3K7EA

Crystal structure of human ligand-free mature caspase-6
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
259
structure length
214
Chain Sequence
PAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRIGKKQVPCFASMLTKKLHFFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Structure-function analysis of caspase-6
rcsb
source organism Homo sapiens
molecule tags Apoptosis, hydrolase
total genus 72
structure length 214
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k7eA00
4EHKA 4N6OA 5IBCA 2XZDA 4N7MA 4QTXA 5IANA 3KJQA 5LU8A 2QLBA 2FQQA 2H4WA 5IBRA 2QL7A 2Y0BA 1GFWA 2CNOA 5IC6A 3OD5A 3DEHA 4JJ8A 4N6GA 4EHFA 4QU0A 2QL5A 1KMCA 4QU8A 1RHKA 3KJFA 5LUBA 4LSZA 3ITNA 3GJTA 3GJRA 1GQFA 3SIPA 1RWPA 1QX3A 2C1EA 2QLJA 3R6GA 4QUEA 2QL9A 5IARA 4N5DA 5IBPA 4EHHA 5H0IA 4QUHA 3S8EA 4NBNA 5JFTA 3QNWA 2J32A 3IBCA 4QUJA 2XYGA 2CNNA 3NR2A 4D3XA 3K7EA 4NOKA 4NOJA 1RWOA 3H13A 3R5JA 5I9BA 1JXQA 2CNKA 4JR0A 2CDRA 4DCJA 1SHJA 2C2OA 4AWBA 4QTYA 2NN3C 4PRZA 4EJFA 3DEIA 3GJSA 3PCXA 4I1RA 4PS1A 4ZVQA 3DEJA 1IBCA 4IYRA 5IAJA 4ZVUA 2H54A 1RHUA 2QLFA 4FXOA 5IAKA 1I4OA 1RHQA 1SHLA 2CJYA 2H5JA 4JJ7A 4HVAA 1F9EA 4HQ0A 1RE1A 2C2MA 1K86A 4I1PA 4D3ZA 4JQYA 1RWVA 3H11A 2J31A 1RWMA 2H65A 4JR1A 3SIRA 4QULA 1CVRA 2J33A 4EHDA 3NKFA 1NMEA 1NW9B 1PYOA 2C2ZA 3NS7A 4ZVSA 5IABA 3V3KA 5LUAA 4EHNA 2CJXA 2FP3A 1CP3A 3RJMA 4FEAA 4NOMA 4NBLA 4JR2A 1PAUA 1QDUA 2CNLA 1RWWA 4QUGA 3D6HA 1RHJA 2AR9A 4FDLA 4QUBA 1I51A 1SC3A 2P2CA 4DCOA 3H1PA 3PD0A 4ZVPA 3R7SA 4FGUA 4ZVRA 1F1JA 4QUAA 1RHRA 4ZVOA 3D6FA 1RWKA 4EHLA 3V4OA 1BMQA 5IAEA 5K20A 3R6LA 3E4CA 3P45A 5IC4A 2C2KA 3V55A 3DEKA 2HBRA 3R7BA 2XZTA 1NMSA 2HBQA 5IAGA 3UOAB 4DCPA 4JB8A 2XYHA 1ICEA 3V4LA 3KJNA 1SC4A 4N7JA 4N6NA 3EDQA 3D6MA 4AW9A 5IASA 2XYPA 1QTNA 3BIJA 3P4UA 1I3OA 2H51A 1RWXA 2Y1LA 3GJQA 4NBKA 4M9RA 1RWNA 3IBFA 4NOLA 3H0EA 3V6LA 3PD1A 2K7ZA 2H48A 4EHAA 4AWAA 1M72A 1I4EB 3R7NA 2HBYA 5LU9A 4QU9A 4JQZA 3R5KA 4QU5A 4JJEA 2H5IA 4IEFB 3UO8B 2H4YA 2J30A 3V6MA 4PS0A 1NMQA 4QUIA 4D3YA 2FUNB 1RHMA 4ZVTA 3S70A 4HQRA 1K88A 1SC1A 2DKOA 2HBZA 4QUDA 4PRYA 2WDPA 3EDRA 3H11B 5I9TA
chains in the Genus database with same CATH superfamily
1KAMA 4KO3S 4KQ6A 1OILA 3CUUA 1E6WA 3O4HA 4PIMA 3ESZA 4YGYA 4LNUB 2GBGA 3CF2A 3DAPA 3KEGA 1JXAA 3SYKA 4A26A 1Q5PA 2JHPA 4DJJA 2QNRA 3H7IA 1C9NA 5HZHA 1Q3HA 2I9PA 4OJTA 1QV7A 3CO0S 4DCMA 1NBOA 1SEPA 4J76A 3ZU4A 5I4CA 2UYQA 3BH7A 3D3NA 3TXAA 2WQ7A 5I9LA 3EAQA 3A2MA 3HXKA 1ORIA 3OPXA 5DASA 2EKQA 4ECEA 3FLMA 3O8NA 2XUKA 2RKBA 2REOA 1GL9B 2FRDA 3TR6A 4IY1A 4RYDA 2EZ4A 1N32B 3NOXA 4KP7A 2P65A 4CDMA 5BWMA 3E2PA 3U9LA 2FP4A 4ZO4A 1DJPA 2W2VA 4TYQA 5EXTA 3AP2A 2C7BA 4ZREA 3K1AA 2CHEA 5EC8A 5C5DA 1HT0A 1CEYA 5C18A 4JLKA 4IDBA 3NNSA 4S0ZA 4EMSA 1JA0A 2AX4A 2C4TA 4LYHA 1EK5A 2GB4A 2F00A 2B3DA 1ZVMA 3NAGA 3R7LA 3M5DA 5LBTA 4XDHA 3A3KA 1U8XX 3PQ6A 3TLYA 1NOIA 3PFBA 3UGTA 4WN3A 1FOEB 4AM8A 4RXTA 4UREA 4BLOA 1MC8A 2FN3A 1C1HA 4FC7A 1VL2A 3WWDA 2QBYB 1HX7A 2AJBA 3DQPA 2EATA 1B6RA 1EE9A 2HZ7A 1K86A 2FPUA 5A3RA 5H68A 4FDMA 2QQ0A 4OFWA 4WKBA 2QTAA 2WQ6A 4NECA 3V7NA 4WLVA 821PA 1HLGA 4HB4A 1TF7A 3WKDA 2HDNB 5FQNA 1A3CA 4G1VA 2GH1A 4DARA 1HE1C 1JHZA 2PL9A 3BTUA 3VDRA 4MYDA 3K4QA 3B53X 2J5KA 4AFNA 4BO1A 1DOAA 1GUAA 1JA1A 1V1MB 3GIWA 1QPGA 2ZJZA 1TF5A 1W1UA 4M1SA 1QG4A 5CFMA 3PXCX 1B74A 3LVBA 3BD9A 4E33A 1YTUA 3X2SA 3WGYA 3GELA 1LBTA 1KYXA 3ODPA 1VP3A 5IDYA 3PGJA 4FP9A 3GP3A 3W2TA 4TTQA 3O7WA 2PFGA 3L1JA 1X9HA 3J7TA 1U5AA 2DRIA 3PSHA 3H6KA 5F1PA 3Q9LA 3IUJA 1HY3A 5A5GA 3DLBA 1XZEA 1S9DA 3IP6A 1E1LA 1U2EA 4YGXB 2ZLBA 1ZS9A 4YRLA 1JPJA 4AUEA 1OXVA 4U39A 4CLOB 1YB2A 4PEVA 3TTSA 1VSUA 4TRNA 1YRWA 5LM3A 3G0HA 3E7PA 1ZNWA 3GJQA 1RIIA 3GLHB 3WI7A 3WK7A 1C3LA 3AFNA 1CR1A 4ZC8A 3DOJA 4RK0A 5AH0A 1SVMA 1Z6XA 5EZQA 2FZKA 3I76A 3TEFA 4H60A 4QGBA 1N2SA 5B1YA 4CLDA 3PIDA 2VSQA 5ELXA 4X90A 1AB6A 3P0HA 3L9WA 3NWBA 2CB0A 1S8FA 4OGGA 3STYA 2AWNA 5K5EA 2B7BA 2CBXA 1ZLXA 1AK1A 4K9QA 4V03A 4DDTA 5IT5A 3AVVA 3L07A 3M6XA 1IXYA 2AOWA 2ZXEA 2ISSD 4YC7A 2QYOA 3C1OA 4O4IF 4IGFA 1TCBA 2M6KA 1SVLA 1UT5A 2P9BA 3ANYB 3T3PB 1MQAA 3NALA 1R4AA 2PS9A 3A7DA 1N2XA 1ZAKA 3KR2A 5FRDA 3BQ9A 3HY6A 1GKIA 3OEED 4ZZ3A 5KREA 4TTJA 2CLLB 1FJGB 1QH0A 2R8EA 1Y98A 1J1IA 3NRCA 1V3VA 2R00C 3G49A 2JJMA 3ZDBA 2FW1A 1OB2A 4PZLA 4MCJA 3GUHA 3HA2A 3OQHA 3IIEA 3QOFA 9ATCA 1SURA 4YRCA 5BXYA 3D4OA 5CD9A 2V3WA 3TM5A 4GWKA 1RE0A 1L7MA 3CNNA 1TK3A 4E3WA 3PQFA 4DQVA 1KA9H 2WWFA 4JR0A 5DHSA 3W5JA 3LH5A 4A5SA 2DB3A 2NPOA 2XR1A 3IUYA 3PCXA 3AVXA 4C7OA 5TY0A 5CFPA 3IHLA 1R0ZA 4HN9A 3N5KA 3T4UA 5A0VA 2GQ0A 3B3GA 1WXWA 2DOKA 4KAAA 1O97C 1J8FA 4DBLE 2CK3A 4X0EA 4F5DA 3UAGA 1EE1A 3G9QA 3QM1A 3R6TA 4JP1A 4OX9Y 5AVJA 3M1IA 3OAAD 1XDGA 1Z7YA 2QRPA 4JUCA 3DC2A 1X74A 2VH5R 5KJCA 3HABA 2GZ2A 3KHKA 2QORA 4PFJA 1P18A 4GWGA 1N5OX 2FZCA 5ADUS 3IMEA 4M3NA 1G4AE 3I3OA 2XVYA 3L5KA 3OOEA 4EQ6A 5EJEA 4JNCA 5FA8A 3AKZA 1GR0A 2NO5A 2XCQA 2YIMA 2R68A 3ETLA 1FEZA 4MPTA 5T8KA 3SS8A 4BZPA 1VJ5A 2FV8A 2ZSJA 5DT2A 4DGQA 4J2HA 5LOVB 3C5HA 3SXUA 3WDSA 3NDJA 4LGYA 4LCBA 5EJ5A 3UWMA 1F8UA 4B7UA 3G2NA 1ULTA 3JATA 