4AECA

Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyase c
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
323
structure length
323
Chain Sequence
AVKRETGPDGLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFVAGIGTGGTITGVGRFIKEKNPKTQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQKIMDEVIAISSEEAIETAKQLALKEGLMVGISSGAAAAAAIKVAKRPENAGKLIAVVFPSFGERYLSTPLFQSIREEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosterically Gated Enzyme Dynamics in the Cysteine Synthase Complex Regulate Cysteine Biosynthesis in Arabidopsis Thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
molecule keywords CYSTEINE SYNTHASE, MITOCHONDRIAL
total genus 112
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4aecA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4aecA02
2TRSB 2O2JA 1VB3A 3L6RA 3L6BA 3SS7X 5IW8A 1KFCB 1WBJB 3R0ZA 5I7OA 1K7FB 1Z7YA 3RR2A 4HN4B 1WDWB 2ZPUA 5KZMB 4D99A 1TYZA 4AECA 1Y7LA 3PR2B 1C8VB 1K8ZB 3X44A 1VE5A 2ZSJA 3AEXA 3DWIA 1V7CA 4D9NA 1TJPB 5JJCA 4D9EA 1F2DA 2CLLB 3HMKA 2O2EA 2ISQA 3SS9X 4ZQCB 4JBLA 2D1FA 3TBHA 3VBEA 1RQXA 3BM5A 2CLFB 1A5BB 4L28A 2RKBA 2JC3A 2BHTA 1WKVA 2WSYB 1UIMA 5DBEX 5CVCA 3DKIA 5IWCA 4D9CA 1K8YB 1KFBB 1CX9B 5B36A 4I1YA 1OASA 4D96A 3T4PA 1QOPB 5I6DA 4D9IA 3SPXA 2V03A 5B1IA 3PC3A 1Z7WA 2J9XB 4HO1X 4L3VA 4ZU1X 4D97A 4AIRA 3PC2A 5DW0A 2RH9B 5DW3A 5C3UA 1J0CA 4D9KA 1C29B 4LMAA 1VE1A 4D8WA 2GN2A 1KL7A 5EY5B 5I7AA 3VC3A 2BHSA 4JBNA 2GN1A 1PWEA 1C9DB 3X43A 1K8XB 2TYSB 1FCJA 3L6CA 1P5JA 4LI3X 4OREX 5E0KB 2CLKB 1V8ZA 1K7XB 4HPJB 5D86A 1TZ2A 1D6SA 2EFYA 1E5XA 1A5SB 4PCUA 4D9GA 2DH6A 1TTQB 2TSYB 2C2GA 2CLOB 5B1HA 5B3AA 1FUYB 2J9ZB 2CLEB 4D9MA 2RHGB 3ZEIA 4L0DA 3FCAA 1O58A 4D92A 2EGUA 3DWGA 5IXJA 3IQIX 4HPXB 4ZU6X 2J9YB 1TTPB 1M54A 4NU8X 4F4FA 1BEUB 5DVZA 5T6MA 5I7HA 4H27A 2DH5A 1J0EA 1J0DA 4IL5A 1J0AA 5D87A 1CW2B 3R0XA 1KFKB 2ZR8A 3V7NA 2CLIB 4D8UA 1K3UB 1UINA 1V71A 4KKXB 2C2BA 5B55A 3IQGX 2CLHB 5D85A 2PQMA 2CLMB 3PC4A 2GN0A 5JISA 4LMBA 4D8TA 1J0BA 3AEYA 4Y6GB 5HBGA 1A50B 5J43A 4D9FA 2Q3BA 3VSDA 2Q3CA 5CGQB 5DBHX 4COOA 3IQHX 5I7WA 4OFXA 2Q3DA 4L27A 1A5AB 4WX2B 5D84A 1TZMA 1TZKA 1K7EB 3VSCA 5BW6B 1TDJA 1X1QA 3VSAA 4NEGA 1TZJA 5B53A 1KFJB 1BKSB 1QOQB 5I7RA 5KINB 4HT3B 1UBSB 5J5VA 3IAUA 2ECQA 1WTCA 1KFEB 4QYSA 4D9BA 4XUGB 1PWHA 3CEPB 3FGPA 1JBQA 2ECOA
chains in the Genus database with same CATH superfamily
1JWLA 3JYQA 3RFUA 3U3OA 4K87A 2N42A 2POQX 3AC0A 2QUKA 3HPQA 3LK7A 4IJ5A 4JR2A 2VQEB 2NM0A 2HW8A 4X1YA 1HFJA 5EWLA 2H0RA 1VJGA 3FZGA 5G4LA 3EWIA 4BGVA 4E03A 3EC1A 1UAAA 3EQ2A 3K0FA 1R5BA 1PVOA 3VX3A 3C45A 2F3QA 4XJTA 5LC1A 1D9ZA 5BUSA 2RIRA 1D0SA 1NC3A 2OO7A 2DM6A 1IHDA 1TC1A 3CX8A 4R81A 2IKQA 4ZODA 4AW9A 4BFZA 5IHPA 3AX6A 2P67A 3PKIA 4BUJA 2QAGB 1L8QA 4YASA 3AF1A 4MRMA 5DTMA 3X1MA 1L5QA 3K6RA 1N9GB 1J25A 2XMGA 4EEZA 4LMPA 4O1MA 1JB1A 1K5DA 1W76A 2PJUA 4DDHA 2VWPA 3AFIA 2IDMA 3E8MA 4LTDA 3RYFA 4L28A 2EERA 2DR2A 4ZI7F 3T9DA 4BNTA 3D64A 3CISA 4F3CA 1NXTA 1S2LA 2E1RA 1JFFA 1TCCA 4RPCA 4TMKA 1HE3A 2A0FA 5CCBA 1CEQA 4R9UC 2H5EA 2HGSA 3PGLA 5A4DA 4F4IA 3UV6A 4PFQA 4K05A 2ZYWX 1LX6A 1U2QA 1OFUA 2CF6A 1KZ9A 4AM8A 2AIRA 2XNHA 3MD9A 1EVZA 3MBOA 2QN1A 1QQBA 1E2JA 3HDJA 4J43A 1RPZA 3KLOA 5BQXA 2VNJA 3OUTA 4XDYA 1PYOA 4L3VA 2V98A 3OU7A 4QD3A 5E1DA 1MHPA 4C5AA 4EB8A 3KV1A 5C2JB 2O54A 3FYHA 3IHLA 3GYBA 1JJAA 2FN9A 4FFBB 5DBGA 1X92A 1DEXA 3ZWOA 3HKEA 5EY5B 2GYYA 4ZVSA 1QTIA 4EKNB 5HNKA 2C96A 5DPMA 3WNBA 1P5JA 4ZZ3A 1YQ9A 3MBKA 3TTSA 2OKGA 4BUZA 2VDJA 3OSUA 3PQEA 3QJYA 4IM7A 5LA6A 3R6TA 1P7YA 1N3LA 2FUCA 2IHZA 3F0TA 4J0IA 3HXMA 4W1PA 1UK7A 2F1OA 5CVDA 4RFLA 3NUGA 1YKGA 2XMZA 4KBFA 2DUNA 3MT0A 4FMDB 1MEOA 2ZT7A 2XJ9A 2W7TA 2WWHA 3NHPA 1HG1A 4I6GA 5AKIA 5MFPA 2IYVA 5BWNA 1IZ7A 1PD0A 3T7KA 3T35A 1ISSA 4BGUA 4PHGA 4FCTA 2NAFA 1NAHA 1WD7A 1RYDA 1QYIA 2ABWA 3OZXA 1VSUA 3EXG2 3NHKA 4LYAA 4MZXA 4NY1A 4YUZA 3EW7A 4HXYA 5EJAA 5T3UA 1NNUA 5AKLA 1GKIA 1E1RA 1LLFA 2VP9A 1USKA 3GJTA 4BLQA 4FYMA 1Y48E 1N57A 3R20A 3AEQA 3DUFB 1T3HA 3LE8A 2WKRA 2QLTA 2AMVA 1WUYA 4F45A 4B71A 3LZDA 1DSSG 1VTKA 1WXHA 3R9IA 4LPKA 2X5KO 5HKLA 5B55A 4OJKA 4EG4A 4YDQA 3MM4A 3OJCA 4OLHA 1E2FA 2QM7A 2XWSA 1NI4A 3GD5A 3HFGA 5LBUA 4QYWA 5DNVA 5C1PA 1JXMA 3QIAA 4D9FA 1RM3A 1KH3A 3J7AC 3CEJA 5CGQB 2WEKA 2QLFA 2BR3A 2A2ZA 2QJTA 3PJDA 4IY1A 3FSGD 2DETA 1Z63A 3GJYA 3AR9A 3COWA 5JI3E 3M4NA 2XAUA 4WASA 3HRIA 4G3XA 2MCFA 4HUTA 1KFJB 3DC7A 3OQ1A 3H3JA 5LN1A 3ZU6A 3C48A 1ZD5A 1TQHA 4LXYA 2ECQA 5T64A 2FMXA 5TR9A 4ZK2A 3H05A 4RTNA 1V5FA 3U3KA 3AL3A 2Q9AA 5D3MA 4DDWA 5SZIA 3REFA 4DSOA 1NVGA 1SXJD 1II0A 4HUQA 3WA7A 4PO9A 4B2IA 2IJGX 2R3SA 2YXBA 4X92A 3LIIA 3CX6A 4LGMA 1S8FA 1YDWA 2GDZA 2XOXA 4HEJA 2HEGA 1WPQA 3PC6A 1EDOA 5HJEA 4H77A 2CMDA 1B1AA 1GQYA 5IRCD 1X70A 2V59A 3EIOA 3H8JA 5DXFA 5FWYA 2PQ2A 5TVKA 3QUQA 3K9LA 3IVRA 4L07A 2I65A 5AW7A 3AIOA 1D2GA 2Y67A 2ZIAA 4RA9B 2HREA 3IPLA 4IUDS 2HSJA 1L0BA 2OT3B 1PTJA 2VDOB 3I30X 3OT5A 3KXLA 4L8LA 3SY8A 3K5WA 4BAUA 1T0PA 2E5WA 4LYHA 4JK3A 3CLTC 3FYCA 2J0UB 1W9HA 3M49A 1H8HA 2C4MA 3BRWA 4ZGBA 2Z1MA 3QBEA 2O1WA 3GY0A 4GS5A 4F3NA 5LQDA 3OZDA 2H51A 