2DSTA

Crystal structure analysis of tt1977
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
122
Chain Sequence
b'RRAGYLHLYGLNLVFDRVGKGPPVLLVAEEASRWPEALPEGYAFYLLDLPGYGRTEGPRMAPEELAHFVAGFAVMMNLGAPWVLLRGLGLALGPHLEALGLRALPAEGVEVAEVLSSKLSYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TTHA1544
molecule tags Structural genomics, unknown function
source organism Thermus thermophilus
publication title Structure of the minimized alpha/beta-hydrolase fold protein from Thermus thermophilus HB8.
pubmed doi rcsb
total genus 32
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12270 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2dstA00
2DSTA
chains in the Genus database with same CATH superfamily
2ZBGA 1CUUA 1FPMA 2BD0A 2O1SA 3I39X 4MRMB 5ITWA 1WSDA 3CNEA 3HCBA 2L18A 1TM3E 3DDOA 1BX1A 3HCRA 2PWYA 4FZRA 4C43A 4D79A 5AW0A 1O4WA 2C3YA 2JD2A 4R98A 3X1JA 3EPKA 2B1JA 1U0EA 1RDFA 2YV5A 4EG8A 4X44A 3ZGNA 3QHAA 6ABPA 3B7PA 5CVVA 1MC4A 3PRYA 1RR6A 1ZI9A 2I03A 2HGSA 2I67A 1MQSA 4ATNA 9ABPA 2GMWA 2CMDA 2LNDA 4CKXA 4QBIA 4X3CA 4OIFA 1Y5NA 4GVPA 1PS8A 2D1SA 2QVCA 1Y8RA 1ENZA 4KLNA 4YRZA 1XGKA 3L7AA 3TVYA 1XYGA 4E3WA 3AHHA 2AG8A 2FN3A 3DTVB 3KB2A 3L01A 4RHUA 3BZWA 1EM8B 1XLTA 2M98A 3YASA 4I1UA 1N32B 1ECGA 2HU2A 2RK3A 1NJFA 3N2ZB 4KIJA 4IAOA 4WCFB 4KPUB 2F43A 1R0YA 2YWFA 4L7QA 2FZ5A 1STOA 2PMCA 4HFJA 2W5UA 1L0BA 5HKOA 2NYAA 2HA2A 3C3DA 3CWZA 3WB0A 4KUGA 3TSZA 3UMRA 1QQAA 4FHZA 3T7IA 2A67A 3AFOA 4L8VA 1EVEA 1AF4A 1RHKA 2IZ1A 3UK6A 4COOA 5BVGB 3BWMA 3W2IA 2H5LA 5DHAA 3PVCA 1GZDA 1W34A 2YR0A 1HKUA 2Z3WA 4XA8A 5DXFA 1E62A 1MZVA 1DO8A 2Z9CA 5K9ZA 2ZRBA 3EZ2A 4C08A 3VNVA 2QAGC 3MZ0A 3MJCA 5JSUA 5HF9A 2VDWB 2B3TA 5B55A 5IZCC 2CXOA 4ZN6A 3I42A 3BMQB 4L0CA 3RLFA 3CKMA 2CYCA 4HXFB 4F4CA 1O9BA 2QF7A 1RWNA 3H11A 4XOIA 2PL3A 2QZJA 4YRLA 3SJCA 3UICA 2QL5A 3ZTYA 5CFLA 8LDHA 2ENWA 1RKXA 1FQJA 2YW2A 3ESCA 3GH3A 3GPDG 4BP1A 3QUSA 4JQOA 3R0XA 1OBVA 5IASA 3WYEA 2ZQYA 1E3LA 4QBTA 1JIIA 2QROA 3PPXA 1PS0A 1HTBA 4WCFA 3SR4A 3A2NA 3NTRA 4JU9A 3RIMA 1WKBA 3NCTA 3PR3A 4M6WB 1HL3A 1ZU4A 2P5YA 3UQYS 1LPAB 1RWQA 3TX6A 4RZHA 4HQ6A 3UCXA 4ZJPA 4E03A 1EK2A 4R1OA 1KP2A 5C5EA 4KQXA 2O7VA 4KXVA 2C5AA 2QTRA 1V43A 2GD1O 1QRDA 1JJVA 2DGDA 2WTXA 3E8XA 4QUGA 1Z9BA 5CLQA 1LDYA 2ZVQX 1BWRA 1HQYE 1XRSB 3C97A 3WLEA 3QVKA 3M81A 5FPKA 3O5AA 4ZRMA 4R1SA 4BO5A 1IHPA 1T5LA 4Q6BA 3VU0A 3IP6A 5HXAA 3U4IA 1BFUA 3NEPX 4XIGS 5K0GA 3WVNA 4MP3A 1NP3A 4OJMX 3MCTA 4XARA 1JR3E 2H29A 3AR8A 3GOQA 4JR1A 4XRGA 3GLGB 2NT3A 1CQIB 1NHGA 2Q1SA 4WGGA 3R09A 2R8OA 2DLNA 3I52A 2BFDB 3RYTC 3O74A 2TMKA 4YIKA 2IYWA 2OESA 3OBBA 3TRDA 1H2XA 4CLOB 4Y2JA 4NMMA 5AI9A 4JT9A 1QBKC 1UFKA 2IY9A 3VO9A 3VC7A 3WAJA 3RFTA 3TRFA 2J07A 4A2WA 3BUSA 4I14A 1VLLA 2ID9A 2YN4A 3S5UA 5B1EA 2F7SA 1RMTA 3M9XA 4H7IA 2QRQA 2Y1WA 2D0IA 4U7GA 3KTFA 5CW1A 5IABA 1PLJA 5AIBA 4FQ8A 4IMJB 1XU4A 1OZAA 3D6AA 2IOHA 3FF1A 4W1QA 4BZXA 5HZGA 1RHRA 3T9BA 1AGRA 2XKJE 2YJ4A 2J1LA 4MKZA 4GX2A 3KOZA 4KP7A 4E1VA 3VR3D 3KYCA 3ZWNA 4EI9A 2Q6KA 2N0SA 1KS9A 3BD6A 3HKEB 2WAXA 3QMVA 4EHFA 1EVKA 1ZD3A 5EXXA 3RRZA 3DFFA 1QHEA 3MJEA 4X6XA 2PX8A 4Z86A 3FA2A 1EVIA 4JLSA 5EIBD 2QD1A 1NV9A 4BNKA 4TYPA 3FZGA 3F6YA 4ETWA 1GFZA 3CLTC 1G5FA 1N2EA 3L7CA 3V1UA 5B7NA 5ITZA 1IHOA 3ZHXA 5JMTA 1C0PA 3DDSA 3F3YA 4BLUA 1UAAA 5J4YA 1IUNA 1GO2A 2X58A 2HA6A 3T94A 4O4JA 2D7DA 4MPJA 2G77B 2GRAA 3OLXA 4HK4A 1YUMA 4DHWA 5HS6A 3T38A 3SHWA 3IJ5A 1MH9A 1YZVA 3SMQA 2IGBA 4X20B 3ONEA 4R3UC 1GL6A 2AKYA 2ZBRA 2WYIA 2ZE5A 2F62A 2W0MA 2X14A 4PVCA 1YVEI 2EBUA 1PJRA 4FCWA 1WKVA 2HD4A 5FDFA 3CNLA 4UBJA 1JR4A 1ZEMA 3L6CA 2PUJA 3VA7A 2HHJA 3WWDA 1QFMA 4FZVA 1SVKA 4Y67A 1BS1A 1L7RA 1Z8DA 3WGYA 2F59A 4WNIA 4UTOA 1RZUA 4FFSA 4QBKA 1LEHA 1NPTO 1OXUA 4JX8A 3WLSA 4DSZA 2ZT7A 4Q9DA 1TUBA 1WB6A 4DHEA 1XUOA 1ZSVA 3MSCA 2FWJA 3QNUA 5J2UF 1XAGA 4LSGA 4G07A 2J4DA 3GD7A 3H9GA 4OQXA 3BHIA 1X70A 3FAZA 4ZVRA 3RSHA 3L3BA 3N70A 2HRBA 3NHJA 2FRDC 2VJAA 2I3BA 4HAWA 2Q1YA 1WXEA 3B9PA 2X22A 2XIQA 5T3YA 1AX9A 3T34A 2CJPA 3BB4A 3C45A 1T43A 4TTTS 5K1ZA 4AO6A 3ZDDA 2LR0A 1RXIA 4MKIA 5JYEA 4C7VA 4J4HA 2BFDA 4W1PA 4Z9FA 4OTZA 5CW2A 2FQQA 4DYVA 4D0RA 1MIHA 1CULC 4YRTA 4CTKA 4ER0A 3V33A 1APBA 1MX5A 3M0EA 2OE2A 2RH5A 2QN8A 3LCMA 3L5OA 3NIDB 3QV1A 3R9XA 2GJAA 3FDJA 4P3PA 2YXBA 3M9LA 4ZOLF 3N6XA 2NO4A 3QPCA 3MTIA 4KWTA 1KYWA 3OWXA 4B6RA 2DHRA 1EXMA 1LZLA 3NKFA 2X15A 3P0JA 4Y3UA 4CV2A 5C80A 1G20E 1T9CA 3PQ5A 4LQCA 4M87A 3II6X 5DCLA 5FTJA 3JWJA 3FFTA 4TVOA 5LZ9A 3BB1A 3USCS 5EQFA 1F8XA 2HO5A 1YIDA 3LYHA 3SXUB 4R7TA 5IJXA 1XROA 4LBZA 2WJJA 1UL1X 3OT1A 1B3RA 3E6AA 2A9PA 4D3XA 1HH4A 4LRTB 5LMUB 3AXTA 3X43A 4MP6A 3DGFC 2FFQA 4HWSA 5JLJA 4BX3A 4WXRA 2G28A 5DT9A 1NM5A 2RHHA 4R51A 5FRDA 4AZWA 1YL5A 3AILA 5IDQA 1JPVA 1GOTA 1KAHA 1GRCA 1UBUS 2OP0A 5IC5A 3EIOA 4EG5A 1JFVA 4GYWA 3TTSA 1MB0A 2P1DA 3R3YA 4U7HA 5EMKA 1V45E 3WK4A 1P4RA 3MELA 1F2DA 5ALKA 1JA9A 3DVAB 5EUBA 1NMYA 3L4JA 2AZ4A 2AGVA 3LRXA 4O4HA 2G40A 2JS7A 4NLLA 4ZEVA 3JTEA 2I6FA 1NVDA 3FMVA 4P3XA 4MW6A 4CHGA 2GCEA 4B3XA 4II7A 5KYYB 1MJHA 3MCUA 3SY8A 1AB5A 4X5OA 3KJFA 5CH5A 1FRQA 4Y6QA 5JE8A 4M8LA 5LZ8A 