A 3OPVA 1PV2A 5CA1A 1QKIA 3T3EA 1MHPA 3FHOA 4IM7A 3UUEA 2X86A 1LBHA 2AG5A 3QBDA 1JN0A 2A3NA 1SPXA 4TRNA 4EZIA 5HUJA 3GLSA 2QY6A 1QG6A 2H54A 5L3VA 2HIHA 2PGDA 3KXLA 2WTUA 4M6WA 4F3RA 1N2BA 2OQVA 2PUAA 2OYCA 4ZJPA 3ONEA 4FEEA 1R6VA 1RPZA 4BV3A 5LJIA 1E9DA 1Y8CA 2OFXA 4KQMA 4PLWA 1MC1A 4OQZA 3GLGE 1PR3A 1XRLA 1WCIB 2ZTHA 4MUBA 4P93A 1AUXA 3M9LA 1AKTA 2VUUA 1FVOA 1GTMA 2Z5VA 1I3CA 3PX2A 3N2KA 4TVSA 3D3KA 4W8OA 1TPZA 2HNBA 3SKVA 1F14A 4XW2A 3IOEA 4EDFA 3DQQA 4EW6A 1HYGA 3C4QA 4A27A 4DY6A 3LCRA 2XHZA 2IUFA 2NVWA 3PSAA 4OLJA 4EELA 2IXAA 1GG9A 3QH4A 4BVFA 1M2HA 2QR5A 3QI7A 3VPHA 4H7EA 1OQAA 2ZE7A 1KH3A 1US8B 3AEUA 4JWTA 2EW1A 4GRDA 4TV9A 2GTPA 2I2DA 1X1SA 4JJFA 5E4JA 2J3MA 3N87A 4P4UA 1Z73A 3PVCA 1AJEA 3I37X 3IAS1 2X0FA 4PCAA 3PBKA 4KREA 5HK8A 2FSVA 4JUBA 1LRLA 4FEGA 3CLUD 2IODA 4Q4HA 4RLQA 3AV3A 4Y2PA 3UJAA 5BURA 4KSYA 1EA5A 4NYMR 3WBJA 4EB3A 3BL6A 4J2OA 3GIWA 2GYWA 3G9XA 4QRHA 5K0SA 4ZCQA 4PQFA 4YLYA 3QJGA 3WGVA 3MJEA 4JYAB 1VHWA 1OBOA 1VZ2A 1P2UA 2RK4A 3L7CA 1OWNA 1XN1A 4LPSA 3ZN2A 5L6LB 3HZHA 4HGPA 2Z98A 2BEVB 2AJ8A 1ZD4A 3P2IA 2O5EA 1H5UA 1PWYE 2WLTA 2ODPA 4D3ZA 4K6OA 1GIAA 1XQXA 3ZHOA 5CDYA 1MN6A 3WQQA 4R8SA 4BUZA 4FS3A 4O4IF 5ER6A 5ALMA 2VK4A 3UOAB 4JR0A 4NTZA 5EWMA 3OF2A 2LE0A 3H42B 1S3SA 1T2CA 2QRVB 2JGMA 3MRTA 3OFSA 1AZLA 2CMFA 4R01A 1OH6A 3ED5A 5KX5F 3JQCA 2WYWA 4U1RA 4GDFA 1GPYA 3HWX1 3QEOA 1DRKA 2W6QA 2YJZA 4I9FA 4IJ5A 3B52X 3TQCA 3EG5A 5AK5A 5JBIA 2NNWB 3DA8A 3L4BA 1P7PA 1FXUA 1T1IA 2HJRA 1NXSA 1PJZA 4LRUA 4NU6A 1EINA 2W43A 1ZH6A 2XECA 3MM4A 1E5VA 3RAEC 1PEDA 3D2AA 3EEYA 4UFPA 1IN5A 2ATEA 1Z82A 4I5IA 5CVVA 1JVSA 2RHDA 1WG8A 4U6NA 2IH5A 3DYVA 