4A6DA 3DP7A 2VOJA 5A5DA 2PS1A 4YH1A 2XSZD 5JCXA 1M10A 4R1MA 1KJJA 3IGFA 2F1RA 4HZGA 3IT2A 3MMPA 4BJHB 1E61A 3I30X 4MW4A 3WKCA 4RKWA 1JIXA 1G5FA 2GAIA 2WTMA 3K3PA 2C8LA 3WMEA 3WAKA 2ZBEA 4M9ZA 4MQFB 2BEKA 4TROA 4GNRA 4TSFA 1IQRA 4CTOA 3CA8A 2CDBA 4HTAA 4J7XA 4D7AA 1B3RA 1WAMA 1H5UA 3RT9A 4NIMA 2Z9DA 3D7RA 2Q1WA 2JJYA 4BNZA 2XJ9A 3GF4A 1PEAA 3VJMA 4C2TA 1YQWA 1WCIB 1XE3A 3JD0A 3H8WA 5EZ5A 2FZ4A 3MLAA 4B7CA 3R9XA 2CMFA 3WK9A 1BCSB 2EKLA 2Q0QA 5JSYA 1FS6A 5TNXA 4CN8A 4HK4A 2VKQA 1CDEA 2C00A 2ZEJA 3PZRA 2HH9A 4MGHA 5EOVA 4E2WA 1NTRA 2EQBA 1W36C 2POCA 1WSBA 2I7CA 2WFAA 3MAGA 2QF7A 4ITRC 1IY9A 3VKFA 1LD3A 2VUHB 1I7LA 1U0SY 4ZKEA 5CIYA 2X0FA 3SMVA 5DE3A 3OZWA 1GAEO 2WV9A 4DS3A 1XTBA 3TECE 2ST1A 5B3LA 3VU9A 4HTFA 1RVV1 3CSSA 1UOQA 4RMHA 3JU3A 2ZI9A 5U4XA 1N7GA 2ERXA 4BNWA 1GOTA 1FFDA 3DOOA 1MOQA 1RLIA 4TMKA 3TAUA 4N5MA 1DRJA 2BFDB 2JLRA 5EJ2A 1XLVA 2A5LA 4QQKA 4LY0A 4A1OA 3BS4A 4B1FA 1Z88A 3VVMA 1IEXA 3PFNA 5TF4A 4AJKA 1H6AA 3CBQA 1I7NA 3A3PA 2PLAA 1RRPA 2GKSA 5JFTA 3IPAA 2AJTA 2Q4DA 3NASA 5SZKB 3TL2A 5GONB 5JMTA 2FAXA 2IX9A 3HCAA 5ARCA 4UQLA 2ANBA 1B2LA 1JU9A 1U3UA 1VCMA 3C6MA 3B6KA 3RF7A 3MYRA 3OZEA 1K5PA 3RT1A 4CGYA 2A0KA 1A8HA 1NW5A 3EC2A 4R68A 5CAEB 5JI3E 1TK9A 1NJ5A 2WYUA 1SUEA 2FSVC 2HLNA 3AFGA 4DV6B 1MAWA 2GXQA 1YTLA 4BO0A 4QXRA 3UK0A 2BP7B 4UEJA 3TL3A 1XOIA 1CUXA 1OR8A 2GVZC 2CD7A 2OBYA 2W5UA 1O3YA 5BN5A 3VDNB 5K0ZA 4O2AB 2VHTA 2GKGA 1U9IA 2IHBA 3NNNA 3OETA 3VR5A 1TB4A 3CU5A 2QMHA 1JR3E 1GQOA 4MO2A 1SU8A 2WKQA 3E15A 3KB6A 4FLFA 1LU9A 4XB6B 2TMGA 5I5GA 1EXNA 2ZSDA 4QXAA 1CDZA 1K6XA 3R75A 1OWLA 4MLCA 4JOQA 4GZMA 1Z2EA 2HTFA 2WILA 2DTDA 5LIRA 2GO1A 2ZUEA 4IOKA 4KHPB 3EXHC 3BBLA 3CF4A 1VPDA 1Z33A 3HU5A 3CWZA 4FX2A 1FYXA 4UFOA 2X5OA 5CBPB 5I9IA 2PRYA 2Y0CA 1GG5A 2YZ2A 4C4OA 2GN8A 5K0EA 1KZ6A 3TZ6A 3ZE9A 2JBWA 1YRBA 1ORTA 4P98A 4LV8B 4W6ZA 2QZ4A 1EWVA 1AZTA 3GL9A 3LUCA 2SNIE 2OHJA 2G06A 1E6LA 2ACVA 2Z5VA 3PDCA 4ZYTA 3IFSA 1CIPA 1ONBA 2XAAA 4HWTA 5IT0A 2D13A 5K3BA 1WW2A 1U3GA 2G9RA 1ADGA 3CLHA 3ENZA 4URVR 1XVLA 2YWHA 1OU0A 3K9FC 4V0ME 2QN6A 2BJHA 3LLSA 4MJLA 2GJKA 4KPUB 1D1TA 4IGIA 2K87A 4PSCA 4EBBA 2O19A 2KB0A 4ZTUB 1U11A 3GZ4A 4BRZA 4AW9A 4YMHA 5CURA 5DCYA 3VNAA 1XMOB 4AY2A 4J43A 2O8BB 4KIGA 4PSKA 1NP7A 2Q50A 2VPTA 4BGVA 4LWQA 3QPUA 4JEMA 2QPAA 3NM4A 4FJ1A 3OECA 4BZQA 5K3OA 3LCJA 3B12A 3JYQA 2BR5A 4PZUA 4AKEA 3A4VA 5BPHA 1Q7TA 3IDFA 4QQ8A 1Y1TA 3NKVA 3PKIA 4OQEA 1XZPA 4QBIA 2YUTA 1SKQA 3EPJA 2IXAA 5KMGB 1L4MA 2VYCA 1Z2DA 5D2CA 2VP5A 2GCIA 4Y2YA 1U3DA 3LGSA 4LX8A 3O2SB 3GK3A 5JFOA 1SFRA 3KUXA 3TG8A 4OA5A 3FMIA 5I9SA 1AV7A 4W8OA 4XIFA 4MEJA 2WSSA 4ITUA 4PV7A 2FK7A 2ZAMA 5KYYB 3IP5A 2SBTA 1JYSA 2R66A 4Q1DA 4J4HA 2PUEA 2GZHA 4F96A 5FD8A 4U6NA 1P45A 1QRSA 1U2SA 2NYRA 2CVZA 3IULA 1BDJA 1VMAA 2IS2A 4F4JA 4Q24A 4C5AA 1VBKA 1F7VA 4ZWNA 1TJ5A 1PN3A 2B9VA 2PPLA 4LBVA 4MRPA 4P54A 5AVKA 1W46A 1Z4MA 3H5AA 2QRVA 3DB1A 5DCUA 4ALIA 2IYWA 1OHHA 5K0FA 3AF6A 2ZT8A 1HE5A 3H1GA 1V71A 3LY8A 3U7JA 1A7KA 1IWOA 3EG5A 3KHUA 3PUZA 1V3QE 4O2BB 5SICE 3EY4A 1ISRA 2P0EA 3TAHA 1FFHA 4XVHA 3TLCA 5K6TA 3RU9A 3ODGA 1G9XA 1YR3A 4JLUA 1YRYE 2GT1A 4IIUA 1D4AA 3M9LA 3RT7A 3RVNA 3W5BA 3DYVA 1BH2A 2AFIB 2BRUA 2RJ3A 3FCYA 3OCUA 3I01A 4B3XA 1P0FA 4KIFA 4KFCA 2I2DA 3K0KA 2R6CA 3AF2A 5TV2A 2I4IA 1SY7A 2P5UA 3QPVA 3D3JA 2H3EA 5B57C 2NZ2A 1JEYB 1W75A 3LC0A 5CTAA 2OQ2A 2X9QA 3GRKA 3KNZA 3QBJA 3WRXA 5C5EA 2NQ8A 1NQUA 1ZNYA 4DW8A 3QH4A 2X40A 4UTRA 4HJRA 4Q9KA 3U3OA 3AK4A 1DAFA 1U7ZA 2CF6A 3NRJA 1Y3BE 4HDNB 1WJGA 2R8XA 5F35A 3QOWA 4KQJA 2YJNA 3GYBA 2COEA 3VC1A 4E2ZA 1TVEA 3K5IA 1E60A 2P67A 4M1WA 4Y18A 1Q0QA 3SFVA 1UFQA 5BW8A 1LVHA 2R85A 2VAVA 4FFBB 5FPQA 4C76A 2QKYA 3H4MA 2OG2A 3UICA 1E3SA 3S1SA 4JDPA 4HAIA 4PTYA 5AUPB 2Z8ZA 3C74A 2OPBA 4KL8S 2V45A 4DUZB 4R81A 1ZD4A 3IO5A 4MP8A 2E4AA 4GVXA 4OMFG 4IWXA 4PSVA 5JXHA 5KU7A 3OLYA 1BIFA 3EHDA 3G2OA 2XYHA 4Q34A 4QDXA 5ALYA 2PSJA 3G5UA 2B4TO 4FEYA 1Y1KE 4BC1A 1FRFS 2ZTLA 5B5SA 1IFXA 4DQXA 3WL4A 2PNJA 1EVZA 5C35A 1QTNA 5LMCA 2H31A 3CZ4A 3WJ2A 2PE5A 4EAAA 2Q9BA 2ZUVA 3WGOA 2C4NA 3QKSB 2ERCA 5LZ5A 3FTFA 2KBFA 3ABZA 1XU7A 2IHJA 2ZIAA 4FFDA 4TMYA 3NOVA 2FPLA 4NE9A 1HZZC 4IIYA 5DLDA 1FTSA 3ZY5A 2VPPA 1A8SA 4D98A 2MSKA 4QQFA 1BMTA 1YR6A 2C1ZA 3DFUA 1N9GA 3TDNA 1U1IA 5ADWA 3FX2A 4Q1CA 3UC9A 4A10A 2IOFA 1XRMA 5AKHA 5ENVA 2GPAA 1XMIA 2QX7A 4MCHA 3I9OA 3QFCA 4GOJA 4R8RA 4FZRA 4J3NA 1UXHA 2WOOA 2XZDA 3C85A 3V1KA 1DVRA 1U9CA 5FBRB 2D6FA 3QFSA 3VOTA 1KSGA 2JB9A 4BU1A 5ES4B 1INLA 1Z83A 3PXUA 4BCBA 3KQVA 1J2RA 3SYLA 1ZGHA 3KKMA 5KHAA 1ZH8A 3HKDA 5HBGA 2WC1A 5BUQA 1RHKA 4ZEXA 3VZRA 5J43A 5IYZA 3PQCA 3R5SA 1I1HA 3NHWA 1S8AA 3IP1A 5HIIA 1JFLA 3TW6A 1K8ZB 1YQDA 4M8KA 1AHNA 2G09A 1XELA 1H8HA 4RF4A 4Y9UA 1J0DA 2WTXA 5ALIA 1E9VA 4Q18A 3WIVA 3FWPA 2XUDA 2Q2WA 3DPSA 3FNQA 4OMUA 4IDQA 2IZ5A 4LXHA 4R2WA 3NTVA 3TSYA 4E15A 1OVMA 5JRDS 2J4DA 3P9RA 4F5WA 3EG9A 1GLVA 2HK7A 1H1LA 1CIJA 3KXIA 4B83A 1ML4A 3U48A 5TC4A 5EIXA 4JHLA 1BFDA 1YBVA 3GMTA 4N7RA 4BFSA 3OPQA 4DWWA 4CT4B 1DKQA 1VHJA 3I2JA 3M6UA 2G9VA 3PC7A 3RANA 4J1NA 1S1CA 1GZ5A 5E7IA 2D62A 4PNPA 1UBLS 2G36A 2GEBA 