4X94A

Crystal structure of lysosomal phospholipase a2 crystallized in the presence of methyl arachidonyl fluorophosphonate (hexagonal form)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
376
structure length
376
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Group XV phospholipase A2
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 130
structure length 376
sequence length 376
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x94A01
4DMKA 3Q8WA 3WA7A 4AN0A 2BUAA 2RIPA 2WTMA 1HL7A 3O4HA 4I4CA 4Q3KA 4Y2QA 3G0GA 1R9NA 2PUHA 1J2EA 3WWPA 2ZJ6A 3OG9A 3PI6A 4Q3OA 1ZGBA 3R3WA 1XZDA 4CCYA 2HU7A 1U4NA 1FFCA 4V2IA 4INZA 2C4HA 2I3ZA 4H77A 3JWEA 3K2IA 4ZWNA 4WJLA 4X97A 3D3NA 5J3JA 1BU8A 2Q0XA 4PO3X 1HPLA 4HXFB 1J1IA 1UXOA 1ZD4A 3IB3A 1VZ3A 4MEBA 3DEAA 5K3EA 2HA4A 3G0IA 3OPMA 4P9NA 2WHPB 4FTWA 5LZ2A 4HRYA 5DTIA 5E2IA 5EFZA 4KAJA 4DMCA 5FP0A 2JGEA 4CCYB 3WMRA 2ZSIA 1VA4A 3QPAA 1A8UA 2V9ZA 4EY6A 2G4LA 1QE3A 3WKBA 2ZJ7A 1E66A 3N2ZB 1XZJA 3O95A 4B84A 2WSLA 3UUEA 5ALVA 5ALHA 1DT3A 5AOCA 1LGYA 1ZIYA 4J03A 2YH2A 3R3VA 3FCXA 3STUA 4U2EA 1AUOA 1AURA 5ALYA 3D0KA 2QR5A 4BRSA 5IVKA 4LKOA 2QZPA 1FFBA 1THTA 3L1HA 4U2CA 4DMHA 1GGVA 2VT6A 3ANSA 4CIBA 4BAGA 3DNMA 2ECFA 5FPPA 3VJMA 2WUFA 4J7AA 5FXMA 3PFBA 5C8XA 1AGYA 1YB6A 4PV7A 1QIHA 5K3CA 4NMWA 2ORYA 2HRRA 1EI9A 3KDAA 3PUHA 4H7FA 5AM4A 2RGUA 5HFNA 1GKKA 4FMPA 4UBLA 4PQEA 1NU6A 2QMQA 5KBYA 1NX9A 2HA2A 1AMNA 3STYA 5AM5A 4FKBA 4C87A 4W1RA 5LZ9A 4G8DA 1JJIA 2XQKA 1IZ8A 3I1YA 4XIIA 4FOLA 3GROA 4PNZA 5FLKA 2CUTA 5EHQA 4BC1A 1U2EA 1ZI6A 5JAOA 1KU0A 3W9UA 3WWOA 4D9JA 3WWCA 1G42A 1EB8A 5D6OA 1WM1A 3OURA 1TRHA 1XRRA 1R1DA 3I2JA 1MX5A 5HF6A 4BTVA 1R50A 3ZLUA 1SOMA 4B81A 4J0IA 5CT5A 2CMFA 4HRXA 2VJDA 5AM3A 3X3HA 2HA6A 2WIKA 5JD5A 1MAHA 2K2QB 1LPBB 1MT3A 4LHEA 4FLEA 5JAUA 3O4IA 4GECA 1MO2A 1QZ3A 3ESAA 4ZGBA 3V9AA 2XI4A 5FOQA 4AZ0A 3E3AA 3C87A 4KEAA 1ZI8A 2C5GA 1BN6A 4QDUA 4DNPA 3WK6A 3RARA 2AJBA 5ALRA 2HFKA 2C0QA 2J4CA 1EB9A 3F97A 2IITA 4X91A 1YA8A 3F9CA 1C4XA 3LS2A 3PUIA 1XZEA 5ALXA 1XRQA 2BJHA 3SC2A 2Z3ZA 3H2JA 3PFCA 5EHXA 5I8PA 1ORWA 2P8SA 2ACEA 1LPSA 2VAXA 5JAPA 1GQSA 2WIDA 5ALUA 4N8EA 4PSUA 4OB8A 1H2YA 1L7QA 2G63A 2XQJA 4LYEA 2EDAA 4UHHA 4C4YA 1CUSA 3NGMA 1QGED 4UHFA 5ALNA 4MWSA 2BCEA 1IUNA 4LIPD 2ZYSA 1XRMA 3WQHA 4C88A 4AQDA 3O9MA 4HTAA 2AJ8A 1FFAA 4X7BA 4JYPA 1HLGA 1GPNA 1EDDA 2ZYRA 3EQ9A 3CCCA 2V98A 2QT9A 1R3DA 3GZJA 1BEZA 1N5RA 2FJPA 1DQZA 3FVTA 1JU4A 3WL5A 2XQIA 3LIIA 2WLSA 1O6GA 5K3BA 3VJKA 5AI4A 1QIIA 3C5VA 3RLIA 2JEZA 3AIOA 4Q1VA 1G66A 4FFWA 3FLAA 1C7IA 2JGFA 4NZZA 5T4FA 3W2TA 1XLVA 3GUUA 4BBZA 4FWBA 3EQ8A 3KOOA 3QBJA 1VZ2A 3EIOA 4A16A 2DHEA 2Y1KA 2B9VA 3WKAA 4E15A 2WUEA 1XZGA 3C8HA 2BUBA 3CCBA 1F0PA 3G0DA 4KAFA 5ALWA 3P2MA 5LYYA 4AMZA 3CXUA 2GZRA 2PBLA 1K5PA 3KWFA 4B6GA 1CUXA 3A2LA 1BS9A 4ZXFA 1WOMA 5ESRA 1W52X 2PX6A 4CFSA 4S0XA 3H18A 2WQZA 4LYDA 3DYVA 2VEOA 1JFRA 1ORVA 1HKHA 4M0MA 2XUDA 1WB4A 1XZCA 4XX1A 1AZWA 4K2AA 3HSSA 1B6GA 4JUIA 4A23A 3FOBA 2Z3WA 4ZI5A 2XLBA 3C6YA 2WKWA 3YASA 1N8SA 4Y9SA 4KAAA 2X5XA 2O2IA 3R41A 3OTQA 3HACA 2DFPA 5CT4A 5JZSA 4G1FA 4X3CA 4KRXA 4Q34A 3MGAA 3WK5A 1PJAA 2D5LA 3AIMA 5EI5A 2WFLA 1WCYA 4G8BA 4BE9A 1CUGA 5CBKA 1EVQA 4OYLA 1P0MA 4PSDA 5D3ZA 3F96A 3GFFA 3EF3A 4ZRDA 1ODTC 4WDRA 2HA3A 5IKXA 1CUVA 2PKYX 3GELA 3RKSA 3M3DA 1D07A 1MU0A 3IUQA 4FBLA 3IULA 5AK6A 3W9BA 4GEGA 2JGIA 2PVSA 1Y37A 4E11A 3IURA 3RM3A 2O7RA 3RK4A 3CN9A 2WJ3A 1ZJ4A 3FYUB 5IH7A 2WFLB 2I78A 5K5EA 5LZ4A 4BP9A 3WZMA 1VLQA 3OC0A 4GI1A 1PV1A 2VQ6A 5AKZA 3C5WP 4AO7A 5ALJA 3FCYA 1AC5A 2HIHA 4FLFA 5LKRA 1CUDA 3I2IA 1DX4A 4W63A 4M0EA 5A7GA 4L0CA 3H19A 4H7HA 3C70A 3HI4A 5KWJA 2BGNA 1CUZA 4CG2A 1F6WA 4BRZA 1BEEA 1R9MA 1UK6A 3WIBA 2W22A 4ZV9A 3FAKA 4G4JA 1CUAA 5AKLA 5AKHA 1M33A 1MTZA 5DLPA 5KREA 4G8CA 1JJFA 4RGYA 3STWA 4JH0A 2J3DA 4OB7A 2XE4A 3WK7A 4OSEA 4BATA 5AO9A 1CUIA 1LZKA 1UK7A 3I28A 3BJMA 4X6YA 5CT9A 3V1LA 1CUFA 1DWQA 1JI3A 3D59A 3DS8A 3DD5A 5EHNA 3W05A 1BN7A 4N8SA 4OYYA 1HQDA 2FJ0A 4L9AA 4UPDA 2ZJFA 5AKYA 5SYMA 3H2KA 2HU8A 2JBWA 2IIVA 5AI6A 2VA9A 4C89A 2WHPA 4H35A 3G02A 4HVTA 1CRLA 1IUOA 2DHDA 4KYVA 3HZOA 5AH0A 4MYDA 3TGLA 5JD4A 3T4UA 2XLCA 4UBNA 2X8BA 3ESDA 5AM2A 1GZ7A 1QOZA 1ACLA 5AKKA 3VKFA 4E14A 1O6FA 4FNMA 1UFOA 4Q82A 4FFVA 1G4HA 4HZGA 2JF0A 1TCBA 4UBMA 3IIIA 2DSNA 2PUJA 3MUOA 1CUYA 4TGLA 1ODCA 1Q83A 4BYMA 4X90A 3R3YA 1UT6A 3R40A 4FBMA 1CUHA 4GXNA 4BCDA 4MEAA 1XFDA 1KEZA 1DWPA 5AJHA 1MAAA 2QJRA 3TRDA 4WCVA 2OGTA 2E3JA 5CH3A 2ZSHA 4DNOA 5AP9A 1UWCA 2AJLI 3V48A 5AK4A 2FX5A 5JATA 2Y2VA 2XUGA 5YASA 3F8SA 1WHSA 2QTBA 3ZV7A 3FBWA 4B82A 3O4GA 2HA7A 2ONCA 1B41A 1XLWA 1XROA 4J3JA 5ALIA 3BDIA 4BDSA 3EBLA 1L7RA 2WM2A 2ACKA 2HL6A 2RAUA 3H1AA 3DL4A 2ZVDA 1VE7A 2VJBA 4UUQA 1DTEA 1BRTA 2B4KA 2GYVA 1E8DA 1ODSA 3QITA 4Y2PA 5BOVA 2QJWA 4KR0A 4PF1A 3D5EA 4DSAA 4W1PA 4H0CA 4J0JA 4K6HA 2AJCA 1JKMA 1BROA 1H2WA 3PICA 4IO0A 5LIPA 4C4ZA 3DOHA 3WYDA 4DNFA 4X71A 5E4JA 4N5IX 4DSZA 1YCDA 1EHYA 4A5SA 3FSGA 5E4YA 1R4ZA 1X2BA 4UHBA 5CH5A 2CJPA 3WLAA 3A6ZA 4I19A 2Y6UA 2W6CX 2J3QA 1GXSA 1KU6A 1JMYA 3BWXA 1VXRA 2JGJA 