4YLYA

Crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
198
Chain Sequence
MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGAYTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETSRFDHVMNEFNGEVKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcus aureus peptidyl-tRNA hydrolase at a 2.25 angstrom resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 62
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4ylyA00
4JX9A 4OLJA 4FOTA 1RYMA 2Z2JA 3VJRA 4ERXA 2PTHA 4YLYA 4JY7A 4ZXPA 4Z86A 5IKEA 4DHWA 1RYBA 3P2JA 4HOYA 5IMBA 3TD6A 4JWKA 3TCNA 5B6JA 3NEAA 4QBKA 3KJZA 1RYNA 4FYJA 3KK0A 4LWQA 4QD3A 5EKTA 3V2IA 4QAJA 3TD2A 4JC4A 2Z2IA 2JRCA 4FNOA 2Z2KA 3TCKA 4DJJA 5IVPA 3OFVA 2LGJA 2NAFA 4IKOA 4P7BA 4QT4A 4FOPA 2MJLA
chains in the Genus database with same CATH superfamily
4KB5A 5CFMA 5BRJA 4B75A 5B55A 2W2QA 2GUGA 1G8SA 3HL4A 2QQ5A 3MPOA 1QWOA 4C0HA 4BFTA 4EGQA 1P0IA 4Z86A 1NJGA 2I76A 1TTQB 5IK2D 2FWIA 1NKSA 2XKBA 2C4TA 1X7XA 3HBLA 1KOLA 2A9RA 2KE5A 1ZK0A 5JJ5A 1E7MA 1AN9A 2H2WA 4O4LA 2FR8C 2DUWA 3FPCA 1ZGZA 2D2IA 1GGKA 1GQRA 2F3RA 2EDAA 2N3ZA 2YW9A 3A3OA 4D57A 1RS0A 2HEIA 3KZNA 5BSWA 2N1BA 5JHGB 4MQEB 3RYHA 1NPTO 1RYDA 3KT8A 2ZZKA 4YRDA 2WMDA 4RL4A 5IXSA 2Q2QA 4KR6A 1ZR4A 2YR0A 1C1HA 4JGGA 3ZJ5A 4E3WA 2FHSA 3UMRA 3DUWA 3OJWA 4YBRA 3EDQA 2WG0A 2HDHA 5IEBA 5KYVA 4BGIA 4EY7A 2HIAA 3AUKA 1T1JA 2VWPA 1N5OX 3GJSA 2VF4X 4LMBA 3IAXA 4Y30A 4DLPA 5IK2A 4YAGA 2HHCA 3RGWS 2D3WA 4UUOA 1FYFA 2CXUA 3TW0A 5JXGA 3AJDA 2FJPA 4U7PB 4RFVA 2G83A 1ZSNA 4UD2A 5LYJF 1YH3A 3A1SA 2CK3D 4F6RA 1KSHA 3AUTA 1PL7A 4J91A 1B6RA 1XQXA 2FMXA 2PXHA 2C1ZA 3ME5A 4WNIA 1SH7A 2Q7DA 4TVSA 1XN1A 1U90A 3AZOA 4BBZA 3G2QA 4G5SA 5EJ6A 1OPXA 1ONPA 4GVXA 2CVFA 4KVAA 4TLCA 1SKBA 2VEDA 3LYLA 4JJ8A 3RWBA 2VYND 3EIOA 1HH4A 2HV8A 4NR0A 3U40A 4BRUA 1D2MA 2FETA 3H6HA 3QHQA 5A5VA 1IWBB 2ZR7A 4LHVA 4XGNA 1O95C 5KBYA 2IC5A 5IG2A 3ZTTA 1II0A 1JHQA 3HB0A 2HBQA 3RI3A 1QIFA 4BEJA 4KSCA 1G60A 2NTJA 3HKEB 4DLTA 3V1TC 5J1SB 4IBOA 5HPYB 2YV3A 5G0WA 3OKPA 2B25A 2I87A 3K1AA 5ESRA 2CE7A 4YNBA 1XLTA 2Z6UA 4OFWA 2M1ZA 1E61A 3HL0A 1U1EA 5T3UA 1Q11A 1V3UA 3H0KA 2RGNA 1ZW1A 2XCRB 2XCLA 3QYFA 1UBRS 3TTXA 4Q03A 1BWQA 3ZGLA 2C0QA 3SYKA 3WL7A 5DM70 4BJ1A 1CUBA 4DC0A 1NSTA 4ERXA 1I0IA 2AN5A 4IGIA 2GXUA 3QKTA 4XD7D 5H1YA 1XTRA 1WHSB 1QHSA 1EBUA 1XVAA 2P30A 4DIFA 1YB1A 2O8VA 1AGRA 2WV7A 3PDUA 5EKTA 3ZVNA 1TAHA 2DH6A 3GLRA 2VYVA 2EJBA 3PJFA 3FZEA 3LHDA 3K0FA 3B48A 3LK7A 5DN6D 1PS0A 2F3PA 2QVXX 2VF7A 3O5AA 1UFOA 2C3MA 2Q21A 4PCVA 5EVCA 4ZYUA 3KELA 1LDNA 1OC2A 4IDNA 3STTA 4C05A 3NAMA 3HFJA 4RS3A 3DUFB 3C7CB 3VO8A 1VYUA 4PLZA 2GRJA 1A50B 3IQZA 4DAEA 4A15A 1KS9A 2FR0A 3BZBA 3TLGA 5K3OA 1JKJB 1S89A 4E2ZA 4Y0VA 4CKXA 3OZTA 2WWHA 4MZDA 4HAYA 4AULA 3LD9A 3C85A 5H68A 2H7XA 4C4XA 3EF1A 1NQOA 3ONDA 3SEQA 1XQWA 4RGYA 4MMXB 4C7XA 4GU5A 2HSEA 3EMKA 2A1TR 4TX1A 4EA7A 4YJHB 3HP7A 4X1YA 4BB5A 3N2NA 3LDUA 1MNQA 1ZK3A 2HTFA 1V6CA 2QRJA 2XADA 3GUUA 3B3JA 3DDZX 3IDQA 4LCEA 4ND1A 4OVKA 3SX4A 1SKAA 4C0WA 5AUOB 4BIIA 2QG6A 1Q3TA 4S2UA 3ADCA 3U4GA 2AFIA 1Y4DE 2R4UA 4AF6A 3MILA 1JPJA 4CN8A 4EBFA 1Z0ZA 1AX9A 1EHIA 2XD4A 3VC3A 4JBWA 5ALMA 3RVMA 2GESA 5ILGA 4KVZA 3IHLA 2C2YA 2E82A 4KXNA 3BCUA 3ZWBA 3C3PA 4G97A 4X7MA 4HRVA 4JYBA 2QXYA 5PNTA 4FFBB 2G1UA 1I4EB 2NUAA 3PQCA 4IOMA 4FFSA 5TQJA 4TXMA 2CXRA 1P2SA 3Q0EA 2HU8A 2AE2A 3HGTA 3VNVA 1EB8A 1YCDA 4ZAGA 2CYBA 1C1XB 4C88A 2K87A 4YWHA 1WBDA 3SOZA 3RFVA 5LWQA 3Q98A 2IIPA 4KE7A 3KPUA 4O59O 5ARDA 4FDVA 4LY0A 4IO1A 2ZRLA 3ANMA 3U4QB 3H97A 1SOMA 1P5FA 4MWOA 3TLKA 1TC2A 2EW1A 2I3DA 3BB4A 5CLFA 5KCZA 3TJZA 1NMEA 2WFLB 3QWBA 1E1RD 3RUEA 1Z5VA 4L57A 5KNBA 1AKYA 1Z22A 5K4GA 2JZOA 3R7FA 2C88A 4MYDA 4AS3A 2RGBA 3KOUA 1J33A 2J08A 2WM8A 3W90A 1XMJA 4B80A 1Q7TA 4O2AB 4V39A 1EK5A 2W43A 1IBSA 1FMTA 5FBWB 1CY1A 3VM6A 3ZWYA 2HGZA 1K6MA 3GU3A 1WW8A 3DL2A 3LH5A 1GFIA 2JAQA 4DZTA 5L9AA 1I2AA 1K06A 4RVDA 1GTRA 2C7BA 2AL7A 3R3ZA 4NKRA 3ND9A 4ZU6X 1G3MA 2FGJA 1FFDA 3KFXA 1KZ6A 3S2SA 1KMCA 1C5KA 3RSZA 1XFDA 2AEJA 2PBFA 3ZZTA 1I32A 3V32A 4D3SA 1ODFA 4N8DA 4CL8A 2P1DA 4U9HS 3UXEA 1N8KA 3C3JA 4U00A 5ICCA 1T0IA 2W0SA 1E4EA 4I3GA 3RF6A 1BGXT 2GF2A 3DVRX 3MHTA 3WO0A 1G16A 4AZ0A 1RI2A 3I5XA 4HVAA 4RORA 4RZSA 2QRQA 3NTVA 3CLRD 3SZGA 1VCHA 1STOA 4OMFG 4OHZA 2ARKA 1IDN1 1JIUA 3M5DA 3S1AA 3HN6A 3HUUA 2UUPA 3M1LA 2BDTA 1I14A 5HW0A 2BMWA 3EUAA 2YS7A 1DX4A 1OJ7A 1SVMA 5H80A 5BOSB 2G6BA 3Q7TA 5F1YA 4EKIA 3EQ8A 5B7GA 3D81A 2B1IA 1ATZA 1M5TA 3JATB 5JTUA 4UDOA 1T2NA 1PU2A 2PYZA 4FOTA 5KAMA 2B2CA 5D5PA 1HOTA 4GECA 1NBMD 3GJXC 3VMMA 3AI7A 1EUCA 3CTPA 3M7IA 5FBHA 4EL0A 3L7KA 1H2BA 3VSEA 4C7BA 4QKQA 4UPEA 1LZLA 5L4NA 3S2FA 1U1FA 1NY5A 3U3KA 1L3BA 3P9XA 4KYIB 2QTVA 1RTKA 2I3BA 4FNGA 4PNZA 3HU5A 4CQJA 3E9RA 1QUEA 1E4EB 2I54A 3RODA 3DV0A 3GEMA 5DYIA 4DV1B 4JELA 4B85A 5AVOA 3VPHA 2ZCUA 1GUAA 2OQIA 3NJRA 4WXRA 1ZAKA 1W30A 1II8A 4KQ2A 3KYIB 2AK2A 4K6FA 1RXCA 1P1RA 2AG8A 2CFTA 4YROA 4ZAWA 5J4KA 3FTCA 3WGQA 1Q0RA 1XDZA 3HXLA 1G38A 1A7JA 1X1EA 2DBRA 2YXPX 1TLLA 2OZVA 1L5HA 3WB1A 4TS3A 4B3BA 1Z2PX 2A0KA 3C74A 5FUMA 1XMOB 