4X94A

Crystal structure of lysosomal phospholipase a2 crystallized in the presence of methyl arachidonyl fluorophosphonate (hexagonal form)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
376
structure length
376
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Group XV phospholipase A2
total genus 130
structure length 376
sequence length 376
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x94A01
4YPVA 3FVTA 1IUPA 1UXOA 5I8PA 3SWWA 3TEJA 1K8QA 5C8XA 1B41A 2I78A 1DWOA 4MEBA 1GPKA 3HABA 3O9VA 4JH0A 2WUEA 4UBJA 2VSQA 5A62A 5LZ2A 2BUBA 2WG0A 4DSZA 2ACEA 4IH1A 5K3FB 4AX4A 2QT9A 4V2IA 1CUUA 3WYNA 2H7XA 3FBWA 4BVLA 4B0OA 4K2AA 3IDAA 4GWLA 4DMHA 4Z49A 2B61A 3PUHA 2DHEA 3DD5A 1QIHA 4GBGA 5FV4A 1YAJA 3A2LA 4UFOA 3D4LA 4LYEA 1AX9A 4Q3OA 4MQLA 3FNBA 1JI3A 4NZZA 4Q3KA 4PO3X 2D0DA 4UHDA 5LYYA 2B4KA 1EK1A 3F67A 2H9YA 2PSFA 4UFPA 1C7IA 5AK3A 3D7RA 1QGED 2WFLB 2B20A 5AKXA 5E2IA 3WK4A 5ALGA 5AJHA 4ZXFA 1KU0A 2PUHA 2BAGA 4HTAA 4MQMA 5EHNA 3HJUA 4OU4A 1SCIA 5ALLA 3E3AA 5AKKA 7YASA 3WL5A 4AMZA 3MUOA 1EDBA 1CUYA 2RHTA 3O4IA 1BROA 4B84A 3F96A 2R8BA 3WWPA 2I03A 5AI6A 5BWBA 1DWPA 1L7QA 4J0JA 2VJBA 1G66A 2WG2A 1E5TA 3ZLVA 1EXWA 4P08A 4AZ3A 2VTVA 3P2MA 4LKOA 1J2EA 1SCQA 3H18A 4H7DA 4IH9A 2BJHA 2VF2A 4X93A 3I2GA 1GKKA 1CUEA 1BCRA 1Y7IA 1WPRA 2JGEA 3QMMA 5AI8A 1CFJA 5ESRA 2O2GA 4H7KA 2XUPA 3O0DA 2XUGA 4H7FA 5AIAA 3CCBA 1H2ZA 2WLSA 5AI4A 2Z8ZA 2PBLA 3UUEA 4B9EA 1C7JA 4CG1A 1ZI8A 4L72A 2XMZA 2Y2VA 1JKMA 2XUQA 1UK7A 2C7BA 2WKWA 3AINA 2PVSA 1XZCA 3FVRA 3RLIA 4Q1VA 1RWQA 3KD2A 3JWEA 2EDCA 4J0KA 1VE7A 5FRDA 5JAPA 5JIBA 3PE6A 2HU8A 1NU6A 5ALYA 1GQSA 2J4CA 1ORVA 5AM5A 2JGLA 4DTCA 3K9BA 1ACLA 4W1SA 1QIEA 1THTA 2J4FA 4GEGA 4LHEA 1EHYA 4U2BA 2HHAA 3IUJA 3DKRA 1CVLA 5FDFA 4WFIA 5CH3A 3MUNA 3W05A 3FWHA 1ZOIA 3AIOA 5AOAA 3RM3A 1R88A 2HA4A 4PSDA 5DJ5A 3IVMA 4DM7A 2YXPX 1ODTC 2W22A 4G4GA 2UZ0A 1ZD5A 5K3AA 2OPHA 2XUHA 4C89A 1UWCA 1UZAA 1N1MA 4B83A 2FJ0A 5K3CA 4FWBA 1CIJA 3ZLUA 4QZVA 4EY7A 1CUWA 2HFKA 1UKBA 4GI1A 5DLPA 3DDUA 1CEXA 1QIKA 1WCYA 4G8CA 3HXKA 4M0FA 4DMKA 5FOQA 3IUNA 2VJCA 3FCYA 3VISA 1UOQA 4QDXA 1CUDA 5DNVA 2X76A 4OCZA 2XUKA 2IX9A 1ETHA 2WHRA 1H2XA 4ARBA 2CZQA 2R11A 5ALTA 4KACA 4WFJA 1TCBA 5J3JA 2K2QB 2GBGA 4X3CA 2RAUA 3VKFA 4C6HA 3W9UA 4I4CA 4W9RA 4FBMA 5LLSA 3GA7A 2QJRA 3W06A 3BIXA 3HACA 5DWDA 5ALDA 2WJ6A 3V1KA 1UK9A 1ZI9A 3IA2A 1XZAA 1XZJA 5EIAA 4WY8A 4ZI5A 5T4FA 4X71A 1Q84A 5AOBA 5AH0A 4C88A 2CMFA 4YX9A 4MEAA 3QMWA 4AXBA 4N5IX 1PJAA 2DQZA 4EUSA 4BATA 1TCCA 4UBIA 3GBSA 4N5HX 3DEAA 1QZ3A 4UPDA 3STWA 4HXEB 1U4NA 1Q0ZA 3ESCA 4BVKA 1EVQA 1R4ZA 2WFZA 4BBZA 2HRQA 5ALIA 1CR6A 3WWDA 1EX9A 1BRTA 4J03A 5FKJA 3QM1A 2WTNA 2I3ZA 4DGQA 1HKHA 2H1IA 1BS9A 5DYWA 3OOSA 2VAVA 1MAAA 3G0BA 4MXDA 2WM2A 1LPMA 4UHFA 2V96A 3LIPA 1EH5A 2C5FA 4X6YA 3H2GA 4OD0A 5BV7A 3EQ9A 4G9EA 2Y1KA 3C6XA 5JAOA 3DL7A 2EDAA 5AKHA 2OCKA 1ISPA 3WKEA 4BRSA 2HADA 3ANSA 3DNMA 1M33A 3WK9A 5AI9A 4K6HA 4KEAA 4M0EA 3AZPA 2XLCA 3HC7A 3C43A 5EIEA 1X2EA 1Y37A 2J3DA 1XKLA 4ETWA 3Q8WA 4OB7A 5ALNA 1LPPA 5JD5A 1QOZA 3D2AA 3TJMA 1G4HA 1W52X 4X00A 1XLVA 1IVYA 4IHAA 1MX5A 4ZRDA 4KR0A 3ICVA 3PF9A 1FSSA 5HK8A 2X5XA 1LLFA 4RNCA 1VA4A 4ZV9A 1XLWA 3ANTA 1Z68A 1QIDA 1QJ4A 4E46A 4U2FA 3E4DA 3BXPA 4TVKA 2RI6A 2XT0A 1QIFA 4U2EA 3ZI7A 2H7YA 2H7CA 3FLAA 1XRPA 2QR5A 5YASA 4AO6A 3VVLA 2XUDA 3K6KA 1XZLA 1MAHA 1GZ7A 5CT4A 3C8HA 1GQRA 2JGFA 2XUAA 2XUJA 2PM8A 5E4TA 3NUZA 2OQVA 2HRRA 1A8QA 4BCBA 3EBLA 4EZIA 3FSGD 5EIHA 3KOOA 3ZLTA 3WIBA 4KYVA 2DHCA 5EHQA 3I2HA 2CUTA 5ALWA 3D0KA 5HZGA 3IIIA 3G9XA 4WY5A 4KAJA 4KE6A 3F9CA 2QVBA 1E89A 4NVRA 4OU5A 5FUMA 4B81A 2JEZA 3S2ZA 3A70A 4Y2PA 1LPNA 1IZ7A 4OB8A 4UBMA 2G63A 5IVKA 1QIMA 4FLFA 3QYJA 2XUIA 1MNQA 1BN6A 3QPCA 1AQLA 2J3QA 3D5EA 3HRHA 4O08A 4QLAA 2C5GA 3FYTA 1MO2A 1U65A 2OLEA 2QMQA 1QFSA 2XMRA 1AMNA 1FFBA 1XRQA 5SYNA 4UUQA 3O4HA 3A2MA 3DKKA 3YASA 2WUFA 3DJYA 4KJXA 3GROA 5ALPA 4PSCA 4CFSA 2AJBA 4BP8A 4QNNA 4HS9A 3I2IA 4CI9A 2ZJ6A 3G0GA 4C4ZA 1CUJA 5JADA 2ZYIA 1RYYA 1W6RA 5ALQA 1JJBA 1NX9A 2QXTA 4K6GA 3BJMA 1K6EA 3AUKA 2OGTA 2HA2A 3AFIA 5I7UA 3O95A 3G0IA 4FLMA 2WHPA 3EF3A 1YS2X 2AJ8A 3QPAA 2QUAA 1QLWA 1XKTA 1JMYA 1SCKA 2XUOA 1E66A 5ALZA 4MJ3A 1TIBA 3ESBA 3BE8A 3NGMA 2VJAA 3ZPXA 3G9TA 3S8YA 2WIJA 1LNSA 2HA5A 2WG1A 1YA4A 3I2FA 3X3HA 2GYWA 1XZMA 3LLCA 5FPQA 4TGLA 3STXA 1FFDA 4F21A 4UHHA 1VE6A 2WILA 5HF9A 3WA6A 1OXMA 1ZIYA 1XZBA 1L7AA 4QLOA 3T52A 1YS1X 2OAEA 1WB5A 3EQ8A 2VQ6A 1YAHA 2QRUA 1YB7A 5A6VA 3WKDA 4Q05A 3FSGA 1R9NA 3QITA 5CT5A 2ZVDA 5IKXA 1ZJ4A 3WIOA 5HKBA 3B12A 4EA6A 5CT8A 4X94A 1FFCA 2JF0A 1VZ2A 4AB1A 5JYCA 4CCYA 1SC9A 1CLEA 2ES4A 3I6MA 4DNFA 2CEKA 3IURA 1Y7HA 1DX6A 1A88A 5JARA 3WK5A 1LPBB 4FNMA 4UBOA 5CT6A 3PICA 4P9NA 2Z3ZA 3A6ZA 3F8SA 4MYSA 3U0VA 3VDXA 5AKLA 2P8SA 4L9AA 5HFNA 3BF7A 5CTAA 3M81A 4QDOA 5F4ZA 4G9GA 2WSLA 1XZDA 2VAXA 1J07A 3VJLA 2PU5A 3DS8A 1MJ5A 1XRRA 1XFDA 4UHEA 4AMYA 2QKYA 1WPXA 5CURA 1QONA 4DLNA 4KE7A 1ZD2P 4U2GA 1UK6A 3H2JA 2XMGA 4BAGA 5DYTA 4GXNA 5EGNA 5A2GA 4H7IA 5HCUA 1U8EA 3R3VA 3WK6A 4JUIA 2QZPA 5ALMA 1KU6A 5CH8A 5A7FA 2XMDA 4G5XA 4IH4A 