2XYPA

Caspase-3:cas26049945
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xypA00
1NMSA 3D6FA 3R7BA 2CJYA 4ZVRA 4QU0A 2CNLA 2HBZA 1RWWA 2QLBA 2FQQA 4EHHA 4QTYA 1PAUA 1RHJA 3S70A 2J30A 1K88A 1NW9B 1RE1A 3H13A 2Y1LA 2H5JA 4FGUA 4JJEA 4NOLA 5I9BA 5IARA 4QU5A 4QUHA 3RJMA 4FXOA 2P2CA 1RWMA 4EHAA 5JFTA 3R7NA 3IBFA 3D6MA 2CNKA 5K20A 4QU8A 3GJRA 4D3YA 1CVRA 2J33A 3PD1A 2K7ZA 1GFWA 4DCPA 1NMEA 4PRZA 3P45A 1RHUA 2XYPA 5LUAA 4N7JA 2CNOA 2QL7A 4D3ZA 4DCJA 3K7EA 4PRYA 3V6MA 4AWAA 3BIJA 4AW9A 2C2OA 1JXQA 3R6GA 4FEAA 4PS0A 2H51A 4QTXA 4IYRA 4QUGA 2FP3A 2H5IA 3D6HA 3EDQA 1I3OA 3NKFA 5LUBA 1RHKA 2Y0BA 1SHLA 4N6OA 5IAGA 1RWNA 3V4LA 1PYOA 4JR2A 5LU9A 3DEHA 3ITNA 1ICEA 3H0EA 1KMCA 4JQZA 4JR0A 4ZVOA 4AWBA 1SC1A 3KJQA 1RWKA 4ZVQA 4ZVPA 5IASA 4QUEA 4HVAA 1K86A 1RHMA 1GQFA 2AR9A 2XZTA 2H65A 4EHNA 2DKOA 4ZVTA 2HBRA 3H1PA 1I4OA 1QTNA 3IBCA 2FUNB 3SIRA 3NS7A 5H0IA 4EHKA 4N7MA 3V3KA 4JB8A 5IAKA 2H4YA 3E4CA 2C2ZA 4HQ0A 2WDPA 4NBLA 5IC6A 1RWXA 5IBRA 1QDUA 3R5KA 4JJ8A 3UO8B 4EHFA 3KJFA 1F9EA 4M9RA 4NBNA 1I51A 1RHRA 3R7SA 3V55A 4JJ7A 5IANA 4I1PA 4EHDA 4I1RA 1SHJA 3GJSA 4N6GA 4NOMA 1NMQA 2C1EA 1QX3A 2J32A 3EDRA 3V4OA 2C2KA 4DCOA 1RWOA 4EJFA 2HBYA 5IABA 3OD5A 4LSZA 2CDRA 4N5DA 4QUDA 3PCXA 3V6LA 2J31A 3QNWA 4ZVUA 2H4WA 2HBQA 5IAJA 4JR1A 2H48A 4HQRA 3UOAB 4NOKA 4JQYA 2XYHA 4QUIA 4PS1A 3PD0A 4QUBA 4QULA 3DEIA 4QU9A 4FDLA 3R5JA 1SC3A 4IEFB 4NOJA 2CJXA 1RWVA 1RWPA 3KJNA 1I4EB 5IBCA 3H11B 2C2MA 2QL5A 5IAEA 1M72A 1IBCA 4ZVSA 1RHQA 4N6NA 5IBPA 1CP3A 5IC4A 2NN3C 4QUAA 3R6LA 2QLJA 3DEJA 1BMQA 2XYGA 2XZDA 3DEKA 5LU8A 3H11A 3NR2A 5I9TA 1F1JA 2CNNA 4NBKA 4QUJA 3S8EA 3GJTA 3SIPA 3P4UA 4EHLA 1SC4A 2H54A 2QL9A 2QLFA 4D3XA 3GJQA
chains in the Genus database with same CATH superfamily
3T1YB 1C2TA 4YRCA 2HRRA 1E3MA 4OB6A 3A31A 5ALKA 4LVOA 4NCJA 3KT3A 3W5IA 4ZCRA 2XGOA 2R6CA 3N28A 1FNCA 4OXNA 1OX6A 2O48X 4MS1B 4P8RA 2Q4RA 4IFEA 3PUYA 2D62A 1H6CA 1HFWA 5K0EA 3BCSA 5SYMA 4DHEA 3LPLA 3K2EA 2AG8A 5GJVC 5KYXA 2A58A 3H16A 3GJ8A 4N8EA 4RTRA 3R4VA 3I39X 1AV7A 2WIFA 2OZPA 2ZJOA 3O94A 3J80A 2CMFA 3H5TA 5EXPA 4P38A 3MTGA 1EQAA 4IPTA 1VM6A 3U0VA 4GIBA 1PJ3A 1D5CA 3OSZA 5LA6A 3IJ5A 3T3GA 3L06A 3QJ5A 5BYAA 2QN2A 2XD9A 3VNVA 3UAWA 