2DSTA

Crystal structure analysis of tt1977
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
122
Chain Sequence
RRAGYLHLYGLNLVFDRVGKGPPVLLVAEEASRWPEALPEGYAFYLLDLPGYGRTEGPRMAPEELAHFVAGFAVMMNLGAPWVLLRGLGLALGPHLEALGLRALPAEGVEVAEVLSSKLSYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the minimized alpha/beta-hydrolase fold protein from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA1544
total genus 32
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12270 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2dstA00
2DSTA
chains in the Genus database with same CATH superfamily
2H3EA 2WKRA 5TS2A 1CJBA 4H0CA 4M0PA 3WGMA 1VPTA 2Q2QA 1KAEA 1RNLA 3DNFA 4KO3S 3T3MB 3W6ZA 1TYDE 1L5OA 3K6KA 3DZBA 1D1SA 4I55A 1GPDG 5AICA 2AR7A 3ZDQA 4Z54A 5ADHA 4DZTA 4QOHA 1QIHA 1FIUA 5HMLA 2H1RA 2FCRA 1D5WA 2PTGA 2X0FA 2JIRA 4A8HA 3OAAA 3EA0A 3GZNA 5E6UB 4FFPA 3V7FA 5KYYA 1NURA 2AXNA 4I6EA 4JJ7A 4B3HA 1KS2A 5EJMA 3DEIA 3ESZA 2LGJA 4XLTA 5DVZA 3KQTA 2AA3A 2Q8NA 1C41A 4EI9A 3D6HA 2QA5A 1EG2A 2R8EA 2SCUB 5EXEA 2P2CA 2WMYA 1ZY2A 4I81A 4N8DA 4GP6A 4F06A 2PQ0A 1IWOA 1TK3A 2DSNA 2RBEA 4I4NA 2QJOA 4FKBA 1TEVA 4XPIB 5IASA 1FMTA 1WHTA 4FKZA 3WMGA 4JELA 5LVAA 4KPFC 2GZRA 2Y0PA 2QT1A 3VV3A 2RHRA 5J5CA 1RLMA 4LTMA 3X3HA 3HUFA 1R9NA 5FH9A 1KWKA 2NN3C 1PJSA 1YD7A 2M1ZA 4UFNA 3RK1A 3OZBA 4DT1B 2H52A 3AI7A 4H9GA 4DDHA 5L45A 3EBOA 4KFUA 1QIFA 1X7DA 2NSYA 3PR2B 3BJMA 3I52A 1E2MA 3G9QA 3U1BA 1EX1A 2O2YA 2XNSA 3PC8A 3RRZA 1RABA 2A78A 2J5BA 3MD9A 2O8EB 4CF4A 4DC0A 1SGWA 3TX2A 1XYVA 4LZJA 1XTRA 1Z8FA 4CU2A 5EJEA 1Y9JA 1ZBQA 5JPDA 1MLDA 2W70A 2AG0A 3IXQA 3PV0A 2PUJA 4ND5A 3PNSA 3LL7A 1ZJZA 3G17A 3IODA 4J0CA 2ZTHA 2RAPA 3QI7A 5K0CA 3V9PA 2FSUA 4L75A 1F2TB 4RKWA 1D07A 3U40A 3A4TA 1Y34E 1CJVC 5DU2A 3K70B 1JJIA 3WAKA 4DQDA 4D8TA 2YICA 3F3SA 1EUQA 2ZFUA 3IIJA 1XTUA 3AR2A 4MUNA 1S3GA 3IOBA 4TUYB 1CJSA 3QYAA 2VTVA 1TI7A 4ZOBA 1QB7A 2DPMA 4BKQA 4HAOA 2F4VB 3CSDA 5KCMA 1E2LA 1FMCA 2PWAA 1MB9A 3HLYA 1CR2A 4HDMB 4L8LA 3CW9A 2NMVA 4PONA 2DLCX 1Z6TA 2GK6A 2ZZMA 4MQBA 4QVKA 4URHA 1BFDA 5F1OA 3WJ7A 1BD4A 1I0ZA 1SCKA 1U7TA 2QLFA 3C3JA 3OPXA 1RBZA 1R16A 1QDLB 1SD5A 2H65A 3A26A 1GAJA 3CX3A 1AQUA 2NXNA 3FZGA 1R7RA 3M6FA 1VOTA 4IILA 5JAMA 3ZWWA 1MHTA 1XMPA 4WUTA 2CVPA 3U5ZB 3ZV3A 1X94A 4AO8A 1EB9A 3ANTA 3IJ5A 2B20A 2PM8A 3OURA 4K46A 2YY7A 1AXGA 2XOKD 1SR8A 3PD0A 3DBOB 1IN4A 1EA5A 2HN9A 1RHRA 1QVWA 1OZFA 2DFKB 4NIMA 4BC0A 5IKPA 3D0KA 1Y37A 3AKEA 4AS1A 1DTWB 5AJVB 1PP4A 1SKUA 4LG1A 1B1AA 2Q3CA 4INAA 3ZWBA 4DIUA 1DXOA 1LK5A 4Q00A 4EG1A 3VZPA 2EXXA 3KPWA 4JNCA 4AG6A 4ADSG 1A88A 1BW9A 2IFTA 3LOPA 1N1MA 1CZHA 2GSDA 5DHSA 2M98A 4G67A 4MV5A 4NZOA 5ICCA 1SZDA 3KOUA 5E7QA 3VKGA 4JK3A 1YZLA 1PX0A 2HSJA 4WTOA 2XGJA 2CXRA 1U7DA 3SZGA 1TZJA 2WJGA 1RXVA 3WRWA 1W1IA 1Q50A 5THQA 5ELMA 3DAHA 4YJKA 4BNJA 1B00A 1Q3KA 1GEEA 4G1UC 4OHZA 1WSWA 1Z4KA 3M6UA 3IR7A 2C9CA 1F0YA 1TOAA 2OCIA 1IOWA 3N7AA 4JLWA 4QHSA 5IUNC 3EGXB 3ZE1B 2RI1A 4D98A 1SKYB 5LA6B 1PV1A 8ATCA 1RR6A 3SM9A 4ZDKA 1USWA 3H5OA 1DMRA 4CLEA 4OYLA 1NQXA 3BQMB 3NWPA 3P20A 4A6EA 4CMHA 1VHLA 2EWMA 1YR3A 1AS3A 4WXEA 1CUSA 2JFYA 4PXAA 1A95A 2I3AA 4ZAFA 3GJ7A 3FNQA 5SZIA 1OFUA 4NDNE 4DLUA 4IDAA 1AHPA 1XWWA 5BT9A 3OWOA 1MVOA 2P4SA 3D8RA 3HWSA 2HA2A 4ZO7A 2PBRA 1C50A 4EVRA 4WUVA 4Y30A 5KOIA 3HCCA 1CUWA 1Z33A 3BF7A 2ZBDA 1IXKA 4FS8A 1OXBB 2WJWA 3HPRA 4G0VA 3CNEA 1E7MA 4WJZA 1CZOA 2A30A 2H18A 2I29A 1E6WA 1OWNA 2WD9A 4TKUA 3SMVA 2CJWB 3M5WA 2H9YA 3JQPA 5KYUB 1BXGA 2XGOA 4ICIA 1B0ZA 2QN7A 3A70A 3UW1A 4O8ZA 3W34A 2GBCA 2XTMA 3WHPA 3PC2A 1GL9B 1TRHA 1SUFA 2EEPA 2GT1A 4QTZA 1MAUA 1VB3A 3I64A 2PLRA 1EFLA 2PYDA 2IOFK 3M3HA 1JPJA 1JIUA 3DDUA 4QJ5A 4YC7A 2BVNA 5BMOA 1XRQA 1T3HA 5ADWA 2WM2A 1OIXA 1GR0A 3H7AA 3GP5A 3PQ6A 5LU9A 4JVSB 5ALTA 1DEKA 1KAMA 2QL7A 2ERYA 2C3YA 4K81B 4PYKA 5JNRA 2GJ8A 1FDIA 1HDCA 3L6DA 4WGGA 3DLBA 1WQ4A 3THXA 2A94A 4DEXA 2FN4A 5CA1B 5DN6A 1I5RA 1YNSA 4M8KA 5HKKD 4RHCA 3C39A 4XR9A 3TM5A 4KYIB 4UEQA 5GJVC 3UUGA 4BMYA 1W88A 3K0AA 4R5HA 1NKSA 3JQ7A 1TA9A 3SDSA 2V4ZA 2DERA 1MP0A 2JB9A 2CL0X 4KDRA 4MDYA 3WA6A 3WYNA 4LF4B 5JXIA 3ELYA 1U0BB 3D8UA 3AL2A 3HABA 5FOTA 5BUZA 2F3RA 2O8FA 2EJVA 4IX9A 3G0GA 4GM4A 2ES4A 4M8LA 1G2IA 4FHGA 4X20A 2M6KA 2V7PA 5KUTA 1TK2A 2AVNA 2D2VA 1W94A 3BL8A 3BK7A 1JYEA 3GEPA 3HVUA 4PZZA 3PUWA 4QQNA 4CQLA 4H77A 4ZVMA 3QQ5A 4UHKA 5EUBA 3NHLA 1SUSA 4UNRA 5B2EA 1U3GA 2OAEA 3X2EA 5ICFA 2AJBA 2VHCA 1G2QA 2WNSA 4JGIA 2QD1A 3P5SA 5I5GA 5ULLA 2PX4A 2F48A 3ZE2B 5J43A 2ZVDA 1YDWA 3HKEA 4YGYA 1L4UA 1Z6PA 3SN6A 1SWVA 3BDAA 4A27A 5JVDF 1ZVVA 3FMOB 5DK4A 4OA5A 2J3KA 3FI9A 4C6TB 3O03A 2WAYA 1QQTA 3FMFA 4V1CA 1U5BA 4URFA 2QYOA 3MMZA 4BO4A 4I6JA 3SIPA 3O9MA 4BYGA 1ZEMA 4YRIA 3ROQA 1PWEA 2I2DA 2W0SA 3KR9A 2P90A 1JG4A 1Z5WA 3FMVA 4PLCA 3EH1A 5GGXA 1ORDA 2A6PA 3VU3A 1UP6A 3PI7A 4PBRA 4GOOD 3C70A 4ESEA 1XRSB 3GVHA 2QTTA 1UPAA 1OZ0A 4H1WA 3R7DA 2F9LA 2RARA 3K73O 1DDGA 3CW8X 1T1RA 1UBUS 3VR4A 2G04A 3O4HA 4KLZA 3BULA 4LHVA 3LMKA 1COWA 4URWR 4RA6B 1L8XA 1W5EA 2FQWA 5JS6A 2LNDA 1H42A 1TZMA 5DXAA 5H81A 1ECFA 1UMCA 2V7BA 4ME6A 4MS3B 4RVHA 3VR3D 1WMFA 3VYRB 