3KUUA

Structure of the pure phosphoribosylaminoimidazole carboxylase catalytic subunit from yersinia pestis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
NSAYAAGVKIAIVMGSKSDWATMQFAADVLTTLNVPFHVEVVSAHRTPDRLFSFAEQAEANGLHVIIAGNGGAAHLPGMLAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILALHDTELAGRLAHWRQSQTDDVLDNPDPREEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase catalytic subunit P
publication title Structure of the PurE Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit from Yersinia pestis
rcsb
source organism Yersinia pestis
total genus 49
structure length 169
sequence length 169
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2009-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 3kuuA00
2FW9A 4YCCA 2FW6A 2FWIA 4ZJYA 4AY3A 4ZMBA 3ORSA 2FWAA 2FWJA 5CTJA 4B4KA 5CLGA 2FW8A 5BORA 5CLFA 3OPQA 2FWPA 2FW1A 1O4VA 1D7AA 2NSLA 5CLJA 2FWBA 2YWXA 3LP6A 5CLIA 2FW7A 5CVTA 1QCZA 4Z7JA 5BOSA 5CLHA 2ATEA 3KUUA 3OOWA 5C5DA 5BOSB 2H31A 3TRHA 2NSJA 4JA0A 4YCBA 3RG8A 1XMPA 3RGGA 4GRDA 4AY4A 2NSHA 4ZC8A 4YCJA 4YCDA 4ZK2A 1U11A
chains in the Genus database with same CATH superfamily
4DLUA 4EJSC 4BWVA 3OVMA 1MABB 4KIWA 5H3HA 3NAGA 1PWZA 3V4PB 2WT4A 3Q0TA 2OBXA 3CBQA 4Z54A 1U2SA 1B2LA 4L4XA 2FR8A 4BKRA 1ZGBA 1I36A 3SXUB 2VF4X 4GNKA 3D6HA 1NP3A 2V6BA 4LXYA 3I64A 5BXQC 4QUKA 5TGZA 1PEKE 4RYDA 3R7AA 2P3OA 2QTLA 2R6R1 4H7HA 4F96A 3DE5X 1Z74A 4E4YA 3VJLA 1QIJA 3ZCUA 4F5WA 3I2FA 3AR5A 1DJPA 1Q44A 2PRKA 1BCSB 4BE7B 3QXGA 1LTKA 2FR0A 2LGJA 1N6RA 4JC5A 4WX2B 4RTLA 2J3IA 2NW6A 3UICA 1YZNA 1NULA 2FWIA 2H9AA 1KEEB 2OBBA 3B51X 2Q41A 3KQPA 3OFVA 4M0MA 1KDRA 2AZMA 1E9DA 1G60A 4ICIA 1HLFA 2XXJA 1FNNA 2N9UA 1FDRA 2HT6A 5BQFA 2H92A 5IMBA 1ZIYA 1YUNA 3JV7A 3EW9A 1J9ZA 3TTSA 1Y89A 1Y9AA 2BKAA 4G89A 4V24A 3BMOA 2BBOA 2BGWA 5AI8A 3FNQA 3PEVA 5F4BA 1IUKA 1L8AA 1QIMA 2C04A 3R5XA 8AT1A 1FZQA 2XPCA 1KJNA 2OPHA 3UM9A 4B79A 1P74A 2C20A 4DQVA 2OC4A 5CBKA 1JA9A 2XB8A 3SJ7A 1GV0A 3MZ0A 1ISJA 5LMCA 4O4JB 5B57C 1OFHA 1N6PA 4LIPD 3PB3A 3Q40A 3MNFA 1FFBA 5FPYA 4BP1A 2DLCX 2VXBA 3K8ZA 4BO9A 1JIJA 5CLGA 4ZAWA 2HHCA 2ZRAA 1YZFA 5KYUA 5LB4A 4BY9E 3P9CA 1AY0A 1PGQA 1A76A 1VGQA 3H16A 3U4IA 4OMCA 2VPWA 4DNXA 4KAXA 2X14A 1ORWA 4DCCA 3AY0A 3LA8A 3OCCA 4Z51A 4V38A 2FZCA 4I55A 3AR8A 3V4SA 2IYZA 3F3YA 3S40A 3CX3A 3R0ZA 4TUYA 3EC2A 1KYIA 3HWWA 4FFDA 4XYGA 3KELA 3RSFA 1BMFA 2VL7A 4AO7A 1BN7A 1HG0A 3K09A 4F84A 4MW0A 1RQRA 4N12A 4C7KA 1GPLA 1R9MA 4O6VA 4IJMA 5T4FA 1E7MA 3WHIA 2SECE 3AZPA 5CCBA 1W36B 3AP3A 1BH2A 4FOPA 1T9ZA 4ZD6A 4GZ3A 4L8FA 4NG5A 5LDDC 3B5EA 2B82A 1L3BA 2H7VA 1TYDE 1QH9A 1QZZA 3I8SA 5DRYA 4NY1A 3DO8A 1GPH1 1W49A 4ALIA 3M9LA 1I6MA 1KVSA 3K0FB 2JATA 3PGA1 4XFKA 3IP5A 5I45A 4EJFA 1L4BA 1OWNA 2DVMA 4YNBA 3W9UA 2JGFA 3HDJA 4AT1A 2MSNA 3P94A 4XVRA 5NLLA 3WGYA 5HVNA 3C8MA 3BMQB 3RJ9A 3K30A 3VR3A 3K2EA 1QGUB 2VTDA 1Y6QA 4X44A 4YPFA 1T6ZA 3G9XA 4DC9A 1UMDA 4DUPA 1T9GR 5EJMA 3Q2IA 2W22A 1VDMA 2PXAA 2RHGB 1BWRA 1KYWA 1JG1A 1QUEA 4IIJB 4U7GA 1NPYA 3TO5A 4YT5A 4P3PA 2Z2ZA 4XB1A 4CLEA 3HXQA 2OP1A 4QRDA 4ZXFA 1IH8A 2X5JO 3NWJA 1UJ5A 4BFLA 5A05A 5GADl 3DTVB 3HLYA 3KZVA 3LG2A 4HB2A 5WRFA 5KSOA 1BJTA 4R7ZA 4GMGA 2QROA 1JALA 2DF8A 3ILHA 4MVJD 4QC2A 1IN5A 4G26A 2C1EA 3ZOZA 3A37A 2DT8A 2C2WA 5F5LA 2VA8A 1XXHB 4B4OA 3GLSA 4WLFA 1L6IA 1XDZA 4JLVA 3RU2A 4WKOA 2YFHA 5I48A 2ZJAA 1GTL1 3E03A 3GOQA 3KZMA 2A1UA 2GEVA 4WZBA 3N7AA 4YRNA 2IWHA 1J2TA 1XPOA 4BNFA 1QS0B 2Q6KA 3F5SA 4QGHA 3EGXB 3KYIB 4YQYA 1EEXB 2XGOA 2Q3CA 1PQUA 1Q1ZA 2E6KA 4KXFB 2ZM5A 1ZXLA 3A0UA 1Z5WA 2VP6A 3X1YA 3COJA 5CYFA 1TO6A 2HJ9A 5KNDD 1U8FO 2BDUA 2PQMA 3TQCA 2XUGA 4PTLA 2XNJA 3R6TA 1KDZA 4XJSA 5KWIA 1DG1G 3FX2A 4DCMA 2V0CA 1IDOA 1K7EB 2D5LA 4JELA 5C1OA 1Y98A 1HEUA 4DOMA 1MQ8B 2E85A 3CF2A 5BNWA 3LSYA 3ECSA 3IX7A 3V97A 4FJ1A 4BV9A 2GEBA 2MHCA 1OZGA 3MPOA 3VYRB 4ZYUA 1BXRB 1DO8A 2YH2A 1FZTA 5KX5F 2O3TA 1V7PC 3HXTA 1YS6A 4HLNA 3OTGA 2BJHA 5I7AA 2VZLA 4DWJA 4FEAA 4N9WA 2DOKA 3EMDA 2P9GA 3FRIA 1KI4A 5HKAA 4EPTA 2PQ0A 1VP3A 3GD5A 3UYLA 1FFHA 2FV8A 1KDTA 2KLHA 3EZXA 4G8DA 4Y67A 3VYSB 3OPNA 5JCZA 3ZHUA 3GG9A 1NPDA 2EF0A 3H5OA 2ZI5A 2RAVA 3PTLA 4JJEA 4KE6A 3NBFA 5EFOA 3NV7A 2PUBA 2E4VA 5C34B 5T4BA 1PJZA 1WF6A 2QPLA 3NYQA 1XTIA 1U2TA 1PW5A 2WPDD 4A16A 1DQYA 4ZYTA 2Z8ZA 3QVLA 3WB0A 1RTKA 1YDEA 2J31A 3WO0A 4DAOA 4MR8A 4UTOA 4CKYA 1IMOA 2R6HA 4MPRA 5FOQA 3WIVA 2HSDA 4QO7A 4AMZA 1JB1A 1BRTA 1JP7A 4V39A 4F2WA 3OWOA 2WINI 1FRQA 2C57A 1A27A 2NLOA 2GN1A 3MRTA 3OTHA 4QPPA 5AW5A 4I3HA 3OLCX 5CA0F 5JZBA 3SBXA 1UDRA 1JKIA 1AS2A 1XV5A 1EFCA 2FWNA 2GXSA 2FPIB 2HA3A 3GL9A 4OSEA 3WL4A 5AUPB 5KU1A 4EB6B 5L6MB 2P75A 3RTEA 5I9IA 4FZ3A 2O8DB 3HVRA 1Q77A 1CULC 1MJHA 2RHMA 3FPFA 4GX1A 2ZJ0A 4N7BA 1XTSA 4IO0A 4YMWA 1WB5A 2NU7A 3DE6X 4JGBA 1K0UA 5B4VA 3U7GA 3SX2A 2HA6A 3C5CA 2HJRA 5DYWA 2J3HA 5KYWB 4HFMA 2DHCA 2G28A 2VZ0A 3TL6A 5KMGB 2QM8A 4H77A 4LYFA 3WGTA 3QA9A 1XZFA 4BXOA 2XOKD 3QEKA 4PX9A 2GHRA 4RYLA 1CJBA 1U4NA 4BP8A 1UQTA 1MDBA 1YQXA 3E23A 4PYQA 4Q3CA 4X00A 2JH9A 3C87A 1LPOA 1ZOSA 1D2AA 1T2DA 2B83A 2EYUA 3MT9A 4P6VF 3QXCA 5JDCA 3OURA 5ICEA 1RXEA 1YKGA 3Q7QA 4OA5A 