5IUKC

Crystal structure of the desk-desr complex in the phosphotransfer state with high mg2+ (150 mm)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
132
structure length
132
Chain Sequence
SMISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase/gene regulation
molecule keywords Sensor histidine kinase DesK
total genus 46
structure length 132
sequence length 132
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iukC00
4O1IA 5D2CA 2H3HA 4L4UA 2W42A 3DLBA 3Q41A 5IEJA 1LBIA 1E6MA 2JBAB 3RVMA 4N47A 1RPJA 2A9RA 2GWRA 2YHBA 5E3JA 4G0XA 4Z99A 3G85A 4NV3A 4F11A 3LOPA 3CG4A 2QR3A 3O2JA 3LUGA 3HDVA 1ZVVA 1S8NA 3CS3A 3GA5A 4NICA 3UK0A 1ISSA 4Z4IA 2JK1A 2VUHB 4Q6WA 3H5TA 1BDJA 4KV7A 4TMYA 5JNRA 4UHJA 3H1GA 3O2QB 1XHFA 5TQ0B 3LMKA 2JBAA 3IPAA 3RVOA 4MR9B 4EVQA 1KRXA 1QP4A 2N9UA 1ZY2A 3ILHA 5HQJA 3TB6A 4MR8A 1U2PA 1VLZA 3KKEA 1PNRA 1F4VA 3H5VA 3B2NA 4LX8A 1BDIA 1EWVA 2F8TA 4MR8B 1AB5A 2PL1A 3OLVA 2P4UA 3NHMA 4MQEA 4E7OA 1GUBA 3C3WA 3OLXA 3CKMA 1MB3A 1QQBA 1USGA 4W5QA 4Z9BA 1VRVA 4UHKA 5DCLA 3NNDA 2IPNA 1FSPA 4HNRA 3KHTA 1TMYA 1F51E 3RVPA 4RK4A 4ZYLA 4OATA 4QICA 4EVSA 2FMFA 3LFTA 5JNVA 5EWMB 3OM0A 1JL3A 3NHZA 4PYRA 4G0OA 2PL9A 5IX8A 3Q7TA 2GBPA 5TPWA 1T34A 4LE2A 2VUIB 3FFXA 3OO0A 1Z2DA 2L2QA 3O1JC 5TPWB 1MVOA 3JTEA 4YO7A 3RVNA 4EUKA 3H6HA 4MS4A 4IF4A 4KNYA 7ABPA 2IDMA 3LUJA 1DJMA 4YR7A 1D2AA 3N75A 5T3YA 1Z18A 3EDCA 3HZHA 4IMIB 1ZN2A 2IPAB 2WRZA 4G86A 3QLTA 4CBVA 5KC8A 3QK7A 1IIBA 4KK3A 3HJFA 1USKA 1D4ZA 1JYFA 2R4QA 4KQ9A 3FDFA 4EGSA 4EYGA 3T8YA 3A0UA 4Z0NA 4MRMA 4PICA 4Q7EA 3NBMA 1RZRD 4G97A 4WUTA 2P9HA 1JBEA 1QKKA 2JCGA 3TX6A 4W5RA 4EYQA 1L5ZA 2E4WA 3KS9A 4P1ZA 3DZDA 3GBPA 1D1PA 5TQ2B 4OLAA 2CHFA 3LUCA 4LDZA 3OLYA 4PE5B 2FEPA 4RK6A 4O5AA 3O1IC 5BRAA 4N0QA 3KTOA 4YGXB 2B4AA 3HSYA 2L18A 2FN9A 2HQBA 2IYNA 3QELA 3T95A 4NCBA 5CNKA 1M2EA 3L6UA 3A0RB 3Q9SA 3IPCA 1DCMA 2H0AA 1ZGZA 5KQMA 4QYMA 5CNMA 3HUTA 5TE9A 1YK0A 3OM1A 3LKBA 1U0SY 1TLFA 3RVQA 2QXYA 1PEAA 5FWYB 3EJWA 1ZHHA 2PUCA 1NXOA 1KRWA 1EAYA 3ROTA 3T6KA 3TD9A 3HEBA 2MYPA 4JOQA 4Z4GA 2MYNA 3F7NA 1ZH2A 3I5AA 3R0JA 4KMRA 4MR7B 1NTRA 3OMWA 2PKXA 3JVDA 3MIZA 3EODA 3LUHA 3N53A 2HQRA 5IBQA 4S04A 5DLEA 2TMYA 5IUJC 4S05A 2V0NA 3IP5A 2FVYA 3FMVA 3F6PA 4LZLA 3CNBA 1ZESA 2IPLA 3DGFC 3O1HB 2WMYA 1QPZA 4MS1A 1DC8A 5JNWA 4LE1A 3RVJA 3H5IA 3RVRA 4DN6A 1P6QA 4PEVA 5EWLA 4PZ0A 4RS3A 4ML3A 1ABEA 3S99A 4D6YA 2QVGA 2PLNA 2RGYA 2B1JA 3SM9A 1ZITA 1Z25A 2MSWA 4YWHA 3RVSA 4F12A 1C0EA 4MAAA 4F8JA 5FWXB 4O1HA 8ABPA 3HDGA 3IP6A 3SY8A 1SD5A 5PNTA 4ETNA 4RY0A 4RK0A 2R48A 2BGGA 3HM9A 1WETA 3DLHA 3QLUC 3H5OA 3RVLA 1M2FA 4GPAA 3OLWA 3O21A 2PMCA 3MYYA 4XLTA 4LE0A 1H9CA 1FFWA 3W9SA 3EQZA 4RV5A 4MQFA 4RY9A 4NCAA 3HXMA 1GCGA 3L49A 1B00A 6CHYA 3N8IA 4WXEA 1USIA 5TQJA 4H60A 3GV0A 5TPZD 1DBWA 2KYRA 1NXTA 2FTKE 2ID9A 3OLZA 4IRXA 2WWVD 4D74A 3QEMB 1JWLA 4OLBA 1RXEA 2DRIA 5KI6A 3BILA 4Q6BA 4RXTA 2HJ9A 1P2FA 1RXIA 5EWLB 1DCFA 3KJXA 2FQWA 4Z9AA 2FW0A 1YMVA 1JFSA 1P8AA 2JVKA 2PJUA 1W25A 4RZSA 2PUGA 1JDNA 3HCWA 4P98A 4RK1A 2NT4A 2A9OA 4JASB 3N6VA 2AYZA 3CU5A 4MPTA 4WXMA 3O75A 2I6FA 3HK2A 4WWHA 4MS4B 1TM2A 3OQOA 2NT3A 5JS2A 2QVCA 4MRMB 4RXMA 3RVKA 3NNSA 2NZUG 5TPZA 4MGEA 1GLGA 3QEKA 4KFCA 1K68A 4Z4HA 2HSGA 4E7PA 1YK1A 3CZ5A 1R8JA 3E3MA 4ZJPA 1JH9A 1NXXA 2PUFA 3EAFA 4WZZA 1APBA 3OQMA 3H6GA 3P9YA 1DP4A 3GT7A 5DKFA 2FLWA 1YS7A 2RDMA 1U8TA 3DBIA 1JF8A 4G0PA 4JB2A 1JYEA 4TLLB 5IEBA 3EGCA 4W5OA 4HNQA 4MS1B 5FBKA 9ABPA 4OG2A 1NATA 3A3KA 1ZH4A 1JFTA 1D1QA 3QEMA 3RQIA 4XASA 3O74A 4Y9TA 4Z4FA 2FEWB 2FLKA 3G1WA 4LDAA 5TQ2A 5GOTA 6ABPA 1LJLA 1W9HA 4D6XA 4JB0A 3CLKA 1HEYA 1QO0D 5GQSA 1QQAA 3QLVA 2R47A 4HNSA 3JPWA 4LRQA 1JHZA 4YLEA 3MMNA 3GRCA 3OO1A 4G0MA 3Q7SA 1DG9A 1BAPA 3HUUA 2PE5A 3F73A 2CHEA 5B3JC 1TVMA 3UUGA 2VK2A 4JP1A 4YP9A 2MYUA 2ID7A 4N03A 3SNKA 4EVRA 3A10A 4JAVC 1PHRA 1EHCA 2RJOA 1XHEA 2X7XA 3C3MA 2MSKA 5IULC 1PNTA 2QU7A 1AB6A 4KVFA 3HVRA 1P6UA 1MIHA 1XWWA 3GBVA 3E61A 1PUXA 3M6MD 4ETMA 4EYOA 4H3HB 5I4CA 1I3CA 5TQ0A 1LBHA 1ZGGA 3N0WA 4ETIA 1D5WA 3HS3A 1QNLA 5JNTA 1A0OA 1PEYA 4N0PA 1JX6A 1KGSA 4RSMA 1KMIY 3VNBA 4N41A 2A9QA 2LP4Y 5B3JA 3CTPA 1C4WA 2M98A 4MR9A 1CHNA 4MLCA 5HM6A 2CWDA 3KSMA 3GWGA 4NQRA 2Q5CA 3KG2A 4RKRA 1E6LA 3ILYA 2PUDA 1NXWA 3QX8A 2L19A 3OMXA 4RXUA 1QP7A 1M5UA 3H5LA 2JVJA 4MLDA 3SAJA 1UDRA 2FN8A 3NNNA 4FE7A 3EQ2A 5BRJA 1VPWA 1Z26A 2E4VA 1Z12A 1U2QA 2PUAA 2FKAA 2WJAA 2ZWMA 3BRQA 4N76A 4W5TA 2RJNA 2JRLA 5HSGA 3LUDA 4MQFB 3N0XA 2MYTA 4MR7A 1DRKA 5EWJA 2E4ZA 3FGZA 3M9WA 3TO5A 4KREA 2JVIA 3H1EA 3IDOA 2E4XA 3H1FA 4H3KB 4KQCA 1JLKA 1MB0A 5C5EA 3CZCA 5FWYA 3EULA 5IUNC 5EWMA 3MQ4A 1M5TA 3OQNA 1SRRA 4TLMB 3QLVC 1ISRA 3LUAA 4GNRA 2VYCA 2NUBA 3D02A 5CHYA 4Z4EA 4ZPJA 5T7BA 3HV2A 1ZDMA 5KQGA 2QV0A 1DCKA 4RKQA 1U04A 3BBLA 1A04A 1QP0A 2A9PA 1JDPA 2WB4A 4XXHA 4G0QA 2CD7A 1FFSA 3KYJB 3KCNA 1QO0A 4B09A 5C5CA 1E6KA 1VKRA 3QX9A 1DBPA 3SG0A 1CYEA 4YCSA 1NY5A 2FMKA 1BA2A 4OBBA 1K66A 3IP7A 3TMYA 3C97A 3T38A 4G0ZA 4F3TA 4RY8A 1EWKA 1BVHA 1LJUA 2E4YA 3DGEC 3I42A 4KRFA 1YMUA 3ROFA 1DRJA 2E4UA 3MF4A 2MSLA 3CRNA 2PUEA 4DQDA 1ZAYA 