1QHYA 4RVOA 2XT9A 4Q1BA 4FS3A 1M2KA 2G04A 4RCYA 1QANA 3V8VA 3W6PA 3N8GA 3IQWA 4RZSA 4ZAWA 2H7YA 5HUQA 2A9QA 1XK6A 1TQ2A 1E0KA 1YCFA 3EAFA 2BHLA 3OLZA 1D2NA 1E1LA 1Z2DA 1X8XA 2J3HA 3BAFA 3OF3A 4REQB 4XZ3A 1Y1SA 2WTMA 5AI9A 1L5VA 5T3YA 3L6DA 4D4JA 2C83A 3MFQA 5IASA 5F9MA 2G0AA 4YONB 1L7DA 3UXMA 4MLPA 3RFUA 3U44A 1MABA 4PYRA 3IALA 1ZMTA 4PC3A 2ID7A 3NBFA 1PNTA 3ZHOA 3KZKA 1D7AA 2BELA 3TVYA 1JBQA 2E18A 2QKYA 1GRVA 2JFWA 3KUCA 2HU8A 4MKXA 5SYAA 2MR5A 2XQGA 3DOEA 1S7CA 4WSOA 5DXJA 4RETA 5BYKA 1M2EA 1VE5A 1P0PA 3TAHA 2BF4A 4MW7A 1ZDMA 2PMCA 4IHJA 1EVJA 3VR2D 1CR6A 1DG3A 2GPYA 4PC6A 1PEAA 3TZBA 2ILVA 4CQMA 1JEYB 3VHXB 1XJ0A 3BDVA 2P9QA 4QBTA 3HS3A 4LJKA 5A03A 1NMQA 2E1PA 4N3BA 2UUOA 5IDVA 4X1YA 4UUOA 4W9RA 3BH7A 2PO7A 1DWQA 5IEBA 1VJ5A 4MPRA 2UZ4A 5CLGA 5JBIA 3MFYA 2J41A 1IY1A 3EVDA 3HUTA 1E9SA 4Q4JA 4Z3DA 2HA4A 1U7OA 3HV0A 2P9YA 1XRSB 2CJFA 1U9CA 2E5WA 3TRDA 4RDXA 2Q49A 5E95A 4I5FA 4OGKA 1I3LA 3E9YA 4UPVA 4MITA 1I33A 1TLFA 2C0CA 3KE8A 4XJVA 1JU4A 4DQ0A 5FWAA 5BN5A 3PNPA 2H57A 1VJ1A 1GAJA 3E2MA 2G40A 3B1YA 1M66A 3GGOA 1DZIA 1FOEB 1L7RA 4O4HB 1XSEA 1A8UA 1IBCA 1IDN1 1Q84A 3DTNA 4GICA 4EGQA 3A3YA 4Q39A 4KE9A 4UQPA 1RXIA 3CNBA 3AZQA 3JRNA 3K0KA 3TNJA 4GFDA 4Q9LA 1J2YA 3P9XA 4Q3LA 5B2FA 1Z6TA 1IVYA 4DGSA 5IYZF 5CEFA 3G82C 4CUZA 1HYBA 4ZQHA 1EG7A 1F1BA 4UREA 1IOWA 1O6GA 2DBQA 2Q1SA 3AETA 4QYXA 3S8EA 1L8LA 1Y9ZA 1O57A 1T25A 2Q41A 3RFTA 4EKGA 1PZNA 2I6TA 2ZQYA 3BG5A 2P2YA 3SS7X 1VCIA 3GVIA 4C14A 4WESB 5LQKA 2XDAA 1USGA 1U3TA 2W83A 3QEBZ 1Y5NA 4C0LA 1RZVA 2Q45A 2V7QA 2UVPB 3QW2A 4US0R 4OJKA 1IY8A 2FW7A 3BRSA 2VXYA 1NI4A 3I9LA 1RIIA 3IIJA 2F59A 4QU8A 1WB6A 1XRMA 3G85A 3PUWA 1EWVA 1I30A 1A76A 2I54A 1SBNE 2FPWA 1B23P 2WJAA 4KQ9A 4JSYA 1E9BA 1YTLA 1J8MF 2FWNA 1JEOA 2GEKA 2G63A 3T3PB 3ZKWB 4M1WA 3MZ0A 3AP1A 2CD7A 4P31A 2IW3A 3GW8A 3MF4A 4Q5IA 5EIAA 1GTSA 2R7LA 3MWEA 2C4HA 4A2QA 1GPKA 4DJDC 5K3OA 4H4EA 3TLCA 1L1RA 3BEOA 1WHSB 1QRRA 3O1HB 1GZVA 3EEQA 4FYYA 5DXAA 2QZ9A 3DULA 5DWQA 1KJ8A 4B76A 2D1SA 3X1DA 1T0PA 4J0DA 4LC0A 3AUKA 1E60A 4YT8A 4Q4DA 4US2R 4DT1A 3RAFC 2FDCA 5CK5A 1PQUA 4HB0A 4MR8B 2AQHA 1X0VA 1RHMA 5C35A 3FTFA 2O8FA 3CE6A 1T5IA 4W8OA 2VKQA 5JDCC 3QWHA 1TZMA 4NAHA 4TL7A 3L7IA 5BT9A 