4W9MC 3TOVA 1SJ9A 1WL8A 4GO1A 3VNBA 1DEXA 3S3TA 3CJRA 4AXBA 4DLYA 2UYGA 1NN0A 2ZBFA 4Y0VA 5JCJA 4OI1A 2A8YA 2QE7D 1A0OA 4IYJA 4MH0R 4NBTA 1KMHB 3D1VA 5ESDA 3WLAA 2NMVA 5AJZA 3K8QA 4NKRA 4A03A 1XNRB 1NV8A 1AMOA 3P71T 3WLRA 2RH5A 5LUBA 2B8NA 2VPPA 1IB6A 2EEZA 3G49A 3N59A 4U9IS 5DPMA 4BKUA 2ZE6A 4DQDA 2BL4A 2W6PA 4P4SB 4LJ9A 2XXAA 4LJKA 1E6WA 2HWWA 3X2SA 1KE1A 2AKEA 2ZEJA 2EKPA 4B6OA 3ETDA 1XMPA 2C2XA 2WM2A 3ASVA 3HLKA 3I76A 3PGMA 4U2BA 3BHNA 5AI4A 5JADA 5CDSA 4YWHA 1SBIA 3RU9A 2J7KA 1VLMA 2Q6LA 2Y1WA 2AFHB 4G5HA 4YPVA 1AT1A 3ZZNA 1U4OA 4MUHA 4Z99A 5KNCD 3WGKA 1I3CA 5GZ1A 2JA2A 2ZRJA 4NICA 5B1DA 5K8IA 1DS6A 3B3AA 2QVYX 3PQ6A 1RKQA 3G7SA 3NHPA 1N1MA 3DUWA 3MTIA 3OKPA 4QPCA 3V8EA 5KINB 3ANXA 4KWIA 2JLUA 2QJWA 2C3PA 1SU4A 3QHQA 1Z47A 4RU1A 4FGSA 2GGSA 4RH3A 3K0KA 3GF4A 1VIVA 5LYJA 1EBBA 1ZP6A 3JWPA 5T6MA 2J7PA 3GEIA 3VR2A 4JK3A 2IS6A 2OKCA 1V9LA 4Y3UA 4YR7A 5AW0A 2BHTA 4F3NA 3WA7A 2EP5A 2FEWB 2ADOA 3GROA 3HDTA 2TMKA 3CMCO 1WXWA 1SQ6A 3I01A 5K8VA 1ICIA 1NXSA 4YJ3A 1ZW6A 3TXXA 1YQEA 2GHTA 4JEUA 4NYMR 4WNIA 3RS3A 4YCCA 2K4MA 2CXNA 3I37X 4S12A 4MZXA 2WQ6A 3KQYA 3C8DA 5K6AC 4EB8A 1E4EB 4FZJA 2CLOB 3IMCA 2GBLC 3TNYA 1IY9A 3GARA 5HZGA 5LP6A 1IN1A 4H35A 3TLGB 4OBBA 3SIPA 2A0YA 2R1VA 2WZBA 4L75A 4Q12A 2Q5EA 3KAJA 1RJGA 1YC5A 2XW6A 1K63A 3QWFA 4YP7A 2X77A 4GVLA 2O1SA 4J9VA 1JN0A 3BFPA 4JENA 4ASUA 3REQA 1YJ8A 3RIHA 1JKXA 3KXPA 2N47A 2E7ZA 1ODLA 5FA5A 4ARBA 3GGJA 3AFHA 4JUBA 5EXDA 1XTUA 5J59A 1YONA 3K92A 4M9XA 4XUGB 1ZPDA 1FFXA 3GJ8A 4PU0A 4CM5A 4AG5A 5HRCA 2X76A 1WR8A 4X7MA 4LK2A 4FYJA 3FGPA 5FI3A 2NZUG 2ZYGA 1PVOA 2H5JA 4R8MA 2QTCA 4RKWA 4ZWNA 1S8OA 3WQSB 4M7OA 2FQ1A 3ZDQA 4E07A 3IAS6 2P4SA 1E32A 2XUQA 4ZP1A 1Z6TA 3DO5A 4I9NA 1X6VA 3TOSA 5I7VA 5LYYA 3FKSA 1EFHA 4EAQA 4JWTA 5AVRA 1DAPA 2QAJA 2I91A 3JY6A 3ZY2A 1IIBA 1Q0PA 4HRAA 2PZBA 1DIRA 4QSMA 5BNIA 1JDVA 2NUTB 1F8YA 4BX3A 2HPZA 1N5DA 1W94A 1Z2EA 3L4JA 1P77A 1W48A 1I80A 2LTAA 1EXDA 2X8JA 1M6NA 1E2KA 3EEBA 4DCJA 5AJWA 1UFKA 4AROA 4Q16A 1KEUA 1FX1A 1YK1A 3RVMA 5JBIA 3VA7A 2ZYRA 3F2IA 4UHBA 5F3DA 3HXOA 3HB9A 4OQPA 1IUNA 1EMDA 4CMJA 2WYVA 4ND2A 3LS2A 1DC6A 1G6OA 1HLPA 4W8GA 5D1NA 3TDMA 2OV3A 4WA7A 1I10A 1K08A 1FP1D 2MMCA 2QPTA 3DE3X 1OPRA 1X2EA 2C4KA 3IB6A 4X1OA 5BW5A 5AVYA 4DB2A 1W76A 2CWDA 4MVJP 1M2GA 4N3AA 4IDNA 3GMTA 5BT8A 2CD7A 3IGFA 4EZEA 5KDLA 1YBHA 2W6IA 4FOOA 4HAWA 1SCAA 821PA 4QNRA 3M2PA 4NYIQ 4C2TA 2VOJA 1SRQA 1CQIB 1M6VB 4NOJA 4C29A 2LDXA 5A7GA 1Z5PA 3OIYA 2PR2A 4KMOA 2ES4A 3ELUA 1E2HA 4L72A 4ERXA 1B3RA 2P5YA 1XPRA 4JI7B 2CXTA 4B5LA 3WMGA 1JMYA 1EM8A 4IUDS 1VPLA 2RKWA 3UOAB 4B32A 4ZC1A 3IURA 3L0SA 3LDFA 3TTYA 4P7BA 4DRXB 4RVNA 4LNHA 1R6BX 3BXHA 3PDHA 4REQB 3ZWYA 4BNYA 4P3YA 4PZEA 3HPQA 4AB1A 3UPUA 4MIKA 4Q6BA 4RA6A 4YV0A 5JRZA 2CBXA 4MDEA 1TC2A 1UBOS 4Z9BA 4ATNA 3K5HA 2I29A 2V7QD 4IMRA 2QPAA 3NHFA 4GE0A 3N0VA 3RSZA 5C8YA 4YIHA 5K4AA 3FAZA 1KP2A 3P9NA 2FFHA 4HAZA 4I14A 1LDBA 1JSXA 2QYHA 3IESA 2P3SA 3ZXIA 3UEOA 3RWBA 5U9CA 2PFKA 1AXEA 4MI6A 5AKLA 4NFLA 2FDCA 4DY4A 4BO1A 1BHJA 3IKJA 4DCGA 1PN3A 1NT4A 1PJ4A 1US8B 1EGHA 5J2UA 1MG0A 3WJAA 1LPMA 1T8PA 3VC2A 4GKJB 4LVUA 4AYTA 4RLSA 1I2AA 3QQPA 3REFA 5F9HA 4HWKA 2QUHA 4GXQA 1Z45A 1OXXK 1LQ2A 3OOYA 3WDKA 1LVHA 2ZRPA 1ONNA 3VYTB 4J2OA 1EFPA 1COWA 3A04A 4YRQA 1C3JA 2BLLA 1U1GA 2OHJA 2V6MA 2VDMB 4C5AA 5FNVA 5JCXA 2DETA 121PA 4IJWA 3TNJA 2DHRA 2PX3A 1EU1A 2ZBPA 4QVGA 5TF4A 1QAQA 1Z5NA 1A2QA 1E4YA 2CZQA 2W2KB 5T7BA 4C03A 3O9VA 5IKMA 2A1TR 4CMIB 3RSQA 2ZJBA 4OV6B 2ZBVA 2E9SA 1SBHA 2DR3A 4OMUA 2Z1NA 1OLSB 3LLUA 1AV6A 3Q0EA 4XIYA 2C88A 3WYAA 1GOTA 4XIGS 3P4XA 4RIFA 1UAGA 4L8GA 1DC8A 2XQGA 4AG6A 3U19A 2OBNA 2YMLA 2C9MA 3T38A 1FCJA 2IIPA 4KQ2A 3UUFA 2JLVA 2KW5A 1SG0A 2GZ3A 2BBWA 2XDYA 1XWIA 3VKFA 1CT9A 5B6JA 3COWA 3RVKA 3I2JA 3DYBA 4H0CA 3WICA 3K20A 2Y68A 1YRWA 3EC1A 4OBXA 2JFVA 3TG8A 4LRWA 2L18A 4MTCA 2ZYTX 2VCHA 5EAIA 3RV3A 3HJGA 3O7WA 4FHGA 1FU7A 1DIAA 3CKLA 1YJAA 4Q0MA 4F2PA 4QXOA 2QTZA 3FWYA 4Q4LA 2B6HA 1XELA 2B4TO 2X8AA 4AF7A 3QFTA 2IHVA 2JK0A 5AI0A 1QNFA 1H6BA 3AO0B 3G2IA 1SBNE 5IVKA 1G6KA 3PQFA 3OBBA 1CZHA 1VSQA 3BIOA 5EESA 3ZHQA 1HMYA 4CR7A 5ITSA 1PS8A 4UM9B 2H16A 3IDQA 3E7XA 1T15A 3RGWS 2MT9A 1QHGA 3PKIA 3B48A 3R7NA 1S2LA 1ZL2A 4QVKA 1U04A 3C5EA 3PPXA 3M5DA 5EWMB 2EATA 1G8FA 4E14A 1E3MA 4NZPA 1WXHA 2FWRA 3JQ7B 3O91A 4DC1A 1XK6A 5JMTA 1QQAA 1Q1AA 3HO8A 3QKSA 1NVEA 3CZAA 4WZAE 4KRGA 3CNEA 1F2VA 4LSMA 4UAGA 1UZMA 3E5NA 2CJFA 1ZICA 4MPTA 1Q7TA 4UHHA 4AWBA 5LJIA 2G67A 2I2BA 2DJIA 2D5CA 3H4TA 3HJNA 2XAUA 1OSNA 5C3UA 5DO9A 4A1OA 3HXPA 1W6UA 3CEMA 5CW2A 3VYUB 4LJ4A 5L4LA 1XZLA 4IX1A 2D13A 3AIOA 5CFPA 2W7TA 1OZFA 2YOGA 3AI7A 3RK1A 1DL5A 5IZCA 3AM5A 3R3VA 4LWQA 4MQMA 1YI1A 4DB4A 2FPMA 4DDHA 9LDBA 1C7EA 2JLYA 3U7HB 1GZ7A 2BFMA 3DD1A 2JARA 1Y37A 2R4QA 2H08A 2RH9B 3E1GA 3G5MA 3GJ3A 3BWEA 1D0SA 1XIVA 1KEVA 4HDAA 4PWYA 4Q66C 1GZ5A 2PX5A 1W0KD 4PBTA 4A27A 2GBIA 1X74A 3T0GA 1U2DC 1GCOA 2ZUWA 4YDQA 3DEYX 4O3FA 5EIBD 2X1HA 4NMLA 1N77A 2B8EA 4N1AA 2P8JA 4EVSA 4L2IA 2NO7A 1XEAA 3CH5A 1NDUA 2R7NA 1KHHA 2OXCA 4IKEA 5F1YA 2Q1UA 521PA 3S2SA 3A2MA 1M8KA 4PQEA 4Y2SA 1XTPA 1YQGA 1YOVA 2HXGA 2CBGA 