1UOPA 4ZV7A 2VTVA 4CCWA 2WG2A 4RNCA 3QMMA 5HFAA 1RP1A 2V96A 3H0CA 3ZLVA 5K3FA 5EGNA 5A7FA 4OD0A 4UBOA 3ZPXA 1P0PA 4M0FA 1W6RA 3HYSA 5DNUA 2OAEA 1Y7IA 1OXMA 2RHTA 2XUHA 4AX4A 3HXKA 2XUFA 3JW8A 1TK3A 2UZ0A 1XZKA 1LPPA 3VJLA 3I6YA 4KJXA 1YAHA 2QOEA 2HA5A 4OPMA 1N5MA 3I6MA 2BUCA 2O2GA 4Y2SA 5AKIA 2AJDA 2PSJA 4QE3A 3VVLA 1N1MA 3G9UA 4AN1A 4IHAA 2GBIA 1ZI9A 3G8YA 4WFJA 5K3FB 5AKJA 3D2CA 4IH4A 4U2FA 1RYYA 1CUJA 3QMWA 2R8BA 4QDXA 2WTNA 3U0VA 4UBJA 5C8ZA 1TQHA 4E46A 1H2XA 2WG0A 5FRDA 4B0OA 4QLAA 3B12A 3WL6A 2HDWA 4W1SA 3ICWA 5AI8A 4J0KA 1QTRA 3R0VA 3F67A 4QDZA 3DCNA 3LLCA 3W06A 4G5XA 1XQWA 3AZPA 3OM8A 5JZ9A 2CEKA 2GZSA 3C8DA 4OB6A 4W9RA 1FJ2A 5T4EA 2WIGA 2H7CA 3O0DA 1J07A 4EB0A 5JARA 4HXEB 1UKAA 4P08A 3QH4A 5HKBA 1XKTA 2OCKA 1WPXA 2C5FA 1Y7HA 3D4LA 3H2HA 1DWOA 2H1IA 1UOQA 2JGMA 1QIDA 4EBBA 5LLSA 4IH9A 1LLFA 2Z8XA 1IUPA 5DJ5A 3IA2A 5AI9A 3N0TA 1LBTA 2BFNA 2V97A 5AICA 4WY8A 5LKAA 1F0NA 4NS4A 5I7UA 1XRPA 2R11A 1SFRA 5LZ5A 5AIBA 4MXDA 4Y2RA 4BCCA 2QKYA 1P0IA 4NVRA 4WFKA 1ZJ5A 3I1IA 3TJMA 5IVDA 4Y2JA 1DT5A 3I2FA 1CUWA 1EH5A 4B7ZA 2JGKA 1QFSA 3VISA 4AO6A 4KRYA 3KSRA 5AIAA 1Z68A 4BB0A 3S8YA 2FUKA 3H17A 4HAIA 5BWCA 3DL7A 2JIDA 1XQYA 4C01A 4DTCA 2QXUA 1BE0A 4UBKA 4F5ZA 2ROQA 3NOXA 4PW0A 4AZ3A 4BVJA 1XZAA 1EA5A 2GBGA 4W1QA 3M81A 3STVA 5K3DA 3HLKA 1CLEA 4UHEA 3C6BA 4X94A 3Q0TA 3H2GA 1YB7A 5C8VA 3BIXA 3C43A 2HM7A 1E89A 4X95A 1XRNA 3DQZA 2WUGA 1SCKA 2QXTA 2ZYIA 5K3AA 4MQMA 4UHDA 5KWIA 2BKLA 4QWWA 2DQYA 2J4FA 1LBSA 2X76A 3ED1A 3S2ZA 4MYSA 4B85A 2VT7A 5C7YA 3BE8A 4K5QA 5F4ZA 2OCGA 1GPLA 2PSFA 3DYIA 1TKRA 2Z5GA 5CXUA 1W75A 3WK9A 2QM0A 3FYUA 1LZLA 4BDTA 5HKAA 3AFIA 3ESCA 2XUJA 1MNAA 2QUBA 3DLTA 1CV2A 2XUKA 1VA5A 1ZD2P 4FHZA 4QA9A 5A71A 4F0JA 2GBCA 4FNGA 3BF7A 3L1JA 2IX9A 4J0CA 5BV7A 3V1KA 2BGRA 4OUKX 5ALFA 3WWEA 3AZQA 5JANA 2PSHA 1P0QA 3GBSA 4YASA 2I03A 4MQLA 5JASA 2VATA 4DM7A 3LCRA 2LIPA 3B5EA 1CQZA 3NWOA 3FYTA 2O2HA 4BZZA 1JT2A 1PFQA 2WFZA 1EINA 1E8MA 2OG1A 5EIAA 5CH8A 5ALLA 4IQ4A 1EK2A 1HBJA 2WFMA 4CIAA 3B3QA 3WKCA 3A70A 5A62A 5JZBA 3R3UA 1MX1A 2OPHA 5HK8A 3E4DA 4DGQA 5CT6A 3TEJA 2G5PA 1CUUA 3C45A 1AKNA 2Y6VA 3V1NA 1WB5A 3ZI7A 4Y2TA 1Q0RA 1J06A 4CG3A 4RPCA 4KE6A 4EZIA 5ALKA 3PF8A 3UUFA 6YASA 5JD6A 1T4MA 2XMQA 3I2HA 1YS2X 1YA4A 3WL8A 3IBTA 3BL8A 3WZLA 2VJAA 4BZWA 4XWGA 1H2ZA 3E1GA 4JYMA 2HFJA 3AILA 1EVEA 5LZ7A 5HF8A 3I6ZA 4GWLA 1XLUA 2D0DA 4YK7A 4QZVA 3DKRA 1QIFA 1CIJA 1LNSA 5HF9A 2XB6A 1OILA 1QIKA 1WPRA 4FLMA 5ALOA 2ZYHA 3ESBA 3UMJA 3A2NA 4TPKA 3ZWQA 4J0GA 2OCLA 1XZFA 3QZUA 3H2IA 4EY5A 2CBGA 1UKBA 1QIJA 4DNQA 3WKDA 3O9VA 5AKEA 4EA6A 4EY7A 3FNBA 2XMSA 1XKLA 4H7JA 2XT0A 1X2EA 2PL5A 3WK4A 1QIMA 5ALDA 1IVYA 3VVMA 2B20A 2GBFA 4Q3LA 1AQLA 3D2AA 1CUBA 3I2GA 2OXEA 5D7BA 4HXGA 1XZIA 3KXPA 4F21A 1CEXA 1EXWA 4I3FA 3GA7A 1X70A 2WJ4A 2OQIA 1QO7A 4UFOA 5FUMA 2B61A 1ISPA 5AM0A 5DYYA 3H1BA 2I3DA 2ES4A 5FDFA 1XQXA 4AB1A 2CZQA 2PPLA 1A7UA 5CXXA 1VOTA 4BP8A 1ZD3A 5T4HA 4EUSA 4P93A 2VJCA 1EDBA 4UHCA 3LIPA 5LZ8A 5A7HA 1QTIA 2XQGA 5AI0A 5DTJA 4Y2VA 5AOBA 1DX6A 3WI7A 3OOSA 4B80A 5EHZA 2VF2A 3L1IA 1XZLA 1TAHA 1SCIA 4GLBA 3AUKA 1XQVA 4C6HA 1JJBA 5C81A 2HADA 2DCMA 1TIBA 1VKHA 1E8NA 3ZLTA 2H7YA 5JALA 2G5TA 1ETHA 3AZOA 5DNVA 1LPAB 1YS1X 3DJYA 4KE9A 1IMJA 4MWTA 5HF5A 5D3KA 4GHWA 4N5HX 3G0BA 2EEPA 3HRHA 3DOIA 1GQRA 4G4GA 2WIFA 1XZBA 2PU5A 3R3ZA 1E3QA 1VE6A 2RHWA 1HDEA 4ITVA 5CRIA 4BAUA 3V1MA 2Z8ZA 3WKEA 1YSCA 4H18A 2WIJA 1K6EA 5EIEA 3FVRA 5HZGA 4IH1A 1QLWA 2PU7A 5A6VA 2WHQA 5AOAA 3AJAA 1YAJA 4X85A 5CMLA 2XMZA 2WHRA 5ALPA 5ALZA 1ZGCA 2OGZA 4AXBA 4YPVA 2CKMA 2CB9A 2XMCA 5CURA 3T52A 4XVCA 1Q0ZA 4L72A 4BVLA 4C4XA 2WU4A 5CTAA 1I6WA 1H23A 3WJ2A 4G9EA 3FLEA 5CW2A 3PE6A 2O7VA 2YXPX 4KE7A 5HCUA 4B83A 2XDWA 4CI9A 5JADA 1VJ5A 5JIBA 1MNQA 4HS9A 4GBGA 4Q05A 3BXPA 4BE4A 1TCCA 5IVIA 3ANTA 4DYHA 4BCBA 3K9BA 3IDAA 5T4BA 1LPMA 3WYNA 4L3WA 1AX9A 2XMDA 5EIHA 4DMFA 3H04A 1T2NA 2XUIA 1ZICA 2OAGA 2C58A 4QDOA 4K6KA 3MUNA 5JAHA 1ZOIA 2WUDA 2JGLA 3IUMA 1TCAA 1EX9A 1A88A 1ACJA 1USWA 1LPNA 4WY5A 2HRQA 1MN6A 5DWDA 1EDEA 1MJ5A 5ALGA 2PM8A 4U2GA 2RONA 1ZIXA 3QMVA 4X00A 7YASA 1QJ4A 2DR0A 3O4JA 1A8QA 4ETWA 3R3XA 5FKJA 1LPOA 4QWMA 4AO8A 5ALEA 4ROTA 4FDMA 5HK9A 4OCZA 3WJ1A 4X6XA 1W76A 2C0PA 5BWBA 2YYSA 4H7KA 2C7BA 2OQVA 2QRUA 4B9EA 3PF9A 5AM1A 1BCSA 1XRLA 4DIUA 4P92A 3HABA 4ARAA 3BIWA 4LXIA 2VSQA 5CT8A 1DU4A 3HEAA 3M82A 4GW3A 1EK1A 3FWHA 1XZHA 2XUAA 2YASA 1VXOA 1UZAA 3WK8A 2GYUA 1QIGA 1ZD5A 3STTA 3ILSA 3G0CA 3KD2A 4J0DA 4GDMA 3PDCA 5SYNA 1F8UA 4Y2XA 3BJRA 3KWJA 4H7IA 3A2MA 1SCQA 1CVLA 1R88A 1MPXA 2XUPA 5A2GA 3HJUA 4H7EA 2DHCA 5LP1A 5ALSA 2OCIA 4KE8A 1FFEA 5FV4A 1DQYA 2QS9A 3CN7A 4JEIA 1FSSA 3VXKA 4G9GA 1YASA 4X93A 2HU5A 3IUNA 3F98A 5HQ3A 3ICVA 1GKLA 3BF8A 4H7DA 1G5FA 2OLEA 3QM1A 1CQWA 1MX9A 4B9AA 1W1IA 1K63A 4UBIA 3WA6A 5DYWA 2RI6A 2Y2UA 5ALTA 3AIKA 2JEYA 3MVEA 2GYWA 4Y2YA 5I9IA 1BCRA 5JYCA 4WFIA 2XMGA 2HA0A 4CG1A 2NW6A 5DNWA 1U8EA 4UFPA 5IVHA 4XJVA 4DLNA 3WWDA 1FFDA 3D2BA 1A8SA 2PSEA 4K6GA 3DKKA 3NUZA 4EY4A 1OCEA 4YX9A 5ALMA 4RE5A 2VAVA 1U65A 3K6KA 5HQ3B 4G4IA 5FPQA 4MJ3A 2HHAA 1QONA 4Y7DA 3FYUC 4EHBA 