4YLYA

Crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
198
Chain Sequence
MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGAYTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETSRFDHVMNEFNGEVKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of Staphylococcus aureus peptidyl-tRNA hydrolase at a 2.25 angstrom resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 62
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4ylyA00
3OFVA 4LWQA 4JC4A 3KJZA 3KK0A 3P2JA 2Z2IA 3V2IA 3TCNA 4QD3A 5IVPA 4Z86A 4DHWA 2MJLA 1RYBA 4OLJA 1RYNA 3TD6A 3TD2A 2Z2JA 2JRCA 3NEAA 4FOTA 4QBKA 5B6JA 3VJRA 4ERXA 3TCKA 5IMBA 2PTHA 2NAFA 4YLYA 4FYJA 4P7BA 4IKOA 4HOYA 2LGJA 5IKEA 4DJJA 4FOPA 1RYMA 4ZXPA 4JWKA 4QT4A 4JX9A 4JY7A 4FNOA 5EKTA 2Z2KA 4QAJA
chains in the Genus database with same CATH superfamily
4L5AA 2XYHA 5IJ9B 4DDMA 4RH0A 4U3JB 1HT1E 1G2QA 2VDOB 3HTXA 5JJIA 4FEEA 1J0BA 1OR8A 2R8XA 4XUCA 3JQ7B 2E5LB 1XHEA 1WCIB 2C57A 3AVTA 1M73E 1B14A 1C7EA 3BXHA 4OQPA 4QPDA 1NATA 4FLFA 3RJ5A 1NXTA 1HURA 2BEJA 4WFJA 3I8SA 1BU5A 3UK6A 3GIWA 3L0CA 1F3LA 3KEGA 4AJNA 3FSRA 1PW5A 2HLDA 1AHNA 4K8RB 2GEVA 3EUAA 4DCGA 2O2YA 1NTRA 3ML1A 5EOVA 1XELA 2IYXA 4G5RA 2OCKA 4INPA 3F4KA 3ZHYA 4BNFA 1I5RA 4K40A 1Y6JA 2EVWX 4HUTA 2C0CA 2OXFA 2QW0X 2OQRA 3C7DB 3VH2A 3WK5A 3BX1A 3II6X 1NBMA 1F0PA 4MQ4A 3ZBPA 1MEEA 1BCRB 1PJ3A 4C4RA 1E0JA 4C21A 3R7NA 2K6GA 4NG5A 5SICE 3VH3A 4P36A 2PV0A 5E9AA 4HNAA 4LHXA 3ZGLA 1EWQA 3BJRA 3K0EA 3GEGA 3SOZA 4PGHA 4FZVA 2XB8A 4G0OA 4QYMA 2JFWA 3PUHA 1B73A 2I6QA 4O8ZA 4R81A 4MR9A 2H16A 2O7VA 1QQ7A 1Z4JA 1KS9A 1Q50A 4RPLA 4F38A 5FWXA 4LQLA 1R0LA 3CXRA 4KBFA 2PD3A 2HRDA 4HQKA 5LP6A 1CUVA 4XX0B 1T2UA 2B78A 2OB2A 1IEQA 1ZD4A 2G3YA 5B3LA 4QAJA 3FTFA 5I9SA 4W4TA 4BGDA 1R5NA 3WGJA 1W2WB 3D1LA 4N3NA 4OYLA 3TKLA 5MHTA 5CB4B 4FFBA 3WA7A 1HK7A 1FFYA 1TAGA 3JZMA 1BKDR 1ENYA 2J9YB 4Y2RA 1ONOA 1EUDA 4IMRA 1FMLA 5LA6A 1Y8RA 3T9AA 4C04A 3B3QA 2XHZA 1ZNZA 3T99A 5HQ3B 2DP4E 4Q4HA 1JG6A 3ZHQA 1CRZA 1PYGA 1YB4A 2H1WA 3GEPA 5FBZA 3WRYA 5CVDA 4LYEA 2V0GA 4TWRA 2R7KA 2VT3A 4P93A 2Q3FA 4GQIA 4TMXA 4V03A 4PR0A 3C8DA 2WWVD 4HRXA 3C8ZA 1SB8A 1KAMA 2TS1A 3UWSA 1SXJC 1SHLA 3OFVA 3U56A 2VHJA 3N39C 4KLRA 1N3LA 3ZCVA 3HN2A 2FUG6 3SR4A 2H07A 4WZZA 4X1IA 1QE5A 1RWXA 2F00A 3RNLA 1RQ2A 3MEQA 1SUWA 4BVHA 5BY2A 5K4HA 4M0LA 1GOTA 4NYMQ 3TNDA 4GR4A 1LI4A 4MVJP 5DNAA 1XA4A 2P1DA 2Q50A 4JOSA 1T4DA 3BERA 4ZK6A 2ZYSA 3AWIA 4IIBA 1II8A 4R7TA 4LHSA 2ODPA 3HWX1 4WDQA 2E4UA 3WHLA 1XTSA 2PKQO 1GPBA 2IYTA 3KLPX 4IJ5A 3V7UA 4CKWB 1N8KA 3MTQA 5JS6A 5DYYA 2ZB8A 3P4UA 2P77A 1OW3B 3KYCB 4MV0A 3HRIA 1H4VB 2YIJA 2YMPA 3LDUA 4RX1A 4X9XA 2CDCA 4YJFA 3RO7A 3ICQB 1E1CB 2ZS7A 2V7WA 5EEHA 1BJTA 1E7RA 2Z2XA 3M9LA 5FBWB 3S6JA 1ODKA 4Q1BA 3Q9SA 1JR3E 4NE9A 4DRXA 3ETLA 1KYIA 3WVNA 1P1JA 1YB5A 4LRYA 4S0ZA 1L9KA 2Z8YA 4NJMA 4ZU1X 3W9YA 5JPCA 1LWNA 1NGSA 5B7PA 1A2KC 3DDZX 3D31A 3CC8A 2FHPA 1Z4QA 3BB1A 3OY2A 1R00A 5LLSA 3WYGA 2Z8ZA 3BTSA 2UU9B 4R1QA 4TTQA 1ZD3A 2IPNA 5CVEA 4CEJA 2BZ1A 4HGPA 3EGDB 1Y4DE 2N3ZA 2R7MA 2V9ZA 1YRAA 3ADOA 4TXNA 2I1QA 2DGDA 3QUTA 4IH9A 4W6QA 2MCFA 5EESA 1LK0A 4CM9D 4MHOA 3ZVKA 2GILA 2VSNA 2XMQA 4GC9A 1LBQA 3TNYA 4ZDIA 3OIUA 2AN1A 3E27A 2AQ8A 3I2KA 2XGGA 2ZRBA 4AJLA 2HYIC 1VJ0A 1CUXA 1TDJA 3PHJA 1JQBA 4WK0B 5A9TA 4Z4EA 3MW8A 4RVNA 1QZ3A 4EYGA 1QG6A 2QTCA 4IOJA 4XDYA 4EF6A 4URYR 3PLAE 3E81A 1SPBS 4IJMA 1FNSA 3MT9A 4PNHA 1PUIA 4II7A 3DSRA 3EXG1 1V2HE 2I9PA 1L5VA 4JASB 2HW8A 1KU0A 2YZ7A 3AB8A 4MW1A 4BFZA 4G1FA 4D99A 1V6SA 2Q4TA 4LFBB 2AJLI 4ON9A 5EKSA 3HE3A 3TL2A 2QTBA 3SLKA 2QUHA 3TIFA 2YOFA 3UF0A 1CQIB 5I9TA 3IP6A 4LY9A 4MYUA 2G67A 1X3LA 1F8XA 1PBTA 1PKXA 2HADA 3WLKX 1FP6A 1IEVA 3WGLA 4TV8F 4CR6A 4UBJA 3L8YA 1NYTA 1FFDA 2CCGA 4RO0A 4DJAA 1LX6A 4HNSA 4FC7A 4CG0A 4MUBA 4PZZA 4B8YA 5H4HA 4Q9IA 4L95C 4BMCA 1OASA 4OEHA 4GHWA 5B64A 1GDHA 1M34A 3C5CA 3UPDA 4JUBA 3QEMB 4PYMA 5JH7F 2YIDA 2BFEB 3I5AA 3UC9A 1QIJA 1RYDA 1U2EA 4Q18A 1I3KA 4EELA 5JYCA 2QD5A 1XCMA 5J1TB 1I3NA 4HDMA 3JYOA 4O1HA 3MSXA 4D9EA 1ZBQA 1I1OA 3FAZA 1U2GC 4ZAGA 3MM4A 1WVMA 2ZTHA 3OCWA 1TVMA 2YHUA 1HA3A 5HKKD 3UMSA 4X6XA 1J00A 4ZVNA 3RCBA 3BD8A 3IKLA 5EZ6B 2XCLA 2E4WA 1NY5A 5JWRA 3WMGA 2VYND 1WHTA 3MWDA 1SCNE 4OHKA 4Y18A 5DLPA 2IOFK 2OYRA 5KWSA 1G16A 1TT5B 3P19A 5JAZA 5K0TA 2BFAA 1GNRA 1CUIA 2WYWA 4KXNA 3W34A 1RW4A 3PRHA 5CW1A 2FEKA 1D2MA 4MVCA 1FNDA 1YB6A 4IXTA 3TDNA 3WLOA 1L5OA 2QT0A 2D5IA 4IFTA 4TTVA 3WYEA 3ZXIA 2CE2X 3OIVA 2VF4X 2XZOA 3F67A 3AUTA 2ZSDA 1COWD 1AUQA 4K9LA 1OU4A 3UCFA 2WTMA 4RKQA 1TD9A 2EWVA 1ZCBA 3BUSA 1Y63A 3H42B 4RTJA 5AYVA 4MW6A 4H7HA 4N3BA 3AKDA 3WFJA 3A1TA 3T7AA 2VK1A 1E4EB 3AC0A 3FNRA 1MW9X 1G3IA 3H13A 2GYWA 4ZRNA 3AJAA 3UAZA 5FTMA 4HEA1 1FXUA 4DSUA 2Q2QA 3KT6A 2QZZA 5KOHB 2PKWA 4CCSA 2FUEA 2V9PA 4RE6A 1JJVA 1Y5LA 4EG6A 5HKOA 3CBQA 1XRQA 4NICA 1LPSA 1KMCA 1MIHA 1BGWA 4OI0A 1RHMA 3GY0A 1ZH2A 5SYMA 3U9LA 3AI7A 3WQBA 3X2EA 3ZWNA 1M2NA 4RNCA 4IF4A 4Z99A 2YVQA 1OAKA 2JIQA 3FFTA 4CODB 2OXCA 2AG0A 3G2PA 2EFEB 2J46A 1E9BA 3M34A 4YR7A 1ML4A 5CH8A 1G8SA 3NDIA 3P9YA 3H75A 5ALLA 1HX7A 2PPVA 2P30A 