4A16A 2OGZA 4B0PA 5ALFA 1ZICA 5DYYA 2QTBA 4U2CA 3HLKA 4CG3A 2BCEA 1CUSA 3OURA 4Q34A 1E8NA 2O7RA 2WIFA 1QFMA 3H2IA 3H0CA 3PDCA 2ZSHA 1HDEA 2XUFA 1TK3A 1YR2A 3DCNA 3WLAA 2PUJA 3R3YA 5ALRA 4HXFB 1EDEA 3ILSA 4Y2SA 3BF8A 1U2EA 2OCLA 1BEZA 1W75A 1LBTA 3R40A 1WB4A 2WHPB 1HPLA 3CXUA 4FTWA 1CV2A 1GKLA 1YCDA 1ZI6A 3H1BA 2YYSA 4I3FA 4QDUA 5C81A 4UBNA 1JU4A 3FYUA 1CUCA 1IMJA 1N5RA 1LPSA 4J0DA 4FBLA 4INZA 1MX9A 4PQEA 2AJCA 3LS2A 4UHBA 3PUIA 1DWQA 2DSNA 3NOXA 2WTMA 2QUBA 4XVCA 4DMFA 5EFZA 3ESDA 1EDDA 4JYMA 2JGMA 5K3DA 1XQVA 2ZYHA 4NS4A 1BU8A 4EY6A 5AP9A 4BVJA 4DIUA 1VKHA 1P0PA 3FCXA 4N8SA 1YSCA 5H3HA 2W6CX 1W4LA 3QZUA 1XZIA 3IULA 2BGRA 4H18A 5K5EA 3V1NA 4AQDA 2PX6A 3V1MA 3AZOA 4W1QA 5C8VA 4BC0A 4IO0A 1P0MA 1J1IA 4X97A 3R3XA 3N2ZB 1YB6A 2DCMA 1R50A 4LYDA 3CCCA 4OYLA 3R3ZA 5EI5A 3RARA 1ACJA 2VT6A 4J3JA 4UBKA 5AK5A 4H7EA 1XROA 1WOMA 3QMVA 5JAUA 1IZ8A 2HU5A 3HI4A 2ACKA 4LIPD 3C45A 3AJAA 2G5TA 1F8UA 1ZD4A 1R1DA 3QPDA 3AZQA 2CBGA 2QS9A 1XRMA 2FJPA 2GBCA 2Z8XA 1THGA 5IVHA 5HQ3B 2RHWA 1XRLA 5JZSA 2X8BA 3C5VA 4MWTA 5ALJA 2GYVA 1F6WA 1H2WA 3C6BA 4X6XA 5AKZA 1JT2A 5CMLA 3ZWQA 1MX1A 1YA8A 1K63A 1QO7A 1LZLA 3W04A 4P93A 3WWCA 3I1IA 4M0MA 1DX4A 1CRLA 1O6GA 2XE4A 4HRYA 4Y2YA 2BFNA 5AM1A 1DT3A 3PF8A 4XIIA 4AZ0A 4E15A 4ZGBA 1CUZA 2WU4A 4Y2JA 1UKCA 4DSAA 3WYDA 2HL6A 2OCGA 3R3UA 5K3FA 3MGAA 3DLTA 4BC1A 1R3DA 1BCSA 5AM4A 1ODSA 5A7GA 1LPOA 1DTEA 1DQZA 2IIVA 2ZYSA 2EEPA 1TKRA 5AKEA 3V9AA 5AKIA 5A7HA 3WMRA 2VT7A 3IUQA 3WL8A 5KBYA 3LIIA 2ECFA 3DOHA 1CQZA 1XZHA 2C58A 2YASA 5DNUA 5D3KA 5D6OA 2PL5A 1EB9A 4C01A 1E8DA 4BRZA 1O6FA 2VEOA 5LZ9A 3HSSA 3T4UA 1QTRA 1H22A 5ALXA 1IUNA 1CUVA 4PNZA 3DL4A 2Q0XA 3STVA 4DYHA 5AO9A 3G0DA 1EK2A 1B6GA 4H0CA 4KRXA 1LGYA 4L0CA 5BOVA 2WIKA 3MVEA 1ZGCA 3I28A 3IUMA 5CT9A 4BZZA 1AZWA 2XMSA 4J0IA 3UUFA 4ZV7A 4E11A 1A8SA 1YASA 2AJDA 4X91A 2OCIA 3O9MA 2PSHA 1SFRA 4BE4A 4X6UA 3WL6A 3C6YA 2XQIA 1QIIA 4OYYA 4EHBA 1QIGA 3BL8A 4J7AA 2GZSA 5ALHA 3VJMA 1OILA 1P0QA 5D3ZA 4QDZA 5CW2A 4QWMA 1R9MA 2WHQA 3KDAA 1T4MA 2AJLI 5T4EA 1TRHA 5AICA 5JALA 1F0PA 3JYHA 4Y2TA 5LZ4A 4GW3A 5I9IA 4BZWA 1GGVA 2VA9A 3H04A 5ALOA 4X95A 4B9AA 5HKAA 2D5LA 1CUXA 6YASA 4KE9A 3BJRA 4WDQA 2WUDA 5IVDA 2JGIA 2PPLA 3D3NA 2PSDA 1Q83A 4FNGA 2ZYRA 1JJIA 3DQZA 3L1IA 4UBLA 4QEKA 2ZSIA 1D07A 3BIWA 3C70A 1HLGA 4BTLA 2BGNA 3ZV7A 1OCEA 3WL7A 3QBJA 2XQGA 4L3WA 1MTZA 4PW0A 4EY8A 2XDWA 4Y2VA 1KEZA 2HU7A 2XI4A 5CH5A 4A5SA 3KSRA 3QVMA 3ICWA 2G4LA 1EVEA 5AM3A 4DNOA 4Y2QA 4F60A 3WJ2A 2XMCA 3FLBA 4GLBA 1H2YA 4YASA 5JZ9A 4RE5A 4EB0A 1XLUA 2WQZA 3GELA 5T4HA 2Z5GA 1XZEA 4PF1A 5AIBA 1IUOA 2XQJA 4CG2A 4BAUA 3G9UA 4A23A 4W1RA 3RKSA 1USWA 1UT6A 4WCVA 4N8EA 1BE0A 4FFVA 1CUBA 4H77A 4CCWA 2ORYA 4XJVA 5AHXA 1H23A 3JW8A 3I6ZA 4C87A 5CRIA 5K3EA 4HZGA 1UFOA 2HA0A 4LXGA 1P0IA 2RIPA 3VXKA 5FLKA 4FDMA 4BCDA 3KWJA 2WFLA 4H7JA 1JJFA 1E8MA 1WM1A 4Q3LA 2JEYA 3RK4A 4MWSA 1JMKC 2OGSA 2JGJA 2XB6A 4OPMA 5LZ5A 2ONCA 3M83A 1K5PA 2CJPA 2HA3A 1VXRA 4H7HA 3O4JA 2HFJA 4ZWNA 2GBIA 3GUUA 1AGYA 2WFMA 3KWFA 5LIPA 2HIHA 5AI0A 5DNWA 1XZGA 3C87A 4W1PA 4RE6A 4QE3A 1XQYA 1XQWA 4X85A 4E14A 2O2HA 2WIDA 3IBTA 4ITVA 2O7VA 4EBBA 2RONA 1BN7A 1WB6A 2WIGA 1QTIA 1AKNA 1DQYA 2JGKA 5DTIA 1ZGBA 1VXOA 4WDRA 5ALKA 2QXUA 5ALVA 3I6YA 2HA6A 3WQHA 3FOBA 3WK8A 1EINA 4Y2RA 5LZ8A 1CUHA 4X92A 5AK4A 4Y2UA 1WHSA 1FJ2A 4U2DA 5EHZA 1EB8A 1J06A 2ROQA 4NMWA 4X7BA 1UKAA 1QO9A 3C6ZA 3G02A 3C5WP 5C8ZA 4DNPA 4ROTA 1VLQA 2PSEA 4JYPA 4K5QA 3R41A 1WHTA 3G9ZA 4BCCA 4UHCA 4KRYA 4F5ZA 3R3WA 3HYSA 3GZJA 4BDSA 3SK0A 1MU0A 2Y6VA 2C0QA 1GPNA 2JIDA 4K6KA 5JANA 1Q0RA 2XMQA 3D2BA 2O2IA 2B9VA 1HBJA 3O4GA 1LPAB 3STYA 5K3BA 5SYMA 4BDTA 4JNCA 3VJKA 3K2IA 1G5FA 1VJ5A 4FHZA 5C7YA 5T4BA 4CIAA 4G8DA 1FFAA 3AILA 3V48A 4EY5A 5KWJA 1EA5A 3VVMA 5LZ7A 2VATA 1N5MA 1ODCA 2DHDA 4CCYB 4BYMA 5CBKA 3STUA 5AKJA 3HZOA 2FUKA 1FFEA 4WFKA 4AN0A 1PV1A 5FP0A 3DOIA 2OQIA 3OG9A 4HAIA 5AKGA 3AIMA 4BP9A 4GECA 2WJ3A 3OTQA 4S0XA 4LXHA 3OPMA 3UMJA 4C4XA 2V97A 4BB0A 2C0PA 3HEAA 3IB3A 4J0CA 1A8UA 1G42A 5LP1A 2PU7A 3BDIA 4YK7A 5AK6A 1XZFA 3FLEA 3ED1A 4FOLA 3L1HA 2BKLA 3DYVA 2XQKA 3E0XA 3I1YA 1AC5A 5JD4A 2ZJFA 3KXPA 4QWWA 1MPXA 5CXXA 4MYDA 2I3DA 2C4HA 2QM0A 5BWCA 1CUAA 3OC0A 3WA7A 4QA9A 5CXUA 1HL7A 2XLBA 5AOCA 5HFAA 1BEEA 2CKMA 3C8DA 1ZD3A 4N8DA 3AIKA 1QIJA 1XZKA 4AO7A 2ZJ7A 5JATA 4KAAA 1GXSA 4Y7DA 3A2NA 1UOPA 4DNQA 3TRDA 3U1TA 4UFNA 1CUGA 3G0CA 4WJLA 2BUCA 1ORWA 2OG1A 2Z3WA 1X70A 3LCRA 4HRXA 3WK7A 1MNAA 1ZJ5A 2V9ZA 2NW6A 4I19A 4B7ZA 3M3DA 3PFBA 1N8SA 3H17A 2WU3A 4HVTA 2DQYA 4HXGA 3G7NA 5AM0A 2Y2UA 3H2HA 1QE3A 3FYUB 4KE8A 5IVIA 1K4YA 3NWOA 5EHXA 4W63A 3N0TA 2VJDA 4H35A 5E4YA 1NU8A 3F97A 1UOOA 2GZRA 1RP1A 2RGUA 4RGYA 3B3QA 2DR0A 3WZLA 5ALEA 3WKCA 2FX5A 3H19A 3EQ7A 2PKYX 3M82A 1CPYA 1JFRA 1UK8A 1F0NA 1DT5A 4JEIA 4P92A 4ZREA 3H2KA 1A7UA 2HA7A 2WUGA 3LP5A 1CUFA 3SX4A 1GPLA 3BDVA 3B5EA 1SOMA 2QOEA 1DU4A 2OAGA 4G1FA 4PSUA 5LKRA 4FKBA 4RPCA 2OXEA 5LKAA 1GT6A 5AI5A 1JU3A 3L1JA 2Y6UA 3D59A 3WI7A 4B85A 1W1IA 2G5PA 1TQHA 3TGLA 4J0HA 5AM2A 3R0VA 3E1GA 4B82A 1AURA 3CN9A 3DYIA 3ESAA 2HDWA 5FXMA 1T2NA 4Y2XA 3W2TA 1I6WA 