4X94A

Crystal structure of lysosomal phospholipase a2 crystallized in the presence of methyl arachidonyl fluorophosphonate (hexagonal form)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
376
structure length
376
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Group XV phospholipase A2
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 130
structure length 376
sequence length 376
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x94A01
4AMYA 1F0NA 1CUFA 3V1KA 1USWA 3R3XA 3FCYA 1VJ5A 2WU3A 3R40A 4DIUA 2I3ZA 2VAVA 5A62A 5ALMA 3O4IA 4MJ3A 1ZI6A 2DHCA 2ZSHA 2WIFA 4C4ZA 2H7CA 2QJRA 1PFQA 2XUDA 4PO3X 4C89A 1UWCA 2XQJA 4Y2PA 4JNCA 5HQ3A 2ROQA 1M33A 3E3AA 2OCGA 4MYDA 1AX9A 2VATA 2VJAA 3V1MA 1MJ5A 2XB6A 4PW0A 2XQGA 3E0XA 4FLMA 4WFKA 5CTAA 5SYMA 1MN6A 4JYMA 4U2FA 3VVLA 3BF8A 2GYWA 3IDAA 1H2WA 2HA6A 3DD5A 1QFSA 3STVA 4G5XA 5AKEA 2C7BA 5FXMA 3RK4A 5ALIA 1R9NA 2DQZA 4X6XA 3RKSA 3FLBA 1LBSA 3FYUB 4Q82A 4J3JA 4UHDA 1YR2A 1QIEA 4GI1A 2XDWA 3WLAA 4FLEA 2XMGA 5C8ZA 1TCCA 4YASA 4JYPA 5BV7A 5JAOA 1X2EA 1EVEA 1NU6A 1X70A 5D7BA 2FJPA 4F21A 4PNZA 1UKCA 3QBJA 3IVMA 1BN6A 5JZSA 2WG1A 2OQVA 3WK9A 4OB8A 4O08A 2QUBA 4HVTA 4XIIA 1PV1A 1XRPA 3FOBA 5E4YA 3QPAA 5CBKA 3I2FA 1BCSA 5C7YA 1VOTA 2QTBA 4UBMA 3ANSA 3KOOA 2K2QB 4J0DA 3W04A 5AKGA 1S8OA 1ZIYA 4UBNA 1QLWA 5CH8A 4OSEA 2I78A 4HXFB 5ALDA 5AJHA 3G8YA 4DNFA 4GDMA 3N0TA 2OCIA 5ALFA 4AN0A 1MX5A 4H18A 1E8NA 4LYEA 2XMCA 1XZDA 1Y37A 3AJAA 3H2JA 4FOLA 1UK7A 4J7AA 1CIJA 3E1GA 1JT2A 4DNOA 3H19A 3PUHA 4AO7A 5IVHA 3AILA 1XLUA 4K6HA 4EY5A 4QLOA 2OPHA 1XLVA 3PFBA 1EK1A 3EQ7A 5A2GA 3R3WA 5AK5A 1AZWA 1YAHA 1UK8A 4PF1A 2ECFA 1MNAA 3ESBA 4RPCA 5JIBA 4QA9A 1XZHA 3AUKA 3BL8A 1YASA 3A2NA 5AKIA 2QUAA 4OCZA 3G9TA 1DT5A 3IBTA 4X90A 3JW8A 3GZJA 5ALRA 4F0JA 1XRLA 1F0PA 5K5EA 1H2ZA 3UUFA 5JADA 4H7JA 2JGEA 2WFMA 1CUUA 3GBSA 1XZBA 4CCYB 2ORYA 2B20A 4L9AA 5EI5A 2JGJA 1I6WA 4CG2A 5K3FB 1ETHA 1EINA 1U8EA 2QXTA 4I3FA 3QMVA 3L1HA 4H35A 5FDFA 5H3HA 3WA7A 2XMQA 3TEJA 3RM3A 4UBIA 5HKBA 1CUGA 2VQ6A 1L7RA 1XZMA 2QM0A 3OURA 5ALQA 3WIOA 4HTAA 1QTIA 5AICA 1EDEA 1PJAA 2XUPA 1OILA 2XUHA 2V98A 1EDBA 3WK8A 3FYUC 4X6UA 1WB6A 3I6YA 1EA5A 2J3DA 3FYTA 3QZUA 2XMRA 2R8BA 4AX4A 4BC0A 3V48A 3D4LA 2BJHA 5LKRA 4ZI5A 4FNGA 5JASA 5JD6A 2VA9A 4CCWA 2AXEA 5K3EA 1HKHA 1J06A 2QMQA 2HA5A 3OTQA 3Q8WA 1DWOA 2XUJA 3NOXA 3F67A 1CUHA 4OU4A 3WL6A 1Q84A 1JJBA 1A8QA 1WHTA 2XUAA 5ALHA 5AM4A 3NGMA 4BB0A 1YA8A 5AK6A 1U65A 5K3CA 3K9BA 2VTVA 2H7XA 3GROA 2YASA 3I1IA 3O95A 4C6HA 1IVYA 4UUQA 1N5MA 4DNQA 2GBGA 3STXA 4KEAA 4HAIA 2PM8A 4N8EA 1QIHA 4J0GA 3ZPXA 5ALTA 3IUMA 1XRQA 4AXBA 4Y2JA 4ZV9A 4KJXA 3L1IA 4UHBA 1R9MA 2QZPA 5JD5A 3GUUA 4KE7A 1O6FA 3ICWA 2JGIA 5E4JA 1ZD5A 4G8CA 2OGZA 3AFIA 3UUEA 1JJIA 3DKKA 4K2AA 4B81A 2BCEA 4BRSA 4BE9A 3KWFA 3TRDA 1TAHA 5AK4A 5CURA 4BAUA 5A7FA 3G9UA 3DYVA 5AH0A 5T4HA 3VJKA 3HRHA 4BTLA 2Z3WA 1UK9A 1C7IA 3STUA 4E46A 4TVKA 1QJ4A 4DSAA 5I8PA 1CV2A 4C88A 7YASA 1VZ2A 4UFOA 6YASA 1MTZA 2J4FA 1ISPA 4UPDA 3O4GA 1FFDA 4RNCA 1DWPA 3CXUA 1UT6A 1C4XA 5CXXA 3DYIA 5CMLA 4C87A 1RYYA 1OCEA 4ARAA 1HDEA 4IH1A 2WKWA 3IUQA 4Y2XA 2XI4A 1XZEA 2ACEA 2IITA 2RIPA 4DSZA 1H23A 1CQWA 2ACKA 2WG0A 2H1IA 3LS2A 5CH3A 5AP9A 4HZGA 1ACJA 2JEZA 3FVTA 5JAHA 4GWLA 1AKNA 4OB7A 1UZAA 2PSEA 1YA4A 3IUNA 4X93A 4Y2RA 1XRNA 5A7GA 2OAGA 3W2TA 2QXUA 2XLCA 3HZOA 4J03A 3FVRA 5E4TA 4HS9A 4GXNA 5EHZA 4C4XA 1WB5A 5IVDA 1UOPA 5AI6A 2X76A 4E15A 2WFLA 1LPBB 1AC5A 2CJPA 4Y2SA 1MU0A 3V1LA 1X2BA 3I6MA 2C4HA 4BP9A 4QDTA 5AI9A 4WJLA 2PKYX 3JWEA 3STTA 2BAGA 5AM2A 5CT8A 2WQZA 4LIPD 4P93A 1XKTA 2VEOA 2WTMA 2OGTA 3BDVA 2AJCA 4Y7DA 1LPNA 1DWQA 2YXPX 4L3WA 2PU7A 3R3UA 1QIKA 4QDZA 1N8SA 3H17A 1XZGA 3STWA 3ESDA 4PSUA 4UFNA 3WKAA 3WMRA 5AKJA 5AM0A 1W76A 2CEKA 5AI4A 5HFAA 1CVLA 2WM2A 1Z68A 2O2HA 5AK3A 2OGSA 3WJ2A 4ZXFA 4MQLA 2C0QA 2C5GA 5DNWA 5HQ3B 1CUWA 2XMBA 5HKAA 1VLQA 2XUGA 5C81A 1XZLA 3SWWA 2XUOA 3ED1A 2GBCA 1ZICA 2EEPA 1W52X 4G9GA 1CUXA 3EIOA 3VKFA 4ARBA 1GT6A 1SC9A 3H04A 3LIIA 4OD0A 1W75A 1EI9A 2Y6UA 1GPLA 4QZVA 3MVEA 4UHHA 3MGAA 4LHEA 2G5TA 3MUOA 4FWBA 4UFPA 2ZSIA 4OPMA 1XKLA 2P8SA 1JJFA 1XROA 2DHEA 1XQWA 3CCCA 5YASA 4EY7A 4BDSA 1IUPA 3I28A 4FTWA 1Y7IA 1CUZA 1LZLA 5FUMA 1JKMA 4EZIA 1JU3A 3ESAA 1LPOA 5KBYA 3DOIA 2GZRA 4W9RA 5LP1A 5KWJA 3T52A 4QE3A 3F96A 4BVKA 1QIIA 2HIHA 5AIBA 1ZD3A 2CKMA 5DYYA 4K6GA 2HFKA 1ZOIA 2XQIA 3IA2A 4X94A 1THTA 4B9EA 5CXUA 3DS8A 1ZD4A 4XWGA 4UHEA 3V9AA 4AMZA 5ESRA 1LGYA 2XMDA 4FBLA 4LYDA 3G7NA 1WB4A 5AKLA 4JEIA 3DCNA 2YYSA 1BE0A 3G0IA 1CUCA 2JGFA 3AZQA 2Y2VA 4N5IX 3WI7A 1Q0ZA 5DTJA 3I2IA 3C87A 1YSCA 4DGQA 2DR0A 1ZI8A 4M0MA 4UBJA 3G9ZA 4PQEA 4QDOA 2GYVA 2GBIA 1UOQA 1DT3A 1U2EA 1AQLA 4G8BA 1QONA 5ALSA 2O7RA 1VA5A 1CLEA 2ZJ6A 5IKXA 5HK8A 2JBWA 1DX6A 3KD2A 1K4YA 4X92A 4D9JA 2RAUA 1J2EA 3HYSA 1QGED 1MAHA 4G4IA 5K3BA 3HACA 3O4HA 2CZQA 3B5EA 1OXMA 4YX9A 5ALGA 5I7UA 4B7ZA 2WFZA 3ZV7A 4UBLA 1YAJA 3STYA 3H2GA 1TK3A 2WUDA 3WIBA 2XUQA 5CH5A 1EXWA 5AI5A 5JAUA 3EF3A 4F5ZA 5AO9A 2RHWA 4IH9A 1E8MA 3C6YA 1IUNA 4W1RA 2WJ6A 4FFVA 1CFJA 4BP8A 5AKXA 1CUDA 3DNMA 3IIIA 1T2NA 2PX6A 1P0MA 