2O54A 2C99A 3WIUA 2DB3A 1YE8A 2GJ8A 1LZKA 1R8SA 3ACCA 1VMDA 3IPXA 3QVGA 4KRGA 4XWTA 5AK4A 5HIIA 5L3ZA 3WZLA 2B94A 4OK6A 1CLEA 1YL6A 1ZO8A 3KL2A 2WU8A 3KTOA 1GRQA 3MUOA 3W5IA 4DQKA 1KFBB 1QK5A 4M0CA 3GT7A 2GD2A 1VKHA 3JYQA 1R6DA 1SVOA 2FQWA 1ZITA 1XK7A 3I09A 4BAGA 4COKA 4PVCA 2VWPA 3DBHA 4G5XA 4UPDA 1XCBA 3B12A 3TZEA 4QE3A 2CVZA 1YCGA 1Z5GA 4B74A 1MJGA 1U7WA 1E3DA 1YGPA 3D3JA 4MWBA 3U7RA 2H18A 1FQOA 3T06B 4ND5A 1QP7A 2CWWA 3KJNA 4FILA 5B1YA 2X23A 4INAA 1H23A 5FUWA 4F7DA 3HXTA 1JEAA 1V41E 3NVAA 3QY0A 5LMNB 3CTMA 4Q24A 3F6EX 4RVUA 1SUCA 4I3HA 4K1LA 5JVDA 1Q1EA 5HKKA 1HDXA 4DLXA 4BY9E 4AB1A 1ISMA 5KOIA 2DH6A 2W4IA 3B7WA 2WOJA 2X5OA 5JS1A 4LZWA 4J75A 2NNWB 5B6IA 2X3YA 3W2EA 4RJKA 3NIBA 2DEUA 1U0TA 4UPVA 1T3ZA 1GTL1 1RXVA 1I6LA 3URKA 1NMQA 5F64A 1M7HA 3NJRA 4ND3A 1XAGA 3NAZA 4HGOA 4NZPA 2BGWA 4ARIA 1N7IA 1MF7A 1CP3A 2ZRLA 2PMKA 4ZI5A 3OX2A 1T8YA 1OAOC 3MJTA 4MLZA 1FQKA 4I5FA 1KO5A 5IJ0B 4YJ3B 3GHHA 3CCBA 1JEDA 3AUSA 3PGKA 3QTLA 5KUTA 2CLKB 4MWEA 1DKOA 1S3IA 1N36B 1JBEA 1C7ZA 4WZAB 3H1PA 2XE6A 2VUHB 4RDHA 2I6FA 4CQMD 2X58A 1M0EA 2DQYA 3PB3A 2XVXA 2HMAA 5ISMA 2YFHA 1R6AA 2OCPA 3C3BA 4FEYA 4TTSA 3IMGA 1EFVA 4Z0NA 3TTVA 1E7WA 4DR4B 1IPHA 1Q0TA 4L27A 1RWNA 2DBYA 3IQIX 1QZXA 1AT1A 1D3AA 2VP4A 2PA3A 1BEZA 1ZK2A 4G37A 4URFA 3ZDDA 3MWGA 1G66A 3A6HA 1N7HA 4GXRA 1Z34A 4LRTB 3A1DA 1OV6A 3FJ1A 3AFMA 4LCEA 4YMHA 3LH5A 4LV5B 1QHFA 3KOZA 4HWGA 4BYMA 1E32A 4YYEA 3IQWA 3NKLA 4YO8A 3UOGA 4NCBA 2BHRA 2CNKA 4P98A 2OKGA 1Q2XA 3H1BA 4JBNA 4R8SA 3KX2A 2OGZA 4Q9DA 4TL9A 5AUOB 3IUBA 4MW4A 4FFNA 3HL0A 2YVLA 2X9LA 4NXMB 1CTQA 2EYUA 1Y5MA 1T9GR 2WWWA 2BV3A 3KJQA 3IELA 4LWOA 1MQ8B 4G1MB 3MGAA 4W8OA 2A1IA 1AB5A 4S1NA 3AERA 1X1QA 2HEIA 2XF8A 2ZWVA 5FQNA 1QNFA 2YJZA 5LZ5A 2FQQA 3TINA 4B4VA 4CBVA 4ITUA 4LZLA 1SBCA 1T1SA 5DHAA 5HP4A 1QLWA 4L73A 1QF6A 2D3WA 1PTKA 1QIMA 1P7ZA 2UV8A 3IQEA 5B2EA 1QVAA 5BNIA 4BATA 1RQ7A 1AY0A 1SM4A 4I4TF 3EDQA 5J5CA 1K0UA 3BDVA 1ZQ9A 3RODA 2VDRB 3OF2A 3GNSA 4ZMRA 3U7QA 5H80A 3LNTA 4JU8A 5CT5A 1ONSA 3C7KA 2Q7OE 4ED9A 1WR8A 5EZYA 1WVGA 4B3SB 3T61A 3Q6NA 1KOLA 3A3OA 4CTOA 2FWNA 1CDEA 2JATA 1AXGA 2NVBA 1M1ZA 1DWPA 2CF5A 3N70A 1GG9A 1QB8A 2NSHA 3BXZA 4O0MA 3BD9A 2OFFA 3VDQA 3WFIA 3H87A 4GICA 1EPUA 3AL2A 3VZBA 1N9KA 2O0KA 1E3EA 1FEZA 3FOWA 3FWHA 4C5AA 1XNRB 2O8CA 1UOEA 3Q98A 1WMAA 3DT6A 4OIMA 3KALA 5NLLA 2XB2A 1IY0A 2WVGA 3NEPX 3W0LB 2GH1A 3U26A 1M6EX 5AKIA 1KVSA 3I1YA 1D0SA 4RJJA 4EUFA 5L7TA 1L8LA 2WWRA 3N2IA 1MU0A 3BJEA 2ZBVA 1G41A 1EA7A 1GGNA 1V7ZA 2G1KA 4IIXA 5DTEA 3HDTA 3ZHSA 2TMGA 2ODNA 3E22A 1ZJ4A 1X8KA 3HSKA 2VCYA 4Q3BA 3DVLA 4M8IA 3SS7X 1JS1X 5ERXA 2ZIGA 1HEYA 5ERYA 2FRDC 1D2NA 4IIJF 2X4DA 4WESA 3SBOA 3LY7A 1UMDB 5FNVF 3OZCA 1I9CA 1SVSA 2A9VA 3LHSA 3QKRB 4HNAB 2EX4A 4MUJA 1NBOA 4YK7A 4IO1A 5G4LA 3S2SA 2W11A 3A6FA 3A1NA 4FX5A 4MDHA 5ELMA 4AKEA 4BTVA 1ZR4A 2Y0CA 1QHHA 2YOHA 2RHGB 1XZ8A 3O1LA 3MT0A 4BMPB 3EMBA 4GL2A 5FWXB 3QVLA 5D5HA 5EWJB 5DV9A 3IULA 3N6RA 4JU9A 3UW3A 3O2SB 5LP6B 1U1EA 2GNAA 4GPZA 1U9IC 4HP8A 1BA3A 4FT4A 4L28A 1GTJ1 2BM0A 3TB6A 4ZZIA 3COWA 1DV1A 2FN7A 1PNOA 4ZTBA 2ZRQA 4Q12A 4AF7A 4FFBB 4YCJA 3TCKA 1QBGA 4F5DA 4ZVSA 4DT1A 1YFKA 4MVJF 1YQWA 1WMEA 3CRNA 3C6ZA 4FYVA 3B48A 4L85A 3SMVA 5CM8B 1UOOA 2EJTA 1TQHA 2WHYA 3DL0A 3QVMA 1YO6A 3K16A 1C80A 3B85A 3DMTC 1A95A 4L5CA 3EYWA 3OCVA 1FVFA 3WI7A 1T5OA 1L0BA 5LQKA 1J1UA 4J0JA 1E2EA 5ALQA 4PZAA 4P7JA 4Q4HB 5CTJA 4HUQB 1VA4A 4FR5A 3O3CA 4N5NA 4PPYA 3WSVA 3EX7C 1W6UA 3NW9A 2QBYA 1TM1E 4IMIB 3B89A 3NT2A 2PWZA 1XD9A 3C15C 3L7LA 1NRXA 1BZYA 2CNWD 2O4UX 3MFYA 5ALFA 3CKYA 2WICA 3NT4A 3QI7A 5HF5A 3I9V1 2IA5A 3WLMA 1FMTA 3RSSA 3D2BA 4TWJA 3PGJA 1GKKA 3BMXA 2X1LA 3LC7O 2C7OA 2BC9A 3IDZA 1CD5A 4AI6A 1JKXA 1PJCA 2R11A 5LQCA 1CBUA 4OGFA 2W2TA 1V47A 2SECE 2XW6A 4X93A 1ISIA 4UVHA 1WDKA 4XYLA 1J25A 3L92A 4LS3A 5IKXA 4BLRA 1YFLA 1K63A 1TGVA 2GJAA 2HK6A 4GGPA 4ILEA 5DYWA 2JIOA 3KT0A 3L93A 3A9RA 3L7CA 3SQLA 4RTLA 1CUSA 1MNQA 3PGA1 4RS4A 5ALJA 5BN4A 3FYCA 4W5NA 2Z3WA 1DAEA 2J3KA 3CISA 5EJGA 4B81A 3FF1A 4KQ6A 2WDZA 1V95A 1IB0A 3MTDA 5TQ2A 2HF2A 1GD1O 4BLPA 2H1RA 4XFKA 5TGZA 3GP8A 3A9CA 2G88A 4RMNA 2ORYA 1AD2A 1WUYA 4G1UC 1AK2A 2CMFA 3L2OB 1TLFA 1DBRA 3OAAA 4UEOA 4BP9A 2QKYA 2V7EA 1YZLA 4MGHA 2TECE 4NJMB 1C1YA 4NYIQ 4ZQFA 4ZO6A 3ZVMA 4TZ6A 2YRFA 2KQUA 2X3FA 3OMXA 1N6NA 3SSOA 4O4JB 1A8HA 1EQUA 2CMGA 4P3XA 1UWKA 5ILGA 3UHAA 4CEJB 3BJMA 4EGQA 2XVAA 2GASA 4H1HA 1QHYA 2ZJZA 2VYFA 5CPBA 6NULA 4CETA 3V34A 4N8DA 3RSOA 1Y33E 3HYNA 4DB2A 1V5EA 1BKSB 2OHVA 4B35A 2I1WA 3ZGZA 2R1UA 2XKBA 1V71A 3V2UA 3GK3A 2VAVA 2PFSA 3CY6A 2H29A 4OJMX 3WZ2A 2Y05A 4V0NA 1USIA 3CYFA 1BRMA 3CVJA 4BNTA 2KLBA 3RKUA 1U8AA 1YZYA 1XWWA 3DL7A 3VDMA 1LK7A 1K27A 3AHHA 1YB7A 4O4LB 3TMKA 4WCVA 5K1ZA 3AVVA 1CEEA 1VE6A 3G2IA 4QBHA 4CIWA 4C0XA 2BGKA 5TJ9A 2Z2KA 4L0MA 2QAGA 3B60A 3C6MA 2RGNA 4GF5A 4F4UA 5BV7A 5H02A 2QVCA 2DE0X 3PXBA 3T7CA 1GFZA 5BOSA 1K06A 2QZ4A 5CH5A 4ZOLB 5H3LA 1PV1A 2JHGA 3CVYA 2DG2A 1SQSA 3LBIA 1R64A 1KYQA 1PJ4A 2QUAA 2ZBRA 4ZYWA 4U5QA 2J9GA 3UT5A 4U7DA 3LUJA 4TM8A 4Z4QA 1MB0A 1XMQB 1YZGA 2FGJA 1A5AB 3MHTA 5JDIC 2WAMA 