4X94A

Crystal structure of lysosomal phospholipase a2 crystallized in the presence of methyl arachidonyl fluorophosphonate (hexagonal form)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
376
structure length
376
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Group XV phospholipase A2
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 130
structure length 376
sequence length 376
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x94A01
3D7RA 2XUPA 1R9NA 4WDRA 4FBLA 5KBYA 2PKYX 4P9NA 2C58A 2O2IA 5C81A 1AGYA 4MEBA 1Q83A 1K8QA 4EY8A 3B12A 2RHWA 3HRHA 3WWPA 3F67A 1Y7IA 1CUWA 4RNCA 2JGFA 1A8UA 3OURA 5J3JA 1EI9A 3HYSA 4F21A 2OXEA 3C8DA 2QOEA 2XUAA 3H2IA 3VJLA 4J0CA 5AKKA 3WMRA 4MYDA 4BATA 2WU4A 4ETWA 1J2EA 4OPMA 1R9MA 5ALMA 4Y2TA 3FWHA 1W76A 3QYJA 4DYHA 3R0VA 3FOBA 3WIBA 2XQFA 5EIHA 1E8DA 2CUTA 3WK6A 2HA4A 5C8XA 1VLQA 1ZD2P 2CMFA 4H7HA 2HFKA 4P93A 3C70A 2VSQA 3IVMA 3QZUA 5C8VA 4OUKX 2C5GA 2I3DA 1QIGA 1USWA 1P0IA 3WK7A 3O4JA 1EVEA 1YAJA 4WY5A 2WIDA 1AURA 2OCGA 3STVA 2H7XA 3JWEA 4MEAA 3STTA 5FXMA 1YR2A 5AIBA 1M33A 5IVDA 1GKKA 5LLSA 2V97A 1CUUA 2HA7A 1F6WA 3GBSA 3A2MA 5T4BA 1Q0RA 3NGMA 2PM8A 5AM4A 5CH8A 2GYWA 3ZLVA 2I03A 2VATA 2YYSA 2O2HA 1W1IA 4H35A 5AI6A 1H2WA 3H2GA 4YASA 1DWQA 3H1AA 1EDEA 4HXEB 4ITVA 1BU8A 2QT9A 2RGUA 1T2NA 4AO7A 1L7QA 2WG0A 3L1IA 2HA3A 1QONA 3VJMA 2HRQA 3E1GA 1YASA 3P2MA 2PL5A 5AKEA 3SWWA 1FFCA 4NS4A 4KYVA 3D2BA 3ILSA 2RHTA 4FTWA 1JT2A 1AUOA 2R11A 4FNGA 4A5SA 3PUHA 1E3QA 1KU0A 5ALXA 4DTCA 1EXWA 4QZVA 3HABA 5ALIA 4C87A 1GXSA 4TVKA 2HA5A 4K2AA 4EY7A 3LCRA 1PV1A 4H7EA 1UWCA 2WTNA 2RIPA 1IZ8A 1XQYA 3SX4A 4PSDA 4BBZA 4G8DA 1ZIYA 1BRTA 1MX9A 4KAAA 3DKKA 2XMQA 3V1MA 3GROA 5DLPA 1JMYA 3HEAA 3AILA 3ANSA 1DT3A 1H2XA 3R41A 3FAKA 5C8ZA 2QZPA 4OYYA 5AK6A 2VAXA 4XWGA 4FFWA 2C4HA 2ZYSA 3IUMA 4INZA 4UHCA 5ALTA 2XUJA 4OSEA 5AKZA 3I2KA 4UBNA 1P0PA 1QTRA 3G0GA 2IX9A 2WUEA 3WI7A 4H7JA 4G1FA 1DX6A 3D2CA 2HA0A 1XRRA 4Y2QA 2XMCA 2ZYRA 4C6HA 3ICVA 3OPMA 5AK4A 3CCCA 1QFSA 4X85A 2Y1KA 3AFIA 4AZ3A 2HA2A 2VTVA 2JIDA 5AHXA 5AOBA 2OGTA 5ALVA 2FX5A 5DYWA 1XRLA 4Q34A 2OG1A 5ALYA 2CJPA 2EEPA 4DSAA 3L1JA 5EIAA 1B6GA 2Z3ZA 4BVJA 3PDCA 2WIJA 1VJ5A 2Y2UA 5JALA 3QPCA 3WKCA 3OC0A 1DQZA 3QPAA 2XT0A 1THGA 4Z49A 1UOOA 2BFNA 4WDQA 4NVRA 2VEOA 4MWTA 5AKGA 4BZWA 3G7NA 5SYNA 5T4HA 1F0NA 3S8YA 2Y6VA 1R50A 2ZSHA 1EHYA 4O08A 7YASA 1XZKA 2HL6A 5HF6A 5LZ2A 3O9VA 4FFVA 4Y9SA 3RLIA 3ESBA 4BB0A 1CQZA 4UUQA 1K6EA 3OG9A 1OCEA 4IO0A 5H3HA 5CT4A 4B81A 4CG1A 4BRZA 5CT5A 1SCQA 1DT5A 3IURA 4OCZA 4DMFA 5CBKA 3LP5A 1ZI6A 4EA6A 3V48A 4E11A 2HRRA 5AI0A 2JGJA 2VT7A 4RPCA 3PFCA 1UFOA 3YASA 4DNFA 1YB6A 3G0BA 3RKSA 1VZ3A 3GA7A 3QM1A 1CRLA 3H2HA 4OD0A 4X92A 1MT3A 4W1RA 2PU5A 3DD5A 3LS2A 4Y2YA 2AJCA 2WJ4A 2WM2A 2D0DA 3EQ9A 1VXRA 5KWJA 3K6KA 3VDXA 1U65A 1NU6A 2W6CX 1YCDA 4RGYA 2RI6A 4S0XA 5IKXA 1CUIA 1CUEA 3G0CA 3ZLTA 4Q3KA 4Y2UA 3QPDA 5DTIA 2DHDA 1FSSA 3QVMA 3MGAA 3I6ZA 3WK4A 4UBJA 3VKFA 5JD5A 3SC2A 4B84A 4DGQA 2VF2A 1DINA 2JEYA 4LYDA 3C87A 3UMJA 3H19A 1LZLA 1R3DA 3M82A 1YS1X 3FNBA 1XLVA 2XLBA 3I2JA 4I19A 3IUQA 1SCIA 4DLNA 3WL7A 1ZJ4A 2PPLA 1CUFA 3I28A 4QWMA 2XMBA 3R3WA 4BAZA 3I2HA 4G4GA 3GELA 2XUHA 3Q0TA 5HF8A 2QXUA 3C45A 2WLSA 4J0GA 5AIAA 5AKLA 4LHEA 1GKLA 1A88A 1BN6A 2PUJA 4MQLA 3HJUA 5AK3A 3FCXA 2HU7A 5E2IA 4FLEA 3DKRA 4PO3X 5CW2A 1CUCA 1PFQA 4HZGA 5K3CA 1FFBA 2PSJA 4KE8A 3O4HA 3WWDA 1N8SA 2XQGA 4HXFB 3ZWQA 5LZ7A 2XI4A 4DNQA 1QIIA 3IUNA 3DS8A 1XLUA 5ESRA 2GBGA 4HTAA 1QJ4A 1A8QA 4EBBA 1ISPA 2WFLB 5FUMA 2I78A 1EK1A 2HIHA 1ZD3A 4PW0A 5IVIA 1GT6A 2HU5A 3H0CA 2YASA 5K3BA 4CCYB 4X00A 1VOTA 4U2GA 1CUBA 3STYA 5AO9A 2WILA 4E14A 4PF1A 4U2EA 1CIJA 2NW6A 1H22A 1XZJA 2PVSA 2GZRA 1H2ZA 4Q3LA 5ALSA 3W2TA 4QDZA 5LZ9A 2PSDA 2HFJA 5ALGA 5AKHA 2WFMA 2QJWA 2Z8ZA 1LZKA 2PSHA 3M81A 1ZD4A 4GXNA 1A7UA 5EHNA 1HBJA 4Y2RA 2QRUA 3C6YA 5ALDA 4UPDA 4IQ4A 3CN7A 5CXUA 1WHTA 4QWWA 2VA9A 4XIIA 4AX4A 2HU8A 2RONA 5EIEA 2Z8XA 1XZMA 3V1LA 2AXEA 1QIFA 1MPXA 2X5XA 3QMVA 3H18A 2ONCA 2XUOA 2WUDA 3VXKA 4G4JA 4PSCA 5LIPA 2BAGA 5CH3A 4ZV7A 3OTQA 2V9ZA 3STXA 3M3DA 1LLFA 4PSUA 2VAVA 1UKCA 5ALNA 4AMYA 3AIKA 1J1IA 2QM0A 3U1TA 2OCKA 5A7HA 3VVMA 1QO7A 3HXKA 1QIJA 4J0KA 4BDTA 4H0CA 2XUDA 1WHSA 1Y37A 2G5PA 1LPBB 3CCBA 3ESCA 3IB3A 4L9AA 4CFSA 4E15A 3DEAA 5A7GA 4QNNA 5JD6A 1LPMA 3QMWA 4J0DA 3VISA 4KAJA 1ZIXA 1ODTC 4I4CA 1CUSA 2OLEA 4GW3A 2I3ZA 2BCEA 3CXUA 3WKBA 4BVKA 5ALFA 2JGLA 2C0QA 5A6VA 3MVEA 4N8DA 2VQ6A 4FOLA 2ZJ7A 4OB6A 1DWOA 1MNQA 3BIXA 4Y2SA 4FMPA 5KREA 3W04A 3A6ZA 4IH1A 1E8MA 3M83A 5JANA 4EHBA 1CFJA 3Q8WA 3EF3A 1HKHA 4B83A 4C89A 5DYTA 1CUAA 2PX6A 2WHPB 3TJMA 1ZI8A 4WCVA 2XUIA 2OQIA 4X3CA 1VA4A 3GZJA 1CLEA 3WWEA 3F96A 3WYNA 5CTAA 4AB1A 1MAAA 4J0HA 3NWOA 2WFLA 4UFPA 1EA5A 2XUFA 2ORYA 2WHRA 3JW8A 4B82A 2G4LA 2Y6UA 4FLMA 3HSSA 5DYYA 1MX5A 4CCYA 1Q0ZA 1QIHA 4X93A 4YPVA 3O4GA 4QDXA 1ZGCA 4AXBA 5AM5A 1JJBA 5HQ3B 4W63A 3EIOA 1OXMA 5K3DA 3BDIA 1MX1A 1VXOA 1JI3A 3DDUA 1XZEA 4K6GA 1RP1A 1MJ5A 1R4ZA 3FYUB 1UXOA 3PUIA 2ZYHA 4A23A 5E4YA 1EH5A 5I7UA 1HL7A 1XZHA 4KRXA 1QO9A 5FRDA 1LPNA 3AZPA 4FLFA 2DCMA 3RARA 3BWXA 