4YLYA

Crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
198
Chain Sequence
MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGAYTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETSRFDHVMNEFNGEVKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of Staphylococcus aureus peptidyl-tRNA hydrolase at a 2.25 angstrom resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 62
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4ylyA00
3KJZA 2LGJA 4QBKA 3TD6A 5B6JA 2Z2KA 5IKEA 4QD3A 1RYBA 3KK0A 4DHWA 3TD2A 4ZXPA 4P7BA 3P2JA 2PTHA 5IMBA 1RYNA 4JC4A 2NAFA 4FOTA 4IKOA 4JY7A 4OLJA 3OFVA 4FYJA 4HOYA 4JWKA 3TCNA 2Z2IA 4Z86A 4QT4A 5IVPA 4FNOA 3TCKA 2Z2JA 4QAJA 5EKTA 4DJJA 2JRCA 3NEAA 3V2IA 4LWQA 3VJRA 4YLYA 2MJLA 4ERXA 4JX9A 1RYMA 4FOPA
chains in the Genus database with same CATH superfamily
4N0PA 3CVJA 1JFVA 1ZRHA 2ATCA 4AY3A 4FZ3A 2NO9A 3EEBA 1NJFA 4OJMX 1M6WA 5H8WA 2ZRLA 1UXJA 3DOJA 3DBIA 2F6RA 2O5VA 2PUWA 1UBTS 3FRHA 4L4SA 5LQRA 3G85A 2O8NA 3IAXA 2HSZA 3LK6A 1Z8FA 5HIKA 1NXWA 1XUOA 2QT9A 5H1YA 5DI3B 1RLOA 2WWVD 4KFUA 3RAEC 8MHTA 1EJ0A 1FP4A 2P9EA 4KN5A 3NNSA 3BUSA 5ALQA 5LQNA 1F17A 1QZTA 3ENWA 3HVKA 3IJRA 4LC9A 2ANCA 4ZIRA 4IIJA 4WOPA 4MITA 1E20A 4LUCA 3WLPA 4ZANA 1DC5A 2MWMA 1Z15A 4URUR 3N8IA 3OLZA 4PHTA 1XMXA 4YT4A 5LOVB 3UH1A 4CKZA 1ZXLA 5B6PA 4RDHA 1FEZA 1OBHA 3HB4X 1DWUA 1EFUA 1CKEA 3U3OA 3C3XA 2YWEA 4MR7A 1QB7A 4MMYB 3RU7A 3V7YA 5A6SB 2QEQA 2BHSA 3I9JA 5K3AA 2IOQA 3L49A 4I1VA 4C14A 3HB9A 4M60A 3WB2A 3UWPA 3ZXUB 2XCUA 5K51A 2A94A 1ENOA 2F1HA 1P2TA 2PSDA 4D6PA 4YIHA 4K9MA 5JAHA 1XRSB 3GH1A 2MYTA 3EZFA 3SKXA 3VO1A 3VR3D 3R8FA 1M2VB 2CYAA 1TJPB 4A1FA 2UYCA 1DQPA 2WIKA 3RTGA 4CKEB 2XGJA 1G38A 2GD6A 1A2QA 2OAP1 3IQIX 1FVFA 4IIUA 4KI7A 5DYGA 3EK2A 5GJVC 3ZJ5A 1KIMA 5TMDA 2NQ8A 2P2YA 3PKZA 4MVYA 4EG0A 1U1FA 1Z5VA 2D0IA 2ZDGA 1ZISA 3JW8A 5FL3A 2CF6A 2HSEA 2Q4OA 2ZRAA 1SA0A 4R8MA 4KPFC 2NXNA 3FJOA 4DMGA 5AWFC 5JY1A 1U2EA 3IUEA 4J3JA 1VKJA 2YDXA 3ESXA 2I1VB 4HDMA 3A9VA 1NBOA 2D54A 3RK4A 1W36D 5D3MB 2BM9A 2V8BA 1HRDA 1SVKA 3OZCA 4N6NA 3DWGA 4ND6A 4QNMA 2O05A 3JQFA 3RRMA 2YQ4A 2ZETA 4MGIR 4RKRA 2O4CA 5E0OA 1JVNA 4H4EA 2OV1A 1YT5A 2GM3A 3IPRA 5EJ5A 3W5CA 3E18A 4B5LA 2PVPA 3CZCA 4HN9A 3UJ8A 2BPOA 4IHKA 1UBRS 4IS3A 3TL6A 1YUMA 2D2VA 3K09C 5LD2B 2LKDA 2WFAA 4HWTA 3EJWA 1A8UA 5ANRB 3T9EA 1L1RA 3FUWA 2AN4A 3VKVA 3MSXA 4DGSA 4LOAA 2EJVA 2PXCA 1Z36A 3WG9A 2E1RA 5IK2D 1PK8A 1USWA 5JXHA 2DFKB 3IBGA 1M75A 3AHDA 2QIPA 3PBKA 4GSYA 4OFWA 5T64A 1WY7A 1E9AA 3M4ZA 4KI0A 3ZY5A 1YAJA 5EP1A 1N9GA 3JR3A 4B2YA 5L9AA 1BGXT 1JDBB 2INGX 2KBFA 1GPLA 2PXAA 1H1DA 5AUPB 2D5CA 5F9FA 4TRJA 4XB1A 1O94D 2P6UA 1Z7WA 1IVYA 2I2FA 2JRLA 1A5AB 6GPBA 2FGJA 2BOVA 4O63O 2WU1A 3DKIA 1Z34A 1SBTA 3LGXA 3NHRA 2Q5OA 3DO8A 1M6VA 3GDFA 4HNAA 1NVKA 1N9ZA 2XV1A 5B12A 2YUIA 3L1VA 2Q1UA 2EKQA 3AG6A 1Y42X 5EJGA 1JPUA 4Q4LA 1TQHA 3LVBA 2FZCA 4CLHA 4MWEA 3RYHA 9LDTA 3UWDA 2QX9A 3G9XA 3CLKA 2XQJA 3ZWMA 1X1CA 2F3SA 4A73A 2AA3A 2BF7A 2Z2YA 3L8CA 1PFUA 1KFEB 5EZSA 2B3DA 2B82A 3A2LA 4G41A 3O8DA 2H57A 1EUCA 2NUPB 2VQ6A 3BMNB 1XK6A 5IT9A 4UM9B 4NBNA 3V1UA 3A3OA 1Q21A 3MW8A 4WZBA 3USZA 1KDPA 4AKTA 2C98A 1VP3A 2DULA 5D5HA 4OGWA 3U1VA 3KJEA 2QMZA 3B8HA 3NVDA 5B5SA 1VDZA 3EGCA 1Y3CE 4UXJA 2ZM6B 2ID9A 1ZM4A 2OVBA 5MHTA 5FOTA 3OEWA 2B4KA 2PKCA 4M0EA 4QQ8A 1MCZA 4AZ3B 5IULC 1XTUA 3A6EA 1KJ9A 1KK3A 2GEDA 2ZIGA 1E79D 2A88A 5JCOA 4Z2YA 1N3IA 3TX2A 2PMEA 1AX9A 1WUYA 4ALIA 2IYTA 5ALGA 4TOIA 3TLGB 1VJRA 1PL6A 2AG5A 2Y1LA 3FLMA 2C3YA 1NIPA 3NV7A 4WBXC 3MLEA 3UWMA 3O47A 4E5PA 2VS1A 3T3HA 1XKTA 3HN7A 4FIDA 3FBTA 4BQNA 5K0BA 1RCUA 4DSAA 4J16C 3MTIA 1S4QA 4HLCA 1DOAA 2FMUA 3PRHA 4CLRA 5IDQA 1KP9A 4MRSA 4LDRA 3EUWA 4FI3C 5K2OA 3BWXA 5AIAA 3F6RA 4ER7A 3NHUA 3L7CA 4HDNA 3R7AA 1CUUA 1S2OA 2YTZA 2Z8ZA 4TMWA 2NYUA 4EBBA 5IKEA 1IEXA 3MTAA 1A82A 3K4HA 4X71A 1ID8A 3K8QA 3CY6A 3CO5A 5M34A 3R5XA 3H2BA 1POXA 4P84A 4L7VA 1NVTA 1Z39A 4BVAA 2DKOA 1VQ1A 2H2IA 4IUYA 4NABA 1R0KA 5D3ZA 1DC3A 1T4MA 2WUGA 3H9GA 3H8WA 1X7YB 5I7OA 3SS7X 5TS2A 4ER5A 3ICCA 4GXNA 2X3FA 4C1NA 4TN5A 4Y2PA 1AS3A 2BW0A 4MROA 4HAOA 1NN1A 2IYNA 4IVPA 4BQQA 2JVIA 4ZZIA 2JBWA 2OY0A 4EVIA 5B7GA 1KVTA 4K9KA 2YY7A 1EFRA 1ZVMA 4LDQA 1J9ZA 1RYBA 4ENQA 3P2YA 3IBSA 1B2LA 3JYQA 4B4OA 2JH8A 2YY6A 3THWA 3SKYA 2UZAA 3UT5B 1QIMA 3CZRA 3MWEB 5DXAA 1ZVJA 4RZ2A 1KJQA 1T9KA 4OUDB 1Z2PX 2NZJA 8ABPA 3LOUA 1QOQB 1GG5A 5HUQA 2QM8A 2EFYA 1ZC3A 2RKWA 3A9WA 3Q0EA 4OXXA 4PSKA 5AW5A 4IKPA 4PLPA 3UB3A 1EXDA 1OFVA 5FO1A 1J21A 3U49A 3ANSA 4Z4EA 2QVBA 2EXXA 3DB1A 3H83A 4G2NA 1H9BA 1LSOA 1SBNE 2BP7B 4G4SO 4GE0A 3PHLA 4ZPJA 4N47A 3FVQA 4PQRA 2R8RA 4KR3A 4BFYA 3CLSC 1OTXA 1ZNWA 1UDAA 1EZ4A 1GRRA 1I0LA 3JWIA 4GZ6A 3HJGA 1MQAA 4B6SA 1D07A 4YONB 4ZN6A 5JEDA 3Q41A 4OV6B 4ZV7A 3ZDYB 1RYEA 4KUEA 1A9OA 2WJ3A 3PYLA 1ULUA 3U9SA 1YZFA 2G83A 5B57C 4IUCS 1D3AA 4IL5A 1IPEA 4WECA 2V59A 1ZUWA 3EG5A 1PUJA 1ISFA 1P1KA 2QSZA 4GSLA 2IK8A 3EAGA 4UEKA 4MPRA 9ATCA 1GEEA 3UQZA 4AXXA 4PLHA 4KB5A 3DTVA 1OGYA 4WY2A 5F9MA 1XB2A 2I2CA 4F21A 2KPOA 2GBFA 3E9QA 5K9ZA 1VLLA 5I8PA 3EDMA 2FI1A 1KVRA 5CCDA 