5IUKC

Crystal structure of the desk-desr complex in the phosphotransfer state with high mg2+ (150 mm)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
132
structure length
132
Chain Sequence
SMISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/gene regulation
molecule keywords Sensor histidine kinase DesK
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 46
structure length 132
sequence length 132
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iukC00
4DQDA 2PMCA 3OM0A 3OQMA 3EAFA 1KRXA 1JLKA 3LUGA 3OQOA 2IPMA 1D5WA 1FQWA 3JS5A 2PUFA 4KRFA 3OMXA 1DBWA 4N41A 4EUKA 3N0RA 3EJWA 2N9UA 1SXGA 3HSYA 1D4ZA 1NXTA 4Z9BA 4D6YA 4ETIA 3KG2A 3C3KA 1SRRA 2QXYA 4LDZA 2HPHA 1EWKA 3NHMA 3LUFA 5ABPA 2OENG 2E4YA 2LBPA 3FDFA 1B00A 2FMKA 3KTOA 3HVRA 1NXPA 3KCNA 4YS6A 3FFXA 1SXHA 5CNKA 4HYEA 4OATA 2P9HA 4PE5B 4IMJB 1D1PA 4EYKA 3T8YA 3E3MA 4WUTA 4FE7A 2E4VA 2QSJA 2PUGA 2PUCA 3LUDA 4S05A 5JNRA 4NICA 1DZ3A 1P8AA 3CLKA 4H60A 4MQFA 1W9HA 3RH0A 5DTEA 2FMIA 6CHYA 3CKMA 2E4UA 3GBVA 1ISRA 2CHEA 5HSGA 2MSLA 5DLEA 4MS1A 4RK1A 2PUAA 4GNRA 4H3HB 3H5LA 4W5OA 3LUKA 4G0OA 4Z99A 1WETA 1H9CA 1DC8A 2PE5A 1PUXA 2MYNA 4TLMB 3URMA 3GRCA 2CWDA 4L85A 2LP4Y 3QEMA 3RVOA 4QPJC 5EWJA 2ZAYA 3H1EA 3QLUC 1VLZA 4D6XA 4MQEB 4XXHA 1ISSA 1APBA 4OTZA 1Y1LA 2FKAA 4JB2A 3NNDA 1Z13A 3B2NA 3M9XA 5DGCA 1ZH4A 4XAQA 4F11A 1USGA 3L49A 4KNYA 2O20A 2NZVG 3GT7A 1RZRD 2JBAB 4JASB 1E6MA 3FFWA 5HM6A 2FQWA 1SXIA 4KQCA 5KC8A 2MSKA 5C5EA 1DG9A 3ILHA 2ID9A 1LJLA 3Q7SA 4IRXA 4QYMA 4UHJA 1ZGGA 2VYCA 1AB6A 3EDCA 4RKQA 3ILYA 3LFTA 3IPCA 3QELA 3CS3A 5EWMB 2QZJA 2XDYA 1JH9A 3LKVA 5TQ0A 5JS2A 1A2OA 4WWHA 2BGGA 3O1JC 3ROFA 1NXOA 5I4CA 1DC7A 1DRKA 2B1JA 1MB0A 1UDRA 3TB6A 4Z4GA 2RJOA 4KMRA 4IILA 3RVLA 3OMWA 1U04A 1C0EA 3G85A 3KKEA 3EGCA 4MAAA 3RVJA 1QKKA 3H6GA 4G0QA 3N53A 4Q6WA 4RK0A 4RDCA 5BRAA 3HS3A 4RZSA 4EVRA 3OO0A 2FQXA 3HEBA 3I42A 2FW0A 2FSPA 4G0MA 1NY5A 2GBPA 4QICA 3FFTA 3A0UA 1KGSA 1P2FA 1SD5A 3TD9A 4RV5A 6ABPA 3OQNA 4MS3B 1JFTA 4WXMA 3UUGA 3MYYA 3O2QB 4E7PA 3GV0A 5EWLA 2PL1A 1GLGA 3ROTA 2PAFA 2I6FA 2WJAA 3H5TA 5IC5A 2MYPA 1PNTA 5FWXB 9ABPA 4YCSA 1ZGZA 3IDOA 4MR7A 1QQAA 1MIHA 4N47A 1KMIY 1A0OA 3QLVA 4EY3A 3CG0A 2MYUA 1ZITA 2ZWMA 3UKJA 1QP7A 2WWVD 4JP1A 1JYFA 1QPZA 1F51E 2FLWA 4OLAA 2LPMA 4LX8A 3LUCA 1ZVVA 3W9SA 1LJUA 4RU1A 3JPWA 3KS9A 1CEYA 1PNRA 2JVKA 1HEYA 1JL3A 1L5YA 1LBIA 3BILA 1EWTA 1M2EA 3CZCA 3H75A 4W5RA 3RQIA 1JDPA 1JYEA 1PEYA 3Q7TA 1NATA 1CYEA 3HM9A 4PZ0A 1OXKB 3JVDA 3IP6A 3JTEA 3M6MD 3EULA 1PEAA 4DN6A 4MS4B 3VNAA 1BDJA 1QP4A 4UHKA 4EVQA 1AB5A 4IGAA 5JS1A 2JRLA 1D1QA 1W25A 3HDGA 5B3JA 3C3WA 2FTKE 2NT3A 3HUTA 3MA0A 4HNSA 4LZLA 1U0SY 1ZAYA 1R8JA 2ID7A 3HK2A 3RVQA 1YK0A 1YIOA 1IIBA 4DADA 1Z17A 3TO5A 4XASA 1A04A 1M5TA 2L19A 4Q6BA 5PNTA 1YMUA 3SY8A 1GUDA 3Q41A 5TPZD 3OLVA 3A3KA 4Z0NA 1RZRA 3DBIA 4Z4EA 5IEBA 1YK1A 2R47A 4XFKA 5T3YA 3T95A 2A9RA 2AYXA 4MR8B 1BVHA 2V0NA 4JAVC 1NXXA 4RK5A 4WZZA 4TLLB 2FQYA 4L4UA 3GA5A 4KQ9A 2KYRA 5IUNC 2TMYA 3OLYA 4JB0A 3UK0A 3O21A 4W5QA 5TE9A 3I45A 3FMVA 1YS7A 3HCWA 1F4VA 2FN8A 3KHTA 3QLTA 5KC9A 4KV7A 4WXEA 5E3JA 3H5WA 3OO1A 3O1IC 3K9CA 4MQEA 2E4ZA 5ED4A 1K68A 1U2QA 4G0PA 2X7XA 2FEKA 4LDAA 5B3JC 4JOQA 4RS3A 5C5CA 1Z12A 4ZMRA 3JPYA 2NUBA 3LUAA 2JBAA 5GQSA 1PHRA 4PICA 3F6PA 3LKBA 3TX6A 3OM1A 3I5AA 3F73A 5FWYB 5IX8A 1U2PA 2QU7A 4F12A 4RKRA 4G0ZA 2PUEA 4MRMB 1JHZA 2E4XA 3IP7A 3LOPA 1EAYA 1TMYA 4OBBA 5TQJA 4RWEA 3H6HA 4RXTA 2WRZA 4YLEA 5EWMA 5TQ2B 2A9QA 5DCLA 2IDMA 1JX6A 2IPLA 3A0RB 3CTPA 4E7OA 5T7BA 3HJFA 3MIZA 1XWWA 2L2QA 4ML3A 3HUUA 4RXUA 3EQZA 1NTRA 5BQ3A 4N03A 2R48A 1P6QA 1YMVA 4W5NA 3K4HA 1Z16A 1USIA 4H3KB 3GWGA 2FN9A 2FXIA 4ZJPA 3H5OA 1DP4A 4TMYA 4YWHA 2IPNA 2VUIB 3GYBA 4NQRA 4O1HA 3HDVA 4QYWA 3DGFC 1YTUA 1QNLA 2A9OA 2DRIA 4EYGA 1FFGA 3D02A 1U8TA 3O75A 4RXMA 1E2BA 3CHYA 3DLHA 1K66A 4MS3A 2MYTA 1VRVA 4RK6A 1TLFA 1DBQA 4G86A 1URPA 3G1WA 1I3CA 1YS6A 3BREA 1Z25A 3MMNA 1Z2EA 5FWXA 2W42A 1ZHHA 2FVYA 3H5IA 4YR7A 4MR9B 2FEWB 4LE0A 7ABPA 2M1ZA 2PKXA 1CHNA 4RY9A 3NHZA 1TJYA 4M88A 4Z4FA 2JK1A 3H1FA 1J56A 1E6LA 3OLXA 1DCMA 4ETMA 2E4WA 4F8JA 5HKOA 3N0XA 1GUBA 3A10A 4XLTA 2HSGA 3N8IA 3TMYA 4YRZA 1NXSA 4F06A 1BA2A 1NXWA 3CG4A 5CNJA 1JFVA 2QR3A 5BRJA 3NNNA 4NV3A 4MS4A 4Z4CA 5KQMA 2IPAB 3O2JA 1XHFA 1QP0A 5JNTA 5GOTA 3QX9A 3O2SB 1M2FA 1ZY2A 2YHBA 4TN5A 4N0QA 2FEPA 8ABPA 4NCBA 4FB4A 2P4UA 1JBEA 3Q15C 3LUJA 2Q5CA 1YVUA 2F8TA 4P1ZA 5TPWB 3SNKA 3T6KA 1DJMA 1DCFA 2HQBA 2M98A 3OLZA 4N0PA 3CU5A 3KYIB 2PUBA 3DLBA 4S04A 5JNVA 5JNSA 2IKSA 2QW1A 2IYNA 3QLVC 3CRNA 4MR8A 3RVKA 4KREA 1GCAA 1RPJA 3Q7RA 5IUKC 3KYJB 3C97A 1JDNA 1QMPA 1ZN2A 4O1IA 5KI6A 2GKGA 4YV7A 3EQ2A 5JNWA 4HNRA 3I09A 4B09A 4NCAA 3D8UA 3HXMA 1TM2A 3BBLA 4LE2A 1JWLA 1NXVA 1EFAA 5BR1A 5CNIA 4CBVA 1FFSA 4ZPJA 2QVCA 1LBHA 3CFYA 2FMHA 2PUDA 3QLUA 4MGEA 2PL9A 2WJWA 4RK4A 4G0XA 2WMYA 4RSMA 1DBPA 1M5UA 3BRQA 1ABEA 1P6UA 1DRJA 2WB4A 3KSMA 1EWVA 3HZHA 2R4QA 3O1HB 1LK0A 4IMIB 3MF4A 5KQPA 4RY0A 3HV2A 3KJXA 2F8SA 1QO0D 3O74A 3SM9A 2RDMA 3QK7A 4YP9A 5FBKA 3T38A 5FWYA 2HQRA 4WT7A 2IOYA 2R25B 4MRMA 4Z9AA 1QQBA 1ZH2A 3KLOA 