4YLYA

Crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
198
Chain Sequence
MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGAYTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETSRFDHVMNEFNGEVKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of Staphylococcus aureus peptidyl-tRNA hydrolase at a 2.25 angstrom resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 62
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4ylyA00
5B6JA 4HOYA 3TCNA 1RYBA 3TCKA 4QT4A 2Z2KA 4LWQA 4JX9A 3VJRA 3OFVA 3NEAA 2MJLA 4YLYA 4IKOA 4FOPA 2PTHA 4JY7A 4QBKA 4JC4A 4ERXA 2Z2JA 4P7BA 3KK0A 3P2JA 4FOTA 4ZXPA 5IVPA 1RYNA 5IKEA 4FYJA 4Z86A 4OLJA 4QD3A 2Z2IA 4DJJA 4DHWA 5IMBA 3TD6A 2NAFA 4QAJA 2JRCA 1RYMA 2LGJA 3KJZA 5EKTA 3TD2A 4JWKA 3V2IA 4FNOA
chains in the Genus database with same CATH superfamily
2WJWA 3P8ZA 3PEVA 1WPGA 2X13A 5A7FA 1L6RA 1Y9ZA 2OV3A 3IMGA 4B44A 2B83A 1W48A 2IBMA 1J0DA 3I9V1 3HXQA 3LY9A 4JXJA 4ME6A 1O4WA 2O8VA 2WG2A 2WWGA 4QBFA 4XVCA 1E2IA 4R1QA 4LDNA 4MCHA 5BQPA 2FRDC 2RHGB 4FOSA 4LXYA 4ZCQA 3S70A 2HBYA 2PV7A 3MTAA 3AF6A 3EPLA 4CMIB 3I72A 1SY7A 2CZGA 3NT4A 4D02A 4D92A 3SQOA 1GN8A 4ISBA 5CH3A 4ALIA 4JYPA 5FEUA 2IA5A 4HEQA 3KOXA 5LMZA 4EM6A 1V95A 4E22A 3DVLA 5L3SA 4PZZA 4KJXA 4XYGA 2XUHA 4V1CA 3UF0A 5ILOA 2ST1A 5B4VA 3IHWA 3VZQA 5CCBA 4H6XA 2GTPA 5FOUA 1XCOA 1Z0UA 4Q4AA 1V11A 3U4DA 3ZBTA 1JZSA 2YICA 4OGLA 2ERCA 2J5XA 1U0OC 1QHHA 2QN2A 4JSRA 5EHZA 1ABBA 1BMFD 2YFYA 1OWMA 1KEWA 1PVDA 3AUSA 3KBBA 3NTQA 2Q0QA 2PAAA 2W8ZA 3F7MA 1FVOA 2NTJA 3IAS6 1ODIA 4ZDJA 2B37A 1PFWA 2XLCA 4FWBA 4KPFC 1YMUA 4D8YA 1VCHA 3BL6A 3K9WA 3U7QA 1QGYA 2VNKA 1A9QA 3QVXA 3SYLA 1K92A 1RR6A 5JFOA 4KUEA 1X39A 2FR0A 2HMAA 2VQSA 3TQCA 2JFHA 1ORHA 1OQAA 1XZBA 4F3YA 1T9ZA 3C1UA 5LOVB 4C2UA 1J6UA 2YNMD 2O8EA 2EBHX 4DLUA 2X6TA 3H5IA 3C8MA 2G80A 1P8AA 3IAUA 3GA7A 4GPIB 1OZAA 3OCXA 4I2NA 4M0CA 4PLVA 4KR6A 1LSOA 5CVCA 5AI9A 2X8JA 1N9GB 1HZJA 2ZSFA 2XUIA 3B3FA 4R6WA 5AKZA 2ORED 3ZOKA 5FWDA 3LQFA 5K4GA 3PNYA 1R0RE 1WQ4A 4IDHA 4OXQA 2GZDA 2QJTA 1T1EA 1G64A 3V7FA 2GK3A 4KNVA 3TKAA 5KSWB 1CYDA 3QBVA 3NB0A 3L8ZA 1DC7A 2B4KA 1O95A 4UNNA 2BMVA 5KIAA 2BT4A 2YN4A 4AJOA 4D5EA 4N5IX 3EQ2A 2JEOA 4ND7A 4KO3S 3F6RA 2KM1A 4CR8A 1TYCA 4UD2A 5EHQA 4JUBA 2R48A 5D3QA 4M1YA 1SHLA 4IOLA 5KNBA 3A4MA 1YZUA 3OLQA 3ZLTA 3ADCA 1TRKA 4KTVE 3DOIA 4E5KA 8ABPA 2FPOA 2I7CA 1XN1A 2NZ2A 3CT6A 4LWZA 3BAFA 2BCJQ 4PNHA 3GFOA 3U60B 3ZK7A 4QJ5A 1SRRA 1IN1A 3GPBA 1SBQA 3AEYA 2XQIA 5LB4A 5H4GA 1LPSA 2FW1A 2HWKA 1AK2A 2VUUA 4L7QA 5TT0A 4CIYA 1W73A 2D00A 5LQUA 3DOCA 4P34A 3B70A 4IX9A 3QQPA 1W0KD 1FVXA 3QPWA 4HGYA 2ZM5A 1ZH4A 3FKJA 2PXXA 4OUDA 2ZBQA 3DZHA 2AEMA 3T3GA 4L08A 3ZXSA 1PZFA 5IVDA 1JKXA 2IU0A 5BV0A 5HOQA 4PHHA 1YK1A 2DPXA 4WAUA 3R23A 1B43A 1D09A 1LPBB 4EGSA 4WNIA 1GKKA 1VBFA 3RIYA 2OAGA 4ITVA 5SYAA 1BDMA 1R1DA 1ZNYA 4QFBA 3K9FC 1RADA 1ZRSA 1CDZA 1UJ5A 2OUIA 3BL8A 3UWPA 4JAVC 4MVJP 3VR2D 3VAYA 3RV3A 4MUFA 1AY0A 3HJAA 3SEZA 4BLRA 4HDOB 1S2LA 4X1OA 5KYXB 1QDUA 3BWEA 4P0TA 3HBAA 4J4HA 1NXVA 3NI2A 4WKBA 4D4MA 1U2DC 2VNSA 3BHMA 1LVUA 3EQZA 4ZVSA 1WCWA 2Q5CA 3QEMA 4LZWA 2PYZA 4FOOA 4EA6A 5HNKA 4FMDB 4F3CA 1L4BA 1L6IA 2PUWA 2OFWA 5DASA 2B30A 3I92A 3NWOA 3NV7A 3N0VA 4H27A 2OV6A 4CE6A 4DHEA 4R2KA 4GMDA 3T7AA 2VYFA 4DDWA 5KWJA 4WN3A 2FPUA 2E18A 3M5CA 2OLEA 5AFSA 1Q7RA 1CY1A 1LGYA 5K0EA 4H3KB 4HB3A 3ZDXB 1QQ5A 4BMOB 3H6GA 4DIMA 1A1VA 3CO0S 3HY6A 4BN0A 2XAUA 4Q1BA 3L4SO 5EJMA 1KKLA 5IYZF 2ZVQX 1P5ZB 1XLVA 2VJLA 3SHTA 3D8UA 1OPXA 1R74A 2PRKA 3ZWDA 1T3TA 2HTFA 4MAAA 5F3RA 3KZXA 2AOTB 1QGZA 4BE7B 1SUSA 4D79A 3U7RA 3E48A 2Z95A 4JR1A 4PWZA 3SC4A 1WEKA 4CMJA 3MUEA 4A5OA 2WNHA 4EQZA 4GYKA 4JL8A 3VSBA 3RRBA 1QQ7A 4X66B 4PRLA 5KCZA 5HK8A 1GSOA 2FA9A 1K2WA 1PFYA 4LWPA 5FPSA 1RI2A 3U5TA 3QEBZ 3ZHZA 1Z9BA 4V39A 1QH1B 1MW9X 2DTEA 3A06A 3E3MA 5JWRA 2R1VB 2GYUA 4RHXA 4ZGWA 5CVEA 4IG9A 2WWXA 4X61A 5ESDA 4EUNA 5C4GB 1C4XA 1C9EA 5A0TA 5IHPA 3AR5A 1G6HA 3OTHA 4C0JA 1MW8X 2BD0A 3CEJA 5E4TA 1KMQA 1UC9A 4D6XA 4BQFA 2PSJA 4OBXA 2WIAA 2HCBA 1NG1A 2VSQA 4ARSA 5AM1A 2IKSA 1W0JD 1IXZA 2B1IA 4ARCA 5HG0A 1CUSA 1RI3A 2X2FA 2ZRMA 5AXBA 1ISJA 3KKMA 3OCJA 4FZ3A 3MTEA 3VR6A 1N2ZA 2FCRA 1IY0A 1ZUD1 3ED5A 5I9SA 4CIXA 3DVSX 3NBUA 4I5GA 2ADMA 4FDVA 2P5SA 1PJQA 5JRZA 2PGOA 1NBMA 4H7PA 3NHLA 4LRSB 6REQB 1PGPA 5EHNA 5AXAA 3TVTA 3GBSA 4U6NA 2BUAA 2YUTA 2YVAA 1ZVQA 2AFHA 2C3UA 1JHPA 2Z5LA 3OQMA 2FRDA 7ABPA 5JR3A 1L3IA 1CF4A 4X3PA 3K5HA 2PWYA 3M6WA 1Z5WA 1U4NA 2FP4A 4K86A 3WQHA 4ZKDA 1Z18A 2QENA 2OPBA 2ZE6A 4RYDA 4FK8A 2GX6A 4JBHA 5DGIA 1FYFA 1LI5A 4YEDA 5LJLA 3DDOA 1PZGA 2AEJA 1KYIA 4ABYA 5KYNA 2ATVA 1NMZA 3PE4A 3I8OA 4C3UA 4Q6WA 4JEMA 5I4CA 3OIWA 3KU1A 1VGRA 1E2BA 3S2SA 3BMCA 4Q01A 2BGRA 3N75A 2Q5QA 2IPOA 1PK8A 2IYYA 2R8BA 3CG4A 1W85B 2FUCA 2NU6B 4LDZA 4JLMA 3QLVC 3Q9LA 1N8NA 5JCZA 4MK4A 4MPPA 1XTSA 4XCQA 1V7ZA 1WXEA 1XRNA 3P20A 4BVHA 3SZLA 1Z3IX 1ZKMA 1XHLA 2HCTA 3C24A 1FP6A 5EIHA 4UTVA 1QOPB 1MUUA 2ILVA 2NU9A 1P3DA 1YJQA 4IJMA 1GZUA 5HOEA 1PI3A 5A5FA 4FYIA 4OI1A 4NOLA 1NXXA 4BP9A 5B53A 4MS1B 3UJHA 4ETIA 4X65B 4GI1A 1JHOA 4U5QA 