3N2NA 4Q66C 4YAIA 5K09A 5UKDA 1GPLA 3ER8A 3KU1A 3ILVA 3NKLA 2A88A 7REQB 3ZJ4A 4HADA 1JNYA 1O0SA 1XL0A 3O9ZA 1KI6B 4MW9A 2C2BA 3FPLA 4IOMA 2HTEA 3EZ2A 1T1RA 5DK4A 1C5KA 3U80A 1T0BA 2F43B 4RY9A 2IYLD 5DI3A 2BF4A 2I33A 5HMMA 3KB1A 1CULC 1ZH6A 3HY3A 1S5PA 2WHPA 3F96A 5EVCA 1GSAA 2Q4EA 3PIRA 4MUNA 3HYSA 3PX3A 4XIIA 4D8WA 3KVRA 3MS2A 3K2BA 3QV1A 2BSXA 2PSDA 4KW7A 2XUHA 3ZNQA 3AUTA 5K4GA 5AI9A 4NLLA 1N2EA 1P2VA 3WGLA 4BMCA 2BUCA 4U2FA 3VH2A 1FVHA 5L53A 1ZBDA 5LJIA 2PX2A 4P3XA 4YQYA 3CZMA 4K9OA 3ADCA 1M2OB 1W4BA 1RS0A 1NAIA 2YMPA 4IGKA 2VLIA 4QL3A 1BRMA 1MVOA 6CHYA 4IFBA 5JDIA 5LD2C 3RGGA 4OLJA 1D6SA 1XTRA 1FTNA 1PP4A 1N6LA 2BUAA 1NFFA 3TTVA 3FPSA 1Z2OX 2XNCA 3HDTA 3MSXA 1UMCB 1UAGA 4HWKA 4P53A 2Z2ZA 4Q3OA 3QPWA 5F2KA 4BPBA 3NDIA 4KN5A 3TFOA 2LCQA 1W52X 2E21A 3EPHA 5HVNA 3PEFA 1PZHA 4LXUA 2O8VA 2AN3A 2MSWA 5ICCA 3V8MA 3K1JA 3K94A 4R9NA 4BLVA 4IDAA 4K0RA 3FI0A 4EG8A 4ENVA 1DUIA 1AZWA 5THQA 1RPZA 3MM4A 4PZDA 3U7QB 3K4PA 3V4SA 1JFVA 2X1HA 4YV0A 4MMZB 3JASA 4C0AC 3U3DA 1U9ZA 3A9VA 4F3KA 1DTEA 5LOVA 3RUCA 2C96A 2FMUA 3RG2A 3CLVA 4WW0A 4C2AA 3ROTA 4DR5B 4CETA 3C3YA 1UWVA 3HUUA 1E4EA 1MO2A 4JJKA 4PCUA 3AHGA 1JECA 2JI7A 1VJDA 5AOCA 1M2FA 1SIUA 2OLEA 1YAJA 2Y9MB 2PLWA 1WHTA 2AMLA 4RVHA 3ZTWA 6REQB 3AU8A 5CT9A 3AW9A 5FP0A 2JI4A 4QUEA 2ZIUB 3JAKB 2B6NA 2YS6A 4FIDA 4PAQA 1NN0A 3FOZA 3MSCA 5H0IA 2ZBQA 1JUDA 4IVQA 4UNSA 5TB5A 2I6FA 1TT5B 4WSOA 5LA6B 1STOA 4LQLA 2I4MA 4P7JA 1LVUA 1TK2A 2RJOA 3GBVA 1C4WA 4BJ1A 1N5IA 2OGTA 3G3EA 1ZOLA 4D0GA 2ATIA 1UC9A 3N5CA 4CG0A 1GZ7A 4CM6A 4YR7A 5COAA 3U5TA 4OJNA 4ND6A 5J5AA 2M6LA 5FR2A 3ZLTA 2V6FA 4NJMB 3OBBA 4P82A 5EYPB 3TOVA 5G2OA 1EVQA 2XRFA 2QYTA 1VKOA 4WVFA 2D06A 2FRVA 2GARA 4Z9YA 3ZQJA 2A0XA 2CJFA 3BGOS 3L0DA 4PC1A 2OR3A 4GKJB 1DJNA 2OVFA 1U4NA 1H23A 3ITKA 3MT0A 4L15A 5D3QA 4F0JA 2VTVA 4XVRA 3ETJA 3W7AA 2P75A 1FMTA 1H2XA 1EB8A 4AB1A 3LUBA 3U19A 3RU3A 3EVDA 3P9CA 1P0QA 1N7IA 1X19A 4KOEC 3SIXA 2Z9CA 4A8JC 4KFTA 4RADA 2NU8B 4OP2A 4F85A 3U4QA 3GGPA 2OHVA 3TUJC 3T9BA 3FTDA 4JI2B 4E5VA 1CLEA 2BEWA 3DBLA 2O05A 2PUFA 3VNQA 3B85A 5A0TA 2SCUA 4V0KA 3W3AD 4P7GA 1E6MA 2RB4A 5CCEA 1M8JA 2JIZA 2OORC 1KJQA 1OAOC 3F8TA 4BWVA 3QU9A 2B5VA 4N03A 4RIHA 4HP8A 4JT2A 3MJSA 4WECA 3H3XA 1ODKA 3M1YA 4N01A 4KPFC 2IGTA 1BS9A 2DUNA 2PQ6A 4RKRA 2PMWB 1ADJA 5FUMA 4QPNA 5FQOA 1QTIA 2VATA 1OFGA 3L1UA 5DM4A 3RRYA 3LDHA 5IK2D 2O0HA 1KU0A 4PFKA 4DR6B 1BD3A 2R2AA 4QD3A 1NR5A 5ALLA 2BL4A 3WLMA 2X22A 2ZS9A 1E1KA 2YVLA 1H2WA 4OGLA 5DGXA 3W06A 3JXEA 3T7EA 4C4XA 5C8ZA 4IHJB 3D0QA 3E3NA 4MGZR 1CJUC 3MWEA 3OT4A 3V1LA 4D81A 4EM6A 4KYVA 2QZZA 3HCDA 5EZYA 1KTIA 3QJ5A 3EULA 1G2OA 1DU4A 2HRRA 2ZCUA 3LLUA 2AI3A 2FSHA 3LT5A 4BTEA 3GLFB 1SBQA 3TG2A 3O8LA 2JFZA 4L28A 3IAM6 3ZI4A 4L7QA 2BELA 3V7WA 1QIKA 1BKDR 2H5IA 4CMEA 1Z2CA 3I8SA 4NBTA 3RSOA 1EWTA 4EPRA 4JSRA 5JRJA 4JP3A 5EMJA 5JD5A 2QK4A 3V4FA 3AUJB 2OCLA 1R6AA 3QF4B 4IILA 4ZC1A 3ZNOA 3ZXXA 2AJLI 3TNJA 1FYWA 2WA1A 3N8GA 4JYCA 4L4XA 1DDGA 3WHLA 1K75A 1XEXA 1ORHA 3DVAB 3M6AA 3R0QA 4XE5A 4C05A 3BH6A 3AOEC 4ZZ0A 5JPCA 1NNSA 1OWNA 2CNWA 1UXIA 1ZGBA 1YZGA 1DAGA 2F9FA 2VP6A 3F4LA 5LCXA 4KR9A 2ZW9A 1KZHA 3QTBA 4BLPA 1WZEA 4EI7A 4GOKA 1SZDA 4D02A 4NZMA 5JZSA 4KXVA 4CYMA 4EHFA 1HE3A 3OMWA 2QTFA 3BL6A 5AKGA 3AQIA 3UT6A 3WGTA 5BN4B 5U1PA 4GM1A 1P0IA 2EZ8A 1I5EA 4NAHA 5DGCA 1G66A 1Q0UA 1TU0A 5ALRA 3UWOA 2Q21A 1XSEA 3L9XA 2VBIA 3HJNA 4M0PA 2F1JA 3CZRA 2C5FA 3S2YA 1X6VA 4NQZA 4XVQA 4IX1A 3ZXIA 4F4HA 3KAPA 5LR6A 2COUA 4IOJA 3R0XA 1KFEB 4FJ0A 3VPFA 4E5PA 3I12A 1M7GA 1H0HA 3LYLA 1DC3A 1MB4A 2QYSA 2WD9A 3OH8A 3V97A 1P2UA 2GK6A 5JY6A 3V8PA 3DB2A 3HJAA 5IYZF 4YV2A 3B3QA 4JQCA 2O50A 2GAFA 1W4LA 3GCWA 1Q95A 3R3VA 2G63A 1CZUA 2ZVQX 3RJ9A 3TJZA 1D3AA 1BXRB 1VM6A 4EB8A 2ZWAA 1YZVA 2CB9A 2Z9BA 7AT1A 2IXEA 2EBWA 3QVLA 2WIJA 3PGVA 4I1RA 1E1RA 3C6XA 2Q1UA 3H4TA 3IO3A 4EYOA 4I9NA 3TINA 4MS3B 1FXWA 3TIIA 1OTYA 4OUDB 4PU0A 3CLSD 4I8IA 5K3AA 2Q3EA 2H5JA 2NACA 2Z2KA 2Z4SA 3DG9A 5SV2A 3ZGLA 1R6XA 3Q7PA 3PHLA 5ITVA 1JIUA 4QOSA 3AGPA 3JQFA 2Y1XA 3KR1A 4KHZA 4QVGA 4TL7A 1E3DA 4GYKA 3EC7A 2VK4A 5I9MA 4KITB 4O5AA 4PYQA 5E9WA 1KFJB 4XB1A 4RENA 1ISJA 2GN0A 2QRKA 4GECA 3FI9A 5LYJA 4QYIB 1AQJA 2LVBA 4NXNB 5AW2A 2JW5A 3HHEA 2BHNA 3DZHA 2HQRA 3VOAA 1XXHA 1AKTA 4TXLA 4FFLA 1XJWA 2WJVA 1X7ZB 3MT8A 4JMPA 2PZAA 4RFLA 3FSEA 3FWKA 4ILEA 4ASUA 4LDJA 1G20E 4Q4JB 1AE1A 4MR8B 2FF5A 3CH6A 3K8QA 3ZQ4A 3THYB 5J2TA 3NBXX 4V1CI 2VZLA 3BHNA 3GDWA 2GWRA 3AESA 1HFJA 1T0IA 3K9BA 4A4DA 4O1IA 1M2JA 2E89A 2Y1FA 4Q7MB 1VXRA 4DJAA 1W34A 4G0ZA 4MK4A 1ZMRA 1F8XA 4BNHA 2HGZA 2R8YA 4W1SA 4HDRB 1DKMA 1P1CA 1QB8A 2BN4A 2VPIA 4UVDA 4E08A 1CS0B 2AWOA 4HNSA 3RSZA 3FZEA 2OZKA 4PG8A 2IUTA 2QZSA 2O5CA 1NVMB 3L8EA 5KDDA 4YJ3A 5CDUA 4AWAA 5DP1A 1JEJA 3IT0A 1ZICA 2BMFA 1SOUA 3HJUA 4J0FA 3UHFA 1QYIA 1SNYA 2RJNA 4QFCA 1PNOA 4EQZA 5FTLA 1GQSA 3UMYA 1AUOA 3X1WA 1E6CA 4WIAA 4MUGA 2WUWE 2LD4A 4HSGA 4MV5A 1NUPA 4N40A 1EZZA 4BQOA 2C3PA 3E6AA 3QPCA 4JB2A 2WAMA 3JRWA 4EY4A 1JQKA 2GCOB 3KLBA 3E18A 3NTOA 3U16A 3DXXA 1NHWA 1BXGB 1UWLA 2E48A 2O8DA 2GEFA 4Q47A 3C7KA 4BZZA 3QFHA 1E2NA 2DBYA 4N9QA 3DT9A 