1YB6A 1G4HA 2J3QA 5HCUA 3BE8A 4H7EA 3C6BA 1GPKA 4W1QA 4Y2QA 1O6GA 1SFRA 1ZI9A 3G0CA 3WWEA 1YB7A 2PSJA 2EDCA 1IZ7A 1EB8A 3C5WP 1QTRA 3U0VA 2DHDA 3FNBA 1UFOA 3WYDA 2XQKA 2Z8ZA 4OYYA 5FPQA 4H7KA 3D3NA 4GLBA 3C6XA 4GHWA 3WWOA 1SCIA 5HF6A 3O9MA 1GZ7A 3WL7A 4X6YA 3QYJA 4LXIA 1J07A 1QE3A 1C7JA 1G42A 3V1NA 5AKYA 4BCDA 1H2YA 4Q3OA 4ROTA 5LYYA 1HLGA 3QPDA 4G4GA 2Q0XA 4EY8A 1ORVA 4WY5A 3DL4A 4BVLA 1G5FA 2GZSA 2WJ3A 1CUYA 3HC7A 5EHQA 2WILA 3H1AA 1LNSA 1GQSA 2X8BA 3O9VA 4DMHA 4HRYA 3D7RA 4MEBA 1EH5A 2HDWA 5K3FA 1E5TA 1HPLA 2OCLA 1Y7HA 2V96A 1DQYA 1P0PA 2B9VA 3CCBA 4Q05A 3R41A 2PL5A 1FFAA 3P2MA 3R3VA 1LPPA 3H2IA 1ORWA 4IHAA 5IH7A 1CEXA 1A7UA 2C5FA 2D0DA 2XUKA 1BEEA 2OG1A 2PPLA 1XZCA 5ALYA 1K8QA 3PDCA 5FV4A 2HU5A 1ACLA 3LLCA 4GECA 5ALKA 5A7HA 5BWCA 2WJ4A 3WK7A 4CIAA 5JATA 3HJUA 2QVBA 1XQVA 2AJ8A 3ILSA 1L7QA 3C8DA 1GGVA 1CUSA 5ALJA 1WOMA 4H7HA 5FOQA 4OYLA 2C58A 1ZD2P 3W9UA 4LXHA 1QO9A 3WZMA 3FCXA 5DNUA 3IB3A 1R3DA 5AI8A 3KSRA 1RWQA 5T4EA 4J0KA 2VT6A 5LZ5A 5ALNA 1CPYA 4BAZA 5LZ7A 5HF5A 2XUFA 1BRTA 4KRYA 4MWSA 3FWHA 5ALOA 2NW6A 4XVCA 4BBZA 2HA0A 4EA6A 4J0CA 3HI4A 4PSDA 4KAAA 1EB9A 1Q83A 2VJBA 5AOCA 2BGNA 4WFJA 3WWDA 1MT3A 1TIBA 2WG2A 1CQZA 4WDRA 2WIGA 5FP0A 5FLKA 4BCBA 2BUCA 4L0CA 3TJMA 3K6KA 1XQXA 3W9BA 3WK5A 4B84A 4A23A 4B82A 1WPRA 4Q1VA 4B6GA 2O7VA 1TCAA 4X7BA 4S0XA 1EX9A 3M82A 3WK6A 1E66A 3ZI7A 1BN7A 5I9IA 1CUBA 1VXRA 3D0KA 4JH0A 1BCRA 1QZ3A 4CG1A 1TKRA 1MX9A 4KAFA 1B6GA 3T4UA 4UBOA 3C8HA 3PICA 4BC1A 4GW3A 2WSLA 4BRZA 2HRRA 2VJCA 3DKRA 4MXDA 4MWTA 3NUZA 4WCVA 4CIBA 4B9AA 3QVMA 2WUGA 3I2JA 4EY6A 5A6VA 2PSFA 1CR6A 4ZV7A 3D5EA 4G8DA 2CB9A 3R0VA 3LIPA 2WHPA 5F4ZA 2HHAA 4DTCA 3PUIA 1ZGBA 3WWPA 2ZVDA 5JALA 3PE6A 1IMJA 2XMSA 1SOMA 4Y2VA 4I19A 4INZA 2QJWA 2J4CA 2WFLB 1HQDA 2RONA 4AQDA 3ZWQA 4I4CA 5DYTA 3WZLA 4U2EA 3GELA 3O4JA 2PUJA 4G4JA 3WKDA 3HLKA 3FBWA 1TCBA 3VJMA 4EUSA 1DQZA 1DX4A 3ICVA 2WHRA 1CUVA 2VSQA 3F98A 1VE7A 4H0CA 3KWJA 4BAGA 3E4DA 2H7YA 1F8UA 3D2CA 2DSNA 1E8DA 4KE6A 3C45A 5CT9A 4Q3LA 4V2IA 3F8SA 2Y1KA 4RE5A 4HXEB 5ISMA 4J0HA 1LPSA 4X95A 2FUKA 2BUBA 4CG3A 1XZKA 3CN9A 1NU8A 1H2XA 2HU8A 3DOHA 4QEKA 1MO2A 1ZGCA 3VJLA 5KWIA 3ZLVA 5LKAA 2WHQA 1XRRA 3AIKA 3ZLTA 3H18A 2ZYIA 3C70A 5AHXA 1W6RA 3S2ZA 5LIPA 4E14A 5A71A 4FKBA 1YS2X 1W1IA 3QITA 4BZWA 2HA7A 4OB6A 2HA4A 3B3QA 4DMCA 4EB0A 5LZ9A 1FFBA 5KREA 2ZJFA 3PFCA 3S8YA 3LCRA 1W4LA 3BF7A 2XT0A 4BVJA 4PSCA 1UK6A 3EBLA 5D3KA 2QKYA 2Z3ZA 2D5LA 1GKLA 4H7IA 4H7FA 1GQRA 1ZJ4A 4WDQA 1ODSA 5SYNA 3WYNA 1EK2A 3C6ZA 4KACA 2Y6VA 5C8VA 4P9NA 3I2KA 5CT4A 4OU5A 5D6OA 5E2IA 5EIHA 4Z49A 3QPCA 4DLNA 5JYCA 3A2MA 4Y2TA 2WUEA 1CUIA 2EDAA 3WA6A 5J3JA 1CRLA 4X3CA 4MEAA 1BS9A 3ESCA 1BEZA 4KYVA 4K6KA 4G1FA 4M0EA 4B0OA 3SK0A 5LZ4A 2H9YA 4WFIA 4AO6A 4KRXA 4X97A 3HEAA 1AMNA 2AJBA 1K63A 5DNVA 1LPAB 1UOOA 1A8SA 1JI3A 2GYUA 4B0PA 1JMKC 3G0DA 4Q3KA 1MPXA 3AIOA 2PBLA 1KU0A 3A2LA 3GFFA 1BROA 4QNNA 2HU7A 1A88A 5EIEA 3FYUA 4ETWA 1WPXA 4C01A 4NMWA 4B83A 4QLAA 1XZFA 1CUAA 5HK9A 5CW2A 1XZAA 5EHNA 4TGLA 1R88A 1YCDA 1YS1X 4EHBA 1DU4A 3B12A 2PSHA 1DINA 4FMPA 1XLWA 1ODCA 1VA4A 3YASA 5ALUA 2ES4A 3G02A 1AURA 4AB1A 5ALVA 5ALEA 5JD4A 2O2GA 3NWOA 1DTEA 4NZZA 5JZ9A 1R50A 5HF9A 3K2IA 2O2IA 4UHFA 3G0BA 3DQZA 4MQMA 4IH4A 2QT9A 2Z8XA 1QOZA 1L7AA 5K3DA 3UMJA 4IO0A 3WQHA 2R11A 1P0QA 3D2AA 4X91A 5K3AA 4A5SA 4DMKA 5AKKA 2WIJA 2Y2UA 4N8DA 3I6ZA 4DYHA 2WIKA 1MX1A 4QDUA 5JANA 3IURA 5C8XA 2JGLA 1QIDA 1GKKA 2FX5A 2OLEA 3QH4A 3KXPA 3H2KA 2OAEA 4AO8A 3W06A 1SCQA 3BDIA 1AGYA 1ODTC 2JEYA 1KEZA 5CRIA 2ZYSA 2JGKA 4Y9SA 4IQ4A 5AKZA 1HL7A 1EDDA 5T4BA 2I3DA 1CUJA 3DL7A 4FBMA 3WKEA 4XX1A 2OQIA 1F6WA 2B61A 1MAAA 2DFPA 1VE6A 4U2GA 4E11A 2QS9A 1WM1A 1KU6A 1LZKA 3FSGD 1H22A 3TGLA 4J0IA 1XFDA 3HABA 1QO7A 4W1SA 3N2ZB 4KE8A 3X3HA 1XZJA 2FJ0A 1UXOA 2E3JA 5D3ZA 5HFNA 3M81A 2WUFA 1FJ2A 2VAXA 2BGRA 3M83A 1RP1A 3C43A 1XZIA 2GBFA 3WKCA 4B80A 2PU5A 1FFEA 5FPPA 3I2HA 5DTIA 2WLSA 5ALXA 3ZLUA 3F97A 4YK7A 4U2BA 3QMMA 4ZGBA 4G9EA 3DEAA 1ZIXA 1IZ8A 5JZBA 4CCYA 4Y2UA 1P0IA 3WWCA 4GBGA 2XLBA 2G5PA 1QIJA 3CN7A 4HXGA 4CI9A 3WL5A 3VXKA 3IUJA 2W22A 3RARA 2G4LA 2BUAA 2I03A 5AKHA 1LPMA 2HADA 3H0CA 1ZJ5A 4W1PA 3DJYA 4H77A 2JF0A 5FRDA 2LIPA 2IX9A 5ALPA 3EQ8A 5ALLA 5EIAA 5BWBA 3AZOA 3D59A 5CT5A 4ZREA 1VZ3A 2JIDA 3SX4A 3BJMA 1R4ZA 3IULA 4A16A 2XQFA 3L1JA 3WKBA 4X71A 3AIMA 4FNMA 5DYWA 3G0GA 5LLSA 1LBTA 4EY4A 3EQ9A 2DCMA 4QWMA 3BIWA 4EBBA 4FFWA 4FDMA 1FFCA 4AN1A 3WL8A 2C0PA 3BIXA 4FHZA 4QDXA 4J0JA 3H1BA 1R1DA 3JYHA 2CUTA 5AM1A 4KE9A 2HRQA 1HBJA 2RHTA 3VISA 1XQYA 4N8SA 4X00A 3GA7A 3QM1A 3OPMA 4CFSA 5EFZA 4JUIA 1A8UA 4Q34A 3FSGA 1TRHA 3D2BA 4BYMA 5JARA 4DM7A 1NX9A 4TPKA 4K5QA 3HXKA 4BTVA 2HM7A 4MYSA 5AM5A 3AINA 4L72A 4B85A 2B4KA 3R3ZA 3BXPA 4KAJA 4BE4A 3SC2A 2RGUA 1VKHA 5T4FA 2PSDA 4XJVA 5DJ5A 4DMFA 2WTNA 1E89A 1MNQA 4DNPA 4M0FA 1QIMA 3A70A 4BCCA 3F9CA 2VT7A 3FLAA 1LLFA 4GEGA 3DDUA 1VXOA 2YH2A 2Z5GA 1JU4A 4BATA 2HL6A 5HZGA 2VJDA 1FSSA 2XE4A 5EGNA 1XRMA 3KDAA 2QOEA 2BKLA 5AOBA 5AM3A 2XUIA 4UHCA 1T4MA 4BZZA 1K6EA 4LXGA 3WJ1A 4AZ0A 4W63A 1BU8A 2WHPB 3VDXA 4C4YA 4U2DA 3FAKA 5FKJA 4QWWA 3I2GA 5LZ8A 