2Y1EA 3K9NA 4R3WA 5CD1A 1CY1A 2JIDA 1BMFD 4MDEA 2MDTA 1MAUA 2A0WA 3ZLTA 2XDQB 2C7OA 2AX4A 2ZJOA 3W8FA 3WSWA 3L18A 3TBFA 3LVQE 1MLDA 2C4UA 3EQ8A 4UAVA 2G67A 5CPFA 1XDUA 4JKYA 1TGVA 4ZMSA 3M2PA 1VECA 1JHUA 1GR1A 3T12A 4YJHA 1N5IA 4QTTB 2QSUA 1DHTA 3O8DA 1UEIA 3G2QA 5K6RA 2V6FA 4YJFB 1MJGA 3I9JA 2GM5A 5IDYA 3U3JA 2XECA 5LYJF 3VTAA 2Q62A 1NNSA 3MWGA 5BURA 1OKKA 2IYZA 3A27A 1CVIA 3P0FA 4EOGA 2DVMA 4HDCA 1ZXBA 3CZ5A 4YJ2B 2WNIA 2CB0A 4DCTA 5L45A 2GFIA 2DP4E 1T2UA 1Z9BA 4ZT6A 5LP1A 4ENQA 1KS9A 1MD9A 1FUYB 2PCJA 2HXGA 4PIMA 1V4NA 1Z22A 3L40A 4E11A 3WK6A 4UTVA 1O58A 2PKYX 4E5VA 2JFBA 3OEED 4MQ5A 4RY8A 1TEVA 3BRCA 1TCAA 3VTZA 4DNQA 5AI5A 3A7DA 1RFGE 3THWB 3CKLA 2HMSA 1GU1A 5LNK6 4Y2SA 3S81A 1M33A 4J6EA 3L1KA 4YXWA 1UPFA 4DLNA 1VE7A 5BXYA 3ICEA 1P6QA 1HL3A 2HQBA 1MNAA 1U0BB 3SN6A 3PXGA 4L4ZA 4EGAA 2QTAA 1R6TA 3RWOA 3OIVA 2FPGA 2QT9A 4IGIA 5ICEA 3GLFE 3RVBA 2CWWA 1PO7A 5C5IA 1CV2A 4XA8A 2N9UA 3HE3A 4WA7A 3NVDA 3PQ2A 4I4CA 3RAFC 4Q7LA 1C3LA 3LECA 4CMAA 2ZE7A 3AUXA 3TZBA 5AVSA 1TMOA 5I01A 2AVNA 4DJDC 2I62A 5IMSA 1NYRA 4EI9A 2BFEB 3QH4A 4BO0A 4DTCA 3VPSA 1RPJA 4OFBA 4O2AB 2Q0HA 1UWCA 4XM1A 4M0FA 1XQXA 2HCFA 1M83A 3Q5DA 4MROA 4UKDA 3W0LB 2QP9X 2XZPA 1NBAA 5LIRA 1C50A 2W6ID 3GFGA 3PG5A 2QZSA 2AK2A 4YRGA 3PE3A 4C30A 3OHMA 2CV0A 5A7HA 4J29A 3GA7A 3TX2A 1T1GA 1M10A 1GCGA 4HPWA 3N0VA 1WPRA 4HH0A 4LZJA 1IHUA 2ZT6A 4N65A 4MPDA 1OYYA 3QBTA 3IELA 3R8FA 4UM7A 1GQQA 2I67A 4HRVA 4O3FA 3F2IA 3F4KA 3GGOA 1X87A 4TS9A 3UW3A 5LXTB 1Z83A 4IFIA 1E3WA 1N2XA 3MS2A 4FOLA 3FZYA 4PSKA 3N2NA 5B12A 2F8LA 4MVJH 1E7WA 2R1ZA 4Z8XA 1T2CA 2EEZA 3ADPA 4KRGA 2PGAA 2QK4A 2V3WA 3L7LA 3RTBA 5I4IA 2F3PA 4UU7A 4GMDA 1SULA 4CCWA 2FX2A 3IB6A 4QL3A 3SZGA 3BSWA 2M98A 3DV0B 4R1MA 1LK7A 1EBUA 2OG2A 1K8QA 2WV9A 3JQEA 5IBCA 1UBTS 1RTTA 1K89A 1H0RA 1R8QA 1VJDA 4ARBA 2B99A 4RHYA 3VNAA 3P8ZA 2BHTA 3VNQA 2WSMA 5JSYA 4IKOA 4YWHA 5CEFA 1QO0D 1KYIA 1U90A 1ZUHA 3I9MA 4ITVA 5G40A 3RT7A 3G2IA 2IDJA 1GPLA 2PQ0A 4I2VA 5IWCA 4MLPA 3O84A 4KE7A 1N6KA 2WW8A 3OCUA 1LEHA 1NF3A 3A7EA 1DRJA 1RQLA 2G36A 2OBNA 2XNKA 2QT0A 3QY0A 3HKBA 2FPPB 3EVNA 2OXTA 4BWYA 3S8EA 2W42A 4URXR 1JA0A 3PC8A 2JAXA 2RI0A 4WLVA 4FE7A 3V4SA 4C5CA 4M83A 3OHPA 3NHJA 3AKDA 4HQFA 4M9XA 1JDPA 1JKFA 3OA0A 4QO7A 3VVMA 4CI0B 4D98A 4S05A 4I3HA 1R0BA 1A8HA 3WLAA 5K2OA 4GHWA 2R86A 1SN7A 2D8AA 3JQBC 1KP9A 1PWEA 3NAQA 3EG5A 4ZKDA 1RLOA 5AW0A 1P0QA 4N7JA 3S2SA 3VGJA 4FZ5A 1Y7HA 4XQ0A 3IQFA 1L7OA 2C3MA 5L4LA 3U13A 1GOTA 3N76A 4ARVA 1DBIA 3FPSA 2R751 2E4AA 2VF8A 1N2HA 4IXDA 2IU6A 2EWWA 2VK4A 2YNMA 2Q2VA 1G21A 1UBHS 1ZOLA 2JLQA 1DEHA 2ZDQA 3P9NA 3L43A 2DWCA 2C7QA 3BCRA 4F91B 4RKYA 5PGMA 2I6TA 4BNVA 3QF7A 1UWVA 1DAGA 1XTPA 4ZCTA 4XYEA 4HAIA 1RABA 4WACA 2PZGA 2VT7A 4HL6A 1XUOA 1CRPA 2O23A 3TK1A 1GNRA 4EMUA 3C3AA 1HETA 1X1BA 1G8SA 1KVUA 4PZYA 1J0DA 3GEBA 4GRIA 1MRZA 4ZV9A 4ES6A 2O7NA 1LA2A 1P1IA 2ZI3A 4V0MA 5EE9A 1CZLA 3U4GA 1IHOA 4JUCA 4KQ2A 3AF6A 3HK2A 2EJUA 5E3IA 4X7MA 1FNDA 3H2ZA 3LT2A 2O8VA 1P2FA 3DVSX 4R6XA 2EWVA 3STWA 2V7UA 3HZOA 5TPZA 4B3BA 1KORA 3Q12A 2P2ZA 3PRKE 1AK1A 1I8TA 2CLDX 1DKOA 3CSUA 3VYTB 4Z3KA 1E2PA 4KIFA 4UM9D 4XB2A 2VNHA 2RHMA 3NEJA 4BJHB 3P20A 5C37A 1WBDA 3ONFA 4G1BA 2I99A 5FO1A 3QU4A 2ZJ5A 4LYFA 2A9KA 4B2LA 1KEUA 2ZQYA 4IQ0A 3SHOA 3TR6A 2IU0A 1OT3A 3FCYA 4NARA 1BRTA 1DJLA 4XEHA 2AUTA 3N28A 4P7FA 2BKLA 4GZ6A 1JX6A 3JWGA 3DPIA 3FOBA 1AA6A 3DJYA 1M1NA 1J06A 2PRKA 3AJDA 1Z4PX 1W1UA 4CGYA 2GLTA 2Q1TA 3AMVA 3MCTA 4GOMD 4PPNA 3QNWA 1IY9A 3JATA 3TAHA 5ABPA 2BFAA 1CUCA 3KQKA 4U7WA 1NMSA 1BMQA 2WIJA 2WPDD 4JP2A 2H5IA 4JITA 2ESRA 1Z5WA 5HS4A 3AXTA 3GMIA 1T8RA 4A3SA 1ZICA 3AFGA 3E3OA 4W7HA 3V8RA 1NL3A 3DT8A 2J0EA 1J56A 2LR0A 4ZTBA 2O57A 4OGLA 2JJ2A 1L5VA 2ZRHA 1UC8A 2QTLA 4BV2A 1JQDA 2A3RA 4MITA 1W30A 5ERGB 1UDAA 2L82A 4QXOA 4CKCB 1Y3CE 4G23A 4EKEA 1ULAA 4LE0A 2NNWB 1VL6A 2P69A 4RF3A 1XTSA 3T34A 3X1WA 2OMKA 4CMKA 3BMQA 1GARA 3EW9A 3G2HA 4KVAA 3NHLA 3T7CA 2G72A 3ACBA 4DPMA 4E13A 4H60A 1IZYA 2OFOA 2WSIA 4L72A 4FD3A 4YP9A 3U6BA 4BTVA 2A5FA 3OZEA 2DQSA 2JFYA 2YKGA 2WF5A 3WWDA 3AEZA 1N1EA 2H1LA 4FIZA 1UMBA 2ZR7A 3NBZC 3OHSX 1XTUA 1HWYA 3RBVA 4DNXA 2ICAA 2MR5A 3IDZA 1UXGA 1C2TA 4FR5A 4B7UA 2FUG1 3UJHA 2JEZA 5KNBD 5I8WA 2DSTA 4MV6A 3ABSB 1G2PA 3EUEA 3ZHUA 1YR2A 2GPTA 4PIPA 3E8XA 3U0VA 1X8XA 2C78A 3HJTA 3KO8A 4XGKA 5K3AA 3TWOA 1UMBB 4NV3A 1PD1A 4AZ3A 5KYXB 4XWYA 3KQLA 3S2EA 1G1MA 3PC7A 2VLBA 1ZX1A 1MPXA 3LC1O 5T5QA 5JWRA 3U31A 2Q0XA 1SUFA 2HHCA 5KAMA 5TMBA 4IIJA 1KBQA 1DP4A 2B1JA 4DSUA 5AP9A 5AM1A 3PFKA 1NF8A 2DOKA 1RHRA 1YULA 3UT6A 4ZFNA 1E63A 4LOJA 1QG0A 3CW8X 3QWFA 2G09A 4S1NA 3TUJC 4F5DA 1DLJA 3CRRA 5DN9A 5KYXA 5AW3A 2ADOA 3JQGB 3D6MA 3CW9A 1SKAA 2P79A 2J9ZB 3BB3A 4ZARA 4Y30A 3C3DA 3AUAA 4H6PA 5C81A 2ZWVA 3L6DA 2C0PA 2XB6A 3SM9A 2FEAA 3K9CA 1SO8A 2VSFA 2I3BA 5TX7A 4NNPA 5T6MA 2LKCA 4KN6A 1ZNQO 4WEOA 5NULA 3LBAA 3PICA 2A78A 4DSAA 1JH9A 3VR2D 2I54A 1ZSNA 1ZN8A 3GPCA 5I3CA 4XR9A 4LQDA 4JLBA 3EPKA 2O8DB 3GLFB 2I3GA 2O3SA 3CZRA 2WT8A 1OCEA 3N53A 2R7KA 2H2AA 2XUOA 2WF6A 2PT6A 4Q05A 2PGDA 4S35A 4R84A 1G1AA 1LLQA 1UXHA 1SHLA 3HH8A 4RLQA 1JV2B 5TQ0A 1C7EA 3HFSA 3U09A 3K70B 3GLGA 2C94A 