4MQMA 4CG3A 1WPXA 2ZJFA 5FP0A 1MNAA 5JARA 4B0PA 4PNZA 2CBGA 3FLBA 3DCNA 1XFDA 5JADA 2B9VA 5DNUA 4EY6A 3D4LA 2H1IA 4LYEA 4CIAA 3RM3A 1NU8A 1LPAB 3ANTA 4UBMA 4AN1A 4WY8A 1FFDA 2ZVDA 1R88A 5AJHA 5C7YA 4BTLA 1TQHA 4OU4A 1DQYA 2XE4A 4N5IX 1ZICA 1GGVA 1P0MA 2J3QA 3WKAA 1WM1A 2VJBA 1YA4A 4U2BA 1BN7A 1H23A 3MUNA 5HCUA 5HK8A 4BAGA 3EQ7A 5AKYA 1IZ7A 1ETHA 2HADA 3F9CA 1UK8A 1HQDA 4EY5A 3FCYA 2RAUA 3AZQA 4ZRDA 2CEKA 1XZCA 1MN6A 4B6GA 5EHZA 3ESDA 1DX4A 4GEGA 1JKMA 1X2EA 2WJ6A 4G9EA 2BJHA 1NX9A 4DNPA 4I3FA 4UHDA 1CUYA 3WIOA 4BDSA 4Q05A 4DM7A 3C6XA 1TIBA 3FVTA 2FUKA 2XQKA 1ORWA 1QIKA 2DHEA 2WG1A 2ACKA 4ZGBA 2WJ3A 4KR0A 3KXPA 1CUDA 1MO2A 2EDAA 2JGIA 4OU5A 3LIPA 3BDVA 2AJLI 5AKXA 2DR0A 3DQZA 1Q84A 4B80A 2UZ0A 4QE3A 4ZREA 4E46A 5JZSA 4Q3OA 2GBIA 4QEKA 1YAHA 3O9MA 4WFIA 1LPPA 4BRSA 2JGEA 5AM1A 2X76A 4J03A 1GQRA 4X71A 5E4TA 4H7FA 5E4JA 2WHPA 5DNWA 1TRHA 2XMSA 3FSGD 5FPPA 1C4XA 5FPQA 2Y2VA 3G0DA 3WK9A 1EX9A 3F98A 3AIMA 3EQ8A 2DHCA 3I2FA 4BVLA 1XZBA 2XQJA 3AZOA 1JJIA 4LXHA 1TCAA 4XJVA 4NMWA 4Y2VA 1QIEA 1THTA 3R3XA 5ALHA 4EZIA 5EGNA 3V1KA 1DWPA 4GI1A 1FFAA 5BWBA 1XKTA 4B0OA 5K3AA 4OB8A 5BV7A 5HQ3A 2WG2A 1P0QA 4FNMA 4MJ3A 1DU4A 3ESAA 5AP9A 4J0IA 1B41A 3DYIA 5ALPA 5CURA 3GFFA 2YXPX 1ODSA 1AX9A 1U8EA 4F5ZA 4W1PA 3UUFA 1E5TA 5CT9A 1ZI9A 4N5HX 1UK9A 2GBFA 1KU6A 4CI9A 5AI9A 1E89A 3WA7A 4Y2XA 4DMCA 3KWJA 3DYVA 3PE6A 5AM2A 3G9UA 2HHAA 4K6HA 5HK9A 1L7AA 1JJFA 1TCBA 4HVTA 1F8UA 5IH7A 3EBLA 2YH2A 1HPLA 4AMZA 3CN9A 4X90A 1UT6A 2QR5A 1QTIA 1XZDA 4TPKA 2XMRA 1O6FA 2C5FA 2ZJ6A 4GECA 4AO8A 4DSZA 2Z3WA 1BE0A 4G4IA 4JNCA 4ZV9A 4ZWNA 4BE9A 3I6MA 5EHXA 4M0MA 1LPSA 3TGLA 4NZZA 4ARBA 1ODCA 3ZPXA 4LIPD 1MU0A 4HXGA 3WLAA 1JFRA 5IVHA 5JD4A 5EI5A 3NUZA 2PSEA 5CXXA 4RE6A 1SCKA 2DQZA 3F8SA 4X95A 4ARAA 1CQWA 3K9BA 2ROQA 4FHZA 3RK4A 5DWDA 5CRIA 2AJBA 2O7RA 4OYLA 1CUHA 4X91A 5CT6A 3BL8A 1IUNA 4TGLA 4ROTA 3WYDA 1ZD5A 2BKLA 1ZGBA 3G9TA 3IA2A 5JZ9A 3FYTA 2QTBA 1ZOIA 1S8OA 2VT6A 2O2GA 1L7RA 1XQXA 2Q0XA 3V9AA 1ACLA 3ZI7A 4G8BA 1HLGA 1XRMA 1XZFA 3WK8A 2J4CA 4KAFA 2OQVA 5JIBA 3U0VA 5I9IA 4W1QA 1AMNA 2DFPA 1VE7A 1IVYA 2WQZA 4UBLA 5ALEA 4C01A 4CCWA 3DL4A 4JYMA 4MYSA 5BWCA 4WFKA 2QS9A 4KRYA 3D5EA 5ALQA 4XX1A 3FBWA 4AQDA 2V96A 4GWLA 4F60A 5A62A 4D9JA 1WB4A 2BGNA 1EDDA 1QFMA 2ZSIA 3K2IA 2CKMA 4H7IA 1YB7A 5ALZA 4UBOA 2D5LA 1SFRA 1XRPA 1G5FA 5AM3A 4K5QA 2OGSA 1YS2X 4LXIA 3S2ZA 1BROA 3A2LA 3O4IA 3T52A 4KJXA 1LBTA 2XMDA 3WWCA 5IVKA 1R1DA 1WPRA 4BCBA 1WB5A 3ZLUA 6YASA 4X94A 4BC1A 4Y7DA 3STWA 3FSGA 5HKAA 1GPKA 3E0XA 3I2IA 4UBKA 1UKAA 5D3ZA 5JAUA 3BJMA 4Y2JA 2V98A 1VA5A 5LZ8A 1CR6A 1G42A 1XKLA 5ALUA 4P92A 3HLKA 4KEAA 4YX9A 1IUPA 2XB6A 1CUGA 1N5RA 3DOHA 1CUJA 3V1NA 1LPOA 2CB9A 4QA9A 4UHFA 3R3YA 1EB8A 3ZV7A 4H18A 3C6ZA 4W1SA 2XMZA 1QZ3A 3B3QA 4J7AA 2H7CA 1U2EA 1F0PA 5LP1A 3WQHA 1UZAA 1W52X 5AKIA 4H7DA 3WJ1A 3GUUA 1ACJA 3H17A 1TAHA 1C7JA 1C7IA 4GHWA 4LKOA 1MTZA 3E3AA 2H7YA 5A2GA 3W06A 4DIUA 5HZGA 3IULA 1PJAA 4QLAA 3H2KA 3L1HA 4X6YA 2QJRA 1K4YA 3QITA 3WKEA 3KSRA 4J0JA 2GYUA 2GYVA 1RYYA 1WCYA 1BEEA 2QUBA 4FWBA 2ES4A 5HF5A 4BTVA 4UBIA 1I6WA 3H1BA 4X7BA 2CZQA 3BXPA 4AN0A 5K3FB 2HDWA 2J4FA 5AKJA 1XQVA 5AI4A 3FLEA 5HFNA 1K63A 1J07A 2J3DA 3ICWA 1IUOA 1E8NA 2C0PA 1KEZA 5SYMA 3T4UA 1LBSA 4BAUA 1QGED 1HDEA 2BUAA 3C6BA 2WUGA 4PQEA 5YASA 3VVLA 2BUBA 3OOSA 5AOCA 2JEZA 3VJKA 3WL8A 1EK2A 1BEZA 5BOVA 3AIOA 5ISMA 2O7VA 4MXDA 2E3JA 4OB7A 1D07A 1CUZA 1CV2A 5AI8A 2OCLA 1EINA 3BJRA 1G4HA 4F0JA 5LYYA 1GPLA 5JAPA 1AQLA 2ECFA 4HAIA 3KDAA 4CIBA 3E4DA 3DJYA 5K3EA 1TK3A 3I2GA 2ZYIA 3WWOA 4B7ZA 1GQSA 2R8BA 4FBMA 2C7BA 2PUHA 1RWQA 2OAGA 2XDWA 4Q82A 1O6GA 4GBGA 2X8BA 4AZ0A 5ALJA 4MWSA 1CUXA 2AJDA 2BGRA 4U2CA 1JU3A 4EUSA 5AOAA 1T4MA 2XLCA 4ZXFA 4C4XA 1GZ7A 2IITA 5JYCA 3LLCA 1UOPA 4BE4A 2FJPA 4BC0A 3WL6A 3R3UA 2WHQA 1W4LA 2WKWA 3QBJA 4H77A 4W9RA 3BE8A 1XZAA 1X70A 3UUEA 2QKYA 2QMQA 5FKJA 2WU3A 3WA6A 3FVRA 3BIWA 4EY4A 2OGZA 5CT8A 4BZZA 1TCCA 1CEXA 2WTMA 4YK7A 5ALRA 3H04A 5KWIA 3HZOA 5T4FA 2H9YA 2WFZA 4DMHA 3C8HA 4B9AA 4LXGA 1H2YA 1AC5A 3DL7A 1QE3A 2B20A 3D59A 2G5TA 4DNOA 4M0FA 5ALLA 4XVCA 3G9ZA 2IIVA 3WKDA 3W9BA 3C43A 1QOZA 4WFJA 3A70A 4HRYA 1XLWA 3DOIA 1UK6A 4C88A 3FYUC 1SOMA 2AJ8A 2B4KA 2P8SA 4M0EA 3IUJA 4BCCA 5K3FA 4G8CA 4WJLA 4N8EA 3W05A 4PV7A 4QLOA 4X97A 4RE5A 1VZ2A 2XUGA 2VJDA 4P08A 3X3HA 1N5MA 3NOXA 3TEJA 2JF0A 2XMGA 3R40A 3MUOA 2WIKA 5DNVA 4IHAA 2GZSA 4JEIA 2JBWA 3ED1A 4KE6A 5DTJA 5JAOA 3LIIA 4L72A 1XROA 5AI5A 5A71A 5FOQA 3STUA 4UFNA 3C5VA 1XZLA 3KOOA 3QH4A 4IH9A 1ZJ5A 4JH0A 4N8SA 4U2DA 2QVBA 3FYUA 1YA8A 2WSLA 1X2BA 1Y7HA 3PFBA 1FFEA 4JUIA 4ZI5A 1TKRA 2LIPA 3I1IA 2WIFA 1EVQA 4B85A 5F4ZA 4HRXA 3I1YA 3H2JA 3R3VA 1MAHA 3FLAA 4KE9A 5LKAA 5JASA 1N1MA 2BUCA 3KWFA 2QUAA 1Z68A 4C4ZA 4UHHA 3IBTA 5ALWA 1UK7A 3WZLA 2W22A 5CH5A 5D7BA 1OILA 1WB6A 1J06A 1LNSA 5A7FA 5CMLA 4UFOA 2DQYA 3N0TA 1QIDA 5EFZA 3WZMA 2ACEA 2Z5GA 2XUKA 1AKNA 1QLWA 2FJ0A 1VE6A 1IMJA 1CVLA 4QDOA 1UOQA 4L3WA 2HM7A 3PI6A 2PSFA 4B9EA 3D0KA 5HF9A 3HACA 3JYHA 4Q1VA 4C4YA 4U2FA 4K6KA 5EHQA 3PICA 1W6RA 1FJ2A 5JATA 1XRQA 3IIIA 3F97A 3WK5A 1JMKC 3PF9A 4G5XA 5AK5A 3G9XA 