1Q0RA 1D07A 2BFNA 5DLPA 2X5XA 4P08A 2QRUA 2PUHA 2AJDA 4RGYA 4FLFA 2JGMA 3VVMA 1UKBA 3C5VA 5HF8A 2ONCA 2CMFA 5BOVA 1THGA 1UKAA 2HFJA 2QR5A 4ZRDA 1B41A 4PV7A 3R3YA 4H7DA 1QFMA 3HSSA 1E3QA 3BWXA 2OCKA 3OOSA 2CBGA 1G66A 1TQHA 2V97A 4NS4A 4Y2YA 2WIDA 4UBKA 4ITVA 2XMZA 1J1IA 3U1TA 1N1MA 5AIAA 4KR0A 1WCYA 1WHSA 4ZWNA 4N5HX 4WY8A 3PI6A 2VF2A 3WK4A 4F60A 1QIFA 1GPNA 4OUKX 3RLIA 3QMWA 5CT6A 5JAPA 5AOAA 2PVSA 2HA3A 3O0DA 4HRXA 3AZPA 1GXSA 1EHYA 1N5RA 4LKOA 3FLEA 4P92A 2UZ0A 5ALWA 1K5PA 1QIGA 5IVKA 3OG9A 3H2HA 1AUOA 1CUEA 1JFRA 3OC0A 3M3DA 3A6ZA 3BJRA 5ALZA 3LP5A 1EVQA 5AI0A 4RE6A 1JMYA 2ZYHA 3ANTA 4YPVA 5LZ2A 2V9ZA 2WU4A 2HA2A 3Q0TA 2ZJ7A 4NVRA 2RI6A 1IUOA 3OM8A 3DLTA 2G63A 2ZYRA 3PF8A 5EHXA 1U4NA 3G9XA 2W6CX 3I1YA 3PF9A 5DWDA 4X85A 4AZ3A 4U2CA 1SCKA 3MUNA 5IVIA 3W05A 2DQYA 2OXEA 2IIVA 2AJLI 4BDTA
chains in the Genus database with same CATH superfamily
2FUG6 4L5YA 4AMYA 3GPCA 3K92A 1K8XB 3RTCA 1ECLA 5THQA 3PC8A 1ORIA 3X0DA 3NAMA 4B2LA 1PW5A 3FUVA 3IIKA 2MYTA 2BMVA 4HHEA 4KTVE 3V1KA 3R3XA 1TTHA 3EDYA 1VRWA 3PFNA 2P5UA 1KQNA 4YP1A 3TZHA 4IHJF 4EVIA 1VJ5A 2WU3A 1Z4LA 4LPKA 1MP0A 2AZMA 2C99A 1IRXA 1F1JA 2I3ZA 2O48X 2X2OA 3D8BA 1PK7A 3DVQX 3EZGA 3KKKA 1RYZA 3L07A 3MT8A 2R9VA 3O4IA 2NUAB 2Z1DA 3V4RA 5CTJA 1J49A 5E8JA 3B85A 3NXSA 4ZXPA 1YIDA 3CG0A 2OP1A 3UGJA 3OQMA 1ZAYA 4MI1A 3ZNQA 1PJLA 3FNFA 1LQTA 2NTJA 3L5KA 3OX4A 3GGPA 1G2OA 2PRSA 4TWIA 5ITVA 4A0RA 3RYHA 1RKVA 3M4JA 3JPWA 4DQVA 2EQ5A 3RR2A 4K9NA 2PGDA 3EVNA 1DARA 4G1EB 1PFQA 4RZHA 2JI8A 1NONA 4FCTA 2XNHA 2XNDD 4I0WB 5M34A 1H93A 2NU7B 2XQJA 1QXSA 4S1TA 3P97A 4A8JB 5A0FA 2IYUA 4D99A 3T7DA 3S3TA 2EAUA 1L7BA 2ROQA 3KJNA 1G7SA 2NYUA 3C8ZA 4N3AA 5BYAA 4FN4A 4PO8A 3U60B 3IOEA 1I6LA 3ECCA 4IDHA 3W3ZB 2OCGA 2IYEA 2XJ9A 2PK3A 3BL6A 2C94A 4P1ZA 4ZN6A 5BR8B 4MYDA 5C3UA 2XKBA 3RC8A 4PC1A 4KXXA 3IUSA 2YY5A 3V1MA 4ZDJA 3CRZA 4HMPA 1N9KA 4RZ2A 2Y92A 1AKRA 3M33A 1WR8A 3B5JA 4MRAA 3CE6A 2HCBA 3E0XA 1Z83A 2R6HA 1T9CA 3GRYA 4Q1FA 3INYA 4D97A 2CT8A 2YWGA 3QLUA 1E1DA 3HCEA 2D0PB 1Y5IA 3D4BA 2WVAA 4FFLA 4WN9B 3CUKA 2JNWA 1GUZA 5CR9A 3UPUA 3OQ1A 3K5PA 2V4UA 5CTAA 2VTBB 4PG4A 1WY5A 3E70C 5SYMA 3SYRA 5B7NA 1WKCA 1ANKA 2XDAA 2YZKA 3RRBA 2O5EA 2GN9A 2AFHE 4TS4A 4U2FA 3GH1A 4R1LA 4PGHA 4Q1CA 5CA0A 1XWWA 5CJJA 2HA6A 2PWBA 2IYVA 2YWDA 3DD5A 2ZJBA 4QQFA 4YMHA 3GG2A 4EQZA 3M1YA 2COKA 3BSYA 3HWRA 4ZYXA 2V7WA 1GFIA 1Y1PA 2RG7A 2HCFA 2C7BA 1X3SA 1T1RA 1A3CA 1UQUA 1D0VA 2JFFA 1R9NA 1VI5A 2J9ZB 1NUPA 4J16C 3RK4A 3DWFA 3VR6D 1KRXA 4GZ6A 3PCXA 4MYUA 2NQ2C 4EJSB 5I5EA 5DBIA 1HE1C 1N5JA 3AU9A 3C6QA 4F5EA 1AHHA 1G8JA 2JCGA 4G0NA 1N3IA 1F1BA 2QUZA 1OAKA 3BHNA 3VYVA 3PDIA 2H57A 4GI1A 3RTEA 2GFHA 5C2JB 2FPKA 5DV9A 2PHZA 3PD7A 3L0YA 2XOEA 3OFJA 4O2BA 2VZ8A 2H4XA 2ZBQA 2CK3D 1RRGA 1Z45A 4ZCLA 3AF6A 4XASA 2NVOA 5CYFA 4FLEA 3E9YA 4BFZA 1CVRA 3LWDA 2Q41A 3X1DA 4MA0A 5C8ZA 4BXOA 3A6DA 3IBFA 2VK2A 1EVEA 3RS0A 4HEQA 5G02A 5IKPA 1M6WA 1DQNA 3R7BA 2JLAA 2ZIUB 3P0IA 5B58T 4A8PA 4F8YA 1ZHHA 2YWXA 2P5SA 1O4VA 3A4IA 4PNZA 4QATA 4KQKA 3A9CA 1UKCA 3HLYA 3JQEA 3PXBA 4RVCA 1BN6A 3U3DA 3QVOA 4V0NA 4ZK6A 5KNDD 1U0OC 1JEAA 3I01M 2JK1A 2IHZA 2WG1A 1OX4A 3UK6A 2CF6A 3FUXA 3WJ7A 4AYTA 1F7UA 1NVXQ 2POCA 3K4HA 4FZRA 2BVNA 1OTYA 1R0LA 4JQCA 3CR3C 3SBOA 3TSWA 3VNSA 4KQ6A 1OD6A 2H31A 3DM9B 1EUDB 5EP3A 1RCTE 4XIIA 5HBRA 3RUIA 5A4MS 1XRPA 2EBHX 3GRKA 4FGJA 3OZ7A 5CX1A 4LJRA 4QM6A 3OICA 3TMYA 3AKEA 2PJUA 1JLLB 3G5AA 3HXTA 3IT3A 5JCJD 4QUKA 4X6LA 3D54D 4U3JB 1YU9A 3WLOA 5CBKA 3I2FA 5G3ZA 1HYBA 2HPAA 3GRUA 3A1EA 3WSVA 2HQ1A 3DV2A 1J8YF 4P8RA 1ZK0A 3ANSA 3AVQA 3KOOA 2BLLA 2P6PA 2P40A 2VF7A 4J0DA 5K05A 3PR1A 4C7MA 4RDXA 2FUEA 2JHCA 3PUZA 1YR7A 1SMKA 5AKGA 4R9NA 3ZY5A 2ATEA 2ZPTX 1YZNA 4N47A 4CQMB 2ZRCA 3QU5A 4OSEA 2QQGA 2QP9X 3QW4B 4YPFA 4C3UA 3PHLA 2V7XA 2P5TB 3NHUA 4KTTE 4XPIB 1CB7A 1R4MB 4PTLA 5ALFA 2I34A 2FX3A 2I3BA 3QLVC 4BFTA 2CJXA 2R6DA 3BK7A 2Q5EA 1UBHS 4WEQA 5CVCA 1R6UA 3OHMA 2H63A 2XMCA 2QYOA 3IVXA 4KXNA 1I4EB 2EKQA 1XZDA 1Y3CE 3MXTA 4GXQA 1Y37A 4C76A 2CXSA 2VWPA 3JATB 1POXA 3JYLA 4YB8A 6LDHA 3W5IA 2D06A 2J0UA 2BMDA 3UPTA 1JAHA 3GPBA 1ONBA 1U2SA 3EWIA 1NQTA 3E1GA 1E9EA 1XTJA 1X6VA 2Q0QA 4RANA 2DFDA 1JE0A 4Q4LA 1W0CA 2WHYA 3C3WA 1WUJS 5FYQA 1A5SB 4ETNA 5IVHA 1XAIA 2IYRA 4L8FA 4TMTA 4PQYA 3FKSD 1P5RA 2WNHA 5FQOA 1A1SA 1N0UA 4RZQA 4ZEVA 1YFLA 1KMHB 2DE0X 1EG7A 3E1SA 1AKWA 1VKNA 3C7AA 5FL3A 5GY7A 3UJBA 4CIDA 4YT4A 1Q0SA 2BFFA 3KSAC 5LBUA 3SHTA 1D1SA 2DTEA 3ZQ4A 4BBAA 5FUYA 2C95A 5EJ5A 1ILWA 2GS9A 1DUSA 3EE6A 3UWMA 2HHLA 2KBFA 5EZYF 4CYMA 1EZ4A 1UC5B 1U7UA 5CUQA 1AZWA 3LOPA 3U3RA 4YXWA 1YAHA 2ZSUA 5THKA 3MJDA 3VR6A 1QMPA 2AC4A 3QX7A 1E6LA 4PF1A 2J1LA 4ETIA 1NAHA 3T7CA 3MLBA 3LUBA 2PCLA 4MHTA 1ORRA 2WM9B 4QBIA 4MAMA 4RPCA 1ZA1A 2EZUA 4RYDA 2KQUA 2PYDA 3SDZA 1J22A 1IN7A 1U1FA 1UCFA 3EQZA 4YFYA 1KPGA 3L7BA 5AKIA 4MV9A 1Y81A 1G59A 1L1QA 1NKSA 3NORA 1ETUA 4RZUA 2EZ4A 3VU9A 2VPPA 3BA6A 4OCZA 3C5EA 3EVCA 2J3EA 1I3MA 4HFNA 1RI2A 3AETB 3I62A 3IBTA 1VBFA 2CK3A 3BMQA 2F9LA 2ASEA 1WXQA 3EEBA 3MBIA 4UVEA 3UK1A 3ZH9B 4NCKA 2ZUFA 1TAQA 3OCVA 3A1WA 4S1PA 2VWHA 4GI3A 5B64A 