2XYPA

Caspase-3:cas26049945
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CASPASE-3 SUBUNIT P17
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xypA00
1RWXA 2NN3C 3R6GA 4NBLA 1BMQA 4PS0A 3H0EA 4N6OA 2FQQA 4JR2A 2CNKA 3H11A 3R5KA 1RE1A 2P2CA 1NMSA 2QLFA 2WDPA 4QUHA 3NS7A 3PD1A 2CDRA 4EHNA 2H65A 4JJ8A 4HQ0A 3PCXA 4EHDA 4N6NA 1PAUA 3QNWA 4EHHA 4DCJA 2H48A 2QL9A 3OD5A 1RHKA 5JFTA 4FGUA 3H1PA 4ZVSA 3V6MA 4D3XA 1RHMA 1F9EA 4QTYA 4NOJA 1RWKA 4EHAA 3D6HA 2XZTA 4ZVQA 4D3ZA 4JR1A 4DCPA 5K20A 4JJEA 5IAKA 3DEHA 2XYPA 2QLJA 4N7JA 4ZVUA 3R5JA 1K86A 2HBYA 5LU8A 3EDRA 1RWNA 4EHKA 4N7MA 2J33A 2FP3A 4NOKA 4QU9A 3RJMA 4ZVPA 3V4OA 2CNNA 1RWOA 3DEKA 4QUAA 5IASA 2DKOA 4IYRA 1RHJA 1K88A 1IBCA 1RWPA 3ITNA 1CP3A 4JB8A 4NBKA 4QUBA 3UOAB 5LUAA 2CNOA 3SIRA 2CNLA 1I4OA 4HQRA 5IARA 2XZDA 4NOLA 3R7SA 4QUEA 1SC1A 1I4EB 3P4UA 4I1PA 1F1JA 1RHQA 4AWBA 4EJFA 1M72A 1RHRA 4JR0A 4PS1A 2C2MA 5I9TA 4FDLA 3NR2A 5IBCA 4EHLA 3D6FA 1SC4A 3V6LA 4I1RA 1SHLA 2HBQA 1GFWA 1GQFA 3KJQA 2CJYA 2K7ZA 1NW9B 3H13A 3KJFA 3GJSA 5IC6A 1SHJA 4FEAA 3BIJA 4QUIA 3V55A 2QL7A 2H5IA 4DCOA 5IABA 3R7BA 4QU0A 2HBZA 1PYOA 4LSZA 4PRZA 1I51A 4QUJA 2H5JA 2C2OA 1RHUA 5IAGA 5IAJA 5LUBA 2Y0BA 3SIPA 1CVRA 3GJRA 2H4YA 4QU8A 1QTNA 2AR9A 4IEFB 2C1EA 2C2ZA 2J32A 3IBCA 4NBNA 4QUGA 3S8EA 4HVAA 4N6GA 2XYGA 2QLBA 1KMCA 2J30A 1NMEA 3PD0A 5H0IA 1QX3A 5I9BA 4JQYA 4NOMA 3DEJA 5IAEA 5IC4A 4M9RA 3EDQA 3H11B 5IBRA 1RWMA 4ZVOA 2FUNB 3V4LA 3UO8B 2XYHA 3R6LA 3KJNA 1QDUA 2C2KA 2H4WA 2H51A 3NKFA 3E4CA 1NMQA 1RWWA 3D6MA 3GJTA 3K7EA 3GJQA 4N5DA 3P45A 5IANA 1RWVA 4EHFA 2H54A 1I3OA 1JXQA 1SC3A 4PRYA 4JQZA 4FXOA 4ZVTA 2QL5A 4QTXA 5IBPA 4ZVRA 4QULA 2J31A 4QUDA 1ICEA 2CJXA 3DEIA 3R7NA 2HBRA 4AWAA 3V3KA 3IBFA 2Y1LA 4JJ7A 3S70A 4AW9A 4D3YA 5LU9A 4QU5A
chains in the Genus database with same CATH superfamily
2Q41A 4PGHA 4M49A 1U4NA 1NLYA 2YASA 3NC4A 4OM7A 3U4QB 3KQQA 3G9TA 3R0ZA 4NMXB 2DSNA 2RCYA 3BE8A 1OTXA 4TGLA 3FYUC 3T0FA 1F17A 2JGLA 4BWVA 2CV1A 4B85A 4I9UA 3GJ7A 1U1IA 3I1FA 3T5TA 4K9OA 4UAUA 2F1JA 2NPOA 4HDCA 4ZCIA 1DKQA 5DBOA 3OF5A 3AVUA 5FPQA 1BW9B 4YUWA 1ODJA 2B2XA 4HAWA 3MRVA 3LKDA 1V2HE 3GUYA 4JCOA 3GGDA 5JTTA 2Z58A 2DWOA 3NBMA 1UZLA 1N2JA 3C7DB 3QGMA 4DCCA 2G09A 3N74A 4O2AF 1PU2A 5AK3A 1ES9A 1ZOSA 1SCQA 1E0AA 5DNEA 3SJBA 1N5MA 3H2BA 1HDXA 4HQOA 2VP5A 5LDHA 1EUYA 1DCFA 3BFKA 2HV8A 4MQ4A 3RYIA 1YB6A 3IXLA 2Y3IA 3OJWA 2WSSA 4IYRA 4RF2A 1A9PA 1FQOA 3CX4A 1H5QA 1TFRA 1E7SA 4I1YA 5AH0A 1L5WA 4V3BA 2PNJA 1TF5A 1KQ3A 3DZ8A 2FP4B 2X4DA 3I9KA 4BLRA 4I1PA 2V6FA 1C8LA 1OT5A 5HTKA 5FDFA 4XD2A 2OV8A 2NUAA 2UZ1A 1ORRA 3D3WA 3R7WB 1FYEA 2C9BA 2QX9A 4MUFA 1QK4A 3GMSA 1IXRC 3UHJA 1NN1A 4JFRA 1JA0A 2JFPA 2QF7A 1KA9H 3CNOA 3UMBA 1Y34E 5FWDA 4A82A 1L4FA 4R8SA 2JLVA 3UC9A 1CDOA 2Q6KA 2R751 4WK4B 1JU3A 3VQTA 2CJYA 2JH8A 4D45A 1I1QB 4BNMA 1H8HD 4ITVA 5AMXA 4FE7A 2P78A 2WVHA 1QKJA 1QRAA 2MJLA 1BROA 3F3MA 3P96A 5DMXA 4M0FA 3WWEA 1YOVB 5KQLA 5KI6A 2FW7A 4LDNA 2HFKA 2NVOA 3O6VA 1U5BA 5CHYA 1FF9A 5THQA 3WHIA 5A03A 3OPQA 4GDFA 5KAPA 1SZCA 3AESB 1NTRA 2C31A 1O95A 1S89A 2PT5A 3LQRA 4ML3A 4MYDA 4TUYB 1EDOA 3ZYCA 3O21A 3OF2A 4RQUA 4AWXA 5BV1A 2XLCA 3TOXA 3WL6A 5G0TA 1YGYA 1RZ3A 3AUAA 4YMIA 1UXGA 1QAMA 1JZQA 3FPAA 4PY2A 4YJFB 5DIFA 4BBPA 4CTKA 1SELA 1XN1A 4U3JA 4M1TA 2EL7A 3EAGA 1AK1A 3A8TA 3SY8A 3K5IA 1LTQA 5LQUA 5K03A 1KO1A 1PRYA 4RZXA 1HE4A 5AXBA 5BN5A 2R8ZA 1NVUQ 4O25A 3W05A 4C2AA 2QW0X 1FFXA 4EY6A 4IHJA 4AJEA 4N1AA 4V03A 1A9QA 3VU1A 4BGEA 4IZHA 1C3VA 4BLOA 4XYEA 5HDQA 3DZIA 1URPA 2C99A 3FHJA 1VIDA 1FXWF 2OM6A 2QJRA 1BDHA 3HWX1 3AR9A 4ZVLA 5IFKA 4Q3KA 3O8QB 2EEPA 3SYTA 1UDCA 1ZKDA 5KYWA 4JEMA 3WK5A 2QUJA 1MW9X 2HAEA 1K08A 3K1ZA 4IOKA 3S8MA 2B8NA 2R87A 4CLEA 2IH2A 1ZSVA 1VI2A 4FX2A 2EW8A 5TNXA 16PKA 3BB1A 4NBLA 1YZTA 3PDHA 3TTWA 4M54A 5K8TA 3DV9A 4G1VA 4LV5B 4BFZA 3PC8C 5A4AA 1QGOA 1MX1A 4R3UC 1UKYA 4M1KA 3VBEA 2AC7A 3R5TA 5BY2A 1U0FA 3PKIA 4WOPA 3RTGA 4DANA 3ENNA 3CEHA 3H2JA 4RA9A 3CUWA 1NXWA 4N6NA 5AM0A 3TW4A 5JOQA 4US0R 1Q3KA 5DGHA 3ZY5A 1YDHA 3HXLA 1L3CA 5KQSA 2G70A 5TF4A 2FF5A 1PZXA 4FHEA 5CX1A 2F59A 2JFHA 3KZKA 3NTOA 3D6TB 4Q7MB 5COBA 3TKYA 3U7QB 3KB1A 1U0BB 4CMIB 4HRXA 5F52A 1B6RA 3H5OA 4GGOA 4L4ZA 4IHJB 3HCBA 4KU4A 3SZRA 4F12A 1RWNA 1Y3BE 1ZJWA 3CVVA 4QDXA 4PR3A 3A6GA 2OAGA 3KTAA 5C5CA 3IX7A 1JEDA 4A16A 2CYAA 3JWGA 1YXMA 2WWVD 2AWNA 1IBCA 1KYTA 3D7LA 2PKWA 3LDAA 3O8QA 3X3HA 5DBHX 2IH5A 3GVIA 1TVMA 2Q6VA 3QSGA 4BMNA 3W6OA 1U28A 3FSEA 5BRJA 3JPYA 4H27A 3GLSA 4TYWA 2B3TA 3RSQA 2HCJB 1X92A 5SV2A 1E66A 1QVZA 2JIZD 4UMEA 1E2FA 5G0VA 1NPYA 3ZNPA 4NBVA 5M7EA 2VFAA 1E6CA 1QG0A 3KJEA 2NVWA 4O4IF 3HLYA 4HC4A 4INAA 1QIFA 2DYKA 2C77A 2WSMA 2GPTA 1MAVA 2Y77A 1LQTA 3GEMA 3GNTA 2HQSA 3TOSA 5MFPA 4LJRA 3ETCA 1UK9A 4Q1BA 3SVLA 3LUCA 1ZU5A 3U37A 3A9TA 1ISFA 3EE6A 4G0QA 3BS4A 2CHGA 5A9TA 4YCMA 1F6BA 4MJLA 3EZGA 3HCAA 1VKOA 4OK3A 1CDZA 1F9AA 4X65B 2BKVA 4EYKA 4MS1B 5FOTA 3ICOA 1RAAA 1QGDA 2BZ0A 1KH1A 2Y76A 3A36A 4HGZA 4KQKA 5HKKD 3RFFA 2WJAA 3DEYX 3A3NA 4N7BA 2BGJA 3QV2A 1NUSA 2K2QB 1RQGA 4G4IA 1UT8A 4LSGA 1M73E 