5SZHB 3K0HA 3DL2A 4J76A 1C0IA 4P2GA 4HH3C 1L2TA 4PW0A 2BVNA 2PRKA 1FQWA 4NESA 4NATA 2FEMA 4FYJA 2DGDA 4Y9UA 1NYLA 5LLSA 5YASA 3U7RA 4D45A 1OBHA 1QDUA 4J2HA 4D6YA 4RBNA 3A1TA 1HDIA 2GN8A 3TW8A 2AMVA 4D98A 3FWYA 4UNNA 2DUMA 2QGNA 4R2MA 2W2KA 2IH4A 1F7VA 3SFVA 3HJTA 2P9JA 4MQEA 4TRMA 4UFNA 1P4SA 1R6UA 1OU4A 2G67A 2RJNA 3CN7A 3EC2A 4B8WA 3X1MA 3CZRA 3GA5A 4LVCA 2VNSA 4WEOA 1X1QA 3ORHA 2QI9C 4KYUA 4HAIA 1VL0A 2NNLD 1FZQA 1R74A 3WRXA 5LNK1 1LPAB 4R41A 2EW2A 1HURA 1TJ3A 3SQDA 3CRMA 3OMXA 1EK2A 2JEOA 4WOJA 1F3OA 4CT4B 1AHNA 1KE1A 4A23A 4W5OA 4L4UA 1JBEA 5HCUA 1AQLA 2YJNA 3C39A 4J1QA 3KSZO 3KYJB 2YFKA 1KYZA 3DDOA 4B6SA 4FDMA 2GGSA 4CCYA 5KI6A 2VPTA 2OECA 2DR2A 4JV5B 4RPLA 1G5HA 1PRYA 1V1MA 2RAVA 3U9SA 1NT2A 4G09A 2H6EA 3G9XA 3INYA 1YSCA 3IPAA 2C1ZA 2HB6A 8AT1A 5HQJA 2MWMA 1X87A 2HJVA 2WRZA 3DV0B 3M6LA 5IC5A 5I9MA 2AG1A 2G28A 2QZ4A 4TMYA 4CCAA 3WYGA 1H4VB 4C05A 2XE7A 4AKIA 1WY7A 5FA5A 3EBLA 4NULA 3CMMA 4B8ZA 3FWZA 2E9SA 2W6ZA 2ODNA 5HPYB 1HYGA 2ORED 3DG9A 4MP3A 1F20A 1QHHB 1DO8A 3UJ9A 3UK0A 2I99A 1BAPA 2OFOA 1T2NA 2RD2A 1X13A 3DYVA 3GP5A 4MWTA 1GITA 4NF2A 4LJSA 4CUJA 3PP8A 3N2LA 1FFCA 3I2KA 1W5EA 2YWJA 1QP4A 1QS0A 3MMZA 1YL5A 4R3WA 4UAGA 4POOA 1RTTA 1PS0A 4M0PA 3EPKA 1E0JA 1EVIA 4EAAA 4OQNA 4ZICA 1SQGA 3MINB 5AHWA 5HIMA 4BFVA 3BSSA 4OEHA 5AVZA 1Y6QA 1XQ6A 2JJ1D 4NZYA 5G2OA 1I3CA 3RPEA 4DBVO 4EHIA 3WYFA 3AT1A 1OLSB 3B2EA 5GONF 1ZUNA 3AFHA 3NM5A 1IHUA 1GCIA 1E0DA 3IP6A 2DFVA 4CIXA 1Y6GA 2CZGA 2JCXA 5K8CA 5DGTA 2ID4A 2KM1A 2YH2A 3S1AB 3WGYA 1DQSA 2ERXA 3KVRA 3STVA 2VDOB 4IDOA 4WN3A 2IYTA 2PEZA 2E6KA 4JR0A 2CXSA 4N82A 4P7FA 3OD1A 5CCDA 1RS0A 4FKBA 3TRHA 5CUQA 1L4GA 1ORTA 4BV2A 1MO5A 3JZIA 4P3YA 2OUKA 2DBZA 3HSKA 5KYYA 1E99A 2GJAA 3WFZA 2BUCA 1V5FA 3NNNA 1VLJA 2PZFA 4UHDA 4FHGA 3DE1X 4QT4A 3B38A 2R8RA 3JD0A 3W2FA 2AFIB 5B1SA 2HRBA 3BCHA 2ZDQA 3AF4A 3NLLA 3ZCVA 5KX5A 4ID9A 4BMZA 3INRA 3PEUA 2OORA 4WZBA 2G25A 3FG9A 3UJBA 2DJIA 4V0QA 3ZE1B 3GY0A 2R6AA 4MPDA 1L7MA 1NGSA 3M8KA 2RCYA 4B4UA 1TD1A 4I66A 4AFNA 1XQWA 3PS9A 4ERNA 3CEAA 2BN4A 5FB3A 1KEKA 5EJGA 4Z3KA 1ZZGA 4K6HA 4OOFA 1JHYA 1KETA 2X5NA 5DZSA 5CB0A 2YWGA 1VFPA 1OFVA 3FFTA 3OP4A 1ISFA 1SZJG 2AR0A 2XA1A 2VSFA 3OPVA 4GM1A 4BXOB 3CF6R 2V59A 