2COEA 3L8EA 5CJ2A 4EA6A 3AF6A 1SBTA 5KX5B 2Y6VA 4EJ6A 4XUDA 3O90A 1YRHA 4QUAA 1EDDA 1PSZA 1Y1LA 1M1ZA 4HNVA 3KJZA 3KXIA 4FUTA 2KLBA 5HA5A 1ZJ6A 1RWKA 4KUEA 1E3JA 1U90A 2PGNA 3ZE6A 4L0QA 4DIMA 4UHCA 4I8IA 1E20A 2I3BA 2QTWB 2XCQA 5T57A 2I5PO 1DOHA 1MZPA 4OP1A 4TV9A 3C3KA 3O75A 4UVDA 3RF7A 5AM3A 3LUJA 1HZZC 5FPSA 5FDFA 5LKAA 1VPVA 2JGMA 4X6LA 2A0FA 3L8HA 4IDDA 2OG2A 1P44A 3EZYA 3VKVA 3DLPX 1CS0B 3NWPA 1IQRA 1H0KA 1ESDA 4ZOLB 5I9BA 4EUNA 1C1XB 5BWLA 2WSBA 3E27A 4K6OA 3U3DA 3HSKA 3IP9A 2WNIA 5CA0B 1UODA 3BF8A 1F1BA 1XJCA 3IT1A 4JUFA 1YFLA 3QFFA 2J0UA 2JVKA 4LA4A 4DSTA 3PDIA 4BU0A 5FOUA 1N0IA 1XVUA 5I4KA 2IEZA 4KW7A 4R01A 1RAIA 2L19A 2HDWA 3AC0A 3IR5A 3R6LA 5DYNA 4EH1A 4GMXA 2BMEA 2YDYA 1D2RA 3OLZA 3A1UA 3RUIA 3T35A 1OI3A 3R3SA 3NTLA 3OPYA 5JSHA 3R8FA 5JEDA 3FNEA 2AWNA 4RIHA 4UBMA 2QMEA 5AHOA 4AL4A 1GGKA 3PQ2A 1JHPA 1V45E 4P3NA 4TN5A 1H3NA 5JNWA 2R4TA 3AOEC 2A94A 1OXBB 1O95D 4DV0B 2H1VA 3GPBA 4IVNA 4E4RA 4EJSB 3VR1A 4C08A 5B55A 5HS4A 5LQCA 3GLGE 4CKWB 2GXQA 1O94A 3G2PA 3IKMB 4C89A 4GR4A 1MAUA 4NBKA 2W2QA 1Q0QA 3OLVA 1E1YA 3ZYZA 1IVYA 1LLDA 1REQA 1QORA 4RH1A 1SUFA 4MUEA 5DEIA 5EZ5A 3RSSA 1U28C 3L2OB 4BECA 4NBSA 1S2OA 3AVQA 3UO8B 1ZJWA 4TSFD 4RHFA 5DI3A 1CD5A 3USCS 5EE3A 3TW4A 1G21E 4JC4A 3AVUA 2LE0A 1DRUA 3MC1A 2XTMA 1PYOA 1UDXA 5J9FA 3H1GA 3BB4A 3CX7A 4MW5A 4DMUB 1P7CA 5IAOA 1XALA 2Q4DA 3LX6A 5E1DA 4BAZA 4ENRA 2I3AA 3BCHA 2HQBA 2W8BB 3V3TA 4AKGA 1SUEA 4KPUB 2ERCA 4CPDA 5CVJA 2EFEB 1ODJA 2HO4A 2IK8A 2BCGY 1BEZA 4PO3X 3TDKA 1SWWA 1JLLA 3RS4A 1PS0A 5FA8A 5LD2B 3NYIA 1ZN9A 3CE9A 1YB6A 4F6CA 2B99A 5HHTA 1CZUA 2WMOB 4KAAA 3BSYA 3OCYA 4TMZA 4UD6A 3D3JA 3MCAA 3W8DA 2O8CB 3FMGA 4K3UA 2GXAA 2BEUB 2O7SA 1AKWA 2QLNA 1OQAA 2PXCA 1XTZA 4XVHA 1FUIA 4G1CA 1W52X 1DKRA 5FOXA 1AM4D 1C7IA 1E62A 1P5RA 1XNJA 1ZJZA 4HB3A 4O4LB 4ZVOA 4WY2A 2WIFA 3C6ZA 3PD0A 4QM6A 1H2FA 2BEJA 1QDEA 4P7KA 3ZY5A 1ML4A 3HVIA 3NC4A 3D81A 4DRYA 1HFJA 1N2CA 1YBAA 2NUPB 3ADPA 3GEEA 4OXKA 4IHKA 5IH3A 3CUVA 1N2HA 4JLBA 2NU9B 4BWFB 1EUQA 2B7LA 3BDIA 4FFSA 3WSVA 2D2FA 3L6RA 1XN1A 3E7PA 3F6EX 4LFCB 3EX7C 3CE6A 1TM1E 5ECYA 4DR3B 1C7QA 1U8EA 4BMZA 3UAYA 4EF6A 5ITZA 3JQBA 3DAOA 3W1WA 4IMJB 2XCSB 3G9ZA 2IBTA 2O50A 3MMNA 1PV4A 4RE6A 1ZJ4A 3PGJA 2LR0A 4JLJA 3DHEA 3SIRA 1WXEA 5EYPA 3R76A 5CA1F 1WHSA 2F43B 1BKSB 2HLPA 2DTXA 2CWWA 2R1UA 2HTEA 3PGVA 3S7TA 3GUHA 2IDKA 5JYEA 1G66A 1Q6ZA 1UKEA 2O1XA 2VJCA 3EWAA 4HFJA 4MQ5A 5BQOA 3TI7A 5CYPA 3KD3A 2I80A 5DBEX 4NU8X 2DP4E 4I0WB 2AQIA 2QHXA 3H13A 1CEEA 3OUZA 1K7CA 3A3KA 2PX6A 3P2EA 3V4VB 2IBMA 3ZY4A 1L7RA 4MUNA 4Z86A 5B6PA 2Q9AA 3JPWA 1THTA 3V34A 4GI3A 3LHIA 1HRDA 1NVVR 3D0KA 2HLNA 4YQZA 2IYRA 3I39X 3KFLA 5CYGA 4C0WA 5DNUA 2V7EA 3IDOA 4NHOA 4WKCA 3MSCA 4MYTA 5KKCA 1KPIA 2BWJA 4IOJA 1XTQA 2BISA 3IR7A 4JP3A 1FSGA 1L5OA 2PZFA 4HGZA 2QX6A 1K68A 3WGGA 4L28A 4NENB 3D6NB 3B53X 3ENVA 1Z35A 2VPQA 1J21A 1CXZA 1KFCB 1CDOA 3K1YA 4HNAA 3MOGA 1TJNA 1BKYA 1RJWA 1EB9A 1NP7A 2ZE5A 3NBYC 4UNSA 1U0HC 2F1RA 1SKBA 4AVYA 5I7RA 2JJ2A 4JIMA 4D4GA 4AP9A 1C3OB 1F9AA 3CPSA 4CL3A 3QZUA 3W5HA 1ZCFA 2FUNB 2AXPA 4BLVA 5BUQA 2NZVG 3LP8A 4NU5A 3TBHA 2XKJE 4PCLA 4OSOA 5HQ3B 2CL7X 4AZWA 3EUWA 2UYYA 3HKEA 3SZMA 4GZ5A 3S81A 5DK4A 4Z9FA 2JGDA 5JAQA 4CEIA 1KKUA 2FF7A 3KYDB 4ARIA 3MTEA 1ORHA 1ULTA 2AG1A 2ISSD 3QX3A 3V8MA 1HE2A 3Q3GE 5JJLA 4QOHA 5LMUB 2QAIA 2AKYA 2O8EA 1TRHA 2XGMA 7YASA 2IX9A 2V7TA 1BA2A 4WK6A 1RYZA 1XZKA 3S1SA 4GLBA 4NE9A 2ZS9A 4GOJA 5C8VA 5KOIA 4AX8A 4DPKA 1QVZA 2CMKA 4MJLA 2EFCB 2C8VA 1XP5A 5AIAA 5ITVA 4PYNA 4X1IA 4PCVA 2NZXA 2WSLA 5A3QA 2QMZA 1NLZA 4LJYA 2UZ1A 2G4LA 3ZHBA 1V4VA 2ANCA 3KCNA 2J9FA 3S6JA 5D6NA 1VE9A 2J85A 3DVSX 3EPLA 4PIVA 1PZEA 2BFPA 4N8EA 4C6SA 4N0PA 2NXJA 2DWOA 2WWXA 1QK3A 1N92A 2HHLA 2QL5A 3IVRA 2HBQA 4WPGA 1E3DA 2C2HA 2M98A 3EQ8A 1E7YA 3VZBA 3MN1A 2VJMB 4ZI5A 4EJ2A 3AI3A 5DJ5A 1FW8A 1CLUA 2GYUA 3DBLB 2PSDA 3OIVA 5EQJB 2PL3A 2V59A 2QB5A 5ALNA 2JAWA 4TS9A 4KMRA 4PRYA 1QYVA 2QTGA 3E8MA 4PPGA 5CAEB 4AO8A 4OMDA 4C0XA 4UMEA 2A58A 4LZJA 1ES9A 1ML3A 2G09A 4I8DA 1XKTA 2R6GA 2PRIA 3RFXA 4EW3A 2Q5FA 1FSZA 4RPLA 4ZZ0A 3SWWA 1PKEA 2Y1OA 3WZMA 3VISA 5EE0A 2Z43A 5J63A 3SXUA 1DWQA 3U4HA 1FDVA 3ZGLA 2K2QB 4M8LA 1KQNA 4KQJA 5H9WA 2WIDA 2RH8A 2ZJ4A 3B6MA 4KGXA 2VK1A 5DMXA 5LLDA 4TVBA 2G5PA 5EKTA 4ITVA 2UXBB 2AOWA 3DGEC 4YO8A 2IEDA 1YV9A 1O57A 3ESYA 4OB7A 4DM4A 1BGWA 2JLRA 2ZUVA 4PSAA 2O20A 4FW8A 3W04A 3PUKA 5H0IA 1RHJA 2XQJA 1T3SA 5ESWA 4YFYA 1M6HA 3P2KA 4Q7MB 1L4HA 5DLDA 4JKOA 3T7IA 1NYQA 1EG2A 1TZMA 2F17A 2CK3A 1NBHA 4P9NA 3W8EA 4ZICA 4J8PA 3ECCA 4YMIA 2W5UA 3KOMA 2P9JA 2PIAA 4V0NA 4BMVA 4JCCA 4N3GA 2I3ZA 1PLLA 1Y3DE 2JGAA 2JJ1D 5JSKA 1RE0A 3KNZA 2JCYA 4R2HA 4YDHB 4J1SA 4QOJA 3LOUA 4GQAA 5LJLA 2DFPA 3OSUA 5DIFA 2PPLA 5DTQA 3M4XA 1XA3A 4N7JA 2Q5OA 1RLJA 4E31A 1O96B 5AJTA 3DC7A 1R0YA 4LXHA 4YROA 1EVYA 3H2ZA 5I9MA 4EI2A 1W5SA 1SIWA 1WMBA 2CNDA 3ORQA 3FWZA 2FEKA 3W6NA 2H57A 2OFXA 4DHEA 3IIIA 4BNKA 2QVZX 4O4JA 4CR6A 3I62A 3U7QA 2EARA 3BA6A 4EI8A 3IPRA 4RCVA 1XNGA 3MJSA 2FOXA 1EPUA 2PUHA 3SMQA 2OFPA 4UTVA 5D84A 3U09A 5KNBA 2XMDA 3A6DA 3NEJA 4E15A 3INRA 1FDWA 4G6ZA 4NYJR 4PO9A 2H9IA 1L4FA 1X8LA 4Q01A 5CD1A 