2WWHA

Plasmodium falciparum thymidylate kinase in complex with ap5dt
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
211
structure length
211
Chain Sequence
HMTDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDILATE KINASE, PUTATIVE
publication title Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 83
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwhA00
2RKOA 1Z5ZA 2KE5A 2HT6A 2YNMA 2OILA 2O52A 1AZTA 1MABB 1WQ1R 3GLFB 3LFUA 4IVPA 4Q4AA 4NPHA 3CNNA 1YR6A 1AQYA 3EWSA 4NCKA 4TL6A 2IWHA 5GJCA 5FBVB 3EXAA 2OE2A 2XZLA 4V0ME 3VR2A 2Q3HA 3T12A 1W49A 1S1MA 1TF7A 1LTQA 2XITA 4KV9A 1OJLA 3AP3A 3LXXA 5SZHB 4M1YA 2P65A 1AK2A 2F43B 2NO7A 2ERYA 2Z83A 3A37A 3QOFA 4KFTA 1VTKA 1E2NA 4O25A 4TLDA 1DELA 1UKEA 5JRZA 3FWYA 3I1FA 2BEJA 4TL8A 3DOEA 4XVRA 1SXJA 3H86A 5JSZA 3KQHA 2UKDA 2IS4A 2GJAA 3CKLA 1W36C 2GJ9A 1JEEA 1KZGB 1MKYA 2CNWD 3QQ5A 1BMFA 1WP9A 2XOKD 2HCBA 3EIQA 3D31A 1FZQA 3L0PA 4EJSB 2G1JA 1E98A 3KJEA 4G3XA 3X1WA 4N1AA 3VKHA 3B1ZA 3BB3A 4ZDKA 2OCAA 2ZM5A 1R4AA 4OI0A 3IHWA 3EZFA 1DTSA 3T5DA 1EESA 3FDIA 4US1R 2W58A 3VNUA 4KAXA 1TNDA 1MRNA 3NBZC 4PO9A 3WYGA 1OKKD 3X1ZA 4GPTA 3BOSA 3A1TA 2OFOA 4CZ2A 4OHZA 3TR0A 4CEIA 2O8BA 3NWJA 1S3SA 2V6JA 1TL7C 1XEXA 1PJRA 1T3SA 1CJMA 4IW3B 4U00A 3BFVA 3GLIE 3TE6A 1JR6A 1OW3B 1TUEA 1DVRA 1GIAA 4PHHA 2BHRA 1O3YA 1YRBA 1XMJA 3LD9A 4KFSA 4O2LA 2IYTA 2XAUA 5IRCD 1AGPA 2QP9X 2ERXA 4V0MA 2WIBA 2RHDA 5CK4A 4PC6A 4UNPA 1G18A 2IYUA 4D0GA 5JRJA 2FFBA 3IO5A 4DHEA 4OI2A 1UDWA 4LJ8A 3N5CA 1LF0A 1D9XA 1DAEA 1Z29A 2KI5A 2ZTSA 1KI8A 5BWMA 2CL6X 3TRFA 1W4CA 2FNAA 4D25A 2C9OA 3U7EB 1SVOA 4IVRA 4JVLA 4HZUB 1RRPA 4IEEA 3VTKA 2D2FA 3FMOB 1EWRA 3GJ8A 3WRXC 3EPKA 1KSJA 1TEXA 1R0YA 3GLHB 3IIMA 4Z1MD 3PEYA 3K0CC 4BUJA 4EQ6A 3EPLA 2WM9B 2JLZA 1J90A 3KXKA 2VO1A 3AVQA 4LJ6A 4QC2A 5F2EA 2R6AA 4NYMR 4RD0A 3X2SA 1U9IA 2EYUA 1M7HA 3TQFA 2C96A 3A1VA 2AWOA 3FPAA 2ZANA 2IXEA 4RD4A 5FL3A 1NVWQ 5E7MA 1A7JA 1XXHE 1FMJA 5LD2C 4LJAA 2BBTA 2PZFA 5DNYB 5JEEA 2A7QA 4BFUA 3A36A 1OFTA 3PXGA 3SS8A 3MWYW 1YR7A 2CVFA 3RC3A 2YKGA 1E9EA 2A78A 1T3HA 4WOPA 5EZ5A 2VQSA 3F8TA 3LQQA 2H8KA 1SVIA 2NO1A 3PFIA 4E07A 2JIZD 1S96A 3GLIA 1XEWX 3EARA 3C5CA 2VL7A 1YR9A 2JLVA 5EE5B 4P33A 1QG2A 2QM7A 3I4LA 1KMHB 3FMIA 2ZR9A 1OH8A 2I1QA 2ZE5A 1JPNA 3AKCA 4BPBA 1Y63A 3SQXA 5SZIA 2AWNA 2OSBA 4AC9A 4E03A 3I73A 5AUQA 2BMEA 1VCNA 1GSIA 4F7WA 2CK3A 4DJTA 1IAQA 4I4LA 2IYYA 2WJGA 4RD1A 4LWZA 3VFDA 2ZSAA 4DWJA 2ZYVX 1VCMA 1GP2A 2Z0MA 3SBDA 5KPJA 3UMFA 1KAGA 1SULA 2N42A 5FTMA 4W9MC 4EIWA 3S1AB 4J0QA 1Y3AA 4Z54A 2J45A 1CXZA 1X3SA 2VP9A 1Z6XA 2PBRA 3SOPA 4DB4A 4HLDA 1D2NA 4ACBA 4TLAA 5AUPB 5GADl 3KQKA 3CH5A 4XSGA 3T1QA 1GNQA 2VF7A 1OT3A 4JBXA 1DOAA 1XXHA 1F3OA 4XD7D 2CLDX 1KTVA 4GNKA 3GLFE 2P2LA 3NG1A 5J4YA 2K5UA 1DO0A 1OF1A 4V0LA 1DBSA 2ZE6A 4BFXA 4A15A 3K70C 4OK5A 1AGRA 4XWAA 1U94A 3DPUA 5IDVA 4GP7A 1W1WA 2HXSA 4DDVA 1HV8A 2VP6A 2G77B 5JI2E 3ZD6A 1JXOA 1LNZA 3M1IA 1E1RA 3U60B 5JWRA 4ZKEA 4M9SA 4O2RA 3U3RA 3LDAA 1AQUA 2QP4A 4EUNA 5AUNB 1YZTA 1JQLB 1Z06A 2GK6A 2W6ID 1SVLA 4DCNA 2QTVB 3AF2A 2LWIA 4M1SA 3KQNA 2YZ2A 3AGQA 1XTRA 3W6OA 3QEOA 3KZ1E 5F98A 1F2TA 1H8HA 3LO5A 4JLDA 2EQBA 4EFMA 3UWKA 5C18A 3GQBA 4WIAA 5EZ6B 2KWIA 2R6GA 1N5LA 3GEEA 2C77A 4G0NA 3QKSB 4ZPXA 3SJCA 4TMXA 1YZUA 4JYBA 1NVUQ 2A5JA 1HA3A 1E9SA 1ZIPA 3RC8A 2ZRNA 1M7BA 3VU9A 1RIFA 4NCNA 3N70A 1G8HA 4GOJA 5CK5A 5JZVA 3A1SA 5BN3A 3G5UA 3EC2A 3QF4B 2RB4A 4HLCA 2ZJBA 5L3SB 3LRPA 4TTQA 4UNSA 4DDUA 2XJ9A 1NLZA 4EFNA 3A1WA 4HAWA 1ZBDA 1BYIA 2C95A 3QXCA 2B7CA 4RSGA 1OV4A 1MABA 4WW0A 2A2ZA 3GLFA 1VYTA 5BN5A 5L3VA 3C41J 2GXQA 4P4UA 5IHPA 2ATXA 4S2EA 4QXAA 3CNLA 4B32A 4KO8A 4DRZA 2DFKB 1TF5A 3DO6A 3RS3A 1ZMXA 2FPMA 2VF8A 2P6NA 1TQDA 3CZQA 4MDFA 2C04A 3LVQE 4YXWD 4LY6A 2F43A 4TWZA 1WF3A 3GJ0A 2O0HA 5CITA 2V9PA 4W5HA 4R98A 1U0HC 4NMMA 3SFVA 1BIFA 2XZOA 4LPKA 2CCGA 1CRQA 1Z08A 4PC3A 2BCJQ 1UBGA 3A4NA 5L3RA 3VR6A 2IS6A 3IBGA 3LVRE 4X8HA 2DYKA 3U6BA 3DKVA 4GMDA 4K46A 4QGHA 5FUYA 4B2PA 3CO5A 1KI1A 3GLHE 4EJSA 1NJFA 3GFOA 3IBYA 4GSYA 4PPQA 5TB5A 2ZRMA 5FOVA 2FFHA 2ZI5A 1QRAA 4GFDA 4JZKA 1AS0A 4S35A 4URYR 4TZ0A 1R6BX 4RCYA 1SHZA 5IF9A 1D8TA 2Y8EA 5JS8A 3AEZA 4LI0A 1Q1EA 1NG1A 4CEJB 3Q9LA 1IOZA 1VKJA 2ORIA 4M4SA 3PITA 1GG2A 3G0HA 4HLQB 3ZLJA 2ZR7A 4Q03A 1KNXA 2P67A 4P4TA 5FPSA 5JCZA 4FW9A 4I1SA 721PA 1W2GA 2VPPA 4JKYA 1TX4B 5D3MB 4JLKA 3ND9A 2VP4A 2YVUA 4UQOA 1GRRA 2F7SA 4P0TA 1E9FA 5JLJA 3B1YA 3HU1A 2IUUA 1T8TA 2YHSA 3BC1A 2WWYA 2O8FB 3FOZA 3HR7A 1N2CE 1ZD1A 2J3EA 1U99A 1XTIA 2J1LA 3LBHA 3MJHA 1T8UA 1X86B 1V43A 2MSEB 3FKSA 1P72A 2XSZA 5FOUA 3UKDA 4YMSA 1XTSA 2RGDA 3TSOA 4AKHA 2CEAA 3FKSD 1KI7A 2ZSEA 5C46F 1FW6A 4P3YA 1T5IA 2AFHE 1YZKA 1Z28A 3T1VA 3SYNA 3BB4A 2PMDA 5FTKA 2HCJB 1J70A 2WSMA 3PR1A 4HZUA 3KFXA 5ELXA 2XEXA 3OEHA 1KO1A 1OIXA 2FU5C 3GLHA 4E5UA 5K8IA 1NY5A 1UEJA 4IOMA 5FL7D 4HUTA 3TQCA 3EX7C 1C1YA 2J0VA 2JLSA 5JHHB 5FTJA 4QGGA 3LW8A 2H17A 3W6NA 4QBGB 5AUOB 4LYHA 3ECCA 1F2UB 4PR0A 5JWHA 1T6NA 3Q7QA 4IDPA 2GESA 3ADCA 5C1BA 3B6EA 1X8JA 4M21A 5GVRA 4BFTA 4DLUA 3KTAB 2GILA 5FOSA 3IIKA 2BVNA 1CR4A 