4YLYA

Crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
198
Chain Sequence
MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGAYTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETSRFDHVMNEFNGEVKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcus aureus peptidyl-tRNA hydrolase at a 2.25 angstrom resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 62
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4ylyA00
5IVPA 3P2JA 4QBKA 2NAFA 3KJZA 4JC4A 2PTHA 5EKTA 4JWKA 1RYNA 2MJLA 3KK0A 2Z2IA 4JY7A 4JX9A 4LWQA 3NEAA 4FOPA 3TCNA 2Z2KA 2JRCA 4Z86A 4QT4A 3TD6A 4IKOA 4QAJA 4FNOA 4HOYA 3V2IA 5IKEA 1RYBA 4P7BA 4ZXPA 5B6JA 4DJJA 3TCKA 5IMBA 3OFVA 4FYJA 1RYMA 2Z2JA 4QD3A 3TD2A 4DHWA 4ERXA 3VJRA 4OLJA 2LGJA 4FOTA 4YLYA
chains in the Genus database with same CATH superfamily
1BMTA 4MKXA 2C3UA 2QQGA 3E7FA 1YC5A 3PHJA 3VR5D 5LP6F 1TC2A 1JH8A 4LBVA 2OWEA 4P53A 3ZIAD 1EVZA 5CM2Z 4F56A 4LBYA 3SSMA 3SZRA 1A2OA 5HF8A 4D9HA 2FSPA 2FFQA 2IYQA 2AQHA 5A6SB 1I9GA 1UEIA 2VDLB 4RMHA 1GNPA 4XI9A 3N2GB 4Q7QA 5HQ3B 3RH0A 4EGQA 3MJRA 3GUYA 3F3MA 5TQVA 3Q5DA 3GLSA 1VGRA 2FZWA 1W96A 2MMCA 1EUDA 5FQNA 4C7XA 3PEWA 4OGKA 1L5FA 4M1OA 3PF9A 3P52A 1N0WA 5BPHA 2JATA 1T2NA 3IVAA 2RHHA 4QQ8A 4I1PA 1U65A 3TD2A 1E2PA 2WMNB 3T9BA 4FWTA 2MMGA 1EB8A 1NW8A 3RHZA 3SXUB 3A3KA 2XNHA 3PQ2A 4AJJA 2VYVA 2AN5A 1JECA 1U7XA 4II3A 3V8VA 4X66B 4TWAA 4HNVA 2NXCA 4KMMA 3SIRA 5EPOA 1OB5A 3L0IB 1YZHA 4B76A 2ILVA 3PDCA 1W8DA 1WR8A 3TZHA 4DM7A 2VRNA 3K0BA 1E0SA 1T2UA 4LA4A 1Y8RB 1KI6A 3C48A 2QUHA 3JYPA 1A7JA 3T3MB 1ZGZA 1KRXA 1EI9A 4KFTA 3UHAA 3GGOA 4EJMA 1Y6JA 4FMBB 1Z12A 1BEZA 2FQXA 3BK7A 3HJUA 3ST7A 1NKVA 3VJKA 3ZWAA 5LBTA 4FB5A 1O0BA 3ZE1B 4M46A 1USKA 2E37A 3M6UA 5JECA 3QUQA 3IVRA 2CK3A 2QF7A 1KU6A 4I0WB 3ZE6A 5EWMA 2H0QA 3MT0A 4UXHA 2O50A 5CM9C 2HKIA 2VT2A 3D9QX 5K8CA 3DCJA 3CLUC 5KX5A 3TM4A 4NPHA 4WKGA 1FYVA 1XJWA 3W78A 7MHTA 3PV0A 2DX7A 4ASUA 1NXWA 1Z0KA 4ZD6A 1OSNA 1AGNA 1SKYB 4YRTA 3D6FA 4RPCA 4AJKA 3AV0B 3ES9A 1M8JA 3WYCA 3KT0A 3KZNA 2RGNA 4LWPA 3BTVA 4NFSA 3ZEIA 4F7WA 1UFVA 1ND5A 2DBQA 4GR5A 2A3NA 2GF0A 1CU1A 1DIHA 2V7UA 3C7KA 3GFBA 1J0AA 3IGFA 4O4JB 2I3BA 4QDUA 3AI3A 4OA5A 4IIEA 3EXHA 4MK4A 1G8SA 3B36A 3G7UA 4RANA 2BFWA 4JROA 3STWA 4BLWA 4DR1B 3M6WA 4MOWA 4N82A 3UB2A 1ZKMA 3UWKA 3T7EA 2VBCA 1AGXA 3U4MA 2IWHA 2H0RA 2WU8A 2VDPB 1MRSA 3IJPA 4R1NA 1EM8A 1QYRA 2J31A 3EEQA 4UDXX 3HFSA 4LKRA 3DFIA 4WLOA 5HCIA 3UHPA 1QO0A 2YMMA 4J0CA 3E3OA 2R7LA 1RC1A 5JBIA 3L4KA 2OFPA 2PGDA 3OIGA 3UJ9A 2J5RA 2CFTA 2QVBA 3RS5A 2PKCA 1M3SA 1FSFA 5CX4A 1SCDA 1FTSA 1L7XA 1SIWA 4GOLD 4FKZA 4NYJQ 4OB8A 4U7HA 3UV6A 4X64B 1U3CA 5BV7A 4LF4B 4YASA 1B42A 2NTJA 3Q3HA 4Z4GA 4P5PA 3IH5A 3DEIA 2FPIB 2IODA 1KVQA 1O7JA 1JJ7A 1Y48E 2AYXA 3NVDA 1PK7A 2ZCUA 2B7BA 2VBIA 4XJVA 3LUCA 5BW6B 4CU5A 4R7ZA 4I4LA 4I7EA 2QHXA 1DU4A 4N7JA 3I9MA 4M76B 1FFHA 4B71A 2QLTA 1R6AA 4U2BA 3GRAA 4JJ4A 3PE6A 1CSEE 2ZAIA 3MWDB 4GLOA 2VAXA 2C07A 3IBTA 5E3HA 2GM5A 4AKSA 1PJZA 3NIGB 3W2GA 2XB9A 3NTVA 2W5UA 2O8VA 3FWHA 1FTYA 1ZUNA 3L7JA 4M21A 4HN2A 3ZWDA 1XPRA 5ARCA 1SOUA 3KR9A 4F84A 4J0QA 2A7XA 3VKWA 4M7PA 3I9V1 1DE0A 1JZSA 1NM5C 2Q7XA 4L5JA 1VCOA 2ZWOA 5JYDA 3R75A 2FPGA 1THGA 3RRJA 1UDCA 13PKA 3WOHA 1E5LA 1RW4A 4QXQA 2H54A 2I3AA 3QPVA 4UVIA 3LUHA 5AJZA 4AQYB 3JTMA 2I1LA 2IVZA 1B0UA 3ESBA 1I14A 1L5NA 1R8JA 1QK5A 2HLNA 1RCFA 4X95A 3UWPA 3D4BA 5FOTA 2ORWA 2GPYA 5JIBA 5JISA 2C0QA 1M6EX 3DKKA 4KMRA 4M1MA 4R8SA 1C81A 3TFOA 5IXJA 5JROA 1N2BA 4EHIA 2AVDA 1STOA 4NIMA 1O77A 2RGDA 3ICOA 2D3TA 3N3AC 2Q5HA 1KDRA 3L0SA 3H8JA 3PPXA 3UG6A 5ADUS 1X0VA 3DE7X 4TYNA 2UVPA 1ACJA 1OYOA 2O6HA 3RV3A 1D2RA 1X2EA 1QGZA 4F1JA 3AL2A 1XELA 1KO5A 2IU4A 1WZUA 2Q99A 4R0MA 1HSZA 2IWRA 1GA6A 1VJ1A 1L4EA 3WGVA 4QM6A 1F17A 3DKIA 2F3QA 3LM8A 4UVHA 2FKNA 4YT5A 2PS0A 3FFXA 5G4KB 3LDHA 5G40A 1NU6A 2J9YB 1UDAA 2D74A 3E3NA 3OJOA 1U28A 5FTKA 4DL9A 3T3EA 3PQ5A 1UJBA 2GCEA 4BWVA 4DWVA 1BX1A 1P31A 1PRYA 5DOVA 5I7OA 3EVZA 4PC2A 4DA4A 1PEAA 2AZDA 2JGLA 1TZCA 1FY2A 2Q2OA 4HB4A 4RXUA 4X63A 1SC6A 3TIVA 1K7FB 3LCJA 4UU7A 3FRIA 1DEOA 3OZVA 2J0UA 1FLAA 4L8FA 1DAFA 3HDYA 4X71A 5TEVA 1IHYA 3QEJA 4KOAA 4X9XA 5BSTA 1GNLA 3AOEA 4MRRA 4ZTUB 4H7IA 4S0ZA 1HFKA 1U8AA 1EP9A 3L92A 4EW3A 3KQNA 4MAAA 3U3XA 3H2GA 1V7PC 4NESA 2F8TA 4QOFA 1TKAA 1DCTA 3PFWO 4FYYA 2WIJA 4PZCA 1J97A 2FSGA 1RZRD 1RRKA 4X00A 1JLKA 1ISIA 4EJ6A 2WT8A 1R2QA 5KEIA 1NT2A 3HVJA 1BCRB 4QUAA 3C3CA 4UEJA 4NTZA 3VO1A 1AZSC 4EPRA 2W0SA 1P6XA 4YRZA 3NWPA 5AUQA 3HWX1 4YP6A 3D8NA 3HCAA 3HVIA 2CLMB 4N8EA 3CB4A 4J4HA 5ELXA 3IT0A 3GYGA 3I9LA 4CGZA 3FLAA 2ZIAA 4BU0A 4TZ0A 1Q77A 2HV9A 5D3MA 4TS4A 3WRXA 4RV4A 3OJCA 2HT6A 5FO0A 4U2GA 1YQEA 3HBMA 3KHSA 4HKTA 3RTEA 1N6RA 1KI3A 2HBRA 4P92A 2DPYA 4DSNA 4UARA 1QGYA 4DLBA 3EVDA 1QCCA 2RGCA 4AJ1A 4L78A 1AV6A 2FWIA 4IEIA 5TDHA 1RWOA 4BX3A 3IDFA 5AM0A 3ISVA 1VL5A 3O93A 2JH3A 4NWIA 4HWSA 5JYBA 1M67A 4B3BA 5KYWA 2BBTA 4QBKA 1P45A 4KITB 1V2HE 4GIBA 5EKTA 5A9RA 4QRHA 1KDYA 1B8PA 3V4VB 1GTSA 3D6NB 3DM9B 4MQLA 3EVNA 1C50A 2G40A 1BOOA 1K4KA 3OCXA 4HDRA 5ALFA 4U7PB 5IBPA 2Y4NA 4BNXA 2ZRNA 