2DSTA

Crystal structure analysis of tt1977
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
122
Chain Sequence
RRAGYLHLYGLNLVFDRVGKGPPVLLVAEEASRWPEALPEGYAFYLLDLPGYGRTEGPRMAPEELAHFVAGFAVMMNLGAPWVLLRGLGLALGPHLEALGLRALPAEGVEVAEVLSSKLSYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA1544
publication title Structure of the minimized alpha/beta-hydrolase fold protein from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 32
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12270 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2dstA00
2DSTA
chains in the Genus database with same CATH superfamily
3AR5A 3CKYA 2BTEA 2FXVA 3L3BA 2I78A 3KVOA 4MVJD 3I83A 3MTGA 4S35A 1B74A 2BH9A 1T9CA 1OFHA 3PJDA 2IOQA 1NNSA 3M6LA 4MLDA 5JDIA 1ISMA 1E60A 2HN9A 3BORA 4FTWA 3VMFA 4ETWA 4F1JA 2BFWA 1PLJA 1ODKA 3KDSE 4JU8A 2WG1A 2J08A 2Q3JA 3ZK9A 3D8BA 4CF5A 1VBNA 3RSOA 4A6PA 1VMKA 2BD0A 3B6ZA 1ZL2A 1IZ0A 2A9FA 1F6BA 4L9SA 2QQFA 3ONVA 3ZU2A 4ALJA 4NESA 2VF2A 1U0JA 3GCGA 3U5TA 1FUEA 2WIDA 3S3TA 3WIEA 3ROFA 2IH2A 3ADPA 4Z6KA 4GLOA 1YKGA 3WLJA 2QG9A 1F0KA 1G291 2SKCA 3PNYA 4OVKA 1CUYA 1H69A 3F3SA 3HKCB 5C46F 5F7XA 3C70A 1EFDN 1FFDA 1WZCA 1YQDA 3OU7A 4R83A 3TLMA 5LU8A 4YEDA 2WSLA 4OM8A 5U9CA 1NBAA 1QGUA 1QCZA 7YASA 1V1RB 4UOQA 5IDXA 3UN1A 2GCIA 1R8YA 4YJ2A 1HYQA 2A0UA 1H4QA 3NDIA 1JIVA 1PG2A 3NLLA 2NZJA 1P74A 4CCWA 1CZKA 1QF9A 1R6VA 1LU9A 3DCJA 3F46A 1SCAA 2ZXFA 3NBKA 1KMNA 2FJ0A 1H2RS 2OAEA 4DARA 1CUJA 3KJFA 1T4DA 1OZFA 3QE0A 4RKEA 4EHLA 5K0EA 2NM0A 4NNJA 4DGSA 1MXHA 1T0BA 3GRPA 1M0WA 1SIUA 1T8PA 5K6AA 1KJNA 4OLFA 1JSZA 3P45A 4TWJA 4F1KA 3O4VA 2AYYA 3BILA 3ORHA 3WMXA 5JNRA 1ZIYA 1A7KA 2C98A 4HDQB 3VAAA 3SKXA 1PAUA 1UM9A 2KX7A 5DYWA 1T36B 1TEVA 3F6YA 4O2AB 3LIPA 4YLYA 5K8JB 2V7VA 3ER9A 3R5JA 5EQDA 4DJDC 1W0JA 2P0AA 5H9WA 1QV9A 1STOA 1K68A 1OR8A 3BXFA 4UAGA 2HMTA 5HOQA 3A9VA 3CLVA 4YRIA 1MKYA 5B57C 1RQNA 4H0CA 2ZJ6A 2FPXA 2IIVA 2QI9F 2CLMB 1ONPA 2VRCA 3S55A 3VOBA 3BSSA 2O8BB 1IM8A 1QBKC 4NF2A 3ZU6A 2UXBB 4PQYA 3QFSA 2QRNA 2B1RA 3EGWA 4GZ6A 3UT5A 2X3YA 1Y3DE 3CZPA 2W9XA 4QOHA 2Q3MA 3LCVB 1PEAA 3KWMA 3S8MA 1GKLA 4OHOA 5C51B 1V0JA 2VQDA 2R6GA 4X91A 4QE3A 2I6FA 1KH1A 1XPRA 2D8AA 1KBOA 1FU8A 2OWDA 3WG9A 4B40A 4O4LF 3HP1A 3RQIA 3HN6A 3FYTA 1GOTA 4O02B 1QOQB 2GK7A 5HILA 5CDFA 5BY2A 5ISMA 2Z9BA 3JD1A 4KMSA 1X8KA 3CF4G 1U4NA 3BERA 4FYVA 4ER0A 3ISJA 1J9ZA 1W5FA 3WDKA 2V4ZA 4G4GA 2JFHA 1IDOA 2YASA 3EB9A 5DCYA 5AW5A 1QU3A 1FYFA 3MMSA 5C8YA 3T3HA 1Z4QA 1OBHA 4F2PA 4PVCA 3KKLA 1VRVA 1K75A 4UTVA 4AJLA 4RMJA 3BXEA 1J8YF 1JG2A 1Z2OX 2YKGA 5TPZD 3DXYA 4FWTA 4HS9A 2GUGA 4LBWA 1JFFA 3K9GA 3E22B 3PCTA 4NPHA 1P5HA 3I37X 4OQZA 4ZQEA 1MPTA 2V96A 2NU9A 2PX5A 5ICMA 4BMVA 1RI2A 1WAMA 4JSYA 4RKWA 1QUEA 2IBMA 2X13A 3W4KA 4C6HA 4QUKA 4Y2VA 1JBQA 4E33A 5HQTA 3V9AA 5JJBA 3EC7A 4F6CA 1JSCA 5A3SA 1MB4A 2OK7A 1LBTA 4OXKA 2R4UA 2Y6UA 4CLOB 4KHZA 1MENA 4IUYA 4MA5A 4TUYF 4Y1GA 5JH7F 4MA0A 4OOEA 2IX3A 4PNHA 3FN4A 5GADl 5IM4F 2P27A 3LX8A 1HNXB 2WHYA 3TIVA 3DF7A 3RO7A 3WTCA 1XDUA 3CZRA 2CB0A 3NOQA 3AJDA 3B1WA 5F7JA 3LVRE 3HYLA 2E48A 3UMJA 4YMSA 5JV5A 5JAZA 4FXPA 3ZK7A 3T3IA 2FZCA 2FPKA 2OKGA 3QLUA 4YK7A 2ID4A 3CV3A 1VI5A 1LZKA 4XDYA 4DLZA 5A4JA 4ZO7A 4JR0A 4CMGA 3DVQX 1WXWA 3ETJA 2VR1A 4I9UA 2PT9A 3O8OA 5K1ZA 2WRZA 4U7DA 1PGPA 2RMKA 3OIDA 3EEYA 4KR6A 2FSGA 4B5LA 4G6ZA 1FCJA 2XUDA 3HU3A 1TJ5A 1YQTA 2C5BA 4Y6SA 2JB9A 3AVUA 1GQOA 3O0DA 2JCVA 1A8SA 1SNYA 2SCUA 4B8ZA 1EVJA 2PA0A 1KO8A 5DLEA 5EJIA 1YOBA 4C4PA 4MRNA 2FK7A 4PZUA 1Y6RA 3DM9B 1K66A 3FDXA 3BCHA 3TZLA 1RRKA 2C9BA 3U7EB 3OY7A 3WNCA 4NZ9A 3WK9A 2XOEA 1VLJA 5K0GA 2PYDA 1E1QD 3IQFA 4I55F 4AUMA 3PFNA 1NMEA 3DLHA 1G8MA 4LNHA 2G5CA 1NV8A 4QVKA 2QTAA 2O7QA 6PFKA 5BMVB 4L8GA 5FTKA 1X13A 3OO1A 3N3AC 4D7AA 5KNBA 3L9WA 2XB9A 3CO5A 2P4EA 2ATVA 2XA9A 1EB8A 4NBVA 3G9XA 3U3XA 4KHPB 1WXEA 2AE1A 4W9MC 1ZY2A 1H42A 1NY5A 2ECPA 2IXFA 2HSDA 2Q6VA 1XT6A 3DAOA 3EXHB 4JKYA 3VYUB 4E4TA 5ALXA 1HEIA 3U09A 2GYWA 2Z1NA 1ZOLA 4EFDA 1I13A 1RHRA 1W48A 4KKXB 2CB9A 1JDSA 1OKKD 2I2BA 4WEOA 3F6RA 2C2HA 4B4DA 3DNFA 7ABPA 1XA0A 1CNFA 3CKMA 3LBNA 3MW8A 5AKLA 3EE6A 3R5HA 1RCUA 2JBAA 2HYDA 2WOJA 3NYWA 4KBYA 3RPEA 4E6EA 4EB3A 4OK6A 3WFIA 1REQB 5C4GB 1I94B 1BRTA 1JEDA 2E4VA 3ELYA 3PXEA 3NMUF 1QHIA 2IOFK 2FRVA 3KVYA 3TLKA 1QBGA 4E5PA 2D5IA 2A7QA 2AQ8A 2AW3A 2G76A 4MUYA 4YPOA 4IUBS 1VKOA 1WB9A 2AMFA 5JBQA 4BLWA 2BLNA 1EXWA 3I23A 4OB7A 5CVEA 3PTLA 3CNLA 4ZO9A 2XQFA 3BM5A 5FT9A 4QJIA 3T5BA 3KKZA 2I3AA 4MLPA 1E2UA 3DZDA 2Z4TA 3O92A 1G1MA 3L0YA 4MVJP 4NMWA 3SJBA 3B5EA 5AVTA 1NNUA 3O93A 2J87A 4I1VA 2AHOA 1HLPA 3PDUA 2JZCA 4LCBA 5A4IS 4V1CI 3BWYA 1E79D 2CXQA 3T5CA 1PSZA 4UNPA 1PR9A 1LQ2A 4INOA 2PNFA 2O9JA 1EB9A 3C0KA 4NZMA 4RPIA 3W06A 1DSSG 4TZ6A 2R1VA 1NMYA 1XZAA 2WTEA 3FYHA 3ITDA 3N58A 4J0IA 3VU3A 1PT7A 3R3WA 4N39A 3QE9Y 1TMOA 4BMSA 1T5SA 3TE7A 4RHFA 3SHTA 3VR2A 4B3HA 2FMHA 3OZBA 3OUUA 4AZ3B 2XNJA 1SZPA 1U0GA 2Y1KA 2WINI 3VGJA 2XCIA 1C14A 3WL4A 3NW9A 1S1MA 2IZ7A 4EARA 2WFLB 1DIHA 3PNLA 4H16A 4MQEB 1RLMA 1SZCA 1DKOA 1U6IA 4HAVA 2XHZA 2FRXA 3AF0A 1KJWA 2PTHA 2A0WA 1VP9A 3NRBA 5LP1A 3KJNA 