3C70A

Hnl from hevea brasiliensis to atomic resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxynitrilase
publication title Atomic resolution crystal structures and quantum chemistry meet to reveal subtleties of hydroxynitrile lyase catalysis
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 92
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c70A00
1XZGA 1EVEA 1C4XA 3TJMA 4MXDA 5IVIA 3DOHA 5C8VA 2AJDA 4Z49A 1W4LA 3D59A 5JZ9A 4Y2JA 4BVJA 4EY8A 3HSSA 4A5SA 1CUZA 1UXOA 1CUBA 5ALLA 4LHEA 3WL7A 3QM1A 4H7JA 4Q3OA 4GECA 1IUPA 3AIKA 3G9XA 1WPXA 4X94A 4U2FA 3HLKA 1BROA 1FFDA 1AC5A 2PM8A 5KWJA 4I19A 4BCCA 1JT2A 1XQVA 5AI0A 1VLQA 4ZWNA 2VJBA 5ALEA 3AFIA 4U2GA 3PICA 1THTA 5BOVA 2ZSIA 3WKBA 2ECFA 3QZUA 4GBGA 1LBTA 1UOQA 4EY4A 3WMRA 5AKIA 4OSEA 4CFSA 4AMZA 3H2JA 3HC7A 3HZOA 1PFQA 4OYYA 2HU7A 2I78A 3ED1A 4IH1A 2WFZA 3FNBA 1AQLA 4CIBA 2C58A 3FVRA 1TCCA 4H7IA 4N5HX 2ZYSA 5ALIA 5AKZA 2I03A 2XLCA 1XZKA 1DU4A 3FYUB 4UBKA 3ZLTA 5SYNA 4B7ZA 1GGVA 1N5MA 4V2IA 4W1SA 4H0CA 1YA4A 1WCYA 4X3CA 4Y2PA 1HDEA 1LPOA 1ACJA 1P0MA 2ONCA 2FX5A 2H9YA 4G1FA 4C89A 5HCUA 5T4BA 5I7UA 5DTIA 4BP8A 2PVSA 2GBFA 4FLFA 1GXSA 4X85A 3DL7A 2RONA 3UMJA 1P0IA 4FFVA 1R88A 1YB6A 3O0DA 5K3CA 5A7FA 1ZD4A 4U2EA 5CT8A 5K3EA 1VOTA 5CH3A 1W76A 4G4JA 4P92A 3MUOA 2ORYA 4FDMA 4BCBA 3R40A 4CG2A 5A2GA 1EVQA 4BBZA 3FVTA 3IDAA 2I3ZA 3OM8A 2PU5A 1LPAB 3A2LA 4CCYA 4DNQA 2ACKA 5AJHA 4UHBA 3ZLUA 1UOPA 1WB4A 5JZSA 4CG3A 5AM2A 2UZ0A 4BAGA 3AJAA 4Y9SA 5CTAA 5EFZA 1XLWA 3FLEA 1JJFA 3BWXA 3D0KA 3ILSA 2RAUA 3D7RA 5AK6A 2QXTA 1T4MA 1MO2A 7YASA 4W63A 4YK7A 2QVBA 4HAIA 2O2GA 4NZZA 4UFOA 1U8EA 4DLNA 3G9UA 4Y2VA 1W52X 1UT6A 1UZAA 4Q3LA 5DLPA 1FSSA 5HZGA 4EA6A 3LIPA 2VJCA 4C4ZA 3D2AA 3C45A 2QOEA 2B9VA 4K2AA 4L9AA 5K3FB 2OXEA 4WY8A 1YSCA 2Y2UA 1UFOA 1UK9A 1P0QA 3AUKA 1F8UA 1CUIA 3KSRA 4DSZA 4MWSA 5HFAA 1XZCA 1CR6A 3H2KA 1DINA 4DGQA 2OAGA 1A88A 5KBYA 5AK4A 3KOOA 1TK3A 4J0IA 2WLSA 4EY6A 3DYIA 4BE9A 3L1HA 1TKRA 2OCGA 3DCNA 3G9ZA 2XQFA 3DKKA 2ACEA 2AJBA 3SWWA 5ALMA 2E3JA 2WFMA 4K6HA 4QZVA 2WIDA 2XMZA 1QO7A 5DNWA 4UBOA 4KE8A 2OCKA 3FWHA 2O2IA 4E14A 4EY7A 3DJYA 1U65A 2HA6A 3L1IA 2HA7A 3BF8A 1ZIXA 3K9BA 5EGNA 1QFMA 5LZ2A 4CIAA 3V48A 5CURA 2YYSA 1XQWA 4MYDA 2VF2A 4IQ4A 1TAHA 4KE7A 1VKHA 1KU0A 2V96A 4G8BA 1J2EA 1QIFA 3ANSA 2HL6A 5DYYA 4BC1A 3LCRA 3LP5A 5AKLA 4B6GA 5ALKA 1EDDA 3A6ZA 3C6ZA 4QA9A 3GA7A 4IHAA 2XUPA 2EEPA 4HRYA 4FBLA 1MN6A 3STYA 3DNMA 1EK2A 4Y2XA 5CRIA 1UK7A 4DTCA 1MJ5A 1CUHA 2WU4A 3O9VA 3TEJA 5FPPA 3IVMA 4GW3A 4BYMA 1LZLA 1BS9A 4XIIA 1CUSA 1CEXA 4HXFB 1QTIA 3I6ZA 1CQWA 3RM3A 1ZICA 3MGAA 1JFRA 2BFNA 4HTAA 3BDIA 3DYVA 4XJVA 4ROTA 3L1JA 1UKBA 1XZDA 4X6YA 2PKYX 1HLGA 3LIIA 3R3UA 3STUA 1SOMA 4QE3A 5K5EA 2GBGA 4QLAA 4EY5A 2Z3ZA 2FJ0A 5EIAA 4X6XA 3WQHA 4TVKA 1TCBA 2OQVA 4RE6A 1LPBB 3QPDA 5AKHA 3VDXA 1XZEA 1FFBA 5CT6A 4X93A 4IH4A 5CW2A 4J0HA 3T4UA 4G8DA 1RP1A 4B0PA 1FFAA 2GYUA 1QIKA 4TPKA 4UBLA 4WFKA 4EHBA 1J1IA 2QUBA 3O4GA 4D9JA 1P0PA 4CCWA 5ALQA 1PJAA 1VXRA 1LPMA 4ZV9A 2HM7A 5FP0A 4B9AA 2C0PA 4DSAA 2Y6VA 3C6BA 5HF8A 4H35A 4EBBA 2H7YA 1TRHA 3ESAA 2BUCA 1WHSA 4XWGA 3PE6A 3WJ2A 4FFWA 1QFSA 5AP9A 2XMGA 2XQGA 2Z3WA 5AM3A 4UHEA 4MEBA 2PX6A 4QNNA 5E4JA 3EBLA 3IUJA 1H2YA 1AURA 3WIOA 1DT3A 3WWEA 4B80A 1LPSA 1DX4A 2X5XA 4BRZA 4YASA 5FUMA 2XMDA 3CCBA 5AKJA 1EH5A 1JMYA 1DWOA 3H0CA 5AI4A 5CH5A 4UBNA 1VZ3A 1MT3A 1XRRA 1E8MA 4W9RA 1MPXA 4PV7A 1CIJA 5K3AA 1DTEA 5K3BA 2QMQA 4OCZA 2OCLA 1QLWA 4DMCA 4X7BA 3UUEA 3IURA 1CUCA 1L7RA 3DOIA 1ETHA 1PV1A 2ES4A 3VVLA 4BAZA 5C7YA 4TGLA 5ISMA 1Q84A 4Q3KA 2BJHA 2G5TA 2VEOA 1SCKA 4N8SA 5AO9A 1UK6A 1XQXA 2DHCA 2DQZA 4FLEA 5FXMA 3M83A 2ZVDA 4BTVA 3NUZA 4P93A 1XROA 1EB9A 4P08A 3STWA 2AJ8A 4K6GA 5KREA 2VTVA 3G0BA 1D07A 4KE9A 1ODCA 1CQZA 2D5LA 5HK8A 3H18A 2WUFA 3GBSA 4PSCA 4EZIA 5I9IA 3C43A 2WG0A 4OU4A 1CUDA 3R3ZA 1CUAA 3WWDA 5EHQA 2J4FA 1R50A 4WJLA 4HXEB 2WTNA 4GXNA 4HS9A 2BCEA 3W2TA 3JW8A 4N8EA 5ALUA 4QDUA 2HIHA 5J3JA 5LKAA 4CG1A 3DD5A 5HF5A 3FLBA 3OOSA 4IH9A 4BDTA 3WL8A 1F0PA 2WHRA 4OB8A 3O9MA 3CXUA 4GDMA 2QR5A 1GQRA 4JUIA 3IIIA 5AHXA 3ESDA 3CCCA 4AO8A 5AKKA 2X8BA 1LZKA 4FNMA 3G02A 3WK8A 1UWCA 3BE8A 3RLIA 2Z8XA 1F6WA 3A70A 4G4GA 2BGNA 1DT5A 2C4HA 5EIHA 2H1IA 4GHWA 2IITA 2WHPA 2XI4A 3RARA 2QJRA 4W1QA 1E66A 3H19A 3ZV7A 2WFLB 2PUJA 2WJ3A 5JANA 5D7BA 4XVCA 1XKLA 2GZSA 3C5WP 1G42A 5JASA 3ZPXA 4PSUA 4W1PA 2HDWA 4FOLA 4Y2UA 1XQYA 4X91A 3H2GA 2GBIA 2O2HA 4LXIA 1AUOA 2XUIA 5ALGA 1JKMA 3OTQA 5A62A 5EHZA 4X95A 4G4IA 4ZV7A 1ZJ5A 2OGTA 4J03A 5ESRA 5CXXA 5EI5A 1BN7A 3G0IA 2XT0A 2XE4A 2HU5A 5YASA 3W9BA 1VZ2A 1QOZA 1CFJA 2J3DA 1R4ZA 4AN0A 5AM4A 3I2FA 3PFBA 1GKKA 2VATA 3W04A 1YS1X 1AX9A 3VISA 1C7IA 1XRMA 2G63A 2ZJ6A 3HACA 3HEAA 1VXOA 3H04A 4E15A 1A8SA 1YCDA 1VJ5A 2XUQA 2CMFA 1K5PA 5JD6A 4Q34A 2Y2VA 2XUDA 5HK9A 3I1YA 2WUEA 4FLMA 3E1GA 2C7BA 2DHEA 3MVEA 4S0XA 2CKMA 4B83A 2XMQA 2WIJA 4LYEA 3M3DA 5JATA 1HQDA 5FLKA 2CBGA 1UKCA 2CB9A 3I2JA 5IVHA 4LKOA 2OGZA 1Q0RA 3JYHA 1QZ3A 5KWIA 2HA2A 4X90A 5JAUA 2XQIA 3ZWQA 3WZMA 2D0DA 1E8DA 4U2CA 5AKXA 2OGSA 2HADA 4P9NA 3O4IA 3GELA 1ZOIA 3DQZA 