3K7EA

Crystal structure of human ligand-free mature caspase-6
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
259
structure length
214
Chain Sequence
PAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRIGKKQVPCFASMLTKKLHFFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analysis of caspase-6
rcsb
source organism Homo sapiens
molecule tags Apoptosis, hydrolase
molecule keywords Caspase-6
total genus 72
structure length 214
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k7eA00
4HQ0A 1RHRA 2CNNA 5I9TA 1RHJA 1RWWA 3ITNA 3DEHA 1QX3A 1SC3A 3QNWA 4QUHA 4AWBA 3BIJA 2CDRA 5I9BA 3R5JA 1NW9B 1SC4A 2H5JA 4N6OA 2H5IA 2QLFA 2XZDA 4ZVRA 5IAKA 4NOLA 1NMEA 2H4WA 2J32A 2C2KA 1SC1A 3GJSA 2Y0BA 3R5KA 4JJ7A 4JR0A 4AW9A 2HBQA 3V4OA 4IEFB 4I1PA 4EHDA 1F1JA 1GQFA 3H11B 1RHMA 2CNLA 4DCJA 3IBCA 4JJ8A 4JQZA 1QTNA 4QULA 3P4UA 4QUAA 4EHHA 4ZVSA 3H11A 4N7MA 1I51A 4N6GA 1RWVA 1JXQA 5IC6A 2Y1LA 2H65A 3D6HA 2H54A 2J30A 1PAUA 2QL9A 3GJTA 2C1EA 2J31A 2XYGA 4JB8A 4NBKA 4NOJA 4QU9A 4EHAA 4EHKA 3GJRA 4N6NA 2P2CA 3PCXA 3EDRA 4EHNA 3R7NA 2NN3C 1CVRA 1KMCA 5IBPA 1GFWA 5IBRA 4FGUA 3UO8B 3S8EA 4EHFA 3D6FA 3R6LA 1F9EA 2CJYA 2CNOA 2FP3A 3NR2A 5IBCA 2XYHA 5K20A 4NBNA 2QL7A 4N7JA 5LUAA 2QLBA 4QU0A 1NMSA 3R7BA 2XYPA 4DCOA 2HBRA 3NS7A 3R6GA 4QUGA 4QUBA 3D6MA 3K7EA 3V6MA 4ZVOA 2H51A 1ICEA 3V6LA 5LU9A 3GJQA 4JJEA 1CP3A 3KJNA 4LSZA 4QUEA 2C2OA 4QUJA 4ZVTA 4ZVQA 5IC4A 4IYRA 1M72A 1SHJA 2HBZA 1QDUA 4QUDA 5LU8A 3R7SA 1I4OA 4JR1A 4D3YA 3V4LA 5IABA 1RHKA 4NOMA 3H1PA 4QUIA 4PRZA 3DEKA 1NMQA 4D3XA 4D3ZA 1RE1A 4N5DA 4QU5A 1RWNA 5JFTA 3RJMA 2K7ZA 1PYOA 3S70A 3H0EA 4PRYA 4QTXA 2CJXA 1I3OA 1I4EB 2DKOA 2XZTA 5IANA 4HVAA 4JR2A 1IBCA 3DEIA 3NKFA 3V55A 3V3KA 2J33A 4ZVUA 4PS1A 4ZVPA 1RWXA 2FUNB 4QTYA 4JQYA 4AWAA 5IAGA 2QL5A 4FDLA 1K88A 4EHLA 3OD5A 5IARA 4NOKA 2HBYA 4QU8A 2QLJA 3E4CA 4HQRA 5LUBA 1SHLA 4DCPA 2C2MA 5IASA 2C2ZA 2CNKA 3KJQA 4FEAA 4PS0A 4FXOA 3EDQA 3H13A 4NBLA 2AR9A 3UOAB 4EJFA 2FQQA 5H0IA 2WDPA 3PD1A 1RHQA 1RWKA 3SIRA 3IBFA 1BMQA 3DEJA 3P45A 1RHUA 4I1RA 3SIPA 1RWMA 1K86A 5IAJA 3PD0A 2H48A 4M9RA 5IAEA 1RWOA 3KJFA 2H4YA 1RWPA
chains in the Genus database with same CATH superfamily
3U61B 4QA9A 3U4DA 3RIEA 1D8AA 4N0EA 1JLMA 3D7SA 5FUBA 3D1JA 3ETNA 5EYPB 1XZNA 2PMWB 3O93A 3W1VA 1RVV1 4WFJA 16PKA 1LH0A 2OHIA 4IDOA 4LY9A 3RJ5A 4AFNA 2C82A 3F67A 2DPLA 3IQXA 1J25A 1XAJA 2WKPA 4IEIA 4FNMA 3AYXB 1O58A 4U7GA 4UFOA 2IEDA 3V8MA 4UPEA 4BQOA 1IQ0A 2E4XA 3I6BA 1O6GA 2Q1YA 3ZLVA 4TWBA 3M4JA 4YA6A 4LMBA 5FOQA 4P0PB 3IOMA 2FW6A 4QGHA 4BS9A 5LQSA 1NQWA 4ZVSA 5AHRA 2R8EA 1Y6QA 1X3SA 3DT8A 3LQQA 4LMPA 3C15C 3BXZA 4YAOA 4AUMA 4D3DA 2IHBA 1ZIDA 4YEDA 1YJAA 2BF7A 4HNHA 1YDHA 2KPOA 3HWRA 3LT2A 5L7YA 1PI3A 1ISFA 1SCIA 2WILA 1TZMA 4E12A 2CV2A 3QFFA 3DDWA 4GRDA 4YRDA 5LQKA 4V2IA 3R3HA 3S4YA 1FDUA 4OP2A 4DAEA 1IZ0A 3MSCA 4UJ3A 1J9ZA 2QUHA 3NBXX 4BB6A 4ZCTA 3KVOA 3QKRA 3JQCA 4KLCA 4F5DA 1U1DA 4GOJA 4Z1MA 2H1WA 2H9IA 1YR8A 5FOSA 1L7NA 2IZ7A 4GQAA 4XQGA 2X86A 4IJMA 2QJTA 4QFMA 5A1JA 4J6EA 3ADCA 1A76A 4A5SA 3HN6A 1B14A 5D86A 4IRMA 1NAIA 2VK2A 3DD1A 3NPMA 2DB3A 2JFBA 4S1PA 4B6EA 4FSXA 3B53X 5JMWA 1GADO 1US8B 3BMXA 3GYGA 1NJ2A 1KYQA 1OZGA 1X39A 2BY4A 3JYQA 3ELDA 2AZXA 2ETXA 3UC9A 3BHJA 4BO1A 2D54A 3WKCA 4B6GA 4R1SA 4D9GA 2PQ0A 4NCAA 3KLMX 3DVAB 3EC2A 3NCHA 4IG9A 1VKZA 3JZMA 1DKQA 3O94A 3O5AA 4L73A 2ODEA 4ANFA 1ZN2A 3L6BA 1BD3A 1VL1A 2WMOB 4W1PA 1M1ZA 4BX2A 5FA5A 3GAFA 2RGXA 4MROA 1RQPA 3ZXYA 1Q2UA 2BR3A 3NETA 4DJJA 4KWCA 3RRFA 3BJZA 4P0QB 3EGCA 4ND7A 2BKEA 1W4CA 1I3OA 3G2HA 3LZ6A 4WHMA 4XD7D 3TNYA 3CVJA 4V39A 4NE9A 4R1UA 3IKLA 2EWVA 3IQIX 2EIHA 4PNHA 1DAIA 1FSSA 5L53A 4UPVA 4ZEXA 4MPTA 3QIVA 2VP6A 2BMDA 2JCYA 4F45A 2A94A 3IEXA 2EKLA 2AR7A 2IV2X 2H3EA 4TUYF 5LUBA 1JGTA 4A27A 4BFTA 3P7MA 3WGHA 1RT9A 3ESCA 1O9HA 2XR1A 2O48X 4RHXA 5ICGA 4ZODA 4HPWA 1H2AS 1PTJA 2VG8A 1VKNA 1ZXBA 4RELA 2MSEB 2IXFA 1L1RA 4LF9B 4GLLA 1JHRA 4WNYA 3D0OA 4G23A 2AVDA 5ARDA 1E77A 2EKZA 1PLLA 3ROPA 4X97A 4XQEA 1EBBA 4W4TA 2NZJA 2QT0A 2VCYA 3BGSA 3BSFA 1QRUA 3C6BA 5B4UA 5FBWB 1C4KA 3ZLJA 3LI2A 2ODQA 3RTAA 1P2UA 4BNYA 2AC2A 4M87A 4M9ZA 5JRJA 2IXAA 2X1MA 3LFUA 3W77A 1YZUA 2B8NA 4P7GA 1OPRA 2FPLA 3TSOA 1YZKA 4JOQA 3RC3A 5AHXA 3WB1A 3ZK8A 4WJZA 1CZUA 5ED4A 1ZS9A 3DL0A 4GFDA 4B3CA 1VHDA 3QKWA 1QHGA 3TXAA 4E1VA 1T35A 2H4WA 4MULA 4NZZA 4FCWA 1W36C 3FKSD 5EWJB 4DA0A 1VKOA 5CTJA 1MIOA 3OIDA 1YFLA 1V5WA 3URMA 3OIYA 5J4LA 1PFUA 3EG9A 5KNDA 5LN1A 1CIVA 3I28A 1KSFX 3ORFA 3GB9A 4BYMA 2K2WA 1LF0A 3OFVA 4FR5A 1WA5A 2ZUUA 1Q1EA 2SICE 4G86A 1Q7TA 4NNJA 3LX6A 4CDRA 3AESA 3ZOZA 2A9OA 1JXQA 1L6IA 2JVKA 1WP4A 3HI4A 1K2WA 4IMIB 1Z83A 1XGKA 1NSYA 1FNMA 2OP0A 4OBEA 3VU1A 4CVNA 5JVDA 1K5HA 3DB1A 2QA5A 4EGCB 1TEVA 4NH4A 4QDUA 3MHPA 3FSGA 5EQJB 3MLEA 4IXMA 3U1TA 4GS5A 1WDMA 3ZGXA 3ZQJA 2ES4A 3ANNA 4MH0R 3IP5A 1WUKS 3GJ5A 2VNIA 3VOBA 5LUAA 5FNVB 1NIPA 2B9VA 1ZH6A 3WK5A 4YS6A 4YP1A 4N8EA 3OCCA 5B3LA 3O26A 3EVAA 4UUPA 1EUCA 2JAXA 3UAOA 2DHCA 3M9LA 4PFKA 1ISMA 3W90A 2C7OA 1JHDA 3DVLA 1E7QA 2PRJA 3CQ9A 3ZJVA 3H04A 1O7JA 3ME5A 4PHTA 5MN4A 3VFDA 3UBMA 2AF3C 