1LQ2A 2E4WA 4OX9B 4Q1AA 2XT6A 5U1PA 2NXCA 1PZMA 4BX0A 1MENA 1RWPA 1B0ZA 1F4PA 2AOVA 3F9CA 3OCZA 2Z3ZA 3AIMA 4BZZA 2XXJA 1VKRA 4HS9A 5F4ZA 2IX3A 3ZWVA 2Q6KA 2RSLA 3WYNA 3X1ZA 1U3CA 2PR2A 3G5AA 5HS6A 3WLQA 1LB1B 1TZKA 1NQVA 3L8GA 3LUCA 2H1IA 4P36A 2JLAA 1WD7A 3E2PA 3M6UA 4IIEA 4P38A 4QTYA 1MB9A 5K0BA 1ZNXA 2WI8A 3I1FA 1CJTC 4KKXB 2XEDA 3II6X 3N58A 1WXFA 2O5EA 3N5CA 1NVXQ 4JLSA 5KHLB 1I4WA 2FPSA 1OLUA 1M8FA 1MB3A 2OB2A 5JU6A 4M8KA 3LL4A 1UADA 4P82A 3UAXA 4QNRA 2IYXA 5BN5A 5FBRB 4OHRA 3UK1A 3KEQA 1AXRA 2FQWA 4FC6A 1GIAA 3VI4B 4CM1A 1JTEA 2AXNA 4EP1A 1GN8A 1TA4A 3ABRB 4TYPA 1XPOA 3PWTA 1DAGA 4F56A 1BA3A 1IY0A 2C8VA 2YZMA 5LA6F 2JAXA 3K4PA 1QJ4A 1FXWA 4PNHA 2J3KA 2XXAB 1SC6A 4URUR 7MDHA 3S8EA 1FU4A 4I1PA 2PWAA 2D1QA 3FMVA 5JWRA 1LFDB 3F3MA 3TFWA 5KYUA 5FAXA 2CUTA 1L4EA 1WZNA 2CMFA 2JAHA 3RW9A 5LZ9A 3FMOB 3LC1O 1I2CA 1R7RA 4FYWA 3K09C 3ZWNA 1RLTA 4L15A 3DLTA 4S04A 4IHKA 3C87A 3ITEA 4L2IA 3MCAA 2VSQA 1Z2AA 1ONSA 1U31A 1JA9A 3BN3A 1OT3A 3TX6A 5AIBA 1SKMA 2GVNA 4UNIA 5LM3A 5K3CA 3G89A 4JVSB 4ZU1X 3UY4A 4YJ2A 1XJCA 2YC2C 2AD5A 3KOZA 4IGKA 1WMEA 4WECA 1BMFA 4GQBA 4UAJA 1NNSA 1EZ1A 4E5DA 3ZNOA 4DV5B 4IEEA 3OTHA 4RK6A 1EK6A 1H94A 2H2GA 3PR2B 2X2PA 1QP7A 2F62A 4FHDA 3NBKA 4AG5A 1U2QA 3D3JA 5BUSA 4MR8A 2WHYA 1Z12A 4D26A 2NO0A 3NIBA 3LF1A 5EUBA 4BQFA 4CETA 3E9MA 4G4SP 4QFDA 4YY3B 3MGBA 2ZITA 5B58T 1N3YA 1UFVA 5DIZA 1GY8A 4W5JA 2BTEA 4U7DA 2VJOA 3KZXA 4L3OA 1XLUA 5IYZF 2HHLA 4UTPA 5CFZA 3PE4A 3VBEA 3OCJA 2R7AA 2IEBA 1W0JD 2X6RA 1EUCB 1BWRA 3HEMA 4YLEA 3QIAA 4BV3A 2XYPA 3I5AA 3LKDA 1SNYA 3PDWA 2FRXA 5JRDS 1CRQA 3FRJA 2QV0A 1J42A 5F73A 1GV1A 3MT8A 2E9SA 4DRYA 2I4MA 4MUXA 3DHVA 3HMKA 1E6MA 2BF7A 4RMHA 1LQTA 2R6DA 1P3DA 1P2DA 3D6HA 3OTWA 4GAEA 4BFYA 3HABA 2IU0A 3WL5A 2LKDA 3JQFC 2HA0A 4ARBA 1I2MA 4XE5A 4CTKA 3ADBA 3GVIA 4JA2A 1X8JA 3QZUA 4TYWA 1Z28A 5KMGB 2O6HA 2A0XA 5E8JA 3DL4A 4NZZA 3GLHE 1JDPA 1NJ2A 4DCOA 3WLEA 1XQYA 5FEUA 4IIXA 2ZJ0A 3A27A 1IQUA 1SBIA 2YN2A 3DZ8A 4FR5A 4Q48A 5AJUA 1ZJ6A 2DE0X 3TL2A 4C3ZA 1KYYA 2NO7A 4DMLA 2HZBA 3JQPA 5TQVA 2DPXA 5BVGA 1KK0A 2V5AA 3AW9A 1N5JA 3RYHB 1UXHA 1YS1X 3E6AA 1DEKA 3KUKA 4MUFA 2FG6C 4A2QA 4EUFA 4FNOA 4KWHA 4AYTA 2ZM5A 1TIKA 4F0JA 4ZAXA 4ICIA 4YHBA 5M5BA 3STWA 3I12A 3GRKA 3N59A 4NE9A 1X70A 4BHTA 2C9ZA 1ICIA 2WUWE 5LFAA 4CKBA 1SOVA 4P4UA 1QDLB 2G4LA 1E9AA 1FUUA 1R0RE 1WO8A 1FDIA 2PZGA 5TMBA 1JWBB 5HWSA 1PW5A 4WZAE 5CTAA 3NYQA 3CA8A 3GY0A 5IMSA 2G88A 3GHHA 4KEAA 4RHUA 1KIMA 4LECA 4R6WA 1QCCA 4EEZA 1RYNA 1XPJA 1U3GA 2XUFA 1PKEA 4OJNA 3R9KA 3W6UA 4D0NA 2J0QA 3NYWA 3M5CA 4JUBA 4BE9A 1NJ6A 2PRSA 1SC1A 2WFMA 2OCPA 3HDTA 3QTBA 4IIJB 1WMDA 1GXSA 4DSNA 9GPBA 2AB0A 2QTTA 3THYA 1QGZA 1O6CA 2PM8A 1PN3A 1K88A 2Q0SA 1PLJA 2D06A 4N7JA 5BXYA 4Z9XA 4WJKB 2G5PA 3TE6A 3HA2A 3PUZA 4QRHA 2RD2A 1O0CA 5AVJA 1HNWB 5EJEA 4C29A 2V1XA 1AV6A 4QODA 4WK4B 3HCWA 3ONEA 3QJGA 3CNLA 3NV7A 1WIWA 3ZH2A 4J0CA 5JLJA 5JDIA 1CDDA 1JSLA 1G4AE 3LOPA 3IEXA 4NRDA 5F9MA 1J9ZA 1JYEA 2C5AA 5FUVA 3WWCA 1X1QA 4POOA 2QJWA 1L7XA 4PG5A 5EFZA 4JLOA 4RNCA 2O23A 4E88A 4EI7A 3I9NA 5JQGF 4HYTA 4UUPA 4J1SA 4QLAA 2VTKA 3DE7X 4E1BA 2IODA 3MUNA 3QBVA 1RZUA 1JQBA 3I6YA 2FCRA 2GN0A 3ENWA 3O1IC 3X2SA 3ZEAA 5BWLA 1K27A 1PJLA 2RHGB 2ZSKA 1SZDA 3ISTA 4O2LA 1W25A 4PCLA 2FPPA 3FCCA 2JAPA 3FPEA 2XNJA 4I55B 4LYJA 4X20B 4OK3A 3FJ1A 2ZJFA 1SU8A 1W1WA 3HI4A 3FTDA 5K6TA 3G9XA 1T3ZA 4AP6A 3QA9A 5E1OA 2PUGA 1GFWA 3NP7A 5G02A 2VT2A 4BQEA 2VEOA 4KQXA 1U0RA 3L0DA 1CUSA 2CXXA 1P6XA 1W5SA 4BN4A 2BKUA 1LWNA 2QMOA 1OYOA 1WV0A 3AINA 2W5UA 2I6QA 1VSQA 1WA5A 4RD2A 1C0KA 8MHTA 3TG8A 1SU4A 1TO2E 4LQ4A 2V55B 4DMGA 4GW3A 3EOAI 4EX6A 3ASYA 3ER9A 5I3ZA 5DASA 3RSQA 4P4SB 2XR1A 3KDPA 5DEOA 1V8PA 1DEHA 4BLUA 4HS4A 1JEYB 1OF1A 4LTDA 1ARZA 4XARA 2ZKLA 2B4QA 3AF6A 2L18A 5AOAA 1SZCA 3T1YB 2VQEB 5IFKA 4MGEA 1DIGA 2EZ8A 4D99A 4ABTA 2YJ5A 1LW7A 3MNFA 2WJ6A 2CNBA 1U8FO 2FMFA 4Q9AA 5GOZA 2IYQA 2RKOA 2JI9A 2JLCA 4X7RA 1T5BA 2Z6QA 4XB1A 3TVYA 2I4LA 1YRWA 2DBYA 2PBLA 4BNVA 5CX1A 2FMIA 4LXTA 3EDRA 3LP6A 2GBFA 2HD4A 4L50A 4E1AA 5CEJA 3P9NA 4RBNA 4WY2A 4DG8A 1BKYA 2X1VA 1SWWA 1KL7A 4FYVA 1GPH1 1DL5A 5CXQA 2CFRA 1O5TA 1S0UA 2OBXA 3K2QA 5BNFA 3IOEA 1GA6A 4DUPA 3SQWA 3H0EA 1M0WA 2GBLA 2ZE8A 1NBWB 4CL3A 4HDNA 1RYYA 2GKGA 2IUSA 4ZI7B 4E5PA 4TUYF 4BNFA 4AJ1A 5G1PA 3RANA 1TPYA 2XGGA 4RZIA 1ECLA 1PNTA 1IBLB 4X65B 4F04A 4H2DA 4PC3A 1VDMA 2VJMB 3ZZ0A 3I9FA 1PSZA 2CXSA 5A3RA 2CZQA 2H1CA 3G02A 5HKAA 4PZAA 2J6HA 2OC9A 2VH2A 1TGVA 3PGJA 3VKWA 3W8DA 4RK1A 1H9AA 5JFGA 3MRSA 4K6CA 2QLTA 2V6FA 4XQGA 4FCTA 3L43A 1Q14A 1ZU5A 4II7A 4Q1CA 4W63A 3PWZA 2ZLBA 2HDOA 3O4JA 5JYDA 2XYRA 5YASA 4RJJA 1ZJWA 2BZGA 1BRTA 2F4VB 4P35A 1U0BB 4QYWA 1ENPA 4BNIA 1UDAA 2FSHA 4UBJA 3NBZC 1RXWA 1OHHD 1SPBS 3SDSA 1RWQA 1JMYA 3OE7A 5KNDA 1TE2A 2H2FA 4OQYA 1BG6A 4KFUA 4Z9BA 5JJLA 4QPCA 3K0HA 1LXCA 1XZDA 3JCZA 1KK1A 4GF5A 2ZJ8A 4HAIA 1WZUA 1GL7A 1QYDA 1EUDB 5DOZA 2L2QA 1Y5LA 2XYVA 1G9TA 2YV1A 1KMMA 1XYGA 2PYIA 3C8UA 3HP1A 1JTVA 1NYTA 4IYJA 5L3QB 3A0UA 4JX9A 1XHEA 4LNUB 2FGKA 4ZOEA 5JSKA 4ZI5A 1R5BA 4GDFA 3IR5A 3OUTA 2K7ZA 3EZ9A 2QDXA 4NJEA 4UHDA 4CF5A 