3K7EA

Crystal structure of human ligand-free mature caspase-6
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
259
structure length
214
Chain Sequence
b'PAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRIGKKQVPCFASMLTKKLHFFPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Structure-function analysis of caspase-6
rcsb
source organism Homo sapiens
molecule tags Apoptosis, hydrolase
total genus 72
structure length 214
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k7eA00
5H0IA 4N7JA 4IEFB 4NOMA 1JXQA 1NMQA 2C1EA 4LSZA 5LUAA 4JQZA 2J30A 5IBRA 4EHNA 2H4WA 4D3YA 1QDUA 4FGUA 2DKOA 1RWMA 3V4LA 4DCPA 1I51A 2QL5A 1RHUA 2XYGA 4ZVOA 1K88A 1QTNA 4JR1A 4N6GA 3R6LA 4QULA 3D6FA 4JR0A 5IARA 3R5JA 2Y0BA 4FXOA 4QUEA 4EHFA 3NS7A 2FP3A 3NKFA 3V55A 1I4OA 4ZVUA 4AW9A 4I1PA 4ZVSA 5IANA 5IAKA 1RWVA 4QU0A 3R7NA 3KJFA 4N6NA 4JJEA 1BMQA 3V6LA 5IC6A 2QLBA 4DCJA 4JR2A 4FEAA 3DEHA 3QNWA 4IYRA 5IBPA 2CNKA 3R6GA 4M9RA 2AR9A 4AWAA 5JFTA 1CP3A 3K7EA 2C2ZA 2H4YA 2QL9A 1RE1A 1RHQA 4NBLA 4EHDA 5IAJA 5K20A 2CNNA 3DEJA 3H1PA 1RWXA 2K7ZA 3PD0A 4PS1A 1GQFA 1KMCA 1RWPA 1SC3A 4JJ8A 4DCOA 2CDRA 2J31A 2XZDA 4NBNA 4PS0A 3OD5A 2HBYA 3SIRA 2QLJA 4D3ZA 2H48A 3V4OA 2C2MA 2H51A 3V3KA 1M72A 3R7SA 3P45A 3S8EA 1NMSA 1ICEA 5IBCA 1RHJA 2H5JA 3ITNA 4NOLA 3P4UA 3R7BA 1PAUA 4PRZA 1RWKA 4ZVRA 3EDQA 3H11B 1I3OA 2WDPA 3GJQA 4I1RA 4EHLA 5LU8A 2CJXA 2CNLA 3BIJA 4EHAA 3NR2A 2HBZA 3D6HA 4QTXA 4QTYA 4QUHA 1SC4A 1QX3A 4PRYA 5LU9A 2NN3C 2H5IA 4JB8A 1I4EB 3DEKA 4QUBA 2J32A 1NMEA 1RWOA 3V6MA 4N7MA 4ZVPA 4ZVQA 2P2CA 5IC4A 5IABA 3E4CA 4EJFA 1SHJA 3H0EA 2XZTA 3UO8B 2XYHA 2XYPA 1PYOA 1RHMA 3PD1A 3H11A 5I9BA 3S70A 1F9EA 3RJMA 4EHHA 1GFWA 2FUNB 2H54A 2C2OA 2HBQA 2Y1LA 3EDRA 3PCXA 1NW9B 1RHKA 4HVAA 2FQQA 3KJQA 4FDLA 2HBRA 2QL7A 4N6OA 4QUJA 4AWBA 5LUBA 1K86A 4NBKA 4QU5A 4HQRA 5IAGA 4QUGA 3SIPA 4D3XA 2CJYA 1IBCA 4NOKA 5IAEA 5I9TA 3KJNA 1RWWA 3GJRA 4JJ7A 1F1JA 1RHRA 3H13A 4QU9A 4NOJA 3UOAB 2QLFA 3GJSA 3D6MA 3R5KA 4JQYA 4QUDA 2H65A 3IBCA 1CVRA 1SHLA 3IBFA 1SC1A 2CNOA 4QU8A 4ZVTA 4EHKA 4QUAA 2J33A 2C2KA 3GJTA 3DEIA 4HQ0A 4N5DA 1RWNA 5IASA 4QUIA
chains in the Genus database with same CATH superfamily
2QRUA 4GP9A 5BR7A 2FPOA 3FWZA 5F7ZA 1MAVA 1I2CA 1P6UA 2H4FA 5HJ7A 2AOUB 2WR8A 3IERA 5I7HA 5FEUA 3DZFA 2CHGA 2JGDB 1G60A 1UJCA 5IF9A 2I3DA 3RIGA 1WU7A 1B8UA 3ZWCA 4FGUA 1RQGA 3CQ9A 3NBUA 3KALA 1TZMA 4R8RA 1I7LA 4LNUA 2PGDA 3T5GA 5JXGA 2Z2ZA 2VBFA 1NMYA 1NR5A 3FY4A 4YJKA 5KSWB 4QOJA 4IL5A 3SS7X 3OI7A 1GAEO 1LJUA 4JJ6A 4HDQB 1Q95A 1RW4A 3M3PA 3F6RA 1OTXA 5KKCA 1KDRA 1PW5A 2XOKD 4BIMA 1E32A 3VDXA 2Z8XA 4NNJA 4CCSA 1F0KA 1NF2A 2HHJA 3E58A 3LFHA 1BDJA 4J07A 3AG5A 3AG6A 3FZGA 4QU0A 5BV1A 2VAMA 2Y1KA 1T3LA 3TINA 1NULA 1Q3HA 4C2BA 3L4BC 3VC1A 3LXMA 1UUFA 3U3XA 5ISMA 2I99A 3VAAA 2JCBA 2HIAA 4KSBA 2HMUA 4FC7A 3EUEA 4QDUA 4J0FA 4UVHA 1E20A 1D1PA 4DQLA 4ZARA 4ESVA 1JHQA 1FTWA 1Q1BA 2YFHA 4QAQA 5EJEA 1NFFA 2BCEA 3QMMA 1R6DA 2JI8A 3O84A 5AW7A 1LY1A 2O3SA 4XYMA 2FMXA 2P6RA 3DEYX 4G1CA 4OI2A 3DV9A 3WX0A 5CA1F 5IKEA 1CJUC 4UJ3A 4GC5A 5TB5A 3WLAA 1PYGA 4NEQA 2V5VA 1P2BA 1FC0A 2BHSA 3HR4A 5ALFA 5CHYA 4YAWA 3ACDA 3TRFA 1R4MA 4Z9XA 4KLNA 2EBUA 2OP1A 3GZTB 4QOFA 3VYUB 4E5MA 1VJGA 2P2DA 3DLPX 5TARA 3LKZA 2QNBA 2I1QA 2FFHA 1NMZA 3SJ7A 4ROTA 3V8RA 2LIPA 3ZW9A 7REQA 2AI1A 3HKEB 5CB4B 2CFIA 3H05A 1VLMA 2K4MA 3EGVA 2DHCA 5KYUB 2I34A 1NVMB 2YVKA 3ASUA 4TVKA 3V5NA 1NJ8A 2OYCA 3WYFA 2IPXA 3BGDA 3Q88A 4KXUA 3OCUA 1CJMA 1SKQA 3PIIA 4LDNA 4NK5A 5LQUA 3T99A 2X8JA 2GD2A 2PO5A 3GDHA 3BXHA 1GAXA 4ZRNA 2F3PA 4N40A 1V2HE 3AK4A 3PGXA 4EJSC 1UKEA 2C92A 2X5KO 4CIBA 3I2HA 2V96A 4PLZA 4ENPA 1WP9A 2OECA 3HXTA 3Q7EA 3RC7A 3AF5A 3WJ2A 1VSQA 2H8GA 3VSDA 4ARVA 1NAHA 3L40A 1WBJB 2XWJI 3DOFA 5TSDA 3NORA 5TQ2B 3NNDA 2DC1A 3WMRA 1KIFA 5A6VA 2N42A 4X1IB 2V7XA 2OGUA 2OORC 2C2GA 2HX1A 5EXPA 4AZVA 4OYLA 4PPNA 4CCAA 2DTDA 1XXHB 1AMNA 2DSNA 2Q8QA 3A31A 3BL6A 3D1VA 4YAJA 4BNLA 4D9NA 1X2EA 1V1MB 2GNOA 5AKGA 3NUQA 4MP6A 1ZD8A 1Z0FA 2P77A 3QKTA 1LFAA 1DJQA 4LF4B 3L6UA 3DOEA 1AS2A 3H99A 1CZLA 4YJ2B 3DJFA 1NXOA 1YDEA 3T4XA 3EXHA 3T7AA 1NMQA 3EFBA 2CK3A 3QVLA 4A0SA 1MD9A 1RDFA 1T15A 3CHYA 2G9VA 4YRGA 3T8YA 4BJ5A 4YT8A 4IBOA 4AS1A 4Y2PA 3K9WA 1YR6A 2FPLA 1X8LA 4RQBA 3EVCA 1N2JA 3CWQA 1NTOA 4GOMD 2ZWIA 2IHBA 3HO8A 3P9CA 5AICA 4CQLB 3CUKA 3OOEA 2FWJA 3FCAA 4JR0A 1Y48E 3GMSA 2QAGC 2QQGA 5I45A 2GPYA 3HBNA 1EB9A 2FP3A 1GL7A 1J22A 2ADOA 4RDCA 3WYGA 4BFZA 2V98A 3TTWA 1H1LA 2RE8A 3BWXA 1EVYA 4CM1A 2PANA 3EXIB 2CFRA 3ND8A 4JBWA 2W37A 1XZFA 1G2PA 2K7FA 4X44A 2M6LA 5HK8A 1G7SA 1XP5A 1ZUD1 2W6ZA 1NUAA 4XARA 3IQFA 4MV6A 2IV7A 4AZ0A 4BU1A 1LNZA 3I72A 4UZSA 1ZESA 4ZIRA 2XVMA 3PX7A 2H2AA 1K7CA 1VSTA 2RJNA 3G2OA 2FMTA 1DCMA 2DUNA 2HDOA 2PSFA 3H1PA 3VXKA 4CMJA 5EJ6A 4KE8A 1G66A 1LA2A 4MROA 5L9AA 1F3OA 1ISMA 3V8PA 4HG2A 1FQJA 3HA3A 5AVWA 1TGVA 1BWPA 2BCJQ 3D0OA 4BMSA 4I8DA 1DAOA 4DR3B 1YZFA 1YJ5A 4QELA 2WHYA 1FW6A 3CLTD 5DNDA 4E33A 1PCXA 4HYTA 1P19A 3CNOA 4AF8A 4CODB 5JTUA 2VQ3A 3KVVA 3GLIA 4JYZA 3UJ9A 6ADHA 3MUEA 3U9LA 3EWIA 2FQXA 4V0RA 5IEBA 3A32A 1QMPA 1Z4JA 4UEWA 2V74B 