3K7EA

Crystal structure of human ligand-free mature caspase-6
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
259
structure length
214
Chain Sequence
PAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRIGKKQVPCFASMLTKKLHFFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analysis of caspase-6
rcsb
source organism Homo sapiens
molecule tags Apoptosis, hydrolase
molecule keywords Caspase-6
total genus 72
structure length 214
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k7eA00
5IBPA 5K20A 3PD0A 1RHJA 1RWWA 2QLJA 4NOJA 4N7MA 4NBKA 2H4YA 5IC6A 3H11B 4QU8A 3RJMA 3PD1A 1SHLA 2CNLA 1BMQA 3NR2A 1RHKA 4NOLA 4NOKA 2J33A 4EHKA 4ZVSA 1SC4A 4JQYA 5LU9A 2CDRA 2CNKA 4ZVUA 4ZVTA 4N6NA 1I51A 1QTNA 3DEHA 4DCJA 4JJ8A 4FDLA 1RWOA 4IEFB 4JJEA 2HBRA 1GFWA 2CNOA 3V3KA 1ICEA 1QX3A 2CNNA 2FUNB 3IBFA 5IBRA 1RHMA 4EHFA 2C2KA 2WDPA 2AR9A 3R6GA 2CJXA 3EDQA 2QLBA 1PYOA 2HBQA 4HQRA 1NMEA 4IYRA 2K7ZA 4PRYA 4AWBA 4QUHA 1CVRA 3R7BA 4M9RA 2QL9A 3KJNA 4QUGA 4EHLA 2FQQA 2NN3C 3DEJA 3R5JA 4LSZA 3D6MA 3GJQA 3S70A 4EHHA 4N6GA 2H4WA 1PAUA 4QU5A 4AWAA 2C2MA 4DCOA 1F1JA 1QDUA 1SHJA 1RHRA 2P2CA 3NS7A 3K7EA 1RWNA 4JQZA 4NBLA 4N5DA 5IARA 1RWXA 2Y0BA 3BIJA 3GJTA 3H13A 5H0IA 2QL7A 3P4UA 5LUBA 4PS0A 3DEIA 4QUJA 4ZVPA 4JR1A 4JR0A 3R6LA 5IAEA 2XYPA 3V4LA 3KJFA 1JXQA 1RWKA 2FP3A 2QL5A 1RWPA 4JB8A 3V4OA 1NW9B 3R5KA 3OD5A 3UO8B 2CJYA 4D3XA 1KMCA 2H5JA 2J30A 5IASA 4NOMA 4I1PA 3SIPA 2H48A 1I3OA 3ITNA 3PCXA 5IC4A 4JJ7A 2C1EA 3NKFA 2J31A 2H65A 4QUAA 1I4OA 4N7JA 4QUBA 1RHQA 3E4CA 5IABA 1I4EB 4QTXA 1IBCA 4QUEA 3H0EA 5IANA 2QLFA 4EHAA 3S8EA 4HQ0A 3V6LA 5LUAA 2XZTA 4AW9A 4HVAA 4QU9A 4EHNA 2H51A 3QNWA 3H1PA 1RWMA 1RHUA 4EHDA 3SIRA 4QTYA 1SC3A 2H54A 3P45A 1F9EA 4QUDA 3R7SA 5IBCA 2C2ZA 2H5IA 3DEKA 4JR2A 4PS1A 5I9TA 3V55A 4DCPA 1RE1A 4FGUA 1CP3A 4NBNA 5IAGA 2HBYA 3H11A 4FEAA 3V6MA 1K88A 4PRZA 1NMQA 1NMSA 5JFTA 4D3YA 4EJFA 3EDRA 2DKOA 4QULA 1GQFA 3D6FA 4QUIA 1SC1A 3GJSA 2C2OA 2J32A 4N6OA 3KJQA 5IAKA 4D3ZA 1RWVA 2HBZA 3UOAB 2XYGA 4ZVQA 2Y1LA 3IBCA 1M72A 5LU8A 2XYHA 3D6HA 5IAJA 4ZVRA 1K86A 4I1RA 4ZVOA 3R7NA 2XZDA 4FXOA 3GJRA 5I9BA 4QU0A
chains in the Genus database with same CATH superfamily
1NUUA 2JZNA 5A4AA 2CV2A 1CR1A 4WKCA 2GR9A 1MX5A 1EUDB 3AEUA 3D5TA 3GF4A 1XTQA 2WWIA 2ISSD 3GW8A 1L4HA 2ZDQA 3HJUA 3F3YA 3MLAA 1R8YA 2B9EA 4B2YA 1SHLA 3TNLA 4MULA 3R0XA 3DZIA 4ZVSA 3H8SA 4KFCA 1F8FA 1KY4A 4ZO8A 4ZVTA 1K2WA 3EWAA 3ZWBA 4H77A 4IVPA 1K6IA 1YQGA 3HCOA 3ZDYB 4AZ0B 4ZEOA 1E5VA 3F6YA 3TGLA 2Q5QA 1F0PA 2R4QA 3L9WA 3UJDA 2ZTHA 5KPJA 3FHOA 2C1XA 2TRSB 1IQPA 3GD7A 4KQMA 4N0DA 3DFIA 5EWMA 5FUXA 4E51A 4JYAB 3TXYA 5CBPB 1NXVA 1XKLA 4S35A 1IEQA 4GYJA 3ASYA 4CMEC 4O4JF 3VNVA 3GP3A 3KT8A 3TH5A 1ZD1A 1GFSA 1OXSC 4I50F 4JXXA 1BX3A 2HSGA 2VTKA 3VO9A 3FMPB 5JPIA 3MS2A 3TXXA 2D2VA 5KKCA 3SSNA 2ZBVA 1BRTA 4C78A 1U7XA 4MYCA 4BP1A 4JYCA 4QQRA 3S44A 2QORA 2WIKA 3HCBA 3OZIA 3OE7A 5SYMA 1OWOA 3ICVA 3SJCA 4NENB 4Z6KA 4CDNA 3GUUA 3HB4X 5JPCA 3UJNA 4GPZA 2WEKA 3OSZA 1HZZA 1NATA 1PFQA 2ONJA 4YA6A 3T6KA 3EPLA 2W2TA 2DPXA 3GJXC 2V7EA 1ZDMA 3UC9A 2AJ8A 3MTDA 1RXSA 1KDOA 1RAIA 3EFBA 1WHSB 5IZ4A 2RD2A 1KRXA 1FYVA 1N32B 4DABA 3P5SA 2D5BA 3TQOA 1DG1G 3E0QA 4YRZA 1RIIA 3QUCA 3W7AA 3BJMA 3OO0A 3JQ8B 3EDYA 3RM3A 4PC7A 3W8RA 1KI2A 3VR0A 3AIOA 3U2QA 2WD9A 1EVLA 3JQCA 4DBVO 1MAHA 3NHYA 2V9CA 4KITB 721PA 2MR6A 1MJNA 1DIHA 2JAPA 2Z09A 3BMQB 1Y8AA 3L7OA 1JG7A 4B3TB 5EXSA 3Q3IA 2ODBA 2IYWA 2Z3VA 1ZIDA 5DOZA 1AC5A 2ZRFA 3WSVA 1UT8A 1GZDA 2C84A 3WWEA 5CLFA 2IY8A 1GCIA 1RE1A 3FKJA 4NBNA 3ZLTA 2C7GA 1JS1X 2E55A 3OOJA 3ELWA 4TN1A 5L3ZA 1QGZA 3WV4A 4BB6A 4TYWA 5F7ZA 2OD9A 4KOAA 2V3VA 4HMQA 3GGSA 2FPWA 1A7JA 5DNCA 4JYBA 1ZGHA 2R44A 1ZCAA 4C06A 2JBAB 4KO2S 1GUZA 1YAJA 3QEBZ 4W8OA 4XD7A 1RXYA 2YV5A 5DHTA 1GGVA 3RJZA 1ZRMA 2JGEA 1WXFA 3E1KA 3WDLA 5FPPA 4TS9A 3D54D 5KHOC 3WL8A 5K3EA 1J39A 3AIMA 5B2FA 4ZU3A 3EA4A 4A0GA 2DRIA 3DF9A 1VDZA 4IJ6A 5D3MB 3ROFA 2J3HA 4AI6A 2X9NA 4N54A 1CQPA 2HHCA 1DG3A 1LPNA 2J48A 3IGFA 2HMTA 4DIFA 1KYTA 1UIRA 3UN1A 5AI6A 4RACA 3UF0A 3C74A 4QU0A 4UTOA 1KVQA 3G5AA 4HH4A 3BPSA 1MO5A 4CV3A 4BLOA 4OQFA 5MGNA 1AQNA 2RBKA 4JCCA 5IC6A 4BNXA 4DARA 2DUJA 1HDEA 5KB3A 3LUAA 3NCHA 3UUWA 3W90A 3LPCA 5DYGA 3VISA 4NOKA 4OHMA 2LP4Y 4K9PA 2INGX 3SC6A 3BDVA 4LYGA 5G1NA 1TM5E 4LI3X 4RSGA 3VVBA 4HLDA 4JQOA 1MOQA 4LQ4A 1LS6A 3FLEA 4QPZA 5DPMA 4M1KA 4CI0B 1J0CA 1O0BA 2P3SA 3O8BA 4BZPA 5AQEA 2J9FB 2DUMA 5J1TB 1Q1NA 1K75A 5C18A 4DV1B 2J5KA 3OZEA 2POQX 4MCAA 3ZY5A 2C83A 5DDIP 4HUQA 1JPUA 1ZD3A 4PAGA 1ENPA 2Y77A 1IHYA 4C20A 1VKNA 5ADWA 1SVOA 2BEUB 1MR3F 4RWEA 3K9GA 1V1JA 1TYAE 3IOCA 3GJQA 5H16A 3VV2A 2VDLB 4U3JA 4ZAVA 2BAGA 1FDRA 4IO1A 2JA2A 1RP7A 2K2WA 1LBTA 4EI2A 1WZUA 2WHPA 4RTMA 2QM3A 4OQMA 1NL3A 4GR9A 1UT5A 1N2JA 1J0BA 2CXPA 3OIDA 4RF2A 4YACA 1U1DA 2ZS9A 3RROA 4ZDJA 1OWLA 2O20A 1NLFA 2IXFA 2WG1A 4HLUA 3BKXA 5EWJB 1OFIA 2QM0A 2AC4A 4AFNA 4V3CA 1R27A 1Z26A 4CDRA 4AG6A 4EG7A 1COWD 2V7BA 4JA2A 2BGMA 2CJYA 2GTIA 4KVGA 5CR9A 1CVLA 1I3LA 2AG1A 4LBVA 2Q62A 1OAKA 3DR3A 1HLFA 3EFHA 4XCVA 2CY0A 2EKLA 4A92A 3ANSA 3H18A 3PUZA 5KAPA 