1C7JA 4OU4A 5AI5A 1QIEA 1K8QA 1W4LA 2OGSA 3AINA 2DQZA 3SWWA 3IVMA 1CUCA 2WILA 4F60A 5E4TA 1E5TA 2XQFA 3HC7A 1THGA 1WHTA 4AMYA 1JMKC 4J0HA 1Q84A 2QUAA 4QDTA 4WDQA 3SX4A 3G9XA 5AK5A 3WL7A 3IUJA 3QPCA 4JNCA 1CFJA 1UKCA 2XMBA 1CR6A 4X92A 1CUEA 4QNNA 3QPDA 4OU5A 4ZREA 1GPKA 1XZMA 3FSGD 1WB6A 4LXGA 4EY8A 2XMRA 3M83A 2EDCA 5DYTA 3I2KA 3E0XA 4UFNA 1YR2A 3U1TA 4N8DA 4ARBA 4BTLA 3QVMA 2WG1A 1L7AA 4PSCA 2XUOA 4TVKA 5AKXA 1S8OA 4U2DA 1GT6A 3W04A 4Z49A 1UK8A 1QFMA 3D7RA 3STXA 4LXHA 1DINA 1NU8A 2XUQA 4KACA 4U2BA 3EQ7A 1UOOA 3C6ZA 4BC0A 1IZ7A 4Y2UA 3SK0A 4BAZA 2AXEA 1SC9A 3QYJA 5AHXA 4QLOA 4B0PA 3G7NA 3G9ZA 4RE6A 4X6UA 5AKGA 2BAGA 5AK3A 2QVBA 3FLBA 5ISMA 2H9YA 2WU3A 2H7XA 3WIOA 1CPYA 3VDXA 1H22A 4O08A 1K4YA 3C6XA 1UK9A 2WJ6A 4BVKA 1RWQA 3JYHA 1JU3A 1QO9A 5H3HA 2PSDA 5ALQA 3G9TA 3LP5A 3DDUA 4QEKA 3BDVA
chains in the Genus database with same CATH superfamily
2EGUA 3GUCA 3ULKA 3QKTA 2WJZB 3NKFA 3PC7A 3Q8WA 1ZUHA 4MVJI 1JQJC 4C0KA 4K9NA 4PX5A 2Q2QA 3L7YA 4KLRA 1UBFA 3DMHA 3KZVA 2UVPB 2RIPA 1NQXA 3KALA 2R8ZA 3EB9A 5U4QA 3O4HA 4KO8A 4MA4A 3EZGA 3PLRA 4C29A 5C5IA 5EKDA 4Q3KA 1PR6A 4Q3NA 2SCUA 1RYDA 3G0GA 2BN4A 1SC3A 4ENQA 1Z2OX 2GD6A 3WWPA 5G4KA 3AJDA 3OG9A 1ETUA 5SY9A 3PI6A 4Q3OA 4XUGB 1BMQA 3GJYA 4ALJA 1YV9A 1GZHB 1I2AA 4BO3A 2CDBA 1UCFA 2HU7A 3MD9A 4N0DA 5KQPA 1RCTE 2NLOA 1ISHA 3A3KA 2A0XA 3LP6A 5BSVA 4YCNA 1I6MA 1Y6RA 2YN2A 3JAWA 5IJZA 4XI9A 4FD2A 2YQ4A 2CLKB 5KAPA 1W36B 1I0LA 1JG4A 3LQKA 4Q16A 4XDZA 3RROA 1B23P 1I4OA 2AG0A 3FB4A 4ZRDA 1AG9A 5LQRA 5DBOA 1XEXB 4WKGA 3QEMB 2MINA 2ODPA 3GGJA 2O3TA 2ZQYA 3FPSA 3GDHA 3K2IA 4UASA 3D3NA 3SEFA 1JFVA 3VTFA 1ECGA 1BU8A 1T2CA 1V47A 2ODAA 1X6VA 3JZMA 4HF7A 3TQIA 2PBFA 3THWA 3ZW9A 4HNAA 1HPLA 4X20A 1CERA 2O7QA 3QPBA 4Q3AA 3W5HA 3JQGB 4N40A 4NNPA 4QJ5A 4R6WA 1OF1A 3MC1A 5IF3A 4M0PA 1Q6YA 3E0QA 4HXFB 3OFVA 2ZAGA 2JI9A 3RVOA 3U4QB 1O0BA 5C18A 1JDUA 1OAKA 4KUHA 2V59A 5BW4A 5A9SA 5IFKA 1ECPA 3DEAA 3OLZA 4TN1A 4RH3A 4PLYA 3EDMA 2RJNA 2B6NA 1T2AA 2WTBA 4BKPA 2SCUB 3OPMA 1FZQA 4KIWA 2DOKA 2EJWA 1W581 1D0VA 2WYVA 4FTWA 3AB3A 4JQSA 5G4KB 1ODLA 3WNDA 5LZ2A 2DB3A 5E2IA 2I6QA 3GCGA 4KAJA 3RAJA 4DZZA 1H3EA 1M74A 5BWMA 3PHIA 4D46A 4WXHA 1G1AA 2JGEA 3BGDA 4H0NA 5FP0A 3NALA 1B2RA 2H2IA 2Z56A 4Q01A 1VA4A 1N3LA 3N8NA 3L05A 3JAWB 3IIJA 1KY3A 3DMRA 2HK6A 1C7ZA 5IC4A 3THOA 1PR0A 3DV9A 3L77A 3RUFA 5EMKA 2XNDD 4HSGA 4D0RA 2V7UA 3WKBA 3FCUB 3JYNA 3M2PA 2MINB 4J6FA 1ANKA 1JB1A 2W48A 2JCXA 1R27A 3L7LA 2PSSA 2QB5A 4B84A 3THWB 1GZSA 4HNAB 4X20B 1CF4A 4IIBA 3G2LA 4FGKA 4YO7A 3K9LA 3FWZA 4ILEA 1H0HA 1P9OA 2NVWA 4ZOQI 2K4MA 1ZJZA 1D1SA 2F3TA 3CNLA 1KO4A 4MW9A 5EQDA 3SYKA 3V42A 3RK1A 5LCXA 5A9SB 5IAJA 3LKBA 2AN9A 3VPDA 4EGSA 4J03A 1DBWA 3OZXA 3R3VA 2GO1A 3DWIA 4YXFA 4OQMA 2HPHA 5D5HA 2GZMA 2CFCA 1FUIA 2SBTA 3ORRA 4E2YA 3KTDA 1AURA 4YRIA 2QR5A 2BH9A 4LKOA 1KVSA 3NDJA 1FFBA 4UDYX 3WYBA 2DPHA 3UYLA 4C7JA 4RQUA 1I51A 3UOGA 1UIMA 1GUBA 3NRBA 7GPBA 4C1BA 4HBZA 4A6DA 3PA6A 4OQXA 4EL0A 5IM4F 2ADFA 2VT6A 3N3AC 5IKEA 1DO0A 3HADA 2IOQA 4UQPA 5TMBA 3HNOA 4BAGA 5TGZA 2HJRA 1E2FA 2ZCVA 3BILA 3AVUA 5IDXA 1WCXA 3MWFA 5KSZA 3P5SA 2WUFA 4L95C 3RH0A 3BVPA 3PFBA 3TQFA 3DTYA 5TB5A 3JV7A 4R2MA 4BTEA 3PX3A 3A11A 3VYSB 2AHOA 3L4SO 4PV7A 1WB9A 5HZHA 3JWIA 1I1NA 5FUBA 4F9GA 1S96A 4JIGA 1T5OA 3AGPA 5HPYB 4I8XA 3DLAA 2J6HA 5MHTA 1EI9A 1LW7A 3FNQA 3VU1A 3GLVA 5G40A 4IFBA 2F3PA 2XBLA 4MIEA 3C14C 3EHEA 2X40A 3IAS1 4GVLA 4P0TA 1TMGE 1KFBB 3QF7A 1KA9H 5CB8A 3WB9A 2R6R1 4DIMA 2RGUA 5DHFA 4O4HB 5DN9A 4QL3A 1C14A 2VHCA 2PA3A 4ZEOA 4QYXA 2SHKA 4PQEA 2ZB2A 2HTFA 2PEZA 2ZYVX 4XSGA 1NU6A 1J8YF 1Q91A 2IGBA 5EWMA 2WD9A 5FLYA 5JH7F 5CNIA 4CEJA 2J4DA 3CEPB 3AWDA 1NPDA 4EPWA 1A4XA 1Z0FA 3LBAA 2OHFA 1OI3A 5AM5A 2YXBA 4IYRA 1LY1A 1RLUA 3CQ9A 4D9GA 1UEXC 5K03A 4W1RA 1F2TA 2W6QA 3CUWA 4I3HA 2G77B 2IOYA 2QVZX 2I3GA 3FNFA 5LZ9A 2XQKA 3A4YA 4C2UA 4RTNA 1MHTA 2UDPA 3TMYA 1TEHA 5B1YA 4YXWA 3FMOB 4O33A 4V24A 3U4GA 3ZGNA 1HOXA 1BIFA 4FOLA 1KMQA 1LD3A 4F3YA 1U8UA 1KI3A 3NTLA 2J9XB 1XLTA 2BDEA 2V7EA 3RYIB 4BHTA 1KJ9A 3Q3HA 5HUJA 2CUTA 2F48A 4CTKA 1PNOA 4URVR 5JAOA 1KU0A 2VBCA 3TL6A 1TVMA 4KMSA 1H1DA 4D9JA 2RKWA 2XYPA 3DCIA 4HL6A 4OEHA 3WWCA 1ZEJA 4HGNA 4URFA 4U2KA 3UPUA 3B1YA 1S5PA 5D6OA 1GIAA 3NVKI 4AUMA 1XDUA 1XMOB 1TRHA 1A95A 1XRRA 2BFFA 3IEUA 5EWMB 1GP2A 2WD8A 2JLQA 1EVLA 3CPEA 3FKSA 5DLYA 4CEJB 3O2SB 1USKA 3EYAA 4JEHA 4BTVA 1KZ7B 1R50A 2JDID 3EWIA 2REBA 1RQGA 5JT1A 1PLKA 2L42A 4G97A 1J24A 1HE4A 3HU1A 4Y6OA 2RE8A 3JQAA 3LDGA 1UH5A 2CMFA 4HQKA 1HDOA 1GTVA 4HRXA 3X3HA 5AM3A 1F2TB 1RHRA 4ZKEA 3IAM6 3HXMA 1Z26A 4B4DA 3CWCA 3LT0A 5B4UA 4LK2A 4HDQB 1IXRC 1KJ8A 2BMJA 4BOYA 4HNTA 1N57A 1XYGA 4PSKA 5EZYA 4N48A 2K2QB 4ISCA 4NTZA 4DQVA 4UUMA 3ZDAA 2P9YA 4FLEA 4PRZA 1JSLA 4HH0A 2YDXA 1X13A 3ESAA 5CR9A 3V80A 3QFCA 3V9AA 4BO6A 1NI5A 3K0EA 3T3HA 3JRNA 2XBUA 3B2QA 4FMDF 1OT5A 3O90A 5FOQA 4AZ0A 5DEOA 1GRCA 4B6QA 3TD6A 5KQSA 3F7TA 1Z74A 4OOFA 4KEAA 1OT3A 1ZI8A 2Q8PA 1Q0PA 4M46A 4UVIA 1YB4A 2RI0A 2R6FA 4DNPA 4IVNA 5GV8A 4YLYA 3DVSX 4P54A 2X3FA 2BFFB 3L7AA 3RARA 4MPRA 2MSNA 4X24A 2AJBA 5ALRA 1KWGA 3MQFA 