4IEIA 3PQDA 3KQNA 1X8JA 4JU8A 4YUWA 1JE0A 3D7SA 3A36A 1WDMA 1E1YA 1VA5A 3EDCA 1MJ5A 3MERA 5T6MA 4XKJA 4JA0A 3E9RA 3M81A 3N9IA 2R7KA 2YWCA 3OPMA 1HRDA 4Z0NA 2J7PA 1F4PA 5LLSA 3VC2A 1HGXA 2KM1A 3LHFA 2BONA 3GJYA 2LV8A 1JMKC 4MHSA 3NAZA 4UXHA 3KC2A 1IZ9A 2ORWA 3RKRA 1TUGA 4TUYA 5F78A 3NU1A 4GC5A 2NZYA 3CUYA 2HXGA 1PT5A 3SIPA 3UJ9A 2GR9A 3CPHA 4GXTA 4EGAA 1X7YA 3T15A 3AIIA 3AHHA 4RK6A 4M54A 2ILTA 3GDOA 2V7QD 4II2A 4EY6A 3EJ6A 5HOEA 3O83A 3V32A 4REQB 5CT5A 2UZ3A 2J4FA 3SOPA 4G5OA 2VYNA 1XMSA 2ECPA 2I78A 2Q3HA 2QHXA 4D3XA 4EKDA 4IJUA 1FCJA 5JWHA 2IV7A 3IDZA 4AECA 2ZIVB 1YO6A 1ST2A 1AGRA 1BKYA 3TBHA 2KPOA 3VNBA 3RTDA 2M6RA 3DMYA 1V95A 3FVQA 5JC8A 3D64A 1LF5A 2FWMX 2M32A 4UBJA 2WHRA 3K9CA 2XMCA 2AOUA 3SE7A 2VHEA 1JLRA 2R1VB 3TQHA 4EGJA 3DKRA 4F60A 2AXQA 2IZ0A 4D0SA 4L5IA 3OU7A 1QM5A 2GJ4A 2CLFB 1C50A 2QG9A 2XMSA 3NI2A 4PVCA 4DMLA 1JFTA 1G5QA 4V0OA 4KRFA 5CCDA 2P1RA 3N86A 3QVJA 4TV9B 2AMVA 4N39A 4D5EA 1Z7BA 4R8LA 2VZ9A 3H16A 1V25A 3NS7A 4DXHA 1ZSNA 1D7AA 2WT9A 2NMVA 1N0VC 2FTKE 1FS4A 3B5JA 4AZ3B 3KOUA 4CU2A 2OQIA 2B4AA 4AJ4A 2CYBA 1OYYA 2QE6A 4FW9A 2J5XA 3FKJA 4J16A 1DBRA 7ABPA 3EEQA 3G82C 5HCIA 3VZDA 5CB6A 3NOQA 1R88A 1O0CA 2LNDA 5JHGB 1RVDA 5J9FA 3DVSX 5JS2A 3W2FA 3AVTA 1ZJ6A 4TYMA 2B2NA 3PT5A 4S1TA 3R3JA 1GN8A 2C8KA 4BZWA 1J21A 1VZ2A 3EZ6A 1RKUA 1LLFA 4MJ7A 1PD1A 3DCIA 1IPFA 3OHSX 1UEJA 2Q99A 5FJJA 3U4AA 1NX9A 1I6KA 5DF1A 4EYGA 4TS4A 5DNCA 2EOAA 5CDFE 3F5QA 3EXIA 4IFTA 4PZAA 4ARZB 1RXUA 3KSRA 1CQPA 4EKYA 1K4MA 2QRNA 1XAIA 1ZMXA 2KE5A 4OA8A 2AFHE 3VKHA 1E1QA 2C4HA 2WAOA 4ZEVA 3KS9A 3DXYA 1O9BA 5EQDA 3NIDB 3T99A 2NTJA 3DLPX 4YMGA 2NVUB 4PFQA 1M7HA 4AIRA 5CB8A 4BEBA 4WACA 1JJBA 2PA3A 2EFYA 4HH4A 4L08A 5KC8A 2HIAA 2O5RA 1JNXX 3LHKA 1W59A 4LY6A 3KKLA 5F5NA 1ZJWA 1ULSA 4ZJZA 2GUWA 2PLRA 3NYWA 4ZHQB 2INGX 4QT4A 1A8QA 3OC6A 3TTUA 1ZGGA 4MUHA 1HEIA 5JPDA 1TA4A 2MDTA 4DIMA 4RD6A 5EZYF 3BJIC 3K70B 2LRHA 4OP3A 1C9YA 5DXFA 3MTBA 1Z7WA 3DZIA 4NCNA 1S2DA 4C3ZA 2R96A 3OOHA 4KBYA 6YASA 1D2HA 1M1ZA 3GLGA 2LW7A 3IBSA 3EH2A 1ZRHA 4W8GA 2QN7A 3W2GA 5ELLA 2YYZA 1LNSA 1QGYA 5AIAA 1HE8B 3DHWC 2ID8A 1LZKA 3M6FA 4I8DA 4DNPA 2E0IA 1EIWA 3W05A 2XE6A 2GBLA 3RLFA 2Y68A 2QQEA 2W2XA 3QLVC 2IYPA 2AC2A 2EU8A 4R7TA 4R1LA 2QXYA 2BGKA 5H81A 2ZI5A 1W94A 1G6Q1 1R66A 3DLHA 1E9CA 1N5LA 2DWUA 3G2PA 3Q8XB 4MP6A 4QSHA 5FAXA 2JC3A 4RTOA 4YPOA 3VU0A 3A6FA 4I5IA 3HR8A 3HCOA 5IARA 1REQA 1ACLA 2OUKA 3ICCA 1KQNA 3TD6A 3EIQA 4CM7A 3JZMA 1D4FA 2OO3A 2PPVA 2V6MA 3TTYA 4JS0A 2HMSA 3PL5A 2EFGA 2N1MA 2QTBA 2RGCA 2Z2YA 4A6PA 4Z7NB 1SXPA 2PGAA 4OBXA 1ENOA 2HIHA 1PFGA 1W2GA 2QMEA 2W6ID 1RYNA 4H7DA 1NG1A 4PTLA 1YOVB 1J42A 2ZUBA 4EZEA 4D4GA 1F2UB 2Q7DA 1YUNA 4GRDA 3OTWA 4OLHA 1VJGA 1IZ0A 1SQFA 2IBMA 1O96A 5JNSA 1BU8A 1UZLA 2QRLA 4B43A 4B81A 3SXPA 5KYXA 1P7CA 4OAOA 3RAGA 4GI1A 4GX5A 1YDWA 4MQUA 1PV2A 2HEGA 3M4XA 4B34A 3CNEA 3PFCA 4NBUA 3QVWA 4KI0A 5LSAA 2JGDA 2HV9A 2ZRCA 2QU7A 1FXWF 1OCEA 2DM6A 2JLBA 3N7UA 4W7HA 3GIDA 3AF4A 5JCPA 2ODWA 2FJ0A 4JLSA 3V34A 2PT5A 2V7TA 4F2DA 1XKQA 2O2EA 4UUBA 1NYTA 1JFFB 1Y80A 2ZAOA 1YR8A 3LXRA 2H4HA 3CW9A 5D1NA 1Z68A 1NLFA 2MU1A 2C77A 3WLSA 3VU3A 2O8EB 5LYJF 3CGGA 4BFTA 4DANA 1DLJA 3CNBA 4RJIA 1ZHOA 2O8CA 2X0IA 3DE0X 4MITA 1CUVA 1NDHA 1N8TA 3LU1A 4HFJA 3KYJB 4BO4A 1S6YA 2B4QA 1DRUA 4PPYA 4MRNA 1SU6A 1YIOA 3FWYA 2O7RA 4L0MA 4ZQIA 5CFRA 3RWMB 3C97A 1ZPDA 3THRA 2PX5A 3ESQA 1T2UA 4QVKA 1DG3A 5FL7D 5JDCC 3SJCA 4NENB 5DISB 1FIUA 2HFJA 5KYUA 4EG7A 2GBPA 4F5ZA 5J2TF 3RVRA 2ONJA 2N47A 2ZRJA 3T5TA 4CKBB 4AS1A 3T54A 3A9WA 3F2IA 4YAUA 3SJBA 3T9FA 1N6OA 1DP4A 1P2DA 2B1QA 3TQIA 1YQQA 2VHCA 4DADA 2VPXA 3HM2A 3ZEIA 4BKOA 4WKGA 5M04A 3AR5A 3CPSA 3PNPA 1IC6A 4KNYA 1DPFA 2OC9A 4CEJB 2I91A 3LL4A 3DKIA 3FNIA 2RK4A 5KTPA 4YJ3F 1FNCA 3N6RA 3RRNA 5CUQA 1AQIA 1UDRA 2W6JD 4G85A 1N34B 2JVJA 4G5QA 1YFZA 3GZJA 3TRKA 4A2CA 4ALKA 1HMYA 3GRPA 3GLIB 1A9TA 4YMSA 1V3UA 2VKTA 4HLDA 3WFZA 3ZYCA 2B1JA 3OZBA 5E95A 2G04A 1LTQA 3OO0A 1DZ3A 4C01A 1Q12A 3M33A 5H9WA 4LFAB 1A4XA 1C9EA 1NBMD 1ODTC 1UR5A 1XLTC 3CURA 1DV1A 3H18A 1NL3A 4INJA 4UBMA 1WD7A 1MFPA 3A1DA 4HHEA 1E2QA 1FNNA 3DVLA 3BPSA 4LNAA 2IYXA 4A0QA 1ADFA 1IBRA 4N5DA 1Y33E 3ZDZB 1NF8A 1XZFA 1GL3A 3VSDA 1N0HA 3FF1A 4K1XA 3BIFA 4N47A 1U7HA 3H1BA 4ALLA 2RI0A 5LWQA 1Y1PA 2ZRPA 1L7XA 1AXGA 3WK8A 2GHIA 3HB5X 4YS6A 4B7AA 3U1VA 1DTWB 4TUYF 1CYEA 2BFBB 4B75A 3VZSA 2Q1TA 3HWWA 1RI5A 1YA8A 3DFIA 1VG9B 1EK0A 4DN6A 4FFOA 4LXIA 4Y0AA 1GU1A 1I32A 1WX1A 2NN3C 5F64A 5EXPA 1A2KC 1GY8A 2XXJA 2H4JA 4MWOA 3EVTA 4HEQA 3FHLA 3BFJA 5LQJA 1E2JA 1C41A 1NXWA 1TD1A 3OZ7A 2QLFA 3DEAA 5E8JA 3ZZNA 1LDEA 1L4KA 1DRVA 3UMCA 2AJDA 4MQ6A 2XNDA 3OLWA 3M3HA 2W4IA 1RBZA 3BSWA 2A5DA 2WIFA 2JPDA 3NIGB 4HNGA 4KUEA 2G9QA 1UANA 4MRAA 1M9NA 2ZVPX 2NNLD 5B6JA 3FZGA 4XIYA 5KVCA 4IEEA 4RWEA 3CVXA 1GZ4A 3ZCRA 1VE3A 1MUUA 2H29A 2UDPA 4DRXB 2B0JA 4K6GA 1WABA 2CNLA 1E8DA 2ILVA 4BAGA 5E3IA 5LFAA 2WVGA 4TQUS 4MINA 4DCOA 4DVJA 2IZ6A 1HDYA 4IJMA 2W8BB 2J3HA 1SKYE 4N7BA 3SXJA 3KR0A 4ESVA 3UMVA 4XFJA 5G0UA 4JI6B 2OWDA 2H1HA 3B60A 1H4TA 4A36A 1H3FA 2HSEA 3UH1A 3OZCA 4LJ9A 4I55B 1N0WA 5C7IO 2DTEA 1OYOA 