2Q4RA 3DZDA 1OFGA 4XLLA 2RCNA 2BUCA 1KAEA 4YJGA 3LCMA 1GYRA 4Q6WA 3CX8A 3LDGA 1OTXA 1CRLA 3X1XA 1Y34E 1NF8A 3T5BA 1D2EA 2H8KA 1NJ1A 4LJRA 3D81A 4DUGA 4ZAXA 1KORA 1A8IA 2O8BA 2RHRA 4PSUA 1AUPA 2RGBA 3ICWA 3MCAA 3TBFA 3MWLA 4AJKA 5K8CA 2QK4A 3RROA 1KOFA 1DV2A 1RYYA 3WJ7A 5FYQA 1XQ6A 3IE2A 3OQVA 4UXJA 1KBOA 3UWMA 2K4MA 1XZJA 3VR2D 5CA1F 5A9SA 5KNCA 5T3UA 1DFIA 5JCJD 4XWOA 3U6KA 1O0BA 3PICA 2G7MC 1KI7A 1NI4B 4ISCA 3ICPA 4M1TA 1JA0A 2BFOA 3A4NA 3A6DA 4AC9A 3H1BA 3W3AH 5JWOA 1FBNA 5DHQA 2X0JA 5ELLA 5KWIA 3IJPA 2XJ4A 4DEXA 3NHPA 2CY0A 3EY9A 3LZCA 3E3MA 4KR6A 3HADA 3EOBI 4K40A 1FC0A 1QQ5A 4ZV7A 1SU8A 2PCJA 1WXHA 3NETA 3ZLUA 3D6HA 1N2CB 4YHHB 1CEEA 4D4GA 2B21A 4FHCA 4MVXA 2XEDA 3C0KA 3HYRA 4KAXA 3ZWCA 3GDHA 2GASA 2JI6A 2WHYA 3WP1B 1D6NA 4WASA 2BMAA 3H5TA 1CNEA 2YTZA 1SQ6A 4ZCIA 4DLVA 5F12A 4US1R 1P5FA 3NEAA 4I6JA 5U4QA 1KMIY 2V6IA 4TV9F 3UJ6A 3O0TA 2LCFA 2AEJA 3LT0A 4NZMA 1I4EB 4EOGA 2CFIA 2IL1A 2YIJA 3GVIA 1P31A 4GBED 4L3WA 2JGKA 2J85A 4J0IA 1RWQA 2XXBA 3F5FA 3HY4A 1X7XA 4EH1A 1N5OX 1LJ8A 2RC5A 4P3XA 2A0UA 4M0MA 3QOFA 4MDFA 1X42A 1GCGA 4XPZA 4LXUA 4E1AA 2G1PA 3WZ2A 3IALA 1JHUA 4PIVA 3VA7A 4IXWA 2ECPA 4TWIA 3EGOA 2JCVA 5JNUA 4ZAFA 2ZCJA 3SCZA 4QA9A 1WXXA 5BOSB 3FPLA 1AUOA 2PQ2A 4Y1RA 3TNLA 3V7FA 5DNCA 4DUZB 1P7YA 5AUPB 4F2WA 3EMBA 1G8KA 3NRBA 3RU3A 3S28A 4BNKA 4DNOA 1RLMA 3CNLA 2YXNA 2QD5A 3OJLA 1TJ3A 2XWQA 2XV1A 3CX7A 2PSHA 6Q21A 1H4VB 4H16A 5HRAA 4KBFA 3U44B 2R6HA 2WG0A 2F55A 1NPTO 3BGOS 2NO1A 4S1TA 3EIQA 5HXAA 4ESOA 5FB3A 3BHNA 1XZEA 2OM6A 2OSBA 2PRSA 1JJAA 2QM3A 3LQYA 4TLBA 1FSGA 1XHFA 1IOZA 2QVYX 2R65A 1FYFA 2QN2A 1PK8A 5M34A 3L7YA 1JEAA 2C1ZA 3I39X 