2B5VA 3ADPA 2PBLA 4O8ZA 3B9PA 3R3WA 4RSRA 3KCQA 1BGWA 4B73A 4L74A 4GL2A 3R7WB 4CL2A 1KRHA 3A6DA 2ZTSA 4IVPA 1B6GA 3L6BA 5E7IA 1T8TA 1EJ6A 2H8KA 4JMLA 5SZIA 5KVSA 4JUCA 3WL5A 4PN3A 1GU1A 4N65A 4I9NA 2BFAA 2HZBA 4QARA 3JRXA 2D1SA 3FOCA 5KVAA 4KLAA 1ODJA 2OHFA 1T91A 2WAOA 3CWZA 3HDJA 4HUQA 5FBQB 3CZ4A 3OPVA 1PNQA 1Q2UA 5ENZA 4BVKA 5JECA 2EKPA 1FB5A 3FDJA 1TKCA 1XYYA 4IKPA 1DC7A 1UBEA 1S2DA 1IBSA 3V8EA 3RADC 1X7DA 2R6DA 3KQPA 3FPSA 1RZ3A 1PGQA 1DMRA 2JIOA 4ZYUA 2VWPA 3VHRA 5D6NA 3QJYA 2FN4A 2FMUA 5K01A 3W5CA 2ZE8A 2J4DA 4NR0A 1T2EA 1PR1A 4FZ3A 4I5EA 2CNOA 4NAHA 1JHOA 2SHKA 4RWEA 2EKLA 1C8VB 2J33A 1H2HA 3VU0A 3CC8A 1QS0A 1BEZA 2H52A 3AR2A 3RVSA 4AAYA 3D8HA 2WSYB 3VR6D 3PLNA 2G5TA 1LX6A 2M2IA 5EMJA 3CVXA 1R10A 1YZLA 2Z4RA 4GICA 1GUYA 5AW2A 4R9SA 5D6OA 3JQ6A 1X7ZA 1FFWA 1OZ0A 1KKLA 1SOAA 2WIJA 3FLBA 5ED4A 3ETNA 3SAJA 2W8BB 3A6PC 3DT9A 4WHMA 2AMJA 3IE1A 2CJFA 2B30A 1W46A 1UMBB 2GPAA 3MJDA 1USWA 1V2GA 4FXOA 3AUTA 4BNKA 3HSYA 3VYRB 1ZU5A 5JAHA 1VL1A 1VPLA 3JQPA 3RAEC 4GMGA 4I1PA 1KI6A 3F67A 5F3RA 2OYRA 3F46A 4QXPA 1MT0A 3ABOB 3MWEB 1YJQA 3AEXA 2Q7XA 4Y6LA 1AGNA 5HOEA 4BVEA 1H93A 2ODNA 5KX5B 5SZHB 1VA4A 2FQWA 3IVXA 5BNIA 3THSA 1ZO8A 3IHLA 2CNKA 4IXTA 1XU9A 1KWGA 1G64A 4UOEA 2P11A 2J3JA 3E7DA 3F3MA 1Q1AA 3OZXA 1UJ5A 4GLBA 4RKWA 5BN4B 5JS8A 3T5PA 4YA6A 4QQNA 1QDEA 4IDCA 2JA1A 2XGMA 4MV0A 1HSOA 1N9ZA 4G5YA 4Z9YA 5JC8A 5HTKA 3O4RA 2PPLA 2XNDD 1BXKA 4PNHA 4DLVA 1OX4B 5B1HA 3BBLA 1G5FA 2I6UA 4JL6A 2HA3A 2IEYA 4DXAA 4GVLA 4X90A 3VSCA 2VZEA 1PVVA 3G2QA 2O2HA 4BFTA 3KWFA 2X19A 3M1AA 2F1OA 2Q41A 5AK5A 4CG2A 2A33A 3D1JA 2Q07A 1L7XA 1U2RA 4I6EA 1XZAA 3N7TA 4JYMA 5EEGA 3VV2A 3OE5A 4Q7KA 3TOZA 1SUSA 3W78A 2ZRFA 2RBEA 2YY7A 3GHYA 1CYDA 3OY2A 4Z4QA 1OHHA 2VH2A 1MO2A 4J16C 3IAUA 3LCJA 4OAQA 1N2EA 2HF9A 3D6UA 3Q3CA 2XCSB 3SF8A 1PFGA 1QQ5A 2P78A 2FJPA 2QD3A 1ZD1A 2JKVA 3LU1A 2QPOA 4Q24A 4QXMA 1V8PA 3TPZA 1OXSC 3KJEA 1IUOA 3BWYA 4HX2A 3ZHBA 2QY6A 4BRWA 4D5GA 4JB8A 2WJ3A 4GZLA 1JFLA 5B55A 4DR7B 1Q77A 2HSWA 2RBKA 4BLPA 1X0VA 5KNDD 3BE4A 2P6MA 1VJTA 1A69A 1UDCA 2JS7A 2JASA 3LL7A 3VR5H 3DOHA 1GFWA 2I5PO 3MB5A 4DHEA 1N0HA 4IOJA 1IVSA 1NVXQ 4HZIA 3PKJA 3CZQA 2WTAA 3SFZA 5THXA 3IS3A 3COZA 2QUKA 3ETEA 2JFYA 4BNUA 3GEBA 3CMCO 1Z7WA 3OMWA 4XYEA 3BXOA 4Q3AA 2F8SA 3IR6A 3L1HA 5DM60 5ALYA 4KXYA 5D86A 3ZXXA 1ONBA 2FZLA 4CQNA 4UBOA 4YUZA 2Z6QA 4CMKA 2VHYA 3LDFA 4KN6A 5IDWA 2H1OA 2BSQA 3KUKA 4RL4A 3NIGB 2QXUA 5HS6A 4ZMBA 3R23A 3RNLA 3EEIA 3NONA 1KZ6A 1P7VA 5EIWA 3EQZA 4L4RA 4CN9A 3U3RA 4DSAA 5AI9A 4LISA 4LF7B 1WHTB 2NSLA 4U00A 1L5GB 3KQMA 2Y3IA 1GQ2A 1WXWA 1XQWA 4LXTA 5B4UA 3CF2A 3NI2A 1T5DX 5AT1A 1REQB 4QYIB 2YHSA 4BL5A 4KQFA 4KUEA 1B6TA 2O06A 1FDIA 3H86A 4PONA 4XE5A 5LBUA 2GH1A 1V0JA 2POCA 3BDVA 4H7DA 1Y9EA 1YKFA 2ENWA 4GLOA 2VUUA 5GJVC 3VDMA 4DVGA 1S9DA 1T36A 4RA9A 1K6XA 3SZUA 4JEIA 1XEAA 2ZWPA 3ESDA 1MAAA 1U0FA 2YJNA 4TS3A 1K7SN 3MHPA 4FHCA 3N76A 4UHDA 1ELOA 1J7JA 2OBNA 4MB2A 5HVNA 5IAAA 4H9GA 1VXRA 3UMRA 3UWKA 3QX3A 4FYKA 4IH9A 1Y33E 2CMDA 5C1OA 4GMHA 1GAWA 3KM0A 3L04A 1JDSA 4J6EA 4K3UA 3I1YA 4LVUA 2WWTA 3PHHA 5JLJA 5J2UF 4NH4A 4EEZA 4MVJM 1MTOA 2AG5A 3CRW1 2QZPA 3R8FA 1Z6PA 3U48A 4A26A 3V8VA 1P17A 2Q50A 3R0IA 2EEZA 3NBAA 421PA 2I6TA 3HH8A 1P9NA 3ZCUA 1LPPA 1UAYA 1WDLA 1SVNA 3JATB 4U6QA 4L0CA 5K0EA 4C6TA 1N5JA 1GM5A 1G9TA 1KSJA 1PK9A 3FSEA 3KKNA 1P33A 5IN5A 1W59A 2BP7A 3E9QA 2VC2B 1BQ3A 2CVZA 2DMRA 2P75A 1U99A 3DQZA 1TTTA 1ODTC 1ZN2A 4JDUA 2YV1A 4TSKA 4B44A 3LY7A 10MHA 2CMKA 2Q0SA 1J99A 3VKUA 4L0MA 3MF4A 1ZA2A 3DDOA 3S5UA 4H17A 4BKUA 3SOPA 3EX7C 4GIBA 4X62B 1R5OA 1TEZA 3URMA 3HGMA 1QAOA 1NWHA 3DZDA 1TFUA 3Q5DA 1H94A 2FRXA 5FUWA 3VYWA 4DV5B 4JMPA 5LCXA 2YS6A 3GJQA 3PFWO 4OX9B 1TW2A 5LU8A 4ZT4A 1Y6GA 2W6QA 3QG1A 5E8JA 5GZ3A 3KQTA 1QB7A 4D8WA 4YAOA 2PGAA 5C52B 2QT0A 1XZMA 2XSZD 3WLTA 1N6KA 4TROA 5KYYA 4X3OA 3FPGA 4ZYXA 3U7JA 1N8NA 1IQUA 2R8OA 1N7IA 2VJKA 2H1SA 3Q9UA 1V35A 4CETA 1JHDA 3TW4A 1MOZA 3OUZA 4Z7QB 2CBXA 1BNCA 1GJRA 3OZ7A 3O2JA 1XZHA 1D2EA 3GUUA 2BI8A 1KNXA 2A5FA 2PUVA 4QXRA 4DLPA 3FLMA 3GMTA 1XNHA 3DOUA 4I55A 1VCNA 5FLXA 2UAGA 1OT3A 2AFHB 4TGLA 3RJ9A 3IVCA 1DIHA 5AOBA 4J1TA 5LYYA 3SEZA 4ZYVA 4MHSA 2XBLA 2EBFX 4JL8A 1U3FA 3Q85A 3FKSD 3OKAA 4KMMA 4GS5A 4M1TA 4YN3A 1NM5C 4I4TF 3IC5A 4TV8B 3VR2D 1L9XA 3AIMA 5JOQA 3BTUA 2ZKLA 3KAJA 2YZKA 1XJWA 1B1CA 2UVPB 1O5OA 3GN1A 3LF2A 2WT9A 5FIUA 5TPZD 3N6XA 3NH6A 4FMDF 1A9XA 2WUGA 3CCBA 4Q7LA 3BOSA 4WJKB 1XDSA 5EP1A 1JDJA 1QG2A 1BE1A 4WN3A 3T3OA 1UXGA 1QIGA 3EA5A 1LI4A 3ZWMA 3F5SA 1K3UB 3DHEA 5GIOE 3A9CA 5EXTA 5IP5A 2NUAB 5HTOA 1WETA 3CVWA 2XPCA 1FYWA 3VH3A 4CHGA 1T5OA 2QY9A 3KBBA 4ER3A 3ZJTA 2W2OA 4XLTA 1UPXA 1YV9A 4QX6A 3PICA 2BEKA 3N1UA 2NYVA 3REQB 4C0JA 3K32A 1OGJA 3P26A 3OWXA 4IMJB 5FOQA 2ZB7A 4UBNA 4E21A 2Y93A 2JAUA 4AUMA 4B2YA 3NIBA 1MTZA 2AEFA 1L3IA 3HCPA 5EKDA 3KOXA 1OAOC 2VYQA 5IH3A 1I01A 1XJ0A 3QBVA 1YZ3A 3A8TA 4OMDA 1IZ7A 2VHTA 1CQIA 1NJ1A 1EWKA 3QWAA 4AFNA 3OEHA 1LRLA 1QIHA 1XU4A 1GPMA 1H2ZA 3W2FA 4XYLA 2G0AA 2WSSD 1R0LA 3WLIA 1HXHA 1NBEA 4EHDA 4JWKA 5TVGA 1CF4A 1PHPA 2C04A 5DCYA 3T7DA 4ZT3A 2UYYA 4YDSA 2ANBA 