3OP1A 5F4ZA 1QP7A 5HRCA 3F5QA 5L6LB 2R5WA 1GQQA 3N3AC 4Z0HO 1YVPA 1EWRA 1T8YA 1T1RA 3BRQA 4U7TB 5EUMA 4GBJA 1G6Q1 3DEJA 3V1KA 4LQ4A 3KSAC 4TTVA 2ZUFA 1BRMA 2L69A 4UVIA 3FTFA 3G9QA 1DFGA 2J5XA 3O2NA 1GYQA 3MT9A 1CFZA 5DNWA 4Y6QA 4NCAA 3OQJA 5REQA 1GVNB 2WFLA 2FW9A 1YL7A 1JPUA 2Z9DA 1VMKA 2GILA 3M9LA 2H4JA 4Q9AA 3NEPX 1WUJS 5F21A 1I0ZA 4G4JA 4DR2B 1JJAA 1E2NA 4OTZA 5ES4B 1H9CA 4DV6B 1HT3A 2XUQA 3RUIA 1QZUA 1ZO8A 3UBMA 1E2QA 2W8BA 3B7PA 5P21A 1UMDB 1W47A 3Q10A 2G4VA 3JRXA 5ALHA 4ZI3A 3OOEA 4KYVA 3TG8A 1DZIA 4ZTBA 4NTZA 1KKUA 4R2KA 2OFPA 4KEAA 1QBGA 4I9NA 3M4YA 4QA9A 5B37A 1MX9A 4G9BA 1LX6A 2H1VA 3LDHA 2YOHA 5HM8A 3HU2A 1B4DA 1XHLA 3AEXA 3I42A 5ILGA 4J76A 5BMVF 2JZCA 5FOVA 4MGZR 3WK8A 2YN0A 5ALKA 3WR5A 1M76A 2HJRA 2GM5A 4K9DA 4DR5B 1F0PA 1OB2A 5EMMA 3UJPA 2XUZA 3FMFA 4TV9B 2DR2A 2G8LA 3PGVA 1WU8A 2DBRA 3ZW8A 3C6YA 1E2BA 4FNAA 3MRSA 4BFLA 3LPMA 3MA0A 4Q48A 3T52A 1MAHA 4EPVA 1J2TA 3SS9X 2L82A 5D87A 3QELB 1PDOA 2P2DA 4HLUA 1JALA 3K92A 4UBJA 2AMYA 3EDRA 4JEIA 4W1RA 1QR6A 2I1QA 2EP7A 3GJ3A 4UFNA 2XB8A 4OKIA 4R01A 4MKHA 5JAIA 2XYQA 2GTPA 4C2TA 3AVWA 2QVYX 1GPNA 1JQAA 2O3QA 2WB4A 3A3OA 3U9LA 3F49S 1EU1A 2H7XA 4U39A 3BKXA 2FUEA 1ZNWA 2B5VA 2WD7B 3C4JA 4HFJA 1NVTA 2XUGA 3VR3D 5KOJB 1MFZA 2VXYA 3G8AA 1VBFA 4Q4DA 1F1JA 3W0LB 2IHJA 4FSHA 5EMKA 2DUUA 3I4FA 1X9GA 1TQ8A 4MIYA 1MO6A 1V4VA 1XQ6A 3I01A 1TTQB 1YZUA 2WT9A 3FH0A 3MTIA 4I6GA 4KXMA 4L3WA 1GTG1 4ZQBA 3RR2A 1YS7A 1FFWA 1GY8A 2OV3A 4DR4B 1IHXA 2KB0A 4JQSA 4NBTA 4PHCA 1WZEA 1OH8A 1ZHOA 3VGPA 3NTLA 2CHFA 3O03A 4F2PA 4K28A 2B7BA 2BFCA 3T9FA 1JILA 3W8EA 2IHZA 4A1OA 4BPRA 2WJ4A 1M2GA 4ZMBA 5FUMA 1KARA 4DIDA 1RXSA 3AR4A 3RAEC 1JFFB 4TV9A 3L02A 5EMLA 1VC2A 5T4HA 3FVWA 2FXIA 2JHGA 4JGBA 5DBGA 3WNZA 5DLQC 3AVQA 2R3SA 3C7TA 2QRVB 4MDFA 1O03A 2PZKA 3EXHA 3SBOA 3SIPA 1ISHA 1E98A 3II6X 1SBIA 1L4HA 1X87A 2YY6A 4IMIB 4UZEA 4DY4A 7REQA 5JHHB 2KJQA 3JAKB 4Y6SA 5CA1B 4E32A 5IAOA 4LJ6A 3PEYA 2JFWA 3WB1A 2AXEA 3BDVA 4I9GA 1XVAA 3AR7A 1OVGA 1GDDA 1QX3A 1T4DA 3MWDB 3ONFA 4J1SA 4RU1A 3C7AA 1HEUA 4J9UE 5G1OA 3AUYA 3GLIB 5JS7A 1N92A 2JFBA 5K3OA 2QXYA 1UJ2A 3KCNA 4YT8A 3SHVA 2IU3A 4I3FA 3LAWA 4DS3A 1JWAB 1QFYA 3C48A 1DEKA 3L7LA 2QTAA 3ILYA 4D9MA 1QRDA 3H65A 3KK0A 4MYHA 2X77A 5KYWB 1H2RS 4RA6B 4DJFC 4GOMD 5FADA 5HFJA 1NP6A 5LQKA 3IUJA 5B30A 5GZ1A 3E9EA 1EFDN 1NFQA 2Y9PB 2CDCA 3L93A 3NLLA 2Z1DA 4Q01A 2W58A 5KNDD 1OFUA 1JT9A 3DOOA 3NBZC 4I99A 1T1JA 1QIMA 5H5JA 2JRLA 1G20E 1RYFA 5KNBH 4IIBA 3ZV5A 2BFCB 3JQDA 1DQNA 1RYEA 3A9WA 5EAIA 3TJMA 2PGDA 3K0CA 3MWEB 2RI0A 5CCDA 4CI9A 2COUA 2D62A 4YJ3A 1GL3A 3A32A 3PDWA 3H11A 3RHZA 2IYUA 3WSTA 2PKEA 4EY7A 5KYUA 1EVJA 2ZT7A 2PEYA 4KIJA 3P2JA 3BX1A 2E4YA 5LR6A 1A5AB 1ITZA 3I23A 1P60A 2HMWA 3B13B 3JCZA 3PWKA 4LJSA 2ZM6B 2FEAA 3MM4A 3SQDA 4MUMA 1V8DA 1AUXA 2NACA 1WVGA 4RHTA 4DUZB 3ZHSA 5A4JA 1TADA 1ZCAA 2JH3A 1E5DA 3RYCB 1DZ3A 4MTCA 3FYUB 4LF6B 2G4CA 2ECKA 2QMEA 3OCXA 1BVRA 2OCXA 1JFRA 3EULA 3FDZA 3H2SA 4HB4A 5HVNA 1GHTA 1YH3A 1Y89A 3B1FA 4UMVA 1SIUA 2YXLA 4IH4A 3PEUA 1J0XO 2YZ7A 4RGYA 3OE7D 3AXTA 4JOQA 3KAPA 1M1NB 5DHFA 1JG4A 4RZSA 5EVCA 3LKVA 3A1FA 3IODA 2OC4A 3D43A 3MWJA 4IO1A 4BX9A 4EHKA 5FAKA 4P0PB 2XW6A 1Z0DA 3HN6A 5FBVB 3Q12A 3KV1A 1Z12A 1Z4LA 3NASA 3UB4A 1Z0SA 2Y0DA 2ZSBA 2KBEA 2QGFA 1XZQA 3GRUA 5ECYA 4KITB 1IZ7A 2ZIXB 4CIBA 3DOIA 3AU8A 3DONA 4OGLA 4RBNA 1XZJA 1MB4A 4QUEA 4URVR 5L40A 1FMJA 3D3JA 5IKPA 3HB9A 3O93A 3TTXA 2G9UA 2XUJA 1T4GA 4LBYA 5DN6A 4C7OA 2CMGA 4L95C 3F4BA 4PRLA 1VYUA 3A3YA 3KQKA 3QVSA 3K9NA 3SLKA 1T5SA 4P82A 4RD4A 1UBCA 1RADA 4H6PA 1MDFA 2R62A 1BIFA 3S1AB 4HH0A 1FB5A 1DKPA 1ZWLA 2WWFA 5J43A 1Y4DE 4R51A 4LV6A 2JRCA 4G0VA 2RH9B 1WY5A 2ZBUA 3PTLA 4Q3DA 1XWWA 2W2PA 4B35A 4F0JA 5IKMA 1B0UA 1EH5A 3ODGA 4JLVA 4FOTA 1T1IA 1O94C 4MK4A 5AVWA 1AJEA 1F2UB 1D6JA 3UTCA 1KOLA 2E37A 1XQ1A 1AQYA 1K0FA 4XGQA 4JI3B 2AUNA 1OHHA 1MVLA 4MVJA 2IU4A 3O8DA 1KSJA 1Z08A 1E8MA 2XH8A 3BERA 3W3AD 4XD7D 1G41A 4YH1A 2CCJA 2W2TA 3QH4A 1QHSA 1KAEA 1VZ2A 2QSYA 4GQIA 4OXNA 1OH6A 2JHFA 2G04A 4CW7A 5K6AC 2IPAB 5FYQA 4DCUA 3FWKA 5I9BA 4NCIA 1C1HA 4HPXB 4NFHA 1RZRA 2VWGA 5EKTA 3JPWA 2X42A 4PONA 3GLGE 2R1UA 3QYJA 3Q3HA 4FMCF 3ZI7A 5HUJA 2WM2A 1WHTB 5EPUA 3EOZA 1FXWA 4EW3A 4LWOA 3SZLA 3CPEA 5KU1A 1HE5A 4AO7A 3DHVA 4JUDX 2UVDA 3RUPA 4JXXA 1BE8A 3AERA 1LBTA 3IPLA 4DCGA 3ROFA 5EZ5A 2F9FA 2ZUWA 4Q9IA 1P2UA 5KSZA 3K0CC 1P0PA 5E9QA 1CZLA 2ZBQA 4OUKX 2G88A 3RU9A 3CVUA 4AD8A 1A8PA 2JC3A 2O7NA 1K4KA 2VZEA 4H7HA 1JDPA 4MVYA 2YZ2A 3EXIB 2MCFA 2GK7A 3JZDA 2AE1A 1R0SA 3O84A 1T25A 4UASA 3RT1A 2XI4A 2QPAA 3GDFA 1Z5OA 4X95A 2AN9A 3SG0A 3RFUA 3SQMA 5IDXA 1QPGA 1SK8A 5D3ZA 1FC0A 1GAEO 2AQHA 2R79A 1OX6A 2WPDD 3PDIA 1DSSG 3RVOA 2PAAA 4IR7A 2R86A 2YZGA 2UYYA 1J49A 3D7MA 4YIHA 3E2IA 3E22B 3PQ5A 2E18A 4GZMA 4NE7A 4REMA 5F35A 1QGED 2Q7DA 2NMVA 1FVHA 4ZQHA 2FSFA 3O4VA 3IESA 1CIPA 1GNTA 1N25A 4OFWA 4WXRA 5EJMA 2ZAIA 3VO1A 3WQSB 1M6VB 4Z4HA 4PSCA 2BIFA 3EQ9A 3O92A 1GQSA 4BO7A 2QBYB 4NEGA 2NU8B 1FXUA 2ZGVA 3T7KA 4L0DA 3WJ2A 3ADBA 2V0CA 3O9MA 2XQGA 3ZDFA 1PSWA 2YJ6A 5SY9A 2ZIGA 1DLJA 2DKFA 