3SDSA 4ZYVA 5KNLA 3GARA 3Q15C 3ZWAA 3KPVA 4FYVA 4Q34A 3MPOA 5SZIA 1FS4A 2XRMA 4CG2A 4EJ6A 2Z2XA 4QULA 3DBHA 3K92A 2VAVA 3ZZ0A 1EIWA 5DASA 4JJ7A 2N47A 2L42A 2VJOA 1JAXA 3KV1A 1QRUA 2HXGA 4LV8B 2H54A 5EXEA 2I7XA 4XWTA 4DG5A 1SO8A 3MRXA 1SQ6A 5IW8A 4BAUA 5B5SA 2QVLA 4NEGA 4AS3A 2XKKA 2GPBA 3LGXA 2POCA 2PH7A 4I1RA 3HXLA 1C9YA 2PIDA 3DEIA 4H1WA 4DV7B 2DERA 5JAPA 2QAIA 1Z2NX 4KGDA 1JJFA 1WF3A 4DY6A 1Y6ZA 2C99A 3JWPA 4OP1A 5HIMA 4YGYA 4D82A 4RY2A 2CCKA 2J3DA 1X7ZA 221PA 4P4TA 2WPNA 3Q6IA 1E3DA 1SK9A 1TTQB 2BKVA 4GPAA 4KDEA 2WFMA 2ZWVA 4M98A 3TOVA 4EG4A 5ITZB 1E7YA 3H99A 2IU0A 1XTQA 4AZ3B 3VR1A 1L1QA 1K6JA 1PK9A 4YMUA 3UJ6A 5CT6A 2ZI7A 2BZSA 2CHGA 3GPBA 2F9MA 3P4YA 5AMXA 2OG2A 4MGHA 2XCSB 4X94A 4PY2A 1Q0HA 4B8ZA 4F4FA 5KX5B 2HLHA 4WV3A 3AVVA 3KUDA 1T9DA 4JP1A 3EZXA 1KY2A 1IXKA 1JIKA 2C8JA 2CEKA 3FSEA 4GBGA 5AKHA 3UGJA 1G59A 1CUGA 4BQOA 3WWEA 2WSLA 3GEIA 4BNMA 4MW2A 4JYAB 3FBGA 4DSTA 4B48A 3KR1A 1T8PA 5EJ8A 5KKNB 4JASB 2GCGA 1M54A 3OM0A 4CEJB 3EULA 3OCXA 4NFYA 1ODFA 3FCXA 4Y1RA 5EKUA 2CJFA 3RASA 4GPZA 3RJ9A 3A06A 5A6SA 4TXHA 1S89A 2WPDD 3L9XA 3C16C 5EI5A 1F9EA 2B1RA 4YRQA 1Q1QA 4Q0MA 1H3NA 1QK5A 3AVQA 2NO0A 2YXLA 5FB3A 2Q49A 1Q1BA 5ELLA 3UA4A 2IHTA 1ZICA 4W1RA 3LHDA 3WWZA 4AP6A 2HOQA 2NZJA 1I4WA 3C3PA 3DNMA 4HI0E 5LJLA 2VBCA 4Y1GA 2WLSA 1ABFA 4IIJB 5J4VA 1L4GA 1XVTA 2D5AA 3CVOA 1YT5A 4UBKA 3SBDA 4CMIB 3H0EA 2WHPB 2C5LA 1RJDA 4GEGA 1GDHA 1DTEA 3TQCA 1M7GA 3VU8A 3ED1A 4YRMA 1DBVO 3LZCA 2KBFA 4RVCA 2OHFA 1PP4A 1UZAA 4CKCA 1GNPA 4PG6A 5ALMA 3H4IA 4A2QA 1JI0A 1WNFA 3ONDA 2QM8A 3K31A 4LYHA 4RXUA 5BR7A 5CYOA 5FFFA 2AMLA 2ZJYA 2ON6A 3PHJA 3ZW7A 3TR6A 1QG0A 3G1WA 5TGTA 4TYNA 5TC4A 1MT0A 3OQIA 4IQ4A 3LC2O 1L5SA 1QPBA 1H2EA 1OFHA 5TGZA 4CUZA 4NCHA 2GPSA 2OHVA 3GRFA 1U65A 2IP2A 3W04A 5AVWA 4DQDA 2XVZA 2Z4SA 1P9RA 1WMAA 3HJHA 4I4IA 2XW6A 3PEYA 1AQUA 1V7QA 1G7RA 1W4AA 3DOFA 4NYMR 3WLNA 3IPLA 3TB4A 4H7FA 3CLSC 5K2MA 2PLAA 3CC8A 4Q21A 4AG3A 1K8QA 5B57C 3QGMA 1TCVA 3LP6A 5F2KA 5B37A 5IJ0B 1EX7A 5KJEA 2QNIA 5A3JA 1C7ZA 1XP5A 3RRYA 4MS4B 3WMWA 4YT2A 2BE7A 3WIEA 4DLZA 2XCTB 4WUVA 2OVFA 1QK3A 2WF7A 5IDXA 4OX9B 2O14A 3STWA 3UGKA 1F2TB 2Z0MA 3GAAA 3EQ2A 3LXXA 3MGCA 4LV5B 1VKHA 3LPCA 3DE7X 2FPWA 3PXXA 4F4UA 3RVDA 4MUIA 3H0KA 3GH1A 3OZDA 5LMCA 4NKRA 3B85A 3RIGA 4C7OA 1HQDA 1PSDA 2CZGA 3WGQA 5FLKA 3SHOA 3F5SA 4AMUA 3I1IA 8ABPA 4B76A 5KWEA 4HWGA 1JQ3A 1N8NA 2PZJA 2QZPA 4IJWA 3TD9A 4PX9A 1ZBDA 5J5CA 4ED9A 5DHUA 2IYFA 1N9GA 1TUIA 1KVRA 4P34A 1EEHA 3L1KA 1QYIA 3RDPA 4R1TA 4C88A 3ZWPA 2MSCB 1XA4A 1CERA 1Z6XA 2VRNA 4GM4A 1PJZA 1Y37A 4TS1A 1ULHA 4UCFA 2ASVA 3QWIA 4LE2A 4YFYA 1ODSA 2PS1A 5IYZA 2O07A 2QL7A 5GY7A 4PM4A 1KC1A 3MPUA 2JARA 5LBTA 1ZONA 3F2VA 2FZKA 3T5PA 3VKFA 1X3SA 3MWDA 2RBGA 4TQUS 3R7BA 3RF6A 1W4RA 2DM6A 1D09A 4YRSA 5L9AA 1Y3IA 4ZOLA 2IF0A 4ZAWA 2M6KA 4B9AA 2O2JA 3M82A 2PHZA 3QVWA 2JGAA 4B33A 4CM4A 3IQEA 4AF8A 3EA0A 1KFBB 3DXFA 5D84A 4X84A 2QW1A 4QPNA 1Y89A 1KGSA 3WBBA 3L8YA 4F2HA 4JI6B 5IBQA 1L3CA 1ZNZA 4A0GA 4HAVA 2BIFA 2W37A 1K7XB 2H65A 2Q8QA 3CF4G 4ND7A 1WW2A 1PF7E 2I2XB 4Q9KA 3SJ7A 4B2YA 4P1ZA 3DAOA 3FOAA 1P1BA 1A9XB 3COVA 1JFRA 4N0QA 1RXEA 3CUEF 2P4HX 2V7UA 1NMSA 2ZRDA 1KYXA 5I8PA 4HF7A 4QJIA 3KXDA 5TF0A 4BHTA 1Z08A 1IWBB 1QS0A 4G6ZA 3B7GA 4RHYA 2R5NA 2Z5LA 4WFIA 3W8RA 4IZOA 4FYWA 1I5OA 1WCYA 4B5LA 2UVPB 4N1AA 1LDBA 5G3YA 4NPAA 4WD3A 2WNIA 1A2KC 4RS4A 3L8HA 4F3NA 1UXKA 3EYWA 2KW5A 3HZZA 4KQ1A 3RSOA 1IEWA 1X1AA 1JKIA 2RGYA 1SVLA 2DWCA 1OT5A 3QV2A 4FU0A 4S0ZA 3GC6A 4UVDA 3ZQKA 1OTYA 2Y2VA 4BLTA 3IOMA 3QQPA 2PUFA 2PKYX 2ST1A 3FR7A 2V6IA 2WFAA 5EIHA 2RGGA 1G41A 2OXEA 5KHLB 2R47A 2ZYHA 1PDVA 3VH1A 1C50A 4F04A 2PX2A 3JRXA 2R48A 1E8MA 2X6TA 5K4AA 1C7FA 3MT9A 4BTVA 4EQZA 3SQXA 1FP4A 1GJRA 3EG5A 3FLMA 3LDFA 4JBXA 4LQ4A 5ALTA 2AR0A 2A5JA 1KAGA 3MIIA 3UB3A 5C8XA 4HGQA 1GT91 2FI1A 2IUEA 3QUCA 4HFRA 1Z25A 4WN9A 3ZBQA 3EUFA 2VT2A 3SZOA 1TK3A 4NI5A 1WEKA 3MTQA 4G0MA 2LW7A 1DEXA 4FS3A 3BGVA 4IIVA 4RIFA 4INJA 1HDZA 3WOHA 3GBSA 4G5HA 1Q7RA 4QDTA 4EYGA 4QGFA 3RG8A 3DKPA 4Z9XA 3PJEA 1ECBA 4EQ6B 1LPNA 1QS0B 3V00A 1E79A 3ND9A 2X7JA 1CUVA 3TIVA 1SCAA 2Z5GA 4IDGA 4IIUA 1CRPA 2AR7A 3PQDA 4US0R 3N6RA 3ST7A 3MUNA 3LQFA 1UIRA 5AI5A 3E9DA 1SFRA 1MO4A 2OFOA 4A0RA 4BFVA 2C5SA 2RONA 4UTPA 5C3UA 3SZGA 5FF9A 3AEYA 3TWOA 2BF4A 1ORRA 1R9GA 1XU9A 2BCEA 3I53A 2A78A 3L82B 3LV8A 1YZKA 3GLKA 3COZA 3JX9A 2WRZA 3PSAA 4JB2A 4NAVA 4YQYA 2CLIB 3P1JA 4QPZA 1QK4A 1FP1D 3A6GA 3F5MA 1U7OA 4XIFA 1L1RA 1TNDA 1JU3A 1U0GA 3GJXC 4FKZA 1P0FA 5KZMB 4ZEXA 5JAUA 3AH8A 3SZRA 4QU5A 3SFTA 1XU7A 2EDCA 1HR0B 4JBHA 3SS7X 1W5FA 5CEEA 6GPBA 1LNQA 4DLXA 2MINB 3GL9A 1SC3A 4RY8A 5ADVA 4I1IA 2PZFA 4OLJA 1XDSA 3N5KA 2BMVA 1I2BA 2CXUA 3ASVA 1S7CA 3M6MD 1EFTA 1KPHA 2OM6A 2VNJA 3CT6A 4JN6B 4REQB 5I3CA 1KEUA 2Y1EA 4Y7DA 4B3HA 1G5TA 2N9UA 2FPOA 1MX1A 2FR1A 4BEWA 3FPLA 4INPA 4K1XA 1M8FA 2HEIA 2J59A 2X8AA 1VPWA 1WAMA 3NTQA 2GXAA 4W9NA 4GC9A 1XLVA 2Z1NA 3GZ4A 2UZ3A 3M5PA 3PUKA 1M34E 4IGFA 2BEUB 1JECA 3CLVA 1ZZGA 2A86A 3P9SA 4XLTA 3EXHB 2XF8A 4KK3A 2OAEA 3NKVA 5KKCA 2JJ1A 3EIEA 1BWSA 5IJAA 1IXRC 4CM6A 3HP4A 3G9UA 3TH5A 3S2FA 4DV5B 2FEMA 2HF9A 4WY8A 