1KBZA 3BF7A 2JBAB 1KEKA 1KH2A 3S81A 4V39A 1UXOA 1GITA 1J1ZA 2Y99A 1W4AA 4LQCA 2DLCX 2CZGA 4B0OA 4YPVA 5JWOA 1PZNA 3D7SA 1DBSA 1L7EA 3D54D 2XE7A 1A97A 4IS3A 3HJHA 3CJTA 4AJHA 4CM7A 2X13A 2HYDA 5LQDA 4ZPXA 4QWMA 2R6HA 2O4CA 1RJFA 2ZTUA 2XIJA 3FJ1A 3NCTA 3PQ4A 2RHRA 5H82A 3UBMA 3O4FA 3ZGXA 2ZCUA 4D6XA 1QLJA 1G20E 1YFZA 3G9TA 3QYPA 2PJDA 3GUYA 5G2OA 3K1AB 3GPBA 4DV2B 1GSOA 2PU7A 2QXTA 1T8WA 4TLDA 1YL6A 2DU8A 4I4CA 2DBRA 3C15C 3TE6A 4YUYA 4ZI7F 3EYAA 4G8DA 2IPOA 3BK2A 2OR3A 1VGVA 1UL1X 2B5OA 3Q4GA 4JNKA 4RC9A 3OFND 5FDFA 4JFRA 2HREA 5JV5A 3WA6A 5EL0A 3BULA 3DVAB 3QU9A 1T4BA 4WZAB 5AW5A 1XYVA 3SMVA 4R7GA 1U98A 4DARA 4I7EA 2IY8A 1NPTO 3QQ5A 5DO9A 1GAQA 1Z4LA 2JATA 1L5LA 5ERGB 1W5BA 4M0DA 1TTQB 3TO5A 2IUEA 1ZQ1A 2ZR9A 1WUIS 3BGVA 3EIUA 2WM9B 4Y7DA 3WSVA 2WF8A 5DF1A 4CKEA 3V34A 2EYQA 4CQMA 5CK4A 3A4LA 1E1LA 2ZB4A 3LFUA 4NS1A 3VPFA 4YMSA 5IJZA 2O50A 3X1JA 1GDDA 2PGIA 3H2YA 1BKYA 1VYHA 2QRVA 1PR4A 2CMGA 2PL3A 2ZBGA 3TXYA 5L95A 1I5EA 1C7FA 1CVRA 1M33A 1U5BB 3KU1A 1BH2A 1GADO 1NKTA 3A1SA 3QRWA 3VU3A 3CXUA 2ZYWX 1ZI9A 4EBBA 4PTLA 2YJGA 3E03A 1D6MA 2FZGA 2UV8A 3JXEA 1N3LA 5B30A 5IASA 3HV2A 5EZ5A 3IPLA 1DO0A 3IP7A 4PYIA 3QXXA 3RFCA 1GDHA 4XKJA 2J30A 4BDTA 2Y0PA 4NTZA 3WAJA 4R8MA 4NECA 2IXFA 2X58A 3F74A 1U1GA 3QBTA 2RGNA 2AOTB 2D7CA 2RB5A 3AVQA 1Q6YA 3AYXB 1XLUA 1JSLA 6REQB 5BT8A 2QL5A 4ED9A 2AMFA 4JHLA 4PZZA 1KJ8A 3C6QA 4B47A 2QTRA 1X19A 3EWAA 1RPAA 4OHKA 4OI4A 3DO5A 5AM5A 4I3HA 1B15A 3RSCA 4GBMA 1LTQA 1Q14A 1X13A 4GYKA 4KIJA 1AB5A 1OBHA 4TLMB 1ZSNA 4DMGA 2CXXA 4K7JA 2N1MA 4DV0B 5KOHB 1L7DA 4FB4A 3RSHA 4EVIA 4CTNA 4IINA 1J5PA 2CXRA 2NAFA 3EMDA 5ED0A 5B58T 3VSBA 2C9YA 2BELA 2IK8A 4UE3S 1JEYB 3FROA 3F7NA 1KO4A 1TB4A 4G01B 3HJAA 3I6MA 3EBOA 5I47A 4Y2JA 5C31A 3UXHA 1HEYA 2OD2A 2P5UA 3CA8A 4O4JF 5JSZA 2JBHA 2FWMX 3DE4X 4H0FA 5WRFA 3R75A 3U2QA 3UK0A 4F84A 2YR0A 1K8RA 4R98A 1N78A 3EF0A 1FUEA 2VDUE 3IQGX 4UEKA 3SIRA 3ZJ4A 1WV0A 1HEIA 1CR0A 2IDZA 3BEOA 3CLVA 3OJ0A 3PYMA 1QIMA 3HFRA 3FTFA 4MVJH 1XKQA 1EK6A 4R3WA 2PYZA 4A23A 1C3OA 4XX1A 3FRHA 5DGXA 1JMKC 4X6LA 4TTPA 2ZS8A 4DUGA 5CDGA 4RF3A 1T2NA 3O73A 4KN9S 2G7MC 2Q0QA 5LYJB 3EJWA 4CM9A 2IELA 4BGDA 3WWYA 4JLKA 4ARAA 4KPYA 3ISJA 3MYYA 2IYUA 5L3SA 1PJZA 4JUFA 4L5YA 4QC2A 3LZDA 1IXSB 1C8BA 2GXUA 3ZXIA 4AJPA 2WQZA 5AM0A 4S1NA 1IJBA 1T2DA 2DQKA 2FWAA 5SYMA 3C7CB 3BWDD 4R2IA 5MDHA 4ZC1A 1G4UR 3JAKA 3ZBPA 4W7IA 3NHLA 3MOGA 1DEXA 3QJGA 5FBKA 2H11A 4AKEA 5IC4A 2V9PA 5I9IA 5JH7B 5M2QA 1WB9A 2RGYA 4Z7OB 1RYFA 3N70A 1SUEA 4MV5A 1JDTA 5EI5A 5HFJA 5LJIA 4MWDA 5G0WA 3HVRA 1MX1A 2BJVA 2C2YA 3O1HB 1YCFA 3CIFA 4B8YA 1E0AA 1KMHA 1KQPA 2CWDA 2PX3A 4F2WA 2WA1A 1WTCA 4MB6A 1WHSB 3RVRA 3CKMA 4ZI3A 1O95A 1M2GA 3EF1A 1PR5A 1RE0A 3WQSB 4I3FA 3ZCQA 1BMFA 1LPNA 1LNSA 4PE5B 5CM9C 3PDIA 1GG9A 4Z99A 3ZDFA 4CIVA 4YV1A 2Q4TA 2AZMA 1EFAA 2GOYA 2WMNB 1IZZA 5KYKA 2GGSA 3E6AA 4C7OB 1LDNA 1NF3A 4XIYA 2CMFA 4EI2A 3ZQJA 4DCSA 4YT2A 1RVDA 2ON6A 4U2CA 1I6MA 2V7EA 3H5NA 4TMZA 3D6TB 4W82A 4EG5A 2IEBA 4UFOA 2DXIA 1EX6A 1XZPA 3PQ2A 4IP0A 2I4OA 4A6XA 1S7GA 2UU9B 1JG1A 3A3YA 4MW6A 5EVCA 5KTRA 1ZGHA 4Y30A 1JAXA 1RMTA 2PTHA 1DVRA 2XCOA 5JWRA 3NDIA 1MO6A 3VSAA 5LUAA 3H8JA 5F7JA 2XUZA 1RBMA 1H0RA 2JJYA 3BF8A 3C3BA 2GYVA 4A82A 1M1NB 2AXPA 3KQWA 1MXFA 2X9QA 4X63A 3KL4A 3Q0TA 1Y37A 2ZJZA 3EGXA 4BX2A 1Y89A 2RGDA 5BV8A 4JXXA 2G77B 4L07A 5K3DA 4V0ME 1V95A 1XRMA 1K88A 2JFFA 5E0OA 2P3OA 4GW3A 1V8DA 4IFBA 4DSTA 4GHWA 5AXDA 4HTFB 2C7RA 4KXVA 4CN8A 1DDIA 1EM8A 2P4UA 3ZIDA 4ZCRA 3SSAA 2WWGA 3TMAA 1Q0PA 3NKFA 4DCTA 3ZH9B 1R0XA 3QA9A 3LGXA 1THTA 1ZVVA 3CKKA 2IH4A 4JJEA 3WISA 1P2FA 1BYIA 3HV0A 2QLBA 2ZIZA 3EISA 1P4JA 3ILHA 3QKWA 2NUPA 1LW7A 3TBKA 3I9LA 5IZ4A 2PX4A 5HKLA 3ZS8A 4L5AA 3VNQA 2WILA 5L53A 1R0WA 4W8HA 1FDOA 3NFYA 2QUIA 4CF3A 2HMTA 4WOCA 1T2AA 4G1VA 1XZGA 3KDAA 4ZOLB 3DA8A 4D56A 2Y6UA 3DTVB 4KOAA 5JQGB 1A9PA 1W85A 3S29A 3HYLA 2A9OA 4HNAA 5EHNA 3WNDA 1OWLA 1MO5A 2QN7A 4DC0A 1SVKA 3V8NA 2CCKA 1C3LA 9MHTA 2VI5A 5A05A 2WKPA 1HI9A 4RVDA 1SEVA 3R7SA 4CMAA 1IQPA 1TK2A 1XDDA 1JWLA 5KU7A 3JQ7A 3K9HA 2QN8A 3HPQA 1NLFA 3K0CA 1LX7A 1PF7E 3H5LA 2I7XA 3U26A 2ZWMA 4YP6A 3QE4A 2H5EA 1ZJ4A 1MAWA 2Q1WA 5T8KC 1Q0TA 3E3NA 1NOIA 5DI9A 3VOAA 3GGCA 1X1AA 3TOXA 1V6AA 2C20A 3EHEA 4BQPA 2LBPA 3OVMA 5FPSA 2XE4A 4GPZA 4JT4A 5D1NA 1Z5PA 2QE6A 4OGLA 5A0TA 1NW6A 1Y80A 3RANA 1I4EB 3R7FA 4CLDA 4RTNA 4A36A 3WDMA 4NU8X 2EL9A 3NH9A 4O33A 2SKDA 1R66A 5LQSA 1Z4NA 1BZYA 1SHJA 2D8AA 2DY1A 1A4UA 4MUGA 2ZBVA 1MO3A 2R1UA 2FMKA 3GD5A 3KOWA 3QPUA 1YF3A 3KZVA 3TLGB 1ILEA 1S1MA 4FLEA 1GTVA 1J0CA 3EDRA 4AKGA 2P9HA 4WFQA 2B20A 2LWIA 3T06B 3ZY6A 4ZCMA 2GPJA 4FNGA 3H18A 3LC7O 4URZR 5DHQA 2MINB 3GRCA 2H7VA 3FHLA 4ZEWA 1E3SA 4AJ9A 2FSSA 1AMOA 4FOLA 1SCQA 2GZMA 4GKVA 3KLNA 2C4WA 1I3MA 3W8EA 3H1TA 121PA 1LB1B 1LPOA 2B99A 2HB6A 2PL9A 2V4MA 4TT3D 2Z6AA 3QVGB 2DBYA 4U63A 1QHGA 2XX3A 4QTTB 3B85A 3CRRA 1NJ5A 3MCAA 3V8QA 5EPUA 3E0QA 4L6IA 5D8DA 1BHJA 4DREA 4PRKA 5A62A 1Z6ZA 2FFJA 3MAAC 4FSHA 3TFWA 4DQKA 1TO1E 1O97C 4AF7A 1JPUA 5C8YB 3QFTA 5FLEX 1S01A 4LK2A 3TLMA 4YI3A 4I9FA 1LF0A 2OZPA 3D8BA 4PO9A 5I48A 3OT1A 3IQZA 4PXAA 