1HO3A 1Z5PA 1KMQA 4P4SA 1W59A 1AKMA 4C4SA 4EO4A 1B26A 2JLXA 1SQGA 1P9WA 1O57A 2P2GA 3K7EA 3PE3A 4KXQA 3PKJA 4Y2HA 5KYWA 2BEVA 1DUSA 1S8OA 4H3HB 5KAPA 3T7DA 2R1ZA 1P4JA 2PRYA 1W4ZA 3GBPA 1HE3A 2YOHA 2Q5HA 1D2AA 3P9KA 1J56A 5K99A 2JGDB 2H0QA 3GVXA 3AVYA 2Q1TA 3LECA 4A03A 1U5BA 1R10A 1ZNZA 2P4EA 3N6RA 3UJ7A 5A4IS 2WZDA 2LBPA 3DLAA 4IDAA 4YACA 4UTRA 3HXMA 4LV6A 1Z17A 4MR9B 1V5WA 3GFSA 1JXMA 1P4RA 2OBYA 4DCTA 4ZQHA 2EAUA 4WHMA 3WLRA 3DE4X 2IXGA 2J59A 1IUPA 3BWXA 4HNHA 4RY8A 3HYTA 2Z43A 1LDYA 3OZDA 4B84A 4IUYA 1G21E 3QNUA 5ALIA 3B1KA 4RAOA 1EQAA 1XKTA 3C1UA 2VN8A 4A8PA 1GRCA 1KH2A 1XKLA 1DO0A 1DP4A 4NZMA 3RROA 1KI4A 1GILA 1Y1PA 2G7ZA 2IK8A 4AO7A 5L7YA 3M4JA 2NO1A 1A4IA 1UPUA 1ZUD1 4FMCB 5DGCA 4TTTS 5BVHA 3D3WB 3G3EA 3UB2A 5JOQA 2ZXEA 5THQA 2IZ0A 4EPWA 1M1ZA 3QPCA 3M6FA 2ECQA 1UJ2A 4K0KB 4Q82A 2B0JA 3A6HA 3AHFA 5DT9A 2OVBA 2OO3A 4LSWA 1XZKA 1P1KA 2ILTA 4P9NA 1FUYB 4NCBA 1SCUB 5G41A 2C2MA 3A4YA 5KYNA 1HYHA 4NOLA 1X38A 4IL5A 5A9TA 3TCNA 1CDZA 1M2FA 2NSDA 4EW1A 4MUIA 3G88A 1UXOA 4QOEA 2JH8A 2KQUA 2DFDA 2R5FA 3WMEA 4ZYYA 1O3YA 4M0FA 4G5OA 1DIOB 1Z74A 1B23P 4RY0A 5JDIC 4L5JA 1DOZA 1YJQA 2CYCA 4TKUB 2ZR9A 2XQJA 4PYQA 4QVKA 2HMSA 3EHDA 1INLA 5LVAA 3Q10A 5AJVB 1G2QA 3P27A 4XUDA 3SEFA 1N77A 1NUTA 4IOJA 1YJAA 4Z4QA 2OSVA 2YZ2A 4PNEA 2R1TA 3AH8A 5CCBA 4PZPA 3G8DA 3WZ2A 1JQEA 1N6NA 2C4VA 3GQBA 4GUDA 1ADBA 2ZREA 3IHTA 3OMWA 4LNUA 4AICA 2AC7A 2CDNA 1VRCA 3Q3CA 1ZK1A 3D7SA 3P26A 4PYOA 5DW3A 3NDIA 4CKZA 3CIOA 3M3HA 3P97A 1FLAA 2VXBA 1VHJA 5L6LB 3HJTA 3FVTA 5HSGA 1COZA 1E2IA 1J99A 2YV2A 5IVKA 1UR5A 1TM4E 3AP3A 1R4MA 4JL8A 1JR2A 2EVWX 2OGTA 3FMPB 3HA5A 3QX9A 4NHEA 1MDBA 1DC4A 1V2GA 4XYGA 3QLUC 2GB4A 3ZCVA 4P58A 4G1CA 4AZWA 2BGJA 1DAMA 1QHFA 5F77A 3QF4A 5B1YA 4II3A 3CV3A 1B15A 1EE1A 1KJQA 3Q6NA 3WO1A 2QRZA 1KH1A 4W1QA 5GOTA 3PGMA 4EDFA 3EPHA 2VDRB 4MICA 1E0SA 4G81A 1ZM3A 4YI3A 1GKLA 1XCGB 4U2BA 5ADWA 4JYZA 4Q1VA 3QBEA 3EFBA 3O2JA 2NUPB 1M8GA 5ISMA 1YMUA 2CMDA 1YZYA 5DX8A 1X92A 2KHZA 3VNRA 2XRMA 3A25A 1Z18A 1JHMA 3CF6R 3DQZA 2APJA 3TNJA 3VR2A 1KNQA 4DB4A 1A9XB 1E3JA 3MQFA 1Y8RA 3MLEA 1TVCA 1EUQA 1YQ9A 1Q1BA 2GWHA 3RT9A 2QD2A 2WMOB 4BNUA 3EULA 3NHZA 3UJCA 1AQ6A 3JQEA 4L8FA 1VKHA 5I47A 4QM7A 3HGQA 4UHCA 2PKXA 3MEQA 4YRBA 4U0JA 2WTAA 3SU8A 2HJGA 1R6XA 3DHEA 3COJA 1XZCA 1E3MA 4XX0B 1R88A 1T9CA 1I3LA 3CW2A 4BGUA 4COKA 3JS5A 1JDUA 4RDHA 1PV4A 2V96A 1CF4A 2ZCVA 1JFVA 2I62A 1LUAA 3NVAA 1RHUA 1RFGE 3CRRA 4AG3A 1XYVA 1QGED 4CIBA 1RR6A 4DWOA 2IX9A 2R87A 4XJSA 2PLNA 1WVMA 3CUKA 3SQLA 4EZBA 3R4CA 1SD2A 1M2KA 1PYDA 1RAFA 4K26A 1O96B 4G0YA 2HHHB 4MXDA 2Z6AA 2A0YA 3OOYA 4C2TA 2PZMA 1T8UA 4HNSA 3DVLA 2Z3VA 3KU4A 1VPLA 4E03A 2FKAA 1BVYF 1WTAA 1MGPA 1SKUA 1Q0UA 2PS9A 3GJ3A 4REQA 1EWVA 2GN4A 3K6SA 3DOOA 1FIUA 4ZK6A 3LQ2A 4BUZA 3QVKA 4TN1A 1QIJA 4J2HA 3SQNA 5JZBA 1OHHA 4BP1A 1PL6A 1QO0A 1WV1A 1B0AA 2HF8A 5BNIA 1GGEA 1LRJA 1AF7A 4B6PA 1VHWA 4JEIA 3GDGA 1MJGM 1SIBE 4TUYA 2ZIVB 3SS7X 2J5KA 4LF5B 1DX9A 5HIIA 2WTNA 1A9RA 2ZI9A 3GJ4A 5KX5A 4X45A 4F5DA 1PI3A 1UKYA 1V1JA 4F8YA 4L8WB 3K5HA 2PGLA 1TVKB 3GXOA 3UKJA 2DWOA 1Y8CA 3SG0A 4EIWA 3OFSA 4KLAA 3PNLA 1NVKA 2OCYC 4A92A 1CR4A 3I9V6 3JAWB 2JD0A 3GA5A 4CU5A 1L3CA 3KEGA 4I1YA 2E4VA 2ZBFA 4E6EA 2P1RA 4BAZA 2FEWB 1MX9A 2I66A 1M66A 1U3FA 4CPDA 1EJ6A 4DCGA 1JEQA 4RA9B 1TM5E 4YDQA 1W19A 1DC8A 1TIBA 4LQLA 3PITA 2D1SA 1U8ZA 4HXFB 4F9EA 5DGDA 4HV4A 4TYNA 2JGIA 2VRBA 3DZBA 2W6OA 1GSAA 5CNKA 1M6WA 3HJHA 4K9RA 5DN6A 2PJUA 5HJ2A 4DJ5X 4IIUA 1HY3A 1NTOA 4KFTA 4TWJA 1CCWA 5J2TF 3FCXA 3H05A 5SZKB 4CF6A 4YGYA 3CR7A 1K3UB 1QR2A 2F1IA 5AKKA 3ZD9A 1O58A 2O50A 3PFGA 2IY8A 3G7SA 1BFDA 1PO7A 1THTA 3HY3A 1NZJA 4NEGA 4RHEA 3KZOA 3TRIA 1QDEA 4JUCA 2PX4A 3H99A 1EEHA 3CURA 4ZT5A 4AU1A 3C97A 4C30A 3I62A 1PR6A 1FJ2A 3N8DA 5BV1A 2DUNA 3PTZA 2WP8J 4UHFA 3IV7A 1CC1S 4XR4A 3ZIDA 4JV5B 6Q21A 4OQXA 1MO6A 1U04A 2I7TA 1RRKA 2ICAA 3VH1A 1I6LA 3WB2A 3GPIA 4DEYA 3GPBA 4OU4A 4PQEA 2IXDA 2XOKA 3G9ZA 3WK9A 2V1UA 2MT9A 3H04A 3LYHA 4R1MA 4EUEA 2GVDC 1VLHA 1EVYA 5IWAB 2OHFA 3FDXA 4G36A 2QYTA 3EC2A 3L1IA 3VSBA 1JDBC 2VZ0A 2ZRAA 3OEYA 5MHTA 1VCOA 1CS4C 1XDWA 2LXNA 3H5TA 3QVXA 3UW3A 4CT4B 5KNCA 2W71A 4G3XA 4RHXA 2PBRA 2V9CA 3F6PA 3A6EA 5CFPA 2QL9A 5ICMA 3ZHBA 3EXIB 4YRPA 3LYAA 1UDXA 3BJZA 3QENA 2CNLA 1T8WA 1GCIA 1LEHA 4OYRA 1SUCA 1ZGGA 2I9KA 1ISIA 3QPVA 2PX5A 4NE2A 2WWFA 2JFPA 3DV2A 4ZQBA 3V7YA 1P9RA 2RAVA 1CVIA 4IG4A 5BORA 2LUOA 2HNKA 3EBLA 4JQZA 4OATA 1JIIA 3SD7A 3Q87B 2LW7A 5AK0A 4RFSB 4M86A 4KNYA 1JBKA 4H1VA 4GBGA 3V00A 2DQZA 3W2GA 1EBBA 2E1RA 4A73A 1X42A 3DTTA 2ZSBA 1RT9A 2YIDA 4QEKA 1U6IA 3I0NA 5FNVB 1J8VA 2CW5A 1VOTA 1PJCA 4IOKA 3RJMA 1N0VC 1JLSA 4ILEA 5B1DA 2JEYA 1QAMA 2VXCA 3RVNA 1JDJA 3ZY3A 1QTQA 4JI8B 2GZ2A 3N76A 4DRXB 5IYZB 1FFWA 1U8AA 1PQPA 2IYUA 2O06A 1KGSA 1T9AA 1EFRD 2B98A 1QGYA 3DOHA 4ISBA 2FQXA 2JCBA 4KDRA 3TINA 2X41A 1R6BX 3I5YA 1RZRA 3FTFA 1CYEA 1JLRA 5KINB 1Z3IX 4DQXA 1XLVA 4A8HA 3G2JA 2OV3A 1YFZA 5M7EA 1NQAO 1P5RA 4PXYA 1T8YA 3ADKA 3ANSA 1OXTA 1LJ8A 3VZBA 3ESXA 3BSSA 5JBQA 2UVPA 3OE7D 2W6ZA 4CEIB 2BL4A 5H83A 1F17A 4GGPA 3IBFA 2RHDA 3FNEA 1AQIA 