3C70A

Hnl from hevea brasiliensis to atomic resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Hydroxynitrilase
publication title Atomic resolution crystal structures and quantum chemistry meet to reveal subtleties of hydroxynitrile lyase catalysis
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 92
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c70A00
2GYUA 2ONCA 1THGA 1DTEA 3R40A 1DWOA 4B0OA 1CUAA 4LXHA 5LZ7A 2RAUA 3AZPA 2EDAA 4GHWA 5I7UA 4PSDA 4HAIA 3R3VA 4CG1A 5LZ8A 3DYVA 3O95A 1MX1A 3GELA 5HQ3B 5JZBA 3H0CA 2WQZA 5EIEA 1L7QA 2V97A 5HFNA 2B61A 4Y2RA 3EIOA 4H7EA 4U2EA 2OQVA 2JBWA 4AMYA 2BCEA 5BV7A 2HRRA 4LKOA 1DT5A 1FFEA 5ALEA 4OU5A 3PF9A 1EK2A 5JD5A 4BRZA 3CN9A 5AM5A 1W76A 4BZWA 1J07A 5LKRA 4H0CA 2O2GA 1LBSA 5FV4A 4UFOA 1BN6A 4Y2JA 3R3ZA 4X6UA 1CUUA 3BF8A 3LLCA 5F4ZA 1P0PA 1XZLA 2OCLA 3R3YA 5CXXA 5IVIA 5ALZA 2XMCA 2D5LA 1N5MA 1E89A 3DDUA 3I2HA 2I3ZA 4M0MA 3C6BA 1W1IA 1XLVA 1EVQA 3QPAA 5EHQA 3WZMA 4H77A 4HVTA 2WUGA 3KOOA 3ZWQA 3C5VA 4BVKA 2XUAA 4PV7A 3N0TA 3PFCA 3E0XA 2BGNA 1XZFA 2XLBA 5CW2A 3FWHA 1ACJA 3DYIA 5AIAA 3B12A 1XZMA 2J4CA 5JAUA 5ALQA 2JGMA 3KXPA 1NU6A 3NUZA 4CCYA 3A70A 4FBMA 5AKZA 4N5HX 5A2GA 4GWLA 4E46A 2RI6A 3B5EA 1CUHA 2XQGA 4U2FA 4RE6A 3S8YA 5EFZA 3BF7A 1VXOA 5LZ2A 3RARA 5JASA 3WWOA 1EH5A 3QVMA 5T4BA 2JF0A 4AMZA 1VA5A 1HL7A 4X90A 2GBGA 4EY5A 4KE8A 4UBNA 1XZHA 2QUBA 4N5IX 4I19A 4MEAA 5E4JA 1XKLA 5K5EA 2IX9A 1ISPA 2OGSA 4ROTA 3ESAA 2OQIA 1GPKA 2XMZA 5LIPA 5ALJA 1VKHA 1MU0A 5AM2A 1Q0ZA 1ZI6A 1GPLA 4GECA 3R3WA 1O6FA 2CUTA 2YH2A 2QMQA 1P0IA 4K6HA 1TK3A 2B9VA 4B7ZA 3T52A 1K4YA 4OD0A 3ICWA 3VVMA 4OUKX 5ALYA 4FLMA 2DHCA 5JARA 5DWDA 3STYA 1VXRA 3EQ9A 4DSAA 1W6RA 4Q3LA 3RK4A 1Z68A 2QJRA 4MXDA 4INZA 3OPMA 3R3UA 3FYUC 2WHQA 4UHFA 3ZLVA 1MJ5A 1DWQA 4MQMA 5IVDA 4BBZA 2QVBA 1XRQA 1H23A 4BRSA 1LPAB 4BC0A 4GDMA 4CIAA 5AK3A 4YK7A 3EF3A 1SC9A 3FAKA 4U2DA 5FRDA 1QIIA 4QDXA 1YAHA 5KWJA 4A5SA 3G8YA 3VVLA 1H2WA 2PBLA 1K63A 5EHNA 2WIFA 4JEIA 3A2LA 2XDWA 2VATA 3RM3A 2OXEA 3UUEA 2QXUA 1N8SA 2XI4A 3C5WP 1YASA 4X6YA 4WDRA 3VJKA 1QIHA 5E2IA 5AH0A 3ZPXA 3UMJA 2OAEA 2ZSHA 4UHHA 1E8NA 3W9UA 4EY7A 5JALA 4K5QA 1XRNA 2WFMA 2OCGA 5AM4A 5A62A 3HJUA 5T4EA 2IIVA 4FKBA 2PL5A 3DNMA 4WFIA 3GROA 1EK1A 2CJPA 4EBBA 4MYDA 4AO7A 4ARBA 4J0JA 5FPPA 3K6KA 2HA6A 2XUJA 1BROA 5DNUA 2Z3ZA 3FSGA 4TGLA 3WZLA 2QTBA 3K9BA 1A8QA 1GZ7A 3F96A 5C7YA 4CIBA 4L0CA 3FSGD 3H2IA 5BOVA 2WHPA 1E8MA 3K2IA 4UHBA 4KRYA 4HXFB 3IVMA 1O6GA 1GKLA 4BCDA 5FPQA 4BCCA 2HU7A 4M0FA 4Y2YA 4WY8A 1UKCA 1ZI8A 1THTA 4BVLA 3OM8A 4J0KA 2VEOA 3F8SA 3PFBA 2DR0A 3WWPA 2JGJA 1B41A 3PDCA 1AURA 4AQDA 2QJWA 4UBIA 5ESRA 1QGED 2BUBA 4DSZA 2VAXA 3DOIA 3R0VA 4X92A 5K3FA 1MNQA 3ANTA 1YS1X 3IUQA 7YASA 3ZI7A 3WWCA 1W75A 2ZJFA 1R4ZA 5ALUA 4W9RA 3OOSA 1U2EA 2B20A 4PF1A 1JJIA 3MUOA 4K2AA 2LIPA 5ALNA 2Y6UA 1XQYA 3WJ1A 3RLIA 2Q0XA 2CZQA 2BKLA 4H35A 4CI9A 2PPLA 4RE5A 2D0DA 1MAAA 2XUKA 5ALGA 5JAOA 1AC5A 3OTQA 3G7NA 1YR2A 1S8OA 4EY8A 3WL6A 3UUFA 1UK8A 3SX4A 3VXKA 3C43A 2ACEA 2J3DA 2G5PA 4BDSA 4H18A 3C87A 3AIOA 3F98A 1U8EA 2RONA 4UHCA 1GKKA 1IUOA 1DU4A 5FUMA 2I3DA 1FJ2A 3V1MA 1EB8A 5AK4A 1WPRA 4Y2SA 4WFKA 1CEXA 4OYLA 3RKSA 2J4FA 5CTAA 2XT0A 3G0IA 1CUVA 2WM2A 2QT9A 5LKAA 1QOZA 3W9BA 1UK6A 1BN7A 2GBIA 5ALPA 1AGYA 5DNVA 4Y2QA 5AK5A 4WCVA 1PJAA 4U2CA 1XZEA 2IITA 3MGAA 1CVLA 1BCRA 2WJ6A 3C6XA 1H2XA 4EZIA 4K6GA 1L7AA 1HDEA 5E4YA 2Y6VA 4ITVA 1LLFA 3AIKA 2FJ0A 3BIXA 4P9NA 2WG1A 2RHTA 1TCBA 2VT6A 5AIBA 2XMGA 1ZICA 5ALMA 1XQVA 4X85A 1WHTA 2PKYX 3F97A 1WB6A 2XE4A 4H7IA 4J0CA 5FLKA 4QWMA 4X97A 4F60A 3L1JA 1ODCA 3DOHA 2P8SA 1SFRA 4GEGA 3AILA 5D3KA 5AKXA 5DYYA 3O9VA 2PU5A 3D3NA 3IBTA 5JD6A 1MO2A 3IA2A 3V1KA 5EIAA 2XUPA 2HHAA 5IVHA 2AJCA 5FXMA 3D2BA 5A7GA 4QDTA 2ZJ7A 4AZ0A 2XUGA 4KACA 1QIKA 4Q82A 1BRTA 2OGTA 1AMNA 2WUEA 2OLEA 1IUNA 4HTAA 2O2HA 3M82A 4ZV7A 4L9AA 1T4MA 3H18A 2WG2A 3H1AA 2WKWA 4UUQA 5D7BA 2BGRA 1XZCA 5LP1A 1RYYA 4Y2TA 4UPDA 4C4XA 1CQZA 4U2BA 2WJ3A 4DMCA 5AOAA 3AJAA 3FVTA 3PF8A 2ORYA 5HQ3A 2JEZA 1MX5A 4LYDA 2C7BA 3NOXA 4WJLA 2WJ4A 5K3DA 4UFNA 3GA7A 3DLTA 3H2GA 3NWOA 3Q8WA 5AI5A 3HABA 2EEPA 5DNWA 3R41A 4KEAA 5LZ9A 5SYMA 1VZ3A 2DFPA 1IUPA 3WK5A 5KREA 2XMBA 3HSSA 1ZD2P 1G5FA 3HACA 5AKEA 1F0NA 3VDXA 4FDMA 5JAHA 1QIGA 1I6WA 3WK4A 5ALWA 4LXIA 1UOOA 4LHEA 1VZ2A 3O9MA 1CFJA 1VE7A 2H7XA 4C4ZA 1W52X 1WHSA 3M3DA 5C8ZA 4QEKA 4NMWA 3H04A 4B6GA 2WTNA 1GQRA 4UHDA 1YCDA 1JFRA 1YA8A 1IZ8A 3STTA 4UBMA 4X7BA 3WKDA 1ZIXA 4DGQA 5I8PA 1FSSA 3DJYA 3O4IA 5C81A 4JH0A 1EI9A 4H7DA 4H7HA 4AO6A 4KR0A 4JYMA 1W4LA 1XFDA 2AJDA 3IURA 3AZOA 1ZJ4A 4EA6A 1R9NA 1DWPA 1G42A 2E3JA 5ALSA 1LBTA 3BL8A 1XQWA 5IKXA 2H9YA 3STWA 1JI3A 3WI7A 3C6ZA 1Y7HA 5AKLA 1LPPA 3P2MA 2V9ZA 1WB5A 4S0XA 1E8DA 3I1YA 3WK8A 3BJRA 4W1SA 3I28A 2ZYRA 3STVA 3I6ZA 5JANA 4RGYA 3PUIA 3H17A 3IUMA 2ZYIA 3WL7A 3BE8A 4J7AA 2V96A 2OPHA 5DYTA 3I1IA 5CURA 1CUYA 5IVKA 3H19A 1MX9A 2XMRA 3DL4A 3H2KA 3JWEA 2DQZA 2HM7A 5EHXA 1EHYA 3H2JA 1IZ7A 1GPNA 1DX4A 5ALHA 2C0QA 4ZRDA 5JATA 1WOMA 2AXEA 3D2AA 2VAVA 3CCCA 1VA4A 2WFLB 2WFLA 5CH5A 4DNOA 5JD4A 3I2FA 4EY6A 1YA4A 4OB8A 1GXSA 