5IUKC

Crystal structure of the desk-desr complex in the phosphotransfer state with high mg2+ (150 mm)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
132
structure length
132
Chain Sequence
SMISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase DesK
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase/gene regulation
total genus 46
structure length 132
sequence length 132
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iukC00
5TQ2B 4JP1A 3A0RB 3QEMA 4RXMA 5GQSA 8ABPA 4Z4EA 1Z17A 3HS3A 2PUEA 1ISRA 1PHRA 2IDMA 2FKAA 3E3MA 4Z4CA 1QO0D 4RY8A 4W5QA 3BRSA 3O75A 1LJLA 2PKXA 4MYRA 4WT7A 3OQNA 5TQ2A 1J56A 4OG2A 4Z4HA 1FSPA 2WMYA 3H5WA 1U0SY 3HUTA 4KK3A 1Z2EA 1B00A 1TM2A 1Z12A 4EUKA 1UDRA 1C4WA 3ROTA 5KI6A 1RZRD 5EWLB 2PJUA 3JS5A 1VPWA 4Z9AA 2FQYA 3LKBA 3LUKA 2QXYA 2DRIA 2R47A 2P9HA 4OLAA 2JK1A 5EWLA 4MGEA 1Z26A 2JB9A 1JYFA 1NXSA 3H1FA 3LUHA 3TO5A 4XAQA 5IEBA 3GBPA 4Y9TA 3CG0A 6CHYA 5HM6A 9ABPA 3IP5A 2WB4A 1JBEA 3H75A 3QEKA 3B2NA 1YVUA 5IX8A 4QICA 2MSLA 1SRRA 3RVMA 4ZYLA 2AYXA 5DKFA 3HM9A 1BDHA 2BGGA 4NCAA 4Z9BA 2WJWA 3RVRA 2QZJA 1AB6A 1DBQA 4W5TA 2VUIB 5IULC 3TMYA 3CG4A 4DADA 2GWRA 1JDNA 3CZCA 2WJAA 2FN8A 3G1WA 3OMWA 3T95A 5KQGA 4EVSA 4KZKA 3MA0A 1XWWA 2YHAA 1A04A 3N8IA 2LBPA 5KQMA 4Z4GA 4N47A 2RJNA 4KK4A 4F3TA 3O1HB 2RJOA 3F6PA 1Z15A 3RVJA 3K4HA 2QU7A 1KMIY 4RDCA 4F12A 2GKGA 4Z4FA 3CRNA 1DBWA 1GLGA 1Z25A 2HJ9A 3KG2A 4XFKA 4Z99A 3RVKA 1QPZA 3KHTA 1LBIA 1F4VA 5ED4A 3KYIB 4ETNA 2GBPA 4O5AA 3KTOA 3MMNA 3RVNA 4LX8A 1NXTA 2JVJA 4WUTA 2WRZA 3C3WA 3QLUA 1JX6A 4H60A 3ILHA 4IMJB 4KMRA 4RSMA 3KJXA 3BILA 4D6XA 2A9RA 3OLYA 4IMIB 4TLLB 2JRLA 1NXWA 3LKVA 3R0JA 3LTEA 1JLKA 5TE9A 1EAYA 3OO0A 1QNLA 3G85A 4MQFB 3JTEA 4LDZA 2W42A 1KGSA 1P2FA 2PMCA 4PICA 3JPWA 1AB5A 4GPAA 1Y1LA 2A9OA 4KPYA 1PNTA 2PAFA 3DGEC 4TN5A 3O21A 3LUCA 1ZITA 1JHZA 2IPMA 3EQZA 4Z0NA 2YHBA 4MR8A 1RXIA 3Q15C 3URMA 1YK1A 4FE7A 3C3KA 1NXPA 5JNRA 2O20A 3DGFC 4ML3A 1QP7A 1D2AA 1RNLA 1FQWA 1NATA 1JFTA 2QV0A 1TLFA 1BDJA 3OLVA 5D2CA 1EFAA 1TMYA 4MS4A 1JL3A 3O2QB 3Q41A 4S05A 5CNKA 4QPJC 3KCNA 3L6UA 1Z2DA 4JB2A 4LRQA 1SD5A 2E4YA 3NHMA 4PE5B 3T6KA 3HSYA 1USIA 5KQLA 4E7PA 2B4AA 4MS3B 2ID7A 3RVOA 5TPZD 2HQRA 1MIHA 2E4ZA 2FLWA 3HJFA 3HZHA 4MPTA 3TB6A 4RWEA 3OM0A 2PUDA 3QEMB 1EWVA 2L19A 3D8UA 3GWGA 3CS3A 4MS3A 3Q7TA 2VYCA 3A0UA 3FFWA 4RY0A 2H0AA 3F7NA 5KC8A 3DBIA 1GCGA 4KQCA 1OXKB 3KLOA 4RXUA 3HVRA 5IBQA 3HUUA 3JPYA 3SNKA 1BA2A 1M2EA 4PEVA 1LJUA 1A0OA 4ZMSA 3T38A 3DZDA 3GV0A 3H1GA 3HO1A 4Q7EA 4G86A 2CHEA 3HXMA 1ZAYA 4JASB 1DCKA 2QSJA 5JNTA 1D1QA 1E6KA 4F8JA 4MQEB 4MS1A 4PZ0A 2ZWMA 4RK1A 2HQOA 3MIZA 1ABEA 3EGCA 2QR3A 3CZ5A 5KWSA 4RU1A 3HEBA 3LFTA 2MYTA 5E3JA 3N0XA 4MQEA 4DN6A 4FB4A 5ABPA 4RK5A 2QVCA 1ZDMA 2IOYA 3H5TA 4G0PA 3NNSA 2LUOA 2ZAYA 5KC9A 5C5CA 2WY2D 3OLZA 5FWYB 5JS1A 3QX9A 5DGCA 1XHEA 1R8JA 4IRXA 4EYKA 1C0EA 3CNBA 4HNRA 5IEJA 4F11A 4Q6BA 1W9HA 2GI4A 4KFCA 1D4ZA 3N0WA 5FWYA 3H6HA 4LE1A 2P4UA 4QYWA 4D74A 4GNRA 2VUHB 2MYNA 4G0YA 4YV7A 2M98A 1ZVVA 4E7OA 2QW1A 3S99A 4EGSA 1IIBA 1JYEA 1H9CA 4F06A 3RVQA 3IDOA 5F64A 3OMXA 1M5UA 1M5TA 4P98A 3Q7RA 4Z4IA 4OLBA 1JH9A 2Q5CA 2X7XA 2NZUG 3EQ2A 1YMUA 1F51E 3MYYA 3EODA 3O2JA 1DCMA 4G0QA 4KV7A 5BR1A 3OQOA 4MLDA 4JOQA 4TLMB 5CHYA 2FMIA 1W25A 4RZSA 4S04A 5KQPA 2PL9A 2LPMA 3CHYA 3H5OA 3K9CA 3FGZA 3QLUC 2JBAA 5EWJA 3JVIA 3H5VA 4D6YA 5BQ3A 3RVPA 1P8AA 3DLHA 1ZH2A 3SY8A 1JDPA 3UKJA 1ABFA 3UUGA 4EVRA 3MF4A 3T8YA 5BRAA 1I3CA 1ZH4A 1LK0A 2FVYA 5JNSA 3OQMA 3NNDA 2PUCA 2LIVA 3F6CA 3VNAA 5BRJA 1USGA 3RQIA 2L18A 1MB3A 3RVLA 1FFGA 5IUKC 4JA2A 4MR8B 3N53A 1QQBA 4YGXB 2L2QA 1MVOA 3GA5A 1TVMA 3H6GA 3ILYA 3QELA 3EJWA 3W9SA 1PNRA 1CEYA 4W5OA 1P6UA 3RVSA 3LOPA 1QKKA 3E61A 4MS4B 4RS3A 4LDAA 1DP4A 2E4XA 5IUJC 4EYGA 3KSMA 4IGAA 1KRWA 4Q6WA 4NICA 1NY5A 2IKSA 5JNWA 2IYNA 3FFTA 1GCAA 3I45A 3NNNA 2AYZA 2F8SA 1BAPA 2A9PA 1D1PA 3SG0A 2FN9A 2HSGA 4OATA 1GUDA 2FMFA 3FDFA 4EYQA 2IPLA 2MSKA 3BBLA 4NQRA 3O2SB 2JVIA 2PUAA 5DTEA 3RH0A 1S8NA 4MAAA 4KNYA 3KYJB 4L4UA 2FEKA 1DBPA 1XHFA 4H3KB 1EWTA 5C5EA 1DJMA 3MQ4A 4O1HA 1DCFA 4M88A 4XLTA 4HYEA 4MR9B 3Q7SA 4N0PA 4JB0A 2PUBA 3D02A 3VNBA 5IC5A 4UHJA 1NXXA 4UHKA 1YTUA 2J48A 5CNIA 5JS2A 1RPJA 1DZ3A 1OXBB 2JCGA 2E4UA 4W5NA 3O74A 4EVQA 1YMVA 3ROFA 4N0QA 4N76A 3OLWA 3FMVA 5EWMB 4MR9A 5B3JA 1L5ZA 1MAVA 3QLVA 3IPCA 1QO0A 4G0MA 4YCSA 4XASA 3I42A 4WZZA 1M2FA 1DRJA 5T3YA 4ZPJA 1PEAA 1DG9A 1DC8A 3NHZA 2MSWA 2N9UA 2R48A 3O1IC 4IF4A 4MS1B 5EWMA 3UK0A 4YRZA 5HSGA 2HPHA 2LP4Y 3M9WA 4WXEA 4ZJPA 3H1EA 4RK4A 4DQDA 3L49A 1RZRA 3KS9A 3CLKA 4LZLA 4QYMA 3P9YA 3LUAA 2GX6A 1GUBA 4G0OA 4WWHA 4XARA 4B09A 1WETA 1LBHA 4YR7A 4H3HB 4ETMA 3HDVA 4KREA 1SXIA 1T34A 2NZVG 3HDGA 2WWVD 2FMHA 2NUBA 5GOTA 3IP6A 2PE5A 2H3HA 2IPAB 2FQXA 4KQ9A 3I5AA 4TMYA 5FBHA 1YIOA 4RY9A 3TD9A 3CFYA 1JFVA 1P6QA 5JNVA 2FMKA 1A2OA 1ZN2A 1JF8A 1BDIA 3JVDA 3C97A 2FQWA 1K68A 3M6MD 1ZY2A 4MRMB 1E2BA 2R25B 3F73A 1USKA 1VKRA 2VK2A 1U04A 3OLXA 3MM4A 5I4CA 3EDCA 3A3KA 1JWLA 1DRKA 3SM9A 2FLKA 1ZHHA 2FEWB 3Q9SA 5TQJA 5HKOA 3O1JC 4MRMA 5HQJA 4YO7A 2PLNA 4YS6A 3A10A 3GRCA 3QX8A 3H5IA 5DCLA 