4ADSG 2NTYC 4JLUA 3P4YA 2JRLA 4IJUA 3VDQA 4P2BA 4BCCA 2Q1SA 5DNCA 3OIDA 1YMUA 1D9XA 1LPPA 1XVAA 1OH6A 2OZLA 4MUIA 3H5WA 1Y1PA 2HPAA 2A7XA 4OHUA 4QREA 1L5NA 3WXMA 4X54A 2BTOA 2MSCB 1CEXA 3TZHA 3W5UA 1QQ6A 4FLFA 4OQDA 2VJNA 4U7PB 2JLZA 2IYPA 4HTFB 4PANA 2WM8A 1H3FA 2OWEA 1PD0A 1M1XB 1E0DA 3EVDA 4K9QA 3MGKA 3ZTTA 2NZJA 1CCWA 4QAQA 1DRWA 5E6RB 3WG9A 2CE2X 2AMYA 2YZKA 4IF4A 3BRWA 4TL9A 1SU7A 5CT6A 2ZIAA 1G41A 1GL7A 3B9PA 2GTHA 3W2FA 2J33A 3HMQA 1VECA 4V0RA 1HBJA 4TV8A 4UUPA 4LTDA 1FC0A 3K0FA 2LV8A 1PJ2A 1ZMBA 2VWHA 2WTNA 3B78A 3Q5EA 1YB7A 4HDCA 3I9NA 3INGA 3WKCA 3NETA 2W2OA 4DG8A 3CLUD 4NESA 3WIDA 4BKPA 4CG0A 5K2OA 2JHAA 4LKOA 4XWTA 4E22A 1LK0A 1QGUA 2OQ2A 3KSDO 1G16A 4DDUA 2YOFA 5CUQA 1EFRD 2R6JA 3FIUA 4ZCMA 1H0SA 2VYNA 3GP8A 3UMMA 2OY0A 1U0BB 5CIWA 1ZRNA 3N39C 4WERA 1QRUA 1Q57A 1DWOA 2IXAA 4P33A 2WSIA 3N8DA 3NJRA 4MP6A 3BHMA 2C4HA 2W0MA 3IKVA 4I9HA 3I34X 3VU9B 4QBHA 4MRNA 2PANA 4ZRNA 3SJZA 4QJ5A 4HO1X 4JYCA 3FI0A 4MI9A 1K6XA 4J91A 3Q7RA 1NVUQ 2ZIGA 5D00A 4BVHA 3CV3A 1ADCA 4TMXA 4QKQA 1JEYA 3P7MA 4O63O 4Q24A 5JXJA 1XXHA 4Q9KA 5TRTA 1ZH0A 2DUNA 1W1IA 5K3CA 2QUKA 4ZGGA 1J2UA 1GPDG 5CFZA 1JI0A 4CQMB 1D1QA 1OXSC 1KAOA 1V9SA 1QS0A 1QIGA 1Z75A 4DY6A 1VE5A 1YAHA 3QVSA 4E3ZA 5D3MB 1V96A 3N8GA 2ZROA 2YW2A 3WGMA 3IBTA 1WUHS 1DJLA 2AG0A 3FNBA 3ZOKA 4JB2A 1LDMA 2WB2A 1EK2A 2D62A 4FOLA 3PNLA 5JZSA 3PRHA 4IUCS 4YRAA 5K0FA 1L4UA 1EJ6A 4EQZA 3JU3A 2WF7A 3WOHA 2HSWA 3VH4A 1E2EA 4IHJF 1PSDA 1NWHA 1W8DA 3CXRA 3R4CA 3RHFA 2PUFA 3PWTA 2FTKE 2VSOA 2XA1A 1S89A 4UXIA 1HV8A 1CR2A 1QFMA 1YQWA 1BXRA 1GQ2A 2ADMA 1SVSA 1CUXA 5JZMA 5IARA 4C4PA 1CJKC 4GBMA 4IO1A 2G07A 4JQOA 1MN6A 4XR9A 2DFNA 3A27A 4JWKA 5JVDF 4CL2A 4R3NA 4D9JA 3H97A 4URVR 1ZGJA 3DEAA 1EXWA 3ZWVA 3ACDA 4UUBA 4BNHA 2GBCA 4MKHA 5KTMA 1M75A 3EARA 5DHRA 2G7ZA 1P4GA 1ZN7A 3BIJA 4GIBA 5C80A 4DLBA 1N8SA 3HCAA 4KDFA 1SUAA 4WNCA 1TXGA 1RQNA 2O14A 3H0CA 2A57A 4ND5A 2J8ZA 2OVBA 4MARA 4NOMA 5JLAA 1DMRA 5GV7A 2VG8A 4FJ0A 1O6BA 2AG6A 4X64B 2EDCA 5FWDA 4BS9A 1M2KA 2FW7A 2H4WA 2Q07A 3HVKA 3PL5A 1B0AA 1G4AE 2BGJA 2YVKA 2RHHA 3ASUA 3H3FA 2V7XA 3ZW8A 1YJQA 2PX8A 3GJSA 1OX4B 3QKRA 4RO0A 4REOA 1HLDA 1TU0A 2GK4A 2ZIFA 3EIUA 1DBWA 3EQ2A 3LFHA 2C1XA 4O4IF 1PI3A 5LU8A 1ELOA 3GZJA 1XRQA 2V7WA 3DKIA 2OGTA 3EIEA 3O6VA 4YGXB 1FNMA 4IQ4A 2EJTA 5CT4A 1F6BA 4WBNF 3BD6A 3OJWA 4R05A 2ZAGA 1UK6A 3LO5A 3W90A 4UAUA 4DV6B 1D2NA 1FEZA 3ZU2A 5DM70 1RQXA 5I7EA 2RK6A 5KYWA 2RKBA 3LCVB 1BU8A 3AETA 1VJ0A 3NHJA 2UKDA 9ABPA 2A33A 2FZEA 2P68A 2XNKA 1LS1A 2JCBA 1P5JA 3NBUA 4HZUA 4INZA 4Q3EA 3LGSA 4Z3KA 3JARA 5COAA 4PBSA 1BDIA 3K16A 4G01B 2GN6A 3PXEA 1DGQA 3A4TA 2X0KA 3CBGA 4DIBA 2BZSA 3IUEA 1KGSA 2OHGA 4M1YA 2XMGA 5K0CA 5CH8A 1GG5A 2IKQA 1GADO 1D0VA 1G5FA 5B1EA 2UYOA 2V9CA 4TM7A 5J5AA 3GJTA 4E5VA 2WHEA 4L5AA 4ER0A 3A6EA 4P84A 4F91B 4URWR 2O5RA 4HGOA 4A6DA 4F11A 5K4GA 3FOZA 2J3MA 2VQDA 3V8VA 1JQ5A 2REQA 3D3NA 4WFIA 3QJYA 5CX4A 4XE5A 2GJ8A 3QE4A 4LI0A 3RTDA 3AEQA 4N7RA 3VJKA 1KK0A 4RXMA 4EO4A 3ENKA 3R2JA 5I7HA 1M3SA 1E2JA 3CRMA 4I36A 4WGGA 4UPEA 3AUAA 1XQWA 2AF4C 1IFXA 5FJJA 2IS1A 2HA4A 4GS5A 2CHFA 3O2JA 3OAAA 1AZWA 3ZE9A 5KSWB 3G5UA 2GCEA 4G07A 2WPNA 3UKJA 3TIGA 3DWEX 5K0ZA 2I7CA 4Z53A 3B85A 3AR6A 4OHXA 3DL2A 3SC3A 4A26A 4BTEA 5KBYA 3TECE 3C6YA 4F8EA 2CLIB 1PDVA 2VQSA 3ZPXA 1I9GA 3S8EA 5C0OE 5I4BA 3V32A 3BD8A 2XDWA 4KYVA 4BNDB 1W44A 1CUEA 1XZCA 1E0KA 4CFZA 1U5BA 2VYQA 4GOLD 2QUZA 2VAXA 5JXHA 4M1MA 3RSOA 1M6EX 3FTDA 1M1UA 1U0FA 1VE3A 5LCXA 1D4AA 5AOCA 2HQRA 2XF8A 3P0JA 4MW4A 3T3GA 1L5QA 1XVVA 3AIMA 4S2UA 4EF5A 2C7PA 3I9FA 1X7XB 3AERB 1RYYA 1W0CA 4KGDA 5FYDA 4L4SA 5UKDA 4DJAA 1JYSA 4RZXA 1O97D 2JJQA 3GHYA 1IN4A 1FYEA 3M6MD 4EEXA 1DKPA 3HB4X 1KTVA 4JMLA 4XM2A 1NQUA 1G1AA 2BKUA 3UW3A 5C1PA 1E4EA 2GS9A 4CIAA 1DAHA 1NQWA 3MWGA 1BYIA 3TFWA 5ARBA 2JASA 4PXYA 4Y2HA 1C9JA 4MVJG 4ZU6X 1TQ4A 4WEQA 3R6DA 1VXOA 3OUTA 5C1BA 1POWA 4JJKA 1GSIA 2CN1A 1A77A 1XDUA 4QUJA 2XUIA 1C9DB 2WICA 3CRNA 2UVQA 3PR2B 2C2BA 2OPBA 3K8YA 3ORHA 1AG9A 1WABA 3MRXA 4PVCA 3BMNB 3HJTA 2BMAA 2CEKA 4MUFA 4TMYA 3KYJB 1B93A 2HREA 2YWHA 4BFTA 2JJ8A 5K0BA 5AOVA 1IXSB 1FVFA 2HKIA 3PHLA 2NX2A 3WFZA 5BV2P 3PDUA 1TVEA 4TSRA 3BXOA 2RJNA 4DT1A 4HQ6A 1G59A 1J56A 3NASA 1OV6A 4KQGA 2JFHA 1R74A 5TXGA 3EVNA 3OJXA 1C3XA 4GI5A 2YL2A 1N9GA 4UU0A 1SQFA 2NUTA 2FX2A 1DELA 4BLPA 1QP4A 3TTUA 3W77A 3T6KA 5K3OA 3SEFA 3C7DB 2IYYA 4JI6B 3ZVLA 4M99A 1TMGE 3DNMA 4CODB 5C5DA 3TW6A 4V1CB 4Q93A 3QM1A 5BUSA 3NOOA 2YC4C 3RU7A 4C4TA 4DV5B 2YYZA 4AO6A 3ODGA 3BCRA 2IYLD 1IBCA 3ZV5A 4EBFA 3EEYA 4MIOA 2PJZA 3UGTA 3IILA 5JBNA 2PBLA 1KJYA 2DCMA 4QBIA 1ZXBA 3MS4A 5MF6A 2QBYB 3IUPA 3A9UA 3ZLTA 2JFBA 2VP3A 3HN6A 3A6JA 3GG2A 2QN3A 3VVMA 4YRBA 3MA0A 4AIIA 1YHNA 4FIDA 3AQIA 1P19A 1U7UA 3LC2O 5JCOA 5T6BA 4JFRA 3Q5DA 4W6QA 4C3ZA 1IK4A 2PSSA 1C9EA 3LX4A 1HT2E 3N2KB 4OB8A 4AJHA 2D59A 4CTJA 2AYXA 3MSXA 1F4LA 3WHLA 2FPUA 2FMFA 4HTAA 3TM4A 5CVTA 1BE8A 1R6AA 3QVMA 3ZHSA 3BE8A 2P6RA 1CQIA 1M6VA 2JGRA 3H2IA 3NUQA 4MS3B 3U4GA 3VYVA 1PT7A 1A97A 1K6MA 1PDWA 4NZNA 2EWVA 3QWBA 4K0RA 4S1TA 4GSLA 2BFEB 3Q87B 4MQLA 4P81A 4YCDA 1N8NA 4W5HA 5ALUA 1UWLA 2R751 3UMRA 4BZXA 4Q3LA 