1NVDA 3PCRB 3IMKA 3GRFA 3GJ6A 3A4YA 3PDJA 2VI5A 1FFXA 5K0SA 1Z6ZA 1OKKD 4N03A 1IUNA 2OHVA 2ZRLA 1H2FA 2B34A 1OGYA 2QAJA 3I2HA 4X20B 5DSZA 5FFFA 1XMJA 5FOSA 1OJ7A 3TZCA 3VPAA 4BE4A 3U1TA 4MRSA 2EKLA 3IA2A 1CQJA 5C8YA 3WSTA 3D6UA 5HDBB 3D2BA 5KJ6A 2BKAA 4V24A 3T3NA 4D25A 4L28A 1HE3A 3CBQA 2F62A 1YC2A 4RAQA 3Q8XB 1GQRA 2QRGA 1GCGA 4MUGA 5ERGB 4AWAA 2D2EA 2QVCA 1E4EA 1G3MA 3A3NA 3FNIA 3ZE8A 2QNIA 5A5DA 4RULA 1TYCA 2C94A 1SBYA 3KB6A 3V4ZA 4OI0A 4WK6A 1P3JA 1C0PA 3H84A 3KQMA 4PHFA 3D6NB 3L6OO 4KO2S 3LUGA 1VGVA 2IA5A 3KKMA 3FWZA 3S5UA 4EDFA 3S2IA 1M2VA 1Q0TA 3OT4A 4GYYA 1HZZA 2NOAA 3DOFA 3QBVA 5J2TF 2Y6VA 1HC7A 1RRVA 4MKZA 5IVHA 4QWMA 3BN3A 3N58A 4A2WA 2KW5A 2AX4A 2H2WA 2XMBA 3MTGA 4JHLA 4G65A 5AWFC 4I36A 1GO2A 1HLPA 2Q4TA 1NC3A 2B1IA 2GMWA 4L4YA 4ON9A 4QT4A 4IDNA 3C74A 2Q6VA 4TYWA 2EBHX 1MTOA 2WSYB 1VLVA 4O4LA 1U2QA 2ONZA 2NG1A 1CQIA 2EFEB 2PS9A 3PQ8A 4LBVA 5BYAA 1Q6YA 1CX9B 3HDGA 1LW7A 3KJFA 3IAFA 5LNK1 2PMBA 4D97A 2RI6A 3NJ4A 4U00A 1PVVA 1KZYC 5KWEA 1LNQA 4LSWA 4YRCA 2R25B 3KZNA 1UBCA 4OXKA 1ZC3A 2H7YA 3U60B 3BORA 4CQMD 4XIFA 1AUOA 1TMOA 1O97D 1U2TA 2YIVX 2JFUA 4C4OA 2OP1A 2O2HA 5A6SA 2RSLA 2XEXA 3FUTA 4FBMA 4TMTA 5BT8A 2ZUBA 2CDAA 2CV2A 2OPBA 3NKFA 4DSZA 3IVGA 4PLPA 2KHZA 2B8JA 3EA4A 2OLJA 4D1YA 1KK0A 1L7VC 1LLFA 3VJLA 4EI2A 2J6BA 2CEAA 3NT2A 1AM4D 1G8KA 4BMXA 3NYWA 1ZAYA 1M1ZA 3HTXA 1GU1A 3SE7A 4JHXA 4DM4A 5J59A 3GY0A 3UJ9A 2IY8A 3VKWA 1T5LA 3EVDA 5LQRA 1OTHA 1ZM9A 4KXVA 2BR5A 1C1DB 4CKZA 3FZQA 3A3PA 1ZGBA 3LK7A 4WADA 5IXSA 1KMHB 2OV3A 1IRXA 2A1UB 3QIAA 4JDPA 3O2SB 2XUAA 1JB1A 4ISCA 4E5VA 3ZV5A 2NXJA 1C0LA 3EVAA 3PXUA 4YROA 4C6TA 3KJEA 5CLHA 4JR0A 1AKYA 1FUIA 1TLFA 1YDEA 3GGGA 3IV6A 4JKIA 5A5FA 2QTWB 2WKWA 1JLHA 1LNZA 1EP9A 2H1SA 2P1ZA 3AH8A 3LBHA 1F1BA 4H7HA 4LXUA 3EVBA 5JI2E 2F9MA 2CJXA 3R09A 1C4KA 3RS0A 3S28A 3ABZA 3T6KA 2WWXA 1OB2A 4E1VA 2QRHA 2WLTA 3DNPA 3KKEA 5CURA 3ZD7A 3AUUA 4QGGA 3EZ6A 1F3LA 2NYUA 5EL0A 1ZVQA 2PUEA 4ZFNA 3IVMA 2OVBA 4RMJA 5G0UA 4ZIRA 4QFDA 5I8WA 4PZEA 4LC0A 3JQBA 3TR0A 4CIDA 4D4KA 1S96A 3ZI7A 1CNMA 1RYZA 2C1XA 2GKSA 3WQSB 7ADHA 1GLGA 5IM5A 1JT2A 1BQEA 1G59A 4YACA 3AHGA 4MO9A 4UTOA 4XGKA 2DT5A 5H4HA 3SNKA 3AEQB 1JG6A 3UAXA 4ZP1A 3B52X 3BCUA 1XKLA 2V7QD 3CH5A 4ZT7A 1C4OA 4ZZ0A 1DRJA 3FSEA 1ELOA 2X19A 3PC7A 3UHPA 3AINA 2HSDA 4Q37A 4EM6A 2DGDA 3EPHA 3K9LA 2N46A 3MJSA 2Q2VA 3ANLA 3DMFA 5E1OA 4J0DA 1V11B 2XUDA 4IXDA 5BN3A 2OEPA 4A15A 3CVJA 3GH1A 3NVDA 1HQCA 2GF2A 5D1HA 2WF5A 4PY2A 2Z6QA 4WFQA 1PI3A 4ZHQA 1JEDA 3H99A 3OX3A 4WASA 2KBEA 3UT6A 5AVYA 2HCFA 3T1HB 3CR8A 3JQFA 1VP3A 2Z2ZA 1KORA 4JROA 3H5TA 5FWXA 2PSDA 3LFTA 4U8HA 4GXRA 4UM9D 5K01A 1VLZA 2PV7A 4J0QA 4X1OA 1UJ6A 3RWOA 2ZQYA 3V1NA 4LXGA 4DLZA 2H4FA 5ALPA 2I5PO 1GQ2A 2C5SA 3MGAA 3UIEA 3PPXA 5K6TA 4BOYA 1S1MA 1F7VA 3TJZA 5I9LA 2HOQA 2Q5FA 1I51A 2GARA 4N47A 1KTIA 4DJEC 3K32A 5AXAA 1U8FO 5C8DA 3ZV6A 3FNEA 5B1IA 1RM4A 5FJJA 1DLJA 2V55B 2FAXA 2I78A 2FG5A 2FPIB 3C87A 4JGGA 4HVAA 4DIBA 3VNBA 2C5BA 4C01A 4OGFA 2GWRA 4BLWA 2Y77A 3WYBA 2BRUC 5DCLA 3FPAA 1YB5A 4DR4B 2P75A 2PD4A 2WY2D 2XJ9A 3AUTA 1U7PA 2Y1EA 2V8BA 5AT1A 1W85B 4G9BA 3WKDA 4BO5A 3D8TA 1RKUA 3HJCA 3QJYA 5IT5A 4KRYA 9LDTA 4JZKA 4TL9A 4HDSA 2O07A 1U2DC 2DCUA 4CR6A 3IP1A 3AFOA 4B79A 2PZ8A 5JEEA 3FLAA 4R4JA 4MKIA 4G2TA 1NXXA 3B85A 2YCLA 3FVTA 1YRBA 4I50B 2GPBA 3NVAA 5DWQA 1VE7A 3TCKA 2OCKA 4P54A 1N6RA 3GMSA 1KR2A 1Y8CA 4OSEA 2FX5A 2Z6VA 4DNXA 2Z5FA 1CIJA 2GKOA 2X1HA 4PINA 3ORYA 5F7JA 4HQLA 5IZCA 2XVYA 4D9HA 1ML4A 1YONA 2CXHA 4BO6A 1HORA 4JP5A 3V4RA 3E7DA 2FP3A 2VZ0A 3OZVA 1IJKA 3ADDA 3ZH2A 1N9ZA 2WWYA 3R0XA 1DG3A 2JFVA 4C0LA 2TYSB 3ZIUA 2QRUA 3E0XA 2AK3A 3LUPA 4J0JA 3A25A 1Q0RA 3O4IA 1RLTA 4F3TA 2W43A 1Y8QA 5D5QA 2ASEA 4QFBA 3TTWA 3SIWA 4J4HA 2RC5A 2QTBA 2PIAA 4DJTA 4EPRA 3ZW9A 1PNRA 5HM6A 5EHQA 2P68A 1C4XA 2Z3VA 4GPZA 4DWVA 3IEMA 2PL9A 3RROA 3DC2A 5I9BA 5F9FA 3HVJA 1U5AA 4HWPA 3P52A 4AUNA 3DMYA 1V16A 4ILKA 4AN0A 4F4FA 3MCUA 5ERXA 3C45A 2ONKA 4O4IA 3ER8A 3IUQA 1HYBA 3L9XA 3IT1A 4EA7A 1G5HA 4NF2A 1I2BA 1P31A 5F5LA 4EDHA 3GT3A 5H0IA 4K2HA 1WY5A 5C52B 4AY6A 2H8GA 2R6ZA 4EY5A 4HDRA 1VG9B 5LSAA 2XGSA 5C31A 3IBSA 4WD3A 1WP9A 4FWBA 5CA0F 1NKTA 4UD2A 4KE9A 3KS9A 4TS9A 5MF6A 2NQ2C 3KOYA 4IIXA 4DA0A 2XXJA 5EPEA 5IAJA 3PDIA 2BM8A 2XNDD 4ZDWA 3FSRA 3FKSD 2ZIUB 4LHSA 3T7CA 1KYZA 1Z3CA 4J3FA 4TWZA 2AXQA 2BFMA 2X0IA 2P3OA 1ZYUA 4B71A 1NC1A 1O8BA 5CH3A 4RTPA 5A3RA 1EG7A 2R2GA 2VYQA 1YOBA 1MNQA 1V11A 2WC1A 3AOGA 3DPSA 3OZWA 3CH7A 4H1UA 3IAHA 3SJCA 1WZ2A 1GA4A 4RD3A 4DDMA 5B36A 3M70A 5JMTA 1UPBA 1V9CA 4NZPA 1U1FA 1QJ4A 1I13A 1U3CA 1XJWA 2HK8A 2V9PA 1DG1G 3IT2A 3OKPA 3PFCA 5SY9A 2VRCD 3T7DA 3A6ZA 2VNKA 2H06A 2BPOA 4ND6A 1KIFA 3JPYA 4OI1A 1ZN9A 4N5MA 3ZY6A 5JROA 4JVNA 1JRLA 3OC6A 1XTSA 5DOVA 4YFYA 1P2SA 2JAPA 1KKMA 3OTQA 4HMPA 2ZJYA 2HC9A 3WK6A 1YMUA 2Q8QA 1SKYE 1CDOA 3NEJA 3Q40A 4XD7D 5IC4A 1PT8A 1H1TA 1TQHA 1OLSA 2OKGA 1DKNA 1VLLA 3BK1A 1GG8A 4K9KA 4II2A 5EWJA 3UVEA 3QLVA 1XB2A 1AD2A 1TDJA 2DFVA 2ECOA 1GGFA 2C42A 4FMCB 1T1EA 2ZSKA 1OFTA 1DRUA 2OENG 3ZH9B 2J9RA 4JYBA 3CLUD 4HG2A 5CNMA 2C7RA 2XMCA 3ZE7A 5AW8A 1WE2A 1T4GA 4MI3A 