5ICEA 4WLUA 2JZNA 4UEJA 1XFAA 4F4IA 2VPXA 1AHPA 1YJ5A 1D5CA 3V42A 3ZNPA 4J90A 3H7AA 3QWBA 5T4BA 1L4HA 2HR1A 5J2TF 1LDGA 4FMDF 3RB8A 1M34B 2BGUA 2ORVA 1ENZA 1N1GA 1NVTA 3I2HA 1I51A 4HYYA 3LFTA 4BLVA 1UBFA 2GLUA 2H9YA 1Q0SA 3E9CA 4F2WA 4P31A 4DA0A 3DZJA 3OE1A 2PRIA 1V4BA 3PFNA 2JZCA 3DXFA 4I3GA 2A0WA 5JAQA 2O2DA 1ZMXA 2ZUBA 4HVLA 3HP4A 4EPWA 4YLGA 4TV9A 3VZRA 3EIXA 3KR9A 2O7RA 1AF4A 5GGYA 2QM3A 4RHYA 2R751 1WHTB 3MWDB 3EQ9A 4GZ5A 3VX3A 2FHSA 3E9QA 3EMDA 2WTBA 1C41A 1BXRA 1ZJYA 3D7SA 1KXZA 2VPZA 1LC0A 3HP7A 3D3WB 2D8MA 5L51A 5ALEA 4HDNB 4UHKA 1HTTA 2GESA 2VF2A 2PD6A 3SJ7A 3KVRA 4EFNA 5F2NA 3OJXA 4Y8VA 1DADA 3UK2A 4GP7A 3ESAA 5C3MA 1TF7A 3AIOA 1WXQA 1WU8A 3BULA 3H5LA 3N1UA 4OLJA 3RRMA 1E2BA 4GPBA 4N0QA 2R68A 1SU7A 4Q4JA 3L79A 1EZ1A 4CFZA 4CYMA 2PGIA 4CNBA 2A92A 4Z7NB 3ZXUB 4Z2YA 2GYVA 3L4BA 4MKFA 3QTBA 1KJQA 2A9RA 2C2MA 3DW1X 1VYVA 2BFDA 4BX9A 4F2GA 4YV0A 1JKFA 1YUBA 3ER8A 2X86A 2V6JA 4G4GA 2NYAA 1TADA 4JC4A 1L1RA 4NEGA 5AOBA 3EPRA 3W1EA 3EPJA 1CRPA 3VO1A 3WK6A 2YZGA 2FW1A 2G9RA 2WU0A 1IBSA 3AR7A 2B6HA 2BPOA 4OFXA 1F3OA 2DULA 1WQ1R 3NC4A 2F8LA 4L8YA 1EE2A 2EFDB 3WLLA 4PRLA 1OZ0A 3H5OA 3K32A 1WUTA 4II3A 3GJ8A 3CEHA 4MS1B 1I4OA 1OBVA 1AQUA 4DMRA 1W7AA 2O8VA 2W43A 2DETA 4A73A 2ZW9A 2HL6A 4LEIA 1P3DA 3FWZA 1I6MA 1IHUA 3TLXA 1JDTA 4DCOA 2PU5A 3DFZA 4UD2A 4LSZA 1DX6A 3LGSA 3I39X 4PWYA 5BWNA 3WBKA 2WIKA 2WUVA 2VUTA 1GPLA 1TM7E 3NRBA 3P2OA 3U4DA 1E3WA 2Z98A 4L4XA 3FR7A 5EHIA 4CV2A 3WRXC 4ZVMA 2G9UA 2N9UA 2FEOA 1S3FA 2Y0BA 3DBHB 2JCVA 3IX7A 4EF4A 1L4NA 1R0SA 2Q6KA 4HX5A 2PZLA 2SKEA 1BIFA 3OZWA 3ZDEA 3LKDA 4AN0A 2IF0A 3S7TA 1XALA 4BRZA 3OQOA 3GCDA 4NV1A 1L5GB 1INLA 4F85A 2C5HA 3D6VA 5IHPA 3KWFA 3TPFA 1OJ7A 2QQ0A 1VBKA 4K9NA 4AUKA 4BLUA 5J47A 1G42A 1MXFA 2WPNA 4WSOA 3T5GA 2OCYC 3U4CA 3KB6A 4KQJA 1TUBA 2WNIA 5M34A 4I66A 5JVDB 1YRYE 3FPGA 1H0HA 1VHQA 4UUAA 1C9JA 3D7LA 3MILA 3KWLA 4GH5A 4NNPA 3DB1A 3OUZA 1E9RA 2TSYB 3QKTA 4PRKA 5B36A 5KWIA 3BFPA 1SEVA 1QIIA 1WZUA 2C4UA 3LECA 4OMFG 3A4IA 5A62A 3THXA 2FFAA 3C74A 4EATA 5MDHA 1UBRS 3L05A 3WYDA 2R97A 1E2PA 1DP4A 1B1CA 1SBHA 2WYUA 4KGXA 2NP6A 2ZITA 1SVMA 4WBNA 5LNK1 3IEXA 4KCGA 4ZZ2A 4XD7A 1RYNA 1UWLA 4FBLA 3ODGA 1P5ZB 3PFHA 4PYKA 2V4ZA 2YH2A 1X2EA 3PSAA 4Q3KA 3HNOA 2B2XA 1KDYA 1RJWA 2QUZA 5IWAB 5L8VA 1XKXA 1H2XA 2IW3A 2H3EA 3G85A 4RM2A 1EINA 1JHXA 1KMQA 1F0NA 1MQAA 1TQ4A 4NCIA 1DEAA 2WAOA 4Q82A 5LYYA 1EFVB 4INJA 1JG3A 1JHVA 2PKXA 1Z39A 3IE0A 4AQDA 4BQOA 4KYVA 2H4WA 1EK6A 3KTDA 5ARDA 2IYFA 4LWQA 1U28A 3W7BA 3WGZA 3Q1LA 4ECEA 3ZZ0A 1U0RA 2OTCA 3U0BA 5DX0A 3ZBQA 4US2R 1KZGB 2QRPA 1CIJA 3NYWA 1IY1A 1XJQA 1K7YA 2YINC 4QIHA 3K1ZA 1FFXB 3MN1A 3NM4A 4ZV7A 1NQAO 4RCZA 5GZ6A 3VPFA 1Y89A 3T5PA 5L7WA 2W42A 1LDNA 2Y1DA 4GQBA 1Y7HA 4NQZA 2VOJA 4QDTA 4RIEA 4YCDA 2HY7A 2V3VA 3OLYA 4O2AF 4UZSA 1ISJA 5JMPA 3P4YA 1Z36A 3GARA 5FFNA 1T34A 5BSGA 1GGKA 4WVLA 1EFRD 2V7QD 3B13B 5GAJA 3RS0A 3FMOB 2I54A 3JQFC 2UYCA 4AN1A 3UB4A 1JIQA 1V11B 3TQIA 1ILEA 1EK1A 4E46A 2C07A 1QO0A 3BVPA 6PFKA 3AERB 3B8EA 3ELDA 2ON6A 5BSKA 4UMDA 1H9BA 1KJ8A 1YS6A 3HYCA 3N59A 4GR9A 3VHQA 3NETA 4B48A 1KIFA 4K2HA 4ZHQA 2WVJA 5FIUA 1KAHA 4TV8B 5C7OO 4LHEA 2YIMA 1A5SB 4B8WA 3DZKA 4QKQA 3EDMA 3WGIA 1PN3A 3U7QB 3QI2A 2WIFA 5EZYB 1NIPA 2ZZKA 3UFXB 2GN9A 1E3IA 2ET6A 1T9DA 2KSQA 4G65A 4I9GA 4DV1B 4DSOA 1ZH6A 2I2XB 3KHUA 1MABA 4DCVA 2VF8A 3QG5A 2PIDA 4GNKA 3SI7A 1M8PA 2AXEA 1Q95A 4CL8A 4K3UA 4KDCA 3K1TA 5E4JA 4ETIA 1BDIA 2ZM5A 1EAYA 1NQTA 4DVGA 2O8CB 1FDWA 2DBZA 4HQ0A 4XB6B 1JJ7A 1HMYA 2HAEA 5E1MA 2ID4A 4GOXA 5J4HA 1QVVA 4K0KB 1VRWA 2XNJA 1QCYA 3HB7A 1Z5NA 2P9BA 3DWFA 5FPQA 4KWCA 4AS3A 4DIDA 3CFYA 4WZBE 3FPLA 1ZJ6A 5JSKA 3HU5A 2DTDA 2I1LA 3WMFA 3IP9A 5K3BA 5JCOC 3PXEA 3RYFB 2ZBQA 3TOXA 2PJRA 5LMUB 4D9KA 2OO3A 3E22B 3K9GA 2C2XA 1YVUA 4XZ3A 3WK7A 1J8VA 5HTOA 2FEAA 3AR5A 4CW7A 2P2YA 4RBNA 3UCEA 1NT4A 3VPCA 5GJBA 3E70C 3S1AB 2IYRA 1E6EA 5EMJA 1KWKA 3AETA 1V7QA 2YJGA 5H59A 1ZM2A 4QQRA 3CR3C 4DF3A 2HJWA 3BB3A 1QOPB 1H22A 5E95A 4B3IA 2IDKA 4O2BA 2HREA 1UJ6A 3SHQA 1C3EA 1VE3A 1B0ZA 1SBQA 4GZMA 3TR6A 3FAKA 4RTQA 3F74A 3GQBA 1QRUA 1N1MA 1J56A 2C0PA 1L6IA 1RKUA 2X4IA 4MRVA 4ZI7B 2B5VA 3FZNA 3GJ5A 3IP7A 1OBHA 3OECA 4HDQB 4W1QA 1PEDA 3OTQA 3IGFA 4FNGA 2FCRA 1XNGA 2Z9CA 4HOYA 2IC5A 3L7IA 4WCFA 5GONB 1UWCA 1NULA 3UGQA 2EGUA 5H70A 4RVCA 2GPSA 4LN1A 5BXQC 4J1QA 3I2GA 5I9NA 3E1KA 1ZW6A 3Q3CA 4K0RA 3DDWA 1EFRA 2V7QA 3PEFA 4DT1B 4N76A 2NUAA 2GLXA 3DOHA 3PGVA 4LG1A 2XCIA 1Z88A 2X5KO 3FTCA 4TX1A 1YOVA 4DLWA 2ESRA 4P84A 2WTUA 1SUAA 4ZFNA 2Z30A 1XE3A 3I12A 2FR8A 4D4GA 3S2GA 5I7UA 2J0QA 4UTZA 1YAJA 1X7XA 2OV3A 3O9VA 1M1NB 3SEZA 4MYDA 2VJPA 4B3GA 5IM4A 4CQNA 3EA0A 4OGLA 2AOUB 4UCFA 3B6ZA 1R0CA 3NTLA 1YB1A 1NC1A 3ODPA 3NB0A 1W1WA 2J0VA 2J59A 1GFSA 1CQXA 2X5JO 3O6VA 4AY4A 5FWAA 3LP5A 2IYSA 4HEJA 5H7XA 4EVSA 1R8QA 3E84A 4CIAA 2WZQA 3UJAA 4K2AA 1D1QA 1NR1A 1UBUS 3TTYA 3AEQA 1J7JA 1TYAE 3M2TA 2X8JB 5TPZD 5ITZA 2HCTA 2NG1A 1PVDA 5C51B 2NO5A 2R6ZA 1HXHA 4H3VA 1M8FA 1P4RA 2WIGA 3ETCA 1KERA 2IL1A 4BE4A 4OHYA 1N2EA 2GEDA 4F12A 2HDWA 4F4DA 1X7HA 4MRPA 2V03A 5IYZF 2JI8A 3EIEA 4NZYA 3JVUA 