2WW8A 3ELBA 4KDEA 4DLPA 1A27A 1NYQA 3KO8A 4OXNA 4AKSA 2C2GA 3MTQA 2Q6OA 3KUKA 1E3LA 4JBXA 4RABA 5H82A 1FDWA 4HDQB 3M83A 3I45A 1T25A 4DCPA 5EHIA 2ZJ3A 3G9ZA 4GPZA 1BQ3A 4E2YA 3BHJA 2H17A 2RMKA 3WTCA 5KTOA 3O2JA 2NXJA 1E2UA 1CY6A 3QU5A 4N8DA 2FLVA 5DV9A 2WHXA 1V6AA 4OGWA 2CHGA 2JHGA 4NWIA 5E9JA 3K6SA 3U3ZA 3EEYA 3BGDA 4FM9A 3KETA 3AY6A 2YMMA 4H7JA 1F2TB 2HBYA 2IYQA 3QGMA 1T2NA 2D1TA 1OLSB 3MCWA 2HSJA 4W5JA 1X0VA 2PRSA 3SZGA 3KSZO 5J63A 3QLTA 4YNBA 4W99A 1OAAA 5HTOA 4WLOA 1TGYA 4Q1EA 3MWGA 1GUYA 1R8QA 4FLEA 4MUFA 4LHSA 3WWYA 3HB0A 3GFPA 5AR1A 4R1QA 4NJEA 5EA2A 4UTVA 2NO6A 1A96A 1T9BA 2PX4A 2WDPA 3GXBA 5ABPA 2JDID 2I55A 4ZI3A 5IANA 3OEWA 4ES6A 1DOHA 3OQ1A 1E0KA 2Y0BA 2W90A 4E51A 1KAEA 1OMOA 3TZCA 3VU8A 1QHGA 2ASEA 1Z39A 2B8EA 3CLUD 3D2CA 4M60A 4DIEA 2Q5JA 4AURA 4G5FA 2WVHA 1BEEA 3L84A 5A6SA 3HYTA 4JT4A 3DUFA 1C9JA 3GJRA 3STUA 2VQEB 1KZYC 1E5TA 1JG3A 2OTCA 2VA9A 4IHQA 3ED5A 3HVIA 3R6GA 4FKZA 3FKSA 4TWBA 5EINA 3RIXA 1A76A 4DMFA 4ARAA 5JJBA 3I0ZA 1IBMB 5FLEX 3NPAA 3KLNA 4GOOD 4JA2A 1HDRA 4ZD6A 1WUTA 1JT2A 2VC2B 2CNNA 3TW8B 3QYJA 2RGEA 2ZU0C 3L4BC 3LPMA 1Y9EA 3BERA 3CB4A 2C58A 2PWYA 1QKKA 3PR2B 4L50A 3F6RA 1JHDA 3IVGA 1DXQA 3UGKA 5C1PA 4MEBA 3G2LA 4FWIB 1EEXB 4IDDA 2GM3A 3WLAA 2ZR9A 4AO8A 4D3FA 3D6JA 5FBZA 1D1SA 2OZEA 4JEHA 4BOYA 3B38A 1EVLA 3IQEA 3IT3A 3AZOA 1XDDA 5AVUA 1QE5A 3DHNA 4N0QA 3CS3A 1EK2A 3JQ6A 1Z16A 5DBGA 3RK4A 4D9BA 2XGSA 4C88A 5DXAA 1JDNA 1EH5A 3CLKA 4JXZA 5C8YA 4R2LA 4H7FA 1B14A 3ZD8A 5AK4A 4XXHA 4I1PA 2L2QA 3VTKA 4D9FA 4KFSA 2W6CX 1HT1E 4LYAA 3EJWA 4RANA 2V9ZA 2CVQA 3SQNA 3ZHUA 4JI7B 1V96A 2EKZA 4ZOCA 4MYSA 4UM5A 1UCFA 1XZQA 2HA0A 3WGHA 1C0KA 2V3CC 4UE6A 2PMCA 2PAAA 3MIZA 3D59A 4ND7A 1OJ7A 4CQMD 2Y92A 3NHMA 3D54D 5FPKA 1NZDA 2QSYA 3T9DA 2FX5A 3DMPA 3SHOA 4DBLC 4EBFA 1DO2A 3JAWA 2CW5A 5GVSA 4I4IA 4ZVPA 4FGUA 1RYFA 4MV3A 4G5GA 3PFFA 1UMBB 5AJTA 3IJPA 3KTAA 2I4OA 3AUSA 4KR2A 4KQ1A 3MLEA 4M0UA 3FB1A 5KQMA 2OCPA 3ZXSA 1XA0A 2C2KA 5EIAA 2LCIA 1D09A 3E7FA 2ZM5A 2QX4A 1XYVA 4MWCA 5ERYA 5F3RA 2CXXA 4GPEA 4UJ3A 5BSTA 1DC5A 5K05A 4RE6A 1GADO 5BVHB 1NP6A 2OHIA 4WADA 3ZY6A 3BDIA 4ENSA 1N2CB 3EFEA 4KQWA 1A9XA 5DU2A 4YJFB 3QITA 1T4DA 1FSGA 1I2DA 1O94C 3NX4A 4H27A 5TE9A 3UW1A 4Y2TA 4QO8A 2XT0A 1W5SA 4TKUB 2EKPA 3EZFA 4XIJA 5ILOA 2OESA 1EBFA 1R0WA 2BFMA 3DC7A 4R83A 5BNTA 1KBOA 4ALNA 3VH1A 2A1IA 2C07A 1D2EA 4KNWA 4LHYA 2QPOA 4QTZA 4A0HA 1P8JA 2EL7A 1ODSA 4WZZA 3LPAA 4KDFA 4P86A 1OXXK 3P9SA 3EGCA 2XAUA 5DW3A 3SP1A 4UHFA 3DM5A 3KALA 4CJXA 1MG5A 1U1CA 3PRYA 4G4GA 1BD4A 4PZEA 3QF7A 4ZO9A 3V6MA 2QXUA 3WA6A 1DQRA 1BMFD 1QHEA 3PITA 2WNSA 3KPWA 5LP6A 2VCHA 2ZSKA 3TLMA 2QTWB 2BUBA 2JGAA 1M34B 4MVJH 2VAPA 1MJFA 5AW0A 1C14A 2J4CA 4I6EA 2WKSA 4L73A 1HYEA 3PVZA 1NPYA 3V9PA 1VLLA 1ZSYA 2YQ5A 1UINA 2WJGA 4D43A 3IQZA 3FUTA 2G6TA 4LJLA 4YP5A 1NVUQ 2Y93A 4BN0A 5MFPA 3RSQA 3OZXA 2X13A 4ARSA 1NW4A 1UWCA 2PTHA 2O48X 3ZU5A 3PNVA 4PQRA 3CZPA 3UT5B 4X54A 1WKCA 4QHSA 5CJ2A 5EIBD 2JLXA 4R2IA 3DMHA 1QCDA 3U1BA 1QV9A 2HLDD 1TKBA 1HZZA 1B00A 1LX6A 2FJUA 3RVKA 2XGOA 1I33A 4B82A 4GAEA 3HZRA 1H2AS 1MNQA 1VL5A 1DWUA 3HVKA 4B33A 1KYTA 3ZDAA 1GIAA 4YPFA 2GVNA 5DX0A 3W0LB 1C3JA 1F1BA 4I8XA 3FYSA 1N7HA 5LBIA 3UWKA 1PZFA 4MUXA 2C5GA 2BFCB 2I54A 1J56A 4AZTA 1SBTA 1RHQA 4EGFA 4XCXA 1ZI6A 1UF9A 4JUDX 1KDRA 3VKUA 2J1LA 3QEOA 2Y05A 3NLLA 2FPIB 4Y1EA 2PUBA 1LDBA 1ZCJA 1FVFA 4I1SA 4LCEA 3QUCA 2FHSA 4GNKA 2X77A 2HPZA 3OZUA 4L8YA 4RPLA 2KWIA 4HZUA 1L7AA 4RZ3A 4C0LA 1RI1A 5C37A 1H5NA 2NQ2C 2O4UX 2P3OA 2XDQA 3H9CA 3L6UA 4KBFA 3SBEA 1BRTA 3WZMA 4WKCA 4X85A 2PRKA 1GGHA 2J09A 1GPDG 2HMVA 2VYVD 2IA5A 3BRCA 4JJZA 3AR4A 1CNEA 4ADSG 1WUHS 2JCXA 3P9IA 5AO9A 3CCFA 3ZHTA 5BOSA 3ER6A 3TQFA 3ZGVA 4BJ5A 3GGSA 2AOVA 4UU7A 3V8VA 2WG2A 3NYRA 4OB7A 4B6QA 1EUCA 5H02A 1Z34A 5IAEA 4BNGA 5JOQA 1I7PA 2F3SA 3QEMB 3MMZA 2WJAA 4NBVA 1I4LD 3CX3A 4RETA 5D00A 5AXCA 3RODA 1KSFX 3I9LA 4FYWA 2Y0EA 1UBNA 2YJZA 5HR5A 1KP9A 3MIIA 4B6OA 1TVKA 2MTBA 3KE9A 3B6MA 1P2GA 5D5HA 2EW1A 2ARKA 1HTWA 3SDZA 4RDIA 1GTG1 3AR8A 4P33A 1UP7A 3A3YA 5D87A 2DXIA 4FMDB 1Y89A 2HMTA 1P3Y1 5CDSA 2C8VA 1SXIA 2QSUA 2QLLA 3JX9A 2A58A 421PA 4DNQA 4A1FA 4PLWA 4RD2A 5JS7A 4ZZ2A 2OZLA 3D1VA 5FWDA 5ALEA 5CVTA 1OXKB 1JSZA 3EGDA 2AF4C 3F67A 1J9EA 3H65A 4HUQA 1RSZA 4I1OA 3JZDA 3AZQA 2UVPA 1HA3A 3HZZA 4L57A 2A92A 4LUCA 2RHOA 4UBNA 1GZHB 4CTNA 1B2RA 8OHMA 4KE7A 2K4MA 3D6TB 5JVDA 4KMRA 2WMNB 4RVSA 4KRYA 1USKA 4TSRA 3T7AA 3UOGA 3ELUA 4CF6A 1NVFA 5LQCA 3PPVA 4LYEA 3IEVA 3LNTA 1GNRA 4JSTA 2JGIA 2JFBA 1DCKA 3AJEA 8ADHA 1G18A 1Z0UA 4B85A 4PFSA 2AB0A 3DWGA 4B3JA 4IDHA 3ABRB 1J1UA 5A3SA 4YO8A 1GYQA 4IMJB 3R8XA 4OOEA 4DILA 1GFIA 1HO3A 3OIVA 4BNDB 1KAGA 3DBOB 3N8IA 2FN7A 2QRJA 2EBHX 3DCNA 3DQQA 3GN2A 1CZHA 2KLBA 1ORVA 4FOOA 4B4DA 1NM5A 2R2GA 1H66A 1I4WA 3BF8A 1A5AB 5LB2A 4PLPA 5KHLB 5D85A 1UJ6A 3JSAA 1XC7A 1ZWKA 2NSHA 3BZWA 4ZQCB 1BEUB 1TO1E 3OM1A 4RQTA 4XRRA 3RS4A 1D6JA 3A6JA 3OZGA 4N5LA 4DIKA 4DV5B 2QX6A 3QNUA 4RJKA 4KO1S 3BB3A 1KP3A 4FGWA 4Y0VA 2HIGA 1ZLYA 2JIPA 4DCUA 2B3TA 5P21A 3RWBA 3DKPA 2GWHA 2QB5A 2NZVG 3LX6A 3UFXB 2WZQA 3PCTA 1TXGA 3WY9A 1CCWA 2ZPUA 