3RVJA

Structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89q
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
130
structure length
130
Chain Sequence
HMADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAQAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvjA00
5IEBA 4JB2A 5GQSA 2HJ9A 4LE0A 4MS1B 1D1QA 4F12A 1D5WA 2QVCA 3OM1A 3O75A 1LJUA 4KPYA 1JYEA 3GV0A 2RJOA 1KRXA 5KQGA 2NT3A 3HDGA 2IPAB 4RXMA 2E4VA 1ZDMA 1QKKA 2E4YA 3HVRA 5IUJC 1CYEA 1Z26A 3L49A 4MPTA 2PUCA 3K4HA 4EYOA 3QLTA 1GCGA 4DN6A 3CNBA 1J56A 1BDJA 1VRVA 3H1EA 2NUBA 3H5TA 5CNJA 1K68A 3O1IC 4LZLA 4YR7A 4NCBA 1ISRA 3HK2A 3A0RB 3MM4A 4RKRA 1D4ZA 4XLTA 2IPLA 2E4XA 5FBHA 4RK5A 5FWYB 4OTZA 1TVMA 3HXMA 1JBEA 2MSWA 1DC7A 3OLVA 1TMYA 3CZ5A 4Z0NA 4YV7A 5HQJA 3T8YA 5EWLB 1YMUA 4RY9A 3QEKA 5BQ3A 4FB4A 5JNTA 4CBVA 5JNWA 4G0OA 1PNTA 1SRRA 2AYXA 3C3WA 2IPMA 3I5AA 4KZKA 1JFTA 1GCAA 3LFTA 3MF4A 3Q41A 5B3JA 3SAJA 5HSGA 3KG2A 4IGAA 4MQFA 4S04A 2GBPA 1DRKA 4JASB 3R0JA 4RY8A 4IMJB 3CFYA 3EDCA 5KWSA 3NHZA 4MS4B 4HNQA 5TPZD 2LBPA 2FN8A 1LJLA 1URPA 3LUCA 3Q7SA 2WJAA 3I09A 3JS5A 2MYNA 3ROTA 4E7OA 5DKFA 1MB3A 3MQ4A 4YCSA 4Z4EA 2AYZA 3N6VA 3RVJA 3TMYA 2PUEA 3EODA 1Z13A 1JLKA 5TQ2A 4ZMRA 3LUFA 4TLLB 1JDPA 2PUAA 3B2NA 1ZY2A 4NICA 4RKQA 1EAYA 1MVOA 3GRCA 3KLOA 4KRFA 3LKVA 5TQJA 4MLDA 2OENG 1ZGZA 1ZH4A 1EHCA 2NZVG 3QLUC 4LRQA 5IUKC 3QEMB 2N9UA 3QX8A 1KRWA 2FW0A 3H6HA 1L5ZA 1KMIY 4Z9AA 3S99A 4L4UA 1NXTA 2RDMA 1BA2A 4RK6A 5DGCA 3DLBA 4MS3B 2WRZA 4MYRA 4G97A 2FEKA 3BRQA 3HUUA 2GX6A 3GT7A 2A9QA 3H5IA 1JFVA 5TQ0A 4Z4HA 2HQBA 2PL1A 3SM9A 2J48A 1D2AA 4EVRA 4ZJPA 2I6FA 5D2CA 2NZUG 2R25B 3TX6A 2JVJA 3ROFA 1DZ3A 1PEAA 4D6YA 4ZMSA 3OM0A 1L5YA 3OO0A 4G0QA 3JVIA 2E4WA 3SY8A 2HQRA 4YRZA 3O21A 1LBHA 3RVKA 4TMYA 5DCLA 5JNVA 1JFSA 5CNIA 1YS6A 1TM2A 3HSYA 3KJXA 5IUNC 2ZAYA 1QQBA 4Z4IA 5FWXA 4JB0A 1ZESA 1OXKB 2GI4A 2LPMA 1ZAYA 4PE5B 4LDZA 4RZSA 4XAQA 4KFCA 2JCGA 2P4UA 4F3TA 4TLMB 4DADA 5IULC 1QMPA 4IRXA 1P6QA 2MYPA 3OMXA 1ISSA 3D8UA 1Z2DA 3QX9A 1RZRD 1P8AA 5HKOA 3KYIB 1FFWA 1JX6A 4YLEA 1T34A 1C4WA 3CRNA 5EWJB 3C6QA 5ED4A 2LP4Y 4OG2A 5KQPA 1CEYA 4MGEA 5TE9A 3IP6A 2PUBA 3OQOA 4Z4CA 4N76A 1ZH2A 2XDYA 1ZVVA 1DBPA 5FBKA 3SG0A 4E7PA 1QP0A 3GBPA 5E3JA 3LUAA 4GPAA 1JWLA 1ZGGA 4MR8B 4EYGA 1AB6A 2ZWMA 5JNUA 4O1HA 2MSLA 2FMIA 2FN9A 3LKBA 1W9HA 4KK4A 1U04A 2JB9A 2NT4A 3A0UA 5TPZA 3CKMA 1JH9A 3ILHA 1A2OA 3IP7A 7ABPA 4OBBA 4W5OA 1EFAA 4YS6A 1DG9A 3LMKA 3EJWA 3LUDA 3GL9A 1DRJA 1Z25A 5GOTA 1P2FA 3FFTA 1Y1LA 1A04A 4IMIB 3G85A 4YO7A 3M9WA 3CZCA 1EWTA 2HSGA 2JBAB 4G0MA 1E6MA 1DCKA 3K9CA 5EWMA 2R48A 1DJMA 3D02A 2P9HA 4MR9B 3EQZA 5TPWB 1M5TA 2ID7A 2JVIA 4EVQA 2L17A 4Q6BA 1NXXA 3GYBA 1DC8A 1ZHHA 4G86A 3KCNA 3FFXA 1GUDA 3RVOA 2FMKA 1YK0A 3DZDA 4QICA 4ETMA 5B3JC 3OQNA 3A10A 2PKXA 4B09A 6ABPA 2VYCA 4RWEA 2L18A 4G0ZA 2VK2A 3Q7TA 3RH0A 2WY2D 3UKJA 5IX8A 4P1ZA 3C3KA 3QLVC 4EVSA 4WUTA 5KC9A 1GLGA 2CD7A 3NNSA 5T3YA 4OLAA 1YMVA 4Y9TA 1FFGA 1VKRA 2W42A 4JAVC 4MR7A 1XHFA 3GA5A 3LUKA 3RVSA 2RGYA 3BRSA 2VUIB 3E3MA 1YTUA 2JRLA 4RDCA 1UDRA 1QO0A 3DGEC 3I45A 4N0PA 1BAPA 3N8IA 4M88A 3SQNA 4MQEA 4OATA 3HO1A 4UHKA 1WETA 2CHEA 2QVGA 1TJYA 3HZHA 1H9CA 3OLWA 3H1FA 2FLKA 4FE7A 1RZRA 3QELA 3N0XA 3O2SB 1JYFA 4KNYA 2FTKE 1E6LA 3ILYA 3BREA 4MAAA 1YS7A 4KK3A 2FEPA 2PUGA 3HV2A 3OMWA 1W25A 1Z16A 1BDHA 3NNNA 2V0NA 2FQXA 1M5UA 2QZJA 3N0RA 3TO5A 1DP4A 4MS1A 2QU7A 4O5AA 1NY5A 4RXTA 2R4QA 3CLKA 3IP9A 4TN5A 4NCAA 3LTEA 2H0AA 3T38A 5KQMA 2VUHB 3O1JC 3H75A 5CNKA 4EUKA 2PL9A 1FQWA 2FXIA 2IYNA 1QQAA 4H3HB 3TB6A 1VPWA 4KREA 3FDFA 3H6GA 2R47A 1IIBA 2HQOA 4IILA 3RVPA 1QO0D 2FQYA 2CHFA 3EULA 3NNDA 4RK7A 3CTPA 2WMYA 2QSJA 2RJNA 4Q7EA 3P9YA 4HYEA 2A9PA 1JL3A 1DCFA 1LK0A 1R8JA 4MQFB 4PYRA 4DQDA 5KQLA 1Z2EA 4UHJA 4Z4FA 1DBWA 1OXBB 4H3KB 2QR3A 1RNLA 3H5VA 1YVUA 4WZZA 4ETNA 1QNLA 8ABPA 1C0EA 2H3HA 3KHTA 4JOQA 4LDAA 3DLHA 5FWYA 1RXEA 1NTRA 2MYTA 3A3KA 1SD5A 2O20A 3EQ2A 3L6UA 3G1WA 5EWLA 4N03A 3O2JA 5TQ2B 2QV0A 3W9SA 3RVQA 3NHMA 1Z18A 3LUGA 1U2PA 3T6KA 2YHAA 2MYUA 1JHZA 5DTEA 1NXVA 1PEYA 1EWKA 4HNSA 1D1PA 1VLZA 3CS3A 4PZ0A 4WT7A 3CHYA 5CHYA 1AB5A 1U2QA 3IPCA 4LE1A 5C5EA 4N41A 3CU5A 2WWVD 4MS4A 3M6MD 1QPZA 3N75A 1SXHA 1USKA 1USIA 3Q15C 3RQIA 3RVNA 5IEJA 1SXIA 2E4UA 3OLYA 2FLWA 1Z15A 1RPJA 2L19A 2ID9A 1B00A 5JNSA 2FMFA 1SXGA 2JK1A 2M1ZA 2WB4A 3H5WA 4HNRA 1MAVA 2FVYA 2OQRA 5TQ0B 4G0YA 4QPJC 1TLFA 3KTOA 2GKGA 2IDMA 1YK1A 3KKEA 2PUFA 1APBA 3VNAA 3HEBA 5KI6A 3KYJB 3QEMA 3JTEA 3MMNA 2YHBA 4L85A 2IOYA 1NXOA 1DCMA 1M2EA 4RXUA 2F8SA 1E2BA 2A9RA 5DLEA 3BILA 3T95A 2FMHA 2FEWB 4MLCA 3KLNA 2MSKA 3IPAA 1DBQA 4RK4A 2TMYA 4F8JA 5FWXB 1U0SY 3C3MA 4MS3A 3E61A 3F73A 1BVHA 4W5NA 3H5OA 5IBQA 1MIHA 1MB0A 2PUDA 5T7BA 4ZYLA 4W5RA 3HM9A 3JY6A 4FE4A 4PEVA 4XFKA 2LIVA 2CWDA 1PHRA 2FKAA 3JPYA 4MRMB 1PNRA 4G0XA 1USGA 1ZN2A 3LUHA 3O74A 2IPNA 4Z99A 5JS1A 1HEYA 4XXHA 1Z17A 3RVRA 1RXIA 2BGGA 4YP9A 2WJWA 1U8TA 5F64A 3GBVA 5BR1A 3IP5A 4PICA 1FFSA 2A9OA 3MA0A 2B1JA 2PJUA 4ML3A 4KVFA 4Z4GA 2FSPA 4N0QA 4Q6WA 1F4VA 1Z12A 3CG4A 2QXYA 3JVDA 4S05A 2PMCA 3RVLA 1CHNA 4XARA 3HS3A 