4UASA 1X1BA 3LWZA 3PA6A 4DJDC 1TK9A 5EOVA 3Q98A 5J2TF 3U0VA 3WRXA 1ESMA 1RRKA 2CC2A 3FKJA 4HAVA 1F0NA 1I6WA 2CNNA 3JQAA 4GQIA 1XMQB 4XM1A 3U7JA 1QZ3A 1JDSA 2R97A 2CLMB 3NRJA 1XJWA 3N87A 2EJUA 1THZA 2XJ4A 3GY0A 5BRNA 5CFLA 1GTMA 1Q0SA 1OH8A 1QRRA 4GHWA 4HRXA 1E3TA 4ISCA 4TRJA 2R8RA 4WAUA 2ODWA 3QFSA 4D9IA 2HGSA 1NBMD 1DJQA 2Z83A 3G6WA 3RVQA 3EA5A 4HDNB 2QRVB 1X1RA 4QQ8A 3I45A 4OD0A 1E0SA 2LP4Y 1A8IA 2WJ3A 3UG7A 3ZUPA 2HPHA 4U39A 4QU9A 2OAGA 2WJZB 4ZT6A 4H7KA 4IILA 1U3CA 1Q50A 5JAMA 5HE9A 3QU7A 5PNTA 2F1JA 1PNOA 3BIWA 5CCXA 3UMSA 3EEOA 1ICEA 3M6FA 1V0JA 1YRQA 1ETUA 1OJLA 1M8JA 2XADA 3NW9A 1UR5A 1M0SA 5DXJA 1J1ZA 2BY4A 5C52B 3WY9A 5L40A 4P7JA 2J9XB 4I4CA 3OZXA 2PS0A 1XMOB 3L04A 1D3AA 4AZ3B 2C31A 3PEFA 1NQXA 1OOEA 3OCVA 4K9SA 5JSQA 4OHZA 2W2KA 2WA1A 3QMVA 2XIQA 5HPYB 3U9LA 5CCDA 1NMZA 1ZJJA 3KDSE 1YNSA 1KI7A 2W48A 2PZAA 2XRYA 4DAEA 1NBAA 1UC5B 1H93A 1HDYA 1OF1A 4WMLA 4RIIA 4CMIA 5IXJA 4HDRB 2TYSB 1ULAA 2W2LD 1W0JA 1OLSA 2A4KA 1QYDA 2FW9A 3VRHA 4BVBA 4QUDA 5LMNB 4LDRA 3JQFA 1G9TA 5CT9A 2FWJA 4Z0NA 4L4YA 3TX2A 3PD7A 1JZQA 3FCEA 1FMCA 1IN7A 4RSHA 3PD1A 1IQUA 2A14A 4Y0NA 3SQDA 4B3BA 4X61A 3BDAA 1HYHA 2DWCA 2TS1A 3MWKA 2GZAA 3U5ZB 4M1TA 2JFQA 1CDDA 2VDWA 2ZS7A 2ZYSA 1F6WA 3QGMA 1L4GA 4IOKA 2ZIEA 4HN9A 2IKSA 2WTBA 4PIMA 4WASA 3R20A 1SEVA 4LVCA 4MV9A 2VDOB 4W63A 2HEIA 4PLCA 4DV7B 1R8JA 1ACLA 5DCYA 3THXA 3RR2A 1E5LA 1GQRA 1L5MA 1D6JA 3GPDG 2GK3A 1N2GA 1UBCA 2XMSA 1T2NA 1TA9A 2ZB2A 1RMTA 1D2CA 3L0YA 2NO9A 4JA2A 2X0DA 1BS1A 3WISA 3WK5A 4JJFA 3GEMA 1J0XO 1EAYA 4B4VA 5EIFA 3LT5A 3MPUA 4LYEA 1ESCA 1PSWA 2G82A 2RCNA 3OKCA 3VYWA 3WGQA 5HQTA 3QKWA 1FLVA 1SC9A 2J6HA 4UTZA 2VT6A 5FL7D 3UMVA 4CUJA 3KR9A 1OB2A 1PYGA 2VQFB 2PX4A 3ITEA 3WA6A 1CHDA 1VA4A 3U44A 3JQ7A 1R0ZA 4F6LA 3M6LA 3PIDA 2ZJ3A 5L3VA 4YTEA 2IRWA 3UIEA 5BP7A 3NMUF 5AW7A 1D9ZA 4TQAA 3PQ3A 4NF2A 2WKSA 2AUMA 1J1UA 4I3FA 4IV5A 3W34A 4F2DA 4M0CA 3PITA 1BMFD 5LB2A 4WKPA 1VE1A 2QT0A 3SP1A 3FCUB 5AKIA 3ZK9A 1AGPA 3PNPA 5KVSA 3T06B 1N9ZA 2CJXA 4RHTA 4UM8B 3UK7A 4YA6A 4O25A 1ADBA 2R48A 3BB3A 3LJKA 2LNDA 3WAKA 2P2SA 4H7FA 1GKKA 3AHJA 4YI5A 1O4VA 2ID4A 2IY9A 3NGLA 1J2RA 3WYDA 5FFFA 2F3TA 3L1KA 4A7PA 2Q8QA 2Z8YM 1KZ4A 3TLZA 3AH8A 9MHTA 5B7NA 1RWBA 5BSFA 1KWKA 5GMOA 3EAFA 4JD5A 4XIJA 2EL7A 3D0QA 4XGNA 2X0RA 5JR3A 3AL2A 3U3MA 1LBEA 4IHJB 4XH9B 2N3ZA 2YNMA 3KHTA 4K9NA 4ZGWA 3OU6A 4Z9YA 3QFRA 1QH1B 3HU2A 4M1WA 1UBEA 3JS5A 3IR6A 5KX5A 3CZ9A 2ABWA 3L77A 1PUIA 1WXFA 3M1IA 3VU8A 3M8KA 4G9BA 4AJKA 3IT0A 2ZJ8A 4NS1A 1ISGA 2Q21A 3EDYA 4TGLA 5BRAA 1DINA 2GLUA 2J3EA 4K86A 5HK9A 3SVLA 1TTQB 1Z2PX 3ZI4A 4ALJA 3W3AA 4I9UA 4PFSA 1QPZA 5JXGA 4K3VA 4YB8A 2VJQA 4B6FA 1Q7CA 2J59A 2W6JA 3OTOB 4OJNA 1SKQA 2IE8A 3AL3A 1TB4A 1WSBA 4LV6A 4PR3A 4NPHA 2QUAA 4BB6A 3QW2A 4IQFA 4QNMA 4BJ3A 4PQYA 5L4SA 4PRLA 1FP2A 5IJZA 3WAGA 1KOJA 4RJJA 1USIA 3MBOA 1Z37A 1HDCA 1N2ZA 3BQ9A 4IG9A 2BZ1A 3F5FA 3LQRA 2QSZA 2YR0A 1TK2A 4MYRA 5EE9A 1T3HA 1X39A 3P45A 2IHTA 1S3GA 5CA0A 1ORIA 2GETA 4O4IB 5A3JA 3OJ0A 2C0PA 3CUWA 4DRZA 2Q4EA 3A4LA 2BGLA 3Q1KA 4MQUA 4C4SA 2AX3A 2VDUE 3GDFA 4JLAA 1DKMA 5CFNA 2QP3A 1BHQ1 2QK4A 2RK3A 3IUBA 3K1AA 4GMKA 5CLIA 5J4VA 3A6LA 4XCXA 4BNTA 4WBNB 4FCCA 3QOFA 3KJHA 5SY9A 1T2UA 2QR5A 4MO9A 5KTPA 4F3TA 2ZWVA 4KPGA 1HURA 3KOZA 1A9TA 1NLMA 3PI7A 3TQHA 1PGPA 1E4OA 1LLQA 2J3JA 1L8OA 5EFZA 4BZPA 4DJFC 5AXBA 2JIRA 1AQLA 2HJGA 3B70A 4R0VA 4ZVPA 1UPFA 3L0OA 5BQ3A 3T5BA 1PFKA 4PBRA 1AGXA 2YXPX 5BYJA 1JQBA 4EG8A 4WRRA 2HHHB 1DHRA 3EXEA 4C07A 3P9PA 4N5DA 5TQ0A 2PNFA 4CKWA 2ZXEA 1WA5A 4ZO6A 2GBGA 5E95A 4ZDJA 3I04M 4RPKA 3AMVA 2CVOA 4X85A 4PRKA 1JR3A 2BSXA 2MR6A 5KUTA 2P40A 3V42A 1JUDA 1KAMA 4D3SA 3JR7A 3G5LA 3IULA 2J46A 1AXRA 3N9IA 3SYLA 4G0UA 3IBFA 1QHYA 1ZGZA 1NJ5A 2WU1A 3EQZA 4YJHB 4UTPA 1VSUA 3ZV3A 1MKYA 3D7SA 5FQNA 3RYCB 3PVZA 1SUDA 1ESNA 2DHEA 2W93A 4BAUA 4ZZ2A 2ZW9A 1ENOA 3FE2A 4KPUA 3ROPA 5BSVA 4D6XA 1NPTO 3ADCA 3G6KA 1T5SA 1DADA 4D4LA 2GESA 5B5SA 1IWBB 1KC1A 1YCHA 5JAIA 5IASA 2GMWA 4OQLA 4URUR 5CEJA 4BNVA 4DWOA 2JRCA 1VIMA 2HRCA 1NVDA 2PX2A 4IAOA 1SQ5A 1RNLA 5FHQA 2ODNA 3IUJA 3RRNA 1X77A 1OBOA 3ZV6A 2C9CA 3ZXYA 5ICMA 1RJ9B 1VB3A 1EQUA 5IAAA 4EJ0A 4WIAA 5KTSA 2C2MA 1BQEA 3RUAA 1SQSA 4WQMA 3RODA 1DRKA 3VXKA 3LZDA 3IAM1 4JA0A 3TSAA 2FP3A 1V11A 1TCAA 4ZT2A 5AVQA 4Q7JB 5FCDA 4JHXA 4JR2A 5EJEA 4G0NA 4IIHA 4B3MB 3E7DA 1O8BA 4IOLA 1OT5A 1VFPA 1UUFA 3UBTA 4CM8B 1U6KA 1BROA 3KDAA 1C7RA 1ZEMA 1DAFA 4QBTA 1NQVA 5D51S 1S3IA 1C80A 1JMKC 1VLLA 4C21A 2OT3B 3HKCA 4HQKA 4I4TF 3TOCA 4F5EA 3UPDA 4EKNB 1VHLA 2VYVA 2OCBA 3NDIA 1M1YE 1J49A 1NTOA 1YHZA 1ZH6A 1X1EA 2EFGA 4DFDA 5EPEA 4KSBA 2VF5X 4DZTA 1RQ2A 3PFFA 1SB9A 3FG9A 3KM0A 3IPXA 1FQKA 3H0KA 5EJAA 2F43A 4AQYB 2NO0A 3O4JA 4MUMA 3T3PB 2RC6A 1Y4DE 4URHA 5JRJA 3W8NA 1E99A 1U0NA 4BQIA 1FY2A 3NVMB 4F9FA 4D0LB 4IS2A 2P9HA 2QV7A 3DZCA 2XMRA 4ZV4A 3HYLA 3X1ZA 1NVFA 4MGEA 1NY5A 1PR9A 2EX4A 2BE9A 1YA6A 1P7ZA 2Z1MA 1ZVVA 1ULZA 1XD9A 2VRWA 4Y2PA 3ZE2B 1WMEA 3CONA 5I51A 1HG1A 1ZVMA 4ENPA 4F4DA 1WDWB 2O2YA 2QM7A 4UQOA 4RCZA 3SBDA 5EIXA 5SYAA 4F6RA 5ADVA 3CN9A 3PEUA 3SSOA 3PFCA 3J7TA 1I2BA 1L1FA 2P41A 1QAMA 3ZDEA 1SXJE 4L02A 1XYVA 621PA 1OIWA 