1GU7A 4QRIA 3TKYA 1F48A 4CBVA 4KNVA 5B36A 3PC8C 4GBJA 5H3CA 3NHRA 2HA4A 3O8BA 1UMKA 5GIPE 4H3VA 1DE0A 3ZN2A 2ZJ8A 2XWJI 2F64A 4ETWA 3LIIA 2DVMA 3FR8A 4RKFA 4XPZA 3THWA 3D6VA 1NJFA 1CW2B 3JYNA 3M9WA 5JSFA 5JYCA 3EXEA 4WL0A 1P29A 2OBLA 1C80A 4IXMA 4NPAA 2BEJA 4ZCLA 1H0RA 1U7TA 3IPXA 1C2TA 3WADA 1PD0A 4J3JA 4COKA 1V8DA 4O1HA 3X2FA 2F9MA 4ZN6A 1CUUA 2QU8A 4TZ6A 4QDJA 5AKJA 2PGOA 1N3YA 5FULA 5LZ7A 5AD1A 4XARA 3AVQA 2DWCA 5FBLB 3JQAD 3OEEA 3T3HA 1RMYA 4JLNA 3FHCB 4KK3A 3AERB 2LGJA 2FPXA 1NUTA 5C8YF 5JU6A 4YAKA 1I51A 3N2GB 4KACA 5C4MA 3PD0A 1TVMA 3ZHXA 2UZ1B 3AVUA 4YQEA 4HYYA 3DDCA 2X8BA 3NJ8A 2QNIA 3ZIDA 4EPWA 1Z8FA 1HTBA 4HZIA 4DXAA 2RIRA 5IUJC 5CITA 4M7WA 1DIBA 1YA4A 1I4DD 1ZM4A 2JAHA 4TQGA 4TYNA 1X2EA 5ERGB 4E7PA 2ZT5A 1DL5A 1RJ9B 2BE9A 3L92A 3NC1C 2I1VB 3PG5A 5EERA 4EPYA 1QC5A 4DJDC 4N6NA 1TIKA 2Z2XA 3I9JA 3PFGA 2OZVA 1NYLA 4BVJA 2HQOA 1XQXA 4NQRA 4L4YA 1P1FA 3SHTA 2GZ1A 3IBFA 5ICSA 4MP3A 1Y5NA 2OVBA 1VECA 4DSTA 3COJA 3I9NA 3OAAA 1IVNA 4AKGA 2BBWA 3H9JA 5KSOA 4YDRA 2HA5A 3I01M 1HR0B 1S01A 4XQEA 2FETA 4WJKB 4GWLA 1U63A 2ECFA 1KO1A 1UQTA 4KO4S 4ZPJA 3CN7A 3OIWA 3SC2B 2DT5A 2HX1A 4LJSA 3S55A 3HFGA 3LPNA 3OFNA 3P0EA 5ESXA 5K3CA 2WQZA 4UEKA 221PA 3H8VA 2EJBA 1V4NA 4IS2A 1G42A 3KVYA 1KDYA 3A1TA 3CSDA 2YJ4A 4O02B 3T0GA 4BX0A 3NFYA 1B23P 1T6BY 5GZ3A 2ZUWA 3GCZA 1Y1SA 4HQKA 4A2WA 5IBRA 1VKJA 4ENPA 3OJWA 3O95A 3OA0A 4J0EA 4MUAA 4QXQA 4RGQA 5AKIA 2N46A 1XR3A 5EEGA 3TMKA 5FA6A 5LP6F 1DKPA 4DDMA 1U31A 2JFQA 4CIVA 4NNOA 1U8EA 3HKBB 3VPHA 3UMSA 4RA6B 2Y6VA 1VRWA 4LRWA 3OPNA 4S1WA 1QFYA 1KVTA 4BN4A 2IITA 4WXRA 3D6NB 1ISIA 3D02A 3ZUPA 4S1NA 1W96A 3PX2A 3P2IA 1XZJA 2VFAA 3IAS1 4UMFA 1ZHHA 2VWQA 1I3MA 5CYOA 2W98A 3WWCA 4RUKA 3FOBA 1QLWA 3KTFA 4NS1A 3PTAA 1E1MA 3O26A 2BI8A 1WSWA 3AHCA 1J25A 2IXBA 4G8JA 2HSZA 3AINA 3HKCA 3L1IA 1JDUA 2FEWB 2I2AA 3E9NA 1QE3A 4ZODA 3T5AA 1A0OA 4FW8A 4ZKDA 3QVGA 3BG5A 2FFBA 1SOMA 4EJ6A 1L3BA 3D7NA 3I1FA 4NHOA 2OSBA 2XADA 1LTHR 3ZTTA 1HSOA 4H3HB 4B40A 5AW1A 1LPNA 2GYVA 1T8YA 3ANXA 3OZTA 4P4NA 4W9NC 1XCGB 5EE3A 1WP9A 4ZAZA 4OU5A 1LBQA 2XEXA 4ETIA 1ABBA 3MBIA 1AIPA 4JQYA 4TXJA 4OI4A 4HV4A 4PZCA 1ML3A 2C7GA 1NONA 1Q57A 1ULBA 4WOCA 1F51E 3BK7A 3OU2A 1X15A 2OHFA 4RZIA 3Q0TA 2GCEA 5KTKA 3GUCA 4RACA 1L4FA 3W5IA 1QIGA 2PYDA 4JELA 4ZMSA 3LGXA 2XHEA 5BV2P 2ZULA 1XQ1A 5HGJA 2X3YA 2D2XA 3EUWA 1SC3A 4MRRA 4FSXA 3AHEA 2B20A 3CNQS 1S02A 2IZ7A 1K63A 1YQTA 5IJZA 3UJBA 3GZTB 1TOAA 2ON6A 2WINI 1IHPA 1DMRA 1P4GA 1YE5A 4E5DA 5TQVA 1JWAB 2R751 2H1FA 3IKLA 3PSAA 4GR9A 2P9HA 2HY7A 1QXSA 5G3YA 1NX6A 5H3LA 3DVQX 5CU7A 4OLAA 3OZAA 2RGBA 1U1DA 1XN4A 2JGMA 2PZLA 2VYQA 3IJEB 2XRMA 4TTVA 4Y2RA 4YECA 4HB0A 2QGFA 4FD2A 2REBA 2CXOA 2GD6A 4UFPA 2Z1NA 1HBJA 5CVUA 1Z73A 2EG9A 2JBAB 4R8VA 4R8SA 4LJAA 1GPH1 3AL0C 3SSOA 2QD4A 1VCIA 5IZCC 1Z6PA 3ELDA 1KEUA 1AK2A 2HIMA 3D2AA 4E11A 1LFAA 4GPTA 1MQ8B 2VI5A 3OPYA 1FQOA 4JENA 4PPGA 4JU9A 4P84A 4DB2A 3H1TA 2A9KA 1PT8A 3CG0A 3SKVA 3UAVA 4ZTZB 2AHRA 4FIZA 1B0AA 1Z38A 2WICA 4JDUA 1N1MA 5J2UF 1JE1A 2XMQA 5LKRA 1U2DA 1XEWX 2P41A 3CX6A 3DCYA 3HGTA 4OSEA 4XLZA 5IJ9A 4IP0A 2NUPB 5K8TA 1D7OA 4X94A 2E1RA 3D8SA 4UCQA 1W47A 4XGNA 3IRVA 4ZAWA 3ORFA 1NR7A 3TRJA 1Y4UA 4V0LA 1SG0A 1ZOIA 4F4DA 1X1RA 2H1RA 4PPQA 2AG6A 4FI3C 1YJBA 1H6BA 5F5XA 5CVJA 4FPXA 4F2WA 5JVDF 2RCNA 1W4ZA 3IEXA 1C8VB 1XF9A 3OIDA 5DKFA 4WZBA 4TMXA 3FPGA 3C8ZA 3PZBA 4C06A 4X7MA 3RRMA 1WCWA 3M6IA 5JNUA 3QQPA 3JVVA 4RE5A 3EFHA 1FY2A 3FPHA 3H8JA 2OYRA 5HKBA 3ZW7A 2CLOB 3GH1A 3OFVA 2BI7A 1Z22A 2BLNA 2ZWMA 2QTHA 3CF6R 4MR7A 4LXYA 5IVHA 4NU6A 1W0CA 4NBNA 4WXYB 3W5VA 3LK7A 1RJFA 2A0FA 1FFYA 1TKRA 4LRUA 5TIIA 1K5DA 4LDRA 3WMXA 5EMHA 4JIGA 4M55A 1DKRA 3ONFA 4QBFA 3ONEA 5C1IA 3CQ9A 4LZNA 2YVKA 3EGEA 3DEFA 1R4NA 1ENPA 2JGEA 1EGMB 4R31A 1YNOA 3T1NA 1SVSA 1YV9A 1G5PA 1O5IA 2WYWA 4K6KA 4AUNA 2W00A 3IA7A 1WQ3A 5JJ5A 5I48A 5BR8B 4ZOBA 1NUQA 3PRJA 3EARA 4FHGA 4RMJA 3U7IA 5F33A 2YIVX 3TX6A 4M99A 4P36A 1YQ9A 5K3FB 3CINA 1K08A 1N75A 4B87A 2Q8NA 2W37A 1VJRA 4FOPA 4ZV9A 2GJSA 4D9KA 1OAKA 4OXRA 4OKIA 1G9SA 1TMKA 3CEAA 2RSLA 3E3AA 4B4OA 2GZDA 1JHXA 3S2ZA 4K9RA 2CLKB 3D4BA 1E5LA 2BSAA 2ZJYA 3N8DA 4WBXC 1KSHA 5A7HA 3UCEA 3ZK9A 4RHTA 1V7ZA 3BEDA 5E7JA 2Q0HA 3WLRA 1Y3HA 2PT9A 5B1DA 3DDNA 3NP9A 1SCUB 1K66A 2WVAA 2FMXA 3ILHA 3QVMA 2O3RA 2PKCA 4PX2A 4H17A 4LBWA 3SVZA 5IAAA 2CE7A 5DEIA 3QYPA 3ZIUA 4CM8B 3L6EA 4OHMA 5ITZB 2DX7A 4FD3A 4Z9AA 2EVWX 1F12A 3ETGA 3RS8A 3TNDA 2G67A 1ZI8A 1Y8ZA 4XTCS 3PC2A 4UAJA 3MUOA 4Q6BA 2D1RA 1PCXA 1N2HA 2P91A 5K0SA 1BTOA 4HLUA 4H7EA 3MFQA 4LBYA 4OOFA 3QHPA 4WDQA 1KFCB 2ZJAA 2ZTHA 2QGZA 1XRPA 5EE5B 4KFUA 4ROTA 1E1NA 3IR6A 4M37A 4WA8A 1HQCA 3E1KA 1MAAA 2IKQA 3E53A 3NC4A 4X20A 2HYIC 4NOLA 2PUTA 2BGTA 1NN3A 2P0YA 3AHDA 4GG1A 3O3NB 5FCDA 5G0WA 4DCSA 3KQKA 3RUDA 4LJYA 4TVOA 4EFNA 4Q7EA 2J3QA 5D3KA 1Z12A 1YZNA 1N2ZA 1V39A 5DTRA 3T5MA 4YRNA 1UJ5A 2R11A 4RVUA 4D4IA 4RMIA 4GRAA 3ND6A 2G7ZA 3N2YA 5HRAA 4B80A 3I6YA 2V8BA 3USES 4HNAA 2A5JA 1U9JA 1ZCAA 4FGZA 4DLAA 4NSNA 3F8WA 5EWMA 1XZLA 1JA9A 5CGZA 2XQJA 3ORYA 4RMGA 1JJIA 1Y8RB 1ZL2A 4FK8A 1H2HA 3HA3A 2BHTA 1U02A 2CUKA 3K0FA 