5AI9A 1AQLA 3JW8A 5ALVA 4N8EA 1CUIA 4KRXA 4O08A 2AJLI 4Y9SA 5AKKA 4QDZA 1NX9A 4ZWNA 3ESBA 1X70A 3AINA 3O4GA 4B0PA 4G8DA 3LP5A 4MQLA 4EY4A 1BEEA 1VOTA 2PU7A 1AUOA 4YASA 5J3JA 3QBJA 3VJLA 3V1NA 1DINA 4Q3OA 2I03A 1UOPA 2Z3WA 5AOCA 4BATA 1M33A 2G4LA 1TRHA 4DLNA 4J0DA 2HA2A 3DQZA 4A23A 1C4XA 2I78A 2NW6A 4ZXFA 4BCBA 4FLEA 5YASA 2UZ0A 1UWCA 3WK9A 2GYVA 4B84A 4I3FA 2PUHA 5HCUA 1H2YA 2EDCA 2PSHA 4DNQA 1MPXA 2PM8A 4B9EA 1TQHA 4DNPA 4WDQA 2BAGA 3WKAA 1GGVA 1CUFA 2HFJA 3EBLA 5EIHA 2ES4A 3D4LA 1Q84A 3DL7A 4IHAA 4MEBA 2CEKA 1E3QA 1UKBA 1WPXA 3VJMA 5CBKA 1H2ZA 2QZPA 1LPSA 2ACKA 2JGLA 3HEAA 4QZVA 5CT8A 2W22A 4G1FA 1K5PA 1QJ4A 4XWGA 5ALTA 1XZBA 4BP8A 5K3EA 2C5GA 2WIGA 3ESDA 3NGMA 3D7RA 3BWXA 2VT7A 1LZKA 1OXMA 2PSJA 2Z8XA 2Y2VA 1AX9A 4DMFA 4W1PA 1BCSA 5HKAA 2R11A 2QRUA 3D2CA 3ICVA 3LIIA 2VJDA 3IULA 4DM7A 4P08A 3MUNA 4X91A 2VQ6A 2O2IA 3B3QA 3O0DA 4QA9A 2OCKA 1BU8A 4B85A 3A6ZA 2CMFA 3WLAA 3WYNA 1QO7A 4BTLA 3SK0A 4P93A 1EA5A 2XUOA 1QO9A 2CB9A 3OC0A 1VE6A 4FFWA 3DD5A 3DKRA 2DSNA 1QE3A 3QMMA 4IH4A 1Y37A 2WLSA 3M81A 5D3ZA 1YSCA 1ORVA 2BJHA 5A71A 4BE9A 2WSLA 2BFNA 4AZ3A 2Y2UA 5CH3A 2QXTA 5AOBA 5AI0A 1QFSA 4DYHA 3YASA 2O7VA 4L72A 4QWWA 5CT4A 5AP9A 3OG9A 2RHWA 2JGFA 2O7RA 3D0KA 1JMYA 2XMSA 2GYWA 4Q3KA 3QMVA 1QIEA 4TPKA 4PSCA 4A16A 2HL6A 3BXPA 1XZDA 4HRXA 1GT6A 1EINA 1CUEA 1XROA 5T4HA 4ETWA 2CBGA 3C45A 5FKJA 4Q34A 1CR6A 2DHDA 1SCQA 4OYYA 1A88A 5T4FA 4ZGBA 1QIDA 4J0IA 5HF9A 1QLWA 3DCNA 3WA6A 3GFFA 1FFBA 2W6CX 1PV1A 1CIJA 4AN1A 5KWIA 1HKHA 2H7CA 3W04A 3HZOA 1UOQA 2C58A 4X94A 2OGZA 4GI1A 4HZGA 2XMQA 4Q05A 1HLGA 4BP9A 3BIWA 3E4DA 1XKTA 2DHEA 3I2IA 3R3XA 3G9UA 5AI8A 3PUHA 3QPCA 1CRLA 4C87A 4LXGA 3ZV7A 2B4KA 2GBCA 2WTMA 3U0VA 1F6WA 3I2JA 5C8XA 5CXUA 1JU4A 4IO0A 5HKBA 1UKAA 3F67A 4FBLA 2PUJA 4Y2VA 2WUFA 6YASA 2BUCA 5DTIA 3PI6A 4C89A 3C8DA 3N2ZB 5AO9A 4UHEA 1XQXA 3VISA 3WL8A 4G9GA 5K3CA 1QFMA 4GLBA 5ALKA 3WKEA 4EUSA 5LYYA 3HYSA 2WILA 5JZSA 3KSRA 1XRPA 4FOLA 1PFQA 4FFVA 5AI4A 5EHZA 2PVSA 3QM1A 5IH7A 1X2BA 5C8VA 2FUKA 4B82A 3F9CA 3HI4A 4M0EA 3WK6A 1LPBB 1CUXA 4JYPA 1KEZA 3HXKA 5H3HA 1F8UA 4G5XA 4KAFA 4OPMA 2ZYHA 3WWEA 3CXUA 3T4UA 1QTRA 1ZGCA 2QS9A 2QM0A 3S2ZA 5AHXA 2C0PA 3FYUB 3FYUA 2ZVDA 4NZZA 3G02A 4X3CA 4JUIA 2XQKA 1JT2A 4BZZA 1CUCA 1WM1A 2Z8ZA 3QYJA 4IH1A 4IQ4A 3WMRA 2XUDA 2HU5A 4WY5A 5EGNA 2JIDA 4QLOA 3GBSA 2PSDA 1OILA 4B81A 1CUWA 3HRHA 4KJXA 1F0PA 2XB6A 3KDAA 4MWTA 2G5TA 4C6HA 3IIIA 3O4HA 5HF8A 1NU8A 5ALIA 1P0MA 4BDTA 1JJBA 1TCCA 4FLFA 2XUIA 3PICA 3AZQA 1Y7IA 2ZYSA 1U4NA 1E5TA 1T2NA 2JGIA 1LZLA 3H1BA 4FWBA 3WK7A 1ZD4A 5HK9A 4KAAA 2QUAA 3FYTA 1ACLA 1UT6A 5AKHA 3W2TA 5HF5A 2XQJA 1TCAA 4OB7A 5AKJA 2XUHA 1LPOA 4QDOA 3WJ2A 5ALRA 5CMLA 3KWJA 1EX9A 4YX9A 4GW3A 4L3WA 5JADA 4RPCA 2PSFA 3TGLA 4F5ZA 5BWCA 3WA7A 3L1IA 2DQYA 2VA9A 1DQYA 1A7UA 2QR5A 4BC1A 5JAPA 4K6KA 1LNSA 1R1DA 4ZI5A 1SCIA 4PNZA 4OCZA 4V2IA 3TRDA 4CCYB 1C7JA 1UZAA 1OCEA 2HA4A 2HIHA 4X6XA 4F21A 4Q1VA 4H7JA 4UFPA 4J0GA 2WUDA 2YXPX 4IH9A 1JU3A 1BE0A 4YPVA 1DX6A 1UFOA 5LLSA 4N8DA 2X8BA 1UK9A 1EXWA 4CCWA 4DIUA 1H22A 2AJBA 3BDVA 5SYNA 2ZJ6A 1TAHA 4HXEB 2R8BA 5ALXA 4QNNA 5ALLA 4HS9A 4UBJA 3TEJA 1MNAA 1QTIA 4P92A 4PO3X 4QE3A 1ETHA 2VSQA 2AJ8A 2FJPA 1MAHA 1WB4A 1KU0A 2WG0A 2XLCA 1L7RA 1X2EA 5CT5A 5AKIA 3WWDA 1USWA 4KAJA 1GQSA 5HF6A 1CLEA 4QDUA 2ZSIA 2V98A 4GXNA 1EVEA 5HZGA 2HA0A 4B9AA 5LZ5A 2ROQA 4X93A 4G4IA 4DTCA 3GZJA 5JIBA 2Z5GA 4XX1A 1QIMA 1D07A 2XUQA 3JYHA 1FFDA 2OG1A 2YASA 1ODSA 1U65A 3OURA 5ALOA 2HRQA 3IUNA 4UBLA 1ZOIA 1Q83A 1CPYA 5AKGA 1EB9A 4E11A 2HA7A 4NS4A 1XRRA 4C4YA 1JMKC 5DLPA 2VJBA 4BVJA 5BWBA 1EDBA 3WKBA 4OU4A 3C70A 1CUDA 4AO8A 1ZD5A 3WQHA 1QZ3A 1R50A 3QPDA 4TVKA 1SOMA 3E3AA 1XZKA 4CG2A 3ESCA 1J06A 1LPMA 5CH8A 3HLKA 3W06A 4UBKA 3FLAA 3X3HA 4MJ3A 4BAGA 3G0CA 1R9MA 2VF2A 1HBJA 5A7FA 1EDEA 4FTWA 1XZIA 2H7YA 1UK7A 3WYDA 1XLWA 4FHZA 1FFAA 2H1IA 1YS2X 3I6YA 3DEAA 4C01A 4DNFA 4AB1A 1R88A 3G9ZA 5AM0A 2XMDA 3VKFA 5KBYA 3FCYA 4AN0A 3LCRA 1UXOA 3I6MA 4BAZA 5K3BA 3W05A 3V1LA 1IVYA 1J1IA 5FOQA 1XZAA 1XZJA 3WIBA 5AJHA 4J03A 5AK6A 4DMKA 4KE7A 2DCMA 3HC7A 2XQIA 5EI5A 2JGKA 3QH4A 5A6VA 1TIBA 3G0GA 4U2GA 1LPNA 3QZUA 4ARAA 1DQZA 1AZWA 3G0DA 1CUGA 1QIFA 5ALDA 2VJCA 1BEZA 3QMWA 3EQ7A 1YB6A 2J3QA 2XUFA 1XZGA 4BYMA 1JKMA 3G0BA 4G8BA 4JNCA 2OAGA 1LGYA 3ILSA 3FNBA 4NVRA 1CUSA 2WHPB 3AFIA 4PW0A 1R3DA 2QOEA 1XRLA 2GZRA 3SWWA 1AKNA 3FVRA 1ZJ5A 2C4HA 5DTJA 4C88A 1C7IA 2WU4A 4E14A 3EQ8A 1IMJA 4Y2UA 3H2HA 4FNGA 3GUUA 1HQDA 5CT9A 1A8SA 4G9EA 4BAUA 1MN6A 1MT3A 3BJMA 3V48A 4BE4A 2VJAA 1KU6A 4GBGA 3ED1A 1B6GA 1RP1A 2RGUA 3IUJA 2HFKA 1CQWA 5FDFA 3D59A 4MWSA 4FNMA 3QITA 2CKMA 3A2NA 5K3FB 5FP0A 4W1QA 2GBFA 2WIDA 1VLQA 3WIOA 2WFZA 4W1RA 3D5EA 4BTVA 4AXBA 3A2MA 3IB3A 2JEYA 1ZD3A 4J0HA 1CUBA 1XRMA 2XQFA 1CUZA 3WL5A 2Y1KA 1E66A 1DT3A 2FX5A 4ZV9A 1CUJA 5HK8A 5ISMA 1P0QA 5AKYA 4XIIA 4Y2XA 5AICA 3ZLUA 1QIJA 3C8HA 5CRIA 1SCKA 2PX6A 3DKKA 4PSUA 4D9JA 4LIPD 1A8UA 2X5XA 3O4JA 2ECFA 3ANSA 2QKYA 3FCXA 4Y7DA 1XLUA 2X76A 1ZIYA 3E1GA 4KYVA 4Z49A 1N1MA 2YYSA 3CCBA 3DS8A 5AM3A 3LS2A 5HFAA 4FMPA 3L1HA 2HA3A 1ODTC 4N8SA 1K6EA 4EB0A 