2B1QA 3RVMA 1FYEA 1JDJA 1O8CA 3MJRA 4H1VA 3CX7A 3GA5A 4BBAA 5KDOA 2IX3A 2GRUA 5IUJC 1U2TA 1Y81A 4MGIR 1VJTA 4K81B 3VVMA 1CK4A 2EATA 2OL4A 3G3EA 3RS0A 1GAQA 3GRPA 3A2KA 1ONNA 3J7AC 3MK31 5DBIA 2RBEA 4G0XA 3DDNA 4DKXA 1LPSA 1PX2A 4DPKA 2FUCA 5BY2A 4E5MA 4EVRA 1ZC3A 2IYZA 4Z7NB 1DVRA 2BISA 2C92A 3ZD9A 2YNMA 3A2MA 3JYOA 3T7TA 3ABZA 3H8SA 3T9AA 1DEHA 2BJHA 3V4LA 4D3YA 4NBTA 4WWHA 1WZCA 2IDJA 1DXOA 2IEZA 2J0QA 1KR5A 2GZDA 5AVRA 1N1MA 2WT4A 3NH6A 2CWDA 4P53A 5DW3A 2XCQA 5FUWA 1DBIA 4ZC8A 3TJRA 4CF3A 4BRSA 5AXCA 1RCUA 3O3MB 4CHTA 1PL6A 5K4GA 2HU5A 2UYYA 3PNOA 4GBMA 5KVQA 3E2IA 3TQTA 3UOAB 2WIGA 3BF8A 3C4VA 4YJGA 1DOHA 1EGQA 2P2DA 4X92A 4HRAA 3WGTA 3PD1A 2NUAA 5FI1B 4XVCA 3FUCA 2J9RA 4OXNA 3WYFA 2QQEA 1TYZA 1IFXA 1XTSA 2D06A 3C8HA 3P7MA 1O58A 1UBMS 1YR8A 4RGVA 1Y1KE 4G0YA 4PC2A 3HFJA 5TQ0B 3KAKA 4DM7A 3D64A 4GG1A 1VL2A 2HV9A 4ZZ0A 2GCNA 4WBNB 1U28A 3VR4A 1DLIA 2W6MA 4P4SA 1ICEA 3AY6A 5E2IA 3FDXA 5EP1A 4JI3B 4CKEA 1QBGA 2AF3C 3GWGA 3UW1A 1FW8A 4XD7D 1F6DA 4I8IA 1H05A 3QITA 5JRJA 4L6IA 1BDMA 1P73A 5IMSA 1E5VA 3L6BA 4RZ2A 2YY5A 4LBYA 3RUDA 3AL0C 2GTPA 2YVKA 4G5SA 3RG2A 3V2GA 2RHJA 4BB0A 4CQMB 1HYBA 4ZT2A 4DIUA 1R3UA 1DHTA 2JRCA 4H3SA 4FILA 2VUTA 1C1HA 2SECE 2A0WA 1QUEA 1PT7A 4JYBA 1WSAA 4X41A 3M3DA 3V6MA 4AK9A 1KGDA 4ASUD 2I4OA 1ID8A 3GUYA 5L95A 3HHPA 5LZ4A 4W5QA 3H5LA 4PCAA 3ZU3A 1P39A 1LW7A 4EUEA 2E5WA 2ZPUA 3FM9A 1C9DB 3L79A 2HK6A 1BN6A 4E88A 3N8NA 4O3MA 3MT8A 2R7MA 3ESAA 3KWLA 3OF5A 5LZ2A 4KQWA 1WSBA 1PZFA 2IXTA 4N49A 3DBVO 1ZRSA 2AD5A 3ZE8A 5CLJA 4MVJM 3HRIA 4QHSA 4KE7A 2KS6A 2GARA 4Q1EA 2NZUG 4LJYA 4C5BA 4CLHA 2C3OA 2GWHA 1HT1E 2BEKA 1NM5C 3PUZA 1DUIA 4BO3A 1JNYA 3BTUA 4D81A 1HRKA 3OLZA 4U2EA 2NNWB 4ND6A 3UIEA 3VZDA 3KQOA 4AWBA 4DDHA 4ZV4A 1DWPA 1WZ2A 3OPMA 3VH4A 3OIDA 2OA0A 1KVSA 2VSFA 2HUPA 4IXNA 1N33B 1J7KA 1T5BA 1N5MA 4UZSA 2PV0A 3UJ7A 4TRRA 1VCHA 1DX9A 1IBRA 2G0NA 3M4YA 2AUNA 3WDLA 2O2GA 1DJLA 3B5IA 3U7JA 5T64A 1I30A 1RFGE 1SAYA 3NDIA 3WMFA 2XRFA 1PTJC 4LTDA 4M1EA 4A0FA 2VDVE 3KVVA 4QATA 2Q5LA 5KU1A 2XWBF 1XRPA 2JJ1D 3GMSA 2QRPA 1XL0A 4AUKA 2NZWA 3GRYA 1WL8A 2UYGA 1RBQA 5DU2A 3CQ9A 4BO0A 5MGBA 5J2TB 1JAIA 1GAWA 1XA0A 1Z5VA 2NOAA 4MUJA 5TQVA 3VX3A 2XEDA 1J4AA 3CBQA 4IIXA 3TTTA 2UZ4A 3E70C 1ESCA 1RRKA 2PL9A 4U02A 5CIYA 4J16A 2Q8PA 2PVPA 3C7DB 3VHXB 4GOXA 3SYRA 3H8VA 1U2PA 3ZDEA 1I32A 1IY0A 4C87A 4DMGA 1E6LA 4HS4A 1E2NA 4HR7A 4FT2A 4C0LA 1F60A 3L8CA 4CCSA 2JKVA 4EQ6A 1X7ZB 5CK5A 3PXGA 3EZ7A 3PC6A 3QKSA 2H1OA 2JLWA 2IVZA 1H22A 1V8BA 5FULA 2IPXA 2XUPA 4IGIA 2A35A 2OGSA 4P32A 4GQAA 2R84A 3EFBA 1LFAA 1N2JA 3JU3A 4HAYA 3QWHA 5J47A 1U0JA 2P68A 2PXXA 2HJSA 2XUKA 2BMWA 3W5AA 1YASA 1WU7A 3BGSA 4G1MB 3DT9A 3I9MA 3ON5A 4D9MA 1L9XA 1L4YA 3DZIA 5AD1A 3RSCA 1UMDB 1IBSA 4IZIA 2C4KA 2R6DA 3EB9A 3OECA 2FWNA 3VKGA 4KOAA 4H3HB 1KEKA 3SGLA 4DLRA 1UZUA 3W77A 4C6TA 4YLEA 4CIVA 2WF5A 1PYOA 3FWKA 1VLJA 3G2IA 4IIJF 4K8OA 3W9YA 1ECPA 2I6SA 2I3AA 4V39A 5HGJA 4Z8YA 1G9XA 1O95A 2OCKA 4GU5A 4L75A 3U3KA 1SKQA 4EPYA 4RYLA 1TEHA 3A1CA 2B2CA 4BMVA 4DADA 3LWDA 3CS3A 1ZAKA 5AW3A 3EPLA 3VOTA 3WRYA 3LQYA 4IQ8A 4DM4A 1AKQA 4GS5A 4I0WB 2I5PO 5DMXA 4CMIA 4K40A 5D85A 1JDZA 3UAZA 5HHTA 3TZCA 1YSCA 4QXOA 3THXA 4IVPA 1OIWA 1SWWA 1T36B 2YJ3A 1V16A 3A10A 1NF3A 3CKLA 4WDRA 1BVHA 2PD6A 2P0AA 3BTSA 1UT8A 2AI1A 1KVQA 1E5TA 1G4AE 3D7KA 3DXXA 4FDAA 5HIJA 2VAWA 3OEEA 1SQGA 3C98A 4LOHA 4UHCA 1RI5A 2YASA 4MW1A 3CUYA 4MI6A 4TX1A 3TLGB 4CM9D 3L1VA 5CBPA 1J0AA 1E60A 1A9OA 3GVPA 3IAAA 1WA5A 2HIHA 3T9FA 4BJ5A 1RAEA 2P9YA 4EFDA 3EQ9A 1R8YA 5BMVB 1X94A 2Q45A 3GQVA 3OOWA 1Q6ZA 3LUCA 1QYWA 2CNWD 2QQ0A 3A8TA 2EIHA 1O95D 4L85A 4X71A 4MJ7A 2G9VA 4M49A 2FVYA 3P9RA 3GFFA 4JOQA 3QE9Y 3P52A 4MW4A 1UAYA 1E0JA 3MJTA 2NUTA 3I1YA 5L51A 1U8EA 1U5AA 1Q20A 1WVMA 2GZAA 4O02B 3AHCA 2QJWA 3BQ9A 2GBLC 2IEGA 4QU8A 2V0GA 4O2RA 4G5OA 4NCBA 2MT9A 1E0AA 5IVPA 1QZUA 5FEMA 5IH7A 2YZMA 1KBOA 2ATVA 2VRCD 2TS1A 1HSOA 5A3SA 4QLBA 1IAQA 1OWLA 1Z7YA 3DV0A 4UOQA 3QLUC 3MIZA 2O2SA 3BSWA 5CIQA 3E9YA 2OMKA 3ZWYA 2Z2ZA 3WJAA 3TLZA 5AHKA 4EI8A 3FIJA 4WBXC 1RIIA 4LX0A 1QR6A 1T3SA 2XNJA 3OLYA 9ATCA 7GPBA 3ZVMA 1C41A 1OOEA 5K3EA 5ISMA 4BVLA 4WOCA 1TZBA 1R5JA 2HDHA 1UMDA 4QUIA 1VG9B 2OHHA 3RGGA 3PFKA 3JS5A 3O75A 1Z6QA 2YZKA 4WERA 4DJTA 1GITA 1A72A 4B4UA 3F2IA 1R7RA 1VL8A 2BFWA 3AR7A 4OLFA 1BC5A 5F7ZA 4OHRA 4C2TA 4OUDB 4ND8A 3BJIC 1D1QA 5ER9A 1SEPA 3HVHA 3S68A 1XX6A 5JCJD 3W9UA 4EHAA 2PZKA 3OTWA 1Z8NA 2BGMA 2I2AA 2WF8A 5AH0A 3UGTA 1KI4A 3FGPA 2EX4A 2BCGY 4R8LA 4EEZA 3GXOA 5CA0A 4XX0A 3KT6A 1QTQA 3EVCA 3W1EA 4MH0R 4Y6LA 3ZWWA 3SLGA 2J41A 4PLFA 1UK9A 4F12A 5D87A 2EWWA 4IDFA 1HSZA 1HE5A 1R6UA 1R64A 3GB9A 3JXEA 3HMQA 3NT4A 4LXQA 4FWTA 4TTRA 5J2TA 1W2WB 1QO7A 2PIAA 1RU3A 1Z07A 3R23A 4O2AB 1TD9A 1YV9A 3DMPA 4IEFB 1KOLA 3UJAA 1RZRD 3NHAA 3F6BX 3AEUB 3DVQX 4Z3OA 3SYMA 2VUUA 1X9GA 3P9ZA 4ZJYA 5EJ5A 3PNKA 1JHZA 1M2FA 1L7EA 4MUGA 4N6NA 3IQFA 2O8BB 3GGDA 1YF3A 7AT1A 2BW0A 1DT3A 5HWSA 4KQCA 2C57A 2PUGA 2CUKA 4X64B 2GVZC 1M1XB 1W8IA 5CFMA 5CX1A 3F4KA 1L5OA 3VI4B 5G1NA 4MCJA 2JFZA 1E8NA 3A9RA 1P1HA 4Z7QB 2ALJA 4XTRA 1QIFA 1SUCA 2BEVA 2I0FA 4ZTUB 5E8JA 4HLQB 1LF0A 1LA2A 