4AECA

Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyase c
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
323
structure length
323
Chain Sequence
AVKRETGPDGLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFVAGIGTGGTITGVGRFIKEKNPKTQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQKIMDEVIAISSEEAIETAKQLALKEGLMVGISSGAAAAAAIKVAKRPENAGKLIAVVFPSFGERYLSTPLFQSIREEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords CYSTEINE SYNTHASE, MITOCHONDRIAL
publication title Allosterically Gated Enzyme Dynamics in the Cysteine Synthase Complex Regulate Cysteine Biosynthesis in Arabidopsis Thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 112
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4aecA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4aecA02
4JBNA 1J0CA 4JBLA 5IWCA 4NU8X 3L6CA 5J43A 1Z7YA 1QOPB 1TJPB 2GN2A 5BW6B 3VSAA 1K7XB 1K8ZB 1Z7WA 1PWHA 1K7FB 2J9XB 4OFXA 5CGQB 2Q3DA 3SPXA 4AECA 5JJCA 2GN0A 1TDJA 4D99A 1J0DA 1K8XB 1V71A 5B3AA 2J9YB 4D9CA 3BM5A 4HT3B 5B1HA 2ZSJA 4HPJB 4XUGB 1V8ZA 1K8YB 3VBEA 3FGPA 1A5BB 2DH5A 3PR2B 3R0ZA 4F4FA 2TSYB 5DVZA 2RHGB 1A5SB 3RR2A 3T4PA 2C2GA 4L27A 1TZJA 2BHTA 2CLEB 4LI3X 3VSDA 1KFCB 5E0KB 3L6BA 1K7EB 2C2BA 1JBQA 1O58A 4OREX 3VC3A 3PC3A 3DWIA 2JC3A 4LMBA 2ZPUA 2ISQA 5B55A 5I6DA 1P5JA 2CLLB 3VSCA 3ZEIA 5B53A 5DW0A 4D9IA 1C9DB 3TBHA 4D97A 2V03A 4IL5A 1RQXA 1V7CA 2ECQA 3L6RA 3X43A 4D8UA 1UINA 1WTCA 4WX2B 4H27A 4HN4B 3IQHX 5C3UA 5I7RA 2J9ZB 1CW2B 1KFEB 1BEUB 1UBSB 1WBJB 2PQMA 3FCAA 3SS7X 2Q3CA 5J5VA 5I7OA 3AEXA 5I7HA 4L28A 2CLOB 3HMKA 5D87A 1FCJA 3PC4A 1Y7LA 2TRSB 3X44A 4HPXB 4D9NA 2ZR8A 4PCUA 2RH9B 5IXJA 4L3VA 2WSYB 3V7NA 4AIRA 1KFKB 1QOQB 1KFJB 1TTQB 2CLHB 4D9MA 1TZ2A 1WKVA 2CLKB 4D92A 4D9EA 2EGUA 5KINB 1FUYB 1C8VB 1X1QA 1E5XA 5D85A 2TYSB 1A5AB 3R0XA 4D9GA 4D9BA 4D9FA 2CLIB 1F2DA 5DW3A 5EY5B 4KKXB 1TZMA 1BKSB 4ZU6X 1TYZA 3PC2A 5B1IA 5JISA 1VB3A 4HO1X 4L0DA 4I1YA 5I7WA 5IW8A 1KL7A 5T6MA 4Y6GB 1A50B 1VE1A 1J0BA 1VE5A 5KZMB 1KFBB 4D96A 3CEPB 1J0AA 2EFYA 4NEGA 1C29B 4D9KA 2Q3BA 1TTPB 2D1FA 3IAUA 1OASA 4D8WA 3AEYA 2CLFB 2O2EA 4COOA 1WDWB 5CVCA 4D8TA 5B36A 5D86A 3SS9X 4LMAA 3DWGA 5D84A 5DBEX 1UIMA 1J0EA 4ZU1X 5DBHX 2BHSA 1D6SA 1M54A 2DH6A 1K3UB 2O2JA 1PWEA 2CLMB 4ZQCB 1TZKA 5I7AA 3DKIA 2RKBA 3IQIX 3IQGX 2ECOA 2GN1A 1CX9B 5HBGA 4QYSA
chains in the Genus database with same CATH superfamily
3HY6A 4MJLA 2AR0A 3PNPA 1M5RA 3LKVA 4INOA 2QMQA 4I8IA 3CRNA 4ERXA 3WYBA 1P5HA 3ZDDA 1OU0A 2VP0A 1HRKA 2F1KA 1PKEA 3K5HA 3KNZA 4P7GA 3T7CA 4E14A 1GADO 5E3IA 2C8KA 2Z3ZA 3VNUA 1CE8A 4EEZA 1W96A 5KBYA 1FSSA 3RROA 3HHEA 4PWYA 2PLNA 4DDVA 5K9ZA 1P0QA 2ATIA 1DEXA 1OF1A 3I4CA 5JAZA 5L4SA 3EUAA 4PBSA 2FX5A 5LJIA 2PZBA 5A6SA 2A0XA 1X7GA 3L6DA 1PR5A 1I7SB 2B92A 4G0UA 2XKJE 1BIFA 4GXRA 3T7JA 1RWPA 4EO9A 3QFCA 1RPNA 3EFBA 3NLLA 1E20A 2D06A 4OP2A 1RKVA 1E0KA 5DBGA 1BTOA 3S3TA 1N6KA 3W8FA 1M1UA 4OQNA 2YBDA 1WETA 3OFJA 3I8XA 4TKVB 1SCKA 1N2EA 1N2XA 2ZIUB 4E1VA 4NPCA 1O0SA 4PLYA 4RACA 4IMPA 2VQ3A 4ZC8A 1J1IA 2UDPA 3T95A 3MAJA 4O25A 3HWWA 4RC9A 4BJ5A 2ZWVA 3TI7A 2PL9A 1UMDB 4GRDA 4IHQA 1E0JA 3UMSA 3VNRA 3GDFA 5C7OO 4NV1A 5FFNA 1E5TA 2GBFA 3BZUA 5DISB 5T41A 2REQA 3RRYA 3CEJA 3N0VA 1JVNA 1HDCA 3ZCTA 5CRIA 1A8PA 2QUBA 4FJ0A 3WGJA 2VEDA 1EQ2A 4ALKA 3BTSA 4DPMA 3I5AA 4D57A 1ZKDA 1QVZA 1X1SA 4TZ0A 1ECJA 1M2OB 5ICFA 3TSZA 2GPAA 3ND9A 1B0UA 3TZKA 1S7GA 5EXSA 4J2HA 2HRRA 3DZ8A 3M6MD 3NX4A 2R2GA 3GCDA 2XMDA 3W1WA 3GUUA 3E22B 4WNAB 3RYIB 5F98A 1PBNA 3TZ6A 3RHZA 1DQZA 1JDBB 1NZDA 2Y0EA 4RF4A 4ZAWA 1XSEA 2IC5A 2XMCA 3FNEA 3NTUA 4N0PA 3BSSA 2BIFA 4KQFA 4LTMA 5AM1A 1PT9A 1SUBA 2J32A 5JLAA 3W9YA 3IAHA 4CQLA 4DCMA 2GASA 3U4MA 1Z15A 2JZNA 2WVAA 4A5OA 4EY7A 2O0KA 2GZ2A 5ES4B 3GWZA 4ZZ0A 1SJ9A 3IA7A 2QM7A 2VT7A 3W06A 3EHDA 2PVSA 3AF1A 2GFQA 3WIDA 3WYDA 2WFMA 5G1OA 1A9QA 5CFZA 4LNUB 5KQLA 2ERXA 1J9GA 2PHZA 2XE6A 1OD6A 4GBGA 1ZM7A 4QPNA 3EFOB 4WFKA 2PDAA 3MCZA 821PA 1GTVA 3GLHA 3WQHA 3DQZA 4PX3A 1K7YA 4YP7A 2YOHA 3OMXA 3VR2D 3ZIAD 4KRYA 1YZFA 5J5AA 3VGJA 3WI7A 1AQJA 4ZO8A 4M9ZA 4ZIRB 3FR8A 1CNEA 3VPSA 4JVSB 1WPRA 4B3MB 4Z0HO 1EFPB 3SFTA 1F7VA 1Z3IX 2AMVA 4JDUA 5JDIA 4JGGA 2LKCA 4UHKA 3H1TA 2QUKA 4K9NA 4RKQA 3BL6A 4BMCA 1POWA 1GY8A 4TLEA 4QEZA 1DUVG 2CJWA 2MU1A 4MUJA 1RM3A 1SNYA 2GTHA 3B5EA 3S2IA 1P4RA 3AETB 1JEAA 4KTTE 3L7NA 3R7FA 4F6LA 3THYB 1ZJJA 1IHUA 3EFHA 3KOUA 1PYDA 1YDEA 2WUGA 3VH1A 2IS6A 4OG2A 1MT0A 3C5CA 1QS0A 2A30A 3SMQA 1U7XA 4EH1A 1JS1X 3C3JA 4JJFA 2GPSA 3V6LA 4JBHA 1C9KA 1CUEA 3QXGA 2H9YA 2PL5A 3LDGA 5HIAA 2G70A 1JMKC 3CC8A 3IT1A 5F7XA 4MS3A 4EUNA 4EYOA 1JYEA 1H94A 5L3ZA 4GKKB 4GLOA 3IVAA 3C3CA 1G16A 2ZBVA 5IF9A 5J4HA 3N8IA 1AA9A 2A7QA 3VZCA 2QK4A 4I55B 5D7BA 2F4NA 2NPFA 2QG6A 4N48A 3ORRA 5ALFA 3LHKA 3EAFA 4P08A 2ZTHA 3AXSA 3V1MA 1O97C 2PANA 3A3PA 3LT1A 1Y9JA 3OZEA 4KHZA 1OREA 1PNVA 4L02A 1NLMA 5J63A 2XB2A 1IFXA 3GLRA 2QU7A 4JELA 1TM3E 1Z75A 1SUPA 3HXPA 3MAGA 4LHZA 1EA7A 3GNSA 4DG5A 1R4MA 1JR3D 1P6XA 3N0XA 1EX6A 3A1DA 1UF9A 4NFLA 3T5GA 2W5UA 3VR4D 2A78A 3RS9A 4GPZA 4B3RB 2F48A 1JR3E 2C1EA 2YWRA 2W58A 4X54A 1XRJA 1JKMA 4S12A 2ZULA 1HFEL 3LQKA 