4P98A 4WXMA 1F51E 1NATA 2Q5CA 4G0PA 2QW1A 3F6PA 5C5CA 3HDVA 5JS2A 2L2QA 1ABFA 1XWWA 5EWJA 3QLVA 3LOPA 3VNBA 2HPHA 4LX8A 9ABPA 3HJFA 1NXWA 4ZPJA 3NBMA 5JNRA 2FQWA 5I4CA 3OO1A 4EY3A 4LE2A 3HCWA 3DGFC 2LUOA 3FMVA 3LUJA 5BRAA 3M9XA 4D74A 3EGCA 1S8NA 4JA2A 5EWMB 4MR8A 4H60A 1P6UA 4RK1A 4YGXB 5HM6A 3BBLA 3QK7A 3Q9SA 4D6XA 4RU1A 4KQCA 3QLUA 1FSPA 4QYWA 4Z9BA 1YIOA 2F8TA 2B4AA 3DBIA 3FFWA 3HUTA 3FGZA 3OLZA 1E6KA 1QP7A 1EWVA 4KV7A 1BDIA 3O1HB 3RVMA 1ABEA 4JP1A 4NV3A 5IC5A 3OQMA 2GWRA 5ABPA 4RV5A 1K66A 3F6CA 1JDNA 2JBAA 4F11A 2KYRA 4W5TA 5CNMA 4RK0A 2X7XA 3N53A 4N47A 4MR9A 4NQRA 4F06A 4EYKA 1JF8A 4WXEA 3KS9A 4RY0A 5TPWA 1I3CA 1NXPA 1M2FA 4MR7B 3URMA 1A0OA 1PUXA 2PLNA 3CG0A 3UK0A 4ETIA 3C97A 4RSMA 4YWHA 5BRJA 3H5LA 4QYMA 4OLBA 3F7NA 1NXSA 4RS3A 4GNRA 2IKSA 3JPWA 2M98A 1KGSA 1ZITA 1GUBA 2E4ZA 3IDOA 4KMRA 4MQEB 4EGSA 1LBIA 4MRMA 4W5QA 3GWGA 5PNTA 4WWHA 3O2QB 3MYYA 3KSMA 3Q7RA 3MIZA 4XASA 2DRIA 3TD9A 3QELB 3UUGA 4EYQA 3SNKA 1XHEA 3OLXA 2PAFA 2PE5A 1QP4A 4KQ9A 6CHYA 3H1GA 5KC8A 3EAFA 3I42A 2JVKA 4O1IA 4IF4A 3N0WA
chains in the Genus database with same CATH superfamily
1HRDA 1U0OC 1XB2A 2F3TA 2HLHA 2FOLA 2VC2B 2W98A 3COVA 2EGUA 2FQ1A 5CDUA 2W2PA 4BBAA 3PYMA 4H7PA 3GT3A 1TFUA 4NYJQ 3SYRA 1LJUA 4D9HA 3E35A 3AQIA 2QRGA 1VZ3A 3VYTB 1QSGA 3IQGX 2E4AA 2FKNA 4WKBA 1P0CA 4E1VA 5BNWA 3KSAC 4HRYA 4KE6A 3CLSD 1UBOS 3NJ4A 2X5NA 1DBRA 4AMVA 1B6RA 4DRZA 4MP3A 1QKKA 1FSGA 1XTTA 1LLQA 2Q99A 1CUAA 2QJTA 1X80B 5EN4A 1K6JA 4GMKA 3TD6A 5FBLB 1S9DA 3NALA 5LQRA 2QL5A 3R3HA 4WJLA 1J39A 3QHPA 1GYQA 1MDBA 3Q11A 4M8NE 1HH4A 1ULUA 3QNMA 4PC2A 4EHAA 1XTKA 1Y7IA 2V9ZA 1ZX1A 3A6HA 3T41A 4BNIA 1Y9AA 1JAYA 1CLUA 4PAOA 2ONZA 3AHCA 2V4ZA 3IAUA 1G2PA 4YV7A 1NBHA 4FIDA 4IIHA 3Q8XB 3A1WA 3PF9A 2YJZA 1JHUA 4QGBA 5F1PA 4BNJA 4Y6PA 5KOIA 4N8SA 1B3BA 4CBVA 4WNAB 3D6AA 1I7DA 1XA4A 1R0LA 3FWNA 4OHVA 3AJAA 3BK7A 4MKXA 3WYFA 3GG2A 3GUVA 1JQBA 2BEWA 4FMPA 2HD4A 1RDFA 4C87A 2XYVA 3K20A 5JPDA 1PS9A 1VPLA 2I9KA 4R51A 2XUFA 4H7EA 4CQLB 1L1RA 3FSJX 5B58C 1UDBA 2QDKA 4JUAA 5JH7B 2ZJ5A 3NUQA 1N2SA 4NAVA 1U7HA 4B73A 3OI7A 1ZCJA 2QP3A 5EHQA 4MRPA 1I13A 2BMWA 5CAEA 1FYEA 1SCIA 5HRAA 2VAXA 3OZCA 5IARA 1X8KA 1O8BA 3IXLA 4I9HA 1Z28A 4A5OA 4RJTA 2H2HA 3RVJA 5LQCA 1EFLA 4N7BA 3TMYA 1JLKA 5TQ2A 3AZQA 5E6SA 2XIJA 2H1HA 4NCJA 5TT0A 2NTJA 1N5DA 2V6BA 3ZE2B 3ZNNA 4ATNA 4I3GA 4DR5B 4QRDA 4RHEA 3ZY6A 2WT4A 1CRZA 1GFIA 1GVHA 2H29A 4JYPA 1B1AA 1OAOC 1F1BA 4LWQA 1LQ2A 5JYBA 2VSFA 4HUQA 1U2DA 1NR7A 1EHCA 1P0PA 1DX6A 1YQGA 2PKEA 2O2YA 2QNIA 4RSRA 5JCPA 2P6MA 2XCSB 3H2KA 2AQHA 2X8JA 2RI6A 2WDZA 5IVKA 1WUKS 2A9KA 1IZ8A 4UBMA 3J81A 1CULC 4TSFA 5BWCA 2P1ZA 4MI6A 2OQ2A 3VAZA 3R6WA 4ISCA 3THYA 3OSUA 1QCYA 3IQDB 2ZVDA 4FS3A 2J08A 3TQFA 1Y3DE 1ATZA 1FUIA 2YXNA 4ZZ2A 3DAYA 1SUAA 5KTMA 3BRQA 4HQNA 3GFBA 2AR0A 3GAZA 5EE3A 2GK4A 5G0TA 5AW6A 2PSHA 2VNAA 1ZUIA 3GB9A 4LF4B 2AFHA 1N57A 3FYHA 1V16A 1OYOA 1IBSA 4F5EA 2NU8B 3TX6A 5HKKD 4MUNA 8ADHA 4D9BA 2GQ0A 2R7NA 3K7EA 4GU5A 4ND2A 5JADA 2MHCA 4KUEA 2VQFB 1IEVA 2Y0CA 5JNVA 4RTJA 1KIMA 3L7IA 3LY7A 1QZZA 3QMWA 3ZDXB 4C7XA 5HM8A 5HG0A 2WI8A 2KLHA 1Y1RA 2UKDA 4NMXB 2LVBA 4G9GA 3A6JA 4XAQA 1SUEA 2WWTA 2I7CA 1XWFA 3AEUB 4MCJA 4U63A 5BURA 3L79A 3HGMA 5LU9A 4PANA 1GEEA 2A92A 2XDQA 1WCWA 4IRXA 4BB6A 2AN5A 3KKOA 1IE3A 1TO6A 4BASA 4BLWA 4DYVA 3C5HA 3E8MA 1RZRD 4TSFD 4DLPA 4IUBS 4CTMA 3NBZC 3NKLA 3UJ8A 1F17A 2IGTA 3K0CC 2CF5A 2WWIA 3IO3A 2ODNA 1QC5A 1K08A 2WNSA 4PLZA 3D5TA 4BBPA 5BUQA 2ISSD 4QXQA 3GO4A 2YBDA 3SSMA 3KQVA 5NULA 4O4LF 1VMEA 2DUJA 4B6RA 1BCSA 6LDHA 4QOFA 3G8DA 3V5NA 3DF9A 4Z51A 2GXQA 2QTWB 2NXNA 3CLTD 3FCEA 4RSHA 3DYBA 1BRTA 3GLIB 5E3JA 1JXMA 2O7QA 3LUAA 3KELA 4LNUB 5JS8A 2ZE5A 2BGWA 4EYGA 1TUGA 2JJQA 2ZWMA 2J3IA 5GVRA 2HN9A 1JHAA 2FMIA 5J2TA 4IJ5A 1YR8A 5GGXA 4AVYA 1LDGA 4DBLE 1FFCA 3QH4A 1AQ6A 3CKKA 3G79A 4LBZA 1CZUA 3PFNA 3V1UA 4L50A 3V3TA 1U3GA 1RWMA 2W58A 4PSKA 5F78A 4ADSG 2PUWA 1JZTA 4X24A 5GONB 2QAGC 4AXBA 4Z2AA 2PZEA 4YRPA 3GL9A 4LZZA 4K1XA 3W5IA 4KE7A 2HIHA 4TWJA 3CX6A 1YR1A 4QX6A 4QWMA 2BE7A 1XK6A 1RCTE 1NJGA 4L9SA 4ND8B 4X92A 4LOHA 5IDXA 5CEEA 1ESNA 3K16A 3UC9A 1GU0A 4U2EA 4RDXA 1JI0A 2HMVA 1MX9A 3UH1A 3PHBE 1FW6A 1G21A 3RRXA 1CQJA 1EK2A 1KY2A 1QFZA 1MW8X 1FU7A 1RCUA 3ZZMA 5A5GA 1G38A 4HLUA 3VSCA 3TL2A 4X66B 1CKEA 1L1QA 3IT2A 2PKXA 4PWYA 2F59A 4E4YA 5ALQA 3HR7A 5A3QA 2YXLA 1BWQA 4QREA 1I2ZA 5ELMA 2C77A 2JLQA 1E5VA 3I8XA 2JFUA 1GGJA 3KKQA 1QMGA 4KW7A 4REQA 1ZNWA 5I7RA 1A8HA 1M8GA 1N6KA 3OZBA 3V32A 1YQTA 1R0CA 1LLCA 2V7BA 1Z0ZA 3SZLA 1JU9A 4F4FA 2H00A 3EZ7A 5DSTA 2B8NA 2BGKA 4BNVA 3ZDAA 1YE3A 3LUKA 1E9BA 2W6NA 4W5HA 1ND5A 2B7CA 3P0JA 3RHZA 2RGYA 1KAGA 2V55B 3FRJA 4FGJA 3E3MA 3RUCA 4A6EA 3RSFA 1LPMA 1UDRA 4F3RA 3C1UA 3G6WA 5C51B 4E09A 2PMKA 1G64A 3N8IA 1YZLA 1FK8A 4MYTA 3S4YA 3UA3A 3K0AA 3HWX1 4K6MA 2VNSA 4PAGA 5I6DA 1RYBA 4MWCA 1SZDA 3U0BA 3AI2A 3LZ6A 4ROSA 1C7FA 3FYTA 4FYJA 4ZEXA 2AG0A 2GVZC 4BRZA 1YA4A 1Q6ZA 4KLAA 4PLPA 2PMDA 1XP5A 3FMGA 3IMKA 3IUQA 5FOVA 4B6QA 4DIMA 5IXSA 1SCUB 3BREA 1BKYA 2FEPA 1SN7A 1DCTA 1EUDB 4XCVA 4NCBA 3H9CA 1QH9A 4Z1MA 