3JVIA 3NNSA 4KZKA 3SQNA 3H5VA 4HNQA 2VK2A 3MQ4A 4RY8A 5F64A 4EYOA 1KRWA 2H0AA 3C6QA 5TQ2A 3DZDA 4MQFB 5D2CA 3F6CA 4XARA 4ETNA 1JF8A 4MLCA 3IPAA 4YGXB 3RVRA 4KVFA 3SAJA 4O5AA 2L18A 3RVPA 2FLKA 1ZESA 4G97A 3N75A 4W5TA 2LIVA 4JA2A 4MS1B 4ZMSA 1S8NA 1MAVA 3IP9A 5JNUA 2FMFA 4EVSA 4EGSA 2YHAA 2QV0A 2RGYA 4FE4A 5DKFA 3BRSA 5CHYA 3GL9A 5IUJC 3LMKA 1ZDMA 2HJ9A 2WY2D 2LUOA 5IEJA 2NT4A 4MPTA 1JFSA 3H1GA 3MM4A 3L6UA 3QEMB 5EWJB 4D74A 2CHFA 1VPWA 2CD7A 3LUHA 1BDIA 1BAPA 1DCKA 1OXBB 1ABFA 1E6KA 3HO1A 3EODA 1USKA 1RNLA 3VNBA 1BDHA 3FGZA 1RXEA 4IF4A 5KQLA 4F3TA 2GI4A 4MYRA 4MR9A 4EYQA 3LTEA 4Z4IA 2JVIA 2RJNA 3CZ5A 3N6VA 5IULC 4Y9TA 2JB9A 5HQJA 4MLDA 3RVSA 3P9YA 3CNBA 4OLBA 4KFCA 4LE1A 2GX6A 3E61A 1L5ZA 3OLWA 3JY6A 3QELB 2JCGA 1Z2DA 4P98A 5TQ0B 3S99A 3GBPA 1TVMA 1MB3A 3RVNA 2HQOA 1VKRA 1T34A 4KK3A 1Z18A 3DGEC 4ZYLA 3IP5A 3KLNA 1RXIA 5TPZA 5IBQA 3C3MA 3SG0A 4G0YA 2PLNA 1FFWA 2OQRA 3R0JA 1GCGA 5KQGA 4N76A 3M9WA 2GWRA 5KWSA 4PYRA 2VUHB 3QX8A 2JVJA 1Z15A 2AYZA 4OG2A 3N0WA 4PEVA 1MVOA 1FSPA 2A9PA 3QEKA 4YO7A 1C4WA 1EHCA 1XHEA 1Z26A 1D2AA 2MSWA 5TPWA 4Q7EA 4KPYA 5FBHA 2B4AA 5CNMA 3F7NA 3NBMA 2NZUG 3Q9SA 2QVGA 2H3HA 5EWLB 4LRQA 4Z4HA 4RK7A 3RVMA 2PJUA 4MR7B 1QO0A 2L17A 4GPAA 2J48A 4KK4A
chains in the Genus database with same CATH superfamily
4WZAA 2J5KA 2VRCA 1ZBQA 2IUUA 3OQMA 1NVBA 1WULS 2JIBA 1FRQA 3CW2A 1JLHA 3LCJA 2PPVA 2WKSA 1NPYA 3HHPA 4R2WA 1KS2A 1HUQA 4N8DA 1GEGA 1HDYA 4GHWA 4M8KA 1DB3A 4BEWA 1EVLA 3AONB 4D7AA 1NDHA 2JEYA 2OXFA 4XKJA 2BKUA 1MX3A 1U3DA 1CY0A 1GPNA 1XMPA 1ZH8A 3ONNA 4BNIA 3UWDA 3WGVA 1YZTA 1AKUA 5AICA 4XR9A 3M6AA 4Q3AA 5ENVA 4BZPA 3RJMA 1CG6A 4QX6A 1ISJA 4O08A 4V0ME 4J91A 3OPMA 2OCDA 3G68A 1T3GA 2OK8A 1TA0A 2O2DA 1D1PA 4BGVA 1MGOA 3A9UA 3B6ZA 4TTSA 1NP3A 4D0SA 2O7RA 2OHVA 4FE7A 3RNOA 3TG2A 1S3SA 3MTAA 5C3MA 4HN2A 2YFYA 5JNRA 2PS1A 3WSWA 4MYUA 1BXRB 1OH7A 4AU1A 1NIJA 4U2EA 1VSTA 2J67A 1TT5B 1JEOA 3B3FA 4J7CA 1V6SA 3OJOA 4C30A 3RVBA 4YP5A 3TUZC 3GDWA 1WZIA 1W5SA 1MJGA 2YXEA 3V8RA 4FLFA 3CJQA 5HIMA 5HS6A 4CQLA 3P4XA 4X60A 3WZMA 4B17A 3C6YA 4V03A 2Q21A 3RREA 2QTBA 5B36A 3W8FA 1N75A 1CT9A 1YI1A 2OEPA 3UT5A 2C97A 4MITA 1A8UA 2QDKA 5PGMA 3NWEA 3URMA 5HRUA 5I7SA 2B8JA 3OF2A 2QYOA 3WHIA 5AW9A 1EIWA 3T7AA 3RS7A 2ZAYA 5CPFA 2QMYA 3CT6A 4QAJA 5K0LA 4UHFA 3SLKA 3QVJA 1G8KA 4PLHA 1KSGA 1Y1LA 1Y8CA 3RWOA 1DQRA 3VSCA 2Q0HA 5CB8A 1YJ5A 2YMQA 5REQB 1DKRA 3PUXA 4DRXB 1UPBA 2A0WA 1V3UA 3GT7A 5E6SB 4GXNA 4JASB 3QI7A 1BQEA 1C8VB 1QPBA 1YCHA 1OLSA 3RTAA 1N5RA 4AUEA 4DILA 2ALJA 4J4TA 3R8CA 2RH4A 1GNLA 3OQIA 1EXNA 2IHYA 3AHFA 2HR1A 4YPOA 1OU0A 1KAGA 1MJGM 2ZP1A 3VI3B 2OZLB 4G5RA 2Y6VA 4JLDA 2XQJA 5G02A 1WDKA 4EHKA 3W2GA 1UDCA 2YV3A 2I78A 3IKVA 2GILA 4XWAA 1LTKA 3FDXA 3R3VA 3JWJA 2BGGA 2EHJA 3FPBA 3JR7A 3QVLA 5GIPE 2PMDA 3TDNA 5LZ9A 3OFJA 1SUPA 4BNTA 1UDRA 3ZCXA 1U0JA 4K87A 3REGA 1I24A 3CVXA 1PV2A 4EUFA 3OPVA 2EC5A 3PD0A 1V5IA 1CSEE 4F85A 1GYPA 4REMA 3HS3A 2QSZA 4DIKA 3IUEA 1M6WA 3GNLA 4FZ5A 1M34E 1CIJA 2AKYA 4D3SA 4RIIA 1SWWA 1DKOA 3FYHA 4TTRA 3RJ5A 1CUAA 2QGZA 3F6EX 2QM3A 3C6XA 1P4AA 3P2EA 5GOZA 3WRVA 5BOSB 3B82A 3B6MA 1XDUA 3OJCA 3MYYA 4V02A 3OHMA 1CF2O 1P45A 4BO1A 4GP6A 4JX9A 1QGDA 1R9JA 3RLFA 2MYPA 3GH3A 3ZE6A 3OEHD 1GM5A 4NAUA 1K98A 4J76A 1IOVA 1HTBA 2EEPA 1Q7TA 2BEWA 3MS7A 3I32A 1GNQA 1VJRA 5LXTB 3T9DA 1GJRA 3ST7A 2I3ZA 4X1KB 3WO0A 5KNDD 2OBYA 1K3FA 4ZKDA 1ESNA 1SC4A 1I3OA 1N5OX 4L5YA 1M2VB 4RL4A 3G7NA 4HUQB 5H81A 4O4JF 2RGCA 3RFCA 3TOSA 4MHTA 5ICGA 3GRUA 4HDKB 3AVQA 3KS9A 1KJNA 1XTJA 3ASYA 4WRRA 1XEAA 5LPNA 3N1UA 3Q3VA 1ICIA 4GS5A 2W5UA 1U8ZA 2E18A 2PX0A 3U44A 1YDWA 2R97A 3BZUA 4JKOA 3Q7TA 2W4QA 3RSGA 1L6IA 4HVTA 2A9JA 2PXCA 1ZK1A 2O2CA 4J07A 3DAYA 4REOA 2Z2XA 1MQAA 3K5WA 2A4KA 4OQMA 1NE2A 3R7AA 1FNMA 2R1ZA 5DEOA 3B3AA 2B69A 3DW1X 1RRPA 3MCUA 4E32A 1UM8A 2H9IA 3AM3A 4Q93A 3HM9A 2XXAA 3ZTYA 2XE7A 4K6GA 2AXPA 2DGDA 5IDWA 2YVKA 2AG8A 2NT3A 1T29A 2FUG1 4HDRA 1T4DA 1LBEA 2VHUA 3SYKA 1O08A 1WXQA 1YK0A 1CR1A 1O77A 1V7ZA 3BB3A 2CVHA 5BP7A 1NW6A 4FJ1A 1FB5A 1T2DA 4MVJD 1NZDA 4OJTA 4XASA 3G5TA 2C8KA 3DFIA 3K0KA 3W78A 3ZG6A 4RV9A 3K9FC 1EUQA 5HJ2A 5FUYA 3BA6A 2PH1A 3FA2A 3AUYA 3N8DA 4ZAZA 5EIXA 1G41A 2ODQA 2R47A 3ETGA 3MAJA 1J24A 1NU6A 5DX8A 4UU1A 2Q8PA 4ZEMA 1M6VA 5CEJA 5JDCA 4EMTA 1EVZA 1M3SA 1GCUA 2DHEA 4CTJA 3SQDA 4CDNA 1T1IA 3ORSA 2OSVA 3UT0A 1VA5A 5ALOA 2CHUA 4IGEA 4HQLA 3ZKAA 2HHAA 1XR3A 1SEPA 2Z8YA 2GF2A 3QLTA 1YBHA 2FN8A 2WUGA 3R3XA 4WPGA 4U0JA 2MWMA 3TTUA 4BLOA 4ZYUA 3FOZA 3BKXA 3USCS 1QJCA 5CVCA 3FCUB 1WJGA 5CD9A 4W1RA 1GN9A 1T2NA 5ALGA 5ED4A 4JYPA 2D2FA 2QSUA 3C6MA 4G0NA 3HC7A 1I3MA 4NBTA 2JBAA 4OYYA 1XLWA 4OOEA 3SXUA 5JQGA 1YULA 4CDRA 3R4VA 3PEUA 4Z3OA 2CWWA 5CH5A 2ZVPX 2XCQA 1MGPA 3G8BA 3GF4A 2H1WA 4HDMB 2Q3FA 1NASA 3GFRA 4KN8A 2C5HA 4MARA 1EAMA 4MCIA 2OB1A 2OXCA 3GFGA 4ND2A 4ZI7F 4WOCA 5I4KA 2VHVA 3PGA1 2ZW9A 5H7XA 1QFXA 3AR7A 1RM0A 3FM9A 4LBVA 4UDYX 1QIKA 3ZLVA 3OX1A 4ZAFA 4QJBA 1YMVA 2Z8YM 2WAMA 4NPCA 1F0NA 1XCGB 3UUFA 4ZAGA 1B2LA 1QLHA 1FUIA 1NUQA 2WWIA 3WLLA 3L6EA 1PT8A 1TW3A 2GJSA 1TU4A 5DNWA 1O94A 1XF9A 1QGUB 3B7PA 1ZBDA 4U9UA 1WS6A 