5JSHA 2VA9A 4S1PA 5FI3A 1J2JA 1GVNB 2QRJA 3CZ4A 4XSVA 1WMSA 3KOUA 4FB4A 4N41A 1V7CA 4WOBA 3D8BA 4ARBA 4ZVVA 5B2FA 1BXZA 1P7CA 4N1AA 5LP6A 4H4CA 2W37A 3JARB 3ZU2A 4BJ1A 2GXUA 2ZJ1A 3WLPA 4DLVA 3WA7A 2XJ4A 2DFLA 1OV6A 1JEAA 1X8JA 5ELLA 4JJGA 1J42A 4W5JA 5PGMA 2ZJBA 5BN4B 4IS2A 3EZGA 2VYCA 2P3SA 1VKHA 2WAOA 3AEXA 2YRXA 3MWDA 3RJ9A 1GNQA 3DMTC 4J90A 2O2SA 2R6FA 3DR5A 3O75A 5LSAA 3CE6A 4GX1A 1YL6A 1BHSA 2QR3A 2YYSA 4BATA 4EW1A 5EINA 1PTKA 3MMNA 3S4YA 1ZGJA 3HY3A 3FPFA 3I4LA 3H2SA 2ZUVA 3O2QB 3ONDA 3VFDA 2Q29A 2C5EA 2BW0A 5KYKA 1N33B 3ENVA 5CLJA 2C3MA 3A2KA 3DL2A 4JOBA 4G6ZA 4RENA 4NYIQ 2NVWA 4TUYB 3LPNA 1W5SA 1YBMA 3K0FA 4URVR 1EEXB 1SXJB 3KE9A 1VGQA 1E2JA 1M2OA 5AKZA 4IGIA 1ZITA 1J1UA 3JAKB 3M4XA 4D92A 2NUTB 3EWNA 1H05A 4H1UA 2VBGA 2QTNA 3ANTA 2ORYA 4J2HA 3BK1A 1KP3A 1MH9A 4OH1A 5JNRA 3NBKA 1E64A 5BMOA 3GZ4A 5I47A 2Q5JA 4K6MA 3B53X 4UW9A 5BW5A 3DEZA 4EATA 2FGKA 2I8AA 1DP4A 1YMUA 3TTXA 3THXB 2BC9A 4IV8A 2VAPA 5AKHA 5I7UA 2ZJ2A 5CYOA 3N5CA 3W6NA 2VP3A 2AK3A 5FKJA 2HA0A 4JLUA 4JI0B 4KGDA 4NS4A 5A06A 1NW4A 4G81A 4EHLA 3HB9A 1KH3A 3AJRA 3I2KA 4HQ6A 4Y6GB 3WL6A 2LVBA 5E8RA 2ANBA 3L8MA 3RBZA 3B85A 4XWKA 5G53C 1VB3A 3EARA 3OCUA 1V5WA 2WSBA 1TM5E 2YHIA 4IDEA 3L77A 2QYOA 4RNDB 3TQOA 3VHLB 4DGSA 5HRAA 1XC7A 2YXDA 3AI2A 5H4HA 4XR4A 5JDCC 1X94A 2I87A 2KE5A 3OUTA 3V5NA 2KW5A 1JHRA 2GK4A 4QXMA 4R1OA 3T7AA 4EP1A 3TUJC 3OTGA 3IQDB 5AI5A 3TLBA 2D5LA 4DG8A 3T1OA 1EVYA 3WK9A 3ICCA 4W9MC 3NEAA 2PUJA 2OZEA 1E4EA 1ULTA 2P8SA 3GLTA 4UDOA 3ORYA 1LX6A 3FCUB 1T0IA 1WB4A 3N07A 4MWZA 1P4GA 4Q01A 4L0CA 3U3DA 2QTFA 5JS1A 3Q9SA 1INLA 2YWFA 4XX0B 3HA2A 5EJ9A 2F3SA 4B82A 1MIHA 5CMLA 4EB0A 1YD7A 1R0XA 4NJMB 2H85A 5ECYA 1IN4A 4L75A 2DQ4A 2B4AA 3CH4B 1MGOA 4IZOA 3F74A 5D7BA 3NHFA 4MGEA 3ENWA 2FVYA 1WCIB 1EUCB 2YFQA 2P62A 3BL8A 1JYEA 3OWOA 3QVLA 4QPPA 5GY7A 1CLUA 4C87A 1Q1AA 3G9XA 3PYXA 5DSXA 1R5JA 8OHMA 2X8JB 3RQSA 4IUBS 1Q11A 3AJ9A 3KWMA 1PNTA 3GGSA 3HWRA 5HA5A 4RDIA 3A3PA 2ATCA 4FDAA 2R5FA 2QK4A 3ABRB 4H6WA 4IJ6A 4MYCA 4UNPA 4G4GA 4Q9DA 7AT1A 5CUQA 3QWHA 4M54A 5BUSA 2X0FA 4BQQA 3A1VA 1KP2A 4GSLA 3DO6A 3O1LA 1SKYE 3FMOB 1AM4D 2XE7A 3A11A 3RYFB 1Z7YA 3C8DA 4U5QA 3KXLA 2FWBA 4RVNA 1PNQA 4MW9A 5JMOA 1R66A 1M2JA 2VPXA 1YOVB 1XJ5A 3FVVA 4E31A 3CLVA 1QFXA 3NC1C 1RAGA 1W1UA 1JDBB 4UAUA 1DOHA 4L02A 4FEYA 3A9TA 2G9RA 2C5FA 2H00A 3R5FA 4X61A 3CLUD 4B3MB 1Q1GA 1H1LA 1QIDA 2B6NA 5H82A 1C4WA 5FLXA 3K1AA 1ATIA 1DQYA 1NR7A 2DJ5A 2QRLA 2WV7A 4BV9A 5JLJA 2OG1A 3O9VA 3S2ZA 3CT6A 5AI8A 3JD2A 1XB2A 2N0SA 2QUBA 4EKGA 1OILA 2MYTA 1C3EA 3GLHB 2NUBA 4XJSA 1LLFA 2H2FA 1NIJA 4PAGA 3B70A 4B85A 1N1GA 2WYIA 1KR2A 4MB2A 4KAJA 5KYXB 3HC7A 4ECEA 2WVAA 4B75A 1PJ3A 4HDMB 1FNNA 5ALMA 3SF8A 1HT1E 2PRKA 2X5KO 5DISB 1QTRA 4TRNA 3N0XA 2PYDA 3K5PA 3LYHA 5KYUB 1U8YA 1Y1LA 4HUJA 3TLMA 1EWVA 5G1OA 2A1UB 2GF9A 4FOLA 4EPYA 5BSEA 1IY2A 3B9RA 1DVRA 3UMFA 4AZTA 3W3ZB 2WWWA 3FETA 2ZPTX 3OTIA 4UBKA 1K9VF 1L5YA 3LBHA 3L6UA 2OOSA 2C2WA 2BKLA 1U7PA 4N5MA 1BQ3A 2H2HA 1WA5A 1OWNA 4JLAA 4OHYA 3BMCB 2QP9X 3A6JA 3DR3A 3FNQA 3LOUA 3RFTA 4PYLA 3HNOA 1USGA 2IYRA 1CNEA 1U94A 1KEEB 4S1NA 1QH8B 1DZIA 3P2JA 4LCBA 4MA0A 3MMZA 5BN3B 3G2KA 1BN7A 3C8UA 4YP9A 3ROXA 1FK8A 4DLTA 3BD8A 3NIFB 3V3KA 1F3OA 3MOSA 4GEKA 4QG3A 2Q1YA 3FW1A 4RKYA 2EFYA 4YROA 2ZRLA 3VPDA 2PG3A 3B3FA 4FBMA 1IZ0A 4KNVA 4XH9B 1THZA 1HQKA 2HJ9A 2B8TA 4RH3A 1PQ4A 3FIJA 1WF6A 1YZVA 2O7QA 4Q1CA 1T2VA 5IYZA 1DT5A 1H4TA 3CN7A 4LK3A 2BVNA 2B4KA 2G7ZA 3EBPA 2PA3A 1JALA 2XUDA 4NOLA 5AR1A 2GN6A 1YS7A 2WFLA 4DC0A 3SY8A 4MDFA 2A3RA 4QDOA 3SBDA 2F9FA 3RBXA 1HT2E 3GJ4A 4NK4A 4FPXA 3WGKA 2ZW9A 1LFDB 2I2DA 3ANSA 2BGUA 3EB9A 3AFOA 4RHFA 3VR0A 3QFFA 5B3JC 4LOAA 1I4OA 4HNRA 4NMLA 2WZBA 4X1KA 5G2OA 3UCFA 2IQ5A 1MDFA 4LJYA 9MHTA 1NN5A 4ND4A 1K5PA 2CYBA 2XEDA 2R6HA 3TS1A 3GJTA 3KOXA 2XGGA 3I05A 1U2GA 1UC8A 5ISMA 5KINB 2V7TA 4QU8A 1QF7A 3K0CA 1E4EB 1I2CA 1U8FO 3P9YA 1NULA 3LNTA 1BHQ1 2PWPA 4QNRA 3B7GA 3Q2OA 4YJ2B 1WXFA 3ZX5A 1J0EA 2DY0A 4EY7A 3NVMB 3BMQB 1GTL1 4Y6LA 2Z4TA 3ANNA 3KFXA 1EDDA 3SBEA 2ZP1A 3SC2B 3MBKA 1TJ4A 1XZFA 2W22A 1U2ZA 1FE8A 3C1TA 3X1XA 1LVHA 1W4LA 5B57C 1YVUA 1LQTA 2RB5A 1A88A 4KQ1A 4LJ6A 2WOJA 5LC1A 5I7VA 1X86B 4EFNA 3IMFA 3Q7EA 3BZWA 3B6KA 3ZK7A 3LF2A 2JANA 2W4MA 1T2FA 3LT5A 3Q0TA 4MLPA 4N8DA 4QHYA 3UB4A 3CVYA 1UMBB 3PITA 5JT1A 4X1OA 4U63A 2HGSA 3VYWA 4ENSA 3V2IA 5B7PA 5BMVF 4KK4A 2VJMA 5IJZA 5AOBA 1T3ZA 1SD2A 3DXYA 4X3PA 2ZTMA 1L5QA 1WD7A 4NDAA 4QT0A 5FNVB 3ZY2A 1TD1A 5KKCA 2MDTA 1O5OA 1OR8A 2WHPA 4EG1A 1X1EA 3ETNA 1KFCB 2BLLA 2WT9A 1JNYA 3O47A 2IKQA 1GP2A 1KETA 3SC4A 2BOVA 2QP4A 2C4HA 4N4AA 3IA2A 4NYJR 1RR6A 4MKZA 4LYAA 4W1PA 3QBJA 3GT0A 3LZDA 5TF4A 2JFBA 4GC9A 1HDEA 1C4KA 3VV2A 2QZSA 4IX1A 2WG0A 1WF3A 4FD2A 1RIIA 4PBTA 1YS1X 4MWOA 3R74A 4AD8A 3RC9A 1PO7A 1NRIA 3B60A 1KEVA 3O7MA 1U1FA 1LBEA 1VJGA 1WQ3A 3EA0A 3H83A 3S1AB 1UPUA 1VP9A 1K89A 1PF7E 5A2GA 1H69A 1U02A 1ULUA 1G21A 2BT4A 2PGIA 4RV5A 3CW8X 2Y71A 3DAOA 2WEKA 2JLAA 1TYAE 3GN1A 3H2IA 3U4QA 5BQOA 3ZVNA 3I9V6 3KR0A 1LLQA 3NXKA 4TYPA 3REGA 1FDWA 2EIHA 3HMKA 2OO7A 2H08A 1M76A 4UUQA 5EQJB 3DCYA 3OICA 1CUHA 