5C81A 1R9MA 3F9CA 3TRDA 3CN9A 5AOBA 5DNVA 5LKRA 4KJXA 1XZIA 3LS2A 2B4KA 2WUDA 3ANTA 1WHTA 2OG1A 2Y6UA 2WJ6A 3H1BA 1A8UA 1IUOA 3H17A 2HU8A 4HVTA 4YPVA 1EB8A 1QIDA 1Q83A 2GYWA 3P2MA 1KU6A 1B6GA 2JGMA 3H2HA 2B61A 1H2XA 5LIPA 1B41A 4CCYB 3O4HA 2XUAA 1XRPA 1EDEA 5AKEA 3AZQA 1NU8A 1X2EA 2VT7A 4QWWA 5T4HA 3X3HA 4U2DA 1AMNA 1TIBA 4DNFA 4B84A 2O7RA 2BAGA 1IVYA 1QJ4A 3STXA 4L0CA 5CMLA 3RKSA 1DQYA 1YR2A 2OQIA 1ISPA 1LPNA 1YASA 3WK7A 1X2BA 1EA5A 2R8BA 1BRTA 2AXEA 5CBKA 2GBCA 4HRXA 1UKAA 2XLBA 3NWOA 3R0VA 1GKLA 3WK9A 1EK1A 1ZGCA 3R3VA 2W6CX 1THGA 1E5TA 4ARBA 4MWTA 4U2BA 1M33A 1NX9A 1WOMA 2I3DA 1J07A 5CT9A 1QONA 4BTLA 3ZI7A 3VKFA 3OURA 3R3YA 4BAUA 5ALHA 3OPMA 1KEZA 4H7KA 3DLTA 4BE4A 3G7NA 3NGMA 2J4CA 1ZGBA 2YH2A 3G9TA 4BC0A 5AOCA 4UPDA 4OB6A 2R11A 3U0VA 3WA6A 2XMSA 3H1AA 2DHDA 4AB1A 1MX1A 2O7VA 5AKGA 3IULA 5FDFA 4RPCA 3SK0A 4INZA 3C8DA 2YASA 3BIXA 1EHYA 3BJMA 5AK3A 1IUNA 1HKHA 1MNAA 2GZRA 2PSJA 4C88A 3KD2A 3V1KA 2PSHA 4Y2TA 3WL5A 4FHZA 1O6FA 5IVDA 1OILA 4K6KA 3W05A 1UK8A 6YASA 1K8QA 3FCXA 2EDAA 3FOBA 4HXGA 1CUVA 2HA5A 1QGED 3FAKA 4ZI5A 5FOQA 1Z68A 4FTWA 2DQYA 4H7EA 2XUKA 5FV4A 4ETWA 1GQSA 1MAHA 3ESCA 4W1RA 4GWLA 2QXUA 4X71A 2PSDA 4WY5A 5ALPA 3KDAA 5AI5A 3WWCA 2ZYRA 3WL6A 5DWDA 1QIHA 3D3NA 4G9GA 4G5XA 1IZ7A 1CUWA 1ACLA 1JI3A 1DWQA 4B9EA 2G5PA 4H18A 4BCDA 3IUNA 1H2ZA 1H22A 4OYLA 4DNOA 2V97A 2XUFA 4LXHA 2PSFA 3BXPA 4X92A 3C6XA 3Q8WA 4AZ3A 3FYUC 1CVLA 2PSEA 5LP1A 2WG2A 3MUNA 2QS9A 4H77A 1W75A 5FPQA 4DMFA 1UOOA 4UFNA 4DM7A 1CLEA 4PSDA 4BATA 4DMKA 3K6KA 3WJ1A 4F60A 1ODTC 4BVLA 3G8YA 3DDUA 2XMCA 4EB0A 1ZI9A 4Y2RA 1SC9A 2JIDA 3C5VA 2WJ4A 3WA7A 4WDRA 3FSGD 1OCEA 4ZRDA 3G0DA 1HL7A 1S8OA 5CT5A 4IO0A 3H2IA 4OB7A 1CRLA 5HQ3A 3ESBA 3TGLA 2NW6A 2HA0A 3QPCA 1IMJA 1BN6A 4M0FA 2JGKA 4C01A 3PF8A 4J0DA 2Y1KA 5JYCA 5ALFA 3STTA 3FBWA 3HI4A 3Q0TA 3OG9A 1W1IA 4H7HA 5D6OA 4F21A 1LNSA 5LYYA 2HA3A 3IA2A 3DKRA 4Y2SA 3HRHA 2OAEA 4PQEA 4RNCA 2C5GA 4UBIA 2CUTA 4UBJA 3PUIA 4QLOA 2XDWA 4NS4A 5EIEA 3GFFA 3GUUA 4DYHA 1CUFA 2WTMA 1JU3A 3I1IA 1MX5A 5BWBA 5T4FA 3I2IA 1VE6A 1R1DA 2DR0A 1K4YA 5LZ8A 4UHDA 4GI1A 3M82A 1FJ2A 4QDXA 1TQHA 1MX9A 4QWMA 4ARAA 3M81A 3AIMA 2XQKA 4JNCA 1MAAA 4ITVA 1CUJA 2ZYIA 5A7HA 5HKBA 1XRQA 3WI7A 4QDZA 4LXGA 4WDQA 4RE5A 3IBTA 1H23A 2ZSHA 2QRUA 2WIFA 5LZ7A 1QIJA 4L3WA 3NOXA 5AICA 5JARA 2BUBA 2XUHA 1HPLA 1N1MA 4Q1VA 4WFIA 2DCMA 4FWBA 4Q05A 3PF9A 1LLFA 1I6WA 2WILA 3D2BA 3WKCA 2DSNA 2WU3A 4KE6A 1VA4A 1TCAA 2B20A 1Q0ZA 2WQZA 2PL5A 1FFEA 5DJ5A 2JGFA 1JU4A 4ZGBA 3VVMA 2HFKA 2VA9A 3HABA 1CUEA 2JF0A 3N2ZB 2OCIA 1USWA 3B3QA 3WKEA 3C70A 4KAFA 1EI9A 1ZD3A 3FYUA 2AJLI 4MJ3A 2WM2A 1XZBA 4X6UA 5ALSA 2BUAA 1WM1A 4JYMA 4J0JA 2PPLA 2QJWA 4AQDA 4E46A 4OUKX 4C4YA 1CV2A 2HA4A 3DS8A 3WZLA 1YS2X 1G5FA 1XFDA 5A6VA 3PI6A 3HYSA 3WYNA 3WKAA 1SCIA 3SX4A 2PBLA 5FRDA 5AI8A 3DEAA 4UHHA 1WB6A 1RYYA 4BP9A 4L72A 1T2NA 5ALZA 5AM5A 2YXPX 1CUYA 1K6EA 2ZJFA 3AZPA 5E4YA 1QE3A 5LZ5A 4N8DA 4OPMA 4K5QA 2WHPB 4I3FA 4M0EA 2DFPA 3QVMA 3YASA 4J0CA 2VQ6A 4PO3X 5ALOA 2WUGA 4KRXA 3FYTA 1A8QA 2QTBA 3WK5A 2QKYA 1ZI6A 1SFRA 2P8SA 3ICWA 2BKLA 1CUGA 4PW0A 5C8XA 3WWPA 5JALA 5ALRA 4MQLA 2WSLA 4UUQA 2J3QA 2WIGA 2JEZA 5AH0A 1F0NA 1DWPA 2IIVA 5DYTA 3HXKA 3QMMA 2G4LA 3O95A 4J3JA 1MTZA 2LIPA 3BDVA 2QUAA 1N8SA 4JEIA 5IVKA 1K63A 3BF7A 5A7GA 2Z5GA 5K3FA 3EQ9A 1H2WA 3ICVA 2VSQA 4G9EA 4FBMA 5A71A 1XZLA 2JGEA 3W9UA 5JAHA 1YAHA 2AJCA 2JGJA 2JBWA 5JD4A 4EUSA 2C5FA 4MEAA 3WLAA 3WK4A 2Z8ZA 1EXWA 1GPNA 4PNZA 1Y7HA 4C4XA 3F98A 4QEKA 1DQZA 5JAOA 3EQ7A 5ALJA 3QITA 1WPRA 1ODSA 3IUQA 5BV7A 1XZMA 3V1MA 1XLUA 4KAJA 4LYDA 1AKNA 5AM0A 1MNQA 5ALXA 2H7CA 2HHAA 4X00A 1ZI8A 1RWQA 2XMRA 2RHWA 2BGRA 5CXUA 1E8NA 1XZHA 1XZAA 5ALWA 1A7UA 3KWFA 4J7AA 2JGLA 1QIEA 2PU7A 3R3WA 1QIIA 3FCYA 4B85A 4QDOA 3I2HA 5D3KA 3OC0A 3F67A 1CUUA 3G0CA 2ZYHA 1QIMA 5HFNA 2K2QB 1X70A 5ALDA 1XLVA 3EQ8A 2Q0XA 4B82A 2H7XA 4X97A 4AMYA 1R9NA 3I2GA 4QDTA 2QZPA 1JJBA 3A2NA 5AM1A 1LPPA 1Y37A 4H7FA 3GROA 3KWJA 1XZFA 3R41A 3AIOA 2WIKA 4AX4A 2XUGA 4PF1A 5EHXA 4GEGA 2HFJA 1G66A 3F96A 3QYJA 5HF9A 3O4JA 3BJRA 4A23A 4BRSA 1JJIA 2JEYA 4RGYA 4KEAA 4AXBA 4FNGA 5ALVA 1LBSA 2CJPA 5CT4A 5DYWA 3WIBA 4G8CA 4UBMA 4UFPA 3QBJA 4AN1A 2JGIA 2V98A 5E4TA 5JIBA 5AKYA 1BCRA 5HKAA 4N5IX 1WB5A 3WK6A 1BU8A 3AILA 1XKTA 4YX9A 1CPYA 1QO9A 4KACA 5JAPA 3PUHA 1YB7A 4A16A 5D3ZA 4B81A 1EINA 5C8ZA 5JZBA 1AZWA 3V9AA 4CI9A 4E11A 4HZGA 1W6RA 1BE0A 4BDSA 2RGUA 1CUXA 2VAXA 5AI9A 4UHCA 5JADA 5F4ZA 4FMPA 3T52A 4BVKA 1ZJ4A 1G4HA 3G0GA 5ALTA 4C6HA 3D2CA 3I6MA 2PUHA 4AO7A 2ZJ7A 4MYSA 2FUKA 3S8YA 3A2MA 2VJAA 3AZOA 4Y2QA 4ZXFA 1O6GA 4WCVA 1ZD5A 2XB6A 3E4DA 2XQJA 1QIGA 3I2KA 4KYVA 3JWEA 2VJDA 1E89A 5CH8A 3U1TA 3FLAA 4BZZA 1DX6A 3IUMA 4NMWA 3STVA 2XUOA 3FSGA 2ROQA 5HF6A 4BB0A 4Y7DA 5AIAA 4KAAA 1Y7IA 2QT9A 2VAVA 3C87A 1XRLA 4WFJA 5BWCA 3B12A 4H7DA 4DMHA 3WYDA 3QMWA 3KXPA 2OPHA 4DNPA 3BL8A 5K3DA 1R3DA 1ZIYA 2W22A 3S2ZA 3QMVA 1QTRA 2V9ZA 3WKDA 1ORWA 3QPAA 1NU6A 1L7QA 1BCSA 5LZ4A 5DNUA 2RIPA 1ORVA 4C87A 1HBJA 5H3HA 3VJKA 3ZLVA 1GPLA 3EIOA 3WWOA 1XRNA 4XX1A 3W06A 4F5ZA 2CEKA 5AI6A 4JYPA 4LIPD 3D4LA 3DL4A 1OXMA 