4XYLA 4K03A 4O4IF 3I5MA 5EXSA 3LGAA 4MJ3A 4TTJA 2C3OA 1Z5UA 3N6VA 4E5DA 1VGQA 1Q0QA 5CFRA 3GD5A 3V8RA 1ORDA 1DJQA 4AW9A 4CN9A 1QH9A 2RKOA 5KSYA 2XDAA 4KK3A 3INTA 821PA 4TYNA 4Z4IA 3WDSA 2Z43A 3M81A 5HGJA 1BGWA 4OHCA 4LJ7A 4PGAA 2QTRA 1QCDA 2OKCA 3L1KA 2R6CA 3LYUA 2XAAA 4YIKA 4FGWA 4NEQA 4LK2A 2CLHB 3QBEA 1Q7RA 1M6WA 1CR0A 2Q5EA 3AZQA 4J7AA 1NP7A 1ABEA 3K70C 1D2GA 1E20A 1XZGA 2VJMA 4FEAA 2FSIA 2QUBA 2ZSKA 5AJZA 1VMEA 5DBGA 4DLAA 1ORHA 2FW9A 3PWZA 3ZWMA 4B4UA 4ENQA 2QXUA 4MGIR 1E1LA 2Q3FA 3NAZA 1YXMA 2F4NA 3EWSA 1IY1A 4I2NA 2ATXA 1NQWA 2DUNA 4GICA 5IAGA 4CDGA 3EF1A 1DS6A 3LUPA 5E3IA 5HIJA 1KQNA 3K15A 2X9QA 4GWLA 3ITNA 4K6OA 3T3NA 3TZHA 1ZJ4A 1LTKA 1O03A 2ZCUA 3A70A 2PGOA 2AUTA 3GV0A 5IEBA 1IRIA 3EIEA 3DNPA 4C21A 2G0NA 5ALRA 3ILYA 2VAWA 1PX0A 3TUZC 1X1SA 2CJPA 2IDZA 1I3LA 2TECE 4RTRA 3BK7A 1BMDA 4N1AA 1Z15A 1YD7A 2IP4A 1KR2A 2O1XA 2QVGA 4WLOA 1ZN8A 5GJWC 2QAIA 4IEFB 2PUTA 4G4SO 1E7RA 4U7TB 1C8VB 2A3RA 3LOPA 4H3VA 4ODIA 4WECA 5C31A 5CB8A 2XB8A 3IKVA 3F67A 4DT1B 5A0TA 1ZGGA 3R9XB 1AGPA 4XD7A 4B3MB 3PNVA 3WE7A 3OCWA 4HF7A 5KWVA 4XPIB 4BC0A 3BAZA 2E1RA 5M5BA 4E09A 1E61A 3COWA 4RD4A 1JE1A 2JI9A 4YBRA 2ZUWA 4NQZA 2FUNB 2FZGA 4U7PB 4W5WA 1XVIA 4Y1RA 1C81A 3QWHA 4OPMA 2GFIA 3LA6A 2VJQA 4L3WA 5KTNA 2VP0A 2JATA 2H4XA 3NTQA 1GSOA 1N34B 3B1JA 1ECBA 5A03A 1NR1A 1P33A 3O7MA 5B7QA 1G0NA 1E2JA 4X61A 3HI6A 1Z8NA 4CCYA 3NXSA 5FUVA 5K0LA 3W5IA 3G79A 4LZAA 3PC8C 2J5KA 2Q4DA 1EXNA 1CVIA 1A50B 3QLVC 1G60A 4GPBA 2FEPA 2FKNA 4ZCRA 1YB1A 4BLTA 1KMCA 1KS2A 1IH8A 1JHMA 1D6SA 3F2IA 3K9WA 4JELA 2Z8YM 4LRTB 4CLEA 3CNNA 8GPBA 2F3UA 4X93A 1RWWA 3GL9A 4BHTA 2ZB2A 3IT3A 1E99A 1M2EA 3ZXUB 4M1QA 4ARSA 1FP6A 5JECA 1JA9A 3AF6A 2WHPB 3D59A 3N70A 1TUGA 1W4BA 2O3RA 4AN1A 3C5EA 5FH9A 3K0SA 4P2BA 1M34A 1Z7EA 1MX3A 3QKIA 3C98A 2AKAB 3VHRA 2O0JA 1D1TA 2ZIVB 4RHTA 5KYYA 1TNDA 2AD1A 2CVHA 5IVHA 4N0EA 1LDYA 3C3PA 4MTCA 1IG3A 1EESA 3BE4A 2G1AA 1QRTA 4BMCA 4DUPA 1IHPA 1N2SA 3QKRB 4XB2A 3PA8A 3OSUA 2ZJOA 2H29A 1C3LA 3CZ9A 1ZH2A 3JVIA 4PG6A 1HYBA 2DXIA 3MLEA 4FS8A 1EGAA 5ALKA 5CX4A 2VA8A 4M7PA 1AM4D 5I3CA 4ICIA 3AIOA 3FYUA 5EJ4A 5D2CA 3MJTA 2NQ2C 3O82A 2FUEA 3DTYA 4DAOA 3CCBA 2VBGA 2JLRA 2WJJA 4PLVA 5FV7A 2RG1A 1HK7A 1U81A 3LC1O 4OKNA 4B76A 4RTMA 5AIBA 4ZGWA 3S28A 2DR2A 1F2UA 2WZBA 1LX6A 4GEKA 4WA8A 4Y6OA 3U62A 2EHDA 4NL4H 4M88A 2IHJA 1Y8RB 3HHPA 3Q98A 2YUIA 4AJHA 2H1OA 5THKA 3K5PA 2B1GA 3KZNA 1VDMA 2Q46A 1V1JA 2ZT5A 1GZ5A 4RQBA 3RVDA 5IUJC 3O8DA 3OFND 3GA5A 4BEJA 4D3SA 4Y6PA 1RNLA 4X97A 3A25A 4GC5A 4H08A 3OA2A 3VR0A 2XKJE 3KZKA 1U0EA 3ECAA 3V4SA 3VC2A 3SBDA 3LW8A 1K3UB 3FWKA 2LCFA 2F4VB 4TLEA 4HNAB 3CLUC 3SICE 4I5GA 3T38A 2O14A 1EINA 1NBMD 4L02A 3OFSA 3U4DA 3TCNA 1UDCA 3JU3A 3HV0A 4HWRA 3R5TA 4HJRA 1JKFA 4R69A 1SG9A 3MBOA 1KMMA 4GFDA 4KQEA 1P7CA 1T91A 3PC6A 1I7PA 3DMFA 4U8HA 2ZUFA 2P6NA 3ES9A 3KOXA 5HJ5A 1EFPB 1NTRA 4Q0MA 2P4SA 3SFVA 5IAOA 4G0XA 2EF0A 4DLXA 1DUIA 3BQMB 1JB1A 5CFPA 1MCZA 4M2LA 2I1LA 3LCUA 3VJRA 3HH8A 2HLHA 1SK9A 5D5QA 3GG2A 1CEEA 1RJEA 3BSFA 1JG6A 3G0OA 4JL5A 4BDTA 2XH8A 1ZUWA 1WLSA 2H4YA 4DIUA 3L1IA 2EFCB 3DVRX 4RBNA 4BPBA 3HFGA 5EC8A 5TSDA 2D1TA 2QX6A 2YFYA 4N0PA 2FPRA 3JQ8A 5I7UA 2NYVA 3LK7A 1EGMB 5FWDA 1WM1A 2CLSA 5DM4A 3UJPA 3LVFO 2W2LA 3X44A 1FXWA 2AMYA 4NYIR 2C9DA 3R76A 4BU0A 4DL9A 4EYSA 1XQVA 4HUQB 5KNBH 1M7BA 3FUTA 2JIQA 4GOJA 3ESAA 5CXUA 3EVEA 2L0XA 1XU7A 1L7QA 1F6DA 2FG5A 2N3ZA 5E4TA 3GT0A 3U6BA 3DE1X 4WLFA 2UUBB 4JT4A 1VJ5A 5JROA 1EXVA 1Z2NX 2PN1A 1L7VC 3MFYA 3SSNA 3S81A 1Y89A 2CE7A 4ALMA 4MKIA 2E9SA 2YICA 3H5RA 1EHYA 1TL7C 2NWQA 2XEXA 4Y8VA 2F8MA 5KAMA 2CVOA 1AZLA 4AL4A 1E9CA 2AOVA 3MTJA 4WDQA 5UKDA 3KKNA 1AZSC 4FD3A 2PJDA 4GWGA 3PEWA 1KRXA 3ZE0B 1TO6A 4J6EA 3HNPA 2E4UA 3KOUA 1T10A 3C3WA 1AKEA 1YR1A 4GXQA 2Z6UA 4JB3A 4F92B 1O0CA 3UW3A 4WCFC 3OMWA 1Z0KA 4IZOA 2IQ5A 2RHHA 3TJRA 1D09A 3GJYA 3UOAB 5AW0A 2GM9A 2VYVD 3RI3A 4FI3C 1B6RA 5DLQC 5EQFA 2R1TA 1OB2A 2QXYA 4W5RA 3NWOA 5CIQA 4XIYA 4BTEA 4A8JA 1BN6A 4I5DA 1T2EA 1BRMA 3FD8A 1XKQA 3AMVA 2JLWA 3EXG1 2OO5A 1T6NA 3L6BA 3SP1A 1QYXA 2I65A 3TLCA 5A4DA 1OTHA 3LGXA 1X1QA 3OC0A 5HX7A 1AG9A 3UWOA 1Y4ZA 1KI8A 1D4FA 2R5FA 1XDSA 2C0CA 3HUTA 3QBVA 4N5IX 3X1ZA 4BE7B 4PNEA 4DNFA 2ZJ3A 3A6HA 1H6DA 1TYDE 4RJTA 5K0BA 1ZMOA 4PYNA 1PGOA 4DBLC 3EX7C 4JJZA 3ZLJA 2EU8A 1JR3D 2C4VA 2ONZA 1FZTA 1SUIA 1XG5A 4WDRA 3DYVA 4PAQA 4RGBA 5AJXA 3ZWBA 1LJUA 2V0CA 2H92A 2JIBA 2B98A 2QZZA 3V32A 4ZQGA 2VG8A 4XVHA 3T3PB 1K63A 1L5GB 5JANA 3LD9A 1XCBA 4XD2A 3BZUA 1N7IA 1I14A 3H4TA 4N5NA 4BYGA 5BUSA 2P2LA 4FHCA 4KOAA 1KBQA 5REQB 4K9MA 4JP8A 3OQJA 2XE4A 3LMKA 4EECA 2LNDA 2P9HA 3VFDA 4AY6A 3RAPR 2O8EB 4GP7A 1I0IA 1A9XB 2I29A 3QY0A 4FCWA 4HNRA 2JJMA 4BL5A 3BIFA 2NUTA 3SMVA 3OQ1A 3V7YA 1R10A 2BEWA 3EXAA 2QPAA 1OWLA 3DLCA 6REQA 2IIPA 1U3GA 5FTLA 2BP7B 1NRJB 1PYOA 3UYKA 2KBFA 3FPBA 1KO4A 3ZDRA 4BWFB 3E7XA 4LYFA 4YP0A 4PN7A 1G5PA 4A6XA 1VIYA 4HL6A 3O73A 1UBFA 4B3IA 2QRUA 2GPBA 4Y2SA 2W6JA 4JUBA 1W2HA 4U2EA 1OLXB 1QCCA 3QSYA 3G0HA 2JGAA 5G2OA 1YGYA 1XP5A 1ZINA 1CR2A 3B3QA 3AEQB 4R1MA 2ORYA 4BMPB 3ODGA 4L5BA 4HMOA 1WA5A 4PO9A 4BX8A 1CUHA 4AT1A 1I10A 3IC5A 3HO1A 