4AURA 3FNQA 3TVYA 221PA 4YT5A 2VRWA 2FYTA 2JLRA 2WUWE 3KSMA 4X54A 3GUHA 3D4IA 1UT6A 3EBLA 3K0FB 3I61A 2QV0A 4CM9A 4D8VA 3QVGA 1D2AA 1P17A 4LJ8A 2RAFA 2UYOA 1RQGA 4V0SA 1IBCA 1SKYE 2JGAA 4MQUA 4P31A 5THXA 1VMIA 3D5EA 3U7RA 3W4KA 4EJ6A 4CMCA 3ASUA 5C51B 2VNKA 4WOKA 5CJ2A 1EUCB 1YCDA 5IVKA 4URUR 3AP3A 4GNKA 2JGJA 2Z2XA 1LY1A 3DE6X 4JEUA 2I6TA 4DCPA 4H0CA 2JGFA 4M46A 2VP6A 1HE2A 1U4OA 5DEIA 2G9QA 4LE0A 3JSXA 2QBYB 3IMGA 2IHZA 3MMSA 3N7AA 3LNCA 4KX3A 3VPAA 4RY0A 5BMVA 5FUMA 1JI0A 2C3PA 1GQFA 1Y63A 1RJGA 1WD7A 1VL6A 1AE1A 2O23A 3D2CA 3W8NA 5HKLA 1R6UA 3R8CA 1YRQA 3IP9A 1LBIA 3D02A 4GUAA 4QAJA 3WHLA 3ZZTA 6ADHA 2HI0A 2NSJA 5HILA 2ECPA 4YROA 5JRZA 1J7JA 1EJ0A 2FV8A 2H63A 5K99A 4EVRA 1DINA 2QT0A 1M2HA 3IEXA 1OJ7A 1BX1A 3F71A 4I1YA 1YCGA 1YD7A 3C7TA 1YQEA 3PPIA 2GN2A 4MGHA 2YVLA 1ZUWA 1UFVA 3R9KA 3DFZA 4D9IA 2HLPA 1TW2A 1LW6E 3SPXA 2VATA 4ITUA 2ZTUA 3G2IA 4DR1B 4QRDA 1RHJA 1OCEA 1WRBA 1U0BB 3BIWA 2QGFA 3FBWA 1SKQA 3WYBA 1FOEB 1W9MA 4OP1A 5EKXA 3TBFA 4GBED 4PG6A 1P2UA 3A4MA 3AYZB 1NKSA 3GRCA 1J2EA 4KZKA 1L6RA 3BGWA 3DW1X 4YRRA 2V8BA 1OOEA 1E79A 1S6YA 4XJVA 5SY6A 2YV1A 2VTDA 1UH5A 1DKOA 3RS9A 1RWOA 2CXXA 5KBYA 3GZ4A 3UWSA 1OWMA 2QAIA 2GZMA 1HURA 4DDUA 2EAUA 2XKKA 4KLAA 1Q14A 3LCMA 5ENZA 5AKJA 5DP2A 1NY6A 1GGNA 5EJIA 4OM7A 3ZXUB 1F8UA 2FXVA 4Q7KA 2ICAA 3JQBA 1I6WA 5FL7D 3SDSA 3JAMA 1TM1E 4MJLA 5B3AA 2IX9A 3UT6A 4NFSA 1G3UA 2NXNA 1FSPA 4MV3A 4HNQA 3F6EX 1GFZA 4EHLA 3FLMA 3ENQA 1KZYC 1W96A 1ZESA 3R5JA 4KAJA 5TDHA 3R7DA 1K6JA 2AOTB 4YV7A 1NVDA 4QNMA 3QWBA 3OURA 3BX1A 4H4EA 4R2WA 2Z6QA 1IUKA 2H0AA 1CUHA 2PGJA 3AM5A 4IIDA 5EZYB 2IOFK 4NMHA 4DMFA 1Y1SA 4PN7A 4QWMA 3GPDG 1KQOA 1NOKA 5CYPA 1OIWA 1W4LA 3BMNA 4Q7LA 1URPA 4GL4A 5H9WA 5LZ4A 1MGPA 1DVRA 3OECA 3BTSA 1JDZA 5A9RA 3OT1B 4WOCA 3STXA 2BJVA 2IIBA 4RMJA 3O8CA 3SC4A 5CGZA 3V33A 3TINA 6LDHA 3SDZA 1SIUA 1YULA 3ZKWB 2R8BA 4U5QA 4R1SA 4B85A 3QMVA 3L5OA 3NHLA 3E7FA 1MT3A 3UZUA 3SMVA 2HHAA 4EPWA 1N2XA 2F67A 1MJGA 1W44A 1YGPA 3FD8A 1GPYA 3OTGA 4OHUA 1LPMA 1XRNA 4PLCA 4XX1A 2R6DA 5TVKA 2PL3A 3K4HA 5HZMA 2C94A 2RHHA 1EBBA 5JCPA 1IBSA 3GT4A 4UCXA 2CXSA 2PGNA 4RX1A 4BTEA 1QZXA 4K46A 1T1RA 4ZDKA 4OLBA 4G09A 5D6NA 4FU0A 5B2ZA 1SHKA 2XE4A 4QTYA 1GNTA 5AKKA 4DJDC 1Q84A 1CJTC 421PA 1J1UA 1AQUA 4LYHA 5HNKA 4TZ0A 4I46A 1NYTA 2BZ0A 5H70A 1THMA 1TYDE 2C9YA 5FBQB 5A04A 1IK4A 1LBEA 1UMBA 2MYNA 2OFXA 2PSFA 3W04A 1TK3A 1J2JA 4E6EA 3UAGA 2D2FA 2WYOA 1MA0A 4GOJA 4MHTA 3VI4B 4EFNA 1OY1A 1P81A 1OPRA 3SVLA 4WSOA 4RA9B 2BJWA 2DSNA 1DAGA 4N6OA 1U0GA 2GD2A 2GN1A 3C5VA 2M98A 2ZUVA 3H5OA 4LE1A 1FC0A 3GEGA 2PRZA 2O8VA 3DMRA 3HN2A 3ZV5A 4BX3A 3LUHA 2AIRA 2GCOA 3CCBA 4IINA 4CW7A 3I42A 4DL9A 2E48A 3FFXA 2ZJ5A 3EGXB 4IQGA 3PFWO 4L4YA 3U7IA 4U0JA 4K9MA 5PGMA 1SBNE 3G8DA 2IE8A 3RRBA 5BN4A 2NYVA 3NBKA 2OXEA 4N01A 3PE6A 1X8KA 1AQYA 1SBIA 1CJSA 3QVOA 4EY8A 4R2JA 4BS9A 2PPLA 3QTLA 4DANA 4ZI7A 3PA8A 3L7LA 1N33B 5HVNA 3RV4A 4Q6WA 3L6CA 4RYDA 3QXGA 3V48A 1Z6GA 3ABOB 3K16A 1RYBA 5AW2A 2Y0DA 3BCHA 2JHGA 3E9MA 1TZ2A 2OCGA 5FHRA 3DP7A 1GGEA 3R3YA 4ZHQF 1QGUB 1L5WA 3V5NA 1GTRA 4K9RA 4L5IA 2GAOA 3I0NA 3FPSA 1ZOIA 4MS3B 4PSCA 2IJGX 1MENA 1XRRA 3IKLA 4PVDA 5IN5A 4FGZA 1QH8B 2A0KA 4XDHA 3SJAA 4H7FA 1XRJA 1SOWA 3KE9A 3M0EA 1FU7A 3BXGA 3ESCA 4TQ9A 4TKVA 3CH6A 2TECE 2NYUA 3E05A 3EC2A 2P4HX 4IYRA 2A7XA 3V4VB 1DP4A 1WBDA 2WW8A 4QUHA 3C3AA 4PCAA 5JH7A 5JQGB 4EA9A 1W4AA 4H60A 4DEYA 3PI6A 1CBUA 1Z16A 4WK2B 4EG0A 1UXKA 5U1PA 4JLUA 1Z4JA 1SXJD 3QSGA 4RULA 1ZMOA 3PD7A 1RLMA 3KJHA 3NS7A 5JD4A 5T4HA 5K0GA 2YS7A 2BGIA 1ZD8A 5HA5A 5TXGA 7AT1A 4XM1A 3EPHA 2CVZA 4DLKA 3AKCA 3WLJA 2ILVA 1E2UA 2GAIA 1QIFA 3D0RA 2BMDA 2PV7A 5FNVF 4D25A 2I54A 5E1DA 5LQSA 5LQJA 1F9AA 4KXVA 4R2XA 3VR5D 4UTZA 2E18A 4OVKA 3U09A 1BE1A 1XG5A 3QUTA 4Z2AA 1Z29A 4LRWA 1YQQA 3OD5A 3PGLA 4HOYA 4OGLA 2X22A 3ES9A 3IPLA 1OB2A 3HKBB 2NO6A 4J7XA 2HDOA 2XADA 1GQ2A 1CNEA 2C29D 2DG2A 3REQA 3KWMA 1F51E 3CUUA 2ZI7A 4XDGA 5DHFA 2B7CA 2H4ZA 2ZI9A 4CEHA 3FAKA 4RE6A 4REMA 5IMSA 3R5FA 1T10A 2WU3A 2I91A 2B21A 3FWKA 3GIDA 4K5QA 1G3QA 4N0MA 5IM4A 1MAWA 2VJLA 2P30A 1SXPA 1ZGBA 4TZ6A 4FCTA 3AJ9A 3C5EA 4IOJA 1CDDA 1LQUA 2Y0CA 5CHEA 4LF6B 1QHIA 2P9FA 4JJZA 1IEWA 3OH8A 4LZWA 5GZ3A 2CLCX 2V8OA 2H5IA 3P71T 1MAUA 2PMEA 2ZRKA 1U8XX 2CCKA 3R2JA 2Y2VA 4PZLA 1OA1A 1LNSA 5FI3A 3O92A 4BLWA 3ADDA 5GGXA 5CMLA 2TSYB 1B74A 5EHXA 2Z30A 1TKAA 1DBPA 1XF9A 1T0JB 3G49A 5FTLA 4TLDA 1GTSA 5EPUA 5CH3A 5EVJA 2AZ4A 1T1SA 4B2LA 4BKRA 4DHEA 1E3JA 4O08A 3AOEC 5H68A 3S68A 5DM1A 4ZI5A 2PQ2A 1E6WA 4UDYX 4CXMA 3LRPA 3L7CA 2HMWA 2WYUA 2VYND 5CT9A 2P2LA 4DC1A 3E2IA 4RL6A 3KXPA 2Y1CA 4N0PA 5K4AA 3P2KA 3I64A 1PGOA 3R76A 3RAJA 1TIKA 3VYRB 1G1MA 3K70D 2GM4A 3G0BA 4ZQCB 3L4SO 2NU7B 2O2GA 3RS3A 2FRDC 3UWOA 1XV5A 4GVXA 4L8VA 2GF2A 1GGKA 1QHNA 3TD9A 4M1ZA 4YP0A 4EYSA 4D8TA 2FWIA 2WHXA 4PY2A 4Z51A 5JWOA 1Y7TA 1C3OB 2ENWA 1D6SA 2GCIA 2R1TA 2WA2A 2X2FA 2QN1A 3QKSA 4L6CA 2ATIA 3N28A 5C2JB 1L7VC 3K30A 1OZHA 1SUBA 1F2DA 5FI5A 3COSA 3RUHA 3T3GA 4M9QA 5ESRA 1XVLA 5EZYF 3ZS9A 2WI8A 3PA6A 3AFNA 5JFOA 1N9GA 4J1TC 5SZKB 1EA5A 3K15A 2QUJA 2RGBA 3UGKA 4JLOA 1DI0A 1RLOA 1U8FO 