3G9TA 3WKCA 3STUA 1ZGBA 3I2GA 3LIPA 5A7HA 4EHBA 4ZREA 2WU3A 4X95A 5ALFA 3M83A 5DYWA 4HRYA 2RIPA 3KWFA 4Y2PA 1N5RA 4G4JA 3AUKA 2HADA 2WIKA 4AX4A 1K8QA 4H7FA 4CG3A 4X71A 4E15A 1J2EA 2WIJA 3FBWA 1VJ5A 1YAJA 5JZ9A 4PQEA 1G66A 4LYEA 4MYSA 3STXA 2G63A 3PE6A 4B83A 2BUAA 4F0JA 3U1TA 3G9XA 4I4CA 3SC2A 3CN7A 5K3AA 5JYCA 5AI6A 4KE9A 1QONA 3MVEA 1MTZA 1BS9A 5D6OA 4G8CA 1Q0RA 5I9IA 3ZLTA 1YB7A 1RWQA 1WCYA 4XJVA 4DMHA 1CV2A 4W63A 1ZI9A 4OB6A 4H7KA 5AM1A 4X00A 5DJ5A 3FLBA 3KD2A 3C6YA 2K2QB 4CFSA 3BDIA 2HDWA 3Q0TA 4QLAA 4B80A 4XVCA 2HU8A 4OSEA 3FOBA 5LZ4A 4RNCA 4J3JA 4WFJA 2OCIA 1FFCA 3FLEA 1HPLA 1EDDA 4KE6A 3I2KA 4HXGA 3IDAA 2HA5A 5CT6A 1TKRA 2GZSA 2VTVA 3AIMA 4BB0A 2JGEA 1G4HA 3TJMA 4UBOA 1ORWA 3V9AA 2WHRA 2C5FA 1JJFA 5E4TA 2PSEA 4G4GA
chains in the Genus database with same CATH superfamily
2ONCA 4O1HA 1THGA 2P9CA 1QQ7A 3F9RA 1BDHA 1TKCA 3H16A 3T3PB 3JVVA 1ZU5A 2XRZA 3MS2A 2E5FA 1UMDA 2WU0A 4TXNA 3PE4A 3QIVA 1DWOA 2JASA 2P9ZA 5DZSA 5FNVB 3U7IA 4QLBA 2RGBA 4LXHA 3TQOA 2HQRA 1IJFA 2IYPA 1O96B 1F1BA 4H3KB 4POAA 3AZPA 1CT9A 2EDAA 5ARBA 5K9ZA 3A25A 1DC7A 3CJQA 3K0CA 3K9HA 4P4SA 1JJ7A 3SJ7A 3HB0A 4C4SA 2XB8A 3WLJA 1NBAA 3GFGA 1IM8A 4F45A 3TPZA 4OK3A 4TXMA 1L8AA 2NTYC 5LDDC 4B3GA 1ZBDA 1TZ2A 2DPHA 4NV1A 3M70A 1GGHA 5IH3A 5DN6D 3H9BA 4BY9E 3GV0A 3H0CA 5LB4A 1P1FA 1SCAA 4Z4GA 1AN9A 2WQZA 3EEFA 1KP2A 1L7QA 4A5OA 5EIEA 2V97A 4HKTA 1TQDA 5DYGA 2B61A 3C7KA 4IJMA 5TQJA 3PXGA 4DBLE 7ADHA 3EHEA 2OQVA 4ZVKA 2RIRA 2P6UA 3RSGA 2H4HA 3CH7A 4AMYA 2BCEA 3UFXB 4LXYA 3DXFA 1T1GA 2X8LA 3IRVA 5LQCA 1STOA 3SHQA 2JVIA 4A6PA 3EPHA 3ELUA 5SY9A 4R1NA 2JLZA 1FFEA 3F6BX 4A15A 2O0HA 5ICMA 2LDXA 1T5OA 1PT9A 3CNEA 3EVNA 2QVGA 1VMEA 4MI3A 4WN9A 1G21E 5FOTA 4PPNA 3CKYA 1QV7A 3VV2A 1PV2A 4BZWA 3OZEA 4ENTA 4ZI3A 5LKRA 3K09A 4H0CA 1LVUA 3IX7A 4N39A 2FXIA 5JYEA 1QPZA 2G1AA 2MYPA 1HSOA 5DP1A 3GXBA 3RYCB 2EV9A 5ABPA 2FAXA 1E3MA 3QSGA 3DMGA 3NT5A 3R3ZA 5KVQA 4PG4A 3RFVA 1JZSA 2A9VA 3C16C 3K7EA 3L5OA 5B3JA 3REQB 2RHHA 4IS2A 1JIIA 3K5WA 4V0MA 3HGQA 2EF1A 3H5WA 1EG7A 1P0PA 5CXXA 4M4SA 5C1BA 1YTUA 1IVNA 2XMCA 4O25A 3KJGA 5KYXA 4F5YA 1XX6A 4YJ3A 5I48A 3H5OA 4Q1DA 4JBYA 4BJHB 2ZUFA 3AVOA 1WHSB 2YXDA 3CZPA 1KC1A 3FM9A 5DWQA 3PGKA 5IDWA 4E4TA 4NHEA 2EBHX 1EWVA 2CL5A 3FGZA 4I5FA 4OJQA 3ICEA 1QVRA 3HE3A 1JEQA 2DPGA 1W1IA 4ZAWA 1VMDA 2I3BA 3JZAA 4ZVNA 2XGJA 1P4JA 2GZ3A 2VHQA 4R0VA 2YS7A 4US1R 2Q3HA 1RXYA 2GEJA 4HVTA 4MARA 1MJFA 4L5BA 3NX4A 3OHMA 4V0RA 1FFGA 1PG0A 1SU6A 2H2DA 2Q50A 3AF0A 2JIOA 3FWKA 4L3OA 5KOHA 1LEHA 4JHLA 1LDYA 4HTFB 1TEXA 1BFKA 4BGUA 1XZFA 2XLBA 2R1TA 1NYRA 3JYOA 3A3OA 4IDOA 3AKZA 1P1JA 1QZUA 1XZMA 2DECA 2J4CA 4QTUB 2QPLA 4WESB 4A9AA 4LDQA 1TU3A 3FCEA 2PKEA 1J2TA 2JGMA 2Y1DA 3LYAA 5ESDA 1IDN1 1BGVA 2ZRNA 1RWVA 2A0KA 3MJRA 2IHZA 3KXPA 3MBKA 4B6PA 4I3GA 1NU6A 4BWFB 1UMCB 2RC5A 2PGLA 4GQIA 3CEHA 4W6QA 2ESRA 2P1ZA 5AKZA 3VPSA 3EG5A 1X80A 4N5HX 1RWNA 2ENWA 2IYQA 3F78A 3MJCA 5CCDA 3H97A 3T1QA 4D8XA 1VQ1A 4XIYA 1MQAA 3QVKA 3E18A 1U3DA 3DL0A 4MGZR 3TLAA 2OBLA 2XQGA 2WYWA 4U9IS 2MSCB 4DVGA 1Z25A 4BNMA 5B2FA 4JK3A 3ZH9B 4EM6A 4OHWA 1S2OA 1JTVA 2Q8QA 4KMMA 1LS6A 4HLQB 1Z83A 2HXSA 1NV9A 1E3EA 1VXOA 1KEEA 1XELA 2PUCA 3ORYA 3EVFA 2YIVX 3PWKA 4QBHA 2L2QA 5FTMA 2X8WA 1OHHD 4JLVA 4YJHA 3CGWA 2FQXA 2IS6A 2GZDA 4OLBA 1GYQA 2AB0A 1XZ8A 3ESZA 1NXQA 1FC0A 3GOQA 3L01A 3OX2A 5G0VA 1HL7A 4EB8A 2QE7D 5E1BA 2ZRFA 1IEQA 3FCUB 3HZHA 2K4MA 3Q6MA 2JIMA 4X90A 3WQSB 3AVYA 3GMTA 4KE8A 4UBNA 1C9EA 1XEWX 4F91B 3QXXA 1NN3A 4KOEC 3A3YA 1LDMA 5KVVA 4F06A 2ZXUA 4Y1RA 4Y18A 1J2YA 2ZR9A 4MEAA 1F4VA 4E22A 1OASA 5E8JA 2AOUB 2ZJ2A 3F6YA 5JQGA 3O90A 3D31A 4N01A 3PNLA 4CKWB 2IX9A 5GADl 1CB0A 4LZPA 3DBOB 5IRCD 1BXZA 3OLWA 4GGOA 1GPKA 1L2TA 5B57C 4MI1A 4PPYA 3DE1X 3S2FA 5EXPA 3KXDA 2VDVE 4TTIA 4ERXA 5HKKA 5FO1A 2H48A 2G25A 3GZNA 3O8DA 1Q3HA 3QXCA 3AFGA 3K3PA 1JKJA 3GLHA 1QGOA 1DJOA 1O7JA 1SVKA 3T7AA 4A8JB 1V45E 3PGJA 4GPIB 2WYUA 1SUWA 2YXLA 3LBHA 3R3WA 4YO7A 4ATNA 2CUTA 2B1IA 1P29A 3Q5DA 2QMQA 3KKOA 4TZKA 1XTVA 4X7BA 3BORA 5FPSA 4RL4A 2VPPA 4NX2A 3B7GA 4XCQA 3TR6A 5JJBA 3WGOA 1RZRA 1YD7A 1K4YA 3LCMA 3PD1A 1PFUA 4OD0A 2PK3A 4UPVA 5F3DA 1NDQA 2Q5HA 4OH1A 2WYIA 3N9IA 4UM9D 4YMVA 4OUKX 4MV1A 1FZQA 3PKZA 1A4UA 2DFKB 3EFOA 5CU7A 1C7EA 1IM2A 1DIOB 3BMNA 4O4JB 1XLTC 1DAHA 3D6TB 3KXKA 2R6JA 4GKVA 5JBQA 4YP9A 1EFCA 2F1IA 3F2VA 3JQAB 4H3HB 1TLFA 3AW8A 3ROEA 2OXRA 5FI5A 3UWPA 3GCZA 4L15A 2M9MA 4KG7A 5LC1A 1XQ9A 1GT91 3I8SA 4B6JA 3AEKB 1P9RA 3NS7A 3STYA 1VXRA 1Q2XA 3M1LA 2FHPA 3DFUA 5K6RA 2OT3B 4Q1BA 1QC5B 3HKCB 3UFBA 3C7AA 4AS3A 1E62A 3Q3EA 5IYZA 1QS0B 3N2EA 4GSKA 3R7WA 3TZQA 3Q2IA 1B3RA 1ZW6A 4HMQA 3S8MA 4B2LA 4ZOQI 1X13A 1AUXA 4N54A 2VBIA 2EL7A 2AC2A 3RVQA 3OPMA 1XAJA 1XTTA 4FHDA 5ECDA 2A84A 4CLEA 2QN9A 7GPBA 3EMDA 1ZD1A 4M1SA 1SZPA 2ZIVB 3EXFB 5CB8A 3ZLVA 3JD1A 1H0RA 4G36A 5T6MA 1FDVA 1J4AA 5JI2E 1DWQA 3IEPA 2PD6A 1RYHA 4FR5A 4IXWA 5LM3A 4K9RA 1L5ZA 1CY4A 3GIWA 4MQEA 5DX0A 3TZEA 1KAHA 5IVDA 4N3CA 4MRMB 5JSYA 1FDRA 5JRDS 5C7LO 4TZ6A 3A26A 1XRQA 4MGKR 5ITSA 2W8ZA 2I6TA 3VZDA 4CM3A 3ICQB 1GZSA 4IWYA 2ZI7A 4BC0A 1ESNA 