1FZQA 1IN5A 1H8ED 2Q41A 1BD3A 4HNAA 5KYKA 1Y1TA 5COQA 1N6IA 1UM8A 3BQNB 1R0SA 1SXIA 3LDAA 2VDLB 4EGQA 3A0UA 4HQRA 2NUAA 5CEEA 2FQ1A 1W7AA 4JLBA 4PGFA 2J30A 5J5AA 2BTQA 4G9GA 3R5HA 1W4BA 2Q4OA 4JJ6A 4BASA 1P5ZB 1SVLA 4KGDA 4RPJA 5JYBA 2HU2A 1ILEA 2EHDA 4P4TA 2JHCA 1E3EA 5EY5B 5JCXA 1SQSA 3D2CA 2RGAA 1VZ2A 2O23A 2PXXA 2D1TA 3RRFA 1NG9A 3R3VA 2FTKE 3UJ8A 1U3UA 3ILSA 3ZTTA 3X0DA 2CJYA 2EKBA 2FSFA 4IJKA 3QXGA 3EOAI 1CJKC 2RBKA 4C89A 2XBUA 3U7HB 1FMFA 2IEYA 4YV0A 4ZV4A 3IQGX 1E18A 2H8KA 3NGMA 5C81A 4B3GA 2IHTA 2V0GA 2P3QA 2LIPA 1IIBA 2ZBRA 3LUHA 3IYLW 4B6JA 4KW7A 3U19A 1W9MA 3ILXA 3F78A 2ZTMA 2VPXA 5JDIC 4JFRA 1DI0A 4MUFA 1UBHS 3B2EA 3NCTA 4RDIA 2VJMA 1RJGA 4OAQA 1BHJA 3TPCA 1XCLA 4GP9A 5LZ9A 3VTZA 3ANSA 2FE1A 3AR6A 1WHTB 2YQ5A 1U2SA 4RF5A 2I62A 2OILA 4RGYA 3AR8A 1SIBE 1H23A 1CUZA 1RHUA 4UBJA 3R7WB 4RSHA 4W9MC 1WB4A 3CVXA 5AFSA 3ZDZB 4CM5A 4R2XA 4XWOA 5BY2A 1Y4DE 4Y2GA 3BD8A 1X1DA 3QVVA 1XV5A 1TTHA 5E1BA 3A6EA 4QHTA 5C3MA 2YFHA 1IPFA 5ALFA 3CVYA 4NCAA 3Q3VA 4I9UA 3WZ2A 2C4MA 3FDZA 4I0WB 4DKXA 1M34E 2NW6A 3L5OA 4L15A 3H5IA 2AI1A 1E0AA 1ADGA 3RJ5A 4Z1OA 3SQXA 3DFKA 3LC1O 5IHPA 3DTYA 4WCFC 5CB8A 4BBZA 3VR5D 3PDIB 1P4RA 1RQLA 1UIMA 3AUXA 3HJHA 2O0KA 3HRIA 3OFNA 4Z0NA 2DUJA 2J59A 2OHJA 4JOCA 3PC4A 3IUNA 3EWAA 4K1LA 4QUEA 2FMXA 1F0PA 5L4NA 2EG9A 2XEDA 2O59A 2ZI7A 2VSOA 1QTRA 3PUHA 3NIWA 3AZPA 3Q10A 5ETJA 1D1TA 1KK3A 1CUUA 1ZJ5A 2H1CA 4JBHA 1EGHA 1OVMA 5G3YA 1N3IA 3GNQA 5LM3A 2RKWA 1R0WA 2XKAA 1BHQ1 1AGNA 2FMIA 4MS4B 3TQOA 1XYGA 1PX2A 4DLYA 3DTVA 1J8YF 1HWYA 5LB4A 3ZE0B 4OGWA 3OOJA 2IDMA 3L0PA 3AP3A 3EFHA 4F4CA 1CUFA 1HFWA 3JQQA 1L5MA 5I7VA 4D0LB 2XB2A 5KYYB 2O3RA 1J9GA 3DB2A 4PAGA 4KJZA 5AVWA 3JPWA 4I1YA 4EYEA 1MC5A 4BNDB 4EGFA 4UFPA 2Y3IA 3K1TA 3BT7A 1NXPA 1UEIA 1JGTA 1NXOA 1Q83A 5AMXA 2XMQA 3U4GA 3V2GA 1DC5A 3HZOA 1UK9A 4LJRA 4UM9B 2Z30A 2NO0A 4TWAA 1OREA 1ADJA 2DUNA 3KVRA 3WKBA 3UJNA 3AB7A 3KZCA 2GXSA 4N0QA 4WCDA 3ICPA 4XWTA 1YCGA 1YS9A 3H8SA 3L0IB 3FBWA 4YI5A 5K2MA 4D8YA 4YRMA 2Q7DA 4L5IA 4NLLA 3AJDA 3TL3A 4Z8YA 2BIFA 3FY4A 4V1CB 4R7TA 5ALWA 1DJNA 2C84A 3DOEA 3E9NA 4S0XA 3R5KA 4FQ8A 1USVA 1OOEA 4R1MA 1RE0A 2E37A 1EVZA 1ZNWA 4Q1FA 2RBGA 1O03A 4Y8VA 3RVKA 2C7GA 2H4HA 2IIVA 3I09A 5F5NA 4DTCA 4YRSA 5KTPA 1G3RA 4AU1A 4W5NA 4IZOA 3TTXA 4DSAA 1QG4A 4EG4A 3RYIB 3C15C 2PVSA 3ICOA 2C0QA 4TLLB 5G0SA 4GLJA 1DKUA 2XZLA 4F12A 3NTRA 4E4TA 1XRNA 3EQ6A 4YT4A 3DDWA 2GESA 2R1TA 4C7OB 1LTQA 3SEQA 2CLKB 1A9SA 1BMDA 1Z6YA 2JHFA 1VHQA 2RHBA 3GWZA 3KSDO 1VKJA 4ERXA 2IYEA 1A9YA 1D7OA 1XALA 4JJIA 2ZSEA 1E1CA 1REQA 4XDZA 4F45A 4ETWA 3WTCA 1J33A 1EX9A 3EXAA 3OICA 1B76A 2Q3MA 3AY6A 4UNIA 4CKCA 4TTSA 1MFPA 1QHIA 3CUSA 2O2IA 3Q1KA 3T52A 4DLPA 2G06A 5JYCA 3Q3JB 1SBCA 3PYXA 1Y33E 5I7HA 5I7FA 2YW2A 4PSDA 4PRZA 5E9AA 4PLGA 4HNUA 2CW5A 1MW9X 5JATA 4FFSA 4UTVA 1T9KA 1Z83A 2VP4A 3WTBA 3V8QA 4BV3A 3JYNA 2I7XA 2WVAA 3UMRA 3BH6A 1RC8A 1YHZA 4GZ6A 2I8CA 1I0IA 3D4LA 4GMFA 2R8BA 3OFSA 4Z49A 4DV1B 4PGHA 2B78A 5UKDA 2NXEA 2JFNA 3PGXA 4HI0E 4HNVA 5B55A 3TRJA 3V3KA 4I1OA 2DQ4A 3LX8A 4EJ2A 1GDHA 4LYAA 3IPYA 3VPHA 1EFDN 4G8JA 4CGYA 3FPLA 1ZIXA 1LBIA 2WW8A 4P80A 1GD1O 1K9SA 2OBBA 1QH8B 3EUEA 4KPUA 2QYTA 3WYDA 4UTPA 1PG0A 2ECQA 4MJ3A 2B4QA 2JGLA 4ZHSA 4IIVA 1NDHA 4X93A 3UC9A 3GLHB 2CDRA 4EA8A 5KSYA 1JXOA 2QV0A 4CKWB 3RJMA 4DCTA 3A6HA 2Y67A 2BSAA 3AFMA 1IQ0A 4BZZA 3RUPA 5FUQA 1Z0DA 5F9MA 1GNSA 1T8UA 1FMJA 4GBJA 5DKFA 2PGJA 3UHFA 1D3AA 1DOAA 3GUVA 4EG3A 3LGXA 1M2JA 1W9HA 5DX1A 2ZP1A 4N3NA 3CNHA 1L7EA 3G59A 3ZU5A 1X1TA 4UE2A 1IH8A 1NKVA 3FF4A 4F3YA 1OZHA 3IUSA 3OKAA 1LLCA 4I4TA 3R3HA 1EYZA 2BKUA 2WU4A 5G0VA 3K9QO 5JBQA 2A1TR 3ZWKA 2J5RA 3L7AA 4RCVA 1TT5A 1X7ZA 1YRWA 1FU4A 2VDJA 3ORFA 5DRTA 5KSPA 3WXBA 4HB0A 3SX2A 4KYTA 3TLBA 2ODPA 1E9EA 1WSDA 5BSGA 1NMQA 3PJFA 5L8VA 1NRXA 2I2CA 4L72A 2CLDX 2Y2UA 4K9LA 4C06A 2ILVA 3E5NA 5LDHA 5CYOA 2QRZA 4JEMA 2W71A 2F1IA 4JJ8A 4AUKA 2JKZA 3NHSA 4QXQA 3SXJA 1IY2A 3QSYA 3RBAA 1C80A 2RE8A 1V48A 1GUFA 4BFUA 3DAFA 1JG2A 2WPNA 4R2HA 1SA0B 2HV9A 3I2IA 2F4NA 1HQDA 4IDQA 1CVLA 2JD2A 8AT1A 1P2VA 2QX8A 4MEAA 4Z9XA 2FEWB 1XC7A 1Y5MA 3D8SA 5GVRA 3DE4X 1Y3DE 3GP3A 3GFBA 1O95C 2QMEA 1YR2A 3EGDA 2IE0A 4LXYA 2FFBA 2XT6A 3TQQA 3C3XA 1G4UR 3R7FA 6PFKA 3MTBA 1HZJA 1EJ0A 1OBCA 4QARA 5ALZA 3U39A 1Y9ZA 3B38A 3EFOA 2FEOA 1R0YA 4LAFA 4CMAA 3B7GA 4C0XA 2OG1A 3ZZNA 3SYLA 5FNVB 4M1MA 4O1MA 3I73A 1CFJA 4TYNA 4PVCA 4FLFA 4ZWNA 3ZJ4A 2TECE 3ZWPA 3ZVRA 2X2EA 4V3CA 1BWSA 4MQFB 2VDUE 4RZUA 4BWFB 2ZVJA 2R62A 3DDSA 5CK5A 5DHRA 3B9BA 2X0EA 1L5WA 1VPDA 1E89A 3BWBA 4LI3X 4FMDB 1Y6ZA 4UBIA 4B3TB 2VF4X 3N7UA 3GMDA 4YAFA 3WYFA 1NATA 4YVFA 4PAQA 5LDGA 3SP1A 1OH7A 2PZJA 3I2JA 2FYTA 4YMGA 2QROA 3AJEA 1JQLB 2MSCB 2L17A 4US2R 5FBHA 1TM7E 3V7WA 3BL5A 1U8CB 2HSEA 1KEEA 5LXTF 4E51A 4PHTA 4N5DA 1Z6AA 4EHIA 3AUJB 1TCUA 2O8FB 4O4JB 3B1VA 3Q6NA 4RA9B 4HAZA 1W93A 1LPPA 3I6YA 1IYZA 5CT9A 5BOSB 1OB5A 2WIKA 3FWYA 3OOWA 2J3EA 4DBLC 1R9JA 3I05A 1KO1A 3DAYA 3UA4A 3BE4A 3DMRA 3ZK9A 3CPHA 3IAAA 1SG0A 2NZJA 3LLCA 3TEMA 1T1JA 1X7WA 1K4YA 1GCIA 4GOKA 3K31A 1E8DA 3ISTA 3LHIA 4BNTA 1ISRA 3HKEB 4KAAA 3CIOA 2VRBA 4OBBA 1ZICA 2NO6A 