5AKXA 3NR2A 2CLFB 1W19A 3Q85A 3CFYA 3ONDA 4KDRA 3W3ZB 4RSMA 4MRVA 3EIQA 2H2HA 1T0UA 2CBGA 3ZW8A 4KMMA 1CZLA 3SQLA 3CVUA 1JHRA 1GYQA 1N6RA 5IDYA 2IS1A 3GC6A 1PJ4A 3SIPA 2GK4A 1IDN1 4X95A 4KEAA 2G70A 3T7SA 4Q3KA 3U81A 3S28A 2IQIA 2GJ8A 3IP9A 2F43B 1XX6A 2C78A 1QIJA 2VRCA 3AFMA 1U11A 4IFTA 5DM2A 4DLAA 1L7RA 1J8VA 2CEKA 4QL3A 3L0DA 4HXGA 1HG0A 3GNLA 1K7SN 3H65A 3RSHA 1VG0B 1PR1A 1GL9B 1OD6A 3AHHA 1BX0A 2XECA 4WZAA 4OM8A 3TW0A 4A15A 4PC7A 3E9EA 5C3UA 4YLGA 4BQRA 3L5KA 3ANSA 4RM2A 3P2MA 4YMWA 1G1MA 2IUEA 4GLLA 3UH1A 4MI1A 1F8GA 1QU2A 2PGXA 4D46A 2HI0A 1M67A 3NT5A 3RVOA 1IN6A 2GM5A 4INZA 5K0LA 2YUIA 4B43A 2WJHA 5B1HA 4OHRA 1XXHB 4CN9A 3KAPA 1M0EA 1OHHA 3DLIA 3K70C 4CV1A 1IG3A 2WRZA 4OQNA 5DGDA 2CFCA 3RK1A 4DUZB 4FLEA 4IIUA 3EFEA 4TLBA 3ZJYA 5REQB 3FYUC 3ZTTA 2NYUA 4C7MA 10MHA 1BN7A 3B6ZA 3NHSA 3THXA 4AP5A 2IBTA 3GFPA 4PBSA 4DMUB 2WTEA 5JQGA 2FPIA 2Z3WA 3OPXA 4EG1A 1V1JA 4DR4B 3FPJA 1J8DA 3PGJA 2JI7A 1S0UA 2FFAA 1FTNA 3EVDA 3W0LB 3FMGA 2QM7A 4CTNA 2JGIA 1O6BA 3CUEF 1SIBE 2FSHA 2AXEA 3FNRA 1AUPA 1YIOA 2VVTA 4M7OA 2PRZA 5EAIA 1HH4A 1JW9B 2IUFA 3BIWA 4L8GA 4EUEA 2PZJA 3C98A 4XVHA 5DU2A 1V5FA 2XI4A 1ZLXA 4BY9E 3RBVA 3PDJA 2NPIA 5GJVC 4UAGA 3VOAA 3SQWA 1ZXLA 1MB4A 2FQQA 3BGDA 4BMSA 5G41A 4L73A 3T38A 4LSGA 4O33A 4YCSA 3EXFB 4QUEA 4U9UA 2CEAA 1R88A 2D8AA 2YMQA 4TQ9A 1JFFA 1MDFA 2B9EA 3LWDA 3U2QA 3QXXA 2IHTA 2QSJA 1U2DA 1BHJA 1WIWA 2C03A 2LTAA 3K5IA 4FDUA 4GBMA 3T9AA 3KTDA 1RWKA 4W5RA 1EM6A 3GN1A 4RORA 5AJUA 5JUWA 5MN6A 1V3UA 2H65A 4OMCA 3FDZB 1PL7A 4ZOLA 2INGX 4NBKA 4HS9A 4TV8A 5AVKA 3WMRA 2GCOB 3NCTA 1UP4A 3D3WA 1UDRA 1UJ6A 4H60A 1ZUWA 5CAEB 3RJ9A 3WYAA 4ZJPA 5KOHA 2VUIB 2X5XA 2O14A 3JQPA 2AX4A 2XHZA 2R7LA 1AF7A 3A4YA 5EE9A 5B37A 4NQZA 2AIRA 3NETA 4KP7A 1G7TA 2VP3A 2EFDB 2YJZA 5A6SA 4E51A 2ZRCA 1RZRD 2JAPA 2P9ZA 5K8IA 4F72A 3IUEA 1XOIA 2DFVA 1U0BB 3QVLA 4PF1A 1SD2A 2ZAIA 3EC1A 1PFKA 2Q4DA 1CUHA 1JLLB 1LPOA 3MWGA 5KQMA 3FAKA 1ODJA 4IRMA 4U0JA 4BO4A 2Z43A 3W2TA 1RLOA 2IY7A 1G60A 3K0KA 4KC0A 2NP7A 4GM1A 3RUFA 1W4CA 3DT6A 2XHEA 4J1QA 5C34B 4B74A 2OQ2A 2HK6A 4YLEA 4A92A 1XDSA 4JNCA 3A70A 2W37A 1OASA 5HS6A 4ZYLA 4EITA 2QZ4A 2A9OA 1WM1A 1TCCA 3O93A 2D62A 4BE4A 1XG5A 4WINA 1G5QA 5HF8A 1XNHA 1UR5A 1JBEA 3GP5A 4WJZA 3RK4A 3G1WA 3IL2A 2ZS7A 1VL1A 4PR3A 4RJKA 4E0BA 5AJYA 3V2HA 3RWBA 1ZMOA 1T9AA 3E22B 2SCUA 5C9ZA 2NVOA 2YJNA 3DBRA 1NVAA 4IIGA 1GQ2A 2E1PA 2ERYA 2JCVA 2A84A 1ZD4A 1FE8A 1OX5A 1W44A 2VK4A 3EGXA 3IQHX 1HMPA 3PF8A 4L0MA 3ZQ4A 3TLMA 1GPAA 3W9BA 3FPHA 4GI5A 4A8TA 4GSYA 4J0GA 3NT2A 4US0R 1EPUA 3FOEC 1AV7A 1NXPA 2ZYUX 1TUIA 2WJGA 1BXRA 1J23A 1B16A 2VJQA 3PGA1 5I5EA 2BF4A 3IAAA 3N07A 2BL4A 4NMWA 5SYNA 4IO0A 1TD1A 2O7QA 4BECA 1KWKA 1ZIOA 3EOBI 3EAQA 4NC9A 3H0CA 3L6DA 1D5WA 4MGZR 4DJDC 4NRDA 2ATIA 1KP9A 4I3HA 3UM9A 3IVGA 1C9JA 1U5AA 4QDZA 1COWD 1SXJD 4JA2A 2PHZA 3EG9B 4D9NA 4ZT2A 3QENA 2VFAA 3DAPA 3QYFA 4UTNA 3ONFA 2F2TA 3HO8A 5ITZB 4P32A 1XD2A 5FNVF 3P4XA 4LDQA 2QE7A 2YQ5A 3KAQA 4U6SA 1ST3A 5K03A 3AEQA 4X62B 2NT4A 2Y0CA 3OETA 5KQSA 3U09A 3J7AC 3Q3IA 5NULA 2QI9C 3FOZA 5EXXA 1SCDA 5EKSA 3H5TA 3WA6A 1G63A 1VJRA 2HHJA 4C4TA 4L22A 3QLVA 4W7SA 1ZIPA 1N1DA 2PSSA 3LQ1A 5JXJA 1MH9A 1NYLA 2FQXA 5F33A 4QOFA 3E4DA 4X20A 1TZKA 4WNAA 3E4CA 5KTRA 2HA2A 2HJGA 4JVSB 4AO7A 1HNNA 1UZLA 1SVUA 4ZI2A 4LMBA 3A31A 3PWSA 1PYGA 3HMKA 5KSPA 2H8GA 4AKSA 2WYHA 3EEFA 1MO6A 3ZQKA 2O1SA 3QKSA 5KX5F 1QS0A 2YHUA 3ABIA 1WCXA 2D5CA 2DE0X 2P9EA 2QXYA 2ALJA 1XDBA 1WMSA 4I1IA 3OLXA 3TBKA 1MLDA 1AA9A 3WQSB 3OE5A 4BYMA 4TV9F 2BEWA 3OZ7A 2XXAA 4HSGA 1QZUA 3A26A 1EX6A 2QLLA 4Q12A 3HVJA 5HFJA 5JSZB 2CJYA 1I0IA 2GFIA 2Z98A 1KHTA 4MKRA 1CWUA 1TAHA 1ZD2P 4OKIA 3R7FA 4PHGA 3ROPA 1YNOA 3GYBA 3QXJA 1T35A 2AA3A 4X9XA 4PYQA 1RPJA 4NQRA 1Z26A 1MEEA 4XA8A 4S2EA 4BNDA 4DNFA 4H1WA 1FW8A 3WLKX 3R3JA 4UM9B 3WB0A 3M34A 5FTLA 2G40A 3GEEA 3VO8A 1FFDA 2R8ZA 3DFZA 1Q17A 3EFOB 5CRIA 4YFYA 1U4SA 4YAEA 5EKDA 5BVGA 2RAVA 4G24A 4PFQA 5IXJA 1DU4A 3FVVA 2J6CA 4RSRA 5JNWA 3V8VA 2NG1A 4BB6A 4HWGA 4MV8A 1GNRA 4I5DA 3H1TA 4RVCA 1E60A 2YY5A 2FG5A 2PEZA 2VJMA 5DULA 2Y93A 2G5PA 3BFVA 3LDHA 3U80A 3K9LA 3ZXIA 4EBFA 5FBKA 4Z4GA 3OM1A 3UPUA 2HRDA 1EDOA 1R5JA 1EFCA 3FYUA 4B79A 3GZ4A 3ONEA 1PJLA 3A9SA 3ODPA 5CP8A 5DT9A 4L5JA 2R5FA 3AR6A 4KGDA 5DW0A 2HWUA 5T4EA 3TOXA 3VPDA 1V1RA 2E37A 2PZBA 1Q19A 2CF5A 2W70A 2XE8A 3RSGA 4YRRA 4JZYA 2QMUA 3RVLA 3VYWA 3WOHA 5BY2A 1P19A 3RHZA 2V6BA 4R41A 1EWRA 1VXOA 3RREA 2PO5A 3D2CA 2WAAA 4HMPA 4D4GA 2RBGA 4H0NA 1G18A 4F2PA 4HCJA 1XTRA 2GTHA 2QM8A 1J39A 3DYVA 3VDQA 4B87A 5A4MS 2Q4BA 2R7KA 1LSUA 4M9UA 3VNRA 2R7AA 1S2MA 5ECYA 4DZZA 3DE5X 1JSXA 3PUYA 1YS2X 4S1OA 4UOQA 2NZ8A 4IFIA 2RHHA 3PLNA 2H4XA 3VJMA 1PJ8A 2C4WA 3VBEA 4BB5A 4MV6A 3RVKA 1ZWLA 4TT3D 1QIGA 1N25A 3PX2A 4MS4A 1UC4B 3O83A 1YQQA 1KFEB 4RHFA 3W06A 1PQPA 1KPHA 1T2UA 3EXHC 3B78A 4KE8A 4DCCA 2QJWA 1YR2A 1Q11A 2P6PA 1UF9A 5K0ZA 1SWVA 4YHHB 4TV9A 4X1YA 1A8IA 4RL6A 4RANA 4BLQA 4LBWA 2CE7A 4B7XA 2CVFA 3FH0A 1TM2A 4Q66C 2GZHA 5JV5A 1MB9A 2CXTA 1JWBB 3IPRA 3KE9A 3ZLUA 2BFBB 4HB4A 2QI9F 3FPCA 5JNTA 2HW8A 2CZCA 3R41A 1QH8A 1CW2B 3CPSA 2YMPA 