4EHKA 4JP3A 1ACLA 2BLNA 2DERA 2EP7A 3E3NA 4M22A 3UGTA 1DP4A 4IMRA 1FOEB 3TE6A 3FYDA 2C0QA 1PJQA 3T5TA 3NM6B 4OQZA 4PFQA 4E51A 3ETEA 1KJIA 3HN7A 1E9AA 1ZIYA 4XRRA 1GRCA 4IR7A 3AR4A 2H1SA 4M83A 2K2QB 4EHBA 4ZGBA 4IIGA 5IYZB 1HQYE 5CFMA 5L53A 5C1DA 1A71A 4FCWA 4WACA 3FA2A 4N7JA 3H6GA 3PXGA 3SPXA 5K3FB 4CEJA 3GPIA 5ADWA 4HZGA 1VC2A 4UXIA 1GPUA 1KHHA 3BGVA 4KXFB 4O2BF 1LKZA 3F49S 1A7JA 3X1YA 4KQXA 5FORA 3W04A 4CGZA 1JFLA 2AC4A 2WG2A 1KYZA 3DMYA 2DHCA 3C1AA 3PDHA 2ZRHA 1K2WA 8ABPA 5FV7A 1PUIA 1KKUA 3B38A 1ULHA 3EVZA 4CDNA 5CDHA 2VUSA 4ZV9A 3IQXA 3BVPA 4WX2B 1R0RE 2YJTD 5FWYA 2A5FA 5EFOA 2O2IA 2M32A 3ZD8A 2I6SA 3DDOA 5CITA 1M72A 5A4IS 3HVUA 1W8IA 5JJIA 1D8AA 3HKCB 3HGTA 4EUFA 5EJIA 2GEVA 4LWZA 4V0RA 3DPSA 3KJNA 1DJPA 1PGOA 1D2NA 2OBMA 2RKWA 2WHPA 2WSLA 4MK4A 5HK9A 1J00A 2IS1A 2ZUVA 1ZG3A 3GHHA 3HN2A 5FF9A 1E5DA 1OT5A 1JKJA 1PYGA 1HT0A 1JWAB 2I4RA 3AOGA 3USES 3FGPA 4XCXA 1JLRA 5CDGA 4DV2B 1IXRC 2ATEA 4WOJA 1W52X 1XCOA 3QV1A 1J07A 3AKEA 2J5RA 4G0UA 1T5BA 2AQKA 5KEIA 4AY2A 3RJTA 1SXHA 3TGLA 3F1KA 5FJIA 3KLMX 5D84A 3FNEA 1P7WA 4ZAWA 1U7OA 4ZAYA 3MJEA 1L7PA 3WYGA 4HQOA 1TZJA 5JY1A 4ARUA 3LE8A 1F8GA 5I3ZA 1SVIA 2J30A 5EIBD 3VPSA 4JLOA 1LDEA 5EGNA 2IIVA 3NHKA 1RWPA 3QOWA 1YK1A 2JHFA 1DINA 3LT2A 5TVGA 3VNAA 4LJ7A 4NSNA 1GPYA 2GJAA 5TMEA 4CMJA 2R6HA 4KIWA 4P4SA 1YRAA 4JDUA 1R64A 4OQMA 4S1NA 1JSLA 2AW5A 2Q3DA 1H9BA 3B13B 3DW1X 4P5EA 4CKEB 2V96A 5FQOA 5KNLA 1QIMA 1WZUA 2PPVA 2RCNA 3VZBA 5LSAA 3CSDA 5JQGA 4FHCA 3A3NA 3KLNA 4RD0A 3MQFA 3RU9A 1OE0A 2TMYA 1N5JA 1JXQA 3CC8A 4MS3A 4LJSA 1DX4A 1H2FA 3NLLA 2BW0A 3BSWA 2QMQA 4NONA 4OGGA 2QRLA 4EB0A 3AVUA 4I7EA 1Q1QA 2Z1MA 4JI3B 2J0QA 3GJSA 3VA7A 1YU6A 3LG2A 1S89A 1U0FA 4LCJA 1FVFA 4WTOA 2A0WA 2JEZA 4YASA 4YMVA 3ANLA 5JSZA 4B1FA 3LVRE 4IEEA 2IIQA 3OKAA 1EI9A 1GT91 2IPNA 4JC8A 1HR0B 4O4JA 4E13A 3ND7A 1NMQA 3BIWA 4ZT5A 2UZ1A 2VSXA 1JEYB 1SCKA 5GY7A 3FUVA 4YP9A 2BGGA 1WV0A 4CG0A 2B1GA 2Q21A 3GJTA 1N34B 2WLTA 3RU2A 1NTOA 1TEZA 1YZKA 1KIFA 1R4MA 3T5AA 3MJVA 1KK3A 3IR6A 5SYMA 4AZ3B 4XWGA 3M6LA 1KDPA 1CJKC 2G17A 4IJUA 4B80A 2FZGA 2AN4A 1XROA 3HS3A 2OCKA 5B2FA 2BDUA 1NATA 4WXMA 5D8DA 2IEYA 1FMTA 4O1MA 1D0VA 1SVMA 2FWJA 2O3JA 3LXXA 3WK4A 1UT5A 3DQZA 4IQ8A 1D4AA 1H93A 4C14A 1B6TA 2BISA 3WB9A 4EGQA 1EBBA 5AOVA 1T6XA 2Q3BA 3PPVA 3ZDRA 4JMLA 1KNQA 2FN4A 4JUCA 1NXWA 3GLKA 4HNAB 4X5OA 3QPVA 3ZGYA 3WRYA 2F67A 2W2VA 5E3HA 4FWBA 4N5IX 2FRVA 5E8RA 5BQ5A 1SC4A 1MRZA 2BZSA 4KMSA 2XYPA 1VE3A 1WHSA 1P1CA 3CPHA 3PUXA 3W05A 3H5RA 1WNFA 2X19A 5B7QA 4Q1VA 2WHRA 1D1SA 3PX3A 4MAFA 1IBMB 3FYUC 4I1SA 1UXKA 2XE6A 3EFBA 3K94A 4ER0A 4N8DA 4MMXB 2YV3A 1C1YA 5ALNA 1IZZA 1HFWA 3IA7A 1V7CA 1O0SA 3BWMA 2AF3C 3ECCA 1X70A 2ANCA 2GR9A 1HK7A 3FPBA 2BMJA 4H7KA 1W4RA 1LDBA 2WA1A 4KO1S 4OP2A 3W1WA 3MD9A 1F5SA 5CGZA 1UMDA 1EVLA 3PEWA 4EG7A 3ZN2A 2FSSA 1M67A 4J6FA 1HLDA 5B7PA 2GD6A 3L8CA 3V4VB 2VDNB 2PZGA 4L0QA 2BUCA 2GWRA 4D9JA 4Y1RA 4YDQA 2VHQA 2JBAA 4EL5A 5CNMA 1BFKA 3L0DA 1OC2A 4JP5A 5GZ6A 4ZI3A 4MR9A 1HQKA 5TPWA 3ETHA 4IYJA 4OSPA 4R8VA 2MSEB 4RY0A 2DPMA 8GPBA 5J5VA 4AT1A 4YRMA 4DR3B 4GKAA 4G5RA 4BO5A 3LBAA 1E3EA 3N86A 5KAMA 5C7OO 3EZ9A 5AKJA 4QYMA 4YLGA 3QKTA 2JGDA 1SD1A 5FB3A 2A86A 3RTGA 1RYMA 2C5FA 1U3FA 2LW7A 2CBZA 3IDOA 4IAOA 5FTLA 1QG4A 2V8BA 3GRFA 1A4RA 4RH3A 1USUA 3A1FA 1BYIA 1RHKA 2O2ZA 4MRSA 1C1XA 4TV9A 4IOJA 5CM8B 2OZLB 5EYPA 1FCJA 1JEAA 4RABA 3ZE6A 4EB8A 2Y9PB 3WWCA 4EPRA 1TI7A 3ZX4A 5KVSA 3CMMA 5K0LA 1KP9A 1TK3A 2HMYB 3NFRA 4MP6A 1JFFB 1P3Y1 1R8QA 4E21A 2GAAA 2PV0A 2ZSEA 4B40A 1P7ZA 2NGRA 1K7EB 1KO1A 3CO0S 1NHWA 3JQ6A 1F9EA 4MKRA 5C52B 3V9AA 1Z6QA 4AZTA 3VR6H 1U9CA 3EPJA 4F7WA 2XNKA 2Z3ZA 2XKKA 4FFMA 1L3CA 3O75A 2B2XA 5KSPA 3TPFA 1QTQA 1Z6YA 4RV9A 3E27A 4FMBB 3WGYA 5DSZA 2RJOA 4NNJA 2JIMA 2D2EA 1KSGA 2NT3A 3AYZB 3OU2A 4F45A 3LC7O 5FTNA 1DXYA 4I9FA 1IUPA 4ZVTA 3GBSA 3JQAA 3UV6A 3LCVB 3BB1A 4KE8A 4OM8A 3I53A 2A59A 5K3EA 3MRTA 5AT1A 2YJ6A 3GDOA 1EESA 2PS3A 4DYDA 1EVIA 2QENA 4ZVRA 1IZ0A 2E4YA 3OQBA 4ALMA 4CKZA 1CYEA 3P97A 2DB3A 3GRVA 3A1TA 1O96B 4L7QA 4CTJA 3IAEA 1DMRA 1OFVA 1Z47A 1O4WA 1NI4A 1AKNA 1P2TA 2J3KA 3KR9A 2VNHA 5JWOA 1S96A 2NUBA 1IN7A 2RGNC 3H5TA 1K68A 3QE3A 5TXGA 1W1UA 3NTOA 2FMUA 4YH1A 4EHDA 1D4ZA 2DWOA 3J81k 1SKMA 1RLIA 4URFA 4QGFA 4RK5A 2W22A 4KXXA 2H1WA 2XUKA 1LS6A 3BD7A 2XQIA 3ZHYA 2FPKA 3HYRA 5LQUA 3ZHTA 4RGYA 3ZU5A 1M0TA 2FG7C 5E7JA 3ENKA 4D80A 3RIHA 2OD7A 4MCAA 3RC3A 1KQPA 3VDNB 4D0GA 3ISTA 3I9OA 3TW0A 4NBWA 4KZKA 3DV2A 4DPMA 5KCZA 5HSGA 5B3JA 3HACA 5LYJA 1LC3A 4IMJB 4AUMA 2DBRA 2UDPA 1Q0PA 2D7JA 3E9QA 3FAZA 1ZIPA 3KB2A 3IL2A 3VU9B 2FFAA 3JQAD 2FZVA 3B12A 3DZJA 4E2ZA 2AMYA 1G60A 4UM7A 3Q7SA 4M2LA 3M3DA 4AY4A 2JBHA 4F9EA 2BP7B 4WI1A 2HQSA 2PQ2A 3DO6A 1JIKA 1H2XA 3N6VA 4KWTA 4QXOA 5U4QA 3UMVA 4CLDA 5JZOA 4Y1FA 3MCUA 5KNCH 3NOXA 4ZMRA 1X19A 3LUFA 5K6RA 1Q6YA 1YRWA 1JJIA 5F5XA 2BHTA 3UWSA 2ZJAA 1NQVA 1P5ZB 1HX7A 5L51A 4K3UA 2ZE7A 4OI4A 1IK6A 4FBLA 3GJ0A 1TTHA 1G7RA 1NWHA 3IXMA 3T7TA 4CDRA 5IJ9A 2D06A 3WHKA 1FYVA 1R9JA 2HPAA 3B1JA 2WP8J 3ZJTA 4E2FA 5GM1A 1IAQA 2DWQA 4RW0A 3FOEC 1NU6A 4PG5A 