1E2BA 1TJYA 3UKJA 1SXIA 4RK7A 2WJWA 3C3KA 3GYBA 1QMPA 3RH0A 3CHYA 1A2OA 1BDHA 1YVUA 4G0YA 1DZ3A 1FQWA 3HO1A 1Z13A 2IOYA 2FEKA 3O2SB 3QELB 3URMA 4EY3A 4FB4A 4KPYA 5CNJA 2J48A 3M9XA 4MQEB 5EWJB 2O20A 4XARA 2GKGA 1Z2EA 1NXVA 4MYRA 4XFKA 3IP9A 1YIOA 2FQYA 5IUKC 2NZVG 5JS1A 1OXBB 3Q7RA 4YS6A 3H75A 3LTEA 3BREA 2YHAA 3JS5A 4FE4A 3GL9A 1Z15A 3LUKA 4ZMRA 2XDYA 3Q15C 4MS3A 3C6QA 5KQLA 1SXGA 4IILA 1L5YA 2OENG 3CFYA 1URPA 1DC7A 5F64A 5JNUA 5KC9A 5KWSA 3MA0A 3LKVA 2JB9A 2LPMA 5BR1A 3VNAA 2FXIA 2ZAYA 3K4HA 4IMJB 3FFTA 1SXHA 5ABPA 3QLUA 3JVIA 2GI4A 2QW1A 5DGCA 4JA2A 3MM4A 4RK5A 2QZJA 2IPMA 4Z4CA 2OQRA 2LUOA 1OXKB 1ABFA 1RNLA 3LUFA 1CEYA 1YTUA 2IKSA 1LK0A 1EFAA 4KZKA 4ZMSA 5DTEA 3BRSA 3I45A 2PUBA 2GX6A 5JNSA 3KLNA 3FFWA 1MAVA 2FMIA 2R25B 3F6CA 3KLOA 5FWXA 3SQNA 4QPJC 1JFVA 4RWEA 2FSPA 3JPYA 4QYWA 2LBPA 2PAFA 5BQ3A 5HKOA 2HPHA 1EWTA 3CG0A 4XAQA 4WT7A 2FMHA 1J56A 3N0RA 1GUDA 1GCAA 3H5WA 5CNIA 3D8UA 4TN5A 4RDCA 4DADA 5ED4A 2HQOA 4MS3B 4RU1A 4YV7A 2FQXA 3I09A 4M88A 1Z17A 2F8SA 4OTZA 2AYXA 4KK4A 4IGAA 4L85A 5IC5A 1DBQA 3K9CA 1YS6A 2M1ZA 2LIVA 2L17A 3JY6A 3KYIB 2QSJA 4EYKA 4F06A 1Z16A 1RZRA 5FBHA 1Y1LA 5KQPA 4HYEA 1FFGA 4YRZA 4W5NA 1NXPA 1NXSA 2WY2D
chains in the Genus database with same CATH superfamily
4KIUA 4O1IA 4ND6A 4L28A 1VZ2A 3ZJTA 2JLXA 4CTMA 1Z5UA 4M1SA 5LWHA 3L6RA 1U9CA 2OHOA 3KOZA 5TARA 1SHUX 3NVAA 1K5GA 3GP8A 2Q1UA 1TA4A 2IJGX 5DW0A 1K9VF 1SXJA 3B78A 4BP8A 2W11A 3IE1A 1W7AA 2QR3A 5AVJA 4C6SA 3C7AA 2C59A 3F6EX 5IN5A 1T8PA 2O1EA 2QG4A 4IIJB 1ISSA 4U7HA 4PG7A 3DMNA 2W0SA 3H5TA 3MCVA 3BQMB 4HB2A 5K3AA 4HT3B 2XZLA 2C92A 2G09A 1QOPB 3O2QB 3TRKA 1YKSA 4CLOA 5P8WA 4YCNA 2UKDA 1VG0B 3LMKA 4QAQA 4PLTA 5IC4A 3CVUA 3O92A 4E1VA 3PFKA 3DD5A 4MR9B 1FA9A 4L08A 4U2KA 2CYAA 1P9WA 2E5WA 3G8BA 3P0IA 4RCYA 3T0FA 4J16A 3VNRA 4HDNB 4LX8A 3UMVA 1IONA 1O6FA 2VHUA 5B7GA 1QVVA 3CSSA 4JUIA 1E0SA 1EVJA 3FWNA 1E4VA 4MMZB 1UR5A 4HQKA 1D2MA 1L4GA 1V47A 5I9MA 3UJ6A 3C3WA 3U4AA 1CJMA 3CNOA 4IQ0A 4OQ4A 4PANA 4YHHB 4UAGA 3KZVA 4MYDA 4G84A 4ZIRA 5A5DA 2PRJA 3AZOA 1L5RA 4J2HA 1KKUA 4IGIA 3BDIA 1CQPA 2GAAA 4KR3A 2ZUDA 5CYPA 3HXQA 1F2UA 4ARSA 1XKLA 2O2ZA 3GARA 3LFTA 3VJKA 5IANA 4CXMA 4R16A 2HT1A 1PFGA 1PSDA 3F5MA 2GB4A 1YE3A 1KRHA 5HIIA 3QXCA 3HCDA 4JLWA 5H3HA 4YUVA 2AIRA 5DYGA 3DMYA 3OCJA 4JC4A 3U6KA 3JASA 3KYCA 4GF5A 1CZRA 3IHTA 3JAKB 3RIYA 5AVUA 3FMIA 2BGJA 3DMRA 3C6KA 4X8MA 1VA5A 4CKCA 4WNYA 1X74A 2WQZA 1F06A 1A7AA 2OO3A 2ZWVA 3K2BA 1CD5A 3BB1A 3GQBB 4XSGA 7ABPA 5A6SA 3DVLA 1KWKA 4QDKA 3G02A 4YRSA 3H3JA 1OLOA 1SC1A 4HNTA 3T7JA 1SM4A 3OCWA 4ZYWA 3NASA 2BDUA 1TL7C 2EKLA 4RE5A 1SD2A 3QMWA 5JCXA 2JJMA 2WNIA 3OOWA 4IYJA 1GTZA 3HKDB 4R68A 5DSZA 3HKBA 2HI0A 3SVZA 2HV9A 4NPCA 4P5DA 4NBTA 2GXUA 4DQKA 5D6NA 3RANA 4W1SA 3TR6A 1F1JA 1Z0AA 3OZUA 3NJ4A 4QBGB 1T5LA 2HLPA 4LZWA 4ZD6A 4NYIQ 5FHQA 3E9RA 1ZRHA 2PZMA 4GE3A 4IMRA 3LKDA 3SVTA 1LRKA 1P1CA 3LUCA 2GM4A 4RPCA 4B4VA 3I1JA 2EKBA 2I80A 5BN1A 1K7EB 1CRZA 1AIPA 2X19A 2VHQA 2FN9A 2X0IA 1CZHA 3ELYA 1T2DA 3GEIA 1DU4A 4UAJA 1LPNA 4O5OA 3WJ1A 4CV3A 4YO8A 1ZJ6A 1E2FA 1P31A 2GQ0A 2IRWA 3SI7A 5JO9A 2W2KB 4K05A 1RWMA 3LD9A 2ZYVX 3FIUA 5HS4A 2JH3A 3WJAA 3AVUA 2VXYA 4XR4A 3N58A 4KDFA 3AUJB 4YJFB 2VWGA 2AHOA 1EAYA 4GBJA 5FXMA 4AZVA 1T8RA 1UXJA 1MC5A 4O08A 1T9HA 5JAOA 1WUIS 1XYGA 3QE2A 1YQXA 2ZOSA 3QVVA 4KMRA 1ADYA 4LZZA 2C84A 1DAOA 3EEQA 5CB4F 4LGVA 4JI5B 1AQYA 5AW8A 1E3LA 1M1ZA 2C2GA 4OB6A 1J90A 4LY3A 2WM9B 3H5NA 4FBGA 4MPJA 2ZRFA 4RPKA 1O54A 1Q2UA 5HBRA 1WV0A 1GZ3A 3DTTA 1XZEA 3QNWA 4CF3A 4UTNA 4PZ0A 1ABEA 4KE7A 5K03A 1Y3CE 3P96A 5IP5A 3T5GA 3U40A 4D9FA 4HQRA 1J2YA 4F8JA 3OEEA 5BN4A 4BX2A 2QRUA 1FYVA 4C4XA 1PLKA 4IQ8A 3AEQA 5HF6A 4OF4A 3GLHA 5F33A 5JISA 5KPJA 5EHZA 3CUTA 3QKUA 1OX4B 4KXYA 4K8RB 3Q8LA 4F56A 2J9FB 4QUDA 3HGMA 4D82A 2ZIEA 3QLUC 5D5PA 5JNLA 1GGHA 1CC1S 1F38A 3F2VA 2PZEA 4LYJA 4OAQA 3Q8KA 1HA3A 1TECE 1P62B 2Z6VA 5LNK1 2GFHA 3LWZA 3FCEA 4EJ6A 4I9FA 1Q3HA 5K01A 1LSJA 2C98A 1GUAA 1NLZA 1VKOA 3M34A 4UUAA 3RHZA 1M54A 5LP6C 4OH7A 2XJ9A 1N2JA 4KC0A 1G66A 4FLEA 1NXTA 5AW1A 4HH0A 1P1IA 5AXDA 1DJPA 5HGXA 3VJMA 3NAMA 2FK8A 5DLDA 3WK7A 1JWLA 2XNDD 1M2VB 1KJZA 4I8DA 2I1LA 4UNPA 1X0VA 1ZQ1A 4S1WA 3VR5D 1JDNA 1F3LA 5ADVA 3OC6A 3O5AA 1XQYA 3A6DA 3CTMA 3ZZ1A 3K09C 4YDRA 1GXSB 1I3OA 4ENVA 1TIBA 4OM8A 3D8NA 3PEVA 5AUPB 2R7LA 3HK2A 3OX2A 5KYUB 3FOAA 1BHSA 2RGWA 5F23A 2D7DA 1XV5A 3ZHZA 4MW4A 4Z2AA 5CDFE 2X1HA 2X9GA 2QVCA 3BWMA 1HV8A 3RC2A 5J2UF 1ZUHA 2WTEA 3QUQA 4PG4A 1KSHA 1CDEA 1MABA 2CHVA 5D6OA 2NZUG 5E38A 3ANTA 3SJBA 1UPXA 1NKSA 2PZLA 3UMSA 4AZ3B 3V2IA 4HHEA 4YRTA 4Z4HA 2QRVB 1Q7TA 3BD7A 2ZE8A 4ANFA 3PE3A 4JVLA 2FPGA 4XB1A 3E8MA 3G59A 4OYRA 5D3MA 4ZKEA 3OG9A 1SQGA 3UV6A 4DC9A 3PK0A 3FOEC 1LPSA 1GQRA 1T8WA 3BERA 3F9CA 4CIAA 2CJFA 4CT0A 2IYVA 4RQUA 2H0RA 2P2DA 4IO1A 1EMDA 4QXOA 2IUTA 2YV1A 3IULA 4KUEA 1L8XA 1LNQA 2ALJA 2DPMA 5F4ZA 2IBTA 2G6BA 1W4AA 2D6FA 1V16B 4UFOA 4OQXA 3VPXA 1ZMOA 3T9DA 5C35A 4B79A 3E3AA 4XASA 1MEEA 1YC5A 2A5FA 2P3OA 4LC9A 5GZ6A 4ZK2A 4DCNA 3GELA 1KY5A 3RC9A 6ABPA 2ZU0C 4MMXB 2PX2A 3MJCA 1I2AA 4ZT5A 4DV0B 1UJCA 4H7DA 