4PG4A 4J3FA 3TJMA 3PRYA 2VNAA 4D3ZA 3DZIA 2A1IA 2D4HA 3EZFA 3SR4A 1WSDA 3WIOA 5B55A 2GRUA 1XPJA 5CLFA 1RWXA 2ADFA 2DHRA 4U2FA 3RYHB 1DG3A 1QVVA 2QR3A 1ECBA 3R7SA 4HD8A 4CMHA 5F7OA 4PG8A 2AQKA 1Y4UA 2XUFA 1PNTA 5TNXA 1G1AA 3V4SA 5MHTA 1X1CA 4NYIR 5CEJA 1IVSA 2ZZNA 3WHPA 1BYIA 3E7WA 4KO2S 1NR1A 3FMFA 3ZV3A 1EWYA 1C0IA 3FUXA 1XZAA 3N5KA 4K1XA 1GG2A 5TVGA 3AIIA 4BRUA 1JHZA 1XQXA 3E15A 4LJ6A 1GFSA 1U3FA 2V7XA 2F8LA 3BSYA 4ZT6A 3ZU6A 4ID9A 3MWYW 4BAUA 3JVIA 5BSHA 4MQ6A 2RHLA 1EGHA 3H86A 4ERNA 2G17A 2Q41A 5IKMA 3QU9A 4X8LA 3U4HA 1U3VA 1WUKS 3QPUA 4H17A 1JG7A 1G3UA 2JCYA 2UDPA 3C5CA 2O0JA 4DQVA 2VQ6A 4YQYA 1PL8A 2IZ1A 3RC2A 4DL9A 4KV9A 5JFTA 5IF3A 4UNSA 2W4MA 4PYRA 1UBFA 4KRGA 3LNTA 4X6LA 2NUPA 4GECA 4ZVQA 2J0SA 2PPLA 1VLZA 2JIZA 1H3NA 2ZFUA 3OJWA 2I3BA 5BP7A 2HMSA 1I4DD 3TLZA 3GCXA 5AMXA 4EKIA 4MJ7A 4B7ZA 4IV0A 1SQ0A 4GGMX 5AI0A 2IITA 3BE4A 4ECAA 5M34A 3JD3A 2VQDA 2YWEA 1HQCA 1KXJA 2Z9BA 4MS3A 4N9QA 4OY3A 4H18A 4DC0A 2WMOB 4ZVNA 3M5PA 4UXIA 3CWQA 4Z8YA 1NV9A 4K03A 3A1DA 4R51A 3ZCQA 1SFRA 1TZ2A 2BY4A 1AN0A 1BROA 2C3PA 3GA5A 3FRHA 4MCIA 5BNIA 1H0KA 1FUUA 1I10A 1ONOA 1OI3A 1VKRA 1YVUA 5DN9A 5ELXA 3I9JA 3GUHA 3VDRA 1GZ6A 1FDTA 3ACCA 3M9WA 1E8DA 3TQRA 3GGDA 5A4IS 2PRYA 4IKPA 5T3UA 4IJUA 4QDTA 3HYNA 4CF4A 5C7IO 4ZALA 1WAMA 1YO6A 3HA3A 2XMDA 2H8KA 1P0QA 1L1QA 2OY0A 1JAZA 1ESCA 4OQMA 1S6YA 4ZZ1A 1JSLA 3H2ZA 3DPSA 1XN4A 1E3WB 2QRZA 3G0HA 2CNKA 1RJ9A 1RWVA 1X7XA 2HMYB 1IEVA 2I8LA 3A1CA 1OAAA 3EXG2 3HCWA 2EKQA 3IRVA 4R7ZA 1KVUA 3TOVA 1D1PA 2HCJB 3H2BA 4W1RA 5A2GA 3HJRA 3K71B 3QE9Y 4UJ3A 1KYYA 2DWQA 1E0SA 1LY1A 1RJWA 3OKPA 2YQZA 3PK0A 1BCRA 3LP5A 3B3JA 3RT1A 5L4LA 3FJYA 1TIPA 4YYEA 4LDRA 1QGED 2IHYA 2PMBA 5BPHA 4NCKA 2QBYA 4OHZA 4AJPA 2P3OA 3IUJA 2CDRA 3NEAA 1C3LA 4NPCA 4ZOBA 2H85A 3ND6A 5AP9A 2LR0A 4LJSA 3SDSA 1HE4A 1R5NA 3KQLA 3F7TA 1W52X 4OHCA 1TGYA 1S4MA 2ZUWA 4FDMA 3SZOA 2V8OA 1VB5A 4L72A 4UVGA 4D9JA 1M8PA 3KZKA 2XODA 2OWDA 2W00A 3ND8A 5MFZA 2VTBA 3AIMA 5L4SA 3T7CA 4V3BA 2C7QA 3H2YA 1NC3A 3K0AB 4RK5A 1SCUA 2VT7A 4B3BA 2ETXA 2FWAA 4YCJA 1GRVA 2D2EA 1QVWA 2FTKE 4DT1B 3E8MA 1YU6A 1OLXB 4EQ6A 3KUDA 1Q50A 2A58A 1MX9A 5BSUA 1PQWA 1UIMA 3BK7A 4CF6A 2X9GA 1PJZA 2XUKA 4C01A 4P82A 1XK7A 1II8A 1HDEA 2AOUB 2P9HA 2FZGA 2WWRA 3ILXA 1J25A 3BSFA 5CYFA 5HIJA 3WQQA 1M2OB 4F5WA 4D3DA 4B45A 2G4CA 1XVAA 1E89A 4MQUA 4V0KA 4NYMR 2I4MA 3VKWA 3LT5A 4B6JA 4MCAA 3FFWA 5JT1A 1XRQA 3Q5GA 3WTCA 2JW5A 2OL4A 4GXNA 4C4ZA 1L8AA 2KWIA 1X3SA 3DEAA 2D59A 1ETUA 2J0EA 4UEWA 1FVHA 3VPSA 2Z2XA 3PJFA 3WLLA 3ZWBA 1Q15A 1FJGB 3FMVA 4ESEA 3AR4A 4II7A 3EEYA 2RH9B 4I50A 4LZOA 4NONA 4BVGA 2PH5A 2YZKA 3E3NA 3M7IA 3PFHA 2QVYX 4U4AA 1PZNA 4RGBA 4YMTA 5IXSA 2G1KA 1WDTA 2JI6A 4FCVA 5I47A 3ZHYA 3WO0A 5JALA 3O3CA 3AOGA 1IMOA 1XU9A 2P8JA 3AR9A 4GX1A 4FBLA 1QJ4A 3T52A 4BMZA 5H8WA 2QD1A 5LSAA 3H4MA 2GT1A 3O7WA 2IYUA 3ZNQA 3M3PA 1E2GA 1RI4A 3DZBA 3UWKA 5JH7F 3VKGA 1QHYA 2PSEA 3OJFA 2XCSB 5CK4A 2Z9CA 3VR5A 2D1TA 4DSOA 3EXHA 3IPCA 1R9NA 2VSFA 1T2VA 1A76A 2Y77A 2VHJA 1IULA 5L6LB 1ZN2A 3DKPA 4LYJA 1THTA 1N6LA 3IAS1 4WZBE 1Z36A 4XD7A 3TNDA 5CFLA 1AHHA 2MDTA 3QXHA 1LDYA 1L5NA 5K0CA 3S8YA 4LW8A 1GUBA 2CW5A 4RXMA 4ZYYA 3AO0B 2IU4A 5ESWA 3M3HA 4DPMA 3A9TA 4C20A 3EDRA 1DJQA 1Y6FA 2VXOA 4JV5B 3PI7A 3IAEA 2C5FA 4B4VA 3WWDA 3GK3A 4MRNA 3O9MA 3T9BA 4XX0A 1GAXA 1OYOA 2MR5A 3UK1A 2AKEA 1NR5A 1P2SA 1Y5LA 4DC9A 3B9RA 5L3SB 2D5BA 1Z8HA 4RVSA 2BJWA 3D7MA 1RM5A 1RHQA 3Q6IA 3MGBA 2BI8A 2LGJA 1LSJA 2FRVA 3ESBA 3MOGA 3OZCA 4RO0A 4NZZA 4RQUA 1UAAA 3JD1A 5DBGA 5H81A 5B2EA 2WUVA 4FYKA 3UXHA 4Q4AB 1V11B 2QRGA 2ZSIA 4BGDA 3NVDA 1DC6A 1QHHB 1Y7IA 4HH3C 5KKCA 1NNLA 2YXNA 4Z1MA 4C78A 4DLNA 2VNHA 3G9ZA 2GPAA 4JKIA 1SC9A 4GICA 5EQDA 3ROMA 4AUNA 2C5BA 4DXDA 2I91A 1D6NA 1XWWA 2V7GA 1CS4C 1NVTA 1W96A 5I7AA 2J31A 1XEAA 1SGWA 3MJVA 5JJCA 1E4OA 4RD4A 3U7QB 4EO4A 4GPBA 5A5VA 2B7LA 1JIVA 1P4RA 1UFQA 4QXRA 1I33A 2E5FA 4MKGA 1KR5A 1P81A 3PPVA 4R54A 2FFBA 2ZUVA 5EJ2A 1F8XA 1E2EA 2DH5A 1JFTA 2O8EB 5IARA 4DNXA 1GKLA 4L6IA 5TRTA 4H4CA 1SM4A 3RRMA 1I94B 3CWZA 1F0NA 4M1WA 1NI3A 3BXEA 4M98A 4Z4QA 4CDGA 1Z5VA 2X8JB 1C80A 2CMFA 5E1DA 4ZGGA 3HDHA 4RHTA 2F3QA 3SBEA 5J58A 1L7AA 1LA2A 4LTMA 3C8ZA 4LQ4A 3EF0A 3VPHA 1JE1A 3OBBA 2W2OA 1N2OA 1DAPA 4A2WA 5EMLA 1B2RA 3ZXUB 1G6Q1 2XCUA 2DCMA 1FNMA 1XZJA 1EGAA 2KS6A 3B20A 1Q7CA 3DO6A 5DNVA 4AZTA 2Z2ZA 1NY5A 2PRJA 2XVYA 1WPRA 5EESA 5T5QA 4FZJA 2PZ8A 5F78A 5IP5A 4ZK2A 4JI4B 1DXYA 4BV2A 2G9QA 3K0BA 3VUEA 3STTA 1F3LA 3P7MA 2HRRA 4H15A 2RSLA 4AL4A 4L5IA 3QX8A 2EJTA 1Z8FA 1GTVA 3AMVA 4AZVA 3EIWA 1H69A 1NE2A 1XNJA 4LIPD 1FSZA 1ZA2A 3BMQA 4FINA 3P9CA 5H7XA 4B09A 1T43A 4JB8A 1DLJA 2BELA 4EJFA 3HKCA 1T8PA 4RGVA 3WV4A 3F8WA 3W7VA 1TKBA 2IIBA 2JZCA 2V0CA 3CR3C 1K5GA 2Z9DA 2Z1DA 3CTPA 3R0VA 3K6RA 1EFRA 3RNOA 3HCBA 3E03A 3P2JA 2J9XB 3NOQA 3RVBA 3SZ3A 5D51S 2FZKA 3FAZA 5C46F 1XKXA 4IMPA 3ESCA 4OUDB 4RA6A 2CV2A 3LBIA 1FS4A 4D4HA 1EFVA 2C2YA 4JP2A 1OGIA 3HABA 1Q7EA 1BIFA 1FJ2A 3D0OA 3FWYA 4I4CA 4Q0MA 2FQYA 2DUWA 1F5NA 5AVSA 1UFVA 3V4RA 3ZBQA 2NSHA 4GMKA 4B6FA 3W78A 1ONNA 1YASA 5MN5A 3O6VA 2C5HA 3NTUA 3TW8A 5HF9A 2PKRA 