2QJTA 1JTEA 2O8CB 3LF2A 3UMBA 5CDTA 4ATNA 2I22A 5CB0A 4M37A 3K9QO 4R71A 3UJAA 5E9JA 5FUMA 1U0GA 2HRBA 3FUVA 3G1WA 3UJCA 1P6XA 1UMCB 2H00A 1Z2EA 2C2BA 1YV9A 2FEXA 3DVQX 3PNVA 2UUPA 2RKOA 1B4DA 4LJRA 2DFLA 1NT4A 1WF6A 1IK6A 1OSNA 1NOKA 3TTYA 1CVRA 1LY1A 2H17A 2V6IA 3OOHA 2ANBA 3NAGA 4LNAA 4OPMA 1LC3A 3RHTA 3RAJA 1VHTA 4WFJA 5B7PA 3UJNA 1Z0AA 2A14A 3CIFA 1P72A 1WZNA 3GQBB 1GKKA 4KLZA 3EQ9A 2GZRA 4H08A 4KLAA 4Q1FA 6Q21A 3A70A 4ESVA 2E4WA 4I4CA 3HUDA 4X64B 1N1GA 3ZQJA 4GOKA 1OJ7A 2O8NA 4IICA 3SZLA 3BGSA 4HMOA 3OKFA 2ASEA 1CUYA 2FFJA 3PXEA 2P75A 2I2AA 5AOCA 1AQJA 1Y98A 1SUIA 3A6KA 4G5GA 4F86A 3FLEA 4O2AA 1IVSA 1GFIA 1HZZC 3TBFA 3TIVA 1FFBA 2FUEA 4FT2A 2SKDA 2EFYA 1PD1A 1Z45A 3A1FA 5DZSA 5EXTA 3WS7A 3DPIA 5AXAA 5C5IA 1NAIA 2R2GA 2VJPA 3N87A 4G85A 2HXYA 4RH0A 1XXHB 4BFUA 5A4AA 4D25A 3CVUA 3N2GB 5CA1A 1NW4A 1NR7A 1W88B 1D7AA 1U28A 4PTYA 4QIHA 1DUVG 1T0HB 1G60A 1E3QA 2X8JA 1YZGA 5BVHB 2GZ2A 5C8YB 5K8VA 1OPRA 2FEPA 4QJ3A 2PKWA 4FCWA 1JBEA 1PR2A 1WMAA 2BKEA 1LNQA 2C8JA 2PGDA 4IGKA 1FW6A 1L7AA 4NU8X 5TPWB 2H1HA 3D6JA 3K0FA 4LPKA 4FIDA 3CZQA 3ON5A 3NUZA 5TB5A 1VGQA 2AN4A 2NTNA 2VDPB 1NUPA 1NUUA 4AJOA 4NDZA 2WABA 1DAKA 1NDUA 3KC2A 5JNVA 2PZBA 3GR6A 5F12A 4TV9F 1X38A 4JB3A 3K1AB 4CV0A 4KREA 1FQOA 1II0A 1CE8B 4DLRA 1W59A 1TDJA 5IUKC 5I9IA 3SMQA 3MJHA 2J3EA 1JDNA 3I4LA 3JVEA 5FTWA 2UZ0A 4TV8A 3RFFA 3T4XA 3AR3A 4B09A 5C34B 5GP1A 3D8UA 1AMOA 5I45A 4JYMA 3EF3A 2COKA 1Z62A 4BC1A 3G5MA 2QVZX 2WNIA 4F7WA 2ADOA 2GESA 2HT6A 3OPQA 3SQMA 1UXIA 2D8AA 5CX1A 4RHTA 2P2CA 1I4EB 2O5CA 2SECE 1HO3A 2XTMA 4MLZA 4DLPA 1W93A 1CNEA 2CXSA 2GN4A 3KXKA 4P4UA 3V8NA 1JAXA 3TE6A 5AVXA 1CU1A 1XVUA 4BMDA 3QVGB 2MSEB 4WUVA 2ILVA 1TYAE 3HH8A 1YZFA 1KPIA 3PCXA 2B37A 3DO8A 2QPLA 4UEKA 1PLLA 1DFIA 2OFPA 1CB7A 2P68A 5IXSA 1IWBB 1M1YB 2EZ8A 2WJIA 3D3WB 5K0CA 3JVIA 4L8GA 1GA4A 2ZB7A 4UUAA 4C43A 1FSZA 5HKBA 1TYCA 2P5YA 2FZEA 4C0KA 2VCEA 3IA7A 1L5HA 1F8YA 4JELA 2DTEA 2ZAIA 1DL5A 4YGXB 3SBXA 4DQ0A 4ARZA 1PWYE 4G0UA 2H8KA 1FP2A 3GT0A 4MVJP 4PZZA 5BQPA 1EK5A 1Z0JA 1HDEA 3S7ZA 4RQTA 4X3OA 1BROA 1SQ5A 5D5HA 2EW1A 2HREA 1OR8A 4QG7A 3LBNA 4IIJF 2RHOA 3IBYA 2BM0A 3O3MB 5AJXA 2FZVA 1LSSA 2GEDA 3LDAA 5IUJC 1U8FO 4IIXA 1GRQA 4RTRA 2D0PB 2J6HA 2O9JA 4GAEA 3EHEA 1UPFA 2KM1A 2IW3A 2IYAA 3H1GA 3HQ4O 3QEMB 3KYCA 3Q5EA 2IUEA 3F5SA 2NVUA 4BCDA 1J9ZA 1JT2A 1JVSA 1R4ZA 5IDVA 2NAPA 2HB6A 2EBFX 3SDZA 1A82A 2GBGA 1IJFA 1ML4A 3N2IA 5KSPA 1IEVA 3DE0X 1E6KA 4J1QA 3AKEA 1GT6A 2Z4TA 1RNLA 3AV3A 3MJSA 5AKYA 1R4MA 1Y5RA 2C00A 2NTYC 5G1OA 1IN4A 2YXPX 2XSZD 1GNPA 4U2BA 3NHPA 1P4SA 1ACMA 5I7AA 3UW3A 5IHPA 1H6DA 3KOOA 2F3SA 2PG3A 3LT5A 4L72A 2FR0A 2O2HA 4CETA 4COKA 4GIBA 3GO4A 4LVOA 1NF2A 2HC9A 7AT1A 1DEHA 4G1UC 2GHIA 1NVEA 3HRHA 3ND8A 1Y5NA 1HT3A 2HFJA 2FGJA 4R51A 4RD4A 1E9BA 1GGKA 1SOMA 1BVRA 1TK2A 1CRLA 4FN4A 1C1HA 4IXTA 4ZT4A 4NYMQ 3ADOA 1A1SA 3AR9A 4QQNA 4WGFA 3CVWA 3HY6A 1MLDA 1YBVA 2ODNA 4ZALA 2VT6A 2VQ6A 2ZSAA 1RKQA 4LV6A 3EPLA 1VCNA 4DM3A 1JB9A 1RXIA 2WDZA 3HB7A 5TPZA 1NUHA 3IP1A 1JR3A 4OUDA 5ADHA 4Z53A 1XTSA 2P3LA 3LRTA 1EXWA 1RPNA 1XAJA 4S0ZA 5T8KA 4BQEA 2HD4A 2M1XA 3B2EA 2ZZNA 1R6DA 2XUIA 4WLVA 1QAMA 2DH5A 1FP7A 5FWNA 3AY7A 1PZXA 4DIBA 4DNXA 1MVOA 1GRNA 1YB2A 2A9PA 1TF5A 5BW4A 1ZWKA 2JAWA 1VJGA 3G1UA 4FYHA 1LDBA 1OC2A 3E9MA 1PU2A 4GPD1 3TMKA 4GFDA 2JAUA 1JB1A 3NM4A 3G2IA 1SH7A 2ARKA 3GLRA 1ZUWA 3N2ZB 4ABYA 4EQ6B 2HJSA 4BVJA 5J43A 4LRSB 4XJTA 3EVNA 5JS6A 2B0JA 2JAXA 2BSXA 4US1R 3V7FA 3WADA 4C88A 4CKXA 1ST2A 3HLTA 4Q3EA 1LFAA 4UU7A 3LV8A 3MG9A 5DYYA 4DQDA 2XIJA 2XKAA 3E3AA 4DY4A 5MGBA 3EPJA 2J9YB 2OGTA 3NHUA 4GRDA 4M38A 1RYEA 3RU2A 3JZIA 4XCVA 1FQWA 3CCBA 4I4NA 3IXQA 5FI3A 1HWYA 3FJOA 3N7TA 3R4CA 3NKFA 5IVDA 4EG0A 1W19A 1O0CA 1KDZA 2QVYX 3LVRE 1E1CA 2JFWA 2VH1A 4MUJA 2N9UA 4OUKX 3VJRA 3PNOA 4YRMA 3KG2A 1JH8A 5H9WA 2DEUA 3K20A 1Y80A 3ORHA 3E84A 2UVDA 3ZU2A 2J0UB 1ID8A 2IDZA 3R5SA 4U5XA 1YA6A 3FDFA 1XKTA 3WYDA 4ZHQB 4GNKA 4Y2QA 1OBCA 2BM9A 4H77A 1EK6A 1SXHA 4H31A 1F17A 3P8ZA 4PU0A 2R5NA 4DDKA 3KJIA 1OGJA 4BKMA 4NJMB 4TMTA 1E2GA 5LB2A 1A9XA 3FPHA 4LC0A 3FYUA 1F6BA 3C3PA 3E3MA 3MPUA 3W8EA 4MULA 2PUGA 1ONNA 4D96A 4UBNA 1DQNA 4HN4B 2MJLA 2Z1MA 1DZ3A 2PFSA 5FNVB 2WSSD 3QWIA 4M0DA 5AFSA 2VYVA 3CCCA 2O23A 2WTAA 3DXZA 4H6VA 3OCZA 3LLUA 2RGNA 3O84A 5EXSA 3ZJ5A 4YIHA 5L3SA 4QU5A 4ZTZB 4XSHA 3W0LB 2OR3A 1T8PA 2BWJA 4J2OA 3LQKA 3BC1A 1UBSB 2Q6IA 1X7WB 5GIOE 1MJNA 1UL1X 1AO0A 2GYVA 2G9QA 1J2YA 2HX1A 5BYBA 4OAPA 3HFSA 4Q39A 3CPSA 5LD2C 3EC1A 4MQMA 5EXDA 3IS3A 5LFAA 2P2SA 2AFIA 3G9ZA 2ZRIA 5K3FB 4LDRA 1NJ2A 4N7MA 1MIOB 3NX4A 2LP4Y 5AKKA 1ENYA 5EWJA 2HMAA 4B3HA 3SZMA 4HVCA 1DOHA 4WFIA 2AN9A 1MRNA 4FGWA 1VBNA 3PDIA 1DRWA 1NC3A 4F6RB 1ILWA 4P93A 3DEIA 3C85A 4OHXA 2Y1OA 1LTQA 3HXMA 4GM4A 2X41A 3JQAD 4XJVA 4M60A 5LJIA 1L5RA 2VN8A 4UNSA 3ABZA 4X8MA 1E6MA 4DBLE 1G2PA 5ADUS 5JWRA 1K4KA 1O95C 3NONA 4JGIA 2HYDA 4PS0A 4L51A 2DPYA 4KFTA 2O4UX 2P2YA 1ZJ6A 3EUWA 1Z4PX 4KYVA 1HFKA 2C07A 3FTNA 1Y42X 1EM8A 4IRXA 4M1KA 1ZGGA 1QVAA 2LCIA 1IZ0A 2O3UA 1PCXA 4EJSC 5HBGA 4ER6A 1G42A 3B70A 3QXXA 1ILEA 3A4NA 4Q9AA 1ZPDA 3EIUA 3LL7A 1TA9A 