3TK1A 2PGJA 3AG6A 1PBNA 3UQZA 2Q4EA 5DGIA 3B2NA 4AS1A 3ZV4A 4Q3LA 2GN0A 4YH1A 3V80A 4QHTA 2NSLA 4KJZA 4F2PA 1LD3A 5D7NA 3IA7A 1LZLA 3TJMA 1ZL0A 2ZVQX 2GPTA 3H9GA 3H5TA 3SQOA 1W0KD 3E2MA 2BMVA 2A5DA 2RKBA 2WTAA 3FLEA 4YAWA 1IN7A 3S99A 5CEFA 5LQJA 4A2WA 4HQLA 1NYQA 3RWBA 1I30A 5C4GB 3EMKA 5TQ2B 3H9UA 4ENRA 4BNWA 4MKIA 5AD1A 5TMPA 3K0CA 3FUXA 3KE8A 4J7UA 3EZNA 1LDYA 1HT0A 3V6LA 3AVPA 4YRRA 1KIMA 4Q4CA 2EBHX 1R10A 5MGBA 2BH2A 1W46A 5IXJA 2CXUA 4ZCQA 2PVSA 3V2GA 2J7PD 2ZWPA 1U7UA 2QN9A 2ZB2A 4P4LA 3NTXA 3UQYS 5B3AA 3A4LA 1N6LA 2HWWA 3HJNA 3O9MA 3L0YA 1EAMA 1Y5IA 3JWIA 3N53A 4U8HA 5FEMA 5B58T 1R37A 1WBDA 3R3VA 3JAKB 5G2OA 2F8TA 3FTEA 4LC1A 1ID1A 2I6UA 2RHJA 2PUCA 2RARA 2Y1OA 1CJBA 2XQJA 2NO6A 1QH0A 2Z5LA 4NBSA 5AJWA 4EA7A 2AYXA 4JUFA 4L9SA 3FYUA 3GJ3A 3IAM1 4LZPA 3VGPA 2NNLD 5IKPA 1ZRNA 4MHTA 2A7XA 4A0RA 4AY2A 1SCIA 3FPFA 3E0QA 1V96A 3Q5DA 4UCWA 1T0UA 4QXQA 1TOAA 4G85A 3TR5A 3SC2A 3WX0A 1MX5A 1KETA 1U7HA 3PE3A 5BN3B 1GN9A 2WJPA 4HWPA 1PUXA 4NBVA 1QU2A 3NPMA 1QQ6A 3KB1A 4PGGA 5ALZA 3BXGA 3KS9A 1VGVA 3UB3A 4WY5A 1NXXA 4RTSA 5KNCH 3STXA 4UHEA 1V9SA 2W2KA 4IZHA 4ZVVA 3TKYA 2GBFA 1WSAA 2EP8A 2QAGB 2BFBA 4LSWA 1VG1A 2VDPB 2FOXA 2GA9A 1H3EA 3K96A 3NBFA 4PYLA 2YS7A 5KOJA 1A2OA 1I2AA 3M4XA 3NS7A 4LHYA 4TT8A 5DH9A 4ZVOA 4ZVRA 4Z4IA 3IVRA 5EHNA 4J2HA 3VVCA 3VNBA 2K7FA 3JQ9A 3UT5B 1X86B 5MF6A 1RWWA 2D13A 2X2FA 3V4SA 3GDGA 1G7TA 2IYEA 5H8WA 1E4OA 4YIHA 1T26A 4XQ9A 2PV7A 3BKWA 3IEPA 4EJ2A 3PVCA 1EX6A 4PSVA 3SYMA 5KU1A 3O7WA 3TL6A 2JLQA 4L7QA 1ADGA 1W581 2OOKA 2R1VA 1A4UA 4JB8A 1UJNA 4LDNA 2Y1EA 1U63A 3FNHA 3TRFA 3N7TA 2XDYA 4ZEOA 3A6EA 3S55A 1T0IA 4EUNA 1AK9A 1E79D 1PWHA 2UXDB 3OETA 5LCXA 5FOXA 1Y7LA 3O1JC 3W6OA 4F96A 3QX3A 3U81A 2OO5C 2Y6VA 4WA7A 2JHAA 4YXWD 1G8MA 1OBOA 2B69A 3GELA 3G49A 1QAMA 2WQZA 2FG5A 2FPRA 5CYOA 5BNZA 4URXR 4CI9A 3A27A 4L76A 3PQ6A 1AKTA 2QLBA 3MD9A 4BKOA 1DQZA 3GOHA 1DQYA 4X6UA 1LI7A 1V8FA 3I9OA 1BXZA 2PAAA 3K31A 2YXNA 1ZSNA 2CHFA 2FFQA 2XZDA 4G4IA 4J4HA 3S2IA 4YRSA 1TZBA 4QL3A 4MMXB 3DTTA 3L7OA 3QBEA 2PSJA 3ZWMA 1KRWA 1L5LA 1EGHA 1NUTA 1X7WA 1UP4A 3HCAA 2WJ4A 1OILA 1P73A 3IDQA 4D9BA 1KIAA 1LPPA 1A9YA 1J2UA 2PX2A 4LC9A 3BGVA 1QCZA 1QXSA 3DMHA 3TL3A 2JGIA 4X84A 1QX3A 2XVMA 3R77A 1MT3A 3GLGE 3IIJA 3ANSA 4M1YA 4DV4B 1JXMA 2FKNA 1OF1A 1ZIXA 3PL5A 5CA0F 3LF1A 2OHHA 1TTHA 3NKVA 1WS6A 2PTGA 3IAHA 4TMWA 3SZ3A 4BECA 5BR1A 5L3SA 4Q4JB 1F2UA 3HPQA 3OMLA 3ZZNA 4HPWA 1EESA 2B25A 4W8HA 3MRXA 3N7UA 3PI6A 3ZWYA 3SPXA 4YT4A 4RANA 4MI3A 4DCNA 2Q29A 4AZTA 2BGLA 2W6NA 1F7UA 4O6VA 3L01A 2CC2A 2B4AA 1WUHS 1E2KA 1JT2A 3M70A 5EIBC 2FMTA 1VFNA 3LL7A 1E0AA 4RTMA 1QE0A 1DBWA 5AKHA 2QHXA 4QBKA 2VRBA 1YQDA 4Y2QA 4F92B 2FN8A 4V3CA 4J4BA 1ZWLA 4QBFA 4YRZA 5ILOA 2FJ0A 1C9MA 3EB9A 1OA0A 4LSGA 4R1LA 3OQNA 3O0DA 1E18A 5F7XA 3DD1A 4A5SA 1IUNA 1BCSA 1J23A 4G5YA 5HQJA 5E7MA 3HDYA 5FYDA 3UJBA 5KB3A 2AZTA 3A7EA 3QSYA 1JDBC 2SCUA 1S1CA 1RPNA 2VBCA 1XI2A 2JASA 3OQ6A 4CCYA 3MMZA 2VHXA 5F78A 1PZHA 5IAEA 3S44A 4XUEA 4ZYXA 2ZT6A 7AT1A 3DTVD 1DO8A 3DFIA 4XEUA 2YNMC 2OLEA 3RYIA 4NOLA 1CEXA 1S2OA 1UZMA 2R7AA 3GOQA 3MK31 4M1TA 3HUEA 3TFWA 3LY9A 3CJRA 1HEIA 1X77A 3K20A 4FYXA 1ZXLA 5CIQA 4JQZA 3CPSA 2J6HA 3M4ZA 4FWTA 3MTEA 4DLUA 1XDDA 5TGDA 3RU9A 4CL3A 3OPMA 5JZBA 3O4JA 2QN2A 2PTHA 4OXQA 1E79A 4BN0A 4Y2YA 3QOFA 1F4PA 1Q1NA 4F6RA 1O6CA 4E6EA 1EUZA 1P62B 1NSTA 3L43A 3QP9A 4KWEA 2PUEA 1EWYA 4KNWA 3USCS 3Q9NA 1U99A 3RSLA 4X3PA 4B82A 3I05A 4M1WA 3ZWPA 1FDUA 1P2GA 1Z7GA 3N86A 5KVSA 4U02A 5EE9A 4KLNA 1ZZGA 2ATIA 3NCTA 1TUBB 3DTYA 4L3VA 4LPKA 1NJ1A 4LXTA 3ZXYA 1EE1A 4B40A 3BAFA 5C5EA 3VU0A 1OU0A 1ZXXA 3V97A 5AW7A 1XTBA 3C6KA 3L8EA 4DUPA 3ET4A 4KRFA 3GMTA 2B7LA 1GJRA 2AF4C 2JGJA 3PX2A 4MR7A 4X24A 5BSRA 5EIHA 2Y0EA 1GA1A 3THXB 2VP3A 5JXGA 1SCUA 3GCGA 5F9FA 3RK0A 4UUMA 2P75A 3FBGA 4OQDA 4BEBA 3ESYA 3HNRA 2PCLA 1VQ1A 3FOCA 4GPIB 4WBNB 1USUA 3LWDA 1Q3TA 5J9FA 2O3RA 3U17A 5CYFA 3CWCA 3T38A 2XNHA 2I4NA 1U0BB 4LFCB 5L40A 1E89A 2OE2A 3RDPA 2BI8A 1TTTA 5E1OA 4U7GA 3SKYA 3HWRA 5EEGA 1FVHA 2D54A 2P2ZA 1JLRA 1I32A 4Q1FA 2ISSD 2WIBA 3IAS6 2G6BA 2W6MA 3OHPA 3VM6A 1STOA 2ZUFA 2N0SA 2NXNA 4DPMA 2HV9A 2FWPA 1Z3CA 3QOXA 3C3PA 3I9FA 5A4JA 3ENNA 2IV7A 2G1UA 5EKDA 5HF8A 5BQPA 1WZ2A 3VRHA 3D3QA 1HG1A 2AF3C 1IZZA 3D54D 4AG3A 4IG9A 4ZO8A 3OTOB 4BNVA 4IVRA 5CT6A 2FSFA 2KX7A 4ILKA 2N1MA 4B3BA 3RUDA 2P2CA 4LMPA 1GDDA 4RY9A 5GP1A 5T4FA 5B30A 2P9YA 2YDYA 5KTMA 3HBJA 3RT1A 3FUTA 4AWAA 5LPNA 2ZJ4A 2PLWA 3VR4H 3B9PA 4BLSA 1TC1A 1YE3A 1W4RA 2UZ3A 2ZUUA 1CERA 1CR4A 4J6FA 5TQVA 2AFHE 4AF6A 1G1MA 2HOQA 5CR9A 3ZHUA 1RIIA 4D0NA 5K45A 2B2NA 1E0DA 1CSEE 1EVEA 2GCEA 3ZWVA 5IK2D 4AX8A 4LBYA 5LR6A 3AEUA 4QBIA 3SCZA 5LZ2A 2QGNA 5H3HA 5E8JA 1U7PA 3BXEA 4GXQA 4A16A 5K3SA 1TF5A 3ZBUA 4DLBA 3C3EA 4YBRA 4IL5A 4IMJB 4A15A 4WN9B 1N6PA 5JFTA 2ZPTX 2Q41A 3PSHA 3IBFA 4MARA 4BMVA 4KI7A 4G1BA 5H4GA 3Q8LA 1UDBA 2ZRCA 2MR6A 5D3MA 3KQLA 3SHTA 1H9AA 3BJIC 1VG8A 1MVLA 4JEIA 3HO6A 4UHDA 4WJKB 4B9EA 1TM2A 5CXQA 2O5RA 2DLDA 1WU7A 4HB2A 1YK1A 3AEKB 1UBKS 3QXSA 4QPPA 1HBJA 4ZVLA 4F72A 4MCHA 5FORA 3SYRA 2WSSD 1O57A 1NNUA 2AYYA 3DBOB 4IZOA 