2DQYA 3QKIA 5CVDA 3RJMA 2ZKLA 5LQJA 2F8MA 4OBXA 3E05A 4GI3A 2JD2A 3HVUA 5FWYB 4MRPA 2B2NA 3PUKA 2ACWA 2O8BB 3BWEA 4BNJA 2ANCA 1CP3A 2TS1A 4K40A 1KNQA 2AMLA 4X97A 1EFVA 3UWPA 4DR6B 4MYCA 4QDUA 4YHBA 9ATCA 4I55A 3FF4A 1UBFA 3ACBA 4YRCA 1KVTA 5FUYA 1UMCB 3GNLA 2HHHB 2N9UA 3COPA 1W76A 2DT5A 1LPNA 3GEIA 2PLFA 2KLHA 4WNAB 5AVUA 4DMFA 3OOHA 3QNUA 4FE4A 1L8XA 2CYBA 4PQEA 2X0EA 1JMYA 1PUJA 2QUAA 4IMPA 1RRCA 4U1RA 2X5KO 4I19A 3OQOA 3Q2IA 1V1JA 2ZCVA 4HDSB 4J2TA 2YC2C 3RD5A 1PT9A 2NYRA 4RZIA 4EENA 3S44A 4Q3AA 3L8DA 2IA5A 4MUBA 1DAPA 4O4JB 4CFYA 1MHTA 3PQDA 1NJGA 2GPAA 2YFQA 1L4KA 4KNYA 2J7KA 1ONPA 3GCZA 2B4YA 4NZYA 1YC2A 4PRZA 4L8FA 4DT1A 2FPRA 4MR7B 4C05A 4PLHA 3A4IA 4QYIA 1G9TA 1AQIA 4YDQA 3EISA 5I6DA 1ISSA 3NHAA 4V2UA 1YQGA 4KUGA 5B1EA 5CG1A 1N36B 1KMMA 4UM8B 4PSUA 4GYKA 2JFYA 5ITVA 1KDPA 3PKZA 5AUNB 2PSDA 2BELA 2TMYA 1MB2A 4YTEA 4GPZA 2RI1A 4XFKA 4LUCA 4O0LA 2FWJA 4OCZA 1JDNA 2SCUA 1THZA 1KBZA 3IMEA 3DGEC 1YOVA 1RLOA 2X3YA 1TLFA 4XTRA 1I4DD 5JNRA 4ZI7B 3PTAA 5FF9A 4F9FA 1SIWA 2WABA 2XIJA 4JLWA 4CPDA 5JBNA 1QNLA 3DTVB 3EC2A 3AESA 5H16A 4PLGA 5TR9A 4HWKA 4CR7A 1DLIA 1G3IA 1SZDA 3UATA 1K5PA 3KQLA 1L7VC 3KSMA 4S3MA 4O0MA 2PSSA 2YHAA 4JKIA 1ZWKA 1QCYA 2Z5GA 1GSHA 3SEZA 3TQCA 1EA7A 1JSLA 5BPHA 1JR3E 5IZ4A 3MINB 1G8AA 4PFJA 4PFQA 4JI1B 1EM8B 1ST3A 4LHVA 4B71A 2IW1A 2QLMA 2W6ZA 2F1KA 3PHIA 2IS1A 2X9QA 1RJDA 1J99A 2WD9A 4UREA 4XFJA 4BS9A 5CD9A 1NZDA 1JDUA 4RVCA 3VH1A 2RK6A 2J4CA 3JZMA 3Q5DA 4AJ4A 3CA8A 5B3KA 1BS1A 4BFSA 1NV8A 2GUGA 4Z49A 2I99A 1AZSC 1VIVA 4DADA 1JLRA 1GXSA 3CZ4A 5C0OE 5U1PA 2Y92A 4IHQA 3LQYA 3SFTA 2OG2A 3GRYA 5D8DA 1Z4IA 2FW6A 3H5VA 5KOIA 1IU9A 3K4PA 4J4BA 2QUHA 4IJVA 1TO1E 1ZONA 2JLRA 4CODB 2HF8A 1OW3B 1KXZA 2WHYA 2IYLD 3MWGA 1TKAA 5A1TA 1JE0A 4QTYA 2FDCA 4UBKA 5F1YA 3IL2A 2XVMA 5SYNA 1JU4A 1MTOA 3FBTA 1D2EA 5BSFA 1ABBA 1LQUA 1YBHA 4R8LA 1TI7A 2KI5A 1WXGA 2P2SA 4OHZA 2Q3LA 4W5OA 3O2JA 1HYEA 3R2JA 4R1MA 3HUTA 2LUOA 1QC5B 3FYSA 2ZYSA 3H75A 3LJKA 1NW5A 1BQ3A 4KKVA 4MW9A 3R3XA 4ZVPA 3VVBA 4FB4A 2OCPA 1AOXA 1KI2A 4HGNA 5HGXA 3H97A 1OI2A 4EKYA 3ICQB 5TX7A 6REQB 3VI3B 5IKEA 4KR2A 2IV3A 3PE3A 3DAGA 3G0IA 1KS2A 4D9CA 4C87A 1GFZA 5LP6B 1LSUA 3JU3A 1OLSA 3HPRA 2FZCA 4NJMA 1ZD1A 1E2GA 5I9TA 1YBFA 3T7DA 4EHLA 1TD9A 5CBKA 4WDQA 4I5FA 1V3UA 3NDPA 4ZARA 4NYMQ 4EA6A 1EFUA 3DC7A 4Q3BA 1TJ4A 1Z6XA 1VE1A 1E18A 3E03A 1WIWA 2Q2NA 5G40A 2OXEA 3N76A 4LQLA 4GVXA 3BGOS 1OY1A 3PPVA 2O57A 4NS4A 3OKFA 1YOBA 3GJ0A 4MMZB 2XLBA 3DAOA 3AHFA 3UA4A 4LJ4A 5KCZA 2XCTB 3HJGA 4QOEA 1KS9A 1U7HA 3IPYA 1EK6A 3KVRA 4JL5A 3AM1A 2VLBA 1GGJA 2RARA 4I1IA 4O2BF 4HXEB 3JQ8A 4NARA 2A59A 5LC1A 1XSEA 3GVHA 3KD3A 4BASA 3DCIA 4RHYA 3V1MA 3KUCA 3LOQA 7ADHA 3IP5A 1NQWA 3GDWA 5B6JA 1JLMA 2VBFA 3VMMA 1KZ4A 4LOLA 1Z3IX 1HEYA 3SP1A 1W30A 3DAFA 4TMKA 1X7XB 2PYZA 1G6HA 3KXKA 1U1EA 2P9HA 4F96A 1T5IA 3F46A 2ZR0A 3NTXA 4NDZA 2O1XA 4B82A 2XQFA 3LT1A 3SICE 1OILA 2XVZA 3ZZNA 2DPMA 2X1MA 3TQSA 1NIPA 3LTEA 5KHAA 3ND6A 2Z09A 5KC8A 2REXB 2HMTA 5EEGA 1Z4QA 2A9QA 3T1VA 2O59A 1SIBE 2JZNA 4G65A 4X0EA 1CETA 2XQIA 4LZJA 4HYEA 3RU2A 3V8BA 3TF5A 2WZQA 3Q0EA 4WLFA 1CQJB 1FSZA 2FP4A 5FWXA 3W9UA 2VSFA 3H8JA 4G86A 5CVTA 4L5AA 3IJPA 3K0SA 3AWDA 4KQIA 1OBOA 3W2IA 3ER8A 5IJ9B 4XLTA 1WULS 1CE8B 3DXZA 4B8YA 4X7PA 4V0QA 1N3IA 4N6OA 5D1HA 3GCGA 1N2HA 2BEVA 1P9OA 3LPNA 4LHWA 2YX1A 1DAGA 4QEKA 4ZYWA 1KP2A 2FJPA 1ZI9A 4RSRA 5LWQA 2A0WA 1FVFA 1BFKA 1ZM3A 1DKRA 2V6MA 3CVOA 3NU1A 4UPVA 3O7WA 4YPOA 3ANLA 3MMZA 4M7OA 4XQ0A 4MKXA 1EB8A 3VYWA 2CVHA 3LNTA 1QRTA 1GPAA 1YBMA 3LE8A 3ZD6A 1FFCA 3EIUA 2EBWA 4OX9B 2AK2A 2NU6B 1XKXA 1FMFA 1LBQA 4KR7A 2B0JA 4RKFA 3ZBQA 3W4KA 4BDTA 3I04A 3G8YA 2ESRA 4ZVQA 1Q95A 3L8GA 4G63A 5L6MB 4LCEA 1AKVA 4PIVA 2HU2A 5F1PA 1ND5A 3IRUA 1N2BA 4B84A 4Z7OB 2ZXUA 4RHUA 2YXEA 1DBWA 4B40A 1C0PA 1YK0A 5DOZA 4HUTA 4WH0A 2RH4A 3A9SA 3RT7A 2GM9A 3LUGA 5K3EA 1BXZA 1GZ5A 2CLIB 4YQZA 4P36A 2EW2A 3COZA 5AJHA 4CKXA 1XPRA 1XVVA 2A0YA 1G7TA 1VPEA 2VDJA 3AZQA 1PQPA 3C2QA 3DMFA 3AHEA 3PX7A 3FMOB 4FLEA 4RK4A 2DXIA 1PSDA 5I4CA 13PKA 1CG6A 1HG1A 3KDAA 1N5LA 1KOJA 3DBIA 1OOEA 3FR8A 4CMCA 1DMRA 3WISA 4CLRB 3PFIA 3WA6A 2EFEB 1B2LA 2I6GA 2SBTA 3FCAA 2HSJA 2B20A 1DIGA 3LBFA 4JU9A 2XE8A 1G3MA 3GGSA 4YMSA 1YAHA 1VDMA 1FTNA 3P7MA 3QKSA 4LDQA 1JHYA 4MJ7A 3DO5A 3LGAA 1R50A 1WXHA 4DQLA 1TKCA 5LQCA 3I9NA 3ESQA 1N34B 3FPHA 4GVLA 1GTRA 4RD6A 1AY0A 1K5HA 3ONWA 5DB4A 3WWYA 2CD9A 5FI0B 3LQQA 2E4ZA 2VJMB 1UP4A 3DL0A 5D3QA 4BL5A 4TVKA 4D41A 2ZT8A 4B6SA 4CV3A 5KOHB 4XM2A 4HD8A 1AM4D 4ZCRA 2FQWA 2CK3A 3QVUA 4LOJA 5KX5F 2XXAA 3FIJA 3AZOA 4CL0A 3JATB 1ODCA 2PZGA 3DSRA 3JXEA 1A72A 4E11A 4LOKA 1R4NA 2VTBB 1NG9A 3ABQB 1D3AA 1KPIA 3RU3A 1RBMA 2ZIZA 1F2VA 2F9MA 1KI8A 2O1SA 1GTL1 2OZEA 2YJNA 3KYJB 3K0FB 3TFOA 3RKUA 2IK8A 2OYCA 4A36A 1NHWA 2WFLB 3L79A 4F7DA 2QY6A 1T2EA 3Q7RA 3E2MA 1H1DA 5AKKA 1T91A 5ERGB 1RRKA 1OZ0A 5C5EA 5KNBA 3LTNC 1WUTA 3THYA 4IWYA 4BRWA 4C7XA 3Q85A 3JV7A 4CDNA 3K71B 3A2NA 1HDZA 4DVGA 4JI8B 3E3AA 3FFBA 2O8EA 1M2JA 2FUNB 1N6OA 3BWBA 1N9GA 1NVVR 1DAIA 2D59A 2XVXA 2GA9A 3BH7A 1SXPA 1BO6A 5IMBA 