4ZO6A 4IIUA 1KH1A 4YAGA 3TDNA 1NP7A 3RK0A 1EB9A 1K66A 1X1TA 1OZHA 2C1XA 4M54A 3JQAB 3SY8A 3G1WA 2RH9B 4XM1A 5C5EA 3QX8A 4A0RA 1T13A 5K8LA 1GKUB 1VJTA 1ZVQA 1P5ZB 2VHWA 1T9DA 1W2WB 1NLMA 5JZMA 1C4XA 3IV6A 5EZYB 1G5RA 3LGAA 3PGLA 2FOXA 3F90A 1CQIA 3MCVA 2Z3ZA 4ZCLA 2XSZD 1E2NA 3EGDA 1K5DA 1WJGA 4NCHA 2R6GA 4XVUA 1Q0TA 2X0IA 2VAXA 3SYMA 1KJQA 2ET6A 1GQSA 4TRMA 1P31A 4NU8X 4AKGA 2WB4A 2WU8A 1WQ1R 4MCJA 3RC1A 2VKQA 4OB8A 3WLEA 2WDPA 2WRZA 3B36A 3E3LA 2G63A 4RZ3A 4F3RA 4ZN6A 2D0IA 5HP4A 5GONB 1KS9A 1ZUIA 1JQ5A 1IHYA 4UHFA 5ALNA 4D8XA 3ONVA 5EMHA 2BYTA 2BCEA 5SY4A 1F7VA 1XPRA 3G23A 3NHFA 4M36A 2VYND 5KZMB 2HRCA 3CLVA 3WNZA 2L18A 3V4SA 3WTCA 4ZA2A 5HOEA 4FM9A 2GD2A 3UXEA 1M9NA 4LFCB 2I2BA 3N7UA 1WV0A 5F7XA 5ICGA 1WG8A 4C88A 1DCTA 4AQDA 4DMGA 1OU0A 4HQNA 4HTAA 4K28A 1PVOA 1L3BA 3NDRA 3BMOA 4LQCA 1CP3A 1ZGGA 3B78A 2C20A 4X7BA 4HH4A 1HLGA 1YGYA 2HMSA 2O07A 2OC4A 2QTFA 4JYPA 1J2JA 2HWYA 3CE9A 4N5DA 4R9SA 3RJ9A 1XTZA 1KOLA 4Z7NB 5EJMA 3E7WA 4ZK2A 4Q00A 4WINA 3CWQA 2FYTA 4RYDA 4BUCA 1J9EA 3CCCA 2BE7A 4BL5A 2AKYA 4V3BA 4YQYA 4ZJPA 2XVYA 4FQ8A 3CT4A 1ISRA 4OI1A 5J43A 5AW7A 3SDBA 5F1OA 3TJZA 1GUAA 1GVHA 4B43A 1T9BA 3A4IA 3TBHA 3W6PA 4LHWA 4CHTA 3JY6A 2I67A 4OHMA 5HIAA 3FSEA 4HUQA 4DLXA 1RI1A 1WUIS 3LT1A 5IANA 3GLGE 3GZNA 3HHEA 1JU4A 3H9GA 4NYJQ 3K6SA 5D3MA 5KC9A 2JAQA 1RQPA 5ELLA 4H2DA 3A2KA 3C7TA 3K1TA 1HORA 3D8RA 3KTOA 4DREA 3DFUA 2VRCA 1T36A 1L9KA 4P3PA 2CKDA 1R74A 1K27A 1PBNA 1X1AA 2NXJA 1UJ4A 2ZRCA 2REQB 1D6SA 1ESNA 3RW9A 4ARZA 1XK7A 3BMOB 3IAUA 3HO8A 1FFXA 1RAEA 2BE9A 3FLAA 4UUPA 1T0PA 1PJSA 2XDQA 4BBJA 1QVRA 4BBZA 2EIXA 1LS6A 2QVCA 4YROA 1G2OA 2H4HA 4WZZA 2Y1FA 5B7NA 1I5OA 5GGXA 2RG7A 1NSFA 2CJWB 3QBJA 4K9KA 3WOHA 4AY2A 5EXTA 2JEOA 2NO4A 3IBGA 4P7BA 3RODA 3QOFA 3GYBA 4KGVA 5I9TA 2F9LA 4ND1A 4Q9DA 3OZBA 5C8YF 1YHNA 4AWXA 1JXOA 3KQMA 2B9VA 1RT9A 3C74A 3WKAA 4HUQB 1AH2A 1ZW1A 1TK9A 4PPFA 3NOOA 3SP1A 2GXSA 4C06A 1HWYA 1Z4LA 2FEKA 2X1MA 3BD9A 1F2DA 3C7DB 3GZNB 3RFTA 3U3JA 5D3MB 3K6SB 5L6LB 5FHQA 1L8LA 2EJTA 3C8HA 3ZJTA 1IJKA 2PDAA 5ITZA 3T5DA 2VNAA 4XVRA 5ALWA 1RHJA 5B6IA 1N2JA 3GJ0A 3OSUA 3OT4A 2AYYA 2FPLA 1HMPA 1XF9A 2X15A 3KJQA 5ERGB 2AUTA 2XYGA 1FFXB 5E1DA 4ARZB 2Y4OA 4BB6A 2YWRA 2XDQB 4BNVA 1IMOA 1P1RA 4MH0R 1Z4JA 1I3KA 3HA2A 4KX3A 1KDOA 2JI6A 2C7GA 1XHEA 2FY8A 5ES4B 1A2BA 3CA8A 3FLMA 1E2MA 2FUCA 4HMOA 2PG3A 2A94A 3A2LA 1BJKA 4ZXFA 4XRGA 1G2QA 3AC0A 2P90A 2P9CA 1ZKDA 3DC7A 3RCBA 1P77A 3CNHA 5JCXA 2PX6A 3HVRA 5DHRA 3PPWA 4S0XA 3DOFA 4FONA 1GZDA 1U9YA 1KP9A 1P4SA 1I4TD 2IU4A 2OWEA 3HB1A 1GTL1 3HUDA 2AHRA 2C88A 3QYFA 3S68A 1ORVA 3TTSA 2DPMA 4UE3S 1E4OA 1UADA 5F7ZA 3OHPA 4IXMA 2DU8A 1WSAA 3L46A 2HEGA 1Y9AA 3IS3A 4K46A 1VIYA 4RVFA 1YFLA 1I5RA 2W4IA 3T4EA 4M0MA 4OI2A 1WBBA 4RIHA 3F3YA 3WBBA 2M6SA 1XZCA 4JZYA 2V5UA 4EB8A 3ICOA 4QODA 4BNYA 3HKDB 3ZNPA 1HZJA 2J09A 2P2LA 4KH0A 3NHWA 2FNAA 5LUAA 1OZAA 1TA0A 4IUYA 2JLVA 2RC6A 1OE0A 3NIBA 4JUIA 3BIJA 4P4UA 1VJRA 5K8JB 1FTWA 3FOBA 4L85A 5HS4A 1SVNA 2O57A 2D7JA 4ZI5A 4EA7A 1X0VA 4B46A 2WKWA 3QEBZ 4RV4A 5E2BA 1IRXA 3U2QA 1N8SA 1R64A 4H3KB 5DLEA 3I5XA 4GR5A 4KAAA 1J90A 1QYCA 3BGSA 4L9WA 3L4EA 3QHPA 3R41A 4PFSA 1X9IA 2YQZA 1N5IA 1UMCB 1FP4B 1WP9A 2BFBA 2C8VA 5A04A 1W5EA 3OQOA 1PIWA 2G06A 2ZI5A 2GWHA 3U4QA 1D2MA 1WS6A 2B7LA 1KNQA 3MGAA 4KRXA 2IYNA 1RKXA 3CR3C 2FWBA 1CR1A 4F12A 5A06A 5T6MA 1T15A 5EIFA 3D1VA 5JBNA 3OUTA 5KWSA 4A0FA 2Q5IA 2FPXA 3BTOA 1DHTA 1TO6A 1U1CA 5EI5A 1NW9B 2G7MC 4H1WA 1CR0A 3IOEA 1IWOA 3NO4A 4MWBA 4ZI7B 3AKYA 3JQBC 1VRVA 4C6SA 1ZXXA 1PQWA 3ZDEA 1IAVA 1G21A 1L1FA 1ZOSA 2GLUA 3N07A 3NTVA 3R4VA 3PC4A 2J33A 2YRWA 4AECA 3U4MA 3DVRX 3E05A 3D8TA 3FOFC 5LQCA 4QELA 1E1YA 5IUKC 4W5NA 1NDUA 1TYEB 1QOPB 1D09A 3AEZA 4QAJA 3OWHA 5D3ZA 3UT5A 3F96A 4F3KA 1H4SA 2IZZA 3EF3A 3A4LA 3FB1A 4HAOA 1ODTC 3RU9A 2K5UA 1LDEA 3SIXA 2HIAA 4UM9B 4I6GA 4RV5A 3K92A 3RYFB 3DQQA 4K1LA 4QSHA 1M8JA 1BHJA 1W48A 3FZQA 4Y98A 3RKSA 3VPBA 1TTTA 5BR1A 1JDPA 2D3WA 3M3DA 5JAMA 5AW3A 4AIRA 4Y0AA 2C7QA 2O8EA 3KEFA 3AP3A 1GZ4A 3IJ5A 3PUXA 4FHDA 3IUQA 4E2XA 4I7EA 4YWJA 2G9UA 3H84A 3M6WA 1GG5A 2DC1A 4GEGA 3RO7A 1WNTA 5TS2A 5TR9A 2PVSA 2WM8A 3AF5A 4Q37A 2BISA 1VPWA 3IURA 2O7RA 1RWNA 2P0YA 2E82A 2P6UA 5IP5A 1XMQB 1ZJ4A 1TZMA 4UUBA 1QHXA 4ARCA 1H05A 1R0CA 2EW1A 2PMBA 1LI7A 4XJXA 2QVYX 4NNJA 5TARA 3X1XA 3GVHA 4IQFA 2C7PA 3IEXA 3KB6A 1G21B 5H02A 4BP9A 4F2GA 4IIVA 4N3BA 3OC0A 2VL7A 1CY2A 2BCGY 2O1EA 2Q41A 4TL7A 5D00A 1EQ2A 4J91A 5DLDA 2R0QC 1JR4A 2QG9A 4C4TA 3ZVMA 1RZ3A 1O94D 4JOCA 1E3WA 3ER6A 1SC1A 4GOJA 5ALJA 3ZR4B 1EZ4A 1N1DA 3HZZA 1ZK1A 2GCGA 2HIHA 2RH8A 3WGGA 2PRSA 2P7IA 4OQNA 2RK3A 3RVRA 3PG5A 3ZWXA 2C59A 1U8FO 1XMVA 4NULA 1YA6A 1OFVA 4C1NA 4P36A 4MUIA 2J6BA 1KYZA 4LF6B 1SD2A 1GAWA 4PZ0A 3UC5A 1D0IA 4E03A 2GJ4A 1UQTA 1BHQ1 3BH0A 1RKBA 1KIFA 3P27A 4QOSA 3RRZA 3V8BA 1ILEA 2J41A 2O8EB 2YN4A 3GCXA 1B26A 2NPFA 1KERA 1Y42X 5B7QA 4I55B 4R84A 1NBIA 1EBUA 2V6MA 2VDMB 1QKKA 1W5FA 3HP7A 3WSVA 1OFUA 3RRMA 3OOYA 4Y9TA 1F6WA 1WZUA 2DE0X 4EB6A 1TJPB 2HDOA 4MVJM 5I4KA 4KQ6A 1BEEA 2IYEA 2YY5A 2F1RA 4QJ4A 3RU2A 3X1YA 3MB8A 4L7QA 4ZC1A 4JENA 