2YFHA 3ROEA 1YU6A 4ZK2A 1K5HA 4HLDA 1XMJA 3BE5A 2VT3A 2FMFA 4XX0B 5T6BA 3GMDA 2CYBA 5CNIA 1JYEA 1H2FA 1KI6A 3PGJA 2FLWA 2GJSA 2UU9B 5B1HA 1J56A 3ELDA 4U3JA 1U2ZA 1QRRA 4CL0A 3P0FA 1Z73A 4QTXA 5BQXA 2R4TA 3L40A 1TKAA 1YB1A 1LLQA 3BIWA 3ZLBA 2H85A 1MO3A 2KYRA 5U9CA 1YA6A 1FQOA 1HI9A 1PKXA 4TSFA 4FTWA 5DLYA 3JQ9C 2VXBA 3MWLA 5JI3E 3I8SA 3KXLA 3EIWA 2PZGA 3CEMA 4YY3B 3ZGLA 1I1OA 5HW0A 4KQ2A 5CNKA 1QTNA 1U3WA 5JWHA 3UHJA 2VQFB 1IDN1 5EZ6B 1ZGHA 2JIMA 3QHPA 4D25A 4KIGA 4TZKA 2C78A 3SYNA 1RADA 4P08A 2XWQA 4L57A 1N1GA 1E2MA 4H17A 4LCEA 5TQ2B 1EK0A 5BMVF 1MJGM 3TGLA 4MR7A 1Q3HA 3RYFA 1WMEA 3RHTA 2XYHA 4OA5A 3D8UA 4Q24A 4RV4A 3W4KA 1R6XA 1JQ5A 2MSDB 3JCZA 5M34A 3A4MA 4K2HA 2HQBA 1XCBA 2OILA 3R7NA 3PKZA 5C8YA 4DLNA 3I9NA 1JN0A 3OX2A 1JL3A 4M1KA 4YUYA 4KQKA 1CIPA 4I66A 5JG7A 5LOVA 3PJRA 1ISJA 4MCAA 2UYCA 1RYDA 3GLFE 2NU8A 1M34A 1M2KA 2EW2A 4BJHB 1BOOA 3AP1A 4UHDA 4ZQBA 1RYMA 2TSYB 4F86A 2AJCA 3SF0A 1YRLA 3OICA 3FROA 4RGQA 1ADJA 1AKMA 3G59A 4NMLA 4Q4HA 3FOCA 2C00A 3GZTB 3M1IA 3V2UA 4L72A 2DKOA 2V5AA 3BILA 4B87A 1FUKA 1Y9ZA 3E0XA 4FVTA 4LJ6A 4UU1A 2N1MA 3HK2A 3G5AA 3K5PA 4EVIA 5K2OA 1C1XB 2JAPA 3WAKA 1W5AA 1EXWA 1NBEA 2GEFA 1KXJA 2X6QA 4R9VA 3ASYA 4K26A 4CLRA 3BFVA 4BJ1A 5KYWB 2WQ7A 4LPKA 4XCXA 1MRZA 4JR0A 2P2LA 5CXXA 5TQ2A 3NBYC 3IYLW 3EG9A 1B7GO 1QAMA 3DFIA 3EZ6A 3GGCA 3DPUA 3M4ZA 3MINA 3ZXIA 1UEXC 4XJTA 2RDMA 1P81A 3F47A 4DJJA 2HREA 3PEEA 4EHIA 1XMPA 2J33A 4GSKA 4Y9UA 2EQBA 1PE0A 1SN7A 2FG5A 3UQZA 6REQB 3PF8A 3A1SA 3IP5A 3AG6A 3OT4A 5AK4A 3TF5A 1HDGO 1KJIA 1S2IA 1S4QA 5TVKA 4L15A 2VAPA 3W1WA 1IXSB 4ROTA 1OX5A 4BUCA 1T5TA 1LK5A 4FW8A 4NE7A 4JVNA 1S3GA 1RC1A 4AJ1A 1HZJA 1JU9A 2C7BA 4WZZA 3ICWA 3JPWA 3ZNOA 3BTOA 5A4KA 3TXXA 2QVXX 4BKPA 1YQWA 1IPHA 4WKGA 1WQ4A 4NZMA 2ZYAA 3I28A 1PEDA 3GG2A 2OBLA 1Z0FA 4OQYA 3UFXA 2J9GA 1DZ3A 3PICA 5IT9A 1AQ6A 1VB5A 3AFGA 3T7RA 1F2VA 2X2FA 1IIRA 1K3FA 1JSZA 1QLJA 2YDYA 4PLGA 4Q7EA 3SU8A 5BUZA 3UPTA 1I01A 3LHIA 3TD6A 2PY6A 2ZM5A 1SB9A 2PKWA 2QTBA 3C5HA 3PG5A 1AG9A 4LJ7A 3BSYA 5DYIA 2XDYA 3SC4A 3WTBA 4OHCA 3C3EA 1WXXA 5EKSA 1K4KA 2B25A 1W4LA 3DO5A 4Y0NA 5LVAA 1OTXA 4YLYA 4G0QA 2F3SA 1YACA 3LWBA 2QOEA 1QYVA 3GFBA 1AQJA 4Z1MD 5FI5A 5JZMA 5DNCA 2JEZA 3KZ1E 2DH5A 3REQA 4HX9A 1XNGA 5DGTA 1NF8A 5MFZA 5B3KA 1HT0A 4FFMA 1UKAA 2PU7A 4UZEA 4G25A 4KUEA 3RNOA 2JHGA 5EUMA 3WDSA 4YCLA 1X9IA 1XQYA 3FVQA 4I9FA 5K0EA 2AOTA 1EK5A 4YJHB 3VPDA 1NXQA 4Q37A 2XJ9A 2Y0DA 1EG2A 3LRPA 4NDZA 1ZW1A 2PXAA 4LFBB 4QQNA 4XUDA 4DIMA 3P0RA 3W7AA 1W9MA 1J06A 5C46F 1PHRA 1T3ZA 4G26A 4RHEA 1HT3A 2JH3A 2OZEA 3ZY2A 3AP3A 3DOOA 4MR9A 2CVQA 3SKXA 2O1WA 3RU2A 4FOPA 1UODA 3C2QA 4OGWA 3LF2A 4URZR 1F17A 1P3Y1 5HFJA 3SD7A 4NICA 1DCKA 4ITVA 1SXIA 1M1YB 2M6SA 4MUAA 3PUYA 4O4IB 1Z29A 4CCYA 2Q1UA 1YRAA 4WJLA 1DAGA 3TD2A 3AR6A 1I3CA 1WXQA 1LSJA 2BOVA 2P4QA 5EWLB 2AC7A 5AW9A 1I6LA 2QLTA 4AO8A 2R8ZA 2HO4A 2Q2QA 4EBBA 4KJZA 3PC8C 4G63A 1U81A 3RVNA 1WIWA 1E0DA 3WXMA 6NULA 1W5BA 3O7WA 4P3NA 1U2GC 1QDLB 3CT4A 4KZKA 1UXIA 3RYIA 4JJ4A 2O8CA 1Z16A 4D3ZA 2CVFA 3WIBA 3UT5B 2WW8A 4DR4B 2RJNA 1OTHA 3NKLA 4HEQA 1MA3A 3B9QA 3NYWA 1QWOA 1R9NA 3X2SA 5EJ7A 2DFLA 4MK4A 1PJ2A 4YJHA 5FNVA 1NUSA 3PDIA 3RK0A 3TZKA 3VV3A 1F3OA 1W6RA 4YBZA 1Z2AA 5J2TF 4N12A 4CMJA 5LOVF 1NP7A 2OWEA 1HX7A 1NONA 2FOXA 3E15A 3NC1C 3JQBA 2I3ZA 4FK8A 1RZ3A 3OFVA 4FFWA 4N01A 1YB7A 4LC1A 3PFNA 4K87A 2F1KA 1BXRA 2P9BA 1U2DC 2P35A 2QHXA 3OAAD 1GTL1 3SX0A 2P2NA 4EATA 2A0XA 2V03A 2X76A 3ACBA 4IHKA 3RRMA 5L7TA 2ZIWB 3L4SO 1MPTA 4G0OA 4OI4A 4BV8A 5K01A 4U1RA 3LW7A 1HURA 1KO5A 3PGA1 1ZR4A 1O54A 2NIPA 1E99A 2Y6VA 4IV8A 3ENKA 4Z9YA 4PQRA 2HRZA 1IN4A 1SXHA 1I7QB 2R87A 5GGYA 3CM0A 1PTJA 2IEIA 3U80A 4RTOA 1TLTA 5EKDA 2GLUA 2VTKA 4EBFA 5KYWA 1SZJG 2Q5CA 2R7KA 3ME5A 4NH4A 2I33A 3GP3A 5JAHA 4O3FA 5DXAA 5ALVA 4K2AA 4ZVSA 1I3MA 1UM9A 3DWIA 1YQTA 1VYTA 3SAJA 1DS6A 3OJ0A 1SR8A 4GRDA 4NQRA 2GF0A 2FNAA 1XB2A 2QZSA 1WMBA 1OJ7A 3ISJA 4HJXA 4HSEA 2PKQO 3KOXA 1CQJB 4WNAB 1G4HA 1PGPA 3R8CA 2HJGA 5HG0A 4KDRA 4EYSA 1P2BA 2DJ5A 2I4NA 5BWNA 2ZYVX 1U3TA 4G86A 3J80A 1YBFA 4B3GA 2C5EA 2YMQA 1EM6A 1NWCA 4LNHA 4ND4A 2YYZA 3C24A 4RWZA 5GJCA 1P4JA 1LLFA 2BTOA 3K2EA 2R68A 3G2KA 1XCPA 2HC9A 2VQ3A 1LI7A 2CV0A 4B73A 1E9FA 4YJ3B 5LMZA 4D9NA 2H2IA 2VHZA 2Y1LA 4OMFG 2K87A 2EFGA 2ZUSA 3G0GA 4JL5A 4M8IA 5KTYA 2Q2WA 4POOA 4RA6A 1RW4A 3L77A 3RIXA 4INOA 4DUYB 4YIHA 4ZIRB 1P2FA 2VK8A 4H6XA 4NV1A 4AULA 4KQGA 4CU5A 4U2FA 5JJKA 3EUAA 1XMIA 4F5YA 1WJGA 4GH5A 3WDKA 4C0KA 3PQ8A 1JHPA 4GEKA 1XNJA 3KQSA 3R0VA 4E5KA 3BFKA 4WXEA 3PR2B 2BYTA 3LL7A 1GQYA 2ZJZA 2PUEA 4C0WA 3BERA 1QG4A 3DMYA 3FYUB 4DAOA 4RFSA 4FFBA 2G09A 3ZZUA 4Q03A 1NKSA 4E09A 3DAPA 2EVWX 4DCUA 1UDCA 3RV3A 4U2DA 3MQ2A 4DCOA 4Q3EA 4CODB 1B23P 2WV9A 1EJBA 1VGQA 2ANCA 1BXRB 3K0HA 3QXXA 4IS2A 3R77A 4YUAA 3W5CA 1AN9A 1VIMA 2EWVA 2H1WA 3E7WA 2F17A 3BH7A 2QTGA 4JHXA 3AFMA 1SG9A 1GKLA 5AFSA 3N9IA 1YB4A 1LF5A 1YDHA 2X2EA 3D0RA 3MB5A 4YJ2A 1JXOA 1NJ2A 1ORVA 2P4SA 4HDRA 5CJPA 5DLDA 4PZAA 3ONFA 1XZJA 3AR4A 5A4FS 3R7WB 5KSYA 1D2GA 3K1YA 4UMVA 5YASA 4PPNA 4BNYA 1C0LA 4ZYZA 5EQTA 2RGDA 1AZSC 3BK2A 3HGTA 3OE4A 2HADA 2V58A 1CYDA 1ZR2A 2E85A 