2ENUA 5DB4A 1G64A 2ZLBA 2EERA 2IEBA 4E6PA 1PX0A 2E6UX 3QUBA 4GM1A 4ZOBA 1UODA 2RK3A 3HBLA 4XGIA 2YWJA 3VHXA 1L4UA 1EJ6A 2OKCA 2O06A 1WX1A 3DVQX 3PFCA 3QU2A 5HRUA 2ADFA 1R12A 1I7DA 2V5AA 1RJFA 1CULC 1DCKA 5DX8A 1BAPA 1ESDA 1SUIA 5HDQA 4KITB 2CT8A 2A1TR 1Y8QA 1JZQA 1T9GS 1Y7PA 2BKAA 1SOAA 2FLKA 5CXSA 2BT4A 3G7UA 4PC3A 1OQAA 4Q37A 1FNCA 5DM1A 3SLGA 1JUDA 2G8NA 5LQUA 3MNFA 5HIKA 5AJXA 2QN8A 3UMYA 5SZKB 3WIBA 1A8PA 2QK4A 3T3PB 1AH2A 2RJOA 3G0OA 4BEWA 4OAPA 4UQLA 4H1UA 3DM9B 3H9EO 4UPEA 1EP9A 4IJQA 2JFHA 2CLOB 3F7TA 1FFCA 5FI1B 1M2FA 4HXFB 1I14A 1SO8A 2W4MA 3QUAA 2ZRFA 2Q1TA 2X3UA 4O2RA 2PQ0A 2VXCA 5AM5A 1ST2A 3GR6A 5KMGA 2HWYA 2NAFA 1VPVA 3BDIA 4O2BB 3BKXA 4FCTA 5ICSA 2A2ZA 1FQWA 1YULA 3IYLW 4N7BA 1Z73A 1DKQA 2E89A 2HO4A 1FSSA 4DC1A 3WMRA 3WLPA 3ECAA 4IGFA 3JASA 1ONBA 1RHQA 1EDDA 3D4OA 3GQBB 4IDOA 4F8JA 1JG2A 4BQRA 4X8LA 2DUUA 4IILA 4QTUB 1DFHA 2A0UA 4YNBA 2GZHA 1L4GA 3DZDA 2R48A 3OFNA 4NDZA 2HX1A 3JQCA 1GEGA 4H3KB 3TCXB 4X6LA 5AVSA 1G8GA 1Z5ZA 2CXSA 1CG6A 1HZJA 5IT5A 3BFKA 3R9IA 1YOVB 4WK4B 2GM4A 3VR3D 1JIUA 4REMA 3RRBA 3W2HA 4K6CA 2GPNA 2E0IA 4MS3B 2NXCA 5HKAA 5DWQA 3GLGA 4QGBA 1X7XB 1MNAA 5TF0A 3S1SA 3IXQA 5FDFA 5CVUA 2OZLB 2W6ID 3P1JA 3EVAA 1G20E 2WIDA 4KODA 1WL8A 4YFYA 1YBFA 3ZUGA 1R4MA 2A78A 3C45A 1R0ZA 1QSGA 4LYHA 4BO3A 1U2RA 1MX9A 1FSGA 2HJSA 1W94A 2L2QA 4JP8A 4Q05A 3R3ZA 2P7HA 3E2IA 2FETA 2ZQ5A 4R54A 5IHXA 3OICA 5JNVA 4NU8X 1E2GA 3AEQB 1TZMA 2VFAA 3UJ3X 5ITZB 5F9HA 4BFCA 5BQFA 3OCYA 4PCAA 3SZGA 3FCOA 4G9EA 3HCRA 4MVJM 3WLIA 1GUYA 2PGNA 3TI7A 3V8NA 2ZYVX 2CLLB 2D8AA 5D1NA 5IJZA 1WQ3A 3FPJA 1CU1A 1TC2A 4D9GA 2CLMB 2VC2B 2O8BA 2VDWA 3GCZA 1XZJA 2ZRHA 3G68A 4TVKA 4F6LA 2J0UA 3A1SA 3WWPA 4E5MA 5AJUA 4K9MA 4LXHA 3O4FA 3AR3A 1L7EA 4OUKX 1M0SA 4WLFA 5DNDA 4EH1A 4CCAA 2I7XA 4DGQA 3ZNNA 1NKSA 4JMLA 3T3DA 4RFVA 1VTKA 2YZMA 4G24A 1EFDN 3PQDA 3KOUA 4Q1AA 5KSWB 3QBJA 1G3RA 4JLSA 1SCQA 3Q0EA 1B23P 3KPUA 1UXGA 4MVJG 5FEUA 5IAGA 3ZWBA 3DMPA 2I7VA 4KJXA 1YNOA 4H35A 1U11A 3SYNA 5BYAA 3SSNA 1JDPA 1NW6A 1J97A 4N1AA 1ZIOA 1BA2A 3TB4A 4C6TA 3G9ZA 1P4HA 2XWJI 1I1QB 3ER6A 3OUUA 3D6AA 1YIOA 1KDVA 4X71A 1W5BA 1YRBA 3IJRA 4H7JA 1XK6A 4XJTA 1LU9A 2O2EA 4U0JA 3U3OA 4IIEA 1A8SA 3P27A 1VMEA 3FYUB 3NHBA 3HG7A 4Q39A 1A4XA 4F9FA 1P39A 3A2MA 2KWIA 1PT9A 3DHWC 3KJXA 4I1UA 1NVAA 2ZRNA 4ZT5A 3WWCA 3COVA 3UAOA 1RE1A 3I62A 1XZBA 4G4SO 1APBA 3BXFA 1G60A 3WDLA 5KIAA 2HCRA 2G06A 4WXYB 2DZDA 5LOVF 1UMBB 4UU8A 1AO0A 1VYUA 4EJSB 1OH6A 4JJ7A 3ZK7A 1EUCA 4HB3A 2I99A 2PYZA 2DHEA 1R3UA 3L0SA 4D45A 3K3PA 1MFZA 2Q4DA 1T4GA 3NBYC 2YKGA 1S8OA 4GT1A 1B74A 3AF1A 3VR3A 3WGOA 3IIMA 4AW9A 3SK0A 1K6MA 2CHEA 1RZRD 1NJGA 3FCUB 2A57A 1KZ7B 2EIHA 2J08A 1Z6ZA 3I3SR 3TZLA 3RS7A 5KOJB 3G9UA 2P2LA 2O07A 1K1EA 1RHUA 2JJ2D 2VSOA 2W6IA 5B12A 4BZWA 4YFVA 5KNBD 1PS0A 3H11A 4P22A 2JCGA 4XTRA 4YASA 1MX1A 4MPPA 1RRPA 3GN2A 1HRDA 4HXYA 4Q4AB 2H52A 3EHEA 2LIPA 3PA6A 3VNAA 1FP1D 4F5ZA 3MTAA 5IN5A 2UUBB 5F98A 3STTA 3VU8A 2R1VB 4DKJA 1YVEI 3G1TA 3BH6A 3TD9A 1DJNA 4RWZA 4DR6B 3A4MA 3O74A 3CV3A 2PEZA 2AI1A 1J8FA 1JEJA 1T6XA 2CZQA 2IITA 4Y30A 1XEXB 2V8OA 2GF0A 1MC4A 3B6JA 4PX2A 2C3MA 4XM2A 1G4UR 5G3YA 4D79A 3H3XA 4JI8B 1DRWA 1CY4A 1N9GA 1N3IA 2C83A 1A71A 2XCQA 3INRA 3QHAA 4KGVA 2YHAA 4BFYA 4BQEA 2QTRA 1HYHA 2H3HA 3A10A 4F4HA 2QMOA 4DUGA 1ULBA 2GXQA 3ZD9A 4PAQA 1TLTA 3P0JA 4URVR 1U0GA 1QM5A 3BE6A 5A4FS 3ROTA 3NGXA 4GC5A 2I4RA 3TXYA 1Q16A 1XL0A 2ZB3A 3STVA 1RXUA 3FKSD 1QKIA 2R25B 2YWBA 2NZYA 4IEEA 3DYIA 5K01A 3QX9A 1NPYA 3Q72A 4ARZB 1UBJS 1Z2OX 4QLBA 4R71A 2BOVA 3HLTA 2J87A 1SB9A 3ENVA 1DPFA 3GN1A 4JOCA 1VKOA 2CNDA 2XA2A 4UDNA 5JG7A 4FNMA 1OX5A 1HZZA 3JZDA 3V1TC 2R87A 2C4TA 4L75A 5KYTA 1J0EA 1RQNA 5DGHA 3N3BC 3V8EA 4QG7A 4QPZA 5C5CA 1R0RE 3CEAA 1NLMA 4ZXFA 1QRDA 2QVZX 3LRTA 5JQGA 4ASUA 2VBGA 5LQAA 4WNIA 1Y9AA 4LF6B 1QC5A 3AM4A 4S1WA 4BVFA 4ZV9A 1XC7A 5L3SB 2VT2A 2RJNA 1MCZA 3GEDA 3ICCA 1F2UB 3RYTC 3VDNB 3O21A 1UL1X 2LBPA 1K98A 4E5UA 2YV2A 1NM5C 2XB9A 4CMKA 4JVOA 5DLYA 3P2YA 3WWOA 3K0KA 4KUHA 4QTYA 4FPXA 2FUKA 1TA0A 3K2BA 3D4NA 2VTBA 1TJ5A 4LF5B 4OKSA 1SXQA 1K92A 2F1IA 3GH3A 5C52B 3AF5A 4QHSA 4N03A 3UJ8A 1W36C 3OC0A 1YXMA 2C5SA 3CRZA 3NIGB 3OKAA 3QWAA 1XN1A 2FF7A 2I6XA 1ESZA 2BF4A 1A9SA 2P6NA 4OHFA 3W5DA 1Q0LA 5LB2A 3MCWA 1SUBA 5SZJA 3EZ6A 2IZOA 4IY1A 2P0AA 1T1EA 2XTAA 4Z1MD 4J8PA 3LUKA 1G8JA 3P0EA 3UWDA 5KQRA 1NOJA 3WHKA 3H6KA 2DPYA 1AKWA 1MB4A 2JJ2A 4C4SA 4EDHA 5BSUA 2SCUB 3FWKA 5KNBA 3TNJA 1RIFA 1XBTA 6AT1A 1P81A 1F60A 5L4NA 4Q1CA 4S12A 5CCXA 4D26A 1VPEA 4JLNA 2WUFA 2XUGA 4JGGA 1IG3A 3V33A 5EMMA 1FX0B 3RYIB 1D9XA 2HUNA 5TC4A 1LLFA 1V26A 4BNDA 1KY5A 1SU8A 2HA7A 1QJCA 1U4OA 2JFUA 3MMNA 4M0DA 1MORA 1KK0A 3MCAA 3TN7A 3UFBA 7GPBA 3BBPA 1JEEA 5HM6A 3BGWA 3GIDA 5I4IA 4JLWA 3KUXA 4LJAA 3VR6H 4K6GA 1VPDA 4PIVA 5SYNA 2XUOA 2BTOA 3EXHB 1IVNA 5SY4A 4BNUA 3TX2A 3GGSA 3PUJA 4PC1A 5BNFA 1N3YA 1II9A 4ZN6A 5IW8A 1QIKA 2OAEA 2DWPA 1RS0A 3EC2A 3N74A 4GL4A 2G09A 4MB2A 1L2TA 2ARKA 2NO1A 1GPDG 1QYWA 2ZKIA 5T4HA 2O2IA 1ZVVA 2BN4A 3VZQA 3REQB 2I91A 1EHYA 2NACA 1KJJA 3FKSA 1BWQA 3UV7A 2JI6A 3FLAA 3SHWA 3WC4A 4MI9A 