3KRTA 4G9BA 5BP7A 3E9DA 5EE1A 1XA0A 1NOIA 3GLGA 2W2PA 4HUQA 2P6RA 3MTIA 5CNJA 2P79A 3LCCA 4WCFB 4P31A 1I1OA 2G8LA 2QQGA 2AFVA 2AG0A 3CGWA 3G9UA 3Q7IA 1V37A 2CBZA 5CEFA 1N2ZA 4KR0A 2XUGA 2QYOA 4V24A 1U81A 3QV1A 3RU2A 1E9DA 3STXA 1HWYA 5K8IA 4WXMA 3AI2A 1NI5A 3LIIA 3UZUA 1F4LA 3IEUA 1XEFA 4IIFA 4V2UA 4EKDA 5BSMA 1PR5A 3KSAC 1VIDA 4BN0A 2NU6B 8OHMA 4TSKA 4Y2UA 3KXLA 3FSRA 2KM1A 4Q9HA 3BSFA 3O7WA 1KI2A 1R3DA 3ZZUA 5F7ZA 2XTAA 2X0IA 4U9UA 4ZRMA 3L1VA 1EYZA 2VP9A 5JAZA 1VCIA 3ERCA 4W5TA 5IDQA 3MN1A 2QN3A 1B14A 4BKOA 2AI3A 2GS9A 2QN7A 3R3WA 1ZVKA 1DO2A 2IYSA 2TS1A 3O8DA 1OB5A 4C7OA 3FOFC 4LAFA 5GJWC 5BURA 4OQ4A 4D3ZA 1RSZA 4ARUA 4YQFA 3N6XA 4G5XA 3QVMA 1G7CA 4XPZA 3E7WA 5EE9A 1QLWA 1DG3A 1TJ4A 4OXQA 4BXOB 3EXHB 2IYNA 1ULBA 1UMDB 1Z3CA 1PGNA 3PDCA 3MWLA 1JLHA 3Q7EA 4GI3A 4OJQA 4AK9A 1O5OA 4DCMA 1AO0A 4FXPA 2R5WA 3BMNA 3EZ7A 4HYEA 3L3BA 1YC2A 2BM0A 3UXMA 3VSDA 4R69A 2RAUA 2YBEA 4OHPA 4RV5A 5CDFE 5MFPA 4L2IB 3O4HA 5E3IA 4LRUA 2QZZA 4YPFA 1RC0A 3DMYA 4TKMA 2EFDB 1V9CA 1E3EA 4GFDA 4YJFA 5TS2A 4WZZA 1NQUA 3K35A 4INJA 2OB1A 2JLYA 2X76A 2C4HA 2FWBA 3FCUB 5A6SB 3RG2A 3RYFA 4B3GA 1EP2B 3CINA 4FZJA 4TL9A 1VL6A 2P27A 5LQMA 1QFSA 2R85A 3O95A 4OHVA 1JWAB 2NYRA 3ZDQA 4YLYA 1H22A 1QOQB 4XPIA 3V97A 5BVGB 5JSHA 2FEXA 2R1VA 4ZODA 5EYPB 1PJTA 1I01A 3FB1A 5TE9A 2BP7B 2UZ1A 2ZJ5A 4B46A 1E9FA 2CL6X 4Q3BA 1LQUA 3C48A 2ZRNA 2JGMA 2OZLA 2E4AA 3NBXX 1IN8A 1IRXA 1ZD5A 3IUBA 2ZUSA 4NG4A 4QNMA 4YJ3F 4YCSA 5B7NA 5WRFA 3OX1A 4K03A 5AHKA 4REOA 3QELA 3MJSA 3U26A 2J3EA 3FYSA 4KYVA 5AJWA 5EP1A 3AOEC 4TS4A 3OQPA 4JHLA 2WRZA 4DM7A 4NULA 1P5ZB 2DQSA 3NW9A 3PP8A 3BDVA 5BW4A 1YOVA 5HHTA 1BA2A 4QJBA 1X80B 4X61A 4OBBA 1CPYA 1GZ5A 1ORRA 2PH1A 1HBJA 1PEYA 4JXJA 1EDZA 2ZUVA 1XLTC 3I6ZA 1E32A 1PV2A 1E58A 1YL7A 1VYHA 4A82A 4B3FX 1HTWA 1CUAA 1QV9A 2BFCA 2PT6A 3UFXB 2VTBA 1E0AA 3L0OA 2WM2A 4PYMA 3T61A 1KFKB 4BGEA 4IDPA 1H1LB 1WUKS 3E4DA 2HJWA 4Z9YA 1GRVA 3ORFA 4ZOLB 4RIHA 4H1WA 5LQNA 4DF3A 3MB5A 1LSSA 1LNZA 1JT2A 2A5YB 1UEXC 1M76A 4LZOA 4Z1OA 1D2RA 3I28A 5ED0A 4HGQA 5GJBA 2QR5A 1Y6RA 4Q4DA 3CLSC 5CT9A 3O2NA 5DBHX 2OFFA 2EFCB 3U5ZB 4H9GA 3ACDA 4PAMA 2JLSA 1OVMA 1ZSVA 1PVVA 1C9JA 2VS1A 2YJ6A 3DD1A 3GIWA 3LKZA 2Q1YA 3DA8A 3WV4A 2EW2A 2FZCA 3DQPA 3FR8A 2D5AA 3HB5X 2PS1A 1G8AA 3INTA 3IUQA 4LCJA 1P2TA 5EJIA 3DDSA 8ATCA 1RVDA 1J1ZA 5C3UA 1R18A 2NAPA 4GNKA 5JZ9A 3T4XA 3X0DA 1G5TA 2JW5A 1E18A 2I6GA 5KB3A 3DULA 1TCAA 4W5OA 4QWWA 1Z37A 4RF2A 4HP8A 3KJHA 3I0ZA 2X6TA 5ANRB 3UAOA 4B7XA 4M3NA 3PUJA 3GLGB 1XZGA 1PQWA 3M3PA 1UK9A 2JFVA 4ENWA 3WLNA 2WJPA 2J0VA 4DYHA 1CP2A 1OFUX 5G3ZA 1YRHA 1RW4A 3AUFA 2B6NA 3ECSA 2FSGA 3LUHA 4YJ2F 1I94B 3G17A 4LXXA 5CFNA 2C3OA 5F7OA 3E5HA 3HV0A 2X1MA 2WJZB 3AVUA 2GHTA 3PICA 4M7PA 1K4KA 3WIDA 4MUYA 4TYQA 4R7TA 3U3XA 1JRLA 1K2VN 4HX9A 5ICEA 1D09A 2WKRA 3IH5A 3IGFA 3JQGA 4OQFA 3KQWA 1FFBA 1M2VB 2W42A 1Z7WA 3R5FA 2LZ0A 1HNXB 3IR7A 1QOPB 3I6QA 3MT9A 2GHIA 4WOJA 5BRNA 2RKBA 2GLXA 3C45A 3UHOA 2FJ0A 5IBQA 3G23A 3ZE8A 1PFYA 2AJLI 4MS3B 2J3HA 2JFGA 3X1KA 4E4RA 5K9ZA 3NJ8A 4Y0AA 1S4MA 2OHVA 3FKSA 3CVYA 2B92A 2GJKA 1BS2A 2ZWMA 5T4HA 4YAEA 4UBOA 3ET5A 4BAUA 2XLBA 3QVJA 5CD1A 2OBNA 5DGTA 5HF8A 2R9VA 3NHBA 4QYXA 2MOKA 1YZGA 3IPRA 2G4CA 2P40A 4AN0A 4C76A 1Q7BA 3LXUX 1A71A 2BELA 3SYLA 3IIMA 3BK2A 2CNOA 2VHQA 3JVEA 4HEA1 2CKMA 3LFTA 4QBKA 2XUOA 3REFA 1E6UA 2A94A 4WEOA 3GDFA 1DBSA 3ON5A 3SM9A 4ITVA 1Q0TA 1JFSA 1OUMA 4TLLB 3WQSB 3A3KA 3KLBA 1BHSA 1ELOA 3IQGX 4JC0A 4XI9A 1ULHA 1TJNA 5DN9A 1L4NA 2VBGA 4BO7A 3PC7A 2EWVA 2X8LA 4BZXA 2FFQA 3O8LA 4JLVA 5TF0A 1H8EA 3H84A 3ZKWB 2JZNA 3I61A 5BSTA 4YFYA 4ALMA 2X5NA 3RJTA 4MGIR 1ULUA 4JEHA 3WKAA 4DIUA 4UNQA 1F8YA 3KE9A 3NC1C 4Q9NA 1Z2NX 4UM5A 3DW1X 5FFNA 3ZD7A 1RAGA 5H82A 4YAWA 4ZV4A 1J2JA 1L7QA 4NMXB 3EY9A 1AU9A 2ZE7A 1ZD2P 2XEXA 2QLNA 4XWYA 1FS4A 1BS1A 5B3AA 1W4CA 3NDRA 4QTTB 4JJAA 4CLOA 4BWFB 3KBBA 4BB9A 3H2JA 1VJ1A 1E6CA 4C2AA 3MTEA 3T7RA 2XA1A 4ESEA 2NU7B 4FN4A 4OHBA 5GM1A 4XWOA 1M1YB 1K66A 3I52A 4EA9A 1VE5A 1ENYA 5CFOA 3LKVA 3A9VA 2HJRA 4HPWA 2AFHE 3Q5DA 1NIJA 1QNFA 4A0FA 2GZAA 2YJZA 5L3SA 1YZLA 1GNSA 3A26A 2J67A 3ER8A 1VPTA 2H4FA 3EISA 1XRLA 2O1EA 4NQRA 3TYXA 1XCJA 2P6NA 1BDIA 2ZAMA 4PE5B 5FI1B 3SI7A 1A76A 4RE6A 1Y1SA 2Y76A 5JZVA 3LXRA 3VR5D 1XK7A 3H2IA 2R2GA 1IHDA 3LGXA 4FHEA 1Q44A 5C8DA 3CVXA 4OCZA 4YMVA 3GLIA 1IOWA 1E1CB 4V2IA 1GZHB 4HQ6A 1M34B 2P9EA 4B1FA 2PJZA 2ZRBA 1T6XA 3DWIA 3OKFA 4QDKA 5A62A 3CZMA 3VVCA 2BMDA 4LF6B 3FBGA 3JQAA 4ZVKA 4F38A 4RV9A 2LIVA 1UP6A 4M83A 5F7XA 5LLTA 2ZZNA 1DCKA 2A35A 1R2QA 1UIMA 1Q5PA 2PAAA 3RLFA 4NYIR 1N34B 1GQSA 3NS7A 1KP3A 4UM8B 4TT3D 4DMHA 1WQ1R 2IHYA 4WLFA 1UBSB 2Z1MA 4BECA 2C2WA 1AK2A 4R0VA 1L4HA 1QHEA 2L69A 1XQ6A 2EF1A 2Q29A 1PDOA 3CONA 3G59A 4L8GA 1WUYA 4P34A 2BHRA 8ABPA 2BYTA 1MRNA 2C3YA 1NWHA 3H3FA 3KCQA 5K7SA 3N2EA 1QRDA 4A36A 7GPBA 3AB8A 2X40A 5K0ZA 4L51A 2ZJYA 3HZHA 2P8JA 4NCJA 3TCXB 5JS7A 2YRFA 4NJMA 1MX3A 3PGKA 4DJEC 5A5FA 1SCJA 3C16C 4FE7A 1I2DA 3EMBA 2Q07A 4C5CA 4HSGA 4IVNA 1FE8A 2BGTA 2HLNA 3IERA 3EDOA 3R5KA 5GJCA 3CF4A 4BNMA 2HQRA 4IX1A 3ZHVA 4WDQA 2JA2A 3OJCA 1CZLA 3AL0C 4R8MA 