4YQEA 1B8OA 4BQSA 4Y9UA 3W4KA 4AECA 3OUZA 4MUKA 3QIVA 4WUTA 4JBHA 1I7DA 1OWMA 2UZ1B 1WVMA 4ZVUA 4TVSA 3ZDDA 1VLHA 1JQ3A 3RASA 4Q3CA 2D5IA 4HAYA 4L0MA 3WP1B 3A6ZA 1ILEA 1UPBA 3G88A 1FMJA 1R4ZA 4IDPA 3ZUGA 1H94A 2WLSA 2EW1A 1U7WA 2IPMA 3PGXA 4OQYA 2ZVPX 2GAOA 3AF2A 2JZOA 4N0MA 4WZAE 4CQMB 1VE3A 4HEA6 1ES9A 2TMKA 3WYGA 2IZ0A 2QPTA 721PA 4Y2GA 2ZIXB 1WZCA 4TYQA 1WLYA 1EIZA 1MN6A 1O9BA 4TLAA 1ZFNA 4YVFA 3RWMB 2XMCA 1VJ0A 2Z5VA 4XAQA 4FFPA 4TMXA 5AKXA 5FPKA 4S2UA 5AO9A 4E2YA 2DR2A 2G8LA 1RPTA 2IIPA 2RHMA 4GPEA 2R84A 5TGZA 5FBLB 3TCNA 3W7VA 1U9CA 4COOA 2J3LA 4Z51A 4AS1A 3OZAA 4JLOA 1FL9A 5LP6C 2IXEA 1TX4B 4HS4A 1U80A 2CMFA 5AKKA 1ID8A 2NAPA 3UV7A 2IGTA 2VYVD 2MU1A 2B34A 4MV4A 4I3GA 1C1XB 1L7QA 3MSXA 1COZA 2I4TA 2BFDA 1KH1A 1G9SA 2PLWA 2QV7A 2RBGA 2CUZA 2V3WA 3MOGA 4FFVA 4K86A 4WKNA 3SKVA 3SLKA 3UHOA 5EHZA 4OBWA 4JI6B 3PXCX 1WQ4A 3OE5A 5FJJA 2G7MC 4ITUA 3IOBA 3ZW9A 4F5WA 1V8ZA 3JWHA 4A26A 1QOPB 5HILA 2JCSA 2WDPA 4C0SA 4RFSB 5C1DA 1US8B 1WXWA 2H92A 1FU4A 3IIJA 3MS7A 3QBTA 1JG4A 3OU6A 4MYDA 4PRLA 4QLBA 1QZZA 2QG4A 2ZM5A 3DLBA 4ZEXA 3B7WA 3ASYA 3FCAA 4TN5A 2VDRB 1G5QA 2MINB 4AUMA 4D96A 4I08A 4RVCA 4XQCA 3ZIAA 1CP2A 3PR1A 4IH4A 3WLAA 2YFKA 1UOEA 3KLMX 1E6WA 3PTLA 4MS1B 4BCCA 2NZVG 3FWNA 1HQYE 4OD0A 4KPEC 1GUAA 3KDPA 2YWEA 3Q8XB 2JLVA 3OHPA 2IUUA 2FJPA 1DBSA 1E7RA 4FSXA 3U48A 4PINA 5GM1A 3TR6A 4F9FA 1R16A 2A35A 3B9QA 4XJTA 1J56A 3DAFA 1T2CA 2V5UA 2M6KA 1AU9A 1I33A 1NY6A 3FNRA 3HU3A 3QOXA 4H6PA 4JSRA 4RZUA 5ALNA 2BN4A 4MWSA 4MQFA 3ZHOA 4LZAA 2ID4A 1NBMD 4JB8A 1TA9A 4YAEA 4JXKA 3U3ZA 3GGJA 5IAOA 2XX3A 5A4FS 3O82A 2N47A 4Q3DA 5JARA 4TVOA 4E2XA 3QG1A 1UOPA 4ZXPA 4H7KA 1LY1A 3I72A 3C1OA 3GFOA 1PEKE 3LW7A 5BNFA 2OQVA 1O3YA 3GAFA 3I58A 4M99A 4Q6BA 5KMGA 2YHBA 4NFYA 1BW9A 4C0AC 1QK3A 2AR9A 2C4VA 3GA0A 3QKSA 2ZGVA 2Q2NA 3H1EA 4KMOA 1KI7A 1PJ8A 3QVJA 3EPPA 3ODGA 4QULA 1ETUA 4KPFC 3U7JA 4UBLA 3X3HA 4Q21A 1P1FA 1NQ5A 2P68A 5HFJA 4ZYLA 3JR3A 1U4OA 4WBSA 4ZI7F 3JQ9A 1VFPA 2ZULA 2G72A 2ZRHA 3R6WA 1G6KA 1XK7A 4MWGA 4J4TA 4QUEA 4FFSA 2WIFA 4GPAA 4Z5XA 3PXDA 2YJ5A 1QM5A 4BZXA 2B1IA 1E3EA 3GQBA 5KAMA 3VPHA 4AY6A 1QWSA 3P0FA 4G24A 4PCUA 3WYFA 5JHHB 1X74A 3NEPX 3ZI0A 4J9UE 4Z4FA 3LPCA 1X80A 4R8VA 3E9CA 2JDIA 4OMDA 3A37A 2RHBA 2YHAA 3R24A 1NFRA 2QKYA 1L7BA 4HWRA 4LW8A 3VC3A 5JMPA 3AY3A 1UJ5A 3G2MA 3W6UA 3F73A 3RIEA 2QZPA 4GICA 3CUTA 2EF1A 3G2PA 1JIKA 1IY1A 1ZCBA 1WU8A 4L85A 3QMMA 1TM4E 1V48A 2RAVA 1LFAA 1KY4A 4ZCRA 2ZE6A 2G67A 1JDBC 5GP1A 3EFOA 1NATA 3KZKA 1W85B 1JAYA 4DMGA 4YCBA 1X14A 5JPDA 2B30A 4N54A 3ZLUA 1N5MA 3ZWNA 1XJ0A 1KBZA 2UDPA 3LYLA 4LZLA 4P3YA 3NG1A 5JCPA 3W6OA 1WEHA 1L5LA 3VI4B 1G9TA 5EIHA 4NQZA 3DT8A 3P9XA 4EGFA 1C3VA 4PNEA 3VPAA 5BXQC 1GNSA 4K0RA 2OMEA 3C3XA 1M34E 1V6SA 2HYDA 3SICE 4JMPA 5LZ2A 3PX7A 1JDZA 4JBYA 1BWSA 1GTVA 1VE1A 4G1EB 3RPEA 4UTPA 3HA7A 4Y2SA 4M1TA 1R5NA 7REQA 4ZYVA 3DBHA 5JZOA 5L7WA 2WD7A 4JJ8A 1QORA 2JC3A 3PUYA 1W73A 4G0MA 4IOKA 5IT4A 3WQHA 3W05A 3S68A 4BO0A 1P0IA 3IUNA 2G4VA 3ZNQA 1MABA 1U7UA 3QWIA 4RJJA 3BCRA 4RPGA 1M6HA 3GJXC 3OKAA 4WESB 3CVUA 3KLPX 3HU2A 1GHTA 4PU0A 2F3TA 3DZJA 2RG7A 5T57A 4U3JA 2XYQA 1QBGA 3C70A 2Z2JA 1QIKA 1D9XA 3KKZA 2CXQA 4ENRA 3A6FA 3KWJA 4PLCA 1N4AA 1T9AA 4DVJA 1K8XB 2QJFA 1JQEA 2HQRA 4C0XA 4R71A 1E9FA 1MX5A 5FCDA 5KREA 3RF6A 3QXGA 4D80A 3L1HA 2P27A 5TNXA 1I5OA 2FZVA 3C7TA 4N3BA 4R9RA 3UAWA 4LV8B 2PWYA 3IAFA 5CH5A 4DWOA 5FHQA 2L0XA 4UKDA 1HX7A 1XEFA 5JQGB 3SHQA 4UFNA 4OAQA 1KQNA 4TPKA 2P5UA 4MWTA 2IPLA 4IQFA 2BE7A 2LXNA 5JNLA 1H6DA 1ADBA 1R0ZA 1RKUA 1OBCA 2Z04A 3Q3EA 1XL1A 5TMDA 3WX0A 4AJHA 2QT1A 2CLLB 1RC8A 2P75A 5F12A 2IV2X 1HFEL 4FZVA 3BF8A 3TZKA 3JAKA 3CPJB 2VNKA 2GD1O 3F4LA 3QEMA 2ZZMA 1QPGA 1R3UA 3J80A 3W4IA 1G8AA 2A4MA 4DADA 1IMOA 5C8XA 2DHQA 4Q7MB 1KARA 4YACA 3CVVA 1Y4UA 2VSOA 4NONA 3ZH2A 1J8VA 4LXUA 1DMRA 1GSOA 4PYNA 4EAAA 2EZ4A 2VHXA 5DSTA 3QX7A 1RMYA 1F1JA 2Y93A 4QBHA 3H1GA 1DAEA 1UINA 3QUAA 3U39A 1LJUA 2JFGA 2FE4A 4PW0A 3C14C 5K3CA 5KSYA 1DXQA 1W5TA 1XWIA 2E1RA 2VJKA 5FTNA 1DTSA 1HSOA 3T12A 1FMLA 2ZTLA 2R5WA 4N8SA 3G8AA 3DULA 521PA 2BGRA 3TJMA 4UOQA 4BJHB 3FOFC 2QR5A 4GMKA 2AKAB 1Y3CE 3BFVA 2ODQA 1NYTA 2ZI7A 2YIVX 1R5BA 5AI4A 5KKAA 3U17A 1TQDA 2IEAA 2WHXA 4YWHA 2EQAA 2NU9B 3RSGA 1LGYA 4DLZA 3R5HA 2IUEA 4L4RA 3T3OA 4EGJA 1OAOC 1QG6A 3EPHA 2FR1A 1J0CA 2BPOA 2OZLB 4NCAA 1HLPA 5KMGB 2CJWB 3D6HA 3I6BA 3K6SB 2LNDA 3MWGA 1Z2CA 4NYMR 4BV2A 3CLKA 4Z6KA 2GN8A 3TTSA 4DAOA 3FPAA 3VPBA 1OWLA 3UKOA 4LDRA 1BD4A 2BRUA 4F96A 5K20A 1UOOA 1Z08A 4X6LA 5DTIA 4G1UC 1FLNA 1Z5VA 2ODPA 2OLKA 2AN3A 4YJ2F 3OHMA 5AK6A 3DW3X 3PCXA 4QEKA 1F0NA 3AO0B 2BONA 3EDQA 5DT2A 4KXNA 1TQ4A 3MJHA 4MKGA 1CFZA 3PEYA 1BCSA 2QMZA 4KGVA 2P41A 4OXQA 4AKIA 4ZYTA 2I80A 1KZ1A 3C6QA 3LFHA 4JUCA 3K53A 4MYRA 5I7HA 4BJ5A 5DBEX 4R6WA 3HDHA 2ZYRA 2C9BA 1VXOA 3FYUB 4N0EA 4K9OA 3IC5A 4LC9A 5JAZA 4JB3A 1Y7IA 1PR2A 4MIKA 3RNOA 2CUTA 1F2TB 2WP8J 4L3OA 3AF4A 5KKNB 2G08A 4C5AA 4MW4A 5KTNA 4MLDA 5LQKA 2VP6A 1F7VA 5K7SA 2GD6A 4C7BA 2DH5A 3IERA 3MJVA 4J0KA 3OIUA 2QTGA 2WU1A 4OJQA 1L5VA 3PFNA 4PC6A 1E3LA 4ODIA 3S1SA 3LDAA 4KPYA 2CCKA 1JIVA 