1Z13A 3BREA 1K66A 2QVGA 4EYOA 1VRVA 3FFXA 3LUGA 2XDYA 2FEPA 3H5LA 2PUGA 1Z16A 3NBMA 4YWHA 2E4VA 4WXMA 4RXTA 3N75A 4N41A 1APBA 2JBAB 4OBBA 5EWJB 4G97A 4EY3A 1EHCA 1U2QA 1QMPA 3SAJA 1E6MA 3BRQA 5CNJA 1NXOA 3GL9A 4YLEA 1HEYA 3CTPA 3LUFA 3EAFA 3EULA 3QLTA 1EWKA 3HV2A 4HNSA 3CKMA 2NT4A 5PNTA 4JAVC 1FFWA 6ABPA 3I09A 3IPAA 1URPA 3LUJA 4PYRA 1JFSA 4KRFA 3LUDA 1PUXA 3QELB 1DC7A 1PEYA 4W5RA 1YS6A 4HNQA 2OQRA 4RV5A 3HCWA 3LMKA 2OENG 2JVKA 4NV3A 1D5WA 2E4WA 4ZMRA 1CYEA 4RKQA 2IPNA 1KRXA 5JNUA 2V0NA 4LE0A 4OTZA 1ISSA 2PUFA 4MR7B 2A9QA 3HK2A 3JY6A 1QQAA 2M1ZA 3DLBA 1NTRA 4FE4A 2KYRA 1U8TA 4P1ZA 2CD7A 3OM1A 2FSPA 3KLNA 2PL1A 3GYBA 4RK0A 5FWXB 4MR7A 1NXVA 4RKRA 5FBKA 1QP0A 5DLEA 4NCBA 3C3MA 4RK6A 3SQNA 2RDMA 2MYUA 2NT3A 3OO1A 4CBVA 4MQFA 5IUNC 2HQBA 5FWXA 4O1IA 4L85A 1FFSA 4G0XA 1RXEA 1ZESA 1VLZA 7ABPA 5TPZA 1Z18A 2FXIA 2CWDA 5T7BA 4RK7A 2FW0A 1SXHA 1BVHA 3N0RA 1U2PA 5TQ0B 3CU5A 1E6LA 3C6QA 4YP9A 4G0ZA 4LE2A 2TMYA 2ID9A 2R4QA 5B3JC 3QLVC 1YK0A 4IILA 3TX6A 1CHNA 3GBVA 1ZGGA 5TQ0A 3IP9A 2I6FA 4N03A 2MYPA 3IP7A 1YS7A 5TPWB 2CHFA 1MB0A 1L5YA 3M9XA 2L17A 3KKEA 1ZGZA 2FTKE 4XXHA 3N6VA 4ETIA 3QK7A 2RGYA 3GT7A 5TPWA 1QP4A 1TJYA 5CNMA 1SXGA 4KVFA 2F8TA 2B1JA 4MLCA
chains in the Genus database with same CATH superfamily
1EXDA 2VHCA 2ZSIA 2QT0A 1T0PA 4GGPA 3DAPA 2OPHA 3LK6A 1GU1A 5HG0A 3TR0A 5HUQA 2PWYA 3THRA 1ISRA 3E3MA 1JMVA 5BMOA 4YNBA 4RYDA 4GAEA 4O33A 3DP7A 3HSSA 3JYPA 2GCGA 1PCXA 1QBGA 1GKKA 1E9VA 4WT7A 3T9EA 1NSYA 2B35A 3RNLA 4ZGBA 3DULA 3C3EA 1GZ5A 1Z12A 5ES3A 1ZXBA 2HLDD 5K5EA 2OV6A 4IVRA 4Y9RA 1UDRA 5EMHA 1EFVA 1GP2A 3WYGA 3ROMA 4A03A 2DFPA 4L7VA 3LHDA 5ENVA 4CL2A 1RZRD 4BZPA 5KAMA 5JPIA 1U8CB 4RORA 3VAZA 3LC7O 4Q9DA 3RK1A 4G4SP 3N2KA 2AIRA 3QUCA 4M0UA 2LW7A 4L6CA 1K4YA 3E2PA 1ZIYA 3W2TA 2ZSBA 1GRCA 3QXHA 3AEUB 1N8KA 1KWGA 3KE8A 4FR2A 2QTMA 4B85A 3AESA 5AM4A 5FTNA 5KQRA 2AZMA 1RW4A 3H75A 4JUCA 1YJXA 3VR6D 4B3GA 1RQ7A 1R0CA 2I5PO 3AKDA 1P8JA 4FJ2A 2GPWA 1SRRA 4HB4A 5DLYA 3G7SA 5JQGA 2VA8A 1NVXQ 5JECA 3IUYA 2OAP1 3RVRA 2YW2A 3VYRB 4D8UA 2G77B 2GBIA 3PC6A 4ZQIA 1YRBA 3BIFA 4AB1A 3FPHA 3VU9A 2Y0PA 2VT6A 2XVYA 2FZGA 2XDAA 1E2MA 2HWYA 2HUNA 3HGMA 1RZUA 3LVFO 5AOVA 4NG5A 5FOQA 5JYEA 1XPRA 2H18A 3RE1A 3KSAC 4HB3A 3TFOA 1S2IA 2CL5A 2IZ5A 2FFHA 3L5OA 1MU0A 4QPNA 4V2IA 4OF4A 3FNGA 5DGIA 4YMSA 2RJOA 2FHPA 3F6PA 4ABTA 1KKUA 4OK6A 2QU7A 3EWSA 4HAUA 1GSHA 2WEKA 3K9HA 3TVDA 1MCZA 1PWZA 3PHCA 1Z25A 4JBWA 5HYVA 1GQSA 3H97A 1VE3A 3G8YA 1BX1A 4J03A 1PR6A 2I33A 2QD4A 3KTOA 5BV2P 2IYYA 1DJNA 1H2ZA 1Z29A 3QKRA 1GGKA 4IGEA 4O08A 1NTOA 4WUTA 2ZCVA 1FMFA 4JNCA 3NTQA 4FFSA 5I45A 2QPTA 2DR2A 3RIYA 1QRUA 1J0XO 1CUZA 3EXIB 5C1IA 1CBUA 3ECSA 3H4IA 1C1XA 3A1NA 4ISCA 5FEUA 1ORVA 4AECA 1LPOA 1L4NA 2ORYA 4XYMA 3ZHZA 3K0AB 5BT9A 5ILGA 3I64A 4E51A 1UPCA 3M4YA 2PZLA 2BGMA 4M1QA 5IXJA 5IKXA 3A3YA 4BCDA 1DAIA 1W2HA 2A9VA 3E22A 1E8NA 5GZ6A 3FPFA 1AD2A 2ZITA 4MWOA 3AIOA 3CEHA 3O03A 4XIGS 3OIGA 1H5UA 4B8YA 5KUTA 1YFJA 2IP4A 3A2LA 1X8LA 2FE1A 3OI7A 4IUYA 3KAJA 4XRRA 3UMRA 1G3QA 3URMA 2GHQA 4FE7A 2OBNA 3FYSA 4WLVA 3ZDCA 1JXQA 3JSXA 1GYPA 2FPPA 5K0EA 1RNLA 2WWIA 2YWBA 3HKDA 3IJEB 1DDIA 1NATA 5BOVA 3WIDA 2RHCA 3ESRA 4O4IB 3R7DA 1BDJA 3ZZ1A 2ZU0C 3O2QB 3NDJA 4J76A 4TYWA 4FBMA 2WSMA 2X5OA 1GA4A 1S0UA 4D81A 1C9MA 4KQWA 3MD0A 5BSKA 3N3BC 1Y7TA 1SCDA 3AM4A 3HSYA 3HE3A 4HF7A 4UZEA 4J1TA 4Q3LA 5AKYA 5TGTA 2WVAA 3G3EA 3AL2A 1G5QA 4GZ5A 3UHFA 4JL5A 1E69A 4KGZA 1G59A 2F90A 4N3CA 1HZZC 4I9NA 4MW0A 1WABA 3RSSA 3OM0A 3TQQA 3SSNA 1PHPA 2O8FB 4J2OA 4P4LA 1U90A 1YAHA 1DFHA 3WWPA 2MINA 2CBZA 4TL6A 1JAYA 1KY3A 3OZFA 5A6SB 4UW9A 5A9SB 2ZRBA 3HV0A 2GSWA 3QHPA 3IMCA 3A1FA 4V0LA 5LBTA 3W5BA 4Y2TA 3ADOA 4PS0A 5IABA 4KN9S 4HDAA 4GXNA 3X1ZA 1I9CA 2LV8A 3C5CA 2FZ4A 2ZJZA 3JATA 1UWVA 3ISVA 4BE7B 4PCVA 3I1JA 4BMPB 1UKAA 1PJTA 4TYMA 4YCNA 4HWSA 1VKZA 3WS7A 3PTAA 3K0SA 1QGED 1XTIA 1HF3A 4R3NA 5L3VA 3WL3A 4C4RA 4CQMB 2QPOA 4OKSA 1MABB 2OCPA 2YNMD 2R4UA 1JXAA 3LRPA 2HIHA 3EGCA 2O3TA 2PH7A 3RK0A 4AP9A 4AY4A 2OD9A 3OEWA 3EEQA 3RYIA 1CQIB 2EZUA 4Y2XA 2XZLA 4GP9A 1II8B 4U2EA 4NECA 2OAGA 2CLMB 4HR7A 4G0PA 2XPCA 1YE3A 2ZAYA 3D2LA 1E0SA 3FLAA 3ICWA 4KU4A 3RFFA 3TIVA 2YDXA 3T7DA 5JS1A 3LWZA 3ZNPA 1EX6A 3ZC3A 4QJIA 2XB2A 4WNCA 4G0WA 1FJXA 2Z8ZA 3QXGA 2ONKA 1Q12A 1P3JA 2OXRA 4LYJA 1W19A 3JR3A 1MHTA 4F1KA 2NSLA 4B6JA 4L6AA 4NJMA 2HJWA 2PFSA 2VA9A 1N5RA 2M98A 2YMQA 1C7RA 1BKDR 1CZUA 1JW9B 2MSCB 2H65A 2CLCX 1HKHA 2H7YA 2XVZA 3MPOA 4IM7A 4OQDA 5JMTA 2JGRA 4BRSA 1FUKA 1LW7A 4KP7A 3S99A 4EB6B 2VSXA 5JO9A 3PEEA 2XGJA 5AK0A 3BG5A 1NUUA 3GLFB 4LGYA 3RSQA 1G60A 1XTBA 3G2LA 3BHIA 2QUKA 3ELDA 4DB4A 3RTEA 3GFOA 1WV0A 1JLRA 1IM8A 1RXUA 1TQ6A 3H3JA 5K4AA 1H2RS 2A88A 1NW5A 3NRBA 4UUBA 3N7AA 1EB9A 1WQ4A 2AK2A 2W6MA 3PGA1 4Y9SA 2HA3A 4KAFA 4AJEA 3L0PA 3B9QA 2F3RA 3PT9A 3ELWA 4EY4A 5EESA 4F2WA 5BNTA 4FS8A 3KQQA 2YVLA 4B5KA 4G81A 4EY6A 4NI5A 3GJ3A 1JR4A 3L6BA 5JXJA 4OH7A 3RVPA 3VPCA 3RBZA 2XQJA 1U1CA 1DTWA 1GNPA 4C4SA 2C2MA 4GXRA 4XX0B 2XMRA 3D7KA 3CVXA 4NP6A 1UJNA 2BSXA 1GPUA 4HZUB 4WI1A 3TZLA 4C87A 4BB0A 1E0DA 2P27A 2FPRA 3QSGA 1R6TA 1PT8A 