1XQXA 3SC2A 4KAFA 5DTJA 4IQ4A 5E4JA 5HK9A 5HQ3A 2CB9A 1L7RA 4EY4A 5JZBA 2PSJA 4FLEA 3F98A 1ZIXA 1PFQA 1X2BA 4AN1A 3QH4A 4FFWA 1S8OA 4OB6A 4B80A 2DFPA 1MT3A 5D7BA 1EI9A 4BE9A 5IH7A 1VZ3A 4Q82A 4B6GA 2IITA 2QJWA 3V1LA 4D9JA 5ALSA 5JD6A 4C4YA 4GDMA 1DINA 1MN6A 2LIPA 3WKBA 4LXIA 4GHWA 2BUAA 3PFCA 4G4JA 4J0GA 4G8BA 3WZMA 3WWOA 5JAHA 4FMPA 2XQFA 5KWIA 2AXEA 4BTVA 5ISMA 2JBWA 3BWXA 3CN7A 3I2KA 4PV7A 4F0JA 3WWEA 5KREA 3G8YA 3EIOA 5A71A 3OM8A 4DMCA 4BAZA 4TPKA 4OSEA 1CUIA 1W76A 4CIBA 3STTA 1AUOA 3I2JA 3W9BA 3WKAA 5JASA 5HF6A 1VA5A 1TAHA 3H1AA 4QDTA 4Y9SA 3PI6A 5AKYA 4ARAA 5HF8A 1LBSA 4OUKX 1C4XA 3D2CA 2GYUA 3GFFA 4XWGA 2V98A 3FYUC 2E3JA 1VOTA 3FAKA 1TCAA 2WJ4A 3WJ1A 1HQDA 1LZKA 5ALUA 2YH2A 1E3QA 4XX1A 1CQWA 2HM7A 3Q0TA 4X90A 1XRNA 2XMBA 2GBFA 4AO8A 5FPPA 4G4IA 5HF5A
chains in the Genus database with same CATH superfamily
1E6LA 1JBQA 2REOA 3H6HA 3AF1A 1Y4AE 1PDWA 3V2IA 4C5AA 5I8PA 4RIFA 1W85A 1Z2NX 3HCOA 3BKXA 3NG1A 4HH3C 4R81A 5CM2Z 5COAA 5EXTA 1OGYA 3OQMA 1JEYB 3MCVA 4CTOA 5EJ7A 1FW6A 2IDMA 4D02A 1GA6A 1II9A 2IK8A 3AKDA 3ACBA 2I78A 1NC3A 1DCFA 3P71T 3SE0A 1GG8A 2OCDA 1GPKA 2PL9A 3GFRA 1M2VA 2EBUA 2OBNA 3HABA 3O9VA 2WUEA 3OZFA 5JI2E 1Y6JA 4MVJH 1M67A 1HQYE 3F90A 4YJFA 1MGOA 2VSQA 1KS2A 4DAEA 5ENVA 3GHHA 3NHWA 2J3HA 1O77A 4M88A 4OLHA 1T8UA 1WUJS 3QXGA 4BMYA 5A4AA 1QZTA 1RPZA 1VRWA 1CJSA 2ZWAA 2ACEA 4C3UA 1ZONA 3PVZA 2E5LB 2EWWA 5GJCA 3N0RA 3PQ2A 3EVFA 2J5RA 1U5AA 1DRKA 2Q3CA 2OHJA 2QT9A 4V2IA 1AF7A 1L8LA 4EMSA 2C7OA 4HAXA 1EDZA 1BJKA 1CUUA 1E60A 1A8HA 1L7DA 1K5HA 3FBWA 3O21A 3TZKA 3NHSA 1RJEA 3HDHA 4K9MA 4ZIRA 3IDAA 4L2IB 1Z29A 2RSLA 3OT1B 4DMHA 3VTFA 1BG6A 2H4FA 3M6FA 4Z49A 3PUHA 5FWNA 1ZMRA 1I5RA 5DO9A 1QLHA 1QOQB 4MITA 3UFBA 4UZSA 2O5VA 1SUPA 5CLFA 3IQGX 5KMGA 1P7VA 1W8DA 4JBWA 3HYNA 4M8KA 3EQZA 1TYBE 3F4LA 4XWYA 5CPBA 1B00A 3IVGA 4QUAA 1WUKS 4RM2A 4BGUA 2GHTA 4YVFA 3DNPA 2PL3A 3FNBA 3VUFA 4KSYA 5H81A 3CGWA 3E9ZA 5EJ8A 4UNRA 1E3SA 5ES3A 5CEFA 3RUAA 5C52B 2F4VB 3IBGA 4ZOQI 1QXSA 5LYYA 2GOYA 4X7RA 2H9YA 2YJ5A 3D31A 1YS7A 1F20A 2QRMA 1H3FA 1NFQA 1ESMA 1WTCA 1C7IA 3EEYA 4BVEA 4RAOA 1Q0TA 4B6RA 4MVWA 1H5QA 2BM0A 5TXGA 4EWLA 3CZMA 5HUHA 5TS2A 1ADJA 1GY8A 2YOHA 3FTEA 1E7WA 3IQZA 2GN9A 3H9QA 4MR9A 2HJHA 5AK3A 1XD2B 2EKLA 5ANRB 3DBHB 3ZD8A 2GEUA 1ZS9A 2OBBA 4ER7A 4U7TB 2ZG6A 1MOSA 2PY6A 4M22A 5E2IA 5AKXA 3RVRA 5IAGA 2G4VA 1Z15A 5ALGA 4GR5A 1JSZA 1NJ6A 1VCMA 1WSBA 3EDMA 2WF8A 3KNZA 2J9RA 3R2JA 2Y1GA 5AJHA 5FPTA 1ONPA 1KU0A 4ZXFA 2XHZA 5TGZA 1S3SA 2PUHA 4EGCB 5IT9A 1EWKA 4IHKA 1SOUA 4HTAA 3NVDA 2GCGA 4OBXA 3W8RA 3REFA 4IV5A 3FUXA 1U0SY 4L7VA 4Z4QA 3LXUX 4QM6A 4I1PA 3HJUA 4TV8A 3AL3A 3RGWS 1ESEA 2DHQA 3L04A 5KKAA 1RD4A 3CCFA 1S2OA 4OU4A 2WD9A 4Z4GA 1G2IA 4KQXA 2VK8A 3E7PA 3PNOA 3QUBA 4G01B 3WWYA 3GLIE 3T1VA 2PS9A 3DUWA 1QVRA 3M5CA 2I0FA 4M1TA 4IDPA 3RYTC 4BPRA 1VGVA 4ZCQA 1K98A 3JD3A 2KWIA 3IL2A 2PZLA 3WL5A 2E85A 5ICMA 1OASA 4BGEA 1E2PA 4P33A 1M2KA 1N2BA 2AYXA 2V7UA 4PZLA 1FS4A 2AFHB 3M5WA 3VMFA 4E6PA 1HR0B 4MYUA 1DAFA 2F64A 4TMWA 1ELOA 2RHTA 3OKAA 1Z5PA 3GO4A 1QFZA 3O4VA 1P3Y1 3GZ4A 3LY9A 3GLHE 4BX8A 2EW1A 3HXLA 1NMEA 1BROA 3HYRA 1NXXA 3I8XA 4I81A 3TZCA 4B84A 3TG2A 2IS6A 2X5NA 2F67A 4UXJA 4C7BA 2AJTA 4NKRA 1RZ3A 3BRWD 3WWPA 2AOTA 4PGFA 3R3JA 4RXUA 1MB9A 2H1SA 1C8VB 1DWPA 3AESB 3CZAA 2Y0DA 3KQYA 3LWNA 4LSGA 4X9XA 4LBYA 1WF6A 4MUHA 4F9TA 4QXAA 4L9WA 2WG2A 3A1TA 1JPUA 2Q3BA 2QSUA 1E5TA 3H99A 4TMFA 4KBYA 3ZLVA 2FV8A 5HM6A 2P2YA 2ZJ8A 5LD2B 1DB3A 1A72A 1KI3A 1QZXA 2NO0A 3IAM6 2X0DA 1ZCBA 2BFOA 4O2AB 5IP5A 1CJMA 4C22A 1E6KA 1UFKA 1E9RA 4DJFC 2XDAA 4O5OA 5AW9A 1AQNA 2X0IA 4O8ZA 3L1VA 3ACDA 2ZJ2A 5I47A 1HDCA 2AXPA 1AVTA 2VF2A 1W25A 2JJ1D 4MW4A 2GRAA 3KXLA 4EQ6A 2QRHA 4NG5A 2R1ZA 3W6ZA 1U81A 1JR3A 3LF1A 3C98A 2IDKA 3DFIA 1PJ2A 3GT0A 4OMDA 3LQFA 5T8KC 2WTXA 4BTEA 2BM9A 4M6WA 1CY8A 1T5SA 3M9LA 1ENPA 2JGEA 2XCLA 3PHLA 4JMLA 4MLCA 4AN4A 2VHYA 1L5MA 1INLA 1AT1A 3E53A 5KOHB 1TM5E 2GK4A 4QGAA 5HJ7A 4P5PA 1OTHA 3ITKA 2AI1A 2RBEA 4M1ZA 4ZHSA 4XM1A 5EJEA 5LP6B 1G20A 2IYSA 3DCJA 4IGIA 4H7KA 2XUPA 1NQWA 3PFIA 3QUQA 4O4LA 4ONEA 4DXDA 4RK1A 4NQRA 3QEAZ 3F1LA 3PCRB 3CX7A 1ORIA 3PHIA 4D4GA 4J6FA 3FMPB 3PR1A 1MF7A 3FDFA 1JLRA 2JNWA 1U0LA 3C6QA 4JQYA 1V3VA 3WC4A 3EAFA 4N49A 1F7UA 5HXAA 4CMGA 4EGFA 4AKHA 2G71A 4GO1A 5AOVA 1CD5A 1JZTA 3LNTA 4L72A 4ZAVA 5FEMA 3RABA 4EUEA 2Y92A 5GZ1A 2PKCA 3G79A 1JKMA 3D02A 2FWBA 1GJRA 1CW2B 2FMFA 4HDOB 2FVXA 4D4LA 1DEXA 5BVGB 3VR6D 1VI6A 2X8LA 4CFZA 4OXQA 1D2MA 2HNAA 5K0ZA 1VCNA 1DG3A 3JRWA 3FVRA 4MKIA 4YAWA 1C14A 4KIFA 2MHCA 3EGXB 4YJ3F 4DM4A 5L3QA 5D87A 4MUYA 2YIVX 1GTJ1 4G1UC 3RSOA 3NXSA 4MQEA 3RTCA 2PUEA 3QHAA 1R5NA 3EH2A 3VPXA 2FSGA 5FRDA 2QMHA 1I24A 3G7SA 4R9SA 1UDCA 1XA0A 4RF4A 3DBRA 4CV1A 1OFGA 3BOSA 3KUKA 3PE6A 1IY8A 2HU8A 2DQSA 4WAUA 2EJBA 1Q1GA 3BD9A 1QV7A 1XNJA 1XYGA 2EG9A 3I01A 1U0GA 3HBLA 1JIUA 3G2IA 1YKSA 2JZNA 1DJMA 2QB5A 1FTNA 1KZ9A 2ZZKA 1FB5A 1XTQA 4MWEA 5AM5A 4RV4A 2IOFK 4DTCA 1SVMA 1IQ0A 3RC2A 3ESZA 3FOAA 2LW7A 3MYYA 1QIEA 1KVRA 1THTA 5MFPA 3PDUA 1P7PA 4EK9A 4YYZA 2Q46A 4J9VA 3AR2A 3R8FA 2P4EA 5JCJA 5TARA 