4HO1X 3VOBA 2V7XA 3EPJA 5L6MB 1ZL0A 2IK8A 1ACLA 3VAZA 2QR5A 4BJ3A 4BVAA 2P2ZA 1BA2A 1IHDA 1QCZA 2ZKLA 4G01B 3CEPB 1Z56C 2P5UA 2FDRA 3F9CA 4RTJA 4CMCA 1MAAA 3FYSA 3O91A 4FIZA 1H3EA 4W82A 1SHLA 3PCTA 5G40A 1W0CA 5F1OA 4IO1A 5D3MA 2DT5A 2JLVA 1T9BA 3KXKA 3AL3A 4I9HA 2PVSA 2AR9A 2Z2YA 3NFRA 1MW9X 4BGUA 1W30A 4F9EA 2OZKA 2PRJA 3AEKB 5TDHA 2DU8A 3WLQA 1P6XA 4HAOA 4DR2B 2PLRA 1HLFA 1P72A 3MRVA 4KPFC 3W8EA 4DR7B 1U0RA 1Y6QA 3KUUA 4AF7A 4X63A 1C7RA 1U8XX 4QASA 3EW9A 3FPAA 3MAGA 4O2BB 1LXCA 5FNVB 4ZI5A 1GNVA 2XB9A 3RT1A 3HXPA 3BA6A 4LHWA 1DQZA 4YJKA 3W8FA 3FNIA 4JP5A 1JG7A 1C4OA 3QUBA 2BEWB 5FBQB 4OHXA 2OQIA 4OKNA 1VE9A 1ZPDA 4TKUA 4X60A 2WSMA 1F1JA 1KY3A 4NFHA 2OHOA 4G2NA 2FMUA 1JLMA 5FUVA 4PFQA 1Y6FA 2XITA 2YHIA 2REXB 1NSFA 1EVYA 2BFBA 2W6OA 3KJGA 3UF0A 4ETNA 5A2GA 4YI3A 4IH1A 3KFVA 3FWZA 4BNNA 4O2AA 1EA7A 4EYOA 3FZYA 5IKEA 4JUBA 3IDOA 3TXYA 3WYAA 4BBZA 5C18A 3HXOA 2O7RA 1BH6A 2R3SA 4HQ0A 1JQAA 3C74A 4YAOA 3CH7A 3PRKE 5AXBA 3MA0A 1KE1A 3R5TA 3H2GA 1CUFA 1TQ6A 4C06A 1FJHA 1ISGA 2O23A 3ZNNA 3JVVA 1JG6A 1QH9A 3GJ6A 4P0PB 3DBIA 4IIEA 3KOMA 3TZLA 5JALA 1E7WA 2E55A 4HX2A 2V7VA 3ONNA 4K3UA 3SVLA 3P0EA 1E9BA 4QSHA 4D3FA 5IEJA 1I94B 5JO0A 1J6UA 3VJMA 3TZ6A 4B1FA 1EH5A 3V8QA 3K1AA 2Q6LA 3F7TA 2PGNA 4AJEA 2L19A 1UPBA 4ND1A 4YJFA 3U3XA 3LUFA 3U5TA 4RDCA 1C2YA 3L7JA 4LZNA 1K0UA 1FP6A 4L9WA 2UVQA 3H7AA 3R7AA 3S1AB 3TPCA 5KX5F 1RAFA 1OLUA 3QMWA 5D3MB 4DV2B 2PRKA 1NXWA 1VHLA 1J21A 3OKPA 4XGIA 2G3YA 2UZ1B 1M76A 3H17A 5JU6A 4URUR 3CF6R 3I9LA 3TJZA 3UKJA 3SWWA 3LS2A 4TYYA 1YZUA 5KJ6A 3QZUA 4GMHA 4ID9A 3WBJA 4IJVA 1ZG3A 4P5DA 1XD8A 4UJ5A 4F1KA 5KTOA 1QV7A 1K75A 3FWPA 3DEFA 1Q21A 3LF1A 4XM0A 5D3ZA 1CDDA 4JEIA 1SC1A 3SIPA 2ZPTX 5HR5A 4E14A 1VHWA 1WB4A 2BRUC 3TQOA 4UHHA 2XHEA 4OKSA 5DH9A 4BLWA 5C0OE 4YAEA 4JI2B 5CB4B 1V6SA 3RIHA 1I2ZA 2XADA 3FKQA 1AQLA 2C1ZA 3H65A 1L5LA 4ZO6A 5AJUA 3EVNA 2ISSD 3D43A 1SHUX 1YDGA 4PYOA 3NI2A 2YFKA 1SXJB 4K9QA 2BZGA 5ENVA 2A6PA 4EY4A 1QGAA 3G2PA 4E7OA 4UNNA 2M1XA 4U2CA 4XIIA 1J09A 1NAHA 2CUNA 2QV0A 4GC5A 4BLSA 3U62A 4QNMA 3QBEA 4A1OA 3S1SA 3GGGA 1C4KA 5BYBA 5A02A 3JWHA 5I7UA 3U4QA 1VIDA 3K8ZA 3MBOA 1RC8A 3M6VA 2WTUA 3AVYA 3HDTA 4YAFA 4ABTA 2FF7A 3JQ6A 1AHNA 1X39A 1XLUA 3S4YA 2FUG1 3R8FA 3H4TA 2PT5A 2X86A 2CLOB 2XD4A 2B82A 1M1ZA 4Q3NA 3E0QA 1P0CA 1KYVA 3IURA 3O1JC 1C1XA 1J2JA 4UHJA 3HGMA 4D4JA 2CXNA 2DBZA 3B5EA 1KPGA 2I9PA 3OZGA 3QWBA 4IICA 3CZAA 4CLRB 4MLDA 5C8VA 1KDVA 1B8UA 4MSUA 4V0RA 5KJ1A 3V4PB 2ZIXA 1G8JA 4EB8A 5K8LA 2VFAA 4Z9BA 1BVUA 1DC5A 1PTKA 3I92A 4Q3AA 3ESZA 1OV6A 3PE3A 4MDHA 4IQ0A 2CHVA 1JJIA 2HNKA 3A7DA 4WZAE 1YC2A 3AESA 3EY4A 5M5BA 1ZVVA 3SXUA 2VKTA 4CMGA 3M5DA 1IG3A 1ZNWA 2QTAA 4GVXA 4B83A 1JLRA 3UK2A 3Q8KA 4KO3S 1IZZA 1OJLA 2SCUB 1I7NA 2C0CA 5DTMA 5L4SA 4YJFB 4KC0A 1J8FA 1E2FA 1OF1A 2QSZA 4LIPD 1WPRA 4QXAA 3S2UA 5TMPA 2X5OA 3EJWA 2PSFA 5CFNA 2XUGA 1FSGA 5U4XA 3IT0A 3SFZA 2NO9A 2VKQA 1L5FA 3UJNA 1TO1E 2QX9A 1CFJA 4YMSA 3TBKA 2VC2B 3ESBA 3GWZA 3NVAA 2IE8A 5JANA 3MHTA 1RXCA 2VJYA 2HLPA 3ANYB 3LL4A 1KIAA 4WY5A 2HK9A 4TYQA 1O6GA 4E46A 1AK9A 4LUCA 1XZLA 1FQKA 1ODKA 4N9WA 2C9CA 3SSMA 5FUQA 4JYZA 3T3NA 2H1IA 2IUYA 3GYGA 3SBXA 1ZQ1A 3X2FA 2RCNA 3MG9A 2UZIR 5TPWA 1T5OA 1D4FA 3RADC 1X14A 3BL8A 4TMWA 2FLVA 1DX6A 2QT0A 2VP4A 4IF6A 5HF5A 5AI4A 1NL3A 4ZRNA 4R1PA 2RD2A 3HU1A 2BUAA 3H9EO 5H70A 5IT5A 5SZJA 1Y7TA 3VYUB 1UJCA 3VKWA 3ZGOA 5HKKA 3BMNB 2G0AA 2PAFA 1ZJ4A 3BHJA 3TDMA 4F72A 3PF9A 1PQWA 4K9OA 2HL6A 1H42A 2ADMA 3JARB 3LVQE 3DLCA 1ORHA 1V95A 5LKAA 2QGNA 2A14A 4Q02A 5HKBA 3G13A 3DMNA 2W2TA 4BU0A 4JLDA 3G0HA 1Z4MA 1SCDA 4OGFA 4IYJA 1ISHA 1LKZA 4L6CA 1G7SA 1UJBA 1GGNA 2ZUBA 4D4KA 2JFUA 1Z6YA 1V8PA 1OYWA 3Q12A 2IS1A 1VB3A 1IJBA 4DT1A 4IZHA 2NUTB 3EVEA 4H4CA 2XYGA 3TXAA 1JWBB 4PO1A 4PC6A 2FW7A 1W7AA 3MWDB 1ZKDA 2FW1A 2UZ0A 4CIYA 1G21E 4IIYA 5EHNA 1W19A 5NULA 3ZZTA 2IZ0A 3OTIA 4Y2TA 2DFPA 4Q7JB 3OT5A 3TNYA 2Y2UA 1ZK4A 2IBMA 4YCNA 2GJ8A 4GPEA 3NJRA 3FRHA 1OHHD 3JQAA 1U02A 3IAHA 1ZIDA 3VRHA 5KSOA 5AM0A 3K70C 3JQFA 2IV2X 1W8DA 1JDTA 1T0IA 3LOUA 4G56A 1ZZEA 4F6RA 3WHPA 1AUPA 1YE3A 1A9PA 4JXKA 2V8BA 3HCEA 3ADKA 3IBFA 3V42A 1KERA 4GE3A 2DFKB 4Q4HB 3IQWA 2EAUA 1EI9A 3QKRB 1TRKA 4FI3F 2O19A 4BEVA 3VMMA 2E4YA 4GBED 4HT3B 2QGFA 4Y6RA 1NW6A 2CXQA 5AVKA 1M3SA 3SE7A 4YALA 3JARA 1I4EB 121PA 2WIJA 3ID6C 1HDXA 3ZY6A 2BFFB 3NHZA 4KRYA 3ZV5A 3HG7A 4LBWA 5LOVB 3PQ7A 5HRCA 1L8QA 1VBNA 1JEQB 1J33A 3TNLA 3I1JA 2BVNA 3HJUA 2PPLA 2IITA 5AKXA 4EJMA 1CZKA 2YXEA 4E7PA 2XB2A 2CK3D 4NR0A 5DULA 4HLUA 1PGOA 2XXJA 3Q9SA 4PWZA 1CUYA 4J3NA 1YVRA 1XRJA 2A59A 4F4DA 1E9SA 3PLRA 1MMFB 3Q5DA 3ZDFA 1EDEA 1OZHA 5ER6A 3OIFA 5KAPA 4BV2A 1RJEA 4UU8A 1VIVA 1P3DA 4H1UA 3EPHA 2PA3A 3TMAA 3BD8A 1N6OA 3H18A 3I73A 5DGIA 4MWCA 4ZFNA 5I4IA 2PWPA 4B6QA 2PJZA 3OZSA 2HQ1A 2VA8A 1G38A 3K0KA 4ECEA 4YV7A 2HNBA 3UUGA 4G9GA 5DP2A 1N3IA 3R6GA 1FOEB 1DDIA 1DQNA 1JP7A 4KPUA 1FRFS 3ITKA 1XDGA 5LXTF 4CT4B 4EGAA 4PSUA 1ZH4A 3MWEA 2O8BA 1YNOA 2J7PD 1QVWA 2GASA 1IVYA 4BN0A 5KNBH 1FSSA 2J9YB 2KMLA 3O8DA 1MV5A 4YP1A 5KTNA 5AVZA 2AG5A 4OJTA 4PTZA 4FPXA 4YPOA 5ALSA 1A9ZA 3IJPA 4YVFA 5ALDA 2R25B 1V47A 4D0LB 3S55A 1L5HB 