4EEKA 3WQRA 1XZIA 1YTUA 4F86A 1ZH4A 3WGLA 2AR0A 1GKIA 4INJA 4EW2A 4ZOLB 2VSXA 2C3UA 4ETIA 2ZBFA 5HW0A 5H4GA 1M6VA 1KQPA 2IV7A 3V1MA 4KJXA 4Y2SA 5CITA 2XCOA 3QKSA 3A4IA 3GDFA 2IEAA 3DGEC 5E7JA 3RG2A 2DR3A 1U80A 3KAKA 1J2TA 1QZXA 2CHFA 4HPWA 4C6HA 2GCIA 5FPQA 1BE6A 1I2MA 1AHIA 2CHEA 4CRWB 4L8YA 1DU4A 5KVCA 4RLHA 3PQ4A 3EDRA 1VCOA 1QYDA 4QICA 1OAOA 3FRHA 3OE7A 4L4SA 1H0SA 2BZ0A 2G25A 2ESRA 1UUFA 4FKMA 4MWEA 4E5KA 4Z4CA 5EXSA 4B3MB 5TF0A 3RNLA 2W6QA 3TRIA 1C3LA 3V1YA 1ZC4A 3EVNA 4HK4A 2PFGA 5L6MB 2HMVA 4BECA 4DXAA 3SY8A 4RZ3A 1ZFNA 3R2JA 4YQEA 1JHQA 2GM5A 4G4JA 3HFJA 1MJHA 1SK9A 3KUKA 1LPAB 4IO0A 4IRUB 4J76A 3VI3B 2HTEA 3DWEX 4MAAA 5KX5B 5CM8B 3CYFA 4Z1MD 5CA0A 3RQSA 3CNOA 1IAQA 5CX4A 3S2UA 3BX1A 3QUCA 1CQJB 3REGA 2O05A 5C8YB 5IKXA 5KVQA 1NBMD 1XL1A 3A9TA 1Q16A 4MV0A 4BRWA 3ETHA 4D80A 3EVTA 1PL6A 5ARCA 4DANA 4HLNA 4D45A 2R1VA 4BQPA 4NMHA 1E98A 1S2LA 4OB8A 2F1JA 3ICVA 1RAAA 4XYLA 1RE1A 3MZ0A 1WNTA 1O9GA 1NF3A 1U8TA 1P2BA 2VEDA 1V3QE 3DO8A 3LRTA 1E3IA 1O2DA 3TIXB 3R9XB 4C0HA 3ASYA 2BH9A 2PJZA 3O2JA 3PNLA 1JLLB 3GOHA 1NJ8A 3OE1A 4FYKA 4BJ6A 5DI9A 2WWWA 3TTYA 1PJRA 1V1JA 3GPDG 4OLJA 5A62A 2M32A 3DHEA 4LRYA 3V8VA 1VMEA 1RWMA 1LJLA 3HYSA 3TRKA 1SC9A 3AEUA 2CVOA 3AQIA 4R5MA 2H1FA 4EATA 4JLAA 2HSZA 4Q9LA 1EXDA 4O25A 3U3XA 1DPFA 1RRGA 4CI0B 3THWB 4Y1EA 3UC5A 5EJ8A 2ZBQA 1KAOA 4RZHA 2IELA 2WU0A 2C2MA 2IODA 2F17A 1QGAA 2GETA 1OAAA 3CTPA 4JI7B 1QQ6A 4WNYA 5K05A 1Z0IA 4Q6WA 4IMIB 2J9FB 1K98A 3RAPR 3RHZA 1P9OA 3MLBA 2ZIZA 3I04A 1ZINA 2P9HA 1XQ9A 5AI0A 4EMUA 5HRUA 4QGFA 1BXZA 3RT1A 2QVBA 4HD8A 5GMOA 5CA0B 1UBMS 3Q8MA 4GUDA 3M82A 1FJ2A 2EKPA 4HQKA 3AVVA 4TM8A 4QUJA 1L5KA 2FWAA 1LDEA 5HZMA 1JDZA 1KP3A 1Y3FE 4GPEA 1BROA 4UMVA 5BSMA 3LVBA 2IYLD 4FJ1A 1GN9A 1WDLA 3I0MA 5DTRA 2ENWA 1GVNB 5FRDA 3UWDA 1QP0A 3AETB 4BZWA 2F2TA 2EL9A 3TRDA 3BFVA 1WBDA 1BCRB 4B74A 1E2QA 1NHGA 2ET6A 2H17A 3PBKA 2FETA 3QPBA 2XYRA 4HDNA 2ZDGA 5DX0A 2XITA 3ZDYB 3UJ6A 4AW9A 4PBSA 3K9GA 1CK4A 1I6LA 2Z9DA 1UJBA 3RJ9A 2H4YA 1N2JA 1HBJA 1ND6A 4IXTA 2C31A 2PQ6A 3G5UA 4FZ5A 2DHDA 3SK0A 3WGTA 3FFTA 2ZJ2A 3MHTA 3BXFA 4EGCB 3A32A 5ESXA 4AP9A 3K71B 3QUBA 3O6VA 4OK6A 1MBZA 2Y68A 2NADA 3HKBA 2OZPA 1IUPA 2R2AA 5FTWA 4C07A 3H9UA 9GPBA 2GUWA 5EE3A 4AJJA 1RWWA 4JP3A 1RKXA 4UQOA 5REQA 4ZHQF 4ZGWA 1G9XA 1OAOC 5CDFE 4HDKA 1XK7A 4DBVO 3LUBA 1NXSA 5KSWB 2HDWA 2CT8A 2GLXA 1KMNA 2R6R1 3AHFA 3KCNA 4NU5A 2OA0A 3DYBA 4Z51A 5T6BA 1YAJA 3GGSA 3LD9A 3KYDB 2F6RA 1VMAA 1TO6A 2XSZA 3AF0A 4NE9A 1TKRA 3OLYA 1UEJA 3IJEB 1NW6A 2BGKA 2SKCA 1SCUA 4IOJA 3JRNA 1FF9A 1FNSA 3FCSB 4YLGA 1JBKA 4BU0A 4CLXA 4P7KA 4ZCSA 3LQ1A 1G60A 1HMYA 2GCOA 1DWQA 1JDVA 3SBOA 1G21A 1Y7IA 3BFPA 3FTQA 2ZJ8A 4QYWA 2RMKA 4OAOA 4UASA 1MMFB 3IMFA 4D9EA 4N7MA 4YCNA 1T9ZA 3GJZA 3RASA 2I65A 2H0QA 1IDOA 3AEQA 3CA8A 3NX4A 4XRRA 2VHUA 5KX5F 5K0LA 2H7CA 3CKYA 4MKGA 2Q50A 2AQHA 4Q7KA 3OLZA 3ABIA 3NU1A 2DJIA 4LGMA 5CT6A 5DP1A 4E5PA 1T9AA 4WXYB 5I7UA 5KNLA 2F3PA 3FOEC 2VFAA 1J8VA 1DBSA 1P9WA 1XU7A 2ZBUA 3D8NA 4LC9A 4OL9A 4EHNA 1S8OA 1ML3A 4GE3A 4ILEA 1CR1A 1CUIA 4MRNA 4WV3A 2DM6A 4BV2A 5LQNA 2CZQA 5LOVA 4OTZA 4M1TA 1KRWA 4XPZA 3GRKA 2D1SA 4TSKA 5EQJB 1OH6A 4FNOA 1H2BA 3TXYA 4B3IA 3DZJA 3G7UA 4JP8A 3NHFA 5ENDA 1KO8A 4O4JF 5F7ZA 5K3AA 2CK3A 2YDXA 3RRYA 5I6DA 1K6XA 3GDHA 2QUAA 2YJTD 2DHQA 1JMVA 2H1LA 2Z2JA 1TQ8A 5EYPA 3W0LB 4ZO4A 2BZ1A 1RC1A 5FWXB 1AURA 1BDMA 1PS0A 3T3HA 2EJUA 2I03A 3S2ZA 3HPQA 4WFKA 2NTYC 4RTQA 4IEEA 3BIXA 1MO4A 3WE7A 2QUKA 1MQ9A 5H3CA 2ZWMA 4PQRA 1G18A 3PNMA 3DVSX 4MDEA 4XW2A 3DOCA 5BWNA 1O4VA 4GWLA 2XDQB 4OXYA 4FT2A 4HDKB 1IM2A 1I32A 3B3FA 1OV4A 1OFGA 2YY5A 3P9NA 2NYVA 1PNQA 5K1ZA 3BE8A 1UMBB 3TFQA 5CB4F 1EFUA 1VJ1A 3RK0A 4MS1A 4BGDA 2FZGA 2Y9PB 1DL5A 5IT0A 5JJLA 4L85A 5JNVA 1CR4A 3OPNA 3EDQA 3PFHA 3GAMA 1AKVA 3I9V6 1BDHA 3EZFA 2WHPA 1E9VA 3DZKA 4B81A 1MPXA 3FSJX 4L51A 4MI1A 5J2TA 3DVAB 3R7BA 2YKGA 3TCNA 4I2VA 4J7CA 3FPHA 4B85A 2F43A 4KGZA 4CUJA 1R0ZA 2A9VA 4CTMA 1VZ3A 2GNAA 1PS8A 4JXJA 1RI2A 2WJZB 3H18A 4YWJA 4EL0A 2GM4A 4O2AF 1M75A 3BMCB 2Y9MB 3DKIA 4N54A 3LZ6A 3FGOA 1JEYB 1A2KC 4FR5A 1YBAA 4FDLA 1XJQA 3BM5A 3QU9A 1U99A 1R50A 1V6CA 4NV0A 5BOVA 3RYHA 1N5KA 4AKIA 1YZHA 3WL8A 1Y7LA 3ENQA 1XVLA 3SHQA 3IBYA 4PTZA 2C58A 2BFOA 3GRCA 2GRAA 2O2JA 2HREA 3OCUA 3P5BA 1I4DD 1QC5B 4KZKA 4ZYUA 3WAJA 1KQGA 1CUJA 5AXDA 5K7SA 2I6FA 5TC4A 1JU9A 2C9ZA 4CN9A 1B93A 4GQAA 4KMOA 2CDBA 1BE0A 2JLXA 4B17A 1MAAA 5C8XA 3P9QA 2OBNA 3UGKA 3X44A 3TSOA 1N36B 2P6OA 1XZNA 3EB9A 3HBNA 4HWSA 4LK3A 5JJIA 1SXJD 2NIPA 4UUNA 3TSYA 5IZ4A 2GD2A 4JLPA 4US0R 5D3KA 3ZCSA 4C7XA 1X92A 2J6CA 3QSGA 4CR7A 4D43A 4PICA 2KI5A 2A9RA 2DVMA 2Q8PA 3G88A 4JX9A 3Q7RA 3PXCX 3M9WA 3ZHUA 1R00A 5JCJD 3ITEA 1YJXA 1K7EB 1ZUWA 4RESA 4JASB 4LA4A 1FRFS 4EELA 2OESA 4MS1B 4C21A 5IXYA 4E2FA 1VJTA 5AESA 2EFJA 1AKTA 2XUFA 1LS6A 3K4QA 3HXKA 4LE1A 1BQ4A 1OILA 4EB0A 5B57C 2A9PA 3N8GA 4FK8A 1GFSA 1JFTA 1E3DA 3BDIA 3V97A 3A9WA 3ZR4B 4CM4A 4HDQB 2YFKA 4MKFA 2ZTSA 4DHEA 3GPIA 5C37A 3LDFA 1INLA 2PRKA 3N07A 5B6PA 4IH9A 1NYLA 1KMQA 3KWMA 3R41A 2OD9A 3I5UA 3EOBI 3JYOA 3P2IA 1ZSNA 3RT9A 4ZJZA 1NSYA 1OBHA 2YX1A 5EIXA 2IXAA 