3ESCA 4PQFA 1PJCA 4QYWA 5EHNA 3R7WB 1UBUS 3FCSB 4FOTA 1CFJA 1KO8A 3HXPA 1FMJA 4WLNA 5IH3A 4P58A 3RS2A 3OHMA 3T7KA 4BQPA 1ZK4A 1RQ2A 3HB1A 5DNEA 2YWFA 1D0IA 2JLAA 3MWDA 1DKLA 1E9RA 1EDBA 1Y9JA 2D54A 2WWWA 4ML3A 4NV1A 4UATA 1Z2PX 4MWBA 5F1YA 2H92A 3VDMA 3LDUA 4P3OA 1ZQ9A 3PFIA 5HQ3B 3DE7X 4RWZA 3JS5A 1Q3TA 2C9ZA 2BMEA 3ANMA 4MWEA 3EWNA 4RA9B 1AV6A 1Y1LA 1CETA 1L1EA 5GQSA 3WWPA 5ARBA 2PRIA 1E4VA 1YZYA 2YXBA 3O91A 1HLDA 4RS3A 5TMPA 4CEHA 1E2DA 2L82A 3GAFA 1OC4A 4G4SP 3BC1A 3OCCA 3WO0A 4ZV4A 5I9BA 4PGHA 4C21A 4E21A 4UTNA 3GEDA 2B37A 2WEKA 3BAZA 3ZWMA 1N1DA 3QW4B 5KNBA 1U9YA 4Y2HA 4WN9B 2AG8A 1Y6RA 2Q3MA 4M0KA 2XGGA 1AA6A 3WIEA 4TTAA 1RBYA 4TTIA 2EP7A 4IO1A 5HXAA 4CPDA 4K2HA 2FX2A 4XX1A 3WK4A 3CJQA 1P75A 3C7CB 5AFSA 1L4EA 1JDBC 1R15A 2CJYA 3O9VA 5CVVA 5A3JA 1G55A 3QLVA 2WZCA 5HKOA 1BN6A 1B4DA 1G0NA 1DKOA 4K46A 5KOJB 3C1TA 1XQVA 4ZT2A 1UZUA 4C1NA 1JEOA 1T4GA 4D46A 3E81A 5FBQB 3VR6D 1V9SA 1FJ2A 3LP5A 4GL4A 5CB4A 1J1ZA 1G21B 4MO9A 1ECGA 1N2GA 4RHEA 4LAFA 1EFPA 3KSUA 2E6KA 4CMKA 1GZUA 1JPNA 3T9CA 3D0RA 4D3DA 2QN3A 4X7PA 3ZDXB 3NUZA 4C7JA 1KIMA 1YK1A 2ZUDA 2YC4C 4F3RA 5K8JB 2J0EA 4EPXA 3KLOA 3GMSA 1DT5A 3MWJA 5ITWA 1Z5NA 2EAUA 1WKBA 2H16A 1GGVA 1O57A 1YDEA 3HO8A 1DIHA 5L45A 5JH7B 2EFEB 2GEJA 3KZ1E 3OY2A 4X6YA 5HMLA 5I45A 4BFWA 2NIPA 4X1YA 1NLMA 3M4JA 4NBSA 4LVUA 3UOAB 2I3ZA 3CF4G 1ECCA 2ORVA 3X1YA 5JD3A 1TYAE 4BJ6A 4BO6A 4X24A 1QPZA 3C7DB 3L8FA 1ETUA 3GARA 5HEKA 2ZUUA 3MMXA 3RS5A 1TZJA 4BP1A 4F21A 3UEOA 3HUDA 2H51A 2ZYHA 1XU4A 2P4UA 1QS0B 4UHDA 3U09A 5DRTA 3J81k 1HYHA 1E2BA 4TTPA 2WWVD 1VDMA 4NPHA 3NTLA 1PV1A 3TK1A 2ISQA 2LZ0A 5CXQA 4FX5A 2VJMA 3AR7A 3HJCA 2ETXA 2LKDA 3EHEA 3HQ4O 3N2EA 2V03A 3D7KA 1Y7PA 2YWJA 3A6EA 1EYZA 2IYEA 4MVXA 4M1MA 1H4SA 1WB4A 1P6XA 1KEKA 4KXXA 2J5QA 2JAPA 3LWBA 2EP5A 3A4NA 4FMCB 1C9KA 3GJXC 3ZWYA 3I2HA 3C8HA 4DHWA 2BFAA 3JV7A 4EO4A 2Q45A 2ZIEA 1JIIA 3SDBA 6LDHA 2OY0A 4TLEA 3JWJA 5DIZA 3PC4A 4LOHA 1G3IA 3BWCA 1WMFA 3URMA 4YCSA 4YXWD 2CVOA 2AMJA 4NG5A 4LYFA 2PRZA 2KJQA 5DO9A 4H18A 5AKKA 4IIJB 1VKZA 1ES9A 2C31A 4IIXA 1HLFA 4DIUA 1GGNA 5SZJA 4F3TA 5BYJA 1OFIA 1PR4A 3B7WA 1BQEA 5SYAA 1EKXA 5ALWA 5AUOB 4J4TA 3GEGA 4TS3A 1UZAA 4WESA 5HUJA 2QJRA 4JXJA 5EUMA 3SEZA 3NHPA 3D43A 1I3KA 1P7YA 2E87A 3BB4A 5CW2A 4J7CA 3EYAA 1PTJA 1FU8A 1RACA 3PEYA 2JIDA 2PH1A 2ET6A 2I4RA 5DLEA 3MAAC 3TMYA 2AE2A 3WRWA 4ZYZA 1YZKA 2I7TA 2NZUG 3E5MA 2YWXA 3G2JA 2X0NA 1OFVA 5EN4A 1CRQA 4PO8A 1E79D 3OCZA 1UP6A 3HJRA 1JZQA 3BE8A 4XFDA 5F2NA 3BE4A 2FEKA 5IH7A 1YBFA 4AIIA 4CCSA 2O0LA 1YI1A 3O92A 4JJ7A 2O2CA 1XLTA 3BL5A 4GDMA 4LOJA 3DTNA 2WPDD 5EJAA 3DA8A 4D4MA 3ET5A 4Z9BA 2ZE6A 3A32A 1D2CA 3CZ5A 5DNVA 1NQVA 1K7XB 3WV4A 1VE1A 2BDUA 5HFNA 3BH0A 4LA4A 4RMNA 2HDHA 5DNDA 2AKEA 2IUEA 4LXTA 3ZCUA 3A11A 3FNHA 1L7OA 2GN6A 2GN2A 4RD3A 3VGJA 1IQUA 3J81A 1KMHA 1OH8A 2YFHA 1KY5A 2R9VA 2VDNB 2P8SA 1S7GA 3THSA 4ZI7B 3HXOA 5FR1A 5AW7A 1CQZA 4AJ2A 2D5LA 3E2IA 1CC1S 3KBOA 1QQ6A 2HL6A 2O2JA 4RVGA 4D9HA 2GMWA 3G68A 3GEEA 1L6IA 5K20A 1CFZA 1GGFA 4HWSA 2PJDA 1F0PA 3DFMA 1JLSA 2WJWA 3AKCA 4LCJA 3W79A 1SBNE 2UXDB 3ZCVA 3L7BA 1WCV1 2EZ9A 3A2NA 1C8KA 4J6FA 2YS7A 1HG1A 1T5LA 1RDFA 1QE0A 3RC7A 1CHNA 4JYMA 1W19A 3T0FA 1Y7LA 4XEUA 4DUGD 1JT9A 1RRVA 1ATIA 3N39C 5DM70 1QZTA 4PLGA 4EF4A 1G6OA 1N77A 1K4YA 3A3OA 1NPTO 3QLEA 1QGUA 3PLNA 1XXHE 3I32A 3PD1A 4I7EA 4Z9XA 1ABFA 1I3NA 1ADBA 1OFTA 3HB7A 4FYXA 3WB0A 4MGKR 1JI0A 1C29B 5AQEA 4OHXA 4BQFA 3KQQA 4R2JA 1YBAA 2D0OB 2DHRA 2FGKA 3PUXA 2GTHA 3GEBA 1FRVA 2CHVA 1AC5A 3LVRE 3GLSA 4K88A 4ZA2A 4GEKA 1W88B 4XAQA 3W3AA 1GFZA 3C39A 4J0IA 4RFVA 4KQCA 1AS0A 1GQYA 1TU4A 4OHFA 5JAUA 2H9IA 1OI3A 2R5NA 3C24A 3OD1A 4MKHA 4BECA 1JG1A 5AOAA 3ZOKA 3LWDA 4C4RA 2DUJA 5EXDA 4AZSA 4R9SA 1E8NA 2GFIA 4DM7A 1XVUA 4EFLA 2RAFA 5AK6A 3FYDA 2C2HA 5IK2A 4UUQA 4B9EA 1AGXA 3BA1A 1WU7A 2ICAA 1TJ3A 1WEKA 4IDPA 4QRDA 4GU5A 1THTA 2IY8A 1T36B 5DN9A 1SULA 2FWBA 1X7WB 1VCNA 1YGPA 3LQKA 4M1EA 4WZAA 4C43A 4F6RB 1RQRA 3K1YA 2QT1A 1M66A 1XVIA 3HP4A 4DA7A 3L7OA 3TPZA 4E1BA 3O8OA 3L8DA 1Z35A 3WL3A 3H2GA 1EFVB 1BS2A 1II8B 1LBHA 1NBIA 5BNFA 4A9AA 1R1DA 4EG4A 3G6KA 1JJVA 3FBWA 3OT1A 1S8OA 3ZEAA 2AN9A 3ZHYA 2ROQA 4DJTA 3TRIA 5FTNA 5CH8A 4YP9A 4R6WA 3CCBA 5GV8A 1T3GA 3MINA 3H75A 4R9UC 4RHFA 3CVJA 1LW6E 3CLRD 2YN2A 2I4NA 3SFTA 2YNMD 3OESA 4Q3KA 2F17A 5TPWA 1PNVA 1NMYA 2CL0X 2GNPA 2VF8A 5I8PA 4NF2A 1G38A 2ZBVA 5HK8A 4XM0A 4RZXA 5DTEA 2PBRA 3C4QA 5E3HA 1O6FA 3AKEA 2J46A 3ZZ1A 1JTEA 3AQ4A 5AM0A 2WHPB 1Z8NA 4REMA 4BBPA 3S68A 1U2ZA 2OAP1 4QHTA 2V6GA 4K86A 5AVQA 1AMUA 1DBPA 2I34A 4POOA 3IB6A 1XQ9A 5BRJA 5EG5A 5JBQA 3NDBB 4QJ4A 1K0FA 4G26A 3T3EA 2PLNA 3AUFA 1RAGA 3TR5A 3JVIA 3EZ9A 3LG2A 3OQMA 3UMJA 1L5WA 1KIAA 3KYCB 3QTTA 4BBZA 2OCKA 4MB6A 2O3UA 3RTCA 4DR4B 3ED1A 4BTVA 5LXTB 3DDSA 1EG7A 3QI2A 1K3UB 1I10A 2GXSA 1JKIA 3EOBI 2YHIB 1EX7A 1YSCA 3DHYA 4M8SA 5TVGA 4Q7QA 1HNZB 1UZMA 1SUFA 1WV1A 7MHTA 3DPUA 1EBUA 2W58A 1PR1A 5HF6A 2I29A 5CB4F 1MORA 2C2YA 1N8NA 2IFTA 3LFUA 2IX3A 5DLYA 3A9TA 2FWIA 4EHLA 3L82B 1QQTA 3KEFA 3IEMA 4JKYA 5IKOA 1X7XA 3N0XA 2JBHA 2VQ6A 3W9UA 1H6CA 3F5DA 2FHPA 3WYBA 4DZTA 3AI3A 