5LB4A 1GCOA 1V5EA 3NVMB 4ZXFA 2Y99A 1EQ2A 1U7DA 2PZ8A 1ELOA 4D46A 2AXEA 1NJ2A 2XKAA 3HFJA 4ZVKA 1AV6A 1KH2A 2G1UA 4D98A 3R6DA 1RRFA 2ZZKA 3F3YA 4YLEA 3ZCXA 1XA4A 3KO8A 2AN5A 2W90A 5K6RA 2QY6A 3IPRA 4HVAA 4BEJA 1CSEE 1PG5A 6YASA 5G53C 1DQNA 2MYUA 1II8B 3TZ6A 3E18A 3HU5A 3TMAA 1BROA 1GZ5A 3BB3A 5DF1A 3V7UA 5KTYA 1QIFA 1K6XA 3G0HA 3HLTA 3IEPA 5U4QA 2JGKA 1D2RA 5KEIA 1KP9A 2FWRA 2QIOA 3M6VA 1ZHOA 3TGWA 3V7FA 2HWUA 1UANA 2GF0A 2DWQA 1CG6A 1TQ8A 1KBOA 1T24A 2F3QA 2JAQA 3QWFA 3R23A 3AY7A 4Q4AA 5ALHA 5ILQA 3TQHA 1Z2AA 4N40A 1MG5A 1T2FA 2H54A 1JPUA 4W7IA 4L73A 5T64A 4I1OA 3IP3A 4DM7A 1RAHA 4CLRA 4AJOA 2BSAA 1QP8A 1QX4A 1O97C 5EJ2A 1T15A 4GZLA 5DT2A 3EIEA 1CV2A 5FOXA 1IPEA 4A8TA 4NZOA 1H6AA 5CR9A 4H0NA 4RHEA 2QGFA 5ALTA 2R87A 5ALNA 4CW7A 2O2DA 2C5AA 2JLBA 2R5WA 3GUZA 3BXOA 4F38A 5GY7A 1CUXA 3LZDA 3RNLA 2PEYA 1RIFA 2BE7A 3NNNA 1HE1C 1S8OA 4UZEA 1Q57A 3H0EA 4R1UA 5T4FA 2YW9A 1U2QA 3M83A 4ZHQF 1LA2A 2EP5A 2SECE 3F46A 2B6HA 1MV8A 4LI0A 1WXQA 1FU4A 4P84A 5LDHA 2A0UA 3ROQA 4DL9A 1Q0ZA 4EHBA 2VHYA 4I5DA 3FGZA 1JFFB 3SZOA 5D3QA 2JD2A 3PNMA 4IW3B 3UPDA 4XQ9A 2G83A 2XWQA 4O2LA 1UEXC 3UJHA 4GKVA 1STOA 4AVYA 2JEYA 1NUHA 3ODGA 2BJVA 1IZ8A 2GJAA 4K26A 4Z1MA 4ZRNA 4TQUS 2H6EA 3LUAA 3ZXXA 3IB6A 1ZK3A 1SEVA 2VYCA 2C5SA 3ZJ5A 4DLZA 1KORA 3DQPA 4XFJA 5CMLA 4C7BA 2ZE7A 4CCYB 3V4SA 5KQGA 4Q3CA 4QATA 1DFIA 5CLHA 5ULLA 2EJWA 2REBA 3RYFB 3LY5A 4TSFD 1L7NA 2G4LA 2RK3A 2X8BA 1PT5A 3CURA 1Z0IA 3M6LA 2YDYA 2ZROA 3FCSB 4XXHA 2CD7A 4Q9IA 4CF4A 2QG6A 1A77A 1L1EA 3EZ9A 3KCNA 3QU2A 4K03A 4QU5A 5M7EA 4JN6B 2DJ5A 1I14A 1D4OA 3TD2A 1M1NA 1M7HA 1J8YF 2HK6A 1ZWLA 2Q9CA 4ND5A 5E7JA 4DABA 1LLDA 1R7RA 1WM1A 2N0SA 5TVGA 1D3AA 3LZ6A 3M8KA 4GXTA 1VXRA 4QO8A 3UBMA 3IXMA 3JQPA 4HGNA 3VU0A 2A57A 1B26A 2VAVA 3Q10A 1IZ7A 4LXQA 4MUFA 3ZJUA 3HGTA 2C5EA 3TINA 4UNQA 2HMWA 1L8LA 3EUAA 4QTZA 4QYXA 5FB3A 3W6OA 1UBRS 1KU0A 3ZHTA 3KE9A 4DQDA 1PDOA 4DMMA 1ZRMA 2Q9AA 3D3JA 3FGNA 5BN3B 4AO8A 1H8HD 1G19A 2JJ1D 1QKJA 2W83A 2Z4SA 1SRQA 1PG2A 4YRJA 4EA8A 2CYCA 3VTFA 4F5DA 4LW8A 4M21A 1GZUA 5DHFA 1MIOB 3CH7A 2ILVA 3NEPX 2ZREA 5CPBA 1P60A 1DZ3A 5E95A 4DR6B 1EE9A 1E62A 4PVCA 1PZMA 4DZRA 4Z54A 2O8EB 1GNTA 1SA0B 5ALDA 5THQA 3MG9A 2ANBA 3GCGA 3OCCA 3DR5A 3IQWA 4UCQA 5DHRA 3T54A 4DLVA 3T3EA 3EFOA 4RGQA 1LTQA 2X2PA 5FNVF 2FQ1A 1EFPB 1PD1A 1LBTA 1XPUA 4KRFA 4D4IA 1YCFA 3QUTA 4O3FA 1YUMA 4F2DA 2PL3A 4YPOA 4HL6A 1XZNA 4N7JA 4BX0A 4Y7DA 5ALLA 2P9CA 3Q1LA 1LK7A 4ND4A 1SXGA 2IUEA 2VNKA 3OCXA 5C51B 5JNUA 5DSTA 1IEWA 4DR7B 4F4HA 4MW6A 2O2IA 3C14C 1PJAA 3WIBA 1P4JA 2GEVA 3CIFA 1AA9A 1ZK1A 1U2ZA 2RCNA 4H9GA 5CM8B 3NP7A 3T61A 4DCOA 2NUPB 3THOA 3L2OB 3VVMA 3NV9A 4ZCQA 2GYYA 4CGYA 4BLUA 1YZGA 2H31A 3QKIA 1CLUA 5GM1A 4A8HA 3HB5X 2YJ6A 3JWEA 1LBQA 2GVNA 5KYKA 5CCBA 2LDXA 4ZMSA 2BFPA 1PAUA 1QH8B 5DTEA 3D5QA 1KXZA 3HYLA 5FEUA 3UV7A 3OAAA 4XWAA 3P4YA 4Y0VA 4TXNA 5EE9A 3MD9A 4XRGA 1PWZA 5U1PA 1B1AA 3F6CA 2I3BA 2B98A 2CXSA 4OP1A 4RWEA 2WWGA 1E8NA 1I4TD 3AO0B 5A3VA 4XDGA 1QNFA 3WGTA 4ZZ0A 3BHMA 4BVBA 2CK3A 4DM3A 5HKOA 2WUFA 3L6EA 1KARA 1UXKA 1F4PA 1XDUA 3AKYA 4LJLA 3IIKA 5KWVA 5K09A 4I81A 1XPOA 3NEAA 2XNJA 4DADA 1FUEA 3IQIX 2C82A 2WSSD 4EVIA 2BFFB 3QX7A 1BU8A 3DB1A 4YK7A 3U7EB 5BUQA 3ABIA 1LVHA 3GHYA 4DYDA 1V5GA 4UJ5A 1VLVA 5DI3A 4AIIA 5K4HA 1FBNA 2Z6AA 1S9DA 3DTYA 3FWZA 4AJEA 3AR2A 1SULA 3AQIA 3FVQA 4CKWB 4ZDKA 2C4NA 2Q4EA 4Q34A 1OASA 1JFRA 3EZLA 5BQFA 2HR1A 3ZGZA 2W6IA 3OPNA 4OSPA 4FKBA 3TK1A 3RSCA 1WU7A 4S1NA 1F8YA 4PAQA 2X22A 3CZ9A 4G0XA 3VTAA 1AKQA 4OMDA 3LOPA 4NHEA 2EDAA 1H42A 2FZCA 5LUBA 4BRWA 3FCYA 3R4VA 4MWBA 2BMWA 4R0MA 3HDVA 3RGWS 4XVUA 5A7FA 4KQMA 3ZWMA 4X7BA 4Y6OA 1FBTA 5ES3A 5L6MB 4Z3OA 2BFNA 1V11A 1HF3A 1ZG3A 1BMFA 2ZCUA 5G4LA 1RQ2A 4URHA 2PMBA 3EDMA 1RXSA 3ZHOA 4GECA 3KQQA 4RTMA 2GESA 3WX0A 1NHGA 3ND9A 3QOWA 1VKZA 4ZOBA 1WBDA 3K0CC 2VPIA 1F0PA 1W8IA 1ZY2A 3ND8A 3HN2A 1FC0A 5HQJA 4H7HA 3TB6A 1PNRA 3ZV3A 4WOBA 1FVOA 3HWWA 3ROZA 4FP9A 5JC1A 2V6FA 4P0PB 1NQUA 2DH6A 3WKCA 3PL1A 3TLZA 1IOLA 2O0HA 3O94A 4UCXA 4NXMB 1FFYA 2FU5C 3JD2A 4PLWA 1JLMA 4J16C 5DM4A 1P2SA 2B7CA 2YBEA 4Q1DA 5LQUA 4TZ0A 2UXDB 2WIJA 1NW4A 3OLXA 1XZ8A 4G0UA 1MR3F 1F4LA 3UXEA 4K87A 5BOVA 4JBYA 2KMLA 1OTYA 1I0LA 3Q2IA 1JKJB 2GD1O 1SVWA 4B1FA 5ALXA 3WKBA 4B3GA 4NE2A 2DC1A 1HT1E 5BN5B 2HC9A 5TEWA 4FXPA 4K9OA 5BSKA 1NP6A 1NT4A 1TVKB 3E9EA 5IAOA 5AK5A 5JNVA 3RFTA 1N1MA 1KJIA 5I9NA 2JGAA 3KRTA 4GBMA 5C4MA 3U4QA 4C6TB 3KQHA 5H3LA 5KU7A 2CNLA 3VNVA 2PL9A 4RV9A 2GBPA 4TKVB 5HK8A 4P31A 4C3UA 1AUVA 3K1ZA 2OM6A 4S12A 3RARA 5C0OE 4EATA 5LA6A 1NYRA 4NZNA 4B5KA 1V8ZA 2FY8A 4IH4A 1XEWY 4UEJA 5F2EA 5IFLA 2CZCA 2JFVA 3TBHA 4K6CA 5IVHA 2I2AA 2HRRA 1V43A 4W9NA 1SU8A 1R9JA 2GAIA 3KPYA 2BSQA 2F3SA 4HYTA 2X14A 3V1NA 2VP4A 2JIRA 3D8RA 1J0XO 5C1IA 3EXIA 3WC4A 1P4AA 3CH4B 2IHNA 5A4JA 3FVVA 3UGKA 3HNOA 4ZEWA 1DAGA 3DBOB 3NRBA 2HJGA 2NM0A 2XMDA 1COZA 1ISGA 4F96A 4Q3NA 3FLEA 4EZIA 3JXEA 4QOIA 2JI9A 3D3EA 3GJ7A 4PGHA 4PYKA 1BD3A 1Y8CA 1E63A 5G1NA 1FP7A 4WA7A 1C1DA 1DC4A 2JCGA 4UEQA 1VC2A 1WE2A 2E4WA 3FAZA 4OQFA 5GV8A 5H59A 5KQSA 1WVIA 1SA0A 4E32A 1D1PA 1G8PA 1T9ZA 3K73O 