4K1XA 5FPSA 3UIEA 3IV7A 2O20A 2DPLA 3GGSA 1AN0A 1QPBA 2CNWA 3AGPA 3GLFB 2H4HA 3IP8A 3OP1A 3GLIB 1YQWA 3GDGA 1GNLA 2DWQA 2VHUA 3KWJA 4GXNA 1G5FA 3TOZA 1RAGA 3U4DA 4PN7A 4KZPA 2V7EA 3EK2A 3UENA 4PBTA 2FJ0A 3AR9A 4X20A 2I7TA 1UJNA 1DFHA 2WV9A 3AHGA 4IS3A 4RD0A 1JL3A 2I4OA 4ZD6A 5GP1A 3TCKA 1T2CA 1SU7A 2FFQA 2ZUCA 4KXQA 3N3BC 2HRZA 3PL1A 2ZWAA 1PCXA 1U8FO 4GI3A 1ESMA 1VP9A 3HVUA 4P0TA 3CUSA 1J39A 4XM1A 1VI5A 3H1TA 1YZKA 3GRKA 4FYHA 4TZTA 4MRMB 4LHSA 3AO0B 1OPXA 5I7WA 4MJXA 5K0LA 1A5TA 2W70A 3HHPA 4YP5A 3BIWA 3T1NA 4NH4A 1NDQA 3MN1A 3IT2A 4RL6A 2C9MA 5ER6A 3U4HA 4Q3DA 2DH6A 2R8PA 4FE4A 3KT6A 2YL2A 2V7TA 1TM2A 4RL4A 1GN8A 4YRPA 4CL0A 1CQIB 4ZVLA 2W6PA 4LJ4A 4I4NA 2NXWA 3CLHA 5IULC 3BH6A 1EVEA 5FJIA 3QHAA 3EPRA 1C0PA 2VT3A 3CV3A 1YQXA 3F5SA 5E9JA 2IXDA 4ZWNA 1Z0UA 3UUEA 3N75A 1Z5PA 1P1BA 4BP8A 4F9EA 4I5GA 2E4WA 3SLKA 3BFVA 4JJEA 1P91A 2Y1LA 3BWMA 3HE3A 1V9SA 1LBIA 3Q11A 221PA 3VNQA 1VLMA 3T7TA 1X8KA 1KJZA 4B3CA 2IZ7A 4IF6A 5DGDA 2HNKA 1I13A 2JD2A 3ML1A 3LVBA 4YAFA 4CMIB 5KMGB 2R4QA 3Q2IA 4B40A 3NIBA 5K3FA 5CYOA 1N57A 1W4AA 4BNHA 4K9DA 4E88A 2FGKA 2HSWA 1ODKA 2XJ4A 2NP7A 3CZ4A 4TROA 2CZQA 2XRFA 3TW6A 3LUFA 3QJYA 4YCDA 5A1TA 2XDQA 4F2GA 2V7QD 4XSVA 1WA5A 2B1QA 1VGQA 1DE0A 3HKEA 4TOIA 1KEEB 3WLLA 1Q0HA 5GIPE 2DQSA 1VHLA 6AT1A 4Z4FA 1DLJA 1T4MA 3D3KA 3VZCA 5ALJA 5B3KA 3QELA 2C9DA 4E1VA 1SN7A 4YAJA 1JZTA 3HBMA 3I1IA 3R0ZA 4B35A 4R05A 3EN0A 4RS3A 4C7BA 4GMKA 3A14A 2QV0A 3AX6A 1AKNA 1I2CA 2X0RA 3GFGA 4L2IA 1GL6A 5J9FA 3ICPA 3T1HB 4NBWA 4N03A 1TUIA 4ZALA 3T12A 3V3KA 1SU4A 5JARA 1G291 1NVFA 3SHVA 1P0QA 2HD4A 3LIIA 5D85A 3O8OB 4H27A 4B71A 2CXRA 4HWRA 3IPYA 4S35A 3TXXA 3DLTA 1BMFD 1X1BA 4G1VA 4A5OA 4LDZA 1T36B 2IWHA 1RZ3A 2RDMA 1P1HA 4WNYA 5LM3A 1O5IA 3BJIC 5K6TA 4G4SP 4BP9A 3FPGA 4EFDA 3LH5A 3DQPA 3FIUA 3M70A 3P2OA 4E5DA 1H5UA 2C7GA 4ER7A 1T1JA 1V47A 3HM2A 3KB2A 4TM7A 2XGJA 2HIMA 2XPCA 1LLQA 2AC4A 1YL6A 5CLHA 4AX8A 4PZCA 4TYMA 5LP6A 5AW0A 1S2DA 4H6PA 3UB4A 4CHGA 1C41A 4D0LB 2GCNA 3CURA 1ZD9A 4BNNA 4INAA 2P40A 4BGIA 1JKJA 1IN7A 1TUBB 2QTLA 2GBCA 1XLTC 3TNYA 1LLDA 4L0CA 2GDZA 1JLLA 3FGOA 3NFRA 3Q0IA 3IR7A 2BGRA 3PDIB 1M72A 1M34B 2PSHA 2X40A 3O93A 4O2BB 5HS6A 1ZPDA 3W8EA 5CTAA 4B47A 4AY3A 