5D51S 3WGTA 2W2NA 4Z0TA 1BQ3A 5ELMA 5A4MS 4ND8A 2GN0A 2QI9F 1YF3A 1CVLA 4KYTA 3AO0B 1N78A 3L46A 3A7DA 4KMOA 4Y9DA 4WFIA 3AEKB 3P96A 4ZCRA 4QUBA 4HNUA 2VZ0A 1X8LA 1SIUA 4MROA 5F51A 1V45E 2QWXA 2ZRPA 2P90A 2XGOA 3HFRA 3IP6A 3IUYA 2OY0A 3AIOA 4Y30A 5AOAA 2A0KA 2P9CA 3D7SA 2HD4A 4G0UA 3RM3A 1R88A 1B8OA 1WG8A 3AOEC 4MR9B 2M6KA 2F6RA 4X64B 4DVJA 3PHBE 5DJ5A 3IPYA 5LQMA 1EX6A 5I51A 4B17A 5BRJA 1MP0A 3ZKWA 2JBHA 2M1ZA 3IVMA 3HJRA 4UVIA 3QBEA 4KKXB 5HZKA 3OX1A 4TTSA 2PTHA 3D4OA 4ZI7F 2Q21A 2W22A 2B4TO 4TROA 1L7MA 2PWBA 3AR7A 1C29B 3GJ8A 4Y2HA 3GVPA 4X1YB 2UZ0A 4CG0A 1XTJA 5F4BA 2FZ4A 5CU7A 2GD1O 1W5AA 3QSGA 2RDMA 5F76A 1Q92A 3UA3A 3VUEA 4R5MA 3OHPA 3GJZA 4F6RB 1Z39A 2NSHA 3H1TA 2LXNA 1VHQA 1D4FA 1SCDA 5MN4A 2QGFA 5KOYA 4OHPA 4RTQA 3Q9LA 1U5BA 5TF0A 3R7DA 4X84A 4C89A 2Y93A 4Q02A 1DDOA 1UWCA 3B20A 3U16A 3FMVA 2FAXA 4Z4CA 3R09A 3TNDA 1M73E 5G0SA 1N1MA 3QEBZ 2YFHA 2ZIEA 3DOEA 1J0BA 1FU7A 2HBYA 3Q87B 4MQBA 1XF1A 3SXUA 3VGJA 4GL2A 2ZYUX 4XSHA 4PYQA 1I3NA 4XTRA 3QOWA 3RVQA 5K0TA 1Z62A 1UKBA 1UQTA 1IEWA 2G4CA 2ZRKA 4IJUA 4GGPA 4M0UA 2IT1A 1NUAA 4KXVA 1E5DA 5IKPA 3H8SA 3WVNA 5B3KA 4V0MA 5IJXA 3IAS1 2G7MC 4IHJA 4JWKA 3SHVA 4RAQA 3EMBA 4PQYA 2E18A 1E64A 3IUNA 3TINA 1KOJA 1NLYA 1FLNA 2GK6A 3K9HA 4JI4B 1II8A 2I5PO 2PKQO 1IATA 1E92A 2MYUA 2Q3FA 2YC4C 4IX9A 3JQAB 1E7RA 1ZXXA 2HCBA 4YJ2F 4KLAA 1P0CA 3NANA 4ZDJA 4IR7A 4QDXA 3ZQKA 5HBGA 2H2IA 4DZZA 4ZEVA 5KU7A 2PLAA 5KSPA 3DZDA 2NU8A 4CCAA 3CNQS 4CV2A 2VDRB 1YR9A 3F4KA 2IX9A 2ZRJA 2R65A 4A6XA 3QX3A 5BNTA 3GW8A 2VP4A 1R5BA 4GMFA 1VI5A 3IV6A 1R0XA 2F1HA 1TCBA 4XCVA 1I4LD 2C5LA 1IPHA 1U0OC 2R85A 2F55A 2XW6A 4JI0B 4XPIB 4BNGA 3W9UA 1RU3A 3D4IA 4ZDWA 1LTHR 3BZBA 4FBMA 5LLSA 4BFCA 4CLHA 3W06A 4CM3A 3RFTA 4KQWA 3PC6A 2X22A 5DI9A 3TGWA 4CEJA 4BO7A 2G67A 4ND7A 5DWDA 3KOXA 2NSDA 3R76A 3V1KA 1ZW1A 1YHNA 1DI0A 4MUMA 3ZHQA 3IA2A 4D81A 1GRCA 4CEIA 3MB5A 4GYKA 1TO1E 4KQHA 1B1AA 1XZJA 3LY5A 4OH1A 3QENA 5KNCD 1W2WB 1NR1A 5EIAA 1U9YA 2CXQA 1HDGO 5KVAA 4TWIA 2P3LA 2QEQA 3AHCA 3THWB 4X71A 1DRJA 3GL9A 1QMGA 1Q84A 2DFDA 3EC2A 3S1AA 1GRRA 1T34A 1VYHA 3EWIA 1IBLB 4N9QA 1CDDA 4YX9A 2JA1A 3KZCA 2KSQA 4MEAA 1GOTA 2A1IA 5D01A 2J6CA 2X15A 4D0GA 3Q8LA 4EQZA 1E5XA 1PR5A 3GMDA 3A11A 2X42A 2JJ1A 2R4UA 2VF8A 1J09A 1VJTA 3PITA 3U7IA 4B2YA 2AI3A 3J80A 2GEVA 4EENA 3FOEC 2QX9A 3L8HA 3BRSA 4NBVA 3VKVA 3IILA 2CK3A 2BRUA 4B3GA 5CXSA 4DCUA 3G2QA 1TGVA 1MJFA 4D42A 1P19A 2H31A 1KIAA 1I9GA 1U4NA 3LOQA 2JIBA 5KYXB 1L9XA 1TUBB 1M8JA 1EVQA 3DPSA 4MCIA 1NPTO 3UWMA 5JNRA 3DBOB 4RPHA 2RAFA 2RGBA 4R51A 3CRMA 4JJ8A 3DFUA 2D1YA 4AJHA 1TAQA 1Z4LA 1CR6A 2XBMA 1J1ZA 4BO6A 1EX9A 2J45A 1VIYA 1BRTA 1UP7A 3LUCA 5C3UA 3LT4A 2VYCA 3RFVA 2FVYA 1DWUA 3IP8A 2W11A 4ZCPA 4GZ3A 1GITA 2Q5JA 1F51E 4DGQA 5JXWA 4XPZA 4WN9A 3EYWA 1IY9A 1PJ8A 1BS9A 3HDVA 4R6XA 2PMBA 5L7YA 5ULLA 2IPNA 4AY4A 1MG5A 2GILA 1J24A 1MAAA 2IIBA 1U90A 2H4WA 3OQ6A 2UYQA 2WM2A 5AVXA 4UHFA 1FQKA 3KAPA 1OC4A 2I6GA 2V96A 1TOAA 2VDKB 1RAHA 4N54A 3NCHA 4OQPA 2OXCA 4X6YA 4MI6A 2CXUA 4CM5A 4CL0A 1PN3A 1M1UA 1UANA 3L7AA 4HEA1 2BD0A 4D82A 1SZJG 3RS2A 1TB4A 1BAPA 3C6MA 3RBAA 3F7NA 2COKA 4ASUD 4QYIA 4XQGA 2I9KA 4V0SA 4DR6B 4DS3A 4NXNB 3LTNC 2OXIA 2WAOA 2NWQA 4BVGA 3EGDB 5FH9A 5KIAA 2OK7A 4G0WA 2OCKA 1ISPA 3UXEA 1FZQA 2C3MA 2FWAA 3NHRA 4CKEA 2HADA 4DMMA 1A1SA 4FJ0A 2WVAA 3CKMA 3T7RA 4KQGA 1M6YA 1P1KA 2PSSA 3UJBA 5JXHA 4FEAA 3C3YA 1RBMA 3V8QA 3U48A 3OCWA 2BEWB 1DKUA 3TRKA 4L85A 4DHEA 1E1QA 1Y37A 3BEDA 4K6CA 3EOZA 4WEQA 4BLTA 3GLHA 4F3RA 5KS2A 1ZOLA 3L4KA 1DCKA 3E2PA 3MQ4A 1PNQA 2BZSA 2R60A 4BWGA 1A76A 4DMRA 3NBXX 2IYEA 2ZTMA 1AO0A 4J16A 1ONSA 4ZT3A 1UJNA 1QOZA 3D2AA 3L9XA 1H69A 1II0A 1PBTA 5AVZA 3GJ5A 2G0TA 5JJ5A 1UZMA 1WAMA 4QOEA 2HLDD 4DWOA 3OQPA 2YHIA 4EATA 3BXOA 3T9FA 2XIQA 1I7DA 4G0VA 5JRDS 4ZRDA 5JISA 3KETA 3EC7A 4KR0A 2REXB 1AGPA 5E38A 3ICVA 5TQ2A 4TT3D 1WETA 1TVKA 3K73O 3M9XA 5EA2A 1HYHA 4V39A 4F3TA 1LLFA 2C78A 2FSVC 2Y3IA 1FS5A 1KGDA 3B53X 4ALMA 4GH5A 1UMDB 3KQLA 3JZDA 3C48A 2Z4RA 3AWIA 2K2WA 4R4JA 2PGJA 2P6MA 4CKBB 2VHWA 1C1DA 3PC7A 4IOJA 2AZMA 2CN1A 2QTZA 4Y0VA 4B87A 2E82A 2BF4A 4JROA 4ZV4A 3C1AA 5FTWA 4I1YA 3E4DA 1ZQ1A 4IQGA 2P5UA 3GVXA 2R1TA 3WDLA 1P3JA 3MERA 4NPCA 4MRPA 1XVLA 2BMWA 3BXPA 2QG4A 4YCDA 1PL7A 4B7AA 5HRUA 4NZOA 4YXWD 1LDEA 4A4DA 4G5SA 2Q1WA 1T8SA 2W6IA 4U2EA 4A3SA 4Q1EA 2YJ3A 5JS8A 4FPXA 4CN9A 1EAMA 2QM3A 2DETA 2H7CA 2XYGA 1C4KA 3DAYA 1VG0B 4MPJA 3UQYS 5BMVB 5IK2D 3TVDA 4CI0B 4O3FA 1Q7BA 4I9FA 1K75A 4FXPA 4QOJA 1N4DA 1CZHA 1L3CA 4M7PA 2XUDA 2XJ9A 1XZLA 4MPDA 4Q9KA 5EJAA 1L4HA 1M1XB 1SVSA 5LN1A 2BSQA 1MAHA 2CLSA 2OZVA 3M9WA 3SDBA 3DE0X 4RVSA 1CRWG 5J2TB 3ERCA 3VTAA 1JTFA 2X8WA 2XUJA 2NUTB 1Z7GA 3P9QA 1JIVA 4HAVA 2E4ZA 2HRRA 5FTMA 5ITWA 4BCBA 5ERGB 5C5EA 1CB0A 4XGQA 3FSGD 3P9KA 3AI2A 1NXVA 3KOOA 2BEUB 1M75A 4YT8A 3T7DA 2VBIA 1PL8A 2TRSB 1KDPA 3LTEA 1NSYA 2BR5A 3ITEA 4H7PA 4Q3BA 3U39A 4B46A 4K86A 3J7TA 4O1IA 1YUNA 3TXYA 2RH4A 1OFHA 2RFLA 3LA6A 3QKUA 1BX1A 3L0PA 5EHQA 5C1OA 1Z5GA 5AW4A 5I7HA 2CUTA 3MCTA 1RM0A 4GPAA 1WBBA 3B6IA 4TL7A 4RHFA 2Y27A 2NT4A 1WW3A 5TDHA 1VCHA 4G37A 2CZGA 1W5SA 