2G9VA 2HQ1A 4HFNA 3RQIA 1ZH6A 2VF2A 2ZSUA 4OMFG 1DCTA 4KR6A 1JRLA 4LJ9A 3L4KA 3QG5A 1E4VA 3O6VA 4WY8A 3WBJA 2HRBA 4GQAA 3W2IA 3A6HA 3LGSA 4J43A 4AULA 2G1JA 4MV8A 2ANBA 1XTPA 3IUSA 4G5FA 3PJRA 1XCPA 5HOQA 1UBNA 4JKIA 4DWVA 1IRXA 4P9NA 1D8AA 2YC4C 5JYCA 1RRVA 2NU8B 4JJZA 4DVGA 4MWGA 4OQMA 4IL5A 4NG4A 3CNNA 5BMVA 8ATCA 1GU7A 3GC6A 3THXA 1N32B 2IZ6A 3B3AA 1CG6A 4HN4B 1Z37A 4C0LA 5K0TA 3SC4A 3OC6A 1ID1A 3I1FA 5DIFA 1U2GC 3L8ZA 4E4TA 5IM4A 2C04A 2AD1A 4KXUA 3E3NA 2IELA 4F4UA 4YUAA 3C5WP 4JVLA 3MS2A 4UFOA 4NQRA 1G9XA 4RENA 2QYOA 3UMCA 3UNXA 5I47A 3JW8A 3KYJB 4M9XA 2FEKA 2WTAA 5ALVA 3P9CA 4HNTA 2QX9A 2PQMA 4DLBA 3NJ8A 1TM1E 1VGVA 5GVSA 1VL8A 2PWAA 3FI9A 5CIQA 2VSYA 4V02A 2CNWD 2V98A 3IQZA 4JNKA 4MMZB 5DT9A 5BY2A 1ZLXA 3CVUA 1YTUA 2LTAA 1IBRA 3ORSA 2I67A 2REOA 5DBFA 4BMSA 1SXJC 3R7BA 3TZHA 4DWWA 3CCFA 5LQRA 5LD2B 5L3SB 4BB6A 4N76A 3QVXA 1U8EA 4HO1X 4JGGA 4CCYB 4NWIA 4AZ0A 2Y1OA 4RESA 1FF9A 2B1RA 4ECEA 3VR3D 5K8UA 4Q3NA 4QO7A 3DWFA 1DC8A 1KYWA 2N9UA 3H11B 3FOFC 4FQ7A 4HFJA 4E70A 1Q16A 1U31A 3GG9A 3SQLA 2LZ0A 1U7WA 3U5TA 5LZ9A 1J21A 1IY2A 1CRLA 2JGAA 2ZTMA 4TMTA 3M6VA 4YRGA 1RS0A 2JANA 4ZI3A 3KS9A 5F9HA 1RR6A 3WO0A 2A0UA 4Y2HA 2C31A 3KZKA 1Q1EA 3BH0A 5A5VA 4Q24A 1Q1AA 1JKMA 1VJ5A 2XCRB 3NTRA 5CRIA 5AJXA 1YMQA 2GYYA 2PX3A 2CWWA 4D80A 3HDGA 2JAOA 5GOTA 5TR9A 1EHIA 1HRKA 1HG1A 2HMAA 4MJLA 1K9SA 1DPGA 2GCNA 4QFDA 1YE8A 1RAEA 1WE2A 3KC2A 3QWIA 2GDJA 3CX6A 2G17A 4PC6A 3FCOA 2WU8A 1ZXXA 4NNPA 2IHBA 1T5IA 2P0YA 3V4VB 2P2NA 4DREA 1Q3HA 2IUUA 4Y6LA 1A77A 3CLUC 2O52A 4BN0A 5TV2A 1A8IA 4HG2A 1X0XA 5FL7D 1E2KA 4M99A 4JC5A 2AZ4A 3O4RA 5BW6B 1FLVA 5T57A 3SM9A 3GAFA 2Z57A 5E6SA 5DISB 1V5GA 1ZK0A 1KO8A 5CEJA 1R0YA 2BFBB 1KY4A 3RYFA 3WLFA 3QVLA 3IV7A 1G63A 5ES4B 1G2PA 3S55A 1M6HA 3WL6A 4BIMA 1UJ4A 4H7EA 5CW1A 5T8KA 3HWX1 2CBGA 1KQNA 2ODNA 3LUGA 3VOTA 2JLRA 3SJUA 2RH8A 1ZVQA 2B5OA 2DBRA 2JDIA 4OSPA 2PUGA 2AKEA 1XKTA 1MKYA 1QHYA 4TQAA 1OOEA 5LXTA 2FRVA 2J7PD 5AW8A 3AHGA 3DC7A 3JQ8B 1JP7A 3JQCA 1V8FA 1OX6A 1NRJB 4XJVA 3UW1A 3LT0A 1MXHA 2CFCA 3O7WA 4YMHA 3IKTA 1A88A 5J2UA 1P91A 1YU6A 1X7DA 4YRAA 1I3LA 2O1SA 3K8QA 1PJ3A 1WB4A 2C9YA 5EMLA 1XE3A 2H1VA 4MRAA 3QFTA 2ZYVX 4PG5A 2D1SA 4AJLA 4BX8A 1WRBA 2VPWA 5ALUA 5AM5A 1BWPA 1KO4A 3C3DA 4A0QA 2CFRA 2XRMA 3JR7A 5K3EA 2OMEA 3A04A 3N2LA 4Y0VA 4KRFA 3RWOA 3VZQA 4EKYA 5C7LO 1XU4A 4Y1GA 4LUCA 2PBLA 4FN4A 4KN6A 3KUDA 4J7AA 4ZOLF 3SICE 3B1XA 3AUXA 5J58A 2IYEA 1L8QA 4Z4QA 4BBAA 1J23A 2AOUA 1N5MA 1WXFA 2I80A 4R1UA 4YCJA 4GLLA 2YJZA 2ZI3A 4JI1B 3PGXA 1CJMA 3RANA 4FC7A 2SKDA 1Y6QA 4IOJA 3JZAA 3TLJA 4FZ5A 1CUHA 1T0JB 3U0BA 3V8PA 1RQRA 2NP7A 1XLVA 4C6TA 4C1NA 4FILA 4YA6A 4M0EA 4LOIA 4QU9A 4QOFA 2O19A 4JDPA 4AG6A 2PVPA 1UWLA 2X23A 3HLYA 4P1ZA 5KYVA 1S2LA 4CIDA 1DINA 3RIGA 3TLGA 3IESA 1E1DA 1OTXA 4ZDJA 4ZYTA 4CG0A 3AVWA 3WOHA 3OBBA 1QE3A 2O3RA 1BXZA 1ZP6A 2NM0A 5CM8B 4YJFA 3VTKA 4CBVA 4D25A 1F17A 1EK0A 1P4RA 4ZZIA 4XWOA 1ORWA 3HVJA 5J40A 3MG9A 1VLZA 2F3UA 4ZIRB 5T7BA 2Y3IA 2QTLA 3P2MA 2J0VA 2PT7A 3AINA 4LVUA 5BVHA 2R8YA 3IVXA 3JYNA 4UNPA 5IAAA 4I19A 3CU5A 4EG0A 4XYGA 1DB3A 5ECWA 3CR3C 2YCBA 4FLFA 5EAIA 5KYYA 2PLAA 1IWBB 1X9GA 3E5HA 4G0ZA 4W9NA 3ET4A 3SKXA 1K75A 1YQEA 1OX4A 3MT8A 4K26A 3QVGB 5AJZA 2C83A 1P1BA 1O95D 3DFZA 2QVXX 4L8GA 4KG7A 1NR5A 2YTZA 3U6BA 2YOFA 4MK4A 5CM2Z 3WLKX 2XUJA 4JIMA 1GWNA 1T10A 4PZYA 3WGJA 2Y93A 4XSGA 2QD1A 3SLRA 3AI1A 3GU3A 1G4UR 1T5OA 3OWOA 4AL4A 2WTNA 4CM9D 4HKTA 3QMVA 3QLEA 1A27A 1R0XA 1Y3BE 2P9JA 2IV3A 4HAXA 4MB0A 4Z4EA 2R62A 1MV5A 3AOGA 3FYUC 4PCAA 4XGIA 3WLPA 4O4JB 5A2QA 4XJSA 1Z08A 3NEPX 5DRTA 3UHJA 1F7UA 2R44A 3R8XA 3O94A 2F8MA 2UKDA 2WYWA 5K0LA 3Q72A 2VYND 1SUDA 4Q9LA 3V1MA 3ZU3A 4KK3A 3PFKA 1C2YA 5ESDA 4MO2A 5F1YA 2Q3DA 2WG2A 3PDWA 5DXAA 3WZ2A 2W6OA 4I4IA 1HE2A 2H07A 1RDFA 2Z3WA 4E15A 1WM1A 4LYEA 4NK5A 2P35A 2OORC 3TAHA 2R0QC 4NYMR 1U2EA 3S7TA 4TLCA 2FFBA 1XFDA 4Z54A 2R47A 2WU0A 1F2UB 1X1BA 5DM2A 2YBEA 3VPXA 4BB9A 1M8JA 4WZAA 2HU8A 5JCJD 2JBWA 5AH0A 2XUAA 2NO1A 4BGEA 3U4QB 5IVKA 1EUQA 2IUTA 4MRPA 1FTQA 2HRZA 1NNSA 3H7AA 1T2UA 2IS1A 2OFFA 4AT1A 3ADBA 5EJ9A 4DLZA 2KJQA 1XVVA 2P3SA 1ACMA 1WF3A 2GM3A 2Q4TA 1B2RA 3DT6A 3EOZA 5DTMA 2WZDA 1B14A 1KTVA 1X2BA 1JJBA 4I5GA 4IH1A 3R75A 5MGNA 2AYXA 2BGGA 3ZPXA 3QE0A 4EJ6A 3PFGA 5EJ8A 5DGTA 4W7IA 1TMGE 5FTKA 3WWZA 3HBNA 2GR9A 2HJRA 2DETA 1A2BA 3W9YA 3H2HA 3IH5A 4XVQA 3HKEA 2KS6A 2OM6A 2A4KA 2PKQP 3DDHA 1M75A 3CG4A 3X1KA 5HR5A 1IMJA 1LX7A 1PE0A 5KTSA 3T1YB 1QIMA 1FIUA 3GLQA 3H5RA 2ZQYA 2QM3A 1C14A 1DHTA 2IXFA 2WYHA 4AS2A 5JXGA 3CCBA 3QE4A 2PX6A 2WNIA 3ZGZA 2VDLB 5EP2A 4L4SA 5GIOE 1J4AA 1FLAA 2G40A 3BF7A 3WP1B 2C5FA 1MD9A 1MORA 1R3UA 2RAPA 4NE2A 1XF9A 1J90A 3L07A 3ZKWA 1RXYA 3WIOA 2X3UA 4B6OA 2XWJI 4QM6A 1TYCA 1SC6A 1ZK4A 2GUGA 2VDVE 4FT2A 5BSWA 1F20A 5CYGA 2HW8A 1OYWA 5F9MA 1KZ1A 4N8EA 1UBLS 3TEJA 4AZSA 4YJ2B 3TXYA 1CIVA 3LT5A 2C2OA 4FFMA 3HCAA 5E1OA 2EF1A 3DBLB 3CSUA 4TUYB 2QM8A 2BFNA 1IFXA 5JJCA 1OFHA 1IH8A 3BRWA 3ODGA 3MUEA 2XV1A 4UUAA 5AXCA 2QROA 4ZZ3A 2XAAA 4PYJA 4KRYA 3FPSA 1K5PA 3NIDB 5JCZA 2AG0A 3AG6A 3K2BA 5TE9A 4EMUA 2VP0A 4WINA 2J7KA 1KXJA 