4MR9B 3T0GA 2AI1A 4YP1A 2VDQB 5ECWA 3SZUA 8ABPA 3HI6A 4MCIA 1NG9A 5A05A 1PZHA 2Q0QA 2X19A 1XTVA 1JKJB 1PEYA 1KIAA 1HY3A 1UBFA 1AVTA 4TLLB 1H0RA 4PONA 3CX7A 2CXTA 5I4KA 1THGA 2VRCD 1DUSA 4HWKA 2EAUA 2C88A 4RXTA 5B6IA 5AUOB 3OO0A 3FOWA 4NNOA 1E6WA 2JFNA 3VC7A 4OFWA 2REBA 1XVIA 2EX1A 3TKAA 3PUZA 5DBFA 2EW8A 1RNLA 2TYSB 4EO4A 2FV8A 1BEEA 3MXOA 4UATA 1SBCA 3B13B 1YB1A 3KSRA 5EWJB 1A7JA 1KNQA 2R86A 4D4LA 1XDDA 3K8OE 1N2BA 1CLEA 1Y3CE 2R8EA 3EPPA 4KBFA 5DIFA 3RS2A 3IO5A 3E9CA 1FVHA 1H0SA 1B8PA 1CZOA 3BCHA 2QTCA 3BCUA 3I92A 4C0WA 1DIBA 1G8YA 3MBOA 1F2TA 1PJ2A 3M9WA 4ZYVA 4Z0TA 1N36B 1PUIA 1IY9A 3LUPA 4ZRNA 1VP3A 4ML3A 3HN2A 1B8NA 2WF7A 3TZHA 4Q4HB 5IJ9B 2DY1A 3B9QA 3VTZA 1Q22A 2KLBA 3H1FA 1NU8A 3W1VA 3HJRA 1G59A 3FUUA 4OGWA 4R7TA 4Y7CA 3NHUA 9ABPA 3D8BA 4LSGA 1SK9A 5AD1A 1AGRA 3SS9X 1TO6A 5DBIA 2RGDA 3BMOA 4Q9HA 4C89A 2PNFA 5JFGA 3L49A 3I5UA 5DBHX 2BHSA 3U3JA 1V5IA 4BO9A 4FSXA 3SVLA 3LBHA 2GN4A 1R88A 3RVRA 3FPAA 3KVYA 1NXVA 2QN9A 1RWQA 3AUKA 3KVRA 2B8WA 3OFKA 3QU7A 4RIFA 5ECGC 5FIUA 4YUXA 2OGZA 4HNVA 4H1WA 1OIWA 1E8DA 4LZAA 2J1LA 4OMDA 5HBGA 4AY2A 3DUFB 2C95A 2Y3IA 2ZREA 3OIYA 5B5SA 2MYTA 1IL0A 2OV1A 2RGEA 2M6SA 1ZP6A 1QHSA 2HA0A 2Q50A 3BFVA 3VSEA 5CEEA 6AT1A 3GYBA 1J22A 4ENTA 1QH1A 1Y8AA 3ZNPA 1NW9B 3NHRA 4L0MA 3IBYA 5E7JA 5EI5A 2I9KA 4BNYA 3HFGA 3SXJA 4YLEA 2L42A 2PMDA 3DHYA 3ZH2A 2I54A 2V0GA 3VOTA 1DFGA 1LRJA 1E2NA 1NV9A 1T6XA 3DE6X 1Y7IA 1T1EA 4XWWA 4BLSA 4YLYA 5IUJC 4B3IA 1L5VA 3F90A 2Z09A 4TXJA 4UUBA 4MKHA 1QRSA 2C9ZA 3MJDA 2YJTD 3FIJA 3QXJA 4GGMX 3UK1A 5SYAA 1U0LA 1Z2NX 3CKKA 2BLNA 3QV2A 1ABFA 2NU6A 3BYZA 3D31A 3S8MA 4DPKA 4Z5XA 4PHGA 4QOGA 1FDRA 3ICVA 4BQIA 3P4UA 3PUYA 2CWWA 3UHAA 2IHKA 4Y2XA 4DNFA 5H1YA 5LN1A 2P79A 4RVFA 4EPWA 1GAQA 3GT7A 4OYRA 1J7KA 1U9IA 1LJ8A 2Q4RA 4BGIA 3AHIA 1H85A 3KBOA 2H1SA 3IT3A 2H4WA 3IUSA 3R9XB 2GO1A 3HGMA 2IV2X 5C0OE 5L45A 4P34A 2Y77A 4Q3DA 2WF8A 1E3EA 4V0KA 3K6RA 2QRHA 3HTXA 1DL5A 3WLNA 1U9ZA 2O8NA 3F98A 1UOPA 1X42A 2WT4A 1HDEA 1RQNA 2HBQA 1QR6A 3JQGB 3MT0A 4P4LA 2PZ8A 4K6OA 3TLKA 1US8B 1XYGA 4V3BA 3STTA 2X8WA 2Q4OA 3BXPA 4RQAA 3USCS 3I9MA 3B20A 4LE1A 1V8DA 4CEJB 1JG3A 1WPGA 2B30A 4Q4DA 4IOLA 4RXMA 2P5SA 5GVRA 4IIBA 3KPVA 1IXRC 2CE2X 3OLYA 3ZJVA 3ONEA 3ZTYA 1GDHA 1JVBA 1U8FO 4OGKA 4UXJA 1JDJA 2COKA 3PX3A 2B2XA 4IVNA 1J5XA 4LYFA 3VHXB 3TGPA 1XQVA 4QHSA 3R9KA 2PKQO 3HE3A 1VG8A 1Y6FA 3B3JA 2JLYA 1S89A 3LX8A 5F7ZA 2K87A 3KOWA 2G07A 3L4EA 4UTRA 4LOAA 4A2QA 5IJWA 3G13A 4BL5A 1UPTA 1Y33E 5CDTA 2LBPA 2VHWA 1UKZA 1WQ4A 1LNZA 2ZUVA 4C7MA 1IDN1 2GARA 3DT8A 1IEWA 3IAXA 3OY7A 3PD1A 1JSZA 5LB4A 1DJQA 1S8NA 5GV7A 2GAOA 4K9OA 1O6CA 5T6MA 1HEUA 1IPHA 1USIA 1N1DA 1Z0FA 2FN7A 3MIIA 4H60A 1PG2A 5EXXA 4ZCSA 1RYEA 1Z13A 3FBTA 3GT4A 4HQFA 1E3QA 4OSOA 5EUCA 2YMPA 3OFND 2P27A 3NP7A 4I9FA 3W7AA 2WFZA 4KYVA 2VWGA 4ADSG 1XZAA 5A3JA 3TG8A 3MWDB 1JLMA 2CK3D 3QTLA 2QUIA 1GD1O 1RZVA 1NKSA 1YL7A 1GZ5A 4BNUA 1EA5A 2OV2A 4RORA 2DUWA 2ASEA 1ZSVA 1ZUWA 1G5TA 1YQWA 2W6PA 1KYYA 1WMAA 2ZITA 3M2TA 3OCCA 5KYUA 4YRLA 1RI4A 5LNK6 3HXMA 1CDEA 3QITA 5FI5A 1FU8A 4MI6A 1EUDA 1ZRSA 3TMKA 4AO8A 4DG8A 1I5EA 2YWCA 1SU4A 3P1JA 4U7WA 4HQNA 3K0HA 3NYIA 5EIHA 1U0RA 3MINB 1VB5A 2GF0A 3VMMA 4QJ3A 1IN1A 2WP0A 3PA8A 3HYSA 3D8SA 3F5SA 3O38A 4MOWA 3HXQA 1WW3A 4B74A 2HC9A 3Q7QA 4WNIA 4LJ8A 2P7HA 3OAAD 1OFGA 3I42A 3BBPA 2ZBPA 4OJQA 1IY1A 5DYWA 2IF2A 3UWOA 4AMGA 3ZKWA 1E3TA 3KTAB 2ZSHA 3UN1A 5LQAA 2XPCA 2BM0A 1T8YA 1QDUA 2PS1A 4DDWA 2BM8A 3L7MA 4HLCA 4RL4A 5CYPA 3ULKA 4Q3NA 3AEQB 4ARBA 4HXYA 1EFLA 3U4QA 2WQ7A 4KGDA 3PRHA 3T9EA 1DPGA 1GCIA 4XVUA 2R8RA 2B78A 4P80A 3EE6A 1THMA 3KJQA 1DX6A 1PNOA 3D8UA 4GZLA 4AJ2A 3GJ5A 1X8JA 1SU8A 4HEQA 2FR8A 1ZVQA 2ZE6A 1CJTC 5BOVA 5FUBA 2DF8A 2XKBA 1DDOA 1YB6A 1Z0ZA 1KARA 2J3HA 4I6EA 4OI4A 2WWXA 4YIKA 8ATCA 1U3CA 1NAIA 2E82A 4X7BA 2BZ0A 3TW4A 5HRCA 5LPNA 1OTXA 3AEZA 5J2TA 3O0DA 3CMCO 1WZ2A 1SG6A 1P1BA 5DYNA 3K1JA 4DMMA 4OMFG 5IBPA 2QNBA 3V2UA 5AESA 4JI2B 1BVRA 3PUXA 3QFSA 4OHFA 3QUSA 5FI0B 5DGTA 4AAYA 3EZGA 1LK7A 1ZRHA 3AQ4A 3Q3EA 4HBGA 1NVXQ 3LAWA 4IGIA 4NFSA 4NU5A 4RD0A 3UJAA 3WAGA 3WYCA 4YXFA 1V5WA 1PJLA 3SIRA 3JAKB 1O97D 3K9HA 2FFQA 4U02A 4RV9A 2QTRA 1QO0A 2R8OA 1UPBA 1XD2B 1SU7A 4HDNA 2GXSA 2QL6A 4HPXB 4PQYA 1JFRA 3FHJA 5E2AA 4F85A 4P54A 1MAVA 2G9RA 1PGOA 1RWVA 4ESHA 1U94A 3U7EB 1MB4A 3FYCA 4LCBA 5EJEA 4ITUA 2CDNA 4HB0A 1DFHA 4UTZA 2OM6A 4UUOA 1NQTA 3OO1A 4B44A 4IDBA 1IATA 2HBRA 3KYIB 3O93A 1BS2A 3U3RA 1F3OA 3AF3A 3UJ9A 2FZVA 4BB5A 4IDNA 4TWZA 4AZ3A 1R0SA 3ITNA 4M60A 3W8NA 2IKQA 4C78A 5JR3A 3OZFA 2FUG1 5F9HA 3E1GA 1XRLA 2WVJA 5FV4A 1BKSB 3GXBA 4QWMA 3EWIA 4PM4A 1CNMA 1KVQA 4RH1A 1T5LA 4FD2A 5AKHA 1ADBA 1P1RA 5T8KA 4U7TB 1G8KA 1ECPA 1MCZA 3JSXA 1HTBA 5JBNA 3VPDA 2Q2VA 3UGQA 3RUEA 4ZPJA 3UMGA 1Z0SA 5BSVA 4ZPXA 2DPYA 5HIJA 3U3MA 4HRXA 5DJ5A 5JSHA 3DLPX 1Y8CA 3KB2A 4LHYA 1IM2A 5AI8A 3W5SA 4P53A 3WXMA 2Z9DA 2AQ8A 2HUNA 3EGOA 3NWJA 4U6NA 1UL1X 4ITRC 2OD9A 1USGA 4XIGS 2RJ3A 3TZQA 3LX4A 4JLDA 4JP2A 4PAMA 3N1UA 3G23A 4C22A 4P7JA 2C58A 4J6FA 3X1DA 1ZIDA 4C9BA 4DR5B 3O6VA 3SQWA 3KYJB 3QWAA 1N2CB 4HADA 4IICA 2IP4A 3UMFA 1XAGA 2ZZMA 5FT9A 3MGAA 5C2JB 1USVA 4J3JA 