3PR2B 4PPGA 1ORIA 3WGMA 3UUFA 5BYBA 2XCTB 3FCYA 1KHHA 2C0PA 1QJCA 2GCNA 3NEYA 1IBKB 2C2KA 2R1VB 3LVQE 1ECPA 4JLNA 1OI2A 3EZNA 1ZIPA 3H5WA 8ATCA 1E8MA 1H2ZA 4X60A 3UFXA 4DYDA 3GEBA 4FCWA 1NF2A 2PSJA 1A9YA 1GNRA 2DPLA 3R5TA 4OBBA 4WBNF 3I12A 3PUIA 5B3LA 1I7DA 1WB9A 2ZUCA 3CNBA 4I4CA 3ZK9A 2IF0A 5HPYB 3V8NA 5FOWA 3VMMA 2CFSA 4M3NA 3MWFA 4DBLC 3GCZA 4B4DA 1HOXA 1QKIA 1N6IA 4N8DA 5CP8A 3SIWA 4M7RA 3X0DA 1WMFA 2AXEA 1WOYA 4OHVA 2W58A 4QUJA 4PPNA 5EG5A 1I94B 3P9NA 4XB6B 1U7WA 3LV8A 5BSEA 2V5VA 1ISJA 4G4JA 4D4KA 3R77A 2YYYA 2GPJA 3K6SA 1Y42X 3UW1A 1PEKE 3OCWA 3VKFA 2P65A 2VRCD 3TLJA 3W79A 3WDMA 2D00A 1V41E 4DCMA 4ZYYA 4OY3A 3LYUA 4L4UA 1I4WA 4K28A 4M0EA 2A14A 1LJ8A 2CGEA 2VJDA 3OF5A 4QO7A 3PICA 3IUBA 4GWKA 3VKWA 4LG1A 1R4MB 4FQ5A 4LWPA 2JLWA 1NVTA 2OHVA 3WGGA 1WPXA 4ROTA 2IYXA 2G72A 4U1RA 4UXHA 2DFDA 1SQSA 1L7BA 1P2SA 3A3PA 4L27A 1BCSB 5KNCA 3REOA 5LB2A 1E1CB 3GFGA 3V6LA 1GTG1 4IX9A 1JHYA 3NBZC 2L69A 4C2AA 3ESRA 4FVTA 4JBNA 4KR9A 4G01B 4KQEA 5TPZA 1MQ9A 5C80A 5I7SA 5FDFA 4P7FA 3BOSA 4R4JA 4AZTA 1WXGA 2JFYA 4JCOA 4JI7B 1XTZA 3Q3CA 4ZRMA 2GZRA 1QFZA 1JLLB 5ALUA 4U63A 1F5SA 3IVAA 3A4LA 1JHVA 5DBFA 5EZQA 1SR8A 4M83A 4QEDA 5TS2A 4CM4A 4O2BF 1KPIA 3B3JA 3CPSA 3QMPA 3BICA 3ZXXA 1QRUA 1XZEA 1SRQA 2G36A 2HMUA 1NOJA 3DUWA 3NT4A 1SKYB 1WXDA 4PHFA 4DVGA 1JKJA 3ZJVA 4GG1A 1TF7A 4A0FA 5TX7A 2R751 2GBFA 1MNQA 1YS4A 4WI1A 2QW8A 1L5HA 3DBLB 4XEHA 4Q7QA 3FSJX 1I10A 1X7GA 1E9RA 2XYHA 3B8EA 3LWBA 1I2CA 1BKDR 1VE1A 2ETXA 2JLVA 1MZVA 1L3IA 2NXEA 1KJWA 3IUQA 3JVDA 3R7NA 3SICE 4BMSA 5KWIA 1IMJA 2DR3A 1P1JA 1SFRA 1Z8DA 3P94A 3E1GA 1NVVR 2Z08A 5CT4A 4AUKA 5U4XA 3T1NA 2TMKA 1LX6A 1W19A 2ZWPA 3K2BA 1OBVA 1US8A 3LQ1A 4UHFA 1TDJA 4XX0B 1E6EA 1L3CA 4PW0A 1EHCA 5A6SB 5A9SA 4MVJH 1M6VA 3H97A 1V11B 5JMPA 6REQB 2J33A 5FFFA 4EHKA 3TBKA 5ICSA 1REQB 4LJLA 4KSBA 2PUEA 1UC9A 3PIIA 4BP9A 1K63A 4N6NA 1NBAA 2VRBA 4XE5A 1RI5A 4Z4CA 1WW3A 1YCHA 2NTNA 5FNVB 2QRMA 4KQCA 3W7BA 4ARAA 4J9VA 4CMGA 4EG4A 4FGJA 2XBMA 2UVPB 2CBZA 2FETA 3QJ5A 4HZUA 4IIVA 4L8LA 4XX0A 5EYPB 2H17A 4UUMA 2VT2A 4M60A 2HK7A 1KAHA 4Q21A 5ERYA 3LPAA 3EA5A 2DFTA 3QVJA 1W2WB 3FCOA 4W5WA 3WS7A 3UJ8A 3EW7A 2XNSA 1AKWA 4C89A 2EVWX 3Q4GA 1YZQA 4WGFA 3CU5A 4ENRA 4ZFNA 4QUKA 4OGWA 2J4CA 3WICA 3LGAA 1CRLA 3EFOB 1SQ0A 521PA 5JHGB 2FPOA 2QN8A 2ZRHA 1QANA 2I7VA 3EIWA 3FNFA 4RTPA 4YLGA 3TR0A 2K6GA 1RE0A 3JTMA 3VOBA 3T54A 1ZGZA 1U2RA 3FNRA 3KYJB 3ZE9A 4DBZA 2BKEA 4QGFA 4UM5A 4FBGA 4YVFA 1CHNA 2G1AA 2XA1A 4IQ4A 5BN3A 2I3BA 4G85A 5FYDA 5G41A 3C14C 4YCBA 2IP1A 3RSLA 3QYFA 5JR3A 3ZIAD 3T3NA 2Z8XA 3VKVA 1W1IA 4KPUB 5ESWA 5IASA 1W36C 2R8EA 4DQVA 3R9WA 1L1QA 1ZM2A 4UCQA 2WVJA 5KKAA 5A0VA 1YIAA 2HYDA 1SZCA 2H2DA 1O5OA 5LQUA 2JH3A 4GX0A 1Y8RB 5CG1A 1OXVA 2HREA 3J80A 4U2BA 2IHJA 1VE5A 2R97A 3R3XA 1X80B 4YRGA 1RCTE 5KNCH 1NVMB 4DCVA 1SVMA 4ARZA 5BMOA 2FSUA 4YI3A 1LLDA 3O82A 1AGYA 1WDKA 2GO1A 2AYXA 2HLDA 3SJBA 4PZCA 1KSJA 1KKUA 4GE0A 3K9NA 1YRHA 4H6WA 4D82A 3FYUC 4RSMA 4WNCA 1HNWB 4HPJB 4IICA 4P80A 5EJ2A 3G0CA 3QE0A 3WVNA 4BNNA 3AM1A 2LV8A 3FI0A 1T43A 3FRHA 3L4EA 1TQ6A 4G24A 1I0ZA 3TMYA 3BGSA 3ZW8A 3VZBA 3UXYA 3EDOA 4GC5A 5JE8A 3VX4A 1MO3A 1N9ZA 2Y71A 4JOCA 1BVRA 2OC9A 4UHJA 5K0BA 2QU8A 5EP1A 4EJ2A 1PJ3A 2GK6A 4I2NA 2C2OA 3GGCA 4HWGA 3H9GA 1Z2OX 1RI2A 2FE4A 1HLPA 1V1MA 3JAKB 2FPLA 1EWRA 3K6KA 3K8OE 3QLTA 4HB2A 5J23A 2QXUA 1NW7A 2QRZA 5D87A 1TF2A 2RGNC 2OO3A 4EM6A 1A9SA 2YVKA 3VUFA 4PPYA 1XD2A 2ZYRA 1WQ3A 4LK3A 3V2IA 5I7EA 1RJ9A 1EAYA 1GZHB 3DDSA 2IH2A 2QLJA 5A9SB 4TKUA 1PRYA 4I1OA 1EUZA 1X80A 2FX3A 5GGYA 5HX7A 3WYAA 4C7KA 2EKZA 2XB9A 1PJTA 1UBGA 2IW1A 4MLCA 2VTEA 1SCAA 2A86A 2ZI5A 4FE4A 2BFFA 2Z2JA 3AR8A 3HYRA 3N76A 4H1VA 1T2DA 4P5DA 4RVOA 3RARA 5HSGA 1OH6A 2FRXA 3BHJA 4JLKA 4LYYA 5KSZA 3GJ3A 2ZEJA 4HAYA 5ESXA 4HJXA 2J9ZB 2CFIA 1B8OA 1T9CA 5FA6A 2HO5A 3NO4A 2QN7A 1U9CA 3QFSA 4MKIA 4HLUC 3BMOB 3VPXA 1Z7WA 1S2LA 1XA4A 4JI2B 3HZRA 3DDOA 4Y2SA 1DUSA 2JG3A 2ZSUA 2UUAB 1VLQA 2LVBA 4JC4A 4NHEA 4O6VA 4R2IA 1WETA 1WW8A 2ACEA 2PGDA 3C98A 1WW2A 2H31A 4FMDB 4JLDA 3WP0A 5JW6A 1FBNA 5F5NA 1CY4A 3INRA 3OCCA 4MEJA 5IULC 4XVUA 3OZRA 1UM8A 5DN6D 2KBFA 1PTJC 5BV2P 3F3KA 3PYXA 1QAQA 3HI6A 2B83A 1S3IA 5B6PA 5KQSA 2WTXA 1M6EX 4H7DA 1KJJA 2WOJA 4P32A 4EL5A 4JQZA 2PYDA 2WM3A 1G7TA 3PF8A 5CB6A 2X8AA 3TRKA 1WXEA 1BO6A 2QHXA 2WKPA 5DHUA 7REQB 4OU4A 3L0PA 3L0YA 1U04A 4I4LA 4XDYA 3W0LB 1PG0A 2ID7A 2XMSA 3AESA 1O5IA 3NYQA 5CBKA 2FSFA 1O97D 1JBKA 3AF4A 3HPRA 4AF7A 4AROA 4GLJA 3QU7A 3OOEA 5K0CA 3FYDA 3DL0A 1H3NA 4MS1B 2E5LB 1I3OA 1OSNA 3SC3A 3ZD9A 1F0NA 1MX1A 2YHSA 4F96A 1WQ4A 1PUIA 4K2AA 1DJNA 2BHSA 1FUYB 4KDCA 4KDFA 1V8PA 4ZT2A 5AYVA 4KJZA 1I4EB 3UJ7A 3AKZA 1E3TA 5FH9A 1T4DA 1XCLA 1OIVA 3VR4A 2J09A 5G4KB 1E1DA 5CCDA 3OHMA 1DIGA 1K8QA 3QIVA 1ZNWA 2AFHE 2BV3A 2PSEA 4DFDA 2PK3A 1CV2A 3K2IA 4J49A 4LN1A 4EHDA 3VZDA 4F91B 5JEDA 5AK4A 5C8XA 4CFSA 3VHLB 3G2MA 3LP5A 1Y8QB 1CZHA 2ZRPA 1V5FA 4FK8A 4ZOEA 1A9PA 4OV6B 1RMQA 2RJNA 3RJ9A 2D1YA 5JSZA 2WC1A 3Q3VA 1GTVA 3WG9A 3V6MA 1ZD2P 4KLCA 3BFXA 3N5CA 1KOFA 1KZ9A 2WTBA 3GJ6A 3K1YA 3L0IB 3LRXA 3OPQA 4FFWA 1KKMA 4H7JA 1JFVA 3FM9A 