3MVEA 4I3HA 4LDZA 4LYAA 1N2CB 3NKFA 3QFRA 1N2JA 5DX1A 1SHTX 4AD8A 5KNCA 1VSUA 3DQZA 2TMDA 4EK9A 4E14A 3EFOB 4R2MA 3JQFA 2GZDA 4D8TA 1FFXA 3F9CA 4RCYA 2VAWA 4D56A 3LFHA 1G21B 1H8ED 1JGTA 1SCKA 3GJ6A 4GMKA 3T4UA 3H9JA 3UGKA 5B36A 1IN4A 2X77A 1NXPA 1MRZA 3IB6A 1OVGA 2B8JA 2W0SA 4LQCA 4N39A 5FEMA 2D1RA 5AHXA 3PFIA 1FYEA 1X13A 3A3PA 1BVRA 3O4GA 4IIXA 1IBKB 3AM1A 4AN1A 5FNZA 4E0BA 1IUNA 1X15A 1E7WA 3G49A 3COPA 3JQ9A 3GDWA 3OZEA 4N5MA 4NULA 3WK7A 2ZBQA 3MELA 3I76A 3Q41A 4MQBA 4M9RA 4Q1CA 1M1XB 2H2IA 3FWYA 3V8QA 3KCNA 1UKYA 2QVBA 4P4SB 2P90A 5EUBA 3IOYA 3I5YA 2HT1A 3KE9A 3DV2A 3M81A 1L5SA 4XSHA 4FP9A 1UP7A 3EEFA 2BTOA 2GKSA 1UPBA 3UATA 1IDOA 2ZT6A 2AG1A 3TIGA 3UGQA 4P53A 3ZQUA 1H0KA 3HUEA 3L1KA 5HF5A 3ROPA 1MO5A 2QN8A 3GVPA 4Q21A 4YROA 1QPGA 3SX2A 5IJ0B 3GCGA 1AUQA 4IYJA 4CCWA 3B5JA 4QTTB 4RSRA 2QMYA 3OF2A 2IEYA 2BFFB 5BPFA 5A4IS 1W4LA 4B4VA 1NNI1 3F7NA 1BHJA 3VH3A 2NXJA 1WUHS 1MJHA 2GJAA 3U4AA 4I9UA 3KLOA 4RTQA 2H17A 1B6SA 3KZCA 3QWFA 3FWKA 1T1GA 2XVMA 5FPYA 2PGJA 4LZAA 3X1DA 4GOMD 2QM0A 4A2PA 2Q50A 3DZDA 3DVAB 5KNBH 1N33B 3I2YX 2XYHA 4Q7EA 1U3UA 2CHEA 2LE0A 3HXMA 3F8TA 4WOPA 2XCUA 2UYQA 4NX2A 4LHZA 4N3NA 1V3QE 2C2KA 1PUJA 2FR0A 3NV9A 1ODIA 1TU3A 2NAPA 4HEJA 4MQEB 4LRYA 4U3JA 4BMZA 3OH8A 1QE0A 5FKJA 2X7HA 3D3QA 2C92A 4MGIR 3VU0A 1BE0A 2HHHB 3GP3A 3FVWA 2VNSA 3TEMA 5A62A 1TJ5A 5BRNA 2FCRA 3BZBA 3G9QA 1ID8A 2DUUA 3UXEA 2W6ID 5KYGA 1FXSA 1KBQA 2FG6C 2CUTA 3NTLA 2O7SA 3Q0TA 2Z2YA 3GX1A 3V7FA 1W36B 3C4JA 3T0GA 2WUVA 4DABA 2NWQA 1RI3A 1LQ2A 3TL2A 3OQ1A 1ZUD1 2Z2JA 4URUR 1FU8A 4DSAA 2X40A 3AFHA 3P2OA 5IEJA 1TVKA 4F11A 4PAQA 2GI4A 3COSA 2BR4A 2OR3A 3H6HA 4KXNA 1FP6A 5I7AA 4BO9A 5IYZF 1D0IA 1XKLA 4GNRA 4K6OA 3D0QA 4G0YA 3NATA 4TLAA 3R7FA 2CMKA 1KAEA 3GGSA 1OYVA 2P5UA 1EVZA 4B5LA 4FM9A 2HHAA 5ERGB 3R6GA 1G2QA 1JYEA 1L7EA 3RVQA 4M54A 1X19A 2YIJA 4L0QA 3TW4A 4J4TA 1M5UA 2P9YA 1M5TA 2VDPB 4GKAA 2WF8A 4U00A 4V03A 3AUSA 4LF5B 4KI7A 2RMKA 5ALMA 4MVJA 4XUDA 3PUHA 1SM4A 1RHJA 2X7XA 5G3ZA 5C52B 3IOCA 4B3BA 3ABZA 1PWYE 3N8NA 3FSGA 3D6HA 3K6KA 4G0QA 5IH3A 4GYYA 4BVGA 2Q4BA 3VKVA 1G17A 4RL4A 3K5IA 1H94A 5INTA 4LJRA 1Y1TA 3I8SA 4QQKA 1NP7A 5KSYA 4OY3A 3VV2A 1V5WA 4EFMA 1BS2A 4CLHA 4ARVA 1DV2A 1PJSA 3IKMB 4D6YA 4XLLA 1EQAA 2WTMA 2C5AA 4HGPA 3N5KA 2YJTD 3UUGA 1BRTA 1O5OA 2CLSA 2RI0A 3VI4B 1XZFA 1FS5A 1ZAKA 3UPUA 2FVYA 4QDZA 5JR3A 3CRVA 3I2JA 3I8OA 2V65A 3F6CA 3OT1A 8OHMA 1USGA 2KHZA 2CLEB 3W1EA 5KX5A 2YHIB 3F6BX 3RVLA 3WLOA 4RNDB 1ZONA 4LJ7A 5EE5B 4AMGA 2R3SA 4JJKA 2ZJFA 6ADHA 1K3TA 1CJVC 2JKVA 2D1QA 3LOUA 3WC4A 3NHPA 2V55B 3WQRA 3EN0A 1P6XA 4JXZA 4KE9A 1I3NA 3NIWA 2NU9B 3ILSA 3FJ1A 4TMKA 4AF7A 1F3LA 4FFPA 1CY1A 2EZ4A 4E5SA 1YZHA 2YJ6A 4AMVA 3MTIA 2CXXA 4Z49A 5IK2D 5BR4A 3CXRA 1V7CA 5HDBB 3TZBA 3KHSA 1CUXA 3HKCB 5A71A 2VZ0A 1XLTA 1P39A 3CMCO 2XUDA 3TLKA 3DT9A 2YJ3A 3ZW7A 4F21A 2BTQA 5ITVA 1PJ8A 3DF9A 1WMDA 1Z7EA 3BORA 4UM5A 1UFQA 2AYZA 1XTKA 3M3HA 1N3LA 2ZYSA 4E2ZA 1Q3TA 3W3ZB 4QJ3A 3FBTA 2D4AA 4UASA 1CE8A 4KXLA 1N6OA 3DQQA 3QU7A 1NVWQ 1J97A 2ZTSA 3IVMA 3CISA 4L5IA 4NE7A 3BMCA 5AOBA 4CEHA 2A59A 2RI1A 1GHTA 3EVBA 3Q87B 3AG5A 4K40A 5D6OA 4K0KB 2BEKA 4L4UA 1ZMXA 3B20A 4XWGA 4DC0A 3V2HA 2OG1A 3ANSA 1VE9A 3DLAA 3SE0A 4D3SA 5LQJA 1JR3D 1H8HD 4HYEA 5C53B 2YASA 3FCYA 2BEJA 3V80A 4O2AB 4ME6A 4PRZA 4QSMA 1XZJA 2JFZA 2Y0DA 5HS4A 1N7HA 5F23A 2J9XB 4IZHA 3ZDZB 3OOJA 4Q1BA 3SFVA 2I99A 2CJYA 1QGYA 5B3JA 4KLRA 2OAQ1 3CLVA 3PQ6A 1SD2A 1Z38A 4QQRA 3ZY5A 4AJ9A 2ZLBA 4GPTA 1GEGA 4KQ2A 2EC5A 4MI6A 4DM7A 4ECAA 3M6FA 5DX0A 2I2CA 2ZIXB 2VZEA 2ZRQA 1DG9A 3DOHA 3L7DA 3MWDA 4LG1A 4MXDA 4OOFA 3OP1A 5BWOA 3MLAA 4PX9A 2Q07A 1UFKA 3NFYA 1AQJA 4JI4B 4WXEA 1KP3A 3H1EA 2JJYA 4GG1A 1OHHD 4L5YA 1NSFA 5DLDA 3N2YA 3BMOB 5K8IA 4LCJA 3K3PA 3DFUA 2G9ZA 2QZ9A 5AI8A 5FA5A 3TKLA 5LC1A 4R9NA 3VOBA 2ZJ0A 5EJ4A 2H0RA 4ND2A 2J0UA 2ZFUA 4R9SA 2FF7A 3BWEA 3L4BA 2D0IA 4YQZA 4ETMA 3TTVA 1COWA 3BDVA 3LPAA 4NMLA 2FMHA 4B73A 1GFSA 2IPAB 1FBTA 1GY8A 5JE8A 1P2TA 1QTIA 1TUBB 2WILA 4IIUA 4GOOD 3KYDB 4UAJA 1K7FB 4PGHA 1FYDA 2M1XA 3PTZA 5A9RA 3AP2A 1ECPA 4W63A 3ICEA 2A5LA 1YJQA 3U7GA 2DT8A 1KOJA 1OIWA 3JVDA 3C97A 1CY4A 2HU7A 2RARA 1SC9A 1KFEB 2GPSA 4REMA 2CVHA 3OT5A 3R3XA 1FRQA 4H1UA 4CEIB 3OIYA 1ZBQA 4QKQA 2GM4A 2HFKA 2VN8A 1SVOA 1XZQA 3K8OE 3LXXA 4WY2A 3O1JC 4LZZA 4M1ZA 3GUVA 3DE2X 4AY5A 1X1EA 4YS6A 1Y6FA 3WNDA 3IT3A 1HL3A 4K88A 3REQA 2C58A 1RWQA 4WJKB 4BGVA 2B0JA 4D4GA 4CF6A 5B6PA 1BZYA 3CSSA 3UC9A 3T9DA 5FL3A 2BHLA 2O6HA 1J7KA 2PUVA 1UINA 2WI8A 5IAKA 2P5TB 3LV8A 4LYHA 1TZMA 1OXVA 3OCZA 4JLNA 5HKLA 3KPWA 1EVIA 2JGNA 3W06A 2GJ4A 4ENTA 4YACA 5CJPA 4ZVSA 3S1SA 4N41A 1EFRD 1PFKA 5HE8A 1E6UA 3TKAA 2IRWA 1PFGA 3GFRA 4G5OA 4JLUA 4Y2UA 2VRCD 3H8VA 4IVNA 4QA9A 3JWEA 2NNWB 1H9AA 2G5GX 2JGMA 5JD3A 4CTJA 1U9YA 1Z4IA 1XTSA 1KYVA 2HJGA 2PA0A 1MW8X 1VCOA 1YFZA 1D2GA 2BUBA 1FDWA 4FYKA 3WLLA 3ZWMA 2Q45A 4O3FA 1OGJA 3NH9A 2J5KA 4WNAA 4WLUA 5FDFA 1C7ZA 3NIBA 5KYXB 1L8OA 1QH0A 2P1ZA 3ZIAD 1U99A 3TSYA 4HRXA 4M1KA 3LX8A 4QBGB 3N05A 2CHGA 2DT5A 3RABA 1P9LA 1PW7A 2GB4A 1T15A 1CCWA 2FPIB 4DZTA 1FPMA 3IHTA 2YWXA 5K8TA 2ZPTX 1LKZA 