4X1KB 2OENG 2YDYA 5E9QA 1TZKA 2PK3A 1RYNA 3RKRA 4ZZ0A 5CFRA 4RIGA 4B3HA 4LN1A 5G02A 4JU9A 3ZGNA 2CHUA 2L18A 2WZCA 3GP3A 1HNZB 2AX3A 1NONA 2YWHA 4PNPA 3UXEA 1GPKA 1L4MA 3HCDA 3HXOA 2J9RA 2PD4A 2G4LA 1UMDA 1YZTA 3CLSD 4KODA 3ANNA 4PW0A 1VIYA 3RAJA 5B37A 3UY4A 3L6RA 3PSAA 4FNOA 5DI3B 1X80A 4YH1A 3V4VB 2DB3A 1AJEA 2HF8A 1IAQA 4LNHA 3SZMA 2FOLA 4J0GA 4W8OA 4MCIA 1D2HA 3V8EA 1FFYA 2A6PA 3PD1A 5GP1A 4MKXA 1HDIA 3DSRA 5FA8A 2XZTA 3JQ7B 2EP5A 3OH8A 4GO1A 5A4IS 1I6MA 2W6PA 3O74A 4TTQA 3U7IA 5KQSA 4UDOA 3UWDA 4R1NA 1JEQA 3QLUC 3QFCA 4JOBA 2RGRA 2GSWA 1N4AA 2CK3A 4MUHA 5JAHA 3ELYA 4CDMA 3IXLA 3IQEA 1SH7A 1NWHA 3BXHA 4MWSA 3JQCA 1OE0A 2WB2A 4MWZA 1XFAA 2BZGA 3DKIA 4KOEC 2GAIA 4QFMA 4JHXA 3TD9A 4TKZA 4B7ZA 1XPRA 4YUYA 5A9RA 1B15A 5K05A 2R6JA 4LJKA 4DM4A 2CJFA 2ID9A 1R4NB 2QW0X 3IAEA 2IPNA 4LZPA 1VRCA 2C1ZA 2JRLA 2DHQA 3G89A 2NUTA 3HBNA 4R7ZA 4DQKA 1P77A 1O6GA 4M9ZA 1TM3E 3R3UA 3B60A 3UCFA 3GA5A 5AJHA 4IVNA 4WKGA 1QV6A 2HT6A 1QIGA 4FFMA 4N39A 1T13A 4XDGA 3FOZA 1R16A 1X13A 4CKXA 3DTYA 3AKYA 2Q1UA 3N2LA 1B2RA 4BNGA 2PZAA 2VJDA 1TX4B 3KD2A 3JTMA 2B1RA 1UWLA 2R8BA 4FLFA 5FTNA 4HQRA 1TEZA 1HLDA 1N6PA 2D0PB 2OHXA 2YW2A 4EPTA 1IXZA 2NO9A 4P33A 1EESA 1V8BA 3BN3A 2Y99A 2OORA 2YWRA 4Q3CA 4BZXA 1Q7TA 2Q3JA 4MGKR 2RB4A 4KNWA 1T5OA 3JV7A 1E0SA 1PNRA 3VO1A 4M0LA 3OEWA 5KTTA 2GZHA 3ENZA 4EECA 4WNYA 1UP4A 2AJ8A 3GUVA 1Q1ZA 1EVIA 3GCDA 4FMBB 2WYIA 2ZTHA 1RYZA 4RGVA 4MVYA 1X7DA 1XA4A 1QIFA 2QVLA 2VUSA 3P9CA 4Z8YA 5BNIA 10MHA 4UUOA 4Y6LA 3TQHA 3X1JA 4GVPA 1SB8A 5HRAA 2WWRA 4UM5A 1D04A 4IIEA 4URFA 4PPGA 1M76A 3WGGA 4DXAA 3SJCA 3H0CA 4MXDA 4DR5B 3SFVA 4BO1A 3H17A 1PT8A 1AZWA 3HNOA 2GA9A 4KXMA 4EVRA 2CFRA 1E59A 4MIKA 4OBEA 2X0JA 2OBLA 1D2EA 5AKJA 2C2BA 2ZT5A 3EXEB 5HKBA 2IUTA 2VJMA 3I4FA 4I0WB 2XRMA 1UPCA 5ALWA 3A14A 3KQOA 3THYB 2Q28A 4H1VA 4XCQA 3BMNB 4P4NA 1JKJA 4TXMA 3PVCA 4D74A 2JIQA 3GNLA 1A88A 4IS3A 3OT4A 1CG6A 2XTNA 3LGXA 1CFZA 2H11A 5H4HA 4LW8A 2A5YB 4ZDJA 1W8DA 3IAUA 1F6DA 3MJSA 4ZYVA 4U2FA 1FS6A 1VXOA 4RMJA 4UNIA 2NP6A 2AG1A 4WCDA 4P80A 5CT5A 2IU4A 3GC6A 3ILYA 1SU8A 3CONA 3JD0A 4YAWA 4CL8A 1FPQA 3EIHA 1RIIA 1YT5A 3HCNA 3NUZA 2H1OA 2C98A 3TLEA 3X2SA 4AMZA 5IK2A 4Q6WA 2JGKA 1MGOA 2ZSHA 3T9FA 2QQGA 2QL6A 2WWYA 3RUHA 5SZHB 5AD1A 4JJFA 3M5CA 3DNPA 2IWHA 1XVIA 1OTHA 4IG4A 3A6GA 2FZCA 4H31A 1G16A 2BFBB 5LZ7A 1MTZA 1LPSA 4IRXA 4XYGA 2H9IA 3V42A 1CVLA 1FUKA 3W9UA 1WS6A 1L4FA 3IEKA 1VHWA 3WQSB 1GUBA 1OH8A 3TJMA 1Y8QA 3DZHA 4LOIA 4P6VF 3ZWBA 5LP6B 4B46A 1GFZA 2E87A 1YC5A 1NIJA 2DBZA 2II6A 3EEYA 1QRUA 3DOUA 3U40A 3KK0A 3O75A 2Y77A 1WIWA 1M1UA 2H54A 3EQ7A 5A02A 4LZWA 1V35A 1FLAA 2VL7A 2PMCA 2G7ZA 1KSHA 4NOLA 2IP2A 2NTJA 2FVYA 4MQFB 3MMSA 1GPNA 1ZU5A 4OMDA 3WLSA 1VMKA 1X7WB 1ZAKA 2J7PD 4E7OA 4F12A 2FFHA 2KE5A 3NV9A 1Q0UA 5CBKA 3DAFA 5LZ9A 1QHNA 4DLPA 5ELXA 3UA3A 2FPLA 3MWKA 2Q3FA 3HY6A 2GN2A 1XIVA 3PNPA 3UK2A 3WB9A 2DYKA 3NLLA 2BFDB 2DE0X 5B2FA 3BCHA 4LSGA 4L73A 2GILA 4EYOA 4INAA 5B1YA 1DUVG 3C24A 1J5PA 2R4UA 5FTWA 2ZUFA 4ABTA 2ZAGA 4N5NA 5TDHA 5AHWA 2Q1WA 3B1JA 2GFQA 3RSHA 2BCJQ 2QX6A 4Z2YA 5AK6A 1YVRA 3LQ4A 4A8JB 4RDXA 2QBYA 1R6AA 5IJAA 3SNKA 3L0ZA 3JSAA 1A98A 1HYQA 3QFSA 4M38A 2AMYA 5LZ8A 4EPRA 3VV3A 4Q1DA 3C3WA 2GXSA 1XZLA 1X1DA 4CEHA 2ZRNA 4OP3A 3BERA 1V9CA 2YOGA 3C3CA 4CMEC 5AESA 1MZPA 1OZ0A 2Y2UA 5IM4A 1N1MA 3RUEA 3DEIA 3ZHRA 4DSZA 2GLUA 1WDLA 5K0TA 3ADCA 1XXHA 5KNBA 2H1SA 5DYNA 2GPYA 1A3CA 4CQMA 1REQB 2GUWA 4JB0A 4BFWA 5J4YA 1BQ3A 1E7YA 4L9RA 4N03A 3IULA 3DOCA 4QPNA 3VDXA 4WH0A 2J8ZA 3TRKA 1O0BA 4GRDA 4WNIA 2GK7A 2ZVPX 3JU3A 3W05A 3TAXA 3LW8A 2VI5A 1VLLA 2H2WA 1NQVA 1T8TA 4XWTA 1TIPA 3UGTA 5K0FA 1SAYA 1G20E 1MAVA 3LZCA 1MIOA 4U39A 3H5TA 3AF3A 3HL4A 3KCNA 3UMMA 2O2IA 4IIXA 1ATIA 1OBCA 3S70A 4CM8A 3F73A 1ENZA 1JVBA 4JLPA 3SOPA 3VSAA 4EF6A 2CFIA 2YINC 4RK5A 4X6XA 3M1IA 4KK4A 2JJ2D 5CEJA 3OPYI 1ABEA 2MSDB 4X7BA 1F4VA 1PLKA 2QGNA 3H4TA 1JBQA 3ED1A 4I8XA 3VNVA 4U4AA 3OIGA 1RBMA 1IZ0A 3L6BA 2BELA 1BDIA 5ECGC 2CVFA 3ETEA 4RK4A 2NTEA 2EC5A 2J3QA 3QHQA 1RC0A 1KA9H 521PA 2VDWA 4DMKA 1NG9A 2QN2A 1UBFA 3QRWA 4GI7A 4XCXA 2W37A 2R6DA 5DXAA 3NTVA 3QWBA 1MO6A 1KAEA 3AYXB 3LW7A 2J4DA 4DUZB 2NSLA 3OBIA 2RD2A 1OU0A 3QELA 4TUYF 2QPOA 3S1LA 5FBVB 1L5WA 3Q85A 2VKTA 2VSQA 3H0KA 1L8LA 2XZOA 4YBRA 4TLLB 5AOVA 2DPXA 4PYQA 4XARA 3T5TA 5KTPA 1JIJA 5BWCA 3EPHA 1C2YA 4LOAA 4HP8A 3T5AA 3IX7A 1KC3A 2DBQA 2GD2A 4ER3A 1XTIA 3OJ0A 2BFFB 2OVFA 2PMFA 2JKZA 1WEHA 2WJGA 1A7UA 1A9YA 1B0UA 1A9QA 1XCLA 2G70A 4LK3A 4BRWA 1O4VA 5KYNA 2VJBA 1SURA 1IB0A 5FYDA 3ZU2A 3N07A 4F6CA 3HCBA 4GR9A 3PIIA 4M37A 1BXGB 4MZDA 4B79A 1VBFA 2R2GA 5JFTA 1CUDA 1NVAA 2GEBA 3ZDZB 1E6CA 3QIVA 4B6QA 4N1AA 1CP2A 4PVDA 3JQQA 1EWQA 4PQYA 3K7EA 2CVHA 1U6KA 2VAPA 5A06A 1UL1X 3D7RA 3IP5A 3FTCA 3SBOA 1SBHA 2BGRA 4BO6A 2IV3A 5BUCA 3HKBB 4IQ8A 2IZ1A 4CLRA 2BOVA 3N6XA 4X24A 4BV9A 2DTDA 1T4BA 1ND5A 1PFVA 2YV1A 3CF4A 3D8UA 5DMXA 3VYUB 1E5XA 2J5BA 2X8BA 4MWCA 4MRAA 4ZJYA 4IQFA 1YCGA 3AQIA 4O4LA 4J3JA 3C14C 5AOCA 3UANA 5JS1A 1NW5A 3VVBA 3RS7A 1ZK4A 3OKFA 4RGBA 2A1UA 2AC2A 2XOKD 3U4QB 2XT0A 3DWGA 1VM6A 3MAGA 2HLHA 3VYVA 3MPOA 1LC0A 4M89A 1KI3A 3PB3A 4OXKA 3GG9A 4RLSA 