2ODBA 3BERA 3DSRA 4N6NA 3STYA 1SHKA 1ZL0A 3PGKA 2CDAA 4NDNE 4B80A 5JCJD 3HRIA 4CEIA 1NVXQ 3COYA 1D2NA 1OLSB 2QG9A 3PDUA 4ZVLA 1CNFA 4URWR 4RPLA 4RY8A 1RBQA 2YJ6A 4OQZA 2BEVB 1MVLA 3VC2A 1E2QA 5J63A 2Q27A 5JAMA 3JPWA 3ZYZA 3S99A 3C3DA 3KVOA 4O4LF 3QY0A 4YMTA 3UKJA 1YUMA 1XX6A 2V55B 3RB8A 2VCEA 1UFOA 3GNQA 2WFAA 1DOZA 2X58A 3K9GA 3L4JA 2FPWA 2MYNA 5I9BA 3UT5A 2ZJOA 1HNZB 4PLVA 3A4VA 1OWPA 4NCIA 2ZYHA 3JRNA 1FB5A 2GZ3A 1EE2A 3OJEA 3LK6A 4FS8A 5E9WA 4ZO8A 4M9SA 3WHKA 1ULBA 4MHTA 3SP1A 4EEZA 4P4LA 4MVJE 4GD3Q 2BHRA 5KTRA 4KQMA 4E5UA 3IBCA 3G9TA 1H22A 3OESA 1B0PA 3HWWA 4GZ3A 1E2MA 1WDTA 4Q3LA 2H57A 4IMPA 4BO7A 5BSGA 1AKRA 2BRUC 5JVDA 1V71A 2B21A 1G291 3NDIA 5DK6A 5KCMA 4CLOA 3S2FA 1REQA 4UHKA 2XWBF 1C9EA 5ESDA 3HS3A 3RYTC 1ORWA 3U62A 5JHGB 1X1QA 2BJHA 3NASA 3P9QA 4TSKA 3MLAA 4IO0A 4QO7A 2Q8QA 2GARA 1U98A 1WIWA 5ALYA 3OQJA 4H3HB 2AL7A 4CT5A 1QHEA 4P86A 4PSKA 4EPXA 2I3ZA 3MRSA 2FP4A 5F7ZA 4ETNA 2A1UA 1V1MA 2X76A 3WIEA 1VI2A 1TJ3A 4IZIA 2OVBA 3QI2A 2ZBEA 3T5AA 2XQIA 2BGTA 2OR3A 2W2QA 2B37A 3U49A 5ALRA 1QRDA 1T9HA 1YZYA 3H13A 3MUEA 3QUSA 4F06A 4V0KA 3PUVA 3H2JA 4XWWA 2PXHA 3KJFA 4MWCA 1JMYA 3FTNA 3PL5A 4ESOA 4NABA 2JLSA 3TK1A 5I8PA 2GXSA 2PH7A 3CIFA 3SBOA 2W6MA 4YGYA 1Y6RA 1JHAA 2PGOA 2ZI4A 2QXUA 3UUFA 4ARVA 3ZN2A 2BMVA 4A7PA 1P5FA 4BGVA 4DCNA 4CLRA 4F3KA 2R25B 2YZMA 2XMSA 1K6IA 3BBPA 4KRYA 4IKOA 4UBIA 2WHQA 3JZIA 5KU7A 4JLDA 3D8RA 4S3MA 2PT7A 3IR7A 3DMRA 3BM5A 3Q7SA 2GBCA 4X90A 2DEUA 1DIRA 3M4NA 3MIIA 3QTLA 4QSHA 4DDUA 5L95A 1ZMRA 3BBLA 3UK6A 5IDQA 5BN5B 1FFWA 4UVDA 2DB3A 4L74A 2XBMA 1DAKA 4G2NA 4U5XA 4AK9A 3G1TA 1U63A 1HG0A 5JSKA 4Y6PA 4PONA 4ERNA 3TSYA 5B37A 4PGAA 3V7NA 1VBFA 3VPSA 3U7HB 1WUKS 1D4ZA 2D7CA 3DWFA 3MT8A 4KVAA 1PZMA 2H1RA 4C0HA 3KQSA 4AG3A 5IC5A 1EA5A 2Z30A 3IR6A 3UAVA 1N25A 3N7UA 5JD5A 4U4AA 1A4XA 3H9BA 1OLOA 4LJ5A 4RKWA 2NUTA 3AEZA 4BX9A 4W7SA 1C3JA 4AMGA 2CJWA 4FYVA 2BFBB 1CZOA 3OD1A 1ECJA 4L16A 1Z6AA 5DX8A 1GDHA 5HCUA 5HQ3A 1UBCA 3KSRA 3JQRA 2IHTA 4LXHA 1U7HA 3VGPA 5C7IO 3B12A 1OV4A 3OFVA 3DHNA 4G01B 1A8IA 1DKUA 4MQMA 4ALMA 4H7FA 3N39C 1OY1A 1Y9ZA 3A06A 2H5LA 5BQPA 3TLEA 4BQPA 3THXA 1TK2A 3E81A 2OHHA 1PV2A 2ZETA 1RFLA 3J7TA 2QSYA 4NKRA 2QI9F 1BCSB 2PLAA 3ACBA 2R8PA 3VR2A 3W9BA 5J1TB 1YS9A 5FEUA 4BU1A 2AMJA 3LA6A 2OZPA 3EXEB 3KQWA 2A9JA 3NHWA 4ZTBA 3RGWS 3ZBTA 2VXBA 5HMLA 3R7WA 1N2XA 1E9RA 2IUYA 1WRBA 4V39A 4X7PA 4B40A 3PGLA 4DBZA 4YAGA 1WZ2A 2VS1A 4ZI3A 2P3OA 5IKEA 1VA4A 1I30A 4WLEA 4XIJA 1YMVA 1Y80A 4U0JA 1WUHS 4LMBA 1YRLA 3OUUA 1Z82A 2IH2A 3GFQA 3ZY3A 2M98A 3RJMA 2DFDA 2YJZA 4J29A 4QA9A 1X7ZB 1ONSA 4JJKA 2PD6A 4R2HA 4MRPA 1S5PA 4KREA 3EZLA 4LMRA 1RTKA 5I01A 3LA8A 4ITRC 1PJCA 3KSAC 1YFLA 3CONA 3QVXA 4K6GA 1A50B 3TDNA 1ISPA 1IG0A 3OIWA 5LQSA 2J3IA 2O0HA 1MTZA 1P7ZA 1AIPA 3FX2A 3DMDA 3QE0A 3R5KA 4LJLA 1SXJD 4RVFA 2OAGA 1I0IA 4RWEA 3SPXA 1P1RA 2K7ZA 3SYTA 2PUBA 4DCJA 5DSZA 4KRFA 2FYTA 4OYYA 3OZBA 2POCA 1J8YF 4D7AA 2R3SA 2VDJA 4MI9A 5AHXA 5D1HA 3DE5X 1YRAA 4PIVA 1A4IA 1T9KA 5KTPA 3BILA 5DTJA 1JPVA 3IVGA 4MUJA 2XE4A 3H8SA 3KZOA 4EITA 4EO7A 2E49A 3TQHA 2H5EA 4RY9A 4D82A 1TM7E 1XZCA 2DHRA 4KQIA 2QIPA 1GFIA 3IEUA 4B6SA 1S2MA 5IF9A 4MB0A 2AS0A 1KI6B 3O4HA 5DBGA 2W6PA 4ID9A 4XTCS 1X92A 1M2VB 4RD2A 4GDFA 1PGOA 2OO3A 2C8VA 2HHLA 2YV4A 1ZHHA 4GOKA 2VP9A 4PFKA 3SI7A 4AZSA 4M6WA 5ALLA 2WP0A 2XMRA 5MFZA 2JAOA 1LTHR 3E9EA 3KLBA 4KPUA 3F5SA 3QUBA 4DQXA 1RBYA 2J5QA 2PV7A 3ELUA 3OQIA 4E3WA 2PBFA 4XGIA 4EGAA 2IS4A 1TQHA 1BD3A 1VI6A 3L4BC 4IDQA 1WUYA 1X1TA 1XVIA 1T1GA 4XUCA 3BG5A 2O06A 3T7DA 4CDGA 4D6XA 2PHZA 2O8DA 1OIVA 1JDJA 2GHRA 4FMCF 2Y0EA 1NJSA 2ZS8A 4FOOA 5EAIA 4PRYA 4BQEA 1UOQA 1IC6A 4AVYA 3WZ2A 1XNRB 2A9FA 4MV3A 1ZAYA 1N2ZA 2FZKA 1DQRA 3SEFA 3TMYA 4LYJA 3GX1A 4IJQA 3WNCA 2J6HA 5HZHA 3EZ7A 2AE2A 3GAZA 2QRUA 1YZFA 3S2EA 3VAZA 4LVNA 3SOZA 1FTGA 4MXDA 2Q9CA 3EPRA 4KEAA 5K4AA 1K1EA 4MCAA 4CLRB 4UUBA 2O2YA 3B3QA 1GL3A 1T8PA 4QPJC 1IH8A 3F5FA 4DLNA 4NZ9A 3DVLA 4D3YA 3OZSA 2IHKA 4LHSA 2P6RA 4P2GA 4GRIA 5A7HA 4GBMA 4K9QA 1GR0A 1B2RA 4GYKA 1QR6A 2YFYA 1TNDA 3E9QA 3G0DA 3NOVA 4ENPA 4YUWA 4Z1OA 4BQOA 4HD8A 5B3LA 3OTOB 1Y4DE 3T7CA 3ZV7A 1KOLA 4RIGA 4CKCB 1ORHA 1RRVA 4MUBA 2G9NA 3AKDA 2A5DA 1OXKB 1R0CA 3OOYA 3U9LA 1E8NA 1E3WA 2JKZA 1AQYA 4B84A 3KKQA 1E62A 3SC3A 5KO2A 1Z0SA 4G89A 3OIYA 1CERA 5LQUA 3QPDA 1NW6A 2AG6A 2FN7A 3HVKA 5E2IA 4UU8A 1MO4A 2J87A 4OMCA 5E0OA 3KB8A 3WHIA 1ML3A 3R3VA 5DM70 2IXGA 3NNDA 4OI4A 5DGIA 1R0BA 1FP4A 3VYTB 4GXTA 3IEIA 1A9TA 4R2XA 4DQUA 4EHKA 3ELWA 3R77A 4R1LA 3BH0A 4O8ZA 1G4AE 1KMNA 2IRWA 2PX2A 2GBPA 1KKLA 1Z15A 3Q7RA 3W8RA 4FC6A 1JHQA 1KK3A 3TIFA 2CEKA 3KU4A 3HU1A 3ICWA 4QZVA 5F7JA 5EEHA 3AUYA 2R7MA 4REQA 3NZEA 3LH5A 2G1KA 3JQ8B 4Y2VA 1Y5MA 2Q5LA 4G85A 3ZCXA 4WZ6A 1QPZA 3IX7A 1SXPA 2IIVA 4RKQA 2I2FA 1ZGGA 4BNNA 3VC7A 3IV7A 3VOTA 5IWAB 1ZIPA 1DQPA 3FZQA 3TZQA 3CQ9A 1RQ2A 1Z34A 4IDHA 4PEVA 3K7EA 1CNMA 1B7GO 1OFHA 3L46A 3PWKA 4BCDA 1PT6A 4DQLA 4BNIA 3ZI7A 2FN3A 4O6VA 3AH8A 1CTQA 4CI9A 2YWGA 1PFKA 3NT2A 3SZ3A 2H9YA 2CK3D 4H16A 3EHEA 2H1FA 1ODSA 3FTQA 1IB6A 4GZLA 3ASZA 4LHXA 4HK4A 1P7YA 3O8QA 5FR1A 3HADA 5D1NA 