2A84A 3Q8KA 2ZQ5A 4N5IX 3EEFA 4N9QA 2AV6A 1UC5B 1RKBA 3G2KA 4TLCA 1NXTA 3DBHB 4H1VA 3WHLA 5JY1A 1KEZA 1A77A 3FX2A 1U0TA 2HHAA 5HE8A 3VU9A 4D5EA 4ZJYA 2GZMA 3ZJVA 5GJCA 1V8PA 4G36A 4WZBE 1A97A 5LZ4A 1F5NA 4KQWA 3TVYA 3AESB 4CEJB 4EIWA 4FNAA 4ZVNA 4BBJA 2FV8A 4I6GA 1KDYA 4KKXB 4MVJF 2Q6TA 3WIUA 5B1YA 3KL2A 2AG5A 3P9CA 4BJ1A 4DCMA 5DBGA 3IP5A 4ENQA 4FPXA 3AFNA 3HXMA 3L82B 3ESRA 2JK1A 3N1UA 5TS3A 1PGJA 1BA3A 2IYOA 1Z34A 1H5NA 1BE1A 2HTFA 3D2LA 4LXXA 3SX4A 5KYNA 5LJLA 2P2YA 2NO4A 2QGNA 3GBVA 2DHRA 2FPGA 4A23A 3IDOA 4BNZA 2JVIA 4TKZA 5F23A 1WXWA 1ISHA 5FNZA 1L9KA 4YCMA 5JVDA 3ZDAA 4MHSA 5JWHA 3EG9A 2BDUA 3T4EA 2AF4C 2C82A 1A98A 2RGYA 1ZDMA 2GK3A 4IKOA 4C0WA 4E33A 1NG1A 3DMNA 5K3EA 4HX9A 1H9CA 5B37A 1Z7YA 4C5AA 3H9CA 1EFRA 1GSAA 1PZHA 4OYHA 1FFEA 2HHJA 1V25A 2ZAMA 1JF8A 4HLDA 2JPDA 4OLHA 1UM9A 2C4NA 3QA3E 4PVDA 5EAIA 2NQ8A 3ROPA 2XMGA 2RHCA 1C2YA 3CY6A 1ORTA 3EEBA 4GMGA 4KMRA 4AY3A 3QVWA 1W36D 2JFBA 5FKJA 2YC2C 3D7KA 5JEDA 2ZTVA 4MUMA 4Q12A 4PYNA 5G0TA 1SVIA 1T5SA 2ZE6A 2YXEA 2BI4A 2YYYA 2YXLA 3FUVA 4QU9A 2WD8A 1NXVA 2J3JA 2WFMA 1IZ0A 3C3PA 4ROTA 4CFZA 1NWCA 3NLLA 1AX9A 1C8VB 3FAKA 1CY2A 5K4AA 4YV1A 1GR1A 1ONPA 3KT3A 1R5JA 3GR6A 1JIIA 4L0QA 2IS6A 2J87A 4QEZA 1DAFA 4MKRA 2RAVA 2YDYA 3D6AA 4LJAA 1FSFA 3AVPA 2VP9A 3GRZA 2BMDA 3SZOA 3HC7A 4ITUA 1J7KA 1NW5A 2N1BA 1O96B 4CL8A 2MSWA 2FMKA 3T3OA 4FYYA 4HNRA 4YAJA 3KR1A 1R9GA 1T4DA 3O94A 5L3SB 1WJGA 2HK9A 4IWNA 4PAMA 4EYQA 4I5GA 4ZAWA 4UEJA 5H83A 5J2UF 2FPUA 4F5EA 1N33B 1G63A 3OPQA 1CJTC 1NYQA 4I1IA 1FPQA 3CRZA 4PX9A 2I1QA 3RCBA 3H1FA 4JT2A 1TF2A 3R6GA 3KQWA 2VUUA 3ME5A 2IDKA 5D3MA 5TMBA 4HUQA 1U8UA 4E32A 1Z0JA 2H9IA 3L5KA 3HB5X 4NH0A 1WMDA 1TFRA 5L9AA 2ALJA 1GUDA 2PKEA 4JQZA 2JF0A 2NZXA 4XCXA 4CW7A 4M87A 1ZJ6A 1E9DA 2DTXA 4DYVA 4PO8A 5I3ZA 2XUIA 4GI5A 2O2CA 2XJ4A 1K5PA 3DSRA 4EF5A 3LUAA 4JI8B 3A58B 4ZMBA 3AIMA 1DEXA 1WU8A 1ZBDA 2JIQA 3BXHA 4F3RA 1UQRA 1U31A 2O7SA 5HKAA 3D7SA 4IQFA 2XE4A 2YMLA 4A6PA 3UUFA 1AB5A 4U7HA 3AIOA 1NVFA 3QRWA 2QLJA 3I9OA 1ULUA 4XFJA 2E0IA 4XWKA 2WYOA 5GQSA 1WCXA 2J5KA 2YS7A 2B2CA 4OH1A 2ZI3A 16PKA 3TIVA 3MGKA 2JAQA 1W4CA 5AKIA 2XDAA 5DTEA 5FT9A 1G8AA 4C6RA 3K0AB 4QBGB 3M49A 2XVZA 3R0IA 1JDBB 2H00A 3DDCA 3NG1A 3TQIA 3BE6A 1X1SA 3EXG1 4B75A 1CDDA 1YS7A 4JLMA 3WGQA 4E5MA 5AW6A 5L3QA 2QZPA 2X15A 4EP1A 1B8UA 2H5EA 1E1RA 2I4IA 3F5MA 3PX3A 4GECA 1IZ9A 4DUGA 2FZLA 4UTNA 3T0FA 2EQAA 4PAOA 1DAKA 2V58A 5H80A 3QV2A 3D6FA 3T7KA 3A3OA 3OT1A 4YAEA 1IXZA 4P83A 4G01B 2X86A 3VR1A 3VPFA 4EMSA 5I7RA 4ABTA 1LB1B 1ZIDA 5BOSA 3EAGA 2HHHB 4PN7A 4HS9A 3KJGA 1OKKA 4NYMR 4CEIA 2TMGA 1NVAA 2XVAA 3L8HA 3SSMA 3PL1A 4CF6A 1GU7A 3L43A 1YS1X 2C0CA 5CLIA 1L2TA 3AQ4A 3DCJA 2A7XA 2VATA 2J45A 4OQNA 1SUWA 5HR5A 3KJHA 4OHBA 4RMIA 4AN1A 2AN5A 1GTG1 5DNUA 2NZ8A 4DDUA 5C1OA 3MTJA 4GOMD 4PC6A 2JANA 2VVTA 2HMTA 3DF9A 4IYJA 3GLGA 4LJKA 3OVMA 1DTSA 3K7EA 4JAVC 1R6VA 1N92A 1X42A 4NFSA 2ZBGA 3B2QA 1UKCA 2HA0A 4OJTA 4ZYVA 2BBWA 4QJBA 4BYMA 4CLOB 1KH1A 5LDDC 4G1EB 4QNMA 2IH2A 3KSUA 2OD2A 3KEFA 2BFAA 4RM3A 5KTSA 3ZNPA 5A5EA 2Z8YA 4PQEA 4PLHA 1E3LA 1U4SA 2QU7A 2PZEA 3GYGA 3JQGA 4GRIA 2VUSA 4LTNA 3THRA 5IG2A 1ACLA 1VIAA 2FWBA 2PWPA 3N6RA 5GINE 2EFGA 4D4MA 5AK4A 3JZFA 3EZLA 4JQYA 3O93A 1MUUA 1FTWA 3T7EA 1MH9A 2UKDA 1JH8A 4XX0A 4UAUA 1ICIA 2D54A 5HCIA 2ACKA 3Q85A 3U7QA 4DUPA 2K87A 4WIAA 1WOMA 2B8TA 2IYXA 2NVUA 3DVLA 4QGBA 4YAOA 3REFA 3TLCA 2O5RA 3RW9A 3VZDA 5AW7A 1M67A 1CUHA 2HADA 5BSWA 2IZ1A 1CRWG 3BREA 4WY5A 5JW6A 3JQ7B 5CFNA 3C7DB 2B25A 3UAOA 3EULA 3KR2A 2RK6A 2AN4A 3O8LA 3BJRA 3FWPA 2VPYA 2GA9A 3LA8A 3S68A 1IULA 4HY3A 3D4BA 4IJUA 4ZO9A 4NBVA 3VPSA 3P9KA 4TLMB 2LTAA 4TVKA 1MORA 1D8TA 3ITKA 2W2VA 4E7PA 4IINA 2CY0A 4A8TA 4EG6A 1N2CB 5J3JA 1VXRA 1NOKA 3OQVA 1KK2A 2R11A 4MROA 2DFNA 2D5IA 1AXEA 1MNAA 1TEXA 2B30A 3KSAC 3H42B 4ENVA 4G1MB 4IGEA 2HZBA 2A59A 3L6BA 1ZMXA 3H4TA 3KJXA 3JAKB 3CB4A 3QEOA 1QIIA 5AI6A 1MDFA 1W5SA 3AVQA 3SM3A 1Z22A 5AI4A 4X7BA 4NEHB 1D7AA 3LECA 2MDTA 5EJAA 4MVJE 1V4NA 4QT0A 2AC4A 1QE0A 3EK2A 5HIJA 1MTZA 1BQ3A 3WGJA 4E6EA 2CLCX 1EGQA 1YL6A 1D4AA 2GZAA 2WP0A 3SLGA 5B64A 4CL2A 2Z5VA 3BYZA 4G07A 2J5QA 3W7VA 4BQIA 3ENZA 1PR4A 5ES3A 3LS2A 4LV5B 4LVOA 5A06A 2QS9A 5EZYB 4P5EA 1T0UA 2GBLC 1N4AA 4NR0A 1KEVA 2IUFA 3G1WA 1Y48E 1UPCA 5CVDA 3TOVA 1M54A 3UV3A 3QWFA 4N0PA 1C14A 2BGTA 2MSEB 2A2ZA 5JADA 4NBRA 4O4LB 4IMJB 2QI9C 4NK5A 1U7OA 3Q3EA 2DUUA 4WNAB 3AERB 5TGDA 3ORHA 2XE8A 1PHRA 3JZAA 3PU6A 4JVOA 5DWVA 1GTZA 3DLHA 1KO4A 1O6BA 3ABOB 4HH3C 3QPVA 4COOA 3WK9A 5IX8A 3CIFA 3UXEA 2O3JA 3CRW1 4E0BA 4NXNB 1CD5A 2HD4A 3WLJA 1AE1A 1RHKA 1AS0A 2CNDA 4UUMA 4C08A 3ET5A 4RY8A 2X8BA 1KEEB 4G56A 4C7BA 1O9HA 4ZK6A 3RYFB 2QLTA 4DE5A 1U2RA 3OZ7A 1XWIA 4LZZA 3F9CA 4M8NE 4CMIB 3EXIB 4DB4A 3QUSA 1ZW1A 4DLXA 5IKOA 5DHTA 2ARKA 2XUHA 1U65A 4IW3B 3RGWS 4D02A 3VBEA 2B1RA 1H2RS 5MHTA 2WAOA 4C14A 5IPFA 3QPUA 2WWHA 1OBFO 5EXDA 3UXHA 1NUHA 3SF0A 3VNSA 4EJSA 4EX7A 1EWYA 4ZGGA 3O38A 5EIOA 2ST1A 1ZM2A 2V7UA 2R00A 3DVRX 1RYNA 4JWTA 3SEZA 3STWA 2O2SA 4L7QA 2GILA 2A8YA 1BKYA 2ANCA 2FN9A 3M83A 4OHMA 4X1YA 5TMEA 1EP2B 4RIFA 3S1SA 1UBFA 1PTJC 2HXSA 2Z8XA 3SKXA 