4H0NA 4FDMA 2GERA 5F12A 1Q1AA 4CBVA 5EKSA 5F2OA 3JTEA 1GL6A 3UJ8A 2CMKA 3WIVA 1ZJZA 4JC5A 3DR5A 5F5NA 2X22A 3AVPA 1D9ZA 2XGGA 4QWWA 2J0VA 1XL0A 2PFSA 4PG4A 1XXHE 1Z7YA 5FPQA 2H5JA 5CR9A 3W9SA 3KUUA 3K4PA 4R4JA 3GPBA 1VBKA 5BQFA 1SD1A 1MO2A 3F49S 4FILA 7GPBA 6GPBA 2KYRA 4TMZA 1TIPA 2VZEA 3O31A 5HIIA 2CCJA 2R8BA 4PSDA 3IQXA 3ND7A 2ZJ4A 3F6CA 4URUR 3PQFA 5CLLA 4AJNA 3BEDA 1WD5A 4M9QA 4IR7A 1MPTA 2ODTX 3HA7A 4MRVA 3TQQA 2NZUG 4OJYA 5BSFA 2I2DA 1NDQA 4MP3A 3PDCA 4RTJA 3K0FA 2R4QA 2QJWA 4DLPA 4RYLA 3CVJA 5C8DA 2GN6A 1XNHA 4UMDA 3RB8A 1RBZA 3P9NA 1L4KA 3EGXA 3PGXA 2CUKA 1QVRA 4EITA 5JCOC 1ZG3A 4EY8A 4OI1A 3V4OA 2X9QA 3M5CA 3WB0A 1WUKS 4CQNA 1IN5A 1P81A 3DOEA 2FPUA 2GLUA 4JJEA 1UKBA 5DN9A 4H3SA 4HFNA 1E9EA 2BI4A 2AYXA 2KLHA 3K1AB 1F8FA 1WSWA 4X1YB 4L4ZA 2CDBA 2PX5A 3NRCA 4PS1A 2DLCX 4OY3A 1YRLA 3B6KA 1LQTA 3TTVA 3IERA 3JWPA 4LOIA 1PYGA 1I1QB 3QXCA 1M7GA 4QELA 1Z4JA 3SHFA 2B1RA 3Q9SA 4JI0B 2ISSD 3GBSA 4RF3A 4R9RA 1JHDA 1QC5A 3SCZA 4PSCA 1SGWA 2GEBA 3FGOA 2FEXA 3ZTTA 1T25A 3DXZA 4YCNA 2D7DA 1H2ZA 2OHFA 2AUTA 2TRSB 4QUAA 2EYUA 2P9GA 5DT2A 1XCLA 2ZYDA 2Z57A 3K8ZA 4Y7DA 3X1KA 4K9KA 3KL4A 2JBAA 3MWEB 3L77A 1E1MA 5LSAA 1ZBDA 3H7AA 3WHKA 4DUYB 2QX8A 4X92A 3EASA 2BRUA 1ZM3A 5G1PA 1V5FA 1FLNA 4U9IS 1OX5A 2YY7A 1HUQA 1VLVA 3ONWA 4FCWA 4IG9A 1CJCA 2Q0SA 3GMTA 4RHFA 2X76A 2HWYA 2ZE8A 3F5FA 1EGQA 2QD3A 4ZRDA 5HJ7A 2NSHA 4MGIR 4P3XA 5EXPA 1ZZEA 3HCDA 3KR2A 4G23A 4WA7A 1E2HA 4NAUA 1TZMA 3UV7A 4YJDA 2AZDA 5HUQA 3M6XA 1TO2E 4KB5A 3BRQA 3HNPA 3ASVA 3DMNA 4Z2YA 3SZGA 4JI3B 5EMJA 3SSOA 4WCFC 4B6EA 3AP3A 1WZEA 5A4MS 3WZMA 1F1JA 1TA0A 1LEHA 1G8SA 3FDZA 4BNMA 5B4UA 4Q4AA 2JFGA 1YL6A 5E7QA 1H2YA 3QHPA 5LA6F 1C4KA 2WYIA 2QS9A 1VIYA 3LGAA 4Z0PA 3UAWA 4IDEA 3V8NA 1IB6A 1C7ZA 3P32A 3H97A 2O1WA 4G2NA 2RJOA 1NSTA 1ZEMA 4ABTA 1CK4A 1RIIA 2N47A 3WWCA 3N53A 3BJRA 1MU0A 2VTKA 1H6BA 1KPGA 2Y71A 3AJ9A 3AUYA 4O4IA 3MTJA 2DSTA 2GXUA 2XW6A 3OQ1A 4ZVTA 4R2HA 2CNNA 2BKAA 3WL7A 1KRHA 1N6IA 2A9FA 3U1BA 1IXKA 1GGKA 1UJBA 1F14A 1LX7A 1XTSA 2PLFA 2FETA 3ELBA 3P20A 3F74A 3QVOA 1OHHA 4C4AA 4DR3B 3EA5A 3FDXA 4H6XA 2BDUA 3KD2A 2Y92A 2YR0A 2PGIA 1U4NA 2RCNA 2PRSA 4DB4A 1KDPA 3FY4A 3L0DA 2NYAA 4ZVPA 5B3JA 3ZGLA 1JHQA 3OOYA 2PU5A 3JATA 2RAFA 4HNHA 3TFOA 2LW7A 3HPRA 3RVSA 1Y6JA 1QFZA 4Q4LA 3C6ZA 3EVBA 2AE1A 4AJKA 2J4CA 1OFUA 4WK0B 3F7TA 1TJ4A 2G1KA 3KYDB 3PR2B 4JZKA 4BHTA 1WE2A 2CL7X 3LO5A 3EQ7A 3KFXA 2J5RA 2BDEA 1AKEA 3L5OA 2YYSA 3NTLA 4BNXA 2AG1A 3C4QA 3D6HA 4X1OA 2ZT7A 3EJ6A 2DWPA 1LK5A 2B1IA 4NYMR 3ZUGA 1GGHA 1PFGA 3E70C 2QN6A 3H05A 4HYTA 4LZWA 3L07A 3AM5A 3PE4A 4CM8A 5KYYA 3PQ6A 2JCSA 1JHZA 4LMBA 3OQOA 1NAHA 3EG9B 4ND3A 1HDYA 4OSPA 3WLIA 5AIAA 2WJAA 1E4YA 3GJQA 2G1UA 3G0OA 2YDYA 3VV3A 2XKAA 2MSNA 2GKGA 3D8HA 3O8OB 2ZUBA 3GCGA 1KA9H 4HZUA 4PZ9A 2XVMA 3ZW9A 1QHXA 4G0ZA 4I0WB 4BLVA 3OC0A 2RGAA 2H07A 5DU2A 1NUAA 4HPWA 4IW3B 4C0JA 3IODA 4ZVUA 1RRPA 1XAHA 4ZI2A 2PUAA 3CVOA 3FLMA 4PZAA 3N2EA 5IMSA 4MX8A 1A3CA 3JQAA 4XWYA 5F21A 4J0CA 5CH3A 3S40A 4UPDA 1FU4A 2HRQA 1KXJA 4Y18A 1N2HA 1K6MA 1YI1A 4J0FA 4KRXA 2WJGA 2LTAA 3K9QO 1XTPA 1UDRA 1NYTA 3O95A 1PTKA 4ROSA 4F6CA 5JECA 5KEIA 5AK0A 2G9VA 1TF5A 3R5FA 2PCJA 1I7DA 1JDNA 4YA6A 2W71A 2YVUA 5G0WA 3LI2A 4NK5A 4C0HA 2XTZA 3LWNA 2PGJA 4KIFA 3DKPA 3GJSA 4ZT3A 2ZZNA 1VG1A 3UFXA 3WDMA 4O2LA 4P5EA 2XXBA 1RQ2A 3E15A 3ODPA 3RUFA 2B7BA 1GO2A 3MRTA 3GQVA 1XZHA 5LC1A 2J3KA 3E81A 1QYDA 3KQYA 4M9SA 3LY7A 3ANLA 4EKNB 4LSMA 4M0UA 3M6WA 1GAWA 1EUCB 2JGIA 5DGXA 1CYEA 2ACVA 4R05A 3A70A 4LMPA 3T7SA 1B26A 4D8YA 3DEYX 2Y1KA 3DE5X 1R50A 3EC2A 5HM6A 2JDIA 1X7XB 3AR3A 4J90A 3EISA 5DM2A 4IRUB 4MYCA 2OXTA 1WQ1R 5L3RA 4N9QA 4COKA 2X9NA 3OZDA 5F51A 4C0LA 5IRCD 5HEKA 1Y82A 1MA0A 5CB8A 4M1MA 4IJKA 4MWGA 1F4PA 3B3QA 4S2EA 5G02A 1KP3A 2QPAA 4ZHQA 3B51X 4B09A 3ETLA 4D25A 4UBMA 1SBNE 3JVEA 3R7AA 1SQ5A 3QZUA 1CQXA 2FG5A 2GN1A 3QELA 3RREA 4DF3A 1BFUA 2JNWA 5TSDA 4PLZA 4LF9B 4A8JA 4AF8A 4AYWA 1M1NB 2OO5C 4KR7A 1U7UA 4MLCA 4TT3D 1KPHA 5TPWA 1RWXA 5ICMA 3SF8B 3C6YA 3HUDA 5EHGA 1EBBA 5CJJA 4EK9A 1NUUA 1OLUB 4E7PA 3T61A 3KVNA 2FPRA 1J0DA 1S02A 1YZHA 4KUHA 2WV9A 2V9ZA 2FPGB 2X0JA 3FW1A 4GU5A 2OHJA 2GKOA 5D5PA 4HGQA 5K5EA 2XA9A 5GWXA 5TT0A 4C3VA 1G4UR 2ZRCA 1NBEA 4NQRA 3ZXSA 3DEKA 1VHWA 2TSYB 2IY9A 1DG3A 1VECA 2AUMA 3AZOA 3OZ7A 4TLDA 4LGYA 3TMAA 3ZI4A 3DS8A 4B5KA 4ZD6A 4CLRA 1P1FA 1WMDA 2DQZA 3I2IA 3ZD9A 2NYVA 3ZHRA 1Q21A 3R8CA 2ZUEA 1KMHA 2VPXA 4BFVA 4NONA 3SN6A 1II0A 3RSFA 3V4ZA 3NANA 1HQDA 4U2CA 3WLLA 4DSTA 1ZMXA 5LA6B 1JJ7A 1OI7A 5A2GA 4LWQA 1ST3A 3FCXA 1QWSA 3AIMA 4WOJA 5J58A 2IYUA 2QT9A 1IWPB 3HWRA 3QP9A 4HSEA 4EATA 1CNFA 4JASB 4IL5A 2RHMA 3LO8A 1SA0B 4MKZA 1GUAA 1SCAA 3B3GA 1I0LA 3BTOA 2XHZA 1FRQA 1FXSA 3QSGA 5G41A 1ACLA 3RSSA 1KSGA 4J94A 3NIWA 1NN1A 1X87A 2AN3A 2FMHA 2V4ZA 3VPGA 4DLRA 4IDAA 3LDUA 1LCIA 3U40A 2PZKA 1P29A 4BQOA 4CM7A 2OBMA 3MJCA 4GYJA 2PNJA 2PR7A 4JBYA 3LCRA 3WG9A 1K9VF 3GEHA 4V0ME 1XC7A 3RJ5A 1ESEA 1C8LA 2AG5A 2R87A 3WLFA 2ZYHA 3ACCA 3JVVA 2QY6A 4KIWA 2A5YB 3OPVA 5IXJA 1X14A 4CKZA 2NUTB 3PVSA 1Z8FA 3T0IA 4DT1B 2A1TR 3EYAA 1O4VA 1T43A 3CW2A 4KLAA 3DHNA 1Q14A 1RAFA 1JR2A 3ZU4A 1P62B 1YZQA 3QTTA 