1WXQA 2IY8A 1K7EB 2PUJA 5HS6A 2YZ7A 4Y6LA 2Q4OA 1Y6QA 1BG6A 3BB3A 4QSHA 1QOPB 4MLCA 3ASZA 1CUZA 2D2XA 3QWFA 5L4NA 1NASA 5LXTB 1EK5A 1XMVA 1G8FA 2Y66A 2V1UA 1EIWA 2Q5FA 4B48A 2HHJA 1MTOA 5B3AA 3CUKA 1KMIY 4BY9E 4GKBA 4JLAA 4RETA 2RONA 2AEMA 1GNVA 1T2CA 1XXLA 3B1XA 4I0WB 4AICA 3R8XA 2BSAA 1B3RA 4FKBA 4NMMA 1JG3A 5B2EA 5HRAA 1X1AA 1LY1A 1QYVA 4Q1AA 3WYFA 4FINA 2A94A 2EJWA 3C1UA 3OQBA 5DNCA 3THXB 3CH4B 4DV4B 3KTAA 3UVEA 1FTGA 2JA2A 2DAPA 2X40A 3IXMA 5IP5A 3Q9UA 3SQMA 3L7IA 5CEFA 3RODA 5LYJB 1DIOB 3KQKA 4JLOA 1W0KA 5JCPA 1N9GB 1JEYA 3L7MA 1BU5A 1UBSB 2J5BA 5FBVB 1TOAA 4GO1A 2C5AA 2I7XA 2PO5A 3ECCA 4TXHA 4AP9A 3IE1A 1F8YA 1XZ8A 3EY4A 1AIPA 4G8BA 4TS3A 4MYDA 2ZS8A 5EMHA 5FFNA 1FQKA 4MSUA 3PQEA 3SJAA 1TJNA 1GU7A 5AUNB 1V8DA 1ZRNA 1I5EA 1UOQA 2YNMA 3NGLA 4X85A 1SULA 1NL3A 1OX4A 2PM8A 2R1UA 4TYWA 1EX7A 1FDOA 2OCIA 1SB9A 3HCNA 1YS4A 2EZ4A 2I55A 5HE8A 1Q0HA 4ENSA 4ZO6A 5EKUA 1Z45A 2XMPA 1CC1S 4UQLA 5L9AA 1TVMA 2F3PA 3OLWA 2QZJA 1I3MA 4WL0A 4BQRA 5DHSA 1UZAA 4BBJA 4EY7A 2GERA 2YWGA 2ZSJA 3TOZA 6AT1A 1FFEA 1N2IA 3A6FA 1P8JA 5FP0A 3HXQA 1FTYA 4IVQA 1XWFA 3ABZA 3VH1A 3MJ4A 1TJYA 1XALA 1CR6A 2ZOSA 4FYHA 2HB6A 3R7WB 1CYDA 1RMQA 3Q15C 2XMZA 3F8WA 3DZHA 4AUEA 1PK7A 2KLHA 2HPZA 4EEXA 1OFUA 5JYEA 1M75A 4ZDKA 4OHKA 2C9YA 4XGIA 2R48A 3KZ1E 3RJ5A 2Z5FA 1DBRA 5C7OO 2GN4A 2NU8A 2YHUA 4KDCA 5LQUA 2JG3A 2VT2A 4Q18A 3LZDA 2GXQA 5I7AA 1M1NA 1BXRA 4AI6A 3U4MA 3VHXA 3DHEA 5ITZB 3TD9A 3D6JA 5KSPA 4X8HA 4JP1A 1AB5A 1OTYA 4EG5A 1KMHA 3NT2A 1PD0A 3NHJA 3NKVA 4O2BA 1PJQA 4PSAA 2OXFA 3HN7A 2WVJA 3ILHA 3VNBA 1ZM4A 3OFJA 2V7TA 2WAAA 5EWMA 1E9AA 5C5DA 2IYPA 2QZ9A 5B64A 4R2XA 2VZ9A 2FY8A 4DJFC 4BNUA 5FXMA 4PLYA 2P2NA 1W73A 3CZ4A 3FMIA 3G9TA 4PXYA 4YLEA 1MAWA 5AKGA 3TINA 1EM6A 3FOBA 3I9V1 1VXRA 2CNKA 1R37A 4FDTA 4MKGA 1O54A 1M67A 4ASUA 2VNKA 2IYUA 5AXDA 3FCSB 5EIFA 4D25A 3IV7A 3LY5A 1XVLA 1CJUC 4QJ4A 2QAGB 2E18A 4KN6A 2VNAA 3Q40A 2CXXA 1J2TA 3KYJB 2I3BA 4HTFB 3HZRA 4NMHA 3OJWA 4PNZA 3TBFA 5A02A 5KKNB 3SC2B 3SZMA 4C6TA 5K3SA 1XXHA 4XJXA 3ZW8A 2O2CA 4CNQA 4CKEA 1M72A 2VP5A 4JX8A 1B3BA 2RBGA 1YCHA 2OCKA 4S24A 5G4KB 2P79A 4N54A 1Z4KA 4I4IA 2HJVA 3WQHA 4DMFA 2Q1SA 4M1ZA 4DR1B 1H85A 2H59A 2ZRFA 3AEKA 5E3HA 2WQ6A 3NTRA 1YI0A 5EZYB 1J8FA 2GTPA 1PWXA 2EWWA 1J1ZA 4KODA 5HF5A 2WF9A 4E15A 3QI2A 2QS9A 1M1YE 2PS9A 1ND6A 5BN5A 4EJ2A 1H5QA 4L5JA 3C3XA 4RF4A 3KL2A 3PUKA 4UEKA 4X6LA 1MIHA 4Q7QA 4B0PA 3VU1A 3NC1C 2FF7A 5DLYA 4AB1A 5CX1A 3CT4A 1Q1EA 5H4GA 1ZD5A 2ZFUA 1XV5A 2CMHA 3V8VA 1CERA 3L7DA 3FTQA 5MF6A 3K9HA 4J7UA 4TV8F 2I9PA 2NG1A 3H5WA 1LQUA 3SFTA 2VXYA 3KJIA 5FKJA 2FEXA 4GI3A 1XVTA 5I8ZA 2X3FA 2IU0A 2WF7A 3SZRA 5FA8A 4BVFA 4B5KA 1IU9A 5E9JA 3STHA 5FPPA 3QMVA 3U61B 1J0EA 3KOMA 4IZHA 3QVOA 2EBWA 4E5VA 3IMFA 1IYZA 1TVCA 4IV5A 2WKRA 5IDYA 2QUKA 2R5WA 3V42A 1K88A 2X14A 4MULA 4P7GA 4CF4A 1IXRC 1D1QA 3DEYX 1H0RA 3HNOA 4DCVA 4JBWA 1JMKC 4EAQA 2Q1TA 1Y6JA 2EXXA 2IHYA 2J0VA 2P41A 2QMEA 3EMBA 1E4YA 2DBQA 2OFXA 1J39A 4P22A 2BFDA 3HDQA 2BF7A 1NURA 2C54A 3C7DB 4H3SA 4QOEA 3DW3X 2RE8A 3ZVKA 2J8ZA 1SD5A 3NOVA 2J9GA 2ZB3A 5B2FA 4MR8B 3HYCA 4AY3A 3AUAA 1IULA 4PTYA 5A0FA 5TPWA 2MINB 3BWMA 4HSGA 2X5JO 1L4HA 3A1WA 1P4RA 2HDNB 4DCSA 4C5AA 2AXQA 1ZZGA 4B45A 2ACKA 3DD5A 3BSWA 1IUNA 3I1JA 2I66A 3K35A 3BWDD 4IVPA 1E6WA 4UAUA 1NULA 2II6A 3OQIA 3W5UA 3ZDQA 1IUPA 3H1TA 4A2PA 3ZY4A 1JAYA 2WNIA 2NU6A 1RJDA 3DLTA 4AP5A 1TLTA 2A9KA 2JCXA 2SICE 4GX0A 4M3NA 4BO3A 1O4WA 1G20A 1I0ZA 1NFFA 1CJBA 3L8GA 3MTDA 2MYNA 3OPXA 1N5IA 1L7RA 1Q77A 1TRHA 2HA3A 3CA8A 4ZO8A 5JNVA 2FFQA 3MD9A 3UW1A 2JHFA 4WASA 1L5VA 2M2IA 4F0JA 3H2ZA 2WDZA 3OM8A 3ENZA 1VE5A 3OO0A 1T2DA 1JZSA 4ID9A 3ACCA 4DWWA 4Z4CA 3WA7A 1TQHA 4CFSA 3NAGA 3PTZA 2AN4A 4J0HA 3B9RA 1E2GA 3SYTA 3EZ2A 4OU4A 2B2XA 1SPXA 3TLEA 3I3OA 1RP1A 1NT2A 3H1AA 2C2OA 3UFXB 4KO8A 3EFHA 3IAEA 4ZI7B 1Z83A 3IAS6 1PJCA 4IKEA 5KQRA 1JP7A 3HDJA 3MWGA 3RNLA 1P9RA 2UZ1B 2HPHA 2YV2A 4WD3A 4BRZA 4I4TF 4DPKA 4IXMA 1AGYA 1AX9A 2DGDA 4YRRA 2HJGA 4XR9A 1GZUA 2HR1A 1MF7A 1Z62A 2J3QA 5BRJA 3BE6A 3LT0A 3E8SA 3RG8A 4I1UA 3D1VA 4P3YA 2XD9A 4MQ4A 2MCFA 3BD6A 4LQLA 1PWYE 3GJ0A 4BB5A 1TCAA 4MB2A 2LCIA 3DBOB 2KI5A 2Q7OE 5BNTA 2HJHA 4KPFC 3IODA 2FEMA 3MUNA 4QSMA 2QUIA 3CNHA 2HIHA 3BXGA 4G5HA 1ENYA 4JIGA 3LFUA 3RYCA 4OOFA 3AXSA 1E5DA 4OEHA 1NAHA 1WP9A 3LRPA 4JB2A 1G18A 2ZCVA 4H6PA 4DA0A 3NBQA 2ORWA 4R2JA 2ZKLA 2ENUA 5DW0A 5B1EA 5FBZA 3OD5A 3WKAA 2DTEA 4ZEOA 3DS8A 2BMFA 4OFWA 1FMFA 1V11B 6GPBA 4FGKA 1F8FA 5IBPA 1SXJD 5F9FA 2V4UA 4DNOA 3TQIA 3OZTA 4YMVA 3SIWA 3FLMA 3GQBA 5T67A 1JBEA 5AI6A 3QM1A 1EA5A 1A5AB 5LLDA 4ZQFA 3D7MA 1ZCAA 2I8AA 4L78A 4J0KA 1QIIA 1E2IA 4UHEA 5BNWA 4I5IA 4OXRA 3F9IA 3ROPA 1EUZA 1SXJB 1YCDA 4QUGA 4MCAA 1U0TA 3BB4A 4Q4HA 1DPFA 1NM5C 2GILA 4K05A 1OQAA 4D8UA 4ARIA 2GOYA 1DZIA 1Q3HA 1MJGM 1Y63A 3L5OA 1GZDA 1OXTA 1TE2A 1JHYA 2COKA 3TW8A 1PJZA 2XYQA 1IJBA 1CY0A 1HLFA 1ZIOA 1QK4A 3HUUA 2I2FA 2Z5VA 4KXLA 3REFA 3BWBA 1NSYA 1MEJA 4LYYA 2J9ZB 1AN0A 5CVUA 3SQNA 4MI9A 3WLHA 4INJA 3OZUA 3B20A 4KGZA 1RBZA 3OE1A 5CT9A 4ECEA 1KZ6A 1X7WB 4DS3A 3PDJA 3WKBA 2PMFA 3VKHA 4DUYB 1U28C 3G1UA 3HHEA 3EGDB 4WFJA 1QRUA 4YCSA 