5K0LA 4LZJA 3F9IA 3GZJA 1FUKA 3HZZA 1XRLA 2ZRAA 1D03A 4ZVSA 4PLVA 3MINB 5EGSA 1YIOA 1PR4A 2RHRA 1IBCA 4JEMA 4QNMA 3HA2A 3LY8A 2QBYA 2C2YA 3I52A 3L4BA 3OLYA 4WZ6A 3UUFA 5LUAA 2FR1A 2LGJA 1KEEA 2LNDA 5JADA 3DOJA 2AX4A 4QAJA 1BXGB 1YULA 2IXEA 2F00A 2RAFA 4IWNA 1L4KA 5FUXA 5KNDA 4KMRA 5I47A 4ATNA 2A3RA 2JKYA 4JVMA 3GP3A 4P2GA 4WN3A 3I73A 1VJTA 3MW8A 2ZTVA 1H05A 2MJLA 1AN0A 3NWJA 4B48A 1U80A 3C41J 2H18A 5EI5A 2JGJA 2CXRA 3VAYA 4JQOA 2CVZA 3FH0A 1WNFA 4YXFA 5LNK1 3B2QA 3RIMA 2ZJ1A 1W88B 5FTJA 4G1UC 4G5OA 1DTWA 3FUCA 4PR0A 5HKOA 1TVCA 3PUJA 3BRWA 2QRKA 1N8NA 3Q5EA 2HU2A 3COPA 3H97A 3MTGA 1U0RA 3ENQA 4ZU3A 5JCJA 4JASB 3KZOA 3AB8A 3C39A 1EFRA 1GNLA 1VYHA 4ZU1X 1JFFB 2C7VA 3KDPA 5IUNC 4QGAA 1BG6A 5G40A 4I36A 2OB1A 1WPGA 3TG8A 4B2YA 3FNGA 3OURA 4Z2AA 1JZTA 4ZP1A 1M34A 4A82A 4L2IA 2Q5HA 4JR0A 2V45A 5AICA 1U8AA 3T12A 1PJAA 1RJFA 4W9NC 2FWAA 1PHRA 4GFDA 2EERA 4WINA 3ADBA 4ON9A 1RWWA 3DC7A 4YNBA 1OGYA 3PYLA 1MVNA 5BY2A 1FXUA 1VDZA 4RPJA 1ORTA 3RTDA 4JXXA 2IH2A 1AB6A 1EX1A 2A78A 1BH2A 3P96A 2Y0EA 3EC2A 3N6RA 1SXHA 1WB6A 3QJGA 4MW1A 1SVSA 4U7TB 5HQTA 2JAWA 4WKNA 1H3EA 1QVAA 4PZZA 2SHKA 2N1MA 3TLJA 3HJBA 5FR2A 5LQMA 2EKPA 3K70C 4D96A 1RXUA 1VGQA 3N3BC 1HY3A 5F77A 3SLGA 4GC9A 4ETMA 4AX4A 5CVJA 1JWLA 1N6HA 3V48A 2W0MA 1B14A 4QVKA 1I7PA 1T1SA 3IOBA 4GNRA 3ZHQA 5KWVA 2XXBA 4YRMA 2VF4X 4WPGA 1SAYA 1B1AA 2A1UA 4ZI5A 3U09A 2WAXA 1MW8X 3D02A 4XDGA 2VTDA 2OYRA 5A6SA 4HDSB 1KMQA 4LVOA 5K6AA 5KU1A 2ZATA 1ZU5A 1P19A 4JB0A 4QPPA 1CY2A 3R8XA 2AXEA 4AY4A 4EB8A 1NC3A 4BLPA 4JBLA 2Q9BA 2J3HA 2XCQA 3SFVA 1FJGB 3LHSA 2HA5A 1NYLA 3FDJA 3P0RA 3ND6A 3W3AD 4B1FA 4YUXA 4N41A 1RLOA 2H2FA 2HMYB 2Q5LA 1XXLA 2OZLB 2XUJA 3F67A 3KLBA 3NOXA 4HFRA 3TBHA 4ALKA 2H06A 3WL6A 4J6FA 2OHIA 3FPJA 2VNIA 1GZSA 1E0KA 3H0EA 3LU1A 4AUKA 3ES9A 4KVFA 1C4OA 4Y1RB 3U56A 1JJBA 2L18A 4EATA 5HM6A 2V8BA 1HQCA 2FA9A 5JBIA 1FSGA 1ODLA 1XMVA 5BSTA 3WB9A 3B6JA 1N0WA 2F1KA 3DEHA 1V1RA 1PUXA 3DTYA 2GJKA 4MVXA 1T2FA 2G7MC 2PMBA 2ZQYA 3BH6A 3GO4A 5JPCA 4KR3A 2FSPA 3NBUA 2QY6A 2DQSA 4HTFB 2WV7A 3GROA 4QODA 2I62A 4UUQA 3NGLA 3QHQA 4UATA 4RJ2A 2FW8A 2ODNA 2IHUA 2J6CA 3K2QA 1EAMA 5KVQA 3ZTYA 2VJKA 3FPEA 3ZS9A 3STXA 2NYAA 1FSZA 3NM4A 3CW2A 3NEYA 3LX8A 4F2GA 1IWPB 2YXEA 4JT4A 1EFLA 1HSZA 2IGBA 3U49A 3FB4A 2R25B 4JODA 4PGAA 5TNXA 1W36B 4N5DA 4RD2A 3N7TA 1XU7A 1DVRA 2PLRA 3KYJB 3AX6A 3H65A 1M2HA 4R9SA 4UHBA 3VNQA 2FPIB 2VAPA 4L4XA 1TYCA 2H6EA 3TLKA 2XR1A 2G8NA 2HJRA 5TPWA 3U4HA 1FUEA 3V2HA 4QD3A 3ICWA 1V2HE 2HWKA 1XEXB 3G79A 5FR1A 1L3CA 4WOJA 1KVUA 5T5QA 1EM6A 3MS4A 4OP1A 2JGIA 3FMOB 3QELB 2M6KA 1GCUA 2NX2A 2W9XA 3NWPA 4H1VA 1XKXA 3BMOB 3UUEA 1YDGA 3MPOA 3KJFA 2FFRA 2VCEA 3AEQB 4GUAA 1ENYA 3AI1A 2NMVA 1QH9A 2IUFA 4TL7A 4CM9D 4EGJA 3ZLJA 4KQXA 4B81A 1ML4A 1DL5A 2ZRPA 1PR6A 1S89A 2UDPA 2NWQA 1KEKA 1U8XX 4U7WA 4UVDA 3LDFA 4GXTA 2W4QA 3OLQA 4DUYB 3NKVA 2IK8A 2X3FA 2NUPB 5CYPA 2VXOA 3MAAC 3PSHA 2EGGA 3FCSB 3F74A 3HMQA 3L4EA 3R6WA 4D4MA 4E6PA 4EGSA 1M34E 2QSJA 3REOA 4EAQA 2ATIA 1CD5A 2HK6A 3LF1A 2LDXA 3ZWYA 3BSFA 4U7HA 3PVCA 4TSRA 5T4HA 4L02A 2IS4A 3LVBA 3HRKA 1LDGA 3VH3A 4RKYA 1MBZA 2Z3WA 3O5AA 5B6PA 4UARA 4C04A 1UK9A 4MV4A 2XE6A 1C7IA 3C1TA 3GRRA 3SS8A 3WTBA 4PC6A 3JZIA 1ZK1A 3VZBA 1NBMD 4GPTA 4Z4FA 2H5LA 3DD1A 4TXLA 4TVKA 1YQTA 1S8FA 1JQLB 1VLZA 4C88A 3U48A 2M32A 3P9CA 3FNIA 3H8WA 1EE9A 3LVRE 3WLKX 2PMKA 5LYJF 3KQKA 3MUEA 5EE3A 1EFDN 4RVSA 1D8AA 1TJPB 4PTZA 3V80A 4EZEA 6YASA 1OYVA 4BN0A 1YDEA 1OH8A 1FYXA 2VK4A 2J4FA 3GOQA 1E3MA 1II0A 4TTPA 4UPDA 1KNXA 2O2YA 1GFWA 2UYHA 4L9WA 1HE3A 4RNCA 2CJWA 2NAFA 3GJZA 1EFTA 3CXUA 1K4KA 1JEQA 2QUIA 3FW1A 3PGA1 5CMLA 2FB9A 5GOTA 3UNXA 3V6MA 4AKIA 3KLMX 1H5QA 3H8SA 4MR7A 1Z29A 2PL1A 4IH1A 3RRXA 4ARAA 3A3PA 3BWVA 4KC0A 2QNRA 1KI6A 3DMNA 4F3CA 1TZKA 1CQJA 5K7SA 2Y71A 1IVNA 2XI4A 3DB2A 5BW4A 5K4HA 1ZR4A 1C7EA 1WSWA 3A28A 1G8GA 3Q15C 2ACEA 3JQ6A 3W3AA 4BVBA 3R7WA 3MWDA 1A9RA 3AVWA 4MUYA 2P9TA 2FHSA 2QTNA 1DIRA 2W58A 1CQWA 3UG7A 1JQEA 4WBNA 2H1IA 1W35A 3GLTA 2IIPA 4JCCA 1O6ZA 2PXXA 2BFOA 3OETA 1A69A 3FVTA 3KXLA 4K05A 3AOGA 5JAHA 2OV3A 1XTZA 2ESRA 1AJEA 2NYVA 1Z4JA 3NJ8A 5T57A 4H7PA 3P19A 2I9PA 4P35A 2YIDA 1OJ7A 2OORA 1NMXA 3A3KA 4X1YA 3ZH2A 1UZAA 3ETDA 5LN1A 4LC0A 2PSEA 4RVDA 4HQLA 3OQBA 3IUNA 4HZUA 5BT8A 2UYYA 4FVTA 1SWVA 4Y2RA 2PKCA 3LRPA 3W2TA 2CL0X 3EVEA 2QY9A 3H13A 1E9FA 2WPDA 4HYTA 2ZE7A 4M0UA 3D6UA 4ZT7A 5E2AA 4IVRA 2FEKA 1PFGA 3I3OA 4J49A 5H9VA 5IAGA 4J03A 2JJ8A 2Z6AA 4DW8A 1GU0A 3LGXA 5E3JA 10MHA 2GXSA 4RTMA 2QW0X 3G2JA 3BIFA 3KU4A 5IVDA 4ZICA 3GJQA 2IU4A 2QN6A 3DO8A 4NFHA 5ECDA 1J2UA 1KDPA 4IDGA 1KFCB 5AI6A 4M36A 1RQ2A 1A97A 5EPOA 1KC3A 1N9GB 1EVLA 2OCBA 3GL9A 3MMZA 2YW2A 4RYLA 2ZRBA 2GZAA 3FJ1A 1IULA 2XT6A 2C9CA 3WG9A 2VTKA 2QW1A 2EFJA 2DMRA 1HH4A 1QGDA 3SIXA 3OC6A 3V1LA 1Y3FE 1Y9EA 1T6XA 5F7XA 5B7PA 1B74A 3FE2A 3PLNA 5IJAA 4F91B 4Z3OA 2ZJ3A 3JYPA 3L7IA 5HVNA 4CM9A 4BGIA 4POAA 1A2BA 1VBMA 3H1TA 4ZVRA 4PX9A 5LB4A 2AE1A 4LIPD 4YH1A 3LUDA 4S3MA 1EP9A 5FAKA 4NCIA 4G1CA 3DT9A 2PGJA 3AQIA 4XWTA 3ZVMA 1WMDA 1XKTA 3C1UA 4LJ7A 3WC4A 2H1VA 3EMKA 1EE2A 2FGKA 4ZO9A 4N5MA 4MQEA 