2HRDA 1L8QA 2ZOSA 3NEJA 3JSAA 3ZQ6A 3IYLW 4N82A 2YFYA 4QPJC 1DG3A 3WBBA 1NVFA 2HU7A 1D07A 2OENG 1JKJB 4MQ5A 4BB5A 1IPEA 5C80A 2PT9A 3TTYA 4R0MA 4PZ0A 4G1FA 5AOVA 4Y8VA 3HJTA 4P36A 2RONA 5JSKA 2VDOB 2ZBRA 3AONB 4JI3B 1QHHB 1KHHA 3R5JA 3LUDA 4YDQA 3V42A 3K8OE 2EHJA 3NBFA 3ASYA 3Q15C 1I4TD 1PR0A 2IHZA 2QPAA 3Q8XB 4GZ5A 4O1HA 2BFCB 3T7JA 2V0CA 2FEMA 2L42A 2WKQA 3QFFA 1KSFX 2X4IA 1XZKA 4XEHA 4G0VA 1D1SA 3JQFC 4ND2A 4BFCA 4IUCS 4DQUA 4CU2A 1BD4A 4B3DA 3HCNA 1QBKC 3TKAA 4AY3A 1T13A 2IL1A 1CY8A 1R9MA 3DUFB 1LDGA 1UDWA 5JE8A 1U7XA 2L17A 4ZVKA 4TTJA 1TNDA 3AFGA 3FNBA 3N7AA 3Q3EA 4S24A 1R6UA 1T5TA 3EC2A 3EEYA 2Y1XA 1U94A 3TQSA 3CS3A 2GN2A 1NU8A 1T2UA 2M32A 2QTNA 3DL4A 3QI2A 4WLEA 3WP0A 4CF7A 1B00A 2H18A 2QOEA 4Q66C 4P0PB 5HMLA 5H5JA 3ZDYB 1JE0A 3T5BA 2VCYA 1M1ZA 4XQGA 1E2UA 3KSDO 3UAOA 5BSKA 2C99A 1TIPA 4YB8A 2XVZA 5A1JA 2NZVG 4QQ8A 4DQVA 1SD1A 5E0KB 3OPQA 1WY5A 1RKBA 5TEWA 3OFKA 3P19A 4B5KA 5AW6A 5I9NA 1KVTA 2A1TS 3E0XA 1W88A 4F5EA 4QPDA 4UNSA 2L19A 4OHYA 5BSTA 1FDTA 3CTMA 2IU3A 4ZANA 4EQ6B 4OLJA 3LMKA 3V7YA 2V5AA 2Z2YA 4QVIA 3ZIAA 4LJ6A 4G23A 3TCKA 3EIOA 4Q7QA 1EFVA 4BVFA 4GLFA 1PJBA 1AURA 2H1LA 3IUMA 4GX0A 4DVJA 1ZHFA 4WXEA 3U4CA 3KHTA 4BMCA 3WO0A 5LP6B 1BXRA 4RS4A 4D8TA 4Q1BA 1OLXB 2CY0A 3KXKA 3P0RA 4AJ2A 1PSDA 4TS9A 2A1UA 2IJGX 5K09A 1ZJJA 1KOFA 2Y1LA 1YONA 4Q03A 1NV8A 4G2TA 2I4NA 5AHOA 4BNDA 1RMQA 1TU3A 3GZNA 4JLJA 1Y7HA 3C8DA 2IWHA 4ZRDA 4A73A 1AUXA 1JQLB 4GECA 4ZGWA 1QV6A 1U80A 4V0QA 4A8JA 1TW3A 2NO7A 1F0PA 4JQCA 1XLWA 5LZ5A 4S2UA 5TMBA 4CCWA 4WK4B 2GKOA 1K9VF 1JQJC 3RD5A 1KJNA 2B36A 5KPJA 4AQYB 1YQQA 4RXUA 3A27A 1WB5A 2HO4A 1X2BA 4DJFC 1RBYA 3N2KA 3OSUA 3O0TA 2YFKA 5C4GB 1ZRHA 1CWUA 1GOTA 3AETB 4QUDA 1BKDR 1RM0A 5TGTA 3LLCA 5DMHA 2FDCA 1NUHA 3R24A 1TQ8A 4Z4IA 3UAZA 2D2XA 2J9GA 1IY9A 3C3YA 3DLTA 1N0WA 3N0WA 5CVUA 2D6FA 3N0TA 5BN3B 3RV4A 4ZT2A 5AM3A 3QUAA 4NU0A 4Q3KA 4NATA 2O8BA 4KWCA 3L8DA 4KR9A 3S2SA 2BV3A 3WV4A 4ESEA 1IG3A 1GR0A 1JSRA 2HUPA 4FILA 4ZVLA 1GTRA 2YJZA 3IV6A 2OM2A 1Q44A 3FMGA 4M7WA 1NBAA 2IDMA 4Q9DA 1XCPA 3OPXA 4XYGA 4D3DA 2IY7A 3DCYA 2NNWB 3GELA 4RFSB 3IALA 1WKCA 2XYGA 3LYUA 3PPXA 3VPSA 4OXNA 5EE1A 5K3FA 4NG4A 4RGBA 3HU3A 3QEJA 1ISFA 2NXNA 1T0IA 2ODEA 2SKCA 2UZAA 2ES4A 2ZBDA 4KQ1A 2YVQA 1JHRA 5FPPA 4EFNA 1VA5A 2D74A 3CSUA 3D4OA 3IP6A 4LBZA 1HOTA 1I14A 3FDZB 2CHQA 5BUQA 1WVGA 1WZNA 2H0QA 2NXCA 3R7NA 4BC1A 1DC3A 1O6BA 3ET5A 2LPMA 1LK5A 3FYUB 3VO8A 3WWZA 5BMOA 2W2KA 3JVEA 3OTWA 5C35A 5LJLA 3U6KA 4CFSA 4F7WA 1X38A 2EWVA 2BJWA 2IIVA 2GEVA 3FPLA 5CNJA 1HYQA 3OM8A 2PTGA 1KC1A 2I2DA 5ALHA 4IV5A 1XL0A 1IM5A 1NVVR 5HEKA 2DQYA 1Q7EA 1D1TA 1KGSA 2DECA 3K8QA 1IMJA 3HUDA 2FPIA 4K3VA 2LNDA 1PJQA 4MKGA 3T5CA 1B93A 2JD1A 4BASA 4L72A 2FCAA 3OJWA 4CGZA 1E2LA 2OG1A 1PDWA 1Y6QA 3IMEA 4G8BA 4LHXA 4QJBA 2WTXA 3DVLA 4IRXA 1XDZA 5AUNB 3BWBA 1M3SA 2IP4A 4X61A 1X42A 4DY6A 1NLMA 3UB4A 1T6ZA 1CFZA 4UDOA 3I2IA 3C3CA 3DL7A 4XW2A 1NI3A 4IOKA 4JA2A 4KPUA 5G4KA 1KDVA 3MT8A 2YC2C 3UA3A 1UFOA 4Q7JB 3GQBA 5DW0A 1V41E 2O2IA 1B8PA 1RBQA 2QE7A 4ZKEA 3EW7A 3IQWA 2O2DA 4LCEA 1P1FA 3TW0A 3CR7A 1Z18A 3AKCA 3GWZA 1T0JB 3DBHA 4GSYA 4OHFA 3DVSX 1Z0DA 5BR1A 4HBZA 1P61B 4HWSA 5KAPA 2ZU6A 1GPUA 2YRWA 2ZJAA 3AY0A 5K51A 1L5KA 3DAGA 3UK1A 3I61A 1G3MA 1UT6A 4Q93A 3NBKA 1RI3A 1XC7A 3U44A 4LVCA 2CJYA 5HOQA 2UXDB 4YJFB 4B74A 3ZCRA 2XBMA 1G8GA 3C7DB 1DCFA 3AR5A 2IYQA 5IKPA 1RWBA 4LY0A 3GVXA 4KQKA 2BEVA 3HP7A 4CG0A 2JFVA 3KEGA 1M8KA 3LLUA 4FQ8A 1U3DA 4C89A 1K97A 4ZT7A 4FDVA 3F7MA 4EB0A 5CYPA 2PR7A 5HNKA 4WK6A 3BQNB 3R6WA 4PINA 3R3SA 1VCOA 2R6ZA 1P4GA 3D3JA 3ZDZB 2QDKA 2BEJA 4JX8A 4YRLA 3U4GA 5EUCA 3JZMA 1B1AA 2OCLA 2DBVO 2W2LD 3CM0A 3DMTC 1ZAKA 4P5PA 3OURA 4TKUA 4BNMA 4FYHA 2DEUA 3TSZA 1G21E 3DXXA 1RS0A 1RRFA 2I80A 2RGUA 3PJGA 4C29A 4EGQA 3AL3A 4PIVA 2H2HA 4OB8A 4EMUA 2QXYA 3ZOZA 2XKJE 3INRA 3RS4A 5CDUA 3E1SA 1PE0A 1T9GS 3PNBA 1X6VA 2AOUA 2H0RA 2QLTA 4HQOA 1ZBQA 2ZUSA 4KBYA 4YRDA 4GBGA 3WC4A 2JGDA 1I4LD 1TCVA 4PAGA 1PJCA 1JYEA 5T6MA 5BUSA 3AF1A 5TDHA 3ZWNA 3K09A 5EGNA 4JI6B 1MB4A 3JARB 4O2LA 3BH6A 1L5FA 4QVKA 3AESA 3I04M 4ENQA 1PJAA 1CSEE 4HVCA 3COVA 1XQVA 1AKRA 1G8MA 5FOVA 3NIWA 3RT1A 4EMTA 2DWPA 4UU1A 4IDAA 3KQUA 3K0KA 2W83A 2WZQA 3GFTA 3LDUA 4RF4A 2PN1A 3EVEA 4NABA 2J9YB 3L8MA 3QXCA 5KKNB 2GAFA 1CEEA 1Z15A 1QFSA 1WIWA 3VI4B 1MB2A 4ZQEA 3X1WA 1HNZB 1KO1A 1ID1A 1MX9A 2ZRHA 4P6VF 5ALKA 4FFVA 1K08A 1YS1X 3AXSA 5TR9A 4B4DA 1CW2B 4A4DA 2JEOA 3GR6A 5BSVA 3THWB 4BNJA 1JEAA 1GNPA 1DC8A 3UIEA 1KYIA 1YB1A 4X20A 1V9CA 5AKIA 2IWRA 4YIHA 3PA6A 4DV4B 3TQCA 1PAUA 1HMYA 2XA2A 3HCDA 1MU0A 1JIKA 3HWWA 3LK7A 3LX5A 1P2GA 3O90A 4FOOA 4II7A 2O2CA 4Y2VA 1TUBA 1W94A 4AM8A 4C1NA 4Z1OA 2OV3A 3VZPA 1IOZA 4D4GA 3CJQA 4OQYA 5FV7A 2C4MA 1DB3A 1JYFA 1ZD5A 5IBQA 2A78A 3S2IA 2A9VA 2FUG6 5HA5A 1Z6QA 3STUA 2WAYA 4OQPA 2XDQA 1BQ4A 2DCUA 4OO3A 1CYEA 1Q50A 2H63A 3QNMA 4Q9AA 3V6MA 4KE7A 4D80A 1Y8AA 1CDZA 4QOHA 4R1QA 3MWKA 1YZUA 2E4UA 2PXXA 1IN4A 3OCZA 4BLUA 4F9GA 5HZKA 3Q8LA 1SKMA 4WY5A 2KB0A 1IUNA 3A58B 3QFRA 3UKOA 4MTCA 4LXIA 3FETA 4EKEA 6NULA 5JMTA 1PTKA 4ZO8A 1TYBE 3UAVA 3ZPXA 4D43A 3NTRA 3C70A 4P08A 