5AH0A 4GLBA 2GBCA 5HFAA 4DMKA 3PF8A 2OCIA 3DNMA 4JYPA 3G0IA 4Y2PA 1K5PA 2WUFA 3WL5A 4J3JA 5JZBA 2OPHA 5AM0A 3D3NA 2QXTA 5JAHA 4GDMA 4BYMA 3WJ2A 5ALKA 2EDCA 4FKBA 4BP8A 3A2NA 1W75A 5I8PA 1XQWA 2JGKA 2VJAA 2PU7A 3AINA 5T4EA 4A16A 2K2QB 3BF8A 3KD2A 2G63A 2HA6A 1WOMA 1A8SA 1JU4A 1ORVA 1GPNA 2WIGA 1DTEA 4BCDA 2B61A 3IDAA 3R3ZA 5LZ4A 2XUQA 5FDFA 4L0CA 1SC9A 4X6XA 2OAEA 4KACA 4UHBA 2JGMA 1XRNA 3DLTA 3O0DA 5LKRA 4X6UA 4QDUA 3TRDA 3D2AA 3AJAA 1BCRA 3O95A 5AICA 4V2IA 3BF7A 5HKBA 3C5WP 3AUKA 1U4NA 1LGYA 5FV4A 2XQIA 3OM8A 1CUVA 4FDMA 5FLKA 1BCSA 4BP9A 1XZIA 4UHEA 2DSNA 1EB9A 5D3KA 2PBLA 4IH4A 3HI4A 1BS9A 1VKHA 4KE7A 4HS9A 4QDTA 1XZGA 4CG2A 1YSCA 5K5EA 2VJCA 3N2ZB 1AZWA 1G66A 3W9UA 4AO6A 1CPYA 3QMMA 4G9GA 1QIMA 3G8YA 1E66A 4H7KA 3I6YA 4EB0A 3HC7A 5DJ5A 1EDBA 3B5EA 3SK0A 3G02A 5D6OA 5ALOA 1UKBA 5LZ5A
chains in the Genus database with same CATH superfamily
4TROA 2BFOA 2GD2A 2JKVA 2WTBA 3EVCA 1GLGA 2RH8A 4JB8A 1JWAB 1G5HA 1ZITA 2OV6A 2YJ4A 3AR6A 3QU2A 4NYJR 2RBEA 5TB5A 6ABPA 2WNSA 2JAOA 2EYUA 8LDHA 3CXRA 4CL3A 4D3DA 2CCGA 2WMNB 3TIVA 1QRSA 3Q40A 1TEXA 2R1TB 3NPAA 4XPZA 2QZ4A 4DLAA 5BYAA 1H2BA 3FDJA 3KUUA 4GX0A 1T3GA 3F5QA 3HCRA 1IHOA 5KSPA 1K8QA 3RBVA 1WCV1 1C3OB 2C3UA 2RHWA 4PZ9A 5EP2A 2QUKA 3KX2A 4GXRA 2AZMA 3K9QO 4R31A 5JG7A 2PCJA 4CM9A 1XAJA 1HT1E 1TUBB 5FB3A 3WB9A 1Y7IA 5L9AA 5KKCA 3TD6A 1CUWA 2NUAA 1GZSA 4BHTA 3VHRA 1Z2AA 4YJFA 2NADA 2QE7A 4MVYA 3WO1A 1QYDA 3FGOA 1LBHA 4IDQA 3D8NA 4DW8A 2J6IA 1JDJA 5AW9A 4YB8A 4BFZA 4CM1A 3DEIA 3ZTYA 4DQVA 1T91A 2QTCA 4KDEA 1EI9A 3UMVA 4XVRA 4JI5B 3OECA 4PCLA 5GGYA 2Z30A 3FNRA 3T5DA 4DG8A 2VT3A 1PJSA 2XUAA 4UCXA 5B7GA 2JCGA 5LWQA 3ZW9A 2HYIC 3ZWKA 1DJOA 1NJ1A 1WP9A 3FETA 4JHLA 4MYDA 4BATA 3KQHA 3THWB 3LX5A 4XSGA 1HDXA 3KHUA 1NE7A 2G25A 4OPMA 1VJ1A 2L17A 5K0NA 4FHGA 4Y2TA 4S0ZA 2KMLA 3SEQA 3L4SO 3FWHA 3BCUA 1XCOA 1MJNA 5FI1B 3BGIA 1OFHA 4DYHA 3I5UA 1MOQA 3DGFC 5FUYA 4XGKA 3WIBA 1NURA 2MYNA 4I1YA 5GZ1A 1ZVVA 3KL2A 2CUTA 2Z4TA 2ZVJA 3WK6A 3HCOA 2Q3HA 2ZSBA 3IIKA 3O3NB 2F67A 1W34A 4XR4A 1VLQA 1T43A 4OREX 5DF1A 5GM2A 4KREA 1XZQA 1AZSC 4DBLE 3G9QA 1OXBB 1U28C 4IJWA 2Z09A 1EFRA 1X42A 2WTAA 3ZJ5A 5C8VA 4GE0A 1H0RA 1V26A 4C0WA 4BX8A 1BD3A 4RADA 2DH5A 2I3DA 4GKKB 1K0UA 1XTKA 4MHSA 3DFKA 3P0HA 5LU8A 3O4JA 4Y0VA 4JUFA 5F7XA 5TGTA 3B2NA 1EVEA 5BN4B 2Q7DA 3IMKA 1AURA 2C9BA 3Q2KA 4D9IA 3Q41A 1YBAA 1U9ZA 3JYNA 2I6XA 4FP9A 5BWOA 1KA9H 3NYIA 1WQ3A 2GFQA 1R12A 2H7XA 4GX2A 2XZPA 3D8HA 3EIHA 3PGJA 3RIYA 3S2UA 1JPVA 5KCMA 1RKBA 2ID7A 2RBGA 2ZCVA 1FLNA 2AKAB 3NTRA 4EAAA 3N9IA 2YYAA 2P9YA 1X7ZA 2AEFA 3GVCA 4WT7A 1FIUA 4OHMA 2BE9A 5AIBA 1G18A 3LUHA 3OHMA 3PSHA 5IVDA 2PT5A 1WXXA 2DBRA 4RL4A 2JLBA 1A2KC 2FWIA 1UWVA 2HT1A 1F6WA 3QY9A 3EIWA 3A2MA 3EXG2 4WJZA 1JG3A 5AM4A 2PM8A 4EF6A 4K6OA 5JNTA 4Q15A 1K0FA 3JYLA 1QRUA 3MWEB 1JH8A 4YRDA 1YZTA 2POQX 2ZAGA 1YRHA 2XUZA 3AESB 2OYSA 2WSSA 3ITDA 4QAJA 2W42A 1X19A 2N3ZA 4YACA 2GVDC 1VC2A 4GPAA 4PRLA 1AKVA 1Z2EA 2A5YB 4HLDA 1KRXA 4IEIA 5GM1A 4RUKA 1AHPA 2EX4A 2JI6A 3QU4A 5CP8A 1EGMB 1W85A 3W8NA 1X8KA 1HDZA 2GF0A 5EKXA 2C2HA 2Z95A 3DWIA 3JD1A 4LV6A 3EVTA 1TGVA 4CTJA 4NU8X 3U60B 1BHSA 1V1JA 1ZUNB 5GPBA 4YT2A 4YASA 1DWQA 4P36A 3H1AA 2XB9A 3MJTA 3MCAA 1FVOA 1BU8A 3DMYA 3EG9B 2QT9A 5WRFA 3WQQA 4A8TA 1AS3A 2EJUA 2GOYA 2YZGA 2RGUA 4JZKA 1Y6ZA 4Q4DA 5JE8A 4AO7A 5K8LA 5DBIA 1N33B 3K9CA 1NW9B 2QW1A 4QQFA 4QPCA 2A5JA 4Z7NB 3WJAA 5HZKA 1A8PA 1JEJA 3BBPA 3CKLA 1NJSA 4S3MA 1XPJA 1L3CA 2E9SA 2R84A 2VHYA 2HRQA 4R01A 4QTXA 3V8VA 4HH3C 1L5WA 2JAUA 2Q50A 3OLVA 5BP7A 3GJXC 3VPAA 1T6XA 1YASA 3KZXA 5FJJA 4D80A 1GSHA 3MGCA 1KDPA 3ID6C 4LQLA 1FFCA 1FS5A 3AHEA 1FTSA 4CDNA 3NHFA 5BUZA 2CF6A 3VOAA 3WIDA 3UUGA 1V6CA 2I1WA 4UMDA 1DJPA 5CGQB 4BLOA 2Q5OA 4FTWA 1VFNA 2RH9B 1FY2A 3GUHA 4NK4A 4KWEA 3JX9A 2C82A 2Z5VA 3P45A 1PL0A 2C2MA 1G3UA 4JX8A 2XA9A 3PUHA 1JYFA 3K5IA 3V8PA 1RFGE 3IV7A 4OGGA 4PFKA 1NXWA 4TXLA 2I29A 4X1OA 3RVPA 3ZZNA 2PZAA 5DX8A 1Y3AA 5JHGB 2AE2A 2CJWB 2IZ0A 3GNQA 4UTZA 3TI7A 3BHJA 1R0KA 3Q0IA 4EH1A 3R9IA 4ZCMA 1QF6A 2C92A 1H2FA 2D5AA 4HGPA 1FTNA 4JSRA 2PFKA 1LW7A 4P35A 4GICA 4I1RA 2HDOA 1ONNA 3HVKA 4PPFA 4RTQA 4K2AA 821PA 1L8QA 3EGXA 1G7SA 1DAPA 1QTNA 1WMDA 1E2NA 2AX3A 2WTNA 3CF4A 1MENA 4PAMA 4TV8F 2RIPA 2BZGA 2BELA 3CY6A 2QVGA 4WVFA 1WUIS 4QOHA 1JJVA 1JEQB 4TWIA 4Z8XA 1R0YA 4HV4A 1SBYA 2H1WA 1Y1KE 3K70D 2IZ5A 3CB4A 3N58A 5IJ9A 3NVAA 1PR4A 4PSDA 1U5AA 4TRMA 3L93A 4DLKA 1RBYA 4YXFA 1QP8A 2E1RA 3QW2A 4QL3A 3CUEF 3S6JA 3DKKA 2YUIA 2XMQA 2ZWIA 1NF2A 1VRWA 3KS9A 3PCXA 5E9QA 3S5UA 3WLOA 1ZK4A 5CFZA 4X8LA 4I3HA 3TMAA 2VC2B 5DLPA 1JMYA 5JNLA 1CFZA 1SUAA 1UXIA 3EVFA 3H5IA 3HEAA 1KTVA 3M3HA 4X65B 3GFVA 1AKRA 3OPVA 4IUBS 3KQOA 3L2OB 1FX0B 4K9PA 2GA9A 4K05A 3WL4A 1O8BA 2YC2C 2QN2A 1TLLA 3OICA 5F9HA 1C3OA 2XXJA 4U8HA 1QJCA 2I4MA 2VYNA 3COPA 3WLNA 3AUJB 4JUDX 1I0IA 1TUBA 2Q3DA 4C30A 2VA8A 1KPIA 2J41A 2O0MA 5AKZA 1QX4A 4Q21A 1G291 5KYUB 3Q3EA 1FP4A 3L92A 4WNIA 4DWVA 1GO2A 2AOWA 4MKFA 3TLXA 1VTKA 1QDEA 1YUMA 4UOEA 2XNDD 4ILEA 2WUEA 1PSZA 3W6OA 3WI7A 1G8AA 1IRXA 4DOMA 3ISTA 2QYHA 3I01A 4J1TC 1K7CA 5JAIA 4EM6A 4H7JA 