6Q21A 2JHCA 3DDZX 1XNJA 2CHFA 3A4MA 3CISA 3FYUA 5ECWA 4ZALA 3FTEA 2YHUA 3L0OA 1XTPA 1VFPA 4XD7D 4LRUA 1T5HX 3UMYA 5LIPA 4XD7A 3T99A 2ODQA 2PBFA 4P7GA 1Q44A 3ZD8A 3ZU3A 2HLNA 2VHCA 3AF4A 4FDTA 4INAA 1O2DA 4FU0A 1U81A 3UFXB 3VV2A 1L2TA 2B8EA 5KO2A 1E6CA 4DKJA 1DKQA 3AYXB 3A6ZA 1O95C 1FLDA 2RHMA 4NAVA 1N5OX 4B31A 4FT4A 4X8LA 4BL5A 3W2HA 5SZKB 4WBNA 1R0ZA 5I7OA 3AF6A 4B5LA 5FWYB 4WN3A 1O8BA 3KJFA 5B7NA 1KFBB 2ZIWB 2Y1OA 4MULA 1VQ1A 1GYPA 2GHTA 2DHQA 2X9QA 2ZYSA 3Q98A 3ZDZB 1UXGA 3R0JA 3EXG1 4Z7JA 4ZV9A 3TXYA 4QVKA 2UAGA 4B81A 4PQYA 1V1RA 4AJ9A 1IHPA 3K92A 1X86B 4F0JA 1NVEA 4UASA 1W5TA 4EO7A 5AQ1A 4F4FA 2HCRA 2OCBA 2R6ZA 3GR6A 3P2YA 1QH1A 1V2GA 3FAKA 4HGPA 2WMYA 1Y9JA 2AW5A 1GPUA 4I1VA 4BN5A 1N25A 2DX7A 1UBFA 2EQAA 2AJDA 1G20E 3MTGA 1ESNA 2ODPA 4RMIA 1K9SA 3WK9A 1XTRA 4CCYA 1KSFX 3IH5A 3PUKA 4J94A 3RYFA 4D6YA 3UWPA 3SIPA 1ZITA 4YWHA 4TRNA 3WYDA 4ALMA 2YY6A 4F12A 5IS2A 3FWKA 5JQGF 4HDKB 5EN4A 4EG8A 3R6TA 4DR4B 5HDBB 3H0CA 3RSOA 2BFDB 3V6MA 1E9EA 5A05A 4B2LA 2FMUA 1US8A 2NTNA 1E2QA 3I5YA 4F2WA 5HUHA 1Q1ZA 3QJYA 2FDCA 2YFYA 2AVNA 3I1YA 1XL1A 1XP8A 3V42A 1OMOA 1JSLA 1WB5A 2PVCA 5AM1A 1GL6A 3EASA 3LQRA 1HI9A 3MYYA 1OYWA 1ZNXA 4QNRA 3T1YB 4KQWA 3EIHA 4UUMA 3PC8C 3QQPA 1ECCA 4MO2A 4RZHA 5ALOA 3WHPA 1Q3TA 5J5VA 5TQJA 4NESA 4A91A 3LBAA 1JTVA 1KDOA 3MCAA 4IRXA 1UOEA 4S2EA 1AJEA 1JPJA 1RWPA 5CDFA 2GLUA 2FVXA 3QEMB 3LC7O 1WP4A 3DZCA 1OIXA 2I66A 1PWHA 2J8ZA 2PCLA 2PYIA 4U6QA 1IUPA 4OQDA 2QN6A 1JALA 1G5TA 3L6BA 1EUDB 2OSBA 4RXTA 1G6HA 4XQ0A 4EY5A 4LMAA 1J0CA 2QRJA 2FP3A 3LT2A 4R54A 1YRHA 2OB2A 1JR3E 4HK4A 3T3OA 4P98A 3N5CA 4IIFA 3WP1B 2OXFA 4OFBA 5AW3A 3ZZTA 5JAIA 2LRHA 3AEUA 2BMEA 3VR6A 5J3JA 2H17A 4AG3A 3DDUA 2CHUA 3UTDA 3KQKA 2OVFA 1CQIB 3VUFA 4CT4B 1MQ8B 2BF7A 1T9DA 2BBSA 1EDBA 1TM2A 3EYAA 1J42A 1Q1EA 3L7DA 3E58A 3LT0A 4FMDF 2ASEA 1X3SA 1ACLA 2AG5A 5KNCH 2GEFA 3VU8A 1S0UA 4DDKA 4XOIA 3UHAA 1XVAA 2WWXA 1A5AB 2V03A 4C7XA 1Y4AE 3ZLUA 3KOWA 4QPZA 3PWSA 1FXWA 1TD1A 2I2WA 3CJTA 1VB5A 1MLDA 1M1XB 1DJLA 3ANYB 2AR9A 1RAEA 2XLBA 1FJ2A 1ONSA 1P29A 1A69A 3AHGA 4RPLA 2FLWA 4RULA 2RDMA 3DBIA 4G0PA 2V0GA 4WOJA 1MFZA 1FPQA 1ONBA 3IDZA 3OEED 4F91B 1YVRA 4PPNA 3BBPA 3GLGB 1JFTA 4UXJA 3Q11A 2V6BA 4Z4QA 1HQDA 1QYIA 4HFMA 3DKIA 2OK7A 3HY6A 2DMRA 3SM3A 3I12A 3EN0A 3I05A 1ZZEA 5CVJA 3I28A 4R9SA 1KZ7B 3LI2A 4YP5A 1LJLA 1TAHA 1FFXB 5GQSA 1EG7A 3H2SA 1LPAB 3AETB 3AHJA 3N2GA 5BORA 1IXYA 3ER8A 1TO2E 3JPWA 1ZA2A 1W0JD 3D64A 3UWDA 2NPIA 4K9QA 1QPBA 1NVUQ 1NAIA 4LRQA 1H9AA 4OJKA 4U2FA 4CDNA 1PJZA 1RAIA 5KNDD 3GBSA 3MJ4A 4MGYR 3H2KA 3U3DA 1O6ZA 2F48A 4PAWA 4ACBA 1C30A 3R9IA 4BB0A 5D84A 5EUMA 1PVOA 1AUOA 2ISSD 1YWGO 4HZUA 5H81A 2XUHA 3VNUA 3JYNA 2X13A 3E0QA 2NYVA 2X6TA 4JAVC 3JD1A 4LPSA 4XGKA 5EIHA 3SC3A 4NCIA 5IULC 1PX0A 5AM3A 3FBGA 4B35A 2O9JA 3HB7A 4OXNA 3JATB 2HSWA 1WCV1 1ZCZA 4NHOA 5KYWA 2ORVA 1V8DA 1ZJYA 3SC2B 1NJSA 4I2VA 4D41A 3MWGA 1OV6A 2AFHA 2D5LA 5G3YA 1FYWA 3FNQA 1X1DA 1RJ9A 3D31A 1V8FA 1WLYA 3P0EA 2GLXA 3PQCA 1EG2A 4ETIA 3ZHCA 2A7QA 4GAEA 1U7UA 2Q3LA 2XMBA 2C9DA 4J1QA 3HCBA 1Q0QA 1JX6A 4QXPA 5CFPA 3Q1KA 4R1MA 4BVLA 3HDQA 3ITEA 3G8YA 4N41A 3C5CA 2XI4A 4BZPA 1JI3A 3LPNA 4PIMA 5FO1A 3PGLA 4Q3DA 3SHQA 1C7QA 1RABA 3WFJA 3GWGA 3FDZB 3K0BA 3O2NA 2IXTA 3WGYA 1CUWA 3FZGA 4J0FA 1DC5A 1I4DD 1X87A 5C1OA 4CKWA 3JQ9C 3OMXA 1L5SA 2C2YA 1WD7A 2WFLB 3ZY3A 2JVJA 3X1JA 3CCCA 3CX6A 3JZDA 1NOJA 2F3RA 2PXHA 1PK7A 4XJXA 5K3CA 1TEXA 4RDHA 1KEKA 4EHJA 3SS7X 2FKAA 2XDQA 5FUYA 3B9BA 2OV3A 3VSBA 2JDIA 2JRLA 5ELMA 5HSGA 4MQFB 1E0KA 4FCVA 1M75A 4M53A 3ENQA 5IARA 1O94C 4R2LA 1OFUX 3P97A 1OH8A 1XL0A 4B2PA 3F5SA 2WWWA 4MV8A 1UJNA 3O84A 2IOHA 4KQCA 6PFKA 1U4OA 4KWTA 3VKVA 3CZCA 3RDPA 4D6PA 1F9AA 3QF4B 4ZQIA 3X3HA 3MQ4A 1M5TA 5EVJA 2RC6A 2BKUA 3GLFB 3D8BA 4DNFA 1RYZA 2WTNA 2XTJA 2DY0A 4GBED 3SDSA 1TW3A 5KTSA 1KZGB 4OB8A 5T7BA 5FLXA 1W44A 3AXTA 1GNRA 4LBWA 1KMMA 3BE8A 3OLCX 5FBRB 3DZKA 4JDPA 4L5IA 2A59A 1RYMA 1WMBA 1NWCA 3QHQA 3N2GB 3EH1A 1PR1A 2VZLA 2H2WA 1NP7A 3QH4A 1GDDA 3T7DA 4BNFA 2RCYA 5E1DA 3CXUA 3N05A 1FRQA 1N3YA 3KJGA 4CTKA 5I01A 1O08A 1SIUA 1VKRA 3QX9A 5FCDA 1OBCA 1I33A 1NY5A 4B73A 4UE6A 2VHTA 1W4RA 4XFDA 1CY8A 1PYDA 4HADA 2QTMA 4DKXA 3X1ZA 4QG7A 5CTJA 2WAOA 3I42A 1KOGA 2OMKA 3P0FA 5HCUA 2WWRA 3L4KA 3OFJA 4FYJA 1P1JA 2MSLA 2X0RA 2X2FA 3GF4A 3I3OA 2YIMA 3ICCA 4WGFA 4XCQA 3VZDA 1Y1PA 3RWBA 1BX3A 2BGIA 3LXRA 3WBJA 4FS3A 4B17A 1SUFA 3NCHA 2CFSA 2IEGA 2O3RA 4C6HA 5BN3A 3GEHA 1MVNA 1L4NA 3K0SA 1BCRB 1W5FA 4MWOA 4NJEB 1J07A 3UJDA 1U3CA 4DIKA 2VSOA 2FPKA 3FFBA 4HEJA 1YZVA 3U9SA 2WWYA 3ZXYA 5IKPA 2D5CA 4XKJA 4BNWA 5B58C 1YVUA 5LMCA 5REQA 2F3UA 3P9RA 1VI5A 3DHVA 5A4FS 4JCOA 3O2SB 4GPEA 5HF8A 5IFKA 4KPYA 2YHSA 1I4LD 1X2BA 1UFRA 2G0AA 2YICA 5T4BA 4E13A 2REQA 1HFEL 2VPQA 4FFOA 4ZT7A 4EHNA 1Z2EA 1CJTC 4PS0A 4UXIA 2B7BA 4Z8YA 1QGZA 2HA7A 4HATA 4QOFA 3Q7RA 2NACA 3TTTA 4PS1A 2YHAA 2E9SA 3EXG2 2VUSA 3HB9A 2FZKA 2P1RA 3D0QA 4MRSA 3F1LA 4E08A 3BXPA 5ESWA 1L5YA 1W96A 3OT1B 5F64A 4FKMA 1HO3A 5HUQA 4Z1MD 1WSDA 4BNYA 5HOEA 4J0JA 1TAQA 4KIFA 3REFA 2XB2A 4MQ4A 3L0YA 1G5HA 3JVIA 5T57A 3SPXA 2DPYA 3QKRB 