3R7LA 4BUZA 3DLBA 5EMMA 3DZKA 3AUUA 3NHLA 4O3FA 4G09A 1E3TA 1XFDA 4MYRA 5B2EA 5JD6A 5IWAB 4JBIA 3QI7A 2P2GA 1SBQA 3ESAA 1XCLA 4TL9A 3GT7A 3ZYZA 3QEBZ 2HQBA 2HXSA 3JU3A 4I1RA 3MD0A 4ZARA 1X42A 2AI3A 3RC2A 4R81A 1J49A 1WXDA 4ZMSA 2WK1A 2NADA 2WM2A 3A6KA 4TM7A 1FRNA 3T3IA 4CDMA 2D0DA 1HMYA 1AS3A 3UAGA 3B7GA 3RFXA 4HNVA 3O21A 2R8RA 1OI7A 1AKWA 1NVXQ 2HSJA 2Q2QA 4FN5A 4JKOA 4TMYA 5A3RA 1S02A 2XZTA 1ECCA 3CMCO 2INGX 3MAJA 1EQUA 1Y4AE 1VBFA 3D5QA 3R6GA 4G8BA 4JHXA 4YVFA 5JECA 2NUPA 3DE4X 4FQ5A 5KVCA 2RHBA 1SXJB 1NN1A 4MRRA 2F4NA 5DK4A 1I1NA 3ILSA 3L93A 1PQUA 1RPAA 5DPMA 2IPXA 1JDVA 4LJ4A 3DO8A 4X6XA 3OE1A 3SSNA 3DBLB 3OP4A 3KJZA 4G23A 1E4EB 1OLXA 4X54A 2H1FA 1N8NA 1TECE 1FFWA 2R00C 1TYEB 3HLYA 3NHJA 3PNSA 4I55B 4Y8VA 1RKXA 1NAIA 3NBXX 4LY6A 2IU3A 1IBRA 1SVOA 1ZXLA 2V7WA 1LLUA 3PPXA 5HS6A 1X7YA 5IJAA 3RJ5A 3B9BA 5LMUB 2FWPA 1OZ0A 1VMAA 3CUSA 3R74A 2Q5EA 4ALLA 3PXCX 3KLPX 3IIEA 3R09A 2FMXA 1GNTA 5J59A 3ONEA 5FBKA 3GBPA 2AL7A 4D0NA 5LXTB 2VJBA 1L7XA 3T9DA 1WEKA 5E4YA 3VO1A 3W79A 1EU1A 3VYSB 4F1KA 5JYDA 3AVTA 3DL2A 4DCTA 4XJXA 4F6RA 5JZMA 5FRDA 5CBKA 1MOZA 3FMIA 2EP8A 1NNSA 3MGGA 1OBOA 2BH9A 2QTFA 3B82A 1ILWA 3PFKA 5A0FA 4BIIA 5JPCA 3OTOB 2ZG6A 4MITA 1S2NA 1VBNA 1VG0B 1K7SN 2H8KA 2CFSA 2QUAA 3IP7A 3G02A 3G2KA 4EX7A 1DBIA 5GINE 4M8SA 1WKBA 2GZMA 2E0IA 2NO5A 5DNUA 3M3PA 1SUDA 3JZMA 2VOEA 1UBGA 5CJ2A 4POAA 4BU0A 1P2FA 3KEGA 1B7GO 1PJZA 2EQAA 2GGSA 4YO7A 3SLKA 3TAHA 2GAJA 3I8OA 2C5HA 3G2QA 2G1KA 4M0FA 1DAMA 4FC7A 2R48A 3F46A 1Z0AA 1YH3A 1TZMA 3EQZA 2WU0A 2XTZA 5EFZA 4US2R 3ZG6A 3KDAA 2ODPA 1GV1A 4EVQA 3GH3A 3BICA 4YRFA 4DA4A 2JH8A 4RQAA 3GQBB 1LBQA 2FW9A 2C3OA 3IESA 3ME5A 4IINA 4BNTA 5I7SA 1C9JA 3RIYA 1CUHA 4R9NA 4JBXA 1G59A 4AI6A 4ZJZA 2AT1A 4OKSA 4TXLA 5TGZA 2PH1A 4CM6A 2P0AA 1WDTA 2R6R1 5C32A 1F60A 4N6NA 1EEHA 4IS2A 3LP6A 2ZDHA 2JHAA 4MVWA 1C9NA 4FEEA 5IAJA 2CSXA 2WSBA 3LBFA 4PLHA 4S2UA 1FFGA 1TZKA 5D7BA 2FLVA 4C43A 1MPXA 4F5YA 1CU1A 1VKRA 3KQYA 3FGNA 4GZ5A 1V6SA 2RBEA 1F6BA 3L40A 4LBYA 4QOSA 2OCBA 4TS4A 3HDHA 4R7ZA 5KMGA 2IP2A 3UG7A 4CM4B 4W63A 1TD1A 2J3EA 2XCQA 5H3HA 2XKAA 1P9OA 3R5FA 4JL8A 1ISGA 1R5JA 3TX2A 3LZCA 4PHTA 1L5GB 4ESOA 1H65A 4UOQA 2E85A 1AF4A 1ADFA 1Y4ZA 4B3HA 4ES6A 1DRUA 4OATA 4XD2A 2R86A 5IK2D 3HXOA 5DP2A 1C2TA 2CLKB 2SHKA 4JBGA 3T1OA 4IICA 3K8YA 4F3CA 2KBEA 1PFKA 4DSNA 2QR2A 2UZ4A 1XZBA 3FPLA 4TXJA 3N0XA 3W2FA 3DE5X 3T3OA 1GGNA 3VZRA 2PGAA 3LUBA 3B20A 2K5UA 3P32A 1G16A 2O2DA 4Q48A 1TU0A 3K6RA 4MAAA 4D41A 4HDOB 4JCOA 3QOYA 1BE0A 1C81A 2JGEA 2BKAA 1ODLA 1UP7A 2Z0MA 1Y7HA 5FWAA 4EKNB 3RT9A 2Y99A 2FQXA 1GZ6A 1UQTA 4HYQA 4Q1AA 4C0QC 4DXDA 3EC1A 3MWEB 4JI1B 4QJBA 1OZGA 4O5AA 4XM1A 2OYCA 1E6WA 1RFGE 1DMSA 4XSHA 1OGIA 3CLKA 4NP6A 4G1UC 4WVFA 1HDGO 4A8JC 2O2CA 3LL7A 1DFIA 1X1CA 4M1ZA 4EM6A 1YJBA 2C9BA 4EUKA 3KVNA 3CH5A 4M1YA 1PG2A 5D5HA 5CTAA 3WSWA 3OQPA 2EJCA 2F4VB 2D1QA 4U3JA 3FDFA 1HYHA 3NOVA 1I6KA 1AZSC 3W1EA 5LFAA 1KEEB 3WI7A 4BMOB 2QP9X 1MRSA 1Q7EA 1EG7A 3LRPA 3NNDA 4DWVA 2ZSKA 2HF9A 4YRNA 3WA7A 3KXLA 4OBXA 4Q7EA 1E60A 4YI5A 2GNPA 4HWPA 4JLJA 3LRXA 5FUWA 5CK4A 3CNHA 1CUXA 2GZDA 3ZTWA 4WZZA 3RROA 1OWPA 2XPCA 3CEJA 3F67A 3GP3A 2VZ9A 3R0VA 4G56A 1G8KA 3R1IA 4JYCA 3B6IA 4JYBA 4JOQA 4INJA 2ASEA 1U4OA 1TAQA 1ZM3A 5PGMA 3RHSA 3DVAB 1Q1NA 4CIBA 5DASA 2MR6A 3IV9A 5SY4A 5DOVA 3BB4A 1LI4A 2I91A 3BWCA 3ELYA 2RHGB 2ESRA 3V1KA 1E1YA 4OUDB 4L4SA 4K03A 1A9ZA 2B8WA 4BO2A 1KQFA 1XJ5A 3PXDA 5AQ1A 2FPGB 1EJBA 3B8EA 4L78A 1J4AA 2HJRA 3M5CA 4KQ2A 3K5IA 1P2VA 3T6KA 1U6IA 4Z6KA 3NTLA 5J2UF 2MYUA 3BMQA 3F5QA 4AG3A 4G0VA 4UUMA 5B6IA 2ZUCA 3N2EA 2H63A 3WIDA 4A3SA 2Q28A 3R24A 1CJTC 2RD2A 4HQFA 4KJZA 1JJFA 4MS4A 4Q9KA 5DTIA 4NJMB 5LOVF 2JI8A 2B4YA 3KYBA 4JROA 2OCGA 3EVGA 3ZU4A 2IK8A 4UMVA 3QFSA 2XLBA 5FJJA 2JZOA 2VAMA 2QI9C 1G5HA 3OE4A 4M54A 1AXRA 4DUZB 3PC3A 4IXWA 2ZIVB 3IVCA 1KMHB 3WGHA 3O93A 4EY5A 1NYQA 1FFEA 3THWA 2GKGA 2MJLA 4X41A 4X8HA 4V02A 2BFFA 3I52A 4X1IA 4H2DA 5CX1B 4PHHA 3IDAA 2NO0A 4MUFA 1XNQB 3HY6A 2QN3A 1TYDE 3KR0A 3BE4A 3DEJA 4U4AA 4D3XA 5EJEA 1EIZA 1ZISA 1EDOA 2XCLA 3LGSA 5HJ7A 4CKCA 1EFCA 2KHZA 2JCBA 4FKZA 3T95A 3VHQA 3BWVA 1P44A 4DEXA 2OG1A 3CT6A 1MOPA 1SAYA 3O4HA 3DHNA 3MT7A 5KSWB 1SU4A 1CQZA 1Q0HA 1ZOLA 1D09A 1UJCA 3T61A 2O19A 3JQPA 2AD5A 3A6LA 2BKVA 3EXEA 2RHWA 4GM0A 4U0KA 2C98A 4MI9A 4BGVA 9MHTA 3MZ0A 3HZOA 1MXFA 1DGQA 4RIHA 3BFJA 1U31A 3PGJA 4O4LB 1JSXA 1NUPA 4MDFA 2Y77A 1TC2A 1TQHA 2YN0A 3MINA 3FDJA 2YJ4A 4LC0A 3WKAA 3SIXA 1XRPA 2FK7A 4HXFB 3ER9A 4JLDA 2GN2A 1VJ0A 1YCGA 4FDTA 1Z17A 4E4TA 4WEQA 1RXIA 2C7PA 1PWYE 3REQB 1OWMA 4HAIA 3PQFA 2BWJA 3KTDA 3L7JA 2GCPA 4OK3A 4XB1A 3KOOA 1VSVA 3Q3VA 5A4MS 4LFBB 1Y5MA 3WRXA 1NYLA 1ZD2P 2O8DB 1FW8A 4N0QA 3VUEA 2HXYA 4XIJA 2ZIEA 2J0SA 2YWHA 3O9MA 3T1YB 4JLVA 2AE2A 2CLMB 2NSYA 2HA0A 4LVOA 3TNFA 2QTNA 1XU7A 4OM7A 3H8JA 4NS4A 4RJ2A 1SXQA 3ZWQA 4GKJB 1NLYA 4P35A 1YJXA 2GWHA 3L7DA 2IYUA 5CVVA 4A8TA 5HTOA 9ABPA 4XWWA 1LSSA 1N6RA 1XZ8A 3K5HA 3RAPR 4BVAA 1A82A 2AG6A 2XB9A 4KACA 1FP2A 1TM7E 1U02A 3CLTC 2YIDA 4DG8A 2R65A 1HXHA 2Y1DA 3OLCX 4DV0B 3Q7PA 1AV7A 4L1KA 4UDYX 4X7PA 