5KTKA 1RZUA 2NZUG 4R1NA 1HT0A 3GT4A 4Y9TA 4X20B 4ZEWA 5BNWA 3D2CA 2HA0A 4DSUA 3W3AA 5MDHA 3D4NA 3GFBA 3IDZA 1XRRA 4P1ZA 1SBTA 2JDID 4IZOA 1RT9A 4PGAA 2G77B 3KJEA 3TRFA 3LOQA 3WTBA 2G1JA 3ZI0A 4P0TA 3AJDA 4A9AA 1K2WA 2OOSA 2BFFB 2XVXA 3FBTA 3THWA 1LX6A 1V5GA 3T3OA 3OPMA 4MHOA 3WRYC 4J1QA 4EA9A 1ECFA 4ZZ2A 1WIWA 4X85A 2Y1KA 2QP4A 4ZICA 2CDCA 1H5QA 1WTCA 3NAMA 3RJMA 2VTVA 4YRSA 3AGPA 4HD8A 1R8XA 5BMVA 4MGEA 1KAQA 4I36A 1UXGA 2DFVA 5JW6A 4REMA 1ZNXA 2QTTA 2CFTA 2OEPA 4D56A 4G67A 2GLTA 3RC3A 4MW6A 3UWPA 4RM3A 4AZWA 1Y3IA 1XRLA 4PXSA 2JARA 5DISB 3AVWA 1LRKA 2OG1A 1D5WA 1TQ2A 2VNAA 2CJPA 2FRXA 4JXJA 4NOKA 3LC2O 3RUDA 3TTTA 2GXAA 1FSPA 1E64A 2EEPA 3P5BA 5AD1A 4GE3A 3L1JA 4JLDA 4Y6OA 1T5TA 5C1BA 2YUTA 3DZDA 5ES4B 4Q3AA 3RVSA 3WBBA 4I1UA 4BVJA 1C41A 2WIJA 2AQHA 2O8CB 4MPTA 2GJSA 1WCWA 7MHTA 1DS6A 1KJWA 5BN4A 5J40A 5IYZB 1RWXA 1NDUA 3OC0A 4PO9A 4KPGA 3IEVA 4CV3A 3L0DA 4KU4A 5C37A 5DM70 2DG2A 3OESA 4K7JA 1VMDA 3CX8A 3VO9A 5KPJA 1U2GA 1V1RB 4LYYA 3NC0C 4MWTA 2Y1XA 4MYRA 4R05A 5EN4A 3U3JA 1QGDA 4BZWA 5BSFA 4O1MA 1MB3A 3OOYA 4PU0A 4YGXB 3IGFA 3UHJA 2X19A 5F5NA 4DV2B 1AB5A 3L79A 2YZ7A 4RKRA 4ZO8A 3HRIA 1X39A 4OMFG 1IK6A 3ZCQA 1TF5A 1R50A 3RUEA 4N48A 4FB5A 2YV2A 4C4AA 1CS4C 4RTOA 2GETA 3MWEA 2ZT8A 4HN4B 1FUIA 1SPXA 3AESA 5FUQA 2SECE 5LZ2A 2C7GA 4ARZB 4PZAA 5JJIA 1KETA 3O9VA 4D81A 1KRHA 1P77A 2HSJA 3QE0A 1Z07A 3WADA 4Y9SA 3RLIA 2PHZA 3LY7A 4B4KA 4A15A 4RK6A 5LBIA 1X7YA 4DZTA 5IABA 3PUJA 2HWXA 4AY3A 5F1YA 2BLLA 2A78A 3TM5A 1S2IA 5CPBA 3I5YA 5JLJA 2P9QA 4CT0A 2WR8A 1Y8CA 2O8BA 3KFLA 1S4QA 1Y3CE 1E69A 1ZUNA 3AQ4A 3QK7A 1RYMA 4QU8A 4ZVSA 1U1DA 3OX1A 5A03A 1XR3A 3KKEA 1D2GA 1P8JA 2QAGA 3UB4A 1J9ZA 4HATA 4BQNA 3JSAA 4ARVA 2Q1SA 2XYVA 4W9NC 1K89A 3BD7A 3MRSA 4MW9A 2PSSA 3S2SA 1WUTA 1O94D 2IDZA 2XCQA 3AEXA 4OQFA 1AN9A 2ZYGA 4R1PA 3CKYA 3HB1A 4ZCIA 4MPPA 3ACCA 3EZNA 4A0QA 1RWPA 2WOJA 2OYCA 1ZUD1 3TLGB 3LL4A 3LHIA 1EWYA 1G8HA 1NVWQ 3DDZX 1FK8A 3Q12A 3OT4A 4EG4A 4ZYXA 2VRNA 3IVGA 1SIWA 3CBGA 2I66A 1EVYA 4JDUA 1S2NA 1RYEA 1U9JA 5JISA 5JO9A 1T1RA 4DG9A 4FFPA 4DNFA 1IXSB 3RKSA 1YRLA 3GA7A 3OZRA 3H2HA 4EKNB 1OJLA 2FW9A 4G1UC 4QYTA 1QRRA 3OJ0A 4TKUB 3L7NA 3CLRD 3W5VA 5EJ2A 3A4MA 3OPYI 4WCFB 1TRKA 3LTNC 2H4ZA 1PVVA 1PU2A 3DD5A 1PS8A 2WY2D 2CJWA 2WJPA 1CXZA 3E9QA 3OH8A 5ULLA 5ETJA 4ALJA 1X1RA 3LU1A 4OJYA 4ITUA 4Q47A 3E05A 1USKA 3IFSA 4X7MA 2Q9UA 3LC1O 2ZE8A 1DNPA 1SA0B 3CRNA 2WJ4A 1ZR4A 2IYWA 2FWPA 3QUTA 1V16B 2WM2A 2WC1A 4CLRB 2X40A 3GK3A 5JTTA 1XNRB 1ULBA 4GKAA 3ANNA 5CFNA 2CLHB 2HEIA 5BW6B 3KQKA 1PWXA 5DX1A 1PTJA 2IK8A 3NHZA 3VDMA 5K0FA 1SUWA 5KWJA 1JEQA 4IIYA 5DBGA 2W6CX 1R0SA 3PEUA 3VPHA 3M89A 1J00A 1GOTA 2FFQA 3ES9A 1XGKA 2AKYA 3IUYA 3KJXA 2V9PA 2TRSB 1UINA 1OFVA 2RJ3A 4R54A 2JFPA 1NLMA 2RI6A 1OAAA 4S0XA 2BH9A 2RB5A 1X1AA 2VDPB 1CUIA 1I14A 2CDNA 1GTZA 1YR6A 3HP1A 3SU8A 2V5VA 4Z1MA 3QPDA 4MLZA 3ZIAA 1HA3A 3W2GA 3FSEA 2W2VA 3P9QA 2QK4A 3GLRA 3LV8A 4D96A 5ILOA 3KLOA 1DO0A 3WYGA 4UBJA 1FX0A 3C48A 4OJQA 2KLBA 1RLJA 1BKSB 1XJQA 1ZXLA 4MX8A 3RUFA 5HE9A 3UH0A 4DGQA 2PMBA 4LYDA 3I4FA 3RASA 3C87A 1FYVA 2PCLA 3HB0A 3OQ6A 2Q99A 1EQUA 3D8TA 4ZAZA 5HILA 3VKVA 4CM8B 4EW2A 5CG1A 2ZUUA 5H83A 3H19A 3UMJA 5CVVA 2QRHA 1KWKA 3LDGA 4Y8VA 2Q6TA 1R3DA 2J6CA 2JW5A 5KYUA 3DR5A 4DHEA 3R8FA 1H1DA 2EWVA 5AT1A 5CDTA 1YE5A 2EAUA 3OFVA 3T7EA 1Q91A 1ODLA 3WFJA 2CNKA 3I2JA 5CA1B 3OZFA 4TRRA 1XTQA 1KK3A 1UM9B 3IUQA 4QHYA 4AJKA 2V55B 2AK3A 4PZYA 4TQUS 4X20A 3RHSA 2JCBA 4X66B 1ATIA 1YONA 3DBRA 4L95C 3EPHA 2C2GA 2AF3C 2UZ4A 4EYKA 1XT6A 1V71A 5AW4A 1OYWA 1ZXXA 2X9LA 2UYQA 2BFFA 2H3EA 3KKOA 1XHLA 2GZHA 4NBRA 4CT5A 1TO6A 4W6QA 5ABPA 4EJSC 1HQKA 1P7CA 4UM5A 2IXEA 4Q9IA 3GGGA 1RPTA 2W2LD 3DMHA 2WTUA 1QOQB 2WE8A 4RX1A 3D6JA 1TYBE 3ZY4A 4C7MA 5AJUA 3HKEB 3I12A 3TOVA 4I81A 3AU9A 5J2TB 3TQIA 4AS1A 1E3IA 2VS1A 1YIOA 2E2WA 1SKYB 2GI4A 3ZCXA 5C51B 4XGNA 2JLVA 4FGUA 4MW1A 4TTQA 1BN6A 1HYQA 4EELA 1AHHA 4OGWA 3NYRA 4A8JC 3ILVA 4MKGA 4I4IA 1GUBA 3OZWA 4EFNA 1P0CA 3FKQA 1H0KA 5AVVA 3DKRA 3HJCA 1WG8A 5BUCA 4MH0R 1ODFA 4GZLA 1PFQA 3PLRA 3PHJA 3D9QX 3FWPA 1A4XA 3NHLA 4ZQBA 3A6DA 2BSXA 5EP1A 3E3MA 5H59A 3GRFA 1WABA 2WT4A 3HR8A 5CVCA 1SWVA 3EXFB 4RPIA 3O4FA 1YRAA 3PUWA 1MAVA 1RXVA 2XI4A 2Y99A 3ND5A 1NNSA 1ZLYA 2FX2A 5IAEA 5IYZA 3TTWA 4DR3B 1JFSA 3SXUB 5JZMA 1RLTA 3ZU3A 3B51X 4D6PA 1TO2E 4NHEA 1U0RA 3N2GB 5EWLB 4EFLA 4DY6A 4K9SA 5JDIC 5KC8A 5IKMA 4B2LA 2ZT5A 1V1RA 2AZDA 1A8QA 1VKOA 3ASZA 4KHZA 4EBBA 3GRYA 4P7BA 1EK1A 1AO3A 1W48A 1U81A 2F1KA 4I9FA 1U7XA 3KQYA 1DHRA 3U9TA 1K8XB 5AW6A 5FJIA 1OGYA 1I32A 3RS5A 4M1KA 1FLDA 5EMKA 4TWRA 5CM2Z 1TZMA 2HU5A 2M98A 1JR2A 3G82C 2CSUA 3NIGB 2YFHA 4I55F 1AH2A 5E0KB 4EJFA 4YCAA 2F3TA 5K3BA 2G8LA 1R0ZA 1XNHA 2X13A 1QH1B 3GG9A 1NBME 2QRGA 3QBEA 4ND3A 2QQGA 3T61A 2C29D 3LD9A 4Q1FA 3WYAA 4ARZA 5HUJA 1G2OA 5H7XA 4KV9A 4FFRA 5AO9A 4BO1A 2NTEA 2H08A 2WILA 4JQZA 3F6CA 4KLAA 1S7CA 5ECWA 4TZ0A 4C0AC 2GM3A 2JLRA 1F14A 1UP4A 2BM0A 3HDJA 2C84A 3AM5A 3V00A 4XB6B 2JJ2A 1JL3A 1U8FO 3DZGA 5CU7A 3ZQJA 2ZT6A 4RDCA 4MVJD 2NW6A 1H22A 3AVYA 1FBTA 1XZJA 1FDTA 3ENNA 3IQXA 4YH1A 4MWZA 3TL6A 3CH6A 