4NFLA 3HP4A 1KGDA 2GZSA 4BECA 4ZTUB 4Q7EA 3E35A 2EVWX 1FDTA 1HUQA 2C78A 1RQGA 1QQBA 5H7XA 1C30A 3EXFB 5KHOC 5TQJA 3DE6X 2QEQA 3R7LA 3HA7A 2YXEA 1KSJA 2YZ2A 4Q1VA 4X1KA 3T12A 3GZNA 2AFVA 3MNFA 1XEWY 3OF3A 2OLJA 3RVNA 1T4BA 1D6NA 1F8XA 1GGVA 4WXEA 4FOTA 2XDQA 2NNWB 5IJZA 1HFJA 1EBUA 1VL1A 1N3IA 4J2TA 3DCIA 3UG6A 5DKFA 1LEHA 1IEVA 4F3YA 2IYSA 3REQB 621PA 2CVFA 3C3MA 2K5UA 2H2AA 1TZJA 4ZPXA 5JNSA 1QNLA 5DTMA 3PHHA 1E2QA 4HUTA 4NH4A 2YWFA 4G07A 1U7XA 3A6JA 3LQ2A 1S7CA 3IQGX 4HEJA 4BO9A 1FPMA 2FPMA 2PX4A 3EQ8A 4MWGA 3RSSA 3RASA 5H9VA 1QAOA 5DCUA 4S0XA 3MS7A 4HATA 1X7ZA 4JYBA 5M29A 1R0XA 2PLWA 4KW7A 3GA0A 2B2CA 3GG9A 4IFEA 4P4UA 4QPJC 2C2ZA 2Y3IA 4RV9A 3AOGA 1FRNA 3HWRA 1Y33E 1I32A 1YFJA 4GOMD 3OPYA 3AR4A 1OU0A 4HH4A 4TS4A 3AEUB 4LTMA 1NLFA 2XA1A 7MDHA 3UWDA 5HW0A 1XROA 4P7KA 4ENPA 3EG5A 1MABA 1YQGA 4TKVB 5H68A 3OM9A 4FQ8A 4IF6A 1EGQA 1N0IA 2H4WA 3ORQA 3OVMA 4CKCA 3LYHA 1P1FA 1WKVA 4PPQA 2AE2A 3DULA 4RFSB 5B30A 2C7VA 1PWHA 1YV9A 1AGXA 4WK6A 3KLBA 2PNJA 4LNAA 4C76A 3V3KA 3THWA 1C9NA 2PGIA 1I2DA 2B7LA 2ETVA 3ORRA 3WMRA 1QKIA 2LE0A 5D8DA 2OV3A 4KXYA 2G06A 2I34A 4PGMA 4EG3A 2UUAB 4K3VA 5HFJA 3CSUA 5JZ9A 4F7WA 4BO8A 2WQZA 5JJCA 3ZVNA 1BA3A 5AKIA 2ICAA 3AILA 3WKEA 4XDGA 4EYKA 4G9BA 5B3LA 4M1TA 4KFSA 1E3QA 2X76A 4OD0A 5CDTA 1RFLA 1ENZA 1YTLA 1Q83A 2OZEA 4RY2A 3WLQA 4BV2A 3IHWA 2GKSA 1KOFA 4REMA 3JTEA 4RW0A 3UK2A 1NBWB 1GXSA 5IBRA 4X7RA 3WV4A 3F98A 1YNSA 2AI2A 1S2OA 2WKWA 2WM9B 2YL2A 1BNCA 2QW8A 3TVDA 3S5JA 2Y2VA 4BGVA 5DEOA 3P71T 4R9VA 1UL1X 4PSCA 3ZDCA 3RIXA 2BRUC 3QVKA 3MIZA 3J7AC 4AS3A 2IOFA 2Z6AA 3CG4A 5BWMA 4FNAA 2XV1A 4E1VA 1E1CA 2RGXA 3PXUA 4YT5A 1FTSA 2A4MA 2HNBA 2QRVA 2VTVA 5G4LA 4D3FA 1B8OA 2WMNB 4J4TA 5KVQA 5MFPA 4KE8A 1L7XA 5EJMA 4Y2QA 4DCOA 1GVNB 1V45E 3IGFA 1CZRA 3EDRA 4M0KA 4UULA 4NWIA 5KSZA 4NU8X 4HYQA 2CXRA 1JIJA 4N49A 4X3OA 1ZDMA 2X0KA 2BFFA 4MCJA 5TEVA 4HDRA 3B1KA 3K2IA 5EFOA 3A9CA 4A2QA 2VWGA 4NIMA 2WPNA 3ESXA 2AJLI 4ZJUA 1ZMBA 2WWIA 3VR4A 3KAQA 1WU8A 1AKVA 3OKPA 3QTTA 4EVQA 1KZYC 3GFTA 4RQAA 2WD8A 4TKMA 5H4HA 4IIVA 3O0TA 3WMWA 1UC8A 3ABQB 4K6HA 5T4HA 3RS4A 3TTWA 1YVDA 3C4QA 4P86A 1HNWB 3V7FA 3O2SB 3AHHA 4LY0A 1OROA 1XA3A 2OEPA 1W4LA 2X4LA 2XB4A 1ISGA 3DZFA 3QVGA 4J3JA 2H52A 4PPYA 3DC2A 5JARA 3RRZA 2XXAB 1E2BA 2VATA 1H9BA 5LU9A 2ODBA 2ZQ5A 3GPCA 4CLHA 1U2ZA 3PC8A 1K86A 2AA3A 4UVDA 4DXAA 3A0RB 1Z2PX 1KAGA 3QLVA 3RIHA 1QLHA 2JIZD 2K4MA 3MJFA 5AM1A 4B3JA 1X1DA 3RC8A 2Q4BA 4FHFA 1ZESA 2CCKA 3TK1A 5DM70 1II8A 1ZVKA 2VNSA 2BKUA 5A7HA 3RREA 3UMFA 1KU6A 2RHRA 3SS9X 2JFUA 2O6HA 2HU7A 4D9NA 5IG2A 3U5ZB 4DKJA 1DADA 1FLAA 3BUSA 3OHMA 4Q19A 2O7VA 1J25A 2IH5A 3PKZA 4ZHQF 3FROA 3SJZA 3DVAB 1N4DA 4BIIA 3MBIA 4R40A 3ZHQA 1QZTA 5DSXA 5KPDA 1RWOA 3KV3O 4YDSA 3M0EA 4HLUC 1EWRA 1ZNWA 4AWXA 2AFIB 4N47A 1JA0A 1M2NA 1N6RA 2EV9A 3OCUA 1VLZA 2Z83A 3WWEA 2X0JA 5GIPE 3ON5A 4FIZA 1Y1PA 3KALA 1ECFA 4QEZA 3V4OA 4EGSA 2ZB8A 3W8FA 2AG0A 4LV5B 4PZDA 4XQ9A 2ZI7A 2D59A 2I6GA 1F1JA 1KI7A 2PO7A 4KI0A 5D51S 2HIMA 2MSCB 2X8AA 3ADKA 1Q0LA 4HVLA 3R44A 5CLLA 1VDZA 1M2GA 2IA5A 3WWPA 2R4QA 2VQFB 1XGKA 2J0EA 4WZAE 4FFNA 1D2CA 2QJOA 3H99A 4DLUA 3DDNA 3F1LA 4PX9A 1L7EA 2Y1CA 1OBCA 2GCOA 2PT6A 4X45A 2V74B 4GOKA 2J85A 1P4JA 5F52A 3H5TA 1Q5PA 5AJTA 2HAEA 5FPTA 1GTG1 4NJOA 5EE1A 1E64A 3IO5A 3EAFA 1HSZA 3FLAA 1R3DA 3PFGA 4E31A 4C7OA 2ZSAA 3A26A 1X8LA 4G37A 4GG1A 3EJ6A 3VZRA 3TLGA 4C2UA 2XD4A 5GZ6A 2O05A 3FKSD 4V02A 4KXQA 3D8TA 4GSKA 1JLLA 4HGQA 4JJ4A 1QQ5A 3RUCA 3EDMA 3PG5A 5BP7A 2XW6A 1Z8FA 1K4KA 1FJHA 3ZU3A 5KVSA 1SUCA 1C3OA 5AUQA 5KWEA 4K9OA 4Z4QA 4QFMA 1LBQA 1WVIA 2V03A 3X2FA 2W6CX 3N5KA 1EX1A 1IOZA 1JHDA 1FYXA 3R6LA 5A4AA 4IO1A 5B55A 1Z5NA 2GKOA 4EG6A 4QBTA 4EYQA 3K92A 5HIIA 3MUEA 2Y1DA 4LSWA 4U0KA 3W6UA 3FFWA 3QQ5A 3EIWA 4MR9A 4QDJA 2LCQA 1W1WA 2PWBA 3HR8A 3EY9A 3MJDA 4C4AA 2WW8A 4ZD6A 3D3WA 1DCMA 3ST7A 4UM9D 1SKMA 4A26A 4YJGA 4IIJA 3B85A 2OV4A 2IYYA 5E1MA 2IWHA 3A4NA 3TQRA 1M7HA 3OTQA 4D41A 2CUTA 5DWVA 5CA1B 1JIQA 1IXYA 1QH8A 3P1JA 4MRAA 1HURA 2QGFA 3OA0A 4DRXB 4NE7A 1TU3A 4UM9B 5JHGB 3RUIA 1PBTA 2DFPA 4DR2B 1BX3A 3F74A 5DRTA 4NONA 3NTOA 5E4JA 4D80A 5KYWB 1UZMA 1PR6A 1AU9A 2X58A 3CG0A 1AMNA 1JT9A 3E6AA 2PEZA 3QUTA 1T8WA 4YPFA 5FD8A 2QT0A 5AW6A 4J1QA 5E3JA 3ZE1B 1JW9B 4DLRA 3FB4A 4OB8A 4QTUB 1NXQA 7REQA 5K8UA 2O48X 3BWEA 3OEEA 4EX7A 4Y0AA 2P6UA 1E5VA 1A2BA 3IV6A 5SZKB 3DVSX 4QOIA 5CGZA 3TYXA 4ZZIA 1SEPA 3WLMA 2WYVA 4UQPA 3GLFE 4GQAA 2J6BA 3FTCA 3O3MB 5JQGB 3KYCA 3RV4A 3HVUA 4N41A 1W34A 2VZEA 3BDVA 2ADOA 4IFTA 4P0PB 1GR1A 3K0HA 4P54A 3MT0A 3W0LB 1J07A 2VPXA 3QK7A 4HGOA 3RK4A 2A8YA 2P2YA 3JAWB 4E11A 1ZK0A 1TK9A 1Y82A 4F45A 1RSZA 5HQ3A 1E8DA 5K7SA 2DU8A 3CN7A 2RBKA 5K0JA 1Z63A 2EX4A 3FI0A 1J6UA 5M34A 3KB1A 3S7TA 3NCTA 2VSNA 5AW2A 4R2MA 1EFVA 3B1VA 4RIHA 4DQ0A 2XXJA 3A3YA 1UJNA 3MJVA 4WCFA 4M9CA 2HSEA 2JAXA 3OT1B 4M54A 3ZH2A 4ESEA 4JEUA 1EUDA 2HF8A 1CJSA 2FI1A 2IYFA 1R0WA 1DV2A 4OYLA 2IS2A 4YUXA 1EZZA 1NBIA 3T1NA 4L5YA 3WNBA 3AB7A 5A71A 4RVHA 4BNFA 5CDFE 2GARA 3PUJA 1E7WA 5LSAA 5D3MB 4IDAA 3PDIA 1OSNA 1IEQA 1YBFA 1NDQA 3NM5A 2FVXA 4L1KA 1KPGA 1V5FA 3F47A 2REBA 4R8KA 2V7UA 2A84A 