2A1TS 3MA0A 3OKFA 2WM3A 1J9EA 2GK3A 1XCGB 2NTYC 4BUJA 5H0IA 3V4LA 4L6CA 1U7DA 3R8CA 1GJRA 3NP7A 4ZKEA 1VFPA 5TS3A 3EPJA 1IG3A 3TBKA 3LH5A 5AOAA 2P2GA 2Z2XA 2XGMA 3KOZA 1N75A 3C2QA 3DBHA 2A0UA 2ECKA 1G42A 3SQXA 1Q1GA 1JYEA 2PJZA 3BXHA 1W2GA 2W6ID 3PHIA 4NCKA 4NG5A 4YAEA 3HM9A 4H60A 5FTLA 2VF4X 2O8FA 1Z17A 1TA9A 1E6KA 1W0JD 2OBNA 5BQ5A 1RKBA 4BGIA 1SURA 4EG7A 1ZKDA 5ES3A 4KYVA 3UGKA 3GX1A 3B82A 4YRFA 4AO6A 3SX2A 4XWYA 4BC1A 3D81A 1V1RB 1EM8A 1XLUA 3FFAA 3OVMA 3E1GA 3SG0A 1TFUA 2JD1A 2ZKIA 2ZJ7A 4BRZA 1SOWA 4GZMA 1NPYA 2VAWA 4JJ6A 3QRWA 1N7GA 4P5DA 4TXJA 3QU2A 1YOBA 2X2FA 4CQLA 2I7TA 3IBYA 5F9HA 3RVPA 4L9AA 2COUA 3EUEA 3DMTC 3PG5A 3Q4GA 4NBVA 4OGKA 3ILYA 4Y6RA 3UENA 5HZKA 3ZGOA 2QRLA 3QKRA 4WCFA 4S1TA 3JQPA 2P5UA 4OO3A 3K71B 1GU7A 1I4LD 4XZ3A 3IAEA 1T8WA 4DF3A 2KLBA 2FPIB 1CUGA 1UCFA 2IY9A 2EU8A 2IYOA 3DFZA 2UYYA 3JSXA 5ABPA 3HCNA 1JHOA 1F1BA 3V1TC 2BMDA 1IM2A 5MFZA 1QC5A 3QFRA 1J8VA 4M1ZA 4RA6B 3Q1LA 4I14A 4RH0A 5K5EA 4D9FA 1AXEA 3CQ9A 4H77A 4UTVA 1G8KA 2HJSA 3PE3A 1A9ZA 2PZFA 2WHYA 3VPGA 2ZUWA 3S68A 3P26A 4X1KA 4TV9F 5HE8A 1HETA 2Q41A 3AL0C 3K0FB 4WHMA 4JR2A 2C20A 2IKQA 4HQOA 3WE7A 1JH9A 2CBZA 1LDNA 5TGTA 2PX8A 3E7XA 4TWZA 2J08A 2SCUB 3U1TA 4CZ2A 2ZQ5A 1ZK0A 4Y1FA 3K2IA 5IBRA 4EUKA 2VAMA 3ORYA 3WB0A 3TF5A 1II0A 2GVNA 3K96A 5KU7A 3ABIA 1Y1QA 3NIWA 3OQHA 3FM9A 3QEKA 2J07A 3P0RA 3G88A 1RM0A 3H1GA 4GBMA 4JHXA 3RT7A 1KPIA 2YY5A 1V3UA 4YJGB 5IBPA 1E6WA 4LOLA 1PNRA 4FN5A 4M8KA 2Q5FA 2WKRA 3DMPA 4ICIA 1LBEA 3EFHA 3M1AA 4KTVE 1IXYA 1AF7A 2J4DA 3BB4A 3HUUA 4U5XA 3ZK9A 3SEAA 4JDUA 2X5JO 2Q46A 3FKQA 1OYVA 1KDOA 3GEIA 4G1UC 4IG4A 3T4UA 1MT3A 4U3JB 2HJ9A 2F17A 4GPEA 4U2GA 4LBZA 4WD3A 3SXJA 3OC0A 1XV5A 3DZFA 1NP6A 3RAFC 2HCBA 2Y66A 1Z6XA 2J67A 5KPDA 3RYTC 3F96A 1E64A 1VHJA 3CTMA 2XMSA 1FFCA 5AW1A 4C0KA 2KBEA 3RNOA 2IGTA 2PGAA 4BNTA 3HEMA 2DHEA 3IQDB 1P7ZA 4MR8A 4PANA 1Q91A 5CTAA 3TMKA 3TD9A 2RGDA 3EYAA 3G3EA 2J9FB 3AERA 3PQEA 4A82A 4K6CA 1FMJA 1BRMA 1Q6YA 1VKOA 2X6QA 4GMFA 4IXWA 1SC1A 3KTDA 3IEIA 4AUEA 4ZI7F 3BH6A 3J7AC 2Q6IA 4D9BA 4GP6A 5EMKA 3SGLA 3OPQA 2UUCB 1V3QE 1I24A 4E2YA 4EKYA 1FPMA 1ZGCA 2ZK7A 2FQ1A 4BWYA 2Z30A 3QX8A 4Q9NA 3L4SO 5ALOA 3ROMA 5EP4A 3I62A 2W4MA 3C1OA 4MKIA 1J99A 1YL7A 3I42A 4EUNA 3AHHA 3RBAA 1CR1A 5KTTA 5CU7A 1EESA 1P60A 3KV3O 3NDRA 5K8UA 1AXRA 1CUJA 2CKDA 4GOLD 4MKHA 4EG8A 5J4HA 3S70A 3KSUA 5DN9A 1UFKA 4Q21A 4JJIA 2RI0A 3VR6H 2FUEA 3AG5A 3K16A 3ZK7A 3GQBA 1FTYA 1Q0ZA 4B8WA 3H19A 1IOZA 5HE9A 1NLYA 2QD1A 2P2DA 2XBMA 5CITA 1PNVA 4UEQA 2DY0A 3N74A 3AFNA 1SXQA 3MWKA 1GVHA 3EXHA 2XUFA 1X1QA 4PFSA 2Y9MB 3HCWA 4LZAA 4O25A 4RD1A 5TF0A 2B83A 1R15A 2FK7A 2I99A 4GL4A 4CL8A 5ARDA 5ERGB 4C76A 3PNLA 5LDDC 3L82B 5CIYA 1GR0A 5CB4B 4YB8A 2C8KA 1SULA 3AR4A 1I3NA 2NVBA 1UKBA 2JHCA 2PO7A 4CG2A 4ZJYA 3CPHA 3FR7A 2JANA 5C1OA 4QBFA 4PHFA 3LWDA 4N12A 1Q3TA 1UPCA 1ZU4A 2O2GA 4IGAA 1PW5A 3CX4A 3F7NA 1GV0A 1R4AA 1XI2A 3W7AA 2ETXA 2H7XA 5EWLA 4PS0A 2MYUA 1NU6A 1CX9B 3C41J 5HIJA 1FFSA 5GTDA 3KR0A 5HMMA 3ZLVA 2ZYGA 1VMEA 1QOPB 2JAWA 2V9ZA 3GDWA 3MYYA 4QJ5A 4MUYA 1Y3DE 2PAAA 821PA 4RJIA 4H3HB 3SM9A 3EPLA 1BVYF 4NONA 1NOKA 2WWWA 1JA0A 1T4DA 1UM8A 2CSUA 4KSCA 2ZBGA 4BY9E 3WS7A 2O8VA 3R74A 5CVCA 3FKSD 1R66A 5I6DA 2D1QA 4CIWA 3OPYA 3EY9A 5ED4A 1D2CA 9ABPA 1WABA 2Q1XA 3OX3A 1GG8A 4MV7A 1G8PA 1MAVA 3PNMA 1JB1A 1HFWA 3PHGA 2ZFUA 2P5TB 3TIGA 2VTEA 3I9OA 2G67A 1XTPA 3NPMA 3IRUA 2RONA 3J7TA 1NUPA 3JWPA 4M9QA 1I3OA 2C2OA 4TS3A 1RAHA 3HHPA 2HTFA 4DCCA 3AHJA 3F6YA 4B6GA 2LBPA 3WLNA 1ZWLA 3OCYA 3CE6A 4DJ5X 5EOVA 1CY0A 2R48A 2WHRA 3RANA 4E51A 3TVYA 3ZDAA 2AWOA 1XLTA 2H2GA 2WICA 1EVLA 2C2MA 3T6KA 4LF8B 5GGYA 3ILSA 4JLPA 4KWCA 4WE3A 2WT4A 4IH1A 3C6BA 3NDBB 1JR2A 1F8UA 1E8DA 2O20A 5LDHA 3S8EA 1UXHA 1Z5OA 5G0UA 3U16A 3ADBA 1UBSB 3SIWA 4DUGA 2YINC 2P68A 2DE0X 1L4LA 4J4BA 1YBAA 2C2GA 2C9BA 3LQ1A 4LNAA 1LQUA 3FGZA 1LBHA 2XT9A 3WK5A 3FLBA 2G5CA 4POAA 4KQFA 4ZXFA 3OFNA 2F1RA 1Y89A 3FX2A 2GTHA 3V00A 5J5CA 4XJTA 2C54A 1XEWX 1I7NA 2FZ5A 3G2NA 3OCXA 3SQOA 5GVRA 2P1DA 3RJZA 3AW9A 2QTWB 3ZE2B 1L5QA 4LFAB 4Q01A 1H2BA 2CDCA 2HBQA 2PX6A 2CUKA 3VSCA 2GNAA 4C4OA 3GT4A 3E9YA 3KOXA 3LYHA 1HT3A 3OURA 3BJIC 1EK2A 4PQEA 1KE2A 4Y2HA 2NMVA 5CJ2A 1Q3KA 1OA0A 3GPDG 3L7AA 3W2FA 1B6TA 2X3UA 2XVXA 3JX9A 3P20A 5GONF 3SEZA 1V3VA 2I91A 3I1IA 4OHZA 1HT2E 2JIOA 3DEKA 1US8B 1L1EA 3K6KA 1G5QA 1TKRA 2DBVO 2GUGA 3KJGA 4D26A 1RNLA 4CM3A 3OEHD 1NTRA 5J2TB 1GAQA 4F2PA 3OQPA 3AQIA 1DIHA 3GD7A 5JPIA 1D0SA 3H1AA 4W7IA 1E4YA 1H6DA 4G0PA 1K7FB 4QOEA 2WSIA 4XX0A 1CDEA 2AG1A 5FLXA 2IHTA 4ZVMA 3GJ8A 4MUKA 2Q5EA 3PU6A 1U0GA 1OLXA 3KAJA 4NZOA 2HCRA 1JLHA 3MINB 4HNHA 3EVGA 2HLDA 1ZGBA 3LPMA 4LJ9A 3C7AA 3GEEA 5JRDS 1Q1QA 4NCAA 4YV1A 8ADHA 1JEOA 4K3VA 121PA 5DASA 4O3MA 2GBLA 2JPDA 2M98A 3REOA 4FEAA 3ZV7A 1QFXA 2DHRA 1DXQA 4IYRA 5IYZB 5ALSA 1S8FA 2G8NA 1RRVA 4JEHA 4WADA 1GNTA 3FDIA 3ND9A 1V8BA 3UXEA 1RXVA 1PD0A 1YS4A 2NO1A 3VAAA 1L1QA 1CVIA 3D8UA 1P9RA 1YA4A 2XMZA 1KYYA 3JZDA 4AJNA 2Q29A 4C43A 1B6RA 4FGSA 5U1PA 4QDTA 1XTVA 1N8KA 4FFWA 4BMDA 3N9IA 2X5NA 1O7JA 4NCBA 5CXXA 4RQAA 2YYYA 1JAHA 1GZ4A 3IILA 4GAEA 3IO3A 