4OJQA 1UZNA 3DCJA 5IKMA 1QG0A 1G4AE 5M29A 4FHFA 3GJXC 3UJ7A 4PZUA 2OGTA 3R7SA 1RAIA 2BZGA 3CIFA 2AJCA 3WOHA 3TLXA 3IEXA 1XMSA 2WKQA 3C7CB 3SKXA 1NBMA 2OBBA 3LPCA 4FZVA 5FCDA 2QPTA 1PT6A 2YXPX 2I2FA 2RHGB 2ZIVB 3K09C 4FFMA 1W1WA 3R3UA 4L3WA 5B53A 3W5HA 2IYTA 2JG3A 5LXTB 4RM2A 2FDRA 1U7DA 4FFNA 4EW6A 5KJ6A 3ESDA 1KYQA 4AKHA 3HU1A 4Q66C 1F9AA 1YRHA 2AYXA 2IOYA 3TZCA 2LRHA 2VDUE 2HQSA 1R4NB 5CIYA 2QRGA 2VL7A 2EIHA 1UJ5A 2D7JA 1W76A 2CEKA 5AI4A 4W99A 2WM2A 4Y2HA 4JBYA 1PK9A 2BFEA 4JI3B 5M04A 3QTLA 4JLKA 2ZCVA 4ZXFA 4E03A 2ZP1A 5DNWA 5EC8A 3ZU5A 4KMOA 3AEKB 2IWRA 2QAGB 2W8BA 4CM4A 2GTHA 2XMBA 5HKAA 5DM70 1EWTA 1TECE 1VLQA 4C6TB 5GGXA 2P90A 4NXNB 5LR6A 4I9FA 4L73A 4RHTA 1Z25A 1TYAE 4JJ6A 4BQFA 4C29A 3AVOA 5K0SA 3D3JA 4ZCTA 1VE3A 4FHCA 3OEEA 3L8MA 1GAJA 4MITA 2GBCA 1RYHA 3JRNA 4M9XA 2PUAA 1CUXA 1BGVA 4TOIA 4C7OA 1BOOA 1ZGJA 3DBRB 2B6NA 3B20A 3DXZA 5B6IA 1E4YA 3QFFA 1OYYA 1W34A 1JMVA 3HEMA 4FHEA 2IOFA 3SEQA 3CHYA 4ZFNA 3OM9A 4DARA 2BOVA 1J0BA 1UEXC 2I6TA 4HNVA 1BQ3A 3JQ7A 3VZCA 2X41A 1EI9A 2G1AA 4PRKA 1K7CA 4AK9A 3WGHA 5HIKA 1H42A 3D8SA 2YNMC 3W79A 1UPTA 3OT1A 1C3LA 2ZRHA 3IXLA 3DGEC 3C7KA 3KR9A 4JX9A 4RQUA 3F5DA 4TWZA 5AHRA 4D74A 1DXHA 5IHXA 5DNCA 2YBDA 3HUEA 3NATA 2FLVA 1DKUA 2PUTA 3RS9A 1IZ9A 4IDDA 3UOAB 2P3LA 1P1CA 2QTWB 4JL5A 1M72A 2FWRA 3MUOA 4TMZA 3GUVA 4M76B 3RGWS 4CMIB 5K2OA 3OLVA 1G5IA 1Z8FA 3DVSX 4FWIB 4NENB 3T35A 5I9LA 2ZVPX 3GEMA 1CNEA 2G9RA 3M6VA 1LKZA 2FN4A 5LLDA 3AVXA 4CQMD 3D7KA 3EUWA 2IPNA 3TIGA 1E98A 1P8AA 2WHEA 4RKWA 1R27A 4JNKA 3VTZA 2PX4A 3S44A 4GMKA 5H81A 3D0OA 1FBNA 1YHYA 2XODA 3GAZA 3IDZA 5EOVA 3HB0A 3RFCA 2C7PA 3BWCA 3CCCA 2E49A 4K87A 4M4SA 4J94A 4EY7A 4MA4A 4BDSA 1O8BA 3IALA 4FW8A 2VNKA 2O2CA 3WGLA 5BWNA 3NBZC 4Y6LA 3BIJA 3OJXA 4Z54A 3OIWA 1QQ6A 3MC1A 4I5FA 4O63O 2B94A 1L1FA 1L6IA 3JZMA 3MERA 2PV0A 4IHKA 4YDSA 4JYAB 3AFNA 2PMWB 1LPOA 2ZSFA 2DAPA 1UAYA 1YJ5A 5GONF 3OBIA 5DW3A 4D9NA 2GZRA 4W9RA 4RJIA 2FX2A 3EIFA 3QTTA 4WN9A 1FY2A 1K97A 1E7WA 1P60A 1J5PA 5KWJA 4G0OA 3V4FA 1AQNA 1CZUA 5C18A 2ZWIA 1EXDA 1QIIA 2RD2A 3DOCA 3DMFA 4BIIA 5AIBA 4CU5A 1NBME 3HYLA 4IKEA 2D5CA 5DYYA 1L5KA 1N2CB 1QQ5A 4Z0PA 4F85A 4FYHA 1N7GA 1ZOIA 3RDPA 5CDYA 4N5NA 1M7HA 4W7HA 8LDHA 3SD7A 4KQ9A 2QX9A 2NTEA 2X19A 2NZVG 3BMNA 3NPAA 2X5JO 2ECPA 3L79A 5E6RB 4FX2A 1U2RA 2OFFA 4AJEA 1GAXA 4QYSA 1LGYA 1T0PA 2ZTHA 2P79A 2XMDA 3WLFA 4X20A 2JLUA 2OVFA 3Q98A 3A3NA 4MYRA 3BWMA 1BCSB 1J24A 3MT9A 3DULA 1OAOC 4CW7A 4Z99A 4KGXA 4F2PA 2AHRA 1B8OA 1EDZA 1FVXA 1RJGA 1SU4A 1JXMA 3TRJA 1ZOPA 3JD3A 1N7HA 5B3LA 5CFQA 2CKDA 2OKCA 4M8KA 4DKXA 3KJHA 3VHXB 4OI1A 3A1CA 4YO8A 4PAWA 5EINA 1HT2E 2B2NA 2V4ZA 4O2AA 5K4AA 2HX1A 2FN3A 4LYAA 3U2QA 4KQ1A 3ORQA 1I3LA 3CLHA 3NHRA 3GDFA 5HE9A 4DGQA 4P82A 3EPJA 3RUDA 2UZ4A 4FT2A 4M0MA 4IJUA 1EESA 3EEIA 3SFTA 3G9ZA 3QNWA 4E13A 3QSYA 1N3YA 1RQ7A 3EUAA 4A7PA 2QJFA 4AS1A 4GQIA 1TVKA 4P7KA 2QLBA 3QG5A 4URFA 3R9KA 3PYXA 4M7OA 2BM8A 4KZPA 1CULC 1K98A 1T91A 1T9GS 1UOQA 1B15A 1SZJG 3SHFA 5DMXA 3LWZA 2GHTA 1FX0A 3A25A 4G8BA 4NV0A 1E20A 5ECWA 4RV5A 2YFKA 1S9DA 4O8ZA 1NR7A 2ONZA 1XJCA 1JX6A 1IEQA 1LB1B 2ZI5A 3T9FA 3P2JA 2C03A 2YFHA 1JXAA 2KE5A 5IKXA 4MLPA 2V59A 4W82A 4YJDA 1OV6A 2E5FA 2OUIA 3BSSA 3L01A 3UQYS 3RS2A 4HEHA 4BECA 3DWEX 3UN1A 3HYCA 1NY5A 2BBOA 3B1ZA 4PR3A 5AW9A 1J2EA 3HYSA 4B8ZA 1IJEA 2H2WA 2JAUA 4PYOA 5SV2A 3TB6A 5AW1A 2O9JA 2NP7A 4OATA 2RH8A 2CZQA 4GRDA 2GN8A 3N7UA 3Q6MA 1K8YB 1PGPA 2VZLA 1OASA 3WMFA 3JAWB 4GI7A 3S27A 1MH1A 3JRXA 1EWRA 2HAEA 3MB8A 4QE3A 4ND7A 2R62A 1REQB 1T9HA 2CXHA 2I6UA 4JZKA 3TSCA 3ZZMA 4U3JA 1C30B 1J7JA 1SULA 1ENOA 2CXQA 4IDCA 4FHDA 4B7ZA 1SVOA 4Q0MA 3ZV7A 3EAGA 4IIHA 4TLLB 1GNVA 3ZVKA 5GP1A 1BW9A 1AN9A 1SXJB 2CUZA 3A6FA 3RUCA 1CFZA 1E61A 4JUCA 1QANA 3GFBA 1WCXA 3WIVA 1BWQA 1TK3A 2CN1A 3A9SA 4XYLA 2WUDA 1XPOA 4M9RA 3O4VA 1XMXA 2UVPB 3KKLA 4BFWA 5KI6A 2GZ3A 5AO9A 1ULTA 4WMLA 5KNBH 2IPLA 3AH8A 3V4OA 2CB0A 3LQFA 1AKQA 4MRPA 5EMHA 3WLRA 3FOFC 4TUYF 2WJ6A 4XPIA 1L5WA 3T99A 1R4MA 1XX6A 4D3XA 1BDMA 1G6OA 5DDIP 4C3OB 1YF3A 1QV6A 3FSRA 4N5LA 3LD9A 3JV7A 5FWDA 1VB5A 2AN3A 1RADA 3EIUA 2OBYA 3HBAA 4DHEA 4EG1A 8ABPA 4EO9A 1U2GC 1OA0A 3HS3A 1W8IA 3JYOA 5F98A 3CEAA 3JQAB 4D4LA 3EXHA 5F1YA 4KB5A 5JS8A 2HV8A 3ETCA 3B3GA 3IE0A 4TQAA 1KFKB 2GCOB 3CY6A 2ECQA 1JB9A 5DO9A 4II2A 5H02A 5HCUA 1CY1A 1BDHA 3RKRA 3IMGA 1YHZA 3SX0A 4EENA 1FDSA 2JHFA 2ZAYA 5BPFA 1TW3A 1HZZC 1GPKA 1XD8A 3C6BA 1AZTA 1O6GA 1SO8A 4EHAA 3KAQA 4YAJA 2P2SA 1YB7A 2F3RA 1KMHA 3QYPA 3HB7A 4ND6A 3DLIA 4WVLA 1IXSB 4R01A 4TMKA 1IZ7A 1TJNA 1YV9A 3UYKA 4AF8A 5IHPA 1G4UR 5JAZA 5L4SA 3FSEA 3QVKA 3LYHA 4QEZA 3C5WP 1DIHA 2NZ2A 2IV2X 1QKKA 1QTRA 3QXJA 5EMKA 3ROTA 4JLAA 4LTDA 3SAJA 3L06A 3TVTA 3FNBA 4DDHA 5A2QA 1U2ZA 1N77A 2P6UA 5CLHA 1Y7TA 2E87A 2LCFA 3LXRA 3NTQA 2HWWA 1V1MA 2XQKA 4AJPA 1C41A 1VHQA 2Z8ZA 3DEYX 1N5DA 3LQKA 4MKHA 4AG6A 4E51A 1YK0A 2HBYA 1Z7YA 4I50A 1PJTA 3TIFA 1ZVKA 2JFWA 4MINA 5C1IA 4GBMA 4ICIA 2CNOA 2PZEA 4GHWA 3ZXXA 2TS1A 4EA8A 2BGTA 3WWOA 5AW4A 2P2YA 5G4KB 5K0TA 2GM5A 1UM9B 3HMKA 3B1KA 3ILVA 4P98A 4KR6A 4WL0A 3WL7A 3GRPA 4X6YA 3OJWA 1W4CA 5EWLA 