1YB2A 3VDNB 3E82A 3KKLA 1Y33E 2V0CA 3B78A 4M76B 5DV9A 4LJLA 2GWHA 1DKNA 1KXJA 2PEYA 1OWNA 4ARSA 2UUCB 4LRUA 1G6KA 1HURA 3PWSA 4OU5A 3G0HA 4EW2A 5IHXA 3A6JA 4GPIB 4H60A 1N0VC 2JEZA 2PAAA 4B3SB 3DV0B 4B3FX 4KIUA 1FX0B 3CRZA 5CLGA 2AZ4A 1L4GA 2XOKA 3B9QA 1FQOA 3V7FA 4LJRA 2P2NA 1W96A 2XOKD 2GZ3A 4Q16A 4UBMA 2G63A 5IVKA 3F7MA 4ZDIA 2ZIXB 4FLFA 4NNJA 3RSZA 4EI9A 4F11A 1JDNA 3FD8A 2CUZA 1JGTA 3QFCA 5C5DA 1L4KA 5HOQA 4IDBA 1T2DA 2GGSA 3NEJA 3QPCA 1KETA 1HTTA 1FQJA 3RS7A 2R47A 3IMEA 4O08A 5CDYA 3IP5A 1GPH1 1YQQA 2Q6LA 3L41A 1PJTA 3GVIA 1V8ZA 5H83A 4BWYA 3DZIA 3DQPA 1RTKA 1VBMA 3JALB 1O8BA 1U65A 4UCFA 2FOIA 1DADA 1BKYA 1DUSA 1QFSA 3CRW1 1LI4A 1FFBA 2EQBA 1XDWA 1KAGA 1QGDA 2YN0A 2Z4TA 3DAOA 2ZK7A 3NDPA 1R66A 2HGZA 3O75A 3Q88A 1MCZA 3T15A 5U1PA 1JTEA 1RYNA 5CFQA 4GICA 1E2GA 3VZQA 2L0XA 3O4HA 3A4NA 1QK5A 2UUPA 4LFCB 3ZDBA 1JHXA 4V3BA 4AK9A 4PG8A 4JVLA 1U2PA 4N9WA 3DJYA 1P6UA 5T3UA 4WNAB 5ALPA 1P8JA 2P4QA 3D6VA 1IQRA 3R6LA 1H1DA 1BWSA 4G1CA 3AOEA 4YJGB 5I5EA 2PVCA 2AJBA 3A9UA 5IJ9B 4LHWA 1I1HA 1Q44A 2BP7A 1A4UA 2UVPB 2V6JA 3C41J 4K81B 2CK3D 2WIBA 3VM6A 2H1LA 1XCPA 2FMTA 2I9PA 1VDMA 3GG2A 4CI9A 4Z7QB 1VP9A 4KQCA 4TSKA 3HXQA 2BT4A 1JX6A 2F9FA 3V4VB 1P9LA 5GINE 3CW8X 5JADA 1NMYA 5JTUA 1O1YA 2J1LA 3AHHA 1RYYA 1XTRA 4G1EB 2A5JA 1NX9A 1PL6A 3Q5GA 4MGIR 5C8YA 5LMUB 3FTPA 2CL0X 2GTIA 4P3YA 3BJMA 1ZGZA 1GL3A 5B1IA 4BQIA 1AMOA 1H65A 3FWKA 3OC6A 2AFIE 3O95A 1E3LA 2DXIA 2IY9A 1NOJA 1H5NA 3OOEA 4ZCMA 4WTOA 1O96A 3PQ5A 1QQ5A 2R00A 3EF3A 4F38A 1WBDA 2QZJA 3J81k 3ANNA 1ONNA 2V7BA 1K6IA 1NVVQ 1YS2X 2HH9A 2WJIA 3MS2A 4YRDA 2O1XA 4PCUA 3WQQA 1EUDA 1QLWA 1OUMA 3I8OA 4KDEA 4MX8A 3Q10A 3UAWA 2J9FB 2MMGA 5JJCA 4S0ZA 4ZVTA 4RETA 1JMYA 4A0RA 1SCKA 3IBYA 4XQCA 4WN3A 5B1SA 4Z2AA 3EG9B 3FMIA 5FUBA 3ZWPA 1YQTA 2JFPA 3CINA 4YC7A 4RKQA 3SJUA 1ZSVA 2O54A 1SU4A 3KWMA 4H0NA 3BBLA 3BMQA 3ESBA 4TX1A 3BE8A 3NGMA 3OM0A 3UTCA 1PDVA 3EFBA 2EQAA 1QVWA 2W6PA 3HP1A 4QARA 4Y1EA 2Y9MB 4BNVA 3LX4A 2B8TA 4CM8B 3ZPXA 3G9TA 1ADYA 1LSJA 1X86B 4FE4A 4H3HB 5FTNA 3EEIA 1LW7A 3KOYA 2I7CA 5AHRA 1Z7BA 4FYJA 3BHMA 3ZDRA 3TUZC 4CEHA 4K9QA 2WG1A 3TTYA 1GQQA 1L0BA 4ZEXA 1F4VA 1FTWA 1R0BA 3KEGA 1H8HA 1XU7A 3KYCB 2Y1CA 1E1QD 4J49A 1HXHA 1CJKC 5A0VA 5GONF 4AWAA 1J2TA 2BEJA 3DWIA 3RT1A 5IF3A 4Z1MD 3UYLA 1FFDA 3H5LA 1JDSA 3DKIA 3ZOKA 2W70A 2AFRA 4Y6LA 5FQOA 2AN1A 4F21A 1QYCA 4JL8A 1CR2A 4UHHA 3D7MA 2OSVA 3CEHA 3ZHUA 2GCOA 2RHDA 5EEGA 3WY9A 3BTVA 3G8BA 3T9DA 3VH3A 4DIKA 3BEOA 4XKJA 3U37A 1P73A 1U9IC 1H0KA 3WLOA 3O31A 4EGJA 3OPXA 3E0QA 1QPGA 4GXRA 4HDSB 4PPNA 4QLOA 4RFVA 3VR5A 1YS1X 3GDFA 3OCCA 3RS5A 4PRYA 1EFPB 4ZZ1A 2BFCA 4R5HA 2Q9AA 3R4VA 1JFTA 1K8YB 1JR3E 2XCQA 2VQ6A 3F9IA 2J3EA 3KAJA 1GNSA 1KPHA 4W7HA 1S4QA 2CJYA 3AWDA 2I71A 3KQQA 1YAHA 2OC4A 3PGVA 2GT1A 3A05A 3T7TA 3WLTA 1EUZA 1YB7A 3N8DA 4DBLC 2ZCJA 1V37A 5DULA 3IX7A 3RJZA 5A6VA 1IVNA 1VPWA 1U3WA 4BFYA 4Q05A 3LHFA 3F49S 5DLEA 2CLMB 3ABRB 4GPBA 4I1RA 2PWPA 1ZK0A 2GLTA 2VNJA 3C3AA 1OX4A 3N53A 4HZUB 4BMOB 5IKXA 1ZJ4A 3JQGA 3WIOA 1H3EA 2GHIA 2MU1A 2Z2IA 2H8GA 3S2SA 4AJPA 4EA6A 9ATCA 5FBVB 1U0FA 3FWPA 1FFCA 5A9TA 2JIMA 5KTSA 3MGCA 4L5YA 3L77A 2Q9UA 4AB1A 3DP7A 1Q6YA 4REOA 1YIDA 2BZ1A 3M4XA 1FPQA 1CLEA 1Y89A 3ELWA 1XPRA 4IXNA 3M6XA 1O57A 4HN2A 4RPGA 2Z0MA 4LJYA 5TEVA 1RFLA 3IURA 3N8GA 1G64A 4O2BF 5BN1A 2X6QA 4D2IA 2IH2A 1B23P 1WKCA 3CURA 5EUBA 5H80A 3K30A 4NHEA 3N59A 1U0RA 2X2OA 4G5HA 2WM8A 3OZSA 3WK5A 3EASA 1UPTA 4N5LA 1SEVA 4FNMA 5DHPA 4YUYA 3QE4A 3EPJA 4NMXB 2VSYA 4BV8A 1E79A 2IDZA 4M37A 1BDHA 4XWTA 2XE6A 3PICA 4N3AA 1E79D 1M1ZA 3TW8B 1RCTE 4TL6A 3A6ZA 2HC9A 4OLFA 2CYAA 2E5WA 2VTEA 3E7XA 4L6IA 4DLLA 4PIMA 2VUHB 3C1TA 3U56A 4EJ6A 4I1UA 3ZE1B 3UJ8A 4UD6A 2CNWA 1WDTA 4Q01A 1H66A 4DCSA 4B34A 5GP1A 1XNQB 1WUTA 2G17A 2YWEA 2Q4DA 3PS9A 4QHSA 3EGIA 5ENZA 1YUMA 3M81A 4RHEA 1PKEA 3LYAA 1BCSB 2BDUA 3EGCA 2JRLA 4QDOA 1C1DB 1T9GS 5F4ZA 1Z2PX 3JAWA 4E22A 3KSAC 4IXMA 5LB4A 5E95A 1XZDA 2GZHA 5KI6A 4PS0A 4D41A 1YR3A 5FWXA 5JG7A 1FYVA 1DAPA 4KXNA 4OXNA 1FXWF 2V5VA 3BGWA 3H83A 1W36D 2PUGA 1K3TA 1DAOA 2NGRA 1XRRA 4UHEA 4K03A 5TT0A 3GQBA 3ZHVA 2P9TA 1Y5LA 2G6BA 4MKRA 5A4KA 3ZNPA 1KY5A 4P82A 5K01A 2OVFA 4AX8A 4Q9LA 2OGWA 1T91A 4TSFA 4NJEB 4KE7A 1VL0A 1MC8A 1MKYA 2ZRAA 3RYFB 4GYJA 4COKA 1AE1A 2V6BA 1XLTA 2A0FA 3H2JA 3MHPA 5E9AA 3GLSA 4ER6A 2IIPA 4GRIA 1R6UA 3ZHBA 4BAGA 1JU9A 2PH1A 4GXNA 1SQ6A 3D3WB 5HCUA 4MO2A 4LGCA 2X2PA 2JA2A 2WWXA 1OXVA 1P1HA 3GT7A 3Q3GE 4MMYB 3E9NA 3R5TA 5DMHA 1SU8A 2NIPA 2Y05A 3MM4A 4FYYA 1UKZA 1T26A 2QZPA 2QMYA 4R41A 4PM4A 4RSRA 5CH8A 1JFSA 3BWDD 4ERNA 1V8DA 4IIJB 4G5XA 1WZ2A 2C8JA 1AN9A 1QVAA 3PEEA 3A7EA 4PBTA 4AL4A 1LQ2A 3GLQA 4J9UE 1E59A 1V9SA 4US2R 3WSWA 4P3KA 4E31A 2A5GA 2O5EA 1VKNA 3PSAA 1DAKA 2H63A 5KTMA 1M83A 4E5UA 1PUIA 2H1VA 4DB4A 1ZICA 1BMFD 1PIWA 3OIUA 1XMJA 2OL4A 1D2RA 1GPDG 1QG6A 4G84A 2AC2A 2BCEA 3VZCA 3GLTA 5EE5B 3V7YA 3SSOA 4W5OA 4AF8A 3HWX1 4J7UA 1LBQA 1VPEA 3OP4A 4Q34A 4D9MA 2O7RA 3Q7IA 3VTZA 3VYWA 3SIXA 3H0CA 1WIWA 2NU9A 2ZW9A 1YXMA 1V1RA 3B6ZA 1LNQA 3MXOA 3CG4A 2XUFA 4ARZB 3PR2B 3C5EA 4KQIA 3DCNA 2V4ZA 1K2VN 3JQ7A 