3KIPA 2LVBA 1E96A 1P61B 2VJLA 5LZ8A 3KTAA 2EDCA 3CLRD 1DRKA 4MZXA 3H9GA 1FYEA 3ILSA 5E2BA 2GAAA 4AC9A 5JJCA 3GPIA 2YV1A 3EN0A 4UM9D 4ZEXA 2E5LB 1CUVA 1YQTA 4OGLA 2WAAA 1JHVA 3LRXA 4LHEA 4ALIA 4F6LA 4G0QA 3M3HA 1ECCA 3DH0A 5H3LA 4RDCA 5IJXA 3KJGA 4PV7A 4DCCA 3K0EA 4M21A 1BE1A 3IAXA 2RGBA 5I9NA 5CLHA 1NVWQ 4IEFB 3QPDA 2YOFA 2GM5A 2OXTA 3FFTA 2WD8A 2O3TA 4TQ9A 5IDQA 2IHVA 1UBLS 2Q62A 3OTWA 1SUWA 2ZR9A 1GYQA 2WV7A 3WGGA 3S2IA 2JFGA 2NO6A 2GN8A 3KHKA 3PFNA 5DM2A 4DCPA 4EJFA 3B51X 2WJAA 2BFAA 1XZMA 1A88A 3H5TA 3R23A 4OSPA 5LR6A 1N2OA 2BEJA 3AU8A 3RBAA 1G8YA 4RCVA 1IXRC 3EAGA 4E5NA 2PRSA 4ZCLA 1BWRA 1ITZA 2C2YA 1PJ3A 1TQHA 2J46A 4NP6A 5F5XA 4HRYA 3TLGA 3KUDA 1S8AA 1XC7A 3PHHA 2EWWA 3T3PB 4D9KA 2DR2A 2NZ8A 3I04A 5A9SA 2I29A 1R1DA 4V0QA 4BX3A 2C42A 3WWEA 2V7EA 2XTNA 3BIXA 1JL3A 3U9TA 2VO1A 4TYMA 4CPDA 2M6RA 5A5EA 1XTKA 5BXQC 1WMDA 3WB0A 3NDBB 1M2OB 2SHKA 3KOZA 1MC1A 3F5MA 3KQPA 5SV2A 5T57A 1KPGA 1NNI1 3S5JA 5BNIA 4N3GA 4TMVA 2V9ZA 1COZA 2HRZA 3PQ7A 2Q4DA 1P0PA 2X4IA 4EP1A 4GL2A 1KP3A 2BP7A 2QLLA 3RWMB 5HQ3B 1ZK4A 3KQOA 1BDJA 1NJ1A 2I6GA 3GGOA 1SHLA 1XALA 3C5EA 2YRFA 4HNAB 2JBWA 5L51A 2WVJA 2Z3WA 1U3WA 1H2XA 2HSWA 4TTQA 4F5YA 4M7OA 2K7FA 1O57A 3SF0A 1ZU4A 3JYHA 3HCPA 3RVQA 2RH9B 2DZDA 4WESB 3OEWA 1IIBA 2C0CA 2YS7A 2J5XA 2DLNA 2FX2A 4RKYA 1SZCA 3MGGA 2NUPA 3HXQA 3I04M 2X9GA 4BFVA 2C1XA 3KB8A 3NUGA 5CGQB 3A9TA 2BLLA 3GRFA 4N3NA 3RHFA 4CL2A 5T3YA 2DY1A 2A9RA 2AYXA 2HF7A 2ZIXA 4GZLA 4HBZA 1SXJE 2PBFA 3CLHA 3KKZA 4KCGA 4QVGA 3HYTA 4RK5A 4ZI2A 4RJTA 3TECE 2FQYA 3IMEA 3MS4A 2NTEA 3HN7A 4FC7A 4JJFA 2VK4A 1L7DA 1B7GO 2A5GA 4A92A 2BI8A 4JP5A 1E5TA 1RCUA 2IYWA 1WXXA 5AW1A 2VHTA 5TS2A 3EF0A 3MYRA 1A4IA 4UASA 3ED1A 3UW1A 2WPDA 1PP4A 1NN1A 2UZAA 3O8OB 1W94A 2XCIA 3N2KB 3P71T 3G17A 1FUEA 1XTRA 4K3VA 2BOVA 3B13B 4I5EA 3V1UA 1E3TA 2HWWA 2PYIA 3IBCA 5TMBA 1KI9A 2SNIE 3WGKA 3TAXA 1HYQA 3BJIC 4WDRA 3SC6A 1VE1A 3HGTA 1DPFA 1R9NA 5CLFA 4R54A 4IQ4A 3CNLA 3D43A 1CJMA 2VP3A 1Q2XA 4FMCF 3G9XA 3O8BA 1UM9B 3IA2A 3QEOA 4ZVSA 4GBJA 3OEYA 4GZ6A 3DOEA 4FONA 5B58T 4XRRA 3M2PA 2AKEA 4P3OA 1SVOA 4ZYTA 3VR2A 4KE7A 4HX5A 4RKRA 1U5BB 3P9PA 4CMJA 2ZBPA 3G2PA 3IP7A 4DR3B 2PZFA 1TMYA 4OBBA 3W1VA 3WLJA 1XZBA 3E35A 2RB5A 1G6KA 1TUIA 4A8JA 3I5YA 5ENDA 4ZZ2A 1KI2A 3VSEA 1QDUA 3I83A 1CKEA 1L7NA 4U7DA 4J4HA 4RGBA 1E3WB 4WX2B 3V8MA 5T7BA 4DB4A 2L2QA 4FC6A 1UQRA 2P3QA 2R6HA 3LI2A 4ZT6A 3SYNA 1YRQA 2QRHA 4E11A 2YBDA 2R6GA 5KOYA 3RS0A 4TRMA 2RI6A 3K4HA 3QUQA 2FXIA 3RRZA 1SIWA 3VR3A 3NTOA 4V0MA 4ZXPA 1TK3A 2QD4A 1PFVA 2RFLA 2WAOA 3JD4A 4NQRA 5MHTA 3A4TA 1YL7A 1TADA 2AEEA 2OKCA 4FS3A 4CW7A 4O4HF 5KDLA 1Z68A 3VR6H 4EAQA 2DUNA 4NJEB 4CT5A 5H70A 3VDQA 1E0DA 4N49A 1CR6A 2BKXA 3BCHA 3I8OA 3O3NB 4WXYB 3TPFA 4GEGA 3CF4A 2ZYHA 4POAA 2W2KA 6YASA 3D6FA 3KT0A 3AR6A 4UUQA 1Y81A 1ZOLA 1SKQA 2FVYA 4HUJA 3QOXA 3VU8A 5ESDA 5HUHA 4CLHA 4BLPA 4LF7B 1SC6A 2RGUA 2Y1DA 3D81A 3NXKA 1TF2A 2ZUFA 4LE0A 5DBIA 1KK1A 3V1NA 1BGVA 1KR2A 221PA 1U80A 4G1CA 2AA3A 4LRXA 5CFLA 2CT8A 3IEXA 4MQUA 1G6OA 4TMKA 1Z5OA 4LSGA 2QL7A 4OP1A 5CYGA 4KXMA 5K0ZA 1YU6A 3H5NA 5K0EA 3O8QA 4WBSA 1SZJG 1Z5GA 2QM8A 4MQ4A 5CDHA 7MHTA 3UXYA 1TFRA 1Z9BA 2OCLA 3EWSA 3GCZA 3WL5A 2AE2A 4F06A 4ZCPA 3VTFA 3JAMA 2OBXA 4KGZA 5JFTA 3UC5A 1NXWA 5L4LA 1VLLA 2CJXA 3WWDA 1E64A 2ABWA 4I0WB 2XDAA 2WKPA 3NHBA 3PV0A 4QUGA 3ZYCA 3N58A 3NBAA 1KI6A 3OIDA 4YLYA 3VHQA 5F5LA 3L92A 4MJ3A 4JUAA 4UD6A 2JGDB 1HE5A 1WUKS 1QP0A 2QR5A 2WG1A 3Q98A 2RCNA 2FFRA 3UWPA 1KH1A 1RHQA 2Q29A 1E9RA 3ZGXA 1BJKA 1RYZA 3O8NA 3RBZA 2IUSA 4ZOEA 5HKLA 5LDHA 2ZYRA 4GR5A 5EG5A 4EF6A 3EGVA 4Z8YA 3GEEA 3ZQKA 2A1TR 4MEAA 3LGXA 2H92A 4IS3A 2XYPA 5A1JA 1H5QA 3NASA 3W04A 1KIFA 4OKIA 4C4XA 1H69A 2ZVJA 4LHVA 2BBTA 5JD4A 4L4SA 3INNA 3TZCA 1JFLA 4Q1AA 3DLBA 4B45A 1PJSA 2QW1A 3G5UA 5CIWA 1LU9A 1PT7A 1SOAA 4MI3A 3ASZA 2E49A 1WXWA 2I87A 5AO9A 1W35A 3INRA 3ZK7A 1C8BA 2G4LA 1IH8A 2YXDA 2IXTA 5G4KB 1Z82A 5IYZB 1MA3A 2B7LA 1FP4B 2OAEA 3EQ2A 2YQ4A 3D7KA 1SHTX 4KN5A 4XD7A 4UU0A 2QT0A 4N5LA 3ZNNA 2G0AA 3BD8A 3IL2A 4Z4QA 2BHLA 2JCBA 3NJRA 4GOND 1M34A 1OF1A 5EZYF 4N5DA 1PWZA 1RABA 3GGGA 4D02A 5I9BA 1M1NA 2FWAA 1YCFA 5C1BA 5E38A 3CR7A 4I9FA 4NVRA 1EFPB 1JDJA 1MO2A 4XZ3A 5DWQA 1J07A 1IE3A 4HI0E 1CB0A 1N57A 3U4AA 2ECQA 1ODKA 4OI2A 1P6UA 1SZDA 1R4NB 1TVKA 2R3SA 3G2LA 4NE2A 5CX4A 2O05A 3ZWKA 1UC4B 3VSDA 4YRIA 1UDBA 1P5JA 4B44A 5D86A 5LLTA 5FHQA 4JQSA 3FMOB 5B1YA 1ACJA 1D2RA 4WBNA 1MOQA 1GDHA 1BEUB 3F3YA 2R68A 2Q5HA 2WIFA 1ZXBA 2HLNA 2XQKA 5AD1A 3KQVA 4D1YA 4CEJB 3D7RA 1SK8A 2HUPA 4DJFC 4R1LA 2EW8A 2VJDA 3DNFA 1A5BB 1L8QA 2FLKA 5LYJF 1GARA 4YPFA 4PG7A 2JF0A 1IVNA 2HAEA 2PRIA 4TMZA 1S8NA 3KB2A 1W4AA 2V03A 3ZD8A 3OEHA 3DHEA 1SBNE 4EGSA 3EX7C 2XX3A 2RGYA 2XVYA 3TLZA 5LQKA 2CBGA 2ZUVA 3MINB 2PFKA 1M2HA 3JQRA 1CX9B 1M1UA 5EJ5A 1BFKA 3QHQA 5ECYA 4AJKA 1M2GA 2B1RA 1N3LA 4GI7A 4KVGA 1GSAA 1W9MA 3LUHA 3WHKA 5KAPA 1ZD8A 4GP9A 1ABFA 4ZAXA 3KWLA 4KDEA 4M0UA 5F23A 2PCJA 4P5DA 5BRNA 4B6PA 2ZATA 1HI9A 3LX6A 4B82A 1T2VA 5A2QA 3ND9A 2GI4A 2BUCA 4MYRA 3HO8A 4R2KA 4YCCA 3LLVA 4MYTA 5B1EA 1TT7A 5LQDA 3TRHA 1BCSA 3SSAA 4IVNA 1Y7LA 4JLPA 