1BX1A 1X8LA 2O2GA 3B6JA 1NF3A 5IAOA 4YONB 2XCTB 1U4SA 1SUWA 4IIVA 2G67A 2VWHA 4MKRA 1B41A 3L6EA 4YAJA 1O96A 1DARA 3CVOA 5CJJA 2CLDX 2WZCA 2HMVA 4MB6A 1QQAA 1U99A 3SDZA 4LF8B 2D8AA 1HDYA 1N92A 3R6DA 4RNDB 1K3FA 4UJ5A 3G5UA 3TK1A 4CMCA 5H81A 4G01B 1ZMOA 2J5XA 3NGMA 4EJMA 1ZI9A 3BULA 3ND7A 2V5UA 3A05A 4KQFA 3E3NA 1Z06A 5EMJA 3NJ4A 3QEKA 3OO1A 3W6OA 3O84A 1WCYA 4AZ3A 3PCRB 1U9ZA 1OWLA 3JR7A 2J33A 4X84A 1NV8A 1PR0A 2AOUA 4YI5A 3D7NA 3NHUA 3Q1LA 4GSKA 4B3XA 4IDOA 4BQPA 2W4MA 3KUDA 4F1KA 1C7ZA 1MC5A 3HACA 3RK1A 1EVEA 1LDBA 1YB6A 1Z7GA 2ODWA 2W11A 3UB3A 3X1YA 4CZ2A 4I9GA 2M98A 5H02A 4XASA 4UAGA 4M89A 5HKKD 5LP1A 2NYAA 2C5LA 3CPEA 3W6NA 4F6RB 3RASA 4MV4A 3IMKA 4H35A 2TMYA 4O4IA 4G1UC 5BW8A 3JQ6A 1ZCFA 2VAMA 5KSYA 3CVJA 4DKXA 2C58A 4YMHA 3HN2A 3CLTD 1GPAA 1TW2A 3C5CA 4R0NA 5IXJA 4E46A 3SMQA 2RGAA 5JALA 3I30X 4CLXA 3RQIA 4XGIA 3T7EA 1Z6ZA 1AQLA 1YB2A 2DUJA 1V1MB 2X1LA 4KJZA 4FUTA 5EWLA 2B6HA 4P5DA 3TRFA 3UT5A 2GLUA 2PUWA 4NMMA 1A72A 4E94A 5A4JA 1ZAYA 1CWUA 3ZHTA 3CB2A 3NATA 2MCFA 1FP6A 4CODB 1I5EA 1L7MA 1T4DA 2JFHA 2Q62A 1WHTA 2BFNA 4HTFA 4JKYA 1Z13A 3UKDA 8GPBA 3O4VA 2CUNA 4EZIA 2P3OA 5JEEA 1RRVA 1NXVA 4ZOBA 3SQXA 2G9RA 3W05A 3MSCA 1J39A 3F1KA 3PTLA 4URVR 2R6R1 4KQMA 4QOHA 4FOLA 5F4BA 5ALXA 2OQVA 1T9KA 4J29A 5DMHA 2VNKA 1UKZA 3AI3A 4OJYA 3RPEA 1NC1A 1N36B 1ISSA 1P80A 3VR5H 4RSMA 3BXOA 5EE3A 5EHNA 4ZVSA 2PEZA 1QIGA 1AS0A 4URWR 2XDQA 2I3ZA 5ALOA 1AHIA 4G6ZA 2CWDA 3WIVA 1CNMA 3AWIA 1OLXB 3F78A 4NYMQ 4C2UA 2FFHA 1TYZA 3LUBA 2VDMB 5JVDB 2GM4A 3UK0A 1W4RA 1A9OA 2W6MA 2XGMA 1KAOA 3VKHA 3GOQA 3OLZA 2Q5CA 1L7RA 1D7OA 3AJRA 1UBNA 3L7AA 4NNJA 2G0AA 4W9RA 5CXUA 4ZCMA 4RKYA 3W79A 4OK5A 3QPAA 1FF9A 1E6EA 4G0UA 4B81A 1BE8A 4Z8XA 2CXQA 2FUCA 2D7CA 4N65A 1DKNA 4OQLA 2BR4A 3R24A 4E5YA 4HFMA 1M2VA 4V02A 4W4TA 2NPFA 1M7BA 1L4FA 3MWYW 3R0VA 2W37A 4R8LA 5HF6A 3RUDA 3O9MA 4O2BB 2VL7A 2QUKA 1JJVA 2I2FA 2WNIA 1UF9A 2FW9A 2IPAB 2L17A 1RAHA 4LG1A 5E6UB 4K9KA 3T3DA 2EFHB 4B2LA 3KOWA 3KWLA 1IJKA 2P7IA 1QKKA 2DWPA 5E7QA 4B6QA 3H18A 2B1JA 2C9YA 2GXAA 3HMQA 5DNCA 4MAAA 1BJKA 1RWWA 1ZS9A 2EGGA 2ZTSA 3GLIE 3UMBA 2VHEA 4Y1FA 2YWHA 1IB6A 1NHWA 3HVHA 4ZCIA 5KKNB 4ZT7A 3EVAA 4YCBA 4ASUD 3H9BA 2WUVA 3HE3A 1GGNA 3WKCA 4CTMA 3OQNA 1Z36A 1FP7A 2BCGY 2ZJ1A 4HMQA 5KEIA 4F06A 5TJHA 3MJDA 3HUDA 1O9BA 1F2DA 2VDUE 1COWA 3QOFA 2AF4C 1QYXA 3FCAA 4JQOA 3JQBA 4PO3X 3V2GA 1UIRA 1KY3A 4RFSA 5FLEX 5JJBA 2VJBA 2P90A 2UYQA 3P4XA 2DPYA 3BMOB 4CVNA 5LMZA 1ZW6A 2ODQA 2TECE 1B73A 2YN4A 1CY2A 1ETUA 2KLHA 3ZOKA 4FYKA 4A6EA 4EVIA 5JZOA 1HV8A 4JU8A 1WXIA 2Q3LA 5MF6A 1DG9A 4BX2A 3DB2A 3KQTA 4CT5A 1ZHOA 2G71A 2UAGA 2XA2A 2GXSA 4ESHA 2DKFA 3LZCA 1H4QA 4MHOA 4UNPA 5CVVA 3UF0A 2BSQA 4N41A 3GEPA 5FFMA 3LC2O 1DQSA 2NZYA 3AEXA 3OEWA 1TECE 4M88A 4WTOA 1IVSA 1OWNA 2O3SA 3ES9A 2O57A 1DI0A 5CLLA 4TTQA 3GFFA 4QO8A 4EKEA 1UM9B 3D31A 1YVRA 2ZIUB 3KKMA 3G1WA 1NX6A 4FYXA 1HR0B 3P4YA 3CLSD 3HBMA 1VPWA 2O7NA 1VHTA 1AUQA 2GZSA 2PMWB 2QR3A 3WSTA 3A1DA 4BNHA 2P3LA 2XVXA 3C6QA 3FOAA 5JXIA 1P8AA 5K09A 3K3PA 4ND8B 5G3YA 2JGEA 1KAQA 1P4SA 2XW6A 2ZPUA 1JH8A 2G63A 1KHHA 1NFQA 1Y3IA 2P5YA 1B6GA 3PEVA 1E2GA 1WHTB 3K9WA 4KPEC 4M38A 3UENA 1PKXA 1MO4A 1DWQA 3Q8LA 1T0PA 2LPMA 2QJOA 3QPWA 1TM2A 1ESCA 1SVSA 4IXWA 4EBBA 5JTTA 4UPVA 1TX4B 3Q5GA 3FKQA 3FTPA 3GGSA 1KYQA 1ECGA 5FWAA 1PX2A 1GKIA 3ABSB 3VO2A 1KI8A 4MAMA 2XWPA 1OC4A 4KQWA 2WKSA 4GSYA 1E7QA 2ONZA 1ZIXA 4ZMSA 3FFWA 4OHXA 1GQQA 2OMKA 2QPAA 3MOGA 2FZ5A 3ZI4A 4IIYA 1YJ8A 4CM3A 1DAFA 1HDIA 2IZ5A 1DBQA 1BAPA 2CLLB 3U39A 4AQDA 2Q3DA 1U7WA 4DQUA 1CQJA 1NBAA 4F4CA 2Q3JA 5DLPA 2E5WA 3VAYA 1NMXA 3DAGA 4GPZA 4LCBA 3MXOA 4IHJA 3TPFA 2YX1A 2QVYX 3WFJA 3QEAZ 2I2WA 5EAIA 3OF3A 3Q8XB 2WT8A 2CBGA 3PX7A 1EX1A 2IRWA 3QUSA 4IXNA 1V1RB 3B3GA 3DFUA 3R0IA 1N5IA 4KRGA 4UHHA 3KOOA 4RCYA 3SOPA 3FD8A 2AUTA 2OXCA 4LI0A 4R68A 1NN3A 1YIAA 3FLBA 4KLRA 4R3WA 3WIOA 4B45A 1N75A 1PZGA 2OHXA 3IMCA 4IDDA 5GADl 4RDIA 3DSRA 2C4NA 5ECDA 5CX1B 1G5PA 3UPUA 2FNAA 2H7VA 3HLYA 3RYIA 4QU0A 2JIDA 4N3CA 3JY6A 4NYMR 1WCIB 4DG5A 1JDSA 4N7BA 3M81A 1JL3A 5EZ6B 4ND7A 1EFVB 2I91A 1BVRA 4WE3A 3AY6A 4YPOA 2O20A 4WK2B 3RHSA 3GELA 1KU6A 3T3MB 4D96A 1JVNA 2VDJA 1XL0A 3QLVA 1PJ8A 1THGA 1ZOOA 3GO4A 4N7RA 1QTIA 4XIYA 1P61B 2X19A 4TMVA 5ALQA 3M6AA 1NATA 3PNQA 1UQUA 1VBFA 1XTTA 4X60A 1LV8A 3DMFA 4U3JA 4MWZA 5DHRA 5F76A 4X8HA 4XQEA 2ZSAA 3WKEA 1LPAB 2DOKA 3QUAA 4NABA 4HDCA 2W58A 4M0CA 3G1UA 2V7EA 3I34X 1J2YA 2QL7A 4WN3A 5C9ZA 3B9BA 4EJFA 3MERA 5FNZA 3NPMA 4HMPA 4DVGA 5LQDA 3EBPA 4MEBA 2IYOA 1XKQA 3FF1A 3KR0A 1XWIA 2BFFA 4TTPA 3S55A 1P2GA 3WTBA 4BO3A 3D1VA 1TYAE 4KC0A 3HFGA 1PHPA 4ZA2A 2CXHA 1Z4OA 5EGSA 1Z83A 1AQJA 2AT1A 4FFVA 4M87A 3EGEA 1YNOA 3I2KA 3OU6A 4I0WB 3QWFA 2AW5A 2NO6A 3VQTA 821PA 1A8IA 3FLAA 3E27A 4K9SA 1WOYA 2G7MC 2W93A 1CIVA 2PUJA 2GJ8A 4LX0A 3N2IA 4UOEA 1CRZA 2SKEA 2WU3A 3DDNA 4IO0A 1JGTA 1FP1D 4MQLA 1H9CA 1ZRHA 2QX8A 3H4IA 4LHXA 4P3YA 4DV0B 2F8MA 2G25A 2P8SA 2XWQA 3S2ZA 2HPVA 4KODA 2Z5GA 1EE2A 1IIRA 5TR9A 2QVCA 3IAEA 1Y3FE 1ZUNA 4J9UE 2PUTA 2BEKA 4Z2YA 3FM9A 5F2KA 3TW4A 4BEBA 5A4AA 4E2FA 2CUZA 4UC0A 2F64A 1SAYA 