3TW4A 1M2VA 3TPFA 1U8AA 4X64B 5C1OA 4HGOA 3VC3A 2W22A 4A0HA 1Q14A 1V1MA 2ACWA 2WMOB 3G88A 3HCRA 4LY9A 4ZV9A 3FAKA 1R6UA 1Z0UA 4RLQA 4F8YA 3ORHA 3K09A 1E3WB 1KMHB 1AO3A 2HQOA 4L02A 1L8AA 4QBFA 1M33A 4PAWA 4RESA 5HGJA 5JY6A 5LNK6 3EXHC 4M1YA 5GVSA 2QR3A 3AK4A 1KEEA 1K0UA 1U98A 3SQDA 5KNLA 1GG8A 1WZEA 2Q3JA 3SJ7A 1PL0A 4OB7A 1SVUA 2M98A 4ZAFA 5EUQB 1CQPA 4DLBA 4EF6A 3RYCB 1ZR2A 2XOKA 4Q6BA 4GMXA 3LVRE 1Y3HA 1QQ7A 1NAHA 4QPCA 5AO9A 4C3OB 4JBLA 3AY0A 4ZPJA 2SICE 1BC5A 2CMKA 3KZOA 1MZPA 3I28A 3BJMA 4X6YA 5CT9A 5FTWA 3EIXA 5GINE 1AB6A 3OJWA 3CRZA 1FU7A 2HMAA 3QVLA 3DB2A 3IE0A 2VUUA 1G8JA 4D96A 3TUIC 4EB6B 4Q03A 1NJ2A 2Q6IA 1WKVA 2X0JA 1FSGA 3H97A 5E95A 4AUKA 1UPBA 3MOIA 1SUFA 3JWJA 3ZIAD 4DJAA 4MGZR 1XV5A 2JJMA 3PEYA 1T26A 3GMIA 1BTOA 2J3IA 1ZUNA 3DVQX 4JB8A 1M2VB 2QSZA 3IAFA 5SYMA 3WXBA 2I5PO 4YDSA 5AESA 2JBWA 4IJ6A 1SU8A 1ZCZA 1H8ED 1WMDA 4PPQA 5AI6A 3REFA 3FRJA 1O5IA 5K3SA 1UIRA 1ZA2A 3ZBUA 2WHPA 1U5CA 3PNLA 4UOEA 4TMXA 3HP4A 4ZDWA 1WV1A 4EI8A 3HBJA 2OR3A 4N7MA 5JDIC 4CIYA 1JPVA 4P0QB 1ZMBA 3IP6A 1QE5A 4GOMD 1IUOA 4PAMA 3DBOB 3PXXA 2B1JA 3S2FA 3GLHB 3RSHA 3WG9A 2C4WA 5AJWA 1JNYA 4DDVA 4L27A 2QT1A 5COQA 1LKZA 2H06A 5DSZA 1ZBQA 1YQ9A 5I7OA 3D3WA 5JD4A 3TG2A 2QUZA 5CX1A 3V5NA 5AJVB 3JX9A 4HAVA 5DNDA 3IBFA 3VO1A 4AMUA 1RW4A 4FHEA 4K86A 4UBNA 4KQFA 3MHTA 4CDNA 3IQWA 3NEJA 1GZ7A 2F1IA 5G1PA 4CMAA 3ZHZA 5IAOA 4D8VA 1ZD9A 1XA4A 3VKFA 3WLPA 4MPJA 5ERYA 4IPTA 1C50A 4TLEA 4FNMA 4WNCA 1UFOA 4MJLA 3BL5A 1UQRA 4L3OA 4NAUA 3PEUA 4WTOA 5LA6A 4FFVA 2Z04A 2FN9A 4HX9A 1IZYA 1ZUNB 4D92A 4OLAA 1Z33A 3Q5DA 1TCBA 2XKAA 3RVDA 1GGJA 1YR1A 1SELA 5KQRA 1C2YA 1I4DD 2O2XA 2IZ7A 4MS4A 4NBUA 4TGLA 1ISFA 2G8NA 1KXZA 1NFRA 2FF5A 2BY4A 1FNSA 2LR0A 1DE0A 1DHRA 1NP6A 3PCXA 3QLVA 2WWGA 3X1ZA 2Z9DA 4ZQHA 4BYMA 5BMOA 1J1ZA 2UZAA 3D6HA 3R3YA 4N0PA 5KHAA 1GILA 3ZE6A 1KZ4A 1HT1E 2GAFA 3FH0A 4DRYA 3NU1A 4BCDA 2DJ5A 2GK3A 3HBFA 1JJAA 1GCGA 3JRXA 5DGTA 5DMXA 4O4HF 5B2FA 1VLMA 5EIXA 5LWHA 1KEZA 2FMFA 1DWPA 5KCMA 4QQNA 1NKTA 1I2MA 1FFSA 2UZ1A 3I4FA 1DEAA 1MAAA 3D3WB 3ILYA 1J00A 4LVOA 5CVDA 2C3PA 5CX1B 1YDWA 3AONB 2W2VA 3SBXA 1QP0A 3NCHA 4GQIA 5CH3A 4HTFA 2TMYA 1CIVA 2ZSHA 3OU6A 4P7JA 1SBIA 2A78A 3H5AA 4WH0A 2AJLI 4Z9YA 1NJ6A 2O2EA 3NOVA 4QT4A 1X7YA 3UFXB 2Q3CA 2R6AA 2A86A 5AK4A 5JCZA 2FX5A 3PNMA 5DOZA 3GL9A 4Q1BA 1CNFA 1IONA 2FMKA 1QAOA 1KGDA 2VUIB 3G2QA 5LA6B 4M9CA 1NPYA 3TBKA 3KVNA 4WK2B 1TW3A 3CB4A 4GGMX 1P8JA 2H2FA 1SKUA 4O2RA 2EZ8A 3AYZB 4P8RA 2EBHX 2D7DA 4UTXA 2XCRB 2QTBA 3DHEA 5HDQA 3CUVA 2HUNA 3LUCA 4JC8A 4MS4B 4B82A 3EC7A 3GFOA 2XXAB 1BJRE 3O4GA 4HEA6 3SMQA 3U44A 1IEXA 3IRUA 4R71A 4KLCA 3F5DA 3QYPA 3VH3A 5ADUS 4PTYA 4J3JA 1L5SA 3BDIA 4RZHA 3EBLA 1XVVA 1PS0A 1FU8A 3MS2A 4C5BA 5CVUA 4GBED 2Y92A 2B30A 2ZRKA 2JLYA 1D4OA 2MYNA 3KHKA 3HJAA 4OJMX 1E62A 3THRA 1BMDA 1QZXA 1V6CA 1VSQA 5CCXA 4UXHA 1UJNA 2ZVDA 2UZ1B 1KPIA 1L6IA 5GMOA 3UOAB 1V7CA 2GYVA 2PX8A 2A0KA 1JHQA 4KKVA 3DH0A 3RYTC 1P91A 4NPHA 4HTFB 1OZGA 4BO8A 4YQFA 4BGDA 1ZHOA 4LHSA 1P2BA 4XUCA 3PHHA 1EESA 3LC0A 4CU5A 4R2HA 4D3XA 5LP6A 3I09A 5BOVA 3G5AA 2ZQZA 4JN6B 2G6TA 4G09A 1JECA 1KBQA 1ITZA 5BXQC 4KR0A 4PF1A 3D5EA 1YKFA 4M3NA 2W0MA 1V35A 2EQAA 3IHTA 1II8A 5EZ5A 2C2OA 3B7PA 2VYVD 3FBGA 4H0CA 2DWCA 4YDRA 4K9SA 3IESA 1BYUA 3DTVB 3VPGA 1EFDN 2EL9A 4TMKA 4EQZA 3OIVA 3N8IA 3HY3A 2ZYUX 1T3LA 2RGYA 4QTXA 1H2WA 1Z0IA 2FDRA 3U44B 2JFBA 3GP5A 3PBKA 4UNQA 5GVRA 5AVUA 3G7SA 1FDUA 4ZK6A 1P5FA 1E2HA 3HN7A 4ZARA 5IJ9A 1LSJA 1IDN1 2QY9A 4TWBA 2QR2A 2ZIZA 3F4KA 5E4JA 4WHMA 4N5IX 4DSZA 1SMKA 5JRZA 5JI3E 2ORED 3U17A 5A6SA 2A5JA 1EHYA 4EKNB 4BMSA 5E4YA 1A5BB 3A9WA 2CZCA 1NVAA 1U7HA 1WCWA 4R2IA 3RUCA 1CHNA 1D2RA 1J8VA 2X14A 1SXJC 4BKMA 3B6MA 4OQYA 2QMEA 4DSUA 1C8VB 3V7FA 4RTQA 1SUCA 1H6AA 2JJ2D 1VKNA 3MCAA 2PX3A 4JLNA 4ZVMA 2J3QA 5HBRA 1KU6A 3PNQA 4OLHA 4RDXA 1JMYA 2VTEA 1XVTA 4PWYA 2X13A 3DOCA 2O2JA 1TLLA 3AJ9A 2ZJAA 3ELUA 4BQRA 1PDWA 1GGKA 2DCUA 4KK3A 5CB6A 2VTVA 3BGVA 3NZEA 2V6JA 1I30A 3DTNA 4FOPA 1R37A 4CL0A 4GVPA 4B3TB 4FDVA 4NZYA 2FR8A 1KEVA 4QBGB 4RNCA 3B20A 3AVQA 4UUAA 4Z0HO 4K1XA 4GZMA 3A1FA 3EOAI 3JZIA 4I36A 5JFTA 2CV2A 13PKA 3CH7A 4QXPA 2V96A 5JJIA 1IN4A 1JIQA 4GSKA 4EUKA 5EGNA 4DUGA 2FJUA 1GTJ1 5JO0A 2A1UA 2IP4A 4OD0A 4YHBA 4OY3A 2R3SA 3LTEA 5K6RA 2IKQA 1PYDA 3BMXA 3DE6X 4RKFA 1CDZA 2VWHA 4WAUA 4YRQA 5DW0A 3VR5D 6GPBA 5KTPA 4V1CA 2O5EA 5C35A 4KB5A 3ZE2B 1K8RA 4MRMB 1LK7A 1PUXA 3GAMA 2RHTA 3ZZMA 1P9WA 1OJLA 2OV2A 2PS1A 2XUHA 3K3PA 5TQVA 5CVTA 3RUPA 5ICSA 3JW8A 1TK3A 1ZNQO 1Q0HA 3L9WA 5GONF 5GIOE 1QQTA 1T5SA 5CM8B 3MWJA 4G5RA 5A3SA 4URXR 4YRJA 1PVVA 3W6NA 2BTQB 1NATA 2OECA 4HY3A 3GVCA 1YAHA 1KMCA 1KQ3A 1U0HC 3IMFA 4G0PA 4HYTA 2YW9A 3KSUA 1L7BA 2CXPA 2CXTA 1NV9A 1W1UA 1ZM2A 5B3JA 5SZHB 1A76A 1OIWA 3FUUA 3EZYA 2IT1A 4FYKA 3JD1A 2Q7DA 4B6FA 4DV7B 2BUCA 2N3ZA 1P6QA 2FFAA 2FMIA 4Y2SA 4TV8A 2OG2A 3CO5A 4K81B 3AI7A 5BORA 3CPJB 4L08A 5FUQA 1JR6A 3KWLA 3PUKA 5KYKA 1T5LA 3LC1O 3N59A 5ELXA 1SM4A 4IHAA 2GBIA 1ZI9A 4YH1A 3UAZA 3G8YA 4AULA 3UMMA 2P3QA 3K73O 3DZKA 1LDMA 3D2CA 3FUTA 5TEVA 2A1UB 4D98A 1ZAKA 1XAIA 3GLFA 4Z0NA 5LZ5A 1XJWA 