1P60A 3H0KA 3JZAA 1TEVA 4JL5A 1IY0A 2MMGA 4LPSA 3Q5EA 4N0DA 1AN0A 3VX3A 4CEIB 1QG4A 1XMVA 3SJZA 2B7BA 4MUAA 1TUIA 3VHXA 1W4RA 4Q4JB 3W3ZB 2UZ3A 2ZJ5A 4D4LA 1F60A 5B58C 3ICEA 4MA4A 2JLQA 4MGYR 4V03A 1TU3A 3RRZA 5KYKA 1DAMA 5EP2A 4QM6A 4KVAA 1KMHA 4KVGA 4Q01A 5FOXA 4WAUA 3L43A 1B23P 4LHZA 2C99A 4PO8A 1S9HA 3W8RA 2IXFA 3TNFA 1E3MA 2XZPA 1IJFA 4C0JA 1IONA 1R8QA 2VHCA 1M8PA 2F3TA 1E0SA 2ZRHA 3QBVA 4GI7A 4CVNA 5CB8A 1Z6AA 1E1QA 3CRQA 3NHBA 2JDIA 5B57C 3U3MA 3UPUA 2GEVA 2KB0A 3P4YA 3D3QA 3MWLA 1XFAA 1L4UA 1EXMA 2JDID 3BE4A 4G5QA 3QXSA 4BRUA 4LC1A 3MWKA 3I32A 3KXIA 3S1AA 4TYYA 3C7KA 4ZDJA 2GDJA 2YWEA 5BYKA 1YRAA 4PSAA 5HKKA 2ZYUX 1Z6GA 2OXRA 2SHKA 1Q1ZA 4YONB 2BM1A 3A4MA 4HB4A 2HT1A 1KDOA 3IPYA 3AKEA 3R8CA 4B71A 4PAOA 3VHLB 2CCJA 2XNDA 4I81A 4X8LA 3PUWA 1MV5A 1LB1B 5DLQC 3WBJA 1XF9A 3I61A 1XD9A 2C2HA 3DDCA 3EZ2A 1HEIA 1SVSA 4JT2A 4L9WA 1JECA 4IVQA 4K81B 3K1JA 5DH9A 4DUGA 1P3JA 4BGDA 5TXGA 2QENA 1II8B 5BXQC 3CWZA 2A5GA 2C9CA 3B78A 1R0ZA 4PANA 4YQFA 4TLEA 5FUWA 4OQNA 1CJKC 3EPHA 2V1XA 2UZIR 2BBOA 4LJ5A 3WMGA 1NLYA 2JASA 1PUIA 3JVVA 1JEDA 4BEJA 4GL2A 2XTNA 1J8YF 5BQ5A 5FUXA 1E0JA 1OYYA 4LX0A 3ZH9B 2IHYA 5DYGA 1JPJA 1FPMA 3WYFA 1U8AA 3W90A 3K09A 4XTCS 1AS3A 5GJVC 1UBFA 4RJLA 4F92B 3NC0C 3IPXA 4JIMA 4QG7A 5J40A 1XRJA 1ZD8A 3GCGA 1G4UR 4BZPA 3OAAD 2WICA 3EIEA 4M53A 3LA6A 5AR1A 4BZQA 1OB5A 3LAWA 1R5NA 1NJGA 4B2LA 3AB3A 4LHXA 2FMXA 3QKSA 2IWRA 2OCPA 1LY1A 3U3KA 4A6XA 8OHMA 2ZI6A 3KUDA 4DEYA 1K6MA 1G3RA 1NG9A 3FYHA 3KQUA 4LRWA 4LOAA 1W0JA 2DB3A 1G8FA 1IN8A 1Q21A 2D74A 2R44A 3QPUA 4GMXA 1COWD 1W0JD 5CDFA 2PCLA 5HR5A 3D7MA 3CIOA 3QF4A 5L3SA 1IXSB 1U90A 1ZM7A 4TSFA 2EFCB 5CM9C 3PJRA 2J9RA 4MKHA 2QSYA 5FTNA 1FQKA 3SC3A 2ZJ2A 2ZUDA 4KBFA 3QSYA 3K9GA 2NZJA 2DFTA 1RVDA 4C0BA 4MKFA 2QAGA 2WKPA 1YHNA 3UWOA 1KY3A 3BJIC 4TMTA 2GAOA 3AVTA 5DIFA 2JJ1D 2XTMA 3SJBA 2CE2X 1CP2A 1KI4A 2CL0X 5HZHA 1AKYA 1VHLA 1Z2CA 1W5SA 1YR8A 1CR0A 1NP6A 2CHVA 2BMJA 3U4QB 3TSZA 1F48A 2NO6A 3GJ4A 3O8BA 4EPVA 5KTYA 1U0JA 2FFAA 3Q3JB 4XVUA 5DYIA 2J7PA 3QVVA 1G5TA 3CW2A 3TAUA 2IA5A 4AI6A 2WIAA 4RFVA 4RD2A 5C2JB 3K0AB 2ZE7A 2ZRPA 1N0WA 2JLUA 3SR0A 4KSCA 3AKYA 2B92A 1SXJE 2JGNA 3IILA 1VG1A 2GTPA 2GK7A 1LW7A 2CMKA 3H1TA 3NXSA 4C0AC 2W0SA 1R5OA 1BO6A 4MRPA 3IGFA 4KCGA 4NTZA 3L0SA 2GZDA 821PA 4C30A 2BBSA 3V00A 1G6OA 2ZUCA 3CPEA 4HB2A 4URVR 1W47A 4MRSA 1TQ6A 2E87A 4XH9B 2IYWA 4JLBA 4LK2A 4CEJA 4BLTA 2QUZA 2QE7A 4X8MA 4QJ4A 1PLLA 3QUSA 2FGJA 4X8OA 4A82A 2QE7D 3M0EA 4W7SA 5K8TA 1ZCAA 2F1IA 4RZ3A 3MMPA 2VLIA 3BWDD 4JLNA 2HV8A 4WA7A 4Q1DA 4A36A 3QEJA 3OF5A 1OXXK 5D3MA 4PPGA 2BIFA 1GAJA 4Z51A 3O8CA 1BS1A 5SZKB 1F5NA 2X8AA 4IDOA 2VSOA 3B82A 1MRSA 4BFWA 2O8FA 3RS5A 4LHVA 4EJSC 1M74A 4Q7KA 3MG9A 4V02A 3AM1A 1GUAA 3UANA 1P2VA 4CDGA 1CRPA 3BK7A 3WNCA 3FHOA 3VX4A 1E2HA 3DL0A 2EU8A 3CBQA 2WWHA 4BLSA 1EX7A 4M1KA 2FN4A 2QORA 4Q48A 3AVYA 2AL7A 1KDRA 1FTNA 4LGMA 4D0LB 4DT1B 1B0UA 1OFHA 3ASYA 3W5JA 4UXIA 4C0LA 2YOHA 3P1JA 4JBYA 4YMTA 5KU1A 4JL6A 1WRBA 5BN4A 1KO5A 3LWNA 2JATA 2NO9A 3TUIC 1SXJD 3EIHA 3I62A 4D82A 1HE1C 4YMUA 4I99A 1NN0A 3PEVA 4HB3A 3CPHA 1BMFD 1G20E 5JMTA 3CRVA 5ANRB 1BOFA 4NCHA 5DO9A 1F2UA 4JVMA 1A2KC 2FDCA 3F5FA 5P21A 1YZNA 2P3SA 1ZD9A 4LBVA 4PQRA 2FPKA 3KTAA 4LV6A 5FOWA 3TSWA 2OBNA 2FV8A 4XOIA 4B33A 4AY2A 4CYMA 1OH7A 3HU3A 1Z8FA 4G01B 4TL7A 4HATA 4PFSA 1OE0A 5KSZA 3MRSA 1UADA 4AIIA 4QRHA 5CYPA 1P5ZB 4Q4JA 3U44B 4FCWA 5KO2A 3J81k 4C2UA 3ZZTA 2ONJA 3L82B 2A5DA 3ETLA 3NBXX 2N46A 1W4AA 1P73A 3RRNA 1E6CA 4QBHA 1RFLA 3VQTA 2ORWA 2BJVA 4IFBA 4HYYA 2ORVA 1Q12A 1HE8B 1Q20A 4Q1CA 3OIVA 3B8HA 3FHTA 2GRJA 4AG5A 3QG1A 2QRZA 2RGNC 4POAA 2OEPA 2R6DA 3OIYA 4ABYA 3GMTA 3UG6A 3HDTA 4DCUA 3QXXA 2OAP1 1YE8A 4IJMA 4TQAA 2HYDA 4OJKA 2ZRBA 1FX0A 4EPYA 4TTPA 4C0KA 4FMCF 4NL4H 2ZVQX 4KU4A 5FPHA 2WJHA 1XCPA 2WZQA 3IHLA 4OQMA 1EWQA 4KXFB 2BM0A 1DO2A 3OHMA 4JS0A 4OQFA 1KDPA 4KSBA 2QU8A 4MYTA 1DE0A 1E2IA 3WMFA 2BJWA 1Q3HA 1XU4A 1YU9A 1ZVQA 4TLCA 1NIPA 4Q1AA 1XTQA 2J7KA 2XB4A 4JL8A 2QROA 4NCIA 3X1XA 4KITB 3BH7A 4P31A 1KOFA 3T15A 1KK2A 1OH6A 3KKOA 2OG2A 2ZJZA 4QKQA 4V0OA 1N0UA 1G7RA 3GEIA 4QL3A 5HTKA 4ARZB 1QDEA 2HDNB 2Q9AA 1US8B 5G53C 2ZETA 4HDQB 5F3WB 1SKQA 2PJZA 3QPWA 1GOTA 1II8A 3EA5A 4M2LA 3RS7A 2MMCA 1QHHB 1RE0A 2CLCX 3CPJB 1PLJA 3N2EA 5KOYA 4MRNA 2X1VA 4AURA 2AHOA 5KNCA 3E5HA 3ONWA 4TYNA 2IYZA 2GCNA 3KKPA 1P6XA 3SE0A 1G3UA 2QRNA 2QI9C 3L8ZA 2O0KA 2FSFA 2VP5A 1RZ3A 3BERA 4QHSA 1Z63A 3Q72A 3W3AA 2B6HA 2VA8A 4QHYA 4DLTA 5JS7A 2MSCB 2E9SA 4KBGA 4Q18A 3AQ4A 2WAYA 2QSZA 1PZNA 1ZRHA 4PSKA 4HSEA 4DSUA 3WY9A 2CCKA 1MOZA 3CR8A 2ONKA 2QA5A 3NHAA 2IHBA 4M1OA 3RWMB 4IXMA 1II0A 2R8RA 3IKJA 4OHXA 4MGIR 2CK3D 4FD2A 2YWGA 3HR8A 4TN1A 1XMSA 4NH0A 3ZS8A 3VKGA 1T3LA 1W4BA 2BKUA 3VNVA 1N6PA 4B73A 2AR7A 3SJAA 3U5ZB 1HYQA 5TY0A 1QHNA 3QVUA 2WWFA 3OZXA 4MQBA 5JBQA 4Q7LA 2J46A 1VPLA 4FMCB 3U3JA 1KK0A 2Q3FA 1E2PA 1OB2A 4ESHA 1UF9A 3NEJA 4RFSB 1KSFX 2H92A 2QGZA 3ZQJA 4D4JA 1MR3F 2LKCA 3MD0A 4Z8YA 5CJ2A 2GA8A 2WJYA 4D26A 1XWIA 1E4VA 3MCAA 1G8PA 2BMFA 2A9KA 2EVWX 2VHQA 1IN5A 4LV8B 4A0HA 4B3FX 3KDSE 5DI3B 3UXMA 3EPJA 4KI0A 