3F97A 4JH0A 1EDBA 1EX9A 2XUJA 4MQMA 3GZJA 3PFCA 2WHQA 5SYMA 2C0QA 1U4NA 5DTJA 3VJLA 1U2EA 5ALYA 1E3QA 1LGYA 2WG1A 5JD5A 1FFCA 3E0XA 5AIBA 2XMBA 1AGYA 4BZWA 1SCQA 3VJMA 3QH4A 3RK4A 3LLCA 3CN7A 3C6YA 4OD0A 3IB3A 3BIWA 5AOAA 1L7AA 5ALNA 3VXKA 2OLEA 3AINA 3B5EA 3V1LA 1BEZA 2HRQA 5EHNA 1GT6A 1YAJA 3I28A 2RHTA 1ZD2P 3UUFA 5HQ3B 1BEEA 4OU5A 1YA8A 2RI6A 3K2IA 3N0TA 1XZJA 3V1NA 4ZREA 1J06A 2EDCA 3C8HA 4J0KA 4KRYA 2IX9A 4I4CA 4AZ0A 2HRRA 5IH7A 2X76A 3EF3A 3PDCA 1GZ7A 3R3XA 3I6YA 5T4EA 4NVRA 1VE7A 2VT6A 4GLBA 4DIUA 4Y2YA 2QM0A 4M0MA 4Q82A 4AO6A 2FJPA 5LLSA 4O08A 5I8PA 2CZQA 4J0GA 1C7JA 5FKJA 3E3AA 2GYVA 3F8SA 1N5RA 3D5EA 3HJUA 1VA5A 1JMKC 4F0JA 1IZ8A 2WKWA 5E2IA 4UHFA 5AK5A 4KR0A 1GPKA 3SC2A 1MU0A 4B0OA 5IKXA 4FKBA 5LZ9A 2WFLA
chains in the Genus database with same CATH superfamily
4RKEA 1JLMA 1ECCA 1MO5A 3EGXA 4R8KA 1C4XA 3S2SA 3DMYA 3NB0A 2BSAA 4MXDA 2I8AA 3EIEA 4R1MA 3SJUA 3AXTA 4R8SA 1GG8A 5C8VA 2FFBA 2Q5OA 2ZITA 3BMQB 3B51X 2IHVA 3IAM6 4EJSC 1W4LA 1PL0A 4QDKA 3WAKA 4TRRA 3RIMA 5LR6A 2IP4A 3KBOA 5I7RA 2XY4A 3OOJA 4M0CA 1SKUA 2NTYC 3KAQA 3QEMA 4BVJA 2WC1A 3KYCA 4BJ1A 4HDAA 4FQ5A 4RAOA 1HYHA 2DSTA 1VG8A 5CEFA 4A36A 3SXUB 4JUCA 1XT6A 4QBFA 3RC9A 1LV7A 2VPTA 4PC2A 4A5SA 1Z26A 5H4GA 3I37X 2H0QA 1JQDA 3GXBA 4PNEA 2DFTA 4BV9A 1QH1B 3SDSA 4KXLA 1R6VA 1Y3DE 5CVJA 4C76A 3OU2A 4NZ9A 1IUPA 3ROZA 4DWJA 4WY2A 1Y89A 4NPAA 1SUFA 4U2FA 3ZY2A 3DB2A 2P75A 2M1ZA 2DY0A 3ABZA 3HLKA 3JRXA 4WBSA 4E51A 4LJ9A 4MHOA 4RDXA 1KS9A 2ISSD 3A1EA 1P5HA 5C8YF 3PC6A 1G55A 4I19A 4J4BA 3UJAA 3ZE6A 1H1LB 3UMVA 4E94A 2QW8A 1Z37A 1IQUA 1XA4A 4MULA 3S44A 1KFEB 3L8CA 1XTPA 4RU1A 5TSDA 1YQUA 1E9SA 1T4CA 4OHPA 3A9UA 3I09A 5AJVB 4EJ0A 3EPPA 4EHDA 3HYLA 3ER6A 3O3NB 4MS1A 5D1NA 1N75A 3KUDA 1QANA 1P5JA 4NMMA 5F7JA 5BOVA 3DVAB 5B4VA 3WRVA 2RKWA 2ECFA 1FS5A 3L02A 1ULHA 3KJZA 1SNYA 5AW3A 1N1EA 1LKZA 3K1TA 3WMWA 4ACBA 4F4HA 5H59A 4A0RA 5JMPA 5HNKA 4S04A 1UEXC 3SVLA 4CFSA 4CT5A 5G40A 5IG2A 2IPXA 4AMZA 4ZHQA 1DJLA 2ESRA 2EFGA 1V16A 2HCTA 2W2KA 3QVOA 5P21A 3CEAA 4XQ0A 3SLRA 5B7PA 4QPZA 3HC7A 2X8LA 2EJBA 3LT4A 1C81A 3NNDA 4A10A 2GFHA 2YOHA 2OLKA 2FH5B 2CFCA 3CZAA 4HZIA 4JQYA 2ST1A 4EPRA 3G59A 4AP6A 3LY5A 1RIFA 1L2TA 1TKCA 3ED1A 1U6IA 4IH1A 3N9IA 1SKMA 5JUWA 2WFZA 2COEA 1EVIA 2VO1A 1TC1A 4IMJB 2II6A 3RFXA 3VA7A 1AQLA 2QG4A 3KSMA 3C7CB 4Q3AA 4Q4AA 2JI6A 3KZ1E 1HYBA 2NQ8A 3L7MA 4QGGA 1YCHA 3O9ZA 4N5HX 4H7IA 3UHJA 1X15A 5BN1A 4D5GA 1S96A 5TDHA 2J09A 1FFWA 1RLTA 1DU4A 3IO5A 1L7VC 3CLRC 4UUAA 4BHTA 4DV6B 1SXJB 1VGRA 4Z9FA 2I5PO 1IQRA 4EA9A 3L0SA 1SN7A 4K6OA 4KTTE 3D9QX 4UBKA 1H05A 3ZV4A 5FWNA 3TSYA 1V41E 1Z2CA 2FWBA 2VDQB 4V02A 1MX3A 3QENA 4XDHA 4AUMA 2ID7A 4CU2A 2R5FA 1OB2A 1GGVA 1WNTA 3DBOB 1LFAA 3MYYA 1N9GA 4U2KA 1TJ4A 3MMSA 5NLLA 3BTSA 4GDFA 4BECA 2F7SA 1FVXA 1NJ1A 5LQDA 2GLUA 5J4KA 3HM2A 5DM2A 4I55B 3MW8A 1QPGA 2IYAA 1NXVA 1P0MA 2ONCA 2IKQA 3KSZO 1BMFA 3KZCA 4WW0A 2B2XA 1KAMA 3PU6A 2AG6A 2J5XA 2ZJ8A 3P9PA 1EFHA 3TYXA 3R7NA 3SHOA 1JLLB 4C89A 1GSIA 1ZJ6A 5T4BA 1RZVA 4RV5A 4O2LA 5I7UA 5BN5B 2AC7A 4WVLA 4UVHA 4CRWB 3WGNA 4DJJA 1FZTA 2IVFA 1XVLA 1YBFA 4C0SA 4N76A 3KX2A 3PGXA 4KQWA 2X3UA 3D64A 1K3FA 5C8YA 2D5CA 5LD2C 2KLHA 3GLSA 1XI2A 4M0PA 4PPNA 3OCYA 1U2TA 1RPNA 3NMUF 2FE1A 1J2UA 4LFAB 1IU9A 1VIVA 3GCDA 4Z9YA 3UPUA 4PZYA 3UMJA 2HIGA 3FETA 2CD7A 4FFVA 3UFXA 5CLHA 2FPPA 2IOFA 2D1FA 2FPGB 4E22A 2JATA 3OZSA 1Q0LA 3O0DA 2GF9A 2ALJA 1GGFA 5BV8A 2ZIGA 1KJJA 5AW6A 2X40A 1VOTA 4NULA 4LXQA 3L7AA 1LSSA 1W76A 4P92A 4QBGB 3WQRA 3MUOA 3C24A 4JA0A 2HZ7A 1XAJA 3ZDAA 2W00A 4RKWA 1Z2EA 3QWBA 3W5IA 2Z0MA 1R0WA 3C1OA 3NRCA 5CAEA 1IATA 2M98A 3HBFA 4J6EA 4EYQA 3IDAA 2G6BA 3TKYA 3VKGA 1H6CA 1LPAB 5MDHA 3AUJB 3HXLA 1V5IA 2NT3A 3PKJA 1SUIA 4LJLA 4ZEVA 1Z5WA 4GO1A 1TB4A 2RGBA 2WYOA 3TCKA 3VR4A 4IOLA 2UYQA 2O4CA 1QWOA 1R4MA 2X6RA 1V0JA 2OBNA 4K6MA 4XSVA 5BN3A 3A0RB 1U8ZA 3N5CA 1NUTA 2H29A 5ITWA 5BVGA 3O8CA 2ZRLA 1F8YA 1TUIA 4X63A 3AVXA 2G6TA 1FFGA 2QRVA 4RF5A 5EESA 4CG3A 5AM2A 1PWEA 4DA7A 4CTMA 5HFJA 3AJAA 4N0DA 1QRAA 2LXNA 3MTGA 5EFZA 2Q0QA 4GMHA 2W43A 4CL0A 1SRRA 1LW7A 1RHRA 3AHHA 3CGWA 3UUWA 2WD8A 1T1EA 1JE0A 1OZAA 1E4VA 1JKFA 1XZNA 3D7RA 1J8MF 1RDFA 4YC7A 5GY7A 4CCSA 5FEUA 1CVRA 2B94A 3K09C 3QYFA 3N75A 4IS2A 5FT9A 4AKEA 3EXIB 3U37A 1RJ9A 3BOSA 5D84A 5A9SA 4KXMA 3SE0A 3U7JA 2X7JA 3RF6A 1MO2A 5JXWA 2JLVA 1NBMA 4FINA 2QVBA 3EXAA 2PYZA 4YRFA 1NYLA 1NSFA 1W25A 2VFAA 4HAIA 2AN1A 4TSFD 1YDHA 2J3KA 3JXEA 1CZRA 4L28A 2O48X 1IPEA 3A27A 4MVYA 1T3HA 1E2KA 2N47A 2JL1A 1U9IA 4Y2VA 1R5BA 1UT6A 4RELA 3CLUD 1KYWA 2A9RA 1BA2A 4DR3B 2PUTA 1UZAA 3LUGA 4U00A 4I4LA 4PLYA 5T8KC 2DR3A 3TINA 2EKQA 3EDMA 3TS1A 5HZGA 1AGRA 5BYBA 1UBJS 1XJQA 4L4RA 4LYHA 3LTNC 4YEDA 1QCYA 4TLBA 4IP0A 3EPKA 3AHDA 1GNLA 1Y3BE 2WA1A 3QWFA 3KAKA 5LUAA 1EFVA 1BXRA 1NN5A 2BFMA 3SVTA 4N48A 1VKJA 3WWZA 4EVIA 5GJCA 1YSCA 2O8FA 3A1WA 2BSQA 3ENNA 1VJ1A 4NBWA 2YS7A 2XT6A 3RYIA 3A4NA 5HMMA 4B7AA 3AUKA 4MUGA 3R9XA 2RBEA 1KAQA 1YZ3A 4YRMA 3N05A 5MFZA 4LF7B 4II7A 2HC9A 3RCBA 4TKMA 2H1SA 4ZVRA 5F7XA 1SZPA 3REQA 1JKIA 3EA4A 1N4AA 1N0UA 1DIBA 4FFLA 4ZK6A 3A10A 