3MTEA 4IVPA 3P9QA 4IKEA 4K46A 4RV9A 2Z83A 4R4JA 2V9CA 3DTYA 1QHGA 3DPSA 3QK7A 4LHXA 1PZGA 3GP5A 4D46A 4L73A 1UBNA 5SY4A 2Y9MB 4AG3A 3E5NA 4DXDA 3NVDA 4COOA 4IRUB 2I9KA 1U8FO 2X14A 4QGHA 5D3KA 1FFYA 4CCSA 4LRQA 3H8VA 2FF7A 3LRTA 3GLHA 3RRZA 4LOIA 1KK0A 1BQEA 4M1EA 3ZE8A 2B7LA 4I2NA 3WYAA 4DXAA 1CEEA 1P2VA 2QB5A 2PMKA 2BLLA 2V7VA 2ZRAA 3P5BA 3R6GA 3WB0A 3UVEA 5CCBA 3OIFA 3H0EA 4I50B 1KWGA 4WZZA 1SUAA 2HQRA 3D6JA 5HEKA 1T9BA 1WPQA 2OHOA 3SSMA 3WLPA 4B6GA 3UK2A 3RSHA 1II0A 1M74A 4R1NA 2YN4A 1J97A 1GNLA 4KAJA 3BZBA 1KYQA 3M5PA 4YJ3B 1NBWB 4IYJA 2I6TA 4JVMA 5IUJC 4YX9A 4I3HA 3SC6A 1D2GA 4TKVA 1DQYA 2CZQA 2C1XA 2EERA 1FYVA 1UMBB 1O8BA 1W44A 2X7XA 1UWVA 1W85B 5B1YA 5JRDS 5JNWA 3D4NA 2A1TR 4EF5A 4KACA 2W6PA 5GWXA 5C34B 4CDRA 4BHTA 1QIIA 2NUBA 4L76A 1SNYA 5HYVA 4WX2B 1U0LA 2BEJA 2HBYA 3IQZA 2ID9A 3I5XA 3VOBA 4DBVO 3ZDRA 3NQ41 5A3SA 1R0BA 3DAYA 3UKJA 4YP6A 3ETGA 4MLDA 1EXMA 1MGOA 2OUKA 1FLNA 1ODTC 2H17A 2Z2ZA 4YONB 1OLSB 5CDSA 5HQJA 1N4AA 2XXBA 3ASZA 2VHYA 4MQBA 4BMOB 2P65A 2V8OA 3EZLA 3HDTA 4S0ZA 5CH5A 3ZY6A 5IULC 2AFIB 1G0NA 1QYIA 2O3TA 2V9ZA 4BLVA 4O4HB 3MK31 3OIYA 1W48A 3PX2A 5TV2A 3HJUA 3KKNA 2WUDA 4PIPA 1M2KA 5M34A 1FUUA 4FT4A 1JB1A 4KXVA 3V8VA 1YA6A 4DILA 3K0AB 4EMTA 4Y1EA 2VXCA 4PCUA 3CZRA 4H77A 4KGDA 4H18A 1P0MA 4WMLA 4BYGA 1GAQA 2EYQA 1GPYA 5KNCD 5E6RB 1I2BA 1TAHA 4MAFA 3NG1A 3W2HA 4NF2A 1Z8NA 3F6PA 3L0YA 3D5EA 4D44A 2V3VA 1JDJA 3H19A 4JOBA 4U2BA 1AKTA 4B4OA 2OBYA 1SCKA 2C2XA 4WNYA 1RPAA 5CB8A 2GJ9A 2LCIA 2WKWA 2HD4A 1ESEA 2AW5A 1MJHA 2CHUA 3BA6A 4QL3A 2P75A 4YAOA 3THYB 2YMQA 1HTWA 1YZQA 4JENA 2I80A 2JFOA 1I1NA 1I32A 1N5RA 3A4YA 4GKJB 1GJRA 2BFMA 1WXQA 2AZDA 2OP1A 4Q3OA 4A9AA 1QS0B 3N8DA 4UNNA 3T3MB 2FETA 1U4OA 2CE7A 2CZGA 5DI3B 1TAQA 2WNHA 2QRUA 4RJTA 1OLUA 3WYBA 2Z3VA 3AQIA 3AY0A 5DRYA 2HX1A 1L4GA 1YVUA 4U6NA 3UAWA 2D2FA 5HWSA 3EBPA 3NOXA 5JPIA 3HXQA 3GPLA 3DFZA 4JELA 4NE2A 5IVHA 5H83A 1FUYB 3DJFA 4G4SO 5KYKA 1GLGA 2XZPA 4LX0A 2AK3A 3TUIC 2DETA 4ZIRA 1Z37A 1QIJA 3EUWA 3JAWB 3P9ZA 5AOBA 2XGJA 4CM4B 2JW5A 4HGYA 3ZJ4A 3V5NA 5LP1A 4AP9A 4EGJA 3UK6A 1ACJA 1XJ0A 4NMLA 3VU0A 2OFXA 2ZVJA 3DVAB 3NYRA 4HP8A 1J2JA 3ECCA 4QPDA 4C3OB 1ZIPA 4D80A 4RFVA 4IIVA 4EW2A 1ZKMA 4M8KA 3GH1A 1U1FA 5C53B 3UHAA 1FP1D 1AE1A 1UOQA 4MRVA 1Y8QA 3WY9A 5BV2P 1QH1A 2DUNA 3LDUA 4PLFA 4UCQA 1K8ZB 2IPXA 3AJ8A 1XNGA 3FZYA 4XSVA 1VXOA 2QYTA 2VPQA 3A25A 4GX0A 2J09A 4NZPA 3TLXA 3G2QA 4FN5A 2GRAA 1KMHA 2JS7A 2QPOA 1H3NA 1CC1S 1ZUHA 2ZI9A 4TLLB 4DOMA 2D7DA 1AXEA 2HTEA 1K27A 2MMCA 3UW3A 2GYVA 4X8OA 4E09A 2FOXA 3AC0A 1E3WA 2G1PA 1PJ4A 3C45A 3D0QA 3ORHA 5DXJA 6ADHA 4P86A 4B7XA 4D4KA 3WRXC 3LGXA 2V7QA 2IYRA 4X8MA 1ZVVA 4FOLA 1E20A 3UFXB 3DR3A 3ZC3A 4ARAA 4EHHA 3BJIC 1TKBA 1IJKA 2BMFA 1E1DA 4I7EA 4MJ3A 3VBCA 2EHDA 4Q4AA 3MTBA 5CHEA 5ITSA 3DLHA 3LBNA 5CRIA 3QYAA 4F7WA 2H92A 4RQBA 5I5EA 3AEQB 3HKCB 4QC2A 5HF5A 2FZKA 1W1UA 2XODA 4KXLA 2HXSA 3K0EA 1KFBB 4JMPA 5CDUA 2O4UX 2H4ZA 1MZPA 2BSAA 2ZROA 3E9QA 2WU0A 3U09A 3HYCA 1DOZA 5J2TA 1CT9A 1EM6A 2XBUA 4ND4A 3RUFA 3OCYA 4B48A 1RYYA 2VK8A 3TBHA 3PR1A 3X1KA 5BRAA 1CTQA 1I2ZA 1VA5A 3ZPXA 4RTLA 4LDJA 4RDXA 2QAIA 4IV5A 4KE6A 1N2CB 1JX6A 1XF9A 5FPYA 3M82A 4NNJA 1C7JA 1MJGA 3HC7A 7REQB 3NEYA 4XGIA 3QVWA 1T36A 4HSGA 3GAAA 3UF0A 5FWYA 5JV5A 3CBGA 4BO6A 1XU9A 5FI3A 1J39A 4TKLA 4CTMA 2OOSA 5G41A 1AN0A 5LZ5A 5AUPB 1G6KA 3D6FA 5E9JA 1KRWA 3L0IB 1JEYA 3EG9A 4YRZA 1Z28A 2XDQB 4EUHA 3SZGA 3PPYA 1GKYA 2NU8A 5D5QA 4D7AA 1US8B 4G37A 3RRBA 1XDGA 4JBIA 2WHXA 4PLTA 1O7JA 3VM6A 2JGFA 3QPBA 3J81A 4G5QA 5DW3A 5CH3A 2REQA 3N8NA 2WFAA 3RUEA 1YACA 4Y7DA 1N3BA 2OO7A 3FNIA 4M9UA 2Z8XA 5BT8A 3OFSA 4IV0A 3PI7A 5E9WA 3P94A 1S4MA 3K35A 5AM5A 2J6CA 3IJ5A 2ZRDA 4GUAA 1DKOA 2R1ZA 2PUJA 4IFEA 1ZRHA 1DDIA 3C3CA 1AQNA 2WU8A 3UYLA 2SNIE 1C8VB 2H59A 4OK6A 3OQIA 3WFIA 3G5MA 2VDQB 2LKDA 4G36A 3IT2A 2YWEA 5AJVB 1L5OA 3IKVA 3INNA 1Y48E 3DVSX 1Q1ZA 3NFYA 1DQSA 3I76A 3OWXA 4HDQB 1E8DA 2ZI4A 3U7IA 4UQLA 1N9KA 2VZ9A 4B7CA 1N78A 3KDPA 1EK5A 3KHKA 4UPDA 4FXPA 5K05A 4QIHA 4QICA 1ACMA 1CDDA 2VSQA 5HQ3A 2VPTA 3WYGA 1D1TA 2Q9UA 2QG6A 1Y3AA 3DZJA 2H85A 3VUFA 3DLBA 4MYRA 3U9SA 3I6IA 3MEQA 3OQPA 3DWGA 1Q50A 5I3ZA 3I5MA 1ZD4A 4NAUA 4ND8A 1TMOA 1O6GA 4FFRA 1LS6A 1CJMA 1M0SA 5M3BA 2HJVA 2JBHA 1ICEA 1CJCA 2ZRFA 2G1JA 4HH4A 2VG8A 3L49A 4LBVA 2B36A 4MW7A 2ZRCA 3W6NA 5JSQA 1EPUA 3H1GA 4D97A 3RSSA 2F1RA 2HA2A 3OC6A 1PD1A 2OECA 1UDWA 4IIGA 4E1AA 5JJCA 3A2KA 4WY5A 3GNSA 3MOSA 3UGQA 4HDNB 3WG9A 4BLSA 2YN2A 1IJFA 1Z74A 4JR2A 1TEZA 1VJ5A 1R27A 4PPYA 4CM5A 3HCOA 1HDGO 5HJ5A 3OFVA 5KDOA 5CT4A 5C8DA 3BOSA 3QBJA 2W43A 2X5JO 5GIPE 1DKUA 1DQRA 1Q0RA 1XTPA 4H31A 3AETB 2HK6A 2IYVA 1L5VA 3BICA 3U48A 1E0SA 2D74A 1NXVA 1PE0A 2ON6A 1TW2A 1YQUA 4RE6A 1C5KA 3KNZA 4GOKA 4Q4HA 4UUQA 1Z3CA 1Z63A 2XMGA 3A10A 1YSCA 3H9GA 1D0VA 5BOVA 5JAQA 2IF0A 3FTNA 3WK6A 1E2JA 3R9WA 5T3UA 4FB5A 3ER6A 3GRVA 4GP6A 2CF6A 4F06A 2CEAA 1GN8A 1Y9JA 5K8CA 2VYFA 3VKFA 2FJUA 1SUWA 1U2TA 5EZ6B 3I1JA 3CEAA 4TWJA 3VX3A 2HCBA 3SJAA 4HZUB 1SUPA 1E9BA 1YA4A 2M9MA 3F7NA 1QJCA 1L1RA 1R0LA 2PCJA 4OOFA 3TTUA 1F7UA 