1G2QA 1H85A 1COWA 1L7PA 2GBLA 1C7EA 2XB6A 1TADA 3HDYA 4DCCA 5IX8A 5JCOA 2V4ZA 5A4MS 4TWIA 2O7SA 4WOCA 3ONVA 3WL8A 4N49A 4G1EB 2CV1A 1D07A 3M6MD 4OTZA 2WIKA 3FYUC 1AKUA 1KMQA 3FHCB 4GPAA 5DLEA 1YOBA 4N39A 5IJ9A 1M1XB 1OXXK 3JTMA 1V3VA 5HDBB 2AFHE 1ZESA 1A9YA 1I3KA 1T26A 3FI0A 4JP1A 5FNZA 5CA0B 2G88A 4ZT2A 1H9AA 5FBZA 1CEYA 5KNBA 3N74A 3D8UA 1V5GA 2DR0A 1JIQA 1KEPA 4ZPXA 2G40A 4RPLA 5IANA 3BXXA 2GXAA 2IPXA 3CF4A 1HURA 2WFAA 1Y3BE 4XM2A 5HZKA 1G20E 5IKPA 3ZGNA 2ZWOA 1OFTA 2B99A 3PQFA 3K09A 4ZVUA 1DDIA 1P9NA 4DJDC 1SHTX 3DLCA 4H6VA 2J5RA 4F6RA 1R0KA 3TIXB 2DTDA 1H2EA 5DW0A 3JAKA 3NDIA 3WL5A 5TQVA 4IGIA 1G20B 2FRVA 2HMAA 2R11A 3L7LA 5I9LA 1P44A 3QEAZ 3OX2A 4L74A 1G7RA 4MVJM 4Y1GA 2GN0A 1EEHA 1NZFA 2VDUE 2NOAA 3HU3A 3JWJA 4FEAA 4CV3A 3I5AA 4ROSA 2XPCA 4WFIA 1NQUA 3TSCA 2V03A 3EZGA 4OV6B 2VYVA 4PIMA 3O84A 3OEEA 1XDDA 3C6MA 4LDQA 2GPBA 4FMDF 4Q9JA 5DE3A 1SY7A 5LD2C 2VBCA 2GHQA 3EHDA 1ESZA 2AJ8A 3M6UA 4BX3A 4F5WA 1IZZA 2CSUA 4YWJA 4UEWA 2WM9B 1SC3A 1GKUB 1V1MB 2Q0QA 4ERNA 1RHRA 1Z4MA 3RKSA 1VL2A 1AXRA 2BISA 5HKKD 3KC2A 2FQXA 3F0TA 3OG9A 4JSTA 4D3SA 2FXVA 3QVKA 5EHIA 1WXWA 1H8HD 1GN8A 1GZDA 1KH2A 1TTHA 1KP2A 2RK4A 4TV9A 5E4TA 3FPJA 3KOZA 3MMXA 3QJ5A 4L16A 3EN0A 4QECA 5LDDC 2QAGC 3GV0A 4OIFA 3QEBZ 1U5BB 2HBQA 4HFNA 4XR9A 4C0WA 3WGIA 3P94A 4LBVA 1T1SA 2HADA 2PG3A 3FN4A 1A9PA 1CNFA 1BWPA 1G291 4KQ2A 5LLDA 3ND6A 1T4BA 5EAIA 4B5KA 3RUFA 4XYBA 2ZQZA 1IZ8A 3CV3A 2Z8ZA 4PSKA 1ECLA 1IBKB 2OA0A 4IVPA 3ZCQA 2O8BB 4N12A 3GLQA 1QH1A 3U80A 1QB7A 1SXJC 4QYWA 3RC1A 1RC1A 1T24A 2GFQA 2DR2A 1DOAA 4NOJA 5DO9A 1CHDA 2JH3A 3W1EA 1AKVA 3KWJA 2XYRA 4LGCA 3TL2A 4LV8B 3A6KA 2HWXA 5KYUA 3O92A 2ATXA 4GMDA 1Q57A 1Q1AA 5CH5A 3N5KA 4ENUA 3TS1A 4BDTA 2K7FA 4DGQA 1NDHA 3H3XA 3GLFB 1XRLA 3AI2A 3NOOA 1AV6A 1FTWA 2J7PD 3IRUA 2B25A 1H2BA 2ZJFA 4MUBA 2GK6A 4Y2HA 3RS5A 1QHXA 4MUJA 5LL6P 1W0KA 4EGSA 3ZEIA 3B12A 1QNFA 4M1WA 4LRWA 2YMLA 5E6RA 2IKQA 1GXSA 3U13A 3C5EA 4EZIA 1JLKA 3GP5A 3KJGA 5HGXA 1M74A 4RMGA 3JPYA 1OE0A 3G9UA 3EYWA 4G0XA 5BP7A 1M1UA 4NYIQ 5CVEA 4PN7A 5IG2A 2FPPB 3R4CA 1FNBA 3NCTA 3O90A 5K4AA 3W7BA 5KBYA 1N6OA 2KM1A 3UQYS 1XP8A 5L3QB 4EF6A 3SLRA 1U7UA 2VYNA 3N7UA 5T5QA 3DBHB 1XKTA 4XX1A 5TPWA 2YR0A 2VS1A 4KFSA 1GOTA 3F7NA 4Z3OA 4ZVLA 4TL8A 2VJKA 1BE0A 2PLNA 2I66A 3F6EX 3G5UA 2WTAA 4QOIA 4KODA 1X80A 4P3XA 1KPGA 3H9GA 2LXNA 3WIEA 2ZRNA 3QBJA 3I0ZA 5DM70 1LWOA 1OGJA 4X93A 2ATIA 1V43A 2DMRA 3PRYA 4S1WA 4S1OA 3EFEA 4YO8A 2BHRA 4D5EA 3WIBA 4AO8A 3EJWA 4WAUA 4EFMA 4F8YA 3DO6A 1F17A 4NP6A 1CE8A 3INGA 3DHNA 4OP3A 4WVLA 2YV3A 4E31A 2C2GA 2JBWA 4I19A 1C3JA 3C7AA 2E18A 2ONJA 3QFSA 1C2TA 3SC2A 2EJBA 2VPYA 3F98A 3L0SA 3OICA 4Z0TA 2BUAA 4ZEWA 2YC4C 3Q98A 1PT7A 1GPYA 4IDQA 3GG2A 5AJYA 4Q39A 2OV3A 3SNKA 3QA9A 3SIRA 1G4AE 6REQB 1J0XO 1ECPA 1PFWA 2XMDA 4ER0A 1ZITA 4PNPA 3K6SA 4H60A 3DZGA 3KLBA 5GQSA 1YDFA 1GV1A 2NQ8A 1EDEA 1I13A 4C7VA 2HL6A 2CUKA 2FPIB 3UM9A 2CXSA 2IC5A 5I45A 2G25A 1TQDA 2NU6A 4WQMA 1ISHA 1G66A 1G64A 4TM7A 3A4TA 4QHSA 2AW3A 2H5IA 1N4AA 2QQGA 1QE3A 3DAYA 3H83A 1YFZA 2WV9A 1PEAA 3HH8A 2ODPA 3PC6A 3LH5A 1XD9A 1QBGA 4U2GA 1FTQA 1SH7A 1U98A 3CRW1 4RM3A 5EJGA 2DBZA 3H5TA 4R54A 1XU9A 3GQBB 4HQKA 1B15A 1NT2A 3QWAA 5AKYA 5LM3A 2EBUA 1XQ9A 1P75A 4QZVA 2WD7B 5JAOA 4N6GA 4QG3A 4NBUA 3CXUA 1KO4A 1EFVB 2FK8A 3HPRA 1EFPB 5B7PA 5HR5A 2H65A 4WBNA 1FFXB 7REQB 1ODLA 1QFZA 1MH1A 2Q4OA 3L7DA 1DIGA 1FSPA 5IT0A 5HUHA 2HREA 2IQIA 4YCAA 4JSRA 1GPMA 2QE7D 3TDMA 1E20A 4BBPA 1JH8A 4M98A 2A4KA 3AU9A 1YB7A 1OB2A 2IEIA 3L77A 4RDXA 1QP7A 4AJKA 1N25A 5EZQA 1GGHA 1MJGA 2WPNA 1ZH2A 2UYGA 3M70A 3PQ5A 5ICFA 1H23A 3C5WP 2XYPA 4KI7A 1UINA 1YIAA 1BZYA 2WHQA 5CPFA 2VQFB 5K6TA 2WZCA 3R7AA 3C1OA 4OQEA 1J70A 2D1YA 5B5SA 2ILVA 4KRXA 5CFMA 1E9RA 4V0MA 1EDOA 1OHHA 2QJRA 1SOAA 3MWLA 2RIRA 4KO4S 1MR3F 1BHJA 4TLLB 4BJ5A 4DLXA 2QTGA 3G2PA 2OSVA 1D1PA 4GYYA 3SM9A 1Z73A 3UHJA 4E2ZA 1PFKA 2IE8A 1P3JA 2GILA 3PLNA 3U40A 3H7IA 3P1JA 5A03A 4YAUA 3LTNC 4C5AA 4WKBA 2F1OA 1GZ5A 4EYKA 1JAHA 4A1OA 2Y99A 4E07A 3ICOA 2HSEA 4KTVE 5CTAA 4M0EA 4RAQA 3P2OA 3KJHA 3R9IA 3CZAA 3FPSA 3G1UA 1EVLA 1ZI8A 3RIGA 1C1XA 1DTWA 2WU0A 3FF1A 3K0HA 4XYGA 3DGEC 5DM2A 2CDCA 4IM7A 4Y6GB 2BSXA 3Q3VA 2ZSDA 4HYYA 2WU3A 1UKAA 5EUBA 4GOND 5H4HA 3LS2A 3ED5A 3NDPA 2ZPTX 2E1RA 4X6YA 2YVAA 5BYKA 2RHRA 1BGVA 3ANLA 3E27A 2XMCA 3H16A 2Z6VA 3EVDA 3R23A 4IFEA 4B85A 2XKKA 1JVNA 1SMKA 4BE7B 2YZNA 4ZU1X 3EGDB 4X8HA 4RS3A 3KZKA 4PINA 5EWJA 1KEKA 1LU9A 1K88A 1SRRA 3VNUA 1B6RA 1I7LA 2AYZA 2DUNA 3R4VA 4KQEA 3GFVA 1XMIA 3L6DA 2AG6A 3S55A 5CM2Z 1GU0A 1QRRA 1W6UA 3MWEB 1Y8CA 3ISTA 2PR7A 5CX1B 2RGYA 4ILKA 2OC4A 1T3HA 1JR3D 1VDMA 3OHSX 4ND4A 2V7TA 2JGIA 4P58A 4YJFB 1PZMA 2ZTUA 3UF0A 4CNBA 1Q1BA 1U2GA 5HM6A 3RK4A 4R51A 3L4JA 3DQPA 1RR6A 3ER6A 4DMKA 3C7DB 3O1IC 1L4LA 1ZIOA 2QQ0A 2CXUA 1EK5A 4DV2B 1Q7CA 3RSZA 1M2OB 1NFFA 2HIHA 4ZOBA 1WHTB 3AEQB 2FHPA 2HAEA 3SHTA 2YWBA 1O1YA 2KBEA 3S7TA 4TMZA 1ULTA 3GYBA 4HRVA 4J1TA 4JVNA 3PJEA 3S2UA 4NSNA 4RPIA 1AUPA 4H18A 2R8XA 1Z0IA 3RANA 2O1EA 2R7NA 3GLSA 4FJ1A 2EAUA 2M9MA 2Z8YM 5HKLA 4PYJA 3DLBA 1JE0A 4AROA 5CAEB 2JJMA 1P33A 3NANA 4XOIA 3AI1A 