5ECYA 1HDRA 3H5VA 1ZXLA 3DQQA 2WI8A 3NEJA 5C0OE 2C8LA 4FEYA 4QXOA 5H0IA 1DIHA 1M2VA 2AQHA 3ROPA 1R7RA 2JHAA 3IJEB 3C6KA 2I4OA 1QH1A 1W2WB 3EA5A 3OQIB 4DMUB 3ODGA 3LUDA 1PFYA 2PMEA 4QDXA 2PUBA 4NV3A 4Z7NB 1F48A 1USKA 4RAOA 2O2DA 3VVLA 4MR7A 4Z1MA 1YVPA 2P2SA 1K63A 1P39A 2P2DA 3M7IA 1VE5A 4NAHA 1C1YA 4MYRA 4HBGA 1LF0A 4GRAA 3AHDA 4PAMA 1ZC4A 4FYXA 3LBIA 2XCTB 3OP4A 4M1ZA 3TSWA 4Z5XA 1W44A 3G2QA 2IJGX 4IGEA 1TCUA 2OYSA 2B92A 2XDWA 3MMXA 4QQNA 4R2WA 5I51A 3K71B 1B23P 4BO9A 2FGKA 1V3TA 5J1TB 5BUSA 1AQNA 1LFDB 2VH5R 5C32A 4XVUA 2WWIA 2OXEA 4C21A 3QEMA 4N4AA 3AVQA 3TIVA 3TLGA 1N8SA 5AVUA 4ZVRA 3VJRA 3TZCA 4CM4A 2WIBA 1P4SA 4YAEA 4B2YA 3OZDA 4RK1A 3VJKA 5KNDH 1VPEA 5JEEA 1AK2A 4YIKA 2IXGA 3T5DA 2OUIA 1YKFA 4UUOA 1NATA 3O9ZA 1VPDA 3UMJA 3OWOA 1QH9A 4FUTA 1C7RA 2WJYA 1KGDA 3PQDA 4UHHA 5TGTA 4N47A 4IINA 1EFDN 1HY3A 4F7DA 2WOJA 3A31A 3GEMA 4MMZB 2GXAA 1N36B 1WETA 2ZJ1A 1K5GA 2IYAA 1DDOA 1ZS9A 1E6EA 2P9HA 2ZI3A 4JVSB 3UMFA 3PHLA 4UREA 2OCGA 5A62A 2BFMA 2HJ9A 3GARA 4BVFA 1R6UA 1U8TA 1PFVA 3HJUA 1A9PA 4GP6A 8AT1A 1ZMTA 3OQ6A 2IIVA 1MC1A 2NXCA 4NPAA 3V8VA 5SICE 3UG7A 2CXQA 8ADHA 2BP7A 2V7WA 1XN4A 1XMSA 3EGIA 2UYCA 1NDHA 4RV9A 4KPUB 4R41A 2I6FA 2H08A 2XW6A 3MQ2A 2PZLA 4ODIA 3RD5A 1R18A 1ORHA 1SOAA 4M8IA 2A1UB 2HYIC 4ARBA 2Z5LA 1AA6A 1PQPA 4BO0A 5AW2A 2CMKA 1PQ4A 1YUBA 2A14A 3EGCA 3ZZ1A 2Z5FA 4U63A 2HA6A 2JD1A 2NP6A 2VRCA 3VPDA 3CO5A 2QJFA 4TXJA 1JEYB 4UMDA 4OHFA 2QPAA 5AHOA 1DZ3A 2BH9A 3NIFB 4FIZA 3HN6A 3EXAA 3L7KA 2ZTLA 4JDPA 5AJTA 5DHPA 1I80A 3U3JA 1W36B 1JQ5A 3PGXA 1HE5A 4PX9A 4WPGA 2ADFA 3I1FA 3G2HA 1PL0A 3P2YA 1T0JB 2HI0A 1DFIA 1RIIA 1YC5A 4QGHA 4Q4AB 4LF5B 1ONNA 1Y1LA 2V7QA 3O5AA 1EHIA 1NF9A 2VZ0A 4DRXB 3ETJA 1T15A 4DJAA 3FDXA 4EUSA 3OE4A 3MB5A 4IW3B 3GC6A 2QI9F 3FB4A 4FC6A 1B16A 2VPIA 2O8DA 3H2IA 3I92A 4WY2A 2WY2D 4QELA 4ANFA 2NXWA 2IYNA 4TYWA 4WRRA 3RO7A 3K2IA 4D6YA 1XALA 1Z0AA 3CF4A 1I3LA 2A0YA 1EEHA 4OJNA 3DZCA 3UK7A 3BD7A 2KLHA 1Y98A 1ZPDA 2KLBA 4FQ7A 2IE0A 3THXB 2AEFA 2VHXA 3UCXA 4II7A 4M55A 2VJMA 3GFOA 4L4XA 4COOA 1GKLA 1RMQA 4N5DA 3S2SA 3OC6A 3C41J 3GT0A 2O3SA 1XCPA 3I76A 3X2EA 3NDBB 1IHYA 2C4VA 3CH5A 4UU8A 4HAYA 4QQFA 4G0YA 3N2YA 1TMGE 4AM8A 1BZYA 1PYGA 3HJNA 4MUYA 3Q98A 5F1PA 1A8IA 4TTTS 4WY8A 1BE6A 3HU3A 4MV0A 4OX9Y 2ZQZA 4O4IB 2J5BA 4Y6LA 2XDYA 1M2KA 3ZDZB 1FLNA 3ZQ4A 3L6CA 1E2LA 3N39C 3RRMA 2X1HA 4GQBA 1OI7A 3O1LA 3OM8A 3Q7TA 2VEOA 4J0KA 3PUWA 3RU2A 1B42A 2A4KA 2HO4A 1U98A 1P4GA 4AQDA 2XVAA 1QRDA 4BEBA 1F2TA 3SFZA 3QHPA 2PRYA 1AQ6A 1EFTA 2X23A 4L76A 1AH2A 1UF9A 4G1BA 3LWZA 4YJ3F 5TVKA 4C7MA 3HKBA 3FIUA 1VKRA 5F1OA 4JI5B 1M2OA 3F71A 3MRXA 2BUBA 1CJVC 4QXRA 1JG4A 4DCGA 4S05A 2PPVA 1G21B 2RHMA 4OQDA 1WX1A 3DOIA 4UVGA 4Q1FA 2VPYA 4R8RA 4WNAA 4X92A 1W88A 3GRUA 1NNLA 2HSWA 4ZZ0A 5U9CA 2O19A 1GN9A 3GFRA 3ANTA 3OIFA 4IIFA 2IBSA 5I6DA 5BW6B 4LRSB 3TQFA 3I5XA 2DFLA 3M3PA 1QFYA 3A58B 4G1VA 2Z9DA 1ORIA 3L0BA 1BJTA 3LUFA 3O3NB 1EM8A 3RVMA 5K0GA 2ZJFA 1P1CA 1O5TA 3CSDA 1BJRE 2K6GA 3M9WA 4W9RA 2HMSA 3PDIA 3R44A 2B20A 4N6NA 4LC9A 5BMOA 4RK4A 1CJUC 1VHQA 1OZHA 3D7SA 4GR9A 5CCEA 5U1PA 3AM1A 1KI6B 2FX3A 3MUOA 3OHPA 4R4JA 2QAGB 2WKQA 3QU4A 1F12A 4RA9A 4AMGA 5ALNA 4XM1A 5FOVA 4XGIA 5FTJA 1XQYA 1QAMA 1EK0A 3WJ1A 4F7WA 2O52A 4LYHA 4RPHA 3UWSA 1Q74A 1R9JA 3ZVKA 4BVEA 1NJGA 1IHUA 2BKLA 4NULA 4A8TA 1TKAA 4PXAA 3UOWA 1G5IA 1RPZA 1N9GB 4QHYA 4U9UA 1NLMA 4IDNA 1KI7A 1J5XA 3CG0A 3NLLA 4RE5A 4C76A 4GPAA 4AJ2A 1CF4A 3WB9A 3DOOA 2FSVC 4A1OA 5G1PA 2JG3A 5ALGA 3TQTA 3ZK8A 4GWGA 1WCIA 1DKQA 2D8AA 3OLYA 3AYZB 3U4QB 2IEYA 2YHAA 1YR2A 2BEUB 1S8OA 1V26A 4P4GA 2KSQA 3AUXA 3HMQA 2F55A 1VL1A 1C8BA 3E23A 1JE1A 1Q1ZA 3BRWA 3MRSA 5D5QA 5JAIA 1ZK0A 3DFFA 3SX4A 3VXKA 3QI7A 4N0QA 4C0SA 3FHOA 3TQRA 2ACEA 2J3DA 2G5PA 4BDSA 4CJXA 3GJTA 4RIIA 4AJ1A 4BQFA 4LF7B 2HV8A 4I6GA 3O4RA 1FK8A 2BMVA 2SBTA 5KPJA 1MV8A 4YMHA 3TTUA 5LQSA 5DI3A 4P7FA 4QUJA 3DQPA 4E2ZA 5AD1A 5BMVF 4TMZA 1DU4A 4EB6B 1MAUA 2CB0A 5BRJA 2OECA 5H4HA 5TJ9A 4LOLA 1KYZA 4BMPB 4GKJB 4HZIA 2IS2A 5JQGF 3DB2A 3LQ1A 3L4KA 1P1IA 1FW8A 1UBEA 4TZTA 2YOGA 3ZZUA 1XTIA 1CEXA 1ATIA 2WTBA 3HU1A 1YH3A 4OYLA 4QPPA 1P2SA 2M32A 4HCJA 4RLQA 3L0IB 3C4QA 2IHKA 2Z6QA 1S9DA 3EW7A 3B5JA 3U3OA 4C05A 5JJ5A 4WXPA 4FFSA 3CNQS 4EYSA 1VKJA 3ESYA 5EMNA 3VYSB 3ZHYA 5HTOA 4V0KA 5LD2C 3AVUA 3U19A 3PIRA 3HFSA 3W9BA 1UK6A 4YREA 1BN7A 2Z2KA 5J5VA 3V5NA 4I4IA 1U90A 1QXSA 3LY8A 4IVPA 4M1TA 5GIPE 2ZM6B 1E1YA 4ZALA 2Q2VA 3ZWMA 2R751 4US0R 4QGGA 3PPXA 2LVBA 3HBAA 4NZNA 4Y2QA 1H85A 2NGRA 5AK5A 2JFBA 1HUQA 4W5NA 4QNRA 4XR4A 4BNJA 1S2LA 1K97A 4WUTA 3B89A 3IXMA 2JIRA 2I2AA 2IW1A 2EFDB 2IDMA 1YNSA 4DEXA 2WYVA 4PIMA 3HY4A 4U2CA 1XZEA 5C3UA 1PFWA 4DLRA 2BMEA 3SSAA 3PIDA 1EWRA 1QP4A 1AGNA 2BKVA 2FFJA 1WXDA 2GCOA 4RZ3A 1YT5A 1L7AA 1KS9A 2GPSA 2CE2X 1JH9A 2F8TA 1LLFA 2Z83A 3JD2A 4KFRA 2BGGA 1WW3A 1UH5A 2EJCA 3AIKA 3P52A 4WUVA 4PTYA 5IYZF 2WG1A 1HO3A 4L7VA 2YMMA 2VXCA 4JB2A 4OM8A 2B7CA 1TUBA 2EFYA 4BNVA 1XQVA 4FPXA 4X85A 4NABA 4B3IA 3IB6A 3RB8A 1WHTA 2J8ZA 3T5TA 2QSUA 1JL3A 3GFQA 4MLPA 4PU0A 4D2IA 3D7LA 4C0WA 1WB6A 4DR7B 2JFVA 2GN4A 4JENA 2AN9A 1OUMA 