4YDSA 4OHYA 4EMSA 3ZU2A 1F8XA 2P6RA 4Q19A 2BN4A 3AFMA 3A2MA 4MR8A 4DC9A 3PV0A 1RIFA 4XVQA 1P6UA 3Q9UA 1IHXA 5ETJA 2IU4A 1E62A 3DTTA 2V6MA 2QE6A 3TPCA 1HDRA 2DUWA 3ZK9A 3SJZA 1E2UA 5ERXA 2F8TA 4QKQA 1T2FA 1MHTA 1ZD3A 2JLSA 2RGWA 5TR9A 5FFFA 3R8XA 4XX0B 5CB4A 2VHWA 1GY8A 2ZIGA 3GHYA 1RBZA 4MW9A 5BOSB 1Z5GA 5KX5A 1FSZA 2QP4A 3E7DA 2G1JA 1LC0A 3EF0A 3KAJA 2IWHA 2E2WA 4Z54A 2FWIA 3N53A 4OSOA 4NQRA 2Q6VA 2V98A 3GZNB 4X1OA 2DMRA 4H4EA 4WXEA 4G1CA 1YBHA 2Q2VA 3AVQA 5BSHA 4LGVA 3TW6A 1XVTA 3C5VA 1ZCFA 3NUGA 2D2FA 3ORQA 4FDVA 1PJ3A 2HA4A 3CG0A 1GGHA 3SX4A 2VUTA 2GBLC 521PA 4Q4AB 2NXCA 4HP8A 2EAUA 5CVCA 4YWHA 2QN8A 3AF6A 3ZVNA 3QVLA 5EIEA 1PZGA 4B3CA 2OKGA 3K31A 4MEAA 3JWGA 2VQ3A 3CXRA 1NVEA 4MARA 2M98A 1ZC3A 4JI4B 4IBOA 4LFAB 4EGSA 5BW8A 1DARA 3LLMA 5HIIA 1RLJA 3ESCA 1BMFA 1QAOA 1RQ7A 3V3KA 1O5IA 3GROA 3RS4A 2AFIE 1K6MA 3U7RA 1WHTB 1L4GA 2RGGA 1V48A 3KPUA 1YDWA 3IIJA 1AQYA 5F73A 5IF3A 2O5CA 3HA2A 3SXUA 4M9RA 3O8BA 2EFDB 4R4JA 3URKA 1GFWA 1XCBA 2IHNA 3BX1A 2J33A 2IODA 2RG7A 3QLTA 1QTIA 1SBYA 2VP5A 4IKOA 4DIBA 3O8NA 5J4VA 4JN6B 4LTDA 2FEAA 2PRJA 3BM5A 2JFXA 2EX4A 4GR4A 3ADBA 1D3AA 1QYDA 4O2AF 3PFBA 3X43A 1XQ1A 4O2BB 4BQQA 2IYTA 1CEQA 3CE9A 5ITZA 3ZVMA 1I9CA 3CKYA 3CUKA 3V4LA 1JAIA 1S0UA 1CR2A 5ALZA 3O0DA 1E7QA 1D07A 1EE2A 1HM5A 3TKLA 5FPHA 2AXQA 4ZANA 1F4PA 2R68A 4FEAA 2J3HA 1WUHS 1YJQA 5LD2B 1F0NA 4B5KA 4AJNA 3B5IA 3CLUD 5AVOA 2W48A 1M8JA 1RLMA 1XEFA 4LN1A 4OEHA 3A4TA 4RMHA 4OVKA 4YACA 1IYZA 3OCWA 1TNDA 4YRDA 3FYSA 5C81A 4MICA 4Q05A 3WLJA 3STHA 1ISRA 4DBLC 2C92A 3LOQA 5EP4A 3OFVA 4YPOA 1Z0SA 5ELXA 4J1NA 4UMEA 1VQ1A 2AFIA 1PW7A 3AVXA 3HYNA 3WNBA 1PG0A 3UQZA 1Y6FA 1G41A 4BLVA 1JBEA 4U2CA 1SKUA 1OWOA 2AG8A 1Q57A 1N2BA 3PXAA 2BL4A 3S1AA 4UE6A 1S9HA 4M87A 3DZBA 3T9CA 1ZQ9A 3I2GA 1W36B 3T3MB 1E0SA 2IRWA 3MGCA 3CY6A 5HCIA 4QUJA 5KJEA 3WIVA 3I5AA 1KKLA 3NCHA 2XUZA 1VCMA 4IFEA 3KG2A 3O83A 3OPNA 2XCUA 4CL8A 3C4QA 2YS7A 2O8NA 1AN9A 2DHEA 4KJXA 2D4AA 3BQNB 1RADA 4MUXA 5H4HA 3VU0A 1N0UA 1EWYA 2WJGA 3AF5A 4MVJM 3ZHSA 4I66A 1U7UA 4BZZA 3I9NA 4E4RA 3ENZA 4BMVA 5TPZD 5GADl 3OC0A 2EFHB 2SNIE 3D5EA 4A0GA 1QIDA 3FTPA 3PITA 1A1VA 1ADJA 2C88A 1MMFB 5DKFA 3MQ4A 1J06A 2YJ3A 2ZYHA 1ZRHA 1H5QA 2YWEA 4DQKA 4KOAA 2CD9A 3II6X 2PS1A 1GNQA 3FY4A 4NECA 3GCXA 2ZI6A 1TYZA 1K5DA 4JJIA 3RNLA 1NI5A 3JQ7B 2XJ9A 4YV1A 3BMNA 1YASA 1XBTA 3ZZTA 3DJYA 1ZH4A 3USCS 3I58A 4I2NA 3N28A 1SULA 2KPOA 3D4LA 3SHOA 2Z2JA 4DUYB 2R9VA 5FXMA 4FX5A 1L5ZA 3E18A 3TQCA 3U48A 2C7OA 4MWBA 2YY5A 2R8ZA 1I6MA 4NBRA 3AERB 3ZZ1A 5M7EA 2JJ1A 4MW1A 4N82A 5FA5A 5EIBC 3UJ6A 3V4OA 2RK6A 3M6VA 4UPDA 1SA0B 5DP1A 5C18A 3OOEA 1WZEA 1KAMA 2WR8A 1ZEMA 1RKVA 4Y7DA 3BSFA 1YOVA 5BSWA 4DMGA 1JSCA 5GJVC 4Q7KA 1X13A 3SP1A 1SOWA 2G9RA 1A9XB 4KIGA 3Q12A 4MQLA 4OFBA 5DWVA 1LTHR 4ZVMA 4EG5A 3HA7A 5EP2A 1N0VC 1FPMA 1M6EX 1E1LA 3L18A 3GEEA 5DZSA 2NPFA 1I4DD 5L3VA 1I9GA 4ZI2A 2JFYA 1US8A 3FNIA 1OILA 2KSQA 4ZVPA 5D5QA 1N2JA 2AOVA 2J85A 3ONWA 4YJ2A 2D5LA 4UFNA 5ALOA 3LSTA 1ZA2A 2EBWA 4OHBA 4PXAA 4EEXA 1NNEA 2GI4A 2IEAA 4PE5B 2GD2A 4HDSA 2FGKA 821PA 2H2FA 4UNPA 1TAGA 2JHGA 3K6SA 3DMPA 2A78A 3DMTA 3L82B 4JEIA 1S2OA 4TLMB 3C6YA 3PDWA 5AW5A 5LZ8A 1XCMA 4W1RA 5K5EA 1KI4A 5L40A 1BJRE 3T5CA 1WO8A 3RJZA 4CGYA 1VTKA 3DXFA 5CHEA 3KYIB 2QDXA 1QGED 4D0LB 3M6AA 2A5YB 3AG5A 2C1XA 2JJ1D 4NBKA 2VR1A 2ZSJA 3QY9A 2PXHA 4ZICA 3BB3A 3B5JA 5HE8A 1M2VA 2Z6QA 3JQBC 4GQAA 5JCOA 4DARA 5KYYA 1EUQA 2PZJA 3IP6A 3ZE9A 4PPQA 1QBKC 1M6VB 1CY8A 2COUA 5CURA 1ZVVA 3K73O 4M1TA 4MV7A 5KVAA 3NYQA 2QMEA 4UW9A 1R7RA 1JWLA 2X2PA 2GSDA 3F0TA 1DT5A 1LV7A 1Z38A 3E15A 3ZHZA 1KI3A 4C76A 2NUAA 2HOQA 5I9LA 1W9HA 1L7BA 1XNGA 2CXQA 2PZBA 3ZCXA 2NT4A 2JB9A 1GAEO 3MFQA 1OB5A 4NEQA 3CX7A 3TQRA 1G5QA 1NJSA 3EIHA 3KVRA 1JDSA 4CV1A 3IMEA 3TW8B 4ILEA 1A2QA 1H4QA 2ZUWA 3G85A 4B76A 5IVIA 3NGLA 1R9MA 2ZITA 2XMRA 2CLEB 3ZH2A 4E31A 3C85A 1DAPA 1YHZA 2EHDA 4GMHA 4TWRA 5T64A 2BHLA 1FP1D 3FMOB 2CXNA 5LL6P 2ZI7A 1NNI1 3Q40A 2PCLA 3GELA 3OQJA 4MWTA 4Z7NB 2QI9F 1QNFA 3T4UA 4K88A 2ZREA 3EVEA 3KFVA 2RH5A 3N5KA 1KETA 3AUJB 3TDKA 1GR1A 1VKHA 3M70A 2FF5A 3OEHA 2C57A 1ZP6A 1UZLA 2XEDA 1QH1B 3HXLA 3DUFB 1GL7A 3GEIA 3IQWA 4RZIA 5BN4B 3UAYA 3D6TB 1RQNA 2QN2A 3CUVA 3PNKA 3GCZA 4G63A 4GLLA 1EYZA 4HEJA 4JI6B 2X0FA 5M34A 3VPCA 3I64A 2Y66A 1ZMXA 2QSUA 4EJ2A 3RYCA 2XOXA 1QG6A 5IX8A 4Q3BA 5FOWA 4YAKA 3UGJA 5FR1A 5GMOA 1AS2A 3GFGA 2DBZA 4AXXA 2C5BA 1PT8A 3DHYA 5AK0A 5B58T 3ZCRA 1GPBA 2ERYA 2YHIA 4KVAA 3OIFA 3FN4A 4W5WA 3W3AD 4D3ZA 3GA5A 3FETA 1AKRA 3IHKA 1LGYA 2FE4A 1FFXB 1V2HE 1WXIA 3F90A 1QV9A 1T91A 3HVIA 4H16A 4DHWA 2G9ZA 2P2YA 3ROQA 2ZCJA 2QVYX 3AT1A 3BXZA 4M88A 5CR9A 4C29A 1XNJA 2ZIXA 4H15A 1L5FA 2UV8A 4P3OA 1H9CA 1MN6A 4R83A 2O5RA 5EIHA 4MULA 3TMAA 3MCWA 2XD4A 4E2XA 5K4AA 4PGHA 4RESA 1WMDA 5ARDA 3QEJA 3X1DA 2I67A 1KZ6A 2JL1A 4IHJA 3N2GA 3OEHD 3KUUA 3CEHA 3AFIA 4BBJA 2V45A 1XAHA 2X40A 4FHDA 4YRRA 1N5LA 3T9AA 4BO3A 7REQB 1GADO 1W25A 2Y1LA 1SPBS 1LVGA 4JJ7A 4BB9A 1CJBA 2IEIA 4WERA 1W34A 5L9AA 1T6BY 2DY0A 3NGMA 1G3IA 2QAGB 5EI5A 2JARA 1KI9A 2OG2A 4PSCA 4XGKA 4QTXA 3F8TA 3GJXC 