5DNCA 1TKRA 1X7ZA 4A6EA 2FQ1A 4XFDA 1V4BA 2B61A 3WOVA 4QL3A 3L02A 4C4TA 4IV0A 1FTNA 2FZEA 1OXXK 1MW9X 3Q3CA 4R31A 1AHHA 3CUKA 4R69A 3O31A 4BNZA 2NNWB 3SZMA 3UATA 1DV1A 2IDZA 2XSZD 4Q0MA 1XNGA 3NBFA 4JX8A 4ZQGA 5GV8A 1TVEA 3G0OA 1DUIA 4TL9A 4XWYA 3LY5A 3BWMA 3VNUA 1IM8A 4FLEA 4Q24A 4FOTA 4YI5A 3I34X 5TXGA 1ZGCA 4ER7A 1UC9A 3T4EA 1Y63A 1Q7CA 1R5OA 1NU8A 2H2DA 3H9GA 3E61A 3NRBA 2ZBPA 4PZAA 1FYXA 4TGLA 5LZ7A 5HWSA 3FOBA 1OA1A 3U6BA 2OBBA 1NASA 2Q2QA 1LNZA 4IWYA 2XW6A 4E51A 2XZLA 1PQYA 3DONA 3QW4B 1NF3A 1TU3A 4HZUA 1PLJA 3I53A 5EI5A 1W87A 3DMTA 3OTQA 4GKVA 5EGNA 3WIOA 2R9VA 2I6SA 1XD9A 4JYBA 4TQAA 5C4IA 1KAQA 3W5DA 2QN9A 3ABZA 4CNBA 1AD2A 2ECPA 3G0GA 8ABPA 2FSIA 1KY3A 3I32A 1Z0JA 1K08A 4N5HX 5IEBA 3M6VA 4KQKA 1RM3A 4BWGA 1QS0B 4BNGA 1YS2X 2R68A 4CIWA 2ZBQA 2ZJ5A 4K05A 4G41A 5DTMA 3JYNA 2GM4A 3ITNA 3THWA 1KEPA 3BCHA 5CPBA 5HDBB 3V8NA 3BQ9A 1KS9A 4M86A 5EZYB 2Q3LA 4BMPB 5HMMA 1LD3A 2H06A 4XWTA 2X19A 5KB3A 5DPMA 3UT5B 5EZYF 2JRCA 2QD5A 6AT1A 1IXYA 1BXRA 3CW9A 2HU2A 4HDRB 4NATA 5CB4A 1KDTA 4GI3A 4XVCA 2Y0DA 3QNUA 3OZGA 6ADHA 5TRTA 4PYOA 2IYOA 4UPEA 5HEKA 4BDTA 5B6JA 2MSNA 4I1VA 1W49A 2GQ0A 2NZYA 1FNBA 2G0NA 2JFXA 2PKQP 5D7NA 2OYCA 3IELA 3MJTA 5B64A 4KYVA 1MEOA 2FDCA 1FNSA 1E2LA 1XE3A 1EFHA 2A58A 2REQB 2YUIA 3L41A 4KL8S 4EABA 4LNHA 2OCGA 1AO0A 1WBBA 3FTEA 5KYYA 4GMDA 4IZHA 4IWXA 2NV6A 1R74A 2SCUB 2WM3A 1NTOA 4M55A 4UVGA 3EAFA 3NYWA 3LX6A 1HNXB 1D0VA 3FKJA 2IHJA 2H3EA 2I62A 1YI8A 1RMTA 3N3BC 3P2EA 5D86A 4ZCQA 4A6XA 1SUBA 1AT1A 3UMGA 1JKIA 1NL3A 1XRJA 4W6ZA 1WMFA 2PX3A 5IYZF 4CL2A 1GT91 2IYVA 2OAP1 3NH6A 3LF1A 3SN6A 4GOOD 4DCOA 2VSYA 3K9LA 5K3OA 4X24A 1FS4A 2F9LA 1IY0A 1RCUA 1D7OA 3NTUA 5EMJA 3U7QB 121PA 3DE6X 4HX9A 1Q7GA 2W2VA 3A9SA 5KNBA 2Q6OA 1ZOPA 5CX1B 3AETB 4CR6A 1FSPA 3S7ZA 3JASA 2X6RA 2WSMA 4IM7A 4F3NA 5AW4A 5EUCA 5F5XA 4GX5A 4HV4A 1O8CA 1ETHA 1VP3A 3BIXA 4HYTA 1K0FA 4NP6A 1E7YA 2HSZA 2M6RA 1HEUA 2QJWA 2QZ4A 1EBBA 4NOJA 5CLHA 3VR1A 4TTJA 1SNYA 4UAJA 4V3BA 5HX7A 2GILA 2V4ZA 2DUJA 4JQYA 4QXRA 3T38A 3WBFA 2BH2A 1E61A 2DPGA 2OM2A 1RWQA 2QLNA 3FSEA 5G02A 2EVWX 4GMGA 3CX6A 3GZNA 1YE8A 4FYIA 1JBQA 1S3SA 5JBQA 1E6EA 2V98A 3FHJA 1WPGA 4CIYA 4B3RB 5DTQA 3NPMA 1R0KA 3ULKA 1PZNA 1N92A 4WBNB 1NXOA 1JEQA 2ZT7A 5JNVA 4J1TA 1G20E 2BF7A 1TCAA 3O8CA 3CN9A 4PLGA 3H5LA 1K06A 4P82A 4LDNA 3GHHA 5DHTA 2EWVA 2BUAA 2ZYVX 4NE2A 1MR3F 4V0RA 4FC7A 3K4QA 3TG2A 1R18A 2WE7A 2FU5C 4J1NA 3WK5A 1MJGM 4I5FA 4B17A 1TM2A 1IRXA 2Q45A 2WFMA 3L8HA 4IGKA 2JGKA 3NVKI 3RW9A 2ZM6B 3SR3A 2ZRDA 4HEHA 3FDFA 1P81A 4GNRA 4KDRA 3NHKA 1EGAA 2GJKA 4HLNA 4BMVA 3GUHA 1MJFA 3RSLA 5I5EA 1DRVA 5E4JA 2P6NA 3L84A 4NMWA 4NU6A 3O83A 5HSGA 5H0IA 2QNBA 4IHKA 1YB6A 2HA6A 1EHCA 1MO6A 2UV8A 4B79A 5JFTA 3CKLA 2VUSA 3RIMA 4E5PA 5BPFA 5ECDA 3P2YA 1D3AA 1BROA 3KS9A 5CG2A 3RUAA 1GIAA 2ZUSA 1JFFB 3ZKAA 5LQMA 5ERYA 4WFQA 2GCOA 2G8NA 5FBRB 4O29A 3PFGA 1HLGA 5L3SA 2WWTA 4QM7A 1OGJA 4M7OA 4PGGA 1XTJA 1CRWG 2N1BA 4O4IF 3EXG1 5A4AA 2X8AA 1O94A 3KYCB 4MIEA 2PQ0A 1RWXA 1Q7BA 1P5JA 2YTZA 3CCCA 4P22A 3ZWYA 3HUEA 1ZD5A 4MVJP 3RVBA 1JG3A 1BDMA 3I09A 3R7LA 3C97A 2YN4A 1A8QA 1JKMA 3HDJA 2GSWA 3P9KA 2WAYA 4QBTA 4E1VA 4FP9A 5IH7A 5JSZA 2VDOB 4TV8B 1RYEA 4QTZA 1LRKA 4LSMA 4G1CA 2M6SA 3RVDA 2HMTA 3H4IA 3E4DA 3CB2A 3R9KA 1Z4LA 2H9AA 4NBVA 3RUFA 3PP8A 4GU5A 1NY5A 2GCIA 3OQPA 2YDXA 2BFFB 2KBFA 3CRMA 4OG2A 1PWEA 4EYKA 4CYMA 5JYEA 2WAMA 3LDGA 2QLJA 3HM2A 4AKTA 3T4XA 1O1YA 2SICE 2F62A 3CNHA 2B1RA 5U4XA 4D1YA 3CG0A 2AI3A 4OQ4A 1MDBA 4M9CA 3CLHA 1IXRC 2JGMA 3VJMA 5HNKA 1YIDA 2G4LA 5T8KA 1W2WB 3I12A 5I7AA 3DEHA 5JFGA 3HG7A 1TQ6A 2WILA 1JX6A 1VYHA 4KQWA 2QNRA 1XZ8A 3IURA 3FKSD 1HDIA 3MK31 4PICA 1MO2A 4PBRA 3CSUA 4B31A 2O3UA 2PZGA 4JSYA 1XD2B 3HDTA 3VAYA 1R0SA 3MT7A 4M7RA 3LKDA 4B6QA 3GLGB 1FP7A 1X9GA 2W98A 3FSGA 2HWUA 4Y7DA 2H1OA 1KJIA 3C4JA 5A5DA 3AR6A 1ZNXA 4P93A 1B76A 4AM8A 3I5AA 1AQIA 2XMGA 1L7OA 2FMHA 2IGBA 3LTEA 3B1JA 5G0VA 4L2IA 5G0SA 4TYYA 4ND5A 2EG5A 2O2IA 4RZHA 2ACWA 3RYFA 1Y34E 4Z0NA 1ZD2P 4ND8B 5E6RA 1FFXB 1GUDA 5JAOA 1MAVA 3NOQA 3F7TA 3Q98A 3KD3A 4DUYB 3WSVA 4Z4QA 1Y3DE 2PN1A 1IM2A 2WJ3A 3IP1A 4KMSA 3O95A 1YOVA 4J7CA 1SCNE 2ODAA 1YF3A 2C82A 1WW2A 3HABA 3OC6A 3GJYA 1KA9H 4HWKA 4XE5A 2WU4A 3T1YB 1M5UA 2BHNA 1V1MB 3TBKA 3E9YA 3NEYA 3PEFA 3UENA 5AJVB 2YINC 3TRDA 4RQAA 2FLWA 2W9XA 1KYIA 4FFDA 2MJLA 5HDQA 1U3VA 2CBXA 2HNBA 1SKBA 2WPDD 3EC1A 3WL5A 5F7OA 1LW6E 1W8IA 1UQTA 5HXAA 1UPAA 3TD9A 1ADCA 2LD4A 2QN2A 3P9ZA 1J1IA 5DLYA 5H02A 2FPIA 5DVZA 3D54D 3NDBB 3CO0S 4WNAB 4PXSA 3PKIA 2H2IA 2CLIB 2F48A 3F6YA 4K1XA 5IVDA 5E1OA 5JCXA 2DBRA 3C98A 4MPJA 1G7TA 1S2IA 3MBIA 4I8IA 3W7AA 2HF2A 4TV9B 1NQOA 4A82A 1M2NA 1IZYA 1SGWA 3G59A 3LWDA 4IDOA 5B58T 2CJYA 2J85A 1NJ2A 3OLQA 1WU7A 3DFMA 4B4OA 2QGFA 4YQYA 2XUOA 1XOIA 4MGHA 4RTSA 1KH2A 2QJTA 2VWHA 2GHQA 1HTTA 4Y2QA 5UKDA 4YRIA 1Z7WA 3AP1A 5TIIA 1SZDA 4Q7KA 1SD1A 1GDDA 5ARBA 3NFRA 3LHIA 3VPXA 2EAUA 2C2BA 3MOIA 1V5GA 4FONA 4HFJA 3SVTA 2X0JA 1BRMA 4WZBB 1WSAA 3CEJA 4MR9A 1GGVA 3BD7A 4KWIA 5INTA 1T0PA 5ITZA 1BMDA 1T15A 4OQPA 2PBLA 3ZI4A 1K4YA 4D9KA 1ZY2A 2AF3C 2IF0A 4YRFA 3I1JA 