3CRW1 3QMWA 4GLOA 1NBAA 1WD7A 2A4KA 2CHGA 2P3OA 2ZJZA 2ZKLA 3FX2A 4JKYA 4PXAA 4DJDC 4RTRA 3H6KA 1SKQA 3GEPA 2H3HA 4AWBA 8ATCA 4HNSA 4I5DA 3NFYA 4LYJA 2W2NA 3COSA 2OL4A 4E46A 5HVNA 1RKUA 3ZOKA 3BIOA 1H2XA 2WG0A 1DC7A 3PI7A 3M1LA 1JFFA 3TFQA 5TF4A 3PRJA 3NVMB 3IAEA 4M88A 2C8LA 3BZWA 5LQUA 3QVUA 2V5VA 3GAZA 1W35A 3IT0A 3IR7A 1XE3A 4NL4H 4QTUB 5F4BA 2IHKA 4ENSA 2FKAA 2IU3A 2VC2B 3VVCA 4WL0A 4TV8B 2ONJA 3OKFA 1TW2A 4F4UA 1XQWA 1KAEA 2Q9UA 3ZZ0A 1RSZA 1QPGA 2OOSA 5F35A 3TLBA 4E08A 5JZ9A 3E53A 4RY0A 4F6RA 2ETXA 4N0QA 2VIIA 6AT1A 3BL6A 4INOA 2IYZA 4GKAA 1S2MA 4IDEA 3AV0B 4L51A 3T9EA 3ZCRA 3ZHCA 5A5DA 5C51B 4DV2B 4IHJB 1ONBA 4UNNA 3Q3IA 4TMVA 1LNZA 3GLFB 8LDHA 2ZBRA 4ENUA 4P86A 4KITB 3U3RA 4PTZA 3O0DA 1IWPB 1WUYA 4MVJA 3IILA 1J07A 5NULA 1JZTA 1XRSB 4AW9A 1YVEI 1YGPA 3OAAA 4G23A 1IG0A 3UEOA 4EG0A 4FPXA 1C1XB 5BV0A 4OLFA 1JFFB 4DG8A 4MUYA 4AQYB 4MGEA 3SKVA 3GLKA 1W46A 3QH4A 3W7BA 1JFTA 1YE5A 5IYZA 2FRXA 1GR0A 2IH2A 5L6MB 3ZH2A 1X1CA 5CYOA 3ZK9A 2YMLA 4E7PA 1AHPA 4K9OA 2NZJA 2G76A 3H2HA 3W5AA 1UBLS 2E55A 4G1BA 1DWOA 1BGVA 2UXBB 2EC5A 1DP4A 4MAAA 3ENVA 4YRDA 4TM7A 1JHPA 3OTHA 4M99A 5LB4A 1O4VA 9ATCA 2AOTA 1WXWA 3Q88A 2VNJA 3ZVLA 4F6RB 2QLJA 4D56A 4X1YA 5LLSA 1W1WA 2AI1A 2BKVA 3WLFA 2QSJA 1ONNA 4LJ4A 1QLJA 4W99A 4FEGA 2QN6A 4IH9A 4TLMB 1HF3A 1LLFA 2CSUA 4WBXC 1RAHA 4RF5A 4UOQA 4UJ5A 1W36D 2JIBA 1FUKA 1IC6A 1RTKA 1VBNA 4ZEXA 4HAXA 5AI9A 1KQPA 4QTZA 3N0TA 2ZRPA 4LBVA 2X2EA 3HDYA 1V7QA 1N9GA 5AICA 4A10A 3MTEA 2ZIXB 1DXQA 4IMJB 1G21E 3KXKA 4L07A 4KZKA 4HWTA 5CIQA 1IJBA 1NZDA 1AXGA 3EW9A 3E9ZA 3S8MA 3TLKA 3WBKA 2CYAA 4ZZIA 1AK9A 4MVCA 1BHO1 3KB1A 4XA8A 3BGOS 4HBGA 3BK2A 4L3VA 4JODA 3RSSA 3VYUB 1NRXA 4MXDA 3LOUA 4NVRA 4P22A 4NV3A 2J6CA 5L3ZA 4EEXA 4E1AA 2O8FA 1ZJ5A 2I2CA 4NBRA 2D00A 3HU2A 4GAEA 5IVDA 3HKCB 1DT5A 3I2FA 5TPWB 5IAGA 3IOBA 1EH5A 3AEUB 2AOTB 3R5TA 2JGKA 4NR0A 3AUAA 1WIWA 2WM3A 2P65A 2AXPA 1M6WA 2GOYA 2NO6A 3N8HA 4X1YB 3AX6A 3RHSA 3UHOA 4TXLA 4Z8YA 3M4ZA 5FWNA 2PJDA 1F8XA 2YZKA 1KGSA 1SIWA 2CJFA 4L9SA 1QGUA 4Q1EA 2FV8A 4F97A 4F4CA 3S8YA 3QFTA 2R87A 3KCQA 1B0ZA 3UOWA 5FA8A 2H1VA 3Q9UA 3AJEA 1N9GB 3INNA 4GR9A 3V3TA 3M5WA 2WNSA 2Q5FA 4HAIA 4X8HA 3IRVA 4RPHA 2HXGA 3RTGA 1JLMA 3DL7A 2JHFA 2GTPA 5FOUA 6REQA 1X19A 3DZFA 4OQ4A 5CNKA 1H6BA 1K8ZB 1UANA 1O54A 4KVGA 4C01A 4UBKA 4I1VA 1OWPA 3IEVA 4EO4A 2D1FA 1NTRA 3E9CA 3HXPA 4ZI7F 4IMRA 3NBYC 2JLCA 4QYSA 2BCJQ 4CT5A 1I3CA 3PYMA 3GJ3A 3M81A 4W1QA 5ESDA 3GHHA 1CLEA 2DKNA 1NMYA 2I87A 2I6FA 2ORIA 2P2SA 3HPRA 5K0NA 2DPYA 3ZY6A 4CCAA 3C6BA 2O8FB 5U4XA 5EJ2A 5H7XA 3H2GA 5COAA 3M0EA 3TFWA 5C8VA 1JAIA 4JHLA 2ZJ4A 2YICA 1KI1A 2GEDA 1JI0A 4DMLA 5DYNA 1XDDA 1I1QB 3K9FC 2R1VA 2IHBA 3D6VA 3K0AA 2ZROA 2KQUA 3RFFA 1AN9A 4V0KA 5C34B 3DO6A 2ZDGA 1YI8A 2FAXA 2J5RA 3HL4A 4HYQA 3H4MA 5EJGA 3VH2A 2V54A 4PCLA 4NCBA 1NF2A 4XWWA 3EIHA 3LUKA 4MIOA 2H2WA 2QRZA 4MICA 4O3FA 3KKQA 2ZEJA 3KDSE 4B3SB 3H1FA 3PQ5A 2B3DA 5CCDA 4JI2B 5F12A 1W49A 2YMQA 2LBPA 3DDZX 5EJFA 2BKLA 5F7JA 4BNKA 9GPBA 5E9JA 1A7AA 4GOND 2FDCA 1ZGHA 4F3CA 4EG8A 2VUSA 4KHZA 2O5VA 2YJ5A 3AW8A 3HFSA 1Z4KA 4EA9A 1LB1B 3OKAA 1WBDA 2XA1A 3MYRA 1EWYA 4GX5A 4B7CA 3QX3A 3CKLA 1GGFA 3WNQA 1VCNA 1VMIA 2C4KA 4JT2A 5DSXA 1OPRA 2ODTX 1MENA 2COUA 5I9NA 1GPDG 3O75A 1RQLA 1HE3A 1DPFA 1D6MA 4FNOA 4PFKA 4DEYA 1NBWB 1TXGA 1Q1ZA 2XCQA 2CCKA 1BXGA 1NY6A 2Z5GA 3C5EA 2ZRIA 2WLTA 3VZCA 3CF4A 3B52X 2AS0A 3VPXA 4DB2A 3I61A 5KTOA 1KORA 2R1VB 3K0AB 3M9XA 3IHLA 2D0OB 4FEEA 4G41A 3MCTA 1NQUA 1CNEA 2JJ8A 3UKOA 4CMHA 5HZKA 1QGOA 3TI9A 4OH1A 3FYUA 3LCVB 1LZLA 4RIFA 1E1MA 4CT4B 1XZ8A 2C0CA 3BGWA 1Q7TA 3EG9A 3MOSA 4KVAA 4RW0A 4XTRA 4HSEA 4PO9A 3RC9A 5HKAA 3SSNA 5KOHA 3PHBE 4KNVA 4P80A 3EEQA 3Q87B 3FMFA 3UC9A 4I55F 2HK9A 1BG6A 5LC1A 4NFHA 4KNWA 2I2DA 3GJRA 4FHZA 4QA9A 2CCJA 4I08A 3GOQA 3SR3A 4I9UA 1H69A 2QWXA 3BF7A 3FTQA 2YXEA 1JSXA 1NXOA 4FGLA 4UCFA 4G6ZA 4RQTA 1OBHA 2QPTA 4AC9A 4UZSA 1VMDA 3I37X 2PTHA 3G85A 3WWEA 3Q5GA 4XR9A 1L4LA 4A0QA 2NU9A 4YB8A 4EGCB 1ONPA 1P0QA 3HI6A 3GBSA 3ZY3A 3T7EA 4PNPA 1KDZA 2LNDA 2XH8A 3GT3A 5AXCA 4LTMA 1CEYA 2C3YA 3QUQA 5LQMA 1CXZA 5ECWA 3CEHA 3DKPA 3Q2OA 4JBWA 1IH8A 3BD8A 4EG7A 4ZI3A 1BXGB 3NORA 3TR0A 1ZRNA 3AF1A 3LL7A 1KK3A 2IEDA 3U4AA 3VOTA 4RJJA 3FYTA 4ZC8A 2O2HA 1Z8HA 3SQMA 4OHYA 3FWPA 3F6BX 1FNCA 2G1KA 3EEBA 4PHCA 1JT2A 3TWOA 2FW0A 2B98A 1VDZA 3M6AA 4IXTA 1EINA 1RYMA 1SN7A 2C8JA 2I62A 2ZIEA 2AL7A 3LYAA 4FUQA 3RU7A 3ZY5A 1PK7A 3EG9B 4MS3A 3O3OB 4Z54A 1ZBDA 4KFTA 1N5JA 1K7SN 2OG1A 3FI9A 3ML1A 4CV2A 5L9AA 5KOJB 2B8WA 5KOHB 1GYPA 5KYWA 4UDOA 2XT6A 1LNQA 1WDMA 4CEHA 3LSTA 4YXWD 2GPWA 2AYXA 1M0WA 5BOSA 5B6PA 4MDYA 3KOUA 1M1YA 1U0GA 1HBJA 1YR9A 2BM0A 3FPBA 5DX8A 2IU6A 2QPOA 1QH1B 4B8WA 4CM6A 4BKOA 3KEOA 3WKCA 3CRQA 2GJ8A 3TDMA 4BPBA 5F21A 3FROA 4KC0A 1DQPA 4M21A 1PL7A 1U7TA 2NU9B 3PVCA 3DXXA 2GSWA 2O2YA 4EH1A 1G2PA 1MX1A 1ZCBA 4OGGA 4C4AA 5IULC 4Q18A 2JH3A 3LCMA 4PBTA 5CT6A 3TEJA 4EW6A 3FKSD 2YZMA 1UOEA 4G8JA 1VC2A 3C45A 1TECE 3A3OA 4YI3A 5FBQB 5JS6A 2AFHA 5KTSA 3FSJX 4LC9A 1MVOA 2H1HA 4PWZA 1C1YA 3R9XA 1IM5A 3JQAD 1P4GA 2O1WA 1RXUA 4OJQA 3ZHYA 1CHDA 3L43A 