4UQOA 1TMOA 2D1YA 4Q4HB 1DKPA 4H3VA 3N8GA 4XQEA 5A4MS 1E7MA 3O38A 4MKHA 4A6EA 4C07A 4K9MA 1XP5A 1V9CA 4B3XA 3DBLA 1ONPA 3IPXA 1EG7A 2IEIA 1FS4A 1Q1AA 3U3DA 4BBPA 1CY6A 2AZ4A 2ZDGA 3KE9A 1JHYA 3T7CA 1JIVA 3R7NA 2JI8A 3C1UA 1RLJA 3AKYA 3IRVA 3DGEC 1B42A 2GO7A 2C58A 2Z0MA 4R9SA 1DKUA 5GVSA 1OMOA 5IBQA 4YJ2A 2AMVA 3SG0A 5A0TA 3MBKA 1TO6A 3CF2A 4OI0A 3B38A 1J0AA 3MQ2A 4QNNA 3M9WA 2R7KA 4X93A 1DARA 1ENZA 4RLHA 1YE5A 1UAGA 4R2XA 2WG0A 4JJEA 3DFZA 4A91A 3ZZ0A 3G3EA 4O2BA 3KV1A 1TCVA 2X0FA 3EIHA 3W6OA 2FPPA 1C8LA 2OV6A 3IMFA 4LXTA 1WCYA 4YO7A 2FV8A 5F51A 1D2AA 1Q1ZA 5EZ5A 1XPUA 4HLNA 3SKVA 2QN2A 4X65B 2O8DB 1XQ6A 1ZOSA 2HWUA 2H3HA 3JAWA 5EWLB 4OI1A 2WU0A 4DVJA 4EOGA 1YF3A 1IK4A 2J9XB 2Y0BA 3EVEA 3LPLA 5CVUA 3OJWA 1J8DA 1F06A 3GXOA 2DTXA 2L17A 3M4ZA 1U8UA 3TRKA 3WICA 2JFUA 1CIPA 2FRXA 4G5FA 5I9TA 2H4WA 1QIDA 3R24A 5FBVB 3DOHA 1PJTA 4Z1MA 3GQVA 2KS6A 4Q7LA 3HBLA 4YP6A 2E48A 4CKZA 1OWOA 2AK3A 2PSFA 4EUKA 5I7RA 1YR2A 4LVCA 3NH6A 3WTCA 3U1BA 3ZDAA 5DO9A 1XTUA 3AIKA 5FR2A 3BD6A 2QGFA 3ADPA 3QEJA 4XQ0A 4EY8A 1I2ZA 1LLDA 1G7TA 1T8YA 3R3SA 4N7JA 5IP5A 3FYTA 4DV0B 2ONCA 1W4BA 4QFMA 5C3UA 4GG1A 2WVHA 1E1QD 2EATA 2IY9A 2BGMA 2QYTA 4P32A 2HF2A 4OXKA 4CGYA 4RCYA 1V5WA 4EB6A 2J0EA 2C5LA 3UT6A 3EXFB 1OIWA 1P74A 3WGIA 3GG2A 3QPWA 4G4GA 5CLQA 3UKDA 2P9HA 3CW9A 2PS0A 1EVYA 1GL3A 5AM2A 3GLSA 2B0CA 2ATVA 3IULA 4QYXA 5A3RA 2GFQA 2VOJA 2Q41A 1I3KA 1L1RA 4NU6A 3W06A 3CZMA 4XLLA 1H22A 2FUKA 1B74A 3LHKA 3LUDA 4YPVA 1IEWA 3HJBA 5IKEA 4MB6A 2GXSA 5TSDA 1T2AA 3C24A 1UJBA 3HSKA 4CM9A 1YL6A 3KJHA 1JXMA 1K7SN 4LFCB 2FMIA 1ZJ4A 1G3MA 3CKMA 4X6XA 4NENB 4XVQA 4LQDA 1HEUA 2J4CA 4CKEB 5LOVF 1QUFA 3SSMA 1EBUA 2HCBA 1NWCA 1G20B 3M2TA 2VJMA 1Z5UA 4AMBA 3EGEA 4Q7MB 1MEJA 3OE4A 1WW3A 3PUWA 2X1VA 3DV0A 4HLUA 2JCSA 1VSQA 2YMPA 1H9CA 4KOEC 3C70A 2X8LA 3NC1C 3KUUA 4FDLA 1NR5A 1ZNXA 2LE0A 2NO9A 5F1KA 1HYBA 3BWVA 2ID8A 1XPOA 2AK2A 4CM8B 2FSHA 3NBZC 2VR1A 1RAGA 2P5UA 1K5DA 2W2LD 2WLSA 3AY6A 3GDHA 4JOBA 5TGZA 5TMDA 2IH5A 2FWIA 2X15A 3NNDA 3R7LA 5AKIA 1Z13A 1Y4DE 2JI7A 3LJKA 5KOHB 4HXGA 2VT2A 3M6IA 3I1YA 3NBKA 2O20A 1W85A 4KXQA 1NMSA 4M46A 3Q2IA 4P38A 4PTZA 4QHSA 3TDKA 5CDFE 7ADHA 2AOUA 1VJ5A 3WGQA 5A1TA 4JT8A 1XMOB 3WA7A 5JTTA 1RRKA 4OMFG 1P1FA 2FRVA 3EZYA 4JZYA 4BFCA 4EHLA 1KC1A 1T1GA 3BPSA 1Q19A 4PLTA 2B9EA 3HADA 1PZEA 3BXGA 5J5CA 2VDQB 3Q7QA 3UMCA 4C2AA 5JV5A 4RKQA 1J22A 4CLRB 5J3JA 1VL5A 2PS9A 4LBYA 3BG5A 1VE6A 1KI1A 4PPNA 3R7FA 5AJUA 3RARA 2C2ZA 4UOEA 4D97A 1E1YA 4RH3A 1A2OA 1HYHA 3VPFA 1ZKDA 4YT8A 1F6WA 4DQKA 3UXEA 4MI6A 3CB2A 1EMDA 3I92A 3NV9A 2IA5A 1L7XA 3EQ8A 3GLTA 2D1FA 3I72A 4KO2S 4O02B 5J2TA 4JKYA 3PXUA 3E03A 1CR4A 2MU1A 3FPLA 3H6GA 3HWRA 4GGPA 1Z29A 1UKEA 3E9QA 4F1KA 5C7LO 3T1TA 3LOUA 3UEOA 1YU9A 4U6SA 4X5OA 1UWLA 3G9QA 2GCOA 3FUXA 1EP2B 4LQCA 3UYLA 1Z6PA 2PJDA 1KGSA 2Q3CA 6AT1A 1E63A 2JH9A 3LY9A 4GOLD 4B6EA 4YHHB 2BGWA 3OZSA 4TXLA 2WKQA 2QMQA 1RVDA 4IDCA 5LZ4A 1NVXQ 5J23A 2ZUUA 4C7OA 2CXPA 4QQRA 4OBXA 4C78A 4E7PA 1DIOB 3SFVA 2FPGA 2P9ZA 4AYTA 4FKZA 3COVA 4IXDA 5KJ6A 4RTNA 2FWMX 1UJ6A 1NHWA 4F4HA 2HRCA 2JFOA 2FSSA 1BWSA 3EZ2A 1C3VA 1SUDA 4WLEA 3VPAA 4CIYA 5KNBH 3JQCA 4LFBB 4R5HA 2FPMA 2J9FB 5I7VA 1OYVA 2GCEA 3HJRA 1KWGA 3KL4A 3OE7A 2IU4A 1E2QA 5KYGA 1Y6JA 1IBRA 5AOBA 1KJQA 2BFFB 2XE6A 4MW7A 3F67A 1V4NA 3R9IA 4ZYXA 2PVPA 5A06A 1PNRA 5IASA 1C7EA 3BILA 3GD5A 4KI7A 3R0XA 3ESAA 3CINA 3L6DA 2YWXA 5BUZA 2OBLA 1C4KA 5C9ZA 2NZYA 5T67A 1HKHA 1CUEA 3V00A 5EEGA 1E6CA 3GD7A 5BVGB 3BQMB 3KOUA 4HZIA 3W5UA 4AF8A 3JVDA 4WGGA 4EZEA 1DO2A 4B7ZA 1QH8B 2WF5A 1ZC4A 4J3JA 4PN3A 5A02A 3U7QB 1X14A 2NZ2A 1PNVA 3EEQA 4WCFB 1Z8HA 3REOA 2B78A 4FHCA 1IJKA 2X1LA 3HU1A 3CRVA 3NHYA 3PCTA 3KBBA 5AI6A 2VJKA 3E48A 2PGIA 4FM9A 2B5VA 1TCCA 4YP1A 2XCSB 1WKCA 1YQDA 2XRFA 4MWEA 5HKAA 1YQUA 3ZQ4A 5L3RA 1OX6A 1RLIA 4BU0A 4EKGA 5DWVA 1A4UA 3H86A 4MWGA 1M8JA 2PRJA 3MLAA 2QD5A 3WL7A 1KMHB 3BFVA 1RJ9B 3SIRA 3SGLA 3SE7A 3FSGD 4J0KA 3PNMA 1YA8A 3UMVA 3KZNA 1JYSA 1E6WA 2DWQA 2O5EA 2Y1CA 4QO7A 4JJ4A 2C92A 1RRGA 2YHUA 4JAVC 5JOQA 1LLQA 3IUQA 2HEIA 4WZZA 1B6SA 2HMYB 4NEQA 1AVTA 5EMLA 4ARSA 5F2KA 4C7MA 5K01A 5ALIA 3GMTA 4J0CA 3VR4A 3ZE8A 4CIBA 2ZRMA 2JLWA 3FCOA 1DIBA 3AOEA 3UJ3X 5JCJD 4YRQA 3DUFB 3MWEB 3O21A 1ZONA 4OFBA 1FFAA 1JKJB 1RWBA 3FMVA 5DIFA 3WKAA 2ZXEA 4YASA 4LGYA 4GGMX 4J43A 4LYAA 5TJHA 1W52X 1Z6GA 4M0EA 4U8GA 4H6PA 4JUIA 4B87A 4D4JA 5JZ9A 4QDZA 1B1CA 1JDBB 1P5ZB 3KXLA 2WDPA 1Q7EA 1JZSA 1Y8QA 4FD3A 1E6EA 4HYTA 2Z6VA 4WL0A 2VBIA 2PUWA 5DT2A 5LP6A 3I2JA 5JLAA 1RU3A 1X3LA 4YR9A 1K5HA 1M72A 1O5IA 1LPAB 2GTHA 3UV6A 4N54A 4F12A 2HNBA 4B40A 4R9UC 2BFDA 4Y18A 2VSNA 1JNYA 4UVIA 1BGWA 3VV2A 4L07A 4EMSA 2QQEA 4M83A 3DWGA 2J4DA 1CXZA 2CLHB 2I6QA 3IQFA 3R2JA 3L7KA 4DQUA 4R2LA 1FTWA 3SVZA 2X5KO 5FL7A 3R41A 2C95A 3HUUA 2BMDA 4RAQA 5ALDA 5GTDA 2DU8A 1D09A 2ZYDA 3R20A 4URUR 5CXSA 3JARA 3TLEA 5KVAA 4P4NA 3O2NA 1H5UA 2KX7A 4MCJA 2B82A 2DBYA 2SKCA 2XCLA 3P9IA 4PR0A 4C87A 4EO9A 5AUPB 5BMVB 4GE0A 2WPNA 4N5NA 2ETVA 1KETA 4YWHA 1VSVA 3HO6A 5AHXA 3I9OA 5T5QA 3K8YA 5JNLA 3C6BA 4EENA 2XVXA 1YDEA 2G8LA 3AX6A 3RIGA 2ZLBA 3BCUA 2CUNA 