1NUUA 1RVDA 5EPOA 2AFIE 3RSSA 2Q0XA 4JELA 4GE3A 1O96B 2V6BA 3DG9A 3HLYA 1M54A 3PV0A 4HNRA 4KVAA 4RCYA 5E1DA 3RB8A 3VNQA 1ZI6A 2PUVA 4WOJA 1F4PA 2QHXA 1OLSB 2EOAA 3KV3O 1J42A 3K8OE 3CNHA 2A1UA 3UJPA 1A98A 3VR5A 4RDHA 4WBXC 1M67A 1R4NB 3K9LA 2CD7A 2FKNA 2GJ9A 4FONA 4NYMQ 1DMSA 4RDCA 4N9WA 4C78A 4DBLE 3C8ZA 1NJSA 3SZUA 4EHIA 1AM4D 4P86A 4F96A 1CZHA 1Y37A 1TMKA 3VKHA 3T7KA 2ZYTX 1U2DA 5ALNA 2PX8A 4PCUA 2XBMA 1QO0D 5EXDA 3JYPA 1PDWA 3FOWA 4ND8B 1SHUX 3NIDB 4DNPA 4D97A 1YI8A 1WEHA 2G5CA 2GPWA 3FUVA 1ZDMA 1S6YA 5H80A 5B7GA 3TW8A 2O8EA 1DC6A 1J1UA 3N8KA 3LLSA 1JIJA 2AH5A 3QX7A 4QUBA 3PWZA 5JYCA 2WMYA 1Q7BA 2C59A 1KYZA 3T5GA 1G3UA 4X8LA 2A0UA 4QPCA 4LZOA 5A7GA 3L4KA 3GFPA 2W6OA 2CLEB 2AMJA 5B3JA 4P7FA 3DE7X 4XB1A 4CT0A 1BVUA 2OHOA 3TQTA 2JARA 5JS2A 3EXHB 1LWNA 3DVAA 3QKTA 1QDUA 2GBIA 4FUTA 2OXCA 4K2AA 3K6KA 1V47A 2DP4E 2I1WA 2ZAYA 3GPCA 4W1SA 4G3XA 5AM1A 1RI4A 3A11A 1PUXA 3CF6R 3NOVA 5BO5A 1WUJS 1W5TA 2XODA 3MBOA 1CKEA 3M33A 4TQ9A 4O4HA 2ZPAA 4QU5A 1ONPA 4IINA 1UPCA 4KZPA 3ITEA 4BKOA 2W93A 3S70A 3ZVLA 2RFLA 4Q18A 2PXCA 3Q8KA 3M4ZA 4S0ZA 1F6BA 5F9HA 4CCYA 4V0QA 2ONZA 1RU3A 2IYUA 4ZDWA 2Q5QA 2I62A 3W5HA 1JYFA 3QX9A 3FWHA 1OAAA 2VJQA 3R1IA 3LY7A 4N18A 2JLZA 2YIVX 2Q49A 4QG7A 2PAFA 4YUXA 1GYQA 3FDZB 3LVRE 4E33A 4DGSA 3LDGA 5U4QA 4PBRA 4BATA 2ZI4A 3H1TA 3PXGA 3KE9A 1UXHA 1CJSA 1L4BA 2X1LA 5IULC 2A78A 4AUKA 5KAPA 3JQ8A 5DNCA 1JHOA 3ANTA 2KHZA 2IH5A 5KVQA 1NDQA 1BX0A 1SXJB 1GRQA 1TAHA 3OE1A 5DFAA 4DMCA 1EX7A 4WXRA 5GONA 3PICA 1E5DA 4NMLA 2F9MA 5J40A 1GCOA 4YP6A 4F6CA 3ZGVA 1DXYA 3WFJA 4PCVA 4MV8A 5A4DA 4FZ3A 3T1HB 4K5QA 2WWVD 4QBTA 5HDQA 1V11A 1WO8A 1SRQA 1TT5B 1RKXA 2EQBA 2JFGA 2OSBA 3IBTA 1PWYE 1FS4A 2HF2A 4XEHA 3RSLA 2ZIAA 1K3TA 2G71A 3CX7A 5L3RA 2DEUA 1CLEA 1GQ2A 2AZDA 3ICCA 1JAZA 4KXXA 1QX3A 1TF7A 3Q1LA 2PVCA 5LA6B 4ZA2A 4NE7A 4C4RA 1K5GA 4HEA6 3H5NA 3JQ6A 1F3LA 1UKVY 4WINA 3ER8A 3LCUA 3LRPA 4P38A 4YJ3F 1A4RA 4ZCRA 3KVYA 4RW0A 1KETA 3OIVA 3OMLA 1RLUA 4E11A 2WJ6A 3LQ2A 1LCIA 1XRPA 2O2YA 2AUTA 3AESB 1FUUA 1XN1A 5DX1A 3S2FA 1V8BA 4YRRA 4DVJA 2J4DA 1SWWA 2HJSA 4G0YA 1XOIA 1D2GA 1MT3A 4QBFA 1A9QA 1QKJA 5IH3A 3QK7A 3S7ZA 4B81A 4DILA 1VI5A 2XYGA 2PUAA 3PA8A 2D1FA 1T3LA 3G5TA 2W8BB 1XR3A 3TIGA 3B8EA 2Y0CA 3KIPA 4KPUA 4I1SA 4IICA 5CT9A 2BMFA 4KX5A 3X1ZA 1GD1O 4IKPA 4LF6B 1GG5A 1ETUA 3GEMA 3D6AA 4MVJE 4KMOA 2PT5A 1QYRA 5KQMA 3PLAE 2QF7A 4UE2A 1Z0UA 3ENWA 1R9NA 1FYEA 5IW8A 3T3PB 1F8FA 3D6JA 1IEQA 1Q21A 2CD9A 2ZRLA 4O63O 1Z07A 5ECGC 4IHJA 1I2MA 4BNHA 3AHIA 3HI6A 3QY0A 3VSDA 1DIAA 5KU7A 1BE1A 1UBTS 1LTKA 1VJ5A 4GMHA 1SIBE 5AHOA 5CLQA 1LPSA 5CCXA 2I6TA 2OT3B 2R6ZA 5JLAA 5MDHA 4CDMA 4LHWA 4UKDA 4NXMB 4IIFA 5DEIA 4M0DA 2CYBA 1JHXA 4KLNA 1OKKA 2R84A 1LJ8A 1B0UA 2PGNA 1E2UA 4KHZA 4Y7CA 3SF8B 3SYTA 1NBEA 3CWQA 4N0PA 4DG9A 1OXVA 1Z36A 4N9QA 1L5VA 2YJ6A 5FA6A 4EYQA 4L4ZA 2HA2A 3ND7A 3U0VA 1PE0A 5LSAA 4JGGA 1P39A 2PRYA 3NDRA 3F5DA 4I46A 4QBIA 5IHXA 4EFKA 4K87A 1L5GB 4DN6A 3ON5A 1NKVA 3JWPA 3KFVA 1L5FA 3LZCA 4LOLA 4QLOA 3WRYA 4Q4CA 2BFPA 3K5WA 2ZATA 2Q3EA 1E64A 5IDYA 1GLNA 4ITUA 3TOXA 1KVUA 1KDZA 1OI7A 3HVRA 4LSGA 2FUNB 2AZTA 1UKZA 3FUWA 5DBGA 1JEDA 4FM9A 1HORA 3TRDA 1WVIA 2HRQA 2XT0A 5NLLA 3DHYA 3UW1A 1I3CA 2PX2A 3CINA 4C5CA 4P08A 1CHNA 2E49A 2QLJA 2QX7A 2QUBA 4GPZA 3NXSA 3MT8A 1WCXA 1IEWA 1H5QA 1NLFA 2UZ4A 4MW7A 3OY7A 3MTGA 2IX9A 5JH7A 1ID1A 3RUIA 1P2TA 4AQYB 3FNIA 1FQJA 5J3JA 4TL9A 5KNDH 3MWDB 2ZGVA 4KXYA 4NZMA 1AS3A 4JJ4A 4FYIA 3ZV6A 2WDPA 3QHQA 3IUMA 3O1LA 4BFWA 4P4TA 3P45A 2WJJA 3SIPA 3M83A 2A7XA 4H15A 3KQNA 3FZEA 5J2UB 2MSKA 3O91A 2RJOA 2YRXA 1HA3A 4BECA 1V2HE 3U5TA 2ZVJA 1HE5A 2VATA 1V4BA 4OSPA 5DXJA 1H05A 2AXEA 3IAS6 4N3AA 1PT8A 2YXNA 5CRIA 1QQTA 1JKJB 4KAJA 5CNIA 2PKWA 5CM9C 1HXHA 2SKEA 3RUCA 2P7IA 3LO5A 4CHGA 3KAKA 1UM8A 2H85A 3ZTTA 1C7RA 3SXJA 1BU8A 2FYTA 3DWIA 2JI4A 3D3JA 3L01A 4R41A 4AIIA 4BQEA 5JTTA 3U56A 2BR5A 4FQ7A 2VHXA 2G0AA 5HMMA 1X2EA 2N9UA 1KEUA 2QVGA 4BXOA 3VVMA 3BL8A 4L9AA 2FWNA 3FBGA 4Y1RB 2QMOA 3ZV4A 2WF9A 3MBIA 1NNUA 4H6PA 4MWCA 3S5UA 4UUNA 2I4OA 1EHCA 3DE0X 4RJJA 5LZ5A 2W83A 4DRZA 3AHCA 3IQHX 3HKCB 4ZO7A 5FAXA 3WFZA 1MGPA 2JI9A 2XE6A 4Y9DA 5JJIA 4LZZA 2NT4A 4GBJA 3ORYA 3IJPA 3ROTA 1I3LA 4PSCA 1G4HA 4RD1A 1FVHA 5ARCA 4ZANA 5T3YA 4CEHB 1WXQA 1FYVA 2VH2A 2I2BA 5GOZA 2HA6A 4B3DA 1E3WA 2WZQA 4M1MA 1AY0A 3L6EA 2P2YA 3W4KA 3PQEA 3I1JA 3W9UA 4BMNA 4D6YA 2IKSA 3FNRA 5K0GA 3MG9A 3MAJA 1XCOA 1GPWB 1DJNA 2HGSA 3H99A 3NVDA 5AVSA 3WY9A 4AMUA 2I3BA 3EUAA 4G09A 5BR7A 3H0CA 4HNSA 2Z4TA 4OHXA 1M0EA 1Q14A 3N8DA 1FMLA 1YU9A 4KNWA 4PLHA 3CZQA 3S2GA 4RD6A 3T61A 3VNSA 1JFLA 2AFVA 2Q0HA 4NV0A 5GVSA 2JGLA 5FOVA 4BVLA 4DL9A 1C9EA 2NO7A 2VJMB 1GNVA 1KJ8A 3LF1A 4ARZB 1TLTA 1I4LD 2F1IA 4NX2A 3CLTC 4NL4H 1RWNA 4FDUA 2WMDA 3RRBA 2A5GA 1QGYA 1G98A 1K7FB 3ANXA 4YAFA 1LSSA 4EH1A 2CJXA 3O8CA 1QHIA 3ULKA 1OXBB 4X1IB 1XNQB 4HX2A 1SKYB 1IBCA 1STOA 1JTEA 1VLMA 4BGUA 1MLDA 2AEFA 3I6MA 1KVTA 2NUBA 2W2OA 3K0AB 5DHSA 2FPGB 4HUTA 1J56A 3E5NA 1AQNA 1N8SA 3V1MA 1P0PA 2AYYA 1Z6YA 1FDWA 1QVZA 2IRWA 3LKZA 4G26A 4HFRA 2Z2YA 3FAZA 4MO9A 4WPGA 4XCVA 4R0MA 1CRWG 4W9RA 1K7YA 4IDCA 