1B6SA 2X1LA 2VYNA 2A7XA 4NBUA 1BEUB 1RKVA 1PKEA 1F12A 4H27A 2VATA 4WDQA 1NZFA 5AHXA 4B40A 1RHUA 5CLFA 1ZFNA 1CB7A 1QGDA 1IY1A 4C0BA 2R8XA 3EQ6A 3BKWA 4I08A 1SUSA 1G17A 2Q49A 2IODA 2NVUB 3TW8A 4BPBA 1HYHA 1DJQA 2ECKA 3LDAA 3SR4A 1ZUD1 1YB4A 3EBLA 4YIKA 1KR2A 4KDEA 3B52X 3FW1A 4XVUA 3HB4X 4HAWA 3KTOA 5BWLA 1KY4A 6AT1A 4UZFA 4ZHSA 5ICCA 4DLXA 4GDFA 3U80A 1OZGA 1ANKA 3JX9A 3ZU5A 1OA1A 2IW3A 3BH0A 4JB8A 3HRHA 1W36C 4LRUA 4ZO4A 3FJOA 4YRJA 4BKOA 4EBFA 3FIUA 4TMZA 5IF9A 4EHLA 2P30A 2V5VA 3GEDA 2XCQA 4PPQA 4YAFA 4CMIB 4JOQA 2C4NA 3QFRA 4DV3B 1ULSA 3QJ5A 2D5CA 4XX1A 1TD9A 3H75A 3B6IA 5KQPA 1BN7A 3MGCA 1UZLA 4E1VA 3GWZA 1I6WA 5AI9A 1XTZA 3KTFA 1Y9JA 2HL6A 4X8OA 1KFCB 1UMCA 2PKQO 4CFSA 3T5CA 4EGCB 2FJ0A 2VYCA 2P5YA 2HJGA 4KH0A 4KJXA 4PYOA 3GQBA 3UATA 5MGNA 1GTRA 1CIVA 4FSXA 5BOSA 5HK9A 5LJIA 1MQ8B 3RIYA 4QPDA 1SKBA 1KMCA 1N2CA 1NUTA 2VHQA 2VXYA 1SQGA 3A31A 4JUFA 4UDXX 3STUA 3VU8A 4UZEA 2JJ8A 3W8NA 3UV7A 1ILWA 1QRRA 3R3XA 1U65A 3HY3A 4A6EA 1QDUA 2QV0A 3U39A 1G64A 1EIWA 4BVFA 5ICGA 1IUNA 1FLVA 1OD6A 4J3FA 3PL1A 1YSCA 1WMBA 1ZDMA 2GERA 5DYIA 3DDOA 1WXXA 3AETB 3K0CA 1JN0A 2CWDA 4PV7A 2W43A 4FC6A 4JC4A 1L3BA 4H1HA 1ZL2A 2IOFK 3TL6A 5HVNA 4KAFA 4HDNA 2FEKA 4V0SA 4BVAA 1ZKMA 3RTEA 5E7QA 3E2PA 1QH9A 4KQEA 4BQPA 1SG9A 2UUBB 1U1GA 1O1YA 2J87A 3MWDB 3T7SA 2J59A 4ND8A 1G20B 3RSOA 1ACJA 1JDNA 1OC2A 4TT3D 2ZIXA 1YV9A 2LE0A 4BTLA 1GFWA 4LRXA 2PXHA 3DWFA 1KI8A 5E9WA 4H18A 3INNA 3IUEA 1H8EA 2GEUA 1OSNA 2FRXA 2I80A 5GPBA 3RK4A 1Z6QA 4JV5B 4F1WA 3G7NA 1C3XA 1Q95A 1JHOA 3PTZA 2GAFA 4GC5A 4GSYA 4K1LA 3O4HA 4AJKA 8AT1A 2HDNB 1DKNA 2XVYA 2Q7DA 1E2LA 4JI0B 2PKEA 4RPIA 2J4FA 4Q9HA 5C53B 2XGGA 4H16A 1XAJA 1MJ5A 3R7AA 5DM60 4J16A 4Q66C 1XQVA 2QZ4A 5B6PA 4CV2A 1EIZA 1QO7A 4GM0A 2H08A 3DOIA 3W9YA 1ZNXA 1DQPA 2E4XA 1SXHA 5EHQA 3SX2A 3O90A 4D79A 1SVLA 1IEXA 2HIGA 2FI1A 2WVGA 4V0NA 1O97C 4KU4A 3FUUA 1V3VA 4F04A 1RC1A 5BO5A 2VNIA 3I39X 4UE2A 2LNDA 2CSXA 1KZYC 3QWIA 1EX1A 2IA5A 1QHIA 3OUZA 1W7AA 4I9NA 3HCRA 1A04A 4CV3A 4KPYA 1MX5A 1JDVA 2BTQB 2PJDA 3RU9A 1O77A 5BPHA 3GEPA 2C0QA 4P83A 1KEEB 3DTVD 2WY2D 3TR0A 5HZHA 2IH2A 2PUGA 2FLVA 4M1WA 3ZCRA 4YRRA 4BE7B 5AVRA 1HG0A 4II2A 4NAHA 1FNSA 3OX4A 3ORSA 3PUKA 4MTCA 5HMMA 3OQMA 2UU9B 3OOEA 3B70A 3WP0A 1V5WA 3BK7A 4G5OA 1PFYA 2VA9A 2XCLA 2IP1A 4ND6A 2FZEA 2VAVA 2Q3CA 1F3OA 2Y66A 3A3OA 1Y3FE 2HFJA 2EL9A 3A26A 1HT1E 2Y92A 4XW2A 5FEMA 1U0EA 3MT8A 3S4YA 1MDBA 3L8DA 4L50A 3COSA 4QVGA 1IRXA 4BDTA 3ZLVA 3S5UA 4BC0A 3M8KA 2XGJA 4NG5A 4KFTA 1EVQA 1G7RA 5DJ5A 3DO8A 1IJFA 4FSDA 5DXJA 3REQA 2YIVX 2KWIA 4MLDA 1C3OA 1JKJB 5JXHA 1URPA 1C1XA 3CIFA 1Z2PX 1JP7A 1LPPA 2EW2A 3KT6A 1F0YA 2FGKA 3CZCA 4EKDA 3KR0A 2C5FA 4RC9A 4CODB 1FDTA 2AYYA 4ND3A 5JAMA 1QIEA 2GPWA 1YHNA 2QAGC 3SEFA 4BNMA 1Y7LA 4MW6A 5IJ0A 1WY7A 1TVKA 1U80A 3NIFB 3DDZX 1A4IA 4MQEB 3NVAA 3PGA1 4O5AA 4B5LA 3RU3A 3SIRA 2ASEA 5D3MB 3DVAA 1Y4UA 3OETA 1RVV1 1ONBA 1F2DA 4BEWA 4QPCA 3LCJA 5KTNA 4G85A 4PLCA 1VMEA 4KR0A 5E3JA 5K1ZA 4E70A 3HUUA 4KFSA 2CDAA 2QG9A 4B83A 5C7LO 2HLDA 2R9VA 2AG0A 1YKSA 4RMNA 2B98A 1P1BA 1J22A 3Q9UA 4AIIA 1AKRA 3ZZTA 2BDUA 1CUGA 2I6UA 3BCSA 4CIVA 5ES4B 3C5HA 3GBSA 5INTA 1XTVA 4KFUA 4AMYA 3SLGA 5JATA 1Q6ZA 2OHIA 2ZITA 2GCOB 1M9NA 2IYYA 2QS9A 2UUOA 3KEGA 1E2EA 4UBIA 1GDTA 4RY2A 3OFVA 4OHXA 3VI3B 5F5LA 3SYRA 3WQHA 1XMOB 4PCAA 5BR7A 2H1IA 1U9JA 1G2IA 2H0AA 4A92A 3DE6X 1X2EA 2AMJA 4UHDA 1X8LA 1B0PA 4ID9A 1U9ZA 1V1MA 4O6VA 2OD9A 1I6LA 3HJCA 1EK0A 2HWKA 4NS4A 4PYMA 4RPKA 2XQGA 4OUKX 4B3CA 4TM7A 1OBHA 2BBSA 2OCAA 5EUBA 3ET4A 1LDMA 3F7OA 4QJBA 1A9XB 1ZGHA 4KXQA 3GH1A 4IDPA 4LXHA 4I50B 3BQ9A 1CRLA 2SECE 3KL2A 2GZ3A 4OMCA 3MCWA 2OZPA 4X20B 4CG2A 1ZR4A 1F38A 1ZRMA 3IXQA 4HVAA 3IIJA 3JARB 3R44A 5K2MA 3SE7A 1YR1A 4WN3A 4XCVA 1DQZA 3PDUA 1TW2A 2FUEA 3NM4A 3K4QA 4MWDA 4AZSA 4D3XA 4Q1BA 2Y1FA 5JDIC 3HZHA 4D9MA 2ETVA 2PXAA 4PO8A 2B61A 3OOSA 4GZLA 4ZRNA 3PD7A 2GHTA 3TGLA 4MIEA 4KO8A 3ZEAA 3DEHA 1T1IA 1U99A 2FZGA 3KFXA 2Q2WA 4UQLA 4PC3A 3PL5A 2GO1A 5CIWA 3OTOB 2R84A 2B2NA 5FOWA 1CY0A 2N3ZA 3F9CA 3TQTA 5ALXA 3L79A 3BWMA 5EWMA 2CXTA 3WL4A 3RPEA 1Y98A 1AHIA 3DLIA 4KV9A 2NU8B 1J2JA 4KMMA 3WMEA 5IKPA 4GR4A 4NYJQ 4Y6OA 2PQMA 2BEWB 4HFJA 4NMWA 2JGNA 3QFHA 1GG8A 1J0BA 4NZZA 5FLEX 1UPUA 2WU1A 5HOQA 5DYYA 3Q7TA 4MB6A 2X0EA 3WYNA 2OCKA 1T35A 1TDJA 1X86B 2DPMA 3O0TA 3ZHBA 1QVVA 3ZCXA 2WWFA 1SQ5A 4IF6A 2ZZKA 3EXIB 2VFAA 4II3A 5DULA 1Z6ZA 3AJ8A 1F6WA 2DFNA 2QEQA 4GZ3A 4NULA 3E7FA 1G19A 4OXQA 3RTAA 4DAOA 1OH7A 2IHKA 3DKVA 4HXGA 1LWOA 2WPDA 4KWTA 4DY4A 1QVAA 3KU4A 4FQ5A 3LQRA 3U9TA 3TIVA 1K66A 2PRYA 1ADJA 2BJVA 3CZ9A 2JEOA 1I4DD 5IAOA 1EVLA 2FN3A 4IDOA 5IU6A 4I5GA 4QPJC 3VYSB 2DUJA 1UT8A 2W98A 3AINA 4C7MA 3EFHA 4D4KA 2BGGA 4GKVA 2FCAA 5KAPA 1H2XA 1T0HB 3QYPA 1DTWB 3LRTA 3ZDXB 2I4MA 1N9ZA 4M1YA 1Q1BA 4OJYA 4YR9A 3ROXA 3Q4GA 3CO5A 1USUA 3SS9X 2I29A 1NZJA 2XIQA 4AF7A 3P71T 3WAGA 1QKKA 1S3GA 1JPVA 1R5JA 1YJ5A 2BP7B 3DZIA 3DZBA 3P19A 3ZVKA 3NZEA 4PLTA 2INGX 1HDEA 1SVNA 4R16A 2Y6UA 5FXMA 4E33A 3O4IA 2YZ2A 5HIJA 1OFVA 1GLGA 1NOKA 4ER0A 1E9AA 3G9TA 1TQ4A 2NWQA 1WV1A 4G1MB 4TQAA 5CYPA 3NDJA 5K0JA 3EY9A 5IM5A 4LGCA 4J1QA 5EXSA 2WA2A 2NYUA 