3COPA 4KXQA 4V0MA 1CRPA 4LWOA 4NABA 1JLHA 3UAZA 2QTCA 3DGFC 4MQLA 2R5NA 2ZR9A 3CXRA 3TEMA 4F45A 3X1KA 2E4ZA 1O54A 4LVUA 3N76A 3KVOA 2ZRQA 1KI7A 1XLTC 4NH0A 4S1NA 1K5PA 4BWFB 5C1IA 2A5LA 2J48A 4MGYR 5E8JA 3PIDA 3QEMB 2J3EA 3D2AA 3G8AA 3JRNA 4ZHQB 1S3IA 1NUQA 2QQ0A 1ZN8A 3PQ2A 2I66A 1N75A 4XUGB 3UUEA 1AJEA 1QHGA 3ETGA 4BNLA 5HRAA 3QVVA 4BX2A 5KTYA 2DBQA 4IS2A 3UHJA 2XITA 1RRPA 4RELA 2ENWA 2Q21A 2RGUA 1Z2DA 2VDUE 2H2DA 1RHMA 3GGGA 4Q39A 2ZSUA 1A98A 1Q0HA 1SCKA 3FDFA 3Q3VA 2PJUA 3WDSA 2CHEA 2B4AA 3HV0A 4IQFA 5DE3A 4E3WA 2XJ4A 3HNOA 1SIUA 2DECA 4MUNA 3ESYA 3KO8A 4DR2B 3EK2A 4AKIA 2F1KA 4KHPB 3NJ4A 3OX1A 4A6DA 4WI1A 5JSFA 5B5SA 3GAAA 3GPCA 5L53A 1X1AA 3IAHA 1IOVA 3M9LA 2LCFA 3ROFA 4NY1A 1W87A 4MGEA 3P4UA 3S6JA 3K96A 5ADUS 3BPSA 1KMNA 2E48A 4F21A 3W4KA 1JX6A 3B5JA 3HRIA 3IJRA 2C0CA 2QIPA 2YVKA 4C0XA 5A05A 1Z6TA 3IOEA 2HMUA 3T1QA 1HE5A 3VU0A 2BHTA 4GXTA 1FFSA 1O58A 3VC7A 3DT9A 821PA 2WB4A 2VJCA 2E2WA 1ESEA 4R69A 2ATXA 2GCNA 4RD0A 2D0OB 2JJ2A 2H31A 3V2UA 1T6XA 3A9RA 3MWLA 1OBHA 2ZPTX 3BRSA 2HRQA 3C7AA 3CX7A 2PGIA 3Q7QA 4MGHA 1ORRA 2GZAA 1JQAA 4R9SA 1QIIA 1N2CA 3QW2A 3HTXA 7MHTA 1K3UB 2Q8PA 5BW4A 2IH2A 2DT5A 3Q15C 4E70A 3FCUB 2QTLA 2KLHA 2KBFA 4UULA 3PHCA 4CKYA 3LXUX 3M9XA 2NQ8A 4LA4A 1QP7A 1NHGA 3GMIA 3MAGA 3CIFA 3EIXA 4H1VA 1G21A 3AHIA 3IMFA 5EMNA 4FYVA 2WEKA 3WSVA 5JZBA 3B6JA 2JHCA 3T1HB 1T0JB 2N1MA 2VAVA 3SDZA 2PCLA 5ICEA 2QV0A 4KXFB 3WL5A 5B30A 2AFHB 3PWTA 5AKYA 2VHTA 1IVYA 1MG5A 3C14C 3EGDA 1STOA 4IZHA 3KZVA 1CS0A 5FWNA 2FP4B 1SR8A 5E6RA 4G0QA 2R2AA 4RIHA 1VLVA 1Y4DE 3SS7X 2VHXA 1L5VA 5T4BA 1EP3B 3LHIA 3WIUA 4WJLA 1RLIA 5TMPA 2GBLC 4XAQA 2Z5FA 3UJDA 2Q6KA 1AKNA 1UIRA 2JANA 3GLHA 3O2SB 4R2WA 2E9SA 4F9EA 5E8RA 1YSCA 5CCXA 4E21A 1SD5A 1TNDA 4JLNA 3BMCB 5H5JA 2W6ZA 1TOAA 1GGVA 5CM2Z 5CX4A 5DGHA 1CE8A 4ACBA 3DE3X 4F5DA 2E1RA 4BMYA 5K5EA 2VF5X 2YV5A 3NJRA 3RKUA 3VV2A 2WZBA 4BCDA 1YKFA 2ZGVA 1LKZA 4FKBA 3Q6MA 4P81A 5LJIA 3L9WA 5DHSA 1KTIA 2HUNA 3GEBA 3ZC3A 1I5RA 4FDLA 1X1TA 2HK9A 1K98A 1ZESA 3CLHA 5GJBA 2J5QA 3DWIA 3FZNA 5EIXA 4JYZA 2NADA 4GOKA 4Z9AA 4M49A 3KFLA 4V0QA 4ZVPA 4IILA 3WE7A 2Q45A 2PGAA 4K8OA 4WY2A 5AM0A 2QN8A 1M66A 1J2YA 2RGGA 3T1TA 4EI2A 4RKWA 1ZM9A 2XB4A 4C3OB 1PVVA 4QX6A 1P9OA 1NG9A 2JKZA 1L5FA 4GOLD 1HDXA 2Y1EA 3PQEA 1JB1A 4ZYTA 4HOYA 1DEAA 1Z0DA 3OTWA 2X5NA 1PEAA 3IGFA 1N7HA 1RM0A 2QJRA 5IAJA 2EW1A 4TROA 5D85A 1C3OA 2NMVA 1BQ4A 5GZ3A 2FSUA 1UQRA 2TRSB 4MKFA 3FWNA 2ZAOA 3RRYA 4HRXA 4E5MA 1AGYA 1MAAA 2HPHA 4WZAB 5KC9A 1Y9EA 4FHDA 4G0OA 4QYXA 3NVAA 4IH1A 3SR0A 3SCZA 4V0RA 3GUUA 4W4TA 1E96A 2R8RA 2DQKA 3ZY2A 4FU0A 1TUBA 3LLMA 4PLGA 5FB3A 1U8FO 1RAFA 2CE2X 2ZUEA 1IAQA 4MQ5A 6YASA 4YV0A 3GJ6A 1BFKA 2WDPA 3E23A 1NN1A 2QVBA 2YXEA 4ZC8A 5T41A 2PY6A 1MC1A 4NCIA 2YOFA 4GD3Q 4CDMA 1S3GA 1YIAA 2AC7A 3FKSA 5TJ9A 3HEBA 4R2LA 4TL7A 3UGQA 1OSNA 2A9JA 3JR7A 3ZEAA 5J4KA 4JOBA 3THXB 3VSEA 4KQJA 3JS5A 4XB1A 1Y81A 2FPIB 5L7WA 3D7SA 3CZQA 1P61B 4IJKA 4RTQA 1NJ8A 1U1EA 1QCZA 3PTLA 1PDVA 3GJ3A 1EEXB 1EK6A 2C99A 2G82A 3AJDA 3ZV4A 3V6LA 1V2GA 4GYWA 5DNCA 2BGWA 5EGNA 5SY6A 4R8KA 3DWEX 1OB5A 3G0GA 4XFDA 3ZQ6A 3S2YA 3N0WA 1X8KA 3DZCA 5A5DA 4D6PA 3ZNNA 1ZNXA 2AG1A 4UUBA 1W25A 3KYDA 1IU9A 1PF7E 1J2TA 3VZSA 4JBWA 4PM4A 1ADCA 3WGJA 1TK9A 3RSFA 4F4IA 1UWCA 1XDWA 5H82A 5KYTA 5BW6B 2UYCA 3DKRA 3E9YA 4EATA 3QWAA 5LZ5A 1TDJA 1D2MA 1JFFB 2VQ3A 2WPNA 4XSVA 1PFGA 2WLTA 1UFOA 2C98A 1RXVA 4XASA 3V4LA 1UUFA 1XLTA 3BHJA 1SBNE 2SKDA 1JEJA 5A9RA 4E32A 2HOQA 4H6VA 5A0FA 5LU8A 3AP2A 3B8HA 3IYLW 5FPHA 1K3TA 1P73A 2WVGA 5KJFA 3RJTA 5FQOA 2IS6A 4GWGA 5FIUA 2ZT6A 3EVTA 3M6XA 3SBXA 4ZOLB 4AJ1A 2V6MA 2ZU0C 2BBTA 3C87A 3MTGA 2PX3A 4JDPA 4N3GA 3D3WB 5C5EA 4JZKA 2EL9A 5KNDD 5KOHB 4MVWA 4RFLA 1Q6YA 5CDGA 1WUHS 3ZK9A 4NNOA 4FEEA 4K9MA 3WGUA 1AK9A 3ETNA 1ZM7A 3BYZA 4L51A 3UAXA 2AR9A 1X7ZA 1SH7A 3C3MA 1K5DA 5CBKA 5A6SB 1AXEA 4K5QA 3AINA 4WW0A 1T4BA 4B3TB 1UDWA 2ZJOA 3L4EA 4YRIA 3UHPA 2PZMA 2ODWA 2DFLA 3HXLA 1JQ3A 4X64B 2VTVA 3V4VB 1OJ7A 3L0PA 4WLFA 2I4TA 1JIKA 2QRKA 2VO1A 3UMRA 4AIRA 2X4LA 3IBTA 1J0XO 1WMAA 4BO3A 2B94A 3DEZA 3ID6C 3G68A 4MV4A 1XQVA 1G41A 4L6AA 5K99A 1IY9A 3UMMA 1N8SA 3IS3A 3BTVA 1NX6A 2I6UA 1D6SA 2WU4A 2ZLBA 1E0JA 3B9BA 2IXDA 3FWZA 2ZULA 4HNGA 3CN9A 3TH5A 3V00A 1Z75A 4PX2A 1K27A 5IUKC 1POWA 1Q7GA 2OXCA 3DFIA 3UMGA 4F4JA 5EJEA 2DR3A 5FFNA 3CLRC 3KPVA 3UAOA 1EBFA 1M8FA 3KV1A 1LBHA 1ID1A 4UEQA 1NWHA 3W5UA 5KDOA 1GV1A 4UBMA 2P67A 1RWBA 3LUJA 4LCBA 2QA5A 4LQLA 2FR1A 1NFQA 2AKYA 4GXQA 2SCUB 4NZPA 3DBRB 2WPDD 5JJBA 2FSPA 3DTVD 3UG7A 2IHNA 2O3RA 5HE9A 2V3CC 1YBAA 3JQ7B 4K9SA 1E6UA 3EGXB 1GAEO 5HQ3A 2ZXUA 2WSSD 1ZRNA 3AEKA 4W8GA 3ZIAA 5FBHA 2JH9A 4IDEA 1I01A 1W88A 1Y4ZA 1RXWA 4R2XA 1BXRB 5SY4A 3TDKA 2ZSKA 3BZUA 1JUDA 3TTSA 3ZN2A 4ETMA 4Q00A 3U13A 2ZCUA 5ALQA 4DR1B 2FP3A 2YVLA 5KJ1A 4O4IF 2OB1A 4FMCF 4I5FA 2YZ7A 3WLMA 3GD5A 1RI1A 4JB0A 1K8YB 4OQLA 2J7PA 3IMKA 2JLCA 2W6IA 3EUFA 1O5TA 1T3HA 3FOWA 3KWFA 4QJBA 4TYWA 2VLIA 4EYEA 2VP5A 2A88A 2ISSD 5JXHA 3ZDZB 5J5AA 2Z04A 3JQCA 3KZMA 4INOA 1P39A 3L7LA 2KPOA 3F3SA 2NV6A 2ZS8A 3ETJA 5B58C 3K8OE 1KFCB 4BNXA 1GVNB 3PGLA 4U7FA 