3H2KA 3LD9A 3UZUA 4LZJA 4Z0PA 4YLEA 4BV8A 5JNRA 2R86A 1BHO1 1P44A 2XYHA 4DQ0A 2MCFA 4CEIB 1QGDA 3DYIA 4MRMA 1XF9A 1GTRA 5LQUA 1MV8A 3EA5A 1TKRA 4NP6A 5TRTA 1CDZA 1MT0A 1ZHFA 4X7PA 4C20A 4RTJA 1NQWA 3Q7TA 2XQFA 1RJFA 3QE2A 1VJTA 2WIAA 1JB1A 1Z4LA 4OHVA 4TV8F 4BLRA 4LGVA 2AJBA 3HFRA 1L5SA 2FZWA 5J43A 3UNXA 3HG7A 2C77A 1TYDE 1K9SA 1X9GA 2XNHA 1QO7A 3COWA 2QI9F 4TX1A 3OFKA 2D4HA 2OT3B 1REQB 3NCTA 4HNSA 3E58A 2A2ZA 5DT2A 4EFDA 3AQ4A 3CEMA 4UAJA 5IJXA 4OK5A 3REOA 2GUWA 3RS5A 1P1BA 3D6NB 3BIOA 4E14A 5I4BA 1JXMA 2HA6A 2XUZA 1JA1A 4KMRA 1TVEA 2VHWA 4MW0A 3L1IA 2OBYA 2IGTA 3HA5A 4FMDB 3CF6R 2R8PA 5JHHB 1RWMA 4UMDA 1CR1A 1QFMA 3EA0A 4W6ZA 4FHCA 4LJ5A 4IIJF 4BV2A 1XQWA 4HGQA 3RYHB 3NALA 1IL0A 1W44A 5FWYA 4KLZA 2OBFA 1P2FA 4GYJA 4P3YA 3EVAA 1GM5A 1LLCA 1MOSA 2OZLB 4CF4A 1UDAA 1K7XB 4NOMA 5JDIC 1JWBB 3KEFA 3LP5A 4F06A 4DBLE 1TZKA 2P9GA 3L7YA 2PMBA 4WCDA 1YQTA 2OHVA 3F7MA 3PGA1 2C7PA 1WD7A 1Z17A 4BLVA 4EG6A 2V6JA 2AFIA 2ANBA 2Y71A 1NKTA 4QGHA 3EWSA 2HPAA 2XUPA 4IILA 4TTPA 3C97A 4RS4A 7ABPA 5K2MA 3OZDA 4LDNA 3DUFA 3N6XA 2ECOA 2WE8A 4KR2A 4FCWA 1AN9A 1EK2A 1GFWA 1R10A 4MV8A 4QULA 5LQJA 3OZ7A 3S2YA 4DTCA 1MAVA 1MJ5A 2WU4A 4B87A 1ADGA 3H8JA 4GYWA 3AVTA 3ZDEA 2PRZA 1PZEA 5C1BA 3U4IA 2ZYVX 4ER3A 5FPPA 2G4CA 3IVMA 3TTWA 1GQFA 4BNMA 4QU0A 4EL5A 5LYJF 4JL6A 4G09A 3F6BX 1BS9A 1MDBA 3UAVA 3CUYA 3IIKA 2J4DA 4FVTA 4UATA 4K6CA 2OOSA 5FWAA 4B4KA 1E6UA 3BN3A 1BO6A 1JQAA 1G21E 4OTZA 2EX4A 1CQWA 3RM3A 4F9EA 2NQTA 2X19A 4C0QC 2A9VA 1JFRA 4PBRA 4G2NA 2WSIA 3FDIA 1A9OA 2X8JA 4ZOLF 3ABSB 3GRRA 4HQNA 1ODLA 3E9ZA 3OUUA 3E9CA 3DHNA 2FDXA 1N6OA 4KVFA 2VHZA 3QUQA 3WL4A 2EL9A 1UKBA 3NG1A 2PMCA 2DBZA 3BMOB 3GLHE 4EZBA 3FPBA 4JI7B 1VB3A 1BE8A 1QF9A 3F8TA 3LIIA 4DV5B 3JYNA 1E96A 1SOMA 4YBZA 2PJZA 4OHFA 3EOBI 3RVJA 1Q17A 3DL2A 4QE3A 5K5EA 5HEKA 3BCUA 4TV8A 3EVFA 2HLPA 2Z3ZA 4C5BA 3TECE 2V4UA 2PANA 4Z4CA 1TF5A 4O4JA 3E3MA 3QEKA 4YRNA 3K9QO 8ABPA 3HKEA 4TVKA 1IDOA 4R7ZA 2CT8A 1D1QA 1R5JA 5ESWA 5FTJA 3QPDA 1KKUA 4G0ZA 5AKHA 3VDXA 1JG4A 1XZEA 3BVPA 3SX0A 2EKLA 1FFBA 2P5SA 1CU1A 3PBKA 4NYMQ 4ZODA 5A02A 1C3LA 2Y27A 3SI7A 1QKJA 3I45A 3JWHA 4M46A 1ENYA 1D4OA 1KOJA 1Y1SA 4YXWA 5JS2A 3K0EA 4BX3A 1EFDN 1G2IA 1U8FO 4QJBA 4QX6A 2VUSA 1K4MA 4G8DA 3PGLA 5AXAA 4K0RA 3ZE0B 4B0PA 3QFRA 4CETA 4IIJA 3KTAB 2YWHA 2JJ1A 1JFLA 2GZHA 3MCZA 4DC0A 3BMNA 3TE7A 4DXAA 3VOSA 1QIKA 3WO0A 1L5MA 3IOEA 3D31A 3KKEA 2WEKA 1K8RA 3VO9A 4C0AC 3R5SA 2AN9A 2G7MC 5G41A 3CMCO 2CB0A 3O4GA 4ZOAA 5JEDA 3BJIC 4ZI3A 4CV3A 3P19A 4HAOA 3DLHA 2ZROA 3KSUA 3LX4A 5M34A 2GN8A 1F9AA 1SC4A 2VYCA 1FZQA 2I29A 3D6MA 4CMEC 2VTBB 4DDUA 2QN2A 2FQWA 4TS3A 1XWIA 5AJUA 3GFTA 1U1FA 4M0LA 2Q9CA 4FEGA 4ZT6A 2X5NA 5PGMA 5A4MS 4BYGA 1O6BA 4UKDA 5HDBB 4A0SA 2XOKD 2GPNA 4LSWA 1E2BA 3DO8A 1K7CA 3Q6NA 3FW1A 3R24A 1Z6QA 3C6BA 3FM9A 2IYPA 3DNFA 2VCEA 4H35A 4ZT2A 3I58A 1DEKA 1E5QA 1UBGA 1FJHA 1TRHA 4M9UA 5EY5B 1YRWA 4ZVNA 4ZJUA 3G6KA 4DDWA 3GT4A 1V1JA 4BQOA 3FGPA 2GXQA 2PIAA 3WJ2A 1V11A 1YB4A 4AC9A 2PKRA 2JLSA 4FFWA 1SUSA 5LJIA 2Z3WA 3DMFA 5AM3A 4J76A 2H1CA 4QM7A 2ONKA 3CB2A 4MEBA 1YIAA 2NN3C 3B8EA 4NJEA 2I2CA 4QPPA 3V8NA 1CULC 3A1DA 1CDEA 4RXUA 4EGSA 2BBTA 4ZOLA 4RH0A 5A3QA 1KYZA 4MR8B 3L4BA 1SBNE 1SU8A 2VEDA 4LXYA 3PIRA 1U8YA 2OV8A 3EBLA 1O5OA 2I4TA 1VCNA 1OHHA 2FX3A 1NM5C 1H2YA 3C16C 3IHKA 4X1OA 1TZCA 3SYMA 4L6CA 3QGMA 1DT3A 4QNMA 3DDWA 3EIFA 5DGTA 2A4KA 1V47A 3L7OA 4ZI7F 5DNYB 2RC5A 1RJEA 5KX5F 3JASA 4Y3UA 3CCBA 1JR3D 3P9NA 5AKJA 3VZPA 3OLXA 2GK7A 4BX0A 3WQBA 4C0WA 1AKYA 1FVOA 3THSA 2QRNA 4ZOCA 2OWDA 3PP8A 3FROA 1KYXA 2PK3A 3U3DA 3WXMA 1KETA 4Q9DA 3WAJA 5FBKA 1NVWQ 1J8YF 1JBEA 4RD1A 3H0CA 3OX2A 3RIXA 5I9NA 1Q15A 4NBRA 4PYOA 4D81A 1MT3A 3CUVA 1C3JA 3U9SA 2FEPA 4IDAA 2GD6A 3QKSB 2QN8A 1G8GA 5F2NA 3PFFA 1MPXA 2YQ5A 5CVEA 5CUQA 4PV7A 2C2HA 3LHIA 3N2LA 5K20A 1LWOA 4GMFA 1DDOA 5DU2A 7GPBA 3KVRA 3C3MA 2FKAA 4J75A 4AWBA 4DQXA 3E18A 1JXAA 2ZPUA 2OCLA 1KC1A 3IOCA 1LI5A 1QLWA 3CH4B 3LO5A 3NT5A 2QTZA 5DNEA 4B73A 4YRPA 2UUCB 1XNQB 1U0GA 2WYVA 3N8DA 4REQA 5LYJB 3NKVA 1ZUNA 2AQHA 1BCSB 2K2WA 1R4AA 1ZL2A 2RG7A 2RGCA 1GTL1 1PV1A 3DBRB 3GP5A 1IN7A 5FOVA 3V6LA 1PGOA 4RIHA 1DBWA 1DUSA 1MIOB 3IQEA 3SZGA 5CM8B 2OA0A 1DOHA 3UQYS 2ODTX 3NUQA 3O8BA 1FNMA 4OQZA 1SXPA 2O3TA 3EDRA 5K0FA 3AEXA 3O26A 1E98A 2QRMA 4N0PA 1ADCA 5ICFA 4KRGA 3INRA 4EI9A 3KLBA 5DGDA 4N8SA 3P2EA 2EEZA 3K8QA 5KQSA 3DAFA 3IHWA 2R751 3BE5A 1KMMA 3DZFA 4GLOA 4QGFA 2UZ1B 3HA2A 3I92A 2VP0A 3S1AA 5JS8A 1A77A 3UEOA 1V4VA 3O4RA 3QX9A 2N46A 1I4LD 2OK7A 3KOZA 1C9YA 1GRCA 4NCIA 4OJKA 4U63A 3GWGA 2FQYA 1EVKA 4FE3A 1ZNWA 3EZNA 4KWIA 2LWIA 3FYHA 3GVIA 4CQMB 2AC4A 1UM9B 3JARA 3WBFA 4B2PA 3GJQA 3WGMA 3OTIA 1D6SA 2GRAA 2KMLA 3F5QA 1Y3HA 2OC4A 3TPZA 3QYPA 4IVNA 3W7BA 5LQNA 4NPCA 1U0TA 3NORA 1G8YA 1LDBA 3DJFA 1FSZA 1RVV1 3G0BA 3HVUA 2YYYA 3VKWA 2R1TA 5KUTA 1CQZA 2RHJA 3T54A 4KSCA 2TMYA 3FF1A 4J16C 3B9BA 5TQVA 1U1CA 2RHMA 2FV8A 3NATA 4JEHA 3TVTA 3GBSA 4ZYLA 4CKEA 4H1WA 1JR6A 3V8EA 1KYIA 1DFGA 3C43A 4Z9BA 1J4AA 2BMVA 3N3BC 3Q3HA 2G1PA 4CIWA 1NJ8A 1GARA 3R09A 4QAJA 4JLVA 5DLQC 4ZI7A 1XP8A 2A59A 4I2VA 