3ICQB 3ZGXA 3QF7A 2EW1A 4WVFA 3THYA 1EK0A 4K8OA 4G5OA 2FX3A 1NRJB 4R7ZA 3RVBA 5B2ZA 3BXZA 4G5GA 2FZLA 4PAMA 2IF0A 1CJTC 3U4QA 2QPAA 2UVQA 4LBWA 1I4TD 2NG1A 4MYHA 4NYIQ 2VEDA 1D2MA 5KSPA 4NBSA 2OCYC 2YWHA 3WP0A 2XGJA 2H18A 1MO4A 2G6BA 1E1RD 3K0AA 1E0AA 2PX0A 2PEYA 3IDQA 1G17A 2ZI7A 3AF3A 3FB4A 2WWIA 5HE8A 1ZM2A 3L0OA 5EP1A 5JJKA 1I4LD 1ZUIA 4ZI2A 1JNYA 3TAHA 2QTHA 4FIDA 1TMKA 5FFMA 4WXPA 1ZM9A 3K9LA 1H8HD 2WPDA 3GEHA 1CR1A 2QN6A 4PZZA 2GNOA 4BRWA 1E79A 4B35A 5CYOA 2V4ZA 1T91A 2WPDD 4PC1A 4M1MA 2OV2A 4Q9LA 1HUQA 1TPZA 3V4FA 4FMDF 2ZS9A 1NKTA 3CRMA 2R6CA 3QBTA 1E2MA 4PPFA 1SVWA 4LDJA 4PSVA 4ZDIA 3BBPA 3PV0A 4C3ZA 1N3BA 4LBZA 4EFLA 1KY2A 4C4PA 4RVCA 1IXZA 3K70B 1XD8A 2G9NA 2D7DA 5TMPA 3B1WA 4HLUC 1IY1A 2QMUA 3NDBB 4TYWA 2YC4C 2XB2A 2QAGB 1AIPA 3WNBA 3H2YA 2HF8A 2VP2A 1HH4A 3PVSA 1ETUA 1VG0B 1N5JA 2F1HA 3LY5A 5KDOA 4M9ZA 3P27A 3WNDA 4IOLA 1EX6A 1M1YE 4V0KA 1UM8A 2VHJA 3F3YA 4JLPA 3T1OA 3HPRA 1QHXA 4GOKA 1GKIA 3SI7A 3TW4A 2IYQA 1VECA 2VHTA 1T4GA 4DT1A 1OXSC 2VTKA 5E7IA 5EXSA 3U3OA 1JR3E 3CF0A 2AXPA 2DHRA 1NSTA 1OYWA 2W2VA 4LCBA 1FTSA 2CHGA 4DLYA 4JMPA 2ASEA 1G8YA 4V0NA 4MRVA 2G0NA 3T5GA 2FZ4A 1YZLA 5CM8B 4A0GA 4LSGA 2GAAA 3HU2A 1SKYB 1R7RA 3ZDQA 4E22A 2C9YA 3AVPA 2W6JA 3AUYA 4I1VA 1RPZA 2GBLA 4JLMA 2H1LA 2GEDA 2OFWA 3VKWA 4B3XA 1QHIA 2W6JD 3L0IB 4B75A 1MO6A 4D4KA 2ATVA 1OXVA 3QXJA 4UNRA 1FP7A 1NLFA 4WBSA 1Z0FA 5DI9A 3A6PC 2OM2A 1D6JA 2EWVA 2YJTD 5EE0A 1G41A 2WMNB 1IQPA 3PUZA 3E70C 4MKGA 3QKTA 4JSTA 4HUQA 2GETA 1VYVA 3CZPA 4KODA 4FMDB 2EFDB 1SXJC 1S2MA 2ZYTX 4ILEA 3U44A 3RHFA 4Y0VA 1E99A 1KI3A 5JHGB 4G5SA 3MLEA 3AVOA 5EP4A 1SGWA 1BYUA 3PENA 4HZIA 1T5LA 1EFTA 5AK0A 5A0FA 4DC9A 1A2BA 4QJ5A 121PA 2QBYB 3BFXA 1RRFA 1GDDA 3EG5A 4PO1A 1NMZA 1YKSA 1W44A 3IQWA 3ND8A 2CE7A 4Q00A 5KNDA 4F4IA 1JAHA 1X1RA 2TMKA 3Q7PA 5F9FA 1JR3A 2F1RA 1X8KA 1FOEB 2GXSA 2XSZD 4ZCMA 1W5TA 1YVDA 4LHYA 1JR3D 5J4KA 1D2EA 4HAZA 2RAPA 1KSHA 3IO3A 1R0WA 2V55B 3CR7A 2ZJYA 1P9WA 2GHIA 4C0QC 1TQ2A 4OHVA 3TKLA 3OEHD 4P32A 2D7CA 4DIEA 5DE3A 1E2FA 2ECKA 4IRUB 2ZI9A 1SVMA 1LV7A 2A30A 2QM8A 4YDSA 2YOGA 3AP1A 3I8SA 4R71A 3KQLA 2REBA 4PHTA 2BBWA 4WZ6A 1NVXQ 3GFPA 2WJVA 4ARZA 4PZYA 4GOXA 1XJCA 1US8A 3B2EA 3CH4B 4OYHA 2QL6A 2Q9CA 4PX9A 3LH5A 5L3QB 3EASA 1WCV1 5KPDA 4P4SB 1V5WA 1GL9B 1G64A 1T9HA 4KYUA 2YOFA 1M34E 1ZM3A 1QHHA 2H7VA 3VAAA 2ODWA 2V3CC 2F6RA 1T0HB 3THXB 1UAAA 1JJVA 2ZROA 2IXGA 2W2TA 4XVQA 4DLRA 1S4QA 4HDCA 4ITRC 5LB2A 5IK2A 3ZQ6A 2P6RA 3AGPA 3IEUA 1G7SA 4FCVA 3I92A 1QVRA 2OO7A 2DWPA 1WMSA 4TMZA 1NBME 3JZMA 2W83A 4LHWA 4RY2A 5J47A 1NKSA 2FPLA 4JLVA 5KDLA 3X1DA 1FNNA 1ZJ6A 4NYIR 3THOA 1JAIA 3B9QA 5GVSA 2MSDB 2DR3A 1U9IC 3PEWA 1U2RA 3GJ7A 4L9SA 5B30A 3MWJA 2JLXA 5CB6A 1OHHA 3NVAA 4QBFA 4R2IA 3C15C 3T34A 4DXAA 2JEOA 2KJQA 1FX0B 1CLUA 2F3RA 3C14C 1LF5A 1KK3A 4L8GA 3K0CA 1KI6A 5H1YA 1XTJA 4BWYA 1E1QD 3IQXA 4Q1BA 5FOTA 2P5SA 4GDFA 2EFHB 2JLRA 5G40A 2OXCA 2ZSBA 1E2JA 4AK9A 1TAGA 4DLVA 5EUMA 3SHFA 3QG5A 1GL6A 1IN4A 3KJHA 5CDFE 3V9PA 1W7AA 2FE4A 4RFSA 4LJ9A 3KKQA 2YV5A 1XJ0A 3KUCA 4DKXA 5HKKD 1WDTA 2YINC 2XJ4A 3CM0A 4AKGA 4TL9A 1CJUC 4AYXA 3REGA 2CJWB 1R5BA 5DI3A 4F4CA 1ZC4A 4KLNA 2XNDD 5CLQA 1NN1A 1CEEA 2WOOA 2DPXA 3VR3A 2DCUA 5FPKA 2BV3A 2ZEJA 3CX6A 1W0KA 3TK1A 2NZ8A 1Q3TA 2PCJA 3AUXA 3RSOA 4DUGD 3GPLA 2CL7X 2WV9A 4U5XA 3FMFA 3BS4A 2IS2A 3U6KA 1TU4A 5FR1A 1KIMA 1NBMA 1XEFA 4HAUA 1UKZA 5HPYB 2Q6TA 1A82A 3U7GA 5FPYA 1Z0DA 2FSGA 2N1BA 1NBMD 1EGAA 2HJGA 4PC2A 1EFRA 5FPTA 1UJ2A 1WA5A 2ZQ5A 1E2QA 4B2IA 1Z0IA 3U7FB 3MFYA 1G1MA 3CLVA 1EFRD 3LX8A 3LNCA 3KXLA 5FBLB 2KSQA 2QT0A 4ASUA 2AN9A 1RW4A 2HEIA 3SYKA 2OUKA 4Q9KA 2QTFA 1P62B 3CRRA 4TT3A 1Z3IX 5E4FA 2IUSA 3BH0A 4A8JB 3DMNA 3I5YA 2PX3A 4FINA 4TT3D 3AVVA 2IYLD 4AD8A 1NF3A 4B76A 2QQEA 2NTYC 2ZRFA 3B60A 3CUEF 5AJYA 2EYQA 2QAJA 4BFVA 2ZRAA 2E1RA 4UNQA 4IDQA 1NL3A 4WXRA 4KYIB 5EQTA 3RWOA 3T1TA 4QNRA 1EFUA 2GCOB 3IUYA 4H9GA 1UFQA 4MDEA 2HF9A 1NMXA 3QI2A 1KI2A 4TSFD 3QKRB 1P75A 1ONBA 1ZNWA 3R8FA 3VR5A 1LVGA 2RCNA 4DLSA 2I3BA 3KFVA 3I5XA 3THYB 3GFTA 4PHFA 3TVTA 4RKFA 1N6HA 1N5KA 5TV2A 4Y0AA 4BFZA 4M1TA 1VHTA 2QZ4A 2O8CB 4A0RA 2CDNA 5TDHA 3SFZA 3KB2A 1II9A 1YZQA 4II7A 3MGCA 3SNHA 5FUVA 4CW7A 2DFLA 1P61B 3X1YA 3RLFA 4H1VA 2OESA 3B7GA 4RZ2A 1JALA 4EPXA 1OXUA 1G291 2J7PD 4FWIB 1ZUHA 1ZUNB 2V8OA 3I72A 2ZSDA 5IT5A 4C0SA 1NSFA 4NCJA 1G7CA 5AJZA 2HLDA 1N0VC 2X19A 3CB4A 1UPTA 1E9RA 4LZZA 4B3GA 2XTZA 1ZNYA 3VR1A 2OCBA 1KJYA 2VYFA 1ZCBA 1XNJA 1GRNA 2GXUA 3BFKA 3EW9A 1D5CA 1KO7A 5JFGA 1UEIA 2ZVPX 2ZJ8A 4LV5B 2GVZC 4Q4HB 1E2KA 4US2R 2IYRA 2GCPA 4BLOA 1GNRA 1Q44A 5G41A 4A2PA 1A4RA 4GZLA 5FI0B 5G3ZA 4Q9IA 3TUZC 1HY3A 2WSSA 3H84A 3RDPA 2RGXA 4ZIRB 4PTLA 1JB1A 2L0XA 3D6TB 4JVNA 1G4AE 4HAVA 4HAXA 5DHAA 4E09A 1RJ9B 1Z22A 2B8WA 2IF2A 4B74A 4W5JA 4O3MA 4CRWB 1PLKA 2RGBA 2PLFA 2LCFA 1Q0UA 4PAQA 1CBUA 3DM9B 2AK3A 2PJRA 4ZCLA 3TIFA 2AKYA 2DWQA 3ZVLA 4ERNA 1KHTA 2WKRA 2J41A 3TGPA 1JBKA 1I4DD 2PZGA 1FP6A 1U81A 3R20A 2ZRGA 2ZJOA 1O87A 2IC5A 1NY6A 2ZS7A 1VG8A 2IUTA 2AKAB 3ZVMA 4R9UC 3NH6A 4AWXA 2QBYA 3RS0A 3T35A 2FOLA 2GBLC 2NGRA 4Q19A 3RSLA 3EZ9A 