4U7JA 4DARA 3EXG1 4UE2A 3NWPA 1PFKA 4HK4A 5FUXA 3QLVC 2JFWA 4Y6QA 1E0AA 3JASB 1VSQA 5JDCA 1Q0TA 1DLIA 1JV2B 1H8EA 2A9KA 2AI3A 3PC7A 1MAVA 4AXXA 1ZOSA 4GXTA 1FXSA 2P8SA 4UNSA 2Q0HA 1SFRA 2WWGA 2RK4A 3G23A 4N6GA 2ONKA 2V8OA 3IC5A 1QGUB 2HHLA 3KFLA 1IJEA 3GXOA 3RPEA 3FTPA 1DBQA 4DCNA 4ETMA 1GGKA 5JD6A 4HNQA 1DBSA 1TF5A 1UMBA 1FFWA 2TS1A 4MCHA 2ZB4A 4FDTA 4I1SA 2V03A 5K8TA 3FJOA 1NC1A 1MRZA 2ZP1A 4C03A 4OHBA 1U0JA 1MO3A 2GEDA 1Y5NA 2XUPA 4DE5A 3CURA 4IXTA 1JVSA 5FXMA 1M7GA 2I4MA 2OSVA 2X4GA 2X0DA 4CMIB 3R5XA 1HMPA 2I7XA 4QTXA 4Z4CA 4DB4A 3C39A 3ZCRA 4M86A 5BN5A 2CXSA 5F52A 2SKDA 1OFTA 4TVOA 1I7QB 4D26A 1MDBA 5MF6A 4D0GA 3WLIA 1RKQA 1VG8A 2Q27A 1R0YA 1IUNA 3X44A 1TD1A 1NASA 4ZV7A 4KPGA 2BHSA 2BCJQ 3FTNA 2OESA 1Y6GA 1IK4A 1PVVA 3TJZA 5H83A 1V1RA 4C4XA 1P1KA 1WMBA 1CQXA 2ZB7A 1ZD9A 3KV1A 4LJ7A 2WJ3A 4U2BA 1NVFA 3N0RA 5BW4A 2YV3A 1K6MA 4FSHA 1VHJA 4P4UA 3ENVA 3QNMA 4MS3A 4WVFA 5AOAA 2OCPA 3R4CA 2UZIR 1DG3A 1KZ9A 2QR3A 2VP2A 3T0IA 3D1LA 3UGKA 3VDMA 2FOLA 5JPIA 2FXVA 4LJRA 1USIA 3I9KA 4DS3A 3UKJA 1VG0B 4GKAA 3I61A 4GKKB 1CE8B 3KSDO 3ZE8A 1U2DA 2CW5A 3JWJA 4FT2A 5EG5A 4IDBA 3ZK9A 1QZXA 1Y9EA 4LNHA 4BV2A 1VB3A 1E9EA 3ESRA 4UW9A 2HF8A 3F3MA 4UFNA 2OHGA 3INRA 3Q8WA 5K3DA 9LDTA 1P5FA 4L5JA 2GOYA 1SG9A 3CUSA 4HG2A 1CC1S 3UFXA 1M1ZA 4I46A 4IRUB 4JLJA 4L95C 4CGYA 1A9SA 1E7SA 3KKLA 4BMCA 5L40A 4NMMA 3U3KA 2GQ0A 1L4KA 5LZ9A 2V6IA 2FSIA 1EGQA 4AL4A 5B6PA 4N65A 4ZEOA 2QD1A 1QKKA 3LAWA 1I94B 4ARZA 1DRKA 1X8JA 1PO7A 4QREA 1AU9A 1OYYA 3KJIA 1Y1SA 4M0KA 3PQ2A 3AEUB 2C77A 1Q7RA 2C3PA 5FLXA 4LHWA 4AY6A 5C8DA 4YP1A 3MMPA 4OQMA 2VTKA 4FDMA 3PNOA 1LTKA 4P7JA 5TMDA 5D8DA 2QJTA 5JAHA 1GCUA 1T9BA 1JYEA 1U8ZA 3CTPA 2JFOA 3EB9A 3NO4A 1FEZA 4HHEA 3E8XA 4NKRA 1IAQA 2AN4A 4YIHA 1IVSA 4PAQA 3REQA 1UOOA 2J5QA 3BQNB 4GU5A 4MUGA 2QORA 4GLJA 4TYPA 1GQYA 2FPLA 5DHSA 3CT4A 4HFJA 2OBYA 3IUEA 3I37X 2DJIA 2W93A 3D02A 3HFRA 1C30A 3EZNA 2WAMA 1U3WA 2OMEA 3V1UA 3NB0A 2H7XA 4LX0A 4DIKA 2Q62A 3RIGA 1WHSA 3M3DA 2FZLA 4N1AA 4C4PA 1CD5A 2ERYA 2P8JA 2F62A 3MT0A 2XCIA 4ZHQA 3C5HA 4N7JA 4U0JA 1YR9A 2HC9A 3B9PA 1FP7A 1G55A 1GQRA 3FMIA 3G88A 3IH5A 2B69A 5C2JB 1U2GC 4LHYA 1KNQA 4PRKA 1HE2A 3WKDA 3LU1A 1E3SA 2WJAA 1IN4A 4X65B 1ESEA 1HEUA 3FD8A 4JLUA 4OF4A 3TE7A 4DGQA 4QAJA 4ER7A 3BQMB 2V0GA 2EJVA 3DJYA 2IIQA 3NG1A 4HTFA 3DHNA 4OSOA 4E3WA 1P74A 4JH0A 1EI9A 3AF5A 4ZAYA 4IIVA 2FVXA 4KQ1A 4B7XA 1RPJA 2ZW9A 4KL8S 4O5AA 5ICEA 4MV9A 4B7CA 4WESA 4JYMA 1XGKA 2O0KA 1KY4A 2AJDA 2EQAA 3NC4A 1OTHA 1ULAA 3C2QA 1U9YA 5FBQB 2ZI6A 3QVLA 3S2EA 1GFIA 1KK3A 2H2GA 4QGFA 3WWYA 1DWPA 5C1DA 4AF7A 3W2EA 1IHOA 4EYQA 3RS3A 4OHMA 4RY2A 1RYEA 5I8ZA 5TEVA 5IKXA 1NNUA 4S1PA 1AZTA 3C85A 2Q2WA 4KK3A 5HVNA 1NUPA 2CL6X 3WI7A 1DKUA 1FBTA 2ZT8A 4FOOA 3DPIA 1T2AA 1WMSA 4A27A 3WGJA 5IJ9B 4X8HA 4BXOA 3FPFA 3T7SA 3OETA 1H65A 1H3NA 3M6VA 1Y7HA 5DGXA 1Z7GA 2Q6KA 3DG9A 1W0JA 4NQZA 3LE8A 3PTZA 1WB5A 1ELOA 4R1TA 1LRLA 3DBHA 3OEEA 1FQKA 4CM8B 3UBMA 1V48A 4HEHA 1KYWA 1WS6A 2XB9A 3C5CA 2K2WA 3KLOA 1JHQA 5JSZB 2CDAA 2ZEJA 3ZV3A 3WNBA 3LECA 3TVDA 5JYDA 1NG9A 1X7DA 4GXQA 3ABQB 2A1IA 3NHAA 3STVA 5CDYA 4N7BA 1U63A 1SHZA 1K7SN 1Y5IA 3I8XA 2QUIA 5JANA 1E99A 4YMWA 2GK7A 3IUMA 3PUYA 1LU9A 3PT5A 4TLCA 4YMGA 1Z8DA 1K9VF 1G18A 2O14A 3EVGA 3IAXA 2HOQA 5A5FA 1QX4A 5CB0A 4J7AA 3TG2A 3TNLA 2V96A 1EVIA 3RWOA 4Y6PA 4J3FA 2WWTA 3A6LA 5DYTA 4UCWA 2WU1A 2CHEA 5CURA 4CKWA 4KWTA 1DIGA 3ODPA 2DXIA 4G0WA 1U4OA 5IVKA 2H17A 1I1HA 3A3PA 2Z6VA 4ND7A 3W3AD 3ZWXA 5JZMA 5KYYA 2AQIA 1V8FA 4YUAA 3DL4A 3DV0A 1QKJA 3KU4A 1DADA 3JWEA 1OLOA 2J9YB 2BYTA 1R8JA 5JWRA 4EHJA 3W8RA 1FMCA 3NHRA 4WXRA 3CF6R 4A8JA 4BNYA 4DHWA 5EHXA 5C51B 1HOXA 1U2SA 1IZ7A 3F4BA 3N53A 4PLYA 3ZWVA 4WECA 4B8WA 1ZAKA 2TYSB 2C0QA 3LGXA 3HR7A 3KKMA 5GVRA 1C8KA 2FE4A 4KR6A 3JYQA 1KSHA 1L4GA 2C57A 4IIJF 1AO3A 3D2AA 1ULSA 2P4SA 4MIOA 4YNBA 1A9XA 4IQ8A 5KSZA 3SCZA 3H8JA 4A73A 3IEUA 3TI9A 5A02A 5EIBC 4WBNA 2N3ZA 2V4ZA 3NKVA 3G89A 4G0QA 5BWLA 4NIMA 1VA4A 2WFLA 3EPJA 2ZULA 3X1YA 4DNOA 2W8BB 2GFQA 2EBWA 2ODNA 3OH8A 4CHTA 8GPBA 3WRYC 5JJLA 1P81A 4EY6A 2ZE6A 3QE0A 3MINB 4O4JA 1JQKA 3U44B 1RAHA 4HLUA 2NTNA 1ZR4A 4WFQA 5JPCA 3C8UA 3GZTB 4WIAA 2B35A 2IU4A 2AFRA 4PGMA 3IESA 3BK1A 1E9DA 2JLRA 3LO8A 3HVHA 4UU0A 4IX1A 3A6FA 2H1WA 2Y0DA 1Y42X 4HB2A 1VCHA 4MB2A 1P3JA 2AUTA 3KQNA 1OC4A 3HKCA 2HXGA 3PNVA 4HFRA 1QS0A 3VTKA 2CHQA 3K0KA 1TECE 4O08A 2OHVA 2AJLI 4LSWA 4WSOA 3T9FA 4QDZA 3ZU4A 4GR5A 4EF4A 2Z1MA 4C0BA 4LEIA 2FMIA 1C5KA 5DXAA 3ZBTA 3LMKA 5LOVA 3ZWOA 1ZM3A 2JJQA 4OQZA 3ESBA 3EXFA 4WQMA 3L9XA 1SBHA 2CDCA 2BZ0A 2QD3A 1G5PA 3QTTA 2FP3A 3FIJA 4W5OA 2F8SA 4OAOA 1YCFA 3LUJA 3U7GA 4G8DA 3LP5A 3A4MA 4S0ZA 4ZGGA 3K0CC 2JAWA 1P44A 1XU7A 1C2YA 1RHKA 1ECCA 3LCJA 3QUCA 1T6YA 3IVGA 1ZNXA 1DCFA 2FRXA 3B3AA 2ZUCA 4IVQA 5IFLA 4RA6B 4QO7A 4MWEA 2ZBRA 3MWKA 4AJ4A 3ZWPA 5I9NA 5J3JA 5AJWA 1N1DA 3EXEB 1FMJA 3QBJA 5FBWB 5IC6A 4AYTA 4IYRA 1TM7E 1U8FO 2X5JO 6ABPA 1A5AB 2QZJA 3AI3A 4HGNA 1I5OA 1L7MA 1CF9A 1M8KA 3IELA 1GAJA 2OHFA 3F73A 1FYWA 2ZLBA 4GBED 2QAJA 1DINA 2DM6A 3DC2A 4LJLA 5DHQA 2I03A 2H2AA 1UOPA 3QHQA 4EZBA 1IY1A 