1YHNA 2C59A 4WKOA 2ZT7A 4C5AA 1OBHA 4V0KA 4C3OB 2B4RO 5EHXA 3ASUA 2QM3A 1BMDA 3Q40A 3IP5A 1UMBB 4Y2SA 1P0FA 1RWXA 3ZHQA 3SJAA 3WBFA 5FUQA 1OZHA 1JQDA 2VDLB 2Y0PA 1IJFA 1T6BY 2F1HA 3DM9B 3UH0A 3MJ4A 4JXXA 1G7SA 4ZXPA 2ZK7A 1HDOA 2NQTA 1NJ1A 5HZKA 4MQ4A 4WFJA 3ZV5A 1OYVA 4MNTA 3DKVA 4KIFA 1NLMA 2Q6IA 3WX0A 1DELA 3SDBA 2VF2A 5AXAA 4BLWA 4NBLA 1XEXA 3FHOA 5HIKA 1O87A 1GTG1 2EIXA 4MRNA 3RLIA 4DR3B 1B1CA 2ZYVX 2O8FA 1NUHA 3MGCA 2WYHA 1EJ2A 3KXPA 1WPGA 2YXEA 5I45A 1L7NA 1TJYA 2CCGA 3PPIA 1NRWA 2CD9A 4X5OA 3VZPA 1YASA 2RHCA 2YRWA 5MN4A 5HQJA 2D1RA 13PKA 4AZSA 1ABBA 4GR4A 3IAUA 4BFSA 5BR8B 1C0IA 1KAMA 2WDZA 3KJXA 2ZJBA 4ZKDA 2EERA 4YASA 2G8NA 4QUBA 2W90A 4KLZA 4L5IA 4QUEA 1VKOA 4HOYA 3FFTA 4JBGA 4K8RB 4B8WA 5D3QA 5HRAA 1K7CA 1OIXA 1YI8A 2JASA 2KPOA 3VAZA 2CV0A 1DWPA 1IE3A 2JJ8A 2LP4Y 1RFLA 2ZVQX 3C6ZA 1RJFA 3UQZA 2MSDB 4EGCB 5BMOA 4MKGA 3TXXA 2VQSA 1OXVA 5T67A 2MR5A 1XXHA 1ETHA 1T5SA 4J75A 3PG5A 2AS0A 2M6LA 4TVKA 3W8NA 3I32A 2Q5LA 5FWXB 4YRCA 3V5NA 2DLNA 3BGDA 3AT1A 1WXXA 4R3NA 2SKCA 3MINA 1D2EA 1ZHFA 3GZ4A 4KGXA 4QELA 3CEPB 4BV9A 3ENKA 2BJHA 5D7NA 3GRYA 4TKUA 2NVWA 3CYFA 1KRWA 1U80A 3WHLA 3PPVA 5FL7D 5DWVA 2AZ4A 4K81B 3R7BA 2MU1A 3OQBA 3U6KA 2P67A 2TSYB 3U4DA 4OI4A 4D45A 3LQRA 5KNBH 5FIUA 5JCXA 4JP8A 3SC2B 2OP0A 3PC4A 3WLPA 4FKZA 5HBGA 1M5UA 1L4LA 3I3OA 5JZMA 4OQNA 5BN3B 3FJOA 4N5MA 2B4AA 2IDMA 2XTJA 4LX8A 4X1IB 2P0YA 1DRKA 3GT4A 3O47A 4MO2A 1X1CA 1HA3A 3GAAA 2SNIE 2XOKD 3L7BA 4OBXA 4WOKA 3EA4A 1CZKA 5GGXA 4E11A 1U2DC 3L04A 3Q6IA 4KQGA 4QPPA 5IT5A 3GLGE 4M54A 5JAUA 3O8RA 4JI5B 4Z51A 3BHMA 5HDBB 3CUYA 3O21A 2PVCA 2JC3A 4RE5A 2HLPA 1OXSC 2ORIA 1VG9B 1GD1O 1U7DA 3CLKA 4TN5A 1TUEA 3R3VA 1USIA 4W9MC 1QMGA 5I7AA 2HFJA 3ONNA 3IKTA 3R9XA 3D6FA 4BNDB 4K6HA 3RAEC 5CBPA 4IUDS 2QMZA 1KOGA 2N47A 5BUQA 3EVDA 4LEIA 4UFPA 4NH4A 5EJAA 2FSIA 3VVMA 1JEJA 3IPLA 4DZZA 3RFUA 1RADA 1GDHA 2A9OA 4DJJA 2ZE5A 3EZYA 1OY1A 2J32A 2VWGA 3UGQA 3T1OA 3CH5A 2O3UA 4HGOA 1ZVQA 1ZEMA 3F90A 1NWCA 1JZQA 1SKYB 3DBOB 1Y1QA 5ALKA 4IVPA 4DNPA 1XCMA 3VOTA 1CF2O 1IJEA 1QF9A 1ZICA 2XMDA 4LBWA 5GONB 1CETA 3UM9A 1ZI6A 2XCQA 4BMPB 3FUXA 2XRFA 3GCWA 4Y98A 2QVGA 3AL2A 2AJDA 5I7WA 5CA1F 2YXDA 2XRYA 3QFFA 1V26A 4RELA 3TXYA 5AVWA 1ZCAA 4PFSA 2ZM6B 1SPXA 4B76A 4OA5A 3LPDA 4RMJA 4ZEOA 1CZRA 2QN1A 2XOXA 1KY5A 3V8RA 3ZDXB 4D9JA 3JXEA 2D5CA 3H2KA 4N9WA 3EIQA 2A1UA 4J1TA 1O0BA 1IUKA 1LCIA 1IG0A 5E6SA 3WI7A 5B4TA 1KDPA 3N0XA 2VF5X 3ADPA 2QIPA 5D5QA 4KLNA 4B6FA 4UOZA 3RRMA 5HNKA 4BAGA 1XEWX 4CU2A 1MH9A 4DJFC 1DFGA 3WGIA 2PQ6A 4QDUA 4TRRA 1Q83A 2DX7A 4JOBA 1V7ZA 1LI5A 4Z9AA 4OAPA 2B35A 2WHPB 5JMTA 5CB8A 3TH5A 5FHRA 4KAAA 3DC7A 2DFTA 1BW9B 4OHFA 3T41A 5DTQA 4AZ3B 4EY6A 2GBLC 1S9DA 4MI9A 2BV3A 3ZPXA 4WY8A 2QX4A 3F71A 3LP5A 4UMVA 4MHTA 2GO1A 4ZO7A 3ORHA 2FN8A 3G0HA 2Y0DA 4KIWA 3VDMA 5EJ5A 5MGNA 3U13A 3L6CA 4TQ9A 1JJIA 4ALIA 1JAYA 4LDQA 1QBGA 2CCJA 4F5YA 3AR9A 1CLUA 1QTRA 4MQ5A 1ZNQO 4IGAA 1UZNA 3IUYA 3AF2A 4GBJA 4ZVVA 4D0RA 3L0BA 4YYZA 5EP3A 4TWIA 1Y80A 3VPDA 5DGIA 1FQWA 3NANA 3URKA 2AOUB 1EP3B 3GNQA 1EFPA 2WEKA 1V3TA 3OLWA 2VDQB 5I9MA 3HCCA 4MRAA 3WXMA 1C50A 2FSUA 1KVUA 3COSA 3OTGA 1BX0A 5E3JA 3S3TA 3UGJA 1HFEL 3H83A 2OAGA 3H9QA 3LLUA 4NDAA 4RJLA 4R98A 3RIXA 3ROPA 3K6JA 4OPMA 3TDNA 2YZNA 3Q7QA 4Z0TA 3MFQA 2J45A 4OFZA 4PQFA 5D85A 2VSNA 4C7OB 4P2BA 1A3CA 1II8B 1TK3A 3E9EA 4ZV7A 3CH4B 4L72A 1DKOA 1FRNA 1NV9A 1VJGA 2OAQ1 3A36A 4J03A 3I9OA 1W5AA 1GGHA 1OTHA 2ZUUA 4INZA 3JARB 1W4BA 2NAFA 3D6NB 1GPLA 3KJEA 1RYFA 2KS6A 2IXAA 3L93A 3OKAA 4U02A 1WW2A 5HKKA 4QOGA 4EMTA 4MQBA 3TEJA 2OESA 1V9LA 1NURA 3NORA 3RO7A 1PWZA 4WN9B 3CRQA 2V7VA 3SM3A 2MWMA 1K6JA 4Y8VA 1L5MA 4QHSA 3SZLA 1CG6A 4QQNA 4QJ4A 3WYBA 2JD2A 2G1JA 4B7AA 3LZDA 2Q4OA 2E5FA 4CWAA 5LU9A 3TZLA 1U3VA 3BILA 3QVSA 4A0RA 3EGIA 3A9UA 1ZWKA 3BJMA 5E7MA 3PLNA 3OOSA 3SLGA 3N8KA 5T41A 2V98A 5IC5A 4ZVRA 1GPWB 4PLCA 5F3DA 1FOEB 4DBLC 1CZUA 5I5EA 1PTJC 3G49A 2FWMX 2IEAA 2COKA 1RP7A 1GSOA 1WEKA 3MLBA 3DWFA 3DDHA 2POQX 2VYFA 3L8DA 1AZTA 4DGQA 1PSWA 1MRSA 1CY4A 1YBMA 3S2YA 3SKVA 4CEHB 3I9MA 1PWHA 2BEUB 1ICEA 2SBTA 4Q9KA 1RQLA 3R0JA 5AP9A 4EW2A 1V11A 3GFRA 3PDIB 3BOSA 2JJMA 2IY7A 3DTVB 3MINB 3PVCA 2GR9A 3QXJA 1H9BA 5J5AA 2C7QA 4UCWA 1H8ED 1PE0A 2IDZA 2DQYA 3WQHA 5C52B 3PHIA 1GDTA 4EMSA 3ZU5A 3LTEA 5CVCA 5TMEA 2FW6A 5FBZA 2RBGA 1GFSA 1BXRA 1VQ1A 1JLMA 1MFPA 2X4IA 1CK4A 3WNBA 4N0QA 3RBVA 4Q3CA 2MSWA 2IL1A 1X15A 4J0GA 3R9XB 4QUAA 3LOQA 4WACA 3KB6A 5FQNA 1AM4D 3DLPX 5HGJA 3ODPA 1T5LA 1NP3A 2X3UA 4S1VA 3SJCA 1JG6A 3SZ3A 3CLVA 4EB8A 4L3WA 1Q0ZA 1X7WA 1TEVA 4D0GA 1DDGA 3QKIA 5DF1A 4O3MA 2FVYA 1YZVA 2ADOA 1HT3A 2XMZA 4CE6A 4CLOB 2VPWA 1P0QA 2D0IA 4GPEA 2G1PA 5IUNC 2DR2A 1G4HA 4QASA 3RRYA 2RC6A 4OI2A 4X1OA 3WWPA 2WK1A 3F4KA 4X3PA 5TC4A 3U7HB 2AK3A 3FSGD 1HLFA 2VBFA 3UV6A 2ODBA 1QAOA 2NPOA 1V39A 1JIQA 2NSYA 2P2LA 3AY3A 3OFKA 4RVFA 3RIYA 4D2IA 4HK4A 4M0PA 3TQCA 1UXGA 1K6EA 1Y48E 1NDQA 4OU5A 2CNKA 3I0MA 2DP4E 4TLBA 5T4BA 4CN9A 1AURA 2ACVA 1Q0PA 2B3DA 4NCIA 1YQEA 4YRLA 4ZMRA 3P4UA 3USCS 2WNHA 3VFDA 4TYMA 1FBNA 3ZX4A 2GNPA 2V4UA 5C0OE 3L7NA 1RI5A 3KFVA 4R1PA 2M6KA 4MV5A 