4L5CA 1YB2A 1HLGA 2Q3MA 1Y8RA 2H1IA 2HBZA 2QTVB 4RIIA 3TOSA 3NJRA 1EJ0A 4QT0A 5AJYA 5FOSA 2RKOA 4HEQA 1BW9A 1L7OA 2IYTA 3UGJA 5ICCA 4C2UA 3ZIAA 2I7VA 1UBJS 2NU7A 3B3AA 4GOLD 4LSZA 4P4NA 2A9VA 3FFWA 3HABA 1ZMRA 5H1YA 1KPGA 1MT0A 3ASVA 1NDUA 1Q77A 3KPWA 2Q4TA 3FUTA 1UJ2A 4PZAA 421PA 2HPHA 4FQ7A 5BY2A 3LRXA 3N0RA 1W0KA 1WKVA 5JXIA 4Q4HA 5AXBA 3MW8A 4N0MA 1TIPA 1W59A 3MT7A 2V55B 1FP4A 3W04A 1SQ0A 5EZQA 1J8QA 2EZ9A 2NUAB 4POAA 3WAJA 9LDTA 3UAWA 5GMOA 3ZU2A 3FW1A 3TQRA 4EHIA 1FFCA 5JG7A 2GT1A 1U5BA 5BSRA 1FRNA 2WTMA 2M1ZA 4BCDA 1GKKA 4HDQB 3LC1O 5KKNB 5K3DA 5TB5A 4FHZA 1TOAA 2WNHA 4S0XA 1TMGE 4INPA 1X1RA 3OLQA 3PC2A 4I8IA 1NXPA 4ZK6A 5L4SA 5E9AA 5LZ2A 2PJDA 3QEBZ 4W5NA 1AKNA 1EK5A 2VQ3A 4BO9A 2OHHA 5IEJA 1LBIA 5F7OA 5FL7A 2JGFA 4L3OA 1GTL1 2XGSA 4GUDA 1XZBA 1J8DA 1AX9A 1GGKA 2D2VA 1FP2A 4GOND 2LCFA 3FPSA 2XOXA 3NT2A 2P9JA 4EA7A 4JV5B 4EL5A 3QU9A 4CM9D 1XJQA 1EFVA 3U19A 4HOYA 5B5SA 1W1UA 3U3OA 3UB2A 3CS3A 4GBGA 3JWJA 4EA6A 2OZLA 3AX6A 1EVIA 3FI9A 3VR5H 5HZHA 3F9RA 1HEUA 4HLDA 4ZICA 2ZSDA 3BZWA 1PR5A 4U3JB 2GOYA 5BYKA 5DE3A 5ALEA 2ZJ5A 2D13A 4IOMA 1TM3E 3HY4A 4JIGA 5KB3A 3G6WA 4CLRB 1GPNA 4JMPA 1OFHA 4PTLA 1KZ4A 2XA9A 4EIWA 3B1WA 4IIEA 1NKTA 4GXRA 4E46A 4UD2A 1GA6A 3DT9A 4IDDA 4E6EA 5IAGA 3TNFA 4UM9D 1X1BA 1XN1A 3VYWA 5DN6A 2X40A 3R41A 1FL9A 4RHYA 4IDEA 3VI3B 5CFLA 4CQLB 3W34A 5KX5F 2BGTA 1V48A 3EZXA 3GDHA 2ZTUA 4P54A 5CT8A 5FPYA 1Z07A 3LA8A 3WWEA 3OWHA 5ERXA 1JB1A 3RVPA 4RK4A 1N6IA 1PZGA 2O2XA 4DSZA 1R6UA 3IIJA 1I1QB 2AZDA 1AKMA 3QF4A 1W2GA 1EIZA 2W2LA 2IYOA 1EUCA 1VJCA 2AB0A 4PYRA 1XCLA 2DAPA 4JBIA 3F6SA 2DFDA 5D7BA 2VT7A 1BZYA 3QHAA 2F8MA 3U31A 1H6DA 3DE1X 1YS4A 4LMBA 2XYHA 4M9QA 2XSZA 4N18A 4OHPA 5T8KC 1AURA 1AQ6A 1Z2DA 1Z4NA 1R5NA 2EATA 1KYXA 2GZSA 3PE6A 2X2EA 4HDMA 4RA6A 4BLOA 2G9RA 3S8MA 2BMVA 4Y6GB 1DLJA 4IVPA 1CP2A 4BGDA 2DLNA 4BO6A 1N2CA 2KLHA 2H1CA 1KY2A 3B1ZA 2IDMA 3F90A 3M5DA 3PDIB 4I9NA 3SZUA 1DJMA 3D6VA 1ZK0A 3U60B 2IPAB 4TT3A 1ZZGA 3SHVA 1S3IA 3UT0A 4CEHA 1CYDA 1KETA 3QLTA 4JI2B 4C7OB 2C58A 3LP6A 1KQNA 1GZVA 4IHJA 1K7FB 1Y33E 4JUFA 1JIIA 4PX3A 4BIMA 1G4AE 2AE2A 2OHGA 3OURA 3ZVRA 4YJ3F 1NONA 5JZOA 3LWBA 4QRDA 4JI4B 2BZ0A 1O9HA 2ZP1A 2HPZA 1RHKA 3AHFA 3PXAA 4FMCB 3TLMA 4DLRA 3IKTA 4AYWA 1E58A 2B20A 5JSZB 3BWEA 5T67A 4J7AA 1KSGA 1VG1A 3B5IA 3FZEA 2HGSA 3PVZA 4A16A 2C2ZA 1X39A 1GV1A 3BWXA 4MUYA 4X95A 1AK1A 2WW8A 1FOEB 1Z0JA 1UWVA 3C6BA 1IPFA 1SB9A 1TK9A 2V7VA 3KS9A 4LV6A 3TRHA 4AICA 4HAYA 4CKEA 2Z2ZA 2WFZA 4A0RA 2DP4E 4NJOA 1KY4A 3OM9A 3I9V6 4NFLA 5ARCA 1EFHA 2PIDA 3L8HA 3R2JA 4X00A 3VXKA 2MSDB 2FJPA 1RHUA 2YMQA 4NU8X 3K70B 4UTRA 5JVDF 2RK6A 2WSYB 1D2HA 2J6CA 3AEQB 2XR1A 1OU4A 4MCIA 1FMJA 4HH1A 4CLEA 1I3MA 1SR8A 3QV2A 1QGUB 4MP3A 3OEHD 2R6GA 4CV0A 1KQPA 5L7TA 1IK6A 2AX4A 3B6KA 2RH9B 3LNCA 3HUTA 3QOXA 3ZWVA 4NULA 3VFDA 2H2GA 3G23A 3SJUA 4FNGA 4BRZA 3ZBUA 2ZUBA 3ECCA 1ID1A 4C05A 4KYVA 4WERA 4E5UA 4GYYA 1P74A 3MHTA 4D0NA 1S6YA 2WUVA 2P6NA 3E81A 4Z4GA 4BQFA 3LCVB 3KUXA 5FYDA 1VJDA 4RVCA 3VR4A 3PNLA 4F5YA 1YL5A 2R8PA 1WX1A 4YCMA 1OYVA 1I32A 1TDJA 1DAFA 1LF0A 1QAQA 3LXUX 1VMAA 4DFDA 1EUZA 4DR1B 1ZD8A 5DFAA 4OHZA 2H2DA 3C70A 3K31A 3QVUA 1C1HA 4L6IA 4F8EA 5DCYA 3GJ5A 4Q9DA 4GI2A 3H5IA 1PTKA 2P7HA 2WA2A 2P65A 3AI3A 2F9MA 4IDAA 5BXYA 3O9ZA 3TL6A 1USVA 3W9UA 1GM5A 4LXXA 1AS2A 2PQ0A 1V8PA 4PX9A 5AVXA 1Z29A 1HNWB 3DOEA 2J3MA 5F7XA 5EIBD 1C8BA 4PGAA 4MAAA 1DIAA 3QXSA 4GWGA 5JFTA 3L46A 4I50A 2ZJ1A 2AXQA 1OJLA 5C5DA 4NBLA 4D4HA 3SY8A 3L4JA 1JT2A 2PMDA 2IS2A 4F5ZA 2C9ZA 3H86A 4WOPA 3U39A 2YDXA 4ENUA 2XCRB 2CNDA 1BDBA 4GPAA 4N0DA 3QEOA 5EMNA 1X77A 3O21A 4TZ6A 4N6OA 1E6EA 4OSOA 1LPOA 1ZGCA 2QRGA 3B89A 4FYWA 3TLCA 4LHSA 1CZNA 3R8XA 3W9YA 3HDTA 4BKPA 2QYTA 4YMGA 1S4QA 1SQ6A 1USIA 1F2VA 1HDYA 2W6JD 5AI5A 1GPH1 3JYOA 3W5IA 5HFJA 2YXEA 3A6GA 1C4OA 2HUPA 1Z8NA 3MOIA 4I19A 1R4NA 2H92A 2ZITA 1NYLA 2WWFA 1X1EA 4M0KA 2EV9A 4TYQA 4DNOA 2E3JA 3ZE9A 3O7WA 3WFZA 2J3IA 1P8AA 1RBZA 2BKLA 4IDGA 3M3DA 2QSUA 2JW5A 3DTVA 1FNCA 2QLBA 3HEMA 4Y9DA 2P2ZA 2I6XA 4ZRDA 3B52X 5KYNA 3FRHA 4C0LA 3V1LA 4CIDA 2PKWA 3H19A 5LU9A 2OHJA 1XTUA 1BE0A 4RSGA 1YBVA 1JIKA 1JU3A 1HZZA 3WLAA 5EZ6B 3TR5A 3ZQKA 3EE6A 3MAJA 4QYSA 4EW1A 5KSPA 5ITZA 3HHPA 4MVJM 2F8LA 2H0QA 1SFRA 2NTYC 3CN9A 4UUNA 3RG2A 2P5SA 3HE3A 1Y81A 3ABSB 3AR5A 3QITA 1QHIA 1R00A 1UKBA 4LXTA 4GOXA 2WNSA 2Z98A 3RUEA 3GLTA 3PXGA 1H1LA 2JF0A 3ZHVA 5L8VA 1DPGA 4NJMB 4DRXB 3RIEA 1EK2A 2VTVA 5JMOA 3OQMA 1KI7A 2PA3A 5GP1A 1T25A 4F3NA 4REQB 1USUA 4IIBA 3O1LA 1I24A 3T5TA 4EUSA 1JG3A 1EK0A 1JYEA 1X9HA 3E9QA 5KNCD 1GZ4A 4N5NA 2QS9A 2WJIA 1B73A 4NYJR 5H5JA 4COKA 1R9NA 3O9VA 4JITA 1D2EA 3FVRA 2W6ZA 3FSRA 2X0EA 4ZAXA 5CA1B 1IQPA 4FFLA 3HJCA 3A1CA 1GVNB 1XZAA 3ZY4A 1R0YA 4D6XA 2HTEA 3ZGNA 1UKAA 3JU3A 5D5HA 1YA8A 1MA3A 1SXJC 3WQHA 4BX8A 1HC7A 4ZZ2A 4ADSG 4DIUA 1DO2A 2YV5A 3BK1A 4TXHA 5JJIA 1VP3A 1XRPA 1NU8A 2WYUA 1FLNA 5DLYA 4G0MA 2FHSA 3TOCA 1MMFB 3ZUGA 3LS2A 3VO8A 4XOUA 1B23P 3A2MA 3TS1A 1PQUA 4B8YA 3UUGA 2V7PA 3TGPA 4R8SA 1M0TA 2YWEA 4XJTA 1RFLA 4RFVA 2EL7A 2GBLC 1JNYA 3DC2A 1XVLA 2Z2KA 1DTEA 3BMNB 4HDNA 5AICA 2AFIE 1GILA 