5BWOA 5K8UA 2NACA 1K6IA 4P7BA 1G9TA 2PANA 4RF4A 4BATA 4CTJA 4D9GA 1T9GS 1D6JA 2G4LA 4W8GA 1TRHA 2VWQA 4DLNA 4YB8A 3RTAA 4ZXFA 3PNSA 4FLEA 4MAFA 2UZ0A 4R2LA 4HQ6A 1OZAA 1R0RE 3CJTA 2HMTA 2YC2C 3QJYA 4QT4A 3H4MA 1MOQA 5I7SA 2V4UA 2XGGA 3BTVA 2PUHA 2IZOA 1QAOA 3UJ9A 3VR4D 4D8YA 5AFSA 2JI9A 3WRVA 5B3JC 5I4CA 3B6MA 1NT2A 4FFMA 4EITA 4RF5A 1U02A 1QO0D 2DFDA 4AJIA 3GLRA 3VM6A 1HE4A 1CRPA 3AX6A 5DSTA 1MPXA 4EF5A 1C0EA 2I29A 4ACAA 3PDJA 4M8LA 1SKMA 5E6RB 4DNPA 1NXPA 1YBHA 3IO5A 2XKKA 1V0JA 4LDJA 4TS3A 2I9PA 4UEKA 1GSOA 3QBDA 4UU1A 1GGVA 3MWFA 2HJHA 4MKHA 1Z6YA 2FQYA 3FUWA 5C31A 1L1RA 4OKSA 4KQCA 3C0KA 4GMKA 4RWEA 2Q5EA 1S7CA 4KBYA 5HA5A 2FPMA 3U31A 2ES4A 3HN7A 1PT7A 2HSZA 4KO4S 5TF0A 3W5JA 3OMXA 5ADHA 5JSQA 1F6DA 4BFZA 1L4FA 3FBTA 2FFAA 4MEBA 3NNNA 1MGPA 2Q3JA 1TK2A 2LE0A 5E6UB 1Q0UA 5HJ5A 5CBKA 1B2RA 4G09A 3ESQA 1Q0SA 1YV9A 2ODEA 5M29A 4MVJP 5FNVF 3K6RA 5CYOA 4O3FA 3DJFA 3R8FA 5KQPA 4FE7A 3RYTC 1WMAA 1H1LA 2DSTA 3QKSB 4NOLA 4BV8A 5BQ5A 4TL8A 1H2EA 2DE0X 1WVGA 1TEHA 2QROA 4HAWA 3KL2A 1HM5A 5L3ZA 4ZVSA 3DYBA 1Q7TA 2DQSA 3LPCA 1UPBA 4Q4AA 3GNTA 2E18A 3TO5A 1H0HA 1UANA 5I9IA 3E5HA 4DRXA 2B0JA 1W5BA 2BMWA 2BLNA 2I71A 1OZFA 2IW3A 1IQPA 1Y1PA 3IPAA 4B40A 3NGMA 1YE8A 3PR1A 1LX6A 4KXQA 3BH6A 2GO1A 1V39A 5BN3B 1AQYA 1Y6RA 1OXMA 4QOIA 3V6MA 2H1RA 1F3LA 1DHTA 1XMVA 2F1KA 2Y2VA 3U1BA 5IUKC 4XARA 2EZ9A 3IQGX 2VP3A 4WJKB 2NYVA 5A03A 3UHPA 1X3SA 2HT6A 4W1PA 1PZFA 2FWRA 2YDYA 3I04M 3OOYA 5HKAA 4XCVA 3TUJC 3THXA 4DCOA 5CVVA 1YULA 2QRUA 5FTWA 4KKVA 2GPJA 4ETIA 2WB2A 4LRTB 4BUZA 2YHIB 1I4DD 2IBMA 2VYFA 4B1FA 3IE1A 5HMMA 2WSBA 5KYUB 1Z7EA 2XVZA 1FJHA 3LHDA 1Y9AA 3BQ9A 3BD8A 1VE3A 4WCFA 1EM6A 2O2IA 1VMAA 3ZXYA 4GBJA 2QGZA 2J9RA 4R1OA 3RIYA 3ZYCA 4D4MA 1ID8A 1BQ4A 2AL7A 3CGGA 1PWYE 2BD0A 4LJ9A 4ZQFA 3U7QA 4R83A 2ZG6A 1F8FA 4CN8A 4WACA 3P4YA 4Q15A 1YBMA 3QW4B 1T43A 2QN2A 4EPVA 1AHIA 5KJ6A 3NRBA 1MB0A 2CMFA 3BVPA 3EF1A 1F2DA 2GN6A 3AXSA 3FZNA 3LX4A 4Y1GA 1U11A 1RJEA 5DF1A 1R74A 4K2HA 2PY6A 3NFRA 4PYLA 1E98A 1QOQB 2B98A 4NBKA 4LI3X 4H7PA 1KQNA 3ZBPA 1PBNA 1MB3A 3L05A 1G21A 3NOVA 1SPBS 3MJVA 2FWBA 4Q66C 1KMHA 1Y3HA 2A9RA 1MB2A 4ITRC 4X54A 2BMFA 2EYQA 1BDBA 3I5UA 1YQ9A 1GTG1 4RF3A 1YGYA 1JDBC 3E3NA 4TWRA 4YCMA 3HWWA 4JI0B 4OH7A 1A9YA 1SHKA 2DPLA 3HK2A 1T4BA 4FFWA 1SWWA 1R8SA 2JRLA 3EG9B 3JRNA 3L8DA 3ZW8A 1OTXA 4R51A 3O47A 4LOKA 4XDZA 2AC4A 4JLAA 5ESXA 3VSAA 3DD5A 4MYCA 2DSNA 3PEEA 2XNDA 4IH4A 3AKYA 4JI3B 5E2AA 5KSOA 1OE0A 1K1EA 3ZKAA 3S8EA 3L7NA 2QAGA 3LPAA 4X7PA 2CJXA 621PA 3L4BA 2ZU6A 2PZBA 5A71A 2J3EA 2VDUE 2X7XA 4YQFA 3AP1A 3V2GA 1SMKA 2B8TA 4LV6A 4LSGA 4L8GA 4W82A 3IT1A 4F92B 4RY0A 2QTLA 2GAAA 1Y80A 1YBVA 2H07A 3NYWA 4GLOA 5JT1A 2Y2UA 1N9GA 5JE8A 1YWGO 1X42A 1XF1A 1U7XA 3MG9A 3OLZA 4K9MA 4G85A 3L82B 1CR4A 1F38A 3QYPA 4GRDA 1LB1B 4Z3DA 1OYOA 4I6EA 1CBUA 1G5QA 4MSUA 4P3NA 2VT2A 1BA3A 2X4LA 3GDHA 1SPXA 4L72A 2X9VA 5E9JA 5EJIA 5A9SB 2IELA 2Z08A 3U4QA 4BQEA 2ID9A 2D7CA 1SBTA 4DUGD 1N25A 1W85B 4QFCA 2W70A 5JWOA 3GQBB 3PD7A 3ZHTA 3D0KA 4URWR 2QRVA 5TARA 4WW0A 2VWHA 4B31A 3ZD6A 1J9EA 2GYWA 2OHJA 4O2AA 3WYCA 2O59A 2PTGA 3WBBA 2QTRA 3AVPA 2X6TA 3DE4X 3EXHB 4FKZA 5AXBA 4RWZA 3CUTA 4G56A 2HTFA 2Q4EA 2F1RA 2HL6A 3KUDA 5KKAA 1RC0A 2XNCA 5CDSA 5BYKA 4GMHA 5J5CA 1F9AA 4WKBA 5LXTA 5SV2A 4D81A 4XUEA 3BIFA 1K27A 2QK4A 5ENVA 5EWMB 2OFPA 4YRSA 4HRXA 5I4KA 1ATZA 1XVIA 3FJ1A 1EINA 1CUEA 2FSHA 4OXIA 2KJQA 4EB6A 1H2RS 1WSBA 1YR7A 5FKJA 1YZNA 1E2UA 3DXXA 3KB6A 4JT9A 2ZIAA 3RFUA 4CRWB 1CR6A 1XU9A 2FW9A 2ZK7A 3EYWA 3HS3A 4L9SA 4OYYA 4S1NA 3O8QB 3JPYA 2VUSA 2OO5C 3MGKA 2XZPA 3PQFA 3OCUA 2VPTA 4Y6GB 4RULA 4HDMA 3W5UA 1I3OA 1QIDA 3KALA 5HF9A 4ZMRA 1T0HB 1NBHA 1XSEA 3WA6A 2RJNA 4Z2YA 3DSRA 5IAKA 2NTEA 3H1GA 4AN1A 4MUBA 3RF7A 5IDYA 2G9NA 4HGPA 2QRKA 2B9EA 4ND8A 1FTYA 3W04A 2P2ZA 3QOYA 4GOLD 2LXNA 2O23A 2IZZA 1YUNA 3A11A 2HDHA 3IV7A 1GP2A 4R84A 4RESA 5EJMA 4ZIRB 1Z0ZA 1OROA 2NAFA 4QO8A 3ZK7A 3AJDA 5L9AA 2QTVA 3GEHA 3K1YA 3QQ5A 4HZGA 1OI2A 3BMCB 3RSSA 4Q05A 5CD1A 3UOGA 1U1IA 2OLJA 1ZRHA 1E2MA 1GAEO 2DHEA 2AHOA 4JUAA 3JR7A 3ZIAD 2C7VA 1FJGB 3DXYA 3E48A 3SFVA 3HCBA 4IAOA 4IYJA 1RHRA 5C8YB 4GPD1 2BISA 2Y4NA 3IVAA 3LUGA 4MZDA 3WMGA 1W1WA 1JLSA 2EWVA 5F98A 3H9EO 1G63A 2FQWA 4FS3A 5BW5A 2F1JA 5KTRA 1EFUA 1QHEA 2FUEA 4HEA1 4O4JF 4JEHA 3RV4A 3DZIA 1ZVJA 4MV7A 1ABFA 1PJTA 2LIVA 4U3JB 2G1UA 1CRLA 3JWGA 3R5HA 4WZ6A 3ZHVA 4YYZA 3W5DA 3NIGB 1J20A 2VHJA 4LXGA 3FFBA 2VZ9A 1JS1X 1B43A 3HDTA 2C00A 5CDUA 2XZOA 3PK0A 4PC7A 5GZ6A 1Z08A 2GPWA 2HWWA 4I8IA 4FGSA 4MUKA 3DF9A 3W8DA 1M2WA 3UIEA 5C8XA 5HP4A 1XD2B 5KYNA 2EATA 2IKQA 2VRBA 4MYTA 2VT3A 1A9RA 1GUZA 4G01B 3S0JA 3EEBA 2C3UA 5HKBA 1IG0A 1JZQA 1VJCA 2IEIA 2XKBA 1J42A 4HEA6 1X0XA 2NZ2A 1WY5A 4DLUA 3RK1A 5JXIA 5HRUA 4YHHB 5GPBA 4L5YA 4Y2VA 3V97A 1RYFA 4MV3A 1EESA 2BUCA 3L0OA 2FSFA 5JO9A 4AC9A 4RD3A 5AVSA 1Z36A 2C5BA 1M34E 4FC7A 3DAHA 3IBFA 3ASYA 3MTJA 2FFBA 2JAHA 4OGLA 2UUBB 1J6UA 2WV9A 3HVJA 4ZT6A 3D6FA 2XF2A 4H6WA 1J00A 4R2MA 3MAGA 1PQUA 3WL8A 5LPNA 1JR3D 4IV8A 1SZJG 1KJNA 1FFXB 1QFMA 2A9FA 3AY6A 1LNQA 1CJSA 1FDIA 1SXJE 1VHTA 4ZCQA 3V8QA 2V4MA 