3HGQA 4XIYA 2ZJAA 1QS0A 3CYFA 4BMOB 1UANA 3MB5A 4LRXA 4RULA 1SUFA 1QVZA 4RV5A 4HP8A 5BN5B 1M8GA 2E87A 4LXHA 3ER8A 4YAKA 1GSOA 3H05A 2A5YB 4P35A 1Z74A 1RM4A 3FMGA 3U60B 2I8AA 2ONZA 3JD1A 4LE0A 3ZE7A 1ISGA 1RRMA 5F12A 1LY1A 4TYPA 2BLLA 1W0JA 4RE6A 4TXHA 4EO4A 1A7KA 4TWBA 3U4IA 5I5GA 4D8XA 1Y4SA 4FE4A 3UMJA 5FBRB 1DLJA 4XLZA 2PS9A 2DFLA 4RFSA 3EXIA 1MJGM 3EIOA 2INGX 2VEDA 4IXDA 4PSAA 3BXGA 3OJ0A 2ZYUX 3RIMA 1QHIA 2MR5A 4ZANA 1HZJA 3QOFA 5IUNC 1CUWA 4J1TC 3VGJA 3JQDA 3JVVA 4FONA 2FZEA 2WZQA 4EY5A 1XZAA 1YDHA 2VJYA 4WA8A 4QQNA 2FW0A 1C2TA 2DR3A 4XYLA 3B1VA 4RAOA 2PKWA 4R5HA 1BD3A 1DXHA 2ERYA 3EVCA 3IX7A 3L0ZA 4IIGA 5CP8A 4EQ6B 1FOEB 1Z4OA 2VH5R 1UIMA 3IELA 4JD5A 3TZKA 3VHLB 4P0PB 2IYXA 3IQDB 4S0ZA 4X60A 4F9TA 5ICSA 4DXAA 3O0DA 3QBJA 1CY7A 2H1SA 3P27A 3TSAA 1D04A 1C30B 4UXJA 4O4IA 2QI9F 2O2GA 3C15C 2MYPA 1G20A 1R74A 4UM9D 1L5YA 3IT1A 5JCOA 1E99A 3GOHA 4KQEA 5HMMA 1ZJZA 1NJ2A 3BBPA 2QVLA 2OZPA 4ERNA 4HWGA 1ESZA 1I2MA 1T6YA 2DFNA 2JHAA 4UCWA 5TPWA 4YX9A 5GJCA 4MV4A 2OTCA 5ITSA 2NTJA 4M6WB 4OL9A 3U7JA 4F7WA 2VBFA 4J1NA 2XGOA 1ZHFA 4C20A 2X3FA 4EHDA 4F72A 5KTOA 3GRKA 3UT5B 2IYQA 2EFHB 1ZR4A 4EDFA 1M9NA 1X8KA 3D5TA 3PWSA 5GQSA 2O8FA 1C8VB 4EEKA 2LWIA 2FKAA 5CITA 1MOZA 3UB4A 3O75A 1ULHA 1QB7A 4PRKA 1YDFA 5TQ2A 1E1LA 2G3YA 3HUTA 5DBHX 1CVLA 2PGDA 4N40A 4QELA 3TRDA 4HHEA 1SOAA 4HWPA 3DW1X 4R6WA 4DFDA 4RSHA 3DFKA 2QN9A 4B6SA 1QM5A 4FD3A 1Y3HA 1O03A 2V6FA 4R2JA 1DKNA 4EKNB 2Y99A 5T64A 2Q3BA 1E3IA 1AUXA 1J33A 3DB1A 1EJ2A 1V47A 1WO8A 2VJAA 3HPQA 1ZPDA 2YVAA 3DAYA 3WKAA 2ZBRA 4G5RA 1G8JA 3HI6A 3N8HA 3PUIA 3R6TA 5B1IA 4MYSA 4LJ8A 3BCRA 4I14A 4Y6PA 5NULA 3CC8A 4UQLA 3W2FA 4QYTA 4K9LA 3CN9A 4BMNA 5JDCA 2WB4A 1JBEA 3HJNA 2XBUA 4JCOA 3FRIA 5DM60 1UL1X 2M6RA 2G07A 2IOFK 3O8RA 2MSLA 3PSAA 3D8HA 4BHTA 3QUSA 3RVMA 1TTTA 4JXKA 2GK6A 3IURA 2HK8A 1EGMB 3K70D 3RJZA 3WGLA 3F8WA 3OMLA 4JQCA 1TC1A 1JHYA 4R1OA 2FK7A 4C2BA 2IYPA 2I91A 1IN1A 4HJRA 1PEKE 4ARSA 1UFRA 4OJTA 3THYB 4BVEA 3REFA 3F2VA 1XYYA 1V96A 4Q5IA 4WCFA 1E92A 3WB0A 4BQIA 1U2DA 1E79A 5L6MB 3MGBA 4EVSA 2CNLA 4MPRA 1T4CA 2IEZA 4OQYA 1YRQA 1M1YB 3WLSA 4DNXA 1PJRA 1CP3A 4DCJA 4HGQA 3THOA 1U6KA 2KBFA 4J1SA 5A05A 4ZAGA 3T5TA 4AZTA 4E5VA 2GMWA 3NT2A 3O1HB 4KIWA 4Q01A 3VMMA 4C2UA 4P32A 3GLFA 3ZVNA 1EQUA 4BLTA 3EFHA 2Q5JA 3VSEA 1WCYA 1R15A 1TE2A 1E0KA 2WG0A 3AF3A 3HCRA 3O84A 5KKNB 2QX7A 1T24A 1FRFS 2HO4A 4G09A 4QLOA 3TGLA 4RNCA 1T1SA 4Q4HB 2Y8EA 4H0FA 3D8BA 1JQAA 1AKTA 2DUWA 4MKHA 3PGMA 3RB8A 3RVNA 1ZX1A 3M33A 3PPWA 1LFDB 3RHSA 2A94A 5H80A 1Q95A 4KFRA 1L1EA 1HORA 2ET6A 3RLFA 4B76A 4XH9B 2TS1A 1XCMA 1AXGA 1HT3A 1IZ8A 3FSEA 1W6UA 3DWIA 1WMSA 3EXHC 4EATA 4I1YA 3IAUA 1KPHA 2IEDA 1EGHA 3QENA 4LRWA 5A7GA 3GNLA 4KEAA 4TKMA 4YP7A 1ZIXA 2EHDA 2C7BA 1B2LA 2ZYIA 2BY4A 5JVDA 4XX0A 4ARUA 4CU5A 3MTGA 2H48A 1VSBA 2H5IA 5KVAA 1UXOA 1KI6B 1FUIA 2FU5C 2ZSJA 1B0ZA 2W22A 1U5AA 3LBIA 1NKVA 4DJTA 3GLFE 2OZEA 3MAGA 5SZJA 3CV3A 4WY5A 2H4YA 2QQ0A 3T99A 3HRKA 2NV0A 1UPFA 4GDMA 4RPCA 3RC3A 5TT0A 4MEJA 3ZVMA 2Q2VA 4TZ6A 1R3DA 2R96A 4Q4DA 4YMTA 5JIBA 2OQ2A 4A16A 1HY3A 5CW2A 4HFRA 3DTVA 2JAWA 2VZ8A 1TMYA 1ESEA 3EY4A 4HQOA 3GJ4A 4PZAA 2I3ZA 4S05A 1PJZA 2J3QA 3E9EA 3LH5A 2G1KA 3QE3A 4BEVA 4K9MA 2QUJA 3K0CA 4LOLA 3F7OA 2OBXA 4DVJA 3SZRA 1Q74A 4K9OA 1SD5A 3OETA 4TS1A 3WB1A 1X8JA 4FQ8A 1KMHB 4KI0A 4PBRA 4Q4JA 1FS4A 1OROA 2XVAA 5K3AA 4DMHA 5KQLA 1XCLA 2JD2A 3U56A 5BV8A 4N82A 3RS7A 2Z5FA 2QAIA 3JQAD 3SDZA 4D4HA 4DR7B 2BKEA 3FLEA 1UJMA 3ZWOA 3E70C 5A0VA 3CF0A 1E8MA 1JQ5A 4CLXA 1EWVA 3PCRB 4YXWD 5KCZA 6NULA 1O7JA 3E7XA 4E11A 5HRAA 4QUBA 3G79A 3LQ1A 3QVJA 4M0KA 3SR3A 3G2NA 1Q0TA 3BE4A 4Q7JB 1HLFA 3H87A 3QWBA 1K0FA 3D3EA 4DL9A 1WY5A 2P2ZA 4A92A 1N2XA 2W9XA 4J29A 4XB6B 1U5BB 3HVRA 1NLUA 3NTVA 5KPJA 3L8YA 1CB7A 2RH4A 1WBJB 3GUCA 4CHTA 5LFAA 2PDAA 2WSLA 5L3SA 2PBZA 1NDHA 2XYRA 3ZE2B 3EAGA 4ZMSA 4X63A 2ZROA 5UKDA 4CCYA 1W8IA 2IE0A 4IXMA 1SCIA 1ZAYA 1KA9H 1QVVA 1VJDA 3CZAA 3PHLA 4CR6A 4URXR 2C4MA 4HAWA 4EA9A 4NYJR 2DFDA 5A7FA 1P74A 5TJ9A 1BE1A 2CCKA 3EJ6A 3AZPA 3R0XA 4C2TA 2IEBA 1EFCA 4HX5A 2ETVA 3CB2A 2OSVA 1CB0A 1Z0DA 4IVQA 4OHPA 2Y6UA 5CGZA 4NQZA 1P9OA 2C82A 4PAWA 1XO1A 4YXFA 1KAMA 4JVNA 3EAQA 5K0JA 3EBLA 2ORVA 4RF3A 3N7UA 4W5WA 5T8KC 4CTOA 1WXWA 3LY9A 4E13A 3IPXA 2WSSD 4RIEA 2P9BA 5AUQA 4OHYA 4ENPA 1A9SA 1ZH8A 1W0KD 1RYNA 2O2EA 4KLZA 1WKBA 2NPIA 1W5AA 2BHNA 4IRXA 1E9CA 2AHOA 2GTPA 3DZGA 1ZISA 3DZKA 4ER7A 4KFCA 3ZCPA 3WWYA 3QNMA 3UA3A 2PMFA 5CK4A 1WOYA 4ZRNA 1KY5A 3VPFA 1JDZA 1ZNWA 3BZWA 2R6HA 3MTEA 2XE6A 3E9QA 4EHBA 5K3FB 3PCXA 1IBCA 3OJWA 1XQ6A 2D5CA 2J4DA 1RM0A 3LC2O 4ZEOA 3NWEA 1KVUA 4L50A 2QBYA 4FB5A 1HK7A 3I0NA 3UJ3X 1IIBA 2M6KA 2IZ1A 3A4NA 1VE7A 1IHPA 1QLJA 2BFBA 3DJFA 4MTLA 3UICA 4ID9A 5KJEA 5C80A 1KZHA 4X00A 1B6RA 5AUNB 4CFSA 2VJLA 1XRQA 1R5OA 2VI5A 3N8GA 5CA0A 1RAHA 2Z98A 2RI6A 4PG6A 5BPHA 1VPTA 1NFFA 1S8OA 2HBYA 2OPBA 4TKZA 5JZ9A 2C3UA 4P7BA 4IZOA 1TEHA 1JEEA 1NPDA 4RZSA 3JQ8A 4FYYA 1ZN7A 3Q98A 5LQSA 4N3GA 4CQLA 4RZUA 4DQ0A 2XTAA 3QOYA 4Q34A 4XDZA 2O0KA 5C3UA 4QGHA 2J41A 1XQXA 2RB4A 2YQ5A 4QDUA 5FHQA 2R11A 1ULSA 2J3IA 1E1CB 1A4UA 