2PD3A 2GAOA 4K28A 4CIYA 3KRTA 1JBKA 3IMGA 4ZYXA 1JVSA 2GPAA 4KQXA 4W9NC 1BCSA 4BC1A 3DHYA 4RM3A 4IEEA 1TI7A 4KH1A 2VJBA 4S1VA 5LOVB 1ORRA 4D8VA 2GH1A 1WW8A 2HLNA 3TIIA 5LZ7A 1PUIA 3JSAA 4LVNA 5F2OA 5B1HA 3WMEA 5IK2D 5BN3B 2G1PA 3ZU4A 2R6DA 3CNOA 3T3GA 1AQJA 1Y9EA 2PZGA 1OAAA 4IV8A 4RC9A 3UY4A 3BB1A 2E49A 2H3HA 2O8NA 5TF0A 1N32B 3PEYA 2OWEA 5D86A 4PAMA 4A5OA 1HT2E 5I7HA 1KI3A 5E38A 5JCJA 3K1ZA 2D1RA 4EF6A 4B35A 1HTWA 3ANYB 3CSDA 3NGXA 5A3VA 4E14A 4JYAB 4TLLB 2B5OA 4RVFA 4YQZA 1OGIA 4XB1A 3UGTA 2XIQA 4Y1FA 5HUJA 3NCHA 4Z9FA 3ND6A 4EY5A 4EABA 2IBTA 4BB9A 3PITA 4YB8A 4FDVA 5HIMA 5EGNA 5G53C 4LWZA 1VG1A 4E08A 2QL9A 3BIOA 3AKZA 1E2LA 4D5EA 2NUAB 3V2UA 2I7VA 2JKYA 3PEEA 4JI6B 3M9WA 3T9CA 4XFKA 5L45A 1POWA 1ZVQA 3BXPA 3FHCB 3PR3A 521PA 1ZOSA 3BZWA 3KT6A 4RIGA 4EA6A 3GHYA 4BRWA 2YV3A 1U6JA 4QJ5A 4YXWA 3I5XA 2A9RA 3OE5A 2YZNA 4IRXA 2NT3A 3S2GA 1E9VA 1OA1A 3QVJA 1SR8A 3WV5A 3D4BA 4CMHA 4RS3A 1U0BB 3ND7A 1I6KA 1FYWA 4WGGA 4WLVA 2ZE8A 1RM5A 1FFAA 4IIUA 2OVBA 3W7AA 4D44A 4IHKA 1AUOA 3EOZA 1UODA 3OSZA 3QPCA 3DO6A 1D5CA 4ETNA 1J1IA 4DDUA 3L8HA 3LX6A 4UATA 1Z2AA 1L6IA 1TVKB 3LUJA 5I8PA 2V3CC 2FW8A 5IF3A 3D8SA 1UPBA 4QG3A 4YJ2F 3L93A 3QUCA 1P3Y1 1QFMA 4R0NA 3QOXA 2IY9A 3KEGA 1XO1A 2O7SA 3MT8A 2FLVA 4CMCA 1QO0D 3OD1A 1R4MA 3IOBA 3NVMB 3LDGA 4W1PA 2DJIA 3GOQA 1VPWA 2J5QA 1W5BA 4IDDA 4LIPD 5GVSA 3OOJA 1Z2DA 4JZYA 2YN2A 2W58A 4D4LA 4IS3A 3KQWA 1YQEA 4ONEA 3X1DA 1C4KA 1A95A 1OBVA 4X95A 4UC0A 4JBGA 5TQ2B 3D7KA 1JNXX 1PNOA 3ZV4A 4ESVA 3D0RA 3BHMA 3KUXA 1D07A 4K9NA 4EFLA 1R66A 4V2IA 1QIKA 1E69A 4U7HA 4A0QA 2H57A 3L6CA 4TV9B 1XKTA 2OENG 4U2FA 4ZWNA 1HZZC 3ROGA 3TO5A 4KE7A 5EJEA 1KWGA 3FVVA 4OHUA 3KTOA 1XWIA 2GK4A 1P2BA 1WDMA 1U3WA 3B1YA 4OHFA 1E59A 1TPZA 2GA9A 3LKDA 4N9WA 1IUOA 4MVJA 4R41A 4C4SA 2HUPA 3IAXA 5CLGA 3PI6A 4O1IA 1Z4OA 2B30A 4HZIA 4YMWA 3UUGA 4MQFB 3M1LA 4CTJA 3EGXB 3D8RA 1K7SN 4E2WA 4UFPA 5F4BA 1V8FA 3IQEA 3MINB 1G4HA 4BP9A 4QTTB 1Y6FA 1USWA 2HIAA 1A4XA 1GPH1 3B60A 4I8IA 1KO1A 3DLAA 3T61A 1H2HA 1FNBA 3QA3E 1OGYA 5AUOB 2FW6A 4AJ2A 1UBLS 2NUPA 2HMVA 2UZ3A 2ZE7A 3SN6A 4KSYA 1RAFA 3F5FA 3PS9A 3GIWA 3K4HA 4G67A 5FO1A 5H80A 2XQKA 4ZHSA 1GT91 1CZOA 2PMEA 2ERXA 5ADVA 3ONDA 3JS5A 1DC8A 3P9KA 4FEEA 2NYAA 4MXDA 4ROTA 4KLRA 4OSEA 1TU0A 1O95C 1S96A 2XA2A 1PQPA 3GEDA 3PZBA 3LU1A 1XRNA 4G5QA 4CUJA 5IASA 5JPDA 2JLUA 2QAGC 2HF2A 4WEQA 3GT4A 3V1KA 1LDGA 3IULA 2GHIA 4GMDA 3JYPA 3P9RA 3SFZA 1XLUA 3VH4A 5JZVA 2XVMA 4IIHA 1BOFA 2J3EA 4OMUA 3ZKWB 4IQ0A 1FYEA 1FFGA 4LKOA 2BFCB 1I9GA 4CIWA 4RLFA 4O2AA 2Z9DA 1P60A 1U8CB 3M4JA 1AS2A 3ONFA 1JHVA 1S3SA 1WPRA 2CC2A 2ZTHA 3NBMA 4LTDA 1TYZA 1M10A 1PZEA 3T99A 1YVRA 2E2WA 3BJMA 4N18A 2RGEA 5C7IO 1M2HA 2GCPA 4HGPA 1WU7A 3A04A 4NVRA 2F9LA 3PEVA 2CUNA 2ZLBA 3QWBA 2XECA 4HGYA 4LE2A 4PAOA 2FP4B 4NU0A 5DOVA 1JX6A 3HLTA 5L3RA 1CEQA 4KP7A 4HWGA 4ZJPA 5BUQA 1C4XA 2GZ2A 3GMTA 5C1PA 1Z4JA 1BROA 2AOXA 4TKUB 5B7NA 5KYGA 2O8BA 4YAEA 2CK3D 2LDXA 4TMKA 1MAVA 3C24A 4ND1A 1YAJA 2QTHA 1BJTA 2ZVDA 3SQDA 1DXHA 2ZW9A 2WAYA 3A37A 3G2HA 4TTVA 1J0BA 3RG2A 1RXWA 2ZWVA 1G8PA 5H3CA 2XNSA 3SX4A 4B3FX 1OB5A 1Q15A 1O7JA 3I6MA 2I71A 2QL5A 3LXRA 4M8KA 5GM1A 1XYVA 4HLNA 1XTPA 5D3ZA 4JEIA 3MUOA 3T1HB 2NTVA 1QGOA 2CHFA 1DBSA 4QWMA 1A8UA 3GO4A 4TWRA 4CXMA 2FDCA 5KSWB 4I50B 3MGBA 3I0ZA 3II6X 3PSAA 3W3ZB 3ZN2A 4HDKB 2HWWA 5EERA 2I76A 1VECA 2PAFA 3W3AH 4YCMA 1ZH4A 4I4CA 3SZ3A 2OR3A 3WL5A 4KLZA 2R25B 4LI0A 3DE4X 3V1TC 4DCNA 3FFTA 1UIRA 3UBMA 2ZSHA 1JG7A 3BE8A 1HE5A 4JYZA 4HB3A 3ZZTA 3DDOA 1C3EA 3ZI4A 1RM4A 3SR3A 3ADCA 1N5MA 3SCZA 4AN4A 4DCCA 3V48A 4QHSA 1WTCA 2X4IA 3GN1A 4FNOA 4MP6A 1AC5A 4UUPA 1BYUA 4EGAA 1DRVA 3CM0A 4MQMA 2FR8C 2RAVA 1UJ6A 1VL8A 4HFMA 5BN4B 1Y6GA 3ZEAA 2HUNA 1CFJA 4JV5B 1R18A 1VCHA 4Z9BA 2C8VA 4DJEC 1NVBA 2CV1A 4X1OA 1SK8A 1WIWA 2R2GA 2QN7A 4FWBA 5TPZA 4C01A 1RRFA 1JLSA 3QKUA 1JIKA 2Z57A 3VNUA 1EJ0A 1Y8QB 2ID7A 3IP3A 4CLOA 1YCFA 3WL7A 1P17A 5I4BA 3WLEA 1TTPB 2AVNA 2EERA 1UXGA 3CH6A 3HFSA 3R7BA 3OX4A 2BJVA 3QQPA 2PMCA 2J4DA 3HM2A 1ZNQO 2GZDA 4O4JA 4UPEA 3ZWPA 2HWKA 3Q9NA 5AO9A 5EZ6B 1OWOA 5IDQA 1H8HD 1YHNA 2H7VA 1LLUA 3PGMA 4LXHA 1D4ZA 4QQKA 3IP1A 3DOHA 3ETDA 3GGCA 2IV2X 4V0MA 1J1UA 1ID8A 2GS9A 3OLQA 5I3ZA 4CI0B 4B7CA 1VKRA 2OZKA 1EXDA 3K0BA 5H82A 1RQLA 4HZUB 3JWJA 3ICWA 4BZPA 1ZK2A 4CIDA 3A6PC 2O8FB 3D3KA 3FGZA 2Y67A 3JYOA 1GTRA 2NP6A 4C2AA 2Q2OA 3SHVA 1W5SA 4V1CB 2A1UA 1I6WA 2A86A 2FWBA 3BTVA 3GVHA 3LRXA 4XCXA 2IE8A 2O6LA 3GYGA 3ENQA 3N8IA 2D00A 2QJFA 5D5HA 1M1XB 2RC6A 5DLPA 1Y5IA 5G41A 2W6ZA 5BYKA 3AU8A 3ZBUA 1QGZA 5P21A 1ODLA 4WLNA 1X19A 3WB2A 4L4UA 2CFOA 3VPHA 2HEGA 2WVHA 1JI0A 1Z88A 1RKXA 2AD5A 5DPMA 1G9TA 4CV2A 3AGQA 4O08A 3LT2A 3C5HA 4B9AA 4BNWA 1OLOA 1QWSA 2C5GA 2FJPA 4MQBA 5HA5A 3VJMA 4ZJZA 4KL8S 1P0FA 5F21A 1NJ6A 2D4AA 3L6OO 1DU4A 1VIMA 2FH5B 3PHBE 3Q7SA 4JSTA 4K0RA 4OM7A 4TSRA 1U3FA 5EIEA 5JAUA 4AP6A 4CKBB 2Q0XA 1DMSA 1V47A 3BD8A 3DFUA 3LHIA 2LR0A 3ZNPA 3ZIAD 2IIQA 3I8XA 4E5SA 1EJBA 3H7IA 3U7FB 4RSRA 1E1QA 1I1QB 1C5KA 1QE0A 3ENNA 3LYAA 1SCDA 3FCAA 4IRUB 1JQEA 4BNVA 2A5DA 4JBLA 3HR4A 2RBEA 1W6UA 5DWQA 3ROEA 2C96A 4NZYA 3OPYI 1BAPA 3DYIA 2LRHA 