4A2QA 4WOCA 4IDGA 2Z30A 3EXEA 3AM3A 5AQEA 4YUAA 1H1TA 4EUSA 4XB6B 2GWHA 2VDVE 5IUNC 1K4MA 2VC2B 3ETLA 1MC1A 3WO1A 3KQOA 2BEWA 2XKKA 1SVLA 1UT5A 1E1CA 3IAFA 2F00A 4DYDA 3GGGA 5FL3A 3T4PA 5F64A 2OGTA 4EGSA 1GUZA 2XAUA 1EIWA 5AKLA 5AVXA 2ZETA 4DLZA 1RLJA 1Y9AA 3I1IA 3KXIA 3C74A 5KNDH 4LX8A 4KN5A 2N47A 1N5OX 4EEKA 5IAAA 1Q1EA 3BULA 3U3XA 4MUHA 4LXUA 1E6MA 1O2DA 3D2AA 4DLYA 3QKTA 2PWYA 2OMEA 3F67A 1IMOA 2RH8A 2NO7A 4B7ZA 2PH1A 5E3JA 4UNPA 4ZFNA 3VR2A 4ZDJA 4PN7A 1VCHA 2YY5A 3B1VA 4RPHA 3P9XA 3EEOA 4DF3A 2I2DA 3D7NA 4HDMB 1NVAA 1C7RA 3RLFA 4FFDA 3E23A 1TMGE 5C35A 3MUFA 5IVKA 1E7MA 3QF4A 4HJRA 3JYHA 1B00A 1EWKA 2GHIA 3GROA 3GLFB 4B31A 3QLTA 1OUMA 1YR9A 1ONNA 1S1MA 3FF1A 4NYJR 1EUQA 2P4QA 2DWCA 2YUIA 3VAYA 1W59A 1BSVA 2FY8A 2OZPA 4UM7A 1GFIA 3DWIA 2ZPTX 3WWOA 1EX1A 3EF0A 2RB4A 2BFPA 3E7XA 3FDJA 3L4BA 3ZWWA 4G07A 1ZEMA 1SBQA 4YJGB 4QECA 1X7YA 4DSUA 1QYWA 5CR9A 5DLPA 4K0KB 3PYLA 1EEXB 1LGYA 1EDDA 2GBIA 4GGMX 2CLSA 4X20B 5EWMA 3AFMA 3CKKA 3CN9A 3KELA 3V2IA 1TXGA 1EZ4A 3T38A 3AY3A 4X54A 2GAFA 1WSWA 2X76A 1CS4C 1KSHA 2G77B 3K2QA 4O4LB 4K9QA 5GIOE 9LDBA 4AL4A 1B8PA 4MI1A 2FE4A 3CMMA 1C7FA 3KKOA 5E2IA 2A84A 2J59A 4RD0A 2X5NA 5JWOA 3KWFA 2A92A 3BD7A 3O95A 4PSDA 1NBHA 3JQAB 1UPFA 3QVMA 4OSPA 3FPJA 2HA3A 4FFPA 1L8OA 5JH7F 3PJFA 4KQXA 1RRFA 4KLAA 4BQOA 4C20A 1J70A 2YW2A 3QKSB 2WE8A 4ZHQF 3QMVA 1JDVA 1TUIA 1DOHA 1NPTO 4K26A 1C9EA 4TPKA 4XDHA 1A5BB 4OI1A 3SLRA 3UAVA 3UEOA 4A0GA 3VR3A 4NK4A 5DNCA 2J8ZA 1QHHB 4GX1A 4BX2A 1Y5RA 3CLKA 2C8VA 1EK1A 1Z0KA 3A1WA 3NAMA 2Q7XA 1YE5A 3QW4B 4PX3A 4EB6B 1ZESA 4RXTA 2IKSA 3FYDA 4PVDA 3HADA 4RJKA 5TT0A 1HE3A 3H86A 4DEYA 4EG6A 4Z2AA 4O08A 5A02A 5LD2C 5DASA 1TK3A 1N57A 2VTEA 4UDOA 5E95A 2WSYB 3V8QA 4YBRA 4JC4A 1NXPA 1K66A 2FA9A 2J41A 2V03A 3TZ6A 3WO0A 4RTOA 1H6CA 5KJCA 1DQZA 3NT2A 1TYZA 1JFLA 1NAIA 2ZJZA 3EXFA 3QE2A 1WXDA 4N01A 1E60A 4PC2A 5DXFA 4BB5A 2Q9BA 1N8TA 1H8EA 2NV6A 2NU7A 4HAXA 1Z6ZA 1VLVA 1Z9BA 4N3CA 1W4CA 4J1TA 1EI9A 1NX6A 1GZHB 2ZXEA 2OTCA 3NYQA 5LZ7A 1DCTA 1QHEA 3IQXA 2JI6A 4MWDA 3CBQA 1W9MA 1Y8CA 3NR2A 1CB7A 4KQ1A 2H07A 5A9RA 2QYSA 1KL7A 2QTCA 1EHYA 5K3SA 5F51A 4U2GA 3TD2A 5E3HA 1OH7A 2CFRA 2Q5QA 1ZN9A 3D81A 3Q40A 3NZEA 4GWKA 3FWPA 4RLSA 2I22A 3RRYA 2AQKA 3B3FA 3EFOA 3HLKA 4HEA6 5K6TA 4V39A 1U6JA 1S3SA 4RJJA 2FG5A 4O5OA 2XAAA 3FIUA 1GG8A 5IC5A 3TG2A 1U7WA 1G4AE 5JFOA 3V2HA 3KEFA 5A5DA 3E9MA 1AKUA 3LX8A 5F1OA 5HUQA 2ZM5A 1A7UA 1CULC 1MABA 4D92A 2VHWA 3T4UA 2CSXA 4KDEA 4P80A 2ZR9A 1RHUA 4K05A 4ZQFA 1ESMA 2XNSA 3CWZA 4CM3A 1K7CA 2HIAA 4DZZA 3FUUA 1KVUA 2ID8A 5KNDA 4RFSB 5JDCC 1BU8A 3N8HA 4Q1EA 3K9WA 3OX1A 2VTBA 4X3OA 4K6HA 3IGFA 4II3A 4ZEXA 2CKDA 2EC5A 3OQ6A 2JIQA 3OEED 2EZ4A 1XZFA 5CIQA 2QTVA 4M1OA 3BCRA 3I72A 1H22A 3T12A 4KYTA 4R8KA 3B20A 4P31A 1BOOA 1CS0B 4JYCA 4JYBA 5T4FA 2H54A 1E3SA 1CQWA 3I58A 2AFHE 4FJ0A 3E35A 4R2HA 4ALKA 3JR7A 5AKHA 3N0VA 1UJ5A 4YAUA 2N75A 2ZDQA 3VJMA 2EBFX 4DJ5X 1C3JA 3ROEA 3BK1A 3VU3A 4EPXA 2ZBPA 4L51A 2VUSA 3K0FA 3BBPA 3RHTA 1A8HA 3NO4A 4KVGA 2OBNA 3LGSA 1G98A 1N7GA 1KAGA 3FI9A 1DINA 2WUVA 3OQBA 1WW2A 2JAQA 3X1JA 2HSZA 3TEFA 4FZ5A 4CMJA 4CEJA 3RUDA 1JTFA 5DGTA 621PA 1Y3CE 4J0DA 4ZT4A 5BVHA 1RXYA 1CZOA 3DVQX 1RP7A 2BMJA 1OAKA 1LSJA 2TRSB 3W5CA 2HF7A 2YC4C 2BGUA 3ZKAA 2H65A 4BXOA 5K01A 2O8DA 3DHYA 3MBKA 5LYJF 1XU4A 3FUWA 3KB8A 1GGVA 2WJWA 4NJMB 3REGA 3VV2A 3ZR4B 4AMYA 3KEGA 4LCBA 3O9ZA 1JYEA 1CR4A 3L4SO 5HF8A 4UAJA 5JASA 2K87A 1Z73A 3ZCPA 4ZZ0A 5C7IO 3O2QB 3GLRA 1Q91A 3O1JC 2WIFA 4EDHA 1QDEA 2ZTVA 4OQQA 3ITDA 1D1QA 2JEZA 2BM8A 1V3TA 4ENTA 1RQLA 1BH6A 4BTVA 3W34A 1CS0A 4ARIA 3G2OA 4K87A 3R41A 4EY4A 1VI5A 4YRQA 721PA 2QY9A 4UE3S 5CLQA 1VA4A 2JCVA 3KKLA 4J1TC 1V96A 5CA0F 3WLSA 4KR3A 3C0KA 4U6SA 2V6IA 3FNHA 3HB1A 4JP5A 1UPTA 2FZLA 2D2EA 2R7NA 5I45A 3LNCA 1VTKA 1OWMA 4C4YA 1OHHD 4MVJD 5PGMA 4N18A 2QPTA 3CLRD 4JITA 3W5SA 4J03A 1N2EA 4D5EA 2PWPA 1MCZA 1UEXC 4H08A 2HADA 2XY4A 2GD1O 3PQEA 1RABA 4EB3A 4LJYA 2UZ4A 3JYNA 3C5CA 1PEDA 3LT4A 1EDBA 2XCLA 4N76A 4QDKA 1J24A 1R6TA 4CMIA 4PQFA 2ZAMA 1P4GA 4OLFA 3QXSA 2YDYA 4KBGA 3ZWBA 2LZ0A 2WY2D 1WVMA 3PNOA 4TROA 2PVPA 4HF7A 4YS6A 2G0TA 2CVZA 2KPOA 5L3ZA 1G18A 4A91A 1MHPA 1BHQ1 3CEJA 1PHRA 3QVXA 4DCVA 2J45A 1UKBA 3HY4A 5ICMA 4TTSA 1Z75A 3E7WA 3R0VA 5CB4B 1MVNA 1ADGA 1IZ0A 1SH7A 2JHCA 5CUQA 2CUKA 3F98A 4LNHA 3DR5A 1I2CA 1U80A 4K6MA 4LY9A 4RFSA 3VVMA 3EIFA 5JXHA 1I7PA 4ZN6A 3NTQA 5KSYA 3MGBA 4E5YA 1Y8RA 4M0MA 3ZWVA 3D7RA 3Q7PA 3NAGA 4LKRA 4MPRA 4D8VA 1EP1B 1DKNA 1Q16A 2NV2B 2O7QA 3SPXA 4D9JA 3L46A 3Q7QA 3LHFA 2XVYA 4G1MB 1GWNA 4LHEA 2R8OA 2AJDA 2WDZA 4HNHA 2FRDA 4TSRA 2BBWA 1SQGA 2WPDA 4EHIA 2I2FA 3W06A 3NV7A 4ZOLA 5IXYA 3EIEA 1KQFA 1P0IA 3VSDA 5JI2E 2PU7A 1KR2A 1IC6A 1FUIA 4WE3A 1Q7EA 2ZR8A 1NBMA 2X2OA 3DMTA 3DBHB 3EVZA 1K7SN 4FUQA 1KJJA 1SVOA 2C57A 2DH5A 4PPNA 4Z4GA 3K73O 3IMFA 4PE5B 4D3YA 5EHGA 1CRWG 3SX2A 3NFRA 1GKLA 1U2PA 4H35A 4P84A 5CM8B 5AKYA 5LVAA 1NJSA 2QZSA 5DX8A 2HDWA 4EFMA 2CWDA 1C1XA 2RGGA 4B87A 3EZYA 3ET5A 4R2JA 1DG1G 1I14A 2M6SA 3CUVA 2PXHA 3OSUA 3Q7EA 2H8GA 1MP0A 2DMRA 1F3OA 1O96B 2CVFA 4L5YA 