1KDVA 1A5BB 2W7TA 3KJGA 5BYBA 3TIIA 1CYDA 4IDFA 5JLAA 1YCDA 2BAGA 4G8DA 1S02A 1JG7A 3G5LA 1M8FA 2C3MA 3AZQA 4ZOLB 8MHTA 4ZVKA 3HU5A 3LXMA 3DXFA 4KO2S 4BNZA 4OLFA 3OIWA 4EO7A 2XR1A 3IDSA 1BKYA 3U31A 3UB2A 1NN5A 1PQPA 4QUEA 1ZMRA 4B6EA 3AQ4A 5JS7A 3D8NA 1P6UA 2Y67A 3MTJA 4ID3A 2C3YA 3ANTA 4BP9A 5ILOA 3Q6MA 1Q1ZA 3RSZA 1DP4A 2E4XA 1WZUA 2YHSA 2ZJ8A 4DR5B 3IJPA 2H11A 3E8XA 4LY9A 3GPCA 3I45A 1DRWA 2GJSA 4W9NC 4I66A 2VZLA 4RBNA 4BKOA 3K9WA 5B30A 3VH2A 4PXSA 3JQBC 4LS3A 3UTCA 1CNEA 5DHAA 1GO2A 5A1TA 1GUDA 1Q92A 1W48A 2MSKA 4O59O 5DNUA 1F2VA 3EMKA 1D6SA 4GECA 5L7YA 3WNBA 4V3CA 3AI2A 2PO7A 2UVPA 2VHTA 3V7WA 2CHVA 1EWTA 1RHUA 3C8ZA 1Q0LA 4U2DA 4GZ3A 4C01A 1WHSB 4XLTA 2PRZA 4G36A 3Q7SA 4OREX 4ZIRA 1NN0A 2WYIA 1KQFA 4G01B 5K8VA 2Q1XA 2WNSA 3UAVA 5IDQA 3PGVA 4IRUB 4BP3A 4F96A 1QZXA 3FMVA 4YCSA 1L5ZA 1V7ZA 1J2EA 1Y8QA 2X3YA 3ORFA 5C2JB 5LP6A 2VWGA 4HYQA 4KOEC 1P61B 2IA5A 3ADKA 3KX2A 2PAAA 4JBGA 2WUEA 4S0XA 1UDWA 4ZPJA 5T3YA 1M72A 3SJZA 3U49A 4WBNF 5G4KB 4IF4A 2Y71A 5C46F 4DCNA 3RUHA 3RT7A 2GHRA 3HJHA 3K5PA 1ZD4A 2C5BA 2GEKA 3HG7A 3T0IA 3OD1A 3KKQA 3S8MA 1YBMA 2XRYA 3G82C 5K8CA 3ZI4A 1VYUA 2C1XA 1NUHA 2ZKLA 3BN3A 4GI3A 5E2AA 4DJEC 3B78A 4GX1A 5ALOA 4ZDKA 4EP1A 3UAYA 1X1AA 2GAOA 2EFGA 1C3XA 3M1YA 4B09A 3OOEA 4NBUA 1YS4A 5M04A 1TYZA 1VB3A 3FH0A 1JJ7A 1CWUA 5A2GA 2H92A 2FV8A 2GK7A 2LR0A 3CLRD 2JAXA 5DHUA 2RAFA 3WJ2A 3D4LA 3TTXA 5KZMB 1QFJA 1EK2A 1VGRA 4K9SA 5HFJA 1BS1A 1S3GA 2GJ8A 3ONEA 4FYHA 4UE6A 1VHQA 4P83A 4WLFA 3SZUA 4CV1A 4Y6QA 4IDDA 4M21A 2B1GA 2XW6A 4LNUA 5E8JA 1I4TD 1P2UA 2ZYTX 3LT1A 4GMXA 1DRKA 2VSNA 5BWCA 4URHA 3SC2B 4EI8A 5AR1A 4D42A 1P5FA 1P7WA 2V7WA 4KJXA 2POQX 3K71B 4JQSA 3K1TA 1OC4A 5EXSA 2A7XA 1N9GA 5B6IA 3TQTA 4C3OB 1JAHA 1S96A 3LUPA 3SGLA 3GEBA 5BN1A 3IBYA 4BGUA 1E61A 1I1NA 4PPQA 4DUZB 1E6CA 3TUJC 3WGOA 4P2BA 2J0QA 1GN8A 1CJSA 3EHEA 2F4VB 3V4OA 1EEXB 2W0MA 3I32A 4YWHA 3S2FA 3GLGE 3QITA 4G24A 1EK6A 2HRDA 3OVMA 4TT3D 3K4PA 4DLSA 3AWDA 2VIIA 3GRVA 3OTWA 5GZ1A 5E2BA 2Z5LA 1PK9A 3ZDQA 1BG6A 3VDNB 1G19A 2G09A 2JCYA 5JD6A 4DOMA 4EY3A 1FRZA 2X1VA 3K6JA 4O4LF 4KMMA 1JSXA 1H2EA 3NHLA 3IP1A 3DCJA 5CM9C 1JQ3A 1HQDA 2D1TA 5I9BA 3DUFA 4QUJA 3VR6H 1QHHA 1NBHA 3NOOA 4PVCA 1LVHA 5PNTA 4JAVC 3RC2A 3VVLA 3TLAA 3ZIUA 5JYDA 4WADA 4A2CA 4EX6A 1UZLA 3L7AA 1XG5A 3WGHA 3V32A 1H4TA 4MCHA 4MMXB 4E1BA 1MTZA 1KJ8A 1G0OA 2OCBA 3NBZC 4TS3A 4GE3A 5EGNA 3PIRA 3UV3A 3VDXA 3ENQA 4LQ4A 2AFHB 3HCWA 1NQ5A 3HLKA 3QW2A 1NBAA 5HGXA 2FQQA 3CT4A 1WXEA 3B85A 4YMWA 3VR2A 2XEDA 2JJQA 4A0RA 4B3CA 1N2OA 4EPTA 1KRXA 1KERA 2W98A 3F74A 4LJLA 4OIMA 3E2MA 3U4MA 3KOZA 1RCTE 2VJMB 3L4EA 4WZBB 1IN7A 5BWNA 3MJRA 4TUYA 4GR9A 2HTFA 2G9QA 2PYZA 4ZU1X 1FY2A 1UOQA 1YA8A 2FSPA 2Q0XA 4YCLA 2R79A 5JATA 5IT9A 2IP1A 3R0ZA 5FBKA 1Y5RA 4P38A 5FJJA 3A06A 1U3GA 1Z2AA 2Q3HA 5IF9A 1N5DA 5BN4A 4YFVA 5FWXA 5H1YA 1AK9A 1GILA 2BBSA 3S8EA 4U8HA 4G0XA 2X1HA 1N75A 1RXEA 3BXHA 2YV1A 3PD7A 1JJIA 4JI8B 3L6RA 5DEOA 2OYCA 5K6AC 1GL3A 1DJLA 4XQ9A 3PNBA 3RVDA 2RE8A 3L6OO 4EYEA 4ADSG 2ZDGA 1G21A 1C4KA 1DC4A 3DKPA 4HQLA 5C7OO 2X13A 1AKWA 2RKOA 2W6QA 1V7PC 4N5LA 4MNTA 3AUKA 3D9QX 4XQCA 3C6QA 2VVTA 2B7CA 1DBRA 3KOWA 3W5HA 4Y1RB 2WT8A 4LE2A 1FMTA 4C08A 3MCTA 4CPDA 3A4YA 3ENKA 1ZGGA 4C3VA 3G68A 3HZOA 4GRAA 4H7FA 3AHJA 4A8TA 3VNUA 1M74A 2Q5LA 4AJJA 4HH1A 4KJZA 4P4SA 2VATA 4DY6A 4LCBA 2Q4OA 2P6OA 2WYUA 1CJUC 3I6MA 4ZVOA 2O1EA 3QVWA 4B79A 3QU9A 2D0DA 2I0FA 4UD6A 3S29A 3UH1A 3V2IA 4F45A 3QEJA 2F9FA 2R1VB 3PCTA 1N2CE 1W5SA 3TI7A 3Q3GE 1BEZA 3OIUA 1E60A 2Z43A 2ZSEA 3FPGA 4OL0A 4OJQA 3VC7A 5IJ0A 3I1YA 3G2OA 1KF0A 3L7OA 3MILA 3UCXA 3ONDA 1G21E 3DO8A 4PHTA 3ZHTA 2IY9A 4BQNA 5BQ5A 2DH5A 4ES6A 4TKUA 2XOKA 1EP2B 5BNFA 2IQ5A 3SZGA 5CIWA 3DH0A 1GDTA 3GIWA 1SELA 3MAJA 3CWCA 4HAIA 3ZV7A 3Q3VA 2OFWA 2DERA 1S2NA 2GXAA 2VKQA 2CV1A 1QIHA 4JT8A 1G6KA 4EENA 3KOXA 2LD4A 4YAFA 2PJUA 4LGCA 4LY0A 3T9FA 4TZTA 2RGBA 4YV2A 3RYHB 3A1TA 4D7AA 5B2EA 6GPBA 1RWWA 5ALHA 5THXA 3F90A 3SF0A 1RXSA 3UFXB 5CFMA 1XDDA 1NMZA 1QHGA 1TFUA 1YWGO 2WWWA 3H17A 3IFSA 2B2CA 3WWCA 1GL7A 1NBME 1E5TA 2X5JO 3VZPA 4E30A 5KOJB 2W2NA 2O5CA 3VO8A 3FPEA 1DOAA 1UP4A 1O96B 2W2XA 4KO4S 1SQ6A 3I1IA 4WD3A 1BU8A 4AS3A 4FOOA 3AXTA 4E5KA 5AHKA 5F98A 2GM9A 1E1KA 4P7KA 5IX8A 3DNFA 3PDIB 2C8VA 2QNRA 3ETGA 4MKGA 1Z4NA 1ZINA 4UHDA 2AJLI 2B8NA 2VF7A 1Y6GA 3DVRX 4QDXA 2PMBA 5IYZB 4RKYA 2AN4A 2QTVB 3LE8A 3NC1C 2GVNA 3EZ9A 2JIRA 4ZCLA 3AVPA 4GYWA 3TLEA 3PFNA 3E18A 1E1QD 1MX3A 4B3JA 2FN8A 2C7OA 5JISA 2RGEA 1V7QA 1OH8A 1RI4A 2JJ2A 1NONA 3LPNA 4F12A 3FTDA 4K9RA 1OFGA 4MUYA 4KPUB 2WLSA 5TXGA 1NJ6A 2GCEA 4JI0B 4D4JA 4Z4GA 2FGKA 4N47A 1SGWA 4LI0A 3RF6A 2J9ZB 2XKJE 2NO6A 1XA0A 3LX5A 2P4SA 3E15A 3QYPA 3R7WA 1KI4A 1L8XA 1WSAA 2BR3A 3FSJX 3PX7A 3CRNA 1GLGA 2QPLA 3KG2A 4JBNA 5CGQB 2XUGA 2OZLB 2VL7A 1WW2A 1C7JA 5TMEA 4LZNA 4I55A 5CBPB 3Q85A 1A8QA 1JILA 4NF2A 1WTCA 4PGMA 3EEOA 2ZCUA 1H3NA 3MPUA 4J7XA 4D8WA 3KDPA 2V1XA 2PQ2A 1C7QA 1GDHA 1LDMA 1NVTA 1UK8A 2PZGA 1EM6A 1NV8A 5JSQA 2EIXA 2F8SA 1VHWA 3OEEA 3S8YA 2CXPA 4EA7A 2B1IA 2W8BB 3A32A 4U7FA 2B7BA 3L04A 4UTNA 2JFWA 2D3TA 1ESDA 1MG5A 2R5NA 3OLYA 