4ZOLA 2XHEA 4HXFB 3H2YA 1KARA 3ILSA 4YAKA 4YV0A 5C1DA 1W75A 5GIPE 1T4GA 4HNTA 2WHPB 4PZEA 1T6NA 3CXUA 3E9DA 3G2MA 3MGBA 2Z95A 2E6UX 2DAPA 5CYFA 5FAXA 4EHHA 1M34E 3TTSA 3EY4A 2YJ4A 3ETJA 4AMGA 5LL6P 1SWWA 3GGOA 1SG0A 2WD8A 5CDFE 3DZCA 1BO6A 2Z98A 3V4SA 4C0SA 4V1CB 4UBNA 2AEMA 1JU4A 3CV3A 3R5FA 1NA5A 3D3EA 1JKXA 4INAA 3B6EA 2NSLA 4XB1A 1UL1X 3DV2A 1N5RA 3MW8A 4G4SO 1EEHA 3FW1A 4PC3A 2OYCA 2P5TB 3GX1A 1GNRA 5KHAA 3RREA 3E15A 2WP0A 2WPDA 4WLEA 3UPTA 2P35A 4UHBA 4UVEA 1KFJB 2A2ZA 4CF6A 4MV3A 4GLJA 4UMEA 5BSFA 9ABPA 5KYUB 1JWAB 1USVA 4XVCA 1DFHA 2CFTA 5AJWA 4BO8A 2F8LA 4MKFA 1NVGA 1OLUB 1S8AA 4JYMA 4G09A 4NATA 4CMIA 3F9RA 5FUWA 3UG7A 1ZNXA 4V1CA 5IYZA 1VE1A 1I6MA 2DULA 1BE6A 1ESZA 1UPCA 3EGEA 4JLDA 2GPAA 4JQCA 4NS4A 1GPJA 4KK3A 3NATA 4MJXA 4FFMA 4EY6A 4DCPA 2VOJA 4KQKA 3O73A 2BRUC 3QWHA 3BD6A 4N3GA 4OQNA 2DWPA 4DIUA 1QP0A 1P4JA 2Z8YA 1K66A 3COYA 3K70B 3C97A 3UJ7A 2DWQA 1CRZA 5TPWA 1RLUA 5KYWB 4RGVA 3ICQB 3V4OA 3SF0A 1YKGA 1Z0SA 2GEJA 2Q62A 3T35A 1E2KA 1HDOA 3L79A 4OFXA 5EMJA 3QZUA 4RTNA 2VAWA 5DSZA 2IPLA 3Q7EA 2BGRA 4AUMA 1HE2A 1Z18A 3L40A 5EIXA 1KEUA 2IEBA 3EHDA 4FDVA 1WY5A 2NVBA 4F2HA 4W8HA 3RCBA 4E7PA 4YP7A 3GEIA 1HRDA 1GHTA 3G2JA 4XUCA 3R44A 1VPLA 2J7KA 4HEHA 4XUDA 1BH6A 2H1HA 2RGNA 3R3XA 1F14A 4RL4A 4WKGA 5DIZA 2H9AA 3U3XA 1XMQB 1YB6A 3PEVA 2VNHA 2FW0A 4AZ3B 4JBHA 4OYLA 5EIBC 3HGTA 3PJRA 3W8FA 1YB1A 1B8PA 5CJ2A 3U5ZB 5FNZA 1LF0A 3VR0A 2IA5A 3RARA 1Z5VA 2ZI3A 5J2UF 5DM0A 1Y7LA 2EXXA 3C3BA 3AKEA 4UBKA 3GAZA 5ECWA 4AQYB 2R1VA 3OKCA 4BLSA 1PNTA 3WLQA 2XV1A 1PZEA 2COEA 2PCJA 3D0RA 3FZGA 2M98A 3ZIUA 5JAUA 2YS7A 3ZCPA 5JV5A 1BDBA 2GPNA 2QA5A 4JR0A 5FI5A 1Q91A 1W2GA 3H9UA 3SNHA 3C3EA 3KJGA 3PNMA 4EY3A 4HATA 1DXYA 4LIPD 1FFWA 3VAZA 3EB9A 3X1ZA 3AJAA 5I4KA 1AS2A 2JK0A 1F8UA 2G8LA 4OUDA 1ZD4A 2PRKA 3AR3A 3NHFA 4D56A 5IKEA 2IP2A 1VDZA 1IMOA 2X41A 4IUYA 4KDRA 4L8FA 3KX2A 1XB2A 2QS9A 4E6EA 2P9ZA 2FX3A 2QX6A 4B3BA 4YRBA 1Q3KA 3LQ2A 1F9AA 1MJNA 1N7HA 5AJUA 5KYUA 3S44A 3OCJA 4CBVA 4ZCIA 1N9GA 5HQ3B 1T1RA 1XRLA 5JJIA 4AJ2A 1YZLA 5JZSA 4FR5A 3C5VA 3UHAA 1G55A 3VR6H 2W2VA 1I3OA 4RFSB 1UIRA 1LWNA 1E6UA 5EESA 2BY4A 3DUFA 1US8A 3ZZNA 2AHRA 3VU0A 3ZX4A 5E7JA 4X6XA 4DG5A 5B30A 1JT2A 4YLGA 4ZKEA 3N2GB 1OWOA 2PMCA 3DXZA 3TDMA 4DANA 2FUCA 3Q8KA 2HWKA 3AQIA 4H1UA 1ZVQA 3SZRA 1CNEA 5LP6A 4C0JA 3ES9A 4BZPA 3ILXA 5HFJA 3OPQA 3W04A 5AW3A 5HGXA 4KLRA 2PZGA 3RYIB 2C54A 4OHCA 3I5UA 3WLIA 3GH1A 1IN5A 2EP5A 1Z6YA 1KQFA 1O6GA 4G89A 3A58B 4LDRA 4GYWA 4YPOA 4NU0A 3RD5A 1KTIA 4JEMA 3ZE0B 3B60A 4KPFC 4CKCA 1W0KA 5AM1A 4XIIA 1XDSA 4INJA 1WUIS 2PBZA 1G21A 2DFKB 3QTLA 2HL6A 2OCGA 3L4SO 3ADDA 3RVJA 2NACA 1J00A 1HMPA 2G0AA 1BXGB 3NVMB 3OZIA 4P7GA 4QU5A 3CLHA 1U2GA 1ISRA 1V0JA 4TN1A 5K3FA 3AY6A 1TQ8A 4BLOA 4KXMA 3C7AA 3W8EA 3ZU4A 1P44A 2J33A 3AHDA 3NC1C 3BMCB 1HC7A 4GU5A 5D5QA 3RIGA 1A7AA 1QH8B 2W5UA 3D4PA 3JQRA 2XNKA 3ECSA 2J31A 2Q8PA 1ODSA 2QQGA 3NAQA 1UBHS 4ASUA 5J63A 4MARA 3OLZA 1QB7A 1LPOA 2VDJA 1NXQA 1DTEA 1KVTA 3RYHB 4Z5XA 5KQMA 2IIVA 1JAZA 1UBKS 2ZI6A 3AY0A 1GU0A 4Q9HA 1LY1A 1Q20A 1X42A 3VDMA 1QB8A 2PNFA 3DH0A 4MIKA 3HU3A 3LKBA 4AG6A 4QEDA 1LA2A 2EEPA 4WGFA 1TKRA 4QYSA 1ZJZA 1O4VA 4R2LA 3WR5A 1PAUA 1XTSA 5EMHA 2ZXUA 1WD5A 1VGRA 2VT7A 3M4NA 4UNSA 1RAAA 1O0SA 1UXHA 4RXMA 4EMBA 2VO1A 1MO6A 4AM8A 5FLYA 2HN9A 4DR4B 4YEDA 3N7UA 1C8BA 5IVPA 5DGDA 5J1SB 1QH1B 3RF7A 5FBKA 3OLXA 5K4HA 5DNUA 3FUUA 2Q3DA 3H0EA 5IBQA 4IYJA 3UGQA 4XB2A 1PTKA 4B6OA 5K0FA 3D1VA 2QD1A 1AQIA 1TO6A 5AJZA 2EX1A 2AOTB 2B69A 2IZ0A 1UMCA 2H0AA 3ECCA 3M4ZA 1VLLA 5LIRA 2J32A 2YHBA 4IDHA 4CT0A 5GWXA 1VFPA 5JO0A 3PD0A 1C1XA 1O6FA 4N82A 3SP1A 3CT6A 2VEOA 3PDJA 1N57A 5G0UA 1WZNA 3OZDA 4B35A 4CLOB 4MI9A 3FGNA 3CB4A 1YS4A 3QBTA 4U00A 2ZUDA 2QUJA 3HSSA 4BQOA 5LZ9A 2JJQA 3P9RA 2NVUB 2UAGA 5ALXA 1IUNA 3HCNA 4B8ZA 3LECA 3FB1A 2H0QA 3OJEA 4LFBB 4ZZ0A 1GNPA 3AM1A 5JYDA 2BMFA 3UJ9A 4UOQA 2AFHE 1DEKA 4DYHA 3RHFA 2ZZMA 1MLDA 2CVHA 5AO9A 1WKVA 4Y7CA 1U8UA 3D54D 3NIWA 4KWHA 4WOKA 4ZU1X 2ZB4A 4KRXA 8ABPA 3UANA 2A78A 3M6MD 4L0CA 5LU9A 3BIJA 2WIKA 5HVNA 1YOVB 1U2DC 1TJPB 1C0PA 3MWDB 3O5AA 2CDRA 4IMPA 3I28A 4IOLA 4O4LF 5CA0A 4BN5A 3MTQA 3PXXA 4WLNA 3IUMA 1XZPA 4KN5A 5KYGA 4RZXA 1W0JD 1TZBA 2PR2A 4CMBA 4CKZA 3VR4A 3UMFA 3GJRA 1FDWA 3I64A 1YJQA 4Y8VA 1SKQA 5CT9A 4BZZA 1E7SA 4QUJA 1NNUA 2A94A 4IVNA 5GONB 3R8XA 4X1KB 5LM3A 1U0TA 1QMPA 2UV8A 5CD1A 4ZV7A 2XYVA 4CT4B 1IHOA 3LDAA 3D3QA 1MAUA 3MJRA 4YN3A 3REGA 1RHKA 4L4UA 1PNRA 3L0BA 3N39C 3WAGA 4LOHA 3KZKA 1IVSA 2IWHA 1P2TA 4I55F 4URHA 4W4TA 5JDCA 1JXAA 1ZM7A 1G8SA 1LBEA 1SHUX 3OWOA 4P53A 1QANA 4IILA 4PGGA 4IZHA 5EG5A 2ZBGA 1JQ3A 2HQSA 3ON5A 1QIIA 1DKOA 1Q12A 3T3IA 2VDLB 4OJKA 4DA7A 3R7LA 2HR1A 3M49A 1VBNA 3KQVA 1GYRA 4DFDA 1C2TA 1YR7A 3I62A 4EHBA 2BMAA 3A10A 5C7LO 3OM9A 4B75A 1U8XX 1KOFA 2ERXA 4FUQA 4IV0A 4RELA 2QQ0A 1PGOA 2GO7A 1L5LA 1XX6A 4EO9A 5CW2A 5KINB 4U02A 1RBQA 1ZH6A 3OF5A 1N1EA 4QWMA 4DQDA 2K7ZA 5FL7D 4DIEA 2E2WA 4EJSA 1RJ9B 1T4MA 3B3FA 3CUTA 4Z3OA 3LQRA 3ONFA 4BGDA 4ZKDA 1RC8A 5K8TA 2F7SA 3A1WA 5EWMB 2ZAMA 1S7GA 1F0PA 1TM1E 2V1XA 1A82A 4MVJM 4BVFA 1KI4A 2A9JA 