5KYUA 1DOZA 1E3WB 2AJBA 3F47A 1AH2A 5CBKA 4NBKA 1E5DA 2JAWA 5AVUA 3TZHA 1FMLA 1LSOA 4QGSA 2UXBB 3TR6A 2A8YA 4FLMA 4ZAWA 2IOHA 2FSGA 4Y6OA 1P0IA 2VS1A 1MR3F 1VSVA 1RFLA 2JAQA 5AK6A 2CB0A 4KDEA 4DIMA 4RHXA 2EZ8A 4PGFA 5K2MA 3TQTA 3BL5A 2EYUA 2W4QA 5DHUA 2IITA 5FBZA 4CYMA 4BQFA 4E6PA 5EJ8A 3HKBB 3PFBA 1Z12A 5K4HA 3E82A 4A0FA 1GV0A 1HLDA 1JAYA 2CT8A 1NFQA 2X9VA 5DYNA 4L08A 2QYOA 3ASVA 4GLJA 4ZEVA 2PRKA 2PWPA 2PRJA 1G291 2XMRA 5BRJA 3JVUA 4CF6A 3KT8A 2G0NA 3GU3A 4X1IA 4EVRA 3KVYA 2QLLA 1PL8A 1Z75A 1I9CA 3JVIA 1U8UA 3LL4A 3RS0A 3IEPA 4P54A 3WNQA 1DMSA 2YDYA 3ABQB 1V1MA 4MWZA 1QANA 2NU8B 1CULC 1JKMA 1TXGA 2JHCA 3VH4A 4YJ2A 3E9DA 3OWHA 4TL6A 1E0JA 5JT1A 2M1ZA 2O8FB 3EVZA 1FCJA 2WP8J 2FMFA 1SA0B 3RUHA 2NP6A 3LHDA 1OASA 3E05A 1P6XA 1Y1QA 1SRQA 3PKIA 1OYOA 4B4WA 2O1WA 4ND7A 1AIPA 1IZ0A 4CQLA 4EYQA 4C4PA 4FPXA 4AMUA 2BZ0A 4DPMA 5CBPB 4IIEA 4HEJA 2K5UA 5JCJA 3VHXB 4ENSA 3DBRB 3OIVA 1T1EA 1PNRA 1DCKA 1G20B 3S2GA 4L6AA 4FDMA 3U81A 2OFWA 2C2HA 5ADUS 3CO5A 1NNEA 3U7HB 2I2WA 4HL6A 1JALA 3WZMA 2LDXA 4PG6A 3OD5A 1K1EA 1M2OA 1A27A 3W5DA 2WWXA 1N5KA 1J2JA 1YZHA 2BHRA 3WIDA 4JWTA 5KEIA 3QEAZ 2B83A 1DU4A 2ZSBA 1N0UA 4MR8B 1PX2A 1YMQA 3LRXA 1Z34A 3WHKA 4F96A 1SD5A 2GTPA 3OTIA 1G8SA 1DDGA 2QU8A 3C5WP 1OFIA 1Q91A 3HB0A 4BKQA 3NATA 1YJCA 1H66A 1VJCA 3BMOB 4ILEA 4LWOA 4PNZA 3K4PA 4NCNA 3H11B 4K6OA 1OC2A 1GNVA 1BJKA 1JU9A 3WIUA 4P4NA 3FBTA 3HYSA 3R8CA 2YRXA 4Q02A 3IT0A 2ZSDA 5G02A 1YOBA 2QI9F 5JS2A 4AU1A 3LOUA 4BFYA 2X76A 4DLBA 2CJWB 5JPCA 1QX3A 3ON5A 3AM5A 3E2PA 1PZHA 3I6YA 3C3JA 4D5EA 2O7RA 1UZUA 1SUBA 1GEGA 2WIAA 1ZN9A 3C8HA 2OC4A 3EK2A 2RHJA 4KEAA 4KDRA 3ORQA 2PZGA 1I3KA 4MS4B 5CPBA 1O0BA 5CLJA 2WEKA 2VYND 4GEGA 4OTZA 1RHMA 5CU7A 3X1MA 3OX3A 4DNFA 3OJLA 3HJFA 1T4DA 3ZJYA 2D5IA 2W2XA 1ZMRA 4RZHA 3RGGA 2FN3A 3NYWA 5A3QA 1TL7C 3DM5A 2FGJA 4FT2A 4E5SA 2I3ZA 1XPJA 4CLXA 3R7WA 2R2AA 2QBYB 9LDTA 2HQBA 3B3GA 2Z1MA 3PXAA 5KNBD 2ZIWB 1HDIA 2BUCA 3A4VA 2HRRA 2WWFA 3R6DA 4BGIA 2ZB3A 4ENWA 5HRCA 2FWIA 2J3QA 4R5HA 1G5PA 1IY8A 2RGBA 4O02B 3C6MA 3O8NA 5K0CA 2BGRA 4EPRA 5JJCA 5I7VA 1OXMA 1U9IA 1V39A 3U1VA 4EHIA 1JSXA 1IZ8A 3UMSA 4C04A 3EUWA 1KVSA 4N3AA 1OZAA 4NDZA 1QK4A 1LLUA 3G89A 1SELA 4KBFA 4OU4A 2NYUA 4RORA 3FJOA 1D7AA 1E5XA 3W4IA 3H9CA 4C3VA 1D03A 3V9PA 1DKMA 3HN6A 1ZINA 5M29A 1VPEA 2J4CA 2O4UX 3FRIA 4BPBA 4A2QA 7YASA 4LZZA 4JLAA 2D62A 1WL8A 3LNCA 4DNPA 5T7BA 1ZRMA 3OESA 3BMNB 1ETUA 5EIEA 4EGCB 1TD9A 2RG1A 3IULA 2E85A 1QRRA 2HQSA 2IXDA 3WK9A 2IIPA 3ES9A 4GKAA 4PBTA 4F46A 1C9NA 3IQEA 2WC1A 5JVDF 1JDNA 5LQCA 4W99A 2BGKA 2IOYA 2W6JD 3L7JA 3FR8A 4N0QA 4LS3A 3GLTA 2BKLA 2IUSA 3PC4A 3S7ZA 2B82A 3TGWA 4EI7A 3USCS 2W43A 2EF0A 4GDFA 3OJCA 2UUPA 4CW7A 4CIWA 1Y4UA 4JOCA 1J25A 3SR0A 1N5IA 4BO2A 1Z9BA 4JI4B 5F98A 2FU5C 1QOZA 4OP3A 2GDZA 2GSDA 2YJ4A 5TRTA 4YLEA 4B85A 5A2QA 1PD1A 3BSFA 1DRVA 1JIUA 3IOCA 3QFHA 4U6NA 4BMPB 1NG9A 1UMBA 4Y1FA 1GTJ1 2IZOA 2G1UA 1B3RA 1XJ5A 2Z3VA 2R8EA 16PKA 5JIBA 3DZJA 4B6OA 5G0UA 3DAOA 3KHKA 2XLBA 1TLTA 3T4EA 2V0NA 1WDMA 3A37A 4DADA 4YRPA 4MVJF 4F56A 1OH6A 4HZGA 2WSMA 2VOEA 4Q34A 1C1XB 1D6JA 1UP6A 2WY2D 3VR3D 1Q2XA 2EARA 1X77A 4TZTA 1B8NA 4ZQIA 1GRVA 5AOCA 5FBWB 4PG8A 5BWCA 1QO0A 3L49A 1A77A 4N48A 5BN4A 1DXOA 1YR9A 3OQOA 3FFXA 3A1WA 1XQ9A 4MUIA 5KINB 5E7MA 1OX4A 4KYTA 3RYFB 4FB5A 1VL2A 2J41A 2Q9AA 2R86A 3DXFA 3IJEB 4JT8A 4W9NC 1L4FA 3WGTA 4C0LA 2YIMA 3A9VA 4UULA 1A3CA 2G1KA 2COUA 1THMA 2H2DA 3PYLA 5IM4A 1H8EA 4C4AA 5BQOA 1CY2A 4O4IF 1C80A 2O7SA 3KZKA 3PUZA 3TIVA 1FFXB 2OB2A 2HIHA 1H0HA 1N2HA 3HY6A 5J9FA 5HRUA 4ZWNA 1DXHA 1MEOA 1UK8A 2VHXA 3JD1A 1M6VB 2TYSB 1JR3A 4Q5IA 4IQGA 4P98A 1QP7A 2JJ1D 3NJRA 3L77A 4L8VA 3CZPA 4J43A 1SNYA 2J5BA 5EYPB 4BFWA 2O8CB 3PXXA 1L3CA 1JR6A 3LAWA 1I7DA 4NAVA 1GQQA 1MJGA 4XM1A 5GOZA 2NPFA 1EBFA 4DIKA 2NO6A 4F4FA 1DOAA 3B3QA 1EEXB 3ZHRA 4BEBA 4CEIB 1A9YA 5TMDA 5KVQA 1V25A 2QI9C 2ZQYA 3K9BA 4MK4A 2O3UA 4JJ7A 4XDYA 2QA5A 4EY8A 4TWAA 3GGPA 3U3JA 4DG8A 3W3ZB 1GGMA 2R7KA 4PLWA 3LLMA 5HUHA 2BUBA 4MQ6A 2GM3A 2FWNA 2CN1A 2OQVA 4HLCA 1M74A 1YCGA 2EKZA 6Q21A 5JO0A 4YS6A 2UZ4A 3PFNA 1EBBA 2ZR8A 1KJQA 3N2IA 2EP7A 2XCQA 4HXFB 1TRHA 3RUAA 3VR0A 4BATA 3K4HA 4Q4DA 1D2AA 2HM7A 2YWGA 3PUVA 4XLLA 5JI3E 2FX3A 1FYDA 4KWHA 3K3PA 4MRRA 4RMIA 5FADA 3KZOA 1WMEA 2GJAA 5I3ZA 1FOEB 4QSMA 3RS9A 2OV2A 3IRUA 3OE7A 4QQFA 4FUTA 1N6IA 2BH2A 2OZEA 1E79D 2VT7A 1DPFA 2FK7A 1HYHA 4A9AA 1NYRA 1X8JA 3AZQA 1T9DA 1ZW1A 4OV6B 3GNQA 2V7WA 3K9GA 3PV0A 3AL2A 1F51E 4J0IA 1WHTA 4U39A 1E4YA 4DS3A 3EGCA 1R3DA 1YE3A 4IUBS 1BHO1 4J4HA 2ZANA 5K6RA 4QYIA 2NSJA 2Z5VA 4KN8A 4Z4CA 2WMDA 1EDEA 5KUTA 4ND8B 4C76A 1J8FA 3EWSA 3FYTA 3GG9A 3AEUB 4HAUA 1ID8A 2VF4X 3O38A 2QJFA 3KG2A 4UNPA 3BRSA 4C4RA 4D8VA 1SVMA 2R60A 1Q3TA 3QP9A 5TQ0B 2UVQA 4DFDA 3RLFA 3BG5A 3G88A 3DE1X 5AJXA 3SXJA 1JB9A 4MPDA 3QPAA 2BMDA 1INLA 1YGPA 5BYJA 4E5NA 3ZY2A 5CHEA 2Q49A 1R7RA 4L5IA 2P5TB 2ZUVA 5CT9A 3GUCA 1W47A 4OM8A 2W6OA 5AWFC 4DJEC 1I30A 2QMEA 2XV1A 1MV8A 4H1UA 3MJCA 3VR6H 4MV1A 4RVCA 2XAAA 1PUJA 4GPIB 4TV9B 4AO6A 4ZYWA 2PT6A 3C39A 3N8NA 4ZFNA 2UXCB 2R9VA 3VPBA 1YFLA 2HWXA 2WE8A 3RYTC 4D98A 3ZD9A 5IKXA 