3RU2A 3SJAA 2LKCA 1FFXA 1QPGA 1PU2A 2CVQA 3MSCA 1E7SA 5EVJA 3ZX4A 2WHEA 3TRKA 4CJXA 3R44A 3KQLA 1JE1A 2HADA 3BFVA 4ND4A 3FHJA 1B1AA 4EYEA 2NP7A 1U2GA 1GPKA 1R4NA 1VOTA 1D4AA 2GZDA 3EZ6A 1ORHA 2V8OA 1Y3AA 1DNPA 3PDCA 4MRVA 4WGGA 2PJRA 1Y8AA 4CFZA 2PAFA 2GASA 3PUZA 1RZUA 5C8YA 2VOEA 3ABSB 3H8SA 3LKDA 3OLQA 4LRSB 4BO3A 1AO0A 4HOYA 1GZDA 5JFOA 4IDHA 1X9GA 3K92A 4EFMA 3ENQA 4DSOA 2WD7B 3CN7A 1PT9A 1EAYA 5TRTA 1XZLA 1OREA 2J09A 3MLAA 2DWPA 1OXTA 1HYGA 1J8FA 3EZXA 1C3OB 3E2MA 3IPAA 3MUEA 1FDUA 1I6KA 1QE3A 2G4VA 3OZGA 4LHWA 4KL8S 3B60A 1FUEA 1MR3F 4L7QA 1SPXA 1QLWA 4A7PA 1NJ6A 2AX3A 4EB6A 3PRKE 4IV5A 4MDFA 3I2KA 3VR3A 3LWZA 2AT1A 5KMGA 1F8FA 5EP3A 2IEIA 2ZB4A 2CXRA 2ZB3A 3I9LA 5BWMA 3H4IA 5CDFA 3RKRA 3VTFA 1HKHA 2F9LA 3U19A 1XU4A 1OI2A 1P1BA 4BNWA 1R0RE 2GPSA 4PCLA 1LC3A 1GQYA 2G04A 3CGGA 1SH7A 2G76A 1G7TA 3ACCA 1W2HA 1AQJA 1Y1RA 1BQ4A 2QL5A 4I2VA 5GP1A 2Q27A 1G7SA 2W90A 1DI0A 5FJJA 3TAHA 3U7HB 3GAAA 4JB2A 3R5TA 2HJWA 1MW8X 2ZBQA 2FPPA 1IBLB 1KTIA 2QN2A 1MTZA 1HK7A 2QY9A 1H1TA 4V0ME 1CVRA 4ZMRA 1Z13A 4PPYA 1CK4A 1C80A 4MS4B 1NUHA 1WM1A 1IBMB 4Y9DA 1O4WA 2OGWA 3EVCA 1JYSA 3FAKA 3IEKA 1G6Q1 1CQJB 2VDLB 4PX3A 3W5DA 3SX4A 2IWRA 1SUPA 3TTUA 3RSLA 2GHRA 3IRVA 1PHPA 3M82A 5B7NA 1UFOA 3Q0IA 3E4DA 1EFVA 2RHRA 3G5MA 1F12A 5F1OA 5T5QA 4Z4HA 1O96B 3TQRA 5HGXA 3EOAI 5K4GA 3E9DA 4NOKA 1AQIA 3PC8A 4BMSA 2W2LD 1V5IA 4L5YA 1UBGA 2R84A 4BRWA 4GX1A 4B4DA 3OE4A 5JWOA 4YJHA 4HYTA 1OBVA 5FWXA 1PL7A 4XLZA 3OIFA 4Z0NA 3JALB 2WTNA 3WGMA 2NPIA 3UQYS 4TTVA 3DR3A 3KD3A 1OT3A 1H5UA 3WDLA 1J8QA 3QG5A 3DFKA 4KIJA 4C4PA 3SC4A 5ARBA 1TUBA 2JKYA 3Q85A 1U8FO 1F7UA 5DB4A 4R41A 2J1LA 1QBGA 3UZUA 1FSFA 1I33A 1PZGA 3RSGA 1JHYA 5EWMA 1OFHA 3PNSA 4JYPA 2GJKA 2P6MA 2BBSA 2HM7A 3JZFA 1SUCA 1E1DA 1Z2CA 2NU9B 2QNRA 3KR1A 3VTAA 1ISHA 3OETA 4HBGA 4Y2SA 4CCYA 1EUDA 2J3HA 1HZZC 2AYXA 2NUAA 4KZKA 3N86A 2BSAA 1DT3A 3CG0A 1LJ8A 2VQ3A 3BQ9A 4OIFA 5TMPA 4RNDB 3BE8A 1XF1A 4AZ0B 3X44A 2B30A 2WIBA 4G5SA 4HPJB 4KO8A 2IGBA 4HGNA 4Z9XA 2NV0A 1XEXB 1F14A 1PSWA 3I2IA 3KWMA 4LPSA 3V9PA 1BDBA 1DTSA 1D2HA 1RXIA 3R3VA 3ETLA 4Q00A 1OROA 1OU4A 2OFWA 3ECCA 3U2QA 2QX4A 3I2FA 5BN5A 1H42A 5A7GA 4DREA 4YIKA 1OYWA 5FV4A 1TRHA 3BZBA 3O93A 4P7JA 3ONEA 4EJSC 3HVRA 1ZM7A 4ZDKA 2RGNA 1INLA 1IXRC 3C6ZA 3I04M 3ONDA 3JQ9C 1RYFA 2HU2A 2XDAA 2OYRA 1N2CA 2A33A 1IQRA 2II6A 3UMFA 1UBHS 1T9CA 4IDPA 3IOCA 1LNSA 2ZSJA 3DT8A 1KDTA 2Y1CA 4RH3A 2B5OA 1Z7YA 2HRDA 2P6NA 5FL7A 4EY7A 2FR8A 3BIFA 3I6ZA 1CBUA 4ZCQA 4NBUA 3RSFA 1E62A 1UBNA 4M1QA 2FW7A 1XZKA 1EA7A 3A04A 2W8BB 3WRVA 1TMGE 3F9CA 4DW8A 3U4DA 2DC1A 2REQA 2BJHA 5FPKA 2D00A 2YKGA 3N0VA 4FLMA 2ZUTA 5HF5A 3SF0A 3OOJA 4L8YA 4RVGA 2R1TA 5KC9A 2OR3A 4OHXA 2JLWA 1EJ6A 3BERA 3IALA 2Q3EA 1J5EB 3TW8A 1NLUA 2FFBA 3EVTA 4PIMA 3RPEA 3GLHA 4Z6KA 4ZYWA 3KSZO 4J4HA 1TXGA 2BWJA 3AOEC 2D0DA 1N25A 3QMPA 1W1IA 2X77A 3U44B 4QYSA 4F97A 4KAFA 3VYVA 3E70C 2XGSA 2O7QA 3HWSA 3W2IA 3O2SB 2WVGA 3NZEA 4OAQA 5J3JA 2PLNA 1AN0A 2QQ0A 4LSWA 5A06A 4B8YA 1CUWA 1W4CA 3AMVA 1I3LA 1UDBA 2AZTA 1GGNA 1ZH4A 4FOLA 2VHYA 3NWJA 3DE7X 4N6OA 1JPVA 2X0FA 2G9RA 5HNKA 1VYUA 4MPTA 1Z6TA 1E2BA 2GKGA 3AWIA 3HQ4O 4H7FA 2HA4A 4N5NA 2OO7A 3NIGB 4O4HB 3CS3A 1NULA 2YVLA 4RK6A 1XNQB 2B99A 3TD2A 1YZGA 4PFJA 1UWCA 4AICA 2B8NA 4ZCRA 4FFPA 2ZYUX 3B1YA 2ZIFA 3L8YA 4GXQA 1L5RA 4FYPA 1XZEA 1Z47A 5H3HA 1ULZA 1UZNA 5BRJA 3A1UA 4JLAA 4Q4JB 5F2KA 1NVDA 4P1ZA 4GGPA 4OLJA 1E6UA 1C0KA 1IHYA 5K0FA 3JY6A 1GTVA 1LX7A 1E7WA 1YJAA 4JH0A 1CR0A 2EX4A 5CDGA 1OF1A 2PKXA 3HG7A 4ABTA 2VDMB 2J5QA 2D59A 1NZDA 3ZD7A 1EDBA 4QEZA 1T36A 4W7SA 3VR4D 1G9SA 1NRWA 3IDOA 3H42B 1Q1EA 3E4CA 4U7HA 3G13A 5IX8A 3FPLA 1SC6A 3QOFA 5DTQA 4XAQA 1KDZA 3T5TA 3ZXSA 4ZHSA 1VKRA 2O8EB 1L7PA 2HL6A 5DNAA 4WL0A 1AA9A 4NYMQ 2XQVA 3ANLA 3OFKA 5D85A 4G0VA 5AM1A 5CNIA 3DS8A 4KQJA 1Y8RA 1AKRA 2HZBA 4LCJA 3VYUB 3FMFA 3V4ZA 4OIMA 4Q9KA 2YZ7A 1SZDA 1S96A 3H2ZA 1T6NA 4NAHA 3KJXA 4HGZA 3DDHA 3UCEA 1E3WB 3DYVA 1NUSA 1S3SA 3GP3A 2ERYA 5KNBD 1P3JA 3B1XA 4F6RB 3HH8A 1R10A 3WJAA 3PIRA 3HN6A 1U28A 2ZZMA 5I01A 3A14A 3Q2IA 3IIMA 4MVJI 1DELA 4ZOBA 3IEVA 2ZTMA 4GI1A 5TE9A 3W6ZA 4CV3A 1XOIA 1SHLA 3A7EA 3FYTA 3MQ4A 1NRIA 4RD2A 3RFUA 4KBGA 5I51A 5KTSA 4ZOCA 4JJ7A 4RYDA 4R8RA 3IGFA 1GT6A 1W0JA 5GJWC 4PX5A 4OBXA 3HZRA 2GZSA 1E1CA 3A4IA 2QBYA 2QAGA 2ONKA 5F2NA 1NF3A 2XE7A 4EVQA 5LKAA 1MNAA 1WAMA 4C01A 3OX1A 4BNYA 4U7DA 1QFJA 5EQDA 3HACA 1YC5A 3JAWB 4NBTA 2DT5A 4WFQA 2ZSUA 3X1JA 4MV6A 3OCVA 2DFTA 5KJ1A 1N2JA 1MC4A 3G49A 3TLYA 5F51A 3U60B 3R3UA 1II8B 4BCDA 4O59O 2QTCA 4YXFA 3NKVA 2M1XA 1EJBA 2VUTA 3C85A 3K8ZA 1OU0A 3UW3A 2AZXA 1BX0A 4FFBB 3OJXA 5KNCD 2VUIB 3TKAA 4I8XA 4JUCA 1JKJB 1IRIA 1PR2A 4NWIA 4UAVA 1EE9A 1ZLYA 4OQLA 2CK3D 1FP1D 1V5GA 4R31A 4V0LA 3AUTA 1N34B 3IV7A 1A5SB 2D13A 3MRSA 1J20A 2QPAA 3GLGB 4DXHA 4DV3B 1VG0B 2OUIA 4LDJA 5JNLA 4H4CA 3RAPR 5E1MA 2IZ7A 4EUEA 1QYRA 3IA7A 3RROA 2G70A 1AQLA 5B6IA 1UKCA 2ROQA 3DGFC 3QYFA 5C7YA 1M0EA 1TM3E 1ST3A 1PBNA 2GUWA 4HGOA 3SU8A 3PQ7A 2I4OA 3N6VA 4XFDA 1VSTA 2R7KA 4J1TA 1UMBB 1MOPA 2Y68A 2XUPA 3NAQA 3FHTA 1KP2A 2W5UA 3QX7A 4PQYA 2BFBA 2WAAA 1QAQA 4YCDA 