2D1QA 1LDEA 1GCIA 1XB2A 3CE9A 4QPDA 4ZYLA 4XYMA 4PAGA 2PUBA 2C1ZA 2ZJ6A 4NK5A 4YRJA 4RWEA 8ADHA 4ZHQF 4EG4A 3A9TA 3PCRB 4UATA 2HEIA 4XX0B 3D4IA 4FMCB 5E4YA 2FE4A 4BBJA 4MAMA 2LTAA 1EGQA 1H5UA 3CUYA 4NZNA 3HEMA 2HK8A 1U3UA 3JPWA 1LVUA 2XQKA 1YS2X 4FZRA 1FX1A 3W1WA 2VYFA 4EGFA 4W63A 5A3RA 3IOBA 2ZQYA 4B6QA 3D54D 1PS0A 4ZT5A 4LGMA 4DLAA 1TZCA 4O4IB 4P4SA 3T7AA 1C9DB 4QLAA 3BF8A 5ERGB 1RWWA 1Q2XA 3P9ZA 5CEFA 2WWRA 1HRDA 1NW9B 2AMVA 4R16A 1ABEA 4Y2UA 2J0UA 2J32A 3GQBA 3NEPX 1J1IA 2C3PA 2WT9A 2PO7A 4BTEA 4C22A 1I7QB 1JMKC 2B92A 4FW9A 2Y1CA 3C39A 1WLYA 2PBLA 1ECCA 4LE2A 4WERA 1D4FA 5AVOA 4L8YA 1YQTA 2QXTA 2GGSA 2GD1O 3ONWA 3OPYI 2LUOA 4YQYA 1Q22A 5JNUA 4NFYA 1Z0DA 2IZ6A 2ZKLA 4OK3A 1M83A 4QHTA 1KDVA 1D5CA 3CUEF 2BCJQ 3VV2A 2I9KA 3ROFA 1ZOPA 3H9BA 1I7NA 4D8TA 1KFCB 1Z2EA 2X2OA 4P7KA 3QVUA 5BRJA 1XK7A 1KDTA 3Q9NA 2EGUA 1R6DA 1K8YB 2YUIA 2UYOA 3DMDA 4F5YA 1NUHA 3FLAA 3HCNA 3PUKA 3BMQB 1NP3A 5JCJA 1UBRS 1NYRA 4QRDA 3R20A 3BCSA 4ESHA 3ICPA 2QR2A 2HU5A 1IBSA 2EERA 4C0AC 4RVHA 2PMDA 1MO4A 1W35A 5HIIA 2WVAA 3GDOA 4P9NA 3HJFA 4MI1A 4PC2A 2CL0X 2FJPA 1JSZA 4U7JA 2V58A 3OTIA 2QTFA 3GDWA 4RNCA 2ZYSA 3HM9A 4R1QA 3TPFA 1GG2A 4MQFB 1F2VA 4WX2B 4I8IA 3IODA 2P9EA 1Z12A 4M0LA 3LBYA 3WRWA 1BMFD 5AK0A 2ZIEA 3HV2A 4NAHA 2BFBA 1L7OA 4I5DA 5JHHB 4Z8YA 1LW7A 4KDFA 4OSOA 1BFDA 3O7WA 4LYDA 3KKMA 4U7HA 2ACVA 3V4LA 2BFEB 4FIZA 2C2XA 3WJ2A 2P0AA 4Q15A 3HDVA 1W0KD 4C14A 3WJ1A 5IDQA 5J1SB 4R3WA 5IHPA 2VCHA 3VDXA 1Y3CE 4UTRA 1CWUA 3KL4A 3JZFA 4G4GA 4ITRC 3LSTA 3PNKA 2ZT7A 3AI7A 1OWMA 2R6R1 2GARA 3LECA 4B35A 1XPUA 2ZULA 4R69A 4RKQA 3E3LA 4MR9B 3WC4A 3K70C 4FEEA 2X7HA 4PAWA 4C1NA 1NVVR 3ZCRA 5IMBA 3OJOA 3WB0A 4BLSA 2GFHA 2WM2A 2QYOA 3BSSA 1YWGO 4R0VA 3VHXA 1C1HA 2H8GA 4RYDA 3QG1A 3E2PA 4QXPA 3SQWA 4MCJA 1GDTA 1YB4A 2DETA 2AN3A 5ALZA 2VHYA 1U2QA 2HTFA 2AZMA 2PKXA 3KHKA 4HAWA 1F0NA 3ROXA 1AGXA 3KOWA 1JKIA 2P4QA 4V2UA 4DC0A 4WLVA 4DVGA 3GA0A 4KIUA 5FLEX 4G8JA 1UH5A 2X42A 3WNDA 4UNPA 1SQSA 1CR2A 3GCGA 4FWIB 4XJXA 2IHNA 1JQLB 1RC0A 3F8TA 1ZRNA 2P2LA 1RQLA 1O6BA 1OVGA 1N5LA 2F2TA 3ZVKA 3WDLA 1QFMA 2I67A 2X0EA 4Z3KA 4ZGWA 4BMYA 1BMQA 3C7CB 2FVXA 4ZXFA 4XB2A 2QV0A 2WWTA 5KX5F 3WLKX 3ZC3A 4EKIA 5AW6A 1U7XA 3D6TB 1GPUA 4BGIA 4RTNA 1UK9A 1Z74A 4NLLA 5C7OO 1RXVA 2NGRA 1ZMBA 2VWHA 3Q7TA 3DHVA 4TMXA 1A7KA 1W85B 4TKZA 4TVOA 3D6NB 2PTHA 5B64A 3EIHA 3GLRA 3EVZA 3KETA 4OYRA 3JX9A 4AK9A 2PS3A 3TLXA 2YCLA 4HNGA 1PR2A 1B1CA 4H2DA 4KGDA 2W6JD 4CM6A 4JKYA 3DUWA 2PO5A 1YRYE 4KEAA 1KGDA 4A91A 1UEJA 4HEQA 4CV1A 3HXMA 2FEWB 2R48A 5KYUB 4RIIA 3E9YA 1NA5A 5BXYA 3P0IA 2EFJA 1DELA 1Z62A 1BFKA 3LUAA 1HDZA 4LV5B 3VPCA 1KAHA 3K9GA 3QF7A 2C8VA 4RORA 1NU6A 2BGGA 2JLVA 4V0SA 4EFDA 1VJTA 3IMFA 2QTBA 3PR2B 2GLXA 4DMFA 3P9XA 3Q6IA 3NEYA 1PJBA 4MV7A 1SVUA 3Q5EA 4Q93A 2Y0DA 3JATB 3FLEA 1DDOA 3JD2A 5LA6A 5IBRA 3REQA 1JKMA 3TI7A 4H6WA 1R6UA 4GI1A 5IVHA 2P79A 5K20A 4CLDA 2CJFA 2W4MA 3QMWA 2FWBA 3S29A 3IEUA 5FPPA 3QX3A 3GEGA 4KPFC 5IT4A 1R50A 3VOTA 1B3RA 4M46A 1ZVKA 3F7TA 1NVEA 4LOJA 3N86A 4P35A 4AECA 4B46A 2QZSA 2PV0A 1AK1A 3HVKA 3JASB 5IVKA 2ZYWX 5DXAA 5CB6A 2B35A 5E6SB 1GGJA 3AILA 2GT1A 4BQIA 4A36A 3I42A 2WEKA 3BIXA 4H7DA 1JDPA 2HBZA 4UVDA 1A8IA 1XYVA 2JIZA 3BCHA 4AG3A 4WBNF 3ISJA 1XALA 1A8QA 1JQBA 1VL8A 4C89A 1MW8X 4AY2A 3DEKA 2C7VA 5FQOA 3N6VA 4H6XA 4K8RB 2ZBFA 1XZPA 1SKAA 3G7NA 3OQBA 4WOPA 3SFTA 3SGLA 4QYTA 4CKWB 4DA7A 1EVJA 5CDGA 4YQEA 1GPKA 1XYYA 4DWOA 1Q19A 5L40A 4FOTA 2YWGA 1NG1A 1BU5A 2O52A 4KQFA 1RPJA 2XCIA 5FTKA 2JA2A 4BO8A 1P2BA 3CLSD 4JI5B 2DGDA 2DPMA 4JI1B 1SD1A 4QKQA 2ENWA 1C3XA 1AKEA 2GKOA 3EZ2A 2WHRA 4KXVA 5KS2A 2DCMA 2J87A 2ANBA 4R01A 4RD3A 3RJZA 3OQNA 4JH0A 5GY7A 3JQ8B 5B3JC 2XWQA 3N7AA 1CBUA 1M5RA 6REQA 2C00A 5KINB 3VZBA 1P1HA 1Z4IA 2EKQA 2FWIA 2JEYA 2FB9A 4YAJA 4QXMA 2N47A 3VR5H 4HVTA 1W5BA 1S7GA 3OQHA 4NULA 1OMOA 2P27A 2G04A 2O2XA 1QPGA 3K53A 1WV0A 3RIHA 3TFQA 4JA2A 4GQBA 2C5HA 2YNMD 4J76A 4NBLA 1Q91A 4LFBB 5AKKA 1T9DA 2GAOA 5F52A 3KOMA 3ZDYB 5EXPA 2V0NA 4QDJA 2A9JA 3LHDA 2W9XA 3MGAA 5JC1A 3ZHZA 5D3KA 3P2YA 4L6AA 2WWYA 3COYA 3FR8A 1U6JA 3GPBA 1Q1QA 4PG5A 4JOSA 4TMTA 2I7CA 4LQ4A 3ES9A 3PD7A 3AF3A 4FSHA 3O6VA 1G0OA 3K9HA 2QTLA 4P4UA 3DLIA 1JR3A 2EX4A 2C8KA 1QMPA 2GJSA 2PS1A 4CKBB 2PKCA 4UU7A 2P9BA 1SQ6A 1YAJA 1VL0A 3IAHA 2KB0A 4LX8A 2PDAA 3RG2A 3T9FA 1CJVC 3ZD8A 1N1MA 1PJQA 4K40A 2PZBA 1FFXA 7REQA 4RVCA 2HT1A 2IY7A 1Z7WA 4GZ5A 1YR1A 5KNDD 2IH4A 6LDHA 3ZD6A 5JMTA 2WMNB 2VK4A 2ZUSA 3AOGA 4ME6A 5EMNA 1YQXA 4IL5A 4NH0A 2PXAA 3RT1A 1MA3A 1T1RA 3AUSA 4GOLD 1UQTA 4CI9A 4EIWA 4E2XA 1UPBA 1XZLA 1AOXA 3SPXA 2X5NA 2H2HA 1GA6A 2R8PA 4B3MB 2GPJA 4D4JA 4QEDA 5HQ3B 4G24A 3SLGA 2LCIA 4RJIA 1RJ9A 1SXJE 1VG9B 1E1KA 1VP9A 3AFHA 3G7UA 4J7UA 5A4AA 3CLKA 2I8LA 3V80A 4PNZA 4CLXA 4XEUA 4HTAA 4L4SA 5JNVA 2UDPA 1R0XA 3DHWC 4LCEA 4MDYA 4BNNA 3T5MA 5BQOA 3F96A 5A3SA 1KNXA 3A36A 1MRNA 1NBWB 3ADDA 4KBYA 4MCAA 4EMUA 5KWJA 3B51X 1QCCA 2OUIA 3LHFA 1EHIA 2PX6A 3MAAC 3MJDA 4RWZA 4TTSA 2FW1A 1DEOA 3GLGB 2C8LA 2Y93A 4XTCS 2AI2A 3PVSA 4JL5A 1L0BA 1QYCA 4ND1A 5A05A 5E6UA 2M6LA 3R5XA 3AJ8A 1C1XB 3JQBC 3WICA 2OD7A 4CQMA 4OQDA 