3FUUA 1Y5IA 4Q9HA 4WBNF 1GEEA 1T3HA 4N3GA 5CIWA 5A3VA 1PWHA 2AI3A 2ZI4A 1YMUA 3AHJA 1KR2A 1EVEA 3UA4A 2XHZA 1C0LA 1GU7A 2J59A 2V8OA 3LKBA 4X24A 4BP8A 2A0KA 3FAZA 3VTFA 1SXIA 5BOSA 3GLGE 2Q99A 4KWEA 4ZAXA 2DG2A 2HAEA 3MA0A 1U0EA 3WK7A 2BF4A 2E89A 2VTDA 3GBSA 4G26A 4URFA 4WASA 1M2WA 2GK7A 3RVMA 4KX5A 3KJGA 1FW8A 1OROA 1Z6GA 5DTQA 3KKZA 4TXLA 2NP7A 4CUZA 1FMCA 5KU1A 1E6EA 2XE8A 3AKEA 2BFEB 3F0TA 4WVLA 4ZJPA 3G0CA 4YQYA 5HIKA 2BL4A 1IBMB 4A2CA 4P7KA 4ASUA 1FYXA 4I36A 4XB1A 4D8UA 2ZIFA 1WLSA 1E2NA 2UYGA 3KEQA 4I8IA 4TZKA 1NNSA 1V7CA 1E3EA 2V7QD 2D4HA 4URYR 2HHCA 1NVKA 2AL7A 1JB1A 3C6YA 4BNGA 4YUVA 1WCXA 3E61A 3AHDA 1AZLA 5AK0A 3FSGD 1N5DA 2PLNA 3GK3A 3OM1A 4LGVA 3UOAB 3ZNPA 1V5EA 1PJ4A 4BJ6A 3N58A 4FFNA 2GHRA 1JJBA 2W2QA 4RXTA 3ANNA 3AC0A 4AY5A 3SZLA 1JLLB 3IAM6 4GI7A 4M53A 4RE5A 4XWYA 3EMBA 1YS2X 1UM9B 1KF0A 4AJKA 2WM3A 5TS2A 3ZZTA 1W48A 2AFHA 3G9ZA 5B36A 3MWLA 4A1FA 1O77A 5P21A 1KKMA 1QU2A 3IAXA 4LYGA 4M9ZA 2X86A 3ANLA 3MPUA 2XB9A 3EMVA 3OCYA 3WXBA 2I7VA 4EW3A 4ZICA 1UPUA 2HU5A 2OC9A 4WLVA 1Z45A 3AHEA 1Y82A 3W3AD 2XNCA 4OHWA 2NVBA 2XMQA 2ZE5A 3C7TA 3E1GA 3Q11A 2PKYX 4TV8A 4R7ZA 1N6RA 3MW8A 3ELWA 4UHCA 5TT1A 2UVPA 3PRHA 2G9NA 4CI9A 3DZKA 2PX0A 2JLBA 1KR5A 1N77A 1PZFA 2MWMA 1F4VA 1L5VA 1C0EA 3RVBA 1J9ZA 5B3KA 4CIAA 5KTOA 4UVEA 2PZMA 1E2DA 5CLFA 3WGVA 2QP9X 1NUTA 4Z9AA 3PF9A 4A3SA 3NS7A 3OQ6A 5FULA 3HBMA 2H1HA 3KDSE 4G0OA 5JRJA 1T8YA 2NUAA 3A6HA 1VIVA 3HKCB 5C3MA 5IJ9B 5JZVA 1AHPA 3U5TA 1N36B 4JT9A 4Q4HA 2R79A 1OZHA 4EKYA 5HS4A 2O23A 9LDBA 2F55A 1EXWA 5AW4A 2FLVA 1QOQB 3REQA 3ZTTA 1CP3A 1KPHA 3I6BA 5M04A 5I6DA 2I76A 5EFOA 2DR3A 4G5XA 4IM7A 4L15A 4E3WA 2IKQA 3TR0A 1R6VA 4RTLA 2IYFA 4JENA 4RJLA 2I4TA 4HWTA 2LKDA 2XD4A 4IIGA 4K87A 3UKJA 4ERNA 4EF5A 2B4TO 4YCBA 4Z0NA 5KNCA 2P8SA 2M6RA 3EXHC 2WIKA 1NJ2A 3FVQA 1CUFA 2Z09A 2Z3ZA 1CVIA 5IRCD 5F2EA 5F51A 4H4EA 2IGTA 2XUKA 3L0SA 2O2SA 1N5LA 3O1LA 4WFJA 2WJAA 2AE2A 3EAGA 4WOPA 2PKRA 4HD8A 2CLFB 4W1SA 3RHSA 5LD2C 4RNCA 2VNSA 3IIEA 4X93A 1JQAA 5BV7A 4TL7A 3MWDB 3NM5A 4BO6A 3HJUA 4HGOA 3ICQB 3MZ0A 1KXZA 5JCZA 1DC5A 2F67A 2AK2A 1IB0A 4TYPA 4DPLA 3WJAA 1LH0A 3LKVA 2JNWA 3GRKA 1BHSA 4LZJA 4OJKA 4DLTA 4KLCA 1E1RD 2IUFA 3Q72A 1YDGA 3HJCA 1J90A 3OF5A 2BDTA 1JLKA 2ETXA 4AMBA 1NW3A 2C0QA 2NX2A 1OBFO 3TMYA 3K1AA 1UZLA 4HI0E 5CT6A 2PGXA 1Z0IA 3EUAA 3O93A 3P4YA 1U28A 3WADA 1AHHA 5IDXA 1C4WA 1JBQA 2EZTA 1DRJA 4BMXA 3HLKA 2H1FA 3H0KA 3I4CA 4J0EA 4PGHA 5BN5B 3LP6A 1F1BA 4OYYA 3SX4A 3IPAA 5DT2A 3REOA 1CUXA 3R3UA 2DFNA 3WMWA 4N5MA 3W5AA 1UM8A 1SU6A 3DVAA 3K5HA 4N8DA 3EUFA 4RBNA 4AI6A 1LC3A 1RHRA 1T5LA 3T7TA 3RTDA 3PFFA 5E6RA 1TMOA 3H1BA 4JDPA 5ERYA 5I8PA 1H4QA 1GCGA 4RZ2A 2ECKA 3QNUA 2JK1A 1ZXBA 1UMDB 1D0SA 3CG0A 4P3KA 3F8WA 1WOYA 3DE7X 3EIQA 4YJGB 3IBFA 1M8GA 4Z6KA 4X7BA 4QDZA 1KK1A 4R6XA 1OJLA 1C7ZA 2QS9A 3FYSA 3QW2A 2CLLB 5K4GA 2ODWA 4NCAA 4MJXA 2VQFB 1T1IA 4UTNA 2Y6VA 3JASB 4Y2HA 3B70A 1G8YA 1ONPA 3M6LA 2J07A 3BAZA 3I5AA 3DO6A 3MJSA 4I3GA 5T4EA 4CDMA 2VJBA 5ALQA 4LHWA 3IUSA 3F2VA 1Z8DA 4MYDA 4MWEA 3GGOA 1EGQA 4W1PA 1EUCB 1U7ZA 4UM5A 1W96A 1XL1A 2GF2A 4PCLA 4RPJA 3JYPA 4GUAA 1W1IA 1SUPA 4LOAA 2FZVA 5FUBA 3KQKA 4O2AB 3D8UA 4DZRA 1QHYA 3GRRA 3F6CA 1S8NA 4DLYA 3PNSA 4NZMA 4DMFA 4E12A 1QZXA 1IEWA 3D59A 2PRZA 3NMUF 5EVJA 5IAKA 4X8OA 1EVKA 1AS0A 1NF8A 4C0SA 2AOTA 4PM4A 1A0OA 2PRYA 3FN4A 5EY5B 2RSLA 1KWKA 6REQA 4TKVB 1KVQA 3PQ3A 3R9XA 1A4RA 3G8BA 3P2YA 4RJKA 4BGVA 1O57A 2XZOA 4PFQA 1EP1B 3HXPA 4NENA 3RIEA 4CRWB 2BBSA 4BKPA 2N47A 4PRLA 4PZUA 5ALVA 3U19A 2HT1A 5BVGB 1JIIA 1KMCA 4Y0VA 4DEVA 3CW2A 2P9FA 3Q98A 2XKAA 4FT4A 3VPGA 1T29A 2HJGA 1D4ZA 4PGMA 5KOHA 2IYLD 4H3HB 4YCJA 2HLDD 2ZT5A 2C94A 3VX3A 4ZZIA 5JYBA 2O2YA 2V45A 1GZDA 3PEUA 3FIUA 1COWD 5ETJA 5FRDA 3M2TA 4DR1B 3RSLA 4LA4A 2F9FA 3AEZA 3COSA 1JG6A 2JVIA 4UMVA 2ZTVA 1AD2A 3U7EB 4WY8A 1QVWA 2Q6KA 3O4IA 4WECA 3HI6A 4UNRA 1GA1A 1MRZA 1CDEA 2YL2A 4HNUA 4FONA 2TS1A 1VRVA 2XGGA 2XRFA 3F71A 3H6KA 2PL5A 1P1KA 3FBGA 3I42A 2CXHA 4JGIA 3O1IC 5EZQA 1QRAA 5FI5A 2A9QA 3S1SA 1OIWA 5K3EA 1PKXA 1P31A 4G25A 5CFMA 2XVYA 2J1LA 2NU9B 2QVBA 5E4FA 1JEJA 1PR6A 3DEZA 3ZGNA 2OY0A 5J1TB 4LQLA 4BVGA 4OKIA 3MUOA 4PLFA 2BGJA 2QTMA 4XWOA 5AJUA 4WKNA 1CF9A 3OEED 2CDCA 1UZNA 2HJSA 1UR5A 4Q82A 2BUAA 1Z68A 4UXIA 3O2SB 3ILYA 3LM8A 3VNAA 4EUFA 5JNTA 3G6WA 5ALWA 2XW6A 4MO9A 1ZC3A 2VSFA 1ODIA 3WVNA 4NV3A 2XMSA 2AS0A 1VC2A 2JJ2D 4QUJA 3ZEAA 3DD5A 3KTOA 721PA 2DM6A 4IDNA 2JLWA 3REFA 1TQDA 2GZSA 1CUIA 3A1DA 5KSYA 3WB2A 5K8IA 4X6XA 2VAVA 4Z3DA 1U3VA 2P2GA 1G21B 1MJGM 2W7TA 4ZHQA 1E4EA 4BQEA 3ZVKA 2F59A 4Z8YA 4P32A 2MCFA 3U1TA 4KK3A 3ZC3A 2ZJ5A 2G70A 5J4VA 4TYWA 4KGXA 3PPYA 4IQ4A 4MIYA 3CEAA 1A8HA 2PD3A 1Y4SA 1RRMA 3NHPA 1Q0QA 4MGYR 4OGWA 4MVJG 3HB9A 4D2IA 1WHSA 5CCEA 2VQDA 3G5LA 4I55F 2BGWA 2AVDA 4D4JA 4B40A 3H9UA 1S2IA 2DPYA 2QGZA 4BRZA 1V3QE 2AYXA 3HB1A 3I6QA 1Z26A 5ALUA 5FA6A 3IKTA 3NC0C 1UKVY 5CLLA 1CFJA 3I6ZA 5DYYA 4BB0A 4PNEA 4ARBA 2QX7A 5DBHX 1TF2A 5JD6A 4BV9A 2REXB 4C7OA 4JROA 1E0DA 2H08A 1PTJA 4JU8A 4WJLA 4S05A 2G25A 1DZIA 3K31A 5JPIA 4IJMA 2BZ1A 2FUG1 1SO8A 4WPGA 1K06A 2AX4A 2R5FA 3PHIA 3G2PA 