4R8RA 4DRXA 4DA9A 4FLFA 5DNDA 5JXGA 3GRYA 2ZKIA 5J5CA 2H7CA 4I50A 3ZVMA 2XMPA 1XHEA 4RLFA 5F5LA 2V5VA 1PJSA 4XQ9A 2V6BA 4H3SA 5F2NA 3SC2A 3AB7A 3K94A 1Z6QA 2H51A 4PY2A 4LFAB 4FFRA 1MO5A 3O1JC 3B6MA 1HQCA 2FGJA 5KTSA 2JGDB 4M0EA 3QMWA 1EJBA 621PA 1W9MA 1M8FA 1TFRA 3PC7A 1R4AA 1U0NA 2IDMA 1NURA 1PFVA 2A78A 2Q41A 2QPLA 3QK7A 4MYHA 4XCVA 5FA6A 1EWQA 4CZ2A 2PSHA 3NBUA 2V8BA 4AMBA 2QN8A 2OZLA 1T9DA 1EVKA 1W5AA 4X1KB 5GAJA 3QZUA 1GUFA 1ZH4A 5LU8A 2EARA 2GN1A 4B3IA 1KS2A 1P72A 1PU2A 1IQPA 3O5AA 4UHHA 1OBOA 2HGZA 3INNA 4LNAA 3KALA 1YI1A 1XZQA 2R87A 2REXB 3OEWA 2C31A 2NO5A 3GJRA 3U19A 4RAOA 1E8MA 1H8HA 3HKCA 1VC2A 4MKFA 5EUQB 1CIVA 4US2R 5J2TB 4NY1A 2HSDA 1QOQB 1OHHD 4U2DA 3KSBC 5JJIA 3ND7A 2YZ2A 3IT2A 4OHMA 3VR4H 3ZCPA 2IU6A 1QG2A 4LHEA 3TRKA 4I9UA 3V4RA 3FZEA 1SUAA 2IUSA 2ZRGA 4QYMA 1RPNA 4UBMA 4A16A 4EFLA 3E1SA 5ALOA 2EBWA 4HO1X 1I32A 4OCZA 1XDWA 2BCEA 2XD9A 4J3FA 2ZJFA 3V46A 4DWWA 2FW0A 4OHRA 3U0VA 1HQDA 5IABA 3LUFA 2IDJA 2XTMA 1DXHA 3UJAA 4F0JA 1QZUA 1UKCA 4GGOA 1GGMA 4MRNA 3MCAA 4AO8A 1PR3A 1DRWA 4TLLB 5FOSA 1IHDA 1XRRA 4O4HF 1M0TA 5C8YA 1Q74A 3RFFA 5CDSA 1SXQA 3EBOA 3BJIC 2JAPA 3INRA 3W4JA 3WK8A 3FXAA 2QENA 4BRZA 3BE5A 2UZ1A 1GQYA 4TMZA 5JI2E 4KXUA 3N86A 5HOEA 3HCFA 4OHOA 5KPDA 1Y9DA 3JSXA 4FFWA 4J3NA 5I8WA 1S1MA 1PFWA 1XZJA 2EDCA 2O7RA 2R8ZA 4ND8A 4P4TA 4QU0A 1G3IA 3MTEA 2FDRA 2XYRA 2OORC 1UWVA 3CA8A 4PF1A 5HJEA 5IN4A 4CKXA 3DFFA 4ZI2A 1SHZA 2GFIA 3AESA 5CHYA 4G09A 2JJYA 1KYZA 1H1DA 1QGUA 2ZFUA 2C8JA 4INZA 1XZNA 4AY4A 2J7PD 2OLEA 4ZVPA 6Q21A 2EC5A 5EIXA 2A0WA 3EDCA 3OCVA 1R64A 1BFKA 3ANLA 3COVA 3AUJB 3EWIA 4ES6A 6ABPA 4KFCA 1QAQA 1U6KA 3EAQA 4RZQA 2J6BA 4LI3X 4U6SA 2M6LA 3CZRA 2OQ2A 2WABA 3WQQA 3AHDA 5H83A 1J07A 1DJPA 5AXCA 4X65B 2AC4A 5JVDB 1IBMB 2C3PA 1OFIA 1QHYA 3PCTA 4R41A 4WK2B 2XWPA 3AR4A 1UPCA 4GFDA 5CIWA 2ONZA 3WB9A 1OI2A 2PA0A 3OZWA 5IWCA 5FL7A 3C3JA 3PPWA 1JFLA 2IY7A 1PWZA 2EGHA 4R8MA 1P0PA 4U1RA 3RREA 4PTLA 3MJDA 3I9NA 2BGLA 4PO3X 4G9GA 4TRJA 4YAKA 2B92A 1G5PA 4Q7JB 4B47A 4JL5A 3UGTA 3TGLA 1YV9A 4L7QA 3FWKA 4JBWA 1H9BA 4CF7A 3RWBA 4RJTA 1L3CA 2BM8A 1ZH6A 4AUNA 1HG1A 3OLZA 1YL5A 3Q3VA 2G1AA 4AX8A 2HA3A 4J1SA 4YJGB 3FPEA 2DFVA 1HFJA 3B7PA 3GWGA 3Q72A 2NU8A 4JI8B 2ET6A 2V7QA 3X1KA 5BWOA 3WV5A 1AXGA 1PEDA 4TROA 2LWIA 5L3ZA 4B8WA 4GT1A 1CJMA 5D01A 1UMCA 1VCIA 3M1IA 2O5EA 2FHSA 1U9IA 3N53A 1AY0A 2GK3A 2R6GA 2RMKA 4HEA1 4KLAA 4TTIA 3QUTA 3VOBA 2CKMA 4JUFA 1CZUA 1SC3A 2ZPUA 1BVRA 2ZIFA 3AZQA 2OKCA 4TLDA 3DDZX 3JD3A 1H5NA 1NV8A 1ZIXA 2VOJA 2XJ9A 2ZROA 2ZYIA 1MMFB 4HGQA 4G9BA 4W5HA 4H2DA 1NQTA 1W46A 3BZUA 1SB8A 1WCYA 3S55A 2QRHA 3C6XA 3KKOA 1H5UA 1ZD3A 2CVHA 5BN5A 3TQSA 1HZJA 1DX9A 3CFYA 3IUSA 3ZLVA 2GVNA 5A1JA 1DQZA 1KY2A 1ZM4A 1LLCA 3UMJA 3BQMB 4DLPA 4J1TC 1MB4A 2I03A 2VDQB 2C78A 1P5HA 2P9HA 1G8GA 2I99A 3OKCA 2FPGB 4LXYA 1S0UA 4A73A 4D8WA 2PSEA 3C1UA 1N6IA 3OFNA 1TVKA 2B3TA 4NCXA 3TPCA 5D5QA 1WTCA 2YWDA 5JCJA 4LPSA 2EKBA 4WVFA 4AXBA 4MKHA 4ZANA 4MUYA 3OZIA 4PE5B 4Q1AA 4B8ZA 4AX4A 3L3BA 4RL4A 5EHQA 2AOUA 4OUDB 4HEJA 3TLZA 1MZPA 5DN9A 3CZQA 2GBLC 2HF9A 3K6JA 2RGUA 3OMXA 4DMHA 2NVUB 3AOEC 4WCFB 2N42A 2X4LA 4BBAA 5JEDA 2P90A 1EE9A 1J25A 4HDNB 4J91A 2RH8A 4WXMA 4TMFA 1GN8A 3HCEA 3H0KA 4V3CA 1FXWF 1SVMA 5JASA 3OQOA 1O6BA 5LQJA 3IE0A 2CXHA 4JBLA 3ONVA 1SHUX 2C04A 5FPPA 1IUOA 4LJ7A 1IEXA 2C7BA 1CP3A 2HCRA 5A4IS 1KC1A 1AMNA 2BSXA 3E58A 5AJWA 4EW2A 4WOCA 2WSSA 3C0KA 3FMIA 3LY8A 4G8JA 4M1WA 1FU7A 5JJKA 1VKRA 5IJAA 5G0UA 3I0ZA 5BQ3A 1ZVJA 1WKVA 1JR3D 1BJRE 3FNFA 4JOQA 4BMCA 3VZPA 2BFAA 2C0PA 3AK4A 3NYQA 2E6KA 2A1IA 4G07A 2IE0A 2V1XA 4ZA2A 3BCSA 1PYDA 1NNUA 1YK0A 5L9AA 3OEHA 1FW8A 1JT9A 2PS1A 4YRCA 2YQZA 2ABWA 1A2KC 1XRQA 5F2EA 1A5ZA 1XVUA 2BLNA 3D1JA 3G1UA 4Y0NA 5FFFA 3U4GA 4Q3OA 2HCTA 2YQ4A 4EY4A 3O4FA 4DG9A 1W1IA 4WI1A 1IBKB 4K9MA 1NXSA 5FPHA 4AG6A 2O2ZA 3ZY4A 4M3NA 4ENUA 1MA3A 3NFYA 1ILWA 4CMAA 4Q9AA 1L5HA 2C1XA 2XF8A 1UADA 1E96A 1GR1A 4JEMA 4KE6A 4YMWA 3RU9A 3VAAA 5ER6A 3SXPA 1ZISA 5JRDS 1M7BA 1V35A 3ASUA 4R16A 5HJ7A 1L5GB 5L4SA 1T9ZA 5KU1A 1TCBA 1A9ZA 1DJNA 5U1PA 3UC5A 3W1VA 3UBTA 1PG0A 2GS9A 1YCDA 3G9ZA 3I01M 4L5IA 4V0ME 4FE3A 2I29A 2C5HA 3I83A 4H35A 4RHUA 5CB4B 4BVJA 1NF8A 4FXOA 3PNYA 3A6EA 4RTQA 4Y2JA 3L0PA 3E1KA 1ZVKA 2F4NA 4UUOA 2DZDA 1X3LA 2YWCA 5D85A 4EG5A 1ECFA 1B73A 4GRAA 4MJ7A 1ZZGA 1B1AA 3DLIA 2CF5A 1GA4A 3H5NA 4WXEA 3N05A 5G0TA 3U81A 4N3NA 3N8HA 3DZHA 5JPIA 1U3GA 4QJ3A 5JDIC 4GM1A 2HREA 3OZ7A 4EK9A 1CF9A 1V95A 3O8OA 4DMFA 4HFMA 1RHUA 5CVDA 3UJPA 3ZNOA 1DAHA 4JUDX 2XUPA 3MERA 5AKIA 3THOA 3S0JA 1YTLA 3RABA 2P5TB 3PDIB 4K6OA 4CRWB 2HWXA 1F0PA 1XTVA 5CPFA 3LGAA 3FTDA 4KSCA 5T4EA 1BWRA 4PLHA 3TZBA 3VUEA 4RNCA 3AVUA 2O8DB 1Z63A 4XRRA 3LQQA 1U04A 4W8HA 1CZKA 5G1NA 4LC1A 2XGSA 4B1FA 4KQ9A 3IAUA 4H4EA 4I19A 4JWTA 3J81A 1RIFA 2DT8A 3DVAA 2YC4C 4YIKA 4ZOEA 2LKDA 4X3OA 2A9PA 3RTCA 5HTKA 1N3BA 2QS9A 1ZXBA 5CDUA 2IYZA 5FUVA 1USWA 4XB6B 4BNLA 2VCHA 4QPZA 1Y7TA 2Y1FA 5LR6A 3EC2A 1R50A 3D7KA 2XWJI 4G5GA 4QFDA 1NBIA 1EVEA 1G8HA 3FCYA 4HX2A 4BFZA 4BNJA 4I9HA 3NS7A 2ECFA 2XV1A 3N75A 2VTBB 3PJDA 3LP6A 1CY4A 1GPNA 3INTA 4P34A 1DKQA 