4JJKA 4WKBA 3WYCA 4BB5A 1XMVA 3U7FB 3NIDB 4UE2A 3A05A 1TNDA 5HDBB 1SN7A 3WMXA 1WM1A 3LGSA 5CEJA 1VCHA 2QDXA 3DYVA 2JFXA 4C01A 3TOCA 4B17A 1O1YA 3IP7A 1E3WA 2PXAA 2JPDA 1IXZA 3EDCA 3WZLA 3ROEA 1C7ZA 4DJTA 5H8WA 4IDNA 5DM70 1K4KA 3OCZA 4WOJA 3JWPA 3GJ7A 2QZZA 5EMLA 3SHVA 1A8IA 4AKSA 3Q8XB 2VPWA 4NMLA 2GBPA 1BVUA 2HXGA 1TF5A 4GYWA 2GI4A 3MXOA 3QX9A 1TYEB 3C8UA 3A4IA 4LXGA 5IG2A 2RJ3A 1FJXA 3HCPA 2XI4A 3OU7A 4CL0A 2D5LA 1Z33A 3TZLA 1VKZA 1X8XA 1ECGA 3AEQB 5ETJA 4HPWA 4D9NA 2QE6A 4MYRA 3G0GA 5HRCA 3BA1A 4YPFA 4DWWA 4IPTA 3TEFA 3PD1A 2PQ0A 4A82A 2YIMA 4JX9A 1C8LA 1GCGA 3MMZA 3MT0A 4NXNB 3T3PB 5BN1A 2ERXA 3AM4A 2QV7A 3Q12A 4D57A 4B80A 3LD9A 1IMOA 1MJHA 4FFNA 2NSHA 4PYRA 1HBJA 5GONF 4FDUA 2C2YA 3ECCA 4FYHA 4AXBA 1ZIOA 2AQHA 3GJZA 3EODA 1T8UA 1SXHA 3QKWA 5BV1A 3EVGA 2FLWA 2XPCA 1AV7A 1Y3BE 3BF8A 3LTEA 4MW5A 4U2CA 1R18A 2R68A 5IXYA 2KW5A 1GT6A 4I6GA 4J0JA 2JA1A 1I1OA 1Q7RA 1CUGA 2PZ8A 2RI1A 5AR1A 1NVGA 1VLLA 4IAOA 2C0QA 3UT0A 2UVQA 1TC1A 2ZT6A 4IIFA 3KOWA 4CG1A 5IUNC 3DMTC 4QSHA 2NO4A 4KFRA 2NU9B 3INNA 4RGYA 4WBXC 4Q9DA 3VTAA 4C3ZA 5AM3A 3SWWA 4D26A 1WUHS 1PK8A 2NTEA 3A9WA 3AMVA 2R79A 3GFTA 4JBGA 1MEJA 1T3LA 1SVUA 2R5FA 5HXAA 5JO9A 4IBOA 2JAOA 4IILA 1MRSA 1KEPA 3OC6A 4DQ0A 1JPJA 4F38A 4P6VF 4FMCB 4IXWA 4MV6A 4BFYA 3FETA 2WHQA 1R9MA 3GT7A 1RQNA 4I1PA 1DIOB 3COZA 5LQAA 3ODGA 4JJ7A 4F1KA 5J2TA 2IEAA 3AR7A 9LDBA 1F8YA 3DOJA 2F8MA 3RVLA 2REOA 5NLLA 1JR3A 2LCFA 4DIKA 1OBHA 3ML1A 1WXWA 4QKQA 3FHCB 3TLMA 3CX4A 4U7JA 4I9NA 1E2JA 5MN6A 1U7OA 4G23A 3FSEA 4RPIA 4AJKA 3FYUA 2ZJ1A 3P9IA 3PFKA 4LJ9A 1LPPA 2ZIUB 4JU9A 2XVYA 5AW1A 5E2BA 1EU1A 4RBNA 3JRNA 3I73A 2J3MA 1V7CA 4BGUA 1GNPA 4NJEB 3RBAA 4ZAGA 1ZN7A 3TUJC 3MGGA 4H3HB 4MUNA 2ONKA 4XSVA 2HZBA 3JASB 3NATA 1NR1A 4HDAA 2F3RA 2X41A 3LDAA 1FYEA 2AHOA 4UM8B 1G8JA 2YQ4A 4A7PA 3RAEC 3IERA 3JWIA 1WTAA 4B3CA 4JK3A 3QNMA 5CVVA 1C9KA 1YIOA 3RRMA 4GIBA 4PO9A 3RB8A 1HEUA 3K31A 2ZJ2A 2QPOA 4DTCA 2ZSFA 2FZ4A 3FBTA 3IIIA 4KK3A 1RM4A 3WNQA 3A37A 2XYGA 2OZVA 3AF1A 5L4NA 2WTNA 2WUFA 3EVEA 2X1VA 5LYJF 1HX7A 2CHFA 2JARA 3L8HA 3TOXA 3RVQA 2BE7A 2JGDA 3BRWA 2A33A 5CDSA 1S0UA 2UYQA 3GLFE 1UODA 3QZUA 4QT4A 4J07A 5JMTA 1KJNA 3MWJA 4GOKA 2XNJA 2XVXA 4GMDA 4IIJB 4F3NA 3EZ6A 4A03A 1DRUA 3T7SA 2A3NA 1GV0A 2BGKA 5C5IA 5JSQA 2RGUA 3NU1A 3ONFA 1NRXA 3DAYA 4N5LA 4IDGA 4X97A 3WWOA 1KJYA 2OCLA 2I4TA 2OLJA 3A6HA 3GPLA 2HW8A 1WU8A 1LBHA 2EIHA 2C5LA 1J8YF 4FGSA 1PR4A 3GN2A 3MPUA 4X6XA 3OZTA 5EHNA 4C6HA 5C0OE 3WX0A 1GFWA 4K88A 5HKAA 4XJSA 2ID9A 2GJKA 2RSLA 4LMRA 4ZVLA 2P78A 1A1VA 4HDMB 3ZDXB 4RGVA 2VCYA 1XR3A 2NZVG 5AHOA 3E18A 3UMFA 4GS5A 4QWWA 1V39A 2IIPA 1AJEA 3UPDA 5JAUA 1ACMA 4LNUB 3R7WB 1RXWA 1HXHA 4BVEA 2VP4A 2ZM6B 1LXCA 4TV9B 1ZW6A 2CNWD 3W77A 1VMDA 3U5ZB 4Z9BA 4B4KA 2GILA 2AUMA 4EHHA 5KYKA 2GPAA 3EGOA 1NNSA 4NJMA 4QYSA 2O5CA 5JRDS 5AVJA 3D4LA 4IHKA 1TA4A 3D8HA 2GASA 3NOQA 4MH0R 4LC0A 3D3EA 4LOAA 5IS2A 1SA0A 1PDOA 1Z2AA 2QRHA 5A4DA 5KVVA 3HUFA 2ZKLA 2EZ4A 5MDHA 1AHIA 1X6VA 2FUG6 2V5UA 3NVMB 3CH4B 2SBTA 1V0JA 1JFFA 1JI3A 3P0HA 4QXPA 1F2VA 1LSUA 4RK0A 4RK1A 5KJ6A 4MWOA 2IE0A 3KELA 3ZI0A 4B6RA 4W5QA 1ZSVA 1YB6A 5BMVF 1X42A 1UK9A 2EFCB 1QYVA 2O1XA 3DOFA 1H6DA 3E70C 2XUPA 3DS8A 3PHLA 1PJCA 3PCXA 1TO2E 1PGJA 2PKRA 3UK7A 5TEWA 3GBPA 4BQFA 4CHTA 1RZRD 3O95A 3RC8A 1Y82A 5B12A 2VYVA 1G63A 3K5HA 2FPPB 1KAQA 5IW8A 3C15C 3AR5A 4R1PA 3T7AA 4GR4A 3ACDA 1PGPA 1H4TA 3DW3X 3IPRA 5CVDA 1R4NA 2L42A 4TXJA 3WGYA 3IJPA 2JLSA 1CCWA 3HDVA 4GE3A 1UPXA 4PG7A 4IMRA 3LPDA 3NTQA 1W1WA 4XGKA 1GTL1 1UFRA 2NPIA 2D4HA 1WV1A 5K8TA 2NOAA 2R9VA 1NLZA 2J67A 4YV2A 4GZ5A 4ND5A 3ZPXA 2W6CX 4PN3A 3KPYA 1O9HA 4CCYA 2GEJA 1RQPA 3ANYB 4HDRB 4BZWA 3R8FA 2O6HA 1V43A 4BKMA 4BV2A 1BFUA 2ZIFA 5ER6A 4YRPA 4ARVA 4QUIA 1DCTA 1TTQB 5F7XA 4DT1B 2HGSA 2EFEB 3LX8A 1OYVA 5F21A 4FGKA 4TGLA 5B1IA 2FKAA 1K8YB 2HMVA 4AY3A 1WDLA 1Q7BA 2WF6A 2O3RA 4KAXA 4Z8YA 5DIFA 4BTVA 4DOMA 2X5XA 3BFKA 3C3WA 4P5PA 1KYVA 4ZT5A 4TMZA 1YXMA 2Z56A 4IGKA 4XVQA 4WNIA 1DTSA 2CDBA 1Q0LA 3IQDB 4IJVA 1DKMA 1B0ZA 3AR4A 3I2KA 1TCUA 2XKAA 1PL0A 2GD0A 5EMJA 5I5GA 3OPXA 1SZJG 3SNHA 2GVDC 2R8PA 3OAAD 3V4SA 2O8BB 1LBSA 3RGGA 2PO7A 5F4ZA 4OLAA 1TX4B 4PR0A 4B7XA 1KU0A 2H92A 4MAMA 4BZQA 1Y1LA 4L9SA 1VP3A 1X19A 4KO8A 3OT5A 2ZPAA 2GK4A 2FTKE 1DO8A 2E4WA 1U1GA 1OLXB 4M53A 2NQ8A 4C0BA 3DWFA 5IXSA 4AMZA 1R0BA 2ABWA 2HA4A 2XDQA 4URYR 2FSVA 2XTNA 4G1MB 4GC9A 1J07A 1QKKA 1U2GC 1YKSA 2PKWA 1U0FA 1CSEE 4UHDA 5C4MA 2OUIA 3OO1A 1MN6A 4FFVA 2G82A 1AMNA 2OO5C 2ID4A 2X3UA 4ZP1A 3KPWA 1XXHA 2F3SA 1FMJA 2RHGB 2V96A 3GLSA 3UJ6A 4ER6A 1FRZA 1X7YB 2OAGA 3DL2A 3PX3A 2DOKA 5CYOA 3EIEA 2CUZA 1I8TA 1T4BA 3AI2A 1L5KA 4Q66C 3U9LA 2G17A 2JIDA 3QENA 3OCVA 3MBOA 4YUVA 3HDGA 1SVKA 3JZMA 2FW8A 5CFMA 1XX6A 2OOSA 2Y6UA 4PO3X 2C9ZA 4PYMA 2PNJA 4KO3S 4LUCA 5A4MS 4TSKA 3DDUA 2W2XA 4UQOA 3M1LA 4PWZA 4ZVPA 4EI9A 3I4FA 1ABFA 3O8DA 2LR0A 4F4JA 5I7RA 4G36A 4TKUB 1QAOA 5EE9A 2FP3A 1I6KA 5EN4A 2BZ1A 2F90A 2QL5A 1OVGA 3N0TA 5AVWA 1XNRB 3AHCA 5AXBA 1KFBB 4C0LA 5ES4B 4BKUA 1CUBA 2WFLB 4NSNA 4YIKA 4DA9A 3AB3A 4RVDA 4BBZA 3HJHA 3I1FA 3W9YA 2RAPA 2RH8A 4GM4A 1RAAA 4BEVA 