3QVJA 4FE7A 3ND8A 2BEVB 1RD4A 1XZJA 3OTWA 4Y2PA 1K4YA 2WG1A 4UJ5A 3R7BA 1H2WA 3L1UA 1ISPA 2QR2A 2ZROA 2CLIB 3SHQA 2O8BB 3IBGA 3U5TA 2FN3A 1NRJB 2XRYA 3O2QB 4QOEA 1J2JA 2V7XA 4BFZA 2O50A 2NZWA 2D1YA 2V58A 2XXJA 1UK6A 3SLKA 2IOQA 2QVYX 4ESEA 5I4BA 2R68A 5AW4A 1Z4PX 4V0LA 1O1YA 4UNSA 3K70C 4P58A 4PBTA 1W34A 3GEIA 5C53B 1IE3A 3G17A 4Y1RA 3NKVA 4RD2A 7AT1A 3G1UA 5U4XA 3RUCA 1LC3A 3UMCA 4KIUA 1QX4A 4FB4A 4YGYA 3A9WA 4EEXA 4ZJYA 2I55A 5FCDA 1JQJC 4MGEA 1IK4A 1M54A 1OKKD 3UAVA 1C7RA 1Q1EA 1FNDA 2QLFA 4JI7B 5KMGB 2QVLA 2I91A 4ASUA 4HEJA 2UVPA 1YCHA 2P9YA 2ENUA 3WLTA 4RJTA 4DZZA 1S2OA 2B21A 4DIBA 3HBJA 4GZ5A 4PGMA 4AMVA 3J81A 2P6MA 4UTPA 5IWCA 3M7IA 1WVIA 1C7IA 2OB1A 3TL2A 3GELA 3LDAA 3R8FA 1E59A 1E61A 1PI3A 3OZIA 1LRLA 3QUCA 3RK4A 4K81B 3SPXA 2Q0XA 1S1CA 1WDMA 4BLOA 2AGVA 4BO4A 4CKBB 3DBRA 1YBHA 2WMDA 4X0EA 4KDFA 4M1WA 5A5FA 1WB9A 3AVXA 3QMVA 4ZVQA 2XSZA 2FOIA 4KIGA 5ALUA 3TE6A 4XA8A 4IY1A 4KLZA 1IHOA 4QT4A 3ECCA 1B00A 3WMXA 1X1AA 4UNPA 5FNVF 2ZSIA 2WSSA 3CUUA 1BDIA 1G9SA 1T3HA 4H4DA 5EUQB 3PQ3A 3LKZA 4QUHA 2OZPA 1OWPA 5H8WA 3D7NA 3LQ4A 3FJ1A 3CWCA 1VPTA 4DV3B 5FWDA 1JFFA 1OR8A 3KUDA 1A9RA 5JS7A 2OTCA 3EPJA 1GNPA 2WEKA 4PVDA 1U0TA 3T06B 4PHFA 3UA3A 2CT8A 5CFQA 4BNZA 5IK2D 2IHJA 3DVSX 3I9FA 1IHDA 1CY0A 1QF9A 3PUWA 1RU3A 4N1AA 3UCEA 1RM4A 2VUIB 3E9ZA 2Z1DA 1KH1A 4FI3C 3RVBA 3LUBA 4I3FA 4IH9A 1C7QA 2FHPA 1K0UA 2MDTA 5EHNA 3ETCA 1R74A 3FSJX 5IEBA 3P4XA 4FB5A 1EJ2A 2ECFA 3QU4A 5TARA 4F3NA 2DMRA 3W3ZB 4EECA 1P39A 3SR0A 3F73A 1MV8A 1OLXA 3LT2A 1EG2A 3MWGA 1KFEB 4KXXA 4N8SA 3C3AA 5D5HA 1D8TA 1G9TA 3QUQA 4CMHA 5IWAB 1Z68A 2O3UA 2P1ZA 1PTJA 3GLQA 2WD9A 4UHHA 5C8YA 3UBMA 3S28A 4CMKA 3R6GA 2F3PA 3MBKA 2G5PA 1NNEA 2CE7A 2ZYIA 3HJGA 1U2PA 3JQ9C 4Y6RA 5TQ0A 4DLSA 1D2RA 3TSWA 1AKMA 2VDWA 1C14A 3KZNA 1R0RE 3CLUD 1HNZB 2JI7A 3M1IA 4L5YA 5GIPE 1NVMB 1FLVA 1D07A 2VJMB 2H8KA 3K31A 4NH0A 1DB3A 5D3MA 4DARA 5JSFA 1QV6A 5DMXA 3RTDA 2WTEA 5EVCA 4US0R 1ULBA 1PHRA 2GTPA 3R44A 5ARCA 3TLGB 5JSQA 5KPJA 1D5CA 5BXYA 2JEOA 4FD3A 5BWCA 2XVYA 3Q72A 5HW0A 3U4GA 3U7GA 3IOYA 4WRRA 3VU9A 1X8XA 2EVWX 2FK8A 4F3KA 4ZOBA 1K9SA 3RAJA 5FOXA 1PX0A 1YFZA 2UYOA 2WI8A 2XYPA 1R6UA 3D64A 3IJRA 3QW4B 2E3JA 3R6LA 4RESA 1NRWA 4K87A 3RM3A 3A58B 1W85B 2EOAA 2VNJA 3EDOA 3FD8A 2E6KA 3G88A 4JJIA 2AK3A 3ZHXA 4DA6A 1PG5A 1NLUA 3CE9A 4PSAA 3B52X 1NMSA 4WCFB 3WNZA 1F6DA 3BD9A 4OUDB 1HYEA 3P9RA 5E9AA 4COOA 4BRSA 4D8TA 4M37A 2H63A 2BY4A 2I78A 5EXDA 3RU9A 1M34E 2Z5FA 4O6VA 4US2R 2P40A 1SOMA 4HDRB 4MAFA 4R2XA 3RO7A 5EIEA 2IEBA 3D8NA 4RQUA 1RJFA 3WJ7A 1CUSA 1LBSA 1V6CA 3EW9A 4QBFA 1C9NA 2J0UB 3FNQA 2RI6A 3OWOA 3D5EA 3AG5A 3LZCA 2RGUA 1NP6A 2RBGA 4P0QB 4KGVA 4K40A 5EE9A 2PQ0A 4EBFA 1AUOA 4QYSA 3BPSA 5A4DA 1YVRA 4I3GA 4RK1A 1WS6A 2Y9MB 1NBMD 1ZM4A 3A6GA 5DN6A 5KOJA 2IUTA 2VI5A 4L0QA 4UFOA 3F4KA 1HL3A 5DGDA 2WAAA 1KDVA 2KBEA 3DKVA 3GRAA 2ZRDA 2C31A 4XB1A 5HIMA 3UT5B 3VPHA 4DCVA 5SY6A 4W5QA 3C3DA 2BJWA 4G0VA 1L5QA 2V6GA 2ZJZA 3BM5A 2D2VA 3CE6A 4HUQA 3RAGA 3S2SA 1BKYA 1DAGA 3EVZA 3KQTA 2F8SA 1PK7A 1YBMA 3NHFA 2DFVA 5HJ2A 3C6XA 1MO3A 2O6LA 3HADA 4UEQA 4EG8A 1G8GA 2HU2A 3QE2A 4QDOA 1T3SA 4RDCA 5ICEA 3UC9A 5AVUA 4M6WA 1ZXLA 4Q34A 4LDNA 2R00C 4YMWA 1GXSB 4NCHA 3ZS8A 2ILVA 5CVVA 2GCGA 1JBQA 3VC2A 4R2KA 5B4VA 3DXYA 4KJXA 4Q3LA 5KNBD 4M1TA 2LWIA 1OWOA 4IDOA 1T2CA 2OLJA 3RTEA 4M1QA 5KI6A 3ZHOA 4BO8A 1U0HC 5TLSA 1ONNA 2E4YA 4U39A 3L7KA 1FTNA 1Y5NA 4JYMA 5TJ9A 2HDWA 4V1CA 5H83A 4WSOA 1PQYA 4EHLA 3DCYA 2E5LB 3U7QA 4IGEA 3P0FA 2XMRA 3GFGA 5FBVB 1CQIA 1UWVA 3CTMA 1I4EB 5CFNA 1M2VA 4J76A 3SZ3A 4C7JA 3M3DA 1G7RA 3A6PC 1YV9A 5HE8A 4PIPA 3GZNA 1QKJA 3VZSA 3HXKA 4ND8B 1Y98A 3VVLA 4EHNA 4YRIA 5F78A 3CF0A 2ZATA 2Q4EA 1J97A 2GUGA 4Y2QA 3EIEA 4E2WA 4JH0A 2Y1WA 4R3NA 4F4UA 1YBAA 4LHXA 4NCKA 2K4MA 1ST2A 4IKEA 3HA2A 3CX6A 4FFLA 3QIVA 3S29A 2FSIA 4QDXA 1XT6A 4L5AA 2H00A 2NUAA 3C39A 4QPZA 1M34B 2H4ZA 1T13A 4TQ9A 2ZBRA 4ON9A 5KOHA 3Q3VA 3KWFA 4IV5A 3HYCA 4O5AA 4WESA 4OXNA 4NYJQ 1THTA 1TYZA 1DO8A 3G8BA 1LLUA 5DTRA 4O63O 1HI9A 3SQLA 1T4CB 3K5WA 5ALWA 2R1TB 2B20A 2C2WA 2VVTA 3A4NA 2X0DA 4CF6A 1HETA 1W1UA 3GMSA 4Q3EA 5LOVA 2B1QA 2C0CA 3PRYA 4C6RA 1OVMA 2HK7A 2G3YA 4EUKA 4JU9A 3SIPA 1CR2A 1P77A 2F43B 1T4BA 2XQJA 5KYWB 1P72A 1M5UA 3Q7EA 1MX1A 3SC3A 3T54A 3R77A 4MIKA 2OV6A 1WOYA 2WIGA 1ZGGA 4Y3UA 1XD9A 3D7RA 1N1GA 4GXNA 4DCNA 2YOFA 2IYXA 1N9GB 3CLSC 4MKGA 1R6VA 4EWLA 5B7NA 3QJYA 5JD4A 3MWJA 1KMNA 2VF7A 3FIUA 2PQ2A 1VLHA 3BWCA 4R6XA 5H02A 2XRFA 2HCBA 2O52A 4RA9B 4P82A 4UNIA 1AK1A 1H0HA 2FW9A 2OFWA 1X7YA 4M7RA 4UE3S 4X7MA 4FR2A 2HCTA 2VRWA 2XNCA 3ISVA 1FDIA 2IV7A 3K70D 2Z4RA 5H4HA 3DKKA 2P3QA 4LF6B 2IPNA 5AVWA 2NO5A 5HFAA 1BSVA 1A9PA 1AC5A 2FQWA 4JI1B 3TBFA 3L4BC 2XT9A 5BWNA 2XJ4A 1TA4A 4LDJA 3WXBA 3AVUA 1F5NA 3FF4A 1IPFA 1X2BA 4BAGA 5FUXA 2XUJA 1FB5A 5TJHA 2C4UA 1DINA 1DBVO 2DPMA 2TS1A 2XF8A 3TEMA 3UUGA 1RCFA 2V1XA 1IONA 3CLKA 3CCBA 3T7IA 2PWPA 2BM1A 2HSGA 3TAUA 1A5SB 2AH5A 2YMQA 1Y4DE 1NJSA 3IOCA 2FRDC 5EWLA 3NHLA 3QYAA 1PL0A 4GP6A 3EXHC 2DQYA 2VF5X 4EHBA 2JIDA 1KTIA 4DNXA 5JANA 5F64A 4YN3A 2I4MA 2XQKA 3HSKA 1QHHA 4I7EA 1U4OA 3UKDA 4YR7A 2JJ1D 1GA6A 5FOSA 3HJBA 3GRUA 2V6JA 