3G5LA 1VP3A 5KX5A 3T7TA 1J5XA 2JAPA 5GGXA 3VNAA 3EG5A 2YZ7A 5FPKA 2WTNA 3VMFA 3ZJ4A 2WFAA 1EJ0A 1US8A 2OTCA 3I9FA 3TLJA 5CITA 5KQPA 4GXNA 1U7DA 2NU8A 2R1UA 3PFIA 4HTFA 4IJ5A 3TD9A 4UOZA 3BT7A 1XD2B 5HQTA 2FPSA 2PMEA 5AOVA 1PEAA 1YXMA 3OFVA 5HW0A 2BCEA 4YNBA 4ILKA 3RVSA 1S0UA 2BJWA 2XNDA 1G8SA 1BZYA 1HRDA 3A4MA 3GDGA 2QGFA 2EJTA 3C0KA 3I1FA 4EF5A 5J4HA 2D6FA 2X5JO 4DM4A 1U3UA 3HZZA 4PGGA 4UTVA 3LW8A 1HDGO 3M49A 2FQ1A 1VJ0A 4LVNA 4XD2A 1TMOA 1VHWA 2GR9A 1PR0A 3CSDA 3H4IA 3IXLA 2FLVA 3WNBA 5KSWB 1Y81A 4GX1A 5J3JA 1J33A 2DH6A 3DFMA 1W34A 4HD8A 5TQ2A 1N1GA 3H4VA 3P97A 3VZSA 1T9BA 2PJDA 1TUEA 5HIIA 4AZ0B 1UC9A 4L95C 1MR3F 1U11A 3FLBA 3L0DA 2R60A 4EPXA 4ZQCB 1B4DA 2J41A 3I05A 1NNEA 1KDYA 3EXG1 4IH9A 1GG5A 1PT5A 1XXLA 3FNFA 1X9IA 1W5EA 1VB5A 1XVUA 3S2IA 2XGJA 3KYDB 2V45A 4LZPA 1NVVR 4N03A 4L07A 4BS9A 1NW7A 2PD6A 4B40A 3Q72A 1GA1A 3ND7A 3H11B 4IY1A 2C3YA 4OJTA 3EZGA 4DMMA 4JUIA 1H85A 2A5DA 2VXCA 3IIIA 1X8KA 5FJIA 1E2UA 2QY6A 3C1TA 1KR5A 5IW8A 3TCXB 4EW2A 3ESDA 4HWSA 4N7JA 3CCCA 5DN6A 3RDPA 4Y30A 2M1XA 1U0BB 1IBLB 5HDQA 4IICA 2FR8C 4EKEA 4ZGGA 2FAXA 3ER9A 4BQIA 1DRUA 2GZAA 3WK8A 1UWCA 1TLTA 3OCWA 3CH6A 3OQIA 4NE2A 3MLEA 4M2LA 1SHTX 5FTNA 3ND6A 2Z8XA 1YNOA 1ZNYA 3NCHA 1XN1A 2CL0X 4BLUA 2ZZNA 3WADA 2E85A 5J9FA 4YAUA 1PR6A 4IO1A 3RGWS 4UOQA 4P53A 5ESXA 5D3MB 4DJAA 2C4HA 1EUDB 2PEZA 2AN4A 4RSMA 1L8XA 1ZN9A 4GUAA 1F0KA 1MLDA 2ODBA 3RT9A 5L6MB 1DL5A 2RDMA 2OGUA 2FY8A 4AYXA 3IUEA 4DE5A 3KLPX 3FGOA 2XI4A 3K9NA 2XQVA 5CP8A 5L7WA 4HDCA 6AT1A 1IEVA 4JWTA 2BVNA 8OHMA 2VOJA 3EQZA 2CYCA 3GFBA 4E1BA 4G0VA 4ILEA 5KS2A 3NTOA 5GVRA 1PFYA 2HOQA 4XVCA 1AHNA 4QQRA 1XNRB 3C5WP 2Y0CA 3LSYA 3KZOA 1XDWA 1DIOB 3ASUA 4PSUA 1OX4B 3VI4B 3SHTA 5F2OA 2HDWA 4FOLA 4D6PA 1QMPA 4MGHA 4WEQA 2I67A 4X91A 4PSAA 5EINA 4M1YA 4KL8S 2GBIA 2FRXA 1YJAA 1LXCA 2Q9AA 3L4KA 3GGOA 2ZS7A 1QKIA 3HDHA 4FILA 4QUGA 1N6RA 4C5CA 4KPYA 1JKMA 3OTQA 4X95A 3FCEA 4GKJB 3BH7A 3Q3CA 3OOYA 2F3QA 4PGFA 3PSAA 3R6WA 3ZHBA 4CR6A 1XVTA 5ESRA 2H1OA 1BN7A 1E69A 1H1DA 1MORA 3D3WB 3G0IA 3TFOA 3CSUA 3FJYA 1PNQA 4P4TA 1NV8A 4HDKA 4EEZA 3HSYA 3W9BA 5EQDA 4KHZA 2Q0HA 3THXA 3SQXA 1N7IA 2GERA 1O87A 2P9CA 2WWFA 3I6QA 3Q7QA 5JS6A 3TR5A 1RZRA 3WNDA 2OZEA 5IS2A 1SQ5A 3GCWA 4JLUA 5I7VA 5LN1A 3MA0A 1I14A 3A9CA 3PFBA 4M3NA 3W8DA 1Q5PA 1Z9BA 4MJLA 5CFRA 1IQ0A 1OH6A 1II0A 3ZZ1A 1TRKA 2R7MA 5C3UA 4D3FA 1W4AA 1YS1X 2J9RA 4HFNA 3ZVLA 1YBVA 1AKUA 2VP3A 3VISA 4NTZA 1ZCZA 2D1SA 4TWBA 5AVSA 4OQDA 5TJ9A 1BOFA 1S2NA 1E1QA 4UM9B 5KTKA 1I36A 4E88A 3CR3C 3BEOA 1J5EB 4EO9A 1TX4B 1TQ2A 2PVPA 3CT4A 3DZJA 1NIJA 2VDMB 3GMSA 3H04A 4JL5A 3SJBA 2UZAA 5KYGA 1VC2A 4TMZA 2JASA 5REQB 1DAKA 2O7SA 2NLOA 3IL2A 3KQNA 1S2GA 2PTHA 3PVSA 3HB1A 1N34B 4G41A 1Y34E 2C92A 1OLSA 3ANYB 4RD0A 4RVCA 4KSYA 1XYGA 3UG7A 1YHZA 2C8JA 1P4GA 2GZ2A 1DAPA 5AVYA 3FNEA 1SD1A 4OMDA 1DZIA 4NDZA 3NV7A 2C7BA 2JJ8A 4EUFA 2F1KA 4JBLA 3JTMA 2P6RA 4MICA 1O4VA 4V0ME 4IR7A 3MVEA 1R5OA 1CY8A 1ISFA 1OVMA 1U0EA 1XQ1A 3OU7A 3OZUA 4S0XA 3SU8A 4ABTA 1MB2A 4XE5A 1KJ8A 1U9YA 3ISTA 4LYEA 1HDIA 3F4LA 4QTXA 2JFOA 3W2FA 4KQMA 1UKCA 2ZW9A 2B4TO 1QGUB 3NGLA 2P5UA 1RQLA 3OE5A 1J7JA 4B3GA 2JI4A 4GX5A 1UBMS 3F5FA 1P17A 3OFND 1T2DA 3IHLA 3X1MA 5BUCA 3B85A 4U9HS 5BMOA 1Y5LA 3ZU4A 3UJNA 4LJ7A 1NULA 3I4LA 1CVIA 1IBRA 4X90A 1NY6A 4DLYA 4CGYA 1Y1KE 5JH7B 4ARCA 3LDHA 2HRZA 4UQPA 1Z6XA 3LFUA 2MYUA 4H27A 2UDPA 3DAYA 2Q5JA 3I9OA 2IHKA 3WZMA 4JXJA 1P77A 1E8DA 1SG9A 1XKQA 2Q3EA 4RQAA 3FKSD 5AKXA 5I9MA 1OWLA 2HADA 1L1FA 1TM1E 3NUGA 2OYCA 1ECGA 3BCRA 4UASA 2XSZD 3TD2A 4D92A 2PO7A 3KT3A 1FUEA 3LU1A 3H9QA 3PNQA 3X2SA 4C7JA 3RVKA 4B3XA 1U7TA 3O4IA 2WR8A 3KHKA 4JJZA 2VDJA 3FBTA 5JI3E 4JI3B 1NVEA 3GELA 3E9MA 1F1JA 3WYEA 1C0PA 5K0EA 1KJ9A 3E61A 5C81A 2DFNA 3F9CA 4BZPA 3WP1B 7ADHA 3SZRA 4JQSA 2I2BA 1Z2AA 4R16A 1PFUA 2OCXA 4XFDA 5DNVA 3D8UA 4GOLD 4D4LA 3GCXA 5GIOE 2CFOA 2EFJA 2XGMA 2GEKA 1W19A 3AF2A 3WGVA 5BR4A 3DW1X 1JS1X 1T5LA 1V48A 4DRZA 5IN5A 1Z06A 2SCUA 2V1XA 1HO3A 3L6CA 1JZSA 1HDZA 3PCXA 1TD9A 3LVBA 3PRHA 3ANTA 3A1NA 1V1RB 3IKLA 1DHRA 5A9TA 1SQGA 2OG1A 3HEMA 3ZDXB 2Q9BA 2UYHA 4PCLA 1IUOA 5KHLB 2P9FA 3U6KA 4DPKA 3CRNA 1G19A 1PZHA 2ATXA 3EG9B 2IPMA 4YCMA 1GNRA 2CLHB 3P0FA 2FZGA 3DDHA 3W5BA 1QIDA 2HMTA 1CS0B 1N6NA 2ZT8A 3BFKA 4RF2A 4JI5B 3RVLA 1N5IA 3DHEA 3AKYA 4MPDA 2B61A 2BEUB 3H86A 5JQGB 1SPBS 4TT8A 1M1YE 2EW2A 1B41A 3GNTA 4F2DA 4CCYB 1AHIA 3FG9A 1DADA 1ZISA 2IZ1A 4QHYA 1B8PA 6NULA 2FFHA 3ZJVA 1EDEA 2VOEA 1NMYA 1NU8A 2ZUBA 2AIRA 2I4MA 2WAYA 1YIDA 4CNBA 3FXAA 2C20A 2VT7A 2E9SA 2LPMA 4P35A 5CNJA 5EA2A 1V2GA 4E2ZA 1O94A 5EIFA 4EQZA 2HK9A 1WF3A 1M2VA 2V03A 1OZHA 1UT5A 2CXHA 2RGDA 2I3BA 3BXXA 4B47A 5CVTA 2JLZA 2NYUA 3FDZA 1G5RA 2O7RA 4LMAA 5I4IA 3LY9A 2F1IA 2AE1A 1ONSA 4J91A 1V7ZA 4RZXA 4HQLA 4PC1A 1A9TA 4NMHA 2AEFA 4LK3A 5I7OA 2ZUFA 1SCUA 3CZ5A 4ZVMA 1T1GA 3KTOA 1QGAA 3P2JA 1C9MA 1FDIA 1ULTA 3F4BA 4FGSA 4I4TA 3RKSA 4C4SA 3K0AB 2OQIA 5C32A 1ISPA 1IOWA 4ZYWA 4MPTA 4ZYZA 2I3GA 4C04A 1LPNA 3HJGA 3NIWA 1XAIA 4RVOA 3VPGA 3L4SO 1LV8A 5DWVA 5A3SA 3WK7A 3OTHA 4HF7A 4PRKA 4GM4A 4UEKA 3MWFA 1J24A 3DWGA 4OHCA 2WQ7A 