4MRRA 4M1WA 5CIWA 3RAPR 1E2GA 4C7OB 2PL3A 4A9AA 3TR5A 1AZSC 3D8BA 1P9RA 2HXYA 3MAAC 4O0MA 3GLGB 2OLKA 1ESMA 4PHGA 2RGGA 1CULC 2ZI3A 4PPNA 3EZ7A 1HT2E 3OEEA 4HAYA 1GTVA 2IEZA 3ADBA 1VMAA 5KHOC 5KSYA 2R62A 1Z0KA 1CKEA 2FF7A 5J4VA 4DB2A 3OEED 4DZZA 4BZXA 1BH2A 1L7VC 2ZSFA 1EG7A 1Q57A 4I1UA 4Z8XA 4CT4B 4MYUA 3CNOA 2ZE8A 5G3YA 3WRYC 2XX3A 2QMEA 4LYFA 4DDTA 3FMPB 2Q0HA 1Z47A 3CONA 3A4LA 1SQ5A 2A5YB 4D0NA 4QHTA 4ZCIA 1G7TA 1XCMA 4UXJA 5C4GB 4MH0R 2O0JA 1P2SA 5GJBA 5L3QA 2CNWA 2QMOA 4XTRA 2XOKA 4P4SA 1I2DA 3T06B 2RHMA 1YQTA 1WBDA 2H57A 3SYLA 4PXAA 2ZU0C 3WYAA 4FXPA 2IK8A 4R2HA 3TUJC 3THXA 4DBLC 4HUQB 3Q85A 4DLWA 2I1VB 3EAQA 2WAXA 2EFEB 1PV4A 3BAFA 4IFEA 3K53A 4FMBB 5AWFC 2F55A 1L4YA 2CHQA 4L4UA 1N6LA 5DISB 5GJWC 2GEUA 3ZZ0A 1OKKA 2BMDA 1EFCA 2D2EA 3EWAA 4HEJA 2IW3A 4WZAE 4AKIA 4A4DA 1DAKA 1Q22A 2DBYA 5AJXA 5EJEA 3LXRA 2IYXA 4Q4LA 4XIGS 1ANKA 3HYRA 2BC9A 3UK6A 1SHKA 4DDWA 3U7HB 1W36B 1L2TA 3A1UA 4CIDA 2Z43A 2J59A 4LBYA 1XP8A 1RC8A 5EUQB 5J4LA 1MO3A 2ODBA 2V54A 1OFUX 1XD2B 4B48A 4AKEA 2OT3B 1YZGA 4QGAA 3LLUA 5M04A 2JAQA 4W5WA 2JLYA 5H68A 3TW8B 4UJ5A 4D4MA 1U0LA 5JECA 2HYIC 2VSXA 2IX3A 4Q5IA 2J0QA 3THWB 1G9XA 2NO0A 1NMYA 3BORA 4ZO4A 1GRQA 4JLOA 1KK1A 4TMKA 4AYWA 1KDTA 1CU1A 2FG5A 1XCGB 421PA 4B47A 1KJZA 1VCIA 1IN6A 1FL9A 4I1OA 4EPWA 4URZR 4GP6A 5UKDA 1ELOA 5HE9A 3LW7A 4ZDWA 2CJWA 1KKLA 1N6IA 1FUUA 2NPFA 3WP1B 2V1UA 1SZPA 4URXR 1VYUA 3OE7A 3TVDA 4OL0A 4D81A 4Z1MA 4NU0A 2WWGA 2QPTA 1F6BA 1ZU4A 3OIUA 4EPRA 1H65A 1N6RA 3OE7D 1JXMA 2VHUA 4B6EA 4ESVA 1W48A 1TQ4A 3FTQA 6Q21A 2C98A 2YYZA 2AXNA 1E96A 2CXXA 5K8UA 2QG6A 2BOVA 1K8RA 1P2UA 3KX2A 4Q9JA 4URWR 1WBBA 1NIJA 3NBYC 2X2FA 1XZPA 2BKEA 3MSXA 4TMWA 1S3GA 2P0EA 1R8SA 1E0KA 1HTWA 1SVKA 1UBEA 2ZREA 2O8EB 4EAQA 5JWOA 2I4IA 2R65A 2IEYA 1IXRC 5AJVB 2AK2A 2JIZA 5KSOA 4F91B 2GZHA 2A3RA 1KI9A 3W34A 4URUR 1H8EA 2QP3A 3PUVA 3B1VA 3K9NA 2ZRLA 3KB1A 2Z4RA 3HWSA 3M6AA 2OAQ1 1Q1BA 2ZRDA 2ODNA 3KKMA 1H8ED 1AKEA 1P7CA 4PZLA 1DAIA 2C78A 1KI6B 4TQUS 4A8JA 3I8XA 4Q66C 4B34A 1R2QA 2VP0A 4L15A 1I2MA 1JI0A 1GKUB 5H70A 1PUJA 3W9YA 2J87A 4BLRA 1X6VA 4DSOA 2RGAA 4M9QA 3TBKA 2DFNA 2ZAOA 4ZV4A 1GKYA 5LD2B 3K09C 3PG5A 1ZNXA 1OSNA 4B3BA 4OBEA 2VBCA 2VRWA 2GCOA 3AV0B 4OKSA 5TVKA 4A92A 2QT1A 2ZPTX 3QE0A 2O8DB 3WXMA 3U2QA 2ANBA 2VIIA 4RCZA 4OHYA 1KAOA 3QKRA 1CR2A 5JI3E 4JLJA 2CLSA 4F93B 1CJVC 4GZMA 4D80A 1ZP6A 1N6OA 4BEBA 4IHQA 3HJNA 621PA 2WOJA 1E9AA 1E2LA 4JJKA 3SEAA 1K5DA 4MGZR 5DN6A 2O8CA 2OFXA 2OLJA 4EKDA 3R7WB 1R10A 5CIQA 1WE2A 3NIBA 3RRYA 5LPNA 1Z6TA 5DN6D 4XD7A 2QY9A 4WZBE 4NYJQ 3GLGE 2REOA 2C5LA 4G1UC 4MGKR 2RMKA 4Q7JB 1UKVY 1ZINA 1OFIA 2LKDA 4CEHB 1DPFA 3VMFA 4OK6A 3BH6A 3LBIA 2Q9BA 4BFSA 3OIWA 4CT5A 3EZ6A 3AKDA 5EXXA 3REFA 1Z2AA 5HCIA 1C9KA 3NKVA 4PC7A 4TTRA 2V6IA 1ZIOA 2OBMA 2QAGC 2J5XA 1CS4C 4DCVA 2D62A 2W00A 3P4XA 3SDZA 4Q4HA 3WHLA 2B8TA 1ODFA 5E3HA 3BGWA 3EA0A 2W6IA 1GILA 5EE9A 1VIAA 1GVNB 2ZI4A 3R9IA 1LS6A 3B85A 1GM5A 1J8MF 4B44A 3ZIAA 2G0TA 1X1SA 4PQYA 2F9MA 1E79D 4G5RA 4NP6A 1D9ZA 1A1VA 1XZQA 4JT4A 4ZIRA 3FE2A 2DY1A 521PA 3ZIAD 4AG6A 4C2TA 2ZIAA 2B21A 5E7JA 1E2DA 5CLLA 1RJ9A 2PZEA 4IOKA 4N3NA 1OLOA 1QF9A 1Z07A 3BIFA 1Z83A 2BDTA 1TTTA 2C03A 2ZAMA 5A5GA 5EXPA 4YMWA 2GVDC 2R9VA 1J2JA 1XBTA 3ADDA 1ZNZA 3TLXA 2ZYWX 3RYTC 1KMQA 5BYJA 1LFDB 4DCTA 3C5HA 3E1SA 3QENA 4FI3C 3CWQA 4C7OA 4MKIA 1GZSA 1W2HA 2NIPA 2O5VA 2YC2C 1G16A 3GLGA 3NDPA 3BB1A 3CX8A 1P9NA 3I3SR 4FN5A 3UATA 1NVVQ 1E2EA 3FVQA 4JKIA 4OK3A 1KO4A 2KBEA 3VR4A 4C0HA 4D6PA 1IY2A 2JJ8A 1KKMA 4QGFA 4UKDA 4MITA 1N25A 3DEFA 4PQFA 2C8VA 3FFAA 3K0FB 2PH1A 3NH9A 4YXWA 4U7DA 3K9HA 3W6PA 4DVGA 3CX7A 3HYTA 2W2XA 1S9DA 1JQJC 3JVUA 4IOJA 4RZUA 2NOAA 4YLGA 3UIEA 2ZR0A 5DGXA 5JCPA 2FJUA 4LJYA 4EPTA 1NN5A 2XXAB 2WTUA 4QJ3A 4GT1A 5E95A 1OXTA 2GF9A 1C4OA 4LYJA 1IHUA 2R2AA 2Z4SA 3B9PA 1J99A 1KZ7B 4GRAA 4HDOB 4M9XA 1T0JB 3MUFA 3F0TA 4FCTA 2GF0A 2NQ2C 4JBWA 1E4YA 3LQRA 1ESNA 1FNMA 2ZRIA 1OIVA 4RD3A 3WBKA 3K0SA 4B43A 3QY0A 1E94E 1MT0A 1ZC3A 4M22A 3FKQA 4DLXA 3PEUA 1E32A 1G6HA 1WXQA 4IKEA 1ZU5A 3E2IA 1RRCA 3SN6A 3K8YA 3SZRA 3A8TA 3R9WA 4QFMA 4JVSB 4M8NE 4TYPA 1RYHA 3GJ6A 1G3QA 3M4YA 2QMHA 2WKQA 1Z0JA 3NBFA 3ZYCA 1N6KA 3CF2A 5HZKA 5F9HA 3T61A 5K8LA 3UMSA 1IM2A 3SQWA 1HURA 1L8QA 2J0UB 2WMOB 1E9BA 1VIYA 5SZJA 2JJ2A 3C8UA 2WJIA 1Z0AA 2F9LA 4LUCA 1W36D 2WBLC 1DAGA 1XD2A 3ADKA 4BQSA 4FWTA 4F4JA 2JJ2D 2NMVA 2ZS8A 2X2EA 4Q4AB 2G83A 2AD1A 3NTUA 1GFIA 2IBMA 3GJ3A 4QOSA 5FH9A 5KNBA 5L8VA 3FHCB 3THWA 2PMKA 2W0MA 4IEIA 5AJWA 2WWWA 1FFHA 2IL1A 3B1XA 4U02A 1Q1QA 1G5PA 4KJZA 2GJ8A 3OESA 2FEOA 1E69A 4OI1A 2G88A 1AA9A 1G5RA 2V7QA 1WB9A 2GXAA 4OQLA 4C9BA 1KSGA 2QNRA 2FFQA 2VSFA 2V7QD 4TMVA 1SXJB 1S0UA 5FTLA 5JSZB 2EFGA 2WWXA 5HCNA 5FL7A 3DOFA 1FUKA 1UKYA 1FMLA 3B5JA 1G19A 1KJWA 3LLMA 1Z6YA 2VH5R 4ACAA 2QGNA 1XPRA 3K0EA 3ZZUA 2AD5A 3PUYA 3ZJYA 4AYTA 3UMRA 1XPOA 4TYQA 2BCGY 3BD9A 3SU8A 1AM4D 2RGNA 4YDHB 2GKSA 1QHGA 1EFHA 3KKNA 3G82C 1CF4A 3IIJA 4BLQA 1IJEA 4L5BA 5IK2D 2AX4A 2RGCA 2FH5B 4A0FA 2JA1A 2P6UA 4NONA 5EP3A 2RH5A 4YC7A 3KL4A 3DKPA 4UJ3A 1RYFA 4NZYA 2O8EA 4NKRA 4DSNA 3L2OB 