3I9V6 1HQCA 3AFNA 1OA0A 3N58A 2W43A 4KXNA 5CFOA 4YV7A 1E1YA 4IHKA 3C1AA 3MM4A 4CFYA 5L4NA 3IP7A 3AV3A 2J6IA 3C48A 3R77A 1ZGCA 3N8GA 4CLEA 1PX0A 3KHSA 1TUGA 1LK0A 5TF4A 1Z5WA 4BNMA 2B94A 2OFPA 1EIZA 4UUMA 1J22A 3AOEA 3VZCA 2C92A 5A0TA 3QLUA 1CQJB 1VYHA 2EHDA 2R7LA 4P4GA 3ZNPA 4EZBA 1IBMB 2XNSA 3SXUB 3TB4A 1G8MA 2I3GA 4FFRA 4BQRA 3AEZA 5JLJA 4Z1MD 1UBGA 4F2DA 2XQVA 3DYVA 3MWEA 3PF9A 4LRQA 4ZC8A 3CLSC 1SEVA 1H2ZA 1XJ5A 1TMGE 3C97A 1QHHB 3R44A 3ACDA 3KRTA 1EK6A 3TTUA 2JAPA 3C4JA 4IDPA 5M3BA 4G0OA 1YJXA 4UTPA 5CG2A 2JFVA 1FP1D 1YRWA 5TS2A 2HT6A 2ZANA 4KKXB 1M75A 1E6CA 4W9MC 1LNSA 3ZKWB 3FRJA 5IN4A 1A2KC 5JADA 1U7OA 2XVAA 3K2BA 4CMHA 1ESNA 2BC9A 2DT5A 3V8BA 5IASA 2VLBA 5IM4F 4QWMA 3OCJA 3ZCTA 4DMLA 4V0OA 3GJ3A 3TO5A 3EOAI 3WYFA 2YFHA 4AY4A 1TYCA 4RY8A 4K81B 5B53A 3AL0C 5CYPA 3DL7A 3LK6A 2CVQA 3WGVA 1EX9A 3GFTA 1CX9B 3AZPA 1QTIA 1QFXA 3AF4A 4BKPA 4GICA 1IN1A 4YP9A 1X7ZB 4FHCA 4B83A 5E4FA 3SHQA 3BXHA 5D3MB 4RC9A 3W04A 4MX8A 4FLMA 3L0IB 4J3FA 4ENSA 1SC4A 3T38A 1GZ3A 4IZOA 2PLAA 1A4XA 3U44A 3C3CA 4QAQA 1JQJC 1CT9A 2IOFA 2C2KA 2G17A 4OQYA 3AY0A 2F48A 3L9XA 4EUKA 1DQSA 1UWLA 3R5FA 4YCDA 1ABBA 5FO0A 4NDZA 2CNLA 1B1AA 1RCFA 5IVIA 3F3KA 3PITA 2GEJA 4RNDB 3OBIA 1RQ7A 1ZXLA 4KN5A 1W73A 5FIUA 1W29A 1LS1A 2QLLA 1BG6A 1C7JA 3A4LA 3O8QB 1U7DA 2A6PA 2QRVB 3ZLBA 4RULA 4P92A 1L4GA 2XI4A 3L40A 3UWDA 3PC7A 2ZZKA 1AUVA 1EFCA 4NBKA 2ZIXA 1R5NA 1N5MA 1DEHA 4LRTB 1UAAA 1IAVA 3FHJA 3TRJA 4IIYA 4EEZA 1ZJYA 1Z8FA 4QYXA 1UDRA 1WZCA 3WGMA 5IBCA 3FTPA 1DUVG 1WXIA 3NWOA 3TW0A 2HPHA 1V71A 2EZ9A 1Z2AA 1L4FA 1V7ZA 2I8AA 4OQ4A 4IOLA 1LGYA 3QEJA 4FKZA 3F78A 4BBAA 4CIYA 3WWPA 4CWAA 1XD2A 3RRNA 2TMYA 1WL8A 1JHZA 4W7SA 5KX5B 1JR6A 1P29A 2C95A 4M3NA 4TRJA 2UKDA 1M1YB 4FDAA 5CLIA 4ZVOA 2QLTA 4KDRA 5JCPA 1AQIA 2ISCA 3M1LA 4LJSA 3CR3C 4UNQA 3URKA 5CGQB 4AJIA 5B3KA 4NBVA 2IYPA 3C3XA 5H16A 3TNLA 4OF4A 2WF8A 1FRFS 3ZTYA 3F6PA 4ARZA 5K8IA 3V1NA 3ORHA 3RV4A 2QMYA 4RVGA 1USGA 5ALVA 5K0TA 3MEQA 1VLLA 2HSWA 1ZVMA 2OFXA 2WJGA 3WGJA 5HOEA 2PX5A 2OECA 4N5DA 1EVIA 1D9ZA 4JL8A 3T1TA 5DN6D 3L4SO 3ZNNA 3QXJA 4B3RB 2J6HA 1JPUA 5JFOA 1AXEA 1GU7A 2WFZA 4G5OA 3HBMA 1RPZA 1QQ6A 1DS6A 1E4EB 4C4PA 4LXTA 3AL3A 1LRKA 1DPGA 4F2GA 4TS1A 1LC0A 3SSOA 1WMAA 3E58A 2YFYA 3BEDA 3CF2A 1Y8RA 4G0QA 1OH7A 2HXYA 4IMRA 3HO8A 3LC1O 3DT6A 3PLRA 1N32B 3S1SA 4PCAA 1E9CA 1UC5B 2IIBA 2IYWA 3IS3A 1W1IA 4ZALA 1XPOA 1JKXA 4GSLA 5EE0A 1NI4A 1R8XA 3B6ZA 1VQ1A 3HCBA 5G1NA 1MABA 5T6BA 5LKAA 4H7JA 4B7UA 1CTQA 1JAXA 4FHZA 1NMZA 2R60A 1WS6A 4BIIA 3FAKA 1UODA 1MB9A 2C9DA 4K1LA 1Z22A 2GCIA 1J8VA 1JDBB 1C7QA 3FNBA 3PX2A 1JR3E 3HYTA 3UAYA 2VJLA 3L49A 5AR1A 2Z4SA 3GUHA 1TCBA 2H4YA 1ZCJA 1DHTA 2XE4A 2HU8A 3WKDA 3T3GA 1C29B 3U9LA 1QYVA 1JLLB 5G3YA 4X3PA 1KZ7B 2RGRA 5JZSA 2ENUA 2ZE5A 5EXTA 2BBOA 4N47A 4ZEOA 3E1GA 1XSEA 2XDYA 1LK5A 4IMPA 1F2TB 1KYWA 2FSFA 3OPYA 4BCCA 2QM7A 3DLTA 5DW3A 2WKQA 3HR7A 4YXWD 4EX6A 4TMWA 3SE0A 5SY4A 1EXDA 2FEMA 4U7DA 1QIKA 2VT2A 2E9SA 4MWZA 2QE7A 4J0GA 1PZFA 3UYLA 5HUQA 1PDVA 4LS3A 4QUAA 3Q40A 3SZRA 3ZU3A 3BBPA 3DLAA 4M8NE 4JI7B 2VOEA 4OXQA 1T1JA 4OMDA 5K03A 2VJCA 2R66A 1UBMS 4OUDA 1H5NA 4DQXA 2JIOA 1DEAA 4MZDA 4GZMA 5H9WA 5I4BA 1O4WA 5JZ9A 1CEEA 2XCTB 5K2MA 2LCQA 3GWZA 3I9FA 2WK1A 3NV7A 1N5KA 3NHFA 2SKCA 3M4XA 3Q2KA 4IJVA 4JI6B 2Z56A 4KR6A 3R7BA 3RYHB 4XIJA 1ODTC 5E8RA 3CG0A 3HDGA 3SEAA 1LRLA 4Z0PA 3VZRA 3V4SA 5IFLA 1X86B 4Z99A 5ER6A 5C8VA 3L8CA 4KL8S 1ONNA 2ZTSA 3VYUB 3EZ7A 3IEIA 3M6FA 4UFPA 1Q3TA 1VKRA 2FZVA 1VBMA 2HIAA 2WIDA 4YCSA 3K70B 2R6FA 2VK1A 1PJ4A 4ZEVA 5ELMA 1QH8B 4KSYA 3QPVA 4LSZA 1KK0A 3S68A 1RYDA 3J81A 4RH3A 4Q1EA 4Q48A 3UUFA 2DSNA 3PHJA 2WA2A 4YMWA 1B73A 3PNYA 3RGGA 3UGQA 1NHWA 2JLWA 1P5FA 1MP0A 3CW8X 1SQ0A 1B2LA 1N7HA 2JLCA 3A9UA 1AIPA 5L6MB 3PWTA 2PQ6A 1U9IA 2I5PO 4DLPA 5I7OA 2GS9A 5IVDA 3QVSA 2XQFA 3D6UA 2A0KA 4PG4A 4Q4JB 2GZ3A 5EHGA 5ENZA 3ZZ1A 4YT8A 1A2OA 3KKEA 5AKHA 3DNPA 3LKDA 2CF6A 3FTFA 3K2EA 1IY2A 2XVXA 1IVYA 2W6NA 1JNYA 1RMYA 4EVSA 1EFUA 3BERA 1GFIA 1GVHA 2CNWD 4BU0A 2DTXA 2FTKE 4K1XA 1YRLA 1ZUHA 3ET5A 4X7BA 1GJRA 4BU1A 3UJ9A 3WG9A 1U1CA 4IDAA 1GRVA 3JTEA 1HQYE 2OZLB 1MV5A 4II3A 1E3TA 4LY6A 5HJ7A 3UKJA 4GR5A 2ACWA 3VYVA 3SU8A 5TE9A 4P3PA 5EG5A 1JAIA 2GCOA 2REQB 3CCBA 3FUXA 4EKYA 3ZBTA 2R2GA 3WZ2A 3QH4A 4G01B 1ULZA 1X94A 5U1PA 1S4MA 1PZGA 2VRWA 1TXGA 2YW9A 1P91A 4P5PA 4P4LA 1IB0A 1H3FA 1NULA 3AY7A 4OBWA 3RBAA 2WG2A 1PLJA 5CFNA 3GRVA 1QONA 3NKVA 2QBYB 4HCJA 1IZYA 3TRHA 3U7QB 4ER6A 3UEOA 3A1FA 2VDOB 1RWKA 3LKBA 1HTBA 1HI9A 3M8KA 1U04A 3O8DA 3PGJA 3UK6A 5TMEA 3RVSA 1OC2A 5EIAA 2ET6A 4ESVA 5F5NA 1G2IA 2F4NA 3VDMA 1I36A 4TTQA 1RXUA 1X1DA 1VZ3A 2A1IA 3PGKA 1FU4A 4OJQA 3MTAA 3ZE0B 2PRKA 2BGKA 3GRYA 2YJ3A 2B36A 3MMNA 2DWQA 2I7DA 3NASA 4GF5A 4BP9A 4J7XA 4CG2A 5B58T 1FMTA 1EUYA 2KI5A 2VQ6A 4O2AF 3O3NB 4A10A 2FWAA 1ZKMA 1FP2A 4R2KA 1I6MA 4R31A 2IXBA 1EUDA 4BX8A 4D4HA 2ZUBA 2A1TR 3QP9A 4LI3X 4C5BA 4W5QA 5JS1A 4J2TA 2FPWA 9LDBA 3HKEB 4CQMD 2QNRA 3GR6A 1RLTA 1GGEA 2F3TA 1VIDA 1Z2CA 2VHJA 3GL9A 4NJOA 3DTVD 3MJHA 4FVTA 5EJMA 4WZBB 1PV2A 3NB0A 2O3UA 5G2OA 4C7XA 3T41A 3KXDA 4LF8B 3K16A 3UG6A 1Z6QA 1H4QA 