1GGJA 2IYLD 1TTQB 1GO2A 1XEAA 4HRVA 2CNNA 2CCKA 1QB8A 5K01A 3V8MA 4GNKA 1GNPA 1C7JA 3REQB 4UNQA 1E1LA 1ZL2A 1PR3A 1RQXA 2RJNA 1AHPA 3NDRA 1A9XA 1W36D 5BNZA 1X8JA 1YHNA 4HQNA 2NZ8A 1VPLA 3EAQA 2V4MA 4EDFA 1XAGA 1SBTA 2P4HX 5A9TA 5LYYA 3QPDA 4GWGA 3PPVA 4JBGA 1I4WA 4O5AA 3U7EB 1IZZA 2Q49A 2LTAA 2O0MA 3CRRA 5CIQA 1ST3A 4KYUA 1MTOA 4AG5A 1U1IA 1J33A 3DL4A 1EGHA 1QK5A 2GZSA 3IPAA 1BXGA 4XGNA 4NCJA 4Y6PA 2WJ3A 1OZ0A 2EX0A 3HC7A 2A1TS 3FBGA 1T35A 4RV4A 3WAJA 5ICCA 2WILA 2JFXA 3BE4A 3PQEA 3H1AA 3FMFA 1LNSA 1GQSA 4M6WA 4EFKA 2A0WA 5BN3B 4N7RA 1DKLA 1E9BA 3OE7D 4TSKA 4KQFA 3RU3A 3D7RA 1RAGA 4L8GA 4QT0A 1A2KC 2FFBA 2JA2A 821PA 2F3PA 3AY7A 2P2DA 3V34A 3R1IA 4FJ0A 3QEKA 3K1ZA 1Q1AA 2JGDB 1YKFA 3INRA 3Q40A 4MKXA 2DBVO 5EG5A 3K6SA 4CEHB 4IHJA 1X8XA 2B25A 3GG9A 3LBHA 4NV1A 4A73A 3C4VA 4PYLA 1AO3A 4QBTA 1XGKA 4MMZB 2CVFA 4KPGA 4AF6A 1V7PC 3FMIA 2V5AA 2JLWA 3DFFA 5E1BA 3R3HA 4B44A 3TSZA 1CYDA 1WHTB 1QQAA 1LTQA 2VHZA 3VI4B 1Z2CA 2CFCA 4BFCA 5DX8A 2BE9A 1WCIA 1YUMA 2IXBA 4LQ4A 2DF8A 2NSYA 4BVLA 3F90A 2P2CA 1PJ4A 1LC3A 1Z5WA 3HN6A 5EJGA 5AVJA 2EKBA 4AN4A 5ALYA 2EJBA 4YV0A 1USVA 2X9QA 4WGFA 4JD5A 4FDLA 3S5JA 5AOVA 1QYVA 1AHNA 1X7YB 2YWFA 4PN7A 2JD2A 4G2TA 1ACLA 5FV4A 5MGNA 5LP6C 4NCXA 1YACA 2YJ6A 4GECA 3QXXA 4RVFA 1NE2A 3MHTA 2BEWB 3QU7A 4DB4A 2BCGY 4IV8A 1FNNA 4X1OA 2R86A 3QUQA 1O96B 1K2VN 3VPHA 2ZUWA 3KWLA 2GKSA 4J3NA 1VHLA 1OV4A 1ZN9A 2HSJA 4HGQA 3SQOA 4CIAA 4JJAA 1XQVA 1YBAA 1QCCA 5FQNA 2XCRB 1PJ2A 2FLWA 4DCGA 4WK0B 1CUSA 3URMA 5KNCH 1U2DA 1XDUA 4TKMA 5ENVA 3K5HA 5FOQA 1QAOA 3EXEA 3QNUA 3K30A 3ZYCA 3C8MA 1JHDA 1QGUB 4DSUA 3IL2A 3OLZA 4MV0A 3KELA 3OHPA 4A9AA 4RH3A 1NQ5A 5BYKA 2ZWAA 1QVVA 3SX2A 3FCXA 3L0ZA 3IB3A 3FMGA 4BMCA 4KFRA 5DNUA 3U4AA 4MI6A 3P9QA 3KSRA 1RWQA 3G89A 4YGXB 1UBFA 1WBJB 2WD7B 1JILA 3QF4A 5K6RA 3DZBA 3LI2A 3N0XA 5LZ7A 4HNAB 3OA2A 5FV7A 2APJA 3AKZA 5TMEA 1ZFNA 2A9VA 3S2FA 2XUFA 4MS4B 2LCQA 4ZCIA 5AVYA 1APBA 2B2CA 4Q9NA 5CLLA 2C5BA 2NW6A 1Z8NA 1RBYA 3GDHA 5DCLA 3DV0A 4BBZA 4XVCA 3UB4A 2PTHA 2AFVA 4IQGA 4EPXA 1OXTA 4HNRA 4KVAA 4QOSA 3HI4A 4QU0A 5B1EA 4MPJA 4W5WA 2QVXX 3PITA 4QTUB 3TD9A 3H2BA 2Y1OA 4ZCQA 2H2IA 3QV1A 1C0LA 1YRWA 2CV2A 2VJBA 3K73O 3JWJA 4RWEA 1OLOA 4R98A 3ICEA 2UKDA 3FNEA 2I4OA 4EHKA 2D7DA 2OMKA 3IXQA 1NG9A 5BORA 1TIBA 2WG2A 4AZ0B 1CQZA 2C00A 4IKPA 1VYTA 2WIGA 3BERA 2WJJA 3Q4GA 2LVBA 3KT3A 2PWZA 4M86A 1GCGA 2W43A 3ZNNA 1LK7A 2Z2YA 3JQ9C 4BCBA 4E2FA 2XB9A 2UYCA 1IY1A 1D1PA 4MYTA 1SHUX 5TQ0A 1C7ZA 3S28A 3UB2A 3CT6A 1XQXA 1PYDA 2Q0SA 3KFXA 2I8LA 4I8IA 4DY4A 3WK5A 4ER6A 3HV2A 3O90A 3WGUA 2HHHB 2IBSA 3DXYA 4EPYA 4N7MA 4Q7EA 3VOTA 3U44A 4PNEA 2QN3A 1XEXA 3EVFA 4K9KA 4AL4A 4OREX 3K5IA 3I9MA 1NN1A 3N87A 5JS2A 1BMDA 5AVVA 3ABIA 1E66A 1M73E 1IPFA 2WEKA 3R2JA 1MO4A 3ZWWA 3AEQA 3AY6A 4M1YA 4H1WA 2Y1CA 5HILA 5E1MA 3GLGA 1Y4AE 1CUBA 3TUZC 1NW3A 3UKOA 3TQRA 5AVZA 4BKUA 3IXMA 3VC2A 4YI3A 4EPTA 3S2YA 3FDIA 1RJ9B 4YRZA 7AT1A 4JJKA 4XD2A 1YUBA 1HTTA 2IQ5A 1MX9A 3KJZA 2XVZA 3PIDA 1CJKC 4RFLA 2NUPA 1PG0A 3HBLA 3FWPA 4HDMB 1ADGA 1EJBA 3B9PA 5DHTA 5C9ZA 3T4UA 4QKQA 1SXGA 4UBOA 5IJ0A 1JNYA 2AOUA 3B5IA 3HU3A 3ITEA 4L15A 1RPJA 1Y9AA 4MV3A 3UW1A 3WGQA 2NSJA 3PENA 4F7DA 4BC1A 2D1QA 2UYQA 1TEHA 2IOFK 1OZAA 2WSLA 4WXMA 5TEVA 3W5JA 5CDTA 2FQXA 5KMGB 3GRCA 4E5SA 4AWBA 3NUZA 4YDQA 3IDFA 2FR8C 4II3A 1OLUB 4B9AA 5SICE 4F3NA 5AW3A 3H3FA 1FTYA 4I9HA 4PYQA 3ZE2B 2YV5A 4FJ1A 3L5OA 5BN5B 5BUQA 5K0FA 4DLBA 5JBQA 4HZIA 1S3GA 4KX3A 1KARA 5FBHA 4CTOA 3A1UA 4YY3B 1XDDA 2DHQA 2IJGX 4MOWA 2CLMB 1ZINA 1X7WB 3PNKA 3WWPA 1IMJA 3HCBA 2XD9A 4W8GA 2I4IA 2BTOA 1B6TA 1GRRA 2N0SA 2SBTA 2V7UA 2M98A 3FMPB 3OZEA 2YINC 4FE4A 3ABZA 3TMAA 4BP3A 1ZMTA 1UEIA 5DHAA 4QT4A 3TBFA 2C82A 3PXGA 5C51B 1XVIA 1PLLA 2GLXA 3MMNA 4KK3A 4IL5A 4M0KA 1JQKA 4ZYYA 2REOA 5DEOA 2OZKA 4YCDA 1YCFA 4Q18A 2WFLB 4AQDA 3JTMA 1H3NA 1MCZA 4L27A 3JARB 4G65A 2UYGA 1S9HA 2CFOA 1V71A 1F4LA 4I4NA 1NBHA 3NLLA 3PS9A 1EUQA 3DT8A 3B9QA 1E96A 4DV4B 5ELXA 5EZSA 3SS9X 4LMAA 1STOA 2BHNA 4ZOBA 1H4TA 2BE7A 2ZQ5A 3HLKA 1IM8A 4YQZA 2W70A 4EG5A 1ITZA 2ZULA 4QUJA 4E12A 2H4YA 1DX4A 3QV2A 5JFGA 2H5IA 1MAVA 4LNUA 3W7AA 1CR1A 4FZ3A 4QXAA 1FCJA 4QFCA 1NPTO 2VSQA 3F98A 5EZYA 2B6HA 3OVMA 4AURA 1HNZB 5B37A 1K9SA 5JU6A 4N76A 4C22A 1JI0A 2L19A 1SKBA 2B36A 4S12A 4YALA 5AESA 1R12A 4HPXB 3NBKA 4CMAA 1QDLB 3KUKA 4P33A 4A6XA 1EVKA 1F8UA 2JFBA 1X15A 3D2CA 2F17A 2XKKA 2DSNA 4BO4A 1YOVA 5JWOA 4PXSA 5JQWA 3OESA 2FPRA 1E8DA 1N6KA 1Q2XA 5SZIA 4AKSA 5JV5A 4EO7A 5K8VA 2F8MA 1DRKA 4OFZA 4DT1B 2BM1A 1L5LA 3T41A 4BVEA 3GN1A 1L4FA 3F8SA 3GAAA 3I05A 3KXIA 3PUVA 4NDAA 5EJ6A 4B3CA 4CVNA 3V8NA 4RE5A 4HXEB 5F7OA 1D6SA 1DAMA 2W90A 3GP8A 3ERCA 2O7SA 2FSUA 3WQBA 4CEJB 1QOQB 1XZKA 1IDOA 3LC7O 2EW2A 5FX2A 1H5UA 1KYWA 3CN9A 3TR0A 5DCUA 3OO1A 3OLCX 1ECFA 3RSGA 2DR2A 2HJWA 1KSFX 2RGYA 4TRMA 1KYZA 4MZDA 1XCPA 2HU8A 3DOHA 4I5DA 1QAQA 1QHIA 1RCUA 3KOZA 2R00C 5DISB 4QXOA 4R8LA 5D3MB 1QYRA 1DBRA 1T1JA 1ZH6A 2P78A 3GFSA 1H94A 3PQ6A 4EECA 3UHAA 4CMBA 3GLGE 3JQGB 1XRRA 1N2HA 2KW5A 2RBEA 3N3AC 3R6TA 5JSYA 3JSAA 1E6KA 4RLQA 3EZXA 3X1ZA 5A4AA 2RGDA 2IP1A 3MBOA 3T61A 