5ANRB 2WJJA 5JO0A 3QOXA 4WW0A 4RH1A 1LV8A 1KI8A 1OH8A 2R4QA 3OD5A 4ZXPA 3CZQA 1LNQA 4EGFA 2VUHB 3T5DA 3HBAA 4DT1B 5LKRA 4Y6GB 5CB6A 2HADA 2C4UA 1DAEA 4YY3B 2ZOSA 3LCUA 1N7HA 4P7BA 4QQRA 2R47A 3D7LA 3U3ZA 3G0OA 4TTTS 4YMIA 2PKWA 3ZGXA 1OAKA 1JEQA 5BNZA 4NV1A 5HZKA 1R0KA 5CLGA 1Z29A 4FR2A 3DNFA 1II8B 3ORSA 2R4TA 3GUCA 3O31A 1M34E 1EFHA 1G8JA 3IBTA 3ER8A 2K7ZA 1MHPA 2XTJA 3HDTA 4N65A 2YXPX 1T4CA 1GQSA 2ZJBA 4RDIA 5DHFA 2I2AA 4XLZA 3QPAA 2XWQA 4FK8A 4Z0HO 4HEHA 3X0DA 4D92A 4D43A 1QGAA 1OYWA 2E89A 2I0FA 2LCIA 1BXZA 3O3CA 4JU9A 4NZNA 5EC8A 3TOCA 3UCXA 1NZFA 2EJVA 2IBTA 2PGLA 1C9YA 2D13A 2FRXA 3L1HA 3PSHA 4LPKA 3KOWA 3UCEA 1GNLA 5CA0A 2V7EA 2I22A 2HK9A 3OT5A 4QTTB 3CH7A 1YS2X 4KDEA 1QHFA 1TVKA 1XU4A 2QTRA 4OREX 2IS2A 2OXCA 1PQ4A 2CJWB 1U6JA 3AUYA 3DOIA 3LUGA 4EF5A 2DUUA 1I4WA 1X0VA 1OYVA 4RTPA 3PF8A 1EWKA 1OU0A 2VLBA 3GPLA 3ZWMA 3CHYA 3RFVA 4FB5A 1T0BA 1MD9A 2E37A 3G7NA 2XGGA 4G4SO 1EFPA 2QVXX 1TF7A 2QK4A 1CLEA 3CW8X 3D8RA 3RVNA 4KDFA 2AVDA 2OFWA 3H5AA 5DVZA 3BRWD 1QS0A 2C29D 3D7MA 3G9ZA 4LKRA 5EUBA 2AFVA 4KGZA 3UCFA 1TPZA 2JK1A 1JS1X 2ZBDA 2F1HA 1MAVA 4FILA 1W96A 3TJZA 4DCGA 5CFRA 4QDTA 5CLLA 4ZQGA 3WHIA 4KO8A 3L8EA 1L4FA 3TRJA 3DVSX 4QUIA 1M34A 2QD5A 2B5WA 1IB6A 1YL7A 2AGVA 2I2BA 5D51S 3PEUA 1EXNA 1APBA 1W44A 3HEBA 2A1TS 4EJ0A 4BVGA 5THKA 2XMDA 3ACBA 3QEMA 3WISA 4CU2A 4L85A 1DCMA 4RXUA 2J7PA 1SJ9A 4QUEA 3ESRA 4JJ6A 4NLLA 2I2WA 5EEGA 4OQLA 4R0VA 4U1RA 3E53A 2CMFA 1OT3A 3R7DA 5F2EA 4CR7A 2A4KA 1CZHA 2C9DA 3JQEA 3F73A 2OGZA 1BVHA 2IVZA 4R54A 1E8NA 3BERA 4GG1A 4UEQA 5T7BA 5FD8A 4HGQA 4IX9A 5K6AA 4YHHB 5B7GA 4A6PA 2ONJA 3F7OA 3BWEA 1Y6JA 1T2CA 3WNCA 3KPYA 1KY5A 2MT9A 4N5MA 1PL0A 3Q8MA 2V7QA 5K8CA 1SKAA 3PUIA 3WK6A 3G9TA 3SE0A 1TJNA 2AMLA 4X63A 1I1QB 2HHCA 3NIFB 2ZSFA 3OHMA 4J6EA 4PN3A 5FBWB 3G2HA 1KJWA 1NF3A 3HJCA 4PTYA 3TTSA 3QJGA 1SKBA 1M2OB 1T6YA 2OD9A 3EGOA 5LQKA 4ODIA 2HF2A 2ODWA 2OHOA 3DM5A 4TLDA 2A0FA 2B7BA 2NO7A 4P58A 1B8OA 3SYNA 4YFYA 3PYLA 1O97C 1WE2A 2I4MA 3HB7A 4BCBA 4MV4A 4YUVA 4ID3A 2AX4A 3H5NA 3K4QA 4YWJA 3ZCPA 4BJ5A 2R6AA 3I5MA 2H85A 2J7PD 4HV4A 1YR3A 1VZ2A 2G72A 2YZNA 3C5WP 3EVCA 2R66A 4C2BA 1Q84A 2OL4A 3B89A 3OT1A 4WSOA 4D46A 3N2LA 5AW2A 1CBUA 3X1JA 1JXAA 5AJTA 5EWJA 2JLBA 3V8VA 4BQFA 2WB2A 1TCBA 3Q2OA 2VWPA 1WR8A 2HPHA 3DV0B 2NQ2C 2WTXA 4ZU3A 4OP3A 4B3JA 4V0QA 2GK3A 2Q4EA 3EVFA 2FSIA 3SM3A 2FY8A 3SVZA 2G7ZA 4WEOA 3VHXB 2XTAA 4W1SA 2LUOA 4M0KA 2GBFA 5I8WA 4ED9A 5L4LA 2X4IA 1DELA 1Z3IX 3BDVA 4TS3A 1QKIA 5DGIA 5FYQA 3UATA 3QWIA 3WQRA 2EFYA 3EVBA 3P4YA 3RPEA 3BBLA 2GEFA 3R0QA 4GPTA 4TROA 4P5DA 3UM9A 1LTKA 1GL6A 2GRJA 3P9ZA 3QLUA 4RU1A 3U62A 4JSRA 1KARA 3PNYA 2VTBB 2HRDA 5ALXA 1ZIOA 2I8AA 5AXAA 4EZEA 1YNOA 2CNWA 2O1WA 1BDIA 2B0CA 1NLZA 2G6TA 2HCTA 4N18A 2VT2A 1KDRA 1KH3A 3LYUA 3KV1A 4JGGA 4BQNA 4D8VA 4G9EA 4XE5A 4DXHA 1EJ6A 4G5XA 2XQKA 4BX8A 3NORA 2P6UA 2BD0A 1GM5A 3TAXA 4WADA 3T12A 1Q7BA 1SM4A 1JRLA 4YX9A 1YCFA 2XCOA 3UMGA 4LJRA 4YCJA 1WLYA 3NHRA 3ZV7A 3KQMA 3NPAA 1QRDA 4MB2A 3NM4A 1L4HA 1PJBA 1EFVB 1SHJA 4ZYWA 1XDZA 2XOKA 3LA6A 1P2GA 4J07A 4M1WA 4MWEA 4UVEA 4X20B 3I39X 2Q9CA 3OLQA 2PVPA 3URMA 1QFMA 4BEBA 4B6OA 2PWBA 2WPDA 1TF5A 3KXPA 1DB3A 3OUZA 3RKUA 2JAWA 2GKOA 2P40A 3O90A 4V1CA 5BVHB 4HB2A 1YZHA 4TLAA 4LCBA 1GJRA 5HS4A 2P5TB 2Q3JA 2X23A 1V45E 4M1KA 3SJBA 4C6HA 3RTDA 1U5CA 1EWRA 1PTJA 2AZTA 1U7WA 3JYNA 1KEUA 3M2PA 3MWYW 4NZZA 4Q15A 3NBFA 3MRSA 3I5UA 2XMCA 4JQOA 4M0UA 2P69A 2BM0A 4JELA 4MQEB 2QTTA 5ER6A 5HKLA 1EFRA 1E98A 3HBNA 5COBA 2YFYA 1FUKA 4G4GA 4AZ0A 3DOUA 4W9NC 3KVOA 2PGJA 2VCYA 3W9BA 3DDWA 3Q3GE 4FDUA 2CNWD 5T4HA 2C5SA 4QHTA 3U4AA 4CIYA 4HWOA 1MV8A 2D8AA 2I78A 4ZT7A 5CFLA 1FTSA 1D8TA 1ENYA 3TIXB 4IPTA 4UJ5A 1EVQA 2PX0A 2I4TA 1MW9X 3A3OA 3DE2X 2ZUDA 1QVVA 1SVWA 1UKCA 2HJVA 3ITDA 5C8YA 4B7CA 2RGCA 2WV7A 2GF2A 3DTYA 3HADA 1VL8A 1M7BA 2COEA 1DTSA 4QDKA 2J5QA 4Q01A 3A28A 5IH7A 5FLXA 1XMXA 4L51A 4CEHB 2P4SA 3WJ2A 3KT0A 4URUR 2JC3A 2UU9B 3U60B 2OQIA 4IDBA 4LQDA 3TINA 5TMPA 3FYUB 3FJYA 1ZCBA 3R9KA 3QEOA 1EIWA 4N3GA 4JX9A 4KXNA 5HKKA 3W9UA 3QKRB 2Y71A 2DPYA 4MPTA 2PUCA 4L9RA 4YN3A 1VG9B 1T3HA 2ZSHA 3DTVB 1RQGA 5HILA 4EYOA 2ENWA 5KYUB 2XHEA 3U44A 2H16A 1AMUA 1RC8A 5EP1A 4PPYA 4CG1A 1EFRD 4ZD6A 4ACAA 4LYDA 2ZCUA 5HKAA 1WG8A 1YL5A 1W5SA 2IUFA 2AW3A 3IAM1 5DYYA 4B3RB 2QB5A 1CZKA 2O7SA 4YHBA 3PR3A 2QTMA 1E8DA 1TT5A 1J23A 3BHMA 1X2BA 5J2UB 1GKIA 3G5LA 5DNEA 2MSWA 1PLLA 2QY9A 3RTCA 1XA0A 4HEA1 3CZ5A 2ZYTX 1W5TA 5HQJA 2IU0A 5A4FS 1ZVKA 1I3NA 1MQSA 3Q2IA 5JR3A 4NCXA 4IOLA 2IIBA 1KP3A 3CGGA 3OTWA 1PNTA 3QVSA 4G4IA 5LOVB 2Q50A 2FMTA 4JQSA 3MGKA 1B0UA 4LDJA 2H0QA 2PLRA 1N5RA 2SKDA 3BYZA 4H27A 5DSXA 1KEPA 2ZI5A 4NWIA 2FW6A 2Q0SA 1KVQA 2EJWA 4V2IA 3CFYA 3LV8A 2EWMA 5G41A 2ZT7A 4DDVA 2AI2A 1CZRA 1HFJA 2Z2YA 4HNQA 3E5NA 4IQ4A 4GQIA 5SYAA 5K0SA 1E58A 3KQHA 2PS0A 2A6PA 2J6IA 1NMEA 1Z3CA 1PJRA 1T15A 1A98A 4RFSA 2NIPA 2Q1SA 1DV2A 1MVLA 3IV6A 5DCWA 4E7OA 2QVLA 5F21A 5DYTA 4BNDB 4RNCA 3S2GA 3K9LA 1ND6A 2Z1NA 3OKCA 2RAPA 3PZBA 3U2QA 4KQMA 5CG2A 5LCXA 1JDPA 2RC5A 4LV8B 4HX5A 3TM5A 1C30A 1EAYA 1Z4JA 1N9KA 4W82A 3VAYA 