2CY0A 2G1JA 2JIBA 1IN4A 2PS0A 2Y0EA 3D3KA 2EG9A 1SCAA 2AXEA 1JVNA 2QGNA 4XIJA 1KEEB 2GZDA 5TV2A 2JH3A 1RFGE 4CMKA 1QK3A 2O0HA 2PZEA 3M4NA 4RD6A 4JR2A 2VWPA 3ROXA 2FMTA 2I6GA 1I0LA 5JDCA 1O97C 2JDID 3ORQA 2P2LA 1XNJA 3RYFB 4BNXA 4AY5A 2A88A 1EK1A 4P86A 1GFSA 3R0QA 1T4BA 2G9NA 4PCUA 4PTYA 2I2FA 1E5TA 1YU6A 2RGEA 4RJTA 3QJYA 2JLRA 5A9RA 2OV2A 4RVHA 4U2BA 4F7WA 4DBLC 3R9WA 1JNYA 2NPOA 1NX9A 2C5EA 1H2RS 5JY6A 1X39A 1XHFA 2WD7A 3V4RA 4EKDA 1F7VA 3BXGA 2ZJAA 3LPCA 5AW0A 1CB7A 2ZUEA 1V8PA 2C8LA 4FOSA 3U4HA 2AXNA 5ICMA 5E3HA 1P73A 1Z88A 2LDBA 3F1KA 3KYIB 1F2UB 2AQIA 2DETA 5T41A 2DUWA 3KEGA 5DYIA 5C4GB 5BW5A 4M0UA 1QR6A 5ALHA 4LQ4A 4J94A 1LLQA 1BWQA 4OMUA 1ECBA 2POQX 4CKYA 5BVHA 2HN9A 2HRCA 4PHCA 4WA8A 2JFQA 1WO8A 3DD1A 3DHVA 1KZ6A 3GFGA 3GMTA 1O5IA 2W2OA 4XUEA 2YZNA 1ZGBA 5KNBD 4G0UA 3DPSA 1R8SA 3U1VA 4X8HA 3D6UA 1UZNA 4ND8B 5FTMA 3PWTA 5JT1A 3WYBA 4ZQEA 4DR5B 1JDUA 1N78A 2ZIUB 3KJXA 3P9RA 5I3CA 4LMRA 2A7XA 2BISA 2G76A 3CLTC 1HT2E 2Q4EA 4UOEA 2GFIA 3HKDA 1IY2A 4HFMA 4TQAA 4DANA 2Q8QA 4R6WA 2HLDA 2XVXA 4BGDA 3HO1A 1YBAA 3IULA 2FI1A 4HDMB 2GCOB 1M0WA 1N3IA 1XV5A 3SK0A 1AA6A 2WJZB 1ISMA 1NYQA 2J0UA 4TQUS 1XCLA 1V6SA 1VCIA 2YASA 1Q19A 2GHQA 4EHJA 1NF9A 3TOVA 3MJEA 4Z2YA 1JZQA 3E22B 5TMEA 1USGA 2HSEA 1XO1A 2J5BA 2HJWA 2LR0A 4LGCA 2CDAA 3V1KA 1GL3A 4HGPA 3GLIB 1PTKA 4HB2A 1W0KD 1ZM2A 1J99A 4X3OA 2C2OA 4EENA 4MCAA 3BREA 3VPXA 5FPTA 5BSFA 3UW1A 4OSPA 2VWQA 1H9BA 3B52X 2GOYA 2WOJA 2OOKA 3H05A 4XQ9A 5D85A 3UAXA 3H97A 4DA8A 3FMVA 3T0GA 1G6HA 1QUEA 3K9GA 1QM5A 2VNAA 4E5YA 2OMEA 4M6WA 3KE8A 2HDOA 4ZAFA 2YNMA 1BVRA 3QJ5A 4CXMA 3I1JA 2JIPA 2IYFA 3PTLA 3H2BA 1GZ4A 2D0IA 2V9CA 3FUCA 5EJGA 4WK6A 3A9VA 1Q3KA 3K0CC 1XZPA 1HH4A 1I0ZA 2HA5A 2X1MA 3AUYA 5BNIA 3M70A 3DMGA 2JFPA 3FAKA 4H6VA 4ZI5A 2OHGA 3ZGYA 4E2WA 5THQA 1VG1A 5FOQA 2W6JD 4UE6A 4RZIA 4ZP1A 5L4SA 3K5PA 4FTWA 5FV4A 3ZW9A 3M9WA 1A76A 1GLGA 1GQSA 3AJRA 2UV8A 2NTNA 4Y0NA 1MAHA 2VKQA 3E9DA 1N5JA 3BA1A 1SVNA 3P0HA 4G8JA 2DBYA 5DX8A 3TOSA 4Q7QA 5BUZA 1IOLA 1KH1A 1MA3A 1S1CA 2A94A 2B2CA 2ERXA 2PSDA 4L08A 4N39A 4RY9A 2SKEA 5ALPA 1AQUA 3PI7A 1G5QA 3B2QA 4OG2A 2CXQA 4Q4HB 1N5KA 3SS9X 1XU9A 3E53A 3M6XA 1HT1E 2GEUA 3H1PA 2EJCA 4L5JA 3IERA 4TXMA 3NVMB 5DWDA 4UDOA 1QIHA 3Q41A 1BKSB 4Q3DA 4D3YA 5BRJA 3OZWA 1X80A 1FP1D 1GEEA 1II9A 2YXLA 4PIVA 1L5WA 3CRVA 3AVQA 3ZHUA 1WAMA 1N92A 3PJRA 4QU8A 2DPLA 4B79A 2XNCA 1N2GA 3KSBC 5SZJA 1TTTA 2VSYA 2ECQA 1ORDA 4R71A 2CJWA 1E6MA 1ZLYA 3E35A 5DM4A 2JGNA 3WTCA 4H18A 1Y6QA 1AS2A 1U04A 1K7EB 3AEQB 3K0FB 2N1MA 2WT9A 3QY0A 3ZG6A 1JEEA 2HMUA 2P9ZA 4OYLA 4E2FA 4OYRA 4B6JA 2OO7A 3FZGA 1T9GR 2DTEA 1C14A 4LXHA 1M1UA 1OLXB 2HX1A 3L0YA 3RUAA 2PSFA 4ARUA 2GGSA 1OXBB 4Q9JA 4EJFA 3GGPA 4X92A 3EOAI 4IZ6A 3C6XA 1GKYA 4F6LA 1O95C 1V9LA 4RSHA 1D8AA 4OI4A 1W2HA 1F6DA 4BWYA 2WHYA 1FSGA 1P7ZA 3EGOA 3GLGB 4LHVA 1Q7BA 3DHYA 3A3NA 3HNRA 3SLKA 4CUKA 4DA9A 4K9RA 3JZFA 3JWPA 2MINB 5KYWB 3PWZA 1ZM7A 3TIIA 4RW0A 1UDCA 4CLRA 1ZITA 3IUBA 4BZQA 4CMGA 3MUNA 1C7ZA 1MB0A 1O57A 4H77A 1ISRA 4DMFA 1CIPA 1UOOA 1WQ1R 4LCEA 5DEIA 2JAWA 1HOXA 4PSDA 5EJAA 4B4OA 1YQWA 2D8MA 1SXJE 5EE9A 3R6TA 3VYUB 5IBQA 1VSUA 2C9MA 1U8UA 4N5LA 3UAGA 1PHPA 1KDZA 3Q10A 1GKIA 1CQPA 4DF3A 3GRUA 4O2AA 1ODTC 2D7JA 4M1KA 3SJAA 1J22A 4D2IA 3GYBA 3L2OB 1RQ2A 3OCCA 4HATA 5K8IA 1J8DA 1GD1O 1M7BA 2QTCA 2I2DA 5HS4A 1P6QA 2XMCA 1MKYA 3LVFO 1MJFA 1WTAA 2F90A 5DLEA 4EB0A 1VRWA 1ZI9A 4OGGA 2AYZA 2WJ4A 3IBFA 4WDRA 3WA7A 4EQ6A 1R4NB 3CVOA 2UKDA 2FZEA 2VNHA 3TL6A 3AK4A 3B3JA 3P20A 3AR4A 2FW8A 3OZAA 3JVVA 4G89A 4GP6A 4JZKA 1S8OA 3DOJA 3M4JA 4I1OA 5CT5A 3E6AA 2JLCA 5FOWA 3ZK9A 4RPLA 2BWJA 3CE9A 1CRLA 3TNDA 1CBUA 3ESRA 5HQ3A 1TQ6A 3AKZA 2BR5A 4RZQA 5IAGA 3O92A 2NW6A 1PJBA 4MS3B 4YT2A 1OWMA 3I83A 3QPCA 2IRWA 3LUAA 2WDPA 5BMVB 1IMJA 3O3CA 2JGKA 3GFQA 3DBHB 4QRHA 3S2EA 1DJOA 1ILEA 4J0DA 3D6JA 5JYCA 2R6JA 1X9HA 1GITA 3STTA 4MQ5A 4NBUA 2RB4A 3BK2A 4P34A 2OHIA 1PJ2A 3U39A 1R8YA 3TF5A 5DVZA 2VRCD 4S1PA 3GB9A 4HMQA 2IBTA 5D6OA 2BGKA 3SYLA 4GXTA 4RSRA 2R44A 5T64A 1G8AA 4QPJC 1RNLA 2VYVA 1MCZA 2YOFA 3OCVA 3HB7A 5LYYA 4DA4A 1MDFA 2AMLA 1PD0A 3IQFA 2HB6A 3OAAD 4CN9A 4E2XA 3C7AA 4CMAA 1AXRA 1ZR4A 3ENKA 4Y2SA 5ADUS 4F93B 2QGZA 5JI2E 1K6IA 3HRHA 3OP4A 2CDNA 2OAEA 2V4ZA 5CLGA 1JDNA 2HO4A 2B25A 2V5VA 4GZ3A 3DYBA 3BHIA 4PEVA 1L7MA 2GM9A 4IW3B 3PUIA 4G3XA 4UBJA 4AM8A 3TSZA 4JEMA 2QQGA 4AFNA 1URPA 4ITUA 4ENWA 2MYNA 1CUFA 2Q5EA 1JU3A 2PBRA 3I1IA 3VHQA 1FNDA 4M1QA 4H1HA 2JLQA 3DUWA 5T4FA 2YX1A 3I2IA 3AHFA 3PGJA 1Q1NA 1RFLA 5HUQA 1H1TA 1JHYA 2HTEA 3IV6A 4OQQA 4ZYTA 3L4EA 5LZ8A 4DR7B 1XE3A 2W5UA 1WDWB 4ZIRB 2PGOA 3MD0A 4ME6A 2XHEA 1MHPA 3NP7A 4PLGA 1CR4A 3CT6A 1DPGA 2F64A 1N0WA 5CVUA 5JZOA 1ZR2A 1W8IA 4F1KA 5FAXA 1WETA 2FF7A 2H08A 5EGSA 3NHUA 1XEXA 4F86A 2Q5FA 1NQOA 1IJBA 2H9AA 3HCWA 4Y9TA 1U1DA 2ZANA 1YDEA 3LNTA 2X7HA 4QWMA 1DRJA 1K4KA 2GEJA 2KI5A 2HF8A 2TMGA 4MQEB 3L77A 1K2WA 4ARAA 3GPLA 1AG9A 3TZEA 2EWMA 4P82A 3SIRA 1XTSA 3M6FA 3P71T 2QUHA 3UJ8A 4ZKEA 4BL5A 1CUJA 1R8JA 4PSVA 2NAPA 3ZGXA 5A7HA 1YI1A 5CDUA 1P7VA 1XRQA 3W0LB 3I0ZA 2QTGA 1IEWA 3TRFA 3KUUA 4TMKA 