5ILQA 2EWMA 4AXBA 1QGAA 3PBKA 3CMCO 2DHCA 1A96A 5CT8A 2ZB8A 3UT5A 2BDUA 2ZTMA 3L7KA 4FOPA 5EP2A 5BVHB 5LOVF 1HX7A 3PC6A 1L7NA 3GPDG 4E14A 2ZJAA 1HQYE 2OBXA 1H5NA 1SHTX 2YJTD 4M53A 3UGKA 4AB1A 3AL0C 3CNQS 1CR1A 1VE5A 4LGVA 3CPJB 4I5EA 5JCXA 1Z6QA 1J2RA 1X0VA 2J4DA 3DOCA 3KVOA 1WR8A 4CL3A 1Q44A 2QT0A 2MMGA 3TQRA 3INYA 3ZHVA 2HEIA 2JGJA 3PEEA 4JLDA 1KZHA 3QYPA 2JDID 3KQVA 1IN7A 1XEWX 4IAOA 1J8VA 2OA0A 3GUHA 1OXUA 4R1UA 3BVPA 1FMTA 2PAFA 3KPYA 1WW3A 1NJ2A 1IATA 3O82A 4QUAA 4JS0A 1SVMA 3JW8A 3IKLA 1FYFA 2I34A 1G8GA 4FFOA 2IEGA 2PZBA 3IT3A 3OBBA 3GFQA 1K6MA 4NEQA 4KE9A 2XDWA 1EAYA 4YQEA 4EELA 1E9CA 2XKBA 1XEXB 1ACLA 2W2LA 3KWLA 1N9GB 3VPBA 3GRCA 2Y4OA 2BFOA 4UUBA 1XRSB 3VJKA 3FHCB 1L1EA 3H5LA 1BG6A 1P6UA 2P77A 3UN1A 1VB5A 1B23P 3O1LA 1BXGA 2MR6A 2RHTA 5T4BA 4E22A 5K8JB 4KE8A 2E6KA 1WDMA 2EARA 2FPGA 3JWEA 4YRLA 1JAXA 3BT7A 2LDXA 2FRVA 4MQMA 2HZBA 5K1ZA 3RYHB 4QWMA 5AW7A 5CP8A 4WXYB 3BIJA 4OHKA 1G17A 1UBKS 3A4TA 4P93A 1F60A 2QD1A 4QHTA 3R3VA 5FO0A 1UKCA 3ETNA 1K8RA 2BFDA 4EK9A 1PT7A 5KQMA 2H5JA 3FRJA 2RGWA 3QQ5A 1CVRA 1ZITA 1HL7A 4ZAYA 5IXSA 1MNQA 3L8ZA 4NENB 2WHRA 3Q6MA 2NX2A 3DL4A 2E5FA 1PSZA 4RJIA 5THXA 1Y80A 1EFLA 1GSOA 3I39X 1TM3E 4LJ5A 4XWGA 1J5PA 3S2UA 2O14A 3B36A 3TDNA 2APJA 1IM8A 1SCDA 1O94D 1GIAA 5CLGA 1VRCA 1NNSA 3TXXA 1SBTA 2CT8A 3OIDA 4LVOA 1X1QA 3NKFA 3HGQA 1FDUA 1WXFA 3WIOA 1S2NA 3K16A 1RKUA 2W2KB 3FYCA 1D1PA 1ZI6A 3PUWA 3PT9A 2WAAA 2PJUA 3WYFA 4G5XA 4DMKA 2DLCX 2X4LA 4OBBA 1P62B 1TX4B 1M6NA 4N5IX 5I7UA 3GPBA 1RBYA 2GZ1A 4AQDA 4NICA 2RHHA 5MDHA 2XMBA 3NCTA 4XVQA 2QJFA 3HH8A 5KS2A 4D4LA 3AJ9A 4IJ6A 3IV6A 4G1BA 5FBWB 3HM2A 2I8CA 3HDYA 3VR6A 1AMUA 3KQHA 5KQGA 1ZH2A 2DQSA 2HCTA 1T3GA 4YRPA 3J80A 2GLXA 1NR1A 1ADFA 1CD5A 1Z7EA 3DE0X 2HRCA 4ND5A 3OIVA 1CQIA 1IRXA 5F2EA 3K31A 4CUKA 4B0PA 3VR4A 1COWA 1AG9A 2X6TA 2C2WA 1II9A 1KDOA 3E3OA 4S05A 2NP7A 2FMUA 3PUXA 1N7HA 3VC3A 1Z2DA 1BE1A 1NPDA 1ZH8A 5F12A 2X0DA 3TPFA 4BNGA 2CSUA 1ZUIA 4J16A 1WKCA 2FWBA 1E79D 2UYHA 4CKEA 3L0ZA 4E1BA 1JR6A 1BC5A 2OPHA 4PC3A 2RC6A 1R8YA 4C9BA 5ULLA 3F8WA 3PUIA 4XA8A 4KBFA 1CJBA 1GT6A 2JGAA 1M6WA 3NHPA 4C89A 5F3WB 2Z57A 4LRYA 5JSZB 1XVUA 2AYYA 3DMYA 3T15A 5I7FA 1XTTA 1Y1SA 4KWTA 3KZXA 1NUAA 2X8WA 4WFIA 2PJZA 1UKEA 1XRRA 2HHJA 4HUJA 3CLRC 3UJCA 4DLXA 5DK6A 3AKZA 4MDEA 4NXMB 4P4LA 1DPGA 2QR2A 3D4IA 1Q5PA 2A88A 2F1HA 4P9NA 3TZCA 3VYRB 4ARUA 1SQ6A 1EP2B 5ESWA 4IS3A 1AV7A 3BXXA 4I1VA 3MHTA 4R0VA 1QVAA 3E7FA 4MMXB 2WP8J 4AU1A 2C2MA 4D4IA 2ZIWB 1DIBA 2XOEA 1MO5A 3BSWA 1VJGA 2IQ5A 2VJBA 4K3VA 4XAQA 1EFHA 1JH8A 4D3FA 4ZK2A 3T1HB 2EKQA 2HBQA 2B25A 2P2ZA 2PX0A 3KUKA 3RYTC 3MIIA 4C4PA 4YJ2A 1GAXA 3LP5A 4EGFA 2GCIA 4OAPA 1XXHB 3HJBA 3PNBA 2X5XA 4FOOA 1ZX1A 3RIYA 4EUNA 1U9JA 3IB3A 3BSFA 1U0GA 3ZD8A 3SEQA 1HDCA 4CQMD 3IXQA 1P8JA 3DCNA 4AULA 1DAOA 2RGRA 1PW5A 2GPNA 5AIBA 5JW6A 3VZRA 2D5CA 5E2BA 3U1VA 3DAPA 1Y8AA 2CYCA 4JT2A 1O4VA 1RXUA 1TYEB 2J0UA 4MQUA 2WOJA 5A1JA 5MN4A 3L5KA 4F3RA 3E70C 1TQ4A 4JDUA 1NKVA 4NCXA 1WMFA 3FETA 3QUAA 1FFHA 4IWNA 2O9JA 4ZAXA 1HDIA 2HMYB 2SKCA 2P0AA 3R8FA 4WAUA 3NETA 4ZU1X 3C4VA 4DA6A 3QHPA 3D1LA 2L2QA 5F2KA 2B2CA 1QYRA 3SJZA 4EGAA 4Z1MD 3RYFB 3C87A 3D3QA 3G2MA 4GG1A 4G5HA 1Y5IA 1XL0A 2VVTA 4ASUD 1Z0IA 4M76B 1GCAA 1XO1A 4FMDB 4AURA 2IODA 1M2NA 1TFUA 3RE1A 3BJRA 2IRWA 5K0BA 3D3WB 3WLNA 2WOOA 5ALEA 5H81A 4B3XA 4YHHB 1LBSA 2G1UA 2H1HA 2WM8A 2Y71A 3DOFA 1SZPA 1JIXA 3HMKA 2ODWA 4OSEA 1OV6A 1JR3D 5H9WA 3K09C 3FOFC 5B3JA 3H9CA 4KTTE 1Z82A 1TRKA 2AG0A 4RK1A 4EITA 3HVRA 2JIDA 2VZ8A 3A6FA 1HT0A 3IAS6 1PR4A 4WINA 5DM2A 3TTTA 4XIGS 2H2HA 4KRXA 4L15A 5BNZA 2ZSKA 4AJJA 4BFTA 3GFTA 4CKCA 3D59A 2BKLA 3DZGA 3ID6C 1MXHA 2E49A 1E2DA 3S40A 3VNBA 4BYMA 4N03A 2C20A 4WBNF 1XVIA 1P9RA 4TM7A 3SMQA 2Q5LA 1XRJA 3CRRA 3V9PA 5FWNA 2H9AA 2V3WA 3PJEA 2HT1A 3BIWA 4AN4A 5LWHA 3C3XA 3WKAA 3D8RA 1ECCA 3W77A 4O6VA 4BECA 4RPKA 4DRXA 1QNFA 1SXJA 1XZBA 3HFSA 4EO4A 1VMAA 2W83A 4H3VA 3EAQA 4X66B 3QA3E 3CEMA 3JZAA 3C7KA 4HRAA 1JHAA 1N0HA 3JALB 4GZ5A 1VLJA 4M55A 1G5FA 1USWA 3H0CA 2GZHA 1GPH1 3KQWA 5I9LA 1C3LA 3A26A 4IRXA 3TW6A 3ZQKA 2X7HA 5AOCA 5JQGB 1R00A 2GD6A 2OORA 3D3KA 4MUGA 4B17A 3N86A 1FOEB 1OIWA 1VSBA 1U99A 3G59A 2LCQA 4BAGA 5FR2A 4DDKA 1WETA 1JPJA 2WJJA 1GNRA 1JEJA 1PS9A 3KPWA 1NBOA 4F38A 3H2YA 1ZN2A 2KHZA 1PGNA 5GGXA 1JQ5A 4OP2A 1DWUA 1MB0A 3OX3A 3RG8A 4DARA 2D5AA 2P3LA 2V5UA 5IM5A 5FLXA 4L4SA 4GQBA 5KJEA 4HJXA 2H7VA 1EJBA 3C3EA 1P33A 2SCUB 3CSSA 4A4DA 5KO2A 4C0QC 5ENVA 3T7TA 2HWWA 4XPIB 1VBNA 3BYZA 5B36A 3FCXA 4ZGBA 4WT7A 2COKA 2IUSA 1BDBA 2ZYUX 5AI4A 5KNBD 2ZBFA 4N9WA 1HK7A 1E6KA 1NKSA 3KC2A 4MVJP 3WKDA 4DZRA 1PWHA 4MPPA 1G2IA 4KXYA 3K6SA 1LDYA 2GYWA 1KZGB 2VNHA 3ACCA 1X14A 4TX1A 5IJZA 1S5PA 1KO7A 2I3DA 4M2LA 4MPTA 1GCUA 2O2IA 3HE3A 1V5GA 1HLGA 2YNMC 3VR1A 2F55A 4IXMA 5JMPA 1QWSA 2A5YB 4DBLE 4LYYA 1Q83A 2I4IA 3TQQA 1CYEA 3KLMX 2QTTA 4HFMA 4B0OA 1HM5A 1UUFA 1U3CA 1DC4A 2O48X 2ORYA 5I8ZA 4B33A 4HFRA 1ZR2A 3ZJUA 3QFCA 1IBMB 3A6PC 2DOKA 1C30B 1ZK3A 3GPCA 4Y6OA 4HB0A 2AMVA 2WF7A 1OCEA 2JGDB 5HS4A 4NFLA 3O90A 3PFWO 1U7OA 1INLA 1B0ZA 2FHSA 