5KTTA 4KRFA 3W7BA 4RTRA 4HADA 5EXTA 2QJFA 1CRPA 4MB0A 1LDNA 4MKHA 2Q0XA 2H52A 3DKKA 4NZYA 5BXYA 5AM3A 2NO6A 2P2NA 1FJHA 1U9ZA 2P1RA 2Y6UA 4LY0A 5U1PA 1QE3A 3QTLA 4I1UA 1Q0TA 3D7RA 3I73A 3AL3A 3REOA 5HQTA 4F12A 1OLSB 3OAAD 5CW2A 4LZPA 1YV9A 3S99A 4KIUA 2B5VA 1HE1C 1T1RA 3H2GA 3KEMA 3IUJA 4BJ3A 1B41A 3OZ7A 4YBZA 3F97A 3WNDA 2J6HA 2SKCA 4L2IA 3GLFE 3C4JA 1X92A 1VHWA 4LYAA 4BAZA 5TQ0A 4DCVA 4GBED 4DPKA 4IZHA 4Y2SA 1ZA1A 2NZUG 3L1VA 2IHVA 5K0EA 1WP9A 4HRVA 3QVKA 1IVYA 1DZ3A 5AUNB 5HYVA 4GE0A 4L3WA 2AOWA 3EMKA 1BVYF 3FYCA 4HH4A 1PFWA 1P1IA 4JJFA 3PQEA 4I08A 4OU4A 2NPOA 5DNVA 3L6BA 1CQPA 1UP6A 5A9SB 2IH5A 1KMCA 5E8JA 3TTXA 4IGIA 3WGZA 3G0IA 4Z4IA 5BWLA 1FTWA 1GPMA 2WIDA 5ESRA 1SKYB 1WSDA 2FEOA 2ZKIA 3FLMA 2C96A 2FPSA 4QUAA 2P11A 2EQBA 7MDHA 5JBNA 1NRJB 3AR7A 4QFCA 4PFSA 4AJJA 1N2ZA 4C2AA 4P0QB 4N48A 3AEYA 1QMPA 1YB7A 1MABB 4FDLA 2H2DA 4NXNB 2B92A 4MWSA 2MYPA 4DV5B 3NAQA 5KVVA 1P8AA 1VKNA 1PU2A 1HE5A 1HZJA 2DFDA 2FZWA 3H9GA 3OFSA 2VP3A 1AE1A 1H5NA 4M1MA 1C4WA 2QW0X 1VL2A 1F6DA 1QR6A 2B35A 2QT1A 5FWDA 1B1CA 5DN9A 5CK5A 3V2HA 3M5DA 4UTNA 5ED4A 1NU8A 2AA3A 2LE0A 2R3SA 3LWZA 4MGEA 5EJ2A 4BECA 1C0PA 5JRJA 2VHYA 3BL8A 2ID4A 3DR5A 3RYIB 4N76A 2H18A 2VF4X 3SQWA 4QXPA 2HLNA 3GLFA 1G8SA 2FV8A 2D4HA 2BBSA 4GOXA 1LSUA 2QG9A 4FI3F 1E3SA 4LK2A 4N3BA 4BWFB 1XRLA 2WICA 4K6GA 2IYSA 2VDPB 2WD9A 4I50A 1W6RA 5FO0A 4J49A 3C3XA 4TRRA 3UGQA 3AI3A 4FXOA 1LD3A 3AR2A 1C7ZA 1C7IA 4KK4A 3HJBA 5BMOA 1HI9A 3IJRA 3RV4A 2UYGA 4M37A 1RZ3A 1Z4IA 2QZ4A 3LHIA 4O4HA 1NVBA 1EFAA 1GD1O 4PV7A 5GAJA 1DXHA 2XCIA 4C08A 1L6IA 3UUWA 2R1VA 3GGCA 3FD8A 1OFTA 5A7FA 4OQ4A 5AM4A 2FPWA 3PGLA 5CM2Z 1WY7A 1P75A 2VHJA 3CM0A 4UCQA 5AW1A 3R9XB 3AESB 1EQAA 3DOEA 2Z2IA 1M9NA 3CUYA 3KPWA 5EXDA 3MWKA 3TRIA 3LLCA 5K3DA 3RBXA 4EKIA 5AM2A 2PA0A 2H1IA 3PKJA 4EECA 4XVCA 2JVIA 4CKWB 1UEJA 3GYBA 3DPUA 4GMDA 1AMNA 1WW8A 2BRUA 1II9A 3FFXA 5K8LA 2M2IA 2SCUB 2EDCA 3WRXC 4DCNA 5JSKA 1HGXA 2PWZA 3TTVA 3CEPB 2D3TA 4YT4A 1XRSB 1ISMA 4F3KA 3Q7QA 1AQNA 1ZRSA 3UJPA 3W34A 3IAS1 5EHIA 1DWPA 2UAGA 2A5GA 3ZWWA 5I4BA 2ZFUA 1UC9A 3Q7TA 2HV8A 1WD7A 4JP8A 4A0QA 3UKJA 1P7CA 3OZFA 4ENPA 4E5PA 3HMKA 3V2IA 2Z83A 3QFRA 2GHIA 4CR6A 1L4BA 1P6XA 1EVJA 2ODBA 3TQOA 1ZK3A 3RSSA 1J2JA 2VH5R 1VE1A 1SCAA 3QKWA 3UJDA 1MJFA 2I1LA 1Y80A 2QJWA 3M6UA 4LWPA 1WCXA 4O2AB 4ZI7F 2G9VA 3ZCUA 1GQRA 1H69A 3UJ3X 4B6FA 3GDFA 4R68A 3UOGA 3JQFC 4XSVA 1QYXA 3ODGA 3WE7A 3BJMA 1G2OA 5HP4A 1Q50A 4GRAA 3MVEA 5DTMA 4F2HA 3ZNPA 2YX1A 1F2TB 3CNEA 3FF1A 4YT5A 4K8RB 1EKXA 4AQDA 2O48X 2F64A 5TS2A 4LG1A 4K6OA 3GN2A 2QLBA 2XGMA 3IURA 1RWXA 1YI0A 3OF2A 3QELA 4KNYA 4HDRB 1O0BA 1ZRNA 1PG5A 3MJRA 3B7WA 3OU6A 1OVMA 4MVJG 4KUGA 4NC9A 2PSFA 4EO7A 2DWCA 2C82A 2VWGA 5HXAA 1WULS 5K2MA 3BZWA 3RIGA 1HQCA 1A9TA 3WIUA 3D0QA 3C98A 4H3VA 5DBOA 2FAXA 1W2GA 3KWLA 1MB4A 2VFAA 4FNMA 4JQZA 1S4MA 2Y1FA 4GEKA 1XD2A 2AJBA 4MS1A 5AKYA 4O29A 4ZCSA 2BEVB 5B55A 1M6NA 1K4YA 4BGUA 5ERGB 3VNRA 5T4FA 5EKDA 4J1TA 3R8FA 1RAHA 3W8RA 5LIPA 2I8LA 1RWOA 3DLIA 3G1TA 1DS6A 4QDXA 4X00A 3Q10A 2OK8A 2FXIA 3OZTA 2TRSB 4QRHA 2Y0DA 3EFOA 4O02B 3ROZA 2QMHA 5FNVF 1NBIA 4ZTBA 4D4MA 3RVPA 4BNZA 4ARIA 3SCZA 3VR5A 5B1IA 5BUSA 5JD5A 2FQYA 1MX3A 3AFGA 3EULA 3NEPX 1LLFA 1QTRA 3P45A 3EQ6A 2PQ6A 1R2QA 1EHYA 1H6DA 5LNK1 2OBLA 1NP6A 2JKVA 2WZCA 2X22A 1J22A 4PZYA 4GLFA 4DCCA 2V65A 5DRTA 4H3KB 2W2QA 3DW3X 3UJ7A 1YVUA 1XJ0A 3DXYA 5IJ0B 5JC1A 5AVUA 1OLUA 5LZ4A 3OPXA 1PX0A 1OFUA 5BN3B 2QRUA 1DAHA 2NZ8A 4LNAA 4M3NA 1Y63A 4MVXA 1EWQA 3P9KA 2H92A 2GCOA 3R3VA 5KNBA 1D4OA 2CK3A 4U5QA 3VPHA 5KJCA 4HMOA 2Y1CA 3VAAA 1F8FA 1DKOA 4OA5A 3HDQA 3P9CA 5IPFA 3X2SA 1IB0A 4XPIA 2NVUB 2LZ0A 1Z18A 3QTBA 2XRMA 1U8ZA 1MTOA 4LXXA 3U9SA 1A8PA 3VZCA 3ESQA 3KU1A 3ZI0A 1W87A 4IZ6A 2CLCX 1QIHA 4RVUA 5D6OA 3F5MA 5ALWA 2C5LA 3Q15C 4E3WA 4CLRA 2QTZA 1Q0RA 4M98A 5DHUA 1DIOB 2Q3HA 2VDWB 3ROGA 3IULA 4BVHA 4GH5A 1YONA 1ZMRA 2QYSA 1Z2NX 3MBKA 4H1VA 4YRJA 2A94A 1M54A 2EYQA 4MYUA 1T25A 2M1ZA 4J7AA 3ZBQA 1S6YA 1MC8A 5TS3A 4YUXA 1IN4A 2REQA 1KVUA 1TLFA 2DFVA 4KIJA 3GDHA 4Q3OA 2OM6A 2ETVA 5HOEA 1UC5B 5CBPA 3PIDA 1A5SB 3KUKA 1MG0A 3DDNA 4GOOD 4V03A 6ADHA 4FKMA 2XADA 2YXDA 4K28A 2PVSA 4E46A 5GVSA 1TTTA 1X6VA 3HR4A 4N0DA 4OYHA 5KNBD 2CDNA 2CK3D 5D3KA 4UHBA 2QLJA 3FPEA 1W0CA 1ZFNA 2HXGA 3ILXA 3D64A 3P9PA 3RT7A 4A8JB 2YOHA 3SKXA 1L5NA 2FSFA 2ON6A 2XB4A 3AQ4A 2GPYA 2VQDA 3IDFA 4MO9A 1JBQA 4QU5A 3E61A 4YCCA 1XMOB 2JFPA 3MCAA 4WLOA 3ZVRA 4OFWA 4Y1GA 4K9QA 2HHJA 3N2IA 5HA5A 1FDOA 1IHUA 2CYCA 2GJKA 2YW2A 4QNRA 4TRNA 3ROEA 3FLEA 2WTAA 4O5OA 2ZGVA 2OPHA 2YRFA 4HQKA 1NJFA 2G5TA 3KSUA 4AJLA 4BOYA 4B74A 2I7XA 3IT0A 4DCMA 1E3MA 4NCNA 4RJIA 4I8DA 1QR2A 4TTVA 3SN6A 5DV9A 3A31A 3Q7IA 1VECA 2DFPA 3R5TA 4KCGA 4D9CA 1PLKA 1T0IA 1CY7A 4TT3A 5K99A 4XXHA 4X8MA 3RVRA 2ZJ6A 4LXQA 4R2MA 1HETA 3E5MA 3I6QA 4UC0A 3VX4A 3L7YA 3G0BA 3H4IA 2AMJA 4FD2A 3ZZUA 3VC1A 2AZXA 5EEHA 2BKXA 2NZ2A 2HTEA 1VFNA 2XECA 4JEMA 5KNDH 5SZHB 2YCLA 1ARZA 1KEZA 2EZTA 3AEXA 4Y98A 3FKJA 3P9SA 2OEPA 5DB4A 5MFZA 3JAKA 3X2FA 3ZBTA 4L6IA 1RC0A 3PQ8A 2CV2A 2V6IA 1QIJA 1R0WA 4MEBA 4O33A 3WV5A 