1NDHA 2I7TA 4FCCA 1W25A 4O2BA 1T5TA 2YOFA 4G0VA 3JX9A 1E0SA 3IBCA 4LY9A 3FDIA 3OCWA 1ZL2A 2RFLA 2WUFA 4H17A 1G2IA 5ALEA 4BVKA 2VDKB 2DGDA 2P5UA 5TIIA 2AE1A 3GG9A 1Z2EA 3LGSA 3DBHA 1TB4A 5GZ6A 3A9VA 3N2YA 5DYWA 2P9EA 4S35A 4AJHA 2VH2A 3A6GA 1G64A 4WX2B 1KTVA 3SBEA 4G85A 5ALDA 2Q6LA 3OURA 4CVNA 2ECKA 2YS6A 3B6MA 3EQ2A 3PE6A 1YB5A 1ETHA 1Y7TA 2HFKA 1WP4A 3H11A 1J2JA 3GEGA 3NIGB 2AH5A 2YZNA 4II2A 3VPDA 2FJPA 4C78A 3H5AA 1FA9A 2IV7A 4DR1B 3MGGA 1VIMA 1OBFO 2O1EA 2RHWA 5CUQA 1QCZA 2HK9A 4NQZA 1RAGA 4ZANA 2VQFB 4CV2A 3N8HA 1NVMB 3GC6A 4IH1A 3U7JA 2GCGA 3WKCA 1ZCJA 2P9CA 2WE8A 4I81A 5J5VA 3VU8A 4MGZR 4YRRA 1G21B 2JGRA 5C18A 2ZS7A 5BSTA 1K7YA 2BELA 4TTVA 2VP4A 1L5KA 3R8FA 1H0HA 2NYVA 4TLAA 4CHGA 2NTVA 2IKQA 4GR9A 4NG4A 1N5LA 4B6EA 4K8OA 3N76A 4KE7A 4LNAA 3EC1A 5TQJA 3TQIA 1YJCA 4D3YA 2WE7A 1H8ED 5JFGA 1DHRA 2A94A 1DNPA 2UXDB 3ZHXA 2XVMA 1Y8RA 1N9GB 1ZD1A 3BK2A 4HB4A 1KJQA 4KYVA 3KSUA 2D5CA 4UHDA 2O8EB 1O96A 1AX9A 1F7UA 2WW8A 3K0SA 1MPXA 4ERXA 2ZTLA 3DMNA 1TIPA 3P2OA 1TZ2A 3GEMA 4OB7A 3PEVA 1L5LA 6YASA 2WJJA 4ZI7F 2A5JA 3VUFA 2KSQA 4QUAA 3PF9A 1ONNA 2J6CA 4QT0A 3SXPA 4Z3DA 3K9FC 2OK7A 1OXMA 3ETLA 3TJMA 4AP5A 2QMUA 2ECQA 3ET4A 2NM0A 3KYCA 5F77A 2OP0A 4N3AA 4XPIA 4JP2A 4AF6A 1C0EA 1UBMS 3DEIA 4RD6A 4JXXA 2WKRA 1X7WB 3MTBA 3OFNA 1HH4A 2ZJ7A 3H86A 4R2IA 5LB2A 4BJ5A 3S0JA 3BF7A 3SBDA 1KWKA 1C30B 2FFBA 1ENYA 3PIIA 1M34B 4RV5A 4YIKA 1WBJB 1JLLB 1EX9A 1V3TA 1XAJA 4IINA 4M87A 1RXCA 3I34X 4JLVA 5EIWA 4JUCA 1CUSA 1AHPA 2ZIEA 1GQFA 1KETA 3TD9A 3O3OB 1UK7A 2QMHA 3OWOA 3T7AA 3Q12A 4BMOB 2PUEA 4XWKA 2PBFA 1SGWA 4UBMA 1G8SA 3HBFA 4TMZA 1Z38A 2OCPA 4Q16A 3PL1A 2BTOA 2X1VA 