2QAJA 1EKXA 1I9GA 2Q0SA 2AKEA 1E5QA 5KYWB 1GTMA 1V4BA 3UAOA 1JDNA 1PTKA 2HGSA 3KPVA 4YRBA 5FCDA 4Z86A 3QOYA 3L04A 3EQ2A 1BSVA 4ZT5A 3FNRA 1M1YB 3IO3A 2R6CA 3PF8A 5T8KA 3UJ3X 3W2GA 1U28C 3PR2B 6YASA 5MGBA 1T4MA 3OCXA 2OESA 1FMJA 2XMQA 3M9WA 1OLXB 3ANYB 4ZVTA 1YA4A 4LRQA 3UWMA 1KQNA 2GDJA 1F8GA 1KYYA 4D42A 1ORIA 3LRTA 2VJNA 2G0NA 4IGIA 2Z83A 2VJAA 4HLDA 5FPSA 3PL1A 2ZSEA 5KTMA 4MAMA 4RENA 4W4TA 4Y9UA 3E1GA 3LPLA 3IQIX 2HFJA 4BRWA 3AILA 1UC9A 3LA8A 4OMUA 5LZ7A 4QUGA 1A9QA 1N2HA 4UUNA 1J2RA 2AFHB 5I7SA 3K5HA 4EHKA 2HLNA 1XD9A 5TV2A 3L4BA 1XLUA 1Q1QA 2D0DA 3ZDRA 3RS5A 2PH7A 1PZGA 1WLYA 2A3RA 5EY5B 4ER6A 5C53B 5JNLA 5TPZA 3ZS9A 5HF9A 1Y63A 3OEYA 5ANRB 4D9FA 4G37A 1DPGA 2E5WA 1EFRD 1C29B 2GCEA 4F7WA 5TGDA 5ITVA 2D4AA 3VR3D 2W5UA 3MUEA 4OM8A 3VTAA 2WAMA 3GDWA 1U3VA 3QJ5A 4DTIA 4BEWA 1TFUA 3BFKA 4MQUA 5CFOA 2CNWA 2YBEA 1O95A 2OCLA 1XCJA 3DNPA 3G5UA 1ZN8A 5EERA 3V4FA 2A4MA 2C5LA 4FSXA 2YW2A 4EY5A 5LA6F 2CBGA 1E3DA 1E6UA 5F2NA 1L4KA 2Q49A 2H5LA 1D2HA 3HVHA 4RIGA 1CT9A 3T3NA 3LFHA 1Z63A 3T9FA 4QU5A 4KMOA 2PTGA 1Z83A 5AKEA 3T1NA 1GDHA 5C0OE 3PD7A 2JA2A 4EY7A 1GSHA 4DNXA 1RE1A 1NXTA 1DAMA 2CF6A 4W5TA 3IMGA 3FPGA 3NKVA 4BV9A 4TZ0A 1DUSA 4LSZA 1CZKA 3LYHA 2I91A 1X7GA 3H6GA 1NTOA 5C46F 1BWSA 3EXHB 4RWEA 4P2BA 3MWDA 4AAYA 4KN6A 3MHPA 1WDLA 2ZT7A 3VVMA 2VAWA 2ZSKA 2HLDA 3ZU6A 3SBEA 1CS0B 3I2GA 4AJ2A 2D1YA 1FSPA 2WJYA 1INLA 4OK3A 1ZNWA 5B4VA 1FQOA 4QHSA 2PH1A 2DPGA 4E1BA 4MKZA 1WPGA 4RD1A 3S1AA 3VV3A 3R8XA 3RREA 1Q74A 2IELA 2OSBA 2VPXA 3PFKA 2CNLA 3AG6A 4I3FA 3W90A 1X70A 3GBPA 4LS3A 4UFOA 1QO7A 1R6VA 4N5LA 2IYSA 2GT1A 3A4TA 3BE4A 3PPYA 4IIJB 3V4LA 3VBEA 3EXG1 1U7XA 3KKMA 5FUMA 4AROA 1EWQA 1TEXA 2G9RA 3HL0A 1NXVA 5AM0A 3RLFA 4LZOA 1E2EA 4L4SA 4X61A 2N42A 4TLCA 3HV2A 3BERA 5DHSA 4UEJA 2R47A 1N33B 1FLVA 2ZUUA 4LA4A 4HNHA 4NU6A 2CZQA 1TUIA 4QQ8A 3T5MA 2B5OA 3PQ7A 5M7EA 2VF4X 2F90A 3TQCA 5IHXA 4OXKA 1RZRD 1A7UA 1VQ1A 1PJ8A 2ZKIA 4QUIA 1Z8DA 1DAFA 4OJTA 4ZVLA 1FMFA 3CJQA 3KPUA 5LQKA 1XUOA 4G5GA 2VRCD 2I1LA 1EK0A 1PZNA 1L4EA 3QSGA 4O6VA 5T4HA 1U94A 4J2HA 3ADCA 1NVDA 1PDVA 2FWAA 5JDCA 1X7ZA 1ZA1A 2W37A 5CXSA 1IVNA 2ZI3A 2VJCA 5D86A 1EDBA 1D1QA 1D4ZA 1QR2A 3LIPA 4G5HA 4GI3A 5DCWA 1TLTA 1QB7A 1SU4A 3U7IA 3LM8A 4Y2VA 5DTJA 1WDKA 3FCAA 5PGMA 3S1AB 5L51A 2P6RA 2RJOA 2QE6A 3MTDA 4RY9A 4S1TA 4EECA 5BYAA 2X7XA 4MW4A 4J16C 2ESRA 1DX6A 2QORA 3EARA 4E30A 4XQCA 5LOVB 4PGHA 4TTPA 5DNYB 1WRBA 2ZJ1A 1X1EA 3M1YA 3G5MA 2F4VB 1N6PA 2C4TA 3R75A 4B80A 2AEMA 1K8YB 1WXDA 2DETA 1KEWA 4AF6A 3GLFE 1FDTA 2FCAA 4IUDS 1BEUB 1XZLA 2WK1A 4HADA 4D26A 1Y7LA 2A67A 3LXRA 1SCIA 3RIHA 2G0TA 3FMGA 2HCBA 3AUKA 3FOEC 1DBPA 1EIZA 1XQVA 2ZS8A 3ABQB 3D3EA 4EUEA 4EW2A 4FC7A 1U9IC 4HX2A 4WBNA 1UAGA 1W93A 5F23A 2FZWA 4L4XA 2P5UA 1ZD1A 1CC1S 3CNQS 5D01A 5ESXA 1TIBA 2ORWA 2QQFA 3QKSA 1MB2A 3RADC 1X7ZB 2QRJA 1E8NA 2I2XB 1MA0A 2BFEA 3N87A 2HPZA 3G7UA 3UPDA 3MCZA 4NZPA 1T1IA 1MRNA 2NSDA 3AZOA 3OU7A 4PPYA 5DNVA 1DIRA 1JXQA 1JDVA 1DC5A 4XB2A 2FEPA 1TTQB 3DJYA 4V0LA 2Q1XA 3AM5A 1P1HA 1ZHHA 1BX1A 5KIAA 4GHWA 4QIHA 2PUWA 1RCUA 1JAXA 1G5QA 1XCGB 3DOIA 2I4LA 4FIDA 1UBGA 4LUCA 5FUVA 2P91A 5FAXA 3OIDA 3HJGA 1E3QA 1U7DA 1XVIA 4GL4A 4QYWA 2RHWA 2VDPB 3HB4X 1RAAA 3LF2A 3P9RA 3N05A 4GKJB 1XYVA 2A35A 4BAUA 2IVFA 3DM9B 4I1UA 1GFZA 2Z8ZA 4LISA 1WULS 1T6NA 1ZXLA 4TUYF 2PYIA 4LPKA 4C76A 4MVJE 1T5DX 3E15A 1C41A 4BGEA 4DDUA 5L8VA 1TVKB 2NP7A 4XWOA 2V8BA 5HZGA 3VO2A 4XVQA 1NURA 4C04A 4WBNB 2O3JA 2QX4A 4ZVSA 2PU7A 4PSAA 1KY2A 3FOWA 5TQ0A 2Y0CA 3COPA 4PZPA 1HXHA 1CRZA 2YIDA 3QKSB 3A1NA 3FTDA 3EPRA 5HXAA 1H2AS 4BXOA 2YJZA 2BFEB 1PFKA 2OBFA 4OA8A 4ZZ0A 1F1JA 1LSOA 3DFMA 3O8DA 5BYJA 4LJ6A 3DE5X 3EJ6A 1MUUA 1KF0A 1U5AA 4G1MB 3HCPA 3OJLA 4UM9D 4H1UA 5JCJA 2EATA 3NUGA 3R44A 1G6HA 3UT0A 4AXBA 4OF4A 3VYVA 1L5YA 5DK4A 1DC4A 3BICA 4TLBA 2AR7A 4DA6A 2CB9A 3TRKA 1NIJA 2FSSA 4RDCA 4QM7A 2JK0A 3HNRA 1ZS9A 4D4MA 4URZR 4TV8F 3WGKA 1Q0ZA 1DKNA 1HE5A 4TL6A 3BUSA 3O82A 4URHA 2IOFK 4CLHA 3CZPA 2JCBA 4CGZA 1RQNA 4R2XA 3RC2A 1I6WA 2UYYA 4HB2A 1B3RA 3F46A 4REMA 3VI3B 1DKRA 2J9ZB 1H23A 4RFLA 5F64A 5DH9A 3LC7O 1BGXT 1HNNA 4G9EA 1MHPA 1NOIA 1QM5A 1DZ3A 2NTNA 3EBPA 4IHJF 3AH8A 3JATA 3PE6A 3QMPA 4QHYA 2J48A 4PHFA 5IK2A 4LXQA 2P4QA 2Q0QA 3D8UA 2JLAA 3ICPA 2JANA 2O7VA 5G0WA 4KE7A 3CIFA 1T4GA 2JAWA 4R2KA 2FZ5A 3C24A 4UU1A 1PUIA 1O6CA 4DT1A 4U4AA 4I9GA 3KSAC 1CJCA 4DCPA 1NVMB 5JADA 5H3CA 4BXOB 5BQXA 3DYBA 1YVUA 2VHZA 1YZQA 1KJIA 1M6YA 3SJAA 2XXBA 2BRUC 3A6DA 4HS9A 1E9AA 3CURA 3BXPA 1AQNA 1NUSA 2FLVA 2WNHA 3WMWA 4YCLA 3TGWA 1ZAYA 3TZHA 3FIJA 3TB4A 2AWNA 2ONKA 1F9EA 4PG5A 3KIPA 3QENA 3MLBA 5IVIA 1YS7A 3EGIA 3ANTA 1ULAA 3F71A 2IV3A 3VMMA 2FPRA 3F3KA 4KU4A 1FYXA 1OGYA 3GNSA 3IDAA 4TRRA 3NYWA 4CTOA 1K9SA 5DYIA 5T4BA 2GPBA 3TLYA 5J2UA 1RJEA 3TF5A 4WN3A 1NN5A 1E2DA 9ABPA 4IDDA 3O4VA 4HH1A 3EOBI 3H04A 1OVGA 4KPEC 1RDFA 2XUIA 5C52B 1NG9A 3RQIA 3UB2A 1YCFA 4KGDA 3Q8KA 3SHVA 2MSDB 4PS1A 3LV8A 3JQ9C 5IHPA 4MV3A 1Q1BA 2F17A 4E5PA 1VIMA 2VCEA 3MUNA 5JY1A 3ESZA 5JAHA 2XD9A 3K96A 3D8NA 7MDHA 1ZOIA 3E2PA 1LQ2A 3DHWC 2WUDA 4OJYA 5EZQA 1DAEA 4MQEA 1F9AA 2IODA 3DBLA 3X1DA 