2QGNA 2YZMA 3D5TA 1BMFA 2IPAB 3H17A 1C3JA 7MDHA 3V1LA 1P91A 4IHAA 2C2WA 3NHAA 1U8YA 3LHIA 4M0FA 3NJ4A 2FYTA 1T6YA 4FS8A 5C3MA 2G1UA 2G28A 5HS6A 1U1EA 3E27A 4LEIA 4WBSA 1DLIA 5LBUA 2BHLA 1RT9A 3GOQA 3UF0A 1V7ZA 1C7ZA 3P9SA 3IR7A 4LQ4A 4P3XA 5K8JB 2LVBA 1DGQA 1P5FA 2CLHB 4OK5A 1SU4A 3DEFA 3KZMA 2MR5A 2D0OB 4DPKA 5DEIA 3DMYA 3ET4A 4EJ2A 4X60A 4J0IA 3W1EA 2BEWB 2WI8A 5F5NA 2IKSA 3OOWA 1SVIA 4RVCA 4C3VA 1KR2A 1NXQA 4EI2A 2YVKA 3HKCA 3A1EA 4FONA 3CMCO 3A9SA 2WQZA 1L9KA 1FSSA 1YBFA 5GV7A 4I3GA 2AC7A 1BCSB 1NM5C 1ZH0A 4QXPA 4RE6A 4XM2A 5E95A 5SY6A 1NY6A 3OE1A 1M34E 1U0SY 4MPJA 2RAFA 3UAWA 4YN3A 1UQTA 2HU7A 4WBNB 5EXTA 4M4SA 4L0CA 2AD1A 2CVZA 1PCXA 2R2GA 4DQDA 2YV5A 4E6EA 3DYBA 3RRYA 2I3DA 3K6RA 5C8VA 5CFRA 2G1PA 3NNNA 1AKNA 2NXEA 3QVOA 1MF7A 4F72A 3AKCA 1FFEA 2V6GA 3R0ZA 4IIDA 2XA9A 1QPZA 3QEOA 3MIZA 3A1SA 3GNTA 3PD0A 4RIGA 4YT5A 2LIVA 2QW8A 1F8XA 3CSSA 3I6BA 4P0TA 3ZI7A 1WVGA 1MB0A 1CQIB 1K6JA 2O0MA 2I4RA 3HYSA 1CUCA 1KSHA 2WNIA 4WOCA 1MOQA 2IYWA 4MKZA 1NXPA 1YZLA 2YXNA 5DI9A 4FFLA 2ILVA 3WYNA 3EIEA 3FCOA 5K0LA 3ZE1B 1W93A 1CDDA 1O9GA 2QU8A 4KX5A 4UE6A 4YRCA 2BONA 3PA6A 2Y92A 3OJCA 3TJZA 3NBXX 3C3DA 3WNCA 3DQPA 1FRZA 5JH7F 5CA1F 3L4JA 1V6CA 1ZITA 4R16A 1R0BA 2Z56A 1WCYA 2PJDA 3T7TA 2C2KA 2EG9A 1V4NA 4YRRA 4EHAA 1B14A 1DFIA 1Q95A 4YYZA 3W8NA 3VNUA 2R8BA 3OIWA 5DGXA 4FXPA 2ZBVA 3N2NA 3U09A 4UUMA 1IEWA 4YHHB 1JA1A 1X7HA 2C31A 4R1OA 4UQLA 3REQA 1E2HA 3OFSA 1WB5A 4M1TA 3SVZA 5JAOA 2Y2UA 1T4GA 3VJMA 2ASEA 3N3AC 4RZHA 3QMMA 3Q2OA 3W6OA 4YRDA 1RXYA 1GFZA 3DZGA 4U6QA 1K06A 3FNEA 3Q3IA 4HMOA 2XSZD 4YGXB 1P0PA 5DFAA 3RTCA 1U5BA 5CP8A 4B6OA 5I4IA 2WSMA 3RBVA 1C7EA 5LQAA 5BN3A 2H3EA 2QLMA 2JH3A 4X1IA 2WJGA 1J0CA 1BS9A 2V4UA 5FIUA 3A9TA 1BOFA 4LJRA 1VL0A 2EZUA 1ZJ6A 5ALLA 3H2HA 4NJMA 3D5QA 4A92A 1A9XB 1ZAYA 4JUFA 2FK8A 4CU5A 4LRUA 4XPZA 1SKMA 3GCXA 4WNCA 5JOQA 5ALUA 4NDAA 4MYHA 4IWYA 3I2GA 3CRMA 5B3JA 2IHBA 1N2BA 3GB9A 4BP8A 4JASB 3SZ3A 4ZVTA 1KYTA 3PUWA 2FP4B 3EIFA 5AK3A 1E7MA 2ZVPX 3EPPA 3LHSA 4CTJA 1UPAA 2B6NA 5GOZA 1C0IA 4DA7A 1HE3A 3VKGA 4HMPA 2EW8A 2GF2A 4NYJR 4LZJA 3FKSA 4BVBA 4JMLA 5B4UA 4Z9AA 1CRZA 4G63A 4BX3A 4TUYB 5KYYB 4XR4A 2X4GA 3TBHA 2F7SA 5CT8A 1LF5A 1EFKA 1LLFA 3DVAA 3MBKA 3Q7RA 2Q6TA 4QL3A 1BD4A 2CUZA 1JFFB 5IW8A 4EJFA 4XR9A 1O1YA 3CWQA 3DVQX 3A9RA 4UZEA 1JHRA 3EGEA 3RW9A 2QVGA 4IF4A 4YP9A 4CF4A 1UP7A 2JASA 1Y6JA 5GZ1A 2DAPA 4WLUA 1ZOPA 1ZUHA 4KWIA 4PV7A 5LUBA 1R6XA 1Y81A 1SKYB 1TYDE 1R6AA 2HB6A 2YVAA 3PC3A 5FA8A 5IT4A 5M29A 2WYVA 3HXLA 4Y8VA 1MPTA 4N48A 1WBJB 2P9HA 3OWHA 1D1QA 3HNPA 2FPRA 2H4XA 4XLTA 3FI9A 2QTNA 3D3EA 3ZOZA 2C9MA 4AL4A 2HREA 1D1SA 4WN9B 5B55A 1G5IA 2VPTA 1ZMXA 1V2GA 3MRXA 1DJQA 3A7DA 4DABA 4JB3A 1Z4NA 4KUHA 4Y2RA 3LNCA 1QIIA 5DHPA 1WUHS 3KQVA 1XCPA 2A67A 2ACVA 4JC5A 1J97A 3HBJA 3CTPA 4OHUA 1JSZA 4FK8A 2J0VA 1A8QA 1BO6A 2A7XA 2I22A 2IHYA 4QFMA 4B7CA 2O2JA 3C3MA 4CM1A 2RAPA 4B74A 1LFAA 5JS2A 4GPBA 1I5RA 5EP2A 1H4VB 3AF4A 3BGIA 5E6UB 4EX7A 2EEPA 1RJWA 3TQOA 5IJAA 4EWLA 4D8VA 5JVDA 2Z4SA 2B20A 1U4OA 2GBPA 4N3CA 1CC1S 4TMKA 1Z2EA 3SQDA 5KQPA 3N2LA 3WHPA 5EJIA 4QDUA 5TX7A 4GDFA 3ZS8A 3IQWA 3QKUA 3V7UA 1I4DD 4ZZ3A 4ED9A 3NDJA 8LDHA 1L8XA 1QP7A 3R6GA 1O77A 1SC4A 1DG3A 3P8ZA 4EHHA 4YR7A 3OZAA 1E5TA 3R7WA 2UXCB 3OEHA 2DFLA 5K4HA 4YNBA 3HPRA 1Z74A 3MERA 1G9XA 3HBFA 4M55A 4D3XA 4FE4A 4IHQA 2FQQA 4FTWA 4NY1A 5CGQB 3A3NA 3GGGA 1NBAA 4PQGA 3C24A 5LUAA 1T25A 4C4RA 4TV8B 4I08A 1LEHA 4LRYA 1QS0B 4J7XA 4I5IA 4NECA 5F21A 3G79A 5DLEA 1SQ5A 1Z0ZA 4IUDS 1W35A 1AGYA 1M6NA 4A9AA 1C4XA 5GADl 2HF2A 4TQAA 1U4SA 1GN8A 1AURA 1I2ZA 2GFQA 4AJKA 1MB2A 4FMCF 1L5HB 3AFMA 3DP9A 4U8GA 3U3DA 3WV5A 4QM6A 3ELBA 1H4SA 1G0OA 3WGTA 1FF9A 5BVGB 3NB0A 3PRYA 3WRXC 4WASA 4HK4A 4Y6QA 3M8KA 2PMKA 3BL8A 4BO1A 2BYTA 3CUKA 4W1PA 3L1IA 4D9JA 3EWSA 4P5PA 1NBIA 2V4ZA 1YR9A 4KN8A 4PN3A 5JXJA 1PFKA 4CTOA 1NURA 2W2XA 1YL6A 2DEUA 5LOVF 4QTYA 1YACA 5FBWB 4HDRA 4XGQA 4IIJF 1U8AA 1W85B 1L6RA 2IV3A 3CURA 4G1FA 2OHJA 4HAVA 4QUGA 3DAPA 2GEVA 4D80A 3CLTD 1UZUA 3KELA 3KXIA 3C87A 3TZQA 2NNLD 2XRMA 1P4SA 3O6VA 1Z2DA 1Y5LA 2LXNA 2RHCA 3BXEA 2UZ1B 3C16C 2O8CA 1YCDA 3KWLA 2F3TA 4EG6A 4QIHA 3CZ9A 2PUHA 3CX6A 3U3KA 5ISMA 3UTCA 4RM3A 3EH2A 3RVKA 4BZWA 2YRFA 2EDAA 4QXMA 2BDTA 4DWOA 4BTEA 1AKQA 1UT6A 2JDID 4OHOA 2MSLA 4RPGA 1ZBDA 2R8OA 1NUQA 4QBIA 5HGJA 1LRLA 4H1TA 2VHUA 3DHYA 4G5YA 5ICSA 2GA8A 3ESAA 2OHOA 4MI3A 4B33A 5CTJA 2C4WA 3GLSA 4HVTA 2X3YA 2NSDA 3UHJA 2CNDA 5HS4A 1SXPA 1GTSA 1XPOA 1Q7GA 2PUDA 3ILXA 2BCEA 2QUBA 5ADUS 2IF2A 4FW9A 2OZEA 4FD3A 2QRHA 4X00A 3SJ7A 4OCZA 3T5CA 3F1KA 3RJ5A 2SICE 1S1CA 1KO7A 5EHXA 1M0SA 3JQ7A 2WE7A 5KYGA 4IOLA 2YZ2A 3WL6A 2RCNA 2VJYA 4CMBA 3SIXA 1MMFB 3STTA 4DLSA 4I1RA 4QOJA 5AVJA 4YRSA 2VQDA 1PVOA 1F06A 2J3KA 4ECAA 5IJ9A 5KDDA 4RJTA 2V3WA 4FDAA 5HOQA 2J32A 4MB0A 3IP7A 4QFCA 3F6EX 2V03A 3OF5A 1B0UA 3FTNA 3ABZA 3MWYW 1PN3A 4H6WA 4U02A 4FNAA 3W2HA 4BE4A 4CDGA 4ZHQA 5KZMB 3C5VA 1FDWA 3KKOA 2P6RA 1IY0A 1WXHA 2DFPA 2GARA 2NXCA 3SR3A 4BAZA 1PD1A 2JK1A 1U2PA 2XOEA 3QH4A 3REFA 5JW6A 4DDMA 3RSHA 4TLEA 5CJPA 1M8KA 3D1LA 2HD4A 1KJJA 2IU6A 4M86A 1QHYA 4UD2A 