3R6DA 2OHIA 1WXIA 2QN2A 3EH1A 3MTIA 5KB3A 1LNZA 2YVQA 3AONB 3UWPA 4R9SA 3WGNA 5AKHA 4JI0B 1V41E 1BD4A 4WINA 1DGQA 3ZE7A 5JNUA 1U63A 1REQA 3OH8A 2PUGA 2UVDA 2D5CA 3S2FA 3MWJA 4IIFA 4ZCMA 4MDFA 1LV8A 1V16B 3CUUA 1ZW6A 1U2DC 5FI1B 4PSVA 3WBKA 1L5YA 3LUBA 4WLUA 2OHFA 3HCOA 1HETA 2JAHA 2ZI3A 2EGHA 1ZI6A 1E5QA 3BBLA 4QUIA 5E6RB 1E3TA 4J0EA 4BJ1A 3IEUA 5EVJA 2X2PA 4YP9A 1BD3A 5DTJA 1RLJA 3PD0A 1NM5A 3FZEA 3P0JA 3S2SA 2C2GA 2ZBPA 3HYTA 2I2DA 4JLVA 4QPPA 3WMGA 4A3SA 1RDFA 4EHAA 2B1QA 5IRCD 1M0EA 5EXDA 4Q66C 2AG6A 2MHCA 1WCIB 4Q5IA 1GU0A 1X74A 5DNDA 3V33A 2GBCA 2P9ZA 1WW3A 2AR7A 3C2QA 1S3IA 3OG9A 5EJ9A 4S05A 3AY6A 3GGDA 5C5IA 3CXRA 3P97A 2GPTA 3N8HA 4U5QA 5DASA 5AXBA 3MRSA 3WWYA 4B44A 2VF8A 3NIFB 4MAFA 4RCYA 2C4WA 4DA6A 1B76A 2VHUA 4MW9A 4YRAA 4FU0A 3NHPA 2JEOA 1RYEA 2JI8A 1AQUA 3G13A 4S12A 5IZCC 3AM1A 3OTIA 4JQOA 4BAUA 5K8IA 3O9ZA 3T54A 4X60A 5TMEA 1FP1D 1U28A 2KB0A 1VM6A 4P5DA 3UOGA 4DBVO 2V6MA 1NW7A 3H9QA 4PFQA 1SC6A 1ZG3A 2CXSA 1NXVA 3QXXA 4PZ9A 4RHCA 4P33A 3RK0A 2ACEA 2C5LA 2W0MA 2Z5LA 3B2EA 3L07A 3CZMA 4G5XA 4KX3A 2R11A 4BZXA 2VKTA 1PJ3A 4IIXA 1T1IA 2DCMA 5BVHB 1N2ZA 4MHSA 4F3CA 2JK1A 1JH9A 1EI9A 4RY8A 1Z0ZA 2J7KA 2H31A 5AIAA 4MQEA 4HRVA 2Z6QA 1X39A 4V0KA 3ETEA 1G3QA 5E8JA 3U3OA 4X66B 4IXWA 3ZHVA 2V5AA 4FZRA 2XMQA 1GNQA 3C6YA 2WUVA 3M89A 5A5FA 4LS3A 3ZCRA 1Z38A 1SBHA 2H4HA 2RK4A 2X1HA 3H0EA 1Z0DA 1N1MA 3EEFA 4ZODA 1PQYA 4ZTBA 2QM0A 4GR4A 1EDZA 3IP7A 4Q21A 1VJ1A 2OBMA 2QX4A 1E5XA 1GTMA 3QW2A 3MGCA 4WKOA 1OXSC 2JKZA 4FSDA 3ZI7A 1GTVA 3M2PA 4S1WA 3WVNA 2VTDA 2E82A 3RIGA 3A1TA 4GR9A 1HOTA 4PWYA 2WZQA 4Y0NA 1E3IA 5CVDA 5LQRA 4NCXA 3MAGA 3KR2A 3DE3X 4Q4JB 2D5AA 4LW8A 5JSKA 1YU6A 3UHOA 1CY8A 3IQIX 2OHOA 2EGUA 1KFCB 2UVQA 2W98A 3DEHA 4MVJH 3ZDEA 2NPOA 4EA8A 4F38A 4Q4AB 1PV1A 2CXUA 3IEXA 1QLWA 4CM4B 3V9PA 5BR8B 2VKQA 2HZ7A 1C2YA 4QO7A 4B7AA 5B3KA 1LVGA 1HDZA 3R9WA 1KK0A 4L0DA 4LDAA 4B3XA 1ECGA 2PZJA 5JPIA 2CNWD 4IGEA 2YOFA 4CG3A 3FJYA 1VB3A 2BSXA 1YZGA 3PGKA 4LHVA 3PQ7A 1E1DA 2OCDA 4PLFA 1JU4A 3K0EA 1HEUA 2FAXA 4HXGA 3IJPA 4ISCA 4Y2XA 1RTTA 4I3HA 2EFEB 2I6TA 5LQJA 4OJKA 3UHFA 1DAOA 3FLBA 3CLRC 3D9QX 2FZKA 1H0HA 1H1LA 1T35A 1ZJZA 3MAJA 1KDZA 4YT8A 1G0OA 1ZM7A 2I4MA 2YZMA 2QP4A 4NENA 3BMQA 1UBGA 5F4ZA 4ZRDA 4DT1A 3E7FA 3OCZA 5F77A 3VM6A 1DAKA 3LFHA 3HK2A 3R9XA 3NHWA 1CF9A 4DJ5X 3FFXA 3TQSA 1WZUA 2K2WA 1ZS9A 4QU0A 2P4HX 3TIXB 2IS4A 1JTEA 1FXUA 3SY8A 3TRDA 1T0IA 4B2LA 4F3RA 2GLXA 5TV2A 3A4VA 3E2IA 4EHDA 2I7CA 3PXXA 4DSAA 4L9RA 4U6NA 3H87A 3O9VA 4PVDA 1BXGB 1UOOA 1F17A 4BVJA 1Z5PA 4TSFA 5FUXA 1K06A 3QNMA 5BPFA 4M36A 1X8XA 1DIAA 1J9GA 1KFEB 3PD7A 2HTEA 4QECA 2I6UA 5F1YA 4A2WA 1YS1X 4FJ1A 1YS9A 4C3ZA 2NZXA 2BRUA 3EZ9A 4YECA 1U9CA 1QR2A 4K6CA 5ED0A 4CHTA 5IF9A 2GM4A 4C3OB 2P4QA 3CX3A 1SCUB 4LBYA 1E6UA 1Q1BA 2BE9A 3MCWA 5ER6A 2WTAA 1KEKA 1MFZA 2O3QA 4XJSA 1APBA 1AVTA 1N6OA 1ML4A 1RXYA 1PE0A 2ZJBA 1UC4B 3GCDA 5FQOA 1ZD3A 2PSJA 2ORVA 3RHFA 1Z8DA 2MYPA 4RIEA 3IVRA 1XZHA 2HRCA 3CVYA 4RZXA 4A0HA 2GR9A 1HMPA 4RZHA 4DLPA 5JYDA 3DZBA 1WUHS 5JOQA 2IDKA 1K4YA 4DDHA 1HF3A 1V7QA 5FJJA 5BT8A 1N3BA 1GQRA 3THOA 1HZJA 5FOXA 1CU1A 1M73E 2FFAA 1NDHA 2JCBA 4PF1A 2Y1WA 1YTUA 2VJYA 2RHBA 4H2DA 1DX4A 2WWGA 1J06A 3HBMA 3VV2A 3OP1A 5G3YA 3O74A 4C2BA 4E4RA 3KVVA 4CCAA 4FILA 4GI5A 3K72B 4I2VA 2VTBA 1YRWA 5FUYA 4B3GA 3QKRA 3FHOA 3NUGA 5ALZA 4MQLA 3IA2A 1AA6A 3BMOB 2IEIA 3K09C 1EE2A 1NJ8A 1H6AA 2DCUA 1AGNA 2ZYTX 4GXRA 4Q93A 2PX8A 2YXNA 3GFVA 1G5IA 1Y3AA 3LHFA 4LZPA 5LA6B 2PZMA 4P8RA 3RUHA 1D9XA 3KUUA 4FN4A 4MGHA 3WIBA 1L5HB 3WLOA 3N39C 3JQCA 4RCVA 4EFKA 1IZZA 1U9JA 2DH5A 2UYQA 4RDXA 4LZLA 5E9QA 2GD1O 3ZDBA 2FWNA 1R6TA 4ABTA 2YCBA 4L8FA 4URXR 4CYMA 2BW0A 4ZEMA 1R4NB 1ES9A 1P81A 4M60A 2CYCA 2KMLA 4J03A 1GPJA 1BMTA 2AMJA 2PG3A 3K6SB 3EFEA 3ZJ4A 3LFTA 3VGPA 3FUWA 3ER8A 1JJFA 4MCHA 1FXWF 5U1PA 5KEIA 3RU3A 3HZHA 3QUQA 1L4MA 3JQFC 3FPAA 4H7HA 1Y8RA 4OHXA 3BJEA 3P96A 4S1OA 2YJ3A 2UAGA 4CUKA 4ALIA 1RS0A 1ILWA 2GYYA 3NTVA 4AYXA 2QRJA 3IDAA 1Y8CA 3AJRA 4HLUA 4BNGA 1YACA 4ETIA 4EZIA 4ZIRA 3WAJA 3RRMA 1Z13A 2EQAA 3B6KA 3F90A 3HZOA 2ZS7A 3REOA 1ZR2A 4OHWA 3U37A 3D2CA 1QPGA 4PLCA 5FORA 4B9EA 1ISHA 2ZDQA 3I8OA 3ZEIA 3E7PA 3KXDA 2YH2A 1IOVA 1GSAA 1KL7A 3OFNA 4ID3A 4BAZA 1B14A 4GPAA 1A27A 3IUBA 3TRKA 3A1CA 1LW6E 1JHAA 3AOEC 2D0OB 4K9KA 3CVVA 4QM6A 3M5PA 3AR3A 2A9OA 1GPMA 2GF0A 1L7MA 3GNTA 5AI0A 1B00A 1YRAA 2I3GA 2YJ4A 3HC7A 3HRHA 2VI5A 4G81A 5HMLA 1CV2A 3SBEA 4QAJA 1NBMA 1NMQA 1ISJA 2PT7A 1SEVA 4C5BA 4HCJA 2HQRA 2H7CA 3L84A 4KWEA 5K0SA 1VL6A 3I73A 1NF9A 2GGSA 3LSTA 1PD1A 1K8QA 4GMFA 4P0TA 4QQNA 3NM6B 4RVSA 1S8NA 2B9EA 1I7LA 3HABA 4JITA 3W2FA 1KDPA 2IXTA 2IHBA 1YS6A 3H17A 2QWXA 3KU4A 2J9XB 3MJRA 4H6WA 5EUBA 1E0SA 3FDIA 4XWWA 2WHXA 1P5FA 1NN1A 3V1MA 3AHFA 3CXUA 4WHMA 4TYYA 1JSRA 1HX7A 1LWOA 1JHQA 2PKQP 3UJ9A 1UF9A 4DN6A 1JPUA 5HKKD 4EFNA 3OY2A 1KQFA 3EQ9A 2A14A 3CR3C 1KJIA 2RK3A 4MMYB 3ESDA 3ERCA 4L27A 2IL1A 2WE8A 4QGSA 5J3JA 2PVSA 4C22A 1D2HA 1AZWA 2WNHA 4GBGA 4HUQA 4MS4B 4XR4A 1G7SA 4RENA 4A5SA 4D9CA 3KELA 5BSKA 3RIYA 4WKPA 1G8JA 2JD2A 4GSYA 3H4VA 2ONJA 4D92A 3ZGZA 1L9XA 2V97A 4XXHA 3HL4A 1M74A 1NBEA 