4ITRC 4F86A 4FX2A 1EVKA 3NH9A 4JN6B 2XQVA 3AJAA 4HJXA 4KJXA 4MZXA 1E3DA 1J0BA 5BNIA 5ALXA 3E9EA 4CEHB 2PPLA 1NF9A 2C77A 1THGA 4DJ5X 2VQEB 1S3FA 1DS6A 3FTQA 4JCOA 1Q21A 1PGPA 4EMSA 2KPOA 1BXRA 3BWVA 2F3SA 2V7BA 4MYTA 1IZ0A 2X1VA 4JOQA 4PX3A 3SBDA 1TQ8A 3RUIA 5K6RA 1CIPA 2C2XA 1T2EA 2P35A 2X5OA 2IDMA 5FBHA 2LCIA 3UJ7A 1U2SA 2WMNB 1X14A 2HBZA 4E5PA 1XTZA 2I6SA 5JD5A 3ECAA 4WLUA 3C4JA 3AM1A 1GQ2A 1ZLYA 2J0UA 2LKCA 3AJ8A 3I5AA 3O9VA 3ZWCA 3K0AA 2ZYGA 4LQDA 2XITA 5JI2E 2X0JA 3OPYB 3EHEA 4YREA 3U80A 1SXJC 3D6NB 5JHGB 2R47A 3ET4A 3KDSE 1J42A 4YBZA 1DMSA 5AKXA 1F4LA 1KVTA 1KYWA 3PGMA 3WLNA 1SVIA 4YRQA 1OKKD 2GNPA 3FVRA 4PS0A 3JYLA 4QTXA 4HADA 3A58B 3O3CA 4QYIB 5A04A 2VF7A 5EYPB 4C06A 1ULHA 1RRKA 3TZHA 1D8TA 2HCFA 2OOKA 2VYQA 3OECA 5AK5A 3R8CA 5JAPA 1FFYA 1C7IA 2AE1A 5L8VA 1PBTA 4ZOLF 4MP6A 5LXTA 1NVXQ 1T8SA 1PNQA 3KNZA 4CLOB 3LTEA 4ZIRB 4B3BA 4G0ZA 1NY5A 3D8BA 4K28A 3S28A 4HNTA 2ETXA 4IVNA 4TVBA 3G8DA 1UBMS 1MJHA 2VHYA 3DBHA 5KQGA 3UG6A 3N8DA 2D5AA 2YRFA 5F2OA 4RDIA 4X1KA 1ULTA 4IQ8A 3OE4A 1CPYA 2V58A 1BDHA 1YVUA 4XPZA 1CUYA 3WB9A 3D8SA 3O0TA 3M6IA 1MOPA 2QJFA 3UTDA 5JNUA 2A1UA 2HF9A 5TNXA 4Q4LA 5CB4B 1FDTA 2QT1A 4D4HA 1GQSA 2PXCA 2TMDA 1JKMA 4ZDWA 2IX9A 3UUGA 4DNOA 2C7PA 5DNCA 4G84A 1H4SA 2E0IA 3MWGA 4IR7A 1JJ7A 4YQEA 3OWOA 4M1ZA 1RC0A 4DV0B 2L2QA 3VGPA 4W8GA 4PTLA 1E94E 2FYTA 3VSAA 3LPCA 5ICFA 4RD3A 2PUBA 2J4FA 2C2YA 2BD0A 4Q4CA 3RADC 4II7A 4FGLA 3GPDG 1HXHA 1Q95A 1IOZA 1L0BA 1EDZA 3NHJA 4ECAA 2HF7A 1PJ8A 4EY3A 5JLAA 4HDNA 5DN6A 3E7DA 4RPJA 1PFWA 2IGBA 1RKBA 5M2QA 3VYVA 3B1XA 4GQBA 3KLPX 4M88A 3NTOA 1N2HA 4XUCA 5E1DA 3S44A 5BXYA 3W1VA 1M2FA 2X2EA 3CG0A 3PDHA 4GEKA 4DSOA 3HABA 1HX7A 2EX0A 1H3FA 1ZGJA 1EFAA 4WACA 2V6FA 1HBJA 2XMGA 3WWDA 3LHSA 2IUYA 3NCHA 2I7VA 1KI8A 1JE0A 4MULA 3SF8B 4CM3A 1X1SA 1PEYA 2J6IA 2WHYA 4P6VF 5J4LA 1CY2A 1DDOA 2XKKA 2YBDA 1EH5A 1NW8A 3FLAA 3GJ0A 3I8SA 3OT4A 4PYMA 4K6FA 5D3QA 1PZXA 1V1RA 2YHBA 4KR2A 1TMYA 3DTYA 4BQIA 3DOCA 1EHYA 1BX0A 1GPBA 3HGMA 3KHKA 2FWBA 4FX5A 4L3WA 4LE1A 4Y7DA 5H02A 5LZ7A 4UUAA 1DJOA 1RABA 2NG1A 2P6PA 1B0ZA 2WFLB 3LLUA 1TJNA 3RYFB 1B43A 3KJGA 3T3MB 1JQ3A 5EQFA 4NE2A 5G4KB 2XCOA 1IXRC 3AY0A 1T0HB 3UHFA 1R10A 2D7CA 3G7NA 4CMBA 1OASA 