2AE1A 2HCBA 1SQ5A 4FOSA 4RHYA 1F9EA 2AR9A 3T54A 3E3LA 3DCIA 1GD1O 1YS6A 3GGCA 1QZXA 2DPMA 3VOSA 2TMDA 2GYYA 3CPEA 3ORRA 3P9NA 3W2TA 4MMZB 4GLFA 2DUUA 1G19A 3QFTA 4QJ4A 4CDRA 4IOLA 2QJWA 3M6AA 1PFKA 1M9NA 2JA2A 3LW7A 4U7WA 1LZKA 4U9HS 4Q3EA 1A7UA 2WM8A 4ZQCB 5EHNA 5B7QA 3ZDYB 4LF4B 2IV7A 1TZBA 4WX2B 2H2WA 2GGSA 1U2PA 2IYTA 1FQKA 1NBWB 1V7QA 3R8CA 4F4DA 2CV2A 4HZUB 3ZY3A 1R6AA 3ANYB 4PGHA 3WYBA 4L7QA 4Z4HA 3Q8XB 4HRAA 3WR5A 4MWDA 1CZHA 1E3TA 4EHDA 1O94C 2EOAA 2DMRA 4OUDB 4PANA 1K7SN 3HH8A 4W5NA 4TKUA 1V96A 1VE5A 2QN7A 1G2IA 3MINB 5GZ6A 4WCFA 2RONA 1OT3A 1Z5PA 2R1ZA 5JJLA 2DC1A 2QAJA 1GDTA 1GTJ1 1JTFA 4FFLA 2XSZD 3KE9A 2ZRFA 1SA0A 3NATA 2PUDA 1ZP6A 1V16A 4A27A 2ONCA 4UREA 4XZ3A 4CLRA 4AUKA 1JQ3A 2WUDA 4J29A 4MRRA 1QHIA 1ZUIA 2EL7A 2F1IA 221PA 1P2TA 1I2BA 2P6UA 4IMIB 3SZ3A 3VXKA 3CLRC 3GLFE 3U2QA 2FY8A 1Y6QA 1F6DA 2B7LA 2BDUA 2MJLA 1PNVA 3EVDA 1PZMA 3PJEA 1JR4A 1MA0A 2BAGA 3UNXA 2CE7A 2AXPA 3G5AA 5FTLA 3F49S 1CJKC 3OTQA 2AZTA 2CXRA 2EERA 2RGBA 2W6QA 3H1FA 4YP9A 5B3JA 5IBCA 5LL6P 5DLYA 3QNWA 3SHQA 1WETA 2VXBA 3RU2A 1CY7A 3AIKA 3VSBA 1IBCA 1J7KA 1MP0A 3GUVA 4JL5A 1JG4A 1T8RA 3Q88A 3TPFA 4JX9A 1ST3A 3KALA 2LZ0A 5C5CA 1UFQA 2FW6A 9GPBA 4NZMA 4HNHA 5KVSA 3CNLA 5JMOA 2BKUA 4BVBA 4UASA 2X9NA 1GPYA 1R6XA 1SBHA 2AG6A 3ELWA 3U1TA 1NBIA 2GBLC 3A0UA 1U0NA 4RY8A 1LTKA 5IUJC 2OCKA 2WBLC 4M86A 1Q1BA 4IOMA 1P9RA 5DDIP 4ZO4A 4C07A 4R16A 2O6LA 4JHXA 4ZYVA 3AUSA 1GAWA 1QIJA 4J0KA 2NQ8A 1M0SA 2AFIE 2FQXA 2XUDA 3ZHSA 4CM8A 3VUFA 2WZBA 4L9AA 4CFSA 4TVSA 2F43B 2JLZA 1ZRNA 3D3QA 4R98A 1FDIA 2X0EA 3ZV5A 2VUUA 2I3AA 2C4VA 2K5UA 2Q5IA 1TADA 3NTLA 1T25A 2W83A 1V35A 1ZQ9A 4J0DA 4KAJA 2ZU6A 2XKKA 3D8SA 2F62A 1SKMA 3KXLA 5CA1A 5CLIA 1FFHA 4I4CA 2PEZA 4Q00A 1UM9A 2MSKA 5CW1A 5AVTA 1J1UA 1K4MA 2ZBDA 2OLEA 2Q45A 2I3ZA 3X1JA 2RD2A 3HEBA 2JCYA 1KMHB 2YMQA 4UEWA 1HT2E 5CHEA 4YAWA 3MCVA 1PHRA 3TZHA 4AQ7A 2H4WA 3X43A 1H1LB 5L4NA 3E8SA 1G8KA 4P34A 4CQLB 5IRCD 3U7IA 4N8DA 3CVWA 3PDJA 4OXNA 3CPSA 3WLQA 1Y89A 1RKVA 2C5AA 1P9LA 2C98A 2F1HA 1YXMA 2WNIA 3HKEA 4OH7A 5A1JA 3WMXA 1E2IA 5J2TA 2G36A 2OV3A 1UMKA 2M1XA 4Y2SA 1L5LA 4ERNA 5KREA 3QPVA 4JDPA 4EVSA 1IM8A 1ONBA 1E8MA 1YK1A 4WHMA 4KYTA 3JARB 5JANA 4N4AA 5TF4A 3B52X 4WLEA 5BY2A 1TKCA 4KDFA 1BU5A 3Q8WA 1ZYUA 2HO5A 3PWTA 3RUHA 1NXQA 4O5AA 5IVPA 1JPJA 3A25A 4ZT3A 4NH0A 2EP5A 4DLLA 5F2OA 1Z0ZA 3LLSA 1NJ8A 2D8MA 3BQMB 4FWTA 1T5LA 2G08A 3GU3A 2CDAA 5CA0F 3IQFA 1KORA 2PL3A 3EXFA 1Z7BA 3GRCA 2PV7A 3ISJA 4NDAA 3Q15C 4O8ZA 4XH9B 1QZZA 2PZBA 4KVAA 5IFLA 3BIJA 2R44A 2AW3A 4TLBA 1RM3A 1NKTA 3WWEA 3C3EA 4YAGA 4I50B 1JHAA 2ODAA 3CQ9A 2FKAA 4AB1A 2BVNA 2H06A 4BGDA 3N2GA 1B8UA 5EWLA 3F8WA 2CNBA 1PZGA 3CH7A 4RAOA 3WOHA 5CB4B 5E6UA 5D3MB 1KO1A 1KVSA 3TJZA 4CCSA 1ZJYA 1MAAA 4YRLA 4F46A 1PIWA 4U7HA 1Q7TA 4IIXA 1IPHA 2K6GA 2QVZX 5EJMA 3ZZ0A 1TJPB 4EUKA 2P9GA 3JQDA 1REQB 2DRIA 3JW8A 4AX8A 2H7VA 4YRBA 1F2DA 1QV9A 3M6LA 3H6HA 4BRUA 3X1MA 2Y6UA 3HFJA 4PTZA 1NI4B 4JT8A 3TUJC 1JSLA 2C3YA 3WNBA 4DLZA 1SN7A 4N5LA 4UU0A 2IJGX 1Q0ZA 1QH1A 2QNRA 4G01B 1ORHA 2WABA 1ABFA 2GN9A 2Q5QA 3OFJA 3WLRA 5JU6A 2PL1A 3H4IA 4RD1A 2YS6A 2OBLA 1CF2O 1P2DA 2G70A 1U3UA 6ADHA 2V7BA 1IN4A 4XWTA 1T0HB 3SICE 4CE6A 3CRVA 4OI2A 2C1EA 3PJFA 4MDEA 3F4BA 1G21A 1M1NB 2FR8C 3IHWA 4RXUA 1MX1A 2A9FA 4CEIB 1ISFA 3DDUA 1JNXX 2VRCD 3LRXA 4OFZA 4TYPA 5B55A 4BFSA 2OO7A 2JK1A 2FZ4A 1HLPA 1SCUB 3L7OA 2JANA 3P97A 1RP1A 2IU3A 2JC3A 4EQZA 3FYUB 2ISCA 4TS4A 5I4KA 1JXMA 4PAGA 3PUIA 4DJEC 4DQDA 1EH5A 4ARUA 2HRDA 4MA5A 2BM8A 2PQ0A 5DHAA 4HEHA 1F38A 2ID8A 3CE9A 1Q22A 3IKMB 2XCUA 3PNLA 3S68A 4AKTA 2XHZA 3KIPA 1W5FA 2VXYA 5AJWA 3SY8A 1FRFS 3JD2A 3RARA 2AMYA 2UUOA 4JLBA 1W0CA 1WPXA 4RKYA 2I91A 4HZUA 1RWWA 2EW2A 5D3QA 1M75A 1TYCA 1GNPA 5FP0A 1PSWA 4RVFA 5IP5A 4KWIA 4OKSA 1NFQA 5JARA 4QTUB 3AKCA 1WLYA 3CB2A 3H13A 3EQ6A 4OUDA 1XFDA 2B9VA 4UUNA 4EY6A 3KQLA 2H1IA 3P20A 4LYEA 2DJ5A 4ZVUA 1NU8A 1Q44A 3MINA 3PGMA 1KR2A 1LPAB 3ANTA 5EEHA 1NJ2A 3TVTA 3G2OA 3I58A 2VRWA 1FFDA 3WMFA 2V7VA 1RWNA 4BLWA 2KYRA 1FFXB 1C8KA 3CSDA 5E2AA 3GVPA 3M5DA 5L3RA 4EG5A 2EVWX 2EU8A 2FHSA 4O5OA 3JZFA 3EXEB 1AXEA 2V7PA 4AKHA 1XHFA 2VHWA 2O8CA 1LC0A 5K0EA 3L9XA 3RSGA 2Q2NA 2Y0CA 2XE4A 3AOEA 2G67A 1NJGA 3KOUA 4FW9A 4ZMSA 4HNTA 3GOQA 5I7AA 1G2QA 5AW3A 3MRTA 4P38A 4IOKA 4X63A 2X6RA 1FF9A 2VQ3A 3O73A 4XQCA 1T29A 1KJNA 5A5DA 3VZPA 4Z4CA 3AF6A 1T2FA 2P62A 4D8XA 4GMDA 3WOVA 4U2BA 2XJ9A 3L02A 3MUNA 4LW8A 1MQ8B 1XF9A 2TS1A 3ELBA 3OETA 5HS6A 5IS2A 1YRYE 3EQ7A 5JNUA 4GKJB 1G8PA 1VPTA 1N2JA 2ONYA 3F9CA 3GDFA 1O9BA 3VDQA 2XY4A 2E18A 4WXHA 3EN0A 3M7IA 5AVZA 2YHIB 4KO1S 5JNSA 4ZHQF 2XX3A 2RAUA 2LBPA 3QG1A 3I09A 3KETA 4QUEA 1GRQA 2WIBA 1D8AA 3H65A 4GEKA 2I2BA 2CEKA 3IQGX 1MHPA 4XCXA 1F2VA 2R8PA 2BKVA 2D00A 3NX4A 5DHTA 1FXUA 1N1GA 4IHQA 5EKDA 2BFMA 4PG5A 3CUUA 1JKMA 1E3WB 2F43A 3TOCA 5CBPA 4FSXA 3IP3A 3HYTA 1B0ZA 1BG6A 3BEDA 3DXFA 3FSRA 3IERA 3OF2A 3PGKA 4KPUB 2DFKB 3R6WA 4UHDA 5EZYB 3RRFA 1XL1A 1A2QA 3W5UA 3WC4A 2M9MA 3ETDA 3GIWA 5LWHA 1VG8A 2OKGA 2Z4RA 2LE0A 2VP6A 3NCTA 1TLFA 2ACKA 3UAOA 1HYHA 4KR0A 3MN1A 3KXPA 3AI7A 4PIPA 1CUDA 4V02A 4YJGA 4C0SA 