3C3PA 3MJ4A 2DQKA 3VZDA 1CP3A 2R11A 3RUDA 4TYQA 3N0XA 4YUXA 3VI4B 3KPJA 1VTKA 3E4DA 3VTFA 3ZI7A 3L8ZA 2GUWA 2QZPA 2YVUA 1U9IC 1PUXA 3GVIA 1XKLA 1X9GA 4BN4A 1XD2B 1ISFA 1OYOA 2HLHA 1B8UA 2X9VA 2ZIWB 3LX5A 4MWOA 3UJ3X 3ZZTA 3FZQA 2IYQA 1CIJA 2BFFB 4MV5A 4XVQA 3OP4A 1M5RA 2AE1A 1BHO1 2HWYA 4MMXB 4UZFA 4H6WA 1YI0A 3CN7A 5HQ3A 3R9XB 4LHZA 5IP5A 3B2EA 2OGUA 2V7GA 3BKWA 3OHSX 4IDQA 3VAZA 1E2UA 1K5GA 1BJRE 4BU1A 3OEWA 2E89A 3TIXB 2JDID 2YIMA 3DOUA 3M1LA 4DQUA 4L8WB 2GBFA 1S8NA 2B5OA 2WJVA 3BH7A 2YXNA 3KYDA 4I46A 4R9RA 4YAUA 4M3NA 1PWHA 2XMPA 3PQEA 2RI6A 2V45A 3D54D 4EYGA 5HOEA 3ORRA 3T3OA 3WGJA 2WABA 3HN2A 5KO2A 3K53A 4TLCA 2SKCA 4YQFA 2AR7A 5J2TB 4YUWA 2XE4A 3FNHA 1ZOLA 3IIMA 4KDEA 2MYTA 5I9LA 1Z0DA 4JHLA 2PNJA 3HUFA 3OQVA 4HDQB 4F71A 2UAGA 1LNSA 2XNDD 1PKXA 1UM8A 3FD8A 2F67A 1VG0B 2UZ0A 5A5DA 3ND5A 1Y42X 3T9FA 3STHA 1B23P 4EA7A 3CKKA 2QN9A 3ODPA 2OFWA 3KLBA 3RRXA 3O8RA 1VHQA 2PGXA 3NRBA 4F0JA 2J3QA 5ECGC 1Z18A 3EOBI 5EGSA 3Q8WA 2JG3A 4Y9UA 4M53A 3R8XA 1UMBB 4PG5A 5DTRA 1DCFA 5HNKA 2WMYA 2PJRA 3FSGD 1P17A 1WV1A 4TTRA 3GT4A 2OXEA 1C4XA 5AKKA 1WRBA 5U4XA 1WB4A 4BCBA 1G2PA 1C3LA 5AW3A 3MMZA 2W6ID 3OOWA 4D4IA 4F1KA 4URXR 4YH1A 2ZSUA 3F5DA 2WAXA 1RWVA 1UOPA 2F1OA 3ET5A 3N7TA 2QGFA 5KNBH 2PLNA 3HXLA 4OJTA 3BWVA 4OUDB 4MQEB 2X19A 2XEXA 3LVQE 4JLDA 4HVAA 4RWZA 3JCZA 4MWGA 4O8CA 1YJ5A 3RARA 5DHAA 4M0FA 3WLNA 3JAMA 1LCIA 2CNBA 5K0EA 2QYOA 1ZAKA 5JWOA 2O07A 4RDCA 4IQ8A 1Z0JA 5BV7A 2HY7A 1X7YA 2HUNA 4K9KA 1G7RA 1SBQA 4YP9A 1E2GA 1KBZA 4C7XA 3SJBA 4E6EA 3U61B 3LHDA 4JT4A 2Y9PB 3E9NA 1HGXA 2FAXA 1G7SA 1RBMA 1ZZEA 4V2IA 4IIXA 3KE9A 3VR0A 4ZI3A 3H5RA 3HB1A 3KR0A 2P7HA 2YMPA 1HPLA 3KYBA 5DNWA 3ZCXA 3R9WA 3O4HA 3VNRA 5A5EA 4HNGA 4IKOA 1Z0FA 2VNJA 3CVYA 4FEEA 1J1IA 1Z7EA 2DKOA 5FWAA 4Z4CA 3L4EA 3SOPA 2PGIA 3RDPA 4OOEA 4P0QB 1J39A 1E7QA 1KH2A 2ECOA 2OILA 3FF4A 3HSSA 4AUKA 4BGVA 1NIJA 1NI4B 1JYFA 2UZ4A 1T1JA 3COVA 4R41A 1YB1A 2SCUA 1COWD 4P4UA 5F5NA 1O96A 5FBRB 3WYEA 1GZUA 3PSHA 2Y66A 3CINA 2C59A 5ARCA 2DFLA 5H5JA 4QYSA 3S4YA 1KEPA 1MW8X 1FX0B 1KH3A 1OMOA 2GO1A 4YCBA 1I1OA 3QLTA 2IHUA 2EG5A 1KJQA 3KQLA 4HB0A 4DR7B 1JEDA 2EHJA 2I4TA 2Q6IA 4CDNA 1QX4A 5TDHA 3CVVA 1AK1A 1T91A 3MUFA 4PYOA 4HAIA 5HJEA 4ZRDA 1KK1A 3GGGA 1WPQA 2C99A 1QIDA 2YN0A 4PGGA 4FFMA 2RH4A 2EKDA 2EP8A 3D8RA 1LF0A 3G2NA 1QXSA 1PJCA 2AKAB 1PWXA 2AOTB 5L7WA 2ZRLA 4I1RA 4FKMA 3EEQA 2QRMA 5BN5B 4D8TA 4E5KA 4OAOA 4MYCA 1K1EA 1GO2A 5KQPA 4DF3A 1I4OA 1MT0A 1V1RB 1L4NA 1WW8A 1EYZA 5DBOA 1JR6A 1BE6A 2JAOA 2C3MA 3UJ9A 1CUZA 2B35A 2UXDB 1SN7A 2NYUA 3UT6A 3LX8A 3O8DA 4RVDA 2VHXA 4YJ2B 1XTJA 5CDYA 3LC7O 4ZIRA 4HBZA 2NWQA 1ZUD1 3OFND 2YY7A 1SCIA 1H1LB 4H6XA 1UFQA 3QKUA 5E6RA 3CW2A 3HCFA 2NYRA 2ZT7A 5K0SA 3G0HA 1E63A 1B0PA 1SA0B 4BVJA 2XDAA 1TUEA 1DI0A 1ZRHA 1JHVA 1Z4LA 2JC3A 2WKPA 3P20A 5K6AA 2BFWA 4DPMA 4XVUA 1DAKA 5LQNA 2X7XA 2Y76A 2PUVA 2XRMA 1T1RA 2ARKA 2IUEA 5AVOA 4D74A 2GFQA 4EFDA 1BO6A 1U3VA 2AMLA 1QLWA 1XO1A 2V7PA 3JD0A 1NRIA 2HIAA 4LGMA 4TMTA 2EV9A 4M1KA 2AN5A 3DMPA 3OT4A 4TWZA 4Y2JA 4GVXA 4MHSA 4F4FA 4DA4A 1VKRA 5BOVA 1UDBA 1CW2B 1SUPA 1E5QA 2F6RA 3IVXA 3B3FA 1W59A 3MIIA 4QBGB 1H4QA 4OLBA 2LCQA 3Q3HA 4IFTA 3R7BA 4EECA 4ZJUA 3DDUA 4W8HA 3VU9A 1SCUB 1U7OA 2PMKA 5DHFA 2ZUTA 2Q5QA 4NHEA 1IHUA 3FPSA 4CDMA 3FOEC 3G17A 1ZHHA 1N7IA 3QNMA 4TYPA 3K4PA 4XGIA 2H52A 2XWBF 8GPBA 1YS4A 1XC7A 1X7DA 3G8YA 4ND3A 2QLTA 4F1JA 1MX3A 3FSRA 3DPUA 5KCZA 1P4SA 3QSYA 3AVWA 1P9NA 3HZZA 2HU5A 5CLHA 4K81B 2CNOA 3MJRA 1AVTA 4DV2B 1AUVA 5K2MA 3D4LA 1EP9A 4A2PA 3X44A 2NT3A 2RAPA 2X4LA 4HS9A 3V7WA 1CETA 1FP4A 4FDUA 4X20A 2YV1A 3WZLA 3QXXA 2VAWA 1Y9JA 4Q3DA 4Y9TA 3R5JA 5BW8A 3ZWKA 1M54A 1KIMA 2YYYA 3GAMA 2O8NA 3CGWA 2RGNC 4J43A 4GI7A 4KVGA 3NTOA 4CTKA 4ZREA 3WDLA 1XEXB 4KNWA 4G4IA 1Y3IA 4EHHA 2OGWA 4QOGA 2Z6QA 1CY1A 3SQWA 3ZKWA 4FSHA 2VDPB 2HCBA 3JYLA 1LRJA 4PPYA 4BUJA 1ZBDA 4CBVA 7REQA 2AC7A 1RAGA 4Y18A 4TN1A 5IF9A 4GBJA 3QBVA 2PGDA 3DB2A 2AI3A 3SZOA 1RDFA 2BFCB 3B3GA 2NO4A 1TZBA 1QLJA 2EZUA 4HYQA 2IEYA 5DX1A 2IZ5A 1T9GS 1UT5A 1MRZA 1TKRA 5SZJA 2B8JA 1UAAA 1Y33E 2FR8C 4EHLA 2L69A 2JFGA 1F12A 3LFUA 5FTJA 3V1KA 4X8LA 1VCMA 2PVSA 1PLJA 5C8XA 4UE2A 4TS4A 1LXCA 1VBKA 3HVHA 3V9AA 3WGIA 3THYB 1L5FA 4IHAA 3HJFA 4X24A 3KDPA 3JSAA 3ZU5A 1NHWA 3PK0A 5JC8A 1XF9A 4ETNA 1NM5A 2GCIA 3NX4A 4A0GA 1E2LA 3K1TA 3IFSA 3W3ZB 5SY4A 4D3XA 2B5VA 2A92A 1PG5A 1PJTA 1WPRA 3TD6A 5A0TA 4V1CI 4KWTA 1Q74A 1J2YA 3DP7A 1OX4A 1X86B 3X1DA 1V48A 1NJFA 5F3RA 1JPNA 4BMDA 5HF8A 3VBEA 3TGLA 3OPXA 3R0VA 1R27A 2WJGA 3VUEA 3NBKA 1B8OA 2I62A 3OZVA 3R3ZA 5CB6A 1T1SA 3W78A 4I6GA 3F3MA 3OA2A 8MHTA 3WK6A 4N76A 4RLHA 4UFOA 1S4QA 1YS7A 1CVRA 1D2EA 2A9OA 1DQRA 3JRWA 4PG6A 2QGNA 1ZK1A 1CQZA 1AHNA 1OB5A 3GLIB 3BWDD 1WD5A 2FZWA 3BEOA 4HJRA 4HX9A 4W6ZA 5CNMA 5K8JB 2IUYA 4KFCA 4HDMB 4DARA 1I2DA 4J0QA 3D6TB 1EQ2A 2KJQA 4QYIB 3VSAA 4MVJE 3LNCA 1KBOA 2BFBB 3A8TA 3C3YA 4YDRA 1DBSA 1GSOA 2YY5A 3GJ5A 1DXOA 1ORRA 4KO3S 1KYTA 2VP9A 1ZD5A 4MWSA 1E0AA 1M73E 1ADFA 1TUGA 5IJ9A 1TNDA 5EHZA 3DLBA 3TFOA 1GYQA 4EFNA 1WX1A 4FNMA 1TUBB 3SKXA 2YHBA 5TR9A 6LDHA 1R0WA 1YVPA 4DBZA 4KKXB 3WFIA 3U49A 3P52A 5CA1A 5BPHA 1MENA 3C39A 1OU4A 