3HO8A 4J0HA 3OY7A 4ZCSA 1FXWF 1T2FA 3W5SA 5IFKA 4INZA 4EMTA 1IN6A 1CY8A 2V9CA 2V7GA 4M76B 3SVLA 1FJXA 3AK4A 3RVPA 1SCUB 2X0JA 2W2QA 5F5LA 1M76A 4IINA 5FA8A 1PQYA 1NASA 1SURA 3KVYA 3OIFA 3VJLA 2PH5A 3P7MA 2XUQA 1UZLA 4MV3A 2BY4A 1ZH8A 2A5JA 1XRMA 2QZSA 3R7LA 3ZWDA 1JPVA 5AK6A 4IXWA 1N8TA 1UPBA 3CW2A 6YASA 1QFMA 2A14A 4QDJA 1QZUA 1JR3D 2EZ8A 2Y9MB 2ZI3A 3Q88A 4UULA 2BJWA 4JD5A 4S3MA 3GMIA 4Q66C 4QFMA 3ZDRA 3QJ5A 1IG0A 3MS2A 1DHRA 2COEA 4KQ2A 2MHCA 4JR0A 3JD0A 4JVNA 5SV2A 5K3FA 4BO5A 2R7NA 2ALJA 3LUHA 4TT3D 5CXXA 5JZSA 3MBKA 2GRAA 3LG2A 4KMRA 2E4YA 5ICCA 3V1KA 3LBAA 3TGPA 4KL8S 3E1SA 1ULHA 2W8ZA 3DJYA 3OLXA 3RH0A 3SE7A 4BB9A 3D6UA 4WNCA 2G1AA 3I6BA 3DLAA 2BKUA 3HFRA 3N75A 1EXWA 4TQAA 4P92A 3O1IC 4EB3A 4J7AA 4RMJA 4PZEA 3KKQA 4JP3A 1MMFB 4QVKA 4LJKA 4MYHA 3UA3A 4XARA 5FTNA 2RMKA 3LGXA 3CR7A 5G4KA 1JE0A 4PHTA 4PV7A 1X7DA 2QRNA 1EFHA 3H65A 4FJ2A 5CX1A 1Q20A 3UW1A 4DCUA 2DLCX 2YWCA 5JFOA 3FUVA 5IAJA 2P9GA 4CT4B 1FSZA 2IYVA 3F5FA 3RAEC 3UVEA 5EN4A 1VMKA 5DTRA 1JTFA 1FF9A 1V6CA 3KYDA 1BFDA 4WACA 3RYHB 3PYMA 4Z3OA 5FRDA 2X1HA 3HXLA 4NH4A 1EMDA 3UT0A 4D4MA 3H4IA 1X94A 3UMMA 1YV9A 2IS2A 4OF4A 2JGDB 2WJGA 3THWA 2B5OA 2O3QA 5D3MB 5D8DA 2AOWA 3GAAA 3KOOA 3V2IA 1V5IA 1R18A 3M5CA 5C3UA 3V1NA 1RKXA 1ZUD1 4HEA6 4UARA 3USZA 4CFYA 4NEHB 2QSJA 3NMUF 4AMUA 5IVIA 1PLLA 1ZOIA 2QG4A 1ORWA 1N4DA 3MGGA 3LFUA 1C14A 3KHTA 4QRDA 5A9RA 4WD3A 1Z45A 1FRNA 1JDJA 3ONWA 1E63A 2BKEA 2WIAA 3IMEA 3P2EA 5DASA 2XDWA 2BD0A 5T64A 3ETGA 1BDMA 3ES9A 3VHXB 1L4YA 2XDQA 2CCKA 3L7NA 3N0XA 3N8NA 5CPFA 4QYXA 1XHFA 2RHWA 2GKOA 3L7KA 4EIWA 5DM70 1TO6A 1DKRA 2ORIA 2DH5A 3B1VA 2CDNA 3OO0A 4A0FA 5F3WB 4FDUA 3HVJA 4R16A 3JQRA 2PEYA 2RC5A 3DNFA 5AIBA 3LCMA 4GPD1 5HQTA 2BP7A 2IEYA 2O1SA 1ABBA 3OU2A 1QYDA 3J81A 1WY5A 1UJ4A 2OT3B 2R4TA 2H92A 1JFSA 4DPLA 3WMXA 5DMXA 3VAZA 1MJ5A 4ZT2A 1AQJA 521PA 4LX8A 4X1OA 1Z8FA 4JVSB 2VT6A 2QN1A 4BFXA 2G83A 1GZ4A 2PUTA 3EGXA 3QFCA 1HETA 1SELA 4Q3AA 3GO4A 3ZE9A 3C70A 5DCUA 2GVZC 1O0CA 3N7AA 3CONA 4W8GA 1AMUA 2CHGA 5BYJA 2AK3A 2XTZA 3OQPA 3NIWA 4X20A 1QG4A 2HH9A 4TT3A 7MHTA 4ZDJA 3KFVA 3ZNOA 1WXIA 2VDMB 3DBLB 5ITSA 3RTDA 1ZK4A 4GGMX 2GZ1A 2Z04A 3KQPA 1YRWA 2RDMA 3B9RA 1TFUA 4PZ9A 2PS1A 2GBIA 3FCCA 4WZ6A 4KE6A 5A6VA 1UPUA 3IXLA 1XDGA 1MW8X 1JIVA 3Q6IA 5HW0A 5EJ6A 2FPMA 2GCIA 1WF6A 3WHIA 3HQ4O 2A3RA 2W2LD 4WASA 3ZWQA 4I3FA 4R1OA 1L4BA 5CM2Z 3L8ZA 5M7EA 3DVAA 2F1HA 1X6VA 3DXYA 3PDIA 3R2JA 5GIPE 2V1UA 1YQ9A 3DUFA 2F3RA 3HR8A 4XDHA 4RSRA 1NMEA 2LTAA 1NMSA 4BMNA 3ZEAA 3AB3A 3EGWA 4I4LA 1XTUA 5C8VA 3FOAA 3QXHA 5CB0A 1ZK1A 1GXSB 1VDZA 3A36A 3INGA 3I0NA 4P38A 3GLGB 1KDZA 2PUAA 1BD3A 3U61B 2JGRA 2X8AA 1XU9A 1DJLA 2VTDA 2RIRA 1WM1A 1TK2A 3UKJA 1JQDA 1XLTA 3KOMA 4FN5A 4XIGS 3WS7A 2D06A 2NV2B 3B82A 2V7VA 1D8TA 4QDOA 3P0IA 2ZVJA 2OFPA 1PLJA 3CRRA 3NM6B 3HXOA 2KS6A 4FOLA 1CQWA 4B4OA 3HKDA 4EJFA 3ZD8A 1BJKA 1X7YA 1HGXA 2R00A 3AG5A 3ONNA 2BR3A 4M86A 4IIHA 3LVFO 3OBIA 1ZP6A 1ZQ1A 4Z4HA 4UJ5A 5LJLA 3UGJA 2VDWB 1P9WA 1T15A 2O8BB 2VHCA 4OQLA 2J0UB 5K0SA 4LJSA 2FEXA 1G3QA 4MJLA 3GJQA 2F67A 4PG4A 3H9CA 2PM8A 4FFDA 1TMKA 1WOYA 2CFCA 5K8UA 3SJZA 1NR7A 2FP3A 1XYVA 2C31A 1N2GA 1P5RA 1RXYA 2GYYA 2BEVA 2QPOA 1NV9A 3N8DA 3R0IA 5IBPA 3VO8A 1QR2A 2JRCA 4CTMA 1N2JA 3A11A 1PEYA 1IU9A 1MO6A 1SXHA 1M9NA 1LSSA 1P7PA 3C1AA 5AXCA 1GDTA 1J2YA 3D7RA 2H5JA 2BTQA 3P26A 3LLCA 4JUDX 5I9BA 1NBAA 3RUFA 4D9IA 1FFGA 4XJXA 1E6CA 3U5TA 3OM9A 1QIFA 1FRFS 5I4CA 1XZIA 3IVAA 2Q2WA 3E58A 3R5HA 5ITWA 2C7BA 5KSOA 1K4KA 2H8KA 3DXZA 3UXHA 1YS9A 3DR3A 1FA9A 5LUBA 1JGTA 2DFNA 2C9BA 3ESCA 4L78A 3HJCA 3MERA 1WB6A 2O5EA 4FDLA 1WO8A 2QX4A 3IC5A 3KKLA 3A9WA 1BTOA 3O3NB 4LYGA 3UG6A 5L45A 1WB4A 4EHJA 2ZDHA 2P5SA 2H9AA 4RZUA 1SD2A 1H8HD 3R3XA 5IX8A 1BYIA 1H3NA 4L9WA 1R0WA 3SX2A 3NUGA 2FSIA 4W9NA 5D2CA 3LWNA 1V3VA 1QHXA 1B00A 4BKMA 1HLPA 1V5WA 1CJUC 2I4OA 2OL4A 2W48A 2GDJA 2EW8A 3DE0X 4GBMA 4JLJA 4ND7A 4FVTA 5K3AA 3R76A 4B6RA 5KNCA 4P0TA 2R6GA 3IUNA 1N32B 1KHHA 3T34A 1EUCB 3X0DA 5B7NA 1SHTX 2IQ5A 5KPDA 1T6ZA 2PXHA 1C9EA 3SS9X 3UM9A 1KVTA 4LNHA 4PNZA 2JFGA 3IURA 1GU7A 1HPLA 4QELA 5T4EA 3G8AA 2XBMA 3LXXA 4UDYX 3DFUA 4R1SA 5E3JA 2OQIA 4RHXA 2NYRA 4DTIA 3FOBA 5CD1A 3OM8A 2GBPA 2P4SA 4G5FA 4IWXA 3H11B 1ODLA 4DQXA 3M1YA 1L5HA 1DAMA 2GJSA 4RSHA 4REOA 4QU8A 5K3DA 4KNYA 2HQSA 2ZROA 5KHLB 4EUHA 3ILSA 4HD8A 4M8NE 3WL4A 3L7BA 5COAA 1O6GA 5LN1A 3AB7A 4N5HX 2QRKA 1IYZA 1VE7A 4U9IS 4G0UA 2II6A 4IX1A 1SPXA 4FHEA 1NW4A 1OZFA 3FNIA 1YE5A 4LKRA 4ZAZA 3STHA 4ZI2A 2IDZA 4P4SA 3AVUA 5AM2A 2B92A 2Q3MA 3LUFA 4B6QA 3BDAA 4A9AA 5CW2A 1N9GB 1N1EA 3KNZA 3ZHCA 1C3OB 2ODBA 4JLDA 1K7FB 5AO9A 2VYVD 3IR7A 4GW3A 5ADVA 4GM0A 4YP6A 1WQ4A 4RZ3A 2P8SA 1SIBE 2NGRA 4QQFA 1F06A 1NUSA 1WXDA 2IZ6A 1DCFA 5CUQA 5L3VA 121PA 2AFHB 4KIUA 5ALIA 1EUYA 3K5HA 4IKOA 4BO6A 2JFBA 3U6KA 1FDTA 5TEWA 3BQNB 3Q7SA 1A04A 4IR7A 3QM1A 2V3CC 4NBKA 3WJ7A 1CT9A 1B26A 1MB9A 1LSJA 4ZCTA 1JEYA 5JMTA 3VH4A 4G0QA 1KKUA 2A9QA 1MOQA 1SC1A 2GCGA 4AX4A 1E5TA 1QOQB 1LFAA 2B6NA 5HWSA 5TRTA 2W22A 1FLVA 3DGEC 3KXPA 2L18A 3OD5A 3ANLA 4M7WA 3QLUC 4MVJD 4NOMA 4X00A 5JQGB 3OQJA 1L5WA 3SXJA 3ZQUA 