1RC8A 1XL1A 3E82A 4L3OA 2ZR8A 1ZA2A 4DL9A 2QUBA 3JQ8B 1DC8A 1QGOA 2ZXFA 3FAZA 5CLHA 3NBMA 2J9ZB 4I4CA 3RPEA 4TTRA 4LJKA 4TX1A 2VHZA 3PPYA 4RKYA 2R1ZA 1CQIB 3UGJA 3EVZA 1YU9A 4YBRA 1N4AA 4O63O 5F9HA 1YRAA 5F5LA 3QVKA 1MP0A 3I39X 3OCWA 5LQDA 3KXDA 5SY6A 2HRBA 2AA3A 2DFTA 3V8RA 3ZBTA 5HWSA 4H1WA 5JXIA 1E8MA 3X1KA 5JAPA 2X1MA 3GA0A 2ZGVA 1VKRA 3JVEA 3CNOA 5F12A 3ZBPA 1I13A 2J9GA 3IXMA 1EJBA 4TM8A 3B70A 4ECAA 1IM8A 1GTL1 1I24A 1EUZA 4JASB 2O20A 4LRSB 3KLPX 3ESXA 4I5DA 1N4DA 1V4VA 1EDZA 2Q3JA 1H2FA 3F3MA 2GF0A 1ZK1A 1X1AA 2QP3A 3K4HA 2O3SA 2QVCA 3HVJA 2ODTX 3P5BA 2V65A 3PU6A 1L2TA 4KE9A 4PAWA 2X1LA 1KMCA 4WMLA 3EN0A 2A9JA 5KWVA 2GLTA 5CK4A 5E6SA 1IOLA 3PK0A 3SSMA 1NPDA 3TZKA 1OFUX 1GQRA 4TVKA 1KZ1A 3BK1A 4W5HA 5FI3A 3S8EA 5BNWA 4S1VA 3EVGA 3QBDA 1CZRA 1JP7A 1U0BB 2PEYA 3PJEA 2CSUA 2C2WA 1R4ZA 1ZI9A 3QKTA 3PC3A 2QG4A 2Y8EA 4DR2B 4H7HA 3GLGE 3LCVB 2GJ8A 4DA9A 4LXQA 5BSUA 4D4JA 2HD4A 1Q50A 3LX8A 3HBJA 1UBTS 1X70A 2H3HA 3QELA 2CKMA 4CKEA 3OX1A 4QTYA 1NVKA 3LUPA 1XD9A 5CP8A 1U7UA 2G9UA 4UPEA 1YZFA 5E4TA 2XZLA 1SEVA 1QCYA 3OZVA 1AS3A 1V5IA 4HI0E 1S4MA 1U0FA 2G25A 3N8HA 5IAKA 5IM5A 3WFJA 2UYCA 1NXOA 3NBQA 3PGMA 1LSOA 4U4AA 2AT1A 4AAYA 3T3NA 1KDOA 1WETA 3L79A 2J3IA 2OBBA 5DBHX 4D41A 1NJGA 3RQSA 4M46A 2HO4A 2IIBA 4B84A 4WXEA 3G5TA 5GWXA 2PX8A 5JPIA 3W77A 4Q3AA 5K2OA 2QX9A 5JYBA 3WX0A 1KRWA 1THMA 1T5IA 2MR5A 4XD7D 3H9GA 3GC6A 4CTKA 3RJTA 1G8GA 2VCEA 3CBGA 5LDGA 4MMXB 1VCOA 3B2QA 5DSZA 4U7HA 2CYCA 4EMUA 2RH9B 4ZO7A 1J2TA 4FDLA 4QTTB 5K8CA 3FA2A 1IN7A 1HUQA 2KBEA 1T0JB 1XWWA 4Q9NA 3OFJA 1I5OA 2ZSIA 3AWDA 4N5IX 1BMQA 1WY5A 4JX8A 4H9GA 4P35A 5C8VA 4ZT6A 3DEYX 5K99A 4OJKA 5CW1A 8ATCA 5F73A 3D4NA 3D8BA 3H2HA 2VDWB 3CY6A 4GR4A 2IELA 4EPVA 4OFBA 5ES3A 4YRFA 1FW6A 2PY6A 5L3SA 1AKMA 2VF4X 4YYEA 1UQRA 3IVCA 3PYXA 4CEIB 2JHAA 3TW0A 1EQAA 3TZLA 1FYDA 2IUFA 1D2RA 1J9GA 1PS8A 4ZYYA 2IOQA 3NXSA 2AQHA 2FUG6 1O95D 3TMAA 1OIVA 2XVXA 3D7MA 3C3DA 5TXGA 4BASA 1U0JA 1EQUA 3O93A 3TLAA 3ONNA 4G5XA 1QANA 1TUBA 4U5XA 1OX4A 1FUYB 1IUKA 3HDHA 3UJCA 3W4IA 1YACA 4EH1A 4K9LA 2FOIA 2VP9A 5CX1A 3CF0A 1TA9A 1QH9A 5H80A 4HQLA 4KAXA 2VDQB 1CE8B 1R16A 1UFOA 3JQRA 5BQPA 2IIQA 3LBYA 2R8RA 1UBCA 3EC1A 3EFOB 3LRPA 4URZR 2JIQA 3PHGA 4KREA 3E7XA 4QBGB 1QYCA 5AUNB 4PZPA 2FX3A 3AXTA 4HGNA 1RM3A 4H35A 1JLKA 3P9YA 3SQDA 1YC2A 4XJTA 1T3TA 1QG6A 4R1SA 2V6JA 4CQLA 3ZD7A 3IE1A 1J33A 3H9QA 4AZ0A 3B3AA 4DM3A 1YQEA 1X9IA 2J59A 4EB6A 4CIYA 2FQWA 3LY7A 4YXFA 1XEFA 4U3JB 2B7CA 5TEVA 1SUBA 3EEIA 2HJGA 5L4LA 2XH8A 2CKDA 4H31A 2PKXA 2IYAA 1U8ZA 3EVFA 1G291 3NHFA 1CEXA 3KT6A 2H4XA 5EKTA 4RM2A 3NVKI 2NZJA 2ZZMA 1MFZA 1SCIA 1R0KA 3E3OA 4G07A 4HFMA 5G53C 5CA0B 1SXJB 3T7RA 1MGOA 1RM0A 3EGIA 1OD6A 4UU1A 2ADFA 2B34A 1NWHA 2VWHA 2QTZA 1SHJA 4BLRA 4L6IA 2A0UA 2GBIA 4ZQHA 4B3HA 5LYJB 4X64B 3LF2A 2OXEA 5I4KA 3MJFA 2IYFA 1IYZA 1KEWA 3V3TA 1NYRA 1Q91A 4E22A 4UQOA 4MI3A 5FF9A 2HM7A 4K6CA 4BNIA 1H2RS 2N1BA 3LFHA 3LHSA 5E9AA 2G4CA 3HP7A 4YP7A 1XWFA 3WQBA 3KEMA 3AYZB 1SUPA 3PI6A 1GT91 2Q4TA 3O74A 3GJ7A 2X41A 3Q9NA 1Q2UA 2FF7A 4JMLA 3KK0A 5EGSA 3IMCA 1ZISA 3W2EA 1G8HA 3SBOA 1Z4QA 2XA1A 1NQOA 1OBCA 1KYZA 4MLZA 4XYEA 3WRVA 4BAUA 5J3JA 3WQSB 4YJDA 3KCQA 1E96A 1ZC3A 3RC8A 1Z06A 3NDRA 4HUTA 2P9QA 3OZFA 3QVUA 1XNHA 2IT1A 5LB4A 3I5YA 1GTMA 1XJ5A 4NYJQ 2ISCA 2A3NA 1J2EA 3PC8A 1MO3A 4C5BA 5EXEA 2KSQA 2FRDC 5MFZA 1RAFA 2VR1A 3AONB 3OU6A 3KQYA 3LX5A 2HJ9A 3OURA 2GPWA 4RTLA 3UIEA 5JAQA 2XKJE 1Q1GA 1HDCA 4PYIA 2BMDA 2IYTA 1GL7A 3R7BA 2AD1A 3T7CA 3U4GA 1NJ6A 3JALA 2W6IA 2DERA 3MPOA 2IRWA 4GVPA 3T4XA 2RHMA 2OL4A 4JBWA 4AYXA 4FQ8A 3FRJA 4NZYA 5KIAA 3U61B 1J9ZA 3MHPA 2IH2A 4ZVKA 2QM8A 5FUXA 2ZT6A 2PU5A 5JSZB 1O9HA 2XUJA 2A7XA 2IOFK 2ZWIA 3K6KA 3WHIA 5IKEA 4C0HA 2OUIA 2AZTA 2DFKB 1Y4ZA 3HN7A 1R4MA 3GNSA 4INPA 3B3FA 3Q7QA 1HYQA 1EI9A 3BD6A 4KN9S 4P81A 4F97A 3UO8B 2V5AA 1GARA 1I5RA 4EJSB 2ZTVA 3WLNA 5FLXA 4I4LA 5EUQB 4ON9A 1NVXQ 2QYHA 2VUUA 1JQBA 1YD7A 4UHJA 3WYEA 1Z0FA 1TYZA 1ESZA 2PYIA 4ZDIA 3EGVA 4YJ2A 1DO8A 1C30B 4Z4FA 3K35A 4EG3A 4YCJA 2QTVA 4DYVA 3FDFA 5FPPA 3DO5A 3UUEA 1H42A 2Z2JA 1G8AA 1ISMA 1ULZA 521PA 2FG5A 5DHQA 5JE8A 1RTKA 4B74A 1V8BA 3F6CA 4M0LA 3EIFA 2W43A 4XFKA 5KZMB 1AGPA 3GVIA 3ONDA 4RVCA 2IHTA 4QU0A 3EGXB 4MICA 2ZM6B 1Z45A 3OWXA 3C70A 3BHIA 5JSUA 3ENQA 3U7EB 2ZG6A 5A4IS 1AF4A 4H4EA 2RGDA 4IDOA 5E6UB 1HKUA 4IXWA 3VX3A 1QFXA 4XGRA 5BSWA 4URXR 4K28A 2J3JA 2R5WA 2Y2VA 3O8RA 1BJRE 3ND9A 4GLOA 4K87A 3GZNB 1R6DA 1SVKA 2GETA 3Q98A 2WIAA 3IBCA 3ZHVA 1HC7A 3LECA 5KYKA 1GRNA 3FMGA 3M6VA 3LKBA 1VOTA 3KP1A 1U6IA 2VDMB 1DC7A 2PIDA 4A6XA 2A1UB 4GICA 2Z6UA 3OUUA 2JH3A 3T3OA 4DLSA 1GKUB 1JQ3A 4XWKA 2I8LA 4HDMA 5F1KA 2HREA 1PS0A 3PXBA 4ZVQA 5TT1A 3JD1A 3L1HA 1A69A 4ZAVA 1HFWA 2HC9A 3UC5A 3EUFA 1PUJA 2MYUA 3M5WA 4L4ZA 1P0PA 3IODA 2BFOA 2Q6LA 2Z4RA 4FILA 2FWPA 4PSDA 2BTOA 3FGNA 1JDTA 1Z6ZA 1N6NA 2OBFA 8MHTA 3SIRA 2O8FB 5IAOA 1EINA 2JF0A 1IXKA 4BMPB 2ZQ5A 4Z4CA 1NBMA 1MNAA 1WRBA 2VJNA 3H2YA 4MWDA 4DDUA 3VPGA 3N3BC 4M6WA 3AUXA 1W30A 3KT3A 3W8DA 2CJPA 4QWWA 4C22A 1LJ8A 2CCKA 1G5RA 4Q9DA 4TTSA 4QYMA 2ZIGA 1X42A 1Z2AA 4JL5A 1M54A 4YRAA 3D3WA