5EZQA 1R0RE 1JEOA 3LY7A 3B82A 1ZK3A 4M22A 3W04A 3P2EA 1W1WA 2YH2A 3JD0A 3GI1A 4L5BA 4OAQA 3GAMA 3UZUA 4C5BA 4ATNA 2N42A 3SD7A 5IDWA 5GADl 2YWDA 5B3KA 4J0EA 7YASA 4PICA 4J94A 2VDUE 3GVHA 4EPWA 3RRBA 3K94A 1VL0A 2CUZA 5JCXA 1QJCA 3K73O 5L3RA 2A9OA 5EIFA 5SZHB 5JAIA 3P52A 4HEA6 4LTNA 4D26A 2VH1A 5BQXA 5AIBA 1PX2A 1ZITA 2YHIA 2NZWA 1TKBA 1KZYC 4KXMA 2YHBA 4TQUS 4A27A 3TDKA 1TOAA 4C0AC 1GA1A 2CJXA 3FG9A 1GG9A 5A1JA 1SG9A 2LDBA 4P34A 1YQWA 1FTWA 4QXRA 3A4TA 2F00A 2LCFA 4IOKA 1ZNZA 4AYWA 1JFTA 1TLFA 2WHPB 2A1UB 2QJFA 2WDPA 5B4VA 5K20A 4D6PA 3F4BA 3KLBA 3TL6A 3TTYA 3SDBA 5EIEA 1U8FO 5IWAB 4D3ZA 1E77A 3VAAA 1PL8A 5CVJA 5D3MB 1D1SA 2OV2A 2VNAA 4MUBA 3HFSA 1PRYA 3A11A 3HCBA 3MJEA 4PE5B 1FP2A 2V6GA 4L75A 1TCVA 1Z83A 2IYZA 1HM5A 2E4AA 3EMDA 4HSEA 4GKVA 5EL0A 2IZ7A 3KQSA 4HAZA 5IM5A 1VG8A 3TVYA 3KPYA 3NAQA 4DLPA 2M9MA 3DA8A 3KSUA 3MN1A 4Y7CA 2EHJA 1TZCA 5L7WA 5HGJA 2PO5A 3D1LA 1WAMA 3O4FA 3OECA 2XMCA 3Q7TA 1B1AA 4R0NA 2LXNA 2VYCA 3UJ7A 2C97A 3A9SA 5SZIA 2EP7A 1PT7A 1U7XA 3D0RA 3L4BC 4JN6B 4FN5A 3GPLA 1KNQA 4N6OA 4NYIQ 2OBMA 3VUEA 4D82A 1OBVA 4OLHA 3DWGA 3QQ5A 2P75A 3D31A 3KQLA 2VT7A 1J24A 1EWRA 1KJWA 1ZUIA 1PL0A 4FJ0A 3GEGA 4OXIA 4WVLA 5FXMA 1M2GA 4HB0A 3AK4A 3RRXA 4BAZA 4GHWA 2PUHA 2NVUB 2GEBA 3IAM1 1OFUX 5KTMA 2EX1A 4GPEA 4BO3A 3EZLA 3GD5A 2WWTA 2YL2A 1NQOA 1PR9A 3RROA 2QSJA 4B35A 3KKPA 3R3UA 4B6FA 1QMGA 2DMRA 2IHTA 2P69A 1YQUA 3KAQA 2DJIA 1QU3A 5E2IA 4W8HA 2IYWA 2PMDA 4UXIA 3U7QB 5BORA 1KIFA 2G06A 2Y1DA 3GARA 3INTA 5FUMA 1NUAA 1ABEA 4PZEA 1E2PA 1JLSA 1Z6ZA 5JG7A 5IVPA 5JMPA 2EX0A 5CG1A 1YGYA 5EFOA 3QZUA 3R7AA 1KEWA 1G3MA 3A6GA 4F2GA 2AC4A 5U4XA 2R7KA 1NI5A 3BHMA 4IIHA 5EQTA 2D4HA 4X3OA 4KBFA 5JQGF 1DKPA 1L5FA 1SIUA 2Y1KA 4QPPA 5DCWA 1XHEA 1XAJA 2WE8A 1E5XA 1N25A 2G71A 3BK1A 3DEKA 3KYDA 4I1UA 4CN8A 4PO9A 2O8EB 4I5DA 3WMEA 1GAXA 1Z5NA 5FWYA 1ZCBA 2JJ1A 1S8FA 2P2LA 3KNZA 3QVUA 4KRXA 4OK3A 5JAHA 4S12A 4NSNA 3QX3A 5CDGA 1Z56C 2DQZA 3LBYA 2AXEA 2DGDA 1PDOA 4IV0A 3NASA 4CEIA 3D0KA 3DHWC 5DWVA 1XPJA 3HC7A 4X9XA 1VBNA 3PENA 1IRIA 1EXWA 4N5NA 4ZT7A 1CIPA 5ALWA 3O8BA 3QWHA 4IDCA 1L7RA 3PWTA 1JKXA 3G1TA 4XM2A 2F67A 1JH9A 4GSKA 3NC4A 4X3CA 5J47A 3FCUB 4TMVA 2PANA 2Z2ZA 5DYYA 1N1MA 4BQOA 1H2BA 4ISBA 2FUEA 1LF0A 2H3EA 1RHKA 1TCBA 2I22A 4F8EA 4EX7A 1FUUA 3O83A 1GNRA 2I9PA 2JCBA 4XDGA 2OT3B 3IPLA 5KQPA 2JAQA 3H5OA 3K9CA 4XSVA 1QXSA 2X1MA 1NVFA 4IEIA 1DKOA 3G17A 3IAS1 3R3YA 4FDUA 2H9YA 4DJ5X 3VDQA 5BQ3A 3HCDA 3OZSA 4RTSA 4Q4AB 1P8AA 2HYDA 4UMDA 1N9KA 4ZKDA 5CD9A 2IGBA 1DUVG 5KTNA 3VPDA 2FK8A 2Y4OA 1CX9B 1LK0A 3J81A 5F1OA 3DYIA 1P4GA 1XEWY 1QYVA 1JMKC 3F6EX 1QKJA 3M1AA 4YAOA 3R9WA 4EGQA 1BKSB 1VXOA 1T8RA 1WPXA 3T34A 3MWKA 4CV0A 1XAGA 3PKZA 2JRCA 3R9XA 3DZIA 1M5RA 1HT0A 2H5JA 2XITA 3BEDA 3DDSA 1HC7A 2IE8A 4JY7A 1K4MA 3SN6A 4BVBA 2WMNB 1DO2A 2QJTA 1TVMA 4W5JA 4Q19A 1MPXA 1XLWA 1FDRA 2AG5A 3HR7A 5F51A 2R9VA 4QTZA 2GAAA 5A4AA 2Y4NA 4MITA 4ZARA 1GD1O 1RABA 3JXEA 4DKXA 1SEVA 1P1KA 1QHSA 1JDUA 5BN5A 1XCOA 4NC9A 1U4SA 2DPMA 2QJOA 1LH0A 3EF3A 3UGJA 3E1SA 3FHOA 3RSHA 1LS6A 1LRLA 3TBHA 1SIOA 3FFTA 1GCAA 1QFMA 3TZCA 1U28C 3HYCA 3LVQE 5AKIA 4UM9B 3VPSA 1RZVA 4RA6B 3FOZA 4JUFA 3MWYW 3GLUA 1ISIA 2JHGA 3HH8A 4JUIA 4ZT5A 2IZZA 4NOKA 2GHTA 1MGPA 3BXOA 2WPDD 3MCWA 2OCIA 1SCNE 3Q8KA 1E2JA 4NBNA 1XTVA 3QKWA 3DAGA 4HMPA 3ITEA 2OXCA 5EKXA 3WBKA 1HMYA 5AI4A 5A5EA 1PSZA 5KO2A 1PG2A 2Q4RA 7REQA 3G0HA 3PXEA 4O63O 1WCXA 1XFAA 2KB0A 3MJTA 3MT9A 4MGYR 4HVCA 1RLJA 2UZ1B 1RPNA 4GLOA 1NPTO 3P0JA 2OHVA 4ZCSA 4N0PA 1VL5A 3TTTA 3OJOA 5MGBA 1DE0A 6AT1A 1RAIA 4BMVA 4G1BA 1N77A 1IK4A 4YP1A 4AIIA 3ZGXA 3B9PA 2VCEA 5H16A 2C00A 3VH1A 2KI5A 3EEBA 5H81A 3ZYCA 3ASVA 4Z8YA 4JI7B 3ROFA 3PL5A 4Z53A 3Q1KA 4QARA 2JI4A 5C81A 2XCSB 2ACWA 4ILEA 2C1EA 3N7TA 1GAJA 3PF9A 4EQ6A 1HTWA 2QRMA 2IUSA 2VP9A 2B4QA 4WGGA 4WOCA 2X86A 2EF0A 3UK0A 1AJEA 3PQ2A 1BXKA 3CH5A 4TROA 5LN1A 1JIUA 4G5QA 3RADC 4H1WA 1VOTA 4R9UC 1N8NA 1OXTA 5LMUB 2QN6A 1E3EA 1H0HA 3G89A 4P4GA 3FVVA 4KO8A 2OM2A 3G0IA 3GEPA 5F78A 1EJBA 2QN3A 4GZLA 1KVQA 4LZLA 5AOCA 3P9YA 2G5TA 3IBGA 2YNMA 4FR0A 4AO6A 4HXFB 1UKBA 3KYCB 4XWYA 1WETA 5ECDA 1RHMA 4A26A 4M6WA 4OKIA 5CA1A 3FY4A 2BF4A 1O2DA 5TNXA 2R7LA 2IWRA 5EVJA 2ZWAA 4GOJA 4MLPA 2A86A 2IYLD 3WRXA 1CNFA 2NXNA 1W59A 1E5LA 3GH1A 4TRNA 5DPMA 3ZTTA 4DPMA 4EHFA 3K70B 4FW9A 4MOWA 4C0HA 1CEXA 1I6LA 4BS9A 4KGVA 1YULA 2MJLA 3IPYA 1WNFA 3NWJA 1G6Q1 2ZJ2A 3O4HA 3GLIB 4EGAA 5I8ZA 1U04A 4QOGA 1ADGA 3FCCA 2B61A 3IDZA 4B8WA 2OBLA 3NIFB 4RTOA 4OXQA 1K6XA 2GM5A 3RVBA 1KZ4A 3MTDA 3RT1A 4BJ5A 3I5XA 4BNJA 1HL7A 1U2DC 2RHRA 3EC2A 2PYDA 4RCVA 3IR7A 1N2BA 2HH9A 1RBZA 3MERA 3PC8A 3CONA 1REQB 4FQ5A 3OOHA 3KO8A 4QVGA 1IXSB 3UYKA 1V48A 4EGFA 1BQ4A 3F5SA 4ENSA 3RASA 3UK7A 1UWCA 2BHTA 3KPVA 4KWEA 2FWIA 3ZXIA 3KQVA 4MW2A 4TLBA 1BXGB 2FEPA 2WFAA 4PZDA 2NYRA 5KB3A 2E85A 4KR3A 5ALJA 2F3TA 3CE9A 3LXRA 1MX5A 4P36A 2XRZA 4KUEA 4EB8A 1Y0BA 1B8NA 3V2UA 5EG5A 2E49A 3GOQA 3IE1A 1PBNA 3FVQA 1C7FA 2JGKA 2O54A 2XF2A 4Q3OA 3U4DA 4W7SA 3BTVA 3EZXA 3ZCSA 3DLCA 2DTEA 3IPRA 4XW2A 4X91A 5CNJA 4F6RB 3QV2A 3QBTA 3VHXA 1F38A 3WY9A 5I3CA 5DOZA 4F5ZA 