4BC0A 3U44A 3CA8A 1QC5B 2X9GA 4QEKA 3HZZA 1Z63A 1RRKA 3R5TA 2FZCA 4QQ8A 5F2EA 1BG6A 4HATA 2EW1A 5E3HA 3Q5EA 4QLOA 2I3ZA 4MWGA 4CEHA 5K03A 5IKEA 3HKCA 3K8OE 3WNQA 1BE6A 4WOCA 1J8MF 4TUYA 1S3GA 3E6AA 1UDCA 1X39A 2SKDA 1ZYUA 2G7ZA 4HGZA 3AXSA 1E99A 4MQEA 4PNPA 4QEZA 1UMCA 4HSEA 3RPEA 3PC8C 4Q47A 5IUNC 5IZCA 2BELA 1F4VA 1KF0A 3CKMA 4TQGA 5HFAA 1E6UA 1YZKA 4K6HA 2H7VA 2QIPA 3D7KA 1PU2A 9LDTA 1J9GA 1BS9A 3GJRA 2YV5A 2ZR7A 1C30A 3NT5A 4PFKA 5L95A 1Z6XA 5DNUA 1H65A 1G5TA 1QX4A 3GPBA 1GRNA 3MQFA 2LNDA 3UATA 4BKUA 5BVHB 1ADBA 5JTUA 1H2RS 2CV2A 1Z2AA 1YS4A 5FBHA 3SKXA 1DG3A 3L1HA 221PA 4I4IA 4EG8A 1ADCA 2J0EA 4FOPA 4CKXA 1XMIA 4XM0A 5B2FA 4FIDA 5B5SA 4G1VA 3MCZA 1U1IA 3RBAA 4XWKA 3ITDA 1GZ7A 5JS2A 1C8LA 3U4HA 4HJRA 1Z33A 1KOJA 4LBWA 3LTEA 3RRFA 5A6SB 3PZBA 1UC8A 4G0PA 3F5QA 4MLDA 4MGZR 2Z57A 4ROTA 1K6IA 2WOOA 1I94B 1C1DB 2XA9A 4RQAA 5IASA 2CFSA 1U5BB 1MAHA 3OA0A 1MJHA 4QXOA 2EZ9A 2H1CA 1E1NA 2QI9C 2XF2A 1SJ9A 1MOPA 2WD7A 1K88A 4L0DA 2BMDA 2PZGA 2VJMA 2Z1NA 4RAOA 5IBRA 3WSWA 2FSPA 3R5XA 4EI8A 7MDHA 1YBMA 5FNVA 1SXJD 4Q19A 3COJA 2QMUA 2OO7A 5SYAA 2QVLA 3LUAA 2OEPA 3PHHA 3T7KA 5CB6A 2BEUA 3R4VA 3ZI4A 2VLBA 3W3AD 1P1RA 2W93A 3IIKA 4GLFA 5E1BA 4C2AA 2XOKD 3ANXA 3ZZTA 5B4UA 4NECA 4KREA 3TMAA 1F2VA 3CLHA 1PG5A 3OX1A 3PWSA 5GGXA 2AKAB 2H65A 2RK6A 2WTNA 4ZJPA 1FVOA 4PG5A 3VPBA 2HK7A 3NVMB 4IDDA 3ZGYA 3UMRA 1EX7A 4YRBA 5EJ8A 3LLMA 3W5BA 2WZBA 3ON5A 1G20B 4DILA 2H5LA 4KR7A 5CAEB 2HF8A 4J4TA 1JFRA 3Q8MA 1U2QA 4ZC8A 4MVJA 4C0LA 2NPFA 3M3HA 1YMVA 3A9UA 3DC2A 3VSEA 4FK8A 4A8JC 1AN0A 2O1XA 4DJFC 2JAQA 2CL6X 2R2GA 3HGTA 1QPGA 3KVNA 4Q3DA 3COPA 3TVTA 1W44A 1IJKA 1OT3A 1VCIA 4LOHA 4G5QA 2OZVA 1R5BA 3MF4A 2XNDD 3H86A 2GN4A 1DL5A 3DCYA 3SQMA 3TMYA 4DEXA 5K3FB 2DR0A 4CDMA 4Y2GA 1TK3A 5CDGA 2ZDQA 3BJZA 1U3GA 3LUBA 3UK0A 4N5IX 3THYA 2D3TA 1YA8A 2WWXA 3R3JA 2AXNA 4QYWA 4RZXA 5DK4A 5TF4A 2XKKA 1MENA 2QL5A 4V0RA 3WGTA 2OILA 3PI7A 4EY3A 1KVQA 3A6PC 3NH9A 4FWIB 1M83A 4NJOA 4UHBA 4MWTA 5K7SA 1XQXA 3ILVA 2PHZA 3KSRA 3VR4A 4CXMA 2PJZA 4RM3A 4ZVKA 2XGSA 4KSCA 2X2PA 2VHYA 4MIKA 1JXAA 3O84A 4MJXA 5D5PA 4E14A 4ENVA 3FFXA 3O4VA 3ANYB 2OZEA 3T5DA 1PDVA 1BJRE 3OQIB 1O54A 1XZCA 2HXGA 2XUPA 1YR7A 2X8LA 4FJ0A 4HQFA 4PFSA 1D04A 1PQWA 3DO6A 3EWIA 3TRKA 4D97A 2ZE5A 5LMZA 5CFLA 1EIWA 1FDSA 1KO4A 4OLAA 5EP1A 4ITVA 4DBLC 4L4ZA 1J0DA 1U4NA 4WX2B 5KYXB 1L5YA 2GEJA 3QLTA 2O2ZA 3L0IB 2OV1A 3KD3A 1XMVA 3PEYA 1HTBA 1Z29A 1UKYA 5A5EA 3LX8A 4AKTA 5KJ6A 2AN4A 1TJ4A 2FX5A 1KJWA 2B8JA 2XT6A 4G2TA 4KLCA 1U2DA 4OTZA 3T0GA 1JP7A 3UWPA 3ZC3A 5DIFA 2XD9A 4NESA 3DMGA 2CVQA 2BW0A 3CS3A 3MOGA 4V0MA 2B36A 4DBVO 1JLSA 4MLCA 1KBZA 3U31A 1K7CA 1HYQA 2YZ2A 4KAJA 4EPXA 1DAGA 1YMUA 4FGZA 2A0KA 4TN5A 3G8CA 3T15A 2A7QA 5DGTA 3I5MA 4RFSA 1UP6A 1NVEA 1SY7A 1SXJA 1ULZA 5ENZA 1UWVA 3SZLA 2HA4A 4BKRA 1DUSA 1KJZA 4J0GA 4V0KA 4TOIA 3THOA 5CLHA 1AOXA 3ESBA 4GOJA 3VOAA 1UZNA 4JSYA 2OK7A 3W3AA 5AKKA 4KQMA 1W4CA 4D4JA 1DIBA 1LFDB 2XOKA 3MLAA 1OREA 1D0VA 4H6VA 4CIBA 5L4LA 3KV3O 1VI5A 1NVGA 1EEXB 1WSWA 1XZGA 2ZJFA 3C98A 1DAPA 2ZWAA 3AV3A 2BP7B 2HA0A 3K15A 1EFPA 3L0DA 3Q5GA 3M6WA 1KZYC 1G5FA 2IZ1A 2K5UA 2P3LA 4B45A 4KO3S 1TEZA 1VKRA 1G4AE 1HL3A 1RKQA 1ZEMA 3DOEA 3ELUA 3VYRB 1IDN1 3OEYA 2IT1A 4RD6A 4OX9B 3DNPA 2VJKA 3F3SA 3EUWA 4JVMA 4R2KA 3ZKWA 2A84A 4ENSA 2C9CA 1XP8A 3OIDA 5KNDH 3R0VA 1XQ9A 4DIFA 2BM1A 1T10A 1JDZA 1LBIA 2D1FA 1E9SA 2WHRA 1BX0A 3A6LA 4H3HB 3GLTA 4O5AA 4A1FA 1RC8A 2DTEA 2XNDA 4A0GA 1O89A 2P40A 4F97A 1V45E 2JDIA 5JO9A 5LQSA 2WP8J 2B8WA 1WEKA 4G4SP 2ZJAA 1T5SA 2JBHA 5ALXA 2MDTA 2UYQA 1U6KA 2NO4A 1HG0A 1KPIA 2IXEA 2VK4A 4W1PA 3SJUA 4CIXA 1JWBB 2YUIA 5CG1A 1H2AS 3CG0A 4V0QA 1AXRA 2ODEA 2A1TS 1K8YB 3KZOA 4DEYA 1EIZA 2AZDA 4JT2A 4N5LA 4TSFA 3WGYA 4DLTA 3LW8A 2R6AA 3I37X 2Q9BA 4H17A 3WLEA 3FUUA 4O5OA 3VVLA 3WKDA 3EQ7A 4E22A 1QYCA 4NCKA 2DVMA 1YCDA 4YAIA 2XMSA 4XEHA 2ZR8A 2EHDA 2KBFA 1DTSA 4TLEA 3T7DA 1D03A 3GRZA 3IS3A 2R4QA 1PFWA 3PCTA 4I9UA 3DUFB 2D0IA 4L8VA 3LPLA 2GFIA 3ZK9A 1NAHA 1OFGA 1ACMA 3R41A 1HLGA 2AWOA 2FPWA 2C20A 2WF8A 3RVDA 2KLHA 1RJ9B 1O95C 5EIOA 4D02A 2PUDA 2O0LA 4QHYA 4S05A 2DHRA 5F12A 3O8CA 2WKWA 1HR0B 3DBRA 3N2EA 4PU0A 1POWA 1N0WA 4BGUA 9ATCA 1SA0A 3I32A 3QBDA 2J3DA 3PF9A 4IOMA 4YRLA 1H2WA 3I4CA 3RIYA 4KBGA 5K0BA 2FRVA 2WWHA 1WW3A 2IU3A 3JQBC 2WTEA 5H81A 4HMQA 1L7OA 1O9HA 1SWWA 4W7IA 5EQTA 5JAOA 1TTQB 3IUMA 1Y4ZA 1ECFA 2JGFA 4OHOA 1T3HA 4HX9A 3HKDB 3LF2A 1ODSA 3TLGA 3Q4GA 2I2AA 3DAGA 4JSRA 2WJHA 5CVJA 2PX0A 4R9RA 5J43A 3FOEC 2WK1A 4RMIA 1P29A 1P2DA 1V35A 2XNSA 3RTEA 1I7SB 4EK9A 1J09A 3P8ZA 4B4DA 2PPLA 4CLOA 2WWYA 2GD6A 4IM7A 2QE7D 4Y2HA 3LI2A 4JH0A 4KXVA 4F3NA 5BMVA 3U6BA 4Y6QA 1NURA 1P60A 4JEHA 3AY6A 3IBSA 5L3QA 3TSYA 1Z28A 2GT1A 2IHZA 1EDOA 1V9CA 2PT6A 3A6KA 3I2FA 3KFLA 4XQCA 3GUUA 1NFRA 2IOHA 4ND8B 4WGGA 2W8BA 4YMIA 2R96A 1U2GA 4B0PA 2DT5A 2G5TA 1VLZA 1S2NA 2PR7A 2RAUA 2JARA 3BSWA 4UU0A 3JATB 3T41A 4E31A 1CJTC 4PLCA 2WLSA 1X80A 2AC4A 1SXGA 3DHEA 4OHWA 4IQ8A 5CFOA 5F1YA 5LFAA 4R0MA 1LI5A 2RGCA 4G0NA 2CDBA 1CUFA 1WW8A 5EIFA 4C7VA 3HVKA 2HHHB 2JPDA 3T7RA 1P1FA 1GPWB 2GEKA 3OU6A 3ZGNA 1IRXA 