4GLBA 1OYWA 1PYOA 3HYSA 4I4TA 5LYYA 4GBMA 4NDAA 3SMVA 2C94A 5A4JA 4A26A 1TVKB 2PQ6A 2CYAA 1UMKA 3G2LA 4JJ6A 1DTWB 5FWXA 2WWXA 5T57A 5JZSA 2EWMA 3CIOA 2GUGA 4KXXA 4UZSA 4NJMA 3SBXA 4TMKA 3JAWA 1PFQA 5AI4A 2PVSA 3QM1A 3F5QA 2GGSA 1X2BA 1YI0A 3OSUA 5FORA 2IXAA 1KJ8A 3SICE 4M60A 4CMIA 1UXHA 2I3GA 5DBGA 2XYQA 1VJRA 5H1YA 3O3MB 3F9CA 3HI4A 4HQOA 3S7ZA 1A3CA 2RI0A 1DUSA 1Y5LA 1ZXXA 4RY9A 4CTKA 4BPBA 3PA6A 3UMVA 5FF9A 1TM3E 5H3HA 2EIHA 3KZ1E 3ZKWB 4ASUA 1IXKA 5KQRA 1ZBQA 3E8SA 4EHHA 1DAGA 4GUDA 2UVPA 2ZJOA 2NNLD 3I73A 3SZRA 1S8NA 2DPXA 4KDEA 3WADA 3WWEA 2ZCUA 1R5JA 2QS9A 3N8KA 2X4IA 2IUSA 3S5JA 4DV7B 2QM0A 2OV3A 4GOMD 3S2ZA 1GG5A 1I9GA 2A5FA 1JSCA 2ZB8A 3LT0A 5BWMA 1KO1A 3FYUB 4AAYA 4F4IA 2VJNA 4JCCA 4JJ8A 4D6PA 3G02A 1KO8A 3SDSA 4K6FA 3NHSA 5JNLA 1T0PA 3CZQA 4Y67A 1EUCA 1HZZA 2ETXA 3OU2A 1WNTA 3DBIA 1TM4E 4C29A 3K8ZA 5CJ2A 3R9WA 2QZSA 2Z8ZA 4UDXX 4IX9A 2Q5CA 2EBUA 2C20A 2MHCA 4CL2A 5F3WB 3LA6A 3QYAA 3K9GA 2JIDA 4QLOA 3I42A 1KOFA 5KKCA 5T4HA 1EU1A 4ESEA 5ITZA 1M2EA 1P7WA 2PSDA 4MS1B 2ZUTA 2AEEA 5I9MA 2IP1A 2ZVJA 3KU1A 3UV3A 4B3HA 1JXQA 2VUTA 2H5EA 1WQ4A 2BFAA 2FYTA 1SURA 1F0PA 2F9MA 2XB6A 3CH6A 3LX5A 2YFYA 3Q4GA 4GOXA 5BN4B 2VP5A 3RBVA 3CVVA 2CVQA 1T1JA 3C3AA 4C6HA 3O4HA 2OHOA 1OAOA 2AMJA 3SY8A 4G3XA 1XKXA 2IHYA 1OYVA 1WDLA 2WUVA 2PGXA 1ZUWA 4FLFA 3AB8A 3FKJA 3N6RA 2XWJI 2PKCA 1CQPA 3VPFA 4UZFA 2RGWA 1YRLA 5BRNA 5DN9A 4YDSA 1RZ3A 4JJFA 2YZNA 5HDQA 3UT0A 3UJDA 3VHXA 1XDSA 2UXBB 3ICPA 4KU4A 4FB4A 5AQ1A 4JGIA 2OD2A 3IR6A 1PYDA 4NEGA 2FR0A 1ZOPA 4HDAA 2JGIA 2D1SA 2FTKE 1E3TA 3H1BA 3NCTA 3K4QA 1V71A 3OPQA 1N6NA 2R2AA 2WE7A 3DUWA 3OZAA 4RCVA 3LKVA 4KFSA 4NE2A 5FCDA 3T9BA 2NUBA 3K1ZA 3PJGA 3E58A 3U4MA 2IU6A 1EZ1A 1U2QA 1W2GA 1IEVA 3BEOA 3FYTA 1WTAA 2OBBA 2V45A 3ZWNA 5I3ZA 1ONOA 3UV7A 1UT6A 1Z8NA 3C3PA 3VC2A 3RBZA 4RBNA 1L4MA 2WJWA 3KQPA 5BQXA 2OGUA 3HJHA 4OB7A 2IYXA 1E6WA 4GPBA 4S12A 4A6XA 1H6CA 3S2YA 3SSMA 2C9YA 2YINC 3L06A 1RDFA 1YUMA 4XW2A 3FDFA 2C2YA 1LUAA 1LPOA 1YTLA 2CVHA 1P0CA 1XR3A 1YK0A 2YWBA 2CK3D 2NZYA 2YY5A 3AR2A 2R5WA 5D3MA 4OQLA 5FI0B 3HYNA 4AS2A 7MHTA 2DFNA 3OJLA 3EZXA 3DL2A 4L3WA 2CNLA 4I1YA 3C4VA 2Q9AA 1ZUNA 1E3DA 4WVLA 5GWXA 5A5VA 2FWJA 1JXMA 3INNA 2FUNB 3FHTA 4XGRA 4UTZA 1XMOB 4ENPA 4O4IF 1RRGA 3IKMB 1GRRA 3PBKA 2RH9B 4JWKA 2IGTA 4OSPA 3L1IA 3TRFA 5A1TA 3FPHA 5EJ9A 2DQYA 2N75A 2L69A 3V34A 1FSFA 2VA9A 4XQCA 2NU7A 4BC1A 5JAPA 3EDYA 1KH2A 3O83A 3ZCSA 4K6KA 4AKEA 4DEVA 5DBIA 1XC7A 1GZDA 4EGAA 4C7BA 3EJWA 4Q7LA 3FKSD 1J09A 4UMFA 1J2JA 4CM8A 1J2RA 1QG0A 3TD6A 2VQEB 1DO8A 1C7JA 4KQEA 4EKEA 1YDFA 3D6AA 1VFPA 2HA4A 1YFLA 4X6XA 1Z7YA 3VNAA 1B0UA 2H00A 4QJBA 4F21A 4PN7A 1ONPA 1YQGA 4PGHA 1AKEA 3EWAA 4J0GA 4QUDA 4MK4A 2IYZA 3OM1A 1DRVA 1OHHA 1CIVA 2ANBA 2VR1A 5LB2A 4GM1A 1K6JA 2UV8A 2PMWB 3IV6A 2ZT5A 1DX6A 4OGGA 1UFOA 3DUFB 4PG7A 1OXUA 2BE9A 3GYBA 4OBEA 5G53C 1MFZA 4W5TA 1W0KD 4RUKA 1D3AA 2DAPA 2J9FA 2ZUDA 4FGZA 5AW9A 2X8BA 4RFSA 3ZI4A 2ZTHA 3Q85A 2IOHA 4Q02A 4MDHA 1UBGA 4DIUA 4V39A 2AJBA 3UNXA 3R8CA 2CBZA 5ED0A 3GNLA 4BYGA 2W4IA 3NXKA 5SYNA 3CS3A 4HNSA 3WYFA 4A36A 2YNMD 5BQFA 3QPBA 2Q4DA 4HXEB 4COKA 1NI4B 3M6MD 5GM2A 2JLWA 4I3HA 1RNLA 3IBCA 4QNNA 2AZMA 1YZUA 4LQDA 1RBYA 5TT1A 2GB4A 3T4EA 4FJ1A 1XNRB 1MNAA 4M3NA 1D1PA 3VVBA 4CM9D 2I99A 4B2PA 2TSYB 1WB4A 3ZXIA 3ITNA 3W6NA 1KU0A 5J58A 3OQOA 4ZU3A 4RQTA 1ZCBA 1GRCA 2MMGA 3HZRA 3SXJA 3I4LA 1H0KA 4R9SA 4B34A 1SCUA 5AKIA 5EUBA 2GR9A 2VOJA 2H52A 4NZPA 3WWDA 4KAJA 3QVTA 1OX4A 4MROA 5IT0A 5JDCC 3OIYA 2W8BA 4DG5A 4GXNA 2GLXA 3PT9A 4HWKA 3O84A 2YJ4A 3E3OA 4E12A 3MINA 4DYDA 4FHGA 1OFIA 4YS6A 3CRNA 2VSOA 3K0AB 5DCWA 5EXSA 3RYHB 1AQIA 2JFZA 2WABA 4YLEA 4Z4IA 4PQFA 4NG5A 4LJKA 2HW8A 2AW3A 4AKIA 1N5LA 1KIAA 4HDNB 3O74A 4UVDA 4MW4A 3CW9A 1NX6A 2PKWA 2F67A 3GEPA 4MQ4A 1WXQA 3M9LA 2OZVA 4I9UA 5SZHB 5TMPA 3HXMA 2Y1LA 4HNHA 6REQA 2RDMA 3LGSA 3MERA 2AKYA 4KDCA 4BKQA 3BXHA 2MYTA 2OG1A 2QL5A 4UTPA 5JS6A 1NLFA 2O8NA 2YASA 1E5LA 3KR9A 3V33A 1GUFA 4D0NA 2DPYA 2OZLB 1W19A 4E2XA 2GD0A 4TLMB 4LPKA 4AJNA 1K3UB 1IOVA 5CIYA 1TMOA 2EJTA 2FR8A 3KB8A 3P9NA 4PQYA 5SZKB 5EGSA 4DDHA 2G07A 3OURA 4K9LA 4NPCA 5K8JB 1MA0A 1UODA 2EZ4A 2HRQA 3MSXA 1KE1A 3ZWDA 5JHGB 1M7BA 3B7PA 5IK2D 4J16A 3ZY3A 2AFVA 1HG1A 2OV1A 1SB8A 2C5HA 4FYMA 2QMYA 4E11A 1II8B 4EG5A 3K1AA 3Q9NA 3GLGE 4F9EA 4HV4A 5ERYA 5FYDA 4V1CB 3A1VA 3NV9A 2NXNA 3KL4A 4P7KA 4NMHA 2F43B 4M1MA 3HY6A 5DGDA 1JMKC 3L8CA 4EI9A 2E82A 4X1KB 2UZ1A 5B6IA 4JP8A 1IY2A 2R96A 3EXEA 3QTLA 1NNEA 3ZQJA 2O0MA 4YAWA 2O5EA 4EMBA 4BVJA 4NICA 2HWXA 4JSYA 1AMUA 3MWLA 5BWBA 1PR6A 1GR1A 4NI5A 5K4HA 4AWAA 2H4FA 4NDNE 3L6UA 3WKBA 3LJKA 1HEYA 2H54A 1CUDA 2W00A 3GUZA 3IVXA 2VHCA 3D5QA 3O1IC 4HVLA 3O7WA 2BM8A 5GJWC 3SKVA 5NLLA 1ZD5A 1RCUA 1Y7PA 1R50A 3JVUA 3QPDA 4TN5A 5DLQC 3WNVA 1JWAB 3T3EA 3VPGA 2FWMX 3E5RA 1XZKA 2BGLA 2E1PA 1O0BA 2CNDA 5KCZA 5DM2A 3OEWA 3VI3B 4YT5A 3IMEA 3A4YA 3OKPA 3ZZMA 4D3XA 3CVUA 1XG5A 3CE9A 4L4UA 1J06A 2FUCA 5CH8A 4Z9XA 4D45A 2AXPA 1EAYA 5CDHA 3KJXA 4QX6A 3HLKA 4AKGA 3QWAA 4Q9LA 3W4JA 5ULLA 1F06A 3IMCA 2HDNB 3L9WA 2YVQA 1A2OA 3AUUA 4LXTA 4R2KA 4UBKA 2GCNA 