3N2ZB 1F0PA 4P3OA 4ZQCB 3QWIA 2P65A 2QX7A 1CNMA 4HV4A 2ADMA 3LKVA 3MUOA 3QV1A 1W76A 2QMQA 4H27A 5L7TA 3V80A 2GS9A 3THYB 1WZNA 4KPUA 4CLOA 1ZVVA 3LL7A 5J23A 4ZU1X 1UL1X 2AHRA 3B3AA 3FOWA 2GCOB 4ZQEA 4BO0A 3D5EA 1L7BA 1B0ZA 2E5FA 5CX4A 1Z35A 4KQMA 2OORC 2FXIA 1P8JA 3SYTA 1G2OA 1DHTA 2W6NA 3NHJA 4KQCA 1ZA2A 2W2LA 3IEPA 4KAXA 1KJYA 1OTHA 4MGKR 5EHNA 1WDKA 4PIPA 2E5WA 1AQNA 2IYZA 2WU4A 3GA0A 3VH4A 1E9DA 2BM0A 3VKUA 2ZAOA 1TM5E 2E6UX 5JIBA 4RXMA 5F7OA 1W49A 3QY9A 4PGMA 4DPMA 2WUDA 2O2IA 4CHGA 2PRIA 2ZTUA 1JVBA 2BMJA 4LHVA 5IFLA 1YZUA 3O21A 3D3JA 1BMQA 4ALNA 3O4VA 5A6SA 5ICEA 2ZOSA 1ZUNB 3AR3A 5E2IA 4DA4A 1TUEA 1EH5A 4LF6B 2Q6LA 5G4KB 4KDEA 4Y2QA 5BQOA 2YS7A 2A92A 2OBXA 3G9TA 1PJQA 2B1QA 5BW5A 4AJJA 4C0XA 2PFGA 5KYUB 2Z5FA 4NEHB 5CFQA 4II7A 4J1SA 1ZHHA 4RHYA 5ALFA 4IMRA 2JFNA 3NHSA 3QIVA 4HAWA 4PX9A 3QNUA 5KI6A 3O1HB 5JAPA 4WCDA 1U04A 2OE2A 1N78A 4KPEC 3ZDRA 3R9XB 1LVGA 1SOUA 2BT4A 2RHOA 4QQRA 2YJNA 2ZZKA 1BH2A 1NU8A 3INRA 3K1AB 1UFQA 3KHTA 4DIOA 1XMQB 1F2DA 2AR0A 2VPXA 2W2TA 1BU8A 3H9BA 2QL6A 4JBIA 4DR6B 4E11A 1NMSA 1MO5A 3FDZB 4NCIA 4XIIA 1DCKA 3VZCA 1EDEA 2BEVB 3CC8A 4B3MB 2EV9A 3BGDA 2DWCA 5U4XA 4BCBA 2ZRDA 3NRJA 3GGPA 3Q3VA 2IXBA 2O1EA 2B5VA 4LJSA 3OMWA 1KAOA 3KTOA 3NTVA 1AS0A 1ZQ1A 4FHDA 1I32A 2XVYA 4GX5A 4EW1A 5JQGF 1DEHA 1J0EA 4JLVA 3TNJA 1BVHA 4H3SA 3AWDA 3WBKA 1DKRA 3QFFA 4NBSA 3TTVA 1PR9A 3EOZA 1M5TA 5ETJA 3SMQA 3LF2A 2WG0A 4G9GA 4M8SA 4RJLA 4E22A 1Z25A 1WHTB 2MHCA 5K0CA 4TM8A 5JATA 2AFHA 2ZYSA 1D5CA 2A7QA 4WPGA 1IOLA 2QX6A 3F0TA 5FI0B 3VKWA 3CX8A 5FLKA 1AUOA 3HB5X 1ZEMA 3MELA 1QIHA 4U2EA 3BMQA 3BQMB 4GPZA 4IF6A 3VX3A 5AM3A 4LXTA 3IHTA 4QBGB 2RGBA 3QBVA 4O4JB 1TL7C 3AUSA 1RRPA 3C5CA 4HTAA 4QFBA 5KQRA 2EWWA 5EFZA 1GM5A 2AHOA 5CDHA 1I1NA 5L3SA 2W2KA 3T5GA 2WJPA 3LKZA 1KJNA 1FYFA 2XCQA 1YRAA 1G20E 1IHDA 3DBRA 3INNA 1X1TA 4RBNA 1E3TA 2ZYAA 4D2IA 4ZVQA 2QN8A 2Y1WA 3R9KA 4RHXA 1R5NA 4MAFA 4E31A 2CVFA 1YE8A 3ANYB 1NQAO 4LF5B 1N6NA 3TQTA 2FAXA 4AQDA 1QVVA 4HEA1 1OTYA 4I0WB 4R71A 3SEQA 1QGDA 2H85A 2QXYA 4WLFA 3OJWA 4BZQA 3RU3A 4G67A 3K1JA 3R0JA 5EKDA 1VHTA 2VUUA 3RTBA 3UA4A 3CRQA 5HQJA 4P7GA 2XADA 4J7CA 4A91A 2WIGA 5IXYA 1LPAB 1PK7A 3OU2A 3JSAA 3DXXA 1FQKA 1SRRA 3WZ2A 2EBFX 3LQKA 4JGGA 3UK2A 4O4LB 3KYCA 2OCPA 4R8VA 4C0AC 5AVKA 2QNIA 2YNMC 1NQOA 5HUHA 3DLIA 2EP8A 4ROTA 2FWIA 4LDZA 1IWPB 3DOOA 4MWTA 1CIPA 3ORSA 1V96A 1M5UA 3PDHA 3LPDA 3T9DA 2CHUA 4AF8A 5C80A 3EUAA 4PPQA 2V6IA 3FPCA 3BTVA 4ZI3A 3MUNA 3AEZA 4KMMA 4R2JA 2AW3A 4J75A 3SI7A 4AZ3A 3RE1A 2GOYA 1JI3A 4H0CA 1RKUA 1T35A 1ZM9A 1O3YA 2X8LA 3MTDA 4I4TF 3ZN2A 1TKBA 2ZSAA 5IEJA 3UMGA 3IC5A 3RGGA 1QONA 4EDFA 2WTBA 3R5SA 3ZGZA 3ZLUA 1J06A 1JEYA 2XJ4A 1JQBA 5JNWA 1W7AA 3CF4A 3KK0A 2OILA 1O95D 1ZVQA 3AEQA 3CW2A 2VDWB 1EIWA 2GT1A 1Y5NA 4UQPA 2O3JA 4C2BA 3RADC 2HSWA 4XYEA 3AVUA 1P44A 3O4RA 3P52A 4KTTE 3Q8KA 2ZIVB 4GPAA 3HYNA 4JT2A 5AOCA 3SE7A 3VR4A 3RF6A 3CZMA 3CLHA 1GAEO 1MEOA 3D0OA 1K4YA 3ILVA 1OLSA 1T0JB 3QUAA 4JDPA 3ZJYA 5CUQA 3ZR4B 5LP1A 5IM4A 4KNVA 1DO0A 2ISSD 4JXXA 5TVGA 1RPAA 1QHGA 1GQFA 1MJGA 3QXHA 3KEFA 3SF8B 1GITA 3HWWA 5J4KA 2VWPA 4J0CA 1GQRA 1KAEA 5KUTA 1Z5ZA 4J6EA 5A3SA 1I01A 4AJIA 1D0VA 2HRCA 2F9MA 3W7VA 5KNBA 4ZAWA 4OHKA 4I50B 1KQPA 3IDAA 5CXSA 2YJTD 5HG0A 3TLBA 1WY5A 1Z6AA 4Q7EA 2XNKA 1OAKA 4KVFA 4C4SA 1PVDA 3LP5A 1VHQA 1U63A 2GCEA 2PPLA 3D4LA 1C9MA 1E69A 2UVPB 1IY1A 1SOVA 2HCTA 4MQ4A 1FNNA 1TYBE 3T3PB 4EA8A 3OQ6A 2GAAA 4CN8A 3MD9A 2ZS7A 2PU7A 2BHRA 5DIZA 2PTGA 1MBZA 5DLDA 5H3CA 3KDSE 1M1NB 1XGKA 1IPHA 2MSWA 4QG7A 3COVA 4M0LA 5CAEA 3F4LA 1DWQA 1S3IA 1K8XB 5CX1A 3BICA 4ZVVA 1AH2A 3DDUA 2PT6A 3EN0A 4Q82A 3BAFA 4ASUD 2QTFA 1JIUA 2OO5A 3AHEA 2CV2A 3F7MA 5LR6A 1GQOA 2HFJA 1O97C 3W4IA 4YRAA 4H6VA 5HQTA 1SJ9A 3E9MA 4RTPA 2WF5A 3CZAA 5LA6B 3WNDA 3R7DA 3DOHA 3KYJB 4PLWA 3U17A 1WA5A 4Z8XA 3UYLA 3WK9A 2C0QA 4NBLA 4ZU6X 3SLKA 3DZBA 2BFCB 3D7NA 3PQ8A 1FTNA 2PT5A 4LHXA 2AEFA 3OQ1A 4XQCA 4B9AA 4PAQA 3JASB 5T8KA 1A77A 3I2JA 3IVAA 1AZSC 1UAGA 5BUCA 1JDSA 1JIKA 5KNCA 3X1MA 2BH2A 3M89A 4BNZA 3N2KB 1OZFA 3KJZA 3GCDA 1DEOA 3SP1A 5JRJA 3MT0A 2CK3A 2BF4A 2O2ZA 4BYGA 2PUAA 3QVJA 2E4UA 2YJGA 4RZQA 3SNKA 1V48A 5G1PA 1HDOA 4F8YA 1IZ0A 3QUSA 4ODIA 3GHYA 2C4HA 2ZR9A 4PINA 3TCKA 3ONWA 4AURA 4HTFA 1A9SA 2AV6A 2I7CA 1LSUA 4W9RA 3PA8A 5BORA 2O54A 5K01A 4F3CA 4RD0A 4YWHA 3AQ4A 3DLPX 3GWZA 5JCPA 1P7PA 2V7XA 3KKZA 4KXMA 3EPKA 5BSVA 5A71A 3KZCA 3W5SA 1Z06A 1BQEA 4IGIA 4UHKA 3DC2A 1N2XA 3WLFA 5KNLA 3Q8MA 1KJZA 2N3ZA 1IWBB 1JEAA 3K20A 3NONA 3RDPA 1GKLA 2H3HA 3A58B 3PI6A 5IMBA 2B3TA 3EEQA 4IAOA 1UPBA 2QTVB 4LZLA 1OZGA 3WFIA 5A62A 3TGPA 3FVVA 1HLDA 3AP1A 1WQ4A 1DTWA 1G4UR 5EZ5A 1D2EA 3CNBA 4CQMB 1X70A 3PPIA 4INJA 3FWPA 1XCMA 2PX2A 3AM3A 3GVPA 2FJUA 4MUAA 2R6HA 3G7SA 3TOSA 3FB1A 4XWKA 3SVLA 3EA4A 3RBZA 3ZJUA 2JW5A 4PG7A 3WLQA 4M22A 4JYBA 3OJFA 4CT5A 3A05A 3K1TA 4REQB 4RAOA 2PHZA 2I5PO 3Q7QA 4TTQA 4U00A 1FNCA 4ZYZA 3H3FA 2QTHA 3NDPA 4FNOA 1RQNA 4EQ6B 4EMBA 1FRNA 5IAAA 1T3LA 4NPCA 3HJBA 2TS1A 4WK6A 4R51A 4POOA 3NGLA 1Y8ZA 4DT1B 1JQJC 2DU8A 4CFYA 3LBIA 1ISPA 4DIDA 2WSSD 1C9EA 2ZJ1A 4IV0A 4M98A 4V2IA 