2PZEA 2VHJA 5ITWA 3R9XB 1MX9A 1D8TA 4TT3A 4EHHA 3HLYA 3VU8A 5KTYA 5JTUA 2QJRA 3CUEF 1V4NA 2NO9A 3IPYA 1E3WB 2FFJA 2ZYWX 3LQRA 3T06B 1RT9A 2R1VA 2HV8A 4KH0A 1DJQA 4JJ6A 3TFQA 5F78A 4LTNA 4E2ZA 3A4TA 3COZA 4R5MA 5AKYA 4CETA 1MO3A 2XDAA 3FN4A 1C7RA 2FK7A 3F67A 3PPVA 3CEPB 4IIJF 5BSWA 4O2AB 5K03A 3PUHA 3VQTA 2DU8A 4WA7A 5ITSA 3ZGZA 1E20A 1UT5A 3B1VA 5CCEA 3T15A 4RY2A 1T4GA 2WHEA 2DULA 3DQZA 4C4SA 1KPIA 2IZOA 3IALA 4HXFB 5EJ6A 1TEZA 5CLQA 3CNOA 3R3YA 3C3EA 4C2BA 1UH5A 4AJ4A 4WE3A 4QX6A 4GOJA 2FXVA 5D6OA 1D4AA 4YRJA 1RYDA 4BE7B 5KOYA 3QM1A 4G0WA 3LLMA 1S3IA 1ABEA 3C7AA 4FIZA 2HO5A 2CL0X 4Y6OA 4D3SA 1PI3A 1QBKC 5JBNA 5AQ1A 3AF0A 4LWOA 4XLZA 1N3LA 3A9RA 4YLEA 3U1TA 3KJQA 3UWDA 4CL0A 1HDOA 4IH1A 3ER8A 3AUAA 3LQ2A 2NNLD 4C0BA 4N3CA 1IHUA 5E7QA 3KV1A 3C5EA 3KQMA 3D5QA 4ALJA 4CFZA 3NHUA 2O52A 2IU0A 1SU7A 2W48A 1LDGA 1L6IA 4Q4CA 3UHJA 3F2VA 3KPUA 3T61A 2YBDA 1E4YA 5BVGB 3STXA 4CW7A 1FFGA 1PR4A 4BVBA 2QTMA 1AQJA 4CHGA 2G36A 3AFIA 4I3HA 4E2WA 4YUVA 5IXYA 5K45A 2BZGA 1FCJA 1OPRA 1FFDA 1GSHA 1XMPA 3VR2D 5EJ7A 3KK0A 2F9MA 2QN6A 5BRNA 1CR6A 4Z53A 2JA1A 2I6FA 4LFBB 1NN1A 2HXGA 3MGGA 5AVTA 3SJAA 2YFHA 5JOQA 2O20A 3TUZC 2F55A 1K68A 3OJFA 5IT0A 2XVXA 2YV2A 4GI1A 4HMQA 3AKCA 4PYIA 3C8MA 1XVTA 3PJFA 2G04A 5HGJA 4Q19A 2PX4A 4C7MA 3GN2A 4EG6A 2I6TA 3GLIB 2NSDA 4KR6A 1AKWA 4N5NA 2W43A 5F2KA 2I7XA 1L5ZA 1CUEA 1MEEA 2B8JA 3BD6A 4GQAA 4WEOA 4LOJA 2H4HA 4Z0HO 3WI7A 1ZLYA 1I51A 1KFKB 1E99A 3OCCA 3R40A 4K6CA 1SKUA 3OM0A 3Q11A 3S5JA 3AEKB 4LZNA 1FIUA 5T7BA 4EFDA 5CVTA 3IXLA 1WQ1R 1MV8A 1N7JA 1S3GA 2DERA 3AUFA 1N1MA 4BFVA 2ZTSA 4B3HA 4C6TA 5FR2A 5BR8B 1N6LA 3RADC 2WF8A 1XFDA 3MXOA 1T5HX 3IIEA 3D5EA 4PANA 4G5HA 2QAGA 3NTOA 1Z4IA 3LNCA 3EW7A 4RESA 4XQ0A 5BV0A 3U7GA 3VO2A 4ACAA 1N75A 4XJXA 1WABA 3JTEA 3TQIA 4DG5A 5C8DA 2HW8A 2C29D 1HYHA 2GZSA 4P35A 4P3KA 4XVRA 4WY5A 3VH3A 1A8PA 1K3TA 1JG2A 1KK2A 2C42A 3FUVA 4Q1FA 1W7AA 4AWBA 4MP3A 3ILVA 3JCZA 2A5JA 4IILA 4RE5A 4RZ2A 3TOSA 5AW8A 1FDRA 1E77A 1SXJC 4KWCA 4FR2A 3D43A 4R01A 2PM8A 1DKRA 1JWBB 4AT1A 4O25A 2XCIA 3PC4A 1XXHE 3QLUA 4G4JA 4QUJA 2Q21A 4JP5A 4PZ9A 4AZ3B 3RVPA 3TQCA 1YKFA 3EWSA 4DXHA 1OU0A 3G89A 2HRRA 4O2BB 1C1DA 4HH0A 1VDZA 4BJ6A 1O95D 3NETA 2NTNA 1KAEA 2JEZA 2Y2VA 4N0PA 3W2FA 3AHJA 1P1KA 5C4MA 1K92A 3IHWA 4IUDS 4NBTA 3K71B 4GWKA 5B1IA 3LZCA 4ZDIA 1A1VA 2QW1A 4PQYA 3GXBA 2C5AA 2QVXX 3D6UA 3DHEA 1NE7A 4KU4A 3YASA 3ZXSA 5HJ2A 1N9ZA 3GW8A 1DWOA 3DNPA 3AVXA 3OZEA 4QSMA 3RVQA 4D9MA 2R6DA 3AUTA 4UM5A 3OQ6A 2WKSA 1RJDA 1WSDA 2J9RA 1R6BX 4RJLA 2DY1A 2P3LA 3CJRA 4U00A 3TTTA 2AJLI 2ZIWB 3A7DA 3WGJA 1LK7A 3WC4A 2CL5A 3G0BA 3WYAA 3UAOA 1N34B 4CUJA 1RWKA 1TEHA 3R0JA 2WYOA 1SBNE 1KK0A 2ZB4A 2V59A 3DDWA 1VYTA 5CVVA 4QVKA 1YQGA 1NN0A 2E7ZA 2P9ZA 2CB9A 5DASA 3RIHA 3TNFA 2BEWB 3ZDCA 1HO3A 4B7XA 4EQZA 2N9UA 4HATA 5FI5A 5KQPA 4B34A 2VOEA 1J1ZA 2ZCVA 3K0CC 2FEAA 2D2EA 1TUIA 3F96A 3JR7A 3RIGA 4MR9B 1SK9A 2Q5OA 2WICA 1TMGE 4RXMA 3A6PC 1LQ2A 2XR1A 3MIZA 3ABOB 1R6UA 4CMEA 4D4LA 1SA0A 5BW4A 1JV2B 5B2ZA 4MR8A 1E0KA 2QVCA 2XIQA 1YDWA 3BRWA 3EA4A 4KW7A 1RI4A 5EWLA 3RVJA 5F98A 2OZVA 5ECWA 4ZT6A 4DTCA 2Z6AA 3OM1A 2DQZA 4MW7A 4P0TA 2BGMA 2X2EA 2XYGA 4HDSB 4W5TA 2A0KA 1EDBA 5KJ6A 4RU1A 4TWZA 2HTEA 2RFLA 1JEQB 4GP9A 4C7KA 4MV7A 4F5YA 2ZIGA 1A2BA 3KXDA 4M1SA 2RJNA 2W90A 3LRXA 4P08A 2FUCA 1B4DA 1U2EA 3AB3A 2REOA 4ICIA 1GZ5A 1H6AA 5DBFA 1TAUA 1NVDA 3UWSA 4GM0A 4LEIA 1EMDA 1W6RA 3UMYA 3EXFB 3WVNA 4ZYXA 1JDNA 4UCQA 2Y1LA 2DKOA 1G7RA 1G8JA 1S8NA 1YJCA 2HBZA 3H6KA 3L6CA 1J00A 3ZQ6A 4NZZA 4C3OB 3WDSA 1IZ7A 3B89A 4DOMA 1I1OA 2VH2A 4IJ5A 2OXFA 2PS3A 2Y77A 1EX9A 1SBYA 1SOMA 3FF1A 3FMGA 1L1EA 1AUXA 1E9AA 3F46A 4LJ8A 5DB4A 2D0PB 3MILA 3TQRA 3OWXA 3WJ2A 1B6SA 1DUSA 5GIOE 2CE7A 3CX7A 1QQ7A 1WSWA 1SZCA 1XCMA 1NBME 4JQOA 5DW0A 5MDHA 1QB7A 2EJTA 5J2UF 4X62B 2BEUB 1XKXA 3IQIX 1WXEA 3H1BA 4RD6A 3RF7A 3S7TA 3VR4D 3LLSA 3I73A 1UXKA 4YMLA 1PR6A 1JE0A 1J5XA 3L8GA 4ME6A 1QVWA 3X1DA 3KLOA 3ZCQA 2XLBA 3M6IA 1I2AA 4H4DA 3F7NA 4L73A 2X4IA 2HRBA 2O2JA 3CVOA 3LY7A 3A9UA 3DFUA 2OGTA 4Q5IA 4BYGA 5HP4A 3GVIA 3M9LA 4HYYA 1FZTA 4F5EA 3BEDA 4JI4B 3LWNA 2HY7A 4XEUA 4MVJI 2JLQA 1B0AA 4GMXA 2Y92A 3J7AC 1CRPA 4ZU6X 2ZS9A 5JXWA 3H7AA 3ZE8A 4LF7B 1PVOA 1G1MA 3WKBA 1OVMA 3S29A 1MORA 1SCKA 4FNAA 3DGFC 1ZRMA 3NAMA 1GXSB 2VJOA 4GSYA 2NWQA 3DV0A 4ZQFA 1U8UA 5I3CA 5JXHA 2XCLA 4AY5A 5C34B 4Z9FA 1XMSA 2EJUA 3UAXA 5L6LB 3VKGA 2I5PO 5EEGA 4KPUB 2GZAA 1I4TD 3TQFA 4RF5A 3NHYA 2AC7A 4OXKA 2O14A 4PLYA 2ICAA 2PAFA 3Q9LA 4NEHB 4CMKA 4PAOA 5LPNA 1GG2A 1K9SA 1XN4A 1NW3A 1Z2OX 3F98A 4GS5A 1OROA 5FLYA 4HFRA 4BKUA 1NXVA 5L51A 1VCMA 1G0NA 1GGEA 3QOWA 5K3FA 3HJHA 4AO7A 1B8UA 1JGTA 2BKUA 1CW2B 1SUFA 3BRCA 3WK6A 5CFNA 8ATCA 1K88A 4E3ZA 4PRKA 1KJZA 2PAAA 3O3MB 3ILYA 1OBVA 3IDOA 3S81A 1KORA 3DCNA 3GDHA 5B58C 5LDHA 3Q1KA 1PQUA 2WG1A 1CVRA 1NF9A 2O4UX 4FWBA 4RSMA 3FCCA 2QBYA 4TLBA 2QT9A 3UA4A 3IQHX 1N6KA 3E15A 5EJ2A 3RFUA 5F3WB 1XCJA 3DV2A 2VQSA 4FQ8A 1KTIA 4RTLA 1MFZA 5YASA 1PR9A 4FX2A 1DQSA 1EQ2A 1NN3A 3KQHA 3C45A 3CO5A 3C6MA 4ZQEA 2V0CA 2PCLA 4ALNA 1PGPA 1DIOB 3SSNA 3DA8A 3NDRA 3DOOA 1TCVA 1K5HA 