4B79A 3TJZA 2W2XA 3QF4A 3LTNC 4JV5B 2BCEA 4PW0A 2QOEA 2XXJA 1E66A 4IDCA 2QU8A 3ADDA 2OAP1 4WUVA 1NMZA 2R8PA 4HPJB 2XCSB 1G7SA 3L6DA 2IZ0A 4D43A 3EEYA 2KYRA 1S4QA 2VSFA 3AFIA 4KLAA 1EWKA 3F1KA 5C4MA 1FRZA 1YOBA 3CZ9A 2DQ4A 4CHTA 1DNPA 1IC6A 4PPFA 4KQ9A 1U1DA 3T3NA 3H16A 3DA8A 4ER6A 1RJGA 2X0KA 2XNCA 3F8TA 5DMHA 2FZ4A 2WM3A 2HTFA 2YZNA 1L5RA 2B34A 2NP7A 1DINA 4RY2A 5FHRA 1Q74A 4O29A 3ZGVA 4QOSA 1VLLA 2X5XA 1LVGA 2QTFA 1DXOA 3HUTA 3OLVA 4BBZA 4CMIB 2CDRA 3O8BA 3HB0A 1I0LA 2DSTA 2ZQYA 4PBRA 2GRUA 4JROA 4PGMA 2RGWA 3UH0A 4EMBA 2QVXX 3CSSA 3I92A 3O83A 3E9NA 4PO9A 1L5HB 4C87A 2XUAA 2RSLA 3AMVA 1EA5A 4ZGBA 1NW9B 4ZI3A 2JA2A 2HGSA 4C4ZA 4D98A 1IEWA 4D9JA 5AW4A 4MW2A 1S8NA 1N2CA 5CIWA 1PSZA 4JNCA 3ZI7A 5F23A 1JHRA 1RP1A 2XVYA 4DCPA 1FNNA 5KYWB 2ZRPA 3CZMA 5ELLA 3RUAA 3BREA 3U9SA 1SIWA 2NTVA 3I1JA 2R1TA 3L7DA 5FPTA 5IJWA 4YCSA 2XRZA 4AYXA 2X0DA 3TOVA 4P4SB 3PTLA 4E5NA 1BE8A 4XGQA 3HJHA 1KZ6A 5JD6A 3QTTA 3JRNA 3D3EA 1YR2A 3HMQA 3V48A 5BNTA 4UVGA 4K26A 1CS4C 5ESWA 2AMJA 1RLOA 3DZHA 4FD3A 2DPLA 2HC9A 3QEJA 1TFRA 5CNMA 5BUZA 2VO1A 3EN0A 2NVUB 3WLTA 4KFUA 4CKZA 2IELA 2TMYA 4CIVA 3IIEA 3OZFA 2QL6A 4HCJA 4UW9A 4DLYA 4TGLA 3W6PA 5T67A 4QG3A 2ATXA 2FZWA 4XPIB 3S27A 3OLCX 2IZ7A 2JGMA 4EZEA 2D2FA 3CURA 1X38A 1PZMA 2MR5A 3I2JA 2FPPB 3NWEA 5T6MA 5GVRA 3LDFA 3CX3A 3WKBA 1B8VA 3ZE6A 1ZUNA 4GZ3A 4MP8A 1KSJA 1P0FA 4Y7DA 5LYJF 3RYCB 3HDVA 4OQFA 3RVBA 1TMOA 1W49A 3PUVA 1OLOA 2GK6A 4EP1A 1RI4A 1EXDA 1EGAA 3PA8A 5T3YA 3BZUA 3DAFA 4RJIA 2G9QA 1F2TA 2XTNA 1GCAA 3G2NA 3HKCB 5KOYA 3RF6A 1RI5A 5IMSA 1H5UA 1TLLA 3BSSA 3BXXA 4S1PA 4TUYB 3SAJA 4X1YB 1XLVA 1ZCJA 3T35A 3W8DA 4YV7A 5F35A 1UMCB 3O47A 1BXGA 1P9OA 1PUJA 4KIGA 3AINA 4Q9AA 1Q77A 2VPQA 4GE0A 4LOKA 4JBYA 4RQTA 2YHIB 4LZZA 1NN0A 2KW5A 2ECPA 4LWPA 1JU4A 1KMHB 5FPYA 5E4FA 3SFTA 1C30B 4HY3A 3ILYA 4LV6A 2IDMA 2YASA 1JQEA 4IIYA 4FMPA 3A2NA 3GEBA 1GYRA 5FI3A 5KDLA 1TM4E 2X1MA 3OEEA 3VKVA 2P4QA 2PKRA 1R1DA 1T2NA 1K4MA 1Y98A 2HA3A 2P2DA 1KO7A 3DULA 1SC9A 3K9WA 3Q1KA 3OHMA 3REFA 3E8XA 3FVRA 2C5GA 1G21A 1TXGA 4IIFA 3FPEA 4PYIA 5JE8A 3BT7A 3STUA 3EBPA 3HB5X 1ILWA 1IQPA 1ZFNA 4CM1A 1F7VA 1MO5A 2CLFB 2ZBGA 1VIAA 3OCXA 1GUBA 4FOTA 1CHNA 2F3TA 5JD3A 3GDWA 3VR6A 2IY7A 1DPGA 2MSCB 4C76A 5DCYA 3ZDBA 4UM9B 1KDOA 5KTKA 2OV6A 5IH7A 1D9ZA 5GOZA 2B61A 1HSZA 3RBXA 1TCVA 1Q91A 2G4VA 2ZB4A 3QPBA 4YHBA 5H68A 2GNPA 4JWKA 5LXTB 3SR0A 2YRWA 3S70A 4C88A 5A4DA 1N2BA 2BRUC 2VJMB 5AW9A 3WYCA 3AUUA 1E1RA 4AKHA 1PZEA 3ESXA 1PGNA 1URPA 4GRIA 5DW0A 4OSPA 4U5XA 2AX4A 1JHQA 2VVTA 4IZ6A 4EA6A 1OCEA 4ZO9A 3RS2A 4CVNA 1C3XA 3HCEA 5DE3A 2YX1A 5ENVA 2AQKA 5JJKA 4DAEA 1P0PA 3R9XA 2KM1A 3QIVA 1UC4B 3O75A 2QRQA 2FSGA 5LQRA 4OHRA 3ASZA 3MS7A 1NXOA 1HI9A 2L42A 2Q5HA 4GNRA 2I4MA 1LJ8A 4U9UA 1PFUA 4B2PA 3ZLTA 4OREX 1SVWA 4TZTA 3KAPA 1WKBA 5A9SB 1PYOA 4GLOA 2NZ8A 5EKTA 3I23A 1WZIA 3T12A 2C8LA 2V59A 1JSLA 3C43A 4L1KA 5E3IA 4LNAA 2B1IA 3EY9A 3FHLA 3OCJA 4KHZA 4E11A 1IWBB 1W4AA 3SZOA 3ZBTA 2QXTA 1H1LB 4HG2A 3B38A 1CJKC 1ORVA 1XCLA 3O8NA 4BO0A 2ZYHA 1Y3FE 4RVFA 4DDKA 5I5EA 1K7XB 4X90A 1G2PA 1R6VA 2I6GA 3CB2A 4FTWA 5FR1A 3OTWA 5LDGA 4GYJA 1OHHA 2P9TA 4KAAA 4NMHA 2FRDA 4OCZA 1WULS 3RF7A 2JKZA 2CD7A 1ZMBA 5AUNB 2C8JA 2XGOA 4XCQA 3KELA 2R62A 1O5IA 1QJ4A 2HSGA 2C2GA 3AU8A 4IJ6A 3WDKA 1S7GA 3WRVA 3ZXXA 2C42A 2XY4A 3D8NA 4B33A 4DW8A 4KACA 4EX6A 1TRHA 4B7CA 4L3OA 4NH0A 4DA7A 1YZVA 1S8FA 1SKUA 3BFJA 2FPIB 1U9IA 3LIPA 1YR1A 1Z2PX 2QTWB 4L4RA 1XU4A 1B93A 4FYPA 2HPAA 2A4KA 4G63A 4TVOA 3CLTC 4KOEC 3UK1A 1OX4A 5KKNB 5KTOA 3RKRA 1UJ5A 1H2FA 5E6RA 4BMSA 3OFJA 3HXQA 1YJXA 4R41A 4QOJA 3SF0A 1K2WA 3PITA 3CLRC 3DMTA 2Y6UA 2J5RA 2C1EA 5HMLA 3DZCA 4WK6A 1KORA 5T5QA 1A1SA 2HJRA 3V7WA 1K8ZB 1XTQA 1MH9A 3ZE2B 2D7DA 2BH9A 1LC3A 4J1TC 2PNJA 1BMTA 3I01M 3TLJA 4Z49A 1KE2A 2Q1YA 1JTVA 4RFSB 4IVQA 3GEIA 2P5YA 4TXLA 3FMPB 2QMYA 2MJLA 1SIUA 3OZBA 1Z4KA 4MKXA 4F21A 2XUIA 4EW3A 2I80A 3NHSA 4UNPA 3VZDA 1Z6QA 3V9PA 3WWEA 4DPKA 4YACA 2O6LA 1JVBA 3A1CA 2GS9A 3OT5A 3QWFA 3FNGA 2TMKA 4BMXA 3VSAA 3JALA 4O4IF 1EFPB 1PJ2A 3EA4A 3O92A 3UXEA 3BTVA 1LNSA 3DGFC 1ZVQA 4CT0A 1TGYA 2O5VA 2E82A 3AHCA 3NTQA 4BO1A 3ZVNA 2IXTA 2H1FA 2J30A 3EWSA 3MGCA 1NUQA 1EM8B 2JKYA 3HJRA 3S40A 5JJLA 3OLZA 3FDZB 1UXHA 3AKYA 2ONZA 2EAUA 1IQRA 4U7FA 5CDFA 1DIAA 2NUTB 4JQCA 2POCA 4TYWA 3ZKWB 1N2OA 3K0HA 3I2IA 5JSFA 2FKAA 3NYRA 2YV3A 3M6IA 4QPNA 5IU6A 1CUDA 1EVZA 4N7MA 3IXMA 5DFAA 3T5AA 2LWIA 2X9QA 4DDVA 3BEOA 1AGXA 3T0FA 2ISQA 1K0FA 1LDMA 3KBBA 1KWGA 4QT0A 1G5IA 5MN5A 1YA4A 3E0XA 2WB4A 4K9DA 1KARA 5HK9A 2C94A 5LDDC 3DE5X 2QD1A 3TWOA 4ZT6A 1DX9A 2FRXA 2XR1A 1E6KA 3A31A 4QXRA 3GGCA 3A25A 4NYJQ 3IILA 1AQIA 1OBFO 3DEYX 3UWOA 3FPKA 3ZDAA 1DWUA 4BO7A 3V7FA 1K6JA 4DFDA 3GD5A 1JFFA 1SZJG 1V4VA 1NRWA 2I4TA 4KGZA 1NC3A 5FA5A 4MW7A 5I3ZA 3RBZA 1J4AA 3M9WA 4MW0A 1ZPDA 3FTNA 1QAOA 1Q3KA 5B6JA 4Q93A 5I7SA 5AVYA 5AKZA 4LKOA 4IGIA 4OXYA 3SIXA 2O23A 2VTEA 3PNSA 3JS5A 5D85A 2C04A 2OP1A 4B6PA 3RASA 2F6RA 1AV7A 2AV6A 3QPCA 4FYYA 3TQSA 3KKKA 3P2IA 4BAZA 2OY0A 3FD8A 3UMVA 1P72A 4PYRA 4Q6BA 5KWJA 3H6HA 1WAMA 4RHFA 3DAPA 3Q7QA 2PWAA 2G1PA 2XQIA 3FETA