4KQWA 1VC2A 1ORWA 3RWMB 1ZITA 1Q11A 4FEYA 4JMLA 1L4NA 3T5AA 4RH1A 4KVAA 4RXUA 2A67A 5A62A 4KI7A 4M7PA 1HEYA 3CJRA 1F12A 5DZSA 4OXKA 4ZT3A 3GMDA 2C2BA 2A59A 4J0KA 3DZJA 3QNWA 3B1KA 1MRNA 3PGXA 1E20A 3VR5H 2CLDX 3RJ5A 1EDZA 1FJHA 1FYWA 1ZGCA 4BASA 1F7UA 4UBKA 2C2ZA 3FZGA 2BF4A 2JLAA 2ZJ7A 2FMFA 4AJHA 2O2XA 4FMPA 3H11A 2XT0A 2QVLA 2VQSA 4FGWA 4X1YA 5ICMA 1FQWA 3FMOB 1QP0A 4B76A 2J0UA 5ENVA 2J87A 3ESDA 1BNCA 2LIVA 2RCNA 1V37A 4EPRA 1S2DA 4AJIA 1U7UA 2PRYA 3AU9A 4EVSA 4ZOQI 2BM8A 4JSYA 4IG4A 3B20A 4NNPA 5AUOB 5F64A 2R00C 3BH6A 5JS2A 3KJQA 3SLGA 2WJ3A 4CM8B 5HKBA 3OFND 3AJ8A 3ZDRA 5F7OA 3U1BA 4CL2A 4RF5A 4WOBA 3CO5A 4HADA 4RTRA 2GM5A 4A2QA 3BDAA 4D42A 2PUTA 2APJA 4OMDA 4YDSA 4AO8A 4F6CA 5C4IA 4FQ7A 4G25A 4OHCA 1RJEA 1G42A 2GFIA 5DX8A 2B69A 3MQ4A 4W6QA 7YASA 3WAGA 4JHXA 2X4LA 2WZDA 1NZFA 3KLNA 5JAMA 3PR3A 5DLQC 4NU5A 3HDHA 2WE7A 5ALKA 5CEEA 3GNSA 5LXTA 4W1QA 5J4YA 1POWA 1A8HA 4HMPA 5JS6A 2JHPA 5LZ9A 2ET6A 2MT9A 2B8EA 4D6YA 4RS4A 4AQYB 1HF3A 3H83A 2FHPA 3M4XA 2B3TA 1BGWA 3K92A 2W42A 3GVCA 3PSAA 1ZMBA 3HVHA 1IATA 2FRDA 3EZFA 3MVEA 3EZ2A 5GZ6A 3UKJA 3DZCA 4RKFA 4MQFB 2DQSA 1E3SA 3MAGA 2Q6TA 5KHLB 3W6ZA 1IRIA 4E33A 3PQ6A 3H05A 2BWJA 3WBJA 1FDUA 1LGYA 2YFHA 1VM6A 3WADA 3HM9A 1ZINA 2F1HA 1LD3A 3K2QA 4UMFA 1RHMA 3S6JA 4Q5IA 2VZLA 3RUIA 1E94E 1VP9A 1J5EB 4PAOA 4YRQA 2BGLA 4F84A 3AVWA 2EP7A 3HEMA 1CQZA 1KGDA 5E1MA 1E4OA 1K5HA 2Z04A 1ZA1A 4HRXA 1BMFA 1W48A 1N0VC 4W9NC 4POOA 1XHLA 3LQKA 4QDJA 4RK7A 2HC9A 4A1OA 1ZZEA 3HBNA 3L0ZA 1T8SA 3TZEA 4B9AA 5KYWB 4U6SA 3V4ZA 3FYUB 1NJFA 4KXMA 4XOIA 1TFRA 1TT5A 4BUZA 5L45A 3PR1A 2VJPA 5HIJA 2ZIVB 4KYIB 2RC6A 4DCSA 4DLVA 4BMPB 3H1GA 3IT2A 3WL6A 1JHMA 4YMWA 4AYWA 1NVBA 1R74A 2Q9AA 1VYUA 3RS2A 1HNXB 4R9NA 1ZGGA 2PFKA 5E38A 2I78A 4L4SA 3WB2A 3CE9A 4S2EA 2I7XA 2Q4RA 3KKZA 3PPYA 4FS8A 4PX9A 5D5HA 4ND6A 3L04A 1NW6A 3NAMA 3SYNA 3UAZA 4LTNA 1ACJA 1U5AA 1I33A 2CJPA 1CERA 2QQ0A 3E7DA 3EQ2A 5REQA 3UY4A 2N1BA 4BGVA 1NSFA 4CMHA 1MFZA 1RPAA 2JKVA 5MFZA 1U5BA 3H75A 3NNDA 1EWQA 3C16C 5CHYA 3EMVA 3SE7A 1XDUA 1PV1A 1YZKA 3DZFA 2DETA 2X1LA 4ZRNA 3DZ8A 4NS1A 3IDQA 3VR6A 1JHUA 2AX3A 2QMUA 3DLAA 4PHTA 1T9AA 1XELA 2J7KA 3EZYA 1V47A 3BHIA 1NA5A 3B85A 3D4NA 4IXMA 2JJQA 3NHJA 4YP1A 3WISA 4CM7A 2DFLA 1XGKA 1MOSA 2WM9B 4AMYA 4MTCA 5AVKA 1JTEA 1KF0A 1SKUA 3WIDA 2F48A 4AZ3B 1CUJA 4ZEVA 3WA7A 4ZOLA 3NI2A 3BB3A 4AJ1A 2QX7A 2PKEA 2YVQA 5DV9A 3KNZA 2CXOA 3MUNA 1DRKA 3F6SA 4LJ7A 1B2RA 5FOUA 1L7MA 1G8YA 5DASA 4OQDA 2R84A 2BTOA 1KH2A 4CE6A 3KUXA 1GAJA 4PGAA 4OFBA 4Q3KA 3GVPA 1UOQA 2QUBA 3SS7X 4A16A 3DXFA 1CVIA 1AOXA 1M72A 4C9BA 3PFGA 1UOPA 5CB4B 2I4NA 1H8EA 2EX4A 3OE4A 5H81A 4BCDA 1NNI1 2JJ1A 4LCJA 1P0PA 1O97C 5C4GB 5KU1A 3WB0A 3HJRA 2IHBA 3SSMA 2L19A 4FHGA 3T5BA 5IJ0A 3Q9SA 1E18A 3BILA 1ZCZA 1PJQA 2R8YA 1SQ5A 1GSIA 1Z4MA 3JYOA 3BERA 2QXTA 3EOZA 3OP4A 4OHZA 4EG6A 5C7LO 1M2GA 1RXUA 1JIUA 1W52X 4GPD1 2B94A 3H2HA 3G2OA 2R3SA 2G83A 2REXB 1AB6A 1AK1A 1ISGA 2GHRA 3BH0A 4NEGA 1Y4ZA 1FVOA 4R9RA 1THTA 1E5XA 5KTYA 3PG5A 1IJBA 1AKEA 2NSDA 4IIHA 3ZDAA 3RVPA 1R37A 2YWEA 4J0GA 2PLWA 3KB6A 3EAFA 1UMDA 2F8TA 4P84A 1TMYA 2GH1A 5LLSA 4MGYR 2A9OA 1HE5A 4GDFA 1QO0D 1E9BA 2IUEA 3F5MA 1WVGA 1E6CA 2QY9A 4LZPA 4MO9A 2IV2X 4CEHB 1XZBA 5JALA 1A72A 2WF9A 3I37X 3OLZA 1CLUA 2R8OA 4IDOA 4BP3A 4XR9A 1TAGA 3PGMA 1RBYA 2OB1A 4W99A 5IUJC 1IIBA 3HBLA 3ZDFA 1RC8A 1XZPA 2EG9A 1ECBA 3AUSA 1K7FB 1O6BA 1NVKA 4K8RB 4ARSA 4HX9A 2ZRCA 3KBBA 4FWIB 4BOYA 1IZ0A 1PSZA 1U4SA 5JAOA 2G70A 1MEEA 3PTAA 1ZH8A 1RIFA 2DR0A 4BYGA 1YA6A 5ALWA 4P93A 1SUPA 1WBBA 3L7NA 1WAMA 5KTKA 3ZGOA 2X77A 2FFAA 2ILTA 2FQWA 4YGYA 4BX8A 4MXDA 1R4ZA 2H9IA 2JGDB 4ZMBA 2QROA 1G19A 3UK0A 4R7TA 3OEYA 1Q1GA 2WWWA 4XM0A 3S81A 5BN5B 1DE0A 1T0UA 2BH9A 2UZIR 3UH1A 2WJZB 1FP4A 1V4NA 3PFFA 2IP4A 3CVUA 4JYZA 3P9ZA 1KARA 2Q5LA 3I6YA 3ET5A 2XSZD 3ONNA 3S1SA 5EHIA 2WWXA 1PWXA 3VR4H 4ZEXA 1DEKA 2ZJOA 2VEDA 4GPTA 4YS6A 1KO7A 4DM3A 3MTIA 3RODA 2EL9A 4RGQA 3THOA 5G0VA 1ZRNA 3AU8A 1ITZA 2C00A 2I2FA 1Y7HA 3AB7A 4LGCA 4E5KA 3R0QA 5BOSA 2QMOA 2C5GA 3KYCA 4Q18A 1YO6A 2X4GA 2C8KA 3K8QA 4TOIA 3AOEA 3FDIA 2ZFUA 4ZAFA 3W4JA 4NMMA 2OXFA 1NT2A 1RCFA 4ENPA 2Y99A 3PNPA 5T4BA 2VT3A 3ABIA 1PNRA 1CJBA 2QY6A 5BSVA 3TS1A 3MCVA 3NRBA 1T9DA 3TQRA 1G8MA 2QMHA 2QTNA 2EWWA 3EAQA 3ORFA 4QICA 3KJZA 4HTAA 4JJGA 3B6MA 4Q39A 4TWJA 2WWRA 1GVNB 2I1LA 1FP6A 2YOGA 2MHCA 1FQJA 3R40A 2PJUA 3DOUA 3O47A 1GITA 4FX5A 3TRJA 1EEHA 4TZTA 4ZHQB 4D0LB 2PX0A 2XCOA 3DF7A 5EP3A 1QS0B 5I9BA 1P4HA 3RFCA 3V8RA 4REQB 2VHCA 1Q22A 1F06A 4GECA 3W5SA 3ZJUA 4PO1A 3W2GA 4E15A 1NSTA 3TRDA 3FPHA 3N8HA 4J3JA 3PC7A 3NTOA 1XEWY 4HC4A 2B34A 4TXMA 5L3SA 3FI9A 3C6KA 1UDAA 5LP6A 4QDXA 4G63A 1IB6A 2AJCA 4A6EA 5IJ9A 1NBHA 4R3WA 1VGVA 4RK6A 3KKQA 3O4GA 4QXQA 2RBGA 4HQ6A 2ZYSA 4U2FA 5DGXA 4I1VA 5DCWA 5GPBA 5I4IA 1KWGA 1KYQA 1L1RA 4J16C 4RD4A 3QQ5A 2HJHA 2ZDGA 3IRUA 1LWNA 4PQGA 1SVNA 4WEQA 4OCZA 5DM4A 5JU6A 2ZULA 3S7TA 2KX7A 1HE3A 1EAMA 5CNJA 1RLIA 3HJBA 3F49S 2ZIWB 5KSPA 4XD7D 4S1OA 1E6MA 3JATA 3IJ5A 3P0IA 4FDLA 2HQSA 3BCRA 4LOIA 4XLLA 3TEJA 2P9TA 1HO3A 5GM2A 4I9GA 5HUJA 4EARA 4F71A 3QPCA 5KCMA 4MS3A 1GNQA 