1IZ8A 5TR9A 2GBLA 4R5HA 4ARBA 1PZEA 1YRQA 1VLMA 2IYPA 4R1LA 3LY8A 4ZHSA 4Z9YA 1SEVA 3IKJA 3AEQB 1PR9A 4QO8A 2VTBB 4NFSA 1U8CB 3AX6A 4PG5A 4IVRA 4S1WA 4RTNA 1WUTA 1P1HA 1HGXA 1Z74A 4KCGA 2Y76A 4CCYA 4XYEA 2OM6A 2R65A 1O97D 5DBIA 3VKFA 1ISHA 2MU1A 4Y9TA 1J2UA 1JFRA 2EG9A 2FFHA 3NBAA 3BCSA 3F6EX 2LV8A 4KLAA 2P62A 4RVDA 4CPDA 3GGSA 4F0JA 5EQJB 4WNAB 3OKFA 5CTJA 4H3HB 1GM5A 1AGXA 3DWFA 2Y27A 1BOFA 3F98A 5EA2A 1J0BA 3O8NA 2M6LA 3AB3A 3BD6A 2C4NA 2K7ZA 1QS0B 3K1TA 3QKSB 4WTOA 3SKXA 5IDQA 3O8CA 4HYQA 2ACKA 5LMCA 1N33B 3ZZ1A 3LC0A 1GYPA 4I4TA 3TIGA 3FMIA 2XXAB 3DO5A 3HLTA 1KZ1A 2BEWB 2FLVA 4JJ8A 3FLBA 2V3WA 5GIOE 2WKWA 4EVQA 2WHPB 1ODKA 5EWLA 1H22A 3TSOA 4PCAA 2EZUA 4BN5A 1TVMA 2I2CA 4IF6A 4JGIA 2B82A 7AT1A 5JO9A 3EQ8A 2AOXA 2AV6A 3B7WA 3E1KA 4D8XA 1HSZA 3R3WA 2YNMC 3QX9A 3O74A 1ZVVA 4JIGA 4KX3A 1P0FA 4PAGA 2HXYA 3D6JA 4JLAA 5F12A 5JD3A 4C30A 5BVGB 4H7IA 2ZUSA 1ZJ6A 5FWXB 4QAJA 2XZDA 3DMGA 5HEKA 3VX3A 2IYRA 3G88A 3P71T 2QL7A 4UQOA 4PSAA 4DIKA 4JP8A 2Q1YA 2P2LA 4EAAA 2QU8A 4CQNA 2YVQA 4YAFA 4GSKA 1JTVA 2QYTA 1OBFO 4IHAA 4BMXA 1N92A 2DSTA 3T5CA 3K70B 4Z53A 1VJ0A 1PKEA 2NV0A 3FYUB 5LQDA 3I6YA 2G1PA 4KXMA 3AJEA 2R00C 1XVLA 5TGZA 3RS3A 4RU1A 1TRHA 4EO9A 1B74A 1V1RB 4RHYA 1S3SA 2J3KA 4RPGA 2R7NA 5FLEX 4BNJA 2PBFA 3SFTA 4HH1A 3HDGA 2F17A 1A8PA 1F06A 2CHFA 4OB6A 5DI3A 4RM3A 4FKZA 3S81A 3PGVA 4XYLA 2HTEA 5F7ZA 3S2FA 3C48A 3WBKA 3SC2B 1C3JA 3F9IA 4DMHA 1NT2A 2CBXA 5LXTF 1XEXA 2VDOB 4YAKA 2JPDA 3H1GA 1CHNA 2ZBVA 1NRXA 2FNAA 5JW6A 3GGJA 3HK2A 3NMUF 5HUHA 1ZK3A 1YONA 1MAVA 1HORA 2RBEA 1PGJA 3GRRA 1CU1A 3GZNA 4GU5A 5BOVA 3WRXC 2PANA 1LZLA 2UZ0A 5EP4A 2AUNA 4F12A 3BJRA 3IEUA 5EERA 1XLWA 3G7NA 4MS4B 1WZUA 4HLDA 4G8CA 2CVQA 1QOZA 1T10A 1TI7A 3K15A 4LYYA 4X71A 3SS9X 4F3RA 3N8IA 1L7XA 2RJNA 1P33A 3SOZA 2XADA 4EYQA 3AY7A 3LCVB 1QF9A 4TV9B 4X1YB 4XB2A 5J5CA 2FEXA 5TF0A 4I55F 3VR1A 1DJLA 4MRMA 4B17A 4OI4A 2GMWA 1YULA 4TWRA 3P45A 4QARA 1Y3AA 1PTJC 4RSGA 4TMTA 3TLBA 3B36A 5KNCH 2HL6A 1ZD1A 5K20A 4QQKA 3CGWA 4IDAA 3QV2A 3KZNA 4ZVUA 4HF7A 1FP1D 3KC2A 1PFVA 1QH8B 1RYEA 3JWGA 1YJBA 4LHWA 1MJHA 2C5AA 3L7DA 3VAZA 4AO8A 2GXQA 5K3FA 2H4FA 3AJ8A 4I19A 3DKVA 2RH8A 4A9AA 3HU3A 1I3MA 3IJPA 4J2OA 4DUYB 4WMLA 3HYSA 2ODNA 4JQSA 5B4TA 4G9EA 4Y6LA 1B3BA 5LDGA 3WYDA 1O77A 5E1BA 2QLJA 3T15A 3ZH9B 2WV9A 1RXCA 4KL8S 1U7XA 5DT2A 1PLKA 2GQ0A 4RADA 3WSWA 1CKEA 1XNGA 4N65A 4D98A 2HYDA 3G23A 4Q93A 3OIUA 2HQBA 2YJ3A 3A1TA 5F1OA 4BKOA 3H04A 4BLVA 1B73A 2UYQA 2XQKA 2PZKA 4FCWA 3UMJA 2ZM6B 1SVNA 4Y2TA 4F2WA 1LF5A 1SCNE 2PS0A 1KVTA 1ZRHA 1VDZA 4PYIA 2GN6A 4K0KB 1H05A 1QGDA 1SVWA 4KXNA 1B8OA 3D0KA 3FOAA 4EPXA 2JDID 1IRIA 3HXPA 3DLPX 1PJCA 1VKNA 3A10A 4D7AA 4EHIA 3ZGZA 1CVLA 3IUPA 4EVIA 1DIOB 2JGLA 4KO8A 4KIUA 1ZKDA 1ZQ9A 2ANBA 2IYFA 1QNFA 4JP1A 4YDRA 2OXTA 2IZ6A 3WB1A 1UANA 4FCCA 5CT5A 3SF8A 4BQSA 3ZLJA 3PI6A 3MBKA 3ENQA 3O1HB 4X1KA 1TC1A 2FDCA 2RHDA 5F23A 1KP2A 1L1EA 1JJFA 1YB5A 3GGOA 1ZCAA 4LDJA 3UT0A 2DAPA 2VEOA 4ZZ3A 3EG5A 4MS3B 3MS2A 4G1BA 1I4TD 1OV6A 4BFUA 1H85A 3Q3CA 1B4DA 2FSSA 1H8EA 2V45A 3JWPA 4Q7JB 4MULA 4WPGA 4Y2QA 5D7NA 5HZHA 4S05A 2VT2A 1UBTS 3VC1A 4I55A 1T2EA 4K6CA 4BO5A 1KI4A 3LMKA 3GQBA 5I45A 3IVRA 3RI3A 3PZRA 5CCEA 1HF3A 1SC4A 4YRGA 2GTIA 2JFPA 3CH7A 3PNSA 1KEKA 3SXUA 3CZ5A 3AVUA 2F9MA 2GEFA 4EMBA 1U31A 2A0YA 4C0BA 3ADOA 4G26A 2YL2A 4V3CA 1TIBA 4YCDA 3KU4A 4UUAA 2MTBA 1VE9A 2ZR8A 1E2HA 1ESNA 4ESOA 2XQGA 4G41A 2X9VA 2FJUA 3JARA 3ZDQA 3N86A 4DLTA 1KP3A 1G8KA 3TZQA 4YCCA 3FYHA 5JY1A 5L3QA 3VISA 4GQBA 2II6A 2PFSA 2XMCA 1RJ9B 1X7XB 1Z8DA 3P19A 5CJJA 4MI6A 5CA0A 1G0NA 2AMVA 5CMLA 1OA0A 1SBIA 1A5ZA 2HA6A 3JQQA 2YC4C 2PMCA 3EDYA 3WI7A 2G5TA 2Z4SA 3TE6A 1YGYA 3TD6A 1RPAA 4K6HA 4C2AA 3V42A 5KREA 4WXMA 1KA9H 2NAPA 1FDWA 3SKVA 4ZMSA 1OMOA 1BMFA 4A8JC 2C58A 2O2DA 1NVVR 2ABWA 2O2GA 5A6VA 1E6MA 2HADA 4PZDA 1TKAA 1DRVA 3B12A 2BE7A 2OXEA 2I54A 3E9NA 3NH6A 4JC5A 3W5VA 5JMWA 1H6BA 1C50A 5AVYA 5LQJA 2IXTA 3I5MA 2HA4A 3RBXA 1E7MA 1F8FA 3UHAA 1G7CA 3BXOA 4BTEA 3RUIA 2CMHA 2JGAA 2DG2A 2PNJA 4LRYA 4HUTA 4XWGA 4B3GA 1B1CA 1RM4A 1S2IA 1ZGAA 2YNMA 4INPA 4JJ7A 4NPAA 5EUCA 2ZETA 4DIOA 1KVRA 5FFMA 3KKQA 2DMRA 3ZE7A 1JLSA 1IVNA 1I7PA 1W5EA 3DDHA 4EKDA 4R8LA 4PAMA 4UE6A 4WASA 5A4AA 5ARDA 1ODFA 4J1SA 1TW2A 1CUXA 1ZBQA 4L27A 2ZYDA 1U5CA 2QEQA 3BA1A 3OT5A 3F9CA 5ADHA 1CTQA 1XTVA 4QAQA 1GEEA 5KWIA 1HV8A 5C1OA 4DA4A 2W7TA 4TSKA 3EHEA 3OLZA 3TSWA 2C9ZA 1II8B 1LNZA 1NBAA 1MQSA 2VATA 2R00A 2QN9A 2XOEA 4ID3A 1QIEA 3R8CA 1XPUA 2UXBB 1BFUA 2J07A 5DHQA 2WU0A 3UW3A 4G1UC 3CKKA 4R16A 3QBEA 4FGUA 4OHMA 3VR3D 2NYVA 1WY5A 5A3SA 4QLBA 2MSEB 5JAIA 2CFTA 2C2OA 2XB8A 1CDDA 1DQYA 1TK3A 4G0NA 5BV2P 1UXJA 4MVCA 3E81A 5CU7A 4ZP1A 1NOJA 1I32A 2H9YA 2OCIA 4D97A 1SUEA 1DC5A 4JUAA 4YMGA 4LVNA 2H2WA 2EKPA 1PT8A 4RZ2A 4BEJA 1R0KA 5IT4A 1IBMB 4I50B 1E1DA 4FNAA 2YZMA 2TSYB 2ZWOA 2I1VB 5K6TA 2AD1A 2FZEA 3DLHA 1PX2A 2GSWA 3NUQA 5SV2A 2AN1A 3ER6A 1W0KA 1YZKA 1NBOA 2QMYA 4X6YA 3WRXA 1QFMA 1CIPA 4LE0A 1VA5A 3SSNA 3IJ5A 2P75A 3VOSA 3GRFA 4YMIA 1W1IA 3CKMA 3ZU2A 3GMTA 1CP2A 3OZUA 2A67A 1ENYA 3I0NA 3AF2A 3M4NA 1P0IA 4CM6A 4RCYA 