3DTYA 3HFRA 5DIZA 3PHHA 2P5YA 2EDAA 1IY8A 4MDYA 1KMHA 3ILHA 521PA 4ZYYA 2VK8A 4AI6A 2O59A 3TKLA 3ZDBA 4M7RA 5DN6A 2DH6A 1H1LA 2AJLI 3O4VA 3IBYA 4CQLA 1KY3A 1Q84A 1QRAA 4OA5A 2UZ0A 4EFMA 2HBYA 3D31A 1T8PA 4RXTA 4TWJA 3G1UA 4ZREA 2NVUB 4TYWA 2PDAA 3UT5B 1IBSA 3T5TA 3LY8A 4Q16A 5FADA 1USIA 2H11A 1IY0A 3EXHB 4Q9AA 5LD2B 5JZSA 3MW8A 3B78A 2GBIA 4Y18A 1C29B 2R8ZA 1PW5A 5G41A 1QV7A 3N6XA 3VU1A 2IU0A 3JARA 3OQIB 4C7JA 3DFUA 4BRSA 5T8KC 4DAEA 4X0EA 1K6IA 3CH4B 2P3QA 4S1WA 4OA8A 1FP6A 3O8OB 4UQPA 3F9RA 1GQRA 3GCZA 4X71A 2B6NA 1IOWA 2O9JA 2ZKIA 3AKDA 1G8JA 1SCAA 3B5IA 5E0OA 5CEJA 1JBEA 3P7MA 4KGXA 2RGXA 2B2XA 5E4JA 4BNGA 3AHDA 1ZHHA 4WZAB 1OH8A 1TRHA 4CIDA 1V43A 2C00A 2AZ4A 1ZMBA 2H59A 3WGYA 4GF5A 4XEUA 3WK9A 2JJ1D 4U7TB 1NF8A 3ZQ6A 1FTGA 3HVRA 3GEMA 3I2FA 4I4TF 4BVLA 4I50A 4LF6B 1N6RA 4HDKB 5DVZA 3GB9A 5D86A 3ZHZA 4ACAA 3FFTA 4TRNA 3GHYA 5CB4A 1Z36A 2YWBA 4XFKA 3P9SA 2F17A 1TCAA 2YXEA 3SAJA 5KQMA 1OYYA 2YJ3A 3CVJA 4BWVA 1IEVA 2VOJA 3E7FA 3Q4GA 4L57A 3TZ6A 2FN3A 2MSCB 3FTQA 2JJMA 3MQ4A 2ETVA 1V39A 1IQRA 1REQA 4XUEA 2Q0SA 3NBYC 1GNQA 5KOYA 1RQ7A 4ESVA 5EGNA 1NI4A 3G59A 3K8ZA 5AHWA 5HRAA 3FOEC 4WASA 4JZYA 4LQ4A 1FFAA 2VWPA 3RSSA 1GHTA 3KSBC 4M8LA 3BCHA 3M6UA 1DFHA 2P2DA 4AP6A 2Z4SA 4B0OA 5IT5A 5JBQA 4EPWA 5KVVA 1PT8A 4KITB 3FYSA 5KNCD 1HNZB 1C50A 1DBVO 5I01A 2W8ZA 2HW8A 1A2BA 4IS3A 3G13A 4ZCRA 1HGXA 3HWX1 1E6CA 1DV2A 2E5WA 2QZSA 3IAM6 3ZD8A 3CURA 4F2PA 1ADJA 1T4BA 1XTUA 2KW5A 4YQEA 4LXYA 3BWCA 1GYRA 1M1NA 4DEXA 3VR5A 3O3CA 4LQCA 3CJQA 5AP9A 4CEIA 1TUGA 1B41A 2J5BA 1H93A 1MR3F 4EHIA 1CZOA 1EFUA 4BN0A 3VZQA 3H9UA 4YCDA 2YXPX 4BQFA 4AMVA 4F5ZA 1ZHOA 1JJ7A 4FB4A 2V3WA 2R47A 3LF1A 1OIXA 3NH6A 3PJGA 4NMXB 1HV8A 1ZI9A 5C7OO 5JCXA 1FQWA 1WNFA 4CM3A 3K16A 2BFWA 4QG3A 1RXUA 1BA2A 2MSLA 1D1QA 1WS6A 1K06A 1ZMTA 5AI9A 1W0KD 1MKYA 1H94A 4AYTA 4RV4A 3UK1A 3PV0A 1KPGA 3H11B 5EZSA 2PGLA 3KWJA 3BM5A 2PZ8A 5KTPA 4M4SA 1NGSA 4TM8A 1VSUA 3K3PA 1U2DA 3K05A 1WSWA 2PFSA 4K6HA 1W7AA 3E61A 1JJFA 3FIJA 2Z9CA 5EJ7A 1SVNA 1TCBA 1WXQA 4J6FA 4MNTA 5KAPA 3EFHA 4PG8A 5AUNB 621PA 4TSFA 4P31A 1D2HA 2OLKA 4RH0A 2YN0A 4WLOA 3ROGA 3IQHX 1TUEA 4ZCLA 1UT6A 3GP5A 3QOWA 1V8ZA 4TPKA 1FFXA 1O6FA 3OP4A 2J67A 3V7NA 2XRZA 1PVOA 3T9BA 4WBSA 4LOKA 5CCEA 4P6VF 4N3CA 3K9WA 4DSZA 3PD7A 3LLVA 4G4IA 4O3FA 1U6IA 4V0KA 3LI2A 2ZRNA 3EXEA 4IWNA 1L9XA 4BKMA 4ZV9A 2P91A 4M1EA 5LU9A 4LI3X 3I6MA 4Z9AA 1ZH8A 2ZBUA 1JECA 5EHXA 3I8SA 3U56A 4MP6A 5AESA 5DHUA 3ABOB 3O2QB 5DIFA 4CKWB 1J8VA 5G2OA 2R7NA 2P2NA 2FFAA 2J48A 1AOXA 2Q9BA 3OTIA 1MU0A 2ZIAA 3CZQA 2ACWA 2GK3A 3H8VA 1VJCA 2CFSA 4KQWA 3SQMA 1EK5A 4XJTA 3RS9A 1X7WB 3ITKA 4Z4QA 3NUZA 3C8ZA 5IMSA 1Z47A 5INTA 4RHFA 4EX6A 4RE6A 3KWMA 3QJGA 3N8KA 2GEJA 3ECCA 4TKVB 2WP8J 2P5UA 2YRWA 1KK1A 1P6UA 4ZT7A 5I8WA 1NMXA 2W6ZA 1KMIY 4QOGA 4G81A 4ARAA 1RBQA 1EXDA 2ROQA 5LBUA 3W8RA 1E9EA 1C80A 4ETIA 2VP0A 4ZVRA 3HDQA 1GL6A 2WJAA 1E3WA 4KQGA 2AN4A 1CDOA 2QNBA 4KMRA 3QVGB 4FOTA 4JQOA 1QP4A 3LQFA 4KPUA 4OXQA 1RU3A 3EQ2A 1P1RA 2CL5A 4IDEA 4WA8A 5EZYA 4ALMA 3DFMA 5F3DA 6Q21A 4WZZA 3MGGA 1B43A 4LFBB 4JLOA 1TAQA 2GJAA 3B6ZA 3ML1A 4MARA 4DLBA 5CT6A 2K4MA 3BL8A 2JFFA 1IJBA 1ISMA 1Z6ZA 3HBNA 1L4LA 1UCFA 3NHKA 4PLCA 5F52A 3FPKA 1ND5A 5G0VA 4A6PA 4PLFA 2I8AA 1QVAA 1U7UA 1TCVA 1CERA 4HH4A 1GG9A 2OA0A 4F9TA 4B4OA 1P9WA 1UFVA 4JBXA 4NIMA 1UBGA 2JFGA 2LPMA 3A11A 2O06A 1L7EA 1UJCA 3IA2A 2L19A 2NVUA 3WLJA 3QEJA 3SKXA 4HSGA 5JZ9A 3ICQB 1KZYC 1ZM7A 4YRJA 1EP9A 4YRMA 2QTBA 3AR7A 3EXHA 2J1LA 3VR6A 4BX2A 1OJ7A 4KIFA 1XG5A 3KVNA 3VOBA 4OLBA 1AUVA 1E1KA 2B36A 3DE1X 3FPFA 3EXAA 2YWXA 3JU3A 2BHNA 2Q0XA 4H08A 1ACLA 2HBQA 3ZI7A 2IEZA 3KUCA 1SXGA 4PZ0A 3UW1A 3AUUA 1E6LA 3CZPA 3J7AC 2W90A 3OQIA 3QEKA 4MZDA 1XRMA 1JU9A 5C18A 1G38A 2GM4A 3EUAA 3JTMA 1XZFA 3QOXA 4CQMD 4ED9A 1DC8A 2J4CA 3CLSD 4KNVA 1K5GA 4RF4A 4R2JA 4R4JA 1YJAA 4BNNA 3O8OA 2OQVA 4L5BA 2IZ1A 4J4BA 4ZMRA 1RYNA 4ZOCA 2OP1A 5EUQB 2V0GA 1TM2A 2I1LA 3K5WA 3MHTA 4WZAA 4YMHA 4ISCA 4HK4A 2QXYA 1L5VA 4DBLC 1F4LA 3K09C 3WXBA 4EO4A 4XD2A 1AA9A 3RWBA 4TX1A 4WV3A 3EGIA 4HDKA 1QX3A 1AQ6A 2GWRA 3JVEA 5IXSA 1Y48E 3REOA 1PEDA 4F2WA 4PFQA 1KVUA 3DL4A 1KGDA 4BLTA 1Y8QB 1JZSA 1YZUA 3H2SA 4EZBA 2QN3A 5G0WA 5LYJB 3R0JA 3RG2A 4WFKA 1JIIA 3E27A 1W0JD 4KQ9A 3WISA 4QGHA 1QDUA 3VPSA 4HYEA 1FNMA 4EO9A 5DGTA 4MAAA 2NIPA 1XDBA 5IX8A 3EVGA 2JHGA 5KX5B 2H9IA 1A4RA 2QN1A 1EBUA 1LDEA 2AMLA 3GA5A 5JWHA 4S24A 2WVJA 2HI0A 1M6HA 2OQRA 4O4JB 2Q8PA 1GARA 4MYUA 1J42A 1SZDA 1NKSA 3HS3A 3DLAA 5CJ2A 5DNEA 1E1QA 3EA0A 2W71A 2FXVA 1KYVA 2CFOA 3HKBB 3OSZA 2PXAA 2K87A 3GAAA 2CKMA 4RAQA 5ALZA 5FOVA 4HPWA 3TVDA 3T5MA 3LQ4A 1VBFA 5I5EA 2RE8A 3MS7A 2DE0X 2WOOA 4WMLA 2C20A 4F71A 1ETUA 4F7DA 3I6BA 3RIMA 4AY2A 3GLUA 3DCYA 2VWGA 2W6ID 3TSOA 5JRZA 5AM3A 2OGSA 5EE5B 5CFLA 1YS2X 5BVHB 4LXIA 3S2ZA 3SQDA 3BFVA 1L5QA 3T52A 3G2HA 3OF5A 4FEAA 5G0SA 3NAQA 2MYPA 3NT4A 4AF7A 1VJRA 2SCUB 1QGAA 3OCYA 1Z83A 4ZDJA 1P91A 4Y3UA 2VK1A 3VZCA 5IVKA 1YOBA 1R1DA 4BL5A 3ONVA 4EUNA 1XK7A 1WPRA 1JB9A 3H11A 1MEOA 1CB7A 1ISSA 2FE1A 3EHDA 1Q1NA 3ZJYA 1YQEA 5IJAA 1C9NA 1RD4A 2LDXA 2G9QA 3OJCA 4NBNA 1VMAA 2XECA 