4G0PA 3RV4A 1NXXA 4DVGA 4B3DA 4CNQA 3BXZA 3HN2A 4Q4DA 5ED4A 1BU5A 1Q91A 3OE4A 1OXMA 3VGJA 3SS7X 2F1HA 4C4YA 3DOJA 2PSFA 4JHLA 1P17A 1HE5A 5HK8A 3C3WA 4JYZA 2FF5A 4GE3A 5KTTA 1QIHA 4KN9S 2V9PA 4C22A 2OBLA 1USVA 1CDEA 3ZCTA 2CDCA 1XHFA 3TQQA 1LRJA 2PMWB 1V1JA 5KYWB 3AMVA 2QLMA 3WLLA 1SEVA 1J9GA 2M9MA 2DUNA 5FUWA 2EBFX 2OP0A 4IVNA 4EHFA 4EPWA 3OG9A 4EM6A 3P9CA 1U8CB 3IT1A 4KHPB 4GZMA 2GD2A 1FXSA 1QNLA 2E5WA 2IYWA 2JH9A 2QN7A 2XE6A 3M9WA 4TKVB 2XUIA 2P6OA 2ZUWA 1R27A 2IELA 4TXMA 5IHXA 5CNKA 1Z28A 3G9UA 2QUAA 2QX7A 3W6ZA 4F46A 2P2ZA 2RONA 3GFRA 2P4QA 1F48A 2P2YA 1OBHA 4F2WA 2MSLA 5JMTA 1T6NA 3OPNA 4C76A 1EK6A 2YJ4A 3IL2A 4MPRA 2R0QC 3LHFA 2NXWA 4YXWA 4OFWA 3KUCA 4YMSA 1NUSA 3F7OA 3FMPB 1W88A 2C61A 5K4HA 4G37A 3TLGA 2RB4A 4A27A 2P6MA 5KBYA 2RCNA 4DKJA 5EP2A 4RHXA 1WB6A 4YCJA 5E3IA 4LC0A 2QZZA 2ZSEA 1WX1A 1XDZA 3N0VA 4NYMQ 1JB1A 1YXMA 2Y66A 4XARA 2PMEA 3L4SO 1IOVA 1EX1A 4DE5A 1IK4A 3O26A 5AVKA 3PX2A 2V6GA 5GINE 2FPLA 3DPSA 1UPXA 1OPXA 1CRQA 1E2IA 1WXDA 2B5VA 4GR4A 2RAFA 1VQ1A 3QPWA 4QXAA 2R8RA 3H5VA 4PIMA 3EMDA 2WWFA 3DEJA 1ZU5A 3FJYA 4L8VA 4UM8B 5EKXA 1VMAA 1KHHA 4C05A 1ZCAA 1AE1A 3AR8A 4BQRA 3VR3A 4LVOA 5T5QA 3HR4A 4GYWA 1KFJB 2AQKA 1EZ4A 4UM9D 2HPZA 2I4NA 4W9RA 4XLLA 3GLFA 3ZH9B 5A3JA 2QRMA 5HBGA 3I5XA 1IOLA 1MIOA 3DMYA 2XKKA 3D8SA 4AYXA 2F90A 3WZLA 3W79A 3A0UA 2BEUA 3E48A 4RPJA 1GG8A 1JYSA 5C3UA 1GGNA 1VSBA 4JQSA 3CKKA 4LKOA 1QYIA 2I22A 3ZHTA 4KSYA 1YZTA 2ZZNA 3IV9A 3D81A 2VJBA 1WV0A 1VYUA 1NGSA 4EARA 4KIGA 1K27A 1JDSA 1M10A 1PN3A 4IEFB 4TVBA 4D8XA 1AK9A 1MT0A 1A95A 1C9KA 2G09A 5FJIA 1VMEA 3IYLW 1DBIA 2BGNA 2FW6A 3GJQA 4DZZA 3OKFA 4OXYA 4MMXB 4RFVA 3SYMA 1Y6ZA 4B7ZA 3OC0A 2VHWA 4JOSA 4QHSA 1SN7A 4MV6A 1NUQA 3VSBA 4QYWA 1M2KA 3CWCA 4N6GA 5B3KA 1J2YA 4PX2A 5KWSA 2AG1A 1CZLA 1KZ4A 1Z0ZA 2KYRA 4EY6A 1X15A 2EP8A 1DHTA 1QE3A 2ZXFA 4L8GA 3G5MA 4FXPA 1I13A 5TSDA 3H2YA 2F3UA 1WW3A 4NENB 4AFNA 5A7GA 3OZXA 4LS3A 5EQFA 2D1TA 2I8CA 3TTUA 3IMEA 3MJ4A 1QS0A 3IEXA 3MMSA 2NTEA 3QJGA 1Q1BA 3BMOA 1AS3A 2FFHA 3DTNA 1SQ0A 2ARKA 2H07A 1EEHA 2H6EA 4NAVA 1W36C 1BDJA 2LRHA 3CW2A 2VLBA 3FVTA 1G64A 4NK5A 3M5DA 4BASA 5BVHA 5JSFA 5KQLA 4K8OA 1E3TA 2P65A 3EIOA 2XT9A 2GFHA 2R1ZA 3PC3A 4C30A 5F9FA 2W6QA 1HURA 2BL4A 3FNHA 2C4KA 2BBSA 4CKYA 3E84A 5J4HA 1QQTA 2ZYAA 5E3JA 2X77A 4YQFA 3HCRA 3JATB 1R4MA 1GAXA 3F6BX 3ILHA 2ZE5A 2BYTA 1E2GA 3MAAC 4DMRA 4IVQA 2X1LA 4DJFC 3ZTWA 3GYBA 5DHQA 5I9IA 4YAWA 1F5NA 4JJ7A 1A5TA 1KKUA 1PG2A 2B69A 3D3QA 3GC6A 1GQRA 1EX6A 1U8TA 3DFKA 1R4NB 2Q3JA 1HYEA 3H04A 1J2TA 4HGOA 4NXMB 3QOFA 1ULAA 3UUWA 3K3PA 2XADA 4RF2A 3LRTA 3CX8A 1JQLB 1TUBA 2VHCA 3T3PB 2RI1A 4B9AA 3NWEA 1R37A 1E9DA 1W47A 3IXQA 1SIOA 3OT4A 4KIWA 1RJ9B 1X1RA 2CUNA 2JIQA 2C7OA 1Q0UA 2JAXA 2NW6A 4ZZ3A 1ONPA 1Q0SA 5FADA 1GLNA 3K9HA 2VPYA 4R1TA 2OBFA 5F21A 2GPNA 5JYCA 3HXMA 2D0DA 2EL9A 1WHTA 4E22A 3NBZC 5JS6A 4NS1A 2C7VA 2PFSA 1XMOB 2NTVA 1HMPA 2IQIA 2OHXA 3I2HA 1CYDA 1GPH1 4G4SP 1AUOA 3H87A 1PBTA 3NAQA 2ZRAA 1J0BA 5GONB 2HPAA 3AFGA 4G0NA 2QQ5A 4CKZA 1DZ3A 3A4YA 3NV7A 3Q2IA 4RTMA 2GXQA 1Z2PX 3AR7A 4NJOA 3PXEA 5LMUB 1R8YA 2BISA 2ZE8A 4LOKA 1D2CA 5C5IA 2HUNA 2IYAA 1G42A 1OFGA 3IQFA 3LKVA 2VTEA 2DTXA 3WP0A 1SUPA 2B1GA 2QN3A 1QX3A 4NLLA 1E18A 1V3QE 4PGFA 2XKBA 2A57A 1ZRNA 2J4FA 3FDJA 3MGAA 4OYLA 4E5YA 1Q21A 1H0KA 1H93A 4UOEA 1VIVA 4D3XA 1GZ6A 1EVQA 3RAPR 1ZNYA 1XCBA 1UJ4A 4GI5A 5LQDA 2YMQA 3BA1A 4GVXA 5AUNB 1C9JA 2AZTA 10MHA 2GA8A 5LYJA 4PHFA 2JFVA 3DYBA 2I1WA 3D6MA 3F49S 3ESAA 3GJSA 3MFQA 1YZLA 4XGQA 4BBJA 1Z2DA 1KZ7B 3IQZA 3W5JA 3BKWA 4CTNA 5FUYA 2V7EA 3P20A 4Q12A 5BOSB 5IXSA 2FUKA 2BM1A 1RRGA 3A32A 3MGCA 4JU9A 3V8MA 1VMIA 4BFCA 4OHBA 3T94A 2UXBB 2IXBA 4O33A 1JKXA 1M6VB 3MQ4A 4BO1A 4RMGA 3UK0A 1MRZA 2QORA 3B1ZA 1S2LA 3QU4A 3BRWD 4Y6QA 1GTZA 4DYHA 5FFMA 3GLRA 3U3KA 5JY6A 1UZAA 1H0HA 2WHYA 1BH2A 3GRCA 4AMZA 1HH4A 1IYZA 3ZDFA 4H1VA 5EMLA 3O94A 3FNBA 4GWLA 4P83A 5AXDA 3S2UA 4LYGA 3K6SA 2OXTA 3OSZA 2Q6KA 4FCCA 1CDOA 3IUQA 3K96A 4X8LA 2V97A 1YUNA 2CC2A 5FLEX 3R9IA 3NHBA 3UHFA 3HPQA 1EU1A 2Q7OE 4CM7A 3AR5A 8AT1A 1NONA 3WWDA 3PKZA 1Y7PA 2I7TA 1PIWA 3HUFA 5D84A 2OT3B 1UODA 1G16A 1X77A 2JJ8A 2P77A 2Q50A 3Q0IA 5CT9A 5AW1A 1RBMA 4HNUA 1ULZA 3EYAA 1GD1O 1ZONA 4DPKA 2I76A 2P11A 1UWCA 3N7AA 4N5DA 5KUTA 5HOQA 5L3SB 1RZ3A 2I0FA 1AKEA 3E53A 3BXPA 4B09A 5LMZA 1AN0A 2W2LA 1PFGA 1ZNWA 1SUEA 1U0HC 3AHGA 1W5BA 2C20A 2VHTA 5DP2A 3A0RB 1FSZA 2PQ2A 3DFZA 4JA2A 2JD2A 4EB6B 2C88A 1CD5A 3HR7A 4UBOA 5IP5A 5ALPA 4G23A 5JG7A 3ZG6A 5KJ1A 4HAIA 5AP9A 3CNQS 3OLVA 4PO1A 1VHLA 3TOCA 4D3DA 3LQFA 5H3CA 4NICA 5JO0A 1GSIA 3FR8A 1V3UA 5IJ9A 3K0HA 4IMJB 1DLJA 1NQUA 3PFIA 5FOXA 1GILA 1D0IA 1P3DA 4XR9A 5ITVA 5IM4F 2WMDA 3QHQA 2CXRA 1BN6A 2ALJA 3MINA 3D4NA 3OEYA 1PL7A 1TRKA 2EYUA 4R1UA 2OFFA 1EJ0A 4BFTA 4OXIA 4KLRA 4Y2PA 4PZUA 3RBVA 4IVRA 5JV5A 4JLMA 1VL6A 1AKYA 3R6DA 1P4JA 2FQWA 2Y4OA 3O6VA 2FEOA 2I2XB 2XTAA 3E5RA 5CHEA 5EE3A 2XPCA 3RTDA 4AJEA 1UBGA 4UNNA 4Y30A 1IMJA 5DTRA 5LZ5A 1Z07A 3H17A 1VJDA 7ADHA 1APBA 3LLUA 1X6VA 3QMPA 4I55F 3WQRA 4EVRA 1JPNA 3W7BA 2PUEA 1FRVA 1NP6A 1TIKA 4LY9A 1CIJA 1UL1X 4MQEA 5F77A 1O94C