4DG9A 2BTOA 2GLUA 2BUBA 4IPTA 1M34A 3KQOA 1P44A 2FN4A 4YRTA 5DH9A 3Q9NA 3VR2A 1F4PA 4D3SA 1U9IC 2CC2A 3CVOA 4Z6KA 1E6EA 1AK1A 4RFSA 5JHGB 3ZGVA 2GCGA 2EX4A 1GTSA 5F9FA 2GILA 3G85A 2J3JA 1G3MA 1EXWA 1PTJA 1QORA 2ZCVA 3G5AA 4N5HX 2KMLA 1XMXA 2OFOA 2A9KA 3I9LA 4FT2A 1OPRA 2CHVA 2F1RA 4WGGA 4BJHB 5KB3A 1LRJA 1FRFS 1JEOA 5KSZA 1I4OA 4UARA 2CFRA 4OK3A 5JAMA 3IE0A 1V5GA 4GKVA 1FU4A 4M1SA 4BMPB 3QVUA 1R18A 1Z07A 5I5GA 3U7JA 4M8SA 4XVQA 2PYDA 3HRKA 3EE6A 4XX0B 3DAFA 3KZOA 4IX1A 4LJ4A 1GGKA 4OAQA 3WZMA 1L7OA 4R1UA 1TZCA 2YIVX 2Q49A 4BC0A 4K6GA 3JD0A 3A6DA 2POQX 2JF0A 3KNZA 5HTKA 3SFZA 1YFJA 4CF5A 4IMJB 2UUAB 1XMPA 4Y7DA 5FD8A 4P7GA 5HBGA 1FFAA 4K6KA 3RLFA 4F4UA 1I2DA 3NPAA 5I4KA 1OBOA 1MHPA 3CKYA 2TECE 1KORA 4G84A 1MH1A 1SCJA 2OBMA 2ZUBA 5EC8A 3GX1A 1HDZA 3PC7A 1OAKA 4Y18A 5FO0A 1R00A 5HCIA 4E6PA 4PYLA 1N5OX 5B6IA 2C5GA 1JH9A 1W34A 3D7KA 4J29A 4FQ7A 1CLUA 4W6ZA 2V55B 3LLUA 3TLXA 3QOFA 4M9SA 4P83A 4BU0A 2PWZA 1C1YA 3T7KA 4M8IA 5B3JC 1A2OA 5G1NA 2PLNA 5IAGA 1V41E 5G4KA 1L5HA 2Z2IA 2QL9A 1T2CA 2QZ9A 3RHTA 3C3EA 4J7XA 4UPDA 5LIPA 2PUCA 5EP2A 4E5PA 3D1LA 3ZE6A 3R75A 3I52A 5KNBH 1WNFA 3L0SA 5L45A 3U44B 1QG2A 3OWHA 3K1JA 1ENZA 3ANNA 1SKQA 1JAIA 1HO3A 3I9KA 1F7VA 1XAGA 3G13A 4NP6A 1R4ZA 2RONA 3FTNA 3GRCA 5AO9A 5G0VA 1NF9A 4HX5A 2WT9A 1Z39A 1HWYA 1W0JA 4HDRA 2PT7A 3IDSA 3KSRA 3IALA 2CHGA 4WLVA 5CX1A 1QANA 2CJWB 1RBMA 1AOXA 2C4HA 2V6FA 3DE6X 4RF5A 4LHXA 5BR8B 3UJ8A 3ZJ5A 1MA3A 3PC2A 1MF7A 5FH9A 2OCBA 1ZM3A 5M7EA 3F8TA 4IHQA 1KPIA 2C8VA 2IHJA 2H17A 3MCTA 1OFIA 2ENUA 3NIFB 5MFPA 3EUAA 3NO4A 1P91A 3CNBA 2ZQYA 3BMQB 2WM8A 4FHEA 4C21A 3KVNA 1SXJC 4YPOA 5D7BA 1CUGA 3ET5A 2W2LD 2XVZA 3HKCB 1XTIA 1L1RA 3PIRA 4ZEWA 1IEQA 4JX9A 2CLLB 3MG9A 3T4UA 4K7JA 2XDQA 3LAWA 5D3MB 4TVBA 2LKCA 4WOBA 4XI9A 3DH0A 3ORHA 1HKHA 2PLAA 1QIHA 3V8QA 3G59A 5DM70 1HDOA 3IULA 1P5RA 3ZBUA 1AURA 1GLVA 4RA6B 5TS3A 3T41A 1EFVB 1DWUA 3DE7X 1ARZA 2CK3D 3ZHRA 4BGEA 4B6QA 4DLZA 3ZVRA 1IXSB 1WF6A 5IN4A 3F9RA 1DJOA 2C8LA 1W581 2E89A 4Q15A 5FOTA 3KSUA 1T9DA 2BHLA 5COAA 5BURA 1N6OA 3AKEA 3TW8B 2DKFA 4I6GA 4A8JA 5EMMA 3H3FA 2HXSA 1KZ9A 1WX1A 3NNNA 4GBGA 1BMTA 4O4LA 4HJXA 2XUJA 5KQLA 1W75A 5EG5A 3RARA 3DE2X 3SEAA 4EJ0A 3MT7A 2Y1XA 1TQ8A 3N8HA 1VSVA 3DQPA 3GCZA 4NARA 1P2FA 5KWVA 4RTKA 4FD2A 3OLVA 4BVEA 2AFVA 4G8JA 3EMKA 2R6DA 2WV7A 3BXPA 2D1SA 3RVJA 1VZ2A 3LECA 3CNNA 4MA4A 4CKBA 1R6BX 4B83A 1TKRA 1OFTA 3INNA 4TVKA 4DMRA 4ENPA 3L6OO 3C3PA 4L8FA 1JKMA 3SEQA 4OQXA 1DKPA 2JFQA 1HDYA 1B1AA 4WK6A 4M99A 5DWVA 3UJBA 4HI0E 4X8HA 4ZCIA 1DXOA 2XKKA 1NVKA 3EGEA 1DQRA 5A4KA 4LY3A 1MKYA 1B0AA 3DDUA 3AWDA 3GLFA 3D3EA 5AVJA 2HV9A 2ZYWX 3NRBA 3U62A 4RFVA 5KQPA 1NVFA 3R3SA 1C7IA 2J45A 4HGNA 1CC1S 3AONB 3V4FA 4EELA 4OJMX 4JNKA 5SYMA 2QVXX 3CIOA 5CK5A 3UT5A 2CSXA 4KIFA 4UM8B 1G38A 2WVHA 5A4JA 1CR6A 4HLCA 1RCUA 1M6VA 1LPPA 2XF8A 1YE5A 5AJTA 2LE0A 3JZFA 4CLXA 4YIKA 2GLXA 1H1DA 2IWRA 3KP1A 1EUCA 3T94A 1FTGA 4W8HA 4E46A 3D4NA 3VR6H 1AG9A 1UJMA 3C74A 3QHPA 1P62B 1CQJA 2FPLA 2JLAA 3L43A 2ZDGA 4HDSA 4NYJQ 5DKFA 4CGZA 3A9UA 1SWWA 1ADJA 4HTAA 1ZGCA 2VKQA 3EGCA 4J0DA 4LZNA 5AI8A 2BMEA 4DR7B 5CURA 3UB2A 1AS0A 3RUEA 2C3YA 4Y2RA 3WB9A 4ZREA 4HNTA 1N2CB 2B69A 2JFUA 2ZRKA 3JZIA 3C70A 4TXHA 3GBVA 4EHFA 4F6LA 4DMFA 3ZHTA 4LCEA 5AM2A 1CETA 2PS3A 1VHLA 3NONA 5CR9A 2P5YA 2WC1A 1WPQA 1EXNA 1J8YF 3E5RA 3SYNA 1HLDA 4AUEA 1U9IA 2AC2A 3PUXA 3QBTA 4XLZA 1RACA 4JI2B 4GP9A 1G21B 3KETA 3DOOA 2P4UA 3W6ZA 3TXAA 2I2WA 3IQGX 3I12A 4S04A 2G06A 1RQRA 3PX3A 1O57A 1T5OA 3AIKA 3DEYX 2VWGA 2ZU6A 3EGDB 3FCYA 1CS0B 1RU3A 3EDQA 5FULA 5KYGA 3G9XA 5E6RB 3SIXA 1V4VA 3TXXA 2D5LA 3UJ7A 3VKUA 4EY6A 1T0IA 1EVLA 5EMHA 2BM9A 2Z2YA 4UVDA 1QYDA 2UVDA 3ZCVA 1ZZEA 2J1LA 3MRVA 3TTTA 4HDCA 3LC1O 3GLHB 2B98A 5DP2A 4RTSA 2JVKA 1P31A 2OHIA 2VA9A 1TPZA 4N0QA 4UNQA 1EIZA 5CA1F 1RZRA 2NWQA 4PPNA 3HFSA 1CE8B 2QLTA 1BO6A 4CHGA 5F9HA 1UXKA 5DRTA 3C5VA 3NWPA 1PWZA 3UFXA 2ODAA 1KQGA 1DBSA 4Y9UA 2PKCA 4PRZA 3ITEA 1XU7A 1Y82A 3O4VA 3EYWA 1S3FA 4RZUA 3GJQA 1IWOA 2FEKA 2QP3A 3GUCA 2COUA 4CNBA 2JGFA 3Q8LA 4MA5A 3NKFA 4Q7KA 5CB4F 2O7NA 1RE1A 1JN0A 4H9GA 3JQRA 4N3BA 2EL7A 3NP7A 4GMXA 3D0QA 4EFLA 1W8DA 1P75A 3FE2A 4HWSA 5B3JA 5TEWA 1BVRA 1U1GA 1YB2A 3DDZX 3URKA 1NNUA 4DV3B 1YVPA 1PNOA 1PYOA 4GE0A 5DXAA 1VG8A 3D8SA 2OOKA 4LX0A 3AOEC 5GAJA 4KXUA 4NK5A 3TI9A 3T1VA 4IGFA 2XNDD 1WDWB 4C4RA 2QD3A 2IWHA 1QGUA 4MKXA 3OUZA 4YUYA 4OX9Y 1C3OB 4TKUA 4ZAGA 2O59A 3PD7A 3DQQA 2MINA 4B2YA 3EEQA 2FZ4A 1M2VB 2YCBA 2Q0XA 3C1TA 2GF0A 1FFGA 3MT8A 1E7RA 2VDMB 3Q6NA 4NENA 3B1WA 2OILA 1W46A 4LYDA 4NBRA 3T5DA 4HWTA 2UYOA 1DI0A 3P32A 4NU6A 1ECJA 1ZMXA 4UQPA 2OP1A 4MEJA 1UBRS 4X7BA 4YUAA 1OROA 4X63A 3ZCPA 4HHEA 3K35A 2ZZKA 4J2HA 1E1QD 1G2PA 4W1SA 3GJZA 1F9EA 3V8PA 1RYHA 4RK7A 1P9RA 4GYYA 2VJOA 1RXSA 3SC3A 1COWA 1SXJA 1KJWA 1DO2A 1FW6A 5EXEA 1EXDA 1NSYA 1DMRA 1VCNA 1R15A 4L1KA 2BFEA 4P38A 4R1MA 3VJRA 1RIIA 1R66A 5ALDA 1JYFA 3ZHUA 4J2TA 4EPVA 4WLUA 1V9CA 4G0XA 5K1ZA 4FPXA 1YC5A 5J59A 1LBIA 4MHSA 2OHOA 4JB3A 2IXEA 1QTIA 4IIHA 3DV9A 5HDQA 4A73A 1G6OA 4XR9A 1Q92A 3PJEA 4RLSA 4IJVA 4YRCA 5JAHA 1EZ1A 2AJCA 4XJSA 