5IJWA 1ACJA 4R5MA 5CVVA 1QOQB 4IV5A 1OTXA 1T2DA 2HRQA 2OLKA 2P35A 3S0JA 5BR7A 2P5YA 4KDRA 3WQBA 1LFDB 5FO1A 2KS6A 4Q4DA 3N6RA 1CRPA 1P73A 3SMVA 1ZC3A 1D0SA 2FSVA 4QFBA 3M4NA 5AHRA 2RGNA 2GF0A 3L8CA 2PM8A 1Q19A 3X2FA 2XYVA 3ROEA 1V1JA 2Q2WA 1Z2EA 4TQAA 1YE8A 1ZIXA 4ZT3A 1PJLA 5L7YA 1QJ4A 5J2UB 5JRJA 3BTSA 1B8VA 4RDIA 5CFNA 1Y0BA 5JS1A 1X3SA 3EODA 1LJUA 4G26A 4TTQA 1L1EA 4YT2A 3WAGA 2H1WA 2PUAA 1GD1O 3KXLA 1XEAA 3ONFA 4QWMA 1IK6A 4KZPA 2DFTA 2W7TA 3IQEA 3LX4A 2DMRA 4ROTA 1Z7GA 4YY3B 2NO5A 1KP3A 4UEQA 5HK9A 4OCZA 1ULUA 2GN6A 4YV0A 4NI5A 3KPJA 3DLBA 3ZLBA 3QIVA 3PEWA 1FE8A 2X3UA 5EXPA 2HHLA 2XZPA 3ETNA 4YP1A 1IEVA 1ZH2A 2AMYA 4LZPA 1NM5C 3H5IA 4WK4B 5FWXA 5BWBA 2QLTA 5HGXA 3AR5A 4KWIA 4B5KA 4MQEB 2C7BA 3DBLB 1PGPA 3OCJA 1IYZA 2JFQA 4PBSA 4ZVKA 1Y33E 1E9EA 1R6XA 2YIJA 3BSYA 5EOVA 3MWEB 2DTDA 2PRIA 4MVWA 3TS1A 4JX8A 5CK4A 4XOUA 1CB0A 2ZUTA 1HNZB 2VZLA 3UV6A 2ZK7A 1V8FA 3I5AA 1OPXA 4F5YA 4M55A 4LNAA 1OFTA 1XRLA 4Q93A 1W96A 2R4QA 1O9HA 2QMYA 4IIGA 2MOKA 1P8AA 2Y99A 2NNWB 3R74A 4DIUA 4P92A 2F55A 4KQWA 3LFUA 1I14A 3HABA 3N9IA 2AN3A 1G1MA 3RF6A 1TUBA 4EJSA 1P18A 3OEHA 3TSWA 1QXSA 3WIUA 4B33A 5IKMA 3CJRA 3BA6A 1E3SA 2FP3A 1P0CA 1PT9A 3SE7A 4KREA 3QKRA 4GW3A 3ZD8A 1USVA 3QELA 1EK1A 1P2FA 1E7SA 4XFKA 4EELA 2XADA 4LDJA 2XUAA 4WKBA 2X5KO 3WK8A 3ZKWB 3UHAA 1YBHA 3BXEA 3TK1A 4Z4GA 5JLAA 2VCYA 4W8OA 4QX6A 2PBZA 4BO1A 3KKZA 5TX7A 4WE3A 5C1DA 2EHDA 2Y8EA 4EHJA 3QE4A 4J0DA 1XQ6A 2VOJA 1AO0A 2FA9A 4NRDA 4HQFA 5BSGA 2WVJA 5FWXB 2HEIA 4RD4A 2P5TB 2ZIVB 4CFZA 2DG2A 1KMNA 1BZYA 3NEYA 3SQXA 4NKRA 1QP8A 2L17A 3VC2A 1J20A 1A82A 4MA0A 1QX4A 3IYLW 5LYJF 1ORHA 2H8GA 1ICIA 4FR5A 1OR8A 5DNAA 3GRUA 3FHLA 3A2MA 3NEAA 3ZVKA 4E70A 4LFBB 1Z38A 4C4OA 4YNBA 4RSMA 5JG7A 1R88A 4DV0B 4LRXA 5F76A 2VH2A 3UZUA 3UMYA 3AY3A 4OXQA 4ND4A 1PNVA 1HA3A 2QTAA 3BEDA 4EJSB 5IW8A 4JR0A 1Z5OA 2OB1A 4FZ5A 1NLUA 4ZODA 4HGYA 2PMCA 4JUCA 2OCIA 3QKRB 2R8RA 2DBRA 1S9HA 2EV9A 2QD2A 2RHBA 1YB5A 1A77A 1SA0B 1U2GA 2YJTD 3HRKA 3QELB 2B6HA 1E9SA 2F3UA 2WHXA 2PD3A 3UWOA 1M1YE 3ZW7A 1UJ6A 1Q1AA 1Q11A 2OBXA 4JEIA 3NWEA 3AIIA 5DW3A 4BYGA 4DB4A 4MDEA 2A9FA 4JLSA 2V45A 2YS6A 1D2EA 1RKQA 3EVFA 4Z8XA 3VXKA 3ZZ1A 2FZKA 4X93A 4PAQA 3LWZA 1WUJS 1PWHA 2QTVA 4CQLB 3H2ZA 3LYLA 5EVCA 2V3CC 5HQ3A 3IUSA 1R8XA 3W2FA 4EK9A 4G0WA 1GKLA 1II9A 3BF8A 4H7DA 2V0NA 4JBHA 1G5FA 3T7CA 3USES 4BWGA 2D59A 2JCYA 2YYYA 3QM1A 3P9ZA 1SR8A 1GTG1 1GNSA 3OA2A 3PDHA 3WZ2A 3C85A 2AFHE 1OXKB 1Y3AA 10MHA 2IOHA 2RI6A 2ZIGA 1K5GA 1RWPA 1YE3A 1N2BA 4QQKA 3O8QB 4N7RA 4J1NA 5EG5A 3KVVA 3VH1A 4KXNA 1AHHA 1UPUA 2WSSD 4RTJA 3KQLA 5GZ1A 4WFIA 5JISA 3TR6A 3H5WA 3R3HA 1L5WA 4NOKA 3RSZA 1Q17A 1K06A 4I4NA 5GOTA 2NW6A 4BQOA 3KKEA 4DLNA 3K2EA 3I8OA 4IL5A 1ODIA 2E2WA 1C7FA 3EGVA 4DCTA 3G6WA 4K6GA 4Q7LA 5BPHA 4DJJA 3GK3A 4MHTA 1JQEA 9LDTA 2FWPA 3EULA 1M7HA 3OJFA 4MROA 4FUTA 2HSJA 4NF2A 4QO8A 1FXUA 5AQ1A 1KZGB 2QQGA 3DTVD 2PLWA 3B3FA 2ZWVA 2QTVB 4RE5A 1G8GA 1YC2A 1QTNA 5IT9A 4JXKA 3TAHA 3FFXA 5BMVF 1I7NA 5HQ3B 4G4IA 5FPQA 4MJ3A 5IKPA 3AESA 3VMFA 3ZD9A 2HHAA 2W83A 3UJ8A 2XOXA 1QONA 1YHYA 4Y7DA 4IOJA 1FTGA 5CX4A 3DP9A 2BEUA 5EJ7A 3DT8A 3T1TA 1H2EA 1GSAA 1MFPA 4WADA 3PUZA 2AEJA 4BO7A 3HSYA 3IHWA 1JPJA 3KSZO 1L8QA 1WXQA 1HL3A 3L82B 1NE2A 4NYIR 4JLAA 1QIEA 2LDBA 1GTRA 3L5KA 4MV6A 3LX5A 1QAQA 2QNIA 3D4PA 2HQBA 1ND6A 4Q3BA 3ASUA 1ZMXA 4TS1A 1LW6E 2DQZA 3TXXA 5REQA 2VXYA 1LQTA 3AUFA 2WAYA 5G02A 4E7OA 5JYEA 1YI0A 2B82A 1VFNA 5E0OA 4R68A 1JBEA 3U7HB 4XYMA 1UBEA 4OREX 5ARCA 4JSYA 4B3XA 1BDIA 2MYTA 4R54A 1S8FA 3EAQA 1FX0A 1QYVA 2HJSA 2XQFA 3HC7A 3N7TA 2OGUA 4KSBA 1G8HA 3U56A 4W82A 3HR4A 1VRWA 2ZG6A 4XLTA 3OHMA 4Z9XA 3SJCA 2H63A 2IY7A 2PMKA 3BK7A 1OY1A 3P2IA 3BA1A 5EN4A 2CLIB 4J0HA 3EH2A 4QDTA 1YJQA 4WDQA 5F3RA 4DYVA 2W71A 3AESB 3ABZA 3CLRC 3KKLA 2HRDA 4JVOA 1LV8A 4IKEA 4BVGA 3WL7A 2OM2A 1M75A 4UHKA 2GVZC 3VZRA 5LJLA 1F2VA 2IQIA 2RGXA 1P7WA 1FDVA 3HB5X 2IYTA 1BQ3A 2XMBA 3T06B 1PO7A 3DMNA 4X92A 2C2XA 5SYAA 3USCS 3QPDA 3UB3A 5AQEA 4ZREA 1J0XO 1GPKA 5BSUA 2P0EA 4UZFA 2C04A 2HMVA 2N0SA 2R5FA 2DZDA 2EG9A 3DDSA 3P71T 3AB7A 2OV8A 4LXGA 1AE1A 3FOCA 4NESA 1NVXQ 4R1TA 1GSOA 3ORSA 4O5AA 3M83A 1HTBA 4PC3A 1JYSA 5JAIA 1JKJA 5DYTA 2JJQA 3LPAA 1EM6A 4JYBA 1CFZA 1E7QA 1KI4A 4YJDA 4F4JA 3E9DA 1RWXA 4EJFA 4UFNA 1A04A 1GCAA 1TZBA 3CFYA 4DUPA 3G0OA 5WRFA 2O4CA 4BLVA 2FMXA 4OYHA 1FX0B 1UKEA 2JGNA 1YU9A 1OAOA 4Y6RA 1Y8AA 4BTLA 3RRJA 1PEAA 4RKYA 2IS6A 4POAA 3T5AA 3E1KA 4PX2A 3PTZA 1R15A 1J2TA 4C2TA 4KSYA 2GAAA 4U2DA 2PK3A 3LG2A 3LJKA 1BS2A 2ZRDA 3ONNA 4DUGD 4ZCQA 1C7EA 1VHWA 4ENPA 4JHXA 5ECDA 1FDOA 4TSFD 1DC3A 1E0SA 3C6MA 1Q6ZA 4IS2A 3ZWAA 4LZWA 1HT2E 2J9FA 3CVUA 4YUXA 1I3MA 2Y1LA 1IHUA 5DMHA 2Q0HA 5ABPA 2VN8A 1N2IA 4RF2A 4RF3A 2G6BA 2PUVA 5CM2Z 4LXHA 2FSHA 3MJFA 4LSMA 4DBLC 2PXCA 2NVBA 3ASZA 3FYCA 4HQ6A 3OX2A 4U2BA 4H27A 4P1ZA 1JXMA 4JGGA 1BDMA 4U63A 1IEQA 1C8LA 1L5FA 4AZSA 1JKJB 3RBXA 1IQ0A 2Z57A 5IT0A 2PWPA 4A2WA 1JHZA 4BLRA 2X8JA 4OLJA 1H85A 1PV2A 4G1UC 3SG0A 1M72A 2ETVA 3UJ9A 5HTOA 2AXEA 3H0KA 1SC9A 2HF8A 1T9KA 2F3SA 2ZULA 2CYCA 4G25A 4JVSB 4UKDA 4GU5A 5FA5A 1YRWA 4PRKA 4PZLA