3H0EA 3HUDA 4GKVA 1YMUA 1A9RA 4BC1A 4RTPA 4JUCA 1YD7A 1OLSB 4Y7DA 2ZFUA 1BMDA 1DBQA 1GNTA 1I4LD 2GPSA 3E0XA 3NAGA 4KQEA 4TWAA 5FPHA 3WYFA 4CIVA 4UBKA 2W00A 1V0JA 5L95A 1T6ZA 1TGYA 2IT1A 2JHPA 2UAGA 3H5AA 1BXZA 1T9HA 3D81A 3HLTA 3PKIA 4FYWA 3N2EA 3DXXA 2C4NA 2A0WA 3OM1A 4DC0A 3BJMA 1G7CA 4G1CA 4A73A 3PS9A 2PG3A 3MNFA 4D2IA 1OXKB 3VC2A 1YTUA 1EFLA 1I33A 1IB0A 5LZ8A 2NSJA 3BRWD 2FWMX 3FNEA 3NXKA 4IP0A 5TEWA 1N2ZA 4G5GA 1X14A 2WD7B 1ZSVA 1CR6A 3ANXA 3OF3A 4N76A 1N6LA 4BJ3A 2AN1A 4RLHA 1GSOA 5DHSA 3RHTA 3V4SA 5CLHA 4AKSA 1L5ZA 4P33A 2J3HA 1ZMOA 2I7TA 1H9AA 2PRJA 4BFCA 4CKWA 1KTIA 3BBLA 3QUBA 3LC7O 2ZI9A 1FOEB 4P92A 2HMAA 1TK9A 3A9WA 3ROKA 3X1KA 2ISSD 1D0SA 3IMGA 5SV2A 4C0QC 3FMIA 4HSEA 4F8YA 5CFOA 2F8LA 5F1OA 3UMGA 1CUGA 2ZUTA 3DOHA 3P96A 2CT8A 1GILA 4OLFA 1X7WA 4Z8YA 1QGUB 1MB2A 5B57C 1MO4A 3HDGA 3LO8A 2OHIA 2GEFA 4UHFA 3V2UA 3OI7A 1T1IA 5K6AA 4MTCA 4TKVA 3JVVA 3EPJA 3W3ZB 1EB8A 4H18A 3EHEA 1RJWA 3ILYA 4HQ0A 5T3UA 3HCWA 1PGQA 1L1QA 2ZRBA 4ZPJA 5DT2A 3UEOA 4BV3A 1QZ3A 2COUA 4G63A 1U2EA 2JIZA 1G63A 2CGEA 3LUBA 4D9MA 2P6RA 3B1JA 1GL3A 3WQHA 1KSHA 1M0WA 3V9PA 3W2IA 3QVGA 1W52X 1WXDA 5HUHA 1E2GA 5AKIA 2EHJA 2NT4A 4EGJA 3LPCA 2YJGA 3KT8A 1SJ9A 4Z9BA 1YU6A 5ADWA 1L9KA 3ZEIA 5DP1A 1EJ6A 4H4DA 3H17A 1KEPA 3U3MA 3ZC3A 2AN5A 1M2WA 4GHWA 4D9BA 4ZI2A 4B8WA 2Y0PA 2XTMA 1MTZA 5KYNA 3R44A 4PS0A 2ODQA 2HJHA 4GVXA 4DIUA 3VC7A 3FBGA 3KSZO 3HZHA 3R0XA 1CR0A 1J39A 1N2HA 2XZDA 3DP7A 3FPCA 4C5BA 5DW3A 5HMLA 1Z4OA 3WBJA 1PJAA 2XWBF 2YWDA 3DP9A 4M8NE 4EZEA 4ZEMA 3HB9A 4HYTA 1C7FA 3OVMA 2VCYA 3H2KA 2ZB7A 4FMDF 4MGHA 5CNKA 1EJ2A 3R5XA 3C3DA 2FPPB 3QITA 5FL7D 3KAJA 3VI4B 5AJXA 4BFYA 1XTSA 3WGHA 4ON9A 1QO0D 3DMTC 3H1EA 4MAMA 1QSGA 1T2DA 2P4QA 3FROA 3OTWA 1SQGA 2J4DA 3GEDA 1K6XA 3QG5A 1ZBDA 4NEGA 4UNNA 4P53A 4YR7A 5AW0A 2JBHA 1QKJA 2CVPA 3HUFA 5I48A 4XDZA 1WCYA 1QQAA 4GOXA 2QN8A 5FR1A 2ES4A 2H2FA 3IEIA 3PXUA 3UJ9A 4GGOA 2Z1NA 4P4LA 4KR9A 4CR6A 2QRNA 2C4WA 4UBIA 1FP7A 4X7BA 3VJRA 2JZOA 1PI3A 3BORA 3EMKA 5DHPA 4DCCA 3C1OA 2WTEA 3GGSA 4DLSA 4DPLA 4MYCA 3DBIA 3QLJA 4PRKA 2QI9F 2OWDA 2X7JA 5E6SB 1GAEO 5AUQA 3W34A 4M36A 3EPKA 1AE1A 3SS8A 3VAYA 1AV6A 1KI3A 2IPAB 2V7QD 2CL6X 1K63A 3B82A 1YDEA 2FSVC 3K5PA 3KCQA 1J2TA 2J3DA 2IYZA 4MS3B 2A9KA 3KJHA 4LJLA 4M0DA 2DEUA 3AVXA 5G3ZA 5IPFA 3M6IA 3PQ7A 4B8YA 2HMYB 3CLSC 3I9V6 1SCBA 3EDYA 3T4UA 4ENVA 4QDKA 1A9TA 4PONA 1LBSA 1OXSC 1SUSA 4O2AB 2FG7C 1Y8QA 5LYJA 4E4YA 4X1KB 4WRRA 5F51A 3RNLA 1GA6A 1U3VA 2YR0A 3HCEA 4UPVA 2HOQA 4LDRA 1R4AA 2G0TA 2H65A 1PWYE 4QGFA 2PRSA 3IB6A 4C7VA 3I62A 3PPIA 4AJNA 2M6RA 1G64A 2O07A 1NBMD 4C0JA 5KX5A 2Q5FA 3OFND 2P1ZA 5B2EA 5DNYB 1E6MA 3O3MB 2O2SA 4G86A 3D4PA 1EVJA 4O4JA 5CCDA 1EK2A 4KXFB 5BOVA 2D2XA 3DKIA 2O7VA 2ZRKA 3GWGA 1DRJA 4IDHA 1RZVA 3GDHA 4PYRA 1FE8A 4EGSA 3IOCA 1GV1A 3HKBA 4OB7A 5AYVA 4LNHA 4LDPA 4KODA 4RA6B 2OYRA 3X1YA 1N8KA 4CMIB 1XPUA 3FB1A 5KUTA 1RI5A 3M2TA 1A7AA 2ZBFA 3DPUA 4ID3A 1CV2A 1YHYA 1A97A 1U28A 2NLOA 1JSXA 4BY9E 2B4YA 3GW8A 1NVEA 3N3BC 3BJRA 4LGMA 1ZRHA 3C14C 5HXAA 4JBHA 4IGIA 2UZ1A 4UCWA 2F4NA 4WLVA 1ULAA 5BVHA 3IPLA 1J2UA 5JQWA 2ZIGA 1P3JA 4QPNA 2QRJA 3SJAA 1WUHS 2BZ1A 3TM4A 2BEWB 4NTZA 2SCUA 4GL4A 1LDMA 2NYUA 4JLPA 4A8PA 1E0SA 2GNAA 2CFCA 1KL7A 1QNLA 1R0LA 3P4XA 4RZQA 5ILQA 2W0MA 4U39A 4EKIA 1FQOA 2A9QA 2NXCA 3CZCA 1XQ1A 2J87A 2Q6VA 3DJYA 4HQFA 1E6WA 1N5DA 5EQFA 5K3EA 2ZYIA 1BEUB 1JDTA 3WWOA 4U4AA 1QH9A 4CF5A 1GQSA 4F6RB 1TA4A 4KN8A 4K0KB 1IUKA 5GWXA 4EF4A 4TM7A 2QRQA 4NBTA 2Z1DA 5TGZA 3JD4A 4AROA 5ED4A 3SP1A 2CMDA 3Q8KA 2AOXA 2C7BA 1SKYE 5A3SA 1JLMA 2A4MA 2XDWA 3VPFA 5L6MB 1O6GA 4K03A 4GBGA 4FKMA 2BRUC 5ALJA 3RTDA 1W46A 3SF8B 2AJDA 4GQBA 5FFFA 4CM7A 1YC5A 2RAFA 4M8IA 2ECPA 2XLCA 3AETB 4Z4IA 2PT7A 1XCMA 1E7MA 4BO2A 3D7NA 5C1OA 5C53B 1LW6E 3Q5GA 3DH0A 1UZMA 4BB9A 5ECGC 5HJ2A 1BA3A 1IEXA 3TZQA 3T7AA 2PYIA 2WD7A 2R4QA 1C0PA 1SIUA 4DREA 5I51A 4PN7A 2FQYA 1UOPA 2FZEA 3AR9A 2IP1A 2Z6QA 2FJPA 3DHEA 3KG2A 1A9OA 1WB9A 2R1UA 1BKYA 2QW8A 4HDAA 3ZS8A 3WO0A 4CLDA 1BQ4A 4P80A 2I5PO 4WD3A 2WKWA 1WXFA 2QV7A 3AL2A 4NBSA 2ZUVA 2EL9A 4P4GA 2IS4A 3KJNA 1BTOA 1WDLA 5TGDA 1P7VA 5TXGA 5C8YB 5K8TA 4OHCA 1K92A 1XZAA 1CB0A 4JS0A 3QPWA 3JALA 3UUEA 1NY6A 3LWZA 1OGJA 1QGUA 4KMMA 4MV5A 4MRPA 5IC4A 3PJRA 3FTFA 1VIAA 1Z4QA 1DEXA 3M6FA 1IAVA 2ZG6A 4IWXA 1LI4A 4IIHA 3FVRA 3WA6A 4DIBA 3U7FB 1BZYA 1JW9B 5IJZA 3SIWA 2R5FA 5CT8A 1TCCA 4NLLA 1CEXA 2BEVB 4R68A 5KNDA 1QK5A 3CPHA 3C5EA 3N86A 4W8GA 4LZWA 3A0RB 2C9DA 4WY2A 1LLQA 1LRJA 4N6NA 4YI3A 2AOVA 4XSHA 1VCMA 1EFTA 4GSYA 1ES9A 3TX6A 4NOLA 2C59A 2I9PA 4D25A 4B3BA 5T4FA 3CWZA 1E1CB 3E5NA 1SHTX 2O54A 4NMMA 2WKPA 3AFHA 2H9YA 2IEIA 2WFZA 2XE6A 1WMSA 3JASB 4D0LB 3R20A 2JHFA 3ECSA 1AGPA 2ZUSA 3O74A 3C8HA 3D6HA 3HA2A 4MUNA 4BV2A 1GUYA 2R86A 4IV8A 4ZYTA 4NC9A 2R0QC 2BN4A 1G21E 2CXSA 3IEPA 2C5SA 1AC5A 4TOIA 5HRCA 2FPMA 1KZ4A 3KVVA 3OWHA 1Z18A 2G9ZA 3LHSA 4LZOA 4AP5A 1KYIA 4QKQA 5JCJA 3LSTA 1SUBA 1Y8ZA 3A3OA 1WVIA 1KSFX 3C7TA 4C7OB 2PKWA 2JIBA 3RRJA 3FF1A 1BNCA 2W8BB 5ALLA 3W5IA 1VBNA 2HMUA 4G26A 4XVCA 4OJTA 1UBUS 2CC2A 2OR3A 2R4TA 1W30A 3IP1A 4MP8A 2N46A 1FU8A 