1T1SA 1M72A 1U90A 2PT9A 1ENPA 2I1LA 3KDSE 2C2ZA 3NDIA 1AZWA 2WMOB 4YRCA 3OSUA 1C9DB 4D0SA 5ADUS 3QWBA 3DBIA 2AN4A 1M8KA 4CKCA 3VXKA 1V8FA 3EUFA 1BOOA 4MDFA 3GL9A 4BEWA 2DLDA 3P97A 1Q95A 1DC3A 1WABA 2YHIB 4I99A 1UAAA 1S3IA 3PI7A 1JQDA 2R6DA 2HLDD 4MPTA 3NEPX 3RF7A 3IAM1 4TMTA 2IYZA 4RMGA 5MN4A 1WQ3A 1DZ3A 2RHHA 1ELOA 2VSOA 3DAPA 3IAS1 3SBDA 4KQ1A 4ZRMA 3ZV5A 2AKEA 1OA0A 2C3PA 1Z28A 1NQAO 4LVNA 1VJDA 2ZVPX 4RVNA 1OH7A 1K4KA 1R12A 3DLAA 4LDZA 2BE7A 1EMDA 4OGGA 4TL9A 1QFJA 3MXTA 1F0KA 3C24A 3GJ6A 1MAHA 4K03A 4DDKA 5JWRA 4D9GA 3U4CA 3ON5A 1HC7A 3NIBA 3KYCA 3RIMA 2RJNA 1UC9A 3BMQA 4K1LA 1T2VA 1HE2A 4LCEA 4KIJA 4RETA 1CEQA 5E2BA 1TM4E 1GT6A 3GLUA 1R37A 1TKAA 3JQDA 1T0UA 1TVCA 4LJ7A 4A26A 2EFGA 3TOSA 3DEJA 2RB5A 5CYGA 1S4MA 1W5AA 2DBVO 2R6AA 3K9LA 1X70A 5JV5A 1LBHA 4NSNA 3MC1A 3WL3A 2DBRA 4X65B 2YRFA 1BQEA 2NV2B 4NJEB 1D1QA 5H16A 3TD6A 3VV2A 2LGJA 1JNXX 1LF5A 1KYWA 2VHXA 2QUHA 4NPAA 3U81A 4QJ5A 5DM70 1DPFA 4F2WA 3K70B 1VBMA 4NCXA 4MI9A 1JIVA 1WR8A 1X9GA 4GGPA 4H1TA 4IEIA 5DBEX 3N6RA 2PGXA 1YKSA 2DERA 2YZMA 3W2TA 1DIOB 5EZYF 5ELXA 2HFJA 2SKDA 3RRBA 4YRBA 1KBZA 5IKOA 4Z2AA 4H4EA 3G5MA 3IJPA 4QSMA 4N47A 2ZJ1A 2V4UA 1V4BA 3WWZA 4WWHA 1NBHA 3OPYA 4MRAA 1EWKA 2YXPX 4DIMA 5BUSA 5CT5A 1TJPB 1WY7A 2FFJA 3A6HA 2AJCA 3ZXUB 4G5RA 3K9FC 2UXDB 3CWZA 3Q3GE 5H9VA 5JJCA 1ZR4A 5L3SA 2D0DA 5DHPA 1PR9A 5CCDA 2Z5GA 1JN0A 1ODIA 3ENVA 3UW1A 3ISTA 4EUHA 5JIBA 4DA9A 4JI4B 4W5OA 3RVOA 1RXWA 3GLKA 1LB1B 4FCTA 4UCWA 1DTEA 3WA7A 1FDSA 3RBXA 1AV7A 1C3VA 3AUJB 3AHDA 4HNAA 2QWXA 2X86A 3ZQ6A 3RI3A 4QTTB 1VTKA 2ZXFA 3LOUA 2JJQA 4LWPA 4TVOA 1TPYA 3N7TA 4IDDA 4ENRA 2BGNA 3UUFA 1FC0A 3WICA 4GICA 1KOJA 2J6BA 3R4CA 4HAXA 1I80A 4Y1FA 3U9SA 1BX0A 3HU3A 3ICOA 5EIXA 2I66A 1XZNA 3LBIA 1R18A 1S2NA 2OZLA 2VPPA 4B7AA 2ONZA 3D3EA 1W9HA 2PO7A 3CFYA 4UDYX 1U8ZA 1WZUA 2YXDA 2VK2A 1DTSA 4DLLA 2WWFA 1JZSA 2P9FA 1FUKA 3CRZA 3ESXA 3KKLA 1VRVA 2D4AA 4UZSA 1XWWA 2WIKA 2W6JA 5IVDA 4C29A 4EPYA 2JFPA 3K0BA 2FKNA 3ZWQA 3TNDA 2ZIXA 5KNDA 1G42A 1EQUA 4OGFA 3WP0A 3EF3A 2XEXA 2W11A 4QGHA 3WK9A 3AC0A 1NU6A 4P33A 1Z83A 2NZVG 4OA5A 1K5HA 2DBQA 2XLBA 1JECA 3B5JA 4LBZA 5HS4A 2A33A 1QIGA 3HWSA 3Q2OA 4GMHA 5C5EA 1JDZA 3QU9A 2GRUA 1D8AA 3DM9B 1WXHA 3EULA 4M86A 3ZWWA 3GDHA 1B8UA 1FNCA 1IVYA 1FCJA 3OQPA 5THQA 4QU8A 3SHVA 2IUFA 4XUEA 4RVDA 4L3OA 4JXXA 3OQJA 3PKJA 3DMYA 3F4BA 1BRTA 2DAPA 3DC7A 3G7NA 3GHYA 4X7RA 1TKBA 1CQJB 2AKAB 4EQ6B 1GZ7A 1F20A 2ADFA 2HA3A 1PD1A 1H66A 2VTDA 2XTNA 3PNYA 5ALIA 5E6SA 4I66A 2JKZA 4DEVA 4WBNA 2YKGA 1GEGA 1P0PA 1PR2A 1RJ9A 3NIFB 2J59A 4I81A 5JZ9A 3D6TB 5DK6A 4XX0A 1NGSA 4N5HX 4D0GA 1P6UA 4PC3A 3DT9A 4N5IX 4DV1B 1W4AA 1Y3IA 4NKRA 3MD0A 4FFBB 5A3SA 1IXSB 4QBKA 3BICA 3AUUA 4DM7A 2CNLA 3D3NA 3VR3A 2ZVDA 1Z4LA 3A11A 4IJQA 4QJBA 1EFVB 1YR8A 3A31A 1VPLA 4AY4A 5ITWA 1LSUA 1L6RA 4YYZA 1LV7A 4LNAA 3GVXA 1X9IA 3P9ZA 3NTOA 4MDYA 3ZWKA 2AG0A 2BKXA 1AOXA 1RWBA 1Z0KA 5LBTA 4P0TA 1J1ZA 1EVLA 1XCMA 2SKCA 4ESOA 3G2HA 2MWMA 2CJYA 1HA3A 2IUSA 1VP9A 3AIIA 3FRIA 4WJKB 1BH6A 1W2GA 3E7XA 3CW9A 2ILTA 4OB7A 5CAEB 3EDRA 1MW8X 2CXNA 4IEFB 4JIMA 1GVNB 3ZDCA 1KJNA 1L7NA 1U0GA 2OHXA 2OOKA 2XLCA 3IQGX 4LVOA 2ACKA 1KERA 3THWB 1QP8A 2XB4A 2WZCA 3I3OA 3OC6A 3UJDA 3RT1A 2CV2A 4RDXA 2NAFA 3P0HA 9GPBA 4LOLA 2EP7A 4EF6A 4B6GA 1MOSA 2QU8A 4B1FA 4BMPB 1LBTA 3NEYA 4B4UA 2RAPA 5IAOA 1Y3FE 3NAGA 3NNDA 2FWAA 4AC9A 3G2QA 3HO1A 2OCBA 1CCWA 2F4VB 1AUQA 4GPTA 1MABB 3CF4G 5P8WA 1GRCA 5JRZA 4BP3A 5CA1A 3AHFA 4FOOA 3NTRA 3L4SO 4L7QA 1VCOA 3CLSD 1SB9A 4K6MA 3OZUA 3QJGA 2BMFA 1ZC3A 2ROQA 1XBTA 4FE3A 4ZVMA 1F17A 1PD0A 2EFDB 2JGEA 2PX2A 2RH8A 3BIJA 3Q0EA 4L1KA 3TLJA 3ZHYA 1P19A 2C2XA 3V34A 4IJ5A 3MUNA 1C1XB 1KMIY 2NSJA 1HGXA 2ZTMA 4WZBE 4BWVA 3QLUA 4RQBA 1SOUA 3ZHTA 3DMHA 3MWFA 3AOEA 3CNHA 3T1NA 521PA 2GDJA 1GT91 3WB1A 3ZNQA 2PMCA 5FA5A 1ZOSA 2GX6A 3VNQA 2H5IA 2VKTA 3K2BA 3GLIE 5A1JA 3NUQA 4DNOA 4S1PA 3L7DA 1BGXT 2WB2A 4LJSA 1DELA 4EG7A 2QY9A 3VJLA 1KI7A 1XELA 2GD1O 1ICIA 3BSFA 1WF6A 3NORA 3W5JA 2I2CA 3FFBA 4TL6A 5EZYB 4F4IA 4M46A 3KVVA 2F1IA 5J5CA 1GQFA 2VQ6A 4HH4A 4BVFA 1JV2B 1QDLB 4GD3Q 4E70A 2Z3VA 3KEFA 1W44A 2PT6A 2XZPA 1IZ7A 3PFKA 2BFPA 3P0EA 5G4LA 1GZDA 3FUXA 2RAVA 3Q6IA 3TZCA 2RD2A 4BX9A 1DAOA 2WUFA 1TUGA 2XOKA 3DZKA 2QPTA 5UKDA 3BWYA 1YH3A 2QTVB 4JGBA 4DWJA 3FE2A 1FJ2A 2OORA 1MEOA 4LJLA 4PZLA 3C8DA 3SX4A 4EPXA 3FZEA 2ZAGA 3QY0A 2WD7B 1WVMA 2RGBA 2RHTA 2WV7A 2BFWA 1LF0A 3BWDD 4B4OA 4ECEA 5FWXA 4Q0MA 4H7EA 1ZAKA 4FK8A 4QUBA 3QG1A 2QT0A 5J4YA 1IULA 2PGOA 1QP0A 4ZU6X 5AMXA 3GX1A 2G88A 4XDYA 2GBLA 3F9CA 1JJFA 5FNZA 1ZH0A 2FQQA 4ETWA 1F0YA 2VH5R 3BFPA 2V54A 1ZA2A 1XJ0A 5M29A 1C9JA 3D9QX 2XJ9A 3ORSA 4G37A 2ONJA 4RADA 4MV9A 5E7MA 5K20A 4OI0A 4HQOA 3EPLA 4FC6A 3DB1A 2ONYA 3PKZA 4NZOA 4L7VA 2ZI6A 3TCNA 2A3NA 3OPNA 2ET6A 4LHVA 1DVRA 1VZ3A 3OE7D 3R0JA 3ZJTA 1R7RA 3Q0IA 3B36A 2AOXA 2G9QA 3I04M 3IKVA 2WWHA 1KY4A 3E4DA 4JL5A 4C4ZA 3G79A 1R0WA 2ATCA 2W6ID 2WLSA 1R4ZA 1RRMA 1SUSA 2X23A 2XWPA 3PYMA 4UUMA 4BB6A 2HJ9A 4GNKA 1A4RA 3TLXA 3F46A 3OMWA 4C5BA 1Z7EA 4ZFNA 2FSSA 3TTUA 1WHTB 2ECOA 1Z4QA 3QEMB 3UYKA 4BO1A 4BVLA 5BSRA 1E0SA 2ZTVA 4OXXA 2ECKA 2HJHA 5HJEA 3H2GA 4D81A 