4ZOLA 3Q5GA 1V7QA 4UHEA 1CPYA 2ONCA 4B7ZA 3EGDB 1OLUB 4RJJA 1L4KA 1MKYA 1M6VB 3AKDA 4PSAA 4XXHA 4RD4A 2EQBA 1N57A 2F3UA 3SS9X 7GPBA 1SUCA 2O0HA 821PA 2WU3A 2IOQA 3G9TA 4RORA 2AUTA 4QXPA 3QLTA 2V5VA 1JWAB 3PE3A 4PR3A 3JARB 1SD1A 3KAPA 3ORSA 2PSSA 3PQ5A 3WMEA 1NQTA 2Q7OE 3H7IA 2XB8A 5A0TA 2YL2A 2I2BA 3WFIA 2OCAA 2Q9AA 2V9CA 3RBXA 2CLOB 1ORVA 2PMKA 4OQYA 3IXMA 5T6MA 5LXTA 5JSHA 1T2AA 1FS4A 4RF4A 2GYYA 2J4DA 3KJIA 4PHGA 5FI3A 3U9TA 3S1AA 4BCCA 1X8JA 5TMDA 2RK4A 1NOIA 2FZ5A 5EJGA 3RV4A 3VR6H 3V8EA 4L7VA 1XXHA 1YB2A 1GADO 3PUKA 3AP1A 1B0AA 1WXHA 4ZICA 5DXFA 2DRIA 3N2GB 4NABA 3CURA 1ZI9A 2YYSA 4ARVA 4OVKA 1ISPA 2CLHB 1LK0A 2GN0A 3Q0IA 2PUFA 3ML1A 4I1VA 3ZK8A 1F20A 1W2GA 1Z36A 4NFYA 4XQCA 5AIBA 1L5NA 3ZHXA 2BP7A 3A4VA 1M5RA 3OU6A 3B60A 1E92A 4XGQA 5K8LA 2ZUDA 1X7WB 3PCTA 4QPPA 1UC4B 1I2DA 1T13A 1JSXA 4MUEA 1UJNA 2VHWA 4S05A 3GRPA 1H66A 1PFYA 1J2JA 2WMOB 1GL6A 3R24A 4KXWA 3ROKA 3WNVA 4AYXA 4P9NA 2J0SA 3R9XA 2QW0X 2NSDA 3EXG2 3FHJA 5A03A 4O3MA 4P1ZA 4OFXA 4PZPA 4UXHA 4U9IS 3OCWA 4UBMA 3M2PA 5FHRA 3OOSA 2J7KA 3GEIA 1XXLA 2JC3A 2PWZA 3KVOA 4GF5A 1S2MA 2FSVA 4RELA 2ZUCA 4WWHA 3WQHA 4CV3A 4DIFA 4XSVA 4X3OA 1U1DA 2CHQA 2BEWB 2QN6A 2REBA 2ZETA 1NJGA 3KVVA 4MI9A 3DEYX 4PSVA 4YJHA 6YASA 5CLJA 1TEZA 5K8TA 1KXJA 1OLSB 1S2NA 1ZWLA 4QDTA 4L5JA 2XWJI 3KKNA 3H3FA 3Q15C 4ZAXA 2QPOA 4E09A 3LW8A 4X97A 3EAFA 1KE1A 3WHKA 3UPDA 3PXAA 1ZLXA 2IJGX 1GT91 3FF1A 4KX5A 4RD2A 1T4CA 1U0GA 2CFSA 1B74A 2F00A 4DOMA 4ER0A 4B46A 3PT5A 1EWKA 4JNKA 1AG9A 4P92A 5IC5A 4YJFA 2XW6A 3QLUA 3WISA 1Q95A 5KTTA 2FW0A 4MPJA 1FTQA 4BX9A 3BTSA 3DV0A 2KB0A 4DKJA 3E27A 4I9HA 1JU3A 4EUFA 1K2WA 1OI2A 1TQ2A 1K6MA 2AN9A 5HHTA 3QOYA 1UPXA 1M2OA 2D4HA 4KTVE 3K05A 5EPOA 1KZHA 4YLYA 2XQFA 1OMOA 1NVUQ 3S7ZA 3ID6C 2PBZA 4AL4A 4EHFA 1IQPA 2GFHA 3PFBA 5A9SA 2IEBA 1ZWKA 2O8VA 2E4ZA 5FPKA 1XLVA 3EN0A 3W3AA 1XHFA 3L0BA 3RYHB 3R3XA 3LW7A 1S9HA 2WWRA 3QE9Y 3GF4A 2GAFA 3HJTA 1NAIA 1T5BA 3NBUA 3TDNA 3P32A 2B7LA 4TVSA 3T1TA 2HT1A 2BF4A 3VJMA 4M9ZA 2ZJ0A 3C0KA 4IOMA 2A5FA 4U3JB 4AJEA 4EFKA 2EAUA 1E2IA 3O8OB 4M9QA 3RVBA 3DEJA 3WMXA 1LDNA 1T3SA 2VJQA 4D9NA 2FEMA 1D04A 4RZ2A 3FVRA 4TMVA 1JAIA 1QYRA 1SCIA 3S7TA 2HA6A 2O3UA 4QOEA 2ZBEA 4EF6A 2XKKA 3KR0A 4E4YA 3EPLA 1FW6A 1GN8A 4H31A 1ZCFA 4PNZA 5KTRA 1D2NA 3RVSA 1VPWA 5EJ4A 1ULSA 3N76A 3GC6A 2WF8A 4IGIA 3FFWA 3G89A 1MO5A 2LE0A 2A9QA 1E2NA 3FUWA 3HDVA 2ICAA 3JQ6A 4ID3A 5F78A 4AYTA 5BWOA 3DWGA 4BNWA 1XRLA 4EVQA 1EX7A 1XN1A 1Q0HA 3DDNA 3MMSA 1YQUA 1WTCA 4M36A 3UTCA 2EDAA 4LOLA 3TG8A 4UHHA 4M1SA 5JD3A 3G8CA 4D9MA 5CBPB 1U8EA 1TM4E 3KJNA 3DEKA 1NDQA 3KDPA 4FCTA 3ZDXB 3L1JA 1B1CA 1CKEA 3ESQA 4G4SO 1Q44A 1IOVA 1M33A 2DWCA 2DBQA 2OXCA 2H07A 1EVIA 3FDIA 3JVUA 4Q4JB 1RZUA 3PPIA 4AKSA 1XMVA 5B5SA 1TVKA 1FXWF 3LP8A 3Q11A 3SYNA 4CMEC 1LTKA 3K8OE 4CQNA 4B31A 3EQ8A 4XD2A 4B2IA 1M1YA 3HK2A 4D3YA 4HGNA 3VC7A 2B6NA 5KPDA 5HILA 2VSNA 3WAGA 5IKMA 1CQPA 4E2WA 2O0MA 4M0EA 4D8VA 5LMCA 4X6XA 1FDVA 5FEMA 5KYWA 3GIWA 4RVSA 2QVYX 1WW8A 4B33A 1GY8A 3AM4A 1XVTA 3NVMB 1RXSA 3AMVA 3NC1C 3UHJA 4FMDF 3J7TA 3SVLA 4R2LA 1ULZA 2V5AA 1ZD8A 4MR9A 3AFGA 1A5BB 1YBMA 1K0UA 2G4LA 1PUJA 1YB6A 2LCFA 3PKJA 4JJAA 3O1HB 4YQYA 2RGWA 4ZVQA 4IVRA 1C29B 4FNMA 4JT8A 2WYWA 1KJWA 1CZKA 4N5LA 3RFFA 3UT5B 4F2HA 1IXSB 2QD4A 2Q5CA 2UYQA 3NATA 3FTFA 1EFPA 4Z8XA 3AL0C 3CUVA 3F47A 2C2YA 4V2IA 3RPEA 4YDQA 3ZVKA 2HW8A 3IHTA 2C77A 1LS1A 2FWNA 4LSMA 3SQNA 4BQEA 3D59A 2V7XA 4TMFA 4BKPA 5F4BA 4RPLA 1FY2A 2VPWA 2O4CA 2AVDA 2ZE5A 3DQQA 4MWOA 4YP9A 1Z4QA 1JKMA 2FSHA 1V16B 2I2FA 1LRLA 4KEAA 3WI7A 4BJ3A 1M1NA 4JBXA 4CWAA 4GI7A 4DT1A 1K06A 4BRSA 4CODB 4LDRA 4X8OA 2WVGA 1RXEA 3OY2A 3OT5A 4RANA 1GIAA 3FE2A 3PC6A 4M1EA 4A91A 1BHO1 3ELWA 4IO1A 4CV1A 4N82A 4BQOA 1U9YA 3UJ7A 2GI4A 4GAEA 1P17A 4U2DA 4EY8A 3A05A 3W9UA 1G21B 1ZH2A 4HVCA 2X5XA 1C3XA 2WYUA 1MD9A 3F5QA 1LXCA 3GGDA 3MELA 2QJWA 3R77A 4JLOA 4B6GA 4D4IA 2C0PA 3ECSA 521PA 2VJDA 4OXXA 4GPD1 4XARA 3UV6A 4AVYA 4ACAA 1X15A 1GPBA 1V3UA 3OJEA 5D85A 1O7JA 5CPFA 1M2NA 5B1SA 1JQ3A 2X0DA 4DS3A 4P84A 5FUBA 1L3BA 1V9LA 2VDOB 3JQDA 3OU2A 4HAIA 4C0BA 4C9BA 4B3SB 2F8SA 3FBGA 1JL3A 3D3QA 3CPJB 5DBEX 4WX2B 2P35A 4G4IA 1UJMA 3DOUA 3I32A 3KNZA 3MUOA 4OK5A 3L7IA 5TT0A 1CNEA 1QGDA 4X66B 2E89A 5LR6A 3W3ZB 2C7PA 2CZGA 3UMBA 2JLBA 4MR9B 2O3SA 2PQ2A 3OFJA 5GV7A 2REQA 3FVWA 2V7TA 4DN6A 3TTSA 3EGIA 2LDXA 1U1IA 3KPUA 1K8YB 3RR2A 4J0IA 4ER3A 2W42A 4L16A 4NS1A 3FIJA 4KDEA 1NBMA 5ALMA 3KT8A 5HFAA 4ZT3A 1S02A 1ILWA 3M89A 4U0JA 4HDCA 4XLZA 1QHEA 2I4TA 5FLYA 2FZEA 2QX6A 4IY1A 1BXRA 1IB6A 1Z0UA 3A6JA 2FUG1 1UBEA 1V1MB 3OQIA 4P86A 4TRJA 5FB3A 4D26A 3L77A 2GDJA 4JH0A 4JU8A 2N1MA 5LBTA 1H2ZA 5K6AC 2JI6A 4BP8A 3DXZA 3V7NA 4AMZA 1HNNA 3WLPA 1A7KA 4MLPA 2PLFA 4IFIA 2AHRA 5EWJB 2PT9A 3X1WA 4BRUA 4DMRA 1YZYA 3IUYA 5CNKA 2BR4A 3NBKA 1VI5A 5B30A 3OIVA 1UK6A 4HH1A 5B58T 3C8HA 3TLZA 1NP7A 3CX6A 4NMWA 3CG4A 2E2WA 2G1AA 2YJNA 1J6UA 1SBIA 1UBOS 2OWEA 2ZIAA 3OE7D 4FOLA 2D5BA 3C97A 4QGHA 4KFRA 2ENUA 3RARA 3SZLA 3VJKA 3CEHA 3RS7A 5CH8A 4AXBA 3QVGB 4EYOA 1WO8A 1V5EA 1M66A 1YS6A 5J2TB 5DNYB 1OYYA 1DXQA 1JIXA 1BCSB 4V39A 1DV2A 3IE2A 4I1UA 1Z5PA 