2H3HA 2G17A 3BMOA 2IY8A 3E22A 1YS7A 5H5JA 2XVXA 3SYMA 1PNTA 5JNTA 2PRZA 1WG8A 4MJ3A 2FWAA 4KC0A 4PLFA 1LWNA 1F60A 3RG2A 4AJLA 1HBJA 5EZYB 1UC9A 2A0FA 2V7PA 4F46A 3EZ9A 1BWSA 2H7YA 1UK7A 2SICE 1KJ9A 3FHLA 1KJIA 1OA1A 4RXUA 3MEQA 2Z6UA 1XLWA 5K3SA 4C2BA 4FHZA 4BNXA 2DF8A 2VRNA 1G291 4HSGA 5IAJA 4ZI7B 3IR5A 1FFAA 2HNKA 3BJIC 4CL3A 1YMQA 3WZ2A 4ZI2A 5DV9A 3SC4A 1M34B 2ZS7A 1MEEA 3BZWA 3M2TA 1PEAA 3PGLA 3C5EA 3PNBA 4M89A 4Y0NA 4C04A 3FHCB 4MVJE 3ROXA 1NVWQ 3GCXA 1NVKA 1QYRA 3CUKA 3ON5A 3T5PA 1US8A 1NUTA 2HQ1A 3FGPA 2Q29A 3DE2X 2QQEA 1BKSB 3BSFA 3EPRA 1SXJB 2ZRPA 2YWDA 1LTQA 4URFA 1GVNB 3F7MA 3RQSA 3EDQA 3VDRA 1D4OA 5IF9A 2XB4A 1NVTA 2D06A 3TSOA 2GUWA 3F46A 4P3YA 4ZFNA 2IXEA 3ZCVA 1LSJA 2Q1YA 4MW7A 4OK6A 4ZEMA 4PNPA 2GI4A 5FFNA 2E4YA 2QEQA 5FL7A 2ETVA 2P2GA 2Q4TA 1IVYA 1J1IA 3GRFA 4FMCF 5P21A 5IJWA 2JAPA 1XZAA 1XZJA 3WIBA 4KPEC 1NN0A 5AJHA 3NTVA 1RLTA 5AK6A 5I7HA 4U6NA 2PH5A 3BCHA 4BNUA 1I7DA 1JG6A 2OORA 4LV5B 3L5KA 1SKUA 1L7VC 4HN9A 4KE7A 4P5EA 1ECBA 3DE3X 4FHFA 1NFFA 1SD1A 1UPUA 2Q2NA 5AW1A 1C29B 1KPGA 1RBQA 1S3FA 2CFTA 2CVPA 3IIKA 4PLTA 4R01A 1ZAYA 3AEYA 4H0FA 2FU5C 1RCFA 2BBTA 2W6JD 3MTQA 4NEQA 2H4WA 2G3YA 2XTMA 2ZIEA 2OO7A 1DQZA 3LVQE 4JL8A 3E53A 4EEKA 4V38A 9ATCA 4YVFA 2KM1A 2VZLA 4FXOA 5TXGA 5KPDA 2C7OA 4KLRA 2D5CA 4HPJB 5K09A 5EOVA 3U3MA 3KTDA 1ZCZA 4NBVA 5JH7B 1BW9A 2W90A 4G65A 2C5EA 2BFDB 1OW3B 1E1KA 1ML3A 2YHIA 5C4GB 4W5QA 2EFEB 3NEYA 3QX3A 1QPBA 3CM0A 3PQCA 4HP8A 2ZIGA 4DMRA 1YKGA 1PJRA 13PKA 1R8XA 2WHPB 4MO2A 5JY1A 2YJ5A 3VAYA 1XRLA 4Z4FA 1ZK4A 1PSWA 2GZRA 4N5NA 4M9XA 4DZZA 3SWWA 4IICA 4ABTA 4L0MA 2GF0A 2H1LA 4JBGA 2AMFA 1EDOA 4OXNA 2WNIA 4LECA 3OF2A 4QXMA 2J3LA 3C6QA 2YFQA 1RPTA 3PYLA 1C7IA 1TAGA 2IF2A 1X9GA 3GHHA 3LFTA 1X3LA 4GC5A 2NN3C 3SOPA 2Y05A 5ERGB 2UYGA 4R31A 3EQ8A 5AQEA 2X9QA 3SE0A 1PKEA 3KIPA 1PUXA 2FPIA 3JAKA 3L6BA 1Z0UA 3I04A 4RENA 2FEPA 2PNJA 4GNKA 2WHXA 3H2HA 4CQMB 4FNGA 2CSXA 2R7AA 3IALA 2Q8PA 1YDMA 3FG9A 3IILA 4OJMX 1HQDA 5CT9A 1BVUA 1U99A 4TYNA 1A8SA 3V7UA 2B0CA 4L8YA 3WB2A 3CYFA 3GRAA 1ZC3A 2GJ8A 3LDFA 4M1QA 3V4PB 1FTNA 1E5XA 1UZNA 1WUTA 4RSMA 3H5IA 4BE4A 1IE3A 3V48A 3R77A 2YZ2A 3IHLA 3DAYA 4LYYA 3LQFA 1TVEA 4TKLA 1O97C 1U3VA 1T3SA 2IS1A 2V7BA 1JIKA 4HLUC 3VU9A 5FDFA 5BNFA 2GM4A 2PE5A 1M1NA 3DM9B 3LUCA 1YO6A 3QITA 4IDFA 2CKMA 2OHHA 2FPGA 5CB4F 1PT5A 5LSAA 4NK4A 2GBFA 2WIDA 1FXUA 1KJYA 1UJNA 4WZAE 1ZX1A 4BV3A 5LMNB 3H6GA 4RHYA 5JJCA 2C29D 5JS8A 3MD9A 2D3WA 4NECA 2X2PA 1GYRA 2WICA 5KX5B 1DBPA 4RZUA 3ZU2A 2WPDA 3IB3A 2ZTMA 3NAQA 1X7XA 4K6OA 1YDHA 1E2QA 1EFLA 1P7YA 2FR1A 3FI0A 3H7IA 1PV4A 4ZHSA 2M2IA 1SVOA 3CX3A 5I47A 3ZN2A 5KZMB 2XQFA 5EKXA 3WL5A 3QKRB 2BLLA 4BO3A 4H6PA 3IP7A 2WF5A 4HRAA 3VX4A 1W85A 4F3CA 1N2GA 2O3RA 1EP3B 4MJ7A 3CIFA 4MMXB 1CF2O 1P18A 1CETA 2XTJA 3ABIA 4WKCA 2CFCA 1NXVA 2FX5A 5EQTA 3ZE7A 3ZW7A 2ZJ5A 4G2TA 4ZV9A 4LZJA 4YRIA 4I1OA 1L1FA 4CKBB 1D03A 2P2CA 3DHYA 3EH1A 3NYRA 5AKYA 1GKYA 1YDGA 4INJA 1A95A 2I1VB 4MV4A 2PWYA 5FOWA 5E3IA 3OTWA 4JJAA 2E5WA 4IDHA 3EGEA 4Y2XA 3VVCA 1CY6A 3ABOB 2V5UA 4W7IA 3FFAA 1EZ4A 1GGEA 2IF0A 1SCKA 2PX6A 5F35A 2HJWA 5KWSA 3A14A 1WD7A 4WASA 4D9JA 4DUZB 2Z1DA 3LHKA 3O4JA 4BMNA 2HYDA 4HDKB 2X0EA 5JRZA 3UHAA 2W2NA 1R12A 1Z3CA 2EFGA 2X76A 2QIPA 3MOSA 3R23A 1A76A 1K98A 3LBYA 3SF8B 4B44A 5AVXA 1LC0A 4EGJA 1RJDA 3KLMX 4P34A 1N1MA 1NT4A 4NOMA 4P3OA 4R16A 3B38A 1FS4A 4F2DA 3WGYA 1Q3KA 4F38A 3DA8A 1KRXA 2P6OA 3HHEA 2XSZA 1HETA 4OHUA 1YHNA 3QVUA 3OZWA 3OT4A 2RD2A 1KY5A 4CEIA 1MHPA 1D04A 3IEXA 4GOJA 1SVMA 2E4AA 2FDCA 3TIXB 3KD3A 2MDTA 5A4IS 4LMPA 3KZXA 3F5FA 3KR1A 1SQ0A 2XRYA 1FP4A 4WOJA 5DIZA 1ODTC 5ILOA 2VDQB 3UAYA 2N42A 1K6EA 1GFZA 4ZIRA 1QOPB 2CLHB 2HPVA 4B46A 5EP1A 5HWSA 3AF2A 5JISA 3G0HA 4O5OA 2P69A 3BMCA 3WKCA 1JG2A 2BFEB 2XPCA 2ZRCA 3OCWA 1R0XA 1YNOA 2QUKA 3K8QA 5A7HA 1I7NA 3TB6A 2ZB2A 3C1OA 3LHSA 1BO6A 4X95A 4F2HA 1V7CA 1YACA 5GQSA 4HRYA 1ORDA 1DB3A 1NW3A 2NPOA 1R9GA 1V16B 1RVDA 1Z2PX 2BRUA 2V6FA 3FUCA 4HH4A 3GRCA 3T1YB 4HAZA 1NLUA 4P0TA 4YAUA 4HGQA 3K92A 3MWDB 4HH3C 3AB7A 4MA0A 5IJAA 2OXTA 3SJAA 4E15A 4OLJA 1PWZA 2ANCA 4KQMA 3CEPB 3DE0X 1Q7GA 1YAJA 3IMGA 4XGQA 4DLVA 4EGCB 1ZNYA 1G66A 5TMEA 4MYSA 4BMYA 3AF6A 2E49A 5BY2A 3STXA 5KJFA 4LDAA 2FWNA 2ID4A 4QTZA 3PE6A 4D74A 3A9TA 2XJ4A 1EFPB 4PEVA 1H5QA 1VGQA 2QLNA 4KN9S 1XD2A 3EFBA 4GX5A 1XEFA 4I4CA 1I1OA 3TXAA 3U1TA 1WTCA 4BFCA 4K88A 1ZXBA 3OP1A 5IKMA 3LUBA 2HCRA 1FVXA 5JJIA 1SVWA 1FXWA 1O95D 2HO5A 4JJ4A 3PEWA 1BCRB 5HR5A 3COVA 5GONB 1EUDA 1PTJA 1U8CB 3B1WA 1JKFA 1SEPA 2PGIA 1NUQA 3GUCA 4Q39A 3RVKA 3SZGA 4Q48A 4Q1AA 5DNYB 2P6NA 3GGGA 4DMHA 1CV2A 1AKUA 3WHKA 1LCIA 4W63A 2REQB 3G1UA 1LQ2A 1QCDA 4MW9A 4Q12A 3TRHA 2VTBB 4RVGA 3A4IA 5H4GA 3N3AC 4H7KA 4Q5IA 3VR6D 3SZOA 1TTPB 2DZDA 2XDAA 3T3DA 3MZ0A 4HO1X 3V7NA 1R6VA 3WOVA 1QCYA 3P7MA 4H59A 4YPFA 2ZCVA 3KD2A 4RFVA 4M0PA 3IMFA 3QV1A 2K2QB 1MXHA 4OATA 1MRNA 1SH7A 4OHCA 3P45A 4QYMA 4UHJA 4F72A 3LQ2A 4KVFA 1O8CA 4TMXA 3JD0A 3BDIA 2QMEA 3P9ZA 2HDWA 3G5UA 4XYGA 1O0CA 3BFXA 3DCJA 3IR7A 5IJ0B 4B80A 3KZMA 5KAMA 1DVRA 3DW3X 4F4HA 3KG2A 1G2QA 4XIJA 1Z47A 3FOBA 3HJBA 2H2HA