1ZCZA 3MTJA 3ZWDA 1MH1A 1VPDA 1ABBA 2RFLA 1K9SA 1EEXB 3BWYA 4EZIA 3E1SA 1WU7A 2CFCA 2BC9A 1W36D 3BFVA 1LV7A 1G291 4OQXA 5BP7A 4KXFB 3VC7A 1EHIA 1HZZC 3OP1A 3BWVA 3EZ9A 2VQSA 4M6WB 4MTLA 1A96A 3IE2A 3EYAA 5ELLA 1CF2O 2IE8A 3KZCA 2DWPA 3KU1A 4JVOA 3ZKWA 1EZZA 3JQ6A 1AUOA 4WJZA 1XP8A 4IDDA 3KAQA 2RH8A 2B6NA 4ML3A 4MQ6A 2XW6A 3BJIC 2LGJA 1WB4A 3ER6A 2Q9BA 3IUSA 4FYIA 1AB6A 4QEKA 4BMCA 2VQ6A 5LBTA 4G9GA 1EINA 4WIAA 2C84A 2DHCA 1P2TA 1NYTA 3FPGA 4RF2A 4RS3A 1U1EA 4HNQA 2Z9BA 2ID8A 2GPAA 1KJNA 3DBOB 2VRCD 4QFCA 4ZCQA 4QHTA 3WYBA 5DCLA 3ACCA 3KWLA 4IV5A 4RHCA 5IBRA 2OFPA 1P4SA 4AYWA 4P31A 4KG7A 1CIPA 1SCAA 2RBEA 3E23A 4JC0A 1A69A 1NBEA 1OYWA 2C5BA 3FI9A 2ZB2A 2EZTA 3SM3A 3TL3A 3QU2A 4CKWB 3NMUF 2G6TA 4GVLA 2DY0A 1V71A 6Q21A 1MABA 1OY1A 3O03A 5FOSA 1TAGA 1RQGA 2I9KA 3KQUA 3VH2A 2KHZA 3U62A 5CTJA 1FDUA 4HYQA 3HO6A 1Y1RA 1VIMA 1YK0A 1UPXA 3KJIA 3KV3O 1IJKA 4KACA 4FDLA 3DE5X 3CZQA 4ZAVA 4KREA 4J4HA 2O52A 1FP6A 3V7FA 1IBCA 1OYVA 3FDJA 4JROA 1P31A 2Z57A 3Q41A 2CCKA 1MG5A 4YRFA 2IIVA 3ZHYA 3MK31 2O7RA 4X64B 3LD9A 4AF6A 4RH0A 5JNRA 5K0BA 4OJQA 3CMMA 4QZVA 1QRSA 3Q1LA 1T9GS 1AQLA 4FZVA 4TTAA 2JFWA 1QAOA 2XDWA 4RNDB 3TI7A 1OXMA 4HQNA 3IHTA 3Q2IA 5DX1A 1XMJA 1KE1A 1BDHA 3KKPA 1DT3A 1WG8A 4WXRA 2JI9A 2LDXA 2ZRAA 3ZX4A 3VNSA 3C7TA 3K8YA 1JAHA 3EHEA 4DKXA 3C6BA 3EEOA 3PP8A 3M5WA 1JU4A 1WMFA 1YZKA 4RLFA 3I0ZA 3I1JA 4G5YA 1P2SA 2HK9A 3EB9A 2WAYA 1ENPA 3KLNA 4PLPA 5J2TF 3LQYA 2YICA 3DOOA 1ORHA 2QRNA 4BVEA 1E3EA 5I7UA 4X54A 4DLWA 1ULBA 4K3VA 1MX3A 4TM8A 3KWFA 2X8AA 2P6RA 2F48A 2FDXA 2PSSA 2YJ3A 1N6OA 5I4KA 1NASA 2IHNA 2ORED 2CNBA 2FUNB 3C6XA 3ECCA 3NG1A 3ER9A 4PYJA 1L7VC 3GRRA 1TLTA 1LUAA 2OCYC 4BLTA 2A30A 4A5OA 2V1UA 2V9CA 2AHRA 1G3IA 3JYOA 2NADA 3AIMA 5JD6A 3FFXA 5JFGA 4G4SO 4F2HA 4EG7A 4GC9A 5TJ9A 2GR9A 2X7XA 1BROA 3HUFA 3G5UA 1QGYA 4PQRA 2ZUSA 1ULUA 4CM3A 2GZRA 2XEDA 5ER9A 4A7PA 2XCSB 1XBTA 4D9KA 4CIYA 4BXOA 4Y2RA 3GJZA 5IKEA 1ZOIA 1AU9A 2LIPA 3PHGA 3M2TA 4BCCA 4MPJA 2JK0A 1YC2A 3A0UA 4Z1MD 2I55A 5TF0A 4LK2A 4JCOA 1ZHFA 1LZLA 2BM8A 1TAUA 3EFBA 3WP1B 4ZVRA 1RDFA 2JK1A 2UZIR 3MWLA 3AESA 4J0FA 1TA9A 1DC4A 4I66A 3PVZA 3EVTA 4LYDA 4B6OA 4WNAA 1ZVQA 2C7BA 1FRFS 3E0QA 4EW2A 2A5LA 1AQJA 3NNDA 1KZ4A 5AHRA 2O05A 3FROA 1HR0B 3HSKA 1DO8A 1YQQA 2I2WA 2B1QA 1FX0B 2IQIA 4G5GA 4L7VA 3OE7D 5B1HA 1EDZA 3TPZA 4BLOA 5IZCA 3I0NA 5EEHA 5K3OA 5KOJB 2GCPA 4LNAA 3G0GA 3ANYB 1N5OX 4BQIA 4L3WA 2Q46A 1YA6A 3OPNA 2Q4RA 1EGMB 1NE2A 3B1WA 1SHJA 4RKQA 4G9EA 1YBFA 4NMHA 3WBJA 2ZAIA 3ZG6A 3H19A 3P5BA 2VTKA 5GADl 3B5JA 5U4QA 4KQ9A 3VHRA 3UK0A 2EHJA 4X6UA 2XE8A 3N1UA 4Q1EA 5JSUA 2PWAA 4CM1A 4DCUA 3F46A 3IQGX 3KDPA 1YOVA 3C97A 1ESEA 3UAGA 3LUPA 3DP7A 3E2MA 3QW4B 2VTBB 1D8TA 1DEOA 1EEHA 1G2QA 1YDFA 3HV2A 3NWEA 1KQGA 3GRVA 3IS3A 4ZCSA 2QVCA 1NQUA 3OM0A 5D84A 1ZLXA 1E6EA 4L75A 4WJLA 3AERB 2GO7A 2IY8A 4EL0A 1TJ4A 1TB4A 3R0QA 1S7GA 3IVXA 1T9AA 4DNFA 2QP3A 3I9V1 2QI9F 1AO0A 1EDBA 3RH0A 3CLTD 3DZGA 3LYHA 3TKLA 4X44A 3ZN2A 4RD4A 4DWOA 3TW0A 4WOCA 1Z0IA 4TXLA 5IABA 2NP7A 4L02A 3UYLA 4GAEA 2AE1A 5I7OA 1PQ4A 2FUKA 5TGZA 2CK3D 3PDJA 1NLMA 2VHZA 5GIOE 1Z62A 1U4OA 1G0OA 3O8NA 4MGZR 2O3UA 4EY6A 3GB9A 1ZNYA 1VOTA 1RT9A 4FBLA 2GCEA 4DQXA 2R4TA 1CEXA 2ALJA 4DJFC 2AOXA 2DSNA 5EQJB 4B6FA 3EIWA 2N46A 4DV1B 3N0WA 2AFVA 1E3LA 5HTKA 3TLCA 5I7VA 5J4HA 5JNVA 2ZP1A 1CR6A 4JJ6A 2V45A 3DBHB 3F5FA 3HFRA 4AUNA 1YRLA 5ALHA 3AL2A 2PY6A 4FPXA 3CRQA 1HRDA 3P9SA 2HA5A 3MINA 4I9HA 3MSXA 1T25A 3OZWA 4R31A 5FI0B 4EJFA 4CU2A 2YX1A 3GI1A 1KMHA 1Z08A 1T6BY 1PFGA 2BM0A 3HO8A 2UUAB 4CIWA 4OH7A 2QTZA 3JWHA 4M1QA 1JDSA 4R1UA 5BPFA 3PU6A 5JU6A 3HN2A 3W04A 2OB2A 3AB8A 4QLBA 3A4MA 1VI6A 3U44B 1NLFA 1H9CA 3TG2A 1EAMA 1O2DA 4UHFA 3FCSB 4X41A 3K31A 1A82A 3SICE 2DEUA 3AFMA 3IL2A 3WVNA 4FFRA 2IHUA 2WTUA 3EARA 2QB5A 1WSWA 3OZRA 1R5NA 1FW6A 1Q1EA 3ICQB 4FOPA 1N7HA 1WLYA 3DAPA 5AKHA 3TTYA 1WUHS 1QG4A 5GZ1A 2VP3A 4PSAA 3L0SA 3V1UA 4HTFA 3CTMA 4ZOQI 1JDBC 2PKWA 4Y0NA 1CD5A 2WA1A 5ADVA 1AQIA 1RXWA 4EGFA 1NP3A 3KZNA 2GKGA 5CB6A 1XDDA 2BCGY 1J00A 1TOAA 2IC5A 2VWHA 3FG9A 3OMLA 5JADA 2IH5A 2B7CA 5BNZA 3ISVA 5CPBA 1U0LA 2FQQA 3C7KA 1PS8A 3NRBA 1XXHE 2WU4A 3FVVA 3IR6A 3FI0A 4BNDA 2XUQA 3RS2A 4N0MA 4OYHA 4F84A 2V3CC 4Y9TA 1TKBA 1HGXA 1RWWA 3P0RA 4U2CA 5ALSA 1L7NA 3HB7A 3O82A 4EVQA 4Z4EA 3HWWA 4ZQBA 1MNQA 3ST7A 3T9AA 5K7SA 3I3OA 4PNZA 4YCAA 4DL9A 2P4UA 3EEIA 3ZD8A 4DN6A 2ZR8A 3IP1A 4NU0A 5E4YA 1JRLA 5EPEA 2H4XA 4KKXB 2I2CA 2J32A 5LMCA 1V8PA 3EEBA 5EFOA 4FFWA 3EH2A 1N1GA 1ECLA 3N8DA 1JG3A 1H2EA 3LT4A 1THMA 3NCTA 4OHPA 3QPVA 5TPWB 1OXBB 2R8EA 4C5BA 5JDIA 1B76A 3OURA 4YIHA 1XLTC 1VSQA 4WESB 3UW1A 1BE1A 1LI5A 5FWNA 1EK6A 4ZO9A 2GYUA 3RKSA 4XPIB 2ZI7A 4PBRA 2ZANA 4RA6B 1T91A 1LDGA 4JMLA 3RCBA 3N7UA 4FJ0A 4CUJA 1DELA 2H0QA 2Q2NA 3AZQA 3GNSA 3HA3A 5TEVA 2CLSA 4N47A 3KG2A 3ZGXA 1MC5A 2I2BA 3I45A 4QHYA 4GXQA 3FUCA 1ZUNB 1V3TA 3AVOA 4RWZA 4U7FA 2OV3A 4HRAA 3W4KA 4JNCA 1QK3A 2HDWA 3ZDEA 2WSSA 4JHLA 1VG0B 3DMFA 5FH9A 5K8CA 2X6RA 2RKOA 2IPMA 3C5VA 3P7MA 1PZNA 1QSGA 4JDUA 4RTRA 1LRLA 2WIFA 4JXKA 4YO7A 3FPEA 4NRDA 3ZNNA 4FDMA 4DMMA 2P8JA 1VE5A 4O4LF 2JL1A 4XIGS 1X42A 3MUFA 2NU6A 1ZRNA 1KAQA 4XWAA 