4OSPA 3KQPA 4E5VA 5LZ4A 2WD7B 4GW3A 1YDHA 2ABWA 4J0EA 3SHFA 4KRFA 4JUBA 4CUJA 3MJDA 1H3NA 4R1PA 5KQRA 1IM8A 4X95A 1QYWA 3QQPA 4RSGA 1JIQA 1EZZA 5M7EA 3KEOA 3SF8A 1PZHA 4JT8A 1Y3FE 3EIQA 1NXOA 1U8ZA 1BOFA 3RUEA 2FQYA 5FA6A 1RHUA 4KE9A 1K0UA 1GPYA 1X1QA 2WUDA 4WDQA 2JGIA 1FDOA 3WMWA 4O59O 3GRVA 5H9VA 3TTTA 4H1HA 4J0QA 1S3GA 4NAVA 3FCSB 3SC4A 2O4CA 4HO1X 3JRNA 4R1UA 4B6SA 2FB9A 2ZYRA 1ZX1A 4AIRA 1MDBA 1PJ3A 1ZN9A 2ZWOA 5CVEA 2CHGA 4EKEA 3UN1A 3K6SB 2AX3A 4MWDA 3TLCA 2R2GA 4BV3A 2YVAA 2ZSIA 1F3OA 3DBVO 4B4VA 2GHQA 1OA1A 2C31A 3BIWA 3BWBA 1HX7A 4MKGA 5EZYF 3PEFA 1ZP6A 2LDBA 4FHFA 3T41A 2FH5B 3MN1A 4H17A 3VO9A 2EFGA 1QKKA 1EJ6A 2DUWA 3DDOA 4M1YA 4RADA 3EYAA 2P3OA 3ZV7A 3WL7A 1KEPA 1JW9B 1TTPB 2A5FA 2WM3A 2YJGA 3CX6A 3GPDG 4YRJA 1M6VB 3F8TA 5E8RA 4MW1A 3A4LA 2Z8YM 3WDMA 3BCSA 1SCUB 1ZRMA 3H5NA 3FOCA 4PW0A 2ZU0C 2F1KA 1ESDA 3GNSA 4WT7A 1BE1A 3U3RA 1NPYA 2QSJA 2PL1A 2GDJA 1KVQA 3CE6A 3DE1X 1PT9A 5T6MA 2XDWA 4F2DA 5AVVA 3RVKA 3MPUA 4Y2VA 3FJ1A 4XQEA 2HU7A 4KI0A 1JIKA 4NV0A 3BK2A 4KQJA 4LY3A 4A5SA 3KSRA 3QNMA 3DMDA 1PQ4A 4LK3A 5BUCA 3L3BA 2FQQA 2F8MA 2ZWMA 1KFKB 2G4LA 3PB3A 4CCSA 3G3EA 3COJA 2ACVA 1M66A 2Q07A 4DNOA 4F5DA 5GONA 4Y2QA 3MWLA 4RSHA 4J4BA 4RY9A 2IX3A 1N6RA 4IFTA 4CM9D 1YU9A 4H0FA 4C2BA 3O6VA 2Q4EA 3ZNOA 1CHNA 3GELA 3H1FA 2X9LA 4PF1A 3RUPA 4UTOA 3RU2A 4Q93A 1LCIA 3CBGA 2FZ5A 2N3ZA 1TQ2A 2X7JA 3GRKA 1DARA 1P3DA 2C2ZA 3K15A 3MLEA 4N3BA 1YONA 3NDIA 2VUTA 5A62A 2IYQA 4MAAA 2WJGA 5BNIA 1GVHA 3KJHA 4C5BA 5EMKA 3FDJA 4PWYA 2FEKA 2A5DA 2Z9DA 2ZWVA 4M9CA 2KMLA 4KNVA 4EX7A 1RYFA 2ZBQA 3GT3A 221PA 3L6EA 4KNWA 2X2EA 2AZTA 1CQXA 3FGPA 5HKLA 3GLFA 3ETEA 1G8PA 5L9AA 3JW8A 4C87A 1A9OA 3EEBA 1Z22A 2XNHA 3B5JA 1NN1A 3IC5A 3O92A 4XOIA 1GN8A 1JFVA 5TGTA 4INPA 1RRPA 2OZKA 2WZQA 2YIDA 3O26A 3S0JA 1WMFA 1Y5IA 2OV1A 3QXJA 4LJ7A 2VQSA 1X74A 2XZTA 2RIPA 3FM9A 2I76A 5GVRA 3VXKA 4YV1A 2DPGA 1RHQA 3KHSA 2NO4A 4F85A 2CE2X 3RRFA 4UASA 3DT6A 2GCNA 2IUEA 4CF5A 2XTAA 3BK1A 4RO0A 2IXEA 4DIMA 4WPGA 5K8LA 3ZBTA 3AONB 3UMGA 1JJFA 3FCAA 3JQPA 4IDDA 3FMGA 4R1LA 1E8MA 1WM1A 3W78A 4LF4B 3LPLA 1EP2B 4Q3DA 4IOKA 4MS1B 2LV8A 1H2EA 1RT9A 3ICOA 1X77A 4CIYA 5AVRA 3LK7A 1Z6TA 5DTRA 2O8DB 2ZPAA 3ROQA 2Q1XA 3IQHX 3S40A 4WESB 4JB2A 5JCJD 2VBGA 3KTFA 3WBJA 5DN6D 5EJ2A 2XB6A 1C3LA 5D85A 3LQ1A 2MJLA 2O9JA 5LZ5A 4B3CA 4AZSA 3VJRA 1GTG1 4TLCA 3CW2A 3HG7A 4I46A 4M0CA 2CJPA 2B8JA 2V3WA 2W6JD 4FOOA 4H4EA 4IIJF 4NJMA 3HJGA 4O4HF 4NY1A 4XD7A 2L19A 4NPHA 2YFQA 2HZBA 2HSEA 2NXJA 4FC7A 4YPFA 2FFJA 1RAEA 2GWRA 3MS7A 1RAGA 3CZ4A 2HQOA 4ZWNA 3T5TA 2GBIA 1S9HA 5CDFA 3TMYA 4AROA 1NZJA 3JAKA 4P84A 4UNQA 3SKYA 2HIHA 3GZNB 4F5YA 4RK6A 5DNWA 3II6X 1E20A 1XZGA 4MRRA 4OFBA 4W1PA 2FTKE 5FNVB 1UAAA 2EOAA 1NJSA 3OI7A 1CG6A 4JMPA 4QKQA 5AWFC 2BI8A 4DQXA 3R7WB 5EEHA 2HPAA 4IMRA 1RKUA 3HR8A 4AD8A 3CVVA 3TTWA 4AJLA 1XQYA 2I6FA 3CGGA 1E5QA 4TVBA 1FJHA 1FYDA 2ZIWB 4E14A 1YJ8A 2KE5A 2WIDA 3R5XA 5BRAA 1PR3A 4ZOLF 2RH8A 2KQUA 1YNOA 1SBZA 5JCXA 3MAJA 4R0VA 5IUJC 1V8PA 1A7JA 3H8WA 4U9UA 3FPJA 2R00C 4MVJF 4TLAA 3SJ7A 2IHTA 4BKPA 5CFOA 2WIGA 4EHAA 3O3MB 1N1DA 1QTIA 2JGKA 1P91A 1NRIA 2RCNA 1M7GA 1SMKA 2IXDA 1EX7A 5DTIA 1J4AA 1N7IA 4JXJA 5LOVB 1DDGA 1OX4B 4HZUA 4M49A 1AHNA 2ID7A 2CBZA 2NNWB 4JOBA 3V6MA 2QXUA 2XT6A 2R8ZA 1GRVA 1QBGA 3NM5A 4NV1A 3TXXA 3K9FC 1L6RA 2A3NA 1UBCA 1FEZA 1Q7CA 3I6YA 3QKWA 2HA6A 3VHXA 4JC0A 4D99A 2V7QA 3DBHA 2PX0A 1M34A 4GC9A 5C18A 4HP8A 2ZTLA 1NQOA 4NV3A 2CB0A 1TRKA 1SXJA 5JHHB 3E05A 4RTMA 1TTTA 3W1VA 4X6LA 2VSXA 4CEHB 2WLTA 3AVVA 3Q3EA 3I12A 5LZ8A 2FUG6 3JYPA 2IYNA 2CXXA 3DMTA 5AK4A 5GGXA 3BMNA 2BFBA 4Y2UA 2B2XA 1NIPA 1WHSA 1FJ2A 1EE2A 2OFXA 4B43A 1RQ2A 3QYAA 4U2DA 4XIGS 1EB8A 4NMWA 4JCOA 5JEDA 3U81A 4YR7A 3LLVA 1X80B 2FF5A 4OXRA 4LGYA 1Y9EA 4KPGA 3ANYB 4KIJA 3HV2A 3W7VA 3C5WP 2CZCA 3QWBA 1N7GA 5L45A 4ZEWA 3EZ9A 1SKUA 2C82A 5LQUA 1V8BA 3TTUA 3RC8A 4DGSA 1GG9A 3NRCA 2EJCA 4JYPA 4TZ6A 1DS6A 2BJVA 5I48A 3BWEA 3GRZA 1YDWA 2OZLA 1Y1RA 1IZ0A 3LVBA 5IK2A 3U09A 4F4UA 3P9YA 1W9MA 4JP2A 2EZ9A 3UAGA 1APBA 4ML3A 3GZJA 1T8TA 3SK0A 3H5TA 4KN6A 4KZKA 1A3CA 2HSDA 1KMCA 1CS4C 1N5DA 1JDUA 4DLVA 4WK6A 3NT4A 4Q9JA 4RCYA 4WASA 1GPNA 5DX1A 3Q85A 3GIDA 3ORQA 4CV3A 1ICIA 1NVDA 1CYEA 4L51A 2AC4A 1OZHA 2HLPA 3UT5B 3HA7A 3F71A 1T4CB 2O23A 3IR5A 3OHSX 3ORRA 3HMQA 3U80A 1R4MA 2FKNA 4OQZA 4NBNA 5LNK1 1IB0A 4ALNA 2O1SA 1NN0A 1WR8A 1Z16A 2ZIZA 4IICA 1XTKA 2Z5FA 4GX5A 3VI3B 1NJ2A 2B1GA 1KPGA 1MXFA 1P74A 1SAYA 2B3DA 4HGZA 4QSMA 3W90A 4BDTA 5IN4A 4RTPA 1WE2A 2I1LA 3L7BA 2WWWA 4XFDA 4DILA 4HL6A 1KRWA 3CYFA 4IFIA 1QO0D 1ONBA 2FEWB 1XMOB 4FHZA 5C7YA 1Z35A 4MW0A 2PUWA 1N2IA 1KQOA 3CUKA 1FFAA 1UQUA 4LBZA 3X1XA 2FPPA 1NAHA 4XJXA 4Z4EA 2FW7A 5AHWA 2YV2A 3QXSA 4E21A 5K8CA 3GPBA 3OY2A 1Z0DA 3OE5A 1XUOA 1JFLA 5DM4A 5GADl 2HJRA 5K99A 4FOSA 3BSFA 2E6KA 2RHGB 2YV4A 4ZQCB 5K51A 2JDID 1J21A 1A96A 2BDEA 3BBPA 3KFLA 4R8VA 1C3XA 2NZXA 3AGQA 4EEZA 1N5MA 2DHDA 4Q0MA 5EUCA 5BSRA 5DNEA 1XVAA 3TRFA 2ZTSA 4HX9A 1QHHA 1CK4A 4D80A 4YRKA 1CY1A 4OJNA 2VJPA 3IIEA 1ZK1A 2OUIA 5LXTF 5K9ZA 1QG2A 4JLVA 2BW0A 4DSOA 1JQKA 2RHBA 1YNSA 2ZI7A 2IHJA 4HKTA 