4UNSA 3WI7A 5ADVA 2AV6A 3BH0A 5SZHB 1N2JA 5E7JA 1TFUA 3WVNA 4DCMA 2OUIA 2F1HA 1KJYA 1QVAA 1S3GA 3EE6A 4ER6A 1VBMA 1YZQA 1L8QA 1HTBA 1H23A 1OXXK 2GJ9A 4S0ZA 1JQKA 2WIFA 3CONA 3WLKX 1HNXB 5LZ7A 1WXHA 4ZOBA 4MA4A 3WB9A 2QM7A 4CM4B 2DBRA 2FZ5A 1XMIA 3CV3A 3EUAA 1K8ZB 3Q7EA 4RFSA 4G0MA 2FWIA 5L7TA 2FGKA 3IT0A 2CNKA 5T5QA 2B34A 5DCUA 2YY7A 4BV3A 3OPVA 3GRVA 2H2HA 1JHAA 5FORA 4FYJA 4K3VA 5EERA 4F46A 2AI3A 3WLQA 1HPLA 2W0MA 3F1LA 4JCCA 4NHOA 1X19A 4G84A 4Q05A 2IHBA 3O21A 3MNFA 1HOTA 1TC2A 5A4AA 1W46A 3HCOA 2W2PA 3O8OA 4JGGA 2ZRNA 2VHYA 3F71A 1N2CB 5KYVA 3IEIA 3ZBTA 1DC3A 4RTSA 5F23A 3DOEA 5P8WA 2DTXA 1TCAA 2GPBA 2R6CA 5LBIA 3WRXA 3VYVA 4LHZA 1VYUA 1TPYA 1KKLA 2WQZA 2Z2YA 3PA8A 3R5HA 1M2EA 3UMCA 4RBNA 2W8ZA 4KBYA 4TV9F 4B8YA 3DO5A 4YCSA 1M5RA 4DGSA 5I9TA 1WSWA 2H6EA 4HMPA 3PYLA 4W8GA 4QTZA 1CLUA 4I8IA 1R9JA 4BEJA 5DRYA 2WWRA 3GJRA 1J8VA 2REBA 4C9BA 3A7DA 4DR6B 5IP5A 3W6PA 1JP7A 2X1HA 5BN4A 1KPHA 4J2TA 1CUEA 5KTMA 1L1QA 2K5UA 5FNVF 1WG8A 4UE2A 5DT9A 4LPKA 2IODA 2P6OA 1PL8A 2X4DA 4FNOA 3LZDA 2PS1A 4ZKDA 1PSDA 2EGUA 3ECSA 1HEUA 1RCFA 3DDNA 5MFPA 1PDVA 3WKEA 5LMZA 2CL7X 1EI9A 2NZ8A 1H8EA 2R1VB 3MC1A 3NWPA 4NBVA 4TTJA 1MOZA 1N6LA 1BAPA 1VBNA 2JJQA 3FYUA 4MJ3A 4OSOA 5EZSA 2A67A 3LP8A 2D00A 1I3MA 1GCAA 4FKZA 4J6FA 1U02A 5DP2A 2J5KA 3O1HB 4QUEA 5JCOA 4JYMA 4OAPA 1FS6A 3CXRA 4KMOA 4RMGA 3SF0A 1PIWA 4N01A 1U2QA 3AFNA 1U99A 2IKSA 3JD4A 4J0JA 3HL4A 1VHTA 4JQCA 3B1KA 1V5EA 3MG9A 1WW8A 4KIJA 4MUYA 1OMOA 1CXZA 1Y8QA 4US1R 1RSZA 4WBNB 2QW1A 1DIRA 2IPLA 3OWXA 3WS7A 4C4YA 1Q95A 2G25A 3GX1A 2X9NA 4FDTA 1AV7A 3E48A 5AHKA 1DIGA 2IXTA 1RPJA 2BFBB 3V4VB 3P9IA 2QU7A 1Z2NX 3B70A 1E92A 3F47A 1G5FA 1R37A 1XFDA 5A6VA 1E5XA 4G67A 4BBPA 3Q5EA 3SSMA 1TK9A 2PFSA 3HYSA 2X3YA 1SVMA 3WYNA 4X44A 5GZ3A 1E79A 4UMVA 1SCIA 3PC3A 2GLXA 4XVUA 1KI3A 2CXNA 2P69A 1YDGA 1C3OA 3LHFA 5E3JA 2EAUA 1PEDA 1DDIA 4Y6PA 3UV6A 4MV0A 1WB6A 2AF4C 1NPDA 4FFNA 5ALZA 3UWKA 1EP9A 3GLRA 3BZUA 3L1UA 2FFAA 3H16A 3QBTA 3HHEA 4DDKA 4EEXA 4EWLA 3D4PA 1CUYA 1H2HA 4DV7B 3WGOA 4BRWA 3TM4A 4LZWA 2ZJFA 3AZPA 4J1TA 4E5VA 2E2WA 4CZ2A 1UWLA 2RHLA 3AJEA 1QE3A 3FTCA 5DCYA 3EASA 1E2GA 1IWOA 5LZ5A 4N8DA 3EVNA 1DC5A 3BERA 4K5QA 4OPMA 2WF5A 4OQXA 5AMXA 3FR7A 4EO4A 1JLKA 2LUOA 2WHPB 3B82A 4F12A 2ZG6A 2VJMB 4M0EA 1CB0A 3DM9B 5GM1A 4CKCB 3VVBA 4TV9A 1FRNA 5GTDA 4KUGA 2OSVA 3O31A 4NPHA 4EHHA 1H2FA 2CUNA 4PX3A 3YASA 4B46A 4B6FA 2X0JA 1C2YA 1U1GA 1Z4QA 3ZK8A 3MBIA 2OFOA 2YBDA 2RK6A 5KTPA 1S9DA 3X2FA 1I7QB 4EG8A 3PKIA 3K32A 3PD1A 4QXMA 4GUDA 1N5OX 2RJOA 3GJ8A 3RFUA 5FNVA 4KHPB 1SUWA 3KAJA 4B8ZA 3KOXA 3KP1A 4AF8A 3LCJA 4D8VA 5K09A 1UKEA 1SFRA 4LRTB 2M9MA 2CVOA 2ZRBA 3M9XA 4NENA 5FLYA 2FG5A 3N7TA 1WWKA 3BGSA 2HCBA 1XRJA 2C7VA 4LBWA 4CEHA 1M10A 2WE7A 5KSOA 2VHEA 2K4MA 3T0FA 2WSLA 3B60A 3M5DA 4HEA1 4ZQFA 4B2LA 1QSGA 3ELWA 3UOGA 4MDEA 3HFJA 4L50A 4GICA 2WIGA 2VAMA 2JEZA 4O1MA 4TUYA 2NXCA 3DQPA 2DYKA 1F0NA 1SBYA 1PBTA 3M6MD 3T7CA 3Q6MA 1RM5A 4FKMA 1K3TA 1V8DA 2ECPA 3K1AB 3TX6A 4P7GA 2GDJA 3N86A 4HN4B 2YQZA 1GOTA 5F7OA 2ZYUX 1F51E 1Y4AE 2XCTB 3IILA 3JYLA 3U3XA 3QBDA 4TMFA 1XEWY 1KZ4A 4HOYA 1EXDA 3HXKA 1RLIA 3A3PA 1E62A 1UP6A 2JGAA 4J3JA 2FEXA 3LBFA 2R68A 2A1UA 5EKXA 5CLFA 4KITB 3BWYA 2LIPA 3L7CA 4LRQA 4K9DA 2ZWOA 1ZC3A 2PKEA 2C9ZA 2NTVA 1N8SA 2ZRGA 2P4UA 2LGJA 4MKGA 2ODPA 2ID4A 3LC1O 2EKBA 5F77A 3E5MA 4MAAA 4YJ3A 4Z51A 3GDFA 5K8VA 4EDHA 2ZIWB 1K63A 3T3GA 3RC2A 3DH0A 4DBVO 3BF7A 5K3FA 2ZE7A 1Z63A 4N41A 4LBYA 3IQXA 4G9EA 3UMFA 4JS0A 1PKEA 3QQPA 2GJ4A 4X8LA 4H59A 4NDNE 2XDQB 2A1TS 2ZB8A 2I22A 1FNBA 4XEUA 3OZBA 3GJ4A 6REQB 1SHZA 1Z36A 3IKJA 3M1LA 2V0NA 2JBWA 2R4QA 2KPOA 2PCLA 5CM2Z 4EUSA 2P0YA 4DW8A 3EZFA 4M7OA 4PZPA 4D0GA 4EKYA 1C1YA 4MEAA 3WK4A 4HH3C 4A4DA 1N0VC 2ATCA 4UXHA 1ADFA 1FQJA 1EXWA 3TAXA 3TSAA 1GTVA 4PNZA 4OHXA 3AERA 4TTRA 1JEJA 1QRTA 5DBIA 2H17A 2QE7A 3H7AA 3HCFA 1JEDA 4QEKA 1DQZA 2CF6A 4L5CA 1QX4A 3KQWA 4FJ2A 2B8JA 3QITA 5EE5B 2CSXA 3B6KA 1SHLA 1T0IA 1WSDA 1KE1A 3AEUA 4YV7A 3KIPA 2FRDC 3N8NA 2DX7A 3ZHXA 3G2LA 2NXJA 4MRSA 2WQ6A 1IAQA 2QZZA 5BV7A 1XZMA 3SY8A 1YRBA 2ZUDA 3LHSA 5EUQB 3Q12A 4JOBA 1KJIA 2IS1A 3DEIA 1XLUA 2H1HA 1AOXA 1OIWA 3EZ7A 3L7LA 4KAJA 2YZMA 5ELXA 5ALXA 4KR7A 1BKDR 4E6PA 3M9LA 3OJWA 2PGXA 4X6LA 2O2DA 3O7WA 2Q6TA 3B1VA 4KO8A 1RWQA 5FF9A 4XWWA 1QBKC 4PM4A 1YRLA 4M9SA 2ZTHA 3SKYA 3TZQA 4BFCA 4EJSA 3HBLA 4HUQA 1DJNA 4UD6A 1JYEA 5E9AA 3W6NA 5CFPA 3F3KA 1KDVA 3WB1A 2XA9A 1XZHA 4H6PA 2I65A 4LKRA 4DHEA 4FW8A 1I01A 4NJOA 2JGLA 3IAHA 2YS6A 3BL5A 3URMA 3MLAA 4NARA 3DXZA 4F71A 5FJJA 1V1MA 1QIIA 2R6GA 4MCHA 3LY7A 4AIIA 2APJA 2PBFA 1I4OA 3A6KA 3WDKA 2PRIA 2BYTA 2C98A 4O63O 4ZO7A 2QF7A 1YFKA 4DLVA 3CH7A 3UXMA 4L8WB 4WA7A 2O8EB 2VNKA 4W8OA 4DR4B 3GRCA 2NNWB 2FSVC 1I32A 3R0XA 3H5LA 1ZGJA 4PHHA 4QBTA 1UDBA 1V3TA 1YOVB 1UPFA 3N2KA 1Y7PA 4HK4A 2JFUA 1FB5A 4U6SA 3ZZTA 4YPOA 1Y42X 2A33A 1NBEA 1MH1A 2ZT7A 2ZB4A 3EFBA 4HEA6 1H69A 1WHTB 1X70A 4M1EA 3VSEA 5JMTA 2Q0XA 1NNLA 1UR5A 4R4JA 5ICEA 4YFVA 2CXPA 1FTNA 1BJRE 4EATA 1M76A 4GQAA 3VPSA 2E5WA 3VAAA 4F2PA 4B3MB 1ATIA 2QZPA 4M54A 3JAKB 3GOHA 4V03A 3UJ7A 3X1YA 