1YQXA 2P2ZA 4TSFA 2UYHA 1ZJZA 5L7WA 4QAQA 4G0UA 1TJ5A 3GPIA 5AJZA 5DT9A 1ORRA 3Q7QA 2RGEA 1AKYA 5MGBA 1F6WA 3IAS6 1PLLA 2Z1DA 3EN0A 4XIIA 5FADA 1ORHA 4HQNA 1EJ6A 2NO7A 3AHEA 4AKEA 5JI3E 2J6BA 3W1VA 4C4AA 2O8BA 2OHGA 3R44A 4B73A 4ZT6A 2JCBA 5AH0A 3DTNA 4ZZ0A 1MRZA 2C3OA 2FZVA 2ZU0C 3CEMA 3GFOA 3P2YA 3QW4B 4HT3B 1SBHA 1GOTA 2PFSA 2IEDA 3KUCA 4PSDA 1UQUA 3NHAA 3KKEA 1XDGA 3CURA 3ZU5A 4P0TA 1J06A 2VHXA 2FLKA 4OREX 4CQJA 4FD2A 1UWKA 4YXWA 4GLOA 2J45A 1DQNA 4M9CA 2PA0A 3HPQA 3O4JA 5CT6A 2XE7A 4N7RA 1XVUA 2KYRA 2WE8A 4L78A 1I5EA 2PWBA 3ROKA 4WECA 4KN5A 1MLDA 3TZ6A 3WDKA 3OZ7A 3RSFA 3LVBA 2R2GA 3NH9A 3VSCA 2JLYA 4LZZA 1Z4NA 3C3CA 3HFSA 4QQKA 4DLWA 5LD2B 2C9MA 2VWHA 1CDEA 2Y1WA 5ALNA 5C1IA 1L1FA 3ZYZA 4BVGA 2VTBB 1VYVA 2E9SA 3PFHA 2PKQP 3ETDA 4M0LA 5DBHX 1FRNA 4MWSA 2BBOA 3RKUA 2IXBA 1P4GA 1QYIA 2ECKA 2R7NA 1V6CA 4JLMA 4B2IA 1E6LA 2VDWA 2PXXA 4GRIA 3DVSX 4KFTA 1Y5IA 4N5MA 5FNVA 4AXXA 5CDTA 1M1NB 5EMHA 1N1EA 1SVLA 2CN1A 2W0MA 1RWVA 2FN9A 1XD9A 2XW6A 2MSWA 3I01M 2YNMC 1DKUA 3HLKA 3N2YA 2ZG6A 2HFJA 2X5KO 4BV8A 5L3QA 1WB6A 2BUBA 3ROTA 2RCYA 1FFGA 2ADOA 1AHNA 4CM5A 1T5OA 4PSVA 3H7IA 2ATVA 1E98A 1X94A 3V1MA 4DJEC 2XZPA 5AM4A 4YJHB 3ID6C 2QAGB 1YDMA 3AUFA 3FGNA 1YVPA 4B3JA 2YWBA 5BXYA 5DLEA 4NBTA 5CDHA 5I3CA 4IZOA 2H7XA 2I80A 4JVOA 2UUOA 5JCXA 4PGMA 5F12A 4EF6A 4QHSA 2IBSA 2HTFA 3STVA 5CYGA 1Z12A 3B5EA 3ZJTA 3QU9A 4EKIA 1KAGA 4GI1A 5KQGA 1ULAA 5CB4A 2WABA 1P5JA 1W30A 3LT1A 3O2SB 4JB0A 4G8CA 1NWHA 3ZNNA 3BGOS 3AGPA 2O57A 1HRKA 2REQA 2R25B 1RTKA 2FN4A 1BYUA 1Y37A 1JG4A 1VLHA 4BAZA 5ECGC 3LL7A 4ZI2A 4IIEA 5L3QB 3J81k 2OD7A 4UEKA 2I6FA 3RRYA 3WOHA 5BY2A 5EWLA 1XU9A 1OH7A 1Q77A 1W87A 5FKJA 4OATA 3PLNA 4Q19A 1G5IA 1WUTA 1EI9A 2RHDA 4M1WA 4UBMA 2IDKA 4UDXX 3EZ7A 3JVUA 5K0LA 1X92A 3V1LA 2WG0A 1JIJA 1XXLA 5BP7A 4I9HA 4PNZA 1DWPA 1Z34A 3JQFC 3FDFA 1Q3TA 2FEMA 1XTSA 3GA5A 2VKQA 2V4ZA 1GSAA 3QVGB 3KJXA 1G5HA 4K6OA 3TMKA 2QGNA 3WL5A 5JSFA 1N5IA 3L0DA 3G3EA 5AJHA 1ADBA 1BMTA 5T3YA 1RD4A 1MJ5A 3UNXA 4X9XA 2IYZA 1T8PA 4EIWA 2LUOA 2WU4A 2YZ7A 3HWWA 3FNGA 3TTUA 4JSTA 1L7AA 3ZE1B 3FTEA 5LP6C 2AOUA 2P8JA 3DHYA 1IU9A 1E79D 1M0TA 2NX2A 2XCRB 5CAEA 1YS1X 3GBSA 1P2TA 5BSFA 4PC1A 1NFRA 3QOYA 1BC5A 4MQ6A 2ZREA 3V00A 2FA9A 5E4JA 1KDZA 3NASA 4F1JA 4NG5A 4B0PA 2G6TA 1Q5PA 2H1CA 4WY5A 3TZCA 3CJTA 4FOPA 1D2EA 1WEHA 3BULA 2WHYA 3FOBA 5JSKA 4DGSA 2YJZA 3FIUA 3L8EA 3IC5A 1XD2B 1CDZA 1CUAA 1DHRA 1H6AA 3HYNA 3IAHA 3PEFA 3AF0A 4U7PB 4FP9A 4U3JB 4XIJA 3Q9LA 3DFKA 4IKOA 4BNLA 1ZX1A 2H06A 1ZAYA 1WSDA 5KUTA 4LVUA 5GWXA 4X3CA 2ORVA 3FKSD 3KVVA 1Q91A 5KTNA 4L9RA 1YT5A 2IHKA 3LDUA 4ISCA 3ZWYA 3DWEX 4RIGA 1DQSA 2P6PA 2UUCB 1O87A 1PTKA 3WZ2A 3FZYA 3RQSA 1DCFA 1FDSA 2XQGA 3ZDEA 4E6PA 1QHHA 4BFSA 4KVZA 4ZEWA 4A6XA 4P4NA 1Y7LA 3DR5A 3KYCB 1MW8X 1Z6QA 1PR0A 4HAXA 5HBRA 1H94A 3MWLA 4BYMA 2OQRA 3ZZNA 4X1OA 1ZPDA 4WLVA 2W00A 4QBTA 3ESAA 4BNYA 4Z0NA 1B8VA 1M8KA 2Q7XA 3AEXA 1VJGA 4LE2A 3TRFA 3ZVLA 3P9RA 4MDHA 4R83A 1XQ9A 2XOKA 2D0PB 4AN4A 8GPBA 1AS2A 4L7QA 1QPZA 1HDXA 9ABPA 2YIJA 4Y7CA 3SKXA 3CRMA 3BD8A 1JQAA 5J4VA 4RTSA 4G0WA 4GGPA 3SBXA 3TX2A 1SURA 4UEJA 4UJ5A 3WB9A 2ZZKA 4I6JA 1FP1D 1SCDA 1LSJA 2IZ5A 3LT0A 2GXAA 2VDJA 3IP3A 4QRIA 1TKRA 2YZNA 1I3CA 2CLKB 3LC7O 1L7XA 1C1DA 2W0SA 4Q00A 2OHHA 5E3IA 4L3WA 3U4AA 4PPQA 2R6HA 4H1TA 1G291 2Z43A 4UJ3A 3FX2A 4G1UC 1SUFA 1B76A 4NMWA 2B6NA 2ON6A 2QX6A 3EEYA 4KNVA 3W4IA 3NYIA 2YC4C 1QS0A 3KHUA 4D9MA 4YMTA 4LZNA 1PWZA 2RHLA 4NH4A 3O74A 4ZCQA 3SVTA 1F6BA 1KFCB 1MTOA 4IGFA 3TJZA 4LCEA 1YDGA 3TLEA 1X9IA 3DEHA 3GNLA 4OJTA 2DUWA 4LMPA 4XJXA 4C7BA 2V4MA 3KC2A 1QX3A 4M55A 4RQTA 3S55A 2VSOA 4PFSA 1MB3A 2BE9A 2CNNA 1O0SA 2Q6IA 2UZ1A 1TEVA 4LHYA 4Y1RA 4ZOCA 5G4KA 5HBGA 4TLMB 2KLHA 5LQCA 1ZH4A 2CXHA 1KMIY 2ZK7A 1QXSA 1IIRA 4HQKA 3JZDA 5EXXA 5J2TF 3BK2A 3KPVA 2D1TA 1NC3A 3OTWA 1U28C 3TZKA 2B99A 3UB4A 5AKHA 3ZCRA 1O8BA 1X9HA 1G64A 4O4HF 3TSAA 1NMXA 3DKRA 4YQYA 5DTQA 2Q49A 2FPGB 1XFDA 2B4KA 1TFUA 4N40A 1PNQA 1KKLA 3Q88A 2QZJA 3K72B 4RZIA 2HDHA 4BNHA 3D2BA 3HGQA 1U28A 3U7QB 4E88A 3D6TB 3TCNA 3AEKB 5LL6P 2R86A 3AFMA 4BUCA 1E62A 4H17A 1Y4SA 3TD2A 4JBYA 2IS2A 3DMGA 2JHFA 1OF1A 2A9VA 3ANMA 5LUBA 5TQJA 3LW7A 3R3ZA 4AZWA 4BFLA 4I3GA 2KE5A 5CITA 3GCWA 3PENA 4QTTB 3RVDA 1UAYA 1OREA 1PO7A 3FYHA 4NENA 3F9CA 1J2YA 4TTSA 3D81A 4D9GA 3R0ZA 4WXMA 4FR2A 2BFEA 2GSWA 2YS6A 3A1DA 4OQQA 5ITSA 2Z9CA 2BSAA 1DELA 2C59A 2JAWA 1AURA 4YXFA 1Z4OA 3T34A 5E6UA 3FE2A 3VDQA 1U0HC 2RAUA 1OBCA 1QP8A 2AZMA 2DC1A 1PFGA 1GYQA 3F2VA 5BN3B 3B9QA 1QIGA 2VO1A 5C7IO 4BFTA 1ML4A 5G0UA 3VR3A 1EFTA 2BMAA 5FLKA 1J42A 2QF7A 3DV9A 1NU8A 4LOLA 3LWZA 4G37A 3AB8A 3VAYA 4B09A 4F56A 1RWMA 1TK2A 3ONEA 5EIHA 5B6JA 1ZJWA 2WRZA 3IP5A 2BOVA 4B32A 2P4EA 5KQLA 3WQQA 3HSKA 3OKFA 3LQYA 5C9ZA 3D64A 3IBTA 4UQLA 1Z08A 1L7PA 2FWRA 2YCBA 3FUUA 3KTAA 4YFVA 3GFPA 4D4GA 2SCUA 2G6BA 1U0RA 1KAOA 1OX4B 2BTQB 1A2KC 2ZGVA 1QH8A 1H4QA 2YVAA 3S2UA 2ZSBA 2EKBA 3TGPA 4OHOA 1JQBA 1KJ8A 4XFJA 1KDTA 2UXCB 1DMRA 4FGLA 3KU1A 3DPIA 2NU6A 2KSQA 1UZNA 4WFKA 5JAQA 4X63A 5IKOA 1MO6A 2HIMA 1EFKA 4D1YA 1FFHA 1DC4A 1B6TA 1H2FA 1P7YA 3QGMA 3DZDA 1M1NA 3I58A 