2HWYA 5EJMA 1XWWA 2NVWA 3BXGA 3L41A 4B2YA 2BT4A 3AYZB 5AJXA 1G16A 1BCSB 2J3KA 4YAJA 5AYVA 3EMBA 3ZE6A 4CF5A 5AVTA 4MKZA 1L8OA 2P0YA 1RE1A 3Q3HA 3WGKA 1LUAA 4TTIA 1L4KA 2IF2A 1EXWA 2B6NA 1B2RA 1O5IA 4D0RA 3HU3A 4H59A 4JIMA 5BSEA 1M5RA 4BBAA 2LTAA 1JG6A 1VRCA 4YAWA 3RO7A 7REQB 2O7NA 2WT4A 2HMTA 4WSOA 4ZC8A 3FRIA 4ARIA 4OJYA 4JMLA 2WHEA 3CO5A 4C89A 5J2UA 2PUDA 1UMDA 3H3FA 4GEKA 4CEIA 4WL0A 4C7KA 4NFSA 2B5OA 2EFJA 4FW9A 2NSJA 1E69A 3WRYC 1YJBA 3IIMA 3OTWA 4H7JA 4PXYA 5TC4A 2PUAA 4UZFA 1NV8A 3IIIA 1SNYA 2W2XA 3VJLA 5IVPA 1N9KA 3EIOA 3ZZMA 1HBJA 2UUOA 3FUUA 3PYLA 4NDZA 2O3UA 4AMUA 2PGNA 4AS1A 2I7DA 1PZFA 1V5IA 3V4FA 3H1EA 3ZCVA 3NHSA 1DOHA 1Z0SA 5HIMA 2QPAA 3CF6R 2YR0A 2HRQA 1JLKA 1D04A 1W0JA 3PUWA 2AZMA 2H18A 4KUGA 4BNXA 2HK8A 2I6TA 4ZAFA 1N2IA 1Z83A 3II6X 4LYHA 4XRRA 2GBCA 2WJPA 4BRSA 2YXBA 1ZXBA 3P0HA 4M9ZA 3E9MA 4PXSA 2F59A 3JALB 4GNRA 1T6NA 1NJ6A 2D7JA 2A3NA 3F3KA 1NRXA 1T36A 3FYDA 4I5EA 3DBRB 1Y3HA 4TRMA 4XIFA 4JR0A 3HCNA 2FGKA 1KO5A 1ESZA 4RKQA 4E22A 2YN0A 1YFKA 4TOIA 5GV7A 4B0PA 1HE2A 1VJ1A 1Z2NX 4G01B 4G0QA 1SB8A 2H16A 2I3ZA 1YI0A 5CEEA 1JHRA 1HMYA 3N8KA 1J0AA 3SFZA 3F8WA 1DXHA 1MOZA 2PUHA 2HWKA 2QAGA 3TEFA 3A58B 3PNOA 2I87A 2VF8A 1C1DB 1Q1NA 4HGYA 3CXRA 4Q1EA 1YDFA 2MHCA 4W82A 1R4AA 4CFZA 4F6CA 2ZW9A 4P6VF 1SPXA 1V1JA 4L8YA 1B0UA 3WS7A 4G0ZA 4A0HA 1ODTC 2ADOA 4KRXA 1JDTA 1H22A 1LJUA 2FEXA 4GMXA 4EY3A 2GH1A 5T3UA 3VV3A 3CZQA 2VPZA 2HMYB 2YQ5A 2Z30A 3A2NA 3FHJA 3KKZA 5B30A 3EWIA 4K6HA 3QFSA 1VPEA 1K5DA 3C3YA 3P1JA 4B3JA 1QOZA 1RM4A 1CTQA 2HF9A 3NHFA 1QS0A 5ALZA 4RHTA 4LDZA 1OFGA 4X85A 2HD4A 3CC8A 3SQLA 4P2BA 3ZI0A 3AESA 4U39A 1N9GA 3GOQA 4BGUA 3GYGA 3QFHA 3RKSA 1HT3A 3NBYC 4Q3BA 4NLLA 1YS2X 4JNCA 5FKJA 5GZ1A 3RH0A 3W2IA 2QHXA 4LCBA 5CH5A 4HWGA 2I62A 1KU6A 4NK5A 4DLBA 3L8EA 3TRFA 1VGQA 3L0SA 1NN1A 1AHNA 3FOBA 4K9RA 1E77A 1K7XB 2Q8QA 3PTLA 4PXAA 4QU9A 3GLHE 3PEUA 4N8SA 3AM5A 1MJNA 1E5LA 2PPLA 3EIQA 3CVOA 1PJCA 1Y7TA 1PDWA 4ZQGA 1L6IA 4F93B 2EX1A 4HAXA 4F1KA 3DF7A 5JADA 2DG2A 4NFHA 2X6RA 1GEGA 5JS1A 4QUBA 1I80A 4DCPA 3H75A 1WXFA 1FP6A 1P45A 3UICA 3H9GA 4XLLA 4A26A 1M8GA 2Z43A 3AQ4A 3AY0A 2XQVA 2CBGA 2OENG 1J9GA 1URPA 1T1IA 4HTFA 4KQIA 2A0FA 3EZGA 2GZMA 3I2IA 2IYWA 2RHBA 2XQKA 4EFDA 3T35A 2WSLA 5KBYA 2ZAYA 1Q0PA 1K92A 1R0SA 4QYTA 4IZOA 3SLKA 4PBRA 3QLUA 1OGIA 1P1FA 1PT6A 1UEJA 2CMDA 1HNZB 2IUYA 1XTKA 2AUNA 4ROTA 2YMMA 1UFOA 2QAIA 4QLAA 2GETA 3V8BA 3O4HA 3ZZUA 4E94A 4UM9B 1H2RS 3OF5A 5G0VA 4C3ZA 1R9MA 2FZLA 4RCZA 5IBPA 4GLBA 4TRRA 5I8PA 1ZU4A 1LK0A 2MSCB 2PQ6A 4Y1FA 3LK7A 2EAUA 1HQKA 1N1GA 5C1BA 2ZTLA 3BRSA 4AY6A 5JAPA 3EW7A 4YJGA 1PFQA 2COEA 2M6RA 5AHXA 4RHXA 4WLUA 4E5PA 1Y7LA 3RAEC 5FOWA 1JLSA 4UBIA 3CUVA 1QB8A 1MC4A 3NWBA 4PNZA 5F77A 4EQ6A 3HR4A 2WJZB 3IESA 1AT1A 1V3TA 4NE7A 4NRDA 3RIGA 2GLTA 2QTZA 1HLFA 3QVMA 3D4NA 5LYJF 2V96A 2ZI3A 3C24A 5B7QA 2W0MA 3PR1A 2IS1A 3VDMA 4PZZA 2OR3A 4WACA 2ZKIA 1EJ6A 3PPVA 1ENOA 3Q3IA 1X9IA 1U8FO 1ZCBA 2DSTA 4KE9A 4DCVA 4B2IA 3KUCA 1U0RA 2HHCA 1N78A 3SICE 3T3GA 2BGUA 4HO1X 5CW2A 3VOAA 4JC8A 2ORED 4W7SA 4RCVA 4RZ3A 3BK2A 4MWCA 4DARA 1DKLA 4D97A 5CD1A 3LYUA 4ID9A 1M8JA 1TO1E 1Y1LA 5FLEX 1ZR4A 2WF8A 1QCDA 2PSHA 1FFGA 4NEHB 4YFYA 5A9SB 2LIPA 1TX4B 2WKQA 3AIKA 2NO5A 1AY0A 1YULA 3PLRA 2LDBA 4G5RA 2DU8A 3PQ6A 4FFRA 2G9UA 5EXXA 3JQEA 3JRXA 3R74A 4J1NA 5YASA 4G4SP 2DKNA 3D6NB 4JYPA 3F3SA 4HQNA 1JR2A 2G71A 4R1QA 9GPBA 1LLFA 3DBRA 3ESDA 3DKVA 4GX1A 4N12A 3HYRA 1EGQA 1WXEA 3FSGD 4M7RA 4YBRA 2R7NA 4KO2S 1SCKA 2CNBA 1TQDA 3UHPA 1F7UA 3V33A 5ARDA 5JATA 1PJQA 1UMDB 2ZETA 3F5FA 2FSFA 1ZGAA 4YRRA 1PLJA 1VA4A 5JI2E 5E7MA 1V7QA 2C1XA 2GSDA 5FPSA 3H9QA 5DHSA 1Y1TA 1TE2A 3AM1A 4L6CA 2BW0A 2FWPA 2WM2A 5E9WA 2DKFA 1JQAA 4A5OA 2L42A 1EK6A 1Q20A 3WL4A 1V1MB 1U2PA 1VLZA 3H6KA 3KWMA 4EF5A 2EW8A 4AD8A 4F71A 3S1AA 5JRDS 1WZCA 4PYMA 4IGFA 2B30A 2G1JA 3E2MA 1S3GA 3KKPA 5DGHA 3VA7A 3NATA 1UKVY 4DW8A 1K97A 1VJ0A 3QW2A 1CUIA 1PJ3A 4UOZA 3KSUA 1G18A 2PK3A 3V32A 4A36A 2IIQA 3KR1A 2CVHA 2I91A 2YZGA 2HIGA 2Y0PA 2PGXA 1NJFA 2QLLA 3DZBA 3GMDA 1ODCA 3INYA 2VF4X 3DQZA 3FNEA 4FDUA 3QTLA 2FSVA 4DMFA 4E07A 1OXSC 1JU4A 1F5SA 5HE8A 2GGSA 2HW8A 4J3JA 1DI0A 2XZPA 4C0BA 3PC7A 3P9PA 4NFYA 3OZVA 5CDHA 5LSAA 3K70C 3TUZC 2EJTA 2BYTA 2NSHA 4HWOA 3C6YA 1ORWA 3DVQX 4IL5A 4LE2A 4QQFA 2UXBB 1Z62A 3G5LA 5A4IS 2QU8A 5TPWB 3QY0A 1DDIA 3LQFA 4R2KA 1TC1A 1ODIA 1X92A 1SVLA 1B6GA 1ZK2A 4BNDB 4DVGA 5BR7A 3IVMA 5CVVA 1WPGA 2PRSA 2PX6A 3ZDAA 1DUIA 1XZPA 3NT5A 1SUWA 3JR7A 1QR2A 2WD8A 3IERA 2IE0A 1AGNA 2I6QA 3EDCA 3VHLB 1TVEA 2RK4A 4CQJA 4TROA 3U44A 3F7OA 3I39X 3K8ZA 1KZ1A 2NO4A 2VSFA 4FDVA 5JMTA 4PO8A 4NOMA 1USKA 1D4ZA 1JYFA 1U8XX 2G0NA 2WYOA 4PAMA 3PSHA 3DUFA 4GVPA 3UG6A 3E7PA 1V6SA 2V45A 1KK1A 1QFYA 2J32A 4JLAA 5AHKA 1WW2A 4AS2A 2C29D 3PE4A 3I9MA 1MO6A 4LXHA 1NW7A 1Q7GA 3DXXA 3KR0A 4ON9A 4FWTA 4IO0A 3FCOA 4PRKA 4EA9A 1L5WA 2OESA 1LPPA 3AF5A 1K6MA 3ZG6A 1XLUA 4Y7CA 4E09A 3WFIA 1N2SA 3PT9A 4A10A 1T6ZA 2QLNA 3K9FC 4X6XA 5IYZA 1Y6JA 4TYPA 3FTDA 4ZV7A 4G9GA 4DMHA 1L5OA 2JGDA 1E3WB 2QTTA 4N0QA 5CG1A 4YGXB 1C9YA 1JMYA 3QLEA 2G67A 5DASA 2B4AA 1XLVA 1DHTA 