4FHCA 2ZDQA 3D6MA 4EG0A 2JHCA 2ZT5A 3HBAA 2R11A 3SQWA 3R5SA 2FZEA 4E5NA 4KYVA 2OK7A 4E08A 1E3QA 3NRCA 3IIKA 3NXSA 2YZNA 4ZC1A 4RM3A 1HE4A 4CKEB 3IDZA 4P3OA 1K8RA 2UXDB 1JB9A 3ADDA 4NMWA 5HVNA 3WK9A 1DQYA 3V32A 3REOA 3CINA 3HDJA 4MTLA 2FB9A 2QUAA 1Z5UA 3R3ZA 4Q48A 4CL2A 2X2PA 5EJ6A 3H2IA 1OI2A 1NVVQ 3FJOA 3N58A 5K3CA 4PN3A 5A5VA 4PNEA 5BPFA 4UXHA 2WJAA 2WQZA 5H3HA 3BF7A 4BRWA 5JNUA 1QP4A 2WMYA 1F0YA 1PEYA 3VR2D 3H4MA 5ILOA 4NEHB 4XYMA 5TV2A 1I7PA 1NVFA 1QGYA 1W9HA 2JFXA 4PZDA 4Y2RA 3PFFA 3LQKA 4EA6A 2O59A 3R0IA 4L4XA 3LC1O 5EIFA 5BSHA 2ADFA 4QUKA 1KORA 2DSNA 3INNA 2QMUA 4DXDA 1BYUA 4AMGA 4MEBA 5CXUA 4EPWA 5JPCA 3VR6A 1BJTA 2AEMA 1NNSA 3NBXX 5JW6A 2B3DA 2BC9A 5SV2A 4AS1A 5KHOC 1NLMA 2I54A 2YHAA 3GZJA 3RHSA 1W1IA 2OCXA 1USKA 1L7DA 2POQX 4OB7A 1T4CB 2ZBPA 3TLJA 1TF7A 2FPKA 3G0CA 4NARA 3GVIA 4RQBA 1UJ2A 3VVBA 4TYWA 2N1BA 1WMSA 1BIFA 4BNHA 1Y33E 3CO0S 1ZOOA 1U5BB 3JQFC 3V97A 3MM4A 3TI9A 3D6JA 4JLWA 4L4ZA 3ZU5A 3GFOA 4TTSA 3PENA 1M8KA 1PAUA 1T0BA 1XEFA 4DA0A 5F1PA 2H08A 2OECA 2O8DA 4TLDA 4MWDA 1E64A 2NYUA 4MEAA 5IBPA 5BQ3A 2O4UX 1VPEA 3DZBA 3GHHA 3U7IA 4LCJA 5L3QA 1OXXK 1JU4A 5I7HA 3CPSA 3V6LA 2NUPA 5CVUA 2IYRA 3EYAA 4ARZA 5D1HA 4FB4A 2WWHA 3LUKA 2H2FA 3MUOA 1N6PA 1TJ4A 4H3VA 3KKKA 3W6ZA 1SHKA 4AY2A 1GPYA 2FUEA 1SOWA 2FSUA 3CLRC 1W36D 4RIHA 3GNTA 3LAWA 4QYMA 4Y9DA 1JTEA 1N5DA 1QH8B 3V4OA 3H97A 5CTJA 4HDNB 1EDOA 4JLBA 1ZOIA 1EHCA 4RDHA 1SCNE 2CK3A 3KYDA 2EKZA 4BECA 1Q7GA 2AFRA 2NV2B 3OIYA 1PLLA 1VI5A 1KZGB 1WF6A 2ZU6A 3D3WB 3FWNA 1Y5IA 3RYIB 2Q5FA 4JLKA 4EW6A 2HKIA 1GGHA 3WJ1A 1CC1S 4LVOA 4UE3S 2BTEA 2I4TA 1ZJ6A 2O8EB 3FCEA 4TKZA 5B7QA 3IMCA 2X4GA 4OA8A 4INZA 4MV3A 2O4CA 1DBPA 2BH2A 4ILKA 2CNDA 3W06A 5C1IA 1E2KA 4DDKA 2Q5HA 2OSVA 3DSRA 1PVDA 1R0CA 1Z2DA 4GIBA 2Y99A 3EZYA 2DWQA 1N3YA 3PXAA 3DR3A 4G5FA 4R9RA 5FNVF 5JCPA 1OKKA 2VHJA 3L7NA 1T1IA 2Y1GA 4JROA 4RIGA 2HIAA 1RFLA 3JZAA 3ZQJA 2W6IA 5ANRB 1D5WA 1R37A 4WSOA 3PA6A 2HY7A 3IEMA 2HLNA 4IPTA 2CB0A 2QX4A 2LGJA 4MWBA 1QTIA 4FR5A 4P80A 4RXTA 4YK7A 1IZYA 1BEUB 2DPYA 2LKCA 3I0ZA 4G2TA 2NUPB 3DH0A 3PC3A 4R2MA 1RPJA 2BR3A 5BSRA 5SYAA 1KNQA 2ORVA 3BZBA 2HSDA 4ROSA 4S2UA 5EJAA 2YTZA 4ND5A 4KXXA 1SCUA 4NL4H 4ZHQA 1UIMA 1NBMA 4YASA 4HC4A 4RTLA 4X1KA 4Z7JA 3QVGB 1U3CA 4YI5A 2YHUA 3EFHA 4X7MA 1D0VA 4CUJA 3DJFA 3WMXA 1DAMA 5ILGA 3ZLUA 4DNQA 1NNUA 1GKKA 4E6PA 2ZIZA 2WT9A 1LDEA 5REQB 2F90A 1C2TA 4G5QA 4G89A 4P4UA 5FQNA 5AOVA 3KVOA 4IILA 4ITRC 4DRXB 2EZ8A 2OCYC 5HF6A 4RDIA 3TRKA 3VPHA 1M2WA 3NVDA 3K0SA 3CVUA 2R1UA 3ZCXA 1VL0A 1W85B 2LWIA 3BREA 4MOWA 4OYRA 4QRIA 5HQJA 2Y27A 1R4ZA 4GP9A 2CVZA 3ZWVA 1E59A 1GP2A 1P0IA 1KJZA 3UHFA 1UOPA 2QNBA 2VHVA 4EZEA 1U2GA 3K9LA 2H1CA 4YMVA 5BUSA 2QENA 2E1PA 4JGIA 2GM4A 1IQ0A 4P98A 1MJFA 3UK1A 4RESA 4TTJA 1BWPA 3D7RA 3NHPA 1BHSA 3J81k 2IH4A 4MB0A 4RQAA 3E3NA 1O3YA 2QXTA 3O0DA 5G0TA 1GFSA 4G0WA 1U7HA 2DHDA 3ETEA 3NP7A 3F3MA 1NN1A 4AZVA 2P91A 4YCMA 1D0SA 3OA0A 3U2QA 2HA7A 4R71A 4FYJA 3L04A 1WVGA 4TV8A 1OSNA 3OFSA 1DUVG 1JLSA 4IDNA 2M6RA 3DMTC 3LBIA 1M1YA 3QEKA 3VXKA 1C3XA 4ZAGA 3RLIA 2PMDA 1S2GA 1TO2E 3GJ5A 4KFRA 3VPSA 3S1AA 3T3PB 5BWBA 5KNCA 3WAGA 3SF8B 1YKSA 1GCAA 2FHSA 3DC2A 4OQ4A 1IZ0A 2IH5A 4IDQA 5H80A 3QSGA 5FBLB 4EJ0A 4Y2HA 3UVEA 2EQAA 5JIBA 4WZBA 1TECE 2X42A 1SD2A 2WVAA 3WFIA 3PBKA 3K4QA 4ZKEA 1A2OA 2DH6A 4TV8F 3L05A 4Y2SA 3TTXA 2I6GA 5HMLA 3MCVA 5FCDA 5B36A 5BSFA 2PZLA 4GM0A 4YCDA 2EFCB 5E9QA 1ZRHA 2G82A 1HQKA 4Q5IA 7ABPA 3UOGA 1JKJA 4TWZA 3WGJA 5F7OA 2D0OB 4RTNA 3LDUA 4RV5A 2JEOA 1JQBA 2CNOA 2VZ9A 3MUFA 4QG7A 2PQ6A 3B70A 1T0PA 4KMRA 4E5YA 1J22A 1NDHA 3D6FA 5KQRA 4RKWA 1FU8A 3NHRA 2MSLA 1E2JA 2HSZA 2PTGA 4HB3A 1GAXA 3DTVA 1WPQA 2ODNA 1E92A 3CRZA 2H11A 1NVEA 3R3WA 1D7AA 2P6MA 4LDQA 4WASA 3W34A 3OOSA 4E15A 1KVUA 3LA8A 3MERA 3OJWA 4XXHA 4L0DA 4DBLE 1H2AS 3O2SB 4JVOA 1MQ8B 4W63A 2C2HA 1DKLA 4EFLA 2OO5A 1ZA2A 1OLXB 4P31A 5JQGB 4NK4A 3GA0A 1JVNA 4MRPA 2KQUA 3DUFB 4N65A 1BS2A 3L4BA 3PUIA 3WNVA 3R8XA 2C20A 1DXHA 2W2KB 1BGVA 1E69A 4HNAB 4TKUB 5COQA 5AVJA 1YHYA 3R4CA 5DISB 5IFLA 1UEIA 3BQMB 3JVUA 3A3YA 1BMQA 1M74A 2OBFA 4HH0A 4I6EA 1B8PA 1E89A 2FWPA 3CNBA 3Q6MA 4JIMA 4OQMA 3B1FA 3OU6A 2XGGA 1T6YA 4LJ4A 4OHUA 4CDNA 1GGJA 1SCBA 4YGXB 5ECDA 1J8MF 4AJHA 2FSFA 4KEAA 5CR9A 3GDWA 3MYYA 3HWSA 1YS2X 2E4AA 4E5VA 3JD2A 2PMKA 4MARA 5IK2D 2Q1WA 3UG7A 2I4RA 1P4AA 2RB4A 3BG5A 3OJLA 4UD6A 1J2EA 4BNDB 2GESA 5KDLA 3OE7D 1U0BB 1MAWA 1JILA 2DVMA 4OQDA 4G4GA 3WBKA 4CM8B 721PA 2CXPA 3I2GA 4HNVA 2ACWA 3GFTA 2YV4A 4KQ9A 4KQ6A 1WDMA 4A23A 2YFYA 4QHYA 5BMVA 4GOKA 4R8KA 1OZFA 2QPTA 1Z0ZA 4XD2A 5TS2A 3SHFA 1O9GA 5AI6A 5L3VA 1RCTE 4MYRA 5EINA 2G6TA 1PR5A 5B3JA 3UWMA 4EF5A 3TRIA 1I10A 3MN1A 4FLMA 4B81A 3I6BA 4F7DA 2QRMA 1HO3A 821PA 3KQTA 1E9RA 3EHEA 4AUMA 1K6XA 5DPMA 1XK6A 2D3WA 1VKJA 2ZB4A 3UMSA 2BKEA 1H8HD 3I72A 3N2LA 2V65A 4MP8A 1N7HA 4HD8A 4RUKA 1EDDA 2BDEA 2UV8A 3RANA 4QRHA 1J42A 5M29A 1VPLA 4AYXA 1JHUA 1GARA 4Y2QA 4ZAFA 4CGZA 4N7JA 2DJIA 4XGNA 2JJ2D 2CC2A 3H4VA 3TS1A 3USES 3DT6A 4QGAA 3ZHOA 1SUFA 4BZZA 4MQFA 1UBOS 3I9V6 2PUCA 3NMUF 4H3KB 4LF9B 3Q7RA 1YJCA 1DCFA 1UP6A 3QVTA 1Z35A 1NBOA 2P3OA 4PX3A 3M2TA 4GSLA 5EXTA 