2QM3A 2X6TA 1JDJA 2PFKA 3NEYA 2Z04A 2ONYA 5C52B 4KI7A 1JHDA 3INGA 3W06A 3OM9A 4YMHA 2C82A 1QAMA 1X15A 2D1FA 2XYRA 2ZJYA 4FMPA 5F64A 1W0JD 2EJVA 2NZ2A 4ZYLA 2QRUA 4JY7A 3BOSA 5F3RA 4YJGA 3M33A 2ZJ6A 1CJBA 3IP6A 3OIFA 4UNPA 5LQCA 1L4HA 3U7RA 4CFYA 2C9OA 1LPMA 1GGJA 1M75A 1U7PA 2YUTA 3H11A 5E6RB 2EG5A 3WAJA 1PQWA 1G3RA 4UUMA 5F2NA 3ZDQA 3EWAA 2DAPA 3TZQA 4GQIA 3OECA 4AURA 4A27A 3E7XA 5GIPE 4NDNE 1JYSA 1XZAA 2GETA 4XLTA 1WTAA 1HDRA 2W6MA 4D9IA 3VR1A 3RYCB 3PVSA 1U5CA 4XIIA 5AXBA 3AF5A 4QXQA 2J3LA 2C3UA 3JQRA 1TCUA 3MA0A 5MN5A 5DW0A 1O5OA 2PGNA 3PHHA 4CF5A 4EB0A 5DRTA 5L3SB 1LS6A 4QUIA 4WK0B 3HPRA 4TZ0A 3ML1A 4MUIA 4QXMA 3TL2A 4N3NA 3I62A 2YVLA 1LSJA 1W2WB 2OC9A 2XE4A 3EDQA 1HDOA 3NBUA 4JLMA 5DNUA 1WCIA 5K51A 4CHTA 4LVOA 1E7MA 1JZTA 1W48A 5C80A 1GN8A 1KAGA 4Q7JB 4MR8B 1KIFA 1CQJB 2ODBA 4OBBA 4EPVA 1RRKA 4UHEA 1SG6A 4NHOA 4D41A 1JQ3A 3C6MA 2A9PA 4PS1A 4BNUA 3UM9A 2VBFA 1A9XA 3BWXA 3FMVA 3JAWB 5K3BA 1ZRSA 3HBFA 1VYHA 1U0TA 2CLEB 2HY7A 3OZ7A 5KHAA 4ETNA 3EDOA 1KGSA 3AHCA 2Y1OA 3ITEA 1Q22A 1VE9A 1YDEA 3B6EA 3TLBA 3H5NA 4JUBA 1LBIA 1NLZA 4KGXA 3ZPXA 3WJ2A 4YUAA 2YW9A 3OICA 4YQEA 5B3LA 1FFCA 3VDMA 2IYRA 1CFJA 5AKZA 3RD5A 3Q8XB 2HSDA 1M2HA 3LT1A 3GFOA 2ZRCA 3WWPA 3G8DA 1KI1A 2GBCA 1W44A 3AH8A 3VTKA 1O96A 3WKBA 3A10A 3HABA 2B2CA 3LBYA 1RAFA 1S9DA 3E9EA 3O38A 4RTKA 3UCXA 1M74A 4MOWA 3WYAA 2VDVE 3ITDA 3QA9A 4L5CA 2OXIA 1QP7A 3FFTA 3V55A 4LXUA 5DYGA 4PC1A 5ENZA 1HE8B 4V1CB 1OH6A 1YNOA 3N0TA 4EKGA 2OBYA 5AKGA 1QHEA 2IUUA 4BMVA 3UPTA 1TPZA 3PNMA 4MKGA 4TKVB 3STXA 1TVEA 4F7WA 1YR3A 3Q8KA 4NJEB 1EUDA 1JG7A 1N6LA 3L3BA 4BB9A 4G56A 4D9BA 1UWKA 4MQLA 1V9LA 1L5SA 2WHXA 4QXRA 3ZCQA 2VHCA 4OM8A 2XBUA 3CF4G 4Y9RA 4DLAA 2GN8A 4YRDA 3VZSA 2WE8A 2XLBA 2I4OA 3CFYA 1H66A 3ANMA 1SBQA 2BMFA 3N0RA 4I6JA 4P4GA 4PM4A 2XBMA 3G0HA 4G9BA 3B5EA 2B83A 2CMHA 2G17A 3KR2A 1QTRA 4JXZA 4FDTA 1PT5A 3R7LA 4EUNA 2ASVA 3DEJA 2XXAA 4KLZA 4KWHA 3KETA 1JFRA 2VAMA 2OHGA 1L5YA 1LF0A 2KLHA 5JFOA 3IYLW 4YALA 3U4HA 3TBHA 5ENVA 4D4MA 3TG8A 3HVHA 2RGEA 5GOZA 3KT3A 4ARCA 4NE7A 3P9XA 2XWJI 4B3FX 5ARBA 3AR3A 1ZR2A 3NRJA 2W4QA 4AKIA 3U3RA 1ZD3A 2PNJA 1UJNA 4G84A 2XGSA 1EP2B 3HC7A 1XQYA 1NVDA 1COZA 3AM4A 4FKBA 3V3TA 1E98A 3WLOA 2HH9A 1KHTA 3B7GA 1JFVA 1F0NA 2GAAA 2AN3A 4ENSA 1DRWA 4Q24A 1G5RA 1LD3A 2BP7A 2GRJA 4PNHA 3ZXSA 2EZ9A 4J4TA 2QD5A 4QDUA 2CZGA 4Z4FA 4R40A 1KNXA 2FJPA 4F11A 2RGNC 4LQCA 1GYPA 5KI6A 5I8PA 4BPRA 5T4EA 4Z0TA 2QL5A 1TQ2A 4I1OA 1GTSA 1D4AA 1YCFA 3O0DA 1TF5A 2XX3A 3OU6A 5SZKB 3N2ZB 3W77A 1YJBA 2VJKA 3FTNA 2CLKB 4NXMB 1UXIA 4YRIA 1Z74A 5TARA 1ODCA 4DJJA 3KSZO 4DJ5X 1NV8A 2RSLA 3DDUA 3KFLA 5IAJA 1MQ9A 1XDSA 1UZUA 1FXUA 2H4JA 4QTYA 3K6SA 1L7BA 2AOTA 2BAGA 5FYQA 3RFVA 2JW5A 2YY6A 3HL0A 4WFQA 2JJYA 4JWKA 1I3LA 2HMAA 3NB0A 7GPBA 1T9BA 1NDUA 4B3SB 1EB9A 1RBQA 3O83A 4OLAA 2WUVA 3HM2A 2C31A 3GRAA 2WTXA 4JVSB 4UOEA 1T4CB 2B4TO 1NW4A 5EIAA 1BW9A 3THXA 3V4OA 4ZTZB 2ZBEA 3TIGA 5BNTA 5KNBH 1PQUA 3S2FA 1G38A 3DXXA 3N2GB 1S5PA 3KJXA 1EUQA 4WINA 1CK4A 2J3JA 1QQ5A 2I87A 4G0XA 3TNFA 1V5EA 1GSIA 2JLRA 3BIJA 3K15A 1QKIA 4J1SA 3FYUA 4GI2A 2AUMA 5TS2A 5FNVA 1XPJA 2OQVA 1NULA 4Z7OB 3FNFA 4MJ3A 3ZWKA 4BKQA 3E5RA 1TU4A 3GRZA 3K72B 4Q4AA 5EKXA 3ESXA 2GQ0A 4LF4B 2Q7XA 4PG8A 3P4XA 1U2ZA 5CNMA 4YGYA 3EODA 3KOWA 4LE1A 4N5DA 4CKEB 4RTSA 5CB8A 3F3KA 2BKUA 3ZHTA 2VIIA 4O0LA 3MS7A 3UJPA 1SUDA 2X3FA 3K1AB 4QEZA 4QBHA 4I55B 5J47A 4DB4A 4B47A 5C7OO 5KWIA 5G4KB 5IG2A 1U04A 1KZ6A 4RKFA 5F7JA 2IEDA 1NXWA 5JANA 3V1LA 1ZMRA 3PNYA 4GOKA 3WGYA 3A9UA 4MS4A 1NJGA 1S4QA 3K09A 3Q7PA 2ODPA 2IOYA 4WTOA 1OX4B 5A3VA 2XODA 3SSMA 4U2KA 4ZRDA 3WNZA 5KB3A 1RJ9B 5JCJD 1F5SA 3PHCA 4FU0A 3NEPX 3WHPA 4F86A 2HYIC 3LOUA 3D8HA 2ZK7A 1DWOA 2OBBA 2ZCVA 1NSYA 2O7QA 2PS9A 4HATA 1XB2A 2G76A 3WIBA 2JGEA 1YFJA 2HCJB 1JLMA 1Z8DA 4R8MA 2V55B 4CUZA 1L5LA 1YHZA 4XTCS 5D3KA 2HAEA 5F76A 1OXSC 5IVPA 2CNWD 3VR5A 5A3JA 5BR4A 4YMIA 1QYRA 3K71B 4JC8A 4U9IS 1FQWA 3TPCA 1YH3A 1BC5A 3AWIA 2I0FA 3R8CA 4P54A 1TLLA 3T3GA 5K5EA 2X58A 4IIYA 1S01A 4D4HA 4XWGA 2BR4A 2QLLA 3LBIA 3A32A 3LBHA 2QYSA 5I9MA 3ZTYA 4DDVA 4US0R 4DLRA 2QUHA 4H35A 1SC4A 2C8JA 3AK4A 4H6VA 3N74A 4K9SA 2XMPA 2A35A 5ALDA 4C03A 8LDHA 4BE4A 5JBIA 4N01A 1W4ZA 3G0DA 2X4LA 1PJZA 4IWNA 4KLNA 1H5UA 1G8KA 1SVUA 1U8FO 3OG9A 5A03A 2X42A 3DD5A 4M21A 2DWQA 4OHBA 1TKAA 4RVDA 2Q4DA 2QY6A 4XKJA 1NW9B 4BOYA 4C2UA 3OA2A 1AC5A 3OIUA 1T9GR 4IF4A 3R8XA 3DAHA 3ETNA 3TOCA 1YB6A 4B0PA 1VKNA 3SHQA 4BXOB 3DBIA 3THWA 4RXMA 5I9TA 4CVNA 1YS6A 3AVPA 5IS2A 4EVIA 1NIPA 1KZ7B 4EQ6B 4OMFG 1R1DA 3G2KA 1QU2A 1QFZA 3ZI4A 1JYEA 1N0UA 4C20A 1JSXA 4M1TA 3KBBA 2YFKA 1NVWQ 1VJCA 4DSNA 1XZEA 3ZJVA 3WMGA 5JZMA 1D4FA 4NFLA 1GR0A 1WDTA 4CG0A 1DC7A 4LYYA 3BAZA 2YMLA 3NHWA 1EQ2A 1Q3HA 1RAIA 4FBGA 3OTHA 4TQ9A 1UXJA 5DTJA 2CMFA 2O3TA 4DCVA 4WW0A 2G25A 5FA5A 5JHHB 4NJMA 4H3VA 2ZKIA 1VP3A 2G9UA 2M1XA 3DR3A 1WR8A 3OKCA 5ALZA 1E20A 4QECA 4S2EA 5EOVA 1EX7A 1XEXA 3E48A 3M6LA 2CL7X 3BF8A 3BF7A 3I4LA 1FU4A 4LCBA 1MIHA 2H1WA 4B6EA 2ODNA 3T9EA 3LUFA 1VJ5A 5KQMA 2QMQA 3BKXA 5J4VA 1M1NB 1PR1A 5IXSA 1JDZA 2XUDA 3ORQA 5CH3A 1O4WA 3ND6A 3EVAA 2VHEA 3O8LA 1OJLA 2QYOA 1I14A 4MVCA 1TU0A 