3K9FC 2F67A 5ES3A 2EKDA 2ZTHA 4MJLA 3TSZA 1FXSA 1Y8CA 4LEIA 4QLAA 5L3QB 3OZRA 3IMFA 5DM0A 1XWFA 1GZDA 5DT9A 3IUBA 5EIXA 4S1PA 3U7GA 3RK4A 4CM8B 4G37A 3T9BA 2JCGA 4A6PA 4QJ3A 4PNZA 2YXPX 1U9YA 2CDAA 2OA0A 1FNBA 1KZ1A 1OR8A 3AK4A 4G56A 4Y9TA 1DCMA 2QXTA 1TU0A 3IXQA 1UBLS 5LUAA 4DA4A 1UODA 4IXTA 1TK2A 4AWAA 3L82B 3FMFA 4U7GA 3U1VA 9LDBA 3HXOA 1P7CA 1YR9A 2GVDC 2QTTA 3GQBB 3IDQA 2VJQA 3T5CA 1Y6FA 4QWMA 1DU4A 1RHKA 1UDCA 1K8QA 3DDUA 4ALJA 4BYGA 1C1DA 3FTNA 2K87A 5CFRA 3WJ2A 3RRXA 2ZK7A 1G8JA 3R4CA 1ZMBA 5IYZB 1MJNA 3Q5GA 4ACBA 1UJ5A 5BV0A 1P7PA 3PTLA 5K6AC 3Q8LA 1ZNQO 3MAAC 2HMTA 1AHIA 3IQGX 3R0XA 5E2AA 4RXMA 5EZ6B 2HJWA 3B78A 1CQJA 2I33A 1JLSA 1OC2A 1TAGA 2I2AA 2JGFA 3LOUA 5IS2A 4WY2A 1JEQB 2O0LA 4AECA 1UMBA 1XTIA 2DQZA 3T5AA 1I0ZA 3OUUA 5FX2A 3KFLA 4UMDA 1ENZA 1N0IA 1Q3KA 5IWCA 2QTVB 5A71A 3I4CA 1KXJA 5IAKA 4N76A 2A0KA 3DWIA 2VAMA 1ISMA 3ILSA 4FDTA 1Z38A 2ZXEA 4E32A 4YV2A 5AOAA 4KLZA 1UT6A 4BKPA 2P30A 3B51X 2DPMA 2NTYC 2BH9A 3OM8A 2FWMX 3KFVA 5EP2A 3NFYA 4LZLA 3OJEA 3ROTA 1R9NA 5C34B 1OREA 1X7XB 4RDCA 1Q17A 3EH1A 3I1JA 1UPTA 4AIRA 4GQIA 3F4LA 2FX3A 4I99A 4LRQA 3U3JA 1XAIA 5ED4A 1RYFA 3JALB 4MR7B 2C2KA 1SHKA 1O94A 4JI1B 3TBFA 2ISCA 3KUDA 1LSOA 3K0FB 3L02A 1L7OA 4BB0A 2AMYA 2Y77A 3F73A 3LTNC 1I2BA 1PK8A 2IS4A 5J2TB 1SVNA 4WCDA 3EULA 3NALA 3FUWA 3ORSA 5AW4A 1IJEA 3ZUGA 4HQRA 2DTEA 1XA3A 3FBWA 4WX2B 5JJIA 2Y0DA 2IU4A 1H1LA 4YRDA 3F5MA 1UJ4A 5FWYA 1T1IA 2YMQA 1QH0A 2FKAA 3KQTA 3L0IB 4CN9A 8ABPA 4ZGBA 5BN1A 4N49A 1WOYA 1HK7A 4GSLA 1EFCA 4L5CA 2HWWA 4UZSA 5I4CA 1HDRA 4GPTA 2GWRA 1IWOA 2JFNA 1UR5A 3GRFA 3MT7A 3SYKA 1AKYA 3GJ5A 4J4HA 4M87A 4ND1A 4AT1A 4DSUA 2COUA 5IH7A 2D1YA 2GD2A 2VHTA 2ZPUA 4C0SA 1XA0A 3CF0A 3CX7A 1MR3F 3OZEA 4ZRMA 5DWVA 2O7QA 2JI8A 5CPBA 4HAXA 4PNPA 3AVYA 3UV3A 1HZZA 4HXYA 3DFUA 3JARA 2H11A 3H9JA 4IIUA 3V5NA 4X1IB 1KSGA 4EVQA 4Q37A 3OVMA 1JJAA 1J99A 1TVEA 2RHHA 1BYUA 1HI9A 3PYLA 2FW8A 3BHIA 4DTCA 1PAUA 3LC2O 1N6PA 3GLSA 3LUBA 4UMVA 3PSAA 3VKHA 1MF7A 1RJ9A 1TYAE 3GCWA 3KZOA 3QVVA 4RMGA 5BW8A 1WUYA 2WF7A 1LCIA 4W5QA 3SVZA 3MWLA 3W6NA 1V26A 2XADA 2X42A 1VL8A 2COEA 3PE6A 1JFVA 4I5IA 4IF4A 2X8BA 1SXJB 4NABA 4Y98A 3WNZA 4PYJA 2JVKA 2VNKA 2Z1DA 2OGUA 3EVEA 4P7GA 3OM1A 4I2VA 