4GP6A 4FYXA 4YP9A 1M8KA 1O77A 3PT9A 1YD7A 2ZR9A 3C70A 4RHXA 1I9CA 3UJHA 2VJNA 1GTRA 1M2JA 3DL2A 5LIPA 2FOIA 1L8QA 2JDID 4OF4A 4B7UA 4E14A 3B13B 3TNJA 3AEUB 5DGXA 4WKCA 2P4EA 3PC2A 5JD3A 1X38A 1M1NB 3G13A 4R0MA 3X1JA 4DLRA 3LNCA 5K20A 4B43A 5F3WB 1HYEA 2O8FA 1Q95A 3TI7A 4BNFA 1D2AA 1ZOOA 1SRRA 2OVBA 4UQOA 3BKWA 5H7XA 4A26A 4B3SB 1RBMA 1XTTA 2QMOA 2VRNA 3B3QA 3MCTA 4LX0A 3WBKA 621PA 4ROSA 4OIFA 1SCJA 1YRQA 3UAYA 1KY2A 1R0WA 2FMKA 1E1NA 2VUUA 3AFHA 3M2PA 5IC5A 3V46A 2ZJFA 3D4PA 3WLTA 4JSRA 2ZWMA 1CC1S 4HP8A 1I4DD 2YC2C 3WB0A 1N4AA 3GDOA 4WXPA 3G8CA 2SCUA 3KOUA 1MJNA 3KT8A 3PKZA 3RSHA 2HWUA 4IWXA 4BO0A 4YS6A 4HVCA 2IUYA 1B8UA 2GZDA 2NT4A 1T5BA 2YV4A 4G3XA 2AZ4A 5C5DA 3F73A 4TLEA 1W44A 1T8PA 1KRWA 5G53C 2GN0A 1GKIA 5C0OE 4PSCA 2O57A 1UK6A 4LUCA 3CH5A 3F3YA 4DRXB 3D4IA 4LHZA 1NVDA 4JI0B 3N2NA 5FYDA 2QKYA 2GNPA 2Z3ZA 4B6OA 2E4XA 1GD1O 4BNTA 2QMHA 3I2YX 2R8ZA 2R7AA 2WP0A 1PJZA 1Y6ZA 1QP7A 1ZJ4A 1IOWA 3JAKA 4WDQA 2YJ3A 4OUDB 1Y9ZA 5SYNA 1G2IA 4WNYA 2WVJA 1EK2A 3GD7A 5LCXA 2B98A 3ZHXA 4D0GA 3Q5GA 1A5AB 5EJEA 3LRTA 4XRRA 3CYFA 2OTCA 4FIZA 2YDXA 1QCDA 2OOKA 1KDZA 3KJQA 1YE5A 4I6GA 4C6TA 4QYWA 3AHHA 4UQPA 4KR9A 4BV8A 2PH7A 5BSEA 3NETA 4LBWA 5AXDA 2JFUA 2GOYA 3PEWA 1WCV1 2X8AA 1OFHA 1WD7A 3A2MA 4Y2TA 3T4EA 3C3DA 1F0KA 2C29D 4EHJA 3BK1A 4WY2A 3R0JA 1CRLA 2P3QA 3EOAI 4N12A 3M5PA 2F43B 2ZJ0A 1G6Q1 5COAA 5TJ9A 2O19A 1TAGA 1TM7E 4Q4DA 4H3SA 3DE0X 3HQ4O 4QPDA 1BS9A 3WO0A 4CV0A 4U4AA 3ESCA 1VCMA 4HEA1 4KYVA 3I72A 4K6KA 3V33A 3NWEA 3TFWA 4M3NA 4XXHA 2VPZA 1DAOA 3OBBA 1C9JA 4Q9KA 5F7ZA 4DIKA 1UBGA 2B99A 2QG6A 2XV1A 2JLYA 2IW3A 4D0LB 3DBHB 5LZ4A 4TKUA 2QI9C 4OXYA 2FZVA 4ND3A 1Y1TA 4DN6A 1JDJA 3KU1A 3ZIAD 2ZJZA 2O0KA 3QKRB 4OVKA 3K15A 3HEAA 3ZW9A 2OD2A 1AV7A 2AJBA 2GESA 4WZAA 4YRJA 3EIEA 3B48A 1HEIA 4BLSA 4D46A 5DNAA 3ZCVA 3CEHA 1OB5A 1C3OA 1JVSA 2J07A 3MS7A 3O8NA 5DNVA 4CHGA 1BA3A 4F4IA 2QL9A 3KZXA 1E7YA 4NENA 1D0SA 3EYWA 1INLA 3VVCA 4YRGA 2UXDB 4IUYA 3FHCB 4B4UA 5BO5A 3GBPA 5HM8A 1KI7A 3K8QA 1J90A 4D2IA 2GYUA 2R1VB 3CS3A 3LT4A 3T0GA 3ZE7A 1H9CA 1Z2PX 2CDAA 2AH5A 1M8GA 1KZ1A 2R5FA 1IY9A 4OSOA 5IX8A 1W4RA 2MT9A 1MDBA 2ZB3A 1VL0A 1PK8A 4QBHA 4ENVA 4BO8A 3PQFA 1FU8A 2CVHA 1V5IA 1C2TA 3CRQA 3FHJA 4P3PA 3K94A 4LGCA 4HGZA 4WESA 2I71A 4YV1A 1A88A 5LJLA 3DKVA 3JQAD 1BVRA 3TMKA 2YQ5A 1WPXA 3VKHA 5BOSB 2A0KA 4KR7A 4QLAA 1KBQA 1R0SA 1XZFA 4FD2A 4I6JA 4K7JA 3FF4A 4PCVA 3FLMA 1M2KA 1MOQA 3KE9A 4FI3F 3MFQA 3VPCA 2ZT7A 5KJFA 3JR3A 1NHWA 4KQHA 3VOAA 4CLRB 3O1IC 4Q3BA 3I9V1 1YS1X 5E95A 1FNMA 5DGDA 5JRDS 3VH1A 3RC7A 3B12A 1OPRA 5A04A 3QWAA 4G0YA 5CG2A 5D85A 1S4MA 1X1DA 3HBNA 2ACVA 1DINA 2BHTA 2I29A 3EDRA 2XW6A 3GARA 2N47A 4ANFA 1ODCA 4DQUA 3KVVA 5A02A 5ALUA 3VAAA 1XCBA 2W93A 1G8SA 1NZDA 3O8OB 2O8CB 4R1PA 1KH2A 2J6BA 4YUAA 3P9ZA 1PZMA 1PG2A 4MV1A 1U3FA 3KUUA 2AK2A 4TLAA 4HBGA 2RDMA 4IZ6A 4DBVO 1I7SB 5J5VA 2AUTA 1ZRHA 2G9QA 2DP4E 3GLVA 3E03A 3AYZB 3A1DA 2QT1A 3AY0A 2WP8J 3CISA 3PGMA 1ZIOA 2NTNA 3G0BA 4ZO4A 2FYTA 4QYMA 5LYJA 3DZCA 3SXUA 4GZLA 3AM1A 2C3OA 3JZFA 2JFZA 3PRKE 4MEJA 5EUQB 4AU1A 2P6RA 3VHXA 2ISCA 3E2PA 3HH8A 2DWPA 1JYFA 1ZN8A 3JR7A 2QJOA 1QBGA 3AEZA 3P9RA 3RT1A 1TM1E 2JLCA 4S35A 2PGOA 5K3DA 3UMJA 1AQUA 3HJHA 4M8IA 2ZRFA 4JLJA 1P0QA 1VGVA 1YZGA 1YH3A 2C2BA 2O3QA 2R1ZA 3FPLA 4ZT4A 3DMGA 2PG3A 5BRAA 1USKA 4M1MA 4YP0A 3C5CA 3RG2A 3BREA 4H2DA 4H1TA 2VYVD 4CMJA 2ZE5A 3D2AA 3CJQA 4K81B 3UMMA 3A32A 2RFLA 3IP3A 4D9MA 5LMZA 2DLNA 2NUBA 1W0JD 2IU6A 4HDRB 4OMUA 5A5GA 3BD6A 2Y2UA 3CWQA 3Q1LA 4IIFA 5EIBD 1ONPA 3RUEA 4DLVA 3NXKA 1SZCA 2ZUDA 4MVJM 1KAOA 4DV0B 4PS0A 3M4XA 4H1HA 1YB5A 3WNZA 5JANA 2YTZA 3TEMA 5DB4A 1W48A 4P4GA 4XWAA 3ECSA 3D31A 1XMJA 4JCOA 3GJ5A 5FBRB 2NU6B 5TQ2B 4WD3A 5IABA 3HN2A 4GYWA 1HE2A 1KI2A 5AUQA 3HKEB 3SF8B 1E64A 3EXFA 1GRCA 3IURA 4YRRA 3WRXC 1G0NA 4LF7B 2ZAOA 3NONA 5FI3A 1NHGA 4C7KA 3BD9A 3WXMA 3WQSB 2A5DA 2N46A 1GKKA 1ULBA 3OQIB 1CZRA 3C4JA 5DF1A 3JAWA 5A5DA 1NJ1A 2G7ZA 4UJ3A 4WZAE 3KXPA 2B35A 3H2KA 4MVJP 4MH0R 1EP3B 3BDIA 3ZIAA 5TMBA 5LSAA 1ZS9A 2BGMA 2ZYSA 3AQ4A 3D3WA 2YUIA 4YONB 3IVRA 3OT4A 3VR2D 3W7BA 4B8WA 1KO4A 1DCTA 4GOOD 3BILA 3MT0A 1JPVA 1GVNB 1F6DA 1EDDA 1HL7A 2JFVA 5AKZA 5M3BA 2I3DA 3OA0A 5T4BA 4EGCB 3VKUA 1R8QA 1KFBB 4FBMA 4MPPA 4RY2A 4GYKA 1R74A 3F4BA 1ZNZA 1T43A 4WA7A 1KK0A 4LZLA 5LD2C 1QRUA 3PLAE 4XX1A 3LUCA 3NT2A 3T1QA 1E32A 1A7AA 1U2PA 2UVPA 1YBVA 1UF9A 4FFBB 4HN4B 1OX5A 2BD0A 2OQIA 3GGGA 4MR8B 2O4CA 1N1EA 3CW9A 3SJBA 1ZD8A 4LVUA 4DADA 3P9IA 3NHSA 1A2QA 4RFSB 3CU5A 3GVHA 1TLLA 1MAAA 1BMTA 1RQPA 2O2XA 4L5CA 1UJBA 1VE6A 2I87A 1YMVA 1IN5A 2IE8A 4GSKA 3M49A 5SY4A 4E11A 2X0DA 2PIAA 2HTFA 1Z4KA 3TPCA 1JVNA 1GEGA 2W42A 2AT1A 1WM1A 5D5HA 5FO1A 1LZKA 2MMCA 3TQHA 4EKEA 3FSGD 4ZJPA 2AUMA 2GILA 1NW5A 2O5RA 2V9PA 4PBSA 1KWGA 1WVMA 5GQSA 1JAXA 1EZZA 2IKSA 3JQAA 1RWXA 5FFNA 2GXQA 4ZK2A 1QO7A 1JFVA 3OUUA 4TVBA 4QC2A 1J2JA 1JFLA 3WRWA 3HL4A 4O4JF 2C7QA 3ZS8A 3I9LA 3MA0A 2I5PO 4GKVA 2D13A 3S6JA 3REFA 2J08A 3W8RA 3QBEA 5JXJA 5JYEA 5F9FA 1IHOA 5HS6A 3WGGA 2OAP1 5HFNA 4CLOA 4ZVTA 2PUEA 1QPBA 5JVDF 2QLTA 2WUFA 2FZEA 1FJ2A 1N2CE 2LP4Y 2QRQA 1E7RA 2PDAA 