4CLOA 2B2NA 3ZE9A 2RHRA 3CF4A 1XK6A 1LLUA 1Q2XA 4G2TA 2H5EA 3BYZA 1UWKA 1X42A 3KWJA 4AK9A 5KB3A 1XZFA 2EIXA 2VWHA 4NECA 1NV9A 4AG3A 1DKQA 1EPUA 3AIOA 1YVDA 3URKA 1BW9A 5BPHA 4WACA 4ZVVA 4B3CA 2JBAB 4M1TA 2OFPA 4KLCA 1KSFX 1WJGA 4AWXA 5L9AA 1G3RA 1ZESA 1JW9B 1MC4A 4UUBA 4TWAA 4FFBA 5LWQA 2Z83A 4GM1A 5HF9A 4YMTA 2FZ4A 5BQOA 1YMUA 4OUDB 2IVZA 4BRSA 2JFVA 1UP4A 4AY3A 3BAZA 4BVFA 3NAQA 2W9XA 3SBDA 5C0OE 4JP5A 4MWBA 5IARA 4V1CB 2PX2A 3NWEA 4LY3A 2Q3JA 4OMFG 3U3OA 2ID9A 1T5TA 3NM6B 1ECPA 4X24A 4DLXA 4OQEA 4Z9AA 4DT1B 1KXJA 4LDAA 5JIBA 2E0IA 3MRSA 2EKDA 4CMIA 4ESHA 1YE5A 1EU1A 4XW2A 1ILWA 4MWDA 2I4OA 2WWTA 3VYTB 3GGSA 1UMCB 1GP2A 3PCTA 2FUCA 1XCGB 2F3TA 3WLLA 4DIDA 5B3LA 4RD4A 1EBFA 4B6EA 2YN2A 4IWNA 4NAUA 3AILA 2CFRA 4NMLA 5F4BA 2EHJA 4MKRA 2QQEA 4NIMA 5BQXA 4TQGA 1WUYA 4ZYYA 1H2EA 4KH1A 3KHTA 3LYUA 2J30A 1GGMA 4KI7A 3SZLA 2Z6AA 1G6KA 2FUG6 2VQSA 1ORRA 3EAGA 5ECWA 3W8EA 2O23A 1VIDA 5FBZA 5I8ZA 4BB6A 4HNVA 5TGDA 1YB7A 5A1JA 4KFCA 2XGSA 1CYEA 3GXOA 4G1BA 1HQYE 5D3ZA 1AIPA 4B8WA 1DBSA 1V7PC 3LOPA 4Z8XA 3EVEA 4W5TA 4I3GA 5C4IA 4CI9A 1Y1QA 2ABWA 1UAYA 3ESQA 4WKGA 1IXZA 4MV3A 1GZ6A 4RZ3A 1TVCA 3V7UA 2F43B 3QXXA 4BDSA 2H0AA 3C8MA 2YWGA 4NL4H 3A1CA 3TKAA 5LQRA 1JA9A 3I2YX 2RH8A 2V7VA 3AI2A 5JADA 5KC8A 2I7XA 3HJNA 2XZDA 5DF1A 4XCXA 4ICIA 4FMPA 1N3LA 3KJFA 5K3SA 4E0BA 1D2AA 2AW3A 3DKIA 4KFRA 2NUTA 2QTMA 5JJBA 5IKEA 3KC2A 1A27A 1KMCA 3B1WA 3G0GA 3FUUA 4NCXA 3SC6A 4YS6A 5E0OA 3G2NA 3OD5A 3IV7A 3RHSA 5JS7A 1Z7BA 2Z58A 3HS3A 5ALTA 2FOLA 3BQNB 3K92A 2FOXA 4UM5A 3ROFA 2FWAA 2ZXUA 3D2CA 3A1FA 3CRW1 2VF8A 4AX8A 4CLDA 2ZWPA 1H8HA 1FRQA 3VR2D 3CLRD 4G25A 1Q1ZA 1AKEA 5EWJA 1P6UA 1I2ZA 5AR1A 2P9JA 2B21A 2XBLA 2EARA 2HPHA 2CHVA 2XYRA 3V33A 3VYSB 3S8YA 4OATA 2IYNA 4R5MA 2WZQA 1R3UA 2YYZA 3T4PA 1Y6FA 1O6GA 3NHMA 1IOZA 2R7KA 5CW1A 4WCVA 2O0MA 1Z12A 2VDWB 1PLKA 5G2OA 2I34A 1P80A 4ZMBA 2GD1O 5LA6B 1F8FA 1JF8A 1RKXA 1BXGA 4AG5A 1KTIA 3IBSA 4U0KA 3I2KA 2IFTA 4MA5A 4KYVA 2JCYA 4NCKA 1ESDA 1ESMA 2BJVA 3NHZA 5CH8A 4BQSA 4EFLA 2F4VB 4I6EA 4WADA 1DX6A 5HZKA 1E3WA 1OA1A 2CLOB 2Q1WA 3PFKA 3R4VA 4NU0A 2Z9BA 1NT4A 1H93A 2I1QA 1FFSA 1PQWA 3SDZA 4MV5A 4EG4A 3T15A 1Z18A 2ROQA 1VL2A 4WK4B 1PDOA 4HYQA 3G79A 3KTFA 1WV0A 4BLTA 4FONA 1KJNA 3S55A 1OH8A 3K1JA 2DFLA 2W8BB 3LUKA 4WNAA 3JYQA 1QH9A 4NU5A 3H1GA 4INOA 2IV2X 4D44A 3W7AA 4KYIB 5FB3A 2FP4A 2OV3A 2QT9A 3C3WA 2OHXA 2VAVA 2NO4A 1SXJC 4UU7A 1DQPA 1HDXA 3PEYA 3IP8A 3OIDA 3K09A 4P98A 4WFJA 2Q6LA 2FB9A 2QL5A 3H3FA 1P4SA 1V3UA 3RKRA 3VUEA 4DUPA 1QDUA 2ID8A 3QMWA 4YP1A 3KXPA 1JSLA 2Q0SA 2V5AA 2OPHA 3GLQA 4UC0A 1TW3A 3PTZA 4CQLB 4UVIA 4YCLA 5JCZA 1RW4A 3TI7A 3M5PA 1NP3A 2R9VA 4LRYA 2O8VA 4ZT7A 1VHQA 2B8NA 2FQXA 3R7FA 3WTBA 5CJJA 2F67A 4QUDA 4UEQA 3CRZA 3ZX5A 5DHQA 4WPGA 2V9ZA 1E3EA 5TVKA 5CBPB 2V6GA 3DV9A 4M9CA 4C4PA 3LYHA 1CSEE 1XB2A 3MS4A 5T8KA 3W5SA 2R6HA 5B2EA 1VYVA 5LLDA 5GM2A 5CGZA 3DE1X 3HYNA 5DDIP 4BOYA 1S1MA 1NU6A 2VH1A 1HEIA 2VQ3A 2V3WA 4O8ZA 1XJWA 1YVRA 4B2IA 5F98A 1L5FA 2ZE5A 4YUWA 4G65A 1XVAA 5JYBA 3PLAE 1NNUA 2CDCA 3BGOS 1A9PA 4O4LB 1AF7A 1HBJA 1OI3A 2HH9A 3CG0A 5FPSA 5H3HA 4C87A 2O1WA 2UVQA 2E49A 2OBBA 3KPYA 721PA 3RJ5A 3HFGA 1FW6A 4PZEA 1SWWA 4OQNA 2WV9A 3GYGA 5SV2A 4DB4A 4XX1A 3ZJYA 1U9JA 5JSZB 2JJYA 5IJZA 1OREA 2BHTA 1L4FA 4IS3A 2CEKA 3CUEF 3MWDB 2WM8A 1YR6A 3PRKE 4LIPD 4DIOA 4JH0A 3GIDA 3Q7SA 4PICA 2D62A 2ZI3A 2IOYA 2PZMA 2XUJA 4MQMA 4K1LA 5C1IA 3QFCA 3K6SA 4XOIA 4ZYVA 2ZR9A 4JL8A 1P81A 4IEEA 5AJXA 3AEKA 4NMXB 3F6YA 2GEBA 1OBCA 3C4QA 3PCRB 1E3QA 5FL7D 3THRA 2WG1A 2JAHA 2YV1A 4WWHA 5HRAA 2Q1SA 3FMFA 3R8CA 3JALB 1PJQA 1C3EA 1E5LA 4HAZA 3QXJA 3OMLA 2XMBA 1E6LA 1Z4MA 3ABIA 1U5BA 5JFTA 3MINA 3OPNA 3RSFA 3PPXA 3CVUA 5J63A 3C6YA 2GCNA 3SHVA 2GBPA 1L7NA 3R23A 5IK2A 2BH9A 3PNKA 3T95A 2QUJA 3LQRA 2LBPA 3H9BA 2DTDA 2C0CA 4KN6A 1IXSB 3Q2IA 2C57A 3Q5GA 4LDJA 4PVCA 4RS3A 3VHXB 1IJFA 4ZPXA 4B09A 2AH5A 4LVCA 4Q9IA 2NG1A 3B5EA 1KF0A 1U7OA 2MSNA 1ZM4A 2VN8A 3IOBA 2GX6A 2WI8A 3EBPA 4JA2A 1T0PA 3JTEA 1G38A 4JXZA 1NBOA 3GMIA 1II8B 2PO5A 3G8AA 5KU1A 3EGWA 5EMNA 1GT6A 2QVGA 3LUJA 1GUYA 3AR9A 3AKEA 5HJ5A 3HKBA 3AP1A 1ZD2P 2PLAA 1TMGE 2QRLA 4DLSA 3CH5A 1GAWA 1QOQB 3RAPR 1BEEA 1IK6A 1L4BA 1N9KA 3TZCA 2WTUA 3K2IA 3OQBA 3LW7A 2O6LA 2WYIA 4KDRA 1P18A 4BNTA 4RETA 2G0NA 4ZREA 3V1NA 3ZEIA 2R6ZA 3IUSA 1JQEA 1DV2A 3NU1A 4IGAA 4AMUA 1M2GA 2ZKLA 4L0MA 2EVWX 4MJXA 4ZGWA 3S70A 4WZAA 3WNQA 2I99A 5C80A 4M60A 4L16A 8ATCA 3BILA 1J20A 1UKYA 2BI7A 4OHYA 4FGZA 4ZARA 4OGFA 3TQIA 2BHSA 1KXZA 4XD7D 4ADSG 4W5QA 3ZS9A 2A4MA 2GILA 2YINC 4TN1A 5B1SA 5LB2A 3JQQA 3NR2A 1RM3A 4S3MA 3RVQA 3I6YA 4NVRA 1YUNA 2I4NA 2VT6A 4GLBA 2PKQO 3TI9A 1BIFA 4Y2YA 4M0MA 4YJ2B 1CD5A 1V26A 1FTQA 1P9OA 2IXFA 4Q82A 3JQAD 4AO6A 3MWEB 4QSMA 1UZLA 2CHUA 2P11A 1XSEA 1VP9A 3ZCSA 2NSYA 5E9WA 4R9RA 3OUTA 1XTVA 1Q0SA 2DKNA 2NADA 4RLFA 4AD8A 5HX7A 3NFRA 3H8VA 5B58T 2YHUA 3ZS8A 4ENPA 1XAGA 2E89A 3PG5A 4LWZA 4IV8A 4EP1A 2GYVA 3AI7A 3GNSA 1E1YA 1T2EA 4I1UA 2ZCUA 4X3PA 5CM9C 4Q39A 5JFGA 1XN4A 2J32A 3D5EA 4PRZA 2QAGA 2PGDA 4Q5IA 1X8XA 4L74A 3AEYA 5K0LA 3AETB 1QHHA 1T4DA 3ZEAA 1VA5A 1I3LA