1GT91 2NU7B 2R7NA 2RB5A 2FW9A 3QWBA 3V7NA 2G07A 1KAGA 3IPLA 3G0HA 4D9NA 2B7LA 1XHEA 4D9EA 4LZOA 1RQRA 4X8OA 4B7UA 3PIDA 5F1PA 1ZQ9A 2XNCA 3BE4A 3RG8A 4UNNA 4DFDA 4EB0A 1JT2A 2KSQA 2QRPA 3B5EA 4RAQA 4Z86A 1XTJA 2RJNA 2WSBA 3AF3A 2FPIA 3FWNA 3N7TA 1C3XA 4GWKA 1N2CE 2EKBA 5FWYB 2RSLA 4YQEA 3PD7A 2R1UA 2YVUA 3LHDA 4YJ2F 3HUFA 1JWBB 3FFWA 4LI3X 2GD2A 1P1RA 2D4AA 4WXHA 3LDHA 2Z8YA 3H0CA 4WJKB 1V16B 4FQ7A 2OBMA 4UFOA 4ZTZB 4ZAYA 4E2FA 1R2QA 4LSGA 4FBLA 1Y7IA 1EFDN 2XQGA 4RSRA 3JQEA 1O58A 1ZOIA 5A9SB 3L4KA 5IJZA 4JBYA 3ZYCA 4RTNA 1JFSA 2IOFA 3OT1B 4E13A 2OECA 4B6EA 2SCUA 1ATZA 3AR5A 1MGOA 3GFTA 2PBRA 1RMQA 3F49S 3QTLA 1Z6GA 2J59A 3EVAA 4S12A 2N0SA 3NHWA 3PUKA 1VJCA 5HFNA 3DBLB 4RMJA 3U13A 4DMFA 1KWGA 4K6FA 5F78A 1IBSA 2J0UB 2JCSA 1UJMA 5C37A 4KOEC 2JA2A 3G9ZA 3GLHE 2V7VA 3RB8A 4Y6OA 1YU6A 3CPJB 3KTAA 5J4YA 4DKXA 4BUCA 1QGYA 3NTRA 2V9CA 2XODA 3LQQA 3TTWA 1FZQA 3BMOB 3USES 2W0MA 3QLVA 4BO7A 4Z49A 4M7OA 3ORRA 1TC1A 5KB3A 4C2UA 4EZEA 3ZIAA 3L6DA 2IQ5A 1GSHA 1QTQA 1J2UA 2IXGA 1QIGA 1QBKC 4ZT6A 4ZD6A 4ADSG 5H4HA 3DAFA 2ZAYA 2GLUA 4JLMA 3LT0A 2B25A 4M37A 4NOMA 1PDWA 1QZUA 1S3FA 5HIMA 3CEPB 5I8ZA 1Z7GA 3U4MA 1Z4KA 4O4IB 3SXUB 5TQ0A 1FSPA 4KQ2A 3PTLA 1WQ3A 3E8MA 3QFSA 1PJ3A 1P1CA 1SUAA 4TRNA 4JP8A 3ESZA 4K2AA 2PMBA 4NFLA 3M33A 3FUVA 1QLHA 4PGFA 3GLIE 1EWKA 3H8JA 1N3BA 4OB6A 3VSBA 3VYTB 3CR3C 5K8TA 2SBTA 1XZMA 2Q99A 1BCRB 3FGOA 3IAS1 1RI2A 3H5OA 2VJCA 1PUXA 1BQ3A 2PR2A 4B4VA 3GFQA 4EIWA 5H9WA 3TCXB 2ZLBA 2Z6AA 3LBYA 2J9RA 4LNUB 3V3TA 3HNOA 4HS4A 1B74A 3D7MA 4FILA 4NCXA 1M2HA 4KN6A 1KOFA 2QQEA 3OHSX 3RVBA 3D6NB 1PT5A 4UM8B 3UKJA 4BQOA 3DFMA 2FJ0A 4IGFA 5ENZA 4EMTA 2OBFA 1J7JA 1OGJA 2EOAA 2BM8A 3SBDA 2HLNA 4WEQA 5I9TA 2ZJYA 5HCUA 1J2EA 3PQ3A 4DRYA 1SCQA 1SKQA 1Y33E 4Q39A 4MHSA 5BMVB 1U7WA 1XJ0A 3N58A 1FMFA 1PE0A 4F1WA 3EISA 4RPJA 4C2AA 3QHQA 5G1NA 1T2DA 2H1VA 2QL7A 4M0DA 1RWVA 3RYFB 5JV5A 4Q48A 5FTMA 3GRVA 1NBWB 2HSDA 3W7BA 1UBOS 4MIKA 3OJ0A 3QKTA 3QUQA 4CW7A 4B0PA 4LKOA 4ZOLA 1T9GR 2HRBA 5FF9A 4EB3A 1CUDA 4GIBA 2Z43A 1OH6A 4QULA 4W9NC 3S29A 5CB4A 2Q3DA 2K7FA 4JLJA 2ZJ2A 1C2TA 2IYEA 2PKWA 1AZTA 3RRZA 1UDXA 3BSWA 4AFNA 1W5SA 4LJ8A 1Q2UA 4DDKA 5AW6A 4H7KA 3JQBA 1FCJA 4B2PA 2QYSA 5HM8A 4XGNA 3UG7A 4QTTB 5K20A 2DPHA 4CEJB 1XTQA 5ALMA 4C6HA 4HI0E 5JPDA 4MJXA 2Q0QA 5FBKA 1O6FA 1VMKA 4PNEA 3E61A 4CR7A 4G0WA 1IB0A 3WMWA 3WMFA 4QZVA 2GN9A 3L18A 3PR3A 1VJDA 4HF7A 1JEDA 1P4AA 3NIDB 3WNZA 1KDYA 4D46A 1NQUA 1YS7A 2FB9A 3MGBA 4KQKA 4RGQA 5LIPA 3HR7A 2HMUA 5FNVA 5KNDD 3WSWA 2FSIA 3LVFO 4I4CA 3ISVA 4UUBA 3OPNA 1SD1A 2JEYA 1ZK1A 1SXJC 3AY3A 3NO4A 4AJEA 3UUGA 1ESNA 3JQAB 3I05A 3LBFA 1R6UA 4MQMA 4B6FA 4QYTA 3C3BA 5LYJA 1BKSB 2CFCA 4QYWA 4R1PA 5CBPB 1M33A 2OZPA 2AF3C 4L9WA 3KT8A 4OQZA 5AHXA 2GK6A 4JK3A 1NV8A 2EFGA 4RVDA 1Q22A 2D6FA 3GJRA 1XWFA 4YJ3B 5B2FA 3AVVA 1EP9A 1TTPB 2JFXA 1JPNA 3E22B 2KW5A 3QK7A 3BHMA 4KX3A 3VNVA 2L42A 2O3SA 5D84A 16PKA 2DPYA 3FY4A 2Q2NA 4O8CA 3E8SA 5GY7A 4UCQA 5CH8A 2HBYA 5JDCC 2X13A 1XTRA 3IB6A 4IINA 3GZNB 3VM6A 1RJEA 3ZDZB 5G4LA 5TT0A 2W00A 4DL9A 1QH9A 2FZVA 1G21B 3E3LA 3QX3A 4IBOA 2R4TA 5D7BA 5C8YF 1GR1A 3DHNA 2CFSA 1CDZA 1J7KA 4F9TA 2GF0A 1ZUIA 2QG4A 3LJKA 3QWFA 3VNSA 3OQBA 5SZHB 2DUJA 5BSUA 4MIOA 2H48A 1SHJA 3ZTYA 1NC3A 4P3NA 4EFKA 3MWGA 4J0EA 4DB4A 5CD1A 4UXIA 1Y4ZA 2Z9DA 4CV2A 4LHSA 1DUSA 3N5KA 2GM4A 3JD4A 3CVWA 2CFRA 1QHSA 1UKEA 2YIVX 3RUAA 3U0VA 2X2EA 2JDIA 3AGPA 4LGMA 3KXPA 3CWZA 3HDGA 4L95C 2RHGB 3IMFA 1YOVA 4D9MA 3FTDA 4B46A 5ALHA 4ERNA 1NKTA 1M2JA 1KTVA 4ZODA 3OU6A 2Q3LA 4OSPA 4ZJZA 5KVVA 2BHNA 3UV3A 4QLAA 4E21A 3DA8A 4N18A 1YKSA 4WJLA 3QSYA 1CE8A 1QG4A 1RHQA 3QELA 4TMZA 5E9AA 5BUSA 1EP3B 2I2DA 3AIOA 1IXZA 5J2TA 4RK5A 2Q7OE 4FGJA 5KKNB 2AEJA 3IKMB 2VJOA 3JXEA 3QU4A 3IUSA 4HUQB 4UOZA 5GJBA 2IPLA 1U81A 3ZWWA 5DHAA 1ES9A 4QUBA 3BZUA 3TEFA 1G19A 1QF7A 4M8LA 4PNPA 3TEJA 2Y0CA 4L8FA 5JADA 1KYQA 4YCAA 1GADO 1KY2A 1N4DA 2OG2A 3HMKA 1OBFO 5J63A 3W05A 3MXOA 1OWOA 4EITA 1VPDA 3AEUA 4CODB 3A10A 4L78A 4LMBA 1EZZA 1D4ZA 1P73A 4R8LA 1QOZA 3UJ6A 4RKQA 5T4HA 1YRWA 2EC5A 4LHZA 3T3NA 1TADA 2PRSA 4L2IA 2ZYHA 4GI5A 1FUKA 4RFSA 1SXJD 3O8LA 4FWBA 1IQPA 2Q6KA 3HXTA 4S1OA 2AOUB 3HYCA 1YMQA 3LBNA 4GLOA 5DISB 4II2A 3TEMA 4NZMA 3Q6IA 2PR7A 4OLHA 5INTA 1AJEA 4MINA 3OUUA 1Z4JA 1BKYA 3UJ7A 3ICQB 1GIAA 2O2XA 2XAAA 3BEDA 3KTFA 4QEKA 3ZI0A 4PZ9A 2PYZA 4ZRDA 3VPBA 5DM1A 3SIRA 4D02A 5HR5A 1I3CA 4RESA 3ZW8A 1DJOA 2EKZA 1QQ6A 5DIFA 4DIUA 4MO9A 4Q1VA 5FA5A 4EFNA 4HNVA 3IP3A 4WLEA 2IIPA 2AOWA 2HF8A 4U9UA 3V2GA 1H2FA 1MORA 2HO5A 1JDPA 1ZIOA 1GFSA 1SXGA 1EHCA 2XT6A 4K9PA 4L5JA 5CVTA 4Q93A 3B6JA 2HWXA 3S27A 3BGOS 4N40A 5C1DA 3STHA 4UAGA 3Q3HA 4PXYA 3UMMA 4JEUA 3RARA 4FHCA 3T4XA 1OC4A 3FCCA 1L5NA 2QR3A 2YJ5A 2WWRA 5FTWA 4AT1A 1X1AA 2PH5A 4ISCA 5TY0A 3PGMA 4L6AA 3BSFA 3VI4B 2V7BA 3EQ8A 3EXFA 4TWAA 5DX0A 3UM9A 3V7FA 2OM2A 4Q9AA 2V96A 4ZAZA 3VU1A 5LZ2A 1CZLA 4FOTA 2OP1A 2Z98A 4D5EA 1I7SB 1M5RA 3VJRA 2BJWA 1DBQA 1I13A 1JQ3A 1RADA 4MV9A 1OMOA 1NUUA 2XZLA 5KYVA 1MOZA 1OX6A 1BA2A 1VB5A 1RS0A 5I7RA 1QTIA 5DX8A 1YI1A 3P2IA 4LYDA 2YBDA 5LZ4A 1UT5A 3HFGA 5CNMA 5AVYA 5IU6A 