2GYWA 3AR3A 4RACA 3V4FA 1T4CB 2IT1A 4CMAA 4YMGA 1KKMA 1JBKA 2ODAA 4PGMA 5ENVA 1YVRA 2IXTA 2VAPA 5F4ZA 1D5WA 1T5TA 1ULUA 3ER8A 5CJPA 1R1DA 3Q7SA 2ZDHA 2AI1A 5NULA 3SF8B 3U48A 1G8JA 5JUWA 2PRZA 4TQUS 2D7DA 2YCBA 1VSBA 1GAQA 1KC3A 2JK1A 3K09C 4HGPA 1M2OA 1A2OA 3C15C 2Z2KA 3IT3A 3NBXX 4WHMA 2WI8A 4M0KA 5E9JA 4EDFA 3W5SA 3F78A 4KR7A 2WHPA 4LE1A 2GPBA 2G8NA 1TPZA 3BRQA 4RVHA 4RZHA 4BNDA 1FU8A 4UCWA 4BEWA 3KOYA 2G25A 1TIBA 4MV0A 1XP8A 3ABOB 3H4MA 4N4AA 4Z1MA 3BGDA 4ECEA 4UTRA 4O2AF 4DQ0A 3M9WA 3KOWA 2FG6C 4EW1A 3GFSA 1AXGA 4J03A 5F52A 2ZSAA 4HVLA 5L6LB 2RHLA 4RHUA 2Z5FA 2GPJA 5HDBB 4IVPA 5C5IA 3U16A 2CMFA 4IIBA 3HKBB 1X0VA 4IIDA 4WNAB 1Z08A 5C7LO 1UPTA 1ECFA 2IBSA 3U4MA 4JT9A 3GNLA 4ZPXA 1XOIA 4WH0A 3VJRA 3RRJA 5COBA 3HH8A 4ZVUA 1QF7A 1DRJA 1TA4A 1RJFA 5T4HA 1T2CA 2XOXA 4LE0A 2QENA 3FFBA 4WFJA 1RS0A 3T0IA 2BSQA 2FMHA 2HDNB 1X1TA 3UK0A 1TAHA 5L7YA 1YZYA 3CZQA 4CIBA 2Q0QA 2XE7A 2G63A 4PGAA 1FFSA 1IXYA 4IWNA 1U0GA 2A5YB 4JLPA 4L3OA 3TN7A 2QX4A 2ZSHA 2CMGA 1DIBA 2NSDA 4B74A 2DTDA 3DMTA 3HJRA 4AFNA 1VP9A 3DBVO 4CV0A 1NXWA 4OYLA 2IPOA 4UHFA 1CKEA 1UBMS 4YWJA 3GEDA 3H8WA 2QGZA 4RENA 3H2GA 2CT8A 2CXXA 4CEHA 3OTWA 4MUJA 2Z8XA 3GYGA 2AHOA 3W06A 1QAOA 3BWMA 5BPFA 4B75A 3QPVA 4BC0A 4MWCA 1HORA 1U2DA 2L0XA 1RRCA 3I58A 3LOQA 1I7NA 1DV2A 1LDYA 4MKFA 2DECA 4MULA 1Z82A 4O1MA 4TTVA 2BGUA 4E5SA 2YC2C 5EUMA 3HY4A 2LWIA 1TK3A 3R23A 3M1YA 3SDZA 1Z38A 2GA8A 2IZOA 1CQXA 2EL9A 1OROA 1O8CA 1I5RA 4ZU1X 1BD3A 5EQFA 5JQWA 3PKJA 4OOFA 1VZ2A 2KWIA 3IOBA 2PY6A 3ROGA 3GLVA 4U2KA 3G0CA 2H2WA 3AM4A 4LCBA 4EYOA 4MVJI 1SCKA 1PHPA 2OHIA 4OKSA 5CT5A 3QF7A 3WYGA 4ZHQA 8ABPA 3WZ2A 2ZJYA 2RHRA 3FNRA 2NU6A 5JD3A 4A2WA 4NI5A 3GW8A 1HQKA 2BF4A 2J9RA 3DMNA 1D7OA 5FWYB 1HYEA 1KQOA 4Q9NA 2QBYA 2P2NA 1T0HB 1TC1A 4RULA 2IC5A 4LZAA 1U8CB 3STUA 3GXBA 4TKMA 4GD3Q 2ET6A 2VF8A 5ELLA 5FNZA 4B40A 3OFSA 2EKBA 3CEPB 4UUQA 1HZZA 5EQTA 2OCKA 1IUOA 3NAQA 4XYBA 1S3FA 3EGEA 4CM3A 3HABA 4UU1A 3N8NA 3T5CA 1ONPA 3N2KA 1NRJB 2R9VA 3FGOA 1CUGA 1DEKA 3ZDDA 3QV2A 4LFAB 5FFNA 2D3WA 4FN5A 4INOA 3IVGA 4DWVA 2IGTA 1JHQA 5EWJA 3WIEA 3L9WA 1LBTA 3I0MA 4GYYA 4E5UA 1TEVA 3IQHX 4G1EB 2BFEA 3UT5B 1AS3A 4GRDA 4RJIA 1P0FA 4B3JA 3CEHA 2D00A 4J0KA 1QVAA 2WTAA 1DE0A 1DKUA 2RAUA 3CIOA 3PQ4A 4MPJA 4TXHA 1KR5A 2O06A 5LN1A 2IHNA 4XPIA 2FZGA 3B89A 3V1MA 3T1YB 1Y5LA 1K8RA 3HHPA 2WSYB 2VDLB 4P98A 4XKJA 3AOEA 1GL6A 1TJPB 2TMDA 5GOZA 1O2DA 2PVCA 4YBZA 2AK2A 5FHRA 3S2YA 1U7TA 2CJYA 1Z29A 3W7AA 2PGLA 2NP7A 4IZIA 5EHNA 1GA4A 1K3TA 1PV2A 3KVNA 3JRXA 3KSRA 2H4YA 1GAXA 2AHRA 1NVKA 5JJCA 5JDCC 2X2OA 1BFUA 2DPYA 4YP0A 5ED0A 4J29A 4ARAA 3T4EA 5JARA 4GLLA 1U7XA 3BH6A 4RPIA 1MO6A 1E66A 3VNAA 3EC7A 1D1SA 5B3AA 2JGJA 3M5WA 1A71A 1BVUA 1NSTA 1G20E 2Z56A 1M5TA 3OZFA 1L7XA 2FVYA 5COQA 4BLQA 1SZPA 1Z5OA 1YTLA 1Z5ZA 2QMQA 4YRLA 3ER6A 5B1SA 4CF6A 1N5KA 1IBLB 2RJOA 1DU4A 4G4GA 2GI4A 4DDMA 4BV2A 1CB7A 1C30B 2O2JA 1F0YA 1G7TA 4AZ3A 3TRFA 4NJEB 3W5BA 3FCCA 3KT8A 1F6DA 3FB4A 4ALLA 4JZYA 3B8EA 4CIWA 5CURA 2HW8A 2N46A 2QNIA 1WOMA 2VC2B 2KM1A 1TFRA 1HYQA 4XUEA 3QG1A 4CTMA 4XGKA 1OXTA 4JYBA 4ISBA 1JILA 4F2GA 5C46F 2OCGA 4W1SA 5DHPA 2QD5A 3A31A 1RC1A 1C4WA 1FOEB 1P3Y1 4BIIA 1QF6A 1XCLA 4A0FA 5AVVA 2JBWA 1UIMA 2J48A 3CLTD 5IX8A 4EHAA 3DVAB 3FYHA 1R5JA 2ECQA 3IJRA 5GAJA 1DPFA 2DPGA 4X1KB 1UJNA 5G4KA 4ZVMA 4AKEA 1T0BA 4BE9A 2IGBA 4TT8A 2PKRA 1CF2O 3BOSA 3F6PA 4D56A 4YRMA 5A1TA 4WADA 4RSMA 1OA1A 4X92A 4LTNA 4KREA 3OZCA 1ZMOA 3P32A 4DV3B 1CZNA 4KUGA 4J1TA 1EWVA 3F1KA 3R7LA 4Y6OA 4CIVA 3BL8A 1KARA 1YU6A 1QCZA 3EZ2A 4HUQB 3ZWWA 4KNYA 3B9RA 1OU0A 4TRNA 4EUFA 1KYVA 1UZNA 2R2AA 3PC6A 3Q9NA 2JJYA 3EF0A 1IZYA 3MERA 4YJGB 1E69A 4TVKA 1RI1A 4GOND 2AD1A 2B36A 3GZNA 3K9WA 5K0LA 1PDOA 4O4HF 1ZOPA 1T0PA 4WLEA 1EUDB 2IS2A 1P4AA 2AX4A 2C07A 5LP6C 3MWFA 1L7NA 4XGQA 1QO0D 3JPYA 5J5VA 3EBPA 3W3AH 3RTBA 3A2KA 3GJZA 4QU8A 3K0BA 3PUHA 1AZLA 1ND5A 4G5GA 4KODA 8ATCA 3HCBA 1QV6A 3GCXA 4FVTA 3ZI0A 2H5EA 4BO2A 3P97A 1UT6A 1P80A 1VG9B 1FNBA 1M2VB 2Q9UA 1PF7E 3AHGA 1ESZA 2IE0A 1HUQA 2NPIA 1JEJA 2QU8A 2YHSA 1FJXA 4JYAB 4NYMQ 1E79D 3EXHC 3VZCA 3NHAA 3T1QA 2A1TS 5EGNA 1SXHA 3DH0A 1AGNA 1BOFA 4WOCA 1N6IA 4E11A 1KDVA 3ET4A 2ZAMA 3TLEA 4NQZA 2BN4A 3LT0A 3Q9SA 1Y8QA 4GP6A 2PD3A 5J4LA 2HRBA 1YCGA 1W36D 4ODIA 4TWAA 2R4UA 3OKFA 4F8YA 1J9EA 1UQRA 1VKOA 4ER6A 5HCUA 3ESQA 4HADA 4NMHA 4TT3D 4E0BA 2XE8A 1M5UA 4ONEA 4ZO9A 3EQ6A 4UUOA 3JD2A 4ZVLA 3WQRA 3HA3A 3GO4A 2XSZA 4QPJC 4D42A 4D9BA 1G21A 4HEHA 5DK6A 5MFZA 4JGGA 1IEQA 4K6HA 3TWOA 2P9BA 1YZGA 5HUHA 2FPGB 5LU9A 4PLYA 4XA8A 3LHSA 1TIPA 4O8ZA 4CV1A 1J5EB 1J0AA 1RYMA 1BQ4A 1QH1A 5EXSA 2QLLA 4P80A 3ZCRA 2QRHA 1TYEB 3SS9X 5A62A 3UENA 1AO0A 5JC1A 5JVDA 4HGNA 3C3AA 4E33A 4GGPA 1C9KA 1GPJA 3HZRA 3DTVD 4WESB 3V1LA 3MEQA 2YFKA 1QR2A 4C6RA 4W9NA 1XU9A 1SPBS 3ERCA 4BKMA 3Q7TA 2XOEA 1LI4A 1ZN2A 3GUUA 4QU0A 2BTQB 3G9QA 2DHDA 1MVLA 1OBCA 1R4NB 3TCKA 3FF1A 1NW4A 1CYEA 3RTGA 3E22B 3GT3A 1KQGA 4MW2A 1UC8A 4YP6A 1OFUA 4R2LA 4KWEA 1TYZA 3ETHA 5CYOA 2X5XA 2HO5A 2Z4TA 3T61A 4EMTA 1B16A 1I4DD 3AHFA 1GDHA 2R7LA 3A4YA 3PE4A 1RYDA 3Q15C 2H1OA 3HP1A 5BN3A 2UU9B 4H3KB 4DCOA 5AK3A 1UQUA 4JI2B 2I99A 1SY7A 