3KYDB 4QHYA 221PA 3OEHD 4HXYA 4XM2A 1VHDA 2OHJA 5LC1A 4QTTB 1I80A 2YOGA 1SU6A 2G09A 4MDYA 2NXJA 5D1HA 5LQMA 4AC9A 3QMWA 3QXCA 4PSKA 3ST7A 1Y1RA 5FAXA 3IUMA 2I7VA 2CCJA 2OO3A 2FJPA 1MVNA 2J87A 4B76A 1H4VB 1L5ZA 4G36A 4HLNA 1Z37A 5EUMA 4F2DA 1JJ7A 1M5UA 3MCVA 4HN9A 5IJ0B 1W1UA 3BRCA 1JB9A 1QPBA 3I4CA 4YROA 2DFKB 3OY2A 3QFSA 2JLRA 2MYTA 1J2JA 1GZHB 1K3FA 1NMYA 1SQ5A 3U17A 1YZLA 4BCBA 4BLSA 2BMWA 4KGVA 1RWMA 1N5DA 2FRXA 1P4SA 4MRPA 1X7ZB 1ND6A 4HEA6 2IUUA 1PL0A 2J30A 2WJPA 4QUIA 4ENQA 4DQ0A 4BFTA 4L57A 1ATZA 4EK9A 3TTVA 1I6MA 4R4JA 1FMTA 1R4AA 1RZ3A 3RNLA 4BFYA 2AMLA 2HWXA 2MWMA 3KOMA 3M2TA 1GUAA 2H1IA 3CKLA 3DB2A 1XJ5A 3IUQA 3W5AA 2ZXFA 5TMDA 4QEZA 3JD2A 4E5SA 4Y2PA 3BXXA 2AUMA 3B5IA 1JKFA 2NYRA 2QRLA 3HL4A 2P1RA 4F38A 2CLOB 3PFCA 4LV8B 3JAWA 4MUIA 2ZTLA 4G25A 2FXIA 4M8KA 1U0SY 2A8YA 1GD1O 2WG1A 4L8VA 3EPJA 2A7QA 5MGNA 3RABA 1RHKA 3QIAA 2OGSA 4J43A 3H6HA 1U9JA 2PUFA 5ESRA 1QNLA 2QPAA 3IX7A 4OB8A 4PZ9A 2H6EA 1CNMA 2A0UA 5BT9A 5TGDA 3AVYA 5E9AA 3DMDA 4QUJA 3D8RA 4J9UE 2IOHA 3BBPA 1P3JA 3W2IA 1NVMB 3OP1A 2B7CA 3MGAA 1ZW6A 2ZYVX 3GJ8A 3QNMA 4H1HA 1DT3A 3NKLA 3VC2A 3VDMA 3VGJA 4Z7QB 4QGSA 4IJ6A 5H9WA 5HQ3B 3CSSA 3BMOB 3NC1C 5ARCA 1DTEA 3UMYA 3C8UA 2ISQA 1QCYA 1VLLA 2A0XA 2WTBA 3L07A 4JL5A 3QPBA 3BH0A 3H83A 4GQIA 4WUTA 4YAJA 1B76A 3CF0A 3HN2A 3MD9A 4NOKA 2J9ZB 4ETWA 1UBMS 4YXFA 1IE3A 1VL5A 5F2EA 2AHRA 1WXDA 4CG3A 2PBLA 1XIVA 1U9ZA 4FGWA 4N0DA 4TT3A 1NNSA 5FUVA 5TJHA 2ZWAA 2AKAB 4MI9A 3TD9A 2HLHA 3TZBA 3S44A 1IK6A 3RAJA 2K87A 5SZHB 3DSRA 3QXSA 1PRYA 4M2LA 2NX2A 3NV9A 4HB2A 4D6YA 2WJ3A 2J8ZA 3MAJA 1JMKC 4C06A 2AXPA 5TSDA 1TT7A 3GLGA 3IXMA 4G2TA 3KYBA 4AS3A 3JQAD 1T29A 3HDJA 3NWJA 3QHQA 1LUAA 1T8UA 3FVRA 4H6PA 4Y3UA 4CCYB 5JQWA 5JYDA 1EP2B 3COJA 3L0YA 2QJFA 1B0ZA 4Z49A 4LYAA 2GZRA 1P1FA 2WLSA 4TZTA 3RGGA 5BQ5A 6ADHA 4M7RA 2JHPA 1N1EA 4XLLA 2X8WA 3EGIA 3ZV5A 3ZIUA 2VPPA 2A9FA 4HMQA 1CT9A 3B52X 2WHRA 5K3BA 2HA7A 3H0KA 2DUNA 1ATIA 2YXLA 4A26A 5B7NA 1VPDA 2GM9A 5ISMA 2CNOA 3WNBA 3KSZO 3ZTWA 2ZTHA 4UHDA 1EMDA 5KVQA 2XWSA 3WK6A 1U1DA 3TAXA 1NUPA 2PN1A 1MAHA 1R0ZA 3LUAA 4UDXX 4CT5A 2JLXA 4C4PA 3KQHA 3P2KA 2JFNA 1D4AA 2I7TA 3BH7A 3IR7A 4I4TB 5DCYA 2WHQA 4GPAA 3W1EA 3C3YA 3BWMA 1D9ZA 5D00A 3COYA 2JCSA 1RJGA 2QZZA 3AOEA 4UDOA 2DWCA 4BO6A 5BYAA 4KB5A 1KIAA 2P1DA 2PWBA 1NLMA 2D8MA 5EWLB 3KWLA 1AD2A 1DOHA 1L4KA 4ZRNA 2HHHB 1EK5A 2XNJA 2DHEA 3CRQA 4D96A 3L82B 3RTGA 5KDLA 3ECAA 2BFDA 3P9ZA 3PR3A 4P4UA 5J3JA 3AL2A 1IBLB 4WEOA 1UDAA 1JEYB 1KHHA 2QSYA 2ASVA 3I1FA 3ZDCA 1W4LA 1C8BA 1E1YA 4IFEA 3N7AA 1ZH8A 2F6RA 1E4VA 1NW4A 4EYOA 4ZVKA 3CLSD 4KYUA 3ZGLA 5HQTA 5I7SA 1WXHA 3MMNA 1XMIA 1WDLA 5I01A 3DDCA 3PJGA 5ADVA 5GV7A 1B2LA 1KZGB 3D54D 3DONA 3HCDA 3CMCO 4DW8A 3R3HA 2OYRA 2GEBA 4G56A 2BONA 1OAOC 1W76A 1ZM4A 3WFIA 4CTKA 2WMYA 1A8QA 4GRIA 3VFDA 5BQFA 3HBNA 4QNNA 5A71A 4DJEC 2EXXA 1X87A 4MROA 1RWWA 1XV5A 4LXGA 4N3AA 5LBTA 4J3JA 5LYJF 2WUWE 2JBAA 3BIJA 3D2BA 3QWBA 4U7JA 4QA9A 3UJNA 1VXRA 4BQPA 4KQGA 3RJ5A 1FU7A 1Z28A 2RAPA 1GNSA 1E2PA 3FGPA 2I67A 2J4CA 5DI3B 5BUQA 1L4FA 1JFVA 4YUVA 3U40A 3DEFA 1RTTA 3X44A 4BVAA 4ARIA 2Z57A 4HDKA 1SOMA 1LK7A 1ZITA 2C9DA 5IM5A 1EBBA 1Y3FE 2FG7C 5IW8A 3U9TA 2V1XA 4RNCA 4ENSA 1XEXB 3BMXA 4ER7A 1JDZA 3GLIE 2OCPA 5ICSA 1U63A 4MRAA 3FFAA 4PV7A 1NQTA 3NDJA 3WRWA 2H59A 2AN4A 1NN0A 4TN1A 3V2IA 2C9MA 4OQYA 4UC0A 2B25A 3HB7A 2P11A 4DIEA 4Z7JA 3HKEA 3GZNB 5AHOA 3DAGA 5FXMA 2I87A 4OHXA 4AFNA 3WADA 3OFJA 1DADA 1ECPA 2PS1A 3LQRA 4WKNA 1N2SA 3HCCA 3SHWA 5IH7A 3Q10A 1QK3A 1FS6A 2DUJA 2JA1A 2OD7A 3I4FA 3MJSA 2GB4A 1CEQA 2VYQA 4IO1A 4ZOAA 5G40A 4ASUD 4GG1A 2P77A 4MEBA 2PD6A 2G3YA 3DL4A 3CRMA 4M0KA 3CVYA 3VTFA 2ZTSA 1BJTA 4GBED 4I4NA 4EKEA 2N0SA 4MRMB 5HKKD 1NZFA 2FZWA 4QVKA 4UJ5A 2VQEB 3BMNA 3GJ4A 2YMMA 1JZQA 3HP1A 2PX5A 2EATA 3BGVA 3EAGA 4G97A 2YYSA 4QG7A 4UXHA 5LA6F 5A04A 1HFKA 3ZWWA 1IOWA 4JJ4A 1DDGA 1Q3HA 3LFHA 4TTSA 3SFVA 3F4BA 2PSHA 1ZCBA 4X7RA 1CZOA 2GJKA 3CJRA 3IJEB 4R0MA 4YPVA 3ZEIA 3AK4A 4Y0NA 1V35A 5K3FB 2R44A 3TTXA 1VPTA 3X2EA 4B3JA 2C00A 4E4TA 4YV1A 1Q83A 1J8QA 2MYUA 5I48A 5BORA 4LXIA 4KN6A 3TOZA 4Z9XA 4YV7A 2PBZA 4MCJA 3GF4A 2KI5A 2PVSA 4GF5A 5ULLA 1M6YA 1C8LA 4BATA 4G5RA 3K1ZA 3TXYA 3NP9A 2C88A 4IYJA 1T8SA 3TVDA 3KTOA 5A4DA 4X91A 5LYJA 2CHUA 1IHPA 1PJRA 5T8KC 3EHDA 3B6IA 3Q3GE 2Q1TA 1AQNA 2AG8A 3N05A 5C1BA 3QG1A 4O59O 3H1BA 1CQPA 3ACBA 1U80A 1O94D 3PQ3A 4B3MB 1WABA 4BWVA 1F2DA 3W9SA 1GZ7A 1LS6A 3F4LA 4X97A 5E2AA 4ROSA 3HSSA 1E9AA 2EARA 2XGMA 5DHPA 1QF6A 3ITDA 3NLLA 4JC8A 4AY5A 1I5OA 2ORVA 1TX4B 4JT4A 4K05A 5AKGA 5KSYA 1CY2A 3OJXA 3PXAA 3SF8B 1NW9B 3U7FB 3DMPA 4AJEA 1RBQA 2IPLA 4F71A 2IE8A 4D0SA 2FEWB 4X1KB 1XNQB 4OH7A 3OTQA 4IDNA 1EX9A 2W6PA 4C3VA 2X6RA 4ZT4A 4NATA 1TYDE 3S2GA 1UC8A 3E7PA 3N7TA 2EZTA 5J1SB 3G0OA 4CTMA 5H1YA 1YS4A 2BZ0A 3TIFA 4MWCA 2X1LA 2XEDA 4KQKA 4N8SA 2F9LA 1DRUA 3IHLA 3JU3A 2TYSB 4YMUA 5EZYA 2GEJA 3DVAA 1DBPA 3QFHA 3UMBA 2PVPA 3KKLA 4I55B 4MI3A 4PHFA 3GQBB 5BNTA 1KDOA 1QRTA 2YXBA 1SXQA 1WLSA 1BEUB 1U0FA 1XQWA 2QGFA 5LA6A 5JNSA 3SXUB 2A4MA 1RD4A 3MPUA 2EU8A 5I7FA 4DV0B 3NGXA 3AFOA 1MT0A 2COEA 3H5RA 5FOSA 