2P7IA 2DTXA 3HCFA 5L3RA 5FCDA 3SICE 1E32A 4TKVB 2EX0A 1XWWA 1A9YA 1M83A 1O89A 1CUUA 3EJ6A 3ND9A 3QWFA 4E5VA 3RF6A 1ML3A 1X38A 3CF2A 3VTKA 5JLJA 4YJFA 3GXOA 1A7AA 3OCUA 1QQ7A 3ABSB 3GJQA 4PN7A 2GK6A 5DM70 2D1SA 1BS2A 7YASA 3JAWA 2CHQA 4A1FA 2NPIA 1N8KA 2AK3A 2XIQA 4XKJA 1SB8A 2GKSA 2PMWB 3DGFC 5AR1A 3HRKA 3PIRA 4Q0MA 3AIOA 4D74A 1Y1PA 2PBFA 5EWMB 2I6UA 4CMIB 4Z0PA 3L8MA 1NUUA 1ZD1A 4RK1A 3UC5A 3ONVA 4DA8A 2FZCA 1JDUA 2YMQA 1ADBA 1NVWQ 3DZCA 4TT3D 4UM5A 5DO9A 3V1MA 3BK2A 3QVMA 2V5VA 1Y8QA 3DT6A 3ZCQA 4YAIA 1AKMA 1R66A 1R1DA 2FFHA 3DBIA 2DC1A 1PT5A 2JIQA 3C6ZA 2BR5A 3O2NA 3BA6A 1A7KA 1XVLA 3Q8LA 2IVFA 3D4IA 1P1RA 4RIFA 3I9V1 3WWYA 2NTVA 2IYFA 3K9BA 3BTSA 3R8CA 3FBTA 2JRCA 4L5CA 4DA7A 5AVZA 4BUCA 3ZY3A 1IXZA 1I4EB 4F06A 2Z04A 1SVLA 3EIXA 3K15A 3KS9A 4ZAXA 2ST1A 3EVNA 1O08A 5K2OA 2FZ5A 3OZEA 4YNBA 3WRVA 3OQHA 3MJ4A 4FE3A 2PRKA 4KYIB 3RODA 4OKIA 2WEKA 1GSOA 5AD1A 4QFMA 3QU9A 2CDCA 5FPQA 3TRFA 2I3ZA 4AURA 1C3OB 3FDXA 5ICEA 3DWFA 1TLTA 2J0UB 2VNJA 3A37A 4ZCMA 3FGOA 2GT1A 1JMKC 4NEHB 4ABTA 2NAPA 3WLMA 3Q5EA 1HDEA 3LQKA 2OAGA 4IIJA 721PA 3ET4A 3RSQA 1ZQ1A 4RGVA 2XYHA 1JE1A 1MAUA 1QE0A 3Q7RA 2TECE 3ANMA 1DFHA 3DVRX 3HB1A 4FBMA 4IH9A 1V5EA 2A57A 2G9UA 2WU4A 2Z9DA 3FOCA 4ZO9A 5AW9A 3S5JA 4F4UA 4TZKA 5K01A 2DBYA 3JARA 6CHYA 1DZIA 1WVGA 4X93A 3M1LA 1YRYE 3ZJYA 2VZLA 4OU5A 3HNPA 5KAPA 4BNUA 1SMKA 2DF8A 4EENA 1RZUA 2VVTA 3MXTA 2PO5A 4IF4A 4JB2A 1PGPA 2V5UA 3PWTA 4JXJA 2W4MA 1JECA 3DBVO 3PRKE 3C6MA 4FHEA 4LDNA 3EG9A 1ML4A 1XPJA 1D5WA 2X9LA 2XW6A 2J4DA 1KXZA 2Q0HA 3OOJA 2PR2A 4FPXA 3UT5B 2PEYA 4BKQA 4KPYA 1J2TA 1QU2A 3VPDA 4E30A 1NONA 3BIFA 1PO7A 3AEZA 1OTYA 3LCMA 3OA0A 4OHCA 4GZ3A 1XK7A 5FFMA 1T4BA 2ZATA 4B2LA 1ZWLA 1Z4OA 2XYRA 1ZDMA 3RUAA 3ZBPA 3DD1A 3NVMB 4YJGA 3BHNA 5C8ZA 1MVNA 2QYOA 1TJ5A 2WYIA 2PZLA 5I5EA 3WBKA 1Q20A 5AI6A 5K0ZA 5EZ6B 2WFLB 4IG4A 4N39A 1HORA 1MU0A 1BDJA 1Z0IA 2O8VA 1CNMA 5CNJA 3T35A 4LOAA 2OO3A 3N76A 1Q21A 2I3AA 3FLBA 3I9JA 3QI2A 4J43A 4CL2A 1P2DA 3BJZA 2YINC 1KQGA 3K92A 3ESYA 5AVWA 2Z57A 3RSLA 4R7TA 4BLPA 2JFGA 1T1SA 4C7OB 1LUAA 1TMYA 4Z0NA 1PL8A 5CLFA 4QSMA 4GOJA 5BYAA 4MUEA 3AUSA 1YMUA 1UIRA 2F00A 3U9LA 4FB4A 1DJNA 3DAOA 1EMDA 1KZ1A 2QGFA 5KYVA 2AYXA 4D2IA 2YTZA 1BCSB 2LD4A 2QROA 3NZEA 4YQFA 3QYFA 1GCAA 1T3TA 2WNHA 3GEBA 4YP7A 1HSZA 3IBYA 4XIFA 3WHLA 4F9FA 1EUZA 2QGZA 4NL4H 1Z56C 4NOJA 1A97A 5BYKA 3GJRA 4G8JA 3VRHA 3WFZA 1BWSA 4KO4S 4FFVA 4PQYA 4WIAA 4EA8A 3NHZA 2ZTMA 3JZAA 3PEFA 1ESEA 1E4VA 1K8RA 1IHOA 3FPSA 1YMQA 1W30A 3LUCA 5EZYA 5G02A 2QLTA 3SU8A 4CYMA 3E5HA 5HBRA 2FW7A 3ND5A 3VZQA 1MB3A 4BZXA 1J5PA 3ICCA 3DZGA 1ORHA 3C7DB 1Z8NA 3HJUA 1AHPA 4TLLB 1JPNA 2FWRA 3B2NA 3BEDA 2QN9A 3AEKB 4AWAA 1XKXA 2ILTA 1RZVA 3PUYA 3OIVA 1ZGZA 2FR8A 2MIIA 1JLHA 1RHQA 4OXNA 4KTVE 4M8LA 4N5HX 3TGPA 1ISPA 4AQ7A 4HPJB 5I8PA 3D6JA 3GJYA 3ECSA 3MMXA 3H4TA 4I1IA 2HHHB 1D04A 4J0EA 3HI4A 2AEJA 3UUFA 3Q1KA 4EFLA 1RKUA 1IY2A 2WMDA 2OO5A 4X62B 2RGRA 3VTFA 3ZXYA 5CT6A 2XSZA 4IEFB 1CD5A 5AJHA 4Z7OB 4EJSA 4ANFA 1ZM4A 1QQ6A 3ND6A 2ZUBA 2YYSA 3AW9A 3GEGA 4JFAA 3IIIA 4L0DA 4R9RA 3DVQX 2ZI4A 1D2AA 3IHLA 1F38A 3MT0A 5EUQB 1CE8B 2ZIZA 1CX9B 2BGRA 3QWAA 4C1BA 4L57A 4GC9A 4DB4A 3D7NA 4IXTA 2ZJOA 3H13A 4Q4HA 3V9PA 1TZCA 2PL5A 3ZE1B 1XPRA 3FVWA 3L02A 3WBBA 3O9VA 1J0DA 2YMLA 2O3UA 3GPCA 3STTA 4AL4A 4E0BA 3AFHA 4YRZA 2FDCA 2FPRA 3P9IA 2IEZA 1QGOA 4ILKA 5DTQA 5BPFA 3OOWA 5TSDA 3UXHA 4DGSA 2UVDA 1GU7A 2C4TA 2F1KA 2RKBA 3AHJA 2LPMA 2VPYA 1N36B 3RRMA 4EG1A 1CIJA 1EX9A 1A77A 1CFZA 4OJQA 1E0JA 4N6OA 4GPZA 4TXMA 2NSDA 4A7PA 1H6CA 1Z06A 2IY8A 3H8WA 4BC1A 1W0JA 4W99A 1T2AA 4IXNA 3D1VA 1AMOA 4ZZ1A 1SUIA 1KWKA 2CNBA 2XSZD 3MUNA 5DHPA 4B87A 5GP1A 2LP4Y 5LBUA 3VMMA 1UZAA 3ZDQA 2JAQA 1WQ1R 3GEHA 2J6BA 4ND1A 4WE3A 1NQUA 4FYVA 5DMHA 3T7DA 4IQ0A 1LWOA 3KSDO 4QULA 4XSGA 4EY4A 1QFSA 3K70B 1N6HA 1VIMA 3LLSA 3VJLA 3RV3A 3S8EA 3MBIA 4E7PA 3JQ9C 4ZOLA 3LWBA 3CIFA 5G53C 2JGKA 2AQIA 2FG6C 4FNGA 4HZUA 4TQUS 3WIEA 2W0SA 2Y1GA 3IQHX 4HL6A 3EW9A 3KPJA 4ZZIA 3WLAA 1BX0A 2XXAA 3QFTA 3QUCA 5A0VA 4HB4A 1AZWA 4EZBA 3DEHA 3E23A 3JSXA 3X1KA 1U8EA 5JO9A 4ESHA 4NU6A 4X7MA 2IYOA 2VCEA 2PX8A 3U4IA 2PT5A 4HFJA 3M1AA 4KR7A 4NDAA 3B1VA 1Z25A 3ZOKA 2CCGA 2OCXA 3OA2A 1QZTA 3C1TA 5LDHA 3G2NA 1A04A 4HBGA 1VXRA 1HNZB 4ZCPA 1YD7A 1B0PA 2C95A 5DEIA 1E6MA 1N6PA 1BE6A 1DCKA 2HSZA 4BP9A 3FG9A 4TMXA 5EQFA 2P4QA 2QE7D 4R84A 3G2JA 5C37A 4QYIB 3OCVA 4NG4A 1DDOA 4JL5A 3PC4A 1EAMA 3FZYA 4MTLA 2CY0A 5EJFA 5M29A 1DOAA 3KCNA 3HCEA 3MWGA 2CEAA 3RVOA 3VSEA 5HHTA 4C4YA 1YGPA 3LECA 4E2WA 1FFBA 1FUEA 4FW8A 4X1YB 4B3DA 1CP3A 1XZNA 2AOTB 4B3FX 1JFRA 1JG4A 1ESDA 1UF9A 4C0SA 4GL4A 1FXWF 2I4IA 4Q1DA 3LNCA 3C6XA 4HN9A 1OI2A 1WPXA 4W1QA 4CKBB 5BXQC 3C7TA 5HCUA 1KEKA 4OOEA 4RWEA 3JAMA 4R1OA 2GA9A 4AY3A 2X0EA 1P1JA 2OD2A 3NYRA 4WCDA 3M7IA 1U65A 4L6AA 5IKOA 1R0ZA 3GJ3A 4U2FA 2CNDA 3KOYA 5D3MB 4BLTA 2EG9A 3HFGA 3RBZA 10MHA 3NX4A 1H5UA 4G25A 5IM4A 2QTAA 2WG0A 1J0CA 4ZO4A 2GN1A 5TRTA 4ND5A 2E49A 3AF3A 4UTZA 1CUBA 5UKDA 1QO0A 4RQBA 3BFVA 3DGEC 2A1UA 2WJ6A 4N0PA 3M6WA 4XIIA 3TZCA 4IIVA 2C04A 3OTIA 3IBCA 1E4YA 1XT6A