4GGPA 5AJYA 3ZK9A 5F52A 1ZAYA 4LECA 1MHPA 3BMQB 4TRNA 1T5SA 2NZYA 2V55B 2VHQA 1SVOA 2VNIA 3A6JA 3CEHA 4EG1A 2REQA 3NDRA 1GL6A 1T6XA 2VPPA 4FFLA 1UDBA 2EAUA 4RVGA 1M10A 2FB9A 3WIVA 2JIQA 2D1TA 3P9XA 4E51A 2XWSA 4RZSA 1DAPA 2WG1A 3NV9A 1TA4A 1ZM3A 5C8XA 1SCIA 3K16A 5DN6D 1FSSA 4KRYA 2CBGA 3BXXA 2IYOA 4IX1A 4UREA 3E22B 1KMIY 3L7NA 1YIOA 3EXG1 3TB4A 4F8EA 4UTPA 4YCCA 1RYEA 1F8FA 1G18A 3M7IA 5LPNA 2PMCA 3LDHA 4JUDX 1P73A 3HVUA 4AMGA 1RHQA 4P4SB 5FOTA 4Y2GA 2M6KA 4P5DA 2HU2A 3B13B 5FNVF 4YYZA 3WGKA 5DISB 2XYQA 1SC3A 5DHPA 2PLAA 2FHPA 1OJ7A 4R81A 2QD1A 5ICEA 1KORA 2WU0A 5IEJA 5E6SA 5SYAA 4XPIB 5B3AA 1HORA 1Y9ZA 4KC0A 4EATA 4WCFB 1D5WA 1WUHS 3MILA 1VJ0A 3LWBA 4GXRA 4W6QA 1M76A 2I4MA 1Y5NA 2IHKA 1WRBA 4YUWA 3I9NA 3HMKA 3U49A 3KZ1E 1OXBB 1E3IA 3WL3A 3QM1A 5DDIP 5FLYA 3R7BA 1WMSA 3DTVA 5JQGA 3LDAA 5K0ZA 1HR0B 5E95A 3IXMA 2VWQA 4Q3LA 3PX3A 3BE8A 3CH7A 3F1KA 4F2GA 3HZOA 4JUAA 3ZHZA 3OE1A 2KS6A 1YAJA 2PQ2A 2ENUA 4MYTA 3STVA 2AC7A 3QUCA 1M8JA 5FFNA 4AX8A 1WXGA 3FMOB 1HZZA 3O47A 3ZS9A 1YI0A 1QIKA 1BWSA 4OB6A 3FZEA 3P9KA 3JQEA 4RS3A 4FFBB 3V7WA 5JD4A 3RW9A 3BMXA 1MRSA 1VI5A 3AEQB 3ZNQA 1E6LA 2RD2A 1BEEA 1C0IA 2GBFA 1KJWA 1ZNQO 1OOEA 1V45E 2WT8A 5TGDA 2AYYA 1AUPA 1DC6A 3TNFA 2I65A 5I9BA 2XYPA 3HK2A 3QWHA 4JJKA 3HFGA 3WGMA 4HVTA 3WNZA 1JEDA 3FJYA 1AO0A 1IOVA 5H68A 4B8ZA 4ERXA 1E3MA 4AF6A 1FNNA 1BE0A 3PUIA 3BCUA 4DXDA 3QQPA 4HVAA 2ZJOA 2WOOA 3TM5A 5LUBA 1DV1A 1KP2A 3AGQA 1C3EA 1BRTA 1U7PA 2Q8NA 3V2UA 1WXDA 1YJXA 5ES3A 1H5QA 4PPGA 2J87A 4F91B 4O3MA 1EFPB 4Y2XA 1F1JA 4D9MA 2A5GA 3W8RA 4KMSA 2VF7A 1M5RA 2VXCA 2IYSA 3OTOB 1J0XO 4QXAA 4Y1RA 1PSZA 1UFRA 4WXRA 1KARA 3ED1A 5A9TA 4P22A 3TLGA 1TYCA 4F60A 4F6RB 1NF9A 1F4PA 3UATA 5KTYA 3R2JA 2ESRA 3R5TA 5TY0A 1TEXA 1OU0A 1XVVA 4C4YA 1A50B 4FYVA 3SE0A 1LUAA 5C9ZA 3R5SA 3LQ1A 2KX7A 2C2WA 3AGPA 3ESBA 4JGGA 1R4AA 3IJRA 4US0R 5CLGA 3QVGA 3RDPA 3TSWA 5CG1A 1H0KA 1T3SA 5KSPA 4YRJA 1PZEA 4G89A 4RA6B 1ICIA 1I51A 1VJ1A 3QXHA 2IYNA 2PH7A 1T9KA 1OR8A 2SICE 3EA0A 1OB2A 1L5OA 5C8YA 3KC2A 1YAHA 1NI4B 2ZR0A 2Y9PB 2JGFA 2ZRJA 4JX9A 3ELBA 3NBXX 4KX3A 4UVIA 2JFWA 1T0UA 1DG1G 1W4ZA 3AUKA 1U0OC 2V8BA 3FVVA 4J1TC 4NYIR 4F45A 4QKQA 5JHHB 4M0KA 1G2OA 5CXQA 1JKJA 2WD9A 4KO8A 2C5LA 1M2HA 4MXDA 4RGYA 1NA5A 3IOEA 4G5HA 4R9NA 3AT1A 2H29A 4W9RA 1JT2A 3IR5A 5FHQA 3EC7A 2GASA 1VCMA 4C07A 5JFOA 4K9LA 3NAQA 1V7QA 4YLGA 1RP7A 1UJBA 5BR8B 4WX2B 4MCJA 3RR2A 1NBMD 1QNLA 4M9UA 4EJMA 4DZTA 3G5TA 5DNCA 3NZEA 3ZE1B 3Q2OA 4RFLA 2GPWA 1S2OA 4EJSB 1MVLA 2J0EA 3GCXA 4OL9A 2R5WA 1Z4MA 5GAJA 1BKSB 1LLDA 2NACA 3O8CA 2VL7A 4O29A 1P4SA 3N0XA 1ZNZA 2CVQA 2CV1A 3ZZUA 1Q1GA 2I67A 3UM9A 5G0TA 1U9ZA 5IMSA 3U7RA 1LSJA 2D2EA 3MQFA 3X44A 1N9GA 1ZK1A 1E3TA 2C5SA 3IP8A 1PU2A 3CVUA 4KL8S 1JJAA 1X7WB 3GO4A 4DSZA 1UBJS 3SM3A 2P6UA 3KKEA 4ACAA 4WNAB 2R47A 1ZPDA 2H59A 3C3WA 1ACJA 5D1HA 4RSMA 2P5YA 2P4QA 4OREX 4FCCA 2B5WA 4M38A 1SC4A 2G5GX 2VDLB 3RODA 2ZSUA 2H5IA 3VDNB 5CA0B 3IVAA 3OWOA 1O5IA 4UPEA 1IY2A 3PR1A 4DZZA 1Z5OA 3R7AA 1CD5A 1GNTA 2P0YA 3DNFA 3HA5A 3ICPA 1RYZA 1WP4A 1L7NA 1O94A 4GR5A 4TQGA 3RUCA 4NONA 3GGSA 1VIDA 2FN9A 4LXHA 4W7HA 3TAXA 4FIDA 2ZXEA 4RK5A 1SCDA 5AW0A 1GTL1 5ALZA 2AN4A 1HWYA 2HPAA 2QL7A 4FCVA 5CH8A 3RTCA 4QRIA 3MJTA 4XEUA 5CH3A 4C30A 5CDHA 2CLDX 1V11B 1PJTA 1TM7E 1I2MA 4MO2A 5C0OE 5SY4A 3T41A 2XH8A 2OV1A 4LJYA 3SF0A 1EFTA 5JDCA 5LP6A 7ABPA 5TPWB 2QYTA 1OLXA 4J16A 2IZ6A 3VC3A 1RC8A 5BSGA 3H3JA 1PWZA 3A6ZA 4M8IA 3DTYA 1NUUA 3E84A 1QOPB 3GEPA 1CTQA 1QRDA 1J8VA 4MQEB 2I71A 2LVBA 5TJHA 1ADBA 1FYFA 1X94A 3PZRA 4M87A 4YQFA 1ZIDA 3EGEA 2DBZA 4EQZA 3OUUA 1QYRA 3CE9A 3ILXA 4P34A 3A7DA 4Q7EA 4RH3A 3UGKA 1X0XA 4BFXA 1QKJA 2F00A 2LD4A 2CLEB 4EG7A 2V6GA 4QLOA 1RZRD 1M2EA 1NBME 3OD1A 1SVLA 5FUYA 4NCJA 3BCHA 1ZIOA 4EDHA 1YVEI 1XZLA 3HN7A 3CLUC 3F1LA 4JH0A 4RE6A 4J0GA 4D8YA 8MHTA 3QGMA 5EWMB 2E2WA 2WJPA 4HNHA 1HY3A 2COEA 2CXOA 3M6UA 1QTNA 1IU9A 2Q9CA 5HKBA 2OHXA 3AHFA 3BDIA 4K81B 4QULA 1XMVA 5FL7D 3RBVA 4GPAA 2IEIA 2PKEA 2VDRB 2I22A 2R8XA 4MR9B 2JPDA 3PHBE 4KAXA 4R51A 4NBWA 3FMIA 4NKRA 5ITZA 3FCUB 3TOCA 2A6PA 3IL2A 3TAHA 3KELA 4MRMB 5J23A 5DLYA 3SE7A 4HNRA 1C3VA 4YJ3F 4C4ZA 2KLBA 3RK1A 4AULA 4RSHA 3N2GA 4GC9A 4C6HA 4EB3A 4TL8A 3UJ8A 4PCUA 2Y1OA 1NATA 1D6NA 1KGDA 4P4TA 4XVUA 2DPHA 3PTAA 2WUFA 1U3GA 4FD2A 2AR9A 2WD7A 3H9JA 1TA9A 2QRMA 3Q6NA 2H07A 2FW8A 1L1RA 2RGGA 4L2IA 3TTVA 3O21A 3LHKA 4DJJA 1BA2A 4FEYA 5CA1B 2JGKA 3IIJA 1UBOS 3LPDA 3FDZA 3W5VA 3C3XA 3M6VA 3M89A 3NBQA 4JB2A 4QDOA 1TO6A 3B1WA 4NMHA 4K9OA 1JI3A 5ELLA 3W5UA 5HF9A 5TLSA 1TM2A 1XZ8A 1YNOA 1IEVA 3ZGLA 2QTWB 1NY5A 2XODA 3C4JA 5T64A 3MGCA 1XZEA 4Q05A 5KNLA 2MMGA 2Z5LA 5AQEA 3UTCA 1W29A 4LYJA 4X92A 1GRCA 3AM3A 3FNFA 2V3VA 3OCWA 4UNQA 2RGNC 1NUQA 1KO7A 2A3NA 2BM0A 3DZIA 2IUUA 1A9ZA 1LPAB 2FNAA 2QW8A 1FFHA 1R8XA 2R6JA 2BFWA 3MUNA 2OUKA 2P9JA 3MIIA 4FYWA 4ARZA 1NU6A 2L2QA 3SZRA 2AUTA 2DX7A 3PHLA 1I3OA 3ZLVA 2W22A 2ORVA 4ETNA 3B1ZA 2Q3JA 4P3XA 4B6GA 3O6VA 2OHGA 2CE2X 3N2ZB 4KN5A 1E61A 2QJWA 5KDLA 4FJ1A 5BWMA 4U8GA 1NXSA 2NPOA 3C16C 3CF4A 2LXNA 1A5TA 3ZGVA 2RARA 2VDNB 3D1LA 1PV1A 5T4FA 4PLCA 3UTDA 4A92A 1FXWF 