1KO8A 3OZSA 1XZAA 1IZ8A 2ODEA 4IIHA 2OTCA 4MX8A 4RVSA 4FVTA 4DSNA 4F0JA 1BG6A 5DVZA 2H8GA 4NENA 2J5XA 1Y9AA 4QFDA 2QHXA 2VHXA 4JAVC 4WX2B 3ZCRA 3MAJA 4BV3A 4PW0A 2OQ2A 4I46A 2CSXA 1WCV1 4I1YA 1AB6A 4FGKA 1B8UA 5CM8B 4ZTUB 4DGQA 2WHQA 5JJIA 4WRRA 4C5BA 2WR8A 1H2AS 1QB8A 1YB4A 1CQXA 2OBLA 2WKWA 2Z83A 2OA0A 1P62B 1RJ9B 1U02A 5TQ2B 1M7BA 4WLVA 5FOVA 3QKWA 2W6OA 5DT9A 2WB4A 4YDQA 2QPOA 3LY8A 5ITWA 2G71A 1MB3A 2QV0A 5ALVA 1QF6A 5T3YA 5M3BA 1LH0A 3DW3X 2JLRA 3IESA 3UT0A 2JGAA 2G9UA 4AX4A 3VBEA 1FLAA 1U2ZA 5KOHA 4DNQA 3GA7A 2I80A 2OXRA 4LBVA 4QG3A 1Q1AA 1UZLA 4V2UA 2QWXA 4IYJA 3CJRA 4H2DA 4K9SA 1G59A 4PSUA 3SX0A 2C5EA 5ADVA 3PVSA 2PLAA 4MRAA 2WV7A 5DM60 4HSEA 1ZI6A 4BVJA 1NYQA 1NXVA 3DXFA 2RGGA 4TVKA 2JGDA 1APBA 2RD2A 4IRMA 4NU6A 3FIJA 1ZMBA 3T3DA 4J4TA 4YRLA 4BU1A 2BFNA 2EQ5A 4BFSA 3W6UA 4BO5A 5E0KB 1ZINA 1RTKA 3DOEA 1QX3A 3PKJA 4BZZA 5GZ6A 3ET5A 2IHNA 2ODAA 4BEJA 3DE1X 3V33A 4U1RA 3BK1A 2R7AA 4KBFA 3ZLTA 4EENA 2O2DA 3AV3A 1WRBA 3KOUA 4CF7A 1E66A 1ETUA 2E85A 2FMHA 1ORVA 2OV8A 1DE0A 3OZTA 4O4HF 4WGFA 4PLZA 4F4CA 1VMIA 3OPMA 5GMOA 5D51S 4PSCA 2JF0A 1S9DA 5DWQA 1GGHA 5DSZA 3ETCA 2A0KA 3B3FA 5EQFA 1TYCA 3K9GA 1KH2A 2ATVA 4HWKA 2A3RA 5IH3A 4AJOA 4CF6A 4XVRA 1XP8A 2C4KA 2LIPA 4HS9A 3VSAA 5TSDA 4ZCMA 1Z63A 2VI5A 3IQGX 2R96A 4LYFA 1X94A 4YREA 3DOFA 4JT8A 4CN9A 5B2EA 3DDWA 5AW7A 1T15A 1RVV1 4L0QA 3WOHA 3R6DA 1K6MA 1UJBA 4ZYVA 3GT0A 4IMPA 3AZOA 5LNK6 1VHDA 3DZHA 4YALA 1DEKA 5AW3A 1R6TA 1XN1A 3HDVA 3ROTA 2WKQA 3RS9A 4TXLA 4CF5A 5M2QA 4W5TA 2OPHA 3Q10A 1QQBA 1S4MA 1ZRNA 4OQMA 4CM9D 3CZQA 3AM5A 1BX1A 3QVXA 4QGGA 3HJTA 3LQ2A 3ETEA 3I0NA 1LQTA 4X3CA 1LY1A 2AG6A 3HI6A 4R0VA 1MB9A 4YO7A 1QH8B 4JITA 2V98A 2K87A 3R5HA 1LK5A 2X2PA 3L8DA 3WQHA 2P91A 3CLVA 3B85A 1CUIA 3LQRA 4AQ7A 1QRUA 5L4NA 5A05A 2FG5A 4NICA 5E4TA 1DIOB 3U31A 3ZCQA 2IV2X 1REQA 1WU8A 4TYWA 5A3VA 2IHUA 3COJA 5IC6A 4F46A 1CULC 1IK4A 3F4BA 3S5JA 1VFNA 1YS9A 1FSGA 2Z4TA 2WPDA 1PS0A 3F74A 3IOMA 4PVCA 1RM3A 1ZSVA 5IF9A 1W581 4G26A 5DNVA 1Q1ZA 4L85A 4QOHA 2QXUA 1G3RA 5HKBA 5AI8A 1EPUA 1QWOA 1R5OA 5EIHA 4CLEA 4AO8A 3H2KA 3KB6A 4KFCA 4HDSB 2ZE8A 2ZSKA 2X9LA 3OSUA 1Z8DA 3M6LA 4IIVA 3W06A 1B43A 2ECOA 4CM5A 2QN7A 2BD0A 2EL9A 1FRFS 1LVUA 4QDJA 1N57A 1RWBA 4IKEA 3HXPA 3JYOA 5AICA 2VYCA 4NS4A 3STWA 5AVSA 2PRZA 1FRVA 4L4XA 3A6GA 1VXOA 5HJ7A 1NF8A 2IXTA 3MTBA 3WOVA 2VBIA 1KQFA 4AP5A 4ZDIA 4ZVKA 3COYA 1N3YA 1GRVA 1XMSA 3IE0A 5ESRA 5I9SA 3ND5A 3DV0B 2ZIXA 4WWHA 3SZOA 3RYCB 4CGZA 2NO5A 5JSQA 3O9MA 1WXWA 1T5DX 2PUJA 2JI6A 4IDQA 4P33A 1BE6A 4O2BA 3KFVA 4IQGA 3INGA 3T5PA 1VG8A 3IIKA 4M9ZA 2UUBB 3QW4B 4ASUA 4B8ZA 1ICEA 2XPCA 1VE3A 2ZATA 4YR9A 1GPDG 1BN7A 1WULS 2WMOB 3HJAA 1JXMA 2QKYA 3ISJA 4F3NA 3BFJA 3L7MA 5CDYA 1D6MA 2EG5A 3AIKA 4B6PA 4FR2A 4FYVA 5FYDA 1JIJA 1VJ5A 2MSCB 4YEDA 2FZEA 3C8DA 2EFDB 1W8DA 3GFFA 5HCIA 1VPEA 2HOQA 4XQ0A 5K45A 1C4WA 3LMKA 4DVJA 3AIIA 1ULTA 2BGRA 3PFCA 4HNGA 4LMPA 3WK4A 3X1WA 3IJEB 2HUPA 1PFQA 2NT3A 3DCNA 3HCOA 3PUXA 3VNAA 4EX6A 5BPFA 1AUQA 2IVZA 2EZ9A 2WHXA 4BL5A 5IUJC 2QTZA 1E9FA 2GWHA 4F84A 1TT5A 3Q72A 1W0CA 2J6IA 2R7LA 1BW9B 1O08A 1XT6A 3PC7A 4QVGA 4HC4A 3FPEA 4NBRA 1S02A 4CCAA 1XQYA 3W8RA 1CR4A 5T6MA 4DNFA 2O8EA 1WZEA 1EINA 3L5KA 2G0AA 4WNYA 2XVAA 3LCUA 4UASA 3U3ZA 3W79A 3ZGYA 3H4TA 2GCIA 1CZRA 3AFOA 1HTWA 1EX1A 4WZ6A 1GGEA 3B20A 1K5DA 3QJGA 4YV7A 5CK5A 1ULSA 1IOWA 1EUZA 1OI4A 1NTOA 2OXCA 2WUVA 4N5LA 2AIRA 3RVSA 5KYWB 4ARCA 1S8NA 3NC1C 2YL2A 5BNIA 1AZWA 1B6GA 1MB4A 3B7PA 3FSGA 2F64A 5LLDA 3ZBTA 1ZD9A 1SVLA 1QRSA 3NMUF 1G3MA 4G0ZA 4MQLA 3P94A 1ZN9A 2W6JD 3A4TA 3QQ5A 1RACA 1SC9A 1H0HA 1TGVA 3AKZA 2CLMB 2ZJ6A 1P5ZB 4DS3A 4WBNF 3L7IA 2QJFA 3UOAB 4BO6A 3N39C 3LLSA 1QQTA 3C1AA 2CBXA 2I1QA 1L4FA 4XFJA 1PTJA 1JHPA 3KJHA 4JQSA 4OJNA 4X1YA 3Q12A 5MDHA 2YXLA 1JIVA 4FCCA 2AUTA 2EF1A 2FMXA 5JO9A 1QTNA 2A5JA 2EBHX 2D8MA 3E53A 4W7HA 5CBKA 1V35A 4C7VA 1QV7A 2RH4A 1NSTA 2NYRA 1B4DA 1CB7A 1ZGHA 2HJHA 4GECA 4LOKA 1ZD2P 1E3QA 4K40A 1MIOB 1TF7A 5BNFA 2WOJA 5B7QA 5C4IA 4KXFB 3N6RA 3ZGXA 3ZDBA 4R05A 5THQA 4GI3A 2IIQA 4FMDF 4OD0A 5JXGA 3GIWA 1ZBQA 4QDZA 4EI9A 2WSSA 5FPTA 2CVPA 2DLNA 1YMVA 2O7RA 1X13A 2VUHB 1EEXB 1G8JA 3FPHA 3GEPA 3JAWA 4E5SA 2GEKA 2Z04A 4Q15A 2GPNA 5DM70 5F1YA 4JVMA 1PJZA 4AW9A 1U3DA 1JS1X 2C9CA 3VAZA 2F4NA 1ZHFA 1RWKA 2VF5X 3G0GA 2W2PA 4L4UA 1VG9B 1WZIA 4OXKA 4UTOA 3SAJA 3ZX5A 4LTNA 3RCBA 4XEUA 3SC6A 4D3ZA 1QU2A 4NZ9A 1U7TA 2HV8A 4WY5A 1IBKB 2VQSA 5KNBH 1A9PA 1PHRA 3GBPA 3JAKB 4P92A 1XVVA 2IZOA 3L9WA 3GLGA 4GP7A 3QMWA 3MK31 3L8HA 3OCUA 2XD4A 2XJ9A 1A88A 3EIOA 1G2QA 1ADJA 2AFHE 3KBBA 3ZQUA 4GC9A 2V0GA 2PH1A 4NAVA 2WJHA 1E7YA 3RBXA 1GSOA 2PMCA 3HCCA 1W4RA 2FHPA 3U3JA 3QMVA 1QANA 1RC0A 2HIAA 1QE5A 1TYAE 2UAGA 4G8JA 2J7PA 4F3YA 3OEED 5I4CA 2CHEA 4PR0A 3OZDA 3KYDB 4P58A 2PO5A 5IKOA 1GXSB 3RVNA 5J5AA 3QVWA 2VL7A 2OD2A 1E1YA 1SO8A 3NXKA 4L9SA 4KR0A 4PGGA 5CT5A 4OHRA 3WLJA 4CI9A 3PCRB 4FGWA 4LVCA 4OXYA 2C8JA 3C3EA 4M7PA 5EWJB 3L0BA 4EUSA 4E08A 3H9UA 4X7PA 1N0WA 3IUPA 2JGRA 4IZIA 2D06A 2Z3VA 3OM8A 1PSDA 4TLLB 1V9CA 1FJHA 3HU1A 1I4OA 1ZXBA 5COQA 3V4FA 1Q19A 4AU1A 4BMXA 3G6KA 1M8GA 1RRKA 