2FPLA 3A1EA 5AP9A 4DQXA 3IUEA 2BW0A 4GOKA 1VPEA 2ZP1A 4HNSA 3VTFA 3CKMA 2AUNA 1MT0A 4FSHA 1ZM7A 4TZ0A 1DIRA 1FDIA 1N1DA 2ECQA 4KMSA 1FFWA 4NBVA 4CM3A 4RDXA 2I4MA 2OHOA 3IT2A 3QY0A 3LQKA 4QD3A 1JFSA 3R77A 1M8PA 5IAJA 2IIBA 2G9RA 4MGZR 1ORIA 4X41A 1DC7A 3UJDA 1UMBB 2OZVA 1V11B 3DVLA 1XZCA 2VWHA 4UU1A 4US0R 3M0EA 3RU7A 1P18A 2O1XA 2GCOB 4A6DA 1WXXA 1GZSA 4Z3OA 4GI5A 3WJ7A 3G5TA 5IF3A 2YY7A 1TEZA 4DPLA 1ZVKA 2PPVA 4F4IA 2WM3A 2OCGA 5BMVF 4FPXA 2CLIB 4MR7B 3EZNA 4J0KA 3UJPA 1H3EA 2DULA 4BLWA 1T0IA 3DTNA 3X44A 4S24A 4HT3B 1J1ZA 4EW6A 2HDOA 1UEJA 3HM2A 1XDZA 4KKXB 3ZE0B 1Z82A 4LF7B 1USVA 2OKCA 3K0CC 3JZIA 3G2MA 2C0PA 5LQDA 3F67A 2CLOB 2XIQA 2DY1A 4J0DA 1Y9DA 1C9NA 1M1YE 4EW1A 2QW0X 4BRWA 5LU8A 1FSSA 4K81B 1Z0FA 2A1TR 3OFNA 1GYRA 4ZC8A 2FXIA 4C06A 4HEQA 4WNYA 1N2GA 1WLYA 1F8XA 3I3OA 1JA9A 2PKCA 4DC1A 1KI6A 3DTTA 4J0IA 3OEHA 3LO8A 3RG8A 4EFDA 1KR2A 1ZD5A 1E7SA 2A5DA 2R7NA 2FG5A 1K9VF 1P7PA 2C29D 4OI2A 2CNWA 3VJKA 1Z6QA 5AHOA 3E5NA 4UNNA 1TRHA 2Y66A 2W83A 4MVJP 5AVYA 1T5LA 5FORA 4F3KA 3AVTA 2R4QA 3BGVA 1YK0A 4HDNB 4O0LA 5JXIA 1T13A 1MV8A 1X86B 1NUSA 2I6FA 3PHJA 4RPKA 1F5SA 1U0GA 4MI9A 2V7TA 4GEKA 4UNSA 4URFA 3QJYA 3FHCB 4CMEC 4B80A 5LD2C 4DA4A 2P6RA 3AYZB 2OBBA 5CHEA 2ZK7A 2WAMA 3M9XA 4X24A 4DMKA 4X64B 2XQFA 3OJLA 4F91B 1F8FA 2ZS7A 9LDBA 5I8WA 2IF0A 5F33A 1U3DA 2XYQA 3AVQA 4OYHA 3D3KA 2PXAA 1XMXA 1EEHA 3L1UA 1LDNA 3R4VA 1A82A 2HF7A 1DEXA 2ADFA 4C21A 1A5ZA 2VNHA 4UTZA 1IEVA 3CR7A 2O8CB 2NTNA 1KIMA 4L0MA 3KCQA 1KZ6A 3A1WA 1Z17A 1HDYA 2WW8A 4WERA 4DA0A 1XMVA 3H5AA 3WGKA 2CN1A 3WGVA 3KETA 4RY8A 4X3PA 3BRSA 3IE2A 1H42A 1B41A 4Z4HA 4JHXA 3ZBTA 3BXZA 1PFVA 1KSJA 3R2JA 2AJBA 2HWWA 1T9CA 4B7XA 3KTDA 1RYYA 2Y68A 3V7UA 5FL7A 3CNHA 1PYOA 2EBUA 3K9NA 4KX3A 2XWQA 5EWLB 2FFRA 2NAFA 4YV0A 1TCUA 5FWAA 3DM9B 2X14A 4WJZA 1UC8A 2QXYA 3LHIA 3WQSB 4CL3A 3KXKA 1JDVA 3EA4A 4W8OA 2BGTA 5L45A 2HK9A 2OO7A 4QLAA 1Q0PA 4QTXA 3TAUA 3H1FA 1B16A 3LUHA 3B9RA 2DHCA 2PRYA 1Y63A 2IXBA 3C5HA 3HU3A 5AW1A 5LXTF 2C59A 3QEBZ 5EFZA 3X43A 4CCAA 4OXXA 1LV8A 1YHNA 3FA2A 1E96A 1U2SA 4HDMB 1NY6A 2HWKA 4KSYA 1NE7A 1RI1A 4AZ3B 2NU7B 3HM9A 1NBOA 5SYAA 3SHOA 3KQOA 5BW4A 2II6A 1WXHA 3FKQA 4PLZA 1DBVO 4KRGA 4YBZA 5DSXA 2DH6A 4D8VA 3BZUA 3TKYA 3X1JA 2VUIB 5DF1A 3NYQA 4M7OA 3GLHE 1SKBA 1E9AA 5CIYA 2O5RA 4JLOA 1L4KA 3HVKA 2P9CA 3MTBA 5DW0A 4JI2B 1T29A 1F12A 4TWAA 1KOGA 3C3CA 2ZI7A 4DNOA 2QAGB 2A57A 2NO5A 2XODA 4OAPA 4PNPA 2ZAGA 4KCGA 3SVTA 2AA3A 1E0JA 4TM7A 1DX4A 2LBPA 2DBQA 1CF9A 1R0BA 5K3FA 3ER9A 1J5PA 4KL8S 5JS8A 4O6VA 3R09A 2RJNA 4OQZA 1ZOPA 1BO6A 1RCFA 3ME5A 4Y0NA 5HKAA 3CJQA 5B37A 1VKHA 4XPZA 4H6VA 1KMIY 3V8VA 1VPDA 4R51A 2AEFA 2HJ9A 1XN1A 3BK2A 1Y9AA 4MX8A 1GARA 2DPYA 2C4TA 2FNAA 4GPIB 4PC3A 5B58C 4IDHA 3PQ7A 2WTUA 5IARA 1AO3A 3BEOA 3DDCA 2GZSA 2O8DA 4QFCA 3PFFA 2XBLA 4H60A 2BRUC 3I9NA 4L8LA 4Q37A 3KJXA 1H6BA 1LTHR 1XJQA 4W5HA 4IS3A 3THWA 3P32A 1NXWA 3E23A 4AWAA 2UZ0A 3MFYA 2EL7A 1UJ6A 2O2JA 4Q1DA 4HDSA 1XVLA 4ZK2A 4I50A 1KTIA 3OIFA 5JBIA 2JNWA 1B1CA 4CG1A 3AERB 5C18A 1YR2A 4MQFB 1A8HA 1IAVA 1E1CA 1QLWA 3N39C 1R2QA 4RQBA 1ORTA 1IOZA 1RFLA 4U9IS 4WQMA 5BW5A 2ATCA 2H06A 4K8RB 3PHHA 1VCMA 5J5VA 4KHPB 4NBTA 1RJDA 3O21A 4LJSA 4PZ9A 4WN3A 3ZQKA 1Y1SA 5L3ZA 3TPZA 4JLMA 2OWDA 5JNRA 1B74A 3NEAA 1OWNA 2ACKA 2B99A 2NSJA 1CNMA 3NP9A 2WD8A 3NYIA 3LWDA 2MSDB 1C0PA 1OQAA 1DAGA 1OV6A 3GVXA 4G9GA 1XZPA 3AUTA 1OA1A 3LCUA 4WIAA 4JBYA 4X20A 1AN0A 2WIFA 2J30A 4DHWA 2X4DA 1RC8A 2YXPX 3BWYA 1YOBA 3ZWPA 1TXGA 3KBOA 3IJRA 1KC3A 3T6KA 1MFZA 1T4BA 3LA6A 5K1ZA 3RSCA 1KEEA 1GADO 9MHTA 5LWQA 4N48A 1AK1A 4I1PA 4C2AA 2JIQA 1FYWA 1E7RA 1DQPA 3WICA 1RFGE 4NS1A 1IHYA 1XV5A 3V4PB 5CLJA 4MUKA 1XD9A 4FSDA 5D3QA 1JIJA 1KEZA 1XP5A 3RAJA 3QWAA 2JFVA 5CUQA 3KTAB 3MUOA 2KW5A 4YDHB 2IVFA 5EP4A 3WKEA 5T4FA 1FZQA 3E7FA 2X0EA 3GIDA 3U3JA 1DT5A 5EJ2A 3UQZA 1H2HA 4C9BA 1T9BA 5JBNA 4MWDA 2Y0EA 5DEIA 2GF0A 5AYVA 4JR0A 2QRLA 4QREA 4WBNB 3C70A 4PS1A 2I7DA 1GYQA 1XDBA 2N0SA 1J6UA 2ZRIA 2AVNA 2VK8A 3ASZA 2J3EA 3EVTA 3LDUA 1JTFA 4HDKA 4C22A 4FFNA 4CKZA 3GUUA 4XRGA 1QQ6A 5HTKA 5K3SA 2G8LA 3DM5A 4HJXA 3VO2A 2DEUA 4F8JA 5G4KA 3FYUB 2ZWMA 3R41A 4RK1A 4RX1A 4DNFA 2Z56A 4OX9Y 2H9AA 3F6RA 5D85A 3L7CA 1P5RA 1GKIA 4ENRA 3UA4A 3LPDA 4YCDA 3A6KA 3I28A 2GNAA 5E3JA 3OEYA 3HL4A 4BEBA 5FNVF 4JC8A 3L7BA 2V8BA 4M8IA 4ONEA 1N6RA 1MJNA 3RU9A 3EH2A 4V0NA 1H93A 3OBIA 2IY8A 5EP3A 3U9SA 3W2EA 3HFGA 2XXAB 2JKYA 4TVBA 4CLOB 5ECYA 2WVHA 1PDVA 2DQ4A 2ZZNA 3SLGA 4QOJA 2I2DA 3AUJB 1R4NB 4J9UE 3MCZA 2C84A 3OOWA 3CNBA 5AM2A 2BHRA 2AMJA 4IDBA 4OPMA 4C6HA 3ZKAA 3GGPA 5CTAA 2QEQA 3IOMA 2WJGA 4F56A 1GKLA 2HJVA 5FI0B 4JJGA 2AK3A 3G2IA 2W2VA 4WA7A 2IEGA 3I92A 3L8HA 2EFEB 4KR9A 1RI2A 3DE7X 3DV0B 3MW8A 5HIMA 1WY7A 1YIAA 3SC2A 1TKAA 3WHKA 3ZWAA 4EGSA 1Z39A 4OQNA 1GXSB 3Q11A 2EKBA 3E0QA 3QH4A 4A8HA 3JD2A 1N6PA 1NF9A 3D0OA 2QW8A 4INJA 1UBMS 3N2IA 4IIBA 4KSCA 3VI3B 5JYBA 1SUWA 2OXEA 4B3FX 3EQ2A 4WBSA 5FTLA 3KEQA 2EEZA 3LLVA 4CIVA 3OOYA 5CFOA 3SF8A 3OQOA 1FMLA 2R87A 4JUAA 4O4LB 3V3TA 1PSWA 1EUZA 1XVIA 2PL9A 4TS9A 4YYZA 2ZYRA 4RFVA 2G5CA 3C6BA 4F4HA 3K05A 4XTRA 2E3JA 3JU3A <