2KBEA 4NVRA 3FLEA 2HCFA 4B87A 4DDMA 4EELA 2G67A 4LGCA 3VV3A 5K0TA 1T25A 1RAFA 4ZOAA 2FPKA 3DDCA 1P60A 4G86A 1U2DA 2HTFA 1QHSA 2ZVDA 2NAPA 2P40A 3Q41A 5HX7A 4KP7A 5K8JB 2G8NA 3FMVA 1SOVA 5F5LA 3F3KA 1S4QA 2HMWA 2VSOA 3CURA 1UC9A 3PVSA 4KQJA 4M8LA 4RJJA 1Y8CA 3I23A 1RKQA 1AKYA 3TNLA 1OH5A 1F12A 1BGXT 1CV2A 4RETA 4OY3A 2Q6LA 3ETDA 4GM1A 4LOJA 4IGIA 3IKJA 1ABEA 4R05A 2ADMA 4IF4A 2ALJA 2L82A 1P2DA 2XRMA 3ADOA 3B3AA 1SUIA 3T7SA 5JAPA 2F4VB 2P69A 3PGA1 3L0ZA 5FB3A 1Z8FA 3U60B 4EKIA 1Z8NA 2MMCA 3WL8A 3K6SB 3DEIA 1VKRA 4L4YA 2QVZX 4EKGA 4MQLA 1ZM9A 1EH5A 1OI4A 2VJPA 4YJFA 4IEFB 1VRWA 3NNSA 3AFNA 3PJFA 4HDKB 5AHWA 4FW9A 1NLZA 3LQ4A 1Q7CA 3B6MA 3EPRA 4WBXC 1XI2A 4WIAA 2X41A 4YCAA 1EDOA 4NX2A 3I3SR 4I4NA 3ZU6A 2X77A 5EJGA 3S55A 4CJXA 3C8UA 1QLWA 2O0MA 1DHTA 1A95A 2CZCA 3ELUA 3HGQA 4O25A 4U4AA 1SXJE 4HDRB 3UMBA 1I4DD 5CW2A 3VH2A 1XDUA 2VZ9A 4ZQHA 5HDBB 1RYDA 1XGKA 1O95C 4U3JA 2H17A 2CDNA 5BNTA 1J2EA 2HHLA 1SUFA 2XUGA 3QLEA 3OOHA 4YV2A 3M9LA 2HU8A 4P3PA 3C6KA 2YFQA 1R0CA 1L7BA 4QL3A 1E1CB 1Q0UA 2PL1A 4BEWA 2C4KA 3NTXA 1EHYA 3LFTA 2PE5A 5D3KA 2DFLA 4RCVA 5IPFA 5KNDA 2B8WA 1HYBA 2HWWA 2H7CA 4KTVE 3I12A 4JY7A 4NBLA 1P7PA 2G88A 4F9FA 3D3NA 4EGSA 4YPOA 5AUOB 4BMOB 4Y9RA 3HU1A 3NBMA 521PA 1KE1A 3O5AA 4BPRA 2G08A 2JFBA 3GLGB 2I66A 3WGLA 4BNFA 3IAM1 2FF7A 2PKWA 3F4KA 3O8OB 1QGZA 1JEQB 5JFGA 1O96A 3JARA 4TLLB 3TQFA 4KIFA 1N0VC 2QN9A 4X64B 1UEXC 1XAGA 2OBLA 1MORA 3UFXB 4D44A 1V37A 1R2QA 2CLIB 1L4YA 4BXOB 4YP9A 1GLVA 5JZ9A 1G9SA 1IK4A 2A0UA 1T4MA 5JXHA 2G72A 4A6DA 1MNQA 2PGNA 4Z2YA 4NRDA 1ZM4A 4Q3DA 4LDPA 1ZH6A 2QR3A 1YQGA 3G7SA 1IHUA 3N6VA 3U6BA 4IICA 3HRKA 1ZITA 1ZUWA 1DZ3A 5ALGA 8ATCA 3D4PA 5HWSA 4RTKA 3PXCX 3WWDA 3THWA 2VP3A 3I1IA 2A30A 2R1TA 3PCRB 4EO9A 1TEHA 3LY5A 3N7UA 4NJOA 1XF9A 2GD1O 2NZ8A 4HRVA 1D04A 2RC6A 2WUEA 3N5KA 5FPKA 2IFTA 2IU4A 1KI2A 3M81A 4FOTA 3SD7A 3T1NA 5AVSA 4EB6B 1J06A 3LT5A 1CS0B 1G98A 3E81A 1SK8A 3JAWB 4LXGA 4DJAA 1M0EA 5LR6A 3HHEA 2D1YA 3ETJA 1M2VA 2QPLA 3CLSC 5CIQA 4DQXA 4E88A 3FTEA 2Q3BA 1QQ7A 1P6QA 1MDBA 1U9YA 1I9GA 1NL3A 5LB4A 4AP9A 1FS4A 3AEYA 5EE3A 1GDTA 2VDMB 2BFOA 1CJKC 4N0PA 2VN8A 2QVCA 3H0CA 4QBHA 1GGFA 3GLHA 4UCXA 1Q17A 4UTOA 4D4MA 1OI3A 1EWVA 2GSWA 1WOMA 2JD2A 2XUIA 3DYBA 3H9EO 3K0CC 1CIVA 1T3TA 4X45A 1QLHA 2HXSA 4KODA 1E3WA 1L5RA 2MT9A 4QUAA 4QJ4A 4BAGA 1MABA 4HEHA 1A76A 4N5DA 3KWJA 1SPXA 1MB9A 1Z39A 2JGEA 3CCCA 3PFCA 4EHJA 4FWTA 3RTBA 3TDNA 4NU5A 3UENA 4DXHA 4HNSA 2BFDB 2BD0A 3FWNA 2WFZA 4MW2A 5HZHA 3DONA 1OH8A 1FNMA 3KP1A 2HL6A 1Q0RA 3ESQA 5ALSA 1ZI8A 1ADGA 4OQQA 2NADA 3NHSA 3HKBA 3VR5D 5E9WA 2E4VA 3BFXA 4P7BA 2YX1A 2J09A 1K4YA 3QOYA 5TE9A 1AOXA 4JR1A 4PBSA 3S1AB 1ORVA 1Q11A 1JFVA 1VDMA 4HVLA 3X2FA 3H4MA 3EGWA 3IE2A 2PS3A 1E1DA 1OYVA 2AJDA 1ZIYA 7ADHA 1EQAA 1XEWX 5BW6B 1TM1E 1KZ4A 4JXJA 1J42A 1TAHA 4RZUA 1I4OA 2RGCA 4TT8A 4UXJA 3CRQA 2BTQB 4FHFA 1V71A 5AK3A 4JQOA 3S27A 4B76A 4BY9E 2O2GA 2C9ZA 1DAIA 1Y8QA 2YJ5A 4KQCA 2XSZA 4J94A 5ALOA 1I1OA 2JAOA 5ICFA 4MWOA 5KCMA 3AJAA 3HNPA 4JB3A 3V4RA 1YBMA 3MCZA 3R5HA 1FFCA 4LHYA 1PJ8A 2GRJA 2NU8A 3UGQA 4QAJA 1JG7A 4RQTA 5F35A 3IMFA 2E4YA 2WJGA 2B7CA 3H9BA 3DEJA 1TADA 4Y7CA 2AMLA 2O8FA 4ZDIA 1R0BA 3QE9Y 1X7XA 1W8IA 1E6KA 1RPNA 3K5IA 3T15A 3E48A 3F9CA 1T9BA 1CLEA 1Z4KA 3N3BC 4GM4A 4L4UA 3ZCSA 2X2OA 5C5IA 3VGJA 2V7GA 2VHCA 5LOVF 5DLPA 5CM2Z 1QTRA 4C7JA 4BO1A 3CUEF 4G3XA 1BWQA 2C3OA 1OB5A 1J56A 3EDYA 3FKSA 1KTVA 1E9AA 3DAYA 3EJ6A 3IX7A 4PPQA 4H6PA 4PX9A 4JVMA 5GGYA 3ZWQA 5J58A 1AZWA 4JJGA 1HNNA 3R76A 1T1SA 4M36A 1RVV1 2EIHA 3UXMA 4YI5A 4D81A 3CX8A 4CCYB 1EXVA 2OG2A 2J0UB 4P93A 1E2QA 5TPZA 2Q21A 2J08A 4PBRA 2ZI6A 4DYVA 5JNLA 4I6GA 1NE2A 4JCCA 2W6ID 3GP8A 1XV5A 4AT1A 1IXYA 4LW8A 4FLFA 4EOGA 4X8LA 4PFKA 2XUDA 2NV6A 3AY7A 4X00A 3L6RA 2QMZA 1QHEA 2WWVD 3E5RA 2Q5CA 5LU9A 2ECOA 2QTTA 3N6RA 2CD9A 2XNSA 4GX5A 2BONA 3WYAA 1UKBA 3NHKA 4TWIA 3DP7A 3EEFA 4EFMA 4ER6A 1YVRA 2HJVA 2BHLA 1KQOA 2DWUA 2IYPA 3KPVA 2BR3A 1SHZA 2MHCA 5CVVA 5ALTA 5FI3A 3CUVA 1ANKA 3BRCA 4AY6A 3H11A 4YMWA 1QFMA 1DQZA 4ZDWA 1JN0A 1FTQA 4PYLA 3C3EA 3PFHA 4UUBA 5FWXA 1JIJA 2HFJA 2O8NA 1K86A 4Q1CA 3ONVA 5CD1A 4B6PA 1QMGA 3HACA 4WUVA 2OCIA 3DE0X 2Z08A 2AKYA 2PDAA 4IMPA 3RFVA 3ESCA 4DUPA 2AQKA 3EB9A 4BAUA 1T6YA 3ZY4A 4REQA 4BFLA 1W5SA 4TRMA 1VG8A 3GJ8A 3AJ8A 2QTVB 1Z82A 2HGSA 4NPHA 2QUJA 2OCAA 5CVTA 2H65A 3KEFA 2TSYB 4IJ5A 5ILOA 1SVWA 4ZAGA 1SC1A 1GCUA 3SWWA 2BEUA 2Q3MA 2WSSA 2YXEA 4O5AA 1YR3A 3TLEA 4C0KA 3GJTA 3WB9A 3P9QA 1ZL0A 2Q62A 1HNXB 1A82A 3UHFA 2D0OB 5FTWA 3RSFA 3FH0A 4HGQA 2P9BA 1QK5A 2ZAYA 3KYBA 1UOEA 1KZHA 5MF6A 2YYSA 1A9RA 5CNIA 3ZKWB 1R74A 5INTA 4GI1A 3S68A 1NXQA 2OV6A 4FQ7A 5D51S 3BFPA 2JL1A 5G1NA 1A9OA 4ALLA 2CHUA 1ZG3A 4JJ4A 2OAEA 4A27A 4WKPA 1AHNA 1Z5GA 2OFPA 3HYTA 2E7ZA 3DMNA 4RACA 2Z0MA 3PVCA 4HK4A 4DM4A 5EJ9A 3TG2A 4XWWA 4U7DA 1GKKA 2J9RA 2QNRA 5DSXA 3TCXB 3UG7A 1ZJ5A 5GM2A 5J2UB 3SQLA 3HC7A 4FSXA 2EGHA 4FZRA 2FN8A 2J67A 1MW8X 3VBEA 3OZRA 3X2SA 1H2RS 4A8JC 1XROA 1JKFA 3G2HA 1I2DA 1ULUA 1W5EA 2BKEA 2Q5JA 3O8BA 3IAS1 5JY1A 2O5CA 3JQGB 4E11A 5HKKD 2PUFA 3UJNA 3SC3A 1GYQA 3BMNA 1EZ1A 2ZYGA 3Q8KA 1Z4PX <