4E1BA 4I5DA 3E18A 1JS1X 3UK7A 4OJQA 3FHTA 1MJGA 1BDBA 3B1JA 2BFOA 4CN8A 4Q7QA 2G76A 3Q3HA 4Q1BA 4ZVQA 3BH6A 3OEHA 4JB3A 4NMXB 4ZP1A 2FWRA 1H4TA 3ZCQA 5DP1A 1NOIA 3WKDA 5E6RB 2QUIA 2A9KA 5JH7A 1E7RA 5LD2C 3DFKA 4KG7A 3EGXA 4B09A 2PNFA 1H5QA 3DL7A 1TF2A 4QOEA 4WMLA 5GWXA 3ZK8A 4B8WA 2O52A 3LM8A 4ZYTA 5IVIA 1ZM7A 3A0RB 3F6SA 4NU6A 2ZUFA 1H9BA 2QN3A 4XWWA 2I8LA 4MQ5A 1M7HA 2Q46A 3SM3A 1QGOA 1ZD9A 4C20A 2X40A 3KQLA 2HMAA 4BO4A 2ZR7A 3MWJA 2JFYA 3Q9UA 5FTMA 4K6HA 2Y05A 1RM3A 4LE0A 3WIOA 1XKXA 2BBWA 3PV0A 4UFOA 4XAQA 4PLZA 4AI6A 3DULA 2HF2A 4UU0A 5EP2A 4RHTA 1SCQA 1TTPB 1WULS 4Q3CA 3QBTA 1JG1A 4PV7A 3UB2A 1SA0B 3ECSA 4IOKA 2VATA 4LVCA 2ZB3A 2CLHB 4PICA 3T3GA 1JFSA 1QF6A 3ZK7A 5FV7A 3AUTA 3K1TA 1KEZA 1OLSA 3DWGA 1UBJS 1ENPA 2HHHB 1U04A 3ZHQA 4A03A 2L2QA 4GT1A 2R4QA 1R6AA 1A1SA 3C7AA 4DA8A 1NKVA 4KITB 3G2OA 4DCSA 5L4LA 3AF6A 1FNBA 3GQBB 2YOGA 2WQ6A 5JMPA 2J5QA 5EWJA 3KOWA 1PD1A 4FCTA 4BEBA 1HNWB 3DM5A 4HGRA 2XBMA 5DXJA 2GPWA 1XXHE 2DCMA 3IKMB 3OD5A 1F6BA 3TFQA 4RD4A 2I55A 5KX5A 2BSQA 1Q15A 2VDLB 3QFHA 1W1UA 1Y82A 4O29A 4E32A 4M4SA 5TRTA 3KHKA 2VR1A 3JAWB 1JXQA 3FCCA 2D4HA 1EG7A 2AEEA 3SKYA 1Z7WA 4AJ4A 1DC6A 5BV1A 4X6UA 4MJXA 1QTRA 4R05A 3CYFA 2IU4A 4UM9D 3P9QA 4U8GA 4BWVA 4EMBA 3OCWA 1T9GR 2IZ6A 3NNSA 1C4XA 3TMYA 1ZRNA 2PPVA 4BMYA 2YUTA 1O9HA 1QNFA 2WD7A 3FPJA 4DLYA 5IWCA 2OBBA 4KIWA 4N3BA 3OHMA 5AKLA 1BE6A 1XVAA 2FSIA 3IB6A 4UASA 4C01A 5C53B 1CYEA 3DD5A 2X8JA 5JXIA 1IG0A 5K99A 1YZHA 1JHAA 1I80A 2PZAA 2YZ7A 3MCAA 4M21A 5T5QA 5SY9A 2GM3A 4WIAA 4BNUA 4C0SA 1TVMA 2QTCA 3K32A 2OD7A 5T4BA 3HA7A 1M0EA 1I1NA 2OGZA 3W5SA 1Y3HA 2VP2A 5FAXA 3SIXA 4B84A 3LX6A 5F52A 1MR3F 1QH1A 1CLEA 2C2YA 1MU0A 3F7OA 5DGHA 3G1TA 5KVAA 1B15A 1QQ6A 2F6RA 3FOEC 2R86A 3NS7A 2DKFA 2PUHA 4EEXA 1MB4A 1DDGA 1DKNA 2AMYA 5CDHA 3DHVA 2QPLA 2CHUA 1UPFA 1K88A 1SVWA 3FDZB 3FNGA 5DN6A 5ARBA 1IJEA 4HGOA 1ZMBA 3SR0A 2QQGA 4PXSA 2PQMA 1ADYA 2FX3A 4NAUA 4LDRA 5FIUA 4C03A 4CM3A 2E82A 2H7VA 4GP7A 3LBHA 4ZVNA 3CLTD 1FLDA 1K2WA 2O7QA 2KM1A 2GILA 4CCYB 1BEZA 2XMQA 2DPXA 1SY7A 3W2HA 1XTIA 1H6BA 2JFGA 1LLCA 4H08A 1H9AA 4HUJA 1UBLS 2XA1A 3KL2A 2P27A 4JGBA 1GDDA 4LZJA 5DWQA 1OASA 2YJNA 1L5RA 2FOIA 2PKEA 4ZU3A 3JD4A 3DE4X 1TFUA 3EIUA 3KKOA 4C1BA 4O4HB 1CR6A 3UZUA 1D04A 1ZMOA 3ZR4B 3IHKA 1E9EA 4EYQA 2ET6A 4YXFA 2YBDA 3SS8A 4XRRA 4CFSA 3AC0A 3FXAA 3U3MA 2Z30A 4ARUA 4LMRA 5FJIA 3E7PA 1DSSG 4EAQA 4JLJA 1SJ9A 5DDIP 3MB8A 1XMXA 5A5EA 4NYJR 3N2EA 1J49A 1SZPA 1JHDA 4MZXA 4IV0A 1XLWA 5JOQA 3CX4A 4DY4A 1ARZA 1PVVA 4AN0A 3TCXB 3GLIE 5LQAA 2EJBA 5JNRA 3OWHA 1PW5A 2VP5A 1KMQA 3FVTA 3R6WA 5ALLA 3TO5A 2CJWA 1ZJJA 5KQSA 4G65A 1OMOA 5G41A 5FUMA 5F78A 1HFJA 1E6CA 3H6GA 2ZR0A 5EE1A 3G85A 3L7LA 1QOZA 2QG9A 4JYMA 4RIEA 4FHGA 5A2QA 3CNOA 2OV6A 5FEUA 5IJ9B 2W2XA 1JA1A 2ISCA 2MINA 5DRTA 5JD5A 4QBGB 4LV6A 1O94D 1V39A 1T9ZA 1Y4ZA 5AJHA 1EVZA 5LJIA 2GYWA 4K9NA 1NULA 3I2FA 2QRUA 3WHIA 1P60A 1W75A 1ZFNA 5G0VA 4XDGA 1Z6AA 3DXZA 2OHJA 3KDAA 4RK4A 4FE7A 5I9LA 2EKBA 1I9GA 2FR0A 3SVZA 4Z7OB 2HF7A 1G21B 2L69A 1DJMA 1O0SA 2W4QA 4TT8A 5LYJF 3BMCB 4I9UA 2XT0A 3MWEB 4EHLA 1PW7A 4UUPA 1XZIA 5DCWA 1A7KA 3O4GA 3E9EA 4D5GA 4KX3A 2JK0A 2LBPA 4IRUB 3FAKA 5JAZA 5BR8B 3WL3A 1Q2XA 3OZCA 2E37A 1CRZA 1BS9A 3C85A 4M1OA 5I8WA 1I13A 4B43A 4Y18A 4OI1A 5T7BA 3DS8A 3KLPX 3RFCA 1V6CA 4O4IF 3HHEA 1RWPA 3HXKA 5K20A 2OBMA 3AEQA 4KR9A 2FSVA 1X2BA 1M0WA 3EMVA 2AB0A 3T61A 2PSHA 2Y8EA 2WAAA 4P2GA 4GX0A 1ZUNB 1SVOA 1N8TA 3K3PA 3DE6X 4JVMA 4L27A 4TLLB 4WZBE 1ORIA 1TQHA 4W1SA 4U39A 3K4PA 2E1RA 1PT9A 1HTWA 3OOYA 1N6LA 3GAZA 1FNSA 2GETA 2IV7A 3BXZA 3U7EB 5HKAA 3LFTA 3TLKA 4CG1A 5G1PA 1T8SA 5AM2A 1LC0A 1LTHR 2DWUA 1ADBA 3C5CA 1GUBA 2W2NA 1WHTB 3TTVA 1NFQA 2HU7A 1AS0A 1X1RA 4IMRA 3DZKA 1WQ1R 2ZTSA 5JADA 4OXRA 4FBGA 3KVYA 1Q22A 3GGSA 3QF4B 3AF1A 3DTVD 2GPYA 2IL1A 5BT9A 4CIAA 3K09A 3GFRA 2CJXA 5CA1A 1Z62A 4PGMA 5JPDA 3AKZA 2FKNA 2G9NA 4AW9A 5EHGA 3WLMA 1JH8A 3ZY5A 3FTNA 4G84A 1WQ3A 1YE5A 2WYOA 1GPJA 2ABWA 3HWRA 4ZU1X 4ESOA 5IVKA 1Q57A 2Q7XA 5FA6A 2AWOA 1EAMA 4MEJA 1LI4A 2FQYA 2IW3A 2GR9A 3F74A 3HP7A 4HN9A 4N9QA 4AKSA 5IJZA 4CYMA 2KLBA 3G5TA 2VDMB 3QOFA 3ZJ5A 3GDHA 4UE2A 1T9AA 2XAUA 2EEZA 4JAVC 1RMYA 1T26A 2A1TR 3AF2A 3FR8A 4KXFB 5BNIA 1F7UA 2WFLB 2PKXA 4ICIA 3T52A 3BXGA 3FTDA 3TR0A 3KQHA 3MWKA 1VBKA 2YJ6A 3ZVRA 2OQ2A 2XZLA 1BJKA 2C03A 3KKQA 3U6BA 1AC5A 1F4PA 2RGUA 3JZDA 3PYMA 3WMEA 3F9RA 2QIPA 3G89A 5LLSA 2V8OA 3C3BA 1ENYA 1YO6A 2WMNB 3CISA 4FNAA 4D4MA 1PDWA 1SU8A 1GNRA 1E5XA 3PHIA 3PGVA 4TV8B 1U8FO 3BMCA 3NBMA 2H1HA 2YCLA 4JC4A 4RVDA 1KETA 3PNYA 2PANA 3HB5X 4HH3C 4HLCA 4A2PA 4O59O 4Y2GA 5IN4A 5K03A 2AN4A 3LPLA 1C7QA 5LXTA 3I3SR 1XRMA 4PNHA 2AFIE 1ML4A 4H7JA 4PYIA 5DHTA 5SZHB 5MGNA 5JYBA 5JNTA 2EFEB 3KL4A 1I9CA 3R3XA 2FHPA 3SSOA 2JD1A 2P0EA 1WBDA 1QIKA 5CCEA 2Q07A 4G36A 1QOPB 4WK2B 3BWYA 1U7XA 3G2MA 1QANA 1VLMA 2X77A 1SRQA 4CT5A 2X1MA 1ZMXA 5I7FA 1J1ZA 2XUZA 1RHJA 4BFXA 2JIOA 1P9LA 1C30B 1A04A 4K88A 3HJAA 2D0PB 4HYEA 2GKGA 3ZEAA 3PHLA 3RB8A 3EIQA 1RZVA 3BMQA 4X1OA 4DCMA 4WBNF 5HRUA 1MOQA 1W88B 5LQRA 3ECCA 4P22A 4HQNA 5IULC 4A73A 4HY3A 1EQUA 2Z98A 4RA9B 3GNSA 1P1CA 2Z6VA 2FZVA 4TROA 