4REOA 2C4MA 1PHRA 3JATB 4GZLA 1UWLA 1OHHD 1YC2A 1Z6XA 4OL0A 1KYVA 1J06A 1YNOA 1FUEA 2QM7A 3WRYA 5HX7A 1C1DB 3W5HA 4PLGA 1FTYA 2WU1A 1FMCA 5K6AC 4LFBB 3TGWA 1CV2A 2MMCA 3SJ7A 3FFTA 5GOTA 4G84A 8ADHA 2MYPA 3BA1A 3NQ41 3VDRA 1NN0A 1Z28A 2IY7A 2RGEA 4WZ6A 4HSGA 2J67A 5GOZA 1RAIA 1F8FA 3TSCA 1DIHA 2R7LA 4BBAA 1RADA 1TQHA 2XIQA 2LPMA 1OD6A 1VHTA 2BMWA 2FA9A 2NSHA 3JWIA 4CL3A 1TYCA 2P0EA 3P9ZA 4BNXA 1YZQA 3L8HA 3SSNA 1NRWA 4MIEA 4RY0A 2AJCA 4FYWA 4XARA 1UEXC 1V5IA 1PR6A 2VDUE 1GNSA 5C8YB 3GXOA 5E6SA 3K30A 1P2GA 5K3OA 1TM5E 3DMPA 5DIZA 1I32A 1YZYA 3L1VA 4Q1DA 2IEIA 4YRNA 2VRCD 4JJZA 4PE5B 4LXQA 3GJQA 4XGKA 5C1DA 2O0HA 4YRFA 2EKLA 4AKHA 1KEWA 4JC5A 1IUPA 1P29A 1UH5A 4Z4HA 4F9GA 3N6RA 4B0PA 2MSCB 4C08A 1EP9A 2FPIA 4D5GA 4XOUA 5I9IA 2YZ7A 2WTXA 1RYDA 1AK9A 3R3JA 4G9EA 4QVKA 5EXDA 4KPGA 4TMWA 3T7DA 3UK2A 4L5BA 2WP0A 3ILHA 1N7JA 1D2AA 2V45A 1A96A 4WQMA 4EJ0A 1NJGA 3WGOA 4EG8A 2ZW9A 1MA0A 4GG1A 4HC4A 1P7ZA 1K8QA 3DVSX 4I66A 3F47A 3U9TA 3NALA 1T3LA 2HMAA 2IA5A 3LQKA 4GF5A 3SHQA 3SJBA 2GF0A 5CB0A 3OEYA 2FP3A 3NS7A 1LV8A 8AT1A 1CLEA 3RVDA 3BMQA 3SC2A 3I2FA 3IDQA 1HT3A 1C29B 1DKPA 3CW2A 3GUZA 2P2CA 3D5TA 3ZXUB 3FOZA 1KI2A 2C9OA 3FF4A 4ZHQB 1M0WA 5F21A 5JAZA 1O3YA 4QE3A 2VSXA 4MUFA 4G25A 1BMDA 4QGFA 4E2FA 1JJ7A 1J7JA 4R69A 2FE1A 1WV1A 3N2ZB 3K71B 4DBLC 1KY5A 2Z58A 2VPYA 1L7AA 5DTQA 3LF1A 2JDID 4W63A 1XF1A 2QP9X 2D0PB 4BNDB 5BSVA 2QX4A 1FDRA 2IEZA 3KSAC 1LFAA 4N0PA 3WNCA 4JBWA 4P08A 2Z83A 3H84A 1WMAA 2QW1A 2VXBA 3FPCA 4ENTA 2N1MA 3CLSD 4IP0A 4DZRA 4M89A 2AFVA 1SY7A 1XD9A 3VHQA 2DX7A 3VTZA 2PKQO 4BVGA 3W9SA 3RW9A 3DFFA 3OP1A 4FNOA 1PR2A 1X74A 2Z57A 2D1SA 1VLQA 4IAOA