3HU3A 4B40A 3PTAA 2JLWA 2JFXA 2YYZA 3GO4A 2F43B 4NPHA 4R8LA 5E8RA 4V0LA 3LGSA 2IU4A 2EFYA 4JI6B 4HZIA 4LZWA 1PNVA 1WF3A 2Q3HA 4YUYA 2WAXA 2BFEA 1CS4C 3UYLA 4Z4HA 2HJVA 2G71A 4C5BA 2HF9A 2HRBA 5HCNA 4XDHA 4ZPXA 4E4RA 1QRDA 3H5WA 4MW2A 3IKMB 4TTQA 4B83A 4N65A 1E5VA 3PNKA 4U7PB 3T5MA 5JSKA 4YR7A 1IN8A 2N0SA 3ACBA 4CLHA 3DAOA 3T99A 3VH4A 5DNAA 5F2OA 4HRAA 4KLCA 2EP5A 2Q0HA 4HATA 3K5PA 4BNDA 4XFKA 5LQDA 2GFQA 4FFDA 3EQ9A 1NJFA 2J0UA 1H1DA 1YQEA 2FA9A 5AHXA 3SR3A 4BB6A 1AMNA 4W5WA 3M1AA 3NBZC 2QU8A 2YOFA 1ARZA 1THMA 4GGMX 4JLVA 4B4DA 3MS7A 4FEAA 4DQ0A 3J81k 3EDMA 1SAYA 1YZVA 3GZTB 2PUWA 2XZDA 3ZHYA 1H1LB 1DV1A 1GSOA 1H22A 2B1GA 3OIYA 4EMBA 1EBFA 3QKRA 3SEAA 4DJDC 4HGZA 3U9LA 4GKAA 3HUDA 4IKEA 4MA5A 5JWOA 2ZRJA 2YVUA 4W7IA 3PGMA 4YT2A 1M9NA 5TEVA 1DIAA 1F60A 1N8SA 4R1TA 3EFOB 4D6XA 3I12A 4YAIA 1T9GS 2BFFB 4JGBA 1G41A 2XDYA 4BUZA 4WNIA 1PL0A 4XZ3A 1BDBA 5TIIA 4BZXA 4DLLA 3HVRA 3L3BA 4CM1A 2X9QA 4BQRA 4YJGB 7ABPA 1JQ5A 1KVRA 3DM9B 3FNHA 4GGOA 5EIWA 5GADl 1I7DA 4S1WA 1ZCBA 1DWPA 2CXUA 3H16A 3QVMA 4MI6A 3VM6A 4B8ZA 4IR7A 2XGMA 3E48A 4M0FA 2PXCA 4KRFA 4JITA 3ZXSA 4PGMA 4CT0A 4YUVA 3G2IA 1ZM4A 4KMSA 1EINA 2COEA 3S29A 1WU7A 4NU6A 1NXWA 3KU4A 1ZUHA 4GIBA 3RIYA 4B4WA 3AIKA 2QOEA 5JSYA 4AMGA 1W47A 1DWUA 5K8VA 1JHZA 4D5GA 2XWPA 2ZT7A 3JTMA 2H59A 3O8QA 4I4IA 4ND4A 1J0DA 5ALNA 3G2HA 2ZRBA 3HR8A 1L7AA 2A14A 5D5PA 2CCJA 2BEKA 3IMEA 5T5QA 2YUIA 1V6SA 1MC1A 2I76A 3FWHA 4MRRA 4ZVKA 5HKKA 3C6BA 1OU4A 1G5QA 2FPRA 4CLDA 4MA0A 5K51A 3RG8A 3ER9A 1VRCA 2CJFA 2O5VA 3BB4A 4A0QA 1XVVA 1N34B 1H1LA 4BNXA 4L8FA 5DM70 2HJHA 1DKOA 1E6MA 1V1MA 3RIXA 2VKQA 1NMSA 3FN4A 1NIPA 2H57A 4ZYTA 3AUKA 4W7SA 5BSUA 2X8WA 1QONA 3FM9A 5A4AA 1HDOA 1NP3A 1VRVA 1QB8A 3CZ5A 1NNLA 3FOBA 3ZD8A 2F8TA 3WDKA 1R0XA 4YXWD 4S1NA 4R8RA 3TBHA 6ABPA 4FR0A 1PNTA 2ZRPA 2HH9A 4D3ZA 2B4TO 4R6XA 3REOA 2R6JA 3ONWA 5DBOA 5DGTA 4R8VA 4KWEA 1SCBA 2NWQA 5DGIA 1JMKC 1XKQA 3FUUA 4KACA 4WOJA 2QTLA 2BCJQ 1GYQA 3NWOA 2J08A 4QOJA 5JSFA 1A2OA 1UFOA 3CBGA 4F6CA 3J80A 2WM8A 1RWVA 3AERA 1QGED 1KQ3A 3IL2A 5TJ9A 2ZE8A 3H9GA 2ZOSA 1BYUA 5F12A 4RHTA 4DUZB 2P6RA 3GRAA 2YMPA 5ALYA 3VC2A 2PMEA 2VQEB 2R7AA 4E88A 4HB3A 1F2UA 3TPZA 1GYPA 1ZCAA 2B0JA 4ND8B 1MG0A 3N8IA 4TRNA 3UYKA 3V7UA 3CVWA 5I4IA 3NYQA 1UQTA 2EWVA 3L8YA 2E55A 3AT1A 3ICWA 5DW3A 1FQWA 3W77A 1MAHA 2HMUA 2KYRA 4R05A 3W8DA 5JARA 3W8FA 1GPWB 2UXBB 2GVZC 2F3SA 3F6RA 3K09A 4ZOQI 5BUCA 5HNKA 4R84A 1FXWA 2IDZA 2QE7D 2ZQZA 1N9KA 4QU5A 5B4UA 1Z37A 2BZSA 2OK7A 2JFWA 3WWYA 4OQFA 4WL0A 1JBEA 2VDPB 1YRAA 2XT0A 2X4IA 4B3BA 2FP4A 1TW2A 3R74A 5HVNA 5ITVA 1HRKA 1TCBA 3MRVA 4KQJA 3T3DA 2IE8A 2AZXA 2PX0A 1DC6A 3C3WA 3O2QB 1ABEA 4KP7A 1X1AA 3T3PB 4DMKA 4KR6A 1XAIA 3DD5A 3BGSA 1D8AA 2O7NA 2HYIC 5K6RA 1EDOA 2R96A 4NESA 2L18A 5CD9A 1VIDA 2HA7A 3A1EA 1PRYA 4QECA 5HRCA 3RI3A 3N53A 3GJ3A 1P81A 4JC4A 4IZ6A 1GFIA 1X7GA 4PE5B 4RQBA 1OAKA 4OOFA 5AM5A 3WJ2A 1EUYA 3JQ8A 3QM1A 3OA2A 2QN8A 4DV5B 2P9TA 3FMIA 3M8KA 3DCYA 3E7PA 1XRPA 1FW8A 1HETA 1JI3A 1V1RA 2IW3A 4FQ7A 4ZMRA 2O1SA 4NJOA 2ZIWB 4OK3A 3U7QB 5FAKA 4GL4A 3RKSA 3UMMA 1CLEA 1NW4A 2P9FA 3IERA 4LMBA 4WOBA 3TLGA 4DMLA 4F7WA 2B69A 4N49A 4I66A 4DPMA 1LKZA 2B99A 4FW9A 2P30A 2VOEA 3DE0X 4BLSA 1L9XA 1NZDA 2QP9X 2V6IA 2W48A 4LXTA 1SXJB 2FOXA 3V1KA 4EJFA 4CV2A 5I8ZA 5KTOA 3OEHA 3QBDA 5KQLA 4X8LA 1DADA 2X7XA 3PJEA 4IDDA 1Y3CE 5JPIA 5B4VA 5CG1A 3KETA 4ZT4A 1KSHA 2NX2A 421PA 4FDVA 2PS3A 4IS2A 1O94D 2FHPA 4WK0B 3F4LA 4MP6A 4ENUA 2ZJ4A 1AUXA 1ZVMA 3I58A 3SC2B 1EGAA 4AT1A 6LDHA 4ZQBA 1I2ZA 4HPXB 1I3KA 1KJNA 3U56A 4RO0A 1G42A 3Q72A 1ZNYA 2R1UA 4CPDA 5EE1A 1GFWA 4U9UA 1VC2A 3P8ZA 4RXMA 1ZJJA 3FGPA 1DTEA 1P7WA 3K0HA 5JSZB 2BZGA 2I66A 4MPRA 1XDSA 1QHSA 3ZBUA 2DBVO 2ORIA 4UHJA 1U2GC 1YR1A 1WCWA 2PAAA 2Q99A 3IMCA 4ZEXA 4B0OA 2CSXA 2VNJA 4HWOA 4JVLA 1V2GA 3ZIDA 1JR3D 2MR6A 5AOCA 3ZLBA 4BX3A 4P3YA 5D7NA 4F2GA 5BP7A 1M7BA 1JR3E 2X2FA 4FC6A 2D8MA 5H70A 1BVUA 2I99A 5IEBA 1XQWA 4IIGA 1YHYA 3BWXA 3OESA 3VX3A 2FSSA 1NVGA 2R5FA 1T15A 1L1FA 2BGWA 1KBZA 3HVIA 1AKNA 2ZI5A 3OJLA 4MWGA 3MUFA 4RKFA 5TGZA 3INNA 2O52A 2PR7A 4Z6KA 4RVFA 2JIBA 1ESZA 4MB0A 3WVNA 4AZVA 4JXXA 5IT9A 2KE5A 3MTEA 1E5LA 4X24A 1RAEA 3R7AA 3TF5A 2W4QA 4CEHB 1L4NA 1AQ6A 2GHTA 3C3BA 3O7MA 2IZ6A 2YVAA 4QUHA 121PA 6REQB 3LV8A 4BNGA 1X1BA 2OT3B 1CU1A 5H68A 2IBTA 2JLAA 1VBKA 3N3AC 2MHCA 1HG0A 2O50A 2C3OA 3G7SA 4O6VA 3PT9A 3P0EA 2GZ1A 5CUQA 4CKEA 2WUEA 2EOAA 2RC6A 4KZPA 4QPCA 4RYLA 3ZUGA 5C5DA 5EMNA 1FP4A 4EKYA 2A5LA 2QENA 4X1KB 3HCRA 4JQCA 1D6JA 3RBVA 1NX9A 5J5VA 3IP8A 4URUR 4F11A 1GEGA 2YHBA 3WL5A 3D3KA 3KOZA 3G0BA 2WJVA 3G68A 2QE6A 3I37X 3T5GA 3PQDA 1U0LA 2P78A 1VL5A 3FSGD 5TVKA 3ZWVA 1YC5A 3RC7A 1LLDA 2AJ8A 3V34A 1ZUNB 5SICE 3WB2A 1BC5A 2NACA 5EUCA 3T0IA 3SYKA 1U3DA 4MMYB 3WZLA 5AR1A 1ISSA 1OIVA 5AJYA 4ZHQB 4FZ3A 4MR7A 1QH1A 1N6OA 1ZGGA 2X76A 2YZMA 1P5HA 3ORRA 3RVQA 4L9AA 4DAOA 4Q9NA 2BV3A 2DXIA 4HEJA 3FNFA 4R7GA 4PLZA 4FN4A 3QIVA 4F71A 2P27A 1RHJA 3UFXA 3H13A 3HCBA 3VQTA 3IRVA 2ZIEA 1CWUA 4FIZA 4YJ2B 1GTJ1 1QK3A 2CCGA 3FOCA 3PGVA 3OZFA 4KO1S 3W5SA 3DLTA 2G67A 3KDSE 1XX6A 4Q5IA 4BE9A 1X7YB 7REQA 4GSLA 2ADOA 