5E4FA 4ECAA 4HNSA 4MQBA 1WPXA 4R81A 5CG1A 1GA6A 2NX2A 1O96B 2W11A 3G9QA 3AHGA 4MINA 4OFXA 2I1WA 4I9NA 3VX4A 4A8JB 5JATA 1WMDA 1WXIA 2I34A 5KOHA 3U56A 1V1MB 4KPGA 1NQ5A 3GZNA 1R0XA 4JQSA 4KXMA 3ITNA 1P1RA 3LGSA 1GL9B 1KQOA 4O4IA 4FUQA 1A96A 4AIRA 4LXTA 2CBGA 5K7SA 1WKCA 2AZDA 1EAYA 4QAJA 5IXSA 1QMGA 3RO7A 5LYJB 4BFUA 2ETXA 2FH5B 3GR6A 3I2IA 2D13A 3DUFA 4XFKA 4URYR 2GPTA 2LIPA 4XWKA 3HDYA 3BRQA 2NP6A 1BHQ1 1UANA 4OAQA 4RH3A 5TF4A 5CT9A 1RMQA 1QQ7A 2GM5A 2YOFA 2ZIGA 4AX8A 1IMJA 2NYVA 1NN3A 4WOBA 3KSUA 1XZQA 1M2VA 2LUOA 1HLGA 3D02A 3JYLA 5C4GB 3VPXA 1E2BA 2Y0CA 5KQMA 1CE8A 1PGJA 3F3KA 3U3DA 3HB1A 5F3DA 3TW8A 1AKVA 3KC2A 2HT6A 4BO2A 3DLTA 3UXEA 4Y6SA 2H8KA 3Q2KA 1KDPA 3HCNA 2RGNC 3ORHA 1IEQA 5FOTA 2XCLA 3EGVA 4WJZA 3DOCA 3PQ4A 3GJQA 1EP1B 2HMTA 3CH6A 4OHPA 2X23A 3RODA 2AXPA 4I4LA 4YAKA 3IAM1 5KVCA 1M2GA 2PWBA 3ZZ1A 1GLVA 4E30A 1KOGA 3QFCA 3BRCA 4MRRA 5B2ZA 1TKBA 2IY7A 1OW3B 1CEYA 2DE0X 1VJ1A 3UXMA 4Y30A 3RSFA 3SYLA 4A3SA 3VGJA 3KQVA 4LSWA 4MAAA 1U3UA 2CF6A 3D8SA 4I4CA 3IRUA 4JJFA 4PQYA 1USVA 4WAUA 3ODPA 1JZSA 3D31A 1PR4A 3KO8A 5CT4A 2A5DA 5DYGA 5TS3A 4YFVA 1Q95A 5F1YA 4W5NA 1GCOA 1PNRA 3LT4A 5DCUA 3UUFA 5BNTA 4AUEA 4CTNA 4DC9A 3BGWA 1E2IA 3N86A 3W79A 2VP3A 3LLSA 4XH9B 1IMOA 3IKVA 4G8BA 4OSPA 2PEYA 1V7PC 4KAFA 1FNNA 3T4EA 1B3BA 2VI5A 3KFXA 3S2IA 1UKZA 2H92A 3S2ZA 4REMA 4YWJA 5FPHA 2A0UA 3HYLA 1KEVA 2PA0A 4JELA 1LRKA 4FHEA 1GR1A 3CMCO 2PLFA 2D5LA 2NLOA 4L95C 3KSAC 3BXFA 1J2TA 4QC2A 1L4KA 1NPDA 2EU8A 2FSSA 2ZYIA 3K0EA 2OORA 1IQRA 5EMHA 4C5CA 3BXXA 1DX4A 3H8WA 1YJXA 2XD9A 4UCXA 3RFXA 1XKQA 1Z7GA 3WP1B 2VPIA 3KZXA 1EM8A 2FMXA 3K0AB 3BFPA 3BICA 4R2IA 4EEKA 3OZIA 4RK5A 1RYEA 3OZTA 4YAWA 2H59A 1NY6A 1YHZA 1JKJB 3AM3A 3HA5A 5FOUA 1A9SA 4DQLA 3AVTA 1W0JD 4YRGA 1G8AA 4HFMA 4XGRA 4AKTA 3U26A 1BQEA 4V0QA 4PAMA 3D6HA 1XJCA 4ZAYA 2IXBA 1NWHA 2CFCA 4NY1A 2IGTA 4RADA 5IKOA 3QK7A 3WNZA 4B74A 4ZYYA 1J1UA 4F0JA 2EHDA 3CXRA 4KSBA 5KUTA 1Z5OA 2AK2A 4WLNA 4KWIA 5DM70 3ZUPA 4DUGA 3IJEB 1FU7A 3ZHVA 1S3SA 4Q3KA 2YIJA 4X20A 2D00A 2D8AA 5E7JA 3WOVA 5TT1A 2OOKA 2R8YA 4HB0A 1REQA 4JLNA 4XLLA 5LQNA 2J9ZB 3WA7A 4FONA 1UWVA 2BFMA 2JAWA 3NGLA 5H16A 1RYNA 1T36A 1TF5A 3ZGXA 1FDIA 1WLSA 3DE0X 5J3JA 3EXAA 3JZIA 1N5JA 4RJ2A 2ZQZA 3ZG6A 3ER6A 5CD1A 5HKKD 1J9EA 3TINA 3WNCA 1KTIA 3UJCA 3D8NA 3FZEA 5F64A 2QZZA 1ZY2A 3QA9A 4GHWA 3VUEA 4EJSC 3ELYA 3FKSA 2NU9B 1U2RA 4FZ3A 3AUXA 3AXSA 4BUZA 1XLTC 4DWVA 1Z2OX 2Q5QA 5A1TA 1N7IA 1G4UR 2NU6A 2XWSA 3E48A 1U1EA 2JVIA 4Q7LA 1UBCA 2WJ4A 4A4DA 4M3NA 1ABBA 2F8SA 3QH4A 1OT3A 3IILA 2R6ZA 1QKKA 3IALA 1MVLA 1PKEA 3PVZA 3HV2A 4MV9A 4CNBA 2OGTA 2X7XA 3LX4A 3RAFC 2BHTA 3VUFA 1CIVA 2IT1A 5JC1A 1N5IA 1QZXA 2GTIA 3M3HA 4S04A 4CGYA 3HJFA 2PGIA 4UOZA 4FN4A 4PU0A 4BE4A 3UBTA 4PBSA 5CB4F 4NS1A 1D07A 2C88A 1O6CA 1K8XB 4I3HA 3GLGA 1JHVA 4KFSA 4PANA 4PR0A 3PXBA 4PC3A 3LVFO 2GF9A 2YVLA 4O4JB 5CK4A 3E3LA 3U4AA 3KELA 4LF8B 4OI0A 1GGKA 1BA3A 1ZJZA 4FEYA 5IC4A 4RAQA 1MHTA 1E7QA 4X3OA 4A6DA 2A9RA 4P5EA 4RMHA 4I1VA 4ZCMA 2PRYA 2N3ZA 2Q9AA 1TVKA 1ZM9A 4EGCB 4PZLA 1YFJA 2B6NA 1JZQA 2ZB8A 4GLBA 3UO8B 5G4LA 2DQ4A 1M2OA 1WCIB 4IL5A 4O0MA 4OREX 1CUDA 5F7JA 3BDIA 4B6FA 1S8FA 3HU5A 4NE2A 3UAVA 3EIXA 1PR1A 1OH7A 1JHOA 3QX8A 4UREA 4EYEA 5BWOA 4JSTA 3F4LA 5JZ9A 1XMOB 1Y7LA 1X7YA 2OCPA 1OV4A 2MSNA 2VRCA 4OATA 4XFDA 5KTSA 1GAJA 4MUYA 1E9AA 3B6EA 3LC7O 5KYVA 3BJZA 2JZNA 2O7SA 1GNSA 4LRSB 2OTCA 4PCUA 1ISPA 1EVJA 1HG1A 1AHHA 4FC7A 5TY0A 4OU5A 3CSUA 1ESMA 1BU8A 5KPJA 1JR2A 1LSUA 3PE6A 3PVSA 2BT4A 4BVKA 1GD1O 4MWZA 2OXFA 2YWGA 4O4HF 2ZE8A 4EELA 5FTLA 1ZGBA 4FFDA 1RRGA 1ZO8A 2P6OA 2I7VA 5FD8A 4O2AF 1Q91A 4I4TB 1NOKA 4FFNA 4URXR 1YS4A 4H7EA 3GJ3A 3HJRA 1TEVA 3UC9A 3IH5A 4M0EA 2YKGA 2W7TA 4F97A 1UDRA 1PD0A 3U48A 4MR8B 4AUNA 1TM1E 5LQJA 3G8CA 4QWWA 2DBYA 5EHZA 4NRDA 1HE3A 1T0HB 1V71A 2JFPA 3WFZA 4BNWA 3FPEA 2H1FA 5I7AA 2WG2A 4C21A 4LHXA 1B0ZA 5EFOA 3OY2A 1Y1TA 4M1YA 3DCYA 2ZT8A 1CB7A 4YUXA 3NWEA 3NHBA 1S5PA 3CUUA 2OVBA 3TOCA 2ZG6A 1L4EA 4GI2A 4B47A 1KIFA 2RC5A 3H5TA 2XMPA 4AMBA 3QTLA 3ADBA 3TTYA 4ZYXA 4EY7A 4A16A 3KSBC 3BCUA 3ZW9A 3PTAA 1L4HA 1QE3A 3L7DA 1ZL2A 2AN1A 2XGJA 2GHIA 4JT2A 4ME6A 1GYRA 1I24A 1XZDA 3IPXA 4HNRA 4IDBA 4N5LA 2FQ1A 4K6OA 4EDHA 1HMYA 2P1RA 4NZPA 2XJ4A 1RI4A 3B82A 4KQMA 2R00A 1XXLA 5HOEA 2ZI5A 2G9ZA 4ZOCA 4QECA 3OFND 2ZTMA 3EXIA 1IM2A 1F14A 2PT7A 3G9XA 3SLRA 1DBQA 1NIJA 1I3NA 3DF7A 1PG0A 3CMMA 3EFEA 4X24A 5BR4A 3ZBUA 1FIUA 1FMTA 1BVYF 4IIGA 4ZO9A 1GPWB 3A27A 5HA5A 1KZ4A 2Z3VA 4OGLA 2F1RA 4K3VA 5JHHB 1KYQA 1H65A 2FOLA 4JI1B 3E7XA 2ZZKA 3LKDA 3FPKA 2J9FB 1RBYA 3BJEA 4AQDA 4YRKA 5DCYA 3L1HA 4ACAA 3V4SA 2QAGB 1MO2A 2W8BB 4U7TB 4DZRA 2V0NA 5ITSA 4DIEA 2IFTA 3VPFA 1C3EA 2H3EA 3IMFA 3QXJA 4KDCA 5E6SB 1T5HX 5IEBA 2Q3BA 2R8RA 3KUXA 1R4AA 2QYOA 3E9MA 4AP5A 5J2UA 3LE8A 4CKCB 2PQ0A 2FCRA 2K7ZA 4OQPA 3GLVA 4U0JA 1KJ9A 2QLLA 4CM8A 1U9YA 3AHEA 3CWCA 2RI6A 4I1OA 1AVTA 4WCDA 2OCGA 4DV3B 1IOZA 4G24A 4KQJA 3UWSA 2J5KA 2XUAA 5I9IA 1VDMA 1RJ9A 3KTAA 4HNHA 5AJVB 2P78A 3DGEC 3ROTA 3DHEA 1RYHA 2I6XA 1HE2A 2ZBDA 2VHTA 2EFHB 2A7QA 1I1QB 4CU2A 3AG5A 3ZWBA 1GTMA 3QEBZ 2SHKA 2A3NA 4L5JA 5ILQA 1OBFO 2H2HA 3IO3