3DW3X 4HJRA 4J7XA 4KO3S 3TZBA 5HP4A 1NBIA 3FDJA 1P1BA 3D9QX 4TXMA 2YY5A 3QA9A 3TNYA 3K0SA 5AR1A 3G1TA 4WXRA 4XWKA 4IYRA 2BR4A 3D31A 3QBTA 2A7XA 4A2PA 4U02A 3VKWA 2HO5A 5JBIA 5CUQA 3CRQA 4ZOAA 1T1EA 1K3UB 4E4YA 2D7DA 4HFRA 4MHSA 1XUOA 1QHNA 1YC5A 2IYSA 4OL0A 1O8CA 3BREA 3O95A 5DLPA 1YRBA 4O4IF 2NQTA 4EIWA 1E66A 4IIDA 4M0KA 4X1YA 4S1OA 4DDUA 1G21E 3Q10A 4UMDA 5KWJA 1D2EA 5F5NA 3CN9A 1OLXA 3NC0C 3TJZA 3CRMA 1Q3TA 2FEWB 4KQXA 4FCTA 4XGKA 3TZHA 3U1VA 2H11A 2W2KB 1KYYA 2R7AA 3CSSA 4HZUA 4IGIA 4L5JA 4NCKA 3KFLA 3K5PA 1JRLA 3ZBQA 1M0WA 4ETMA 2NXCA 3NIFB 3I8SA 2HM7A 2VKTA 3BRWD 2Y27A 4OB8A 2ZVDA 3ODGA 3TMYA 1LRJA 1J2JA 1ZOPA 3B6IA 5LN1A 4I1OA 4QG3A 3SXJA 2W58A 3EBLA 4WASA 4PTLA 2WSSA 3M1LA 3PC7A 3MCAA 1X8KA 3K6JA 1DXYA 1KFBB 2A35A 2YOHA 2RHTA 3A1EA 3L3BA 1SOWA 3P2JA 4MS4A 3JTMA 3BHNA 4NDNE 4ZO9A 3TRIA 1WTCA 5KQMA 2CDAA 2BTOA 2R8OA 421PA 1SB8A 4XE5A 3O90A 2VPZA 1BS9A 3NALA 1HPLA 3ITKA 3SHOA 2UYCA 4DHWA 3E5RA 2CFCA 3PHIA 1PRYA 2QTVB 3HG7A 4L95C 4Q4AB 1JG7A 2LXNA 3C14C 3GEHA 1KO5A 2XB4A 3S28A 2QY9A 1XPRA 1HG0A 1OYOA 2BHTA 1KI7A 3B7GA 4NFSA 4YAFA 5FA5A 5IAJA 3FY4A 4JBLA 2F8TA 2GZDA 5HIKA 2OV3A 1L6RA 4MUNA 2IP4A 3BORA 4I08A 2VHJA 4YAGA 4HNTA 4HNUA 1L2TA 4NNPA 2YQ5A 1VKNA 5TRTA 4HDQB 3IKLA 1TM4E 3QU2A 2QYSA 4YRLA 4C3OB 4EO7A 3THWA 4YAJA 4II2A 1WDLA 2BEUA 1YVRA 2NSYA 1PFQA 2XUGA 4MMXB 5AH0A 4HAVA 1PGOA 3I12A 4URWR 4YP0A 1UFQA 1XOIA 3SFTA 4M6WB 1W6RA 3GRPA 1QMPA 2RG1A 2BJHA 2OG2A 5IC4A 2GN6A 4CKBA 5JLJA 3BTVA 3GJ7A 1CZKA 3K5IA 2LCQA 2PY6A 1RQRA 3BL8A 3PR2B 3TR5A 1LLFA 1J21A 1SUBA 3RDPA 1U6KA 3CFYA 3DFUA 1J8YF 1LW6E 2WNHA 2XOEA 4HH0A 1SHUX 3C3AA 3DZIA 4R8RA 2UVPA 1M34B 4YAUA 2NAFA 3IQDB 3RJZA 3TCKA 1SFRA 1N3YA 4DMHA 5KYXB 1E99A 2BELA 2CXQA 5EHQA 1MX5A 3UMJA 3WSVA 2AW3A 2QA5A 4Y6RA 1XAGA 2WHXA 2BF4A 2QR2A 4CIVA 2F8SA 3E23A 3PKZA 3HUEA 2Q4BA 3QK7A 5FBKA 4BWFB 2M9MA 4NZPA 4UUBA 5JAQA 5JAOA 2JIQA 2Q5IA 3ZBUA 4EEZA 4ZO8A 4PAQA 1Z39A 3LT1A 3RJTA 2C2XA 2CNBA 2OXIA 3MQ4A 3RIEA 1HV8A 1FRVA 1WHTA 2PM8A 2WI8A 1P1KA 3KOXA 4Y6LA 3SMVA 2V7QD 3X1JA 1SKYE 4Y98A 5KWEA 4JITA 5L3VA 5ALHA 4TLEA 2JGIA 3G2HA 3IVGA 3WLAA 3LDFA 1QRDA 2MSCB 3EG5A 4IUDS 3SYRA 4NH0A 4WBNB 2ZI3A 4D81A 1MAAA 4KDRA 3EPPA 4ADSG 3DR5A 1H85A 2AMLA 3A6EA 2MR6A 2H08A 3AYXB 2B1GA 4OQLA 5EC8A 4UBOA 4OBEA 1V3TA 4XDGA 4BBAA 1P0FA 3KSUA 5JUWA 4KIFA 2Y6UA 3U16A 3H1PA 4HSGA 1GV1A 2QV0A 3PXDA 5DKFA 4BMSA 3GL9A 2NO5A 5CYPA 2I8AA 2CZQA 5GWXA 1SG9A 2YX1A 1VPLA 2CHFA 2CD7A 3PPWA 4NZMA 1TU0A 3PYXA 1FZQA 2VSQA 1K6IA 4KAXA 1E2MA 4Q12A 5F2EA 3L7JA 4J0HA 3H1AA 3ZE9A 4C3UA 5CG1A 3HO1A 4I1PA 4QGFA 3OA0A 1ONBA 2W0SA 2Z8XA 5FADA 3OD5A 4PSVA 2PS3A 3B1ZA 4OM7A 4CF3A 2ODAA 3N3BC 4XLZA 1SXJA 3AZQA 4P9NA 3AV0B 3W2EA 1MDBA 1TYBE 4OQPA 4WXHA 4HK4A 2YXLA 2AG5A 3I37X 4HDSB 1F6DA 3QOYA 3ZOZA 3FNRA 1HL7A 1QAQA 1N5LA 5HQ3A 1UDXA 4NNJA 2J4FA 3L7IA 4Q18A 5CW2A 3MPOA 3HZRA 4XIGS 5FV7A 1JNXX 1LI7A 2VF4X 1CV2A 1FY2A 1ZL0A 1DAGA 1GN8A 5D1NA 5TQ0B 3SR4A 3T1OA 4LOKA 5C8ZA 1VKRA 1IYZA 5E2IA 4QBFA 1V39A 4ZT5A 5K3SA 1VLQA 4BIMA 4X66B 5JVDB 2W6JD 3DQZA 1Y6ZA 4HAIA 1PSZA 2WHPA 4L1KA 2KB0A 5IF9A 2GN1A 4NHEA 4CXMA 3HXKA 1Y34E 4R1OA 5AKXA 3RRFA 3WJ7A 4B6QA 4N76A 1L9XA 3CLSC 3MWJA 4IRUB 3ZJTA 2JVJA 1Y5LA 1KO7A 1OT3A 4W63A 2VDWA 3NW9A 1A9SA 2DYKA 1M2NA 2R0QC 2OV1A 4CZ2A 2ZYWX 3AW8A 4OKNA 2IDKA 3QF7A 2N1MA 4QL3A 5WRFA 1AZSC 1KSHA 2VWQA 1XKLA 5BNTA 4KI0A 1C3LA 4I4IA 4W9NC 5IHXA 1WEKA 4QXQA 1JFRA 2HLDD 3NBMA 3WLNA 1WRBA 4I9NA 3BDAA 1R6TA 1F2TB 2EKBA 4I4LA 1Q3KA 3ZNPA 4Z4HA 2AQKA 3IDFA 4H6WA 1DIAA 2NQ8A 1I30A 4BPRA 3PB3A 2WTBA 1L7OA 1EDBA 2XCUA 3SDBA 1VHDA 2NO4A 1IL0A 1MO4A 2PMBA 3L0ZA 3OZAA 4Q34A 5CH8A 5BPFA 1NXQA 2XZPA 3SE0A 1MABB 3JAWB 1SU6A 2JJ2D 1ENPA 3VVLA 4B83A 4PBSA 1F0YA 3OFND 1UMKA 3DZHA 3I76A 3LUGA 4YMGA 3WLHA 1TAUA 2IYRA 1A8QA 4QXPA 5HCUA 1Z8NA 3N39C 4NONA 2DSNA 1VBKA 2IGTA 2VHXA 1ZH0A 3ZPXA 3HB0A 2FGKA 4E88A 3HSYA 2PEZA 4ROSA 4EECA 3ZOKA 1G16A 2GAJA 4ETIA 5H3HA 2QRLA 1ADCA 5EE5B 4QO8A 4UE2A 3WRYA 2F7SA 2H4JA 4CODB 1KI8A 3AY0A 2JFXA 2J3DA 4MICA 5HGXA 1SVIA 3BH6A 3PUJA 3BXFA 1PJRA 1B00A 3CE9A 3OZWA 3M9LA 4N3BA 5IM5A 4RJKA 2I6TA 3MCWA 3WX0A 4F45A 2NSHA 3QU9A 4OA8A 4X54A 5I3CA 4UCXA 4PR3A 5BWBA 4PC6A 3T1HB 2BSAA 1N2EA 3DXFA 4GZ3A 5B4VA 5DCUA 5AK3A 1JJFA 5M34A 1HE2A 2YHSA 2BR3A 4EB8A 4P22A 3K72B 5J59A 3SS9X 2OV8A 2QN1A 2GTPA 1QX3A 5FORA 3GUVA 5BPHA 3NHKA 2IXFA 4ER3A 5CFPA 3D8HA 1PX2A 2FG6C 1V3VA 4P4GA 3KVRA 4BMVA 1CJSA 4FX5A 1K7CA 1U3TA 1Y7PA 1N2SA 2P4HX 2K5UA 4RVUA 5IVKA 2F8LA 1HMPA 5EIAA 2OORA 1Y3AA 2FPRA 1AHIA 3FNIA 3H2BA 3LW8A 2GZSA 3ECCA 4HBGA 1QYXA 4J94A 4DT1B 3F49S 4JVSB 3ZE2B 4AI6A 3BS4A 2H5EA 4Z99A 3NRBA 3A1SA 5DTMA 1G5PA 1XROA 2FHPA 3H5AA 3INTA 3DLPX 4AP9A 2WC1A 3VO9A 4L0CA 4CG0A 1FXUA 5JSZA 1MPTA 1K75A 3R0VA 3IHLA 3C43A 2G04A 3V1KA 1BMFA 1JVNA 4TWIA 1UXKA 3GGPA 4MKGA 3OJXA 3GZTB 1UMDB 1TC1A 4R3UC 3TLBA 4WJKB 4D99A 4MK4A 5JMOA 1U4OA 4E94A 3RUDA 1V11A 2P79A 4NATA 3RQSA 3RS9A 3LBIA 3AVPA 4WNAB 1KGDA 1PWEA 1XZHA 3LCVB 1M2WA 2ZTUA 5HA5A 2QLJA 2F1IA 4JBYA 2B6HA 2BFEA 3IOYA 1JQEA 2ZT5A 3KP1A 3NYWA 4JBWA 1UFOA 3BK1A 4ZDIA 2VWHA 1NWHA 