3HWX1 4OK6A 2I6GA 3BKXA 3G82C 4FN5A 5K0JA 4CGZA 4O59O 3NHWA 1JTVA 6AT1A 1I4TD 2F9MA 2C97A 4B80A 1SKQA 1U63A 1L5HB 2PU5A 4GOMD 2GCPA 4YDHB 2AC2A 2QNIA 3FNRA 1NF3A 3F2VA 2RGAA 4NH0A 5DTIA 4RSHA 4JI5B 3RWOA 1RLIA 4LYFA 5ALXA 3ZLUA 5LMCA 4ZEXA 5K9ZA 4YK7A 4B3JA 3I1FA 1YS6A 3QKTA 4HB4A 1DIOB 3BAZA 3QMMA 2QGNA 4A0GA 4ZGBA 4ZKDA 1LSOA 1F4VA 1ZIXA 3KEQA 5EYPA 2IS6A 3MF4A 2B5VA 5I6DA 3KPUA 4DB2A 1UBCA 3IEPA 1XUOA 1HK7A 3SLKA 4XUEA 3RC1A 2UUBB 1EK5A 1Y6FA 2GK6A 3QIVA 4S04A 2G5PA 1KSHA 2C2KA 1Z4OA 2XWQA 1F2UB 3AL2A 1L5GB 3UAXA 1X7GA 2G06A 4M83A 1UM9A 4B7AA 1T3SA 3I6BA 3L7AA 2HPZA 4P83A 4NS1A 3X1WA 1F0YA 1ZD1A 4QOGA 2AB0A 1OLXB 3UKJA 4P7JA 4DIOA 1Y34E 1ZQ9A 4LG1A 3M1LA 4DV2B 2HQOA 3DTNA 3O73A 2X9VA 4IEEA 4O3FA 4UVHA 1P8JA 4XIGS 4RENA 4DCSA 2UZIR 4K2HA 1N2BA 1RC0A 1U9YA 3K0HA 3V8PA 3FBTA 4LGYA 1YR3A 3PNSA 1LPMA 1E0SA 2KHZA 3EDQA 3KZKA 1P7PA 2ZSKA 5F5LA 4HD8A 5DYGA 1VL8A 3AFGA 4MDYA 4MS3A 2D2VA 3OQHA 5CLGA 4GE3A 4JZYA 1NBWB 1XTBA 4BQSA 1DIAA 5FUBA 2FMUA 1R5BA 2IX9A 4GLOA 4XRGA 1PW7A 5CDFE 1FIUA 2A59A 4YO7A 1H1TA 3JWHA 1YFJA 1UMKA 3EXIB 3SYMA 5JDIC 2GQ0A 3ZK9A 4YRAA 3E0QA 1NW7A 4QOHA 2AMJA 4ITUA 2B78A 2JIDA 5IFKA 4A16A 4GG1A 2ZB4A 3MWYW 1KAHA 3EASA 4RPIA 5CLQA 3A9WA 1CU1A 5ILGA 3AR7A 1YZVA 3G0GA 2HCRA 1I94B 4FNAA 3T9AA 3U7IA 3OX2A 1D5WA 2VLBA 1JJAA 2R6AA 3OZIA 4YT2A 3LQRA 5K3SA 4DV1B 1V3TA 2PMEA 4CL3A 1IJBA 4K86A 1HNNA 1QRRA 3BIWA 4QWMA 4FFWA 3TUIC 4EBBA 4F5YA 1JDZA 3FTNA 4UW9A 1BE8A 3VR6H 3ZX4A 2YVUA 3PKJA 4OHVA 2PANA 1B6SA 2ILTA 1B73A 4MPDA 3WL8A 4UXIA 1A8PA 3COSA 1RZ3A 3DV9A 1G9TA 1K5HA 2ZM6B 5B5SA 5JMTA 4FHZA 5F4BA 4J0JA 3N6VA 4YUYA 2HOQA 4LHXA 5J2UB 3QVGB 4MO9A 4MRMB 4IOLA 5DGIA 2BH9A 4QO7A 3ESYA 4C7JA 3JYHA 3O8LA 5HRUA 5HE8A 2CUTA 1BOFA 2YYYA 4MRRA 4RIFA 1EGQA 5AM1A 5IEJA 5K0ZA 5MHTA 5CU7A 4QRIA 3HXOA 2HRQA 3O0TA 1HBJA 4MR9A 3ONEA 1TYZA 1VL2A 1TK2A 2DJ5A 1DO2A 1KKUA 2ONKA 4J8PA 4JLWA 1JN0A 4FSXA 3U1BA 3EWSA 2JJYA 3KSZO 1ZESA 1VCHA 2Q28A 3DBLB 3CX8A 4X00A 2JCYA 2ALJA 3WL4A 5C7IO 2JKVA 4FP9A 4OQMA 1MOPA 2OHHA 5SZKB 5A0VA 2QN7A 4Q34A 1X7YA 3EWAA 3FSGA 5GZ1A 3ZCXA 1ZXBA 2BGWA 1Z22A 4A3SA 2G80A 3D2BA 1ND6A 1RI4A 4N54A 1UMBB 1YQUA 3B1VA 1UANA 3PRJA 4NU8X 5DI3B 4BYMA 4CMEC 4YIHA 1NX9A 5HPYB 1Y48E 1ESDA 4GGPA 4HDNB 1I6MA 3D0RA 2OMEA 4MYSA 3ZW8A 4YRSA 4GWKA 1GGFA 3H11A 5KNDH 3G3EA 3AXSA 5GONA 4KODA 4JY7A 5GJBA 4Z4QA 2NU9B 5FWXA 3AIIA 3KBBA 1QGUA 2DBYA 2VYFA 4QUIA 1ZL0A 5M2QA 5JZVA 3UJNA 4IDNA 4GM4A 1NT2A 1VKHA 5T4FA 5JI3E 2PSDA 1UKEA 2A88A 4H3KB 5DJ5A 3A4LA 2QX8A 4J1SA 2QRMA 2WTNA 4O33A 5KYWA 3SHOA 5J58A 1E89A 3L84A 1SELA 3M6MD 4M0FA 2AXQA 2DX7A 5KTNA 1M67A 3F9CA 2CYCA 2WUVA 2Y0DA 4WOKA 1J8FA 2ON6A 3OZTA 1CE8A 1ZGAA 4GEGA 4MS4A 5JROA 2OY0A 2V6JA 1CP2A 3CZMA 2GEKA 1SBIA 2Z5GA 1JU4A 4YJ2B 2AMFA 1T5DX 4BATA 1JA0A 2PFSA 4XA8A 1BKSB 2Q45A 3L4BC 2CNWA 3GHYA 2FP3A 3OZXA 3QQ5A 4L9SA 3R0ZA 5L3SA 1KP9A 2IW1A 1ZHOA 2O23A 5EGNA 3UICA 2J9RA 3I32A 3KDAA 3CE9A 3KOMA 3LTEA 2BKLA 3ONVA 3J81k 2XUIA 1CZNA 1NM5C 4TM7A 4UHCA 5EXPA 1I5RA 4OQ4A 3ZWNA 1KZ9A 3DMYA 3T7RA 2FLKA 3VTAA 1P2TA 4LXGA 3WJ1A 4QASA 4AZ0A 1GTSA 3HRIA 2GJ8A 4Q7JB 3X1YA 4XX0A 3VDXA 1P2VA 1WX1A 3R6DA 4C4YA 2Z09A 4GKKB 1Y3BE 4I46A 2R3SA 5E3HA 1RAFA 3FAKA 5CJ2A 5FKJA 3WAGA 4C30A 5A4FS 4HR7A 1JH9A 2W6PA 4RNDB 1UP7A 1YB1A 1Y5LA 1YE3A 4YMTA 2GA9A 2J9GA 3KYCB 2BFNA 2ECKA 4P08A 3KQWA 2PUHA 1L8XA 4ZCMA 2BR3A 2JGRA 3PL5A 1QH0A 1RQNA 5DHPA 3GLUA 3R24A 3BXOA 5HJ5A 2JGMA 4NG4A 2QQ5A 1RLJA 1FDOA 3LC2O 1FFXB 1T26A 3C98A 2ONCA 3X1KA 2YYAA 3LSYA 2DPYA 2PTGA 1R6DA 1SIBE 3ITKA 3QGMA 5BOVA 3UH0A 1BHQ1 1NTRA 1QX3A 4DANA 1M0SA 1Q1BA 3R3YA 4IX9A 2HPHA 4WXRA 3TX2A 4QOIA 4RVNA 5SY6A 3DBOB 3HHEA 4YHHB 4XFDA 3MWFA 3S2SA 2M6SA 5DCYA 3RFTA 4EI7A 2PSSA 5JSFA 1D7OA 3IB6A 3ICCA 3UANA 2PH5A 1HNWB 2P0AA 3HWWA 4I3GA 4PLHA 2V97A 4XUDA 1A9TA 1FXSA 4HDKB 3LNTA 3RF6A 4IRXA 4QFDA 3PJEA 1VFPA 3M8KA 4ITVA 3FTFA 3GQBB 4QFMA 1JHVA 3FA2A 2XMZA 3U1TA 2QTMA 3JTEA 3KB1A 2YICA 3R0IA 5F52A 4D02A 1I24A 5DT2A 3BJZA 5AIAA 3SNHA 2X7HA 1L7XA 1Q21A 2VCHA 3HZRA 4KR0A 4BNUA 2EF0A 4OHFA 1LW7A 1XMPA 4RZIA 2O1SA 3QW2A 1JV2B 3G23A 4W8OA 4ZWNA 5K6AC 4WY8A 3PI6A 2NU8A 2PEZA 4TUYA 4F60A 4HQ0A 4J1NA 3A06A 3KKNA 3RLIA 5CT6A 1YJQA 4PHTA 4DWVA 1WBBA 3H9BA 1JJVA 1ECPA 4MLDA 4XIJA 1VL1A 1R66A 2HA3A 1ZM7A 2VPWA 3FFXA 3HNOA 4KL8S 3O0DA 4UUOA 4YJGB 5CB4F 5L45A 2C59A 4EJMA 1SQ5A 4JC5A 3QBVA 1CZOA 5G0TA 3FGPA 4KQMA 4DQXA 3FZQA 2PD4A 3V2UA 2ATVA 1A4RA 3D1VA 2PQ0A 3AR6A 3FLEA 1J8VA 6ABPA 1BVYF 2D62A 2XSZD 4P92A 2ZEJA 5ALWA 5I7WA 1WW2A 1AG9A 5IVKA 4UZEA 3JARA 2Z4TA 4L76A 5DXAA 3R5JA 3CZCA 2REQB 2CFSA 3RQIA 2IU0A 2B83A 4DLTA 4MDFA 5BWOA 4JLPA 4BEWA 1A8IA 4QPZA 2GPJA 3GYGA 3X1MA 1E4EB 4HUTA 3C97A 1XTSA 4OFWA 4QXMA 1EVQA 1M8JA 2IEBA 1I80A 2P9HA 1AHIA 2NZJA 3DHVA 3N8NA 1Q19A 2RB4A 4IUCS 4KN5A 4ZAVA 1Z0FA 5IBPA 3ZGYA 2HSWA 3P7MA 3VOBA 1PNQA 2DPGA 4BNGA 4EH1A 1K7XB 1HLFA 2C9OA 2V9ZA 5LZ2A 2WD9A 2HXSA 3I30X 4MULA 1ESEA 4TTSA 3Q0TA 3IAEA 1T5HX 5EMJA 3G5MA 5ITZB 1IWBB 1Z3IX 2OCXA 3U9SA 2J8ZA 4LK2A 4R71A 1IUOA 4RELA 3DLTA 1A96A 2W2KB 4MW0A 4DEVA 3FETA 1XG5A 1N34B 1M7BA 1Y1RA