4NYJR 2ODEA 3HP1A 4LC0A 5EE1A 2CBZA 2ZRJA 3PCRB 5LB4A 1OH5A 2XNSA 1KGDA 1UBCA 3AF4A 5H8WA 1KYIA 2P5TB 1BKDR 3FGNA 2O8BB 4Q02A 1XEXB 4TQ9A 2HJVA 3WHKA 4A6PA 1TF2A 3TJZA 1OHHD 1NI3A 1P2TA 4XSHA 3DZ8A 1XX6A 5EE3A 1QVAA 2FSIA 4XWOA 3AVUA 221PA 2YWFA 3FFBA 4XJXA 2FA9A 3ZD7A 3O47A 5EXTA 5BW8A 2WJJA 3GP8A 1S8FA 1G3MA 1ZM4A 3A58B 3QXHA 4Q1FA 3RS2A 1GNPA 2BEKA 4Q1EA 2O8DA 1QHYA 4LYAA 1VCOA 2PLRA 2REXB 4Q21A 1ZAKA 1QHSA 2GJKA 2Q3MA 4DLZA 1NNEA 5JJLA 2ANCA 2PT7A 1M6NA 3C4JA 3BRWD 1GITA 2FWRA 4KFRA 1M7GA 4A1FA 4XWKA 3QNUA 3W8NA 1ZYUA 2ZU6A 1DEKA 3Q8XB 3DZDA 3DM5A 2WVJA 1VDZA 4JLAA 2OZEA 1AS2A 3QPVA 4BLPA 5JEDA 2J0SA 1ZW6A 4H1UA 3LBNA 4A8JC 1GL7A 4DCSA 4EQ6B 1W0KD 3EC1A 4ZI3A 2G3YA 3R7WA 4IDHA 1FQJA 1XDBA 3L8YA 4B6FA 5LBIA 1IN7A 3SBEA 1CIPA 1GWNA 1G8GA 3AVXA 1AJEA 3GJ5A 4CEHA 4HB0A 2AFIE 3O8DA 1DG1G 1IBRA 4TLBA 4YMVA 4NE2A 4Q7MB 3R9XA 4F38A 3DVLA 4RKEA 1XB2A 4KFUA 3AF0A 3W5IA 1NVVR 3ZVNA 1DARA 2H16A 1DAFA 3MJRA 1SKYE 5DSZA 1DG3A 2HUPA 1MH1A 3AF1A 3PIRA 3QKUA 1A5TA 3GLIB 3N2IA 4ASUD 2ZRCA 5KDDA 2OHFA 1E9DA 4Q9HA 4BFYA 1N5IA 3OAAA 3LX5A 4RD6A 3UG7A 2FGKA 5D3QA 4B3CA 2G1KA 1E9CA 5A4JA 3LV8A 1QZXA 3GJXC 4Q47A 5FBQB 3P32A 2PEZA 1DADA 3C16C 2Z6VA 3RS4A 2H5EA 3QJYA 2CVHA 1U8YA 2IS1A 1VG9B 1XPUA 1DS6A 2QEQA 3QIAA 3U61B 1XEWY 5FI1B 1DAHA 1COWA 1OIWA 4IXNA 2ZXUA 3HPQA 5FBWB 3K70D 4ON9A 4BECA 1RRGA 4KHZA 3TMKA 2NPIA 4QM7A 3AVWA 3CF6R 2EWWA 2GJSA 4NYMQ 1JJ7A 4EDHA 5JJIA 4JSYA 4KLZA 1OPXA 2RGEA 2DWOA 2FSHA 4M0LA 3P26A 4N0EA 1MO5A 2IYSA 2WHXA 4IDNA 1U98A 2QPOA 3CRW1 2JJ1A 4DSTA 1XXHB 5DHFA 3WMEA 4OI4A 1XTKA 2IYVA 2GZAA 5CJPA 5FBRB 2BWJA 2R6FA 2GWHA 1N6NA 2ZRKA 1RKBA 4US0R 1R0XA 4CF7A 5LDDC 3ZS9A 3KJIA 3K0FA 4CGZA 1YJ5A 4L16A 1P4SA 2HLDD 4DIDA 2ZJAA 3ZVRA 1NN3A 2XXAA 3RNLA 2ZUBA 1S1CA 3GD7A 2ZITA 4OQXA 1KO8A 2A5FA 4GBMA 3AH8A 4QBIA 4MYCA 4B3DA 3O8RA 4JYCA 2D06A 5C4MA 2PT5A 3PQCA 2FEMA 4HLUA 5J4HA 1QBKC 3ASZA 1X8LA 4OJQA 3B13B 3KJGA 2WSSD 3NEYA 3DHWC 4ZKDA 3Q5DA 1F2TB 1TADA 4D2IA 2Z5FA 4MUBA 4JJZA 4DEXA 1HT1E 3V4RA 4QNMA 1HQCA 2X77A 5B64A 3OFNA 4BE7B 2QQ0A 1J7KA 2IT1A 1G3IA 1HQYE 1U8ZA 3SHWA 3DMDA 4OHWA 1LS1A 2Q21A 3OFND 4TZ6A 4HI0E 4UNNA 4A2QA 3AP2A 3RRMA 2F1JA 1W46A 1XMIA 1CTQA 2JCSA 1G21E 3PUXA 4LJ4A 4UXHA 5FR2A 4NDZA 3P20A 4BASA 4A2WA 1KNQA 1PVOA 2JLWA 3RABA 2D3WA 3VU9B 3IEVA 1K5GA 5KUTA 2OBLA 3RANA 4NHOA 1M2OB 3TH5A 1XJQA 4RZXA 4LJ7A 5J5CA 3NC1C 2D4HA 5TARA 2J0UA 2KBFA 1UDXA 3H4MA
chains in the Genus database with same CATH superfamily
5M29A 5KTNA 3PHLA 3UJBA 4XLZA 1Y7TA 5L6MB 5AM2A 1LXCA 3T3OA 2MINB 4QOJA 4R0NA 2EL9A 3CN9A 3NEAA 3EC7A 1PDVA 3LFUA 4IVPA 5AK3A 3UO8B 4D3DA 4Q3BA 4FIZA 1W73A 1PHPA 4E33A 1AQYA 3MJDA 1RZRA 2IWHA 1X7YB 4AF8A 4EH1A 2O9JA 3LWBA 1GGFA 1E8MA 5DP2A 4GKKB 3PYLA 3M3PA 4LFCB 3STYA 3T12A 4QQNA 3HDJA 1T2FA 1OJLA 1LBHA 4Z4CA 5K6AA 1M10A 3KCQA 4M1YA 1SC6A 2P65A 3VR2D 2ERYA 2Z83A 3H8JA 5LOVA 1VTKA 1WMBA 1E2NA 2VKTA 3ANYB 2J9YB 4BNLA 3TTYA 3KQHA 2QW0X 3N8GA 1ECCA 5JSZA 3M4NA 4CF5A 1RWPA 1XZIA 4ARAA 3JWGA 4UC0A 1MKYA 1QQ6A 3GUUA 1BMFA 1WP9A 4D3XA 3W5VA 1UWLA 4BNKA 1EE9A 1FZQA 2YJGA 1B14A 5TEVA 5NULA 4WK0B 3ETGA 3X1WA 4DQDA 3NAZA 3Q15C 1Q91A 2JFZA 2QTZA 2G4LA 4Q82A 5HF5A 4ZZIA 1CZKA 3GC6A 5CB8A 4ZDKA 3PKZA 3T7IA 3JQBC 1WD5A 1R4AA 2PR7A 4FGZA 4C4OA 1Q19A 3ET5A 2XA9A 5CB0A 1L8OA 1DTSA 3CCCA 4OI0A 3G9UA 3QU9A 1ISFA 4X00A 1E62A 4PLFA 4EKIA 4US1R 1JLRA 4UUOA 5HIIA 3WGJA 1F1JA 4KQWA 5TS2A 3U4GA 2L18A 1MRNA 4DABA 3NBZC 3WYGA 4E15A 1OKKD 5EHXA 4YY3B 3L7LA 2JGMA 4DREA 3ETJA 3OOJA 2OFOA 2GK4A 1NRXA 3TR0A 2PGNA 4CZ2A 4CEIA 2O8BA 2V6JA 1TL7C 1OFVA 1XEXA 3KXPA 4WXHA 1PJRA 1T3SA 4KPUA 3QU5A 4NSNA 2DUMA 1VSUA 2VXOA 3A11A 3VZRA 3TZEA 2GGSA 3RQIA 3H5VA 2Z1MA 4GQBA 2PMWB 5AM3A 3L84A 4MYSA 4YYEA 1L7DA 3LD9A 4E5DA 4EKEA 2P8JA 1LSUA 1IZZA 3NO4A 1NW3A 1X7XA 3OUUA 2BGJA 5A05A 2QP9X 2X4LA 2ERXA 4GGPA 5B1IA 4W5OA 1AOXA 2X3YA 4AN1A 4MHTA 5J1TB 3FYUC 2RHDA 4F5EA 1V16A 3E84A 4UNPA 1O97D 4G97A 2IYUA 2M6SA 3C6MA 1SZCA 5EINA 4CG2A 4DAOA 1IBMB 4N3AA 3MZ0A 3BXHA 3DVSX 3S5JA 4P34A 4C20A 4DHEA 4OI2A 1UWCA 1UDWA 1N75A 1ZSVA 2N75A 2AG6A 3DMYA 2H2GA 4GL4A 3MT8A 5AVWA 2HDWA 3GIWA 2BFBA 2QYOA 2KI5A 1RQXA 1Z29A 3A1DA 2MCFA 2P4UA 2H08A 3JVDA 4CG1A 3RYCB 1UC8A 4NMHA 5BWMA 2CL6X 2P90A 3FSGA 3PB3A 2FNAA 3T94A 4D25A 1EP1B 4QODA 1RE1A 3ADOA 1AURA 2LCQA 4F3YA 1R0SA 2EIXA 4G07A 1R0YA 1L7QA 4OH7A 3KIPA 5FUBA 3PEYA 1TVKA 3R75A 2WTXA 3K0CC 3A25A 4BUJA 4EKNB 4EQ6A 2QTLA 2C2YA 5EPEA 1F17A 5EQDA 3DFFA 1C3OB 3KXKA 3AVQA 2P4SA 4KXMA 4LJ6A 1C4XA 4OREX 4NYMR 4L6AA 4P3XA 4QC2A 3HN7A 3I2FA 3X2SA 4OHKA 5DP1A 4KWCA 3SLKA 2NXWA 2AWOA 2ZBRA 3FPAA 3WB0A 2ZANA 4EUKA 2IXEA 5JDCC 4RD4A 5JE8A 3HLKA 3L6EA 1EFLA 1NVWQ 4IUBS 4U0KA 1FMJA 4DXDA 5LD2C 2BBTA 3AYXB 2Q8NA 4JIGA 2A7QA 4BFUA 3P52A 3KFLA 4DA9A 2NTJA 5JEEA 1OFTA 2V7GA 2Z98A 3VZPA 2KYRA 1KEPA 3D7SA 4GZ3A 2NP6A 2EIHA 1TD9A 2A57A 2ACEA 3L6CA 3RC3A 4B5LA 1KYZA 2VQSA 2H8KA 4JEIA 5ESRA 3NTVA 4E07A 3S28A 1S96A 3K9QO 3KAQA 1XEWX 2PHZA 1YR9A 2RBKA 3MWDB 1ZMTA 1N0IA 1PQUA 2JI6A 3W5BA 2QM7A 3PHBE 1KMHB 3JQCA 4PLYA 4Z3KA 1N2CB 4AJNA 4R6WA 5ALLA 