2X7HA 4B3IA 1YBMA 5T4BA 5IKXA 2NZ8A 4B43A 4OHMA 2CHEA 2EFCB 4EAAA 2GPSA 5LLSA 3PPWA 5A5DA 1PNOA 4QQFA 2YY7A 3VAAA 1IWOA 1EG7A 1BHQ1 1ESNA 1FNBA 3K8ZA 4GNKA 2PH5A 4W63A 5EQDA 3BFJA 3E9NA 3KQVA 4MYUA 1BEZA 2QUIA 5TC4A 1TECE 2GDJA 5EP3A 1HDGO 1QFJA 1YRYE 2CXNA 1FRNA 1SXJC 4RA6A 3NTXA 4D99A 1MAWA 2Z56A 3IPXA 3L92A 2AVDA 1R9JA 2CBXA 3L7OA 1U11A 3IEMA 4JXJA 2YV5A 4P3NA 4A2WA 2VS1A 2I7VA 1W1IA 3OESA 3RSCA 3WC4A 4XWWA 2WD7B 3OT1A 2IW1A 1VZ2A 1S2DA 1M8GA 1QQ6A 5ILGA 1O57A 1MC1A 3FYTA 1HTBA 1V11A 3WXBA 1R6DA 2WHQA 5J2TB 3EK2A 2I71A 4F8EA 1NKSA 2RHRA 5L6LB 2HRRA 1BWRA 4RZQA 1YA8A 3R4VA 4I5IA 3WYDA 4QFBA 2WUWE 3DBHA 4Y2JA 3K6JA 4BEVA 3FLBA 2ECFA 4R2KA 3X1YA 4F2GA 3DZDA 4UNRA 3JD1A 3F1LA 2CUTA 1LTHR 2JGFA 3GK3A 4ENPA 3SPXA 4ZYYA 1CJVC 4ZU1X 3CS3A 4CEJB 3BMOA 1BJKA 3H2KA 4E2XA 5HR5A 2YBEA 4WHMA 2HZBA 5TIIA 1PBTA 2P1RA 4NECA 2PUTA 2EL7A 4NYIQ 4V3CA 2NQ2C 4GLJA 5SY4A 4DREA 3QLEA 2FG7C 5TMDA 2J9FB 4JZKA 2EIXA 4Q3EA 3PDIA 1X0XA 2IYQA 1OR8A 4HG2A 5JE8A 2UKDA 5AIBA 1WX1A 2Q2OA 4G24A 1YMUA 4IZHA 2PWPA 3ZGOA 5L4SA 4PLYA 3FNQA 2ZPTX 1VIAA 4PGFA 4IEIA 5TSDA 1N7GA 1RE0A 3FN4A 3GDHA 1M72A 1P7WA 2V7QA 2OV8A 3F6SA 4YLYA 4UAJA 2ZVQX 3U7QA 3WV4A 1EQAA 3TIIA 3QNUA 1QHYA 3N2KB 1N0WA 2D1RA 1N9KA 2W8ZA 4OP2A 1JLHA 1BJRE 4X3CA 4AAYA 4F4DA 2QTVA 3PPYA 3JQ9C 3FOFC 3IUPA 1T5BA 4UAGA 3TLYA 3T7IA 1QR6A 3NYWA 2YXLA 1JTFA 1DBVO 5K0GA 2ODQA 1D5CA 2H06A 4K46A 4ZVVA 4YJ2F 4BNZA 1SEVA 3EASA 3LC0A 4P32A 3TE7A 5B2EA 2DH5A 1JHZA 2ZBUA 4UBJA 1G6OA 3ORFA 1RAGA 2VHTA 3C87A 2WJJA 3EBPA 5FHQA 1NRIA 2DT5A 1T1EA 1DC8A 2W0MA 5LYJB 4EH1A 1A97A 3KVRA 5CD9A 2ZIWB 3FDXA 5KCZA 4UNSA 5ALQA 3N7TA 4YJKA 4MDFA 1RYFA 4RE5A 5AVQA 4HDSB 1BWSA 1IM8A 1QWSA 1UFRA 4C0QC 5DSTA 1V95A 4REOA 3OCVA 5A0VA 2D00A 2G06A 4OKNA 2CDNA 2D4HA 2ZR0A 1HEYA 2VH2A 4AS1A 3ZLUA 4PO3X 4ZOLA 4HWTA 3SNHA 4D9JA 3O92A 1OIXA 1MFPA 3EZYA 4CRWB 5A7GA 5F9MA 2PIAA 2ZJAA 4PGMA 5TPWA 3ZOKA 4HEA1 3N05A 1ST3A 2YIJA 2C9DA 5HZKA 4Y2PA 4U0KA 1TK3A 1C7FA 3FVTA 1FDVA 3Q5EA 5DBFA 2B20A 2M6RA 2OXRA 4ALJA 4Q12A 3VKHA 2XRFA 4CKCA 5IC6A 5KSYA 2H5LA 3EXIA 1UZMA 2JLBA 1RTKA 1O89A 1XRPA 4CF3A 4GE3A 3OJFA 3A4NA 2V8BA 4ED9A 3VUEA 2J48A 1GY8A 4N54A 5E0OA 3P32A 3TSOA 1P2UA 4NWIA 1YGPA 1T5IA 4XM2A 1U9IA 3U19A 3MJ4A 4C6RA 5IWAB 3EAQA 1LBTA 3OZUA 2D2XA 2YUIA 2ZJ4A 1RHQA 2B7BA 1U5BB 2JVJA 3LA8A 2C9MA 2ZUVA 4YFYA 1RWBA 1MMFB 13PKA 3V7YA 4D4LA 3LPDA 1R2QA 2PRIA 2OLKA 4F93B 5EE0A 3RLIA 2XXBA 1QIHA 3T54A 3LOPA 5JTTA 3S29A 4LC1A 4Z9XA 1JE0A 3V4LA 4RD0A 4WQMA 1DWUA 5CM2Z 2VDPB 1EDDA 4DMHA 4BFLA 1PR9A 3H1GA 3LO5A 5ALRA 1H2AS 4MUKA 1JFFB 4NCIA 4OBXA 3WGVA 1EM6A 3FKSD 2W5UA 5D8DA 3L6EA 2R47A 3NHRA 2EJCA 1XP5A 2CMGA 3BDAA 3D6AA 3UAYA 4C6SA 1JIQA 2JHPA 1G7SA 1G9SA 2FF7A 3CEMA 2WU3A 3LUJA 4KLCA 4LVCA 3GUZA 4MMYB 2Y4OA 1RKUA 1SM4A 4CG1A 4R2XA 2W6QA 4D0GA 5LQKA 1IHXA 1T36B 1ULTA 2YWEA 3LKZA 1AXEA 4JVLA 1YIOA 4L7QA 5DU2A 3G49A 3ZNPA 1XCBA 1EVYA 1ZC4A 4YYEA 2Y3IA 3AGPA 3DBVO 4NE9A 1EUYA 1BHJA 2XHEA 6ADHA 4HCJA 1CYDA 2AUNA 2O2HA 4MYSA 3DFZA 3TTVA 1ZUWA 3W4JA 2O0HA 4C6HA 2GM4A 4ND4A 4OPMA 3GLIE 4QREA 1I13A 4Q1VA 1NUPA 5FRDA 1MT0A 4KUEA 3WB2A 3ICPA 5A5FA 3GLIA 4U7DA 2PANA 2VQ3A 3B2EA 4R2HA 1DKMA 5EP4A 3VZDA 5BSFA 3JQAD 4ECAA 1DOHA 7MDHA 1SFRA 1K7CA 2J41A 2QRGA 4DCNA 5JMWA 1IBSA 1H65A 5FORA 3GLGB 1NI3A 1J2UA 3ANXA 1PYGA 1VLMA 1X2BA 3PRYA 1DIAA 5EGNA 1JA9A 3S28A 4E09A 3M6AA 4A9AA 1P0FA 1UBCA 1WQ4A 1YAHA 3GUHA 4GPIB 5JTUA 4I1PA 2VF5X 3A36A 1KPHA 3O4JA 2TMKA 1B3RA 1NRJB 3PXBA 1KH2A 3GIDA 2IZZA 4N8DA 3EH1A 4R8RA 2W58A 3GGDA 2HK6A 2XF2A 2PSJA 3BXOA 3BS4A 3EFOB 3JXEA 4WKCA 2HO4A 3BAFA 9ATCA 4YLGA 3NT2A 3TD6A 5ALIA 3IT0A 4AX4A 1OH5A 2QR3A 4JC5A 4MUXA 2YWGA 1NWCA 5FBRB 5L7YA 1H3FA 2OK8A 5KPJA 4OB8A 5BSEA 1HK7A 4WLEA 1B14A 2HIHA 3B9RA 2JLZA 4CPDA 1IZ8A 3HJBA 4CKEA 1ILEA 1X9HA 3F5MA 2BKXA 3I2GA 5C31A 3KPUA 1HQYE 1C8KA 1MP0A 5EZQA 2JCGA 1OTXA 1M34A 4GR5A 4R1LA 1H05A 3GVXA 4LWQA 2ZDHA 3R76A 4HBZA 2V58A 4RH3A 2X8WA 1SCQA 4QBIA 4D0LB 2EW1A 4JJZA 4JUAA 4WUVA 4EGSA 1SXPA 1POWA 3ETHA 4G67A 4DV5B 3B89A 3GHHA 1QZ3A 4KWEA 4LHXA 3JYNA 4HFMA 3D0QA 1EE9A 1Z28A 3G5MA 4PXAA 3HXKA 4WDRA 3QKSB 5ERYA 3W5IA 2GCOA 1VC2A 4NBTA 1OX4A 1QX4A 2BJWA 4TSFA 4E5DA 5KDLA 3S3TA 2DLDA 2VXOA 4MV7A 1ZMXA 1WULS 2MHCA 1Z82A 1KI2A 2UDPA 2PZFA 1LW7A 2I33A 4GGPA 1XAHA 1UADA 5EUCA 3ZH9B 1JZSA 3OD1A 3QITA 4MA5A 2BZSA 2IYWA 2ZG6A 4F2PA 2QQ0A 1EFRD 3QKSA 4J1TC 1FW8A 1J9GA 3DLTA 1IAVA 3B2QA 3T41A 3ZOZA 4OHYA 3LQFA 3SIPA 1Z3IX 1O6BA 4P9NA 3CB2A 5H80A 4TMXA 3OY2A 4BQOA 5CA0F 3VSEA 1HA3A 1COWD 2CEAA 4YJFA 2W8BA 3W5VA 4DBLC 1GQSA 4PWYA 2HWUA 3KE8A 1YNSA 5DNEA 1EXMA 3KYDA 3ZHZA 3A2MA 4TLDA 4MYDA 3H97A 3W7BA 5I7AA 2Q5HA 3OQIA 1U3CA 1IXSB 4TOIA 5JO0A 4YJ2A 4MUEA 1W1WA 3T4XA 4KB5A 1AD2A 3EDRA 4X61A 5HPYB 4EW6A 4Q9KA 4ZQIA 5JCPA 5LWQA 3U7HB 4LF5B 5LB2A 4FHEA 4OY3A 3DKRA 4LQLA 1S7CA 2IXEA 2ZQ5A 3NIWA 4BRUA 3ROTA 4AYXA 3NHBA 1QH1A 1YACA 2AG8A 3PE4A 3O94A 4R41A 4V02A 4JX8A 2EKBA 3JWPA 1Y3HA 5AQEA 3W6UA 1DRVA 1E7SA 1LTQA 2SCUB 2JARA 1X9IA 2AL7A 2J9YB 5KJEA 2A67A 2GSDA 3CN7A 5U4XA 1OFTA 3WK4A 5FTMA 1XTJA 4DM7A 3K6SB 1FRVA 5F52A 2BFOA 5CFOA 3GBPA 2IU3A 3M4YA 1Y6FA 