2KQUA 3BSYA 4EDFA 2LPMA 1NI5A 1TW2A 3OM0A 4QGAA 1VJ0A 4YAOA 4GOMD 4D4IA 5TY0A 4C5AA 4YCLA 4MIOA 3Q40A 4HH1A 1W49A 3KPYA 4ZOLA 1PWHA 4WZBB 3R23A 3G3EA 3PJGA 5FYQA 1A4UA 1OBFO 3D4NA 4LJKA 3DAFA 3EWAA 1XF9A 2IXEA 2X42A 1TLFA 4G9GA 4PYIA 1G20A 2WHYA 4Q1CA 4D9CA 2HO5A 5DYTA 4TKUB 3GLIB 3QEBZ 4WXRA 2FDXA 2WWIA 5C37A 5LZ4A 1HNWB 3PCXA 4OTZA 1UZNA 1P3Y1 5DTEA 1BYUA 3KSDO 3CRW1 4FKMA 2VJBA 2H7YA 4F6RA 3H2JA 1HV8A 3PNLA 4N9WA 4TV8F 1KJQA 3F5MA 5JDIC 4MWEA 4AIIA 2QRKA 4MR7A 3EIFA 3IKMB 4N5LA 2WYOA 4K2AA 4U2FA 2AOVA 5ALPA 2KJQA 5G3ZA 2O2YA 3KJEA 4CL0A 1KSFX 1QRAA 3ZLUA 2ZB4A 4Q7LA 3EXHB 1VGVA 1SY7A 2HGSA 2QMZA 3GRYA 3NASA 3K96A 4XD2A 2I29A 1RC1A 3KSUA 3PQCA 4QUIA 1YU9A 3WGTA 4YCMA 4HFMA 2Q4TA 5L3QA 1OI2A 1BGWA 2HKIA 3QHAA 3P7MA 2PZJA 4QGBA 3AEKA 4MIYA 3Q6MA 4HDAA 2YZ7A 3GDOA 1NFRA 3JWJA 4DV6B 3BL5A 5D8DA 3ST7A 4D3XA 4B2IA 1EWRA 1CJUC 2FOLA 1ULSA 3EH1A 4QAQA 4L9WA 1KK2A 2Y67A 1NIPA 1ZIPA 1NDHA 4H77A 3ZK9A 1UFKA 3NHWA 2W2PA 1DIRA 4BNIA 1E1DA 3DE4X 1G21B 2ZRKA 3SC2A 4D80A 1SUAA 2RGXA 3CWQA 1RLIA 1VG0B 3BHMA 3LX6A 5JPIA 1S2MA 2GEVA 2W6MA 4QM7A 2PMFA 4LGCA 5REQA 4MK4A 3VUFA 1XVTA 2VJLA 3GFFA 4CF5A 2H65A 2W6OA 1JKFA 2B6NA 1PFUA 1UP4A 3TAXA 4DXDA 4AL4A 4KREA 3KLPX 4GMGA 1A5AB 3D8RA 3QLEA 4HQ6A 4D9FA 3BIWA 3K73O 4EI2A 2NU9A 3F3SA 2GYWA 1D03A 3AKCA 4MP6A 4PQEA 2XCTB 3KV3O 4WJZA 3AONB 2AXPA 4X6XA 2ON6A 1GQQA 3FHCB 3JQ8B 4PR0A 5LDDC 3AB3A 1NSYA 4YCJA 4QO8A 1KFBB 1QJ4A 1OI4A 1R6BX 4ME6A 1TEZA 4XKJA 3GBVA 3GLGA 2HTEA 3E0XA 3IAUA 3DD1A 1HLPA 2PKYX 1VCHA 2J7PD 2GCOA 1SPBS 2PD6A 4TZ6A 2H85A 4R9NA 5E9QA 4P4SB 4TS4A 4C04A 1A1VA 1DTWB 1ZNYA 4LDRA 1M10A 3R8XA 1RHMA 4QXMA 1USUA 3QPWA 4R5HA 4OFBA 1E58A 1CJBA 2BC9A 2DTDA 4F5ZA 1TQDA 1I2DA 1Z39A 4NV0A 3ZBUA 3K6SB 3GUZA 3KE9A 3THOA 3PUIA 3NR2A 3AOGA 5JOQA 2GDZA 1SIBE 1I9GA 3R20A 3CXRA 1L7EA 1DV1A 3T1YB 2OO3A 5EA2A 3T9FA 1X7WB 5DM0A 2YV1A 3T7EA 1ML3A 1ZONA 4G89A 1N5RA 2P65A 2ZJYA 2HQRA 3DBHA 4MQMA 4WKCA 2EQBA 1EWVA 2Z2IA 4I5IA 3RYFA 1N1EA 2BCJQ 1RWNA 3EZ9A 5E3HA 4R8RA 1E2FA 1L5FA 2QZJA 2V4MA 1YC5A 2DFNA 3KOXA 1RKUA 3NVAA 4B2LA 5AW0A 5IX8A 2CHVA 4BEJA 4GOOD 2OFPA 3G82C 5BSEA 5GPBA 2FWNA 4ALMA 4BKPA 1CF9A 3DDSA 3IB3A 1OXXK 3JD1A 4H4CA 3C5WP 3VJMA 4CN8A 2YNMA 4RM2A 5AICA 2ZJBA 4GOXA 4CT5A 1T6NA 1BVHA 5EMMA 1P33A 4LI3X 5FF9A 1XLVA 3GLFB 2Q5OA 3H87A 1KRWA 2OZVA 4GUAA 4ZT4A 1NWCA 2RGGA 4QNMA 4LYYA 1A2OA 1E1CB 2H1VA 2JC3A 1B8VA 2WF5A 3BN3A 4S1WA 1ESNA 3O8QB 1II8B 3CLVA 3G9QA 4TLMB 4XSVA 4DM3A 4JZYA 1K6EA 2A92A 4J2OA 5IH3A 4WECA 1H6CA 4DYDA 2O3JA 4QRHA 2PWZA 4MA0A 3ETEA 2CFIA 3V2IA 1V9SA 4CIDA 3RC8A 1JQEA 5LR6A 1P1JA 5GOTA 4JOSA 2Y1DA 5KJ6A 2F6RA 1XTBA 5ALMA 2QSJA 4LTDA 5DZSA 1R5JA 2RK6A 3SMVA 2FWJA 2MTBA 1E0AA 2OCDA 3WRWA 4C30A 4L74A 3VTAA 1XNGA 2X41A 3HC7A 4O2BF 4W5JA 4DRXB 5F2EA 2MR6A 2XVAA 3LPMA 2DX7A 2R84A 2PJDA 2PJZA 4F4JA 1G1AA 4E7OA 4MWDA 5J2UA 3S55A 3G0IA 1GV1A 5J9FA 1ZQ1A 3C6KA 4O2AF 3Q2IA 4NZNA 4IIJB 4PPGA 5JADA 5JXWA 5HF9A 4BX3A 1JTVA 2GN8A 1G5RA 1RYFA 4FSHA 4Y2VA 5MN6A 1U9IC 4HWRA 3UUWA 16PKA 1WUIS 1Y1PA 2FUKA 2JI9A 2V7GA 3N9IA 4Y9SA 3PUKA 3TTSA 3VR5A 3I5XA 4QSHA 1U2SA 2ZQYA 4QYIB 2PN1A 2DBYA 1D2MA 1GA4A 3NGXA 1S3FA 3B1JA 3GNLA 4MLPA 5B1EA 1J8DA 2DQ4A 2OUKA 3H9UA 3P2KA 5KQGA 4TQGA 1GDDA 3TUJC 4TV8B 5IYZA 1J0BA 1Y5IA 4LHSA 3KSZO 3OG9A 1J2YA 2R65A 3WLMA 3IEKA 4D9KA 1TRHA 3EGWA 4F71A 3AEYA 3AKDA 1VJ1A 3EAQA 2JAOA 1M1ZA 4M21A 1RI3A 2Q4DA 4YT4A 1QRTA 4DY4A 4MV7A 2HA6A 4AJ9A 4JUCA 1KO7A 1ODTC 4B2PA 2ZJ7A 4KFRA 4OHPA 2A67A 4ZCRA 2IBTA 3OZSA 2CL0X 1PG0A 3AL0C 3H65A 4MS1A 1T8PA 1PGJA 2NV0A 2OCLA 2A2ZA 1PHPA 3DF9A 4FC7A 3TINA 4EYGA 4K86A 2VBGA 2C2OA 5EJ7A 4BB9A 4X71A 3M89A 5BSWA 1WCYA 3AU9A 3AXTA 4INJA 2O05A 3QBJA 5H5JA 3RFUA 3ZQUA 4C6SA 4A6PA 1N32B 2JFOA 1O0BA 5J47A 3BXOA 1FW8A 1YONA 2BGIA 4IJ6A 1TAGA 3C7KA 3EVDA 5AOVA 3HCBA 4E5DA 3TM4A 1EHIA 4NABA 4JT4A 1R8QA 3PXDA 4FEAA 3U17A 3HMQA 1YS4A 3FMPB 3OIUA 3AVVA 1KZGB 1ORHA 1OBCA 1WJGA 2FSFA 1BHJA 3QKRB 3T5MA 3VM6A 2J3IA 3A1FA 2E37A 1XMXA 4JOBA 4U8HA 3L7OA 3RSGA 3ILXA 3KQWA 1R27A 2PSHA 5D3QA 1ZD2P 1ECFA 1XAIA 1EZZA 3RKUA 4EF5A 2IITA 2JAWA 1GFSA 3D4OA 4K9SA 4PHHA 3JD2A 1Z17A 4RHTA 3SBEA 1BXRA 2ZRGA 3J7TA 3LWBA 2ECPA 5CT9A 2WAXA 3EGDB 4MVJF 5BSTA 2FB9A 3KTFA 5DYIA 4GPIB 3BXHA 1E5QA 1FP6A 2FE4A 3MWKA 1MHPA 3E8XA 4JEUA 2CLLB 3EGVA 4JXKA 4Q7EA 4RSMA 1N8SA 3AY6A 3MD9A 2ZBEA 1RRGA 2O8EA 1NX9A 3O4GA 2BP7A 5IUKC 3L8EA 1MGPA 2BMEA 2N1BA 4GDFA 1T5IA 4FDAA 2YTZA 2AOTA 2I6GA 1E92A 3U0BA 4Y2SA 3GLHE 5I7RA 4CTJA 2W2QA 4K6FA 9LDBA 1SQGA 5K3CA 1CE8B 3H4MA 2AOWA 4DN6A 2QZPA 3O9ZA 5JI2E 3SQMA 4UUAA 3EXFA 3HMKA 1RDFA 4PCUA 4M0FA 4DR4B 2FLKA 4PU0A 1W4BA 4HRAA 3OD5A 3P94A 3FGZA 4GRIA 1J5EB 3IL2A 1EP3B 5JH7F 2FR8C 3QYFA 4ZYZA 4S04A 3FKSD 7REQA 2LP4Y 1Q11A 3OU2A 5GAJA 1QB8A 2H8GA 2Q1WA 3UHOA 3HDYA 3LWZA 3OP4A 1TJ5A 2VWPA 1IEXA 4BNJA 1IZZA 1J8YF 1KORA 3G2PA 4B6PA 1ZD1A 4AN1A 4DBVO 2HQ1A 1QAMA 3CUVA 4IIUA 1U3GA 1JIKA 2GI4A 4NJOA 3RKRA 6ADHA 3QHQA 4IZIA 2FWIA 2V96A 3QA3E 2GYYA 1LX6A 2PD3A 3I72A 3L84A 3I05A 2Q8QA 5ALKA 1LVHA 1P6QA 4ND7A 2QRVA 4PQFA 4XGKA 5CX1A 3UATA 1XMIA 2P77A 4DBZA 4UCFA 1JGTA 6REQB 1C29B 4IOKA 4WH0A 3DULA 