2WSIA 3MWJA 1NNSA 4N39A 3JARA 1D1QA 2CFCA 2QZ4A 4OREX 5E6SB 4YP7A 4QIHA 2PCJA 1B6GA 1IJFA 1I3MA 3THWA 1T9GR 1U7WA 3TLMA 1FXUA 1XT6A 1KJJA 2YBDA 4I8XA 4G0WA 1S8AA 3H1BA 3LVQE 1MVLA 1I4OA 4QHYA 1TUBB 1FTSA 4CKEB 3H65A 1XXHB 3C6YA 2IZOA 2WHPB 2ZK7A 3K1JA 1TLLA 3MINB 4HVTA 3VDNB 1WNFA 3CSUA 1GGJA 3NBMA 2E82A 4LBWA 1TTTA 4DPKA 4NENA 4H35A 3K6JA 5HZHA 4RVCA 3MA0A 2RH8A 3G13A 4Y1RA 3EXIA 4II7A 1R2QA 1QLWA 1JHVA 3TQCA 2W22A 4Q3BA 2FSPA 4HTFA 2EP7A 5DJ5A 2NV0A 3FB1A 1SBQA 3D4NA 3QTBA 4HQOA 4BLRA 1IBCA 1RW4A 4EUNA 4ZOAA 4H59A 4PGAA 3VYVA 4RK6A 1RM3A 1YZFA 1UPTA 1XQ1A 1NJ1A 4CCSA 2FVYA 3TH5A 3RF6A 3KO8A 4IJVA 4S12A 4LRWA 2RJOA 4UOQA 3JQRA 2BCGY 3NIGB 4GOXA 4MUAA 2C8LA 2J4CA 3PNVA 4QX6A 5CB4B 2JLZA 2XWQA 3L8DA 1L3IA 1YVPA 2G72A 3D2AA 1Z63A 2IX9A 4B43A 2UZ0A 3SZ3A 2FPSA 3ODGA 1OH5A 2G4VA 3K9WA 3MT0A 4ZT6A 4BFYA 2PLAA 3ERCA 4B09A 5I4KA 2HNAA 4HEQA 3RFTA 2P2GA 4X62B 1CVIA 1DAEA 3IT3A 3O0DA 4L5BA 4XWYA 1AN0A 1SC4A 2BMWA 3P9XA 5FULA 3RVRA 4BATA 5K4GA 3JY6A 3OZUA 4B8YA 1G8HA 5HIIA 2PG3A 3V5NA 2G4CA 1WD5A 1C7IA 2EDCA 1G0NA 2V7GA 2FPIA 3O1LA 3AVTA 2FUNB 5DYTA 5E0OA 3B13B 1II0A 2RHDA 4XYBA 4AQ7A 1TJPB 2NAFA 3M6MD 2G77B 2XB4A 1L8QA 2VRWA 3FHTA 2HLHA 2XWBF 2FH5B 2XQKA 4BEVA 2HLDD 1YA6A 1T0HB 1ZD2P 2HA5A 3IKLA 5H9VA 1Z0FA 1N7GA 2FW6A 4OHUA 4H17A 2NYRA 2BSQA 1XMXA 2OGSA 4EG8A 1NNUA 2J7PD 1U3TA 3CKMA 1PTJA 4IGFA 3X1ZA 1LWNA 2ATXA 3NPAA 4FYVA 3ETJA 3H1TA 1E58A 3O1JC 2AXPA 1JIQA 4HAYA 4QXAA 1VYUA 1WKVA 1PT5A 4LCEA 4CZ2A 8OHMA 2YZ2A 5JAHA 3SIRA 3HSSA 4ZPJA 2JH3A 4JLDA 4ND2A 5BURA 5CVTA 3ZD9A 1NUSA 2JLSA 2YVQA 1N6HA 3FIUA 4MPTA 4GC9A 4OXNA 4BJ5A 4BB9A 2R47A 5HS4A 4D8XA 1RQGA 2B6HA 4H3KB 4AJ1A 2VO1A 2W6NA 3RS8A 2TRSB 3EVGA 2DQYA 3R5SA 3IEVA 4FSHA 4U3JA 3HFRA 2QM0A 3GPCA 4Y9RA 4KI7A 3VNAA 1PW5A 2Y1LA 4CUKA 1OVGA 2JBAA 5BO5A 3T54A 5A9RA 4I46A 4WZAA 4W5TA 1ETUA 5IAAA 4Y2YA 3GVCA 3K20A 5IC6A 4W6QA 1MRZA 4Z9BA 3HBFA 2GYVA 5EFZA 2V1UA 2O8BB 2C5FA 4FE3A 4EW3A 3D43A 2X14A 3MWYW 1LRJA 1J1ZA 1KJIA 2XBLA 1BXRB 3LU1A 4NC9A 3UWPA 4S04A 4MVJD 1C9DB 4LN1A 4Z0HO 2YRWA 3NXKA 4K9OA 2GBGA 3BILA 4TV8B 4ND1A 4FBLA 3TK1A 5HP4A 4FS3A 1SEVA 4EO9A 1U6IA 1N0IA 4NOJA 2HMSA 5FPSA 4D9KA 5LD2B 4ATNA 3HCAA 3C6MA 3OJFA 5AVJA 2Z09A 3ZU4A 4C7JA 4P93A 2ATIA 1AS2A 2OB1A 4NZYA 4HDOB 1P19A 1KI2A 2EJTA 3NT5A 2LVBA 4Y6LA 1FVXA 4L22A 4FOPA 2JBHA 1LNSA 2VJYA 2HAEA 3F6YA 2IYFA 3MRSA 1YSCA 1KI9A 1LVGA 2PXAA 4YJFB 3H2HA 1F1JA 1SG6A 1GKYA 4CM4B 4EABA 5U9CA 1LPBB 1SQ0A 3I62A 4R3NA 4I1PA 4AY5A 4OX9B 5JC8A 2RHJA 2VXYA 4MEJA 2GHIA 1TIBA 5F51A 4ARCA 4UARA 3PUYA 1ZHOA 1WX1A 4W99A 5F5XA 3DYVA 4KQMA 4RHEA 1KDVA 3MT7A 4K9RA 3IP9A 4EB3A 4IUBS 1EXMA 4KMMA 3AF4A 4TMKA 1O96A 1HGXA 4GP7A 5J47A 1P0CA 1K3FA 1GPNA 1IJBA 3CZPA 4M83A 3GLSA 4NBKA 4EHDA 1VE9A 3EZGA 5K0FA 5JS1A 3WLRA 4ZZ1A 1ZR4A 3N86A 1YQDA 4LQ4A 4M38A 4KUGA 4LKRA 3F49S 1W30A 1D2GA 1P4JA 4KQ1A 5EQDA 3NAZA 2ID7A 1DO0A 1E6EA 2PVCA 3L05A 1TYAE 1TPZA 1E3TA 1Y6JA 4EKEA 4HGRA 5LQJA 3FJ1A 4UTRA 2NQTA 5F2EA 4E3ZA 4RSRA 2A4MA 3E7FA 2VUTA 1RJFA 4DG8A 1CDEA 1W96A 1QGYA 1ZNXA 3WLQA 3IKTA 5AP9A 3FYDA 3UJCA 1X3SA 3JQAA 1K6EA 2CE7A 1CUVA 3S2GA 2Y1WA 4XB1A 1T2DA 2XBMA 2G88A 4KR0A 2QGFA 2Y0BA 1U7HA 4UD6A 5G4LA 2YHUA 2QY6A 1EUCB 2HU7A 3PPVA 4WOKA 3RB8A 3MBIA 2CBGA 4ZARA 1KMCA 1UMDA 4PM4A 4C4XA 2WJPA 5DFAA 4QSHA 1E1NA 4RTOA 2QG6A 4E08A 4MW0A 4M49A 3C8UA 5T7BA 2VDQB 3D4IA 4HNAB 5AVOA 4EO4A 3GT7A 5ICMA 4KNWA 1RJEA 2MINB 3GN1A 4BIMA 1UFRA 1VCNA 1WUTA 3ZWDA 4KL8S 1GNVA 2BTQB 4I5FA 3BA1A 1VYVA 3D1JA 3OPYI 3VGPA 3VNRA 3EVEA 4IIEA 1N0WA 4J16A 1TA0A 4ASUA 2EF1A 3D81A 4CI9A 2AFRA 3WL7A 3AG5A 1FA9A 1LSJA 2JCGA 4IWXA 1BS2A 2BFDA 3CKKA 1XEWX 3AJAA 3ROFA 3D31A 5ALVA 4PPYA 5I8PA 1LPSA 1H2XA 2P0YA 1Y6QA 4Q4AB 1T9HA 1THGA 3OKCA 1W29A 1JA1A 1H0RA 5AJWA 3R5XA 5D6NA 2X1VA 4WZAB 1DIBA 1ESMA 2C4UA 2H9AA 2QT0A 5IW8A 4IJWA 1XRRA 2QW1A 4Q9IA 5DE3A 2HB6A 3OCYA 1NV9A 3TUJC 4YY3B 2FXVA 1RAGA 2RH4A 4RCYA 1CRQA 3C6QA 4MINA 4MQEB 3NHUA 5AK6A 1Z6XA 4UVEA 3GFQA 1CE8A 5U4XA 1ENYA 3HR4A 3NKLA 1OR8A 1LH0A 2FPWA 2AT1A 2HJ9A 2W4MA 4N6GA 5AVSA 5JIBA 2O5CA 3BVPA 4Y98A 4EYSA 5C8ZA 1RRPA 2ZREA 4XUDA 4YHBA 3VAZA 1FZTA 2UYHA 2GXUA 1RS0A 1PT7A 5AI8A 4YX9A 1UC9A 2J41A 4R9NA 4DCSA 3EIXA 1UDBA 1Z4MA 3EH2A 2DH5A 5FOQA 1JQEA 4LYGA 4KYUA 3TMYA 5JAUA 1XP8A 3RKRA 4B2YA 4Z3KA 1XPJA 1EFTA 2M9MA 3PSAA 2H63A 2MR5A 1HFJA 2IZ5A 4JUIA 1SVMA 1U98A 2PKYX 5BYBA 3S27A 3TINA 2AG6A 3CUKA 4U2KA 1NVTA 5CAEA 3B9RA 3NP7A 1GUZA 4E5UA 1ODLA 1B8NA 1PT9A 1DJOA 2P11A 1RSZA 2ZSDA 4HXEB 2VZ8A 4IRXA 2BFNA 3UCFA 4PZAA 2CFRA 3UXYA 1B6SA 4OP2A 4OQLA 5FJIA 4BO3A 4BVJA 2RIPA 2VZEA 2BFDB 5CA1F 3KE8A 1FVFA 1JEOA 3PNOA 1K66A 4MS4A 5IJAA 1O0CA 3DTVB 2JARA 2PKCA 4O2BB 2PKQP 4P5DA 3WNQA 2VWQA 1OYWA 1A4RA 3DOJA 1S8FA 4L5YA 4J03A 1PK7A 2E18A 5BVGB 1ZI6A 2V4UA 4L8GA 3RC3A 5IULC 3ZDFA 3T7JA 5EWMA 4A6DA 1WXDA 2ZAGA 1J1IA 2FR8A 3QTLA 5EWLB 5FTNA 1O94C 3MBKA 4ITVA 4KN5A 2F1OA 1NW3A 4R1SA 2CSUA 4DLWA 1BAPA 1XDGA 5FWYB 4D82A 1YR7A 1U0JA 3HY4A 3IQDB 4UUPA 4Y9SA 4A5SA 4YQZA 5D8DA 5FTJA 1JR6A 2XVMA 4YALA 2AUMA 1DAPA 1SK8A 4ARZB 1GFZA 4P33A 1UWVA 1KYIA 4Z7QB 2J9YB 3RUAA 1FFBA 3VRHA