1YZ3A 4AY3A 2OHGA 1HNNA 4RK4A 4BPBA 1ZKDA 4G84A 4LYYA 1C81A 5I9MA 1MTOA 5L7TA 3SQXA 3IOYA 2F2TA 1ULAA 4G4JA 1I01A 3BA1A 4PEVA 4IUDS 3U4AA 4F7WA 3FOCA 3MCTA 4X95A 4EHIA 3K9WA 1HQKA 2ON6A 4UHBA 1K3FA 4LWZA 2BUCA 2ZSAA 4YP6A 1VCMA 1X0VA 3RCBA 4B4KA 1K7YA 2BGTA 8MHTA 4I55F 3FSRA 3SBDA 2QT9A 2YX1A 3OM0A 4NBNA 3KWJA 4ROSA 5GOTA 5J58A 1P17A 3O2QB 1SULA 1DTWA 1T6ZA 4LJLA 3CGWA 3ZCUA 5HZMA 1DU4A 4UBNA 1FLNA 1ENOA 5BWNA 5HEKA 1FVXA 4OMDA 2HN9A 4Z54A 3KC2A 2VWHA 3KK0A 1EP2B 4KXLA 3CSUA 3QE3A 1Z6XA 4E94A 3NOVA 3ICCA 2JKVA 4L95C 1NW9B 2XDAA 2PBRA 5E8RA 3SOPA 1F2VA 4LJSA 4QOHA 4ACBA 5AUPB 6GPBA 1PR3A 5GADl 3KU1A 2YW9A 4LZAA 3T1QA 1VLZA 1DOAA 3OETA 3WB1A 1YQXA 1PWEA 4HXEB 1F3OA 3KJFA 1X15A 1X42A 2CLDX 1U8TA 3G8AA 2O3RA 3DDHA 4QPPA 2DQKA 3B2QA 4PPYA 3GLFE 3NG1A 2G36A 1Y6RA 2H2AA 3KOXA 5J4YA 2I2WA 5FYDA 2K5UA 1X80A 1OF1A 1UZAA 4UAUA 4V0LA 1DBSA 5A5VA 1JFTA 1EK1A 3H11A 5ETJA 4OK5A 2DG2A 4IDCA 4WI1A 5KOJA 4U8HA 4BCCA 5J2TF 2FQXA 1YRQA 1PO7A 5ICCA 2VAPA 1JXOA 5IYZB 4FGUA 1L5HB 2H65A 2BELA 3DQZA 1LSSA 4M60A 4OO3A 2YV3A 2DKFA 2Y77A 1RCFA 5IUKC 3H13A 4EG1A 1GSAA 1FFSA 3KQNA 3HBFA 2YZ2A 2HCFA 3F4BA 3WWCA 3W6OA 4YMLA 3K35A 3QEOA 1BFKA 3GLUA 1BEZA 1PQWA 1JYEA 3O21A 1I1NA 1IULA 2EQBA 4I3FA 1E7MA 4EFMA 1KZ1A 2W2KA 4WIAA 3GCZA 4AZVA 4ID3A 5EZ6B 3KNZA 3GEEA 3Q98A 3QKSB 4ZPXA 4L3VA 3ZU2A 1HDXA 1R9GA 3FUTA 3IUQA 3ZNPA 4G0UA 3R5TA 4DLNA 1ZSNA 4JYBA 1VRWA 5AVKA 2RARA 1HA3A 1E9SA 1WUYA 6CHYA 5LQCA 1LLQA 5I7AA 3SGLA 1LCIA 3L4BC 2QTRA 3MYYA 3VTAA 3ECAA 2ZRNA 3WLFA 2EJCA 3ZE8A 5DGHA 1RIFA 4D6YA 4E7OA 1MAAA 1T9AA 2D5BA 2FZEA 4K9SA 3RVNA 5IUJC 2O2ZA 3H9CA 1NPTO 3M2PA 1AC5A 1G8HA 4GOJA 5GGYA 1PGNA 4H17A 5CK5A 3HFRA 3N6VA 5K3DA 4REMA 4EL0A 5JY1A 4TTQA 4DDUA 2CNBA 3FWHA 3L1KA 1QZTA 4RGBA 3TPZA 4FS3A 2ENWA 4NAUA 3V2UA 3WGMA 4EFNA 1H6DA 1EE2A 4GR9A 4DY4A 2QN3A 1BYIA 2G70A 4WW0A 3GLFA 4JJ6A 1H42A 1PL6A 4CL8A 3ICWA 1ZRMA 3X1KA 3LT5A 5DHTA 3ZWXA 5L3VA 3K2IA 3P9RA 1CHDA 1KFJB 4IEFB 1K5HA 2B1JA 2FR8C 3EPPA 4XIJA 5B2EA 1TJ4A 3VR4D 4JUBA 2HMWA 3R0ZA 3R3ZA 1N7HA 1SELA 5I7OA 3RS3A 3UAYA 3EHEA 1YASA 5FEMA 1ZMXA 3OOYA 2VF8A 3KE9A 2V5UA 1CY7A 3I83A 1M54A 3ZQ4A 3LVQE 3EY4A 1XQ1A 2W71A 3HLYA 1Z2OX 4LY6A 5FBZA 4AWAA 4B4UA 1Z18A 3G2HA 5JCXA 2QQ5A 2DERA 3WSVA 2V9PA 2YUIA 1NOKA 3SFVA 1T24A 2YJ6A 1E6KA 1JLKA 2XF2A 4GR4A 4LPKA 3PA8A 1OD6A 2GUWA 4K28A 4WXMA 5DNVA 3DTVB 1UBGA 2C5FA 1XQYA 1GDHA 2Q8QA 2IS6A 2O7QA 1A5ZA 3IBGA 1ICEA 3I1YA 4Y2UA 3HB7A 3R23A 4I6JA 2DYKA 2H7YA 4KN5A 4KW7A 4TXNA 1E3LA 5TNXA 2W8ZA 1D5WA 4ZXFA 1NJFA 4EG8A 3JQPA 1PRYA 1EFVB 4GSYA 4V3BA 4FYJA 4J7CA 1XA0A 5TB5A 2DTEA 2EEPA 1ES9A 2SKDA 5JSUA 4S35A 5KWSA 1YONA 4TZ0A 5C31A 2C5AA 4R81A 2Q6KA 4RCYA 1HLDA 1SHZA 1D8TA 5BYAA 1KRHA 5IF9A 2VPIA 2QVLA 3PGKA 1QR2A 2IIVA 1NAIA 3IV9A 3PR3A 4FHEA 3AEZA 1V8FA 1Q1EA 3MRXA 3PRHA 3SD7A 2BTOA 1TXGA 3FOBA 1VKJA 3L01A 4M4SA 5GV8A 4IJ5A 1NSYA 3DUFB 4FSHA 4EF5A 1GG2A 4YJ3F 3LGXA 4YV0A 5EMLA 5LJIA 1JAYA 1B6RA 3ORQA 4HLQB 4C7KA 3EAFA 5AH0A 4DMUB 5MGBA 6ABPA 3FOAA 4G6ZA 1BE0A 9GPBA 2VP4A 3KUXA 4QTYA 4UCXA 5KWEA 2WM8A 1I4WA 3CLRC 4IWYA 4LGVA 4UVIA 4LQ4A 2GA9A 3HGTA 4FOPA 4EELA 1E9FA 4X44A 3W6ZA 4ED9A 5JLJA 3HU1A 2C00A 2O2XA 2YHSA 3BC1A 2O8FB 4O4LA 4P58A 1ZD1A 3EXIA 1U99A 1XTIA 1TFUA 4EG3A 1TCVA 5FWDA 4OD0A 3S2GA 1T8UA 4PTYA 1UT5A 3G59A 4LJRA 4ERXA 4I9HA 5KYUB 1N4AA 1P72A 5BMOA 2XSZA 4UOQA 4YMSA 5DT2A 3LX6A 4KUEA 5FAKA 3FWPA 1LK7A 2ZYIA 2JIDA 3TTWA 4DG8A 2FSVC 4P3YA 2V96A 3WO1A 2XMPA 5LOVB 1YZKA 1ABBA 4OHFA 3SYNA 1Z2EA 1X70A 2H4YA 2I91A 4INJA 3HCOA 4D8UA 2CF5A 2O2YA 5F3RA 2ZG6A 3OEHA 4AZ0A 5I51A 3KQPA 3B3JA 4FFNA 2PQMA 4PYIA 4EHJA 2LRHA 5JS1A 3LOPA 2SKCA 3ZXIA 1BHJA 2JLSA 3GGJA 2Q5EA 2CNLA 3SJ7A 4QGGA 1H23A 1K8QA 2I1LA 1TVMA 3K4HA 3VU8A 5JXHA 3U16A 3A6LA 4PR0A 1A88A 3QVSA 3JATB 3DEZA 4IDPA 3AU9A 4JI4B 1JEJA 1X8JA 4XUDA 3LKVA 4N6OA 3IUNA 1U3GA 3SYTA 2QTCA 1PUXA 2GILA 2W6PA 4PINA 1OAOC 3HCCA 1EWYA 1R0CA 1SUDA 3IIKA 3BZBA 1KR5A 3MHPA 2Q5CA 4G25A 3AY6A 5D51S 1Q17A 3H0KA 2DUWA 1Z4IA 1TEVA 2P3QA 2V97A 4E1VA 1H4SA 5HBRA 4NCAA 1WTCA 4C06A 3VX3A 3ZV3A 3TZBA 1VI6A 1QG4A 4Z0NA 2Q3CA 2XYHA 4CEIB 3E3LA 4QUAA 2YH2A 1ISIA 1CDZA 2XF8A 1N7IA 1UIRA 1WEKA 2UZ3A 2FX2A 2ZJ5A 3K1AB 4P80A 4Q4JB 3STHA 1J22A 3GN2A 1TU3A 1DAMA 2X9VA 1NUQA 5KYYB 4KVAA 5JXGA 2JL1A 3JYLA 4Q01A 4WAUA 5CGZA 5FOXA 4EVQA 5ALOA 1ZGHA 3W8RA 5KC9A 2JAXA 4MW9A 1Z7GA 1O9GA 2ZSJA 3DVAB 1YVEI 4FNAA 3MINB 1HF3A 4ZU6X 4DRYA 4GUAA 4LVCA 4NZMA 4XDHA 5CFQA 2X0NA 1IH8A 1YQEA 1U9JA 1IONA 1D2HA 3I4CA 5IDWA 4DY6A 4KQ6A 1G4HA 1CB0A 3VH3A 2VHCA 3EQ6A 4YP0A 5BURA 1M8PA 4E12A 1E0SA 3QBVA 4R84A 1H69A 3HSKA 2X3FA 1Z6AA 1TK3A 2NW6A 2D1FA 1POXA 3FPFA 5H82A 4OB7A 1AKQA 5LR6A 1MC1A 4OAPA 4YIKA 3U3MA 4DUPA 2BFBB 3M8KA 3MWLA 1OX6A 1XFAA 3A70A 4U2DA 1FFXB 3R7AA 2AVDA 4WFJA 3QXSA 3NALA 1TAUA 2PRJA 1DRKA 3IP1A 1H5QA 1ZOSA 3S1AA 1UPFA 3V7UA 2F4NA 2W4QA 3NGMA 2F8LA 2VBIA 4WNAB 1YRAA 3FR7A 3VH4A 1G20B 4CIAA 3GPCA 4A5SA 4WDRA 4UDXX 2C2GA 3A4MA 3M6WA 1C1XA 3KELA 2QUHA 3A6ZA 3IPYA 4H6XA 2I67A 2HTEA 1NT4A 3E18A 4G4GA 3VHLB 2XNDA 4I81A 4GM0A 4FFBA 4AROA 2RGYA 4JXKA 