3DOIA 2ZM6B 1GO2A 2XJ4A 3OG9A 1XJCA 1DXOA 4H3SA 4BU1A 1XAGA 4N6NA 3O8RA 5CVDA 2GJSA 2WT4A 3ETNA 1Y3IA 1HFWA 5H4HA 1E2DA 3UPUA 1A69A 3TOSA 1FFXA 2RGCA 5HKOA 1ZM4A 2C4NA 3T61A 1IOLA 5CYGA 3L1KA 3VHLB 4FCCA 1J8YF 1GGMA 3UCXA 4LXHA 1SBYA 1LK5A 4XM2A 1ADFA 2XRYA 3I04M 5DRYA 3GDOA 4TTTS 2HW8A 4W7SA 3RYFA 1H94A 2GKSA 2XYHA 4KWIA 2FFQA 4MYCA 3TQHA 1WDLA 3W5UA 1E94E 1P2DA 1YA6A 4UU7A 3GDGA 1LLQA 1U3TA 2BGMA 5LJLA 4K6MA 4P32A 1SA0A 1G42A 1OFTA 2QN1A 1TJ5A 4IIHA 5LP1A 4MGYR 4MQFA 1OU4A 1Y4UA 621PA 3PR3A 1TX4B 5E7MA 2VDNB 1GV0A 3IAAA 5B2ZA 3ZLBA 2CL6X 3KLOA 1SKMA 2OHIA 5J4VA 2XZLA 4D97A 4EA9A 2HXSA 2ZAIA 3DOUA 1Z2AA 1DAIA 2CJFA 3LY7A 5TV2A 1OWPA 1UBFA 3DYVA 3N0XA 3QVKA 4LSZA 2H4YA 2BFWA 3DBRB 3INRA 2YOFA 1AC5A 4WLFA 5CFRA 2ZJFA 2V7EA 3D7NA 4MEJA 2E55A 2PX5A 1FYXA 1JE1A 2V7PA 4JI2B 3T0GA 4BX3A 4JQSA 2IP4A 3R7WA 4AJ4A 5GQSA 5FJIA 3PA8A 1VYVA 5BWCA 4NECA 5DLDA 2OECA 3E9QA 5E6UA 1GGHA 5B7QA 1KR2A 4REMA 3B1WA 3PT9A 1HL7A 3IKTA 3LYUA 2XLBA 4TSFD 2VNAA 4U7FA 3O47A 3CWQA 4AAYA 4RD1A 2CXHA 2PH3A 3P5SA 4Q03A 4AICA 3I9V6 2VSFA 4FNOA 1ECCA 1J49A 3RFCA 2IS2A 4R8MA 1KSJA 2C57A 3IKJA 5IDXA 2I4TA 1L7EA 1ZD3A 4XDZA 4M36A 4JLAA 4N8DA 3JD2A 4J4HA 4MLDA 4DWJA 5EQFA 2IBSA 2ZJ7A 4HGNA 1BU5A 3DTVB 4C07A 2QXYA 2AE2A 2R68A 2V65A 4LGMA 6REQA 4RA9B 4KPUB 2O2YA 2K7FA 3HUUA 2YMLA 4JXKA 2BF7A 1VIDA 2OVBA 2V6MA 4FGLA 4GZLA 3S8MA 5KWEA 2FZWA 3TRDA 3U1TA 5F3WB 1N2CA 4C0KA 5KQLA 1Y1KE 2YQZA 4KK4A 1QR2A 2I2XB 3T1YB 3HRIA 2MIIA 4JJZA 4MS1A 3SJCA 4WJLA 1RE1A 1L5FA 3UEOA 1I0LA 1QQAA 4K0KB 2OG1A 2ONJA 3TSZA 3ZK8A 2Q4BA 3ZU6A 3KZ1E 3OD1A 2R7LA 3VSEA 1QF7A 4URZR 3RW9A 2HRBA 2ONZA 2Z2YA 1MNAA 2W42A 2CDNA 2GK3A 1P18A 2F1JA 3FI0A 1JXMA 4I9HA 4YHHB 4G5FA 1PT7A 2AR9A 3CLSD 3TE6A 2XX3A 1RXIA 1MRNA 2WU3A 5AM0A 2HPZA 3G7NA 5KHLB 3HTXA 2IPOA 2Q5OA 3AKYA 1U7OA 2OTCA 3BSYA 3SZUA 3LK6A 4JXXA 4R1NA 3AH8A 4B71A 1OLOA 1WB9A 3HJHA 2IV2X 4MQFB 2BYTA 3IALA 2A7QA 3B3JA 3NC0C 1LV8A 2D8AA 4TUYB 2QZZA 2OKCA 3W1WA 4FP9A 4GX2A 3KJEA 2NQ8A 1LSUA 2CCGA 1QHSA 3QEOA 2ZWIA 3QEMB 2ZBEA 4MVJA 3DAHA 3GXOA 2NUTA 2PK3A 3W77A 4FYIA 3IBFA 4RD3A 5F12A 2UUAB 3F97A 5FLEX 4FINA 5JQWA 4I6JA 2JGNA 3ZS9A 1DP4A 2IBTA 1TKCA 1FFXB 1RP1A 4AF6A 1D4OA 3BULA 4BFZA 1JXQA 1O8CA 2DR0A 2C99A 1V95A 4M89A 5ALEA 3T12A 4DMLA 2GASA 2XAAA 3E22A 3HY4A 1FXUA 4FMDB 4LXTA 2IYXA 4BEBA 3I9NA 5JFTA 5KVQA 2ZAOA 2I3AA 3I3SR 3QEKA 3H19A 5EZ6B 1I7QB 1F2TB 2PKYX 2HSGA 1E2EA 1ZVKA 4M55A 4ZVKA 1CPYA 2X4LA 1HDZA 4D9KA 5KNDD 5KNLA 3L84A 4L1KA 2AN4A 4AYTA 1DT5A 2ZBVA 3UJHA 4ZREA 3DL2A 3N87A 2HA7A 3IXQA 3LBYA 3REOA 2HO4A 3LP5A 4A8PA 1CUFA 1T2AA 3P9NA 4OI1A 3GGDA 1RZRA 4OP1A 1H4SA 2PFKA 4YAEA 1GPLA 5H9WA 3B82A 4U7JA 1RVDA 4LYHA 5B36A 3BDVA 3MTEA 3TE7A 3KSBC 2ZJ1A 2Z1MA 5KMGB 5BT9A 4E13A 3CMMA 4QDJA 4BX2A 2P2DA 3DGFC 4FUTA 3L9WA 1NXSA 4WN9B 1X0VA 4ZHQA 3C5HA 3T5AA 1LVHA 3GMSA 4KREA 3TIXB 4C7OB 1OI4A 5ADUS 5LKRA 5AUPB 3T5MA 2GARA 1JU3A 2YWJA 2SBTA 1T3TA 1EXVA 1T5IA 4Z0HO 2G07A 4DLYA 1EWQA 3KOMA 4B85A 3E18A 1N92A 5IM4A 2VHUA 1J2JA 4M38A 1OLSA 3LO8A 5I6DA 3TGLA 4AC9A 3F0TA 5JYEA 4CIWA 4G65A 4B82A 4CM8A 2I4IA 4WE3A 5SZIA 3HBFA 4Z3KA 1MAWA 1R6VA 1AURA 3QK7A 3H84A 2JJ2D 2P9GA 3PC8C 4OMUA 2HDWA 4R9NA 4YJGA 1N8TA 1TJNA 3CA8A 3L7LA 2PWAA 1BMDA 3AF2A 1T2NA 3C4VA 3E4CA 4DY6A 1TCVA 1GSHA 3CRNA 3DUFB 1J7JA 1UJ2A 3SR4A 4Y2XA 3ZN2A 5EPEA 3V4FA 5CDUA 1K7CA 2RGXA 2BOVA 4F1JA 3LLSA 4KVAA 2JEOA 7MDHA 5FUXA 1VP3A 2CBXA 5DU2A 1S2GA 1DOAA 1XK7A 4OGWA 3CHYA 4Z99A 1ACMA 4JDUA 3BWCA 4CE6A 2CB9A 3I39X 1CZOA 1X19A 2OFFA 3CLUC 3OA2A 4ZPXA 5CLQA 1Q0LA 3PX2A 3TBFA 1ZIXA 3EXG2 4FKZA 5DNCA 1X2BA 1XMPA 2VPXA 3QH4A 1SNYA 4BRWA 3AHJA 1DKPA 3LP8A 1BVUA 1RQPA 3FG9A 2EKDA 4TXMA 2JLAA 4B80A 4OB6A 1PSWA 3I9LA 5EQTA 3C3DA 1RI3A 1SHTX 4BN0A 3UJDA 3IQWA 3NTXA 3Q6NA 4FW8A 2AMVA 3R0XA 4ARVA 5IN5A 2FDRA 1HZZC 3HKBA 3QXHA 3AM5A 5IH7A 3S2YA 9LDTA 5MFZA 3TRIA 1SUCA 2WMYA 3LVQE 4PLHA 1RRKA 2WRZA 1LRJA 5T3YA 4AZWA 5A4JA 3U4MA 1LJ8A 1G8FA 2ZRBA 1I30A 4G1BA 4JUAA 3TMAA 5EWJA 1A04A 1S3IA 3UNXA 3V1LA 2HWUA 4MLZA 3RDPA 4QOGA 4D9JA 2D4AA 2WT9A 3CR8A 3FCOA 3TZQA 4FD3A 2V3VA 2P3QA 1R9GA 2LIPA 3WKBA 4Y6PA 3URMA 4DYDA 2BHSA 2HIMA 3UO8B 4D0SA 2R6CA 2BUAA 4G4JA 2WF7A 3X2EA 1HY3A 1SA0B 1N25A 3ER6A 4J0GA 1KWKA 1OJ7A 1KZYC 4RGBA 4BNJA 1I2BA 4K6OA 2FPRA 2GYYA 3DMGA 1B4DA 4K1LA 1S5PA 2BKAA 4KFTA 4UTPA 3SQXA 4UCXA 4M1OA 3CF4A 3Q7TA 3HB4X 3ZNQA 1TJ4A 2QGZA 3CN7A 3CNNA 4JBGA 4PV7A 4F0JA 2DSTA 5K0EA 4W5NA 1CR4A 4DCNA 3WWEA 1QH1A 3V4ZA 3V8BA 2NU7A 4NBUA 4ZA2A 1HLFA 4BOYA 3G8YA 1K4KA 1KK3A 4J2OA 2C7GA 1NWHA 1KSHA 2O3UA 3RVOA 2WHXA 3KZVA 3DVQX 4AY5A 3A37A 2Z1NA 2XWJI 2C9MA 2O52A 4D9IA 5JQGF 2ZCVA 1V41E 1ZMTA 5CA1F 5HS4A 1TD1A 2YJZA 1K9VF 4C4TA 2ZR0A 5DHQA 1CUIA 2R79A 3D8UA 3DXXA 2G1KA 3L0OA 1BX3A 4R3NA 3IDFA 5J5AA 2H08A 2FDXA 3V4PB 4IJ5A 3EJ6A 3OVMA 4CL2A 4P0QB 2BKEA 2ISCA 3PPIA 1L4FA 1M72A 3FYCA 2KLBA 1GP2A 1NVBA 3TH5A 1U2ZA 2MR5A 2R5NA 1F38A 1T6XA 3GDWA 4GUAA 1IZYA 4QDTA 1E9BA 3E8SA 3NBFA 1S2IA 3BHNA 3KSUA 4LRQA 4M0DA 1LQTA 3EPRA 4QOFA 3HVHA 3OPYA 3ROTA 2C3PA 3EK2A 4RHCA 3TCXB 1QH8A 4DE5A 1UJCA 3D2CA 5ER9A 5JCOC