2ZU6A 3HG7A 4HEQA 4WK4B 2XEXA 3SEAA 2JG3A 2EBUA 2V7WA 3BIFA 3IO3A 1F4LA 3CT6A 3P26A 2Y9PB 2WNSA 3IOYA 4XEUA 4E15A 1XHFA 1M8PA 2VLIA 2YV3A 4PTYA 4A0GA 1FYXA 1T4CA 4IX1A 1NVTA 3PEFA 3THXB 4HDKB 4KRYA 3TN7A 1XZKA 4N6NA 5K0EA 1DX9A 3CF2A 3U61B 3M6FA 2O2YA 3ZBUA 3AJ9A 1Z0AA 1PZMA 1SELA 1FNNA 3F47A 5DBHX 2ZBVA 3U7FB 4O4IB 3AU9A 4CT5A 4MUMA 3VYWA 4ZAXA 3H9QA 5C35A 5ALMA 1GVHA 1XEXB 2HWXA 2YOFA 4HZUA 4RPLA 1LVGA 1T9CA 2ZIZA 3U56A 3DZJA 1R50A 2HOQA 2YFYA 3NEAA 3HLYA 3G2PA 3BPSA 4EG5A 2DXIA 3VX4A 3EF0A 3IBTA 1ZEMA 2CJPA 3GFFA 4Q03A 1A72A 1PV1A 1BTOA 5ITWA 1N25A 1T4MA 2BKEA 3V4PB 4EJSB 1K7FB 2AOUB 4MH0R 2A5DA 1XRNA 4QDTA 1WZNA 2B30A 3DV0A 2FG5A 4RJJA 1UJMA 5G4KA 4QUJA 2C7VA 3H18A 4JQCA 1DEKA 2IITA 2JFNA 4REMA 5DN6A 2EX1A 4ZTUB 3NFYA 3UG7A 4H7JA 3WGIA 3LX5A 3M5DA 3CJRA 4P82A 1LPBB 6CHYA 1XTBA 1G5QA 1WQ1R 2NZVG 3HJGA 3Q6NA 3PNKA 2D5AA 4U3JB 4YMLA 5L3QB 5CFPA 2I6QA 1SC3A 2HX1A 4ZJZA 1F1JA 2G9ZA 1YO6A 2IT1A 1IIRA 2WYHA 1GEEA 4IV0A 4OXXA 5TV2A 3GJ0A 2GD1O 4PO1A 5BSTA 4WFJA 2Q99A 4JSYA 1PJ4A 3QG5A 3U4MA 2VT6A 5EESA 2WM9B 2IS6A 1F51E 3I09A 3PXXA 3W2GA 4IRUB 4FLMA 4TWZA 2DECA 1P7ZA 5JXJA 2ISSD 3DPUA 2ZRJA 3QOFA 2Q3EA 4OXIA 2XMSA 5C1DA 3UAZA 3GFQA 3MAAC 5H3LA 1E2IA 2BR5A 3BULA 3WL6A 1B73A 1XVTA 5AWFC 1FJHA 4FI3F 4LFCB 2KI5A 3NBQA 3D7LA 4AKEA 1R0ZA 1IQ0A 1KMHB 1ORDA 2H31A 3HADA 1PWZA 2O8FA 1KAHA 2YFHA 4PEVA 4U2DA 2WFZA 1RKXA 1SPBS 2IYUA 1A7KA 3D31A 1U7DA 4U00A 3GRFA 1SUPA 3CNHA 3CMCO 5DM0A 2OL4A 5KOHA 4C87A 2BFCB 2P9QA 2PV7A 1NPTO 5E4TA 1PAUA 4NE2A 3IP7A 4S0ZA 1HPLA 2RHOA 4K6FA 4MEJA 3T95A 3SAJA 4LKOA 2B35A 1ZZGA 3MMPA 3ND8A 4B3DA 2CLOB 2H7XA 3EXFA 2VKQA 1E79A 2QQFA 2EVWX 1Q7CA 2JJ1D 4UUPA 2PZ8A 2BFCA 3EZ6A 1IN7A 2H2IA 4Q4JB 4EVSA 4YRBA 3ABZA 2EGUA 5IT5A 4UU1A 4E5UA 3FKSA 2PKQP 2MMCA 1K2WA 2HU5A 4KWIA 4UCFA 3LPCA 1T3GA 5DNAA 3J81k 1LDEA 3T7RA 4HQLA 3N2KA 2KQUA 5BSWA 2A57A 1Q12A 4P5EA 3T1HB 4GU5A 1NMZA 5J1TB 2O06A 2W71A 1BS1A 2JANA 3ESQA 1UOOA 1Z73A 2AN1A 4OJMX 3LHKA 5JS2A 3F6BX 3ZH2A 1A2QA 2RGUA 4GMHA 4JI1B 4BFXA 1QG6A 2PS3A 3CNBA 2PLFA 4L6IA 4QYIB 4JI5B 1KO5A 2OE2A 2H8GA 3M83A 2J3KA 4OFXA 4UHKA 4DUGA 2NZWA 3H84A 4NZNA 1DAKA 1RPTA 1BCRA 1GP2A 4ON9A 1C9KA 2YHIB 1OLUB 5H02A 1SIUA 5TGDA 1UDWA 1EK5A 3B9QA 2IY9A 2VF2A 2H1RA 4HAOA 5IMBA 2D1QA 2OXCA 4FHDA 4FQ8A 1AMNA 5HWSA 1BEEA 4DIKA 2F1IA 1K97A 1V37A 1E9CA 1UKYA 4I50F 3WLNA 2ZUEA 4O4JB 1R9GA 4RV4A 3RVDA 2ZE5A 3GA0A 3ECSA 2IGBA 3DB1A 4ZAWA 2OYRA 3CUTA 4AT1A 1C0PA 5AI0A 3GQVA 1Z6XA 4Y8VA 4YP6A 5HF9A 3QEKA 3AI2A 4OHVA 3LNTA 3L1IA 4H1UA 3I5YA 2WG2A 4B17A 1S4MA 4GSKA 2CXSA 4W1RA 2GTIA 4ZT5A 1OV6A 1CE8A 1W4AA 4FHCA 2NYRA 4AJOA 2CXXA 1H0SA 3BWCA 4HLCA 4JENA 3GFTA 1Q2XA 2R96A 5ADWA 1T8UA 2ET6A 2G5CA 3U4DA 4YWJA 1SIOA 1SCNE 2G1AA 2PRSA 4OGWA 3RG8A 3K0CC 4RAOA 2GBGA 3AUYA 3D2LA 1IWPB 1DFGA 2AN4A 3A4LA 4G5SA 5JMTA 2HPHA 2G71A 1DB3A 5ED0A 2X3UA 4PBSA 4BP9A 4W5OA 2R1UA 3ODGA 1B1CA 1TYCA 2I4TA 1CDEA 1Y81A 3MWEB 4C4AA 1Z07A 5BYKA 3M6UA 3LVRE 3WJAA 5K9ZA 1AX9A 1PNVA 2YH2A 3KD3A 4UBLA 4X91A 3UKDA 3W79A 1YL5A 4HH4A 2B3TA 4ZYUA 1LBHA 1OGIA 2ATEA 3WIOA 5FNVF 5F23A 3UQZA 3ZD7A 1JR3D 1V41E 2ZWAA 4KQCA 3VR5H 3BMQB 3WWOA 4HADA 4YJGB 1N2ZA 3NVKI 1TO6A 1VPTA 2WP8J 1VCHA 2CNKA 2L42A 2QOEA 4HYEA 5CT4A 3H6KA 4BX8A 3KQQA 4F9EA 1IULA 2OBMA 3RIHA 5IT0A 1C0LA 3EUWA 4D5EA 4YYZA 4KR2A 1SC6A 1N5RA 5BSUA 1GZ6A 4Q7QA 3RVRA 3GYGA 3HZRA 3X2EA 2CLCX 3PYLA 4RMGA 1L4LA 2EFGA 3OWOA 2A1UB 4ITUA 3ZWVA 4DR2B 3U4QA 2GAJA 1C4WA 3RK1A 2QVZX 2BBTA 2IEBA 1DDGA 3N3BC 3FWNA 3RW9A 1QCZA 2HPAA 2JI6A 3GN2A 4N5IX 5BN3A 3O8RA 1J1UA 1NSFA 4C7BA 1H1LB 3KVOA 1BU8A 2P11A 4H3HB 2AD5A 4MKRA 1OQAA 4RENA 2UAGA 1P1FA 1WCIB 2DX7A 2XMBA 3FGNA 3PUYA 3QYAA 4QX6A 4N0EA 3T7AA 2G40A 3VKFA 1IXYA 4OI2A 3MMXA 4RHUA 4GE0A 1JR4A 4K9QA 5LUAA 1JG2A 1PJTA 3F71A 2QF7A 4RL6A 2JDID 5EHGA 4KMRA 1CQIA 2AJBA 4X1KA 3GEMA 3D8BA 2FMFA 2XWQA 4LWPA 3AERA 3AP3A 4K40A 4AF8A 1SXGA 1NR5A 2Z4RA 2XCOA 3EVGA 4QTXA 3HEMA 1A8QA 4BNJA 2VJOA 1E3DA 1E58A 4GXTA 4F3RA 5C51B 5JSKA 3V2HA 3QVMA 3P2IA 3VSDA 4ZCMA 4EUHA 2ZYUX 3E58A 1JUDA 3UV3A 3SEQA 1OAOA 2NYVA 3N59A 1IN6A 2GUGA 3V8QA 2P7IA 1X8KA 2QZJA 3MCVA 4U2EA 3O8CA 4H4CA 2YS6A 3U7GA 4LJ6A 4MI1A 2RAPA 1N75A 1T3SA 3CWZA 3EHDA 4HNGA 4XDHA 3ROQA 1Z16A 1BYUA 1JHYA 2ZWPA 4TS1A 1W25A 5LU8A 4QM7A 4WMLA 2BH2A 3OCZA 1R88A 4X63A 5A2QA 5JDCC 3L4EA 1YUBA 1CF9A 2O5RA 2VSNA 1TYZA 3EGXB 4OKSA 4JSTA 4YECA 3B38A 2C42A 4XM0A 1OB5A 4Q9JA 4P1ZA 2GTPA 3BH6A 4L4XA 5EE3A 3E18A 4YREA 3AI1A 2NVWA 2XF8A 1Z37A 3OFNA 3L1UA 2F55A 3KE9A 2QUAA 2HTEA 1H4SA 1EZ1A 1NA5A 2QL9A 1ZXXA 4PAMA 1Z6GA 5HM6A 5JIBA 1M6EX 2C8LA 1ZJYA 1CHDA 3SP1A 5C5EA 1Q84A 3QLTA 3U5TA 4C21A 2LCIA 4BMOB 3D6JA 4M55A 3L7KA 2PD3A 1EX9A 4ND7A 4AX8A 2D0DA 3E3MA 1AY0A 1P0CA 3HXTA 5T6BA 1E64A 1T2DA 2Q5FA 5KVQA 3DMYA 2WOOA 3GVIA 4WVFA 1VBNA 1UQUA 2I8LA 2VDRB 2VEOA 2AYZA 3TNDA 3LSTA 4G5HA 3WQRA 7REQA 1CC1S 5HHTA 2HBYA 1Y7TA 2XUJA 5FPHA 1O94A 3KJHA 4KTVE 1A8PA 2WKQA 4M7WA 4EG8A 2B6HA 5JAZA 3JZMA 1L3CA 4WLOA 3UUGA 1Y4ZA 1ZS9A 1S3FA 1U0OC 1WXDA 2HA2A 2YZMA 3O3NB 2HJ9A 3OLWA 4OIMA 2D2FA 2OUKA 4ZA2A 2ZTVA 4PSDA 4Q4CA 3R7BA 1Z6AA 3D0RA 3S1AB 2EATA 5AHOA 2JLCA 3F6PA