3I61A 2ECQA 1CUDA 1Y37A 2X9LA 1Z8DA 1XD9A 3GRKA 3DDCA 4GC9A 4D9IA 4DGQA 3NVKI 1TLLA 4Y2HA 2BFDB 2L19A 5KYWB 2Q07A 4BGDA 4UEWA 1BA3A 4NFLA 4UHJA 2QENA 1I7PA 2BFEB 1T9CA 1VMIA 4RIIA 1R0ZA 2OB1A 4C01A 4F4FA 1EXDA 3D0QA 4PS0A 4XOUA 3EPHA 2UZIR 4LJ5A 4GL2A 2JASA 3SX0A 3SAJA 3LZCA 2PXAA 2YHIB 1TM1E 4X85A 3T7TA 2CLIB 1ZD3A 4CQMB 4MW1A 1NJSA 1JPJA 1TT5B 2BF4A 2FEWB 2VNJA 3ESRA 3WYFA 5IN4A 1R16A 3W90A 1AS3A 4RF4A 1SKMA 4RJLA 1Z26A 4PZEA 5J2UF 3KSZO 2B5VA 5CLGA 1VE7A 2QTVA 2E1PA 1SCKA 4EFKA 1XRJA 1ZD8A 2VN8A 1G4UR 3AG5A 4YRKA 1JHAA 2OHOA 4GC5A 2CUZA 4M53A 4BZQA 3OUZA 1KKUA 1U4NA 2B35A 5HOQA 3FPKA 1NJGA 1VMKA 3FVRA 5HM8A 5EMJA 3KSBC 3G2MA 1B0PA 4XR4A 4KXUA 3RIHA 5E3JA 5ENDA 4DUYB 1IVNA 2AZDA 1KMCA 2EZTA 2WE8A 4OAOA 1RKVA 3CA8A 1FP1D 5KI6A 2ZSIA 1K6MA 1G3RA 1MRZA 3I9KA 4JJ4A 3T4EA 3ZBTA 3TPCA 2WIKA 5ITVA 1U28A 1NG9A 2ZUUA 1X77A 2R2GA 4X97A 3WBFA 2UZ1A 2WJ6A 1RHKA 2IV3A 2D74A 1DTWB 2C4VA 1LPBB 2R44A 1YAHA 3EGDB 4AULA 1YS4A 2OGWA 1W6RA 3AHCA 3QX9A 1SRQA 1JG3A 2L42A 4OOFA 4BL5A 2CXRA 2P9BA 2WD8A 3FN4A 5T4HA 2CXHA 2NLOA 3KZOA 4EENA 1ZH2A 3QF4A 4H6VA 1EGVB 4ZT4A 2EFCB 3PJRA 2WSIA 1VE9A 2QSYA 3ZJUA 1HRDA 4RY9A 3DH0A 1ZIXA 2WVGA 4FYIA 2IKQA 5E0KB 4AMZA 4XB6B 3WGZA 3H2SA 4OJTA 1THGA 4V1CB 1LVHA 5I7SA 1VL2A 2BI4A 3BJIC 2Z2XA 3RJ5A 4YUYA 2JJ1D 3SJBA 5A06A 2XMCA 1CP2A 4PZUA 5EXEA 3TKYA 1HK7A 5AVSA 1AKYA 2I7CA 4H6WA 3TRJA 3T3DA 2Y76A 3RTBA 4RA6A 2JGDB 1H05A 1W5SA 2PWAA 4HZGA 3TSZA 2FPGB 5CYGA 4CGYA 4EPVA 1EGMB 3A1FA 2VJQA 2J7PA 3QVVA 3TRDA 4AI6A 3R41A 5ALXA 3I0MA 5ICFA 1GTL1 3KB6A 4RZQA 3SZMA 1OX5A 3KOUA 1FXWF 4UM5A 3NHWA 4Z86A 2ZYSA 4OHPA 3KL2A 4WK4B 2HWKA 5D2CA 5EWMB 3OECA 3S68A 5AVVA 3ZY5A 3KPJA 1JDZA 3JAWB 4LXUA 4X91A 4IRXA 3K6SB 3DCJA 5JVDA 5GINE 1JVNA 2D5AA 1SXJE 2JGNA 3IILA 5EKUA 2JEZA 4ZXPA 4HQKA 4LDAA 4LF8B 4DV4B 1LW7A 2CMKA 3H1TA 2IOYA 4NATA 4QYMA 4CU2A 3GAZA 2WAMA 2G8LA 3R6DA 2DX7A 3UBMA 4PCUA 3ZNQA 4EO7A 4C30A 2ENUA 1XTUA 5E6RB 3V00A 1IAVA 2XCUA 4UCQA 1QS0A 4W6ZA 2OECA 5IW8A 1YCHA 1TQ6A 2ZYAA 1QM5A 1JH8A 2P2GA 3IOCA 4UHKA 3SZGA 4Y9SA 2IYWA 3NPAA 4HF7A 4BLTA 5C4IA 3EW7A 1EXVA 2QE7A 1T4MA 1G2QA 3HBJA 3RO7A 4MIKA 2FFJA 3QUSA 4X20A 4HWPA 1DQPA 1DXOA 4A82A 5KYNA 2HQSA 3M0EA 3UGTA 5FV4A 1ZCAA 1ATZA 2F1IA 2QN8A 3E2PA 3MMPA 4MUYA 4RZ3A 3W1EA 4JLNA 4BV8A 1NMSA 5BOSA 1NJ6A 5CA1A 4A36A 1S8AA 5D3MA 2WWVD 3ZWPA 4R1OA 4QATA 1PF7E 4HNAB 3ZKWB 1IHPA 3QKIA 5SZKB 4IDOA 3QVOA 2VSOA 3B82A 4N7BA 5DM70 1EAYA 2ZUVA 2Z08A 1MP0A 1A8UA 2JNWA 3RS5A 1QPZA 3RAGA 1U7TA 2AJTA 3G7NA 3MG9A 2D0PB 3UANA 3Q3VA 4ZEVA 3HMQA 1BXRB 3CEMA 3FHOA 1B43A 3BSWA 1E2HA 4RH0A 3THRA 3WGKA 4CTNA 2WWHA 2VYND 4M1KA 1CPYA 1CS0A 4Q48A 3AR5A 2AL7A 5CVEA 4WNIA 5IEBA 2O1SA 1FTNA 1RYDA 1BZYA 5KTRA 4DT1B 2IUEA 1B0UA 3GVPA 3A32A 3E3OA 4ECEA 2CV2A 1EB8A 1VL1A 2WIJA 5K6AC 4YV2A 4MV4A 2Y1LA 3RVLA 1WRBA 2FTKE 1X8XA 3JR3A 4HWOA 4IH9A 2XD9A 3RUEA 4CKCA 3MT9A 1SG0A 1NKVA 2D2VA 1VIVA 4L28A 1F6WA 2CVZA 1SU7A 1ZRNA 2QW1A 5TX7A 1Y5NA 4BNJA 5JO9A 2C58A 3VAYA 4KKXB 2RG7A 5F2OA 1VL8A 3L6RA 2FUG1 3L77A 4JR0A 3V42A 3AEXA 1TEHA 1A9OA 4G56A 4U3JB 5B1HA 3PF8A 4KWEA 4RPJA 1K0FA 2Y4NA 3F5FA 2YHUA 5P21A 4LF5B 4LBVA 3I64A 4JJEA 1TCBA 2FPKA 3GGGA 1B15A 2XNKA 2ZJ6A 3KTAA 3LPMA 4RHUA 5FOWA 3RM3A 2OBNA 3TSWA 4B33A 3OFJA 1VJ5A 4CV1A 4L1KA 4CYMA 3NNDA 4AY2A 3HU3A 1E5XA 4IKPA 4TUYF 2B5WA 3BIJA 1RRVA 1RWNA 1T0BA 3FOEC 3CH7A 1GD1O 4ZJZA 4RQTA 3OZUA 1YF3A 4DZTA 2LD4A 5IBQA 1M0TA 1BU5A 2DTXA 3WK9A 1SBZA 1ZOOA 1NMEA 1Y5LA 2O2HA 2PQ6A 3DBRB 1J2EA 1M75A 4X0EA 4C2UA 4HRXA 3E82A 2WJWA 1REQA 3SZ3A 3UC5A 1RFLA 3DNFA 2P77A 4WX2B 1OREA 2XE8A 3HJHA 2P1RA 3X1MA 2BSQA 2QJRA 4HYYA 1JEQB 1LDGA 1HE8B 2KW5A 1LBQA 2D5CA 1FU8A 2NAPA 2GRJA 3OIVA 3KYDB 3R5FA 4Q1CA 3C6YA 5ESXA 5HJ2A 1YL6A 1BJKA 4AG5A 1T5DX 3PZRA 2O14A 2RGNC 2IQIA 1GGNA 2P2NA 1KVRA 1QBGA 3D3EA 2OEPA 2R6DA 3JAKA 3OIYA 4FT4A 4M8SA 4MP8A 2JIBA 3UG6A 4C03A 3HDTA 3BGSA 4FJ0A 1Q0LA 3GXBA 5CFLA 4IJMA 4TQAA 2HYDA 3KSAC 4JP8A 1BQEA 1S2NA 3DYIA 3S0JA 2HPZA 4FMCF 4NL4H 4ENUA 2ZVQX 2R47A 2WJHA 4R1UA 4TXMA 3R7LA 2WZQA 3IDSA 3UQYS 1EWQA 1ONOA 2QRMA 2ZLBA 3Q1KA 2BM0A 2BISA 4H08A 4ESOA 2P35A 4JS0A 5K8CA 2PSDA 3JQ9A 3QYFA 2QU8A 5H4GA 4ZOLA 4X90A 1AGNA 2GPYA 4MYTA 2QG9A 2HFKA 4JZYA 4Y2SA 1BHQ1 1Q3HA 4FP9A 2UYCA 2HDOA 4N54A 3S6JA 1XU4A 3HV2A 4TLCA 5DBHX 4G85A 4PG7A 1FYWA 4NCIA 1E7WA 3G8CA 2V7WA 4LYGA 4HEHA 3H75A 3LIIA 4MV0A 3KKOA 3K20A 3TO5A 1O9BA 1QHFA 2WA1A 3T9CA 1GXSB 1WKBA 4ZK6A 1J4AA 1G8KA 2A0WA 2VBFA 3PPVA 4M1EA 1ZRSA 1US8B 2I80A 2JIOA 4C14A 2E5FA 4MCHA 4IZHA 3MB5A 3P9XA 4HDQB 5F3WB 1UBTS 3QPWA 1GOTA 1XLTA 4ARIA 3D43A 4ZAYA 2X41A 5A9SA 3ESAA 4C4RA 3VSDA 3G5TA 1RE0A 3RKRA 2W8BB 1PR0A 5LQSA 3N2EA 4MR8B 1DJMA 3FHJA 3PYXA 4G5HA 2X1VA 4MRNA 5KOYA 1P8JA 4MUMA 5KNCA 3ZGZA 4BLUA 4RF3A 3DFUA 3X1JA 2X6RA 5KMGA 3KKPA 4I46A 1P6XA 2HCTA 1A9TA 2X14A 2CVPA 3C0KA 2Z30A 1TYDE 1JVBA 4IY1A 4QREA 3RVKA 3WMRA 2PX5A 2YFHA 3B6ZA 3C3AA 3BERA 3M9WA 3G5MA 3WI7A 3I2KA 1W581 4QHSA 4F1KA 2AYYA 1A76A 1EA5A 4ZVQA 3HYNA 1S3IA 3Q72A 2B6HA 2JK1A 3DE6X 1JKFA 4L8LA 4KXXA 2EZUA 4PG8A 5JS7A 2E9SA 1ISGA 4FQ7A 3REQB 3CV3A 