1XRQA 5IF3A 5NULA 1ZL0A 4KYIB 2ARKA 4N76A 2A5JA 5BN3A 4L9RA 2IHYA 3P2MA 2ADMA 3CLTD 5JQGB 1WQ3A 1UK7A 1XCMA 4I6JA 1XE3A 4WCFC 3ZUGA 1E7MA 1HETA 1PJRA 4B2IA 1FFCA 1AS0A 2AV6A 2H4XA 3A1WA 1N2CE 3AV0B 1RQNA 4RA6B 5EXEA 2Q3LA 3N2YA 1ZMTA 4NBNA 1VLJA 3PUVA 4GKJB 1CSEE 4IIUA 1OWOA 1PF7E 1PTJC 4ML3A 2ZRFA 1NXOA 1GPH1 2LKDA 3FRIA 1OREA 2NSYA 3FMIA 2FSHA 3O82A 3M4YA 4WOBA 3GZ4A 4HX5A 1XZIA 4M8SA 5I8ZA 3SSAA 2FWRA 2X1HA 1OTYA 3BTSA 5A9TA 1S9DA 5H1YA 2XUFA 4H7HA 4MVCA 1OFIA 1NGSA 4OA8A 4RK7A 5DGIA 1ORVA 3UHAA 1E98A 2HDWA 4DR3B 3G88A 1GYRA 1HL3A 3NYWA 1FYDA 3UB4A 3SC6A 1W4BA 2E5LB 1XUOA 3DHEA 2QVLA 3ZGOA 3QVMA 3KYBA 2HU2A 4ZI3A 4G4SO 3MC1A 4XD7A 4GGOA 1SVKA 1GGKA 3CONA 5BT8A 1HDXA 4X1IA 3FDJA 4JUFA 2BSAA 2LDXA 4EQ6A 3TLMA 4EQZA 3ZX5A 1MQ8B 1ZC4A 2PFGA 3W5SA 4HWGA 5ITSA 4QXAA 3RU7A 1HE8B 1T2EA 5DHTA 2M6SA 3WWEA 4DPMA 3T0IA 1U8UA 2XEDA 3COWA 1ZNWA 3RRZA 1XTPA 3GRFA 4PBTA 2NMVA 2P6NA 3H0EA 1XNGA 2WB2A 2NXNA 4RSGA 3TM4A 1W75A 3WS7A 5FTLA 1T8SA 3GJ7A 2ZR7A 2WP0A 3VC3A 4HNVA 3KD3A 3MIIA 1CQZA 2R1VB 4TN1A 1F60A 4BCBA 3FZQA 4QTYA 2O2DA 3FZNA 2WJVA 3IERA 4KQKA 1B23P 2XX3A 3K73O 1OGYA 1YZQA 4XWOA 2J3KA 4NV3A 1I0ZA 1QLJA 4KFTA 3EXG1 2AJBA 4CKEA 2XXJA 2CXPA 4WJKB 4JV5B 1BE6A 1P1JA 3T4PA 3NVKI 2ZSHA 2RHMA 5EQFA 4EUSA 4LISA 3AUFA 2IP4A 4TKUA 3TSAA 1QJ4A 3L0ZA 1KDPA 3GAAA 2NVUB 2P5YA 1NXQA 2PMFA 1XRNA 2C7GA 3OZTA 2J5BA 1KDOA 1X74A 3IT2A 4YN3A 3THYA 3DTTA 3E1SA 4MP8A 3QKUA 3DEJA 2YXLA 3OWHA 2GSDA 3RU2A 5C8YF 3PD0A 1DAGA 1DDGA 5BYAA 5BSHA 2UUAB 1OUMA 2MINA 1NC1A 4ZT7A 2NU8B 3TLZA 1FIUA 1H4VB 1EXNA 2JLQA 3KYCB 3RIYA 3GIDA 2Y76A 5JYBA 4YXWA 2D2FA 3N0TA 3NHLA 3F49S 1WV1A 5K0ZA 4ZVRA 1VCHA 4LYJA 4HADA 2Q6TA 1EA5A 3BFPA 1NSTA 2AYXA 2RMKA 1JQ3A 3GFQA 4F4FA 3GGPA 2C9MA 3RK0A 3VH2A 3THXA 2W2MA 1DQZA 1Q0ZA 2JIRA 2X5XA 2WF5A 3E0QA 3FSGD 3C6QA 1N2CB 4WGGA 3HBLA 4JKOA 1FMJA 2I3AA 3GRZA 3IVAA 4QX6A 5HJEA 4REOA 1KAEA 2WYVA 2DPHA 1SKBA 4B6FA 3ZW9A 1A2BA 2Y6VA 4MV9A 1AKWA 5L6LB 1E1MA 5LA6F 4W8OA 4OA5A 1HTTA 5DBIA 1Y9ZA 1E92A 2IUYA 4LXIA 2W70A 3OE5A 1CRPA 5I4CA 3IT1A 1AMOA 1Z2NX 4BMCA 3EXFB 2PUWA 4U3JA 2BSQA 1C30A 1ZAKA 4Z49A 4HB2A 3WGLA 4EGQA 5I9NA 3KKZA 3UJNA 1LPPA 5DK6A 3AEXA 1NVTA 1E0AA 2Z98A 1G9XA 2R6GA 4IKEA 2FRDC 1LPOA 5BV0A 3AOEC 1EP2B 1NBMA 3IMKA 3NC4A 3LUGA 5BVHB 2V4MA 4OHCA 4OM8A 1EH5A 3B89A 4FW8A 5DHRA 3Q2IA 2V55B 2Q41A 4JWKA 2F6RA 3E7WA 3CO5A 4URHA 3A4YA 4ZVTA 3HUTA 5AXDA 1BYUA 2IV3A 3RWMB 2BFFB 3PRKE 4PZEA 4DOMA 3EZYA 4RKWA 5AESA 3OO0A 3D3WA 1SUFA 4OMUA 1L7QA 1L8OA 4C01A 2FFAA 2IITA 3D59A 3K72B 1FL9A 3GNSA 3QXSA 1NUQA 1P7VA 1GPDG 3GUCA 3O4RA 3AF5A 3PC8C 5JSFA 3FIUA 1BVRA 5F51A 4HGYA 4OHFA 3DBLA 1PJ3A 4KMMA 3SKXA 3K9WA 1ZA1A 3LX8A 3H2HA 3RJMA 3PK0A 4G8BA 4M54A 2P77A 5AVYA 3O4IA 1CY0A 4RZHA 1Z8NA 2A0WA 2COEA 2PIAA 5DIFA 3R40A 2JLUA 2C4WA 4HVAA 1I32A 5IVPA 5KYWB 3RHTA 3MRXA 3UJAA 3DZIA 1XTKA 2BFCA 1KZ4A 2Q8PA 2AD1A 5KOHA 5JU6A 1AQLA 2NACA 2OCIA 2ZJOA 3T06B 4ZC1A 5CDFE 4N5NA 3TW4A 4OG2A 3ZDFA 4F4CA 1VIAA 4DZTA 2C97A 2UUCB 2FW0A 1KS9A 2ZI9A 3CZMA 4TTPA 3Q3HA 1FFGA 2PSFA 4IXTA 2AW5A 1JDJA 4PHCA 4RV9A 1GZSA 1MC4A 1SVSA 1HFEL 3UTCA 4LEIA 4UVHA 1IMJA 3KAPA 5GJBA 1QUEA 5H02A 2CWDA 1ADGA 1FRNA 1IPFA 1X7XA 2JLAA 3D8RA 3MMPA 5CMLA 3RS3A 1T91A 1ZQ9A 3EVFA 2O3JA 1E6UA 4WL0A 2FGJA 4M89A 1CUUA 3KTFA 1QS0A 2HQ1A 4YROA 5ES4B 4IO0A 1ORWA 1WOYA 2JIQA 3IQGX 3QBEA 4H17A 4XVRA 4Y6OA 2DJIA 5BQXA 4EGJA 1UANA 4XSVA 2B4QA 1GQRA 1WBJB 1Z0ZA 2NW6A 4RTOA 1WXHA 5C1IA 4RSHA 1ODJA 3IPAA 4HKTA 2DM6A 2HLPA 2UVQA 3CRQA 4ZRDA 1G8JA 3WLIA 3DZ8A 3C1UA 4QNRA 4GDMA 1E7RA 1DP4A 1DRVA 4KBFA 4F3YA 3PNVA 1NE7A 1SUCA 2ZWPA 3TMKA 3OD1A 1SR8A 4D0LB 2GPTA 3W78A 5IUNC 2EF1A 2J3DA 3JQ9A 3RABA 4KTTE 4QJIA 4AMYA 1YO6A 5B4TA 1VA4A 4RTJA 3FNFA 2IIPA 5JD4A 2Z2ZA 3JVDA 4DXHA 1CJTC 1EA7A 4E2YA 3L2OB 1XZAA 1Z4NA 3IV7A 1A9RA 1N0VC 1XO1A 3U7JA 1SURA 3KHTA 4UNNA 1HKHA 3SHOA 3WYBA 2DLCX 2G9ZA 3FOAA 3ZJUA 5DOVA 2I6FA 2Q4TA 2MSCB 1T5HX 3KR0A 4RZ3A 3RW9A 3B6IA 4FC6A 2C5FA 3MS7A 4RYLA 3L7OA 3PUHA 4YFVA 3ZCVA 4BNLA 3TKLA 4OHOA 3EPHA 1FDTA 2AOWA 1G5TA 5EVCA 4CM8B 3G2NA 4G0MA 2PUCA 3C24A 4WY5A 1SQFA 4ZQGA 1BEZA 3K5HA 5GGYA 2WUEA 5DJ5A 1WXEA 1Q7EA 3CZ4A 4MB6A 3UMVA 1GQYA 1OT3A 2VP9A 2M1ZA 5TJHA 5T41A 2XA1A 3INNA 4BP1A 1MAHA 2AOTA 2AOVA 4ZVQA 3L8ZA 4J16A 2BGNA 3B48A 1T5OA 2H1VA 3NBQA 3NHAA 4JBXA 5CD1A 1HLPA 2H0AA 1KWKA 1QZUA 4MVYA 1D4AA 2BGRA 1RYNA 1T1EA 1DFIA 2OAQ1 4RTMA 2J07A 1ZLXA 2ZDQA 1VGVA 3HCDA 4R05A 4R7ZA 3TFWA 5IABA 1F2DA 4MKZA 3VYWA 3EXHC 3JS5A 1LDYA 1W0CA 6ADHA 3K1YA 4M55A 3UOWA 2GBGA 4QLBA 3WYCA 2D2XA 3ZHSA 5LWHA 3K32A 2O1SA 5GINE 1DBIA 1NVBA 2AEEA 4RU1A 1KIFA 1TI7A 4HPJB 1Q44A 4DADA 1U5AA 1UXJA 2QRGA 3M1IA 3N2EA 1K4KA 3VKWA 3BHMA 2BHNA 2R47A 3WSTA 1YS7A 2DT8A 4ZZIA 4ZVPA 3N2GB 5TSDA 2B2NA 2W8ZA 2CXXA 1NF2A 1PFVA 2H7VA 3G9TA 5CX4A 5DYNA 1QV9A 3WYNA 1II8B 1RRKA 2Q1UA 3Q4GA 4MICA 2QUJA 4A6DA 3QE4A 3O8NA 3EARA 1NI4B 1L4HA 2OGTA 2Q50A 1MABB 2C2MA 4O8CA 4PZAA 4K3UA 1JAYA 4RZIA 3KJQA 4BHTA 2P6UA 3G1TA 4FXOA 2D0PB 3INRA 1W46A 1UJBA 3B36A 3MK31 4MP3A 2FQQA 3EG9B 2W2LD 1KO7A 1RHQA 1XF9A 3ED1A 1J9GA 1NWCA 2GZSA 2VJPA 4W99A 