4ABYA 3PCXA 3PT5A 4KNWA 2C9ZA 4KBFA 3VQTA 2W2NA 4BBZA 4JY7A 3DA8A 5BV2P 3BFJA 4Y18A 4Z3OA 4WFIA 5C37A 2XWBF 3HXMA 4EEZA 1XZNA 3JY6A 4BFXA 5HKOA 1HM5A 1QH1B 4RYDA 1USVA 4KIWA 4D3XA 4G84A 2QN8A 1WBJB 2MSNA 1IN5A 1NQAO 2ONKA 5CDYA 1RM0A 5JAHA 1KP2A 2GB4A 2GN1A 2JPDA 2RG7A 2YJGA 4JJFA 4C06A 1GL9B 4JR2A 5E9WA 3GDHA 4HPXB 3L7YA 2NXCA 1E66A 2Q2NA 4AS1A 1TECE 3W1WA 2FETA 5A9SB 3HUEA 5JSFA 1IVNA 3PL5A 1A88A 3WISA 3TB6A 1UM9B 1GAEO 4UQOA 5L3QB 3WWOA 2YHIA 1SG6A 3HA5A 1DHRA 4GYKA 1NNI1 4ZVRA 3E1GA 2R85A 3FPKA 3GAMA 4CMIB 4RTPA 1JEQB 2XIJA 4OQPA 4WK0B 3T7IA 1T8SA 1Z74A 2RH5A 4N65A 4ZVKA 1AKWA 3T4PA 2ZE5A 3HUDA 1RRMA 3OPMA 2RGYA 1XTKA 3IO3A 2WU3A 3DJYA 4Z4HA 1RWKA 1SVLA 3PENA 2B25A 3EMVA 1IE3A 2D7CA 4LGMA 4LJ8A 5NLLA 3V1YA 3P0IA 4IFBA 4COKA 2G72A 3P9QA 5IWAB 1B6TA 4UEWA 3AI7A 3DH0A 4FBGA 4PTZA 3TUIC 1ZCJA 5K3DA 2HXGA 3GVXA 5JFGA 1PJTA 3D6VA 4X8MA 1JDUA 4GX1A 4LXUA 1Y4UA 1P18A 4LRWA 5B4TA 3LPMA 4ZQIA 1KVUA 1YRHA 4G65A 2JKVA 1B4DA 2V7PA 2CWWA 2JCSA 1JG1A 4QJBA 4XIFA 4Y2PA 1QFZA 4LMRA 4LWOA 2AX3A 5CB4F 1XPJA 1KSFX 5REQA 1E2PA 3FOAA 1KAQA 4C4TA 1K7FB 3C7KA 4MVJI 4CM6A 3N0XA 4TTIA 3HJRA 1A9XA 3U48A 1CQZA 3CMCO 4YS6A 2IQIA 2QUJA 4TMVA 2PCLA 2QQ5A 4UM7A 3STXA 4A8HA 1QGED 3L0PA 2BP7A 1DBPA 1R0BA 2C20A 3UTDA 4M46A 1P1RA 4W9NA 1UH5A 1SG0A 1EXMA 1KSHA 2RGNC 1WG8A 1KDYA 4UZFA 4HWPA 5C8YB 3U1BA 5H16A 4E3ZA 5JTUA 4OYRA 5L3VA 4KDRA 5KNCH 1OLXA 4RF5A 3QVLA 1KAHA 1PW5A 1B8PA 2X23A 3QEJA 1BE1A 1RACA 3HL0A 3N7AA 4KQMA 5CT6A 3AEQA 3UJHA 3LXMA 3SZOA 1G20E 4H27A 2GCNA 3ROMA 1G6OA 4LE1A 1XNGA 2PMDA 3HB1A 4L4RA 5A3JA 2ZXUA 1JFFB 3NTUA 5EP1A 3UMMA 1GP2A 4GXTA 1XJQA 2QTZA 4KREA 3P4YA 4KIUA 2HBZA 2JH9A 3B9PA 4U0JA 5IVDA 5CB0A 3VOTA 1MD9A 4H0NA 5LXTA 2BHTA 1JMYA 3AF5A 5EJFA 1EP1B 1QFYA 3DFMA 4QNMA 5JISA 2B4TO 3KKKA 1FYVA 5CR9A 4CG1A 4R9NA 5ECDA 1DV1A 4RMIA 2P1DA 2VTKA 1A96A 2BBWA 4IQ8A 1XDBA 2ZBUA 4LSGA 2BI7A 4US0R 5HF6A 5FHQA 2G5PA 3ME5A 3KJQA 2HA7A 5E2AA 4EPXA 2I91A 2I5PO 4YAFA 221PA 4X3CA 4WBNF 2ZIXB 1GL6A 1RZUA 3R4CA 1F0YA 4L4XA 1EPUA 4QYIB 3CVXA 1LLFA 1RBYA 3QOFA 4YHHB 1HYEA 3I9NA 2BHNA 3DMYA 2ZUTA 3GBSA 1GG2A 2HCTA 2BFEA 2GM5A 1U7TA 3PHIA 1ABFA 2AXEA 3OQHA 2D13A 3AW9A 4X71A 4LCEA 3AKDA 3PEFA 4FDAA 2VDNB 4Q37A 1QYRA 4B4OA 5HGXA 3ONNA 5FWNA 1KEZA 4PHTA 4DB2A 3B6IA 3WL6A 4IV0A 1W96A 4OA5A 4TMFA 4EY8A 4LJAA 3CWQA 1XMOB 4K87A 5KYUB 4BJ6A 1YR3A 1INLA 3KPJA 3WP1B 2FSSA 1VHTA 1U8ZA 1OH6A 2P67A 2JI6A 3FTDA 2SCUB 4N5LA 3NV7A 3L4SO 4J0GA 1G2QA 1WF6A 1U8YA 3CUEF 4WN3A 2GJ9A 2I1WA 4XRRA 4ZAFA 2G9UA 4RJLA 3W1EA 3B53X 2E1PA 4JQCA 4D57A 1A4RA 5TS2A 5KNBD 5FADA 1E7YA 1GA4A 3AUJB 3LC0A 2XWSA 1KI1A 1GZ6A 2VAVA 5K3EA 5JVDB 2PKWA 5BSRA 1HT1E 4EY4A 5ICCA 4P3XA 3M83A 4QOSA 1HZZA 4QUBA 3G17A 2H54A 4FXOA 4W4TA 5FYDA 3R7WA 5DI9A 3VC7A 5HK9A 1N36B 3E15A 3MWDB 3SIXA 1MX9A 2OQIA 3G6KA 4PLZA 4XIJA 1GTZA 2PH3A 3DGEC 4UASA 1U1EA 4XA8A 1OX5A 4DPLA 3FCXA 5FEUA 2NLOA 4DQLA 1T2NA 1PUJA 3UAVA 1F20A 1VE6A 2WMOB 3MWEB 4XFDA 4EMBA 1CQWA 2HZBA 2RB5A 5BUCA 1KBZA 2JD0A 1Q3KA 4GQBA 4R54A 3V4VB 5ITZA 3WJ7A 2QUAA 4UBJA 5HRUA 2B61A 3ZCUA 4M9UA 3RH0A 1UDWA 3WO0A 2F17A 2HBYA 3LXXA 2JD1A 2N9UA 1N9ZA 1AHPA 4R7TA 3O1IC 1U0NA 2ZULA 4KVAA 4OMFG 1VBKA 2ZRCA 4ZZ0A 4EGCB 5B36A 3IEPA 1JE0A 5JWOA 4QUAA 3MBKA 1V26A 1OXVA 2PX3A 4EITA 4C2TA 4JUDX 5HCNA 4PO3X 3H9CA 2PZFA 5C1OA 4W5JA 1O95A 4RHUA 3PKIA 1O8BA 3IE0A 4R51A 2QAGA 3CS3A 2PXHA 2Q3DA 5EQTA 1IZ8A 4OHPA 4WXHA 5A2GA 3E3LA 1N1DA 1FNDA 1FP2A 5DTRA 3VYTB 2ACWA 2I3DA 2OHJA 4JLDA 3G82C 1HWYA 2CF6A 3EGCA 3SNKA 4MQ6A 5G4KA 3WLLA 4F9EA 1A76A 2NNLD 1KK3A 2ZM5A 3WJ2A 1PK9A 4IZIA 4F4HA 4GX5A 3ZGNA 5EZYA 3WIDA 1HR0B 3Q5GA 3LDFA 2Y9MB 2WI8A 1AS3A 4F91B 2YMQA 3SZGA 3FBWA 4CIXA 3EZNA 4KV7A 1QTNA 4IDHA 2BONA 2CLDX 2WJPA 2R1VB 2R8RA 4QWWA 5AI9A 3BX1A 4TWZA 4R71A 4Q03A 5DJ5A 3RC9A 1XHLA 4KYIB 1KF0A 4HAZA 4NS1A 4MRMB 2RHTA 2WD7B 4R7GA 5DSTA 3F4BA 5EIBD 1JU9A 1USIA 5TEWA 5JNLA 1IVSA 4P84A 3TZEA 2HK9A 2I3ZA 1GYPA 4RS4A 3NDRA 1O9GA 4N3GA 1W76A 5CD1A 2YWRA 3PUXA 3EHDA 4UDYX 3RGGA 2FYTA 2R9VA 4G1UC 1CBUA 5LP6F 5KTRA 2FZWA 3K9QO 2PKCA 3UO8B 4EA9A 1Y5LA 4LSMA 4NBTA 1E94E 4U4AA 5HUQA 3WAKA 4AAYA 3NDJA 4D8TA 1L5NA 3RVPA 3DCYA 4GUDA 3QTLA 5L3ZA 1Z5ZA 1IBLB 2XCUA 4L3VA 5K4HA 2CDRA 2H5EA 3T0FA 4OLBA 2EJUA 4TMZA 5F2EA 1CRZA 4UHJA 2AMLA 2WUDA 4UREA 3RYHB 5KMGA 1E1NA 1GL3A 4M0PA 5HOEA 1NW9B 1P72A 4JMPA 3DMDA 2IU6A 4OU5A 3UHJA 4KDFA 4EW2A 4WGFA 1TA0A 1V4VA 4K8RB 4XKJA 5K8VA 1WVMA 2Z30A 5JT1A 4MR8A 1ENOA 2WTUA 1P77A 1N2JA 3RARA 2HCFA 2IV3A 1A97A 1T6YA 3KQVA 2D1SA 1ZSVA 3PJEA 5KTTA 2ODTX 3GIDA 3UUWA 1L8LA 2IUEA 3W5SA 3TTVA 3JYNA 4AMZA 2HPVA 3GFOA 1G38A 3PQ3A 2CUKA 4MMXB 2X7HA 4WJLA 1PNQA 2G25A 1YJAA 1LNQA 2OC4A 3X3HA 1VL0A 3LHKA 1MOPA 4IFIA 1VYHA 5JE8A 3LWNA 5KOJB 4I19A 4I5EA 4IWNA 2JGIA 2NXNA 1VB5A 4GKAA 4CMAA 4OHRA 3RABA 2C00A 1X3LA 1Z08A 2JH3A 1Y1KE 2Y93A 4JA2A 4JKIA 4ML3A 3DL0A 4K6KA 1U80A 2BJWA 4IRMA 4EO9A 1EVLA 2CVQA 5CRIA 2PUCA 2VK2A 3H8WA 4II3A 5DI3A 2Y05A 3ZHTA 3JX9A 1XYYA 2B4YA 4GYJA 1AUPA 2P4UA 2ZRPA 4MO2A 1U8XX 4CTMA 4JI2B 4CNBA 2ISCA 4XUDA 4ZI7A 2W2OA 3NBZC 3RVJA 1ELOA 1TM7E 1ZIPA 1PR1A 4CTKA 3P27A 