3KAQA 2NXNA 1WM1A 4PGFA 4AS3A 4MQLA 2ORIA 1WBBA 3ZDFA 2GM5A 2W22A 1LZKA 1B6SA 5KNCD 1UQUA 4WKOA 4HNTA 4XYGA 5ENZA 1IOWA 3HR7A 3QQPA 3NRJA 1XUOA 3NOVA 2IXTA 4FFWA 4J1SA 1VYUA 2I7DA 4RK5A 1GL3A 1T34A 4G4GA 4JJ8A 2F00A 3FBWA 4FGLA 4B7UA 2Q0HA 4HRYA 3IEXA 1LDNA 4BTEA 1U11A 3OY2A 3C4JA 4MRSA 4O8CA 1XX6A 4UBLA 3JSAA 1I0IA 3V8RA 5MDHA 1AV6A 5FB3A 4DSZA 4PZDA 2TMYA 1EIZA 2CCKA 2XV1A 5H59A 3JXEA 4F21A 3HRKA 1FNMA 1UWKA 4G0WA 3IMEA 4MVJD 4O2BB 2KE5A 4MQUA 3ROXA 3S6JA 3EBPA 3LNTA 2TMDA 3ASZA 4B6FA 1M6EX 1P5ZB 3BBLA 4Q39A 4WOKA 3OZAA 3FPFA 1U04A 2OP0A 4O2AB 3ZLVA 2HR1A 2G9ZA 4CV1A 4Q05A 3CSDA 2JAXA 1A8UA 1O8CA 2GNAA 4PX2A 5K0FA 2GHIA 1NNSA 2Q7DA 3VBEA 3FMFA 1GUFA 3LLMA 4JLWA 1QKIA 2RCYA 3VU1A 5JS6A 5IKMA 1IN4A 1FFBA 3RR2A 3D1VA 1IBSA 4UDNA 4EFNA 4QYTA 4F56A 5TGZA 3IVMA 3PSHA 4CMIA 3CUSA 5GZ1A 3WADA 4KXVA 1XL1A 1MO6A 1ID8A 1W88A 4AMUA 3PFIA 1W581 3KG2A 1XD8A 1B76A 1XVUA 1A9YA 2FWMX 2FXVA 1YBVA 2OBNA 3QLTA 4Y9RA 4LRSB 4D41A 5SICE 4GBED 1Q20A 2HEIA 2JIMA 4B0OA 2ATXA 2G7ZA 5DNCA 4QBTA 5JATA 5FUVA 2CJWB 5TQ2A 4N49A 2Q5LA 2X58A 1EFDN 2R9VA 2XD4A 4V0RA 3ZCPA 2Y8EA 4JB2A 1Q7CA 2MHCA 1XJQA 3V4PB 3U19A 2G25A 4I3HA 5BW8A 3CVVA 1NF2A 2MSEB 3D4IA 2GD6A 5BSUA 1UDCA 4LX0A 2AS0A 3FFXA 2JJ2D 1NW4A 3HKEB 3H6KA 4QRIA 2O3RA 5IAEA 1MPXA 1V25A 3ZTWA 3M6FA 1CZNA 4BXOB 1N8KA 2B9EA 3PGKA 3WQRA 2IYEA 2Q62A 5CB4A 4QOJA 1J2EA 2ZBQA 4MS3B 5HFJA 1HE8B 4ATNA 2PSDA 3EUEA 3LA8A 2BBOA 2I80A 1ONPA 3CIFA 1NN0A 2A1IA 3OJOA 1FQOA 1T0IA 1TF2A 4KWHA 4OBBA 4URXR 5F3DA 2NVUB 3BMCA 3FRHA 1C8VB 4CV3A 2WKSA 2WP8J 3K53A 4WZZA 3EDMA 1XNRB 1JIQA 1MVOA 1R5NA 4KRGA 1AH2A 1QGUA 4QYWA 3L8MA 2Z1MA 1YSCA 3LQYA 1VSUA 2ANBA 3WNVA 1MAWA 1V11A 4K28A 3UHPA 3GNQA 3FN4A 4TZKA 4GWLA 4DJEC 3BJZA 1LWNA 1Z2OX 2R7KA 4MPRA 5K0CA 3LPAA 1XQYA 4ZREA 1LJUA 1I8TA 2P9QA 3P9PA 4M8LA 1X0XA 4TWJA 5CDUA 1O0CA 2J87A 4MI3A 3DLTA 1K0FA 2ZTSA 3COYA 3QFFA 4LISA 1JQBA 3P5SA 3N7UA 4M1SA 4U63A 1LFDB 3MCVA 1SB8A 5BN4A 1OZ0A 3UMBA 4HAYA 1ENOA 2EFHB 3C3XA 2D2EA 4DMFA 1L5RA 1Z2CA 2PT7A 3RJTA 2FX3A 5AVRA 5DX0A 1AE1A 2O19A 2GAIA 2CVQA 4UAUA 1NVFA 3MPOA 2ZUSA 4OX9B 3BKXA 2V55B 1EM8A 1YIDA 2BRUC 1LJLA 2GSDA 5C18A 1UFOA 4FLEA 1V1MA 2JGDB 3FPCA 4H7PA 3NBKA 4AMYA 2HK6A 1FDTA 1UOQA 2GJ8A 3FPGA 4I4TA 1Z6GA 1U7PA 4ENVA 3GAFA 1W2WB 1KQFA 2AFHA 4Z1MD 4LBVA 1A97A 5GTDA 3V8MA 1KI8A 1LSOA 3ICPA 3HV0A 5GOZA 2F67A 4ZDJA 1L7AA 3FWZA 2WWRA 3U26A 1FDWA 2R6FA 4HH0A 4QECA 1XF1A 4GS5A 1U8EA 2APJA 4CM4B 4TX1A 1IUNA 2A58A 3A6DA 3E35A 3TD9A 1E96A 1C30A 3G5AA 4G9BA 3SE0A 3H83A 1FL9A 1MAAA 2J9YB 3AHCA 5FPYA 3VUEA 1E7YA 5JH7B 1F2TB 3L5KA 2P4UA 4DJFC 4EG6A 3MQ4A 2CZGA 4TYPA 4C3OB 3Q12A 4HGZA 4JLKA 4M36A 1TEXA 4Y1GA 4OKIA 2VIIA 4QHTA 4YWHA 2IS1A 3RBZA 5KHAA 1XK7A 5J2TF 1L5SA 1P7WA 4FN5A 3V97A 2DLNA 1BCSA 5AFSA 3IDQA 1SKMA 1D09A 2RHRA 2GRJA 4KMMA 3V42A 3VOAA 4GXQA 4TUYA 1E2PA 3BMOB 2HIMA 4PQRA 1OZHA 1E3IA 1QCDA 2FN4A 3LHSA 3O0TA 1FVOA 4LRTB 4MVJI 1KVSA 4N01A 4RPJA 3NS7A 5AVOA 2AI2A 3DNFA 3LXUX 3H5OA 1SVOA 3IPCA 4EW2A 1O6ZA 3R5SA 1M7HA 2CXHA 3BHJA 1TZCA 8ADHA 1ZNXA 3OEYA 2BJVA 4RV5A 2D5IA 4IMIB 1QH9A 4ZGWA 5A9RA 1U8UA 2PXXA 4IUCS 4P83A 1BA3A 4DMCA 4XAQA 3TK1A 2XADA 3A6FA 5B3JC 3GPLA 1W29A 3Q8XB 3ZDAA 3L1VA 4G5GA 3L9WA 1QH1B 4MUBA 4C0XA 1TMOA 4L4XA 2X2OA 3ENZA 5DWVA 2HJSA 4IFEA 2R47A 5FR2A 4Z1OA 5E8RA 1YUBA 1L8LA 2FLVA 4WGGA 2GN9A 4R16A 1YTUA 3LVRE 2B8TA 3GP3A 1OOEA 2UZAA 1D6MA 1UANA 1IOLA 4N7RA 4CLHA 1ZH2A 3H9CA 1AJEA 5ALDA 2BFAA 3D6NB 2C77A 1JKXA 3LQFA 4E13A 4EI8A 1EX7A 4Q1VA 4RIGA 1UFVA 4ND2A 5KVQA 4U4AA 5H3HA 4EVRA 3IP6A 4MEJA 3MLBA 3OTQA 1WWKA 2NU6B 3LP8A 3Q7TA 1O87A 4GMKA 4AQ7A 1QGDA 1F2DA 3A3YA 3VHRA 1J99A 4PC1A 3UG7A 1XZLA 2RHJA 4DXHA 3GJXC 1E9BA 3ZWXA 5TMPA 4V03A 4I1YA 1W48A 1YHNA 2OK8A 2Y1GA 2JIQA 4QDZA 1BE6A 1Z5PA 4TLAA 3KFLA 2KX7A 2O3QA 2WM3A 1RI2A 4NHOA 1IZ8A 3TL3A 4ZJUA 2C97A 3LBNA 3ZR4B 1PT5A 1QCCA 1G8PA 4S3MA 4GEKA 5AJWA 1XCOA 2CVFA 3QQ5A 2O8DB 3OQBA 2HEGA 2C2MA 2AIRA 3GOHA 3VH3A 5JD5A 2H57A 5I9BA 1S2GA 4R9SA 5AXCA 1E77A 2VHYA 1FXUA 1NX6A 3A3KA 1AGNA 1U8CB 4R1LA 1NMEA 2H4YA 4XM1A 2CNOA 5ELLA 3HO8A 2FZCA 3KJGA 4INZA 2BR3A 2ID9A 4QAJA 3IR7A 2G72A 1DADA 5CVUA 1TX4B 1CLUA 2H59A 2M6RA 2Q6OA 3CH7A 3RUIA 2P2SA 3T7TA 3L7BA 3HACA 3ZY2A 5HWSA 1SKUA 3IIJA 1CS4C 4RW0A 3FZYA 5CCXA 3AKYA 3K05A 3DPSA 3MHPA 4LIPD 1Z12A 5C8VA 1JWAB 5GGXA 2ZYVX 3EA4A 3SDBA 1A9TA 4BLUA 2KM1A 3UM9A 3ELWA 1JR4A 4BN4A 2J31A 4EVQA 2VHEA 2HL6A 3Q15C 4WGFA 4CG0A 4EMSA 5U1PA 4QU5A 4XUDA 3G5TA 4LI0A 3RU7A 3TIGA 4H1HA 2L0XA 4PYMA 2FMFA 3GCWA 3OTHA 3BL8A 1U9CA 2CCGA 3QUAA 2R85A 4EGFA 2YRXA 2E2WA 1X6VA 4LYGA 1I3OA 1X1TA 4AUNA 2NT3A 1LY1A 4TROA 4FQ7A 2IDZA 5A9SA 1Q0HA 3ZQJA 1G3MA 1E94E 1E5LA 1NVDA 1KBOA 1O9HA 3H2HA 5EIOA 3CNBA 4J9VA 1K7SN 1G3IA 1ACMA 1WNFA 3ABZA 4N6OA 1YZUA 5HILA 1W47A 4L8FA 4RU1A 1HRDA 2BZSA 3BQNB 3QTBA 4L2IA 4UD2A 2WY2D 4GMDA 3R9IA 3KETA 1X7ZA 3AINA 3K5IA 5KPDA 5KYUB 2FPSA 2VN8A 4IWYA 2IEDA 3AF0A 4GVXA 4H08A 1Z62A 1HLGA 5CXSA 4A8JC 5ABPA 4TSRA 1EUDB 4KYIB 2YFYA 3PP8A 4HDKA 4L4RA 2ZVJA 1EHCA 3K1YA 4LZNA 1NW5A 4OAOA 2ZBFA 1EX1A 4I1UA 4E03A 5JRDS 1KY5A 3PXEA 1KQPA 1JNYA 2HT1A 4AX8A 3VR6H 3PPWA 4YONB 1ODFA 