3G9ZA 4E5UA 4YJ3F 4ZZIA 4ES6A 2AWNA 2HF2A 2PMCA 4FFOA 3L7LA 3A4TA 3NP9A 4Q5IA 2FPPA 2RARA 2XEDA 4MRMB 4RZHA 4V0OA 1XTPA 3QELB 3ROZA 3TAUA 4UTVA 3TGPA 2GCIA 2FOIA 3BZBA 1TVKB 1WV0A 2V03A 1SCNE 1POWA 4FYYA 5EXPA 2Z04A 4EECA 3DOIA 1M8FA 3O1HB 7ABPA 1IY2A 4HAVA 3ETJA 3L0CA 1YCGA 5IKOA 1WAMA 4Q39A 4RCYA 2JKZA 1DUIA 2ZB2A 3EEQA 1MRZA 3WIEA 2RB4A 2R2AA 4IZ6A 1P72A 2QIPA 1KOFA 2CLLB 2MSNA 2Y1GA 1YZHA 1UWLA 2RKOA 3B3GA 1D1SA 3O8BA 2JCXA 4YAOA 4F8EA 1QP7A 4E0BA 1UJ4A 2OZEA 3V8QA 4M49A 3LGAA 1W6UA 4KXUA 5SY9A 4D26A 5E6SA 2A14A 2EW8A 1EXMA 2E4UA 1RQNA 3N39C 5TMBA 4X97A 5CXQA 3KLNA 1RDFA 1CU1A 1VZ2A 1YE8A 4LMAA 2OZKA 5EJGA 4B5KA 4ENWA 4LX0A 4B3SB 1P4JA 3EXIB 4MS3A 4P08A 1JXOA 2J3LA 3PE3A 3NOXA 3X3HA 2JF0A 4J1TA 4QBKA 4IFEA 4KQIA 5CUQA 4IGAA 2QMEA 5ESWA 3ZY6A 2RHCA 3N76A 1TQDA 1O6BA 2G7MC 3AL3A 3GRZA 4M0KA 4QFMA 3WGZA 3G2NA 3K32A 3M5CA 4O2AA 3R40A 3MUOA 4YXWA 2YL2A 4EHAA 1ACMA 4X1KA 4B17A 1KRWA 2BBWA 1B0UA 1UBKS 4JEIA 2GZSA 4D4LA 2OILA 4N54A 4EJSB 1PWHA 4NOMA 5K7SA 5EE9A 3CVOA 2NSLA 3M9XA 4L7VA 3S2YA 1PR3A 3IAM1 3WRYA 5JAOA 1UFRA 3GEPA 2I4IA 5FT9A 1XUOA 3LXUX 4CLXA 2SKCA 4UW9A 4R7TA 3R9WA 1KJ8A 3BXEA 2Q5HA 2VUHB 1GNSA 3K1YA 3OE7A 2ATVA 3DZCA 2ECOA 4YCCA 3SHFA 4GMGA 1E0JA 2AUMA 3HV2A 3UAYA 3ISVA 5DV9A 4CM9D 2GN8A 3RU3A 2VZEA 4NCJA 3C3PA 3E9RA 3EMDA 3LKDA 1QPGA 3KOOA 4A8JB 3MZ0A 1YBHA 5J4YA 4RA6A 4IH9A 4CMIA 1PWEA 1ZL2A 2BZSA 3R0QA 4JH0A 3WNVA 1ND6A 2QE7D 1FX1A 3CKMA 2JG3A 1E4EB 2AQ8A 4B33A 4ITRC 3IT2A 3TRHA 3ILXA 4RORA 3ZXUB 4DVGA 3IOMA 5LOVB 1XMQB 2NSYA 1JEEA 2WSLA 2HLPA 5M7EA 4GC9A 1AUXA 1OF1A 3W7VA 2W2TA 4LC0A 1Z0FA 2WFAA 3PFBA 4YRZA 3MLAA 4EUHA 5HIIA 2GZAA 5IN5A 1BCSB 1RRKA 2ON6A 2ZQZA 3FXAA 2R8OA 4ZI5A 3H8SA 1A77A 1G0OA 3IDOA 4RVHA 1Y82A 4E03A 3DB2A 2D7CA 4R41A 3I1IA 5H70A 2BEWA 4P81A 4RD0A 5BT9A 5B1DA 2VF7A 4HB3A 1YNSA 1FNSA 2WYIA 1TTHA 1DTSA 4Z1OA 3BCRA 4BU0A 3UUWA 1OXXK 2JIOA 3J80A 2BKXA 1ODKA 1NOJA 3P0FA 1GPBA 2FKNA 4LHYA 3FLAA 3O93A 1Y9EA 2NPIA 3L77A 3PC8C 1FDWA 2V6MA 2ZANA 4F6RA 1DELA 3TWOA 3SFTA 1PYGA 5JEEA 5HA5A 3P9CA 1C81A 1V9SA 1YJBA 2QJOA 1VE3A 4YT5A 2J9ZB 5J2UF 3KWFA 3PQ6A 1T5OA 2ZI4A 1Z68A 3ADCA 4G0VA 1XMPA 1TIPA 2BFBA 4WLFA 3SF8A 1NWCA 3I01M 1E7RA 1QGYA 1EFRD 1QG0A 1BXGB 4XVHA 4MB6A 3AETA 1UK7A 2R8YA 3N7UA 3NASA 2Q8QA 3PC6A 3E53A 3TAHA 4DWOA 3MHPA 3GMIA 4D82A 5J43A 1WB6A 2BEKA 2G1AA 4JLSA 4KUHA 4C0XA 1N77A 5CMLA 2ZJ1A 2UXDB 3FZYA 1KJIA 2JFHA 1DXYA 1O5IA 2ACEA 3CZMA 4H1TA 4M6WA 1I30A 4U5XA 1U4OA 4A2WA 1CJCA 4MQ4A 1IN6A 3IE0A 3TTVA 3AFOA 3OIFA 5JXGA 2E5LB 3QEOA 5TSDA 3KT0A 2E37A 4DADA 4J9VA 3VC1A 4Q7EA 4W9NA 5IKPA 1IMJA 4IIJF 4MUXA 4NMLA 1CVLA 1YMQA 4UHJA 5C8YA 1CEQA 3NR2A 4PLHA 1ESNA 4Z53A 1CBUA 3HQ4O 1BFKA 5ITZB 5HF9A 4I5EA 4RQUA 5ANRB 2CHFA 3BMOB 3EZLA 3CHYA 3QHPA 2ZSEA 4XTCS 4V0RA 1N2BA 4AUEA 2I54A 2XADA 1D9ZA 3OD1A 3BAFA 4K6KA 3H5OA 4RDXA 2HQBA 3VU9B 2BEVA 4Y9UA 5EHQA 2JIRA 3A1NA 3JQQA 2P4EA 5FV7A 4C78A 2O14A 3HDTA 4B6OA 2VPZA 3A26A 4RJTA 1D1TA 4RTMA 4RIIA 2GPTA 1WMFA 1JGTA 4HG2A 4WE3A 3ZGXA 3PICA 3OZIA 3LDFA 5ELLA 1W6RA 3OZUA 5JY6A 3G7SA 3E9EA 3N2KB 4AN4A 3GLTA 1E1CA 4Z86A 4R9VA 5JATA 4DKJA 3QBVA 3D3EA 4IEEA 1GL9B 1XRQA 3FOWA 1T1SA 4B7UA 3DOFA 1Q0LA 3JASA 4C4PA 4GDFA 1RHQA 2FVYA 3L7MA 4AF6A 3O91A 3NHYA 2OXCA 3BWMA 4K28A 5FA6A 3GY0A 4KLRA 5BURA 3C24A 1NJFA 5B53A 3FHJA 3AFNA 2BI7A 4M9RA 2V8BA 4I1OA 1NM5A 1C9JA 2F3SA 4Q6WA 1YBMA 1SURA 2OCIA 4DMKA 3DNMA 4RZUA 3HKCB 4MV9A 2PYDA 4RIEA 1R5NA 3G0IA 2W8BA 2C1XA 1SMKA 2I2AA 2ZOSA 4YP7A 3F0TA 4YRIA 1J5EB 3LQ2A 1C0KA 5AUOB 1MOZA 2OPHA 3VNVA 3W9YA 1CJBA 2PD3A 3HJTA 1DAMA 1UC5B 3KYJB 3M1AA 4M1ZA 4PZPA 3WHPA 3ZHXA 2QRLA 4E08A 2OSVA 3FVVA 1LK5A 2JFVA 3QELA 3BG5A 4FMCF 4O8CA 1NSFA 1QV6A 4TV8B 1JQKA 1UPAA 3IJ5A 4TKMA 5EQJB 3ZXYA 2VCEA 1KF0A 1LJ8A 1P9NA 2V4ZA 3ROMA 3V2IA 4EPXA 2D7DA 4L6IA 2JCVA 2P9EA 4DAOA 4UOZA 4MSUA 3ET5A 1TM5E 3URKA 4BP8A 3GJ3A 1A96A 4F84A 5CXSA 1HE3A 1VM6A 3B3JA 4MQ5A 4DDWA 2W2XA 3A2NA 3VX4A 1P4HA 5I8PA 2QU7A 1D4AA 3BCSA 5GMOA 3H1GA 3DLBA 2PS9A 4MUJA 5F77A 2H8GA 1IQUA 3HNPA 2AFRA 1RQLA 4CBVA 1YNOA 3IXQA 4MWCA 3COVA 4A16A 3C6MA 4YCJA 4ZU3A 1NG1A 2QMZA 1DQNA 4GP9A 1MVNA 5JCJD 5COBA 4F3RA 5HS4A 2B98A 5FTJA 3V32A 1FVHA 4YECA 1W36D 1PDWA 1XYVA 2H92A 1YKGA 4JEMA 3EXIA 1O03A 4LE2A 1U2RA 4GOOD 3DHWC 3GRPA 4Q02A 2HA6A 2K7FA 4CGZA 3JYPA 5TJHA 1RAAA 4ZKDA 1SQSA 3TDKA 4BO6A 1J9EA 1N34B 1MV8A 1JU4A 2RHBA 1X7DA 3OPXA 1J23A 3WRXC 1DTEA 5H3LA 4BCDA 1GJRA 1PFUA 1CJTC 3HDVA 4CU5A 2B61A 2ESRA 5LMZA 1DXHA 1ZGGA 3JYQA 2HF8A 1VPVA 2YIMA 5B58C 3B3FA 5ICGA 3WAKA 4YR9A 1LNQA 1JJAA 2JJQA 2XNKA 1O5TA 2XNDA 4NABA 3UMFA 4EJSA 4X6XA 3MPOA 3I5MA 4KUGA 4JVOA 3LM8A 5K0CA 4CDMA 3RK1A 5CNJA 1MT0A 3VR5H 2YQ5A 3TAXA 1O87A 1JFFB 1DO8A 3UF0A 2JDIA 2VYND 1PR5A 1SVKA 3OWOA 4LBVA 1XWFA 2IW1A 3A3YA 4TVOA 4QULA 1BHQ1 5CIQA 3VPXA 3AJAA 4INPA 2B6HA 4Q9KA 4UU8A 4A8JA 2OSBA 4GS5A 4BECA 3PQ4A 2BC9A 2H0RA 1G8GA 3OO1A 4IJQA 1JI0A 1Q3KA 4NMHA 4D45A 1E4EA 3O82A 1YQDA 1I3LA 3PE4A 5AICA 2C3PA 5TIIA 3IHLA 4V2IA 5LOVA 4QXAA 2X0IA 3AUKA 3QF7A 1FJXA 3CSUA 1TVEA 2WJVA 1UQTA 3D7MA 3OM8A 5CGZA 3QTTA 3E7DA 4M83A 3U39A <