1RWMA 3KVNA 5GOTA 3Q3IA 5IJ0A 3AQIA 1RAHA 3CLUD 3L79A 1RWOA 4Q3LA 3ZY5A 1MU0A 2RGUA 3H3FA 2V7GA 3F6RA 1T9GS 1Q0TA 3S5JA 3VBEA 4GPIB 1ZUIA 2ZS8A 4LTNA 3RGWS 2HIGA 2QPLA 3D3EA 2G1AA 5EJ9A 2AMLA 2VNJA 1ADJA 4FGWA 3LUJA 4MLZA 5ALXA 3LPDA 3QF4B 2O2HA 4GG1A 2OHXA 3RRJA 1XZCA 3SOPA 3U62A 3ZIUA 4DQ0A 2IYZA 2Y0BA 1NN5A 4QJ3A 3ADKA 4TS9A 2PJRA 4NEGA 4KO2S 2W90A 5TF0A 4UD2A 1FS6A 2O3SA 4FGZA 1VOTA 3BCUA 4NJEB 4RGYA 4URUR 3NI2A 4JI4B 1OT5A 2C94A 3OJFA 3W5CA 4U0KA 1Z3IX 3H1AA 1EP1B 3AKYA 2L18A 2AKEA 1LSUA 2NZWA 3N53A 2W2KA 3JYNA 4HP8A 3VO2A 4OK6A 1KJNA 2ZYVX 3QWBA 1A72A 2B4AA 2E55A 3CKMA 4PGGA 5SYAA 1L8LA 3REGA 3PZRA 1TK3A 4FQ5A 3EDRA 2XGGA 2VK8A 1K7XB 4ALMA 1OF1A 2AJTA 4P80A 5KTSA 3IPLA 4KVZA 4PLTA 2HFKA 3MJEA 4HAVA 4YO7A 2XCQA 1TCCA 4BO4A 4CQMB 4CKZA 3RWBA 2QEQA 3WGNA 1FDIA 3MOGA 3KT6A 2O8FA 1ZBQA 1QIIA 2N75A 3TQQA 2CXTA 5KDDA 3LBNA 1YSCA 2AFIB 3OUTA 1XJWA 2IZ0A 3ORSA 5L7TA 3BRSA 5A5EA 5JECA 4A23A 1BH2A 2EYUA 2GM5A 1ML4A 1KU0A 1Q5PA 1RBQA 2GHTA 1VJRA 4AF8A 4AZ3A 4Q9KA 1MD9A 1T9AA 4Z4IA 4QM6A 1HYGA 2QIPA 2V7QA 2ZR8A 2DH6A 2ZSBA 4I4TF 2M1XA 3ZV5A 3C3WA 1Z5VA 1VBKA 1C50A 2FSUA 3I8XA 4HQOA 1FNSA 1RHKA 2H08A 1U7WA 3DVQX 2B61A 3AHDA 2TRSB 3PFCA 3DBRA 2O50A 3FY4A 4M1KA 3PXAA 4XDZA 4Z4EA 5JAHA 2IYVA 3GQVA 4DA4A 3PSAA 4LHZA 3AJAA 5F1PA 1KFBB 2QRUA 2XMZA 2GVZC 3WRVA 2F3QA 4FFOA 9ABPA 2QSYA 1VMIA 1E1DA 1NXXA 2I6GA 4INPA 4QD3A 5H70A 3FSEA 1J6UA 3V5NA 3V48A 5K9ZA 4MKXA 5AWFC 3OE7A 2W5UA 4PYKA 1O87A 4EX7A 5JD3A 3IR6A 3NJ4A 2DHEA 4J16C 4XFJA 1RWXA 1V1MA 2QVCA 2ZBUA 4Y2SA 3RAFC 1F14A 2GCOB 2REQA 2XKBA 4GSYA 2XMGA 1KKMA 4TTVA 5H5JA 5I7FA 4YMTA 2O19A 4FGSA 4I1IA 3GMIA 3LIIA 2BGMA 3TOVA 2GPAA 1GGFA 5E7IA 3RUAA 5JAUA 3LIPA 5JZVA 3RSCA 3GN1A 2H1IA 4J75A 3T94A 2FEPA 2QBYA 1PJSA 5L51A 2RGCA 2PL3A 4F21A 1GNLA 2SKDA 1B6TA 3ZQKA 3L0CA 1G41A 3DKIA 1RMTA 2QDKA 3KJEA 5CVDA 2AS0A 3P2EA 1KDRA 5DH9A 2XE8A 4C1BA 5KVAA 4JLUA 4XCQA 4KE6A 3EQ6A 4UDNA 5TVGA 4CIXA 2XYQA 5BSGA 1SZCA 3OP4A 1KA9H 4K86A 4P5EA 3KJNA 5J47A 3PDIA 3FOCA 4DJ5X 1VCIA 3Q8XB 2VCEA 1HE1C 3PFIA 3QKRB 2C07A 3S2ZA 3K0FB 4G1UC 3ZWVA 1IK6A 4LI0A 1P9LA 4ZVMA 4WESB 4DLVA 1VYTA 3OPVA 4OXXA 8MHTA 1UL1X 5IAKA 1SG0A 1ORHA 3EH2A 3PR1A 4PTZA 4F3CA 1LLDA 3E8MA 1P9OA 3GUUA 1G6HA 3PEFA 5KYXA 4BFZA 3P9NA 4JOCA 1CCWA 4IHJF 3HCWA 1B7GO 1AHHA 1GNTA 3KUCA 5CCDA 3TLJA 1US8A 3KE8A 4RHCA 2C8JA 3AEUA 2FZKA 3GK3A 3DFFA 2PBZA 2NUPA 2CVHA 4I5GA 1KBZA 2FN3A 5FD8A 3ZOKA 2PCLA 2WE8A 2WTXA 2IDMA 4G9BA 2PKYX 4KQ9A 3EB9A 3S1LA 1JYEA 2C4HA 5BV8A 1U3DA 1K7EB 4E5SA 4KO8A 3P0RA 2JDIA 4BFLA 2GN4A 3U26A 1UT5A 2XBUA 2DULA 4ARIA 4JOBA 4JVOA 1XMSA 2VTDA 3QVWA 5CIQA 3WXBA 1TEHA 5JATA 3VH4A 2E89A 4PQYA 5KNCH 3EVEA 3L84A 1NVWQ 3O3MB 3OSUA 3BD6A 3KKNA 1CR0A 2F1HA 3CX8A 4HS4A 1KIAA 4RANA 2DFKB 4C88A 5KJCA 4TQGA 1J2EA 1WXFA 4GWGA 1SBTA 2GBPA 4MUGA 2QRJA 1U2SA 4JUIA 3UCXA 1CB0A 3G59A 3W06A 821PA 3RKUA 4DMUB 4Q4HB 1RI1A 2WHPA 1QKKA 5CHEA 5BW4A 1RRVA 4JCCA 5TQJA 4QYIA 5HSGA 1EDZA 4ZYVA 4IFTA 5I7EA 2QX6A 4D3YA 1YZNA 2WKRA 4HQ6A 4DT1B 1KJZA 4HGQA 4GWKA 5FWXB 2HWWA 4JLWA 3N59A 3EFBA 5K3DA 1N3BA 2H6EA 2OZKA 1RE1A 4PHGA 1EVZA 4PZ0A 1JR4A 1ZA2A 3M89A 1WCIA 4AKEA 2VP0A 4BTVA 1PJAA 2C0CA 2WTEA 2XUIA 3PXUA 4HF7A 3ZW8A 3PJRA 4G2NA 1V39A 2XQIA 4EB6A 1CQIA 1ZL2A 3K6SB 1UWKA 4CZ2A 2GCNA 5KU1A 3S81A 1TZKA 2ALJA 2NTYC 4LJ5A 4X65B 1EK2A 4LJKA 2DFNA 1OYWA 1CUSA 1CUIA 1E96A 1EAMA 1UP6A 4R2XA 5CT4A 3WAKA 2O06A 4BV9A 5FUMA 5DRYA 4CKEB 1SKMA 1HNWB 1OBCA 2W6CX 3KSDO 2FR8A 1I9CA 5ALEA 3ZWBA 4BO3A 2M32A 1WIWA 4PX2A 5TS3A 1ISSA 1IG0A 3CVUA 2P90A 3BWBA 3ZE7A 4DR2B 3U17A 3EWAA 1ZX1A 4HQRA 4MJXA 4U9HS 5DHFA 3SQNA 4AZSA 2NVUA 5BUCA 3C3AA 2JH9A 4AO7A 1LFAA 2NNLD 4FOSA 1KEEA 1MAVA 4GGMX 5BUQA 1GSHA 5ALGA 2XB9A 1W5FA 2AXQA 3A1SA 5JCXA 3HCCA 4LTMA 1SVMA 3R7DA 4IUBS 5IAAA 3RRXA 5IT9A 3TLCA 4IWXA 1ANKA 5ECDA 4IHAA 1LLQA 1TKBA 1PR0A 3I8SA 4LYFA 1U2GC 5A5GA 1RRCA 3TBHA 1GITA 2RSLA 5J5AA 1PQWA 4QFDA 1EFPA 2XUKA 1NZDA 2A0YA 2PN1A 3LXXA 3PFFA 2ROQA 4BKRA 4BQQA 2I4LA 2R4TA 3GVXA 4YRLA 3EK2A 5ALHA 3UMSA 3TIVA 4C2AA 2NG1A 1I4TD 2V6IA 3A58B 1D04A 3CNQS 3MJVA 4ICIA 3L7JA 4X7PA 5C46F 1TAUA 3ZI4A 4F9EA 1ZD9A 5AXBA 4ZZ0A 5KJ1A 4NHOA 1QV7A 3PEUA 4RQUA 4HRYA 3THOA 1N36B 3CT4A 3UT0A 5KYKA 4EI7A 2PZMA 5JANA 1GCAA 2IHUA 4HVLA 2HW8A 1ENOA 1N2CA 1ODKA 1U7HA 4WZZA 4XIYA 5AVWA 4EENA 4HDKB 4CN9A 4TVSA 3L1HA 4R9UC 3BWVA 4BNDA 2QSZA 3HWX1 2Z83A 4WN3A 1Y82A 4R1NA 2AXPA 1UAGA 4J0JA 2B20A 2WYHA 4XIIA 1UT8A 4BVGA 3GJ8A 2QTWB 4KN6A 5IPFA 4H4EA 1XU7A 4IILA 1ADFA 2ZKIA 3BYZA 3PBKA 4B3JA 4X1KB 3OOSA 2D4AA 2HNAA 1E2GA 3DFUA 4IIVA 4TMVA 1Y1QA 4Y67A 5CA0A 2RHWA 3NT4A 4YUAA 1NBOA 1HFKA 3BILA 5KDOA 5KHOC 1THTA 1NW5A 1GPBA 1Q0LA 2K5UA 2OD2A 2QOEA 5ALKA 3AMVA 5DN9A 3TGWA 3FPKA 2VHEA 3VR1A 5EKTA 5K8TA 4C0QC 2PUFA 1A69A 5DPMA 2APJA 1M8JA 2P1DA 4Q3DA 2Q8QA 1EJ2A 1HLGA 3KWLA 5B1HA 1SA0A 4DY6A 2KE5A 2XMRA 3CZCA 4BZWA 5LU9A 4GIBA 4M1QA 4M1EA 4WUTA 5KSPA 2R65A 3UVEA 1SGWA 2X6TA 4EY8A 4RTSA 3IAFA 4FMCF 3N39C 5EESA 4BB0A 2OEPA 1JFTA 2C54A 2EF0A 1UQRA 1PFGA 4O2RA 2ZDGA 3QEMB 3WWYA 3FYUB 3HU5A 3U39A 2XXAA 2ZJ7A 4L28A 2VNHA 3QSGA 3PC3A 