3JVVA 4Y2XA 5B2FA 1VHWA 1VYTA 1JIVA 3OTIA 2OOSA 2WYWA 5AKXA 3Q72A 5DXJA 4NCBA 2GN1A 3G2NA 3IUNA 3QMPA 3A0RB 2H06A 5AW0A 1U3UA 3BPSA 2CE2X 4BPBA 1KXJA 1T4MA 4L6AA 3CCBA 2ZVJA 3SQMA 721PA 1GGFA 4QYMA 5AXCA 1XNGA 2DZDA 3P71T 5AKEA 3OM1A 5K0NA 5CFMA 2BZGA 2BR5A 1BKYA 4Q1VA 2YW2A 4E21A 2O0JA 4H77A 1LQTA 1PFWA 1Y3IA 4LVUA 1J5PA 3IP1A 4G5HA 4OP2A 2NU7B 5LM3A 3W7VA 1SU4A 2QD5A 2ZYRA 3X43A 4DR3B 4JI7B 4JOQA 1K4KA 1SXQA 1FVXA 2TMKA 4J03A 3OT5A 4CM6A 1U8CB 4S04A 5I5GA 1R0BA 1I4OA 2XWSA 3RREA 1GPKA 1AUPA 5HZMA 1HT0A 3ESQA 4Y6LA 2NPFA 1KMHA 3QUCA 4GYWA 4ZPXA 4F4CA 2QLJA 1C50A 1JJVA 3BXXA 4MGKR 4U4AA 1TEZA 1IAVA 4J2TA 1NPDA 5LKAA 1DC8A 1RPZA 3IAXA 4MEAA 3RVJA 4FZRA 2EZUA 4W9MC 3ICEA 1PR4A 5KWEA 4M0UA 4P82A 3M6XA 3MC1A 1XKTA 5H4HA 3RRYA 1CDZA 2XX3A 5D3MB 4XYEA 5E8RA 4YAFA 5CYOA 4B84A 2CVFA 4NECA 1Y82A 2P2CA 2BFBA 4HQLA 4ZOQI 1BMFD 4BATA 2IVZA 4PZLA 3PR3A 3BMQA 2OILA 3LP8A 3V8RA 3C8ZA 3ESXA 1ZSNA 1LRLA 4BE4A 5EG5A 1HG1A 1ZA1A 4ARAA 1M2FA 4UNNA 1EX6A 1O9GA 1UDAA 3OLWA 4KQJA 4Z9YA 4RX1A 2NU8A 4EY6A 2VATA 3W9SA 2P9YA 3QI2A 4QM6A 1HPLA 2OZPA 2PZBA 4PRLA 1CFZA 1GCGA 3QSYA 3QPWA 2R68A 2Z95A 3NOQA 4M7OA 5HZKA 3V7NA 3WGJA 4R2JA 1Q14A 2A1UB 1HURA 3ZHBA 1EB9A 1RACA 1TZMA 2ES4A 2GTIA 3O3OB 4R98A 3PQ8A 2CB9A 2VHEA 3PHIA 4YRGA 4OLBA 1FFAA 4L75A 4IMPA 5ALIA 4ZEOA 3SKXA 2F3TA 2Q49A 5DH9A 1FK8A 1UBKS 1G8GA 2GCIA 4ILEA 1VMKA 3WMXA 3RRBA 2ABWA 3EMKA 3J7AC 1Y8ZA 2UYYA 5HZGA 2A9OA 3K0CA 4NBKA 2YJGA 4K6OA 5HF5A 2GVDC 1MA0A 4EY7A 2V3CC 3OE1A 2VKQA 2I6FA 3LDAA 1NSTA 4F6RA 1XO1A 3G79A 1CQZA 3TRIA 3VR4D 3U9LA 2P5YA 1G8SA 4WBNF 2QUKA 4EJMA 1JHYA 1NYQA 2FPPB 4V0OA 5HTKA 4YPVA 4FGZA 4KFCA 1GA1A 3MB5A 3AERA 3ZUPA 3OJ0A 5I7FA 3STUA 3HWX1 1E5XA 2GKSA 4QYIA 1MX5A 5EXDA 2W6PA 4ECAA 4K9SA 4V02A 4OX9Y 1KJJA 4J0HA 1GXSA 3LFUA 2LCIA 5FIUA 2H1SA 4BGEA 2PD4A 4U7GA 4L0QA 2PBZA 3WWCA 4NCNA 3SSAA 3BDAA 3PUIA 3RU9A 4C5AA 2ZTSA 1CF2O 4D4MA 3KELA 5KAMA 3G0GA 1MRNA 2Q0HA 1NUQA 3FPKA 4HNQA 4MYTA 2XB9A 1SUEA 3OFVA 4P3YA 5CBPA 1N6PA 4JFRA 3ZYCA 5JJCA 2FE1A 1AKEA 4W99A 5LZ4A 4Y30A 4JVNA 5AJHA 1QHHA 3JQBC 5IXSA 1BG6A 1SC4A 1FFXA 3RTAA 1A27A 2J6IA 5EXSA 1E1MA 5KYXA 1JIXA 4HD8A 3T7SA 2HOQA 1CRQA 2HLDA 1E7YA 4B8ZA 3LF1A 5CDTA 4HX9A 4DOMA 5CIYA 1AXGA 5AW6A 5L7WA 4R1NA 4RKFA 3E8SA 1DJQA 4CNQA 1ZJWA 2WFLA 2Q29A 2R6CA 3V9PA 1QK5A 4GXQA 1B8VA 3GRCA 1NVVQ 1R5BA 2I55A 4GM1A 1T3TA 1QHFA 1E2MA 2OQIA 1II9A 1H6CA 2WP0A 4JLSA 4EEZA 5ECYA 2VBGA 4LX0A 3M7IA 5IBRA 3QYJA 2Q3FA 3H1TA 1RXCA 4B3TB 1PNTA 3FETA 3NBQA 2A9JA 3HCOA 3JQBA 3M0EA 5KOJB 1NNEA 3PSAA 2J5XA 4XI9A 3NTXA 2GZ2A 2GBLA 2NSDA 1IMOA 4TKUA 4DLAA 3P9SA 4OKNA 4UZSA 4ESOA 2XQFA 4ISCA 4BQSA 1I3CA 1FY2A 3AWDA 4P53A 2O1XA 2UYQA 4CVNA 4DV3B 4XX0B 1CUUA 1YMQA 1P75A 3AFMA 3V2GA 1OH7A 1H8EA 4MKHA 3ZK7A 3KSBC 1E2PA 2GF2A 1P3DA 2QRPA 3HACA 5E9QA 4G81A 4NKRA 1IVSA 5FO0A 1KMIY 4ZVRA 2IV3A 3W4KA 4WVFA 3S2FA 2M6KA 3B85A 3WADA 4MLCA 2PMWB 1IZ9A 2P3SA 2ACEA 4IHKA 5HM6A 3EIXA 3PIIA 1EBBA 4QQKA 5BWLA 1E1YA 2F00A 4JLBA 3GLQA 1FZQA 4KXFB 4QIHA 2GK6A 4RH1A 4V1CA 3A9TA 4JI0B 2P2NA 1U8AA 3JVEA 1E6LA 3HVIA 4Y2RA 3QX8A 1XU9A 5KOHB 2ZUSA 2NO1A 1DIOB 1EPUA 1QH9A 1Z56C 3CRW1 1UDRA 2W2KA 3QVJA 1F6BA 2OXCA 4CODB 1HE5A 4O2AF 1O94D 1Z9BA 2VF2A 3IVXA 2AEMA 2BFCB 3DW1X 5HMMA 5F5NA 4BVKA 4ZI2A 3QX3A 4ILKA 2NXCA 5TF4A 2AZTA 2ZWMA 3NS7A 5C8YB 4AB1A 4CUKA 4XUGB 2ZSFA 4W9NC 2YWFA 1H2EA 2H9AA 3M4XA 1NI4A 2IZZA 2AC2A 2GASA 4RFSA 1NT2A 1QJ4A 1UP7A 3PB3A 3QTTA 4KMMA 4R2XA 4RH3A 3TLKA 4H3KB 5IRCD 3KOXA 4Z3DA 1E2GA 2YOHA 5C5EA 1BNCA 2QOEA 1BWSA 4FMPA 4IXDA 5FWNA 1K8XB 3DUWA 3A7EA 1IM2A 4ENRA 1IJKA 1XQVA 5HRCA 4Y2QA 1CU1A 3BG5A 3SEQA 5I9BA 2ZI4A 3UB4A 4H1HA 1VSBA 3NRJA 5AM2A 3HV2A 1ZDMA 5CX1B 4F6LA 1SOMA 3R7BA 1AGXA 3GI1A 3BBLA 2P90A 4KBYA 4ZOLF 3DSRA 2BV3A 4E33A 5A2GA 3OPMA 1NV9A 4BNNA 2A14A 4Q4LA 4L78A 4ZU6X 2I78A 2RHJA 3KYJB 1UPTA 4MHSA 4Q24A 3WBKA 3TQSA 3MWLA 2GVZC 1E9CA 3WA7A 4IOJA 4C4YA 4LOHA 4EABA 4D3YA 3VHQA 3AEUB 2XQIA 1ZD1A 3TMYA 3T38A 5LQJA 3Q7IA 2JKVA 3DL0A 4LXIA 3V8MA 4BNZA 3MCUA 4ZMBA 1KR2A 4EPVA 4FCCA 3UCXA 1KAHA 3M1IA 1LVUA 1YF3A 1GLNA 2FW1A 3DAYA 2GDZA 3M81A 5DNAA 3OP4A 5K6TA 1YCDA 4D9CA 5GM2A 2EU8A 1VE1A 4O3MA 2AOXA 3UV3A 221PA 3ADBA 1ODJA 2BDEA 3SZ3A 2C04A 2GCPA 1JUDA 4OEHA 3ENNA 1NI3A 3E5MA 2Q62A 2OV2A 1P80A 1XELA 1XCPA 4DPMA 3P9CA 4YH1A 2FEKA 1P1BA 1KEEB 3KE8A 2FPMA 5MGNA 4KQKA 1R88A 4WEQA 5KVQA 3AVYA 1WHSB 1E3WA 3ZS9A 5BWBA 3PDCA 3VRHA 2ONJA 3EWSA 2GHIA 2VEOA 2WMNB 4MYRA 4PG6A 2UVPA 1KQ3A 3U26A 2NZVG 1E20A 4MAMA 1OGJA 5F4BA 2ACWA 2AKEA 1VBNA 1NBHA 1X7WA 3ROPA 1GQQA 3OZEA 5I7UA 4UEOA 3IQGX 3CRMA 3Q15C 1LI7A 3UYLA 3OPYA 4REQA 3L8ZA 3U7JA 3RT1A 4CM8A 4NMLA 1K8ZB 4YJ3B 1DKMA 3ZKAA 2N1MA 1L5GB 3H11B 3ELBA 4KXNA 4II3A 3HXOA 4EY4A 4TM7A 2JB9A 1JDZA 4WKGA 5HMLA 3SMQA 3EG9B 1A8HA 3C4QA 3LVFO 3Q7EA 5EXPA 3UPUA 5AKGA 3HUDA 3SNHA 3ZWNA 2XOKD 1LPBB 1BCRA 4NJEA 2FWIA 5TX7A 4BNMA 4ENQA 1QYXA 1SGWA 3AR3A 3OQIB 5DGCA 3SS9X 3BHNA 4RK5A 3M3PA 3UY4A 1VKJA 1B76A 4MV1A 2WUWE 5JMWA 5JYEA 4LPKA 1WS6A 3MRTA 4I1SA 1RNLA 4WDRA 4FZVA 3T3DA 2J3LA 2DUJA 2KS6A 4RJIA 2A1TS 4KZKA 3GFTA 1OIVA 3EUFA 