4P3OA 5DGCA 1MUUA 4NV1A 1KYXA 3TNFA 4JUBA 2F90A 2OV6A 2O2YA 4UOZA 1OX5A 2Z6VA 4N3GA 2OZKA 4X60A 1E94E 2RHMA 4H3SA 2Z1NA 5KPDA 3I12A 3WLJA 4HVCA 2R2GA 2EVWX 4M38A 3AF2A 3VPGA 4CWAA 4EX6A 3VC2A 2PUBA 3TDKA 4WCFC 5L8VA 2Q1SA 4G0PA 5HW0A 1V4NA 3D2CA 3ZY3A 5EERA 5C8YF 2P7HA 2D1FA 1D4OA 3QEJA 2XDYA 4PHHA 1T1GA 1BJKA 5DULA 3FKSD 5CCXA 2P3OA 1DWOA 2ZS9A 1Q3HA 4WKPA 1VL8A 4YC7A 5FTJA 1BMFD 1AKQA 5DWDA 3WFZA 3NC0C 3O1HB 5DTMA 5AW1A 2XMRA 2OHJA 3B3QA 2NYVA 5KU7A 2QRNA 3OP4A 3BWMA 4WRRA 3KXPA 5AJYA 1CHNA 4NZOA 1TYBE 3N8IA 1QIKA 2J87A 3IHKA 3JQ7A 4OHWA 5F78A 4GKKB 3ZKWA 4TZKA 5E3IA 1ULZA 3CIFA 5EJ4A 1SBZA 3OPYI 5KDDA 4PO8A 3THRA 3A6LA 4BV8A 4DLVA 1U5CA 4XLLA 3RV3A 2CJPA 2CJWA 2HWXA 2CF5A 2HRDA 2PGLA 2UU9B 5IK2D 3LA6A 3V6MA 1LPOA 1CUFA 1U8XX 2AH5A 3AEYA 3IMGA 1SKAA 4J0GA 3AIMA 4NZNA 4FLFA 1DKMA 3HGMA 2CEKA 4FNMA 4KFCA 2BFFB 1YIOA 3B6EA 4P0TA 4OXRA 4Y2RA 1AMNA 2VQEB 1T10A 4RL4A 4WZAA 3W2TA 8LDHA 1V3QE 1B93A 1UZUA 3N3BC 4FSDA 2A33A 1D6SA 2OQRA 1SCUA 3GBSA 4KFRA 4WW0A 2Q28A 3L7JA 1KK3A 5A71A 3RIGA 3IPRA 1D04A 1H93A 1J06A 1DV1A 1T9AA 3CH5A 4RMNA 3UB2A 3UWMA 1NVKA 4G6ZA 3NVAA 1P7WA 2OHVA 2V6BA 3Q3EA 4HZIA 4DC0A 5T8KA 5AJWA 1E1QA 2PRYA 3DMDA 1CUJA 2A94A 3I1YA 3STTA 3ZLVA 1TT5A 1IY1A 1B42A 1YA8A 2A2ZA 3ORSA 2HLDD 4KPUA 3KR0A 1PLJA 5A06A 2VPYA 3IUEA 1CJUC 2BONA 1QUEA 2QPLA 3QFTA 1EVIA 1GCOA 1ZBQA 4J7AA 3TLBA 2J9YB 4IUDS 4M86A 4BB6A 4QNNA 1ZISA 3L82B 4MP6A 1ZMOA 2WTUA 1X1RA 1JA1A 3EB9A 3N8KA 4G4GA 3I5AA 4KVFA 4Z99A 1NI3A 1B74A 4O4LA 5DNUA 1BAPA 4XB1A 1IAVA 2J3DA 1X7GA 1QVWA 1YU9A 3OJFA 1L4MA 3OLXA 3ENWA 3VTZA 4ALMA 4JJKA 1OLXB 2GBLA 2UUBB 4UHJA 5CCEA 5JDIC 3JQGB 3KYBA 2OQVA 6NULA 4V38A 1QJ4A 1KRXA 4CIAA 3OZTA 4N8DA 4PLVA 5CYFA 4W7IA 4D6XA 2QG4A 3DHNA 3H9QA 1YR2A 2JPDA 1M1YA 1QTNA 2OBLA 3ET4A 4MCHA 4L5IA 3UICA 4EWLA 3K5HA 1G5HA 1Z29A 1V47A 3TR0A 5JY6A 3QKUA 4JU8A 5BVGB 4J8PA 4YPVA 2BFWA 3BRWD 5EJFA 2OY0A 2M1ZA 4IHJF 4CT4B 3TI9A 3Q8MA 1ZQ1A 1X7HA 3SNHA 1Y37A 4W1QA 5AFSA 1XQWA 1KH2A 2PBRA 3RJ9A 1L5SA 2WW8A 3A2LA 4MXDA 3DTVD 2CD7A 1PT5A 1A8IA 2QSUA 3AHHA 1BD3A 2MOKA 2PX5A 1XE3A 3V4FA 4G0ZA 3DTNA 3VOSA 2CWWA 1R0RE 2UUPA 4HGPA 4P33A 4Y2SA 1JLLA 1IUPA 3CZQA 3ELBA 1CVIA 2G5CA 4TYPA 1WS6A 1MO3A 3LWBA 3RREA 4EY8A 2OAP1 1X1AA 5DGDA 4YP5A 2FOLA 1PFWA 2E48A 3PEFA 5JSUA 5KTSA 2FEPA 1OIXA 1LTHR 2WSBA 1P74A 3QPDA 4QU5A 2AF4C 1DOAA 5J23A 3R7AA 5FV4A 5EMNA 3W5IA 3ZW9A 4C7JA 4NV3A 2GH1A 3EGIA 4KWCA 2ROQA 4RO0A 1Y1PA 3WVNA 5CVEA 1A9XB 2CVOA 4FYJA 3QPAA 1WF3A 1RM4A 3FD8A 1D8TA 2CN1A 3IQDB 1DIAA 3CJTA 3ZVKA 4TYQA 2IELA 2X5OA 3PNYA 4GAEA 4QUKA 1HF3A 4X94A 1FTQA 4JXKA 1Q92A 1A2KC 1MC4A 1QHYA 3WK4A 1JIJA 4EZBA 4RK6A 1T29A 1GPDG 3KVVA 2IX3A 4C4AA 4Z4EA 1Z18A 1W87A 1C9MA 2VH1A 2MT9A 2YV1A 3V3TA 4DJEC 1ADYA 2MINB 3DLCA 4YREA 3H1FA 1C7ZA 1PR2A 4F9GA 4OQNA 1QYXA 1K6IA 2RGCA 5AVYA 3IILA 5IJAA 1K4YA 4K9PA 2VYNA 4B79A 2IS2A 3R3HA 1Q1NA 4EKNB 3S2SA 4N41A 1OFGA 1XEFA 1HFWA 2QW8A 4CETA 3W2GA 2PTGA 1I01A 3F4KA 3GVPA 4YACA 2O19A 3V1YA 3JD0A 1QG2A 2WF8A 1GPBA 2UYCA 4LK2A 3EEIA 1SZJG 5FWXB 1KMQA 3GYGA 4B5LA 2MWMA 2WRZA 4B3IA 1O89A 2IBTA 1P75A 2WQZA 1F2TA 4OQFA 2XZDA 3Q0TA 1XYGA 3EEFA 4DB4A 1Y8ZA 1C9KA 5IJ9A 3R6WA 4GLOA 3RC3A 1OAOC 2A9RA 1UP7A 3AX6A 3QG1A 3EN0A 2PA0A 4IHAA 5IBCA 4A03A 5CIYA 3R5HA 1FBNA 2I03A 4EI9A 4DDTA 1T8SA 4Y3UA 4DCNA 4X6LA 4J6FA 4P5PA 5EHNA 5LL6P 3WWCA 5ENZA 4H7PA 3VYTB 4TZ6A 1FS4A 2YMMA 4MR8B 2XWQA 4FR5A 3RS3A 3RS9A 1XNHA 4CKWB 1ESCA 1U2SA 1Q2XA 4GI2A 1VCIA 3RNOA 3V8MA 2NVUA 2V97A 2BPOA 1HQKA 4JT4A 1N33B 2J07A 4QELA 3DBLA 1JFFA 1R4MB 3MAGA 2BM9A 2PD3A 3EVGA 4NZ9A 2BZSA 5IEBA 1U8ZA 3IYLW 3HKEB 3QXGA 4X45A 1AC5A 1OBVA 2RHDA 4S35A 2EXXA 3OPNA 1PK8A 4BE9A 3AJDA 2O8DB 2H2WA 4ARVA 1E9VA 2HK8A 1MD9A 4PHFA 5CLLA 2WT4A 2IYEA 3LVFO 1K3TA 2GSWA 3B3GA 3TL2A 3DE3X 4CGYA 1IWPB 1OXKB 3CX6A 2ADOA 4N0DA 3IDAA 1CWUA 5F9FA 4S24A 2YHIB 4LVNA 3STHA 4DQXA 2ZZNA 4JXJA 1UMBA 2HPZA 3A1UA 5C7OO 1I7QB 2JFNA 1EFRA 2B92A 5BPFA 4W5QA 1A5ZA 1F4VA 2IZOA 2OCLA 4M9ZA 4LMRA 4TT3A 4IDBA 3SC4A 1J4AA 4CT5A 4Z6KA 5KIAA 1XEAA 1T5DX 4EQ6B 3WDLA 5BW5A 4CHGA 3W4JA 1WB4A 2QVBA 1A8QA 2IYXA 3UKDA 2Z5VA 1PJSA 1YK1A 2KE5A 2ZJ8A 4AJPA 5ILOA 2CLKB 3WQBA 1UMDA 2X9VA 3BHIA 3AHJA 2B83A 1ELOA 3G88A 2ZRHA 4IJUA 4ILEA 4DIUA 1N77A 1FW6A 3V00A 1WZUA 4TKUA 5G0UA 4RVGA 5HK8A 3DG9A 5DDIP 4Z3DA 1XP5A 3DZDA 2P5SA 2J0EA 5FNVB 4BRSA 4UEQA 1MFPA 2JFUA 4YFYA 1OLUB 2XUAA 1CR6A 4EZEA 2JF0A 4B6FA 4MRAA 4BATA 2AF3C 1EFPB 1SCBA 2D3WA 1BVYF 2JCBA 4J6EA 4N48A 3DPIA 4XOUA 2RDMA 2CL7X 1ESNA 1K6XA 2A0KA 3FOWA 4P81A 1G5PA 3L9XA 4FW9A 2PUTA 2ZATA 4PX5A 4OHOA 5TMBA 1WCIA 2AJLI 2Z2XA 3GHHA 4N3NA 5FV7A 4ZYTA 5JMOA 2BEUB 5GOZA 1XLTA 4YAJA 3GV0A 3UT5B 4CLRA 2LIVA 4OBWA 4R7TA 4Q4JB 2P4HX 1KY2A 3CUKA 1QLHA 3P27A 2BRUC 3GWGA 2W6IA 3HCWA 2R1TA 4I81A 4PLZA 3UV6A 3F6RA 4FNOA 1TT5B 3H04A 1RHJA 4MO2A 4X6YA 1HNWB 5B1DA 2EFGA 4LN1A 4V0MA 3AG5A 5DJ5A 5KNCH 1G20A 4EG4A 2C2BA 5KYYB 2CNLA 3CVYA 3GRAA 3T7SA 4G97A 2QTRA 2IY9A 3VR2D 10MHA 4R6XA 4N4AA 4NX2A 4MI9A 4OMCA 5KVQA 2YMLA 1N1MA 3IO3A 1Q20A 1ZIOA 1NM5C 1T5LA 2DLDA 2AE2A 