1UK8A 3E3OA 4LHXA 2E4YA 5K0ZA 3K09A 1T15A 3DMFA 3G5UA 1YS4A 1GNRA 3AERB 4RLFA 4OXKA 2XQJA 4X63A 3X44A 1JR3E 2HGZA 3OUTA 4EW3A 1PDVA 4Y1GA 4IRMA 1AGYA 1LF5A 1I80A 4ASUA 2FDXA 4HZIA 2OOSA 5HF6A 2VRCA 2VWQA 4X1OA 4GLOA 3EDOA 4QVGA 2Y1KA 4GP7A 5FUYA 3WGVA 5EHGA 4JLWA 3B1KA 2EV9A 2PZAA 5DB4A 3T35A 3ZZNA 1TT7A 1XHLA 1GRQA 1IDOA 3F49S 3FCEA 2BZ0A 3BMNA 3MJRA 4RSGA 4X95A 1KK3A 2R00C 1K86A 4MW0A 1GQFA 2Q5CA 4ZN6A 4FSDA 1N4AA 4YCMA 5FAKA 2HJRA 2JFGA 1PWYE 3FOZA 1G4AE 1AKVA 3KSMA 4MW9A 4P3PA 1RKUA 4TXNA 4Y1RA 1F8FA 1L5SA 4KXNA 3N8HA 3OZXA 3V46A 1U02A 3Q6MA 1UZNA 5GAJA 3DEAA 5LD2C 2VRBA 3I23A 1E64A 1RVV1 4HMOA 3WADA 3OQMA 4IJMA 2CYCA 4QTUB 4BLUA 3DFIA 1R4AA 1UBGA 2H0RA 3ZD7A 5F3DA 2B8EA 3QFCA 1UC5B 1H66A 2YIMA 3G6KA 4H3HB 3TTUA 1E2UA 1PWHA 3FNEA 2IP2A 4OXYA 4DNPA 4R1OA 5GONB 5J5VA 4DUYB 2MHCA 3LRPA 5GVSA 1L7BA 4HLQB 5EJ5A 1NI3A 4C4SA 3D8RA 1EE2A 4LXIA 4EECA 3ROPA 2I3AA 3L1JA 4OHUA 2CLDX 2VDKB 3G9UA 5JECA 3HJCA 4K3UA 4W5JA 1DIBA 1UEJA 3O95A 1SK8A 1Z29A 3EIWA 3FJYA 1AJEA 1E1DA 2BCJQ 4G5GA 4Y9DA 5BV2P 2RGNC 4B34A 4M0LA 2EYQA 3EEOA 2GAAA 3NAZA 1DIOB 5CHYA 4AMYA 3AI1A 4NBRA 4KJZA 4WAUA 2UZ3A 4QPDA 5AVVA 2QAJA 4GZ3A 1Y5RA 5AVKA 5HUJA 2H4XA 4EMBA 1VYVA 1MLDA 3A05A 1Z34A 2KSQA 1ZJ4A 2X0KA 3A4LA 4KQMA 3HV2A 4G0OA 1BDBA 2QK4A 3JASA 3BZBA 4JUCA 4XAQA 4ZAGA 1PK9A 4YUYA 1OW3B 2I66A 1OXSC 2YY5A 1KBOA 3CRZA 3QPUA 1XA4A 4A0RA 4DDKA 4JI2B 2ZXFA 4KXUA 4RO0A 1FQJA 1XFDA 5DN6D 4UU7A 2FZVA 1CNMA 3VM6A 2NO1A 2B99A 3FTCA 4PGAA 4RF4A 1CUAA 5CNMA 4C3OB 3I30X 4F2DA 2D2IA 2VLIA 3OEHA 5MGNA 4RTPA 2P4EA 2XVAA 1MENA 3GUVA 3OG9A 4L6AA 3STTA 2ATCA 3FVVA 4DRZA 4EG5A 1Z8NA 1E1NA 1YDMA 4GWKA 3O3OB 4NJMA 2Q5IA 1OX4A 2VSQA 3KOOA 3N53A 1GL7A 4NH0A 3RUCA 3WLIA 1S8NA 4B6FA 4BQFA 5CBKA 2XTNA 3CW2A 3HCRA 2QBYB 1KO8A 2QMZA 1P80A 3ESXA 1G4UR 2J5QA 1LZKA 4FFVA 3V1YA 1K66A 2W93A 4FWIB 3LCRA 1U8UA 4B2YA 1LLFA 3E23A 3H13A 1YRBA 3H99A 3R5XA 4BKUA 3FWPA 1C0EA 2VP9A 1FMCA 3DLIA 4G0QA 4L4SA 1YJQA 3D1VA 4YDSA 5MHTA 3R7NA 1OCEA 2GS9A 4GYWA 2QLLA 3PQFA 4UDOA 5K2MA 1CUGA 4AO7A 5B7GA 3S4YA 4YIHA 2EEZA 2VDNB 2VYNA 3C74A 5BXQC 4L75A 4NZNA 6ADHA 2WTUA 2B5VA 3OJXA 4JXZA 4FW9A 2NSHA 2QR2A 2X7JA 3I1YA 3GGPA 3MCUA 3PIIA 3Q3IA 3V8EA 3A06A 1LQUA 