5CJJA 5DXJA 3PIRA 2O2XA 2X2FA 4DV1B 1DMRA 1NRIA 3G2MA 1GZ7A 5LMUB 4M38A 3E4CA 2OGZA 2QG4A 4LSZA 1NV9A 2RHOA 3AF2A 1JYSA 2BDUA 1V95A 1O1YA 4GI1A 2FGJA 1GPBA 1HORA 2IYQA 4Y1RB 1J7JA 3D3EA 3IKMB 3WDMA 4NJMB 3RRYA 2HK7A 2VCEA 4OK3A 1U94A 1T9BA 3OQMA 4EDHA 3SC6A 3FX2A 3NB0A 1MJNA 2GEDA 3GRKA 1P3JA 3C48A 4POAA 4PZPA 1L1FA 4HMQA 2VPYA 1TKRA 2AEEA 1SBIA 3S68A 2JCYA 3TSAA 3JPWA 3PHCA 3QE4A 5TDHA 5G0TA 4N5HX 1QF6A 1LI4A 4P7BA 1RWPA 4K2AA 4UBLA 4W8HA 3RWOA 2NVOA 5AW4A 4NE9A 3EIFA 4AG3A 4WXPA 2IZZA 2YDYA 3N2IA 4G26A 1QM5A 1RQRA 4AMGA 1DAPA 2BJHA 3Q7IA 3GPLA 2VXCA 1WXFA 3T34A 2BI4A 3K2BA 2VPTA 1W85B 3ZJVA 3QFHA 1R8JA 3GJ7A 3CPJB 1BEEA 3ZX4A 4TXNA 5I9SA 1R16A 3M70A 3TQQA 3CISA 3R5XA 1Z2EA 4MUFA 4BO5A 2AXPA 4FFPA 2C8JA 1G7TA 2Q5LA 4W9RA 3NIGB 3GEGA 1C8LA 5LQMA 4OFZA 1AKTA 4BFSA 1S8OA 1FP4A 3DEZA 1QRRA 1TF5A 2RGUA 4RK1A 1M34B 4RHYA 1LV7A 4ZXFA 3MN1A 3RS9A 1YBVA 3UIEA 4EUEA 1USGA 3HU2A 4EW6A 1LC3A 2H00A 1JDBB 2IZ5A 2PRZA 2BGNA 3HB5X 5FI0B 3UHPA 1D2NA 4CIVA 1UK8A 2EZTA 3MC1A 1EZ4A 4A92A 4FMCF 2P9JA 3F0TA 1PL6A 4NOLA 4AMBA 2B0JA 4ITVA 4YCJA 1KY4A 3M82A 3TW4A 3OZRA 1X7WA 2J3MA 1XJWA 1WBBA 4F5ZA 3VKVA 5F9HA 4WTOA 5ALWA 2R8ZA 1RADA 4EY3A 4Y6QA 1LXCA 3TH5A 1YUNA 1U2DA 4PG5A 3LT4A 1DKLA 1M2WA 4JC0A 4FGZA 1N2CB 5ELLA 3VX4A 4DSNA 4PS1A 4XGQA 1R0RE 2GAFA 3KT0A 1IHYA 3AFNA 3EXFA 4DG9A 2Q3EA 5FEMA 5KVAA 3KR0A 4MIOA 2CLIB 4FT4A 1RM3A 3WYGA 4QU8A 1V7ZA 2C2XA 1CRQA 1RKVA 5AJVB 1LFDB 4ZOQI 4HQFA 4JLJA 2B7BA 3OTOB 2KQUA 5AVRA 2BGGA 1IJEA 1K8XB 5TB5A 2YN0A 2ZPTX 1Y5MA 3N6RA 4P34A 4UEOA 4XLLA 5KJCA 3VPGA 2FSPA 3SHOA 1D8AA 4DC0A 1VKZA 2DX7A 4XIIA 3NWPA 3I32A 3CEPB 3VDQA 1GR0A 1ZKDA 2WR8A 3B5IA 1AD2A 3DONA 4JHLA 2CHUA 4W8OA 4ZK6A 1VLHA 4KUGA 3OBIA 1UXIA 1O5OA 5TJ9A 3AY7A 4UD6A 4RNCA 2X0DA 4B71A 3IAFA 3O9MA 1MJFA 2A5FA 4GP6A 4TL8A 3OJEA 3IFSA 5IZCA 4Z99A 3SEAA 4FFMA 1WMSA 1RHUA 1CZLA 2MYUA 2NV6A 1CDDA 2XMDA 4GMGA 4RK4A 4Q4CA 5K03A 3GLIB 1D7AA 2B36A 3U19A 2CGEA 2IKSA 1CUVA 2ZJ4A 2J6IA 1B1AA 3L8MA 1FDWA 5TXGA 1PU2A 4ZYVA 4F72A 4JL6A 4DWVA 2R0QC 2H1HA 1NE2A 4DCUA 4DZZA 1DAGA 3HEBA 2ZUEA 1IM2A 3GBVA 5FUQA 1MFPA 1IN6A 2VQSA 3AEUA 4YQYA 4BDSA 2PZBA 2GPJA 3CONA 5HCIA 3DAGA 1ZMXA 3R0VA 4YC7A 4HGZA 4TKVA 1YKFA 1CIJA 1ODIA 4WLEA 1S7GA 1Z73A 1GAJA 4LZNA 3S0JA 4D9HA 1WCV1 2QD3A 1ZRMA 2V5UA 1P80A 2W2LD 1ZHHA 2XYPA 4U3JA 1GRCA 2F2TA 3LP5A 1X2EA 4FFOA 4RFSA 2CW5A 4FX2A 4M7WA 4RYLA 1P44A 2WU8A 4BE9A 3SQLA 5A2QA 4TXLA 1TZ2A 4M9SA 1PRYA 3BQ9A 4A0SA 1UAGA 4YYZA 2NX2A 1NQVA 3LBIA 3JQ8B 3OZCA 3FNRA 4U2GA 1VL5A 1SHLA 1P0QA 2EFHB 5J9FA 1XVAA 3TDKA 4DFDA 1Y42X 1R0LA 2R65A 5D6OA 3W05A 3QU2A 2PRIA 3AJEA 1JF8A 3PGXA 4BUCA 1KJZA 3K8QA 3ICOA 4RE6A 5DGIA 2ZBEA 2P62A 5IXJA 3B89A 4E21A 4FZVA 1GLNA 2AZ4A 3GAFA 1X7XA 2JS7A 3E03A 3W78A 1C80A 3V1NA 3LC7O 4MWCA 2ECQA 1G16A 3D81A 3GFQA 3KKOA 4ZAZA 1MO4A 1LPAB 5HBRA 2ARKA 2NOAA 2FE1A 4TVBA 2OBFA 1UPFA 1R0ZA 2O2SA 2ODAA 1AKRA 1P75A 5BSUA 2DWPA 3TLAA 5E0KB 5JD5A 2AF4C 3AY3A 4E7PA 1Q7GA 4Y9UA 4BZQA 2FJUA 3IQDB 3V8PA 2HPAA 2QUZA 2LIVA 5GM2A 2FG6C 5CMLA 2P40A 2V55B 4FFLA 4K9SA 1AUXA 1C2TA 2OCLA 5I7OA 2R751 5CCXA 4OH1A 2EGGA 2V58A 2WJ4A 2ZK7A 3PHLA 3CKLA 5AK5A 2AEJA 2D2FA 4A8JB 4GEGA 4GWKA 3AB3A 1KP3A 3P5SA 3LP8A 1A4UA 1SU4A 1AUVA 4Z0TA 2FMTA 2PGJA 2W4MA 3TLZA 3GH1A 3MD0A 3ZDZB 3ZV5A 1CUIA 3Q3GE 4KMRA 5K3FB 3L6RA 1DBIA 4JX9A 3RFTA 3OM0A 1BHQ1 3SE7A 4DZTA 3BQNB 3NNDA 1LDEA 3N2YA 4DBLE 3E2PA 3R3YA 1BE0A 3L77A 3SS8A 13PKA 2VPWA 1R8QA 2J31A 4UVIA 2VJLA 4DMMA 4QX6A 1SUFA 2GAIA 4OF4A 4UNIA 2BVNA 2RGWA 3F6PA 4J7XA 2BN4A 4JC8A 4UCWA 4WA7A 1Y1TA 3QOYA 1PT6A 4EHIA 3QPVA 4GLJA 1YDFA 3ROXA 1OFGA 3L0SA 4Z9AA 3KSUA 4ILEA 2XXAA 3IAS1 2PS0A 2CLEB 4JBYA 1KORA 2FPWA 2Q4TA 2JHAA 5C1DA 4D0GA 3JR7A 3ZHOA 1QRAA 2BM1A 1E8MA 4DLKA 3G5AA 1SFRA 4YGYA 1IFXA 1QV6A 2VJKA 5D01A 3VSDA 2ASVA 2GBIA 1QH0A 1CUDA 1RRGA 2DR0A 1FLDA 3QE2A 2WIJA 1JPVA 1M76A 3AJ9A 4HBGA 4F8YA 1DKUA 1C9MA 2JIZA 1RHJA 4JVLA 1PS9A 2CJXA 2IY7A 2YS7A 3D0KA 4QRHA 1ZK4A 4WWHA 3NX4A 3BD9A 3WADA 1EWQA 3FYCA 4QUEA 1M1ZA 5BV0A 2X8WA 2TMYA 1X1CA 2AFIA 4H7PA 1ESEA 4NNOA 3WDLA 1Y34E 4ZYLA 4OX9Y 1X86B 2OP1A 3O1HB 2Y0CA 1CS4C 1UPUA 2B2NA 3OOSA 5FPYA 2DQ4A 3K09A 5JNWA 4B81A 1Y1RA 1S5PA 5ESXA 2OV8A 2W6ID 7AT1A 2VBFA 3BJZA 5CNIA 4YBZA 3ROZA 3RLIA 2YIJA 5CXXA 4EI9A 1WB6A 2B0CA 4Z7JA 1GLGA 1E77A 2C77A 4Q01A 5ESDA 4MEAA 4B47A 1WHSA 1ZMTA 3M6VA 1LVUA 5CA0F 1FP7A 5AKZA 4ZVPA 2OCPA 3AUUA 3F4LA 4HX5A 3U9SA 4BLUA 3G0GA 1XCLA 3ENWA 1K9SA 3RUDA 1TUEA 1XTIA 3D6FA 3V34A 5I6DA 4RH1A 4EGJA 4MDYA 2XTZA 1IPEA 4UXIA 4DR5B 1W7AA 1WJGA 4L5IA 4X00A 3MAAC 4PBSA 3PPVA 3VSCA 1B6SA 4B3SB 3HCDA 3JQFA 4MK4A 4EMUA 1X77A 3VO8A 4L4ZA 3HG7A 4CETA 2GBFA 3KTAB 1XQ1A 2PR2A 1HDYA 1GG8A 2L42A 2X4GA 1J2YA 1H6BA 2IXAA 4F2GA 1JEYB 4MVJE 5TARA 4AF6A 2TMGA 5K20A 1JWLA 4GM1A 1BDHA 3FAKA 1YRBA 1E4VA 5FPKA 1DC6A 3KJZA 2BR5A 1E2NA 2ZP1A 3MPUA 5AVXA 3FKSA 4AF7A 1NI4B 2IPLA 5IAJA 3WWDA 1O94D 3VAYA 4UUMA 1WZNA 3D8UA 1VA4A 4YCBA 1BH6A 4JMLA 1VE7A 2Y0DA 1HFWA 2DSNA 3AFHA 2XBUA 3ZHSA 2QT9A 2QOEA 1GV0A 2YYYA 3H9GA 3AOEA 2P2SA 1DKRA 3GGOA 2X8LA 4B74A 2Q9AA 4M9QA 4B32A 3QKTA 2WP0A 3NEJA 3UB4