3K0CC 2XGJA 4D9MA 1FFBA 2WAYA 4ND2A 2Q29A 3GDOA 3K9CA 1EAMA 1CXZA 1ZN7A 3K9HA 3L9XA 4DDMA 3PXCX 4DA8A 3JARB 4DDUA 4ZFNA 1DAMA 3IKLA 1RNLA 3G5TA 4IVNA 4Q1FA 4CYMA 4PTZA 2G63A 1P3Y1 3N8KA 5L3QB 2D6FA 1ZOOA 1IXKA 2GHIA 3LK7A 1KAOA 2ZB4A 3F97A 3GJ5A 4OXYA 4XD2A 2OLJA 3C3KA 2CNBA 4FFLA 1JEQA 2J67A 1NI4A 4L75A 4FSXA 4LHYA 1CP3A 3TR6A 1RC8A 1PWXA 1KC3A 2XMGA 3KS9A 4KQXA 4XDGA 3TW6A 4QDJA 2FPKA 1JKIA 1QV9A 3WXMA 1KDTA 1QTNA 3O2NA 3V7WA 1BU5A 1D4FA 3RQIA 3E3OA 4M9ZA 2O8FB 3ZZ0A 4EW1A 1YH3A 2PSDA 3F67A 4YMHA 2A2ZA 3FOBA 2PUJA 5F77A 4QODA 2M32A 4YAWA 2QLNA 4B81A 1NGSA 3JVDA 3ROZA 2Y8EA 5SICE 3K1YA 4KG7A 4Q3DA 3VI4B 1DCMA 1X9HA 3WYFA 2FPRA 2W6QA 4QBKA 3DL0A 5JMOA 4O4JF 3L8GA 3RADC 3JX9A 5K9ZA 3CB2A 4MPTA 4LQCA 2Q6TA 4PQRA 2W6CX 3MMSA 1CZKA 1TXGA 1UXIA 4BPRA 2CXOA 2PRSA 3D7RA 5JZ9A 3VMFA 3HLYA 4HDAA 4P3XA 3VV3A 2YFKA 5K8UA 2MSKA 1L7NA 1F3OA 3IP8A 4MP8A 3GFTA 3AZOA 5HCNA 3IVMA 1H6AA 2VJYA 1BTOA 1IUKA 2BUCA 1GGJA 1OAOA 1U2QA 4KQFA 2PDAA 2PGNA 1XD9A 1KEEA 4BEVA 4NHOA 4ER5A 2B61A 2VLBA 4QT4A 1JVNA 1GDHA 2WAXA 2A5JA 4K9PA 2ARKA 1D8TA 5KS2A 2FX3A 2I78A 2DBZA 3KLPX 3SK0A 4X1IB 2JH3A 3BIFA 2RKWA 3TLYA 3QI2A 3IOBA 2QTHA 4LPSA 4MYHA 1CNEA 1E0DA 1K66A 3N2NA 1M5RA 1NTRA 2O52A 4WACA 3MBIA 5FPPA 2M9MA 4HNQA 4ZVOA 1AZSC 1J5XA 3KQYA 3VR5H 1R0YA 4MMYB 4IICA 4LNUA 4CCAA 3Q7EA 4UEJA 2ZRDA 1KK2A 1ECCA 2ODTX 3UZUA 5K3EA 5ED0A 1OZFA 3DDSA 3EVCA 1KERA 1L5RA 5JEEA 3OZVA 3DPIA 5FPYA 3ZYZA 2OPHA 1LI7A 1OFVA 1C3EA 2YINC 5J4HA 4MO2A 1B15A 4PFJA 3CHYA 1BH2A 1OREA 1QP8A 4L4XA 2BRUC 3KLOA 3FLEA 4NR0A 3R5HA 3PFBA 4Q1VA 4W82A 1ORDA 3FHJA 2VDKB 2GAJA 2RHWA 3HO1A 3NBYC 2DTDA 3JPWA 3Q5EA 1M34B 4YHBA 2X0DA 3RIEA 3PHJA 2R6AA 3SXJA 2IYQA 4PAQA 2ZYTX 3ABRB 4AURA 3DV2A 5DF1A 2H2AA 5ALLA 4RFSB 2UVPA 1WKBA 2DPYA 3ETLA 2JZOA 4FFDA 4M9QA 5TMBA 4OEHA 4BWYA 3H1FA 3VU1A 4ALNA 3A1SA 3S29A 2Q3LA 5GADl 4UMDA 1XPOA 2VHUA 4Q3BA 5TC4A 4GKAA 4A27A 1OX6A 4F9FA 1VRVA 4C9BA 1ECLA 3IB6A 1F5SA 4U2GA 1ZK1A 2CZQA 5CGZA 2QG4A 3W79A 4C0LA 1DFIA 2R9VA 4RGYA 1JBKA 3OPYI 2PUDA 1UK9A 3ES9A 2QW8A 1IRXA 1KJZA 1Q14A 1YS9A 3N74A 1XXLA 2CKMA 3HJGA 3IKVA 4F1JA 1GRQA 4L4RA 1LJ8A 2B99A 1GNVA 2WU3A 3GEHA 5JASA 4M9CA 1EK2A 3ELDA 4I36A 1JILA 2I99A 2Y2UA 4Y1RA 1APBA 5E2BA 1I1QB 3TLGB 4EY7A 2P6MA 1NPTO 5E7QA 1JHXA 3L84A 3BSSA 4ZI7F 2RI1A 5JE8A 2K2WA 3R76A 2O8CB 4EFMA 1A4XA 1MZVA 2C92A 4FFWA 3X0DA 1XTBA 2GN9A 2HK8A 2WM9B 3ZWCA 4BQNA 3KIPA 5T8KA 4CM9D 2XUQA 1E7WA 3U3KA 4Q4LA 4CQLA 1QHSA 4NEHB 2EJWA 4TTTS 3CVJA 1SHKA 1ZGJA 2DTXA 3P9PA 4EB6A 3CPEA 1N2EA 2BZ1A 3A05A 3GCWA 3G2JA 3ZD6A 1JEEA 4F4CA 3HXOA 2ZJ7A 2P2ZA 4QHSA 2H1WA 2REOA 2JJ1A 1JQKA 4B33A 1Y5IA 1JJVA 1T5TA 2LDXA 1UH5A 3IP6A 5DSXA 1XRRA 3LLVA 4MVJE 4RQBA 2CT8A 4BIIA 3OUUA 1ZY2A 2F67A 3UPTA 1T1IA 2OESA 2DVMA 3EMDA 3WL6A 3WKEA 1M2FA 3CT4A 3IDAA 2EGUA 3HMQA 4LK3A 5COQA 1IQ0A 1RYZA 4OYRA 4PZ0A 2CNLA 4WK2B 4XWAA 4HADA 3W5SA 1ZUHA 2PUAA 4KFCA 3RVPA 4BAZA 3L93A 1VSBA 4AMBA 3QTTA 1PS0A 3HWSA 4HDRB 2I2FA 1VE3A 1CUVA 1EWKA 1EM8B 2F3PA 3AEXA 5HZGA 5CX1B 5ES3A 3STUA 1TM7E 4TLLB 1JRLA 1U28C 1LWNA 1MRNA 2D74A 4BU1A 3MT0A 4I66A 1NF2A 5IJAA 1S2NA 2PGDA 1K1EA 4U8HA 1V3QE 1FY2A 1U81A 3MF4A 3R0XA 4GDFA 1EWTA 3LX4A 1TTPB 1GP2A 1RXEA 1YA6A 4QM7A 2UYGA 4JI8B 4E07A 1J07A 2ZRGA 3K0CA 1Y0BA 2I6TA 2RHRA 3OZAA 3MJTA 4TXJA 4X6XA 3KG2A 5DBOA 1KKUA 2XBMA 2ZJ5A 2C3OA 5EHIA 4MV1A 4EZEA 3O82A 4YXWD 3VHXA 1QLHA 2XDQB 3LUBA 1C30A 2K6GA 1MG0A 1S8NA 4HS4A 4L8WB 4YMSA 2CL0X 3KJXA 4B4DA 2V96A 4OXRA 3ZWPA 2FG6C 4RNDB 3CVXA 3HA7A 3U3JA 1D0SA 2WWFA 5T4FA 5CIYA 1HL3A 4OL0A 3W34A 1P7ZA 1DE0A 1J7KA 2H4YA 3GP3A 1I30A 2Q5HA 3K92A 4YFVA 4WN9A 2IS4A 1PT5A 3B53X 1NX9A 1QHFA 4UCXA 2HY7A 1VL8A 2NIPA 2GJ4A 3GT4A 4MWSA 4WOPA 5TEVA 1NJ2A 4HC4A 3UAYA 3FPEA 1WU8A 1NJ1A 1ZISA 4WZZA 4ZRDA 4A8JB 3DW1X 4WBNA 2O23A 4G6ZA 4MV3A 3X1DA 4YUZA 1BDIA 2BTEA 3ICQB 3D2LA 1EJ2A 1NPDA 1GPMA 3LRXA 3O8QA 4QASA 1PN3A 1QZXA 4O4LB 4QFDA 4RPKA 3J7TA 4INJA 4P22A 4TGLA 3ZG6A 4HQ0A 1SURA 1P7YA 4XFJA 5CXUA 4LXXA 3JWJA 1X42A 3IPXA 4BGIA 1JQJC 4R8RA 2DULA 3SSOA 2NO6A 2VPQA 3ZGYA 2V54A 3PUVA 2F3RA 3LRTA 2QTRA 2A14A 3O4FA 2WD8A 1YXMA 2ZJ1A 3QYAA 4HDQB 4LJKA 4CKBB 3OJ0A 4DLWA 1L5SA 5IPFA 3PDHA 4Q9NA 4E5DA 2YWBA 3LWNA 3T9FA 2GBPA 2CL7X 3P2IA 1UOEA 4KXWA 4OXKA 1AQYA 2HZBA 1LXCA 1MC8A 1SZPA 3CZPA 1K89A 1I4EB 2HO5A 3IIMA 2JL1A 5BXQC 1W4ZA 2QL5A 3REOA 1Y4AE 4QGBA 5DK6A 1JFSA 2QZPA 2VPZA 3DF7A 4KO1S 2CDBA 1F2TA 5EWJA 2I65A 1QU3A 4PPQA 3M4ZA 4A10A 1AQIA 3PA6A 2XUPA 5GZ6A 3NWEA 1TU3A 1CBUA 5EZ5A 4II2A 2X0EA 2GPSA 2CKDA 3OBIA 3G8BA 5TVKA 3UT5B 1V4BA 1YJAA 5JMPA 3I9MA 1RC0A 4XIFA 1TAGA 3EZLA 3DXZA 1M6VB 1U0EA 2OBBA 2YIMA 3LKVA 5IKOA 2QRJA 3RWOA 4MITA 3EPPA 5TPWA 2NVBA 4GUDA 2QTGA 1MJNA 5KTTA 4Q4JB 2V03A 1EUCB 2UZ4A 2CLIB 3HZRA 4UUMA 3U56A 3W5HA 2Y1OA 3GUYA 3L5OA 5DXJA 3E6AA 3DL7A 1KOLA 3OU2A 3G2PA 2OXFA 5TQVA 4M38A 5B1IA 5THQA 4IGIA 3TUZC 1CQJB 4HDSB 3RRJA 4A1OA 4AX4A 4KSCA 2QQEA 1NQWA 1GTL1 1XA4A 1VKHA 4EGFA 1VP3A 2A0FA 3V8BA 2BRUA 4QNMA 4UCWA 3FIJA 3T9CA 3VVBA 1C4WA 3QE0A 3OAAD 4G65A 2ZSHA 2VNIA 4OK6A 4PLTA 5FHQA 2ECQA 1WU7A 1IAVA 5JI2E 2EF1A 2F9FA