1E2BA 3C0KA 1DHTA 1G4HA 2CCJA 1X0XA 2XUZA 3L1JA 4B3CA 5AD1A 3CS3A 1T36B 5KCMA 3U31A 1R9GA 1WCIA 1Z0AA 1N2EA 5CW1A 1YZKA 4GT1A 3EZNA 1L5VA 1E1RD 2D6FA 1X7GA 2Z6VA 4WBNA 4PLVA 3E4CA 3GLRA 1WMFA 3NDPA 2XH8A 1QWSA 1NR7A 2C9BA 4MW6A 3H9CA 4R16A 3T5DA 4RMJA 1L1EA 1OV4A 2C4MA 3U60B 2B61A 5EJ7A 1TM4E 1XTTA 5ERGB 2DBVO 5AI6A 3OCWA 3GOHA 2G5GX 4JITA 4BJHB 3VR6D 4GL2A 2BI7A 1OZAA 3UATA 1U8AA 5KB3A 2BR3A 4CVNA 2PUAA 4QQKA 2OYCA 3TCXB 1LW6E 1MGPA 1N5OX 4X94A 4RK5A 1FDUA 2HAEA 1X87A 4PGFA 1FUUA 3UTDA 1EFTA 3VTAA 5IK2A 3O93A 4NAUA 3ESCA 3EPPA 3IQFA 5EUCA 2WKQA 3L0PA 5DB4A 4JT2A 3GMIA 3GFRA 1V3VA 1Z5UA 4C0KA 2FN4A 5HM8A 3O38A 1Z06A 3KKEA 3CM0A 3L18A 3LY8A 1DUIA 1ZNZA 3NBAA 4QIHA 3ZLVA 2VUSA 4YJHA 4Y6PA 2DWQA 4FKBA 2OTCA 3RYCA 4R84A 3MGGA 3G79A 2QD4A 4XDGA 4CI9A 1KJWA 2YXBA 5KTRA 5FR2A 4B35A 2CFCA 1NUHA 3OQIA 1LLUA 4Q4HA 2V58A 3NTXA 3RS7A 1FSSA 1QIKA 3VBCA 4POAA 5EP4A 5B2ZA 1CS4C 1LVUA 1R6XA 4IV0A 3BD9A 2WJYA 1PNVA 3GAZA 1OLOA 3U9TA 4DQXA 4DUYB 1M8FA 3UHAA 1XZIA 2BCJQ 5J23A 5TT0A 2LCFA 3FPJA 1DT3A 1EX9A 3W2TA 1O0BA 4O2AB 1NLUA 1C2TA 4WZZA 2CLFB 2FUG1 1GCUA 2KE5A 3GRFA 3O8OA 1N3YA 1JFFA 3TLYA 4EYQA 1I7LA 5IMSA 2FW0A 4R9SA 4ZVNA 1U3TA 1GL9B 1ULBA 1NYTA 4IINA 4KIGA 2GEDA 1P7YA 2W4QA 2YVLA 1EK5A 2O2CA 2ZQ5A 4UBJA 3EUAA 1BVRA 3KSMA 3D0OA 3H1AA 1B4DA 3LK6A 4D9NA 3U7EB 4HLQB 5BNZA 5JH7F 3CH7A 4ZO8A 2GAAA 5DISB 3EAGA 4FYMA 5FTMA 5JAOA 4U1RA 5L45A 3I3SR 2RHBA 2YWEA 4BOYA 1V4NA 1UANA 1R5OA 3T5GA 3VKWA 4Z5XA 3MAGA 1Y6JA 4UUMA 2WWWA 1MX5A 5TT1A 2G9ZA 3OCJA 3KJQA 1Z16A 5IABA 1NMXA 4J3FA 3OAAD 1C4OA 3VU1A 2ZIXB 3NATA 1QP8A 1WQ4A 2FUKA 4QUHA 1R8SA 3DCNA 3TAUA 4DMRA 1H2RS 2P9YA 3PVSA 1N75A 4B33A 3SHOA 2O4CA 4F56A 3BK1A 3OM9A 2ZU6A 1WO8A 3V1YA 3VNVA 3WGLA 3C6MA 3S70A 5IZCC 1QRSA 3KZ1E 4YUAA 3COZA 4BMPB 4GX5A 3QE3A 4MRRA 5T67A 1TM5E 2PX0A 2DFTA 4L74A 4B6JA 5HKKA 2ZYAA 5LD2C 2VSQA 1Y5MA 3FLBA 1LU9A 5SICE 4MPPA 3CNHA 1VCHA 2ANBA 1KY2A 5TPWA 2PMEA 3FHTA 4GC5A 1O89A 2CGEA 1X7WA 3N2ZB 5JXIA 1EE2A 3A3OA 3RYTC 3TRIA 3AEZA 3GVHA 1GQQA 1T13A 1VPTA 1C5KA 1X94A 1ECGA 1GPAA 2ROQA 2CNKA 3N8HA 5GGYA 3RG8A 1G38A 3OZUA 3DE2X 3L0BA 1DFGA 1Z83A 3WLOA 2VSFA 5CVUA 5DCWA 3OX1A 3TVYA 4DQLA 3FBGA 4WKGA 2AN9A 1I51A 3GC6A 4OH1A 4IFBA 5F33A 5E2AA 3U26A 2X5NA 3DZBA 4TKVB 5TGDA 2R1TA 2HK7A 3UHOA 3D6JA 4MVCA 5C4MA 2AN3A 3FOAA 3IODA 3VQTA 2QP4A 2BFFA 3WL5A 5L51A 3OIGA 4CW7A 1JWLA 3TF5A 4Y0AA 4YMSA 4G84A 1E89A 3S55A 5EERA 3C85A 2ATIA 2OCAA 2H2GA 3CT4A 1RM3A 3EA4A 3ELYA 4C3VA 3IHLA 2JIPA 4IDOA 4LXTA 1JF8A 4H1UA 2RG7A 3BGVA 4ROSA 3RFCA 4WDRA 4KXQA 2O52A 3KT3A 4PN7A 2PSFA 4OGFA 5LA6A 3QOWA 4AMBA 4RHEA 1HKHA 3T7KA 4G1VA 5IAEA 3UFXA 3EGWA 2KX7A 4OHBA 1KRHA 4CGZA 3C7TA 2CB0A 1B6TA 2SICE 1O6ZA 1UH5A 2VRNA 3M83A 2PZMA 3R0QA 2BHLA 4I66A 4JVMA 2A0XA 1SO8A 1TLLA 2E0IA 3PENA 3LQ1A 4BO7A 1FU4A 1XXLA 3ETLA 5TARA 4YAGA 3RBXA 3M6WA 3U4QB 1R4MA 3SJUA 1YE5A 1ECPA 1HL3A 1Q1NA 1W5BA 2ZJFA 4IV8A 4CKCA 2WG2A 1Z6QA 1F8UA 1SC6A 2FYTA 4CT0A 4EY5A 4F4CA 4DG5A 2ZYUX 1DLIA 4PSUA 1BX1A 2ZYWX 3LTEA 4DE5A 3GJ6A 1GYRA 2E4UA 1LDEA 3OWXA 2H2HA 4JJIA 4JLNA 4IMPA 4BZWA 4BNWA 3AEXA 1A4RA 1L8QA 1H8EA 4HH3C 1Q83A 3EFOB 3Q4GA 1UPUA 3PTZA 3PG5A 3PNMA 1IHPA 5DBIA 1R18A 3PZBA 1N5LA 4R2KA 4MRSA 4ZQBA 5KKNB 4CXMA 2BH9A 1DXHA 1KAGA 1UMBA 1O94C 2R6ZA 3NOQA 3RRZA 1J70A 1CP2A 1KZ1A 2ZJZA 3P5BA 4LXXA 4YX9A 1XCOA 1BWQA 2H2FA 2X15A 3O8QB 2WE8A 4L0DA 4QU5A 5G0UA 4I1SA 2WWVD 4C2BA 3CCCA 4AK9A 3JATA 4J90A 4IZ6A 5JH7B 2G4CA 3TBKA 3PXCX 5JZVA 2XD9A 1BS9A 2R87A 3DDHA 4J0JA 2W11A 1GITA 3EFBA 4GPIB 3TVDA 3UZUA 5A5FA 1S2DA 5JOQA 3ZEAA 1H22A 2HZBA 2WV7A 4IEIA 4MQEA 1MRNA 3HJCA 3CZRA 3HFSA 4OREX 1AIPA 1N34B 1RRVA 3DHNA 4P7GA 1G3UA 1K6JA 5ANRB 3EULA 4JQCA 4D9KA 4C1BA 2BSAA 1S2MA 1JAXA 3QI2A 1RHQA 4BHTA 3KZXA 3LIPA 3LUPA 1T9CA 3O73A 1N5IA 4KXLA 4N8SA 4O1HA 2IZ1A 2O2HA 4WCFC 2YWDA 5FBZA 4RFSA 3RC7A 5HZMA 4FB5A 1GKIA 3KEQA 2IPLA 3VI3B 4BNMA 2PFSA 3V8RA 4OM7A 1ITZA 3FPHA 1RRGA 3L7YA 3LPNA 3ZS9A 3FUUA 3L40A 3H6KA 5THXA 2PU5A 1DDIA 2ZTMA 4TPKA 4XD7A 2JGKA 3SICE 1GSAA 3DQZA 4LGCA 4CM9D 5A1JA 4PZDA 3SZGA 1K7XB 2G1AA 3IJ5A 4QICA 3WBKA 4G86A 2Y05A 4CF3A 1I8TA 3QA3E 5HIIA 3ED5A 2FGKA 1VM6A 2YQZA 4C0BA 2VLBA 5EJ5A 1TLFA 3GJYA 2C7OA 1RBQA 4MVWA 1NL3A 2WOOA 5I7FA 1ZYUA 5EZQA 3DQPA 4OQEA 2HBRA 4LRXA 1KGDA 1SK8A 3NGXA 4HQLA 3GCZA 1JFLA 1II9A 1R3UA 2TECE 2ZR8A 2QTRA 3HNOA 3LUFA 4FYVA 4ZQHA 5MGNA 2WYUA 4R1UA 5I5GA 1XAHA 3GLHE 1YR3A 1CUFA 3HGTA 2ZDQA 4LBVA 4RDIA 1DV1A 4G5SA 4O4HB 3PDJA 1XRNA 2Y4OA 2BM0A 3V8QA 4F60A 1WNTA 2FSSA 2GR9A 3KZCA 4JLSA 3X1KA 4B7UA 4TWRA 1FUEA 1FX0A 1RM4A 5TVGA 1E1CA 4I55B 3L43A 2FI1A 4ZANA 3C6KA 1RTTA 4BJ6A 3WLMA 4RVCA 1B74A 4BC1A 2VRBA 2PH1A 4ECAA 1EP3B 3L7CA 1OT3A 2Z9CA 4UCQA 5JI2E 2E2WA 1IEVA 1T2EA 2CLHB 1VCOA 1WLYA 1OKKD 2OSBA 5AT1A 5F7JA 5LXTF 3TLJA 4AXXA 5LQAA 4Q1AA 2GUGA 5A0VA 1AQUA 1PX0A 2I2AA 3BTVA 4PPFA 2AOTA 3GDWA 4GOKA 1PFUA 3GGCA 4I99A 4OYYA 5BRJA 3GAAA 3H19A 5EVJA 1R37A 1V1RA 3UWMA 2JFXA 1N78A 1A7JA 4MW1A 2G72A 4MS1A 2XHEA 3U1BA 1S4MA 1CR6A 4OP3A 1G8SA 3DYIA 1TYCA 5F2KA 3A6HA 5AI9A 3SHFA 3M3PA 4QEZA 1HNXB 1H1LA 1RPZA 5C4GB 3P2YA 1W35A 4HDOB 4N54A 1J20A 1UMDB 4PS1A