2A92A 3RSLA 1K3TA 1PJRA 2IHVA 3MZ0A 3N9IA 3P2KA 4ZAVA 2GX6A 3BVPA 4U2CA 2VP0A 3HPRA 1IWOA 1RWOA 3KLNA 4UE2A 1JSRA 1RKXA 4F2PA 5D86A 2Y77A 4XWKA 3ZBPA 3AFGA 3O31A 1P81A 3VSDA 3QPVA 4MI6A 4UAUA 1RC0A 2DQSA 4IS3A 4Z0PA 4YIHA 1JMVA 2LR0A 3B9PA 2WTXA 3PUJA 5LKRA 2VA8A 2RKWA 3BFPA 3CBGA 3UAZA 5FEMA 4A0GA 1T0PA 3THYA 1QHXA 2R1ZA 1R9GA 2PU7A 4M98A 4TN5A 2H65A 4V1CB 3ANXA 7MDHA 1T43A 1HQCA 3MMSA 3HKCB 1HKUA 4QBTA 2FQXA 1AOXA 3W2FA 2QK4A 3N2YA 1N2XA 4W5HA 4OHMA 3RTBA 3PPXA 8LDHA 4B4KA 2VT3A 4IGAA 1QF9A 3Q7PA 4WFKA 4FOTA 1KJQA 3WGMA 3LC0A 2QIPA 1JQKA 2L17A 4EYKA 4Q12A 4IJUA 1ECGA 1S1MA 1Y8QB 3GGSA 3HA2A 5A6VA 1Q0HA 4WFJA 4D96A 2Z9DA 5CH8A 2HF8A 3U1VA 3FI0A 3AVVA 1PQ4A 3INNA 1OTXA 3DFFA 5D2CA 5UKDA 1DXQA 3MSXA 4MQMA 3M1AA 3OHPA 1FLVA 1Z8HA 2QN3A 3EAQA 4Q4DA 4HEHA 4B6GA 2O2SA 1N75A 2WU1A 1ZK4A 5BPFA 5LXTB 4CIYA 1GL3A 1SBIA 1Q6YA 3IKMB 1KVQA 4WJKB 3ZI4A 1YGYA 4F11A 3IT1A 1MU0A 2KPOA 1EBUA 2Q2VA 1W36B 2VTDA 4E5VA 3IDFA 4WFQA 4Y2JA 1V5FA 3C45A 1KYYA 3MGKA 3I76A 2O7SA 5CXXA 3ZHUA 4WBNB 3Q6NA 4OM7A 4Z4IA 2LKCA 3D43A 3M4JA 3ROKA 1OYOA 2XF2A 3C48A 4R3NA 5D3ZA 3D7LA 4DNPA 5BR4A 2YC2C 4NSNA 4AZ3A 4CMEC 4ND1A 1ENZA 3G9QA 2JASA 1BVUA 5EERA 4UBJA 4G8DA 3D4PA 2QMYA 4XM0A 3VH1A 4TKVA 5LDDC 1F4VA 1RR6A 2EHDA 4QXRA 5JDIC 3NDBB 3CEJA 4E4TA 4PNPA 1D2GA 4E15A 2UYCA 2ODWA 4MQEA 1RWQA 4RJTA 5I7VA 1WW3A 4QGGA 3IBTA 4DNQA 1I8TA 3H2ZA 1GQYA 3MJTA 2ZRHA 4TL7A 1N7GA 2AK2A 1UBMS 2GZHA 2HCFA 2IPNA 3ANNA 3FLBA 3HJNA 4IUYA 4F60A 5G40A 4KQ1A 5C2JB 4IRUB 1WMEA 2EEPA 3GLSA 4Y18A 5JLJA 1H2AS 3QVGA 3RFCA 3TLEA 4EMTA 1P0IA 1I1HA 1Z6ZA 2JCVA 1JL3A 2XRYA 3IOYA 5B1IA 3TKAA 4BLTA 2E5FA 4ENWA 3EFEA 4ZREA 4ZGBA 3S81A 1XHLA 2XDAA 3ITNA 1SU7A 2RHCA 3G2MA 5EEHA 4O8CA 4HGQA 2ZPUA 2IYSA 4PGFA 5F3DA 1TQ2A 5J1SB 3WYNA 1YB1A 2ZYGA 5ILGA 1C2YA 4V38A 3WWDA 4Y3UA 2ERYA 1KK3A 3C3CA 4H3SA 3RROA 4NCXA 3V80A 3N28A 4UDYX 1RRCA 1JJIA 1ORTA 3Q4GA 5BQXA 4EAQA 4PHCA 4NWIA 3PNPA 3HY3A 1NAHA 1QB7A 3OKAA 4ZO6A 5T3YA 1L3IA 1SZJG 2X15A 3CLVA 3OQJA 3UK7A 3MAAC 1HWYA 8AT1A 3G9XA 4CHTA 3QK7A 1UXHA 2GPBA 1M9NA 2BKEA 2YZKA 3HJFA 1ICEA 5AK6A 1KH1A 5FLKA 1ZNQO 3B7PA 3BGVA 2OV6A 4YASA 3EBLA 2ZAGA 3GRZA 2C2WA 2ZBEA 4GPD1 3S44A 2RAFA 4Y67A 1R4ZA 2R62A 3NLLA 3UH1A 2HA6A 4G97A 3RU2A 1O6CA 4WUTA 3ISJA 1QKKA 2VJDA 1NVMB 5EYPB 3TX6A 5K8IA 3TLBA 5I9TA 5ALJA 3GRAA 1S2NA 1X1AA 2PY6A 2OZKA 4DPLA 1YR3A 3CRQA 2ZYIA 4KJXA 1Z5WA 1D6SA 3NEJA 1RHJA 2KE5A 3H04A 1F0NA 3M6WA 3O3CA 4LBVA 1FP1D 5KCMA 3UENA 4POOA 4C0JA 1FSGA 1V3UA 3IAM6 3V3TA 3AFNA 2FN4A 1U2SA 3LU1A 3M9LA 2RI1A 1GUFA 1IY9A 3ND7A 3OZSA 4H4DA 1ZGZA 3S70A 2Z57A 2JLRA 3SSOA 5F73A 1QWSA 3QPBA 1UJBA 2Q4DA 1I5OA 4JL6A 4G5QA 1OREA 1IHYA 2Q4BA 3GMIA 1TKAA 1VL2A 3F8SA 2YWJA 1YR9A 3BH7A 1VGVA 4YJ3A 3U80A 1LS1A 1M3SA 3T7RA 3TLXA 1RBYA 3JWPA 3I5AA 2MIIA 5BQOA 1NW3A 3TIVA 3BMQB 3REGA 5FUMA 3QEAZ 5AESA 1EE1A 1R0LA 4N49A 2RFLA 2V0NA 3CEHA 4ENPA 1N32B 1NXQA 2HA0A 4R7ZA 3UCEA 4DHWA 4KSYA 4NH0A 5HIAA 1WD5A 4OK5A 1LDBA 5CFZA 3TW4A 4AJPA 1G7CA 1GG8A 2IPLA 3E84A 3EDYA 4O4JB 4L07A 4EDHA 5LVAA 4J0QA 1IEXA 4WN9B 5JNWA 3ERCA 4UREA 4OAOA 1MOPA 3FHTA 2HA4A 2DTXA 4DN6A 3MBOA 2IXBA 4Q01A 1P8JA 3EK2A 4DA6A 3L92A 4LS3A 1K27A 2XQGA 3AR7A 2AR0A 2BTEA 1OOEA 2DQYA 3H1BA 3FOFC 1KF0A 1QAOA 5EMJA 2XRMA 1AKTA 2FI1A 2CEAA 4UBNA 3C43A 4K1LA 2H4ZA 2OE2A 1EFTA 2N1BA 3GQBA 1RHRA 2QZZA 4D0GA 2DPHA 2D2IA 2A1TR 4AF7A 1JEYB 2I03A 4RNDB 4UM7A 3GJQA 1C3OB 3OA2A 2P3QA 4FZ3A 5FUXA 5H16A 3E1SA 4LE0A 1FFWA 1TQ4A 1E3TA 1LW6E 2HJRA 3OAAD 3UMMA 4FI3F 2Y1XA 2YWHA 1AVTA 4AZ0A 2P2GA 1B00A 3PUXA 1MN6A 1IY2A 4XGIA 4ZI7F 1H2ZA 4MCAA 4UMEA 2I3GA 3MGCA 4HDKA 3ZJYA 1KO4A 1NMXA 4EI8A 3EEFA 1PEKE 2AC7A 5AUNB 1LSOA 1ORDA 2J0SA 2NNLD 2QX9A 3IPYA 5C9ZA 4KLRA 1VPVA 4ZAGA 1P2FA 5EWLB 3N7UA 2X5OA 1G4UR 2W70A 1UBOS 4AK9A 1UQUA 1H2YA 2I7TA 1YMVA 3C8DA 4RZSA 2N75A 2P79A 3HCWA 4XQEA 3VR5A 4UQLA 4RK1A 3RYIB 1H8HA 2W2LD 1VDZA 2RHDA 1EVLA 3H2JA 3K1TA 1DOAA 1RJFA 2BUBA 3HL0A 2Y9MB 3ML1A 3FROA 4NPHA 3S2YA 2P68A 3WSVA 1CUEA 1U8UA 1T5BA 4NAHA 5AI8A 2QUAA 3TBFA 1E1LA 2BCEA 2D1SA 2QBYB 1S2IA 4Q21A 4UTXA 1UJMA 3B20A 3VX3A 3OQOA 1K3UB 1WPRA 3DMDA 2NZ2A 2YYZA 4QARA 1SBQA 1G20B 1YR7A 4RADA 3RVKA 5I8WA 1ISFA 3GA0A 1UWLA 3WYGA 2JK0A 4HV4A 2B2NA 3TH5A 2JG3A 1MO3A 2NAFA 5AVOA 4ZJPA 4J3NA 2X76A 4V39A 4LTDA 4XX1A 1W5SA 1J24A 3W8DA 2C00A 1QSGA 3BIFA 5LQDA 1CUYA 4WCDA 4XGRA 1RC1A 2XA1A 3R6WA 4D25A 1SUPA 3VO1A 1PS8A 4B7UA 3K5HA 4MI1A 1SHKA 5DVZA 4A15A 4G0WA 4MS1B 5IBCA 2CZGA 1VSVA 2V58A 3H9CA 4J76A 3TPCA 2CCKA 3NBZC 3AB7A 1KTIA 1G5IA 1VRWA 3WWYA 2FLKA 1YU9A 2VNJA 1CT9A 2C2HA 2IHZA 2RGNC 2Z5LA 1NU6A 3NHUA 4V2UA 4ZGGA 2PR7A 2A0YA 1J39A 2GM9A 1UFKA 5DNDA 3VQTA 2WKSA 2C94A 4B3FX 3CJRA 2A8YA 2EF0A 1T5DX 4A6PA 2IEBA 1ESCA 4WJLA 3B13B 2F1KA 2R00A 1QANA 1JPVA 3ET4A 1I3LA 3G7NA 3DDHA 5LA6B 4QL3A 3RNOA 1RC8A 3KZOA 1KI8A 1ZXLA 1SIOA 2XF8A 3ER9A 2X58A 1H6BA 1KI3A 5ALFA 5JZBA 1H23A 2PE5A 1GRVA 3PQFA 3ZV4A 5ED0A 1XROA 2PV7A 2ADFA 1UMCB 1TVMA 2ZI5A 2YASA 3P8ZA 2EJBA 2PLWA 1I2CA 5BO5A 4EVRA 1PHRA 3B9RA 4MYCA 3KKNA 5F3WB 5DNCA 2W9XA 2RG1A 2QRVA 1A95A 4QVGA 4UHEA 4AX8A 4OXRA