5DYYA 4C22A 4CDRA 4NF2A 4EATA 5ALDA 1LPOA 3UUWA 1C81A 1JQLB 3M1LA 4QPPA 1BHQ1 2FDCA 2WQ6A 5HSGA 2XYHA 5E8RA 1XQWA 3S2EA 1LW7A 5HFAA 1KYIA 4M7WA 2Y99A 4G23A 3O90A 1THGA 2XCIA 1J0AA 4MVWA 1OXXK 5AUQA 3VR0A 2PNFA 4DIEA 4EA9A 5A5FA 4TUYF 2QZ9A 2CBGA 3LT4A 3I9MA 4DMRA 4MP8A 1XDBA 1FDSA 1JKMA 2PXHA 2XZDA 1CLEA 4Q4HA 3ND6A 5P8WA 4ND5A 1IMJA 3KXKA 4MARA 4OY3A 2QN9A 4BBJA 5EKSA 2WF9A 1E1NA 1NJ2A 5AXDA 3CVVA 4K1XA 5F7ZA 4OXIA 3IHWA 5FFNA 2IS1A 3L4BA 3L0PA 2JRCA 3HWX1 3RS4A 2C2HA 1YRYE 3P7MA 2FHSA 3BH0A 4KRXA 4AWBA 1HNNA 3ZWBA 4W9MC 2Z2ZA 1FQWA 3NBAA 4WZAA 3HGTA 5EAIA 5B6JA 2ZTVA 4P4LA 3SJZA 5JLJA 1RXCA 1FJGB 5T3UA 2GD1O 4WXPA 3DAGA 1EHYA 1H69A 4HDKB 1BX3A 3S4YA 3UHPA 5BN1A 1T2VA 1ZG3A 3CNQS 1UWLA 4CEHA 2WB2A 3ZNQA 3P9XA 4H7PA 3RVRA 3I6MA 4M0PA 1GARA 1NYTA 4F2GA 2FN9A 3H2JA 2F90A 3LXUX 4F9EA 5HRAA 4KJXA 4PC7A 4PLYA 5CR9A 3FAZA 3CF4G 5KKAA 1YS1X 1ZFNA 4LVNA 5KYXB 4GR5A 4V3BA 2GEUA 1E8NA 4GBED 3F78A 4H35A 4QUIA 2UYHA 5KS2A 3H1EA 3DSRA 3GJZA 4BNKA 2V1UA 1I1OA 1UMCB 2VP0A 2VDQB 4R3WA 4UTRA 4Q34A 2JFOA 4JQYA 1Z16A 3UHAA 1S2NA 3NBKA 3LCJA 1P1FA 3JRWA 4YPFA 4KODA 4F1KA 3AB3A 3AJ8A 2XMGA 4MLDA 5C5DA 4FOSA 1DU4A 3G17A 3B6EA 3CVXA 4Z4QA 1OVGA 2QN6A 3PEUA 3PZRA 2F4VB 2AFVA 1AGNA 1ESEA 5KC8A 1HYBA 1UBMS 2ONCA 2ZQZA 1AN9A 4YGYA 4KEAA 1EB8A 4L16A 5FJIA 4U2BA 5EMNA 4ZT5A 2IV7A 1UDWA 3JQRA 4TV8F 1X1DA 1V5FA 2H0QA 2X1MA 5F7XA 4R2MA 2O2EA 3O91A 3DCIA 3EFEA 3RIHA 5CH3A 1CXZA 2H16A 3G7UA 3WV4A 2H7VA 4IVQA 4JI4B 1XEWY 3HXKA 4CKBB 2O3UA 4IFTA 3DYIA 1JAYA 2MMGA 3EFOA 3NYRA 4P8RA 4BQFA 3IAAA 6REQB 1HNWB 4J43A 2PVCA 3ZE7A 2MIIA 2WP0A 4MKFA 1XVIA 2YICA 2ZI3A 3O92A 4L8GA 2C2ZA 1NR1A 1YS6A 3G2KA 4Y67A 4ZRNA 4YV0A 2JLUA 3VYWA 4BVGA 1H6CA 3VR6D 4F4DA 1SN7A 3G0IA 4C6RA 1YF3A 2P4UA 2BKEA 5A7FA 1SQ6A 3IDFA 1NR7A 3WIOA 4YLEA 1XZQA 4B32A 1GPUA 2ALJA 3NETA 2VJKA 2MSNA 4H4DA 4C08A 4TVSA 2G1JA 1N1EA 3ZG6A 5C8ZA 3DONA 1NVWQ 4M0UA 3V6LA 2XYVA 1NN5A 4NEQA 4LJYA 1BTOA 2PANA 3KFLA 3VHXA 1XF9A 1M1YA 3AUXA 4LVOA 2BFEA 2QDKA 2WWIA 3S2YA 3VAYA 1HDRA 1ZCJA 2W43A 3KZ1E 3M70A 2F55A 1Z5WA 5AXCA 3ZZ1A 5DYWA 2FJPA 4RL6A 1ODCA 4XJVA 3QBJA 1F7VA 1IHOA 4BXOA 1P2GA 3C6KA 4HGRA 3EG9B 1CHNA 2AYZA 2ODWA 3V4OA 1XO1A 1IBRA 1TKCA 1NJ1A 1AG9A 1CS0B 3GJ4A 2NPOA 2QW0X 3I9NA 3IULA 4WN9A 4F6CA 4CXMA 3WMEA 1YIDA 5DHRA 4ARIA 3AB7A 3EVBA 3G1UA 2P1RA 5EQJB 4OJYA 3LX4A 1VE1A 4P7FA 2PZJA 1I7LA 4IH9A 1ISSA 5BN4A 2PV7A 2GN0A 1QNLA 2L69A 3U80A 3GJSA 3GPLA 2ZR8A 5IEBA 2N42A 3U4QB 1AQYA 1KFJB 3BMXA 1ZZGA 2ZJ5A 4G0QA 2RGWA 2JIMA 3PPWA 5ELLA 3IURA 1B26A 1JJIA 2NW6A 3MTJA 4RQTA 4MGZR 2CJWB 4ZQIA 4A8TA 1U3VA 3NBFA 3L8FA 3LC7O 3RK0A 1R18A 4TKZA 4N8SA 2C5SA 1ZDMA 2P41A 4MV1A 1WHSA 1KI2A 1NSYA 4N8DA 5JC1A 1ZI9A 4JROA 4JI1B 3V5NA 4KKXB 2VDOB 2D2EA 1VG1A 3E82A 4BBPA 5DHTA 3VC2A 4K6MA 4F5EA 4UVHA 2BVNA 1UK6A 4Q18A 2GNPA 3O38A 3CEHA 1KMMA 3D3QA 2PWAA 4UDYX 2WU3A 3R7BA 5A3RA 3K0SA 1C8VB 5HM6A 4H3VA 5CLFA 3LQ4A 2B5WA 3T7SA 3WLHA 4DANA 4TV9B 1CUXA 3CHYA 3PJGA 5EZ6B 4BVHA 3OP4A 4LNHA 2C4MA 4Y2VA 3A6ZA 4LWOA 4MEBA 2QNBA 3RIMA 2PL5A 4QBHA 1USVA 2EHJA 4K87A 4D82A 4QOSA 1QVRA 4MQUA 2FWMX 4UFNA 3X1ZA 4YPVA 2GD0A 1GV1A 4MZXA 4PO8A 5DM0A 1NSFA 3PWSA 2WNSA 2OD9A 1EWTA 4RF4A 4RMIA 2R6DA 3CZPA 3I9KA 1P74A 5E1DA 4RGBA 1WZUA 1Y5IA 5EQTA 4DM3A 5BRAA 3NKFA 4YAUA 3AHFA 2UXBB 1Q2XA 1TUIA 3OLYA 4DV1B 2Z09A 3GF4A 3ZIUA 3KYIB 1B93A 1E0JA 2O23A 1WKCA 3U81A 1NOJA 1SXJB 4X54A 2Z8XA 4BOYA 3TNFA 5AKKA 1AXGA 3NEYA 4O5AA 4TS4A 4HFNA 1D7OA 4C3ZA 4OBBA 3M1YA 1NZFA 2W0SA 1SKBA 3EMBA 4ND7A 3RASA 3QI2A 3UMSA 3CZ4A 3U7IA 2B34A 3WGUA 1EDOA 4C6TB 1Z45A 2XX3A 3WDMA 3CLUD 3NVAA 4TLBA 4EARA 3S2GA 2VJMB 4BJ3A 1Y82A 3N2EA 5JTUA 4KREA 1DIGA 1EHIA 3KE9A 3BF8A 3LPAA 1OV4A 4YASA 1QXSA 3A4VA 4M89A 2XIQA 1FYWA 3QP9A 3P9QA 1GTRA 3H0EA 4MLZA 4ZI7B 3KQOA 2IIBA 4Q9DA 1GA4A 4QEDA 4OB7A 1EGQA 1R0LA 1X7WB 3D9QX 4C6SA 3UAYA 2GNOA 1A9QA 1KU6A 1NI5A 3DOIA 3IHLA 3KZVA 1RM4A 1JAIA 4JFRA 4MQBA 4UXHA 3S2UA 3S0JA 3T8YA 3UCFA 1FK8A 2BRUC 1N9KA 1Q7CA 1UIRA 2OBBA 3OZEA 1ZCFA 5SICE 4O1IA 4X92A 3TLEA 5IAKA 1GD1O 1QIKA 1KNXA 2C94A 4TTAA 5ALNA 3HY3A 4D3YA 1AKEA 2I29A 1XLVA 1KI3A 4R69A 3ZHQA 3HKEB 2EKLA 2P9CA 4XFKA 3H18A 4BMOB 2GXSA 1I1HA 4GI2A 2ATXA 3BORA 2TMKA 3CNLA 2Y93A 4U2DA 3RIEA 3WKAA 2K2QB 3E7WA 1DPFA 2GJ8A 2QGFA 2HWUA 3L0CA 1DDIA 2JD0A 4MK4A 3SIPA 4B6RA 4XJSA 2C7RA 4A0SA 3BA1A 1UKYA 3C3YA 1DXOA 3MFQA 1YULA 1XZIA 2PS9A 3OD1A 3OT5A 1ZCZA 2Z5VA 3G0BA 4XX1A 2W6QA 1I2AA 1WSWA 4NV3A 3TZBA 4ZJPA 7REQA 1AKVA 1VPTA 2WF6A 3VZPA 2A9VA 3OX4A 1WXXA 3EXEA 5CB0A 5TV2A 1F2TA 3KLNA 1XL1A 3CO0S 3EW9A 2R1ZA 3J80A 4MOWA 2QUJA 5IM5A 1IHXA 4B3TB 4UHEA 2SNIE 4YAOA 2A1TR 5FUBA 1EFPA 3NI2A 4A8JC 2P78A 2QB5A 3FKJA 5ED0A 1J2JA 4J49A 2X4DA 3K2BA 1CUVA 1GL9B 5ER6A 5GOTA 3HKBB 1KSGA 1QHHA 3TL2A 9GPBA 2AF4C 3I8SA 5IC5A 3THYA 3SNHA 3HJUA 3TO5A 5LMNB 4LECA 2C82A 2PZAA 4G0OA 2HO4A 4JSTA 4P3PA 4AULA 3ED5A 4ONEA 5JNTA 5KQMA 1J8YF 3FUUA 3I9V1 5SZIA 3LSYA 5F7JA 5HX7A 4PRKA 3BWEA 2JGIA 4MZDA 5D8DA 2BFDB 3A8TA 4IS2A 1U7OA 2PL9A 4HGPA 2F3QA 1GCAA 4BNFA 1R5BA 3N6XA 1X39A 2IJGX 3ORHA 1FXUA 3KZKA 3LYUA 4LY3A 1T9ZA 1T1RA