1WVGA 3NC0C 3CGGA 1G18A 3C5HA 3WLJA 3A31A 1JT9A 4BTLA 3F8TA 3HM2A 1U2DA 1K0FA 2Y71A 2IHVA 3KOXA 2IY9A 4IJQA 3VH2A 5I7VA 4HY3A 3BFPA 3FUWA 4G5FA 3ADOA 3ETEA 2D7JA 1WR8A 3A04A 3RS4A 2VK8A 3VHQA 4AWBA 3P2MA 4RV4A 4DCUA 4ETWA 1K89A 5JS1A 1SOUA 1GVNB 1V25A 2RGDA 3X1XA 2CB9A 3JQ7A 3NM4A 1X6VA 1I33A 3SVZA 3LBIA 3OIFA 2H6EA 3GEEA 4R84A 3RHFA 1ID1A 1JFFB 2ZBEA 3K70C 3PZBA 4N0EA 3KLNA 2PU5A 3D6VA 2P4UA 3JD3A 1HEUA 1GL3A 3DPIA 3E35A 4HYYA 2BI7A 1KAHA 4P84A 3B6IA 3IUSA 2WUFA 3KR9A 5FYDA 3WJ7A 4AMGA 4LFAB 3AM1A 4R51A 1LX6A 3IKMB 3N1UA 4FEEA 4MIKA 1D0IA 4WGFA 3BWVA 4R9UC 4ILKA 4BMNA 3JQDA 1A4XA 4LSZA 1R0KA 1TQ6A 3B5EA 1JHUA 3SY8A 3UPDA 3QQPA 1I3KA 1TNDA 4DVJA 1H6DA 2OLEA 1MIHA 4MI3A 3CY6A 5D6NA 3BXHA 1FFHA 3UMSA 3VR6H 4I5EA 1UMBA 5JRJA 2X7HA 3EGDA 5LZ7A 1W29A 3ISJA 1CJCA 4RVHA 2FWAA 3RBAA 4MUJA 4WUTA 5KU1A 4LJLA 5EIEA 1JG3A 5I6DA 2G9QA 2DJ5A 2Q2VA 3ZZNA 3ZJVA 4R40A 3KVOA 3DXZA 2QUHA 1LNQA 1Y3DE 2PX0A 1LJUA 5F21A 5GAJA 5ES3A 3TD2A 3DKRA 3T9AA 1QCYA 5J23A 2FUEA 1YKGA 5ALFA 1R27A 5I01A 1VM6A 3D6JA 4PNPA 3BL5A 1SQ5A 1W87A 1XX6A 4XIGS 2BGKA 1A0OA 4MP6A 3GYGA 2CYAA 1LK0A 1HF3A 1R0ZA 2PZFA 2XGSA 3KP1A 3LVRE 4QPNA 721PA 4RQAA 3AEYA 4K88A 4R41A 4TKZA 3A6LA 4QUGA 2AVDA 2VIIA 2JIBA 2HCRA 5JW6A 4IFEA 4G41A 3TBHA 3SZMA 1BFKA 3V4RA 3HJCA 3BGIA 1ZNYA 4UEQA 3AIIA 1HLGA 3AU8A 5A06A 2OC4A 2BZ0A 1Z34A 3KT0A 3EXG2 2GD6A 3GFVA 2P2NA 7REQB 1OI3A 4I66A 3EGDB 4B4UA 4Q7EA 2W6CX 2QQFA 2ZYUX 1MO5A 3BERA 4FOSA 4JJGA 1GLGA 4N8SA 2H9YA 4YTEA 5EQJB 1DKLA 1P4HA 4V03A 3Q6MA 4NBTA 1YB7A 2CHVA 5JJKA 1EXVA 3H42B 1XRPA 1RXSA 1JQAA 4LYDA 1L4UA 1TGYA 4RK0A 1WCIA 1J8YF 3ANTA 3E9CA 4U7TB 3VJKA 4W8OA 5LD2C 3GROA 1EDEA 1P0CA 4LKOA 1ZL2A 2RHWA 2P9YA 3SJBA 4MVJM 2GA9A 3BMCB 2FEOA 2ZIXB 1P29A 5DTMA 1T1IA 3JYHA 3IVRA 2FPXA 3MIZA 1YUBA 4N9QA 3DBRA 1QVRA 4KLCA 2QG4A 3EDCA 5A6SA 1O6FA 1TMKA 3FJYA 2ZSEA 4LWOA 1PWXA 1YZTA 5AKZA 3T3HA 1M3SA 2P9TA 1V8DA 3QF4B 4CTOA 1CEEA 2IA5A 3JALB 4X63A 1P9NA 1RZ3A 1VMKA 1UDRA 2OR3A 4V0MA 3LLVA 4FJ1A 4I08A 4J1QA 4QULA 5ALYA 4ZRDA 3V55A 2XODA 2ORED 4IEIA 5DPMA 5I51A 3EC1A 1WXHA 4BV2A 1QVWA 3P19A 4PRZA 4ESOA 1C1DA 3NAGA 4AB1A 4B79A 9LDBA 1YSCA 2EFEB 2GJSA 4HLQB 2ID7A 3R6WA 5K0GA 2ZWOA 3ZUGA 3B1FA 1ZXXA 3OD1A 4RVCA 3WWDA 3G0IA 5EJ7A 4V0QA 1JKIA 2ERXA 1CT9A 5GP1A 3D7MA 3E1GA 1MW8X 5HM8A 4EPYA 1GPNA 4JVMA 2JPDA 3AOEA 4ZWNA 5C7LO 1GM5A 1L8QA 1UDBA 5C7OO 5AVYA 3GYBA 1JLKA 1KEWA 1XMXA 3E7DA 1O6ZA 1PK8A 3GRPA 1SHLA 4I50B 1AGNA 1U0HC 2VHYA 3ZDDA 1WMFA 4ALKA 1J1IA 2WSSA 3RRNA 4U9IS 3E5RA 1EWRA 1LDGA 4GGMX 2I9PA 1EVJA 1F06A 4RHYA 2PLRA 1LLUA 3ECAA 4L28A 3ZWKA 4L6CA 4C22A 2CL7X 1TM3E 1RYZA 5KSOA 2O3QA 3OFNA 1J07A 2NW6A 5ELXA 2V8OA 4DJDC 4DUZB 1MMFB 1F1BA 1L6IA 1XNJA 3HWSA 3UXHA 3RU9A 1V9SA 2FQYA 5EWMB 1JAXA 3WZMA 1BD3A 3FOZA 5I7OA 3UN1A 4MVJG 1I1HA 5B4UA 3UTDA 1EFAA 3WGHA 4QDZA 4XFDA 1MJNA 5DRTA 5A71A 1KO5A 1BC5A 2IT1A 3N7TA 1G0NA 2O1SA 4PV7A 3VAAA 10MHA 1C9MA 4XCVA 2DBQA 3NEPX 3RV3A 4KN8A 2AKAB 4PHCA 2Q1UA 5AXCA 1S2DA 1K68A 1SWVA 3ZK8A 3WNZA 4AJNA 2OO5C 4C6TA 4DL9A 2ILVA 4MHSA 1X87A 2OHIA 1X8XA 3IBCA 4ZKEA 3F6SA 2NP7A 1MKYA 2LGJA 4Y6OA 1FQJA 3ZWDA 1F3LA 2J9ZB 4A6XA 4B17A 1AY0A 4EHNA 1FBTA 1BXRB 1E89A 2HMYB 3ZYZA 4P3NA 3UAVA 1JG4A 1H2FA 3E0QA 4A10A 4BEVA 3CVWA 3TOVA 3S0JA 3A4IA 3KJNA 1IULA 3KL4A 2GAIA 4MQ6A 4QE3A 4S1TA 3WRWA 2WJAA 3CE6A 5JC8A 3ZK7A 4IVQA 1H2WA 1I6KA 1OIVA 1ZM9A 3EY4A 3K16A 3KX2A 4B71A 5BYBA 2P2CA 3SIXA 4EEKA 2IWRA 1AUXA 2BFOA 4JI2B 4GL2A 5BN3A 1FDTA 4MR9A 4BKUA 1JQ3A 2Q27A 3ZBPA 3WV5A 3LE8A 3NT2A 421PA 3FNFA 2W2MA 2X6QA 4LZAA 3SWWA 1DHTA 5EKUA 5EFOA 4QQRA 4KP7A 4LFCB 2IKQA 4HZUB 3TKLA 4BRWA 1PZNA 3C3KA 1JAIA 3PEEA 3RK0A 2BKVA 1EI9A 2IEYA 1XV5A 4GKJB 4NPCA 1IQRA 5AT1A 1NULA 4CQMD 4F11A 3O8CA 4JXZA 5IBRA 5AIAA 1WCV1 3L8ZA 3ZW8A 3FA2A 4KV9A 3TSOA 2EW8A 4CUKA 3AFOA 2CC2A 4I36A 2VNAA 3PD0A 1T9ZA 2Q0QA 4WLNA 2QGFA 4BBAA 4QT0A 3ETHA 1NXWA 5H9VA 1PP4A 1EFUA 4R54A 1YS4A 2X3YA 3E9NA 4EYKA 2VI5A 4ZEVA 1T9GS 2CFCA 4Y2XA 5IWCA 1S8NA 1R8XA 5TPWB 4YGXB 2I8AA 4R7ZA 5EIBC 4JGBA 1Z7YA 3D4NA 3PFNA 2JVJA 4JLJA 5IFLA 1ZA2A 2JFZA 1XTPA 2HXGA 3V4LA 2H5IA 5EIXA 3R40A 4MKIA 1AZSC 2Q8PA 3E18A 4UVEA 2Z4SA 3ZWMA 3IURA 5GY7A 2QMYA 5ALVA 2PGIA 4XYEA 4JJKA 3JSXA 2W83A 2LDXA 2Z4RA 5EZQA 5JMWA 1Y5RA 1VYVA 1NE7A 2ZIWB 3CSUA 1GU1A 3QYPA 4MJLA 1LU9A 4CLDA 4EFMA 1U3UA 1IPEA 3KZMA 1N25A 3SVLA 2F43A 2YYYA 2I4IA 3QRWA 3W3ZB 2W8ZA 1DQYA 3D6MA 3VRHA 2C8LA 4ZOCA 1I7LA 4YC7A 2UYYA 4AP9A 2GBIA 4N47A 1O94A 3ODGA 4LWQA 3R8XA 3U7RA 1A04A 1T8TA 3A3NA 3BPSA 4AY5A 1TCVA 1UPTA 4EI2A 3TOZA 4E31A 2HK9A 3OSUA 3KQSA 3O93A 3OPYI 4X9XA 4EG6A 5A05A 4BBPA 4KRYA 3B3AA 4DIEA 3R20A 1C8BA 3IAS6 2XUJA 1XTVA 4XAQA 5LKRA 5IM4A 4FOPA 4P7GA 3MS2A 5KSZA 2WAOA 1ZPDA 4YDRA 3TQOA 1GQOA 5EWLB 1A5ZA 4G37A 4PBSA 2VUIB 1G5HA 5IP5A 5U4XA 5C1DA 2BGLA 2J9RA 1DBWA 1V43A 4Y2GA 1YOVB 4KXUA 2RH4A 2FPIB 4BMXA 3UB4A 1R9GA 3QKRA 4KYUA 2HLHA 1PQ4A 4QXRA 1DCMA 4B4VA 3JD0A 3OP1A 3X1WA 2D2EA 5A0FA 5C4MA 2IUTA 4CMGA 1AQNA 4J7XA 3HKDB 4WZAB 4X62B 1TK9A 3CPJB 3IPXA 1J0BA 3CBGA 2CDBA 2EFGA 1TAGA 2MSLA 2R6JA 1O9GA 1Y4SA 3MMSA 4I5IA 