3VZBA 1DG9A 1R12A 2W9XA 3NWBA 3RNLA 1SULA 3RSLA 1JKIA 2ERYA 2Z58A 5BWOA 3GLFA 1KK2A 3OCJA 3R9XB 1EU1A 1JU3A 1OV6A 3ILYA 1N2CE 1Z6YA 1K63A 3X1YA 1VJCA 3QGMA 4QGHA 1SA0B 3FDZB 3ZGZA 4A82A 4DUYB 4QDUA 3GVHA 3L8HA 1D4OA 2L69A 4BZWA 3N5CA 4MW1A 3P9RA 4TKVB 2DFVA 3F4KA 2GJ8A 2HBRA 2GRUA 1DTWA 2JFZA 4FX2A 4YFYA 5ALPA 2GK4A 3I2FA 3KTFA 2CCJA 3THXA 1SHZA 1EX9A 3VFDA 2X6RA 2MMCA 2ZE8A 1ZIYA 1P2GA 5DTQA 4BMZA 4EDFA 2IEYA 1QHXA 1DADA 2O3JA 2VC2B 1THMA 2VEOA 5KJFA 4KGDA 1KXZA 1FLNA 2XT9A 2CFRA 2YRWA 3UENA 1SNYA 2O7QA 1PQWA 1SO8A 4I7EA 1J42A 2ZBRA 4EBBA 1FPQA 1LVUA 1WXDA 4KHPB 2JAHA 4Y7DA 3G0IA 5C1PA 1BCRB 2G07A 4MS3B 2OGUA 2BF7A 1FJXA 4BO2A 5IM4A 2IZ5A 1BC5A 2GCOB 1J1IA 4BATA 4UXIA 1U94A 2BMFA 1AKEA 2ZTVA 2JI4A 2FP3A 4Y67A 3P97A 2ZJ8A 2UXDB 2PD4A 2ORYA 4PZYA 5GINE 4BPBA 4N6OA 4YALA 2IHTA 2OK7A 2ZWMA 1ZITA 5HK8A 1FX0B 1UCFA 3NKVA 4GICA 4W1PA 5KHAA 3SHVA 4QDTA 2JEZA 4I1UA 4V1CI 3F8TA 3CE6A 5MDHA 2LPMA 2CSXA 2ZSDA 2QV7A 4QE3A 2P67A 1UBUS 2VDLB 2W43A 4D4LA 4YCNA 4RU1A 2NU9A 3OSZA 4FFBB 3WBBA 3W7BA 1B8VA 1E1RA 1FYDA 3PTZA 3NBFA 4BKOA 4EY6A 3DTVB 4PG8A 1LBIA 3HKEB 1A98A 1L5NA 1VG9B 4DWWA 2ZCVA 1F9AA 5TDHA 1N8SA 4RNDB 3A1CA 1YDFA 4PPGA 4X8LA 1XZ8A 3LXUX 2DHQA 4L0QA 4QTUB 5KNCH 1CUGA 1UPCA 2F62A 2UYQA 1U2RA 4NV0A 3LHFA 3PGMA 4BUJA 5ALWA 4DR6B 3PIDA 4WLOA 1L4EA 4ZAWA 4ZU6X 3MGCA 4X1IB 3T61A 1W47A 3V4SA 4UHKA 4TLBA 1QP4A 5A7FA 1JUDA 4Y2HA 4BFSA 2IIVA 4LJ6A 4AF6A 1E61A 2FRDC 3WQHA 5JS1A 4M8NE 5KX5B 1ZGAA 1LI5A 3A1NA 1W0KD 3RG8A 1RPTA 1GUAA 3V7WA 4DC9A 5BW6B 1KBQA 1Y8RA 1UBHS 2OT3B 2WSBA 1JQ5A 4YJ3A 1TJNA 1RYFA 4MV8A 2EZUA 4DL9A 5J4YA 3CM0A 3PXBA 3NWOA 4Q1VA 3DTVD 1DIHA 1YMUA 2R7LA 3B85A 1DXQA 3M4NA 3SY8A 3MAGA 4L27A 1L3IA 4PQEA 3DBIA 5FUWA 1N6RA 1RZRA 2EDAA 4Z4EA 3V7NA 1U9IA 3E82A 1B26A 1UQUA 4JBXA 5IKXA 1CK4A 1GG5A 1KNQA 3G5AA 3B78A 5JQGF 3GA0A 2G36A 2PD6A 4LOIA 2FDCA 1X6VA 2J3KA 3EBPA 1DBIA 3L4JA 1VE7A 4NFYA 1KBZA 2O1WA 2TMYA 2JJ8A 1KMQA 3ESXA 2YWJA 2XUOA 3MNFA 3RT1A 4GU5A 1NMXA 3OPYA 3HXTA 1IQ0A 2W4IA 2B20A 2XAUA 3RANA 1FDWA 4N3CA 3KHTA 3U7EB 5DTJA 1AF4A 5E3JA 4K6OA 2KJQA 5TC4A 3LKZA 1GKYA 4Q3LA 2V4MA 3RC8A 3A2NA 2D2EA 4KQKA 5EQJB 3JASA 5HBRA 3FTFA 1EFRA 1HSOA 2WUFA 3SOZA 1NN0A 3M6FA 4EX6A 5LP1A 1EVIA 2YVUA 2YYZA 2HDWA 3WWZA 1CR2A 2R6AA 1KEWA 3BD7A 2QN3A 1ESZA 2REQA 2ZCUA 3EXEA 3ISJA 2B30A 3F73A 2GZHA 5DNEA 4QFBA 4XIFA 4GPBA 3FVRA 4NHOA 1XJQA 5DSZA 3LOPA 4JQOA 5TF4A 3OT1A 3P19A 4GEKA 2HA4A 1UOEA 5J9FA 2VQ3A 3GP5A 4A16A 2EFDB 1Q12A 1IPFA 2XGOA 3A0RB 3HJFA 4ML3A 1NJSA 1NVAA 1J99A 3QF4A 4W6ZA 1KIAA 4EQZA 3L93A 2OGSA 2DPLA 1G9SA 5J2UA 1Z75A 5EQDA 1QGZA 3D7NA 4WKCA 1XPJA 3AESA 3U3KA 4UXHA 3TR6A 4Q15A 1QGED 1R18A 4QHTA 3SZOA 1FDTA 2EGHA 1NQXA 1U1CA 4TYQA 1I8TA 1WUIS 5COQA 3SQOA 5DP1A 4DYHA 5KPDA 1QHFA 3UTDA 2VUIB 1TPYA 2C3PA 1I7NA 2PEYA 4HDNA 4DR7B 3QE0A 2ORED 3WI7A 3COYA 3O47A 4PQGA 1NLFA 3THRA 2WQ7A 3SIPA 1H1LB 2GKSA 5FBQB 1CQIB 2F48A 3SJUA 4RHFA 4IEIA 4HLCA 1N6PA 4O2AF 4ID9A 1T8SA 1Z0DA 3OZGA 3PC6A 4HDAA 3OP1A 4JU9A 4RK6A 3ZI0A 1URPA 5BN1A 3N3AC 2W42A 1IATA 1V16A 4XD2A 4ERXA 1YQXA 4D79A 2ZQZA 1GAWA 1E60A 3P5SA 4IIBA 5CA1F 1SUEA 1H42A 4Q3OA 5F77A 2NU6A 5BSVA 4O0LA 2CLIB 4D8TA 2VH5R 4DAOA 5K09A 1TO2E 2IVFA 2M1ZA 2PKXA 1CHNA 1BHO1 2ZZKA 4NCHA 4U9HS 3LLMA 4F8JA 1DCMA 3A6DA 1R6AA 4EFNA 3COPA 4IVRA 5CLGA 821PA 3FYSA 4JLMA 3EXG1 3LPCA 2QP9X 2C0QA 4L9AA 2D4AA 1TGYA 4G23A 4Z9FA 3STVA 5LQJA 2C5BA 4BO7A 3WBJA 4ND7A 1JFVA 1P9WA 5H1YA 2A8YA 2GN9A 4F60A 1PLJA 2GN0A 2PD3A 5IU6A 1HOTA 1YACA 1ZM3A 4RDIA 1KO4A 5ALVA 4MJXA 1YBMA 4I1YA 3LWDA 4DNPA 4M9ZA 5AXCA 1DDOA 5C1OA 5CDFA 1XHFA 1BGXT 1KYZA 2PO5A 4IY1A 4AZ3B 4FYPA 2QX8A 2P2GA 4FOLA 3AHEA 4TV8F 5AW5A 1Q1QA 3T99A 4R0NA 1QIHA 5FV4A 1Y1RA 2XPCA 4KN6A 4PCVA 621PA 4M7WA 4F46A 3IOCA 1JLLB 2COEA 3F5QA 5I7OA 3MWKA 1XZCA 3VZQA 2OQVA 5FPYA 1N5MA 1YFJA 2VS1A 3DC2A 4X9XA 4K0RA 3NORA 1PG5A 2OFWA 3HYRA 4KUEA 1ECPA 3CUYA 4PF1A 5FT9A 4B3BA 4DG5A 3C48A 3G0HA 4TTTS 1ZICA 2PUBA 1Y7IA 1RAEA 2I6UA 2AQHA 1TM1E 1RTKA 2ZRAA 2WINI 2BL4A 4IFTA 1A9QA 3WG9A 3FR8A 3LW7A 1GPH1 1M7GA 2FX3A 1K7YA 1X1BA 3CX4A 3Q7RA 4QQFA 2FCAA 4RZ2A 1M6HA 3C97A 4FNAA 4N0EA 3U4DA 3BQ9A 1ZZEA 2H5JA 2IC5A 3QUSA 2WB2A 2JFPA 1IXSB 2C2GA 2PZLA 4HAZA 4KMOA 3TW8B 2P1DA 3OUTA 3UHFA 3VX3A 4CKWB 3D2CA 4RPLA 1GILA 4BFXA 3EW9A 5TNXA 1OWLA 1TRKA 1TU3A 2CVPA 3L4EA 2DSTA 5G2OA 3FMIA 4B3DA 1FC0A 1P7ZA 2CLFB 3ZX4A 4RJIA 3HR8A 3TPZA 5LL6P 1YIAA 1F7VA 2OCXA 3KOYA 5IH3A 3DL7A 1ZIOA 1GKLA 1M5UA 4F4JA 4S1TA 2PGOA 1QE3A 4PNEA 1TIPA 1I3NA 2XMRA 3JYPA 1XCJA 1X2EA 5LDGA 2G17A 3B3GA 4PHCA 4HX2A 2OMKA 4RORA 1M75A 1KF0A 1JEDA 4N12A 5F33A 3ABOB 3U7IA 4AKEA 2C3YA 3ESRA 4EM6A 4G81A 5ICCA 2HQRA 4K46A 2ZSBA 3TVDA 4B4UA 5KSOA 3BULA 1FU8A 4MRMA 2HPZA 4WZBA 2QSYA 1XF1A 3W7VA 4M4SA 1E2KA 2PU5A 3LCUA 1FA9A 4B3IA 4B7XA 3M7IA 2H0AA 2ISCA 4GDMA 5BSEA 4OGKA 2WYHA 2H7XA 4NMXB 3OEED 4Q00A 4ZOLB 1WU7A 1DT5A 4LN1A 5T4FA 4US2R 4B47A 2J3JA 2ZI9A 4OJQA 4PW0A 4Y2PA 5IC6A 5JDCC 4BJHB 5BR8B 1VFPA 1Z7WA 4BHTA 2F9MA 2GLTA 3UFBA 3CB4A 2PXAA 1SKMA 5IN5A 1HNXB 4RETA 2QK4A 3IT1A 2Q27A 2HI0A 2HBYA 4FE4A 3EFEA 2CHVA 