4JWTA 3W04A 1U04A 1HQCA 2IYYA 1R5JA 4JSYA 4X91A 2XA9A 1ZHHA 2ZUVA 3LV8A 3TUJC 4PWYA 1EYZA 4QRIA 3VISA 1V6CA 4AJKA 3IR5A 4AYTA 1Q84A 3WLRA 3VTKA 1ZD3A 3HN2A 1XCGB 4DWVA 3D3NA 4BX3A 2VK2A 1QH1B 3N2LA 1O95C 1W35A 2GQ0A 3OI7A 4LJLA 4M0LA 1TM4E 4B32A 4BBZA 5GZ3A 4Q6WA 1QO0A 3ZY4A 3T5DA 3UTDA 4ZOLF 5EIBC 2NXCA 4OL9A 4DR1B 1WSDA 4U7GA 5DGXA 4LWQA 4MB0A 4IDNA 1GR1A 2C4KA 3VNVA 3CR7A 4UFOA 4WERA 5JANA 3IOEA 1PIWA 2PK3A 4EAQA 1RM3A 2FRDC 3RSLA 1GLNA 3HXKA 2I6XA 4M22A 1PV2A 3LBYA 2YVAA 2P9FA 2HGSA 5E1MA 1I7SB 2PZEA 1JR4A 5YASA 1M1UA 1P7PA 4FHGA 3F3YA 3KTAB 4A27A 5H0IA 8OHMA 2HIHA 2ZUUA 3D1JA 1QF6A 3DNPA 1UJ6A 3N7UA 3Q7IA 4QPPA 3ITEA 5CNKA 5FL7D 1KJIA 1E7RA 2BEVB 3DMTC 1RMYA 1FDTA 3ME5A 4LPSA 1OI4A 1MRSA 5DKFA 4OJMX 1UODA 3R6LA 1DT3A 5EIAA 3PQ7A 1D9ZA 3PF9A 1W94A 2XKJE 3FNFA 2FWRA 4Q4LA 5K3FB 1HDRA 1CRQA 3HSYA 5EUBA 1GPKA 2ZREA 2VF5X 3OPYA 1GZVA 3G6KA 5CDTA 1V7PC 3WGZA 1D2HA 3H4TA 3PZRA 2OYRA 4W7HA 3NIDB 3FHTA 3M4JA 1ODKA 1CIJA 1THTA 4A8JC 4W6ZA 3LYHA 2UZ0A 2I76A 3CNHA 1VPDA 4BFWA 5L3RA 1QOQB 1UADA 2EKZA 1E77A 2NN3C 2IUUA 2PL3A 3AI7A 5CDFE 2FMKA 4PCLA 3WQQA 4EJ2A 1JF8A 3DNFA 3ESDA 3QJGA 4J7XA 1NMSA 2VZ0A 3IP1A 4FX5A 3V8EA 4WN9B 5A2QA 2HJHA 3GL9A 1LDBA 4ZRNA 2F8TA 2GBCA 3IIKA 1TM2A 2HNBA 2XCIA 3F9IA 3F7TA 3GJXC 1PJBA 2YBEA 4HWGA 2O1WA 2B34A 1H8ED 1YC5A 3G9UA 4IZIA 5C32A 2E4UA 3SJUA 4GOND 2FMTA 5AUQA 4B4WA 4QJ4A 5BOSB 5A4MS 5HQ3B 4QPJC 4OQYA 1GNQA 3V8RA 4IIJB 2QN8A 4QPCA 3KV3O 3DQPA 1C2TA 1P3Y1 5C52B 1KI4A 5FYDA 5J58A 1M2OB 3CT6A 1Z36A 3HYRA 1RNLA 4FMCB 1UC8A 2EP8A 4OU4A 3IO5A 3AHIA 1FW8A 1USUA 2OE2A 2R66A 4MB2A 1FTYA 2X0RA 3GQBA 1YKGA 4YJ2F 5CT9A 3WNDA 2W8ZA 3M4NA 1RQ7A 1AK9A 1VL2A 4HY3A 3RT9A 5KC9A 5H8WA 3A7EA 1EUCA 4NATA 2AMFA 2BH9A 3FPLA 4RENA 3Q11A 5AICA 5DH9A 1STOA 1M8GA 3MJCA 1NBME 4FD2A 5FWAA 3QHAA 4ZOBA 4K6GA 2GPBA 3ZCUA 2ZPAA 4PQYA 4Z51A 3L8FA 2BKXA 1GGMA 4O8ZA 4JC8A 4UAVA 2NSJA 1GQFA 2R00C 2YW9A 3UXYA 4F3NA 1A9OA 3G02A 4G3XA 1R12A 2IFTA 2NO6A 2PX6A 2VDLB 2P6MA 4U7FA 1GUFA 4URZR 5IC6A 3V2GA 2C78A 2JFVA 3RCBA 4KGVA 3KO8A 3WJ1A 4B3CA 2J85A 4C6TA 2C0PA 1EVKA 2OB2A 2PXXA 1ZGGA 5AHKA 2XB9A 5IABA 4BO9A 1W5SA 1XTVA 1Z7GA 2R84A 1BWRA 4H7KA 1P18A 2OOKA 4IZOA 4MVJG 4Z3OA 1R8JA 4O4JA 3FKJA 4FGLA 4DNXA 4JI2B 4P2GA 2ZULA 4F60A 2QN7A 1RFGE 3PNQA 1N0WA 1CW2B 4DW8A 2LKCA 5CVUA 1IUKA 4Z9AA 5IYZB 2A1TS 2ZSFA 821PA 2EKDA 4EAAA 1FUKA 2R6HA 3PS9A 3RSCA 1JT2A 1L7OA 2ONJA 3NUGA 2VT2A 3VKVA 1K8XB 1IUOA 2XA2A 1U7UA 4EYSA 3DHEA 2ISCA 4XKJA 3TSWA 1O54A 4HN4B 4JX8A 1JR2A 3L06A 4MCIA 5DO9A 3WSWA 5K6AA 3M5WA 2XWBF 4UQOA 4X6UA 1JHDA 2DFDA 1UAGA 1D2NA 2NZ2A 2JLBA 5IVPA 1SC6A 4BLPA 1U11A 5CEEA 2IHNA 4TSFD 3GJQA 4JJ6A 4CG1A 2OBMA 4PC6A 2DH6A 1V35A 4FQ7A 2WNSA 4DSOA 3DE4X 3N2EA 3PLRA 1KI9A 4EHBA 5SICE 121PA 2HMUA 4HX2A 4F11A 4ZOEA 3N07A 1JQEA 3KJZA 3D8SA 4KJXA 1V95A 1XZCA 2ZIXA 3EF3A 1VLMA 3H5WA 1LRJA 2CLFB 3C3DA 3OBIA 2D5IA 3PNPA 2G83A 4FFWA 4G89A 2XR1A 1JQDA 3EG5A 2PH7A 3GAFA 1PD0A 2J9RA 2REOA 4HH3C 1U3FA 3R7NA 3RYFA 2CXUA 5ED4A 1IN1A 1A69A 1ENOA 1R3UA 2IEYA 2WMNB 3M5CA 3SE7A 4S1PA 4CIWA 5IF3A 3KPJA 2XZLA 4HWOA 5DLYA 3GLFE 3VPHA 1QIEA 2W7TA 3NGXA 1HTBA 4P4TA 4BJ1A 4L2IB 1SUFA 3ENQA 1ZZGA 1JU9A 1W29A 2I7VA 4TQGA 1E5TA 5HKOA 3PVZA 3RARA 1X70A 3TLKA 4P4UA 1FIUA 2C8LA 1YDFA 3B3AA 3JQ8B 4QOGA 4ZDKA 2I2AA 2IEDA 1T6YA 4HATA 4Y0NA 3WYDA 2PR2A 4H60A 4AMGA 4IV8A 3BXPA 2B1JA 2H2DA 2QL9A 3E5MA 1U65A 4HLUC 2VQSA 1XB2A 3IKJA 3CVXA 2P6RA 3RU7A 2J3IA 3GZNA 4LI3X 5HE8A 2PD6A 2V65A 2CXNA 2OLKA 2GTHA 5H9VA 3TAUA 3U0BA 4G5RA 1FNBA 3IOMA 1WUYA 4X5OA 1I6KA 4R9UC 4LGCA 5AKEA 5DBEX 1H9AA 4PGMA 4FEYA 4KTVE 3SKVA 2Q9CA 4MR9B 3AIKA 4RGVA 4KLRA 2Q7OE 3TFQA 4OPMA 2NU7B 1JQJC 2AD1A 3AKYA 4NBRA 4PU0A 5DRTA 3S68A 2FOIA 4FGSA 4ZYLA 2V1UA 1TQ6A 3PUHA 3NHSA 4R31A 5L3VA 4DLKA 1SIOA 4ND3A 3WJ7A 1JEOA 1QS0A 1WHTA 2UZAA 4YJDA 3T7RA 4BWGA 3U7JA 5JE8A 5BMVA 3FVVA 4E21A 3E18A 2C7VA 2GXUA 2QMHA 2XGGA 2XRYA 4PS1A 2ZSEA 4UD6A 5DT2A 3ZXYA 2BMAA 2VCYA 3H4VA 1U0NA 3N2GB 4RGQA 5EKSA 1MPXA 1GGNA 3FE2A 2DT8A 1JRLA 3IBGA 1KK1A 3VTAA 1F3LA 4NHOA 3GOQA 1LFDB 2POCA 3T9DA 2P9CA 3QV1A 3JQBC 5A9SB 1EFKA 1CUDA 1ZCFA 1X38A 2VOEA 4N40A 4HV4A 4D9FA 5JTUA 1LK5A 1RJEA 2O8FB 5DNYB 3KQSA 1Z38A 2I6UA 2XGMA 4L5CA 4NYIQ 1ZC3A 4P3PA 4P34A 2I2CA 1XNJA 1ZL2A 1AF4A 3UWSA 2RMKA 4AZVA 1E2HA 2ZG6A 4J90A 4BNZA 4RKEA 3T9CA 4XTCS 3UXEA 5BN3A 2ORVA 4L07A 3INTA 4RTKA 4M8NE 1USGA 3EPPA 2H4FA 2OAQ1 4A92A 4MRNA 2FN9A 1Z5ZA 3OTQA 4B09A 2HA4A 3WDSA 1TU4A 4RYDA 1LW6E 3PD0A 1O9HA 4FHDA 1GZUA 1RIIA 1N32B 4PGFA 3TSZA 1ECGA 2AGVA 4C78A 3ZX4A 1NQOA 3HCNA 4RWZA 1D5WA 1KYWA 3JY6A 4Q1CA 2BGMA 4JC5A 5K0LA 2C95A 8ABPA 2Z4TA 2Y68A 3U4GA 5LQNA 2L42A 4GZ3A 3RBXA 3DCJA 2JATA 1ZK2A 4LECA 3ZHOA 1G8FA 4LTNA 1NW7A 1L6IA 4E5VA 3DMPA 4WGGA 5ALLA 5A04A 4RVSA 1T2NA 1SFRA 4MA0A 1XZDA 2CNDA 2XMDA 3GZTB 5CJ2A 3W9BA 3VR5D 3ERCA 5JXWA 5JXGA 2H1LA 5J59A 2QE6A 4ZU6X 4B3TB 3S7ZA 4R2IA 3ADOA 4ER0A 2I65A 3ISVA 2OP0A 1JMKC 5GV8A 1SXJC 3QX7A 2GCOA 3PEWA 5DHAA 2FK8A 3KEQA 4MIOA 1BX3A 2AEMA 2ZB2A 3TEJA 1A1VA 1BHO1 2XNDA 3UPTA 3LCRA 3VVCA 5LPNA