1DEOA 3PJEA 4LX8A 5EIWA 4F2WA 1GLVA 1L0BA 2VUSA 4K81B 5GINE 1N78A 3NM4A 3UHAA 4ENQA 4V0NA 3AR3A 1Q7GA 2XMZA 4TRJA 3WLTA 1WCIA 3NGMA 4JD5A 3ZGVA 1ABBA 3V32A 3FOCA 2ISQA 4MVXA 1L1EA 4KYUA 1E9FA 3S2IA 5C37A 1D09A 2FR0A 2J46A 1J9EA 2RKWA 3AWDA 5FOSA 5H80A 1S1MA 3RNLA 3WQBA 2AMFA 1BHO1 1UZUA 3G2PA 2D1QA 2B2CA 4ZQEA 3UA4A 2IX3A 3DFUA 3B6ZA 4J1SA 2C7OA 3WLQA 3PXGA 4DWVA 4F3KA 3ZG6A 1UDCA 5BOVA 3H2KA 2JAXA 3KZOA 1M1YE 1H23A 3LHKA 4IEEA 5L6MB 3SQMA 5EAIA 2P5UA 1O77A 3NGLA 3EHDA 3KK0A 5P8WA 2DHQA 2ZUWA 4MV5A 4DLNA 5I7UA 2P5YA 3KXKA 4UDOA 2D13A 4D74A 4OJQA 1A2OA 4LHVA 1N8TA 4K87A 3IEUA 1S8NA 4NG4A 2D59A 4QUGA 5ADHA 3FCXA 2EKQA 5ALJA 2R7AA 1G6OA 1QIMA 3AONB 4AZ3A 2AMLA 2ZYHA 4NXMB 3C1UA 4MPPA 2E85A 1OBFO 4COOA 2Y1EA 1UPUA 2Q3FA 1FVXA 4F97A 2BFFB 4NFLA 1PX2A 4J4HA 1XRPA 3K94A 3AFGA 4NATA 1XOIA 5FT9A 5I6DA 1F38A 1N2BA 3A6JA 3BZBA 4EB3A 3N75A 2FPUA 2I7CA 1UJCA 1RTTA 3HH8A 3PFCA 2Z9DA 2J5RA 2Q5JA 1EWTA 4PIMA 4BXOA 3SEZA 1HM5A 2BKXA 4DNPA 4HG2A 1EZ1A 5ALLA 3ILSA 3MTBA 3VNRA 1BDIA 1W0CA 4S1WA 3CO0S 1YBMA 3NQ41 2QTFA 4UZEA 3NVKI 2JZCA 3H4MA 3OT1A 2XCSB 3T9DA 3ZHXA 2G5GX 4CIWA 3HFRA 1PZGA 4RWZA 4MW6A 3HVUA 1L4UA 4TL6A 3AEQA 5D86A 5E0OA 3VU9A 1WLSA 1E2DA 1CF9A 3R4CA 4MRAA 3VBEA 3KT6A 4CM6A 1NNEA 4QQNA 5I9MA 3V1UA 1YZFA 3G8BA 3K0BA 3LWDA 3MMNA 2AFIA 4W1RA 4DLZA 3NIWA 1M2FA 3R6DA 4Z86A 2ONCA 3D3KA 5SV2A 3RT1A 2GA8A 1U7TA 4FQ8A 5K3AA 4LXHA 3IT3A 4WUVA 1GJRA 3KTOA 1VJ0A 1KE1A 5JS8A 4IF6A 4K0RA 3UMBA 1DWUA 4HDNA 1F0KA 1QFYA 3F5QA 5HF5A 5BWLA 4TX1A 2P9HA 2AH5A 2OVBA 1O94A 3CF4G 3EDRA 2WWTA 2XUOA 3O3NB 1VZ3A 2IV7A 3RHFA 3JYQA 3T9EA 4BEJA 4E14A 5FOQA 4ABTA 2V6FA 2OV2A 4A5SA 1R5BA 4EKNB 1RVV1 3QHPA 3LUCA 2P2GA 4MW7A 4YECA 1XRLA 2VDOB 5BYKA 1ACLA 4YWJA 4C4PA 1AO0A 3K9FC 4KR6A 2OFFA 5A4KA 1XP5A 4ZVRA 3KEMA 3I3SR 5AOAA 3EY4A 2H1HA 4ERNA 4XPIA 3FXAA 3O9ZA 4CKWA 1YHYA 4OB8A 2BCJQ 3ZW9A 1XK6A 3OWHA 4CR6A 3STUA 1RWWA 3ZVNA 3BWEA 2FCAA 1PZMA 4GOMD 3F1KA 5T5QA 1GSHA 2AKYA 2FPSA 2Y67A 4J9UE 2ZJ4A 1TIBA 1PLKA 1XKXA 2ATCA 3ND8A 4PGHA 4TT3D 4BJ6A 2PVCA 5I8PA 5JD6A 1YONA 1YR1A 5HFAA 5JI2E 1AF4A 1BIFA 5BOSB 3IT0A 5DCYA 1XDBA 4XH9B 3VO2A 4UBIA 4HXGA 1G66A 2DM6A 2H1SA 3RYIB 1PQWA 2ZAIA 2PH3A 2WJIA 3K0AA 1OZ0A 4H7IA 5T8KA 1X1QA 2NZJA 3NWJA 1SY7A 1CWUA 1Z0DA 4R8KA 3KETA 3FSRA 4BY9E 1R50A 3KOOA 2J1LA 4IF4A 2EF1A 3ISVA 2GNAA 3F7TA 3U4IA 3TKAA 4FS3A 1YFKA 3T61A 1P1RA 2G63A 3JQEA 4XTRA 1G21E 3D0OA 4PXAA 3W5UA 5HZHA 1Z2PX 5A4JA 3IDZA 3L8DA 2VG8A 3OQ1A 4TL7A 1P0IA 4R5HA 4BNGA 3U7QA 7MHTA 5CXXA 3I62A 2QLMA 4G5FA 5LJLA 2WJ4A 4FE3A 1K2VN 2J9YB 1KJZA 4OHBA 4HN9A 4HAVA 1SOAA 1ULTA 3K0EA 3FFBA 3BQNB 3TL3A 3DHNA 5AK0A 4YY3B 1P2GA 4MVJM 1Z62A 4D92A 3MB5A 1TA0A 2XEDA 4L15A 1N2SA 2Z4SA 3HNPA 2NPFA 1KH1A 4D46A 3H3JA 1JW9B 1G17A 3T7TA 4RNDB 2I71A 2A5DA 5FPQA 5C1PA 3S8MA 3F73A 2QJOA 4TTPA 2ZB2A 4J1TA 2AW3A 2PZGA 3FRIA 2QTBA 2IBTA 2H3HA 3ILVA 5EJFA 1U2ZA 4PANA 5IH3A 1CS0B 4R01A 1CNMA 3EEOA 1P2DA 2ONZA 5J40A 3RTAA 3RSQA 4TT8A 1L5VA 4UULA 1TCCA 1M34E 5BQPA 4X94A 1P91A 1JR3E 1KI1A 2ZJZA 1WXXA 2GCGA 1C7EA 3KL2A 1IZ9A 4ID3A 4RHTA 1E59A 2QD3A 3LBHA 5DLYA 3I45A 1D2NA 3KQTA 3U44B 3SX0A 4EJSB 2YMMA 1DPGA 2H9AA 2HV8A 3K3PA 4N5HX 4XM2A 3UMRA 2HCJB 4H1UA 5BR7A 7ADHA 4AJOA 2HU2A 3WBBA 4I3HA 2CYBA 3H9CA 1BFKA 1TD9A 3IB6A 5BNZA 2KBEA 1PQUA 4BO6A 5HS6A 1HKUA 4F3TA 4JR2A 3DZBA 5DI9A 2BEUA 1FQKA 3K09A 1Q1BA 4G0OA 1H9CA 3IPCA 1NQXA 3VTKA 4JLSA 2AFIB 1O2DA 3DKVA 1J23A 3P0RA 2JFBA 4HDCA 1LF0A 2NU8A 3J7TA 5D5QA 4BMNA 4C87A 4E4YA 2H07A 2BBWA 2C78A 2OCDA 2Y93A 4ZDWA 3SM9A 4E2YA 4A0HA 2VRNA 5JHHB 2A5JA 5JZ9A 5AHKA 2H4HA 5BQOA 1STOA 1UUFA 3L8ZA 4IIJF 2OV4A 3I0MA 4EA8A 3ICEA 2IPXA 3H5RA 2XGOA 2EBUA 1G4HA 2BEJA 2JFFA 3WA6A 2A84A 1G2PA 3MGKA 4I5DA 4A26A 3ZX5A 3FVQA 1R6TA 2XCIA 3FSGA 4DGQA 4P0PB 3O83A 5LNK1 1W85A 4BN5A 5BWMA 5I9NA 3ANLA 1Z0ZA 2H59A 4LKRA 1NN5A 1LVHA 3BHMA 3FYSA 3RSHA 3H5LA 3RWOA 2WJWA 4V0LA 4XSHA 3TB6A 2GA9A 3TVTA 4E13A 1KYWA 4MUYA 3A6PC 4BFWA 3DVQX 1M1YA 4IY1A 3JYLA 1HC7A 2NUPA 3GV0A 4NCKA 1EQUA 1I36A 5J5VA 4TVSA 2QN3A 1DFGA 1WZNA 1UEXC 2WR8A 2XTJA 2E4XA 4JLJA 2XRFA 1Y3HA 4K7JA 4S12A 5THKA 3W2TA 2C7RA 1MB2A 5GTDA 1XDDA 1JJVA 2VHYA 2QW0X 3EEIA 3NXSA 4GWLA 4L76A 4LX0A 4EAAA 3V3KA 3MJFA 1HQKA 4IUDS 4MVYA 1MORA 3ICWA 2HLDD 2MSKA 3DUFB 2J3IA 2OKCA 3L01A 2AL7A 1T5IA 1L8AA 4J0DA 4CNQA 2RHCA 2VPQA 4WFJA 4FSHA 4IQFA 1ECFA 4O1HA 4AUNA 1P39A 4P1ZA 4HB4A 4ESOA 1AM4D 2K7ZA 3ZCTA 4P53A 1MPTA 5FWXB 4CCAA 2NU9A 5F2KA 3WRVA 5C34B 4JXZA 2WF5A 1GGMA 1Z6YA 2C99A 1M1XB 2QL9A 2XDAA 3LY5A 3GRAA 3DBOB 1GAEO 1W93A 3CC8A 1H2HA 4MQ5A 1N2EA 1R0SA 5HIAA 3DBHA 1G20E 1CFJA 1IEVA 2QTGA 3QA3E 4JFRA 4KVFA 1R5NA 1KAEA 1NLMA 1OT3A 4A6DA 5I45A 2GLTA 3TB4A 3TLAA 2OFPA 1IL0A 1EFVA 2QL7A 4G4IA 3G2KA 2I03A 5KMGB 2ZETA 1SK9A 5LQNA 3L06A 4TS1A 4UASA 2D0OB 1IHXA 2WP0A 5TT1A 1L9KA 4B5KA 1HRDA 4X3PA 1Y1KE 5B2EA 4FOSA 4MPDA 5HK8A 3UENA 1FJGB 3KVRA 4WVLA 4YJ2F 4EG3A 5K3OA 2OA0A 4BNWA 1S1CA 3S7ZA 2XZOA 2CB9A 5LMUB 1WZCA 2JIBA 1NAIA 2J59A 2W48A 5F51A 3IB3A 4G56A 1M10A 1N7HA 1XZGA 2YBEA 4RLSA 5FYQA 5KYXB 3FHJA 1TE2A 1ZLXA 4QYTA 2E87A 3H0EA 4DLXA 2QZ9A 