4G25A 4D9GA 3CH7A 3VA7A 3X43A 2EGUA 3CYFA 3QI2A 1G2IA 3KBOA 2I6SA 3VR0A 1EFVA 1B8PA 1HFJA 1M10A 4Z51A 2GFHA 2XCOA 2JDIA 4YVFA 2P0AA 4KTTE 4LY6A 1PVDA 1TJ3A 4F5EA 5K7SA 2I4TA 3BDVA 4QPCA 4DIUA 1GZ4A 2FZKA 3BWXA 3U40A 3NHLA 1F48A 4X6UA 1SC9A 1I4DD 2JJYA 5LMUB 3PRYA 1T4GA 5EMNA 2Q1YA 2LGJA 4XWTA 4LECA 1ZR2A 4IZOA 1T35A 2FPOA 5IULC 1G7RA 4Y2SA 3CZAA 1ZL2A 5KNLA 2ZIFA 4H18A 2CJWA 2CNLA 2JB9A 4QXOA 2Z5FA 5EKSA 1NMYA 5HQJA 1MR3F 1OPXA 2XJ4A 4FFMA 1NZJA 3L7DA 2VT7A 4B9EA 4BKRA 3OLWA 5LZ7A 3V4VB 4NESA 4PLPA 5FLKA 5ALQA 1N5IA 2QUIA 3ICOA 1ZR4A 1TVMA 3GCGA 4C4ZA 2I9PA 1EBBA 1F8FA 3EZ6A 2VYND 2ZBEA 3DMTC 3AIOA 1PGPA 1RM5A 5IBCA 5J5AA 4M0LA 5DVZA 3KWJA 5BYJA 4XA8A 1C1XA 4BV3A 1SBZA 2A1UA 2Y1XA 2ZTHA 1O94C 1FEZA 1AKTA 1LUAA 3MWDB 4G5SA 4Q3KA 3FPFA 3K35A 5DN6D 2JH3A 1TMKA 5BWNA 5K05A 1FQJA 1II9A 1LNZA 1HORA 1D6NA 3TQQA 1Z26A 4O6VA 2MSWA 2VI5A 1S3GA 3LU1A 1Z5WA 4URZR 2W6ID 5JCJA 1GGNA 1KNXA 4C6HA 4TYWA 1QK3A 4KQGA 5BV0A 1PV1A 4X7RA 3PG5A 2N1BA 2X0IA 2HWKA 3V7UA 4EX7A 1PQ4A 1Z08A 3UJ8A 5AUNB 5DP2A 2XXBA 4RQBA 3BMQB 4TYPA 3NRJA 2BFCB 3FPSA 4RJLA 2C59A 3BDIA 5DPMA 2A0XA 4IUYA 5LZ5A 1H94A 2ZPUA 5ARBA 1VZ2A 3R0ZA 2NXJA 3FTEA 1QDLB 2QNRA 3WGHA 5EHIA 1F7UA 5AUQA 1P2UA 3NBYC 4LCBA 5EXXA 2ONJA 4KRFA 2PUFA 5HF5A 3AJRA 2IEBA 4I50A 4M8IA 4N41A 2YNMD 1X1QA 4XX1A 1XQ9A 5DV9A 1UFRA 3E22B 2ASVA 1KOLA 4D6YA 3PLRA 2D8MA 2D1QA 2ZE7A 4KJXA 4RX1A 2O3SA 2Q3JA 2YR0A 2H7YA 2JAPA 3BIWA 4HRAA 4CTMA 4FYJA 1WB4A 2IH2A 3LLCA 1KVTA 3CX3A 3VO8A 2XCRB 1P9LA 4Z0TA 1PWXA 2PO7A 3CLVA 4FFLA 1C80A 3EZGA 3ORYA 1KJWA 1U28C 1G21A 1QHGA 4RGYA 3VR5H 5JYEA 1QF6A 2O06A 4QJIA 4D0RA 4FOTA 4XJSA 4P8RA 5HJEA 1MAWA 5BR4A 3A14A 5HRCA 4RFVA 2C94A 5GJCA 4D3FA 1QHHA 1I4TD 4K05A 1AQIA 3JD2A 5JE8A 1M0EA 1Z4NA 5LQAA 1PYGA 2UAGA 5TR9A 3SQWA 2EIHA 3MOGA 5FOQA 2OHFA 5LKAA 4OM8A 3WTBA 2WAYA 3GT3A 2HZBA 3P9XA 3W8NA 4D80A 2IHNA 3JQEA 3IUJA 1ZNQO 4A8PA 2X7JA 2X13A 5BQFA 1E62A 5AP9A 1I7PA 3STWA 1TYEB 5BV2P 3ZU6A 2ZSFA 1IRXA 3ISVA 3NAMA 4C0WA 1SELA 1WHSA 1RM3A 1DEAA 2J3IA 4W5OA 1IEXA 4FWIB 3L0SA 2QRNA 2A86A 4B75A 1CS0B 4LF8B 2H4FA 4R8KA 2Q6VA 3ENKA 1COWA 3DTYA 1KDTA 1KJIA 1SQSA 4OQQA 4QASA 2BVNA 3T5CA 2FSFA 4PHTA 3GLIA 1VXRA 4EKNB 1IM5A 2G5GX 2LDXA 3QM1A 3TWOA 4CIAA 4EB3A 3HKDA 2E21A 4B6JA 1R66A 1UIRA 5B1HA 1BSVA 2FKAA 1TKAA 5JC1A 1BJRE 3QX7A 2QAGB 5F7OA 2AEJA 3KSBC 5CA0A 2BFWA 3LK7A 4BP9A 4FYVA 5AUOB 1RCFA 3BXHA 3HB5X 4MWDA 1ZSNA 5F4ZA 3OTIA 2FQWA 3KD2A 3SHWA 2VAPA 2PQ6A 2G82A 2AX4A 3W5IA 4C6TA 1Z56C 2R5WA 5DF1A 2P78A 3EZLA 1UDWA 3IAS6 3PRKE 5BSRA 4PWZA 3Q7SA 3VOBA 2D0OB 4QYMA 3UA4A 4DARA 4XVRA 2NSLA 5EIBC 5F2OA 2VYCA 5GM1A 5H02A 4FINA 3X44A 1BYIA 1MF7A 2Y68A 1UMBB 2QD3A 2AJCA 3QELA 4I8IA 5EWMB 2I8LA 4BKPA 1JE1A 1DKMA 3T1QA 2ZYTX 4PAMA 3WY9A 3ZYZA 1GYRA 2BYTA 2IY7A 3AETA 2YWGA 3GLHB 2CL0X 2ZUWA 1NXOA 3GLFB 3RFUA 2J7PA 2C1ZA 3AFNA 4C4YA 2QN7A 4KYUA 2F1KA 2Y92A 3S7TA 4DEVA 4LNHA 3IYLW 1X80A 1YKSA 2YXBA 3GN2A 4EHNA 4J4BA 3ZE1B 5BO5A 1YOVB 3DCYA 2CLMB 1TNDA 5AKZA 4NEHB 3FTQA 1AA6A 1RC1A 5KU1A 3WK4A 2P62A 3AEQA 4E5PA 4N6GA 1GNVA 2W2NA 1OT5A 1K7EB 1D1SA 1U8CB 4Z9XA 2H5LA 2V0CA 1SC3A 2HY7A 1WZ2A 1ZRNA 4AZ0A 3ITNA 3O92A 4QOIA 3V9AA 5CT5A 3WZLA 1YAHA 3HKBA 4JLVA 4NMMA 4OV6B 1WD7A 3LGAA 1IVYA 4RFSB 2OQIA 1P0MA 3UUGA 3UPTA 1Z4LA 4NFHA 1NJ8A 2H54A 2HNKA 1OB2A 5JADA 2Q99A 3UCFA 2HOQA 2H2HA 1GKUB 1LWOA 1L8LA 3JSAA 4KIWA 4MR7A 5E9AA 3T7JA 3WLIA 3TQRA 1KMIY 2V7XA 4H1HA 4R68A 5FOSA 2AVNA 2WWVD 4NAVA 1DMSA 4J16A 4Q7JB 1RAHA 1EESA 2IJGX 1NJ6A 1YR9A 2V45A 3M3DA 2JZOA 3OAAD 2PX4A 1Q21A 3JPWA 1JA0A 1PEKE 2F1HA 3CH4B 2JVKA 2NO0A 5KVCA 1ODJA 1FRFS 3MTBA 3H0KA 1L8AA 1YFLA 1ONSA 3RYFB 4NBSA 4ARAA 4P81A 3I5UA 5CM9C 2JD2A 4U3JA 2V7QA 3WKCA 3X1KA 4Q48A 3VNUA 1LCIA 4U2DA 3UK1A 1LNSA 3FCSB 2OHGA 3NIWA 3VDNB 4OAQA 3V55A 3WJAA 4A0QA 4WNIA 5DOVA 4ZMBA 2AOTB 4KP7A 1QKIA 4HNHA 1AURA 5T8KC 4XRGA 2HBQA 3BERA 4TKMA 1XCMA 3UC9A 4NU5A 4G1VA 3LBFA 1M1ZA 4EJSA 1AB5A 2HRDA 3R3UA 4TSKA 4UNQA 5D7NA 5EFZA 3UWMA 4QZVA 2ZK7A 4OHCA 3A6ZA 5JSKA 1JEYB 2XQGA 1ZGJA 2AC4A 5K6RA 5K9ZA 3RIYA 4PWYA 5H80A 3F6SA 4ZCIA 1UBFA 1YIOA 1WWKA 5CTAA 3KJEA 4GZ5A 1M5TA 2E85A 4IJVA 4Q6BA 4HNGA 2VF7A 3WYAA 2AOXA 5D5PA 3OLVA 3LXRA 3KK0A 2H31A 4IHJA 2F9FA 4W5HA 4CMEC 3ZCVA 4BJ1A 1SWVA 1RHMA 1S2IA 2D59A 1BVHA 2VLIA 2P40A 2V55B 1B41A 2NU7A 3JD1A 1RWQA 3PGLA 1J70A 3WIOA 4L8WB 3O8RA 2PVSA 1W5EA 4LYDA 3EGIA 1IY1A 3FNGA 4FHEA 3WYCA 3UAGA 3EXIB 3LNTA 3ONVA 4G5HA 5CRIA 5KO2A 4M76B 4CTNA 4YYZA 4YQEA 3DUWA 2O8FB 3IVCA 4L4ZA 1KKUA 1Z4OA 3KU4A 1YVDA 2YFKA 2NV2B 4LHXA 1U9CA 4RFLA 4KV7A 2WJHA 2HIHA 4Q01A 4MQEA 4YUAA 3Q85A 3DM9B 1DV2A 1VFNA 4JH0A 3WIVA 3T34A 2VP5A 2XNDA 3NEJA 1TUEA 1V8ZA 1XVLA 2H9YA 3K9HA 1PVVA 3QPUA 4URFA 3S40A 3TNFA 1WOMA 5CK5A 4XH9B 4GF5A 4R16A 3I5AA 1ZCJA 2BH2A 3FYUC 5BN3B 5FWYB 5DWDA 1U7HA 1U2PA 4P4SA 1ADJA 4G0ZA 5ADVA 1QRTA 3W6UA 4LZJA 1BDMA 4ZK6A 2PN1A 5LJLA 1U9YA 3BMOA 1EK2A 3JQGA 2N42A 3B9RA 5DSXA 5CLJA 1GPWB 5TQ2B 5HKKA 4Q1CA 2IPLA 1L4NA 2IHKA 2RGNC 2X5OA 3I9V1 2VP9A 3UY4A 2HA7A 2R6ZA 3C16C 1H8HD 4EFMA 1Q6YA 2JNWA 3A05A 1M6YA 4P7FA 4M86A 4RLFA 1HT1E 2FPIB 4RF4A