5I9TA 2CV1A 3ZY6A 2ZJ2A 1XJQA 3VTKA 4W5RA 4K3VA 4UNSA 4KNVA 5CTJA 1KSGA 1FUIA 2ZBGA 1BZYA 5IF9A 3DONA 2OCIA 2I67A 2JCXA 4FEGA 3KYDA 3OQMA 1WY7A 3PT9A 5GJVC 1EM6A 5KQSA 5DM1A 1J1UA 3IEPA 4L3VA 4NAUA 1T13A 2UUOA 2OAEA 4CEJB 1IN4A 2FQQA 2QMUA 3L05A 3DT9A 3EVCA 3MT0A 4NH0A 1DRWA 5BNZA 3MOIA 3QHPA 5DI3B 2F7SA 3QTLA 2AC2A 3BT7A 3HS3A 2IZOA 2AI2A 1OH7A 4NY1A 1XALA 3K8OE 3DE3X 3IP9A 4BX3A 5DYGA 5IJ0A 4DHEA 2ERCA 5BMVA 5CVEA 1LPNA 4TWBA 1RXVA 3UGKA 1AIPA 4ZEWA 1R1DA 1L5NA 3U3ZA 2VLIA 3H8WA 1KF0A 1Y4AE 3N2KB 5JH7B 1PFQA 3OCWA 4NP6A 3PA6A 3X44A 1KKUA 2I6UA 2YFKA 3BXXA 1GG2A 3FCYA 3GGDA 2W6NA 3TS1A 4YP9A 1BE6A 1RQNA 1Y6GA 1EH5A 3DC2A 5C1PA 3TR6A 2UUBB 3MJRA 2R8XA 3AC0A 1SQ6A 2IV7A 1S02A 1E3DA 3GLFA 3CNHA 1FRVA 1NM5C 1NN1A 1J2RA 3A10A 5ERYA 1NKVA 1Q0QA 1CLEA 2Q0XA 2GEUA 5E9AA 3TSAA 3W3AD 4EYOA 4E4TA 1QX3A 1XJ0A 3AUAA 1VSBA 2JGAA 5TEVA 3LM8A 2PPVA 1YL6A 3FPJA 4LDJA 1B8PA 1CB0A 5M3BA 4WWHA 1L3IA 3KK0A 4X8MA 4CFYA 1OBCA 3THOA 2CBXA 1RDFA 1KORA 4M1TA 4M1QA 4PO8A 1QP8A 2R6ZA 1IZ9A 1N6IA 3AFNA 3T7JA 3CZAA 3HKEA 1KO7A 2QGNA 2B8WA 4YMIA 5I7SA 3EJWA 4F71A 1DQZA 1Z9BA 1OU4A 2EFYA 2JCSA 2JZCA 2BGIA 2H7CA 1QIIA 3W34A 4V1CA 4OXRA 1RLMA 4IR7A 2HRDA 4Y2YA 4O02B 1P4GA 3L06A 4YXWD 2ZUDA 3NALA 2RBEA 3QVOA 3O8BA 1Q0SA 1XPRA 5A1JA 3I45A 1QK4A 3R0ZA 2PRKA 3K15A 4P81A 4G67A 2O14A 4JP3A 3P8ZA 1IHUA 4L02A 4ZYLA 5D3KA 4HLCA 3R5XA 4QU8A 5T57A 4F2GA 3I4FA 2SECE 2X3FA 1UDCA 4U7WA 3KKPA 2ONKA 2O7VA 1HEIA 1MT0A 1MAAA 1UCFA 1XDGA 4ZJUA 1OH8A 3B38A 1G8JA 3GFTA 3K31A 4ZN6A 3HP4A 3BKWA 2YHBA 3ZTWA 4ZOQI 5B4VA 4EABA 1KYTA 4L8LA 4N1AA 3VGJA 5KTNA 3PHLA 2D59A 3DLCA 3RWOA 2J4CA 1NA5A 2CZGA 3LSYA 4LYHA 3HYSA 1BNCA 2BDEA 4M1ZA 1M74A 2YXNA 3T94A 4CMHA 4DHWA 5HVNA 4PHTA 4PX2A 1F6BA 4MUEA 1E1RA 3MHPA 3DCIA 4W82A 5KNBD 1Q6YA 2GYUA 2WWTA 4IIJA 3LT4A 4JVNA 3WL3A 3INNA 1MPTA 5IC4A 3N3BC 2O8FB 4ZDJA 2J0SA 1F3OA 5A7HA 4RVOA 2JFXA 1DC7A 2CHUA 3DJFA 3GFBA 1L5GB 2OT3B 1US8A 4M8LA 2O8NA 3PKIA 3V1YA 3DZKA 3IP3A 1ZGJA 2BHSA 1YQTA 4UARA 2OLKA 1JXOA 1RZVA 3AK4A 2WVHA 2WU1A 3DZHA 3L6BA 5K8JB 4NENA 4IDEA 1LDMA 3IXLA 2I6TA 4FTWA 5DK4A 3U4QA 1IMJA 1DSSG 2ATXA 5EL0A 3R8FA 4D8VA 3KIPA 4R9VA 5KQMA 1YI1A 1PS8A 3OWOA 4PCUA 4WKCA 2Q1SA 1SQ0A 4YJDA 3TW6A 2QUAA 4B7ZA 3FMGA 2JFOA 5F1PA 2C9DA 4AD8A 2A4KA 3E7FA 1JSCA 2L82A 4NL4H 6AT1A 4IQ4A 2H11A 1AUVA 3L02A 2HF7A 3PQ5A 3N70A 4F84A 3KTDA 3RFFA 4IDBA 2CLSA 2XUKA 3IT3A 5SY4A 1O4VA 4UU1A 3ZHZA 1DJLA 1HXHA 3DL7A 3LHKA 2JLZA 2RMKA 1U6KA 1DTEA 3EASA 5H59A 4HJRA 4TKLA 5EQDA 2AR7A 2FP4A 3UO8B 1RYMA 1VFPA 3Q0IA 4JNCA 3GFPA 2UZ4A 3KR1A 5AI0A 4JOSA 3OF5A 3VXKA 5JYCA 4GP9A 5DTEA 2C9MA 4G5HA 2BGNA 4H59A 2XF8A 3OETA 2GCOB 1WZ2A 2NPIA 2PSHA 3QX8A 4O4HB 3TNDA 1OW3B 2QN6A 3A2MA 3JYNA 4M1EA 1WDTA 3PQ4A 4U63A 3LK6A 4K2HA 1J2UA 4H08A 1CR6A 3B70A 1CQIA 3QMVA 4Z0HO 3ZW7A 1BVUA 1TM1E 2KB0A 3FB4A 4ASUA 2YMMA 2JHCA 4RIGA 5L4SA 1E79A 4FLEA 3S2GA 4D44A 2Y1WA 3FLEA 4GKAA 4CMJA 3NC4A 1HQDA 1I10A 3FUVA 3WSWA 1K7YA 3E81A 2HX1A 3OLXA 1ZJ4A 2FU5C 3NDJA 1SCIA 5FI0B 3OIVA 1Z07A 3V7FA 3LDFA 4I4TF 1E9EA 1AH2A 4NNPA 4P92A 1NW6A 3TLZA 2CLEB 3OLYA 5EXTA 3HBJA 3ZV7A 3DMPA 3RS8A 4CKWA 3VZQA 1U2EA 5DTIA 1L1EA 1Z2OX 4QU9A 3LBFA 3MWEA 3P32A 2Z30A 3ZHCA 3PJEA 3S99A 3DAHA 5JCZA 2YTZA 1UH5A 3S5UA 3RS3A 3PUYA 4RZXA 3ESRA 1EAMA 3IQXA 2OK8A 3RVQA 4D9FA 4E08A 2E1PA 3FR7A 4R2JA 4KDCA 2EC5A 1EX9A 1OLXA 3EEBA 5D84A 1W581 7YASA 1MNAA 1KKMA 3R3SA 5AM4A 5K3FB 4CV2A 3STVA 2N46A 2FAXA 1JS1X 2YY5A 4RTQA 5L4LA 2ZXFA 3I2IA 4L0QA 2XECA 3IJEB 3NHRA 5DHPA 4BMYA 1J49A 3DTVD 4FHZA 3DYBA 1XRRA 4H7JA 1C3JA 3R9IA 5FUWA 4HVTA 5G0SA 4W1SA 3I2YX 4JI4B 5JRZA 3F8WA 1IN6A 1JG1A 5LZ2A 1Y5IA 5EJ4A 4I14A 1KY4A 2BAGA 1FLDA 2P69A 4HJXA 4TZTA 2I2BA 2ZPAA 4O4JA 2UXDB 2BGGA 2NU8A 3ZVKA 3VR2D 4CIWA 1RXIA 1H4VB 1KZ7B 1VSUA 3HI6A 3MK31 4LHSA 5AW2A 1OXBB 2RGEA 3NASA 3NAQA 3W5SA 2WDPA 1KE2A 3G8BA 4EFLA 3CNNA 3O1HB 1WB4A 3CJRA 1P3JA 4JR2A 4M1YA 4WZAA 3DFZA 1T0HB 4UEKA 3H2YA 2B69A 3WGLA 4AKGA 3NG1A 2XYHA 1UC4B 3EXAA 5K8TA 4H3KB 5BSEA 4L1KA 1V1RA 1T6YA 4AKSA 4FFLA 4HNTA 3OM8A 1HE2A 1MBZA 3N0WA 1UZUA 3K2EA 4BYGA 3GP8A 3PCTA 4AJ2A 5EJGA 1RJEA 1YR8A 1CY8A 4QG7A 4FFPA 4MJXA 2NZ8A 5LBUA 4MGKR 5BV8A 4TZKA 3BSWA 4RD3A 4L4YA 5AH0A 4JC4A 3ZBUA 2CHEA 1CXZA 2IEDA 3HKBA 4Z53A 3QE2A 2GM5A 2QGZA 3OT5A 4M9UA 2WU0A 4WEQA 3KSBC 1BQ3A 3R2JA 4HH1A 1IFXA 3AETB 4C78A 4H0FA 2A5LA 3AEZA 1Z0AA 2PO7A 2GNAA 4US2R 1WNFA 1WAMA 5AW1A 2YHIB 5LIRA 2WD9A 4ZYXA 4XM2A 2O8DB 1XBTA 1QZXA 2NXJA 4HDOB 3ROGA 1X3SA 2HWXA 2HA3A 5GV7A 1ND6A 4D6YA 4E13A 3BZWA 1S3FA 1XQ9A 4YB8A 1ZOSA 2Q9AA 3DEKA 3ZHOA 2GCPA 1TMYA 5T7BA 1RLIA 1SK9A 2GPJA 3FCSB 4QFBA 3FUCA 1V4VA 3R75A 4AJPA 5DHFA 2RK3A 3DDCA 2R1VB 5EYPA 1VI6A 4Q6WA 5AJTA 2Q4TA 2FFJA 2GUWA 3IAAA 1V48A 2NU8B 3A1FA 4G8JA 3M1YA 2IUYA 1U0SY 4JIGA 2E21A 4OY3A 4UCQA 5FA8A 5FV7A 4A2WA 4HAUA 3KKLA 1E20A 1CX9B 4N5NA 4E7PA 1DJOA 1PW7A 1QHGA 1W5EA 2QZ9A 4EUKA 4EVRA 1K98A 1BOOA 3NM6B 3GP5A 3RBXA 1XZIA 3T52A 4ZZ1A 2D2VA 1YA6A 3OZAA 1XELA 4JOQA 5BXQC 3BQNB 4W1PA 2XE4A 1V16B 1DT5A 2VHJA 3ASVA 4N3BA 2DULA 2R4TA 3IAS1 1GKYA 4QRDA 3RAJA 3IVMA 3W5CA 1QRRA