2X0FA 5ALMA 1HT1E 3IAS1 1KI4A 2AB0A 2PEYA 2WFMA 1BJKA 4OSEA 3KXLA 5COAA 1TK9A 3RSGA 3D0RA 3LLUA 4M1SA 2QORA 3VDRA 3KKLA 3MWFA 3FVRA 2OENG 3EDYA 2L82A 3L6UA 3RARA 3RVJA 5JHGB 1J0CA 2CLDX 4UBMA 3SJBA 3KKPA 1HRKA 1L5WA 2DUWA 3R3YA 3ZG6A 4YJGB 3DZJA 2ZBVA 1M7HA 5INTA 4EAAA 2F9FA 4F1WA 3FPAA 2A1TS 1ZK1A 1IHYA 2QIOA 4G36A 4NBSA 2WSYB 4IQ0A 5HF6A 5C9ZA 4GEGA 3AVQA 1TF5A 4YRKA 3HKDB 4XR4A 1QG0A 1WKBA 3OX3A 2OCGA 5EMLA 3KEQA 5K3EA 2PVSA 3EXHA 1R7RA 4M1TA 3OJ0A 4P36A 4U6NA 1LBHA 5E7QA 4CU5A 2Y68A 3M49A 4JMPA 4LTDA 2ODNA 4H35A 1E1QA 1BTOA 2POQX 3LK7A 3R41A 2QMEA 2H2DA 4OBXA 5IWAB 2ZUDA 3MW8A 1PW7A 2Z3WA 2ZBGA 2VZ0A 2ZVPX 4ER3A 4ARBA 2BL4A 3M3HA 3QBTA 4WZBE 1EUDB 3E82A 4D9HA 2FDXA 4RJLA 1C0PA 1L4NA 2H9AA 1R4NA 2EGHA 4WDRA 3ZJYA 1Y7LA 2XRFA 4H27A 1Z5ZA 1Z82A 3VTKA 5I8PA 5K3AA 1QQAA 3KR9A 4PZLA 2XUJA 2EIXA 2JBAB 3ABIA 4W5WA 2JLBA 4MKHA 1FY2A 2CFRA 2L0XA 4ITVA 1ULBA 4DCNA 4H0CA 4N6OA 3K92A 4ECEA 2C31A 4DCSA 3TQHA 3Q7IA 4YMVA 4C6TB 3KQKA 1V8PA 2F4VB 5AT1A 1NL3A 2IX3A 3NAMA 1LS6A 2DBQA 2X13A 4FHGA 3UK0A 3SCZA 3UUWA 2X22A 3TBFA 2HRZA 5EE3A 4F12A 3OX1A 2ECQA 2J3IA 1IXSB 2I78A 2OO7A 3BK2A 5SZIA 2I6XA 2OZVA 3LGAA 4AJ1A 3NQ41 2FOXA 1E0JA 4AKTA 4OI4A 2QVBA 3CCCA 1I51A 4NZYA 3OZAA 3QEOA 4IOJA 1MTOA 1NNLA 3UJBA 1P5RA 2UYQA 3BRQA 1UF9A 4MVJP 3RQIA 2GZRA 1U2TA 1GV0A 2OBMA 4NYIR 2DQYA 3SYKA 2BGWA 2V1UA 1L9XA 1S1MA 2O8CB 1FRQA 3GARA 2J9FB 2BH2A 3IESA 2X9LA 3D8BA 1MQAA 5GMOA 1CR6A 3MGKA 1DU4A 4U5QA 4GHWA 4LKRA 5CYFA 4ZFNA 1F9EA 5C7YA 4DUYB 1IM8A 3DR3A 2XDQA 4AULA 4OYLA 1TUEA 2Z9CA 3GAZA 1V25A 4I9NA 4J49A 4BNTA 2GAAA 4OFBA 4Z4HA 3GGJA 1DXQA 3WGQA 1E2LA 1T4DA 4ZVKA 4V0KA 2WSMA 2WJYA 2IWRA 2DX7A 1INLA 2QD4A 1LX6A 4AZWA 2J5KA 1YT5A 4HAIA 1ZN9A 3RNLA 4JP3A 1U7TA 4LOHA 1TMYA 3GD5A 1QIDA 4M1ZA 1WF3A 1PO7A 2AEJA 3UAVA 3WWCA 3QYAA 3A1NA 4QQ8A 5U9CA 3IVRA 2G6BA 3VHQA 4I1OA 2QTAA 3Q3CA 2VPXA 2YJGA 1TK2A 4MQBA 3IB6A 4A2CA 2C4TA 2GD6A 2NUTA 4UBNA 3PGVA 3RTGA 1L2TA 1PSDA 3H86A 4UEKA 1PQUA 1ZUD1 5CVTA 1RM5A 3ETEA 3ILHA 1M2JA 1K68A 4Q1AA 1R0WA 5IDXA 5KO2A 6ABPA 1YCHA 1F06A 1TM2A 3L04A 3N75A 2A92A 4FYJA 2D0IA 1MOPA 4OXRA 4BMVA 3ZVNA 3IBGA 2XCUA 4D9JA 2CDBA 2OQ2A 3FA2A 4FOOA 2TECE 1CC1S 3DL4A 2B9EA 1ZWKA 3C8DA 4PR3A 5FADA 2P9YA 3V7YA 1ZOLA 3DC7A 2FXIA 3EOZA 4OU5A 2VT6A 4FE4A 2VHWA 3T3DA 4F9GA 4IHJB 4S1TA 1N8KA 2XEXA 4JVSB 5EUQB 2GEUA 1QZXA 3OUZA 4FE7A 3SKYA 1LPNA 1TLLA 2WIFA 1G1AA 1DT5A 2G5PA 5KNBD 5FI0B 4DIKA 4ASUA 3ZHRA 1Z6AA 1R6XA 3K2QA 2D62A 3RVQA 4YRIA 5BXQC 1JEAA 4KLAA 1CY6A 5BNIA 4EA9A 3GF4A 4PF1A 1G6OA 4RGQA 3JQQA 2VT3A 1IVSA 1RTTA 1E1NA 5HNKA 3M6VA 3SF8A 4E5KA 2JI8A 1E0DA 4P33A 4BJ1A 4ZCMA 4RF5A 2QDXA 1XDUA 4Y2VA 4EW3A 5IC5A 2VRNA 3LYAA 5AM5A 1E9DA 4EY5A 1SOUA 2EDCA 2OTCA 5C3MA 4L2IA 3ASUA 5JJ5A 4TGLA 1C0EA 3HCAA 4V3CA 4ZWNA 4PLWA 4LE1A 2OAGA 1WMEA 2Z3ZA 4POAA 1E9VA 4WK6A 1KC3A 2BP7B 4E1AA 2EJTA 1Q17A 1EWTA 3QYJA 4AKGA 4KPUB 4FE3A 3SFZA 2BZGA 4NOLA 5KQGA 3N0VA 1P1BA 2H52A 4F56A 3K8YA 3L1JA 1P4JA 2FUEA 3MFQA 4PPFA 4UHHA 3SS7X 3A6PC 1T6BY 2JJ1A 1N92A 1U9JA 3DBIA 3NJ8A 2QR5A 4KUGA 1JH9A 1ZVQA 1PVOA 2AD5A 4S1NA 4AJ2A 4FU0A 2Q1WA 3VZSA 3WSWA 1U4SA 2QPAA 1UXIA 4EB0A 1E89A 1L7XA 3CUWA 4KE8A 3QU4A 1MEOA 2RBKA 4AD8A 2C29D 2HF8A 5FHRA 2EQ5A 1XG5A 4X62B 3NPAA 2VDWA 1OZHA 4Q0MA 2R5NA 1DT3A 2FI1A 2J31A 2YHAA 3B2QA 4L4UA 4M0UA 1JWAB 3I2FA 3PC8A 4X3CA 4OJNA 5A5FA 1SQGA 2PSSA 1DTWB 3F73A 1UEXC 1HEUA 4POOA 1CJKC 2FSPA 4HATA 3Q8MA 1PG2A 4LF7B 5JSZA 1IN6A 1GVNB 1JFVA 2QD3A 5BYBA 1XTTA 3UKOA 2FP3A 5F7XA 5I7VA 4K03A 2P4EA 5E7JA 4O4JF 2XW6A 1JQEA 2HA4A 2QLBA 4D26A 4DRYA 3S27A 4KYTA 4U1RA 4ZEMA 5I7UA 3ZXSA 4BMZA 3IIKA 4IR7A 5CVJA 4ENTA 1E2HA 5AVKA 4CM1A 2DRIA 4U9IS 4FBGA 4D9KA 2X58A 4GZ6A 4S12A 4LDRA 4KIGA 1CXZA 3H18A 3UJ3X 5C1DA 4OI2A 2B3TA 5F5LA 4FZ5A 4TLAA 2J9ZB 3FE2A 4EI9A 3AEYA 3OLCX 4AJJA 1C1YA 4XCXA 4PPGA 5KYWA 6Q21A 4AMBA 3GLIA 4K9LA 2JATA 3UHOA 1K4MA 4KWTA 1AK2A 1U0BB 2NV0A 5KVSA 3TG2A 4M7WA 2QI9C 4FOPA 3T1YB 3IT0A 1VYVA 2VJAA 3AQ4A 4N01A 4KIFA 2RHOA 1FK8A 1U0EA 1XVVA 3NU1A 5F3RA 5TC4A 4KITB 5AKEA 3TOCA 2C77A 3LUBA 4BEVA 1HY3A 3LT5A 2FSIA 4C07A 4EK9A 1A5BB 4PX9A 4X71A 2P91A 2Y67A 4CEHA 5A1TA 2VLIA 1N0IA 2GD0A 2W71A 4ZVNA 4FSDA 3J7AC 5J2UA 3LKVA 4BVJA 2ZRBA 3OJXA 3JVVA 2IYNA 3I6YA 2G08A 3OM9A 5T57A 1C3VA 4WCVA 2Q07A 5F21A 4DV5B 5AP9A 2Q2OA 4AS2A 2OHJA 2R44A 3VYSB 4BLRA 3FD8A 3MPUA 4IX9A 3DVSX 5KAMA 3HCFA 3U3OA 3WGYA 4Z5XA 3DZBA 2XKJE 1JKJA 3RAGA 3K71B 2NX2A 3KB6A 1H3EA 4O2BF 4F4DA 1G5PA 1BW9A 2OV2A 4JBWA 1O57A 5DP2A 5FHQA 3VX3A 2VJMA 4MS1B 3DP9A 3WMEA 1DQNA 5CPBA 2HCBA 1K08A 3EEIA 4ZYZA 1E18A 3C8HA 3NW9A 4F8EA 2W98A 3M2PA 1H2YA 4BXOB 2HSGA 5CVCA 1VXOA 1JT2A 1NXSA 1FFDA 3IE0A 3ELBA 2ZAOA 4XYEA 1HDGO 3RYFA 1RZ3A 3VU8A 2VNAA 1SKUA 1YUBA 2R1UA 4Y30A 3TH5A 1OH8A 1PZNA 2VWPA 4BPRA 4DARA 5KYXB 2VP3A 1FRZA 1HEYA 2YJTD 4ARVA 2P69A 3SR3A 4UBLA 5D87A 3UWPA 3A2MA 4PICA 2PX3A 1XZDA 4NCIA 2O0MA 3A9SA 4OKNA 1UZMA 1P1RA 3PL1A 4LYHA 2QRMA 4KRYA 4ZPJA 2WABA 3HKBB 4KAFA 5EI5A 3WKBA 4D9CA 4JNCA 3I01M 5D1HA 1D1SA 1OXKB 1E5VA 2IU0A 4DQKA 3C6XA 3GVHA 4DR6B 3LO8A 2ZYAA 2P9GA 1CERA 3GELA 3HY3A 2P4SA 2GA9<