4H27A 2NV6A 3OA2A 2CF6A 4II3A 2YVKA 1ADFA 2RK3A 1WU7A 3EEQA 2EBWA 3HP1A 4FOPA 3A1NA 3AQIA 3ZWBA 1A2KC 2UZ1A 5DCLA 4R1NA 4CVNA 3O3CA 1R0KA 3BCSA 3I62A 3D81A 4LRYA 1QYWA 1NBOA 3ZKWB 1S4QA 1GIAA 4KAJA 4P2BA 2W2OA 1T35A 4UBOA 2G1PA 3FXAA 2DHCA 3BFXA 2K2QB 4QFBA 3VJRA 5E8JA 2XQIA 4P98A 4F0JA 4BZQA 4RX1A 4ZOAA 2PBRA 1IBKB 4FQ5A 3D4LA 5TXGA 3VU3A 1XN4A 3U4QB 2FYTA 3IP1A 1SBIA 5K3FA 2Q29A 3ED1A 4BYMA 2VSXA 2UXCB 5CB0A 1GQYA 1IVSA 4G2TA 1Q2UA 3WGNA 4LYHA 5LBIA 2VAXA 3HP4A 5CM9C 1GKUB 3S44A 4AKEA 2DYKA 3PQ7A 4XCVA 5EP4A 5T4HA 5J2TB 1ZBQA 3HBLA 3PNQA 3CG4A 4YV1A 4G63A 3KS9A 1N8TA 2HQSA 1DEOA 4P22A 2Q2NA 4O4IF 3RIXA 3TIXB 1WY5A 4AWAA 5EHXA 2WIAA 1JEQA 4E21A 1SR8A 2WNIA 3CNOA 3EZ7A 4MUAA 4QQ8A 4V39A 4B8WA 4UOZA 4TRMA 3GUYA 2R6JA 5DK4A 5EESA 4MARA 1K6IA 5KB3A 2PL3A 2P69A 5BWLA 5DE3A 6ABPA 3RAFC 1SZDA 1J21A 4D2IA 4NV3A 1QU2A 2HA2A 1SZPA 4OFZA 2P2CA 3ZYCA 2NZXA 3NFYA 4FKZA 2QBYA 1HDIA 3MUEA 1QV7A 2R7NA 3BGDA 3PF8A 1Z8NA 1RT9A 1Z3CA 5CMLA 4F4HA 2R1VA 3AWIA 5LQDA 4GZ3A 4PLWA 2VAMA 4X62B 1FLDA 3CS3A 1M2FA 2BCEA 4QA9A 4WLOA 5G3YA 4GKJB 2BM9A 3DZIA 4DHWA 4DQLA 2ZM5A 3B60A 5GONA 1I10A 3RRMA 4YT8A 1FMCA 2BEUB 5M7EA 3DV0A 4AZ3B 1O9BA 4LTNA 2V8BA 3KQKA 1CDZA 3DC2A 4PE5B 4QEKA 5AP9A 1CDDA 2JL1A 2Q1YA 1Y8QA 2CJXA 3ZX4A 2RB4A 3TFWA 1P4JA 4GT1A 3K30A 1VPWA 2MINB 1WF3A 4DMKA 5CFPA 1PFKA 2C20A 3ZV3A 3OZTA 3ZV7A 1FS6A 2LR0A 2W0MA 4HT3B 4BIMA 3UEOA 2XNDA 4KXFB 1U31A 1TK3A 1TYDE 3HDJA 3LRPA 1CUJA 4DR6B 4Q3KA 3OI7A 2O8FA 3QVUA 2EIHA 3F8WA 5I9LA 3L01A 4QQNA 1E99A 2OHOA 1NN5A 1YB4A 1R8YA 1CKEA 1ML4A 4KXUA 3ASYA 5DIZA 3PA6A 4LS3A 4FX5A 3KXPA 1N9ZA 1IBCA 1K3FA 1TMKA 2ZRFA 1NXQA 2PLRA 1TNDA 4A1OA 4YR9A 5FUMA 3EPKA 3I83A 5F73A 1FTYA 1VC2A 3F1KA 4ZMSA 1A98A 2IHVA 1WDTA 4KV7A 5BV2P 1PL6A 4RPHA 1DBRA 4HEA6 4JLVA 1N6RA 3E1SA 1LH0A 1KI4A 1Z4KA 4RE5A 3JZAA 3GQBA 2P9EA 4GI3A 4X1IA 1P7VA 2B34A 4KPFC 4A3SA 4D8UA 5IABA 1R4AA 1ITZA 2R4UA 3LVQE 3O94A 5AKKA 1R15A 4DCJA 2NXJA 5I7FA 1D2HA 1RXCA 1ESZA 1KEEA 4JJKA 3BIOA 4G9EA 3V4VB 1BKDR 1GDTA 3UFBA 1WBJB 3L7JA 2OMEA 2FQXA 5HCNA 1Z36A 3DMDA 1B6RA 1PE0A 4JODA 3WFZA 1T3LA 5LZ5A 1LLQA 4B71A 4D4HA 4L07A 1N1MA 1Z08A 2ZR9A 3DZJA 4GH5A 4MTCA 2NX2A 3SZOA 2VHUA 2VLIA 3M8KA 3TOZA 1NHWA 1U0EA 3A25A 3L92A 4MVYA 2J5KA 4PPNA 3OHPA 5HGJA 4BMYA 1S8OA 5K8IA 5KSZA 10MHA 3COZA 1TF7A 3MZ0A 1OHHD 2YMLA 5DF1A 2VAWA 4FGWA 1GU1A 5D6NA 5CD1A 2EJUA 1W8DA 2XYRA 3RWBA 4HVAA 5A06A 5KINB 2LZ0A 4A0RA 3NWPA 3UTDA 5D85A 5CDSA 4DB2A 3LKDA 1Y3AA 3UWMA 4NOLA 3OKCA 2LXNA 1T6BY 1GSHA 3M2PA 3RSLA 3EGXB 3AESA 2ESRA 2P91A 2JFHA 3IT0A 3S4YA 3T6KA 3ZNOA 2F1HA 5JHHB 3H11A 3JX9A 4Y67A 5B2ZA 1Q7TA 4OVKA 4D6YA 5LUAA 3DFKA 4KWIA 3JZIA 2HDNB 2W2KA 5IAGA 1Z29A 1N57A 5TT1A 4BB0A 4ZHQF 1A2BA 3OF5A 1KWGA 4IOMA 2H7VA 2O8CA 1QZTA 1VHTA 1Z6ZA 1Y9EA 1EWYA 1PTJC 1OZFA 5BRJA 2OB2A 4LVUA 1D5WA 4MPDA 5AVTA 1QC5B 4EY4A 5BPFA 3I28A 5JVDF 2AHOA 2Q45A 3GT0A 4AUEA 1JG4A 4B31A 3ZZNA 2F1RA 4W5RA 4MV1A 1PWEA 1QPGA 4G8DA 2XDAA 4QODA 1UC5B 2B1GA 4WINA 3UGTA 3CVUA 1H8EA 4QUDA 5CW2A 2JBAB 1QMPA 2R7MA 2ZIAA 4O4HF 721PA 3SNKA 5ICSA 3TF5A 2GTIA 4JJ7A 3OETA 4RLFA 2IX9A 3RASA 3HEAA 1D6JA 3VHQA 4UE6A 4ZYLA 3ZK7A 4HDSA 1ZD9A 4FHFA 1JG7A 1G5IA 2F17A 5LLTA 3H18A 1NWHA 4I50A 4HZIA 3TQOA 1SELA 2FE1A 2HGZA 3DW3X 1Z0JA 1UIRA 3R7DA 1R4NA 1TRKA 5K0SA 1RXSA 4NU6A 2XA2A 3AGPA 4C3ZA 3L7AA 2XCSB 2IHYA 4I5GA 2D7CA 4N3NA 1TJNA 1ULAA 4PFSA 2RHGB 3U13A 2ZJ5A 1Z06A 1EJ6A 2WWGA 4HAVA 4MW4A 5HCUA 4QM6A 2QMOA 5K8JB 3L04A 3VZRA 4ALIA 5JPDA 3I04A 2WA2A 4JXZA 1K7EB 3PUJA 4QDUA 3LD9A 2CLCX 2Y68A 4O4IB 4C14A 1F4LA 1WSDA 3PWKA 3ORHA 2HU8A 2VUSA 1T5TA 3PFGA 4Z4IA 4AWXA 5B55A 1KQGA 4ZVOA 3W8DA 3VSCA 2G1JA 4IJMA 3M9LA 2HHLA 2BEKA 1AZSC 1I94B 2PV0A 5KQRA 2SCUA 2JDID 1V41E 5AW6A 3RF6A 3LVBA 1GLNA 3UJ3X 4FLFA 1UBSB 2H11A 4MEAA 5H3LA 4CETA 3O84A 3P2EA 3K3PA 3P9XA 4YJGA 4CHGA 2BW0A 5J5VA 3V33A 4RJ2A 3CR7A 1LPOA 1NT4A 3DKRA 2WWVD 4XGRA 2QRMA 3VNSA 1W59A 2OBXA 5E1BA 3JATB 3LDFA 3SHTA 1X80A 4U5QA 4WXYB 3F2IA 4DLBA 2XCRB 5ILQA 3ZGOA 4NEQA 5ERXA 2OPHA 1EE9A 2PBZA 4M38A 2YL2A 4DYVA 4R1QA 1TZ2A 1OLSA 4FGJA 1TZBA 1LPPA 4KACA 1RS0A 1U9YA 1KDTA 2VJPA 2GPYA 3F6RA 4KQXA 1HMYA 4I1VA 3BH6A 3T3MB 3O4FA 2JH8A 1AXRA 4FYPA 4HDMA 1RI5A 1E7SA 1I1HA 3DQPA 4KX5A 4P35A 2VO1A 4TVKA 1QZ3A 5ALQA 5EXTA 4CM8B 5KYYB 5DB4A 1QHIA 1DBPA 1PEAA 2VPYA 4FUQA 4LY6A 2YZKA 3C3KA 1DJOA 5JALA 1XQ1A 3CF4A 3B9PA 2X0EA 2JCBA 4YDQA 2XTMA 2AN5A 4HZUB 1MR3F 1MC4A 4GVPA 4ILKA 5KU1A 4O33A 4KQCA 3GN1A 4E51A 2AEEA 2C0PA 4YACA 2A0UA 3WWEA 2J0QA 4C4OA 4R31A 4D9HA 3SZRA 3KXIA 2YV2A 4JFRA 1KR2A 2HIGA 2INGX 4OF4A 5FUWA 3TSYA 5CVDA 2Z4SA 2Q2OA 4A9AA 4Y6QA 3HM2A 4IMRA 1LXCA 1U98A 2JKYA 3HCPA 4FXOA 3HCAA 3OZWA 1M74A 1QYVA 4O5OA 1ESCA 1J2RA 2PH1A 5CT4A 3RTAA 3LC1O 3MBIA 5EE5B 1WEKA 5DTMA 2D74A 2FXIA 1I7LA 5K3SA 1UR5A 2ZVQX 1ULUA 4D56A 4YALA 5DRYA 2HOQA 4MH0R 3MOSA 4TXHA 2FSGA 1EVEA 5LBUA 5BYJA 3WO0A 4BQEA 3KEMA 5K6AC 4LXXA 2ZEJA 3ROMA 3ZD8A 1N33B 4F45A 1L2TA 3U80A 4IRMA 1FRVA 3UFXB 1DOZA 4A6XA 1N3YA 1WUJS 2BF7A 3CGGA 3IR6A 1YR7A 3E7WA 4UQOA 3UAYA 2W2LA 1K8XB 5BN5A 1RCTE 5KVSA 4X95A 2DB3A 1VLQA 1GPJA 3I6YA 2MSDB 5IMBA 1XN1A 1TT5A