4BE7B 5BSKA 3IVGA 1LLCA 1X2BA 1A5TA 4J90A 1IY0A 4PFQA 1OLUA 4HWOA 4MQBA 1I7SB 4MQFA 2I7TA 1DO0A 5JRJA 1YB2A 4ERXA 4GXRA 2OR3A 4HYEA 2ZWMA 4RMIA 3KO8A 4JITA 1M5TA 4AB1A 4ER0A 2O06A 3WYGA 4DKJA 4B45A 4NHOA 1T3ZA 3RU2A 5CDFE 3CN7A 3PQ7A 4CG2A 1JWLA 4YX9A 4M8IA 3C8ZA 4XDZA 3E03A 3KCNA 1LUAA 2JEZA 2CBGA 2QTAA 5GONB 5C3UA 1QH1B 2QQGA 3IIKA 4IZIA 4MPJA 4EJFA 1U1FA 5LCXA 2OYRA 4KNYA 2IF2A 3ENKA 3U0VA 4ZGBA 1LKZA 1TYCA 1VDMA 1ZM9A 3UK6A 2XUKA 4Q1FA 4D9JA 3NG1A 1E0AA 1U7DA 2Q2VA 3LIPA 5C35A 5J5AA 3KVNA 4EUKA 3ASZA 3PXEA 1ZOSA 5K0EA 4L8WB 4LDRA 1ZH2A 2OHXA 3NAZA 4AK9A 4G1CA 2DVMA 4FZVA 2BGNA 2YJ6A 5F52A 4OKIA 2G9NA 1JFSA 2C82A 2NVUA 2RGWA 3AOGA 4A5OA 1ZK2A 2I8LA 2PY6A 4OL0A 4CIVA 1ISMA 1CF4A 1RT9A 1X8JA 2JGRA 3HL0A 1WUYA 3LOQA 3O73A 4XPZA 3EXEB 1UMDB 5KSWB 5CLLA 3A3YA 3H84A 3H11B 4MVJF 3VDXA 2UDPA 3UK1A 2ZBRA 4CUJA 1ZIXA 4I5EA 3I9OA 3ZIDA 1CUCA 4KODA 4LBYA 4X84A 3K9QO 5LLDA 4MVJE 5LA6B 4JL8A 3EISA 4AAYA 1Y6FA 4ZVUA 2XAUA 3EZGA 4X7PA 1KEEA 3K0SA 1WSWA 3MCZA 1S8FA 4QJ3A 1KVSA 3Q98A 1K3FA 2Z2YA 3B51X 3FPEA 3IHTA 5IKXA 1SXJE 2Y66A 4GX5A 2B82A 2Q7OE 3UVEA 5B7PA 5L4SA 4RIIA 1UIMA 4B4OA 4D5EA 5JS1A 1Z2EA 3T0IA 3ZWQA 3INGA 4L73A 2QLBA 2VJMA 2Q1TA 4LXIA 2BISA 3G8AA 1E9DA 1NV8A 1HYQA 1ARZA 3GLVA 3DMYA 4EZEA 1VBMA 5DULA 5IZCC 2EF0A 4OI0A 4XRRA 3TEMA 3MAAC 4Q02A 3AP1A 4ABYA 1R7RA 3C5WP 3LK6A 4M9ZA 4NYIR 1HQCA 3ZLUA 2PYZA 2IHTA 2V5AA 4JFAA 3UFXB 1DWOA 1QZ3A 2X0JA 4GXTA 4IDBA 4K3UA 4CCWA 2H7CA 3UJCA 4DCUA 2DERA 1N2HA 2P11A 2H52A 3TCKA 2JI7A 3AILA 4JR0A 2KWIA 4LFAB 3CHYA 4XR4A 2V6IA 2WJVA 3D6NB 2RKOA 3S2SA 3TTXA 3ZR4B 5KSOA 3FTFA 2V7QA 2OZLA 3FJOA 5CYFA 2HOQA 5BQ5A 2AOTA 3R74A 4K6CA 3IAEA 1EK1A 4C3OB 1FFWA 4FHFA 3FA2A 1Z5OA 3MHTA 2RK6A 1R10A 2AOWA 4DLUA 3I2GA 3FCCA 3DULA 1C7IA 1T1EA 4EO7A 1J97A 1LX7A 5TR9A 5M2QA 2F00A 2PXCA 1D7OA 3DBVO 1RQLA 2AN5A 1YRLA 1SD2A 2XUIA 4NV0A 2RB4A 5YASA 4REQA 2HIHA 2C7PA 2DTEA 3DMFA 1NPTO 1WL8A 2P90A 4B0OA 3EULA 2BFEB 1PS8A 3EF0A 1PWYE 4ZZ2A 2V7XA 1G9XA 4UKDA 2F1RA 1EB9A 1UBUS 1AX9A 1NMQA 3A6GA 4JT4A 4O4LF 4B6OA 2VP5A 5KWSA 1KO4A 2Z3WA 3AQIA 1JILA 1RAGA 2YDXA 1J8FA 4G0XA 5AKXA 4WDQA 1LS1A 1M2KA 2G9ZA 2YWCA 3OIVA 4HY3A 3WO1A 2HSWA 4YRAA 1PL7A 4DBLE 2QP9X 2LIPA 3ETNA 4LSWA 3CUVA 1U99A 4EYEA 5JBIA 3G82C 2BSXA 3DBRB 4ZAWA 5TB5A 2A0FA 2IC5A 1USGA 3Q2IA 4MS1A 4PG5A 5DFAA 2E1PA 5K3DA 3ECSA 1RU3A 2FGJA 4MI9A 4ZYVA 4F93B 3OIUA 3R9IA 2OGTA 4UBLA 3WHIA 3AESB 2WU0A 2YXDA 3PC6A 4LXTA 2FEOA 2P1DA 2GRUA 4INJA 5A3QA 1SCJA 2WKSA 2RAVA 3AZOA 4Q3EA 1O95C 1E2IA 3DONA 3KTAB 1K8RA 1H2BA 1XLUA 2Q1YA 1I9GA 4NICA 1RHKA 1RS0A 2VFAA 4J6FA 4K0KB 1AA6A 4M0KA 1U7HA 3DXYA 1SG6A 3FH0A 3H04A 4I5IA 2QTVA 5H9VA 5FTMA 4F4IA 4M1SA 1U8YA 4J0HA 4OBWA 3G88A 1I2AA 2OD2A 3OBIA 1P4SA 3OZGA 1EFPA 3DKPA 1H22A 1S2MA 3MT7A 3MWEA 2O5VA 4G0PA 4XCXA 3OFKA 4YBZA 5ECDA 1JQJC 3SQNA 3QG5A 4UTNA 5TLSA 1DBQA 1VJCA 4EHFA 1EP1B 1Z0AA 2XDWA 1ZJYA 1IYZA 2TMDA 3BFVA 3X1KA 4BTLA 4ENSA 4EMUA 1X70A 3WKCA 5EWLB 5EE5B 4N5NA 4ZO6A 5CA0F 3ZJYA 3AL2A 4ZJYA 5HKKA 3HNRA 3QFCA 3SQXA 4P92A 4X1KB 2WD8A 3A6ZA 4MINA 5DOVA 3IT1A 1IPEA 1WABA 4AMBA 3AVQA 4WDRA 1KH3A 2W6ID 3K1AB 2RG7A 3U26A 4L8YA 1SQGA 1H3EA 4MKRA 1XXHB 2NSLA 2NW6A 3F7NA 3GL9A 3TQCA 3LHFA 4CEJA 2PPVA 4TYYA 1TAQA 2IVFA 4L02A 2CZQA 3NFRA 1C9YA 4OHKA 4CKEB 3IQHX 3OIGA 1SA0B 4GKBA 4HNGA 3L4KA 5EPEA 4B3RB 3R4VA 4UUBA 1BXGB 4F46A 4EUFA 1P8JA 3N74A 3NYRA 3HBJA 3CINA 3M6UA 4B3DA 3RQIA 3VVCA 3SZGA 1LJUA 3LT4A 4OJYA 2GJ8A 4ZK6A 2EV9A 2G71A 2JJMA 2FSHA 3B3QA 3QYAA 1DQZA 4D4LA 4H4DA 5TE9A 4BE9A 3G9XA 5E2IA 3GAAA 2Q0HA 1HDOA 1D04A 1H0HA 3CLSD 3SHWA 3OOYA 1Z0KA 2VK1A 4W1PA 1ZK4A 4QUAA 1S2NA 3RS7A 1NVEA 1ES9A 1ZISA 1MDBA 2YN2A 5HF8A 1ZJ5A 1KYXA 2Q6LA 3GLRA 2W2OA 1I0IA 3JATB 1TVEA 3QVWA 4DXAA 2RGCA 2OV6A 3C5HA 4HQ0A 5LN1A 3WLOA 1A88A 1Y1TA 1OGYA 2AX4A 3H1PA 5SY9A 1WHTB 5KQRA 3J81A 2FR8A 1CZUA 2GRJA 1F9EA 5IF9A 5DNUA 3DG9A 1WULS 4CYMA 4DIBA 1ODFA 5I7WA 2FQXA 4DUZB 1SCKA 5K6AC 1U2GA 2HLNA 4CNBA 3F4KA 2OBFA 2WVHA 1Z6AA 3VR6D 3ZCVA 1GN9A 5TY0A 3HA2A 2ZP1A 5COBA 2QENA 5B1SA 4DCGA 2GXSA 1XJWA 3P9KA 1H66A 2OG2A 1ZVMA 1RYFA 1W46A 2VDPB 3PDJA 2JRLA 4OLJA 5AKEA 3OZXA 2ZB4A 2EFDB 2WU1A 3X2SA 2HU5A 3X1JA 5IRCD 4WCVA 1SXGA 2GQ0A 4CMKA 3OOHA 4TTTS 4EFMA 1LK0A 4O2LA 3DQZA 4OYRA 3BVPA 4KQ6A 4ND4A 4BV9A 1KP9A 2FVXA 3N05A 3ZTTA 3L92A 4AUEA 4B46A 4J43A 3LKBA 3SFVA 1ZH0A 3F9IA 3QV2A 4QBHA 4YTEA 1KSGA 4ER3A 3OTOB 3KQYA 3QE3A 2IYAA 1PN3A 4U39A 5DNAA 4ACAA 3CXUA 2B4AA 4OX9B 1IE3A 1OWPA 2WHPB 2BLNA 4OH1A 4O1MA 3WRYA 3HMKA 3UKDA 1Z06A 4JMPA 4D2IA 4DJ5X 5J2UF 2X8JA 1C0IA 1T9KA 1YOVB 4RHFA 2Z6UA 3G2QA 3LC0A 3QI7A 3G9UA 4M9UA 4DXDA 1C9MA 3HG7A 2V1UA 2XYQA 4RVGA 1U90A 3QELB 4LOHA 1AG9A 5IKEA 3O8OB 2PCLA 3O4RA 4B6EA 2VJMB 4L6IA 4ARCA 3CUSA 2VAXA 3U6BA 3BRQA 1I7NA 1BOFA 1CR0A 1TT7A 4YRLA 4YQZA 5TGTA 1VPTA 3HCDA 5K03A 2QUZA 1C0KA 4R51A 1TQDA 5IT9A 1VE6A 2R87A 2IPLA 3W5DA 3ZQKA 2G1KA 4MW9A 3SXPA 1YE5A 2WD7B 2BMJA 1ND5A 4GVPA 4EA7A 1LVGA 3ZTYA 1YR6A 2B20A 4TRNA 5LP6F 1CR6A 1ZXBA 3FVRA 1N2CB 5AKGA 1UMKA 4MUEA 2ZRNA 3KYBA 1TCVA 1FYXA 3AQ4A 3GRYA 4IMJB 4G86A 4EOGA 2FAXA 3WWZA 2OZPA 4ARU<