3MOSA 4Q18A 2WAYA 1NYQA 1YQ9A 5EL0A 1JSRA 5IZCC 3ROQA 4F3CA 3CVXA 3FF1A 4JP3A 2VJOA 1LDYA 3D7KA 3FNBA 1ZN2A 2ONKA 2PGXA 2QA5A 3FPLA 4JUIA 3MA0A 3WLHA 3WWEA 2R8RA 3DZFA 1T3ZA 2YMLA 5EAIA 5EMNA 3TBFA 4HGPA 4MGIR 3UYLA 1NNSA 2YWGA 1EVKA 1XMSA 3MTDA 3V32A 3F1LA 3OP1A 1A9QA 1W4BA 2I4TA 3UGQA 3U3ZA 4CIBA 2GPNA 3NBKA 4WCFC 3BZWA 4QOIA 5TY0A 3QVUA 1Y8RA 4ZYVA 5JNUA 1GZ6A 2OXFA 5EJ6A 2BGKA 3BEOA 2PIDA 4N18A 4YJHA 3AHJA 4FMCB 1IVSA 3CCFA 3DLPX 4AKSA 2Q3FA 4CMCA 1QYIA 1BVYF 1OFUA 3HU5A 1UH5A 2Y2VA 5CLFA 4FILA 3NEJA 2JVJA 4N49A 2QGZA 3MJVA 3TFWA 3IUJA 4D4JA 5LXTA 2LKCA 2Z09A 2ZJ3A 5CJ2A 1YKGA 2DUJA 2GA8A 1PD1A 4D26A 1XWIA 2QLNA 1Z4NA 1G8PA 1K3UB 3IAAA 1Q2UA 3KP1A 4FFBB 2PD4A 4KGXA 2A9KA 2A9QA 3BT7A 1Q0SA 1VSBA 1SOUA 1M0WA 2M6LA 4PIPA 3ICQB 1RWOA 1Q6YA 2C4WA 3ER9A 1DV1A 1DUVG 3GL9A 1TC1A 4OIMA 2EW1A 2VHWA 4WVFA 3THYA 1EK0A 2I9PA 4ZCTA 4MVYA 4R7ZA 5CURA 1E8NA 1PJAA 1Z5VA 1EM8B 3BXZA 4PR3A 3LNTA 5BSKA 4JP2A 2BI7A 2Z9CA 1YZYA 1KP9A 4C7JA 2UVQA 1WCXA 4LBWA 3JQFA 5E6UA 4MUEA 4CV2A 2VT3A 2JAHA 3PK0A 1N2ZA 4ISBA 4GQIA 1T9BA 1Z62A 1KQFA 1BGVA 1YQWA 2ATEA 4FEYA 5KSPA 4BNNA 2YWHA 3TZCA 3DONA 1UBKS 1BROA 3K0AA 5KJCA 1E0AA 3JR7A 5TQ0A 3VNQA 2Y0DA 1BVHA 3BX1A 2ZI7A 4OHRA 4DR4B 3TR6A 4JK3A 3O9MA 4EY4A 5HK9A 4Z9BA 1VFNA 2VAVA 5JJKA 3DMTC 3TE7A 5A1JA 3GH3A 3TAHA 4FIDA 3UH1A 3QP9A 3U3XA 1PK9A 2XDYA 2QRHA 2ES4A 3QELA 4QXPA 2EKBA 4X45A 3LVBA 1CR1A 2PIAA 2JHPA 4PZZA 3SDBA 1U1GA 3TLZA 4DV7B 2BDUA 5CYOA 4BV3A 2K7FA 3IYLW 2VPXA 4CM6A 3TLMA 1P1HA 4BHTA 4IZ6A 4Q9LA 3N0WA 2FMTA 1TPZA 1E4EB 2BEUB 1H2ZA 3V4FA 1NKTA 2SCUB 1C2TA 1H3NA 2R6CA 4Y2GA 4BE9A 4US2R 4KGDA 1ZHOA 1M2VB 4FWBA 1R1DA 2OB2A 1Y3HA 2B3DA 1YB5A 4PPFA 1C0KA 1RIIA 1SVWA 3BWMA 3HXLA 3Q2OA 4JJAA 4JVOA 4LDJA 1O03A 3HCBA 4ZDIA 4TXLA 1DIOB 3SZUA 4LAFA 2M98A 4R3UC 4EFLA 3ZWNA 4RBNA 1KXZA 3DQQA 1IXZA 1NUPA 3K70B 4X1IB 3HUEA 2QX4A 5IH3A 1A0OA 1IY1A 4AICA 2XDQB 2YC4C 2XB2A 2VF5X 2NYUA 3ME5A 3WNBA 1KEZA 2VP2A 1RKQA 4HWGA 3PLAE 1Z37A 3CISA 1ETUA 1C9MA 3MJ4A 4I14A 3S40A 2F1HA 2HNAA 4WBNB 2O54A 5DEOA 3WNDA 2WY2D 3WKAA 1EX6A 1M1YE 1SUAA 3DAPA 1B26A 4RA6B 5AVZA 5ILOA 1WXFA 3T1OA 3HPRA 1UBMS 1HZZC 2E55A 2PDAA 3S1SA 2X15A 4GLFA 4ND5A 4RHXA 2OC9A 4I0WB 2C0CA 4AZ0B 3U3OA 3TSYA 3T4XA 4LW8A 1HQDA 1K08A 1SEPA 1M2JA 1TMGE 2AXPA 2W2VA 3CBGA 3LWZA 4LA4A 2ASEA 2FOIA 4MTLA 2G0NA 1QO7A 5HKAA 1P7ZA 2FZ4A 3LECA 3O0DA 4J6FA 4LSGA 2HEGA 3L02A 4HNTA 3HU2A 1SKYB 3TS1A 4O5AA 1GGEA 3PIDA 1PT8A 3EVAA 2ZRQA 3H8VA 4H0CA 4WLFA 3OJLA 1NLMA 1QKIA 3RSHA 1SFRA 1BDMA 4I1VA 3TOCA 4HEA1 3DE0X 2GEDA 2QX7A 3LP8A 2P6MA 2UZ0A 4IRMA 5DHUA 1MO6A 4D4KA 2RIRA 2LXNA 2ATVA 1QCCA 5C5IA 2COKA 3QXJA 1BS2A 4UCFA 4BU1A 2Y68A 2V7EA 4PF1A 3ZHUA 3OIFA 2HIGA 4J49A 2ZATA 2NVWA 4G36A 1HG0A 1Z3CA 2YWJA 2EWVA 3EE6A 4H3VA 4M76B 4PLZA 5EE0A 1UMKA 2PRIA 2Y99A 4X20B 3PUZA 3JD4A 1EVYA 3IAFA 3QKTA 3RC9A 4MVCA 1ZMOA 1G2PA 1WY7A 1P45A 1NAHA 2EFDB 2IE0A 4KQXA 2P2DA 1VJGA 3V97A 1IQUA 5IMSA 4Y0VA 1D6SA 1SOWA 1Z9BA 1KI3A 4IMJB 4YFYA 3V1TC 1OASA 1BWRA 2HWWA 1QIJA 2ZBFA 5LBIA 4M7WA 3AVOA 5TJHA 3PENA 4HZIA 4CM8B 3GROA 1BDHA 2B78A 3OCJA 4J6EA 3TSCA 1YE3A 4QJ5A 1M1YA 5B6IA 2FR0A 3TLKA 3D1LA 1RRFA 3OO0A 1V39A 1JNXX 3D3JA 1A27A 1NMZA 3E15A 4GM1A 4PO1A 1DC8A 4XDGA 4F4DA 1RAGA 3Q3CA 1CEYA 5DNCA 4XUGB 1ATIA 4RKRA 2VCEA 4DC0A 5EJ7A 5BSWA 2FMKA 1AD2A 3DSRA 5F9MA 1QP0A 1X8KA 2HA7A 1FOEB 3R3VA 3TTTA 4CFZA 1XNQB 4MZDA 4U4AA 5DM0A 2IYOA 4CJXA 2QM3A 5B53A 2O3UA 4HQLA 1FPQA 1D2EA 1PAUA 5D1HA 1BDJA 3T3NA 1DQZA 4LWQA 3LJKA 3V3KA 1DEXA 1GUZA 3KHUA 2V55B 3EUWA 3CR7A 1EVLA 3IAM1 3OM9A 4E4YA 1RI1A 2D2IA 2ZJYA 3JQBA 4V39A 1P9WA 3E2MA 2G9VA 4I2NA 4MDHA 2I7VA 3INNA 2QZSA 1NQOA 4OGLA 4PXYA 5DTMA 2B34A 4LMAA 1IJKA 1J33A 3TKLA 1NYLA 2D7CA 4R71A 2BE7A 2QM8A 2HIMA 3I8SA 2ZIXA 4YDSA 1XTZA 4PLWA 4AF6A 3DOCA 1H6BA 3BMCA 3P2IA 3COSA 3EH1A 1H1TA 5T5QA 2CVQA 3LBFA 1FLDA 1VLMA 2QL6A 2Q9CA 6NULA 5LIPA 5AVOA 5L3QB 4Y6RA 1XMOB 1N2IA 1YV9A 4ZO6A 3M9XA 4J2TA 1GL9B 2CWDA 5BSUA 1U3DA 3AFGA 3GAMA 3QFFA 1K4KA 4FJ1A 2P4HX 3ZE7A 1NFRA 1LW6E 3AUAA 5J3JA 4IGFA 2P6OA 4ND8B 3WWOA 5JCJA 4ZWNA 2ZKIA 3OLVA 1S4QA 2O50A 3EUAA 4N6NA 1HOXA 5IK2A 4CR7A 3OJOA 1G7SA 3FYUA 1S02A 3DE1X 3GOHA 1QB8A 4L4YA 4M83A 3K5WA 2Q1UA 5EYPA 4M0KA 5FFFA 4R7GA 3VAZA 4WRRA 3EG9A 2VCHA 4H31A 4LHWA 4C6HA 5J47A 2Q28A 2Z5VA 4JCOA 2VPWA 4QQKA 4NYIR 2D1RA 3UB3A 4X1KB 1QYDA 3EXFB 1ZK2A 3KQOA 2VNIA 2WSBA 5GVSA 3UK1A 2VHVA 4B3IA 4HWRA 3HM2A 4BX0A 2CD9A 4YRTA 4YRPA 4JI7B 1DDIA 1ZMBA 4E2WA 1U2RA 5B30A 3MWJA 2JLXA 2QZ9A 4FFOA 3SE7A 4MLZA 5F7XA 1NI4A 4R2IA 1YDGA 3HXMA 2IH2A 2YZ7A 3KYIB 3UA4A 4AMGA 2PAAA 4AMVA 2KJQA 3H5OA 2F3RA 4AUMA 1AUVA 3K0CA 2OGZA 3MTBA 3AY3A 1M2EA 1CCWA 3O4RA 4Q1BA 4WESA 2P5SA 4GDFA 2AOVA 4W6QA 1AG9A 1YC2A 1V8DA 2FF5A 2ABWA 2XAAA 5G40A 3WLAA 3D0KA 3I53A 4NXMB 1A77A 1E2JA 1NBWB 2PKRA 4S0XA 4AK9A 1TAGA 1ZITA 3IQFA 1XEAA 3SHFA 4DLVA 5JDCA 3EK2A 1C9DB 1S2IA 2WD7A 1E2BA 4RFSA 3DD1A 3KKQA 4X7MA 3HL0A 5YASA 5CJJA 3AR7A 3ZH2A 5HKKD 1LUAA 4DKXA 4CF6A 4GGMX 1N0HA 3E9QA 3JQ7B 3NORA 4TL9A 4XM0A 1Z2NX 5LZ5A 1ZZGA 3EQ7A 3VYVA 4OLFA 1GPWB 4B4WA 4CM4B