5C8YB 1AN9A 1R0RE 3O7WA 1UC9A 2W98A 2XQFA 1V3TA 2H5IA 3QKSA 1WWKA 4MEBA 4RVNA 4DG9A 4NAVA 3D8HA 4HF7A 3N87A 3PPIA 4JOCA 4KWEA 1FUIA 2YZ7A 4RSHA 1O95C 3V4LA 5FI0B 4C3ZA 2OM2A 1H0HA 3CC8A 5LDHA 3L5OA 1R8JA 2C7OA 4GKBA 5AW5A 2AOXA 4LOHA 1CP2A 4P0PB 3BM5A 5IPFA 4DOMA 3M0EA 4M9SA 4H7KA 1FTGA 5KTPA 1SEPA 1QH1A 4R69A 1S1MA 5T64A 5HM8A 2B0CA 1A50B 1ZVQA 2DHCA 3QEJA 4X97A 4IQ4A 2FUNB 3OLCX 4F3NA 4GWGA 4AWXA 2QRHA 3TQTA 4QG7A 5IVHA 1HT3A 1NAIA 5C9ZA 2CXUA 2VHEA 3K20A 4NBLA 4ZP1A 3UEOA 5FPHA 3TX2A 5AHOA 1F6WA 3AFIA 3C6ZA 1D5WA 1GUAA 1P4RA 2UVQA 3PPYA 1SVSA 2RJ3A 4Q00A 4A2CA 4D0NA 5IUNC 3B6EA 4J94A 5AW8A 1NJFA 1OXXK 5HS4A 1ZIOA 4EVSA 1FNDA 3IKLA 4LJ5A 4XR4A 5AK0A 5GOTA 5I9LA 3GNTA 3GJ6A 2PZBA 1FFEA 2OCYC 2Q1YA 3DLHA 3OEEA 4GE0A 3DXYA 2GCIA 2JHAA 5BR4A 1SUAA 1ZCJA 4HNGA 4W5TA 2C0PA 3HSSA 1Y1LA 2H59A 3LI2A 2X3YA 2WSLA 5KU1A 3LRXA 5DTQA 3NKVA 2HREA 3KP1A 2YX1A 5FI3A 3GEHA 4KQXA 4OTZA 5B30A 3D6VA 7ADHA 3GEPA 5L3ZA 3BA6A 2VOJA 1GXSA 2P0AA 1QQ5A 4NQZA 3HKDA 1CQPA 3GH1A 4BO6A 2L82A 1AQNA 2JGMA 1O94D 2CYBA 4KMOA 1EUDB 1YDFA 2IKSA 4G01B 4MX8A 1NAHA 1TTHA 3AEZA 1NUPA 3X2FA 3PQDA 2OCXA 9LDTA 1K8ZB 2ZWOA 4FWTA 1A71A 1F7UA 5ALZA 3C16C 3AUJB 1T8TA 4NZ9A 1Y4AE 1Y8RB 2PZMA 2VTKA 3DOFA 1TA0A 4RPGA 5EGSA 5C81A 5A0VA 1M2VB 3T5PA 4BV9A 1EFKA 1C9KA 4XGIA 3ICEA 2QTNA 1AF7A 3LE8A 4KE7A 4PV7A 5CHEA 3WXBA 4D44A 4B32A 3UMRA 1BD4A 4GAEA 4E09A 3NTVA 2HQRA 1E4YA 1N2CA 1J49A 3FZNA 4GOND 2RKOA 4D3XA 2IUFA 2PGIA 4U63A 5AKLA 1YIAA 3PWKA 3JSXA 1L4LA 4KUGA 4X3CA 4OGWA 3QA3E 5TF0A 3OTQA 3RCBA 3LUDA 1E8DA 2YXBA 1V8OA 3BULA 2X77A 2BGGA 1JGTA 3O4JA 4AURA 3Q9NA 4MVWA 2BM9A 4NCKA 4D9KA 2FRDC 4ZEMA 5EJAA 4CZ2A 4QXOA 4P35A 3KSRA 4OL0A 3PGXA 4OQDA 1IK4A 2PMKA 3CH7A 1NPTO 3DO8A 2VWHA 3CNEA 2JLYA 4LS3A 1M9NA 1KY5A 3LP5A 3P2MA 3LNTA 4BQQA 3DVLA 3UT0A 3EGDA 1I7LA 2WHPA 4ZV7A 4JKIA 5GGYA 1RPZA 5C1OA 1MXFA 1N3IA 4D3DA 2ZVJA 4FFSA 4R1QA 3L7JA 3COZA 3UV7A 3GMSA 3QWIA 1E6MA 3AB7A 2RGGA 4FCVA 4BX0A 1EINA 4L76A 2RK6A 2CE2X 4X7MA 3UANA 4Q3OA 3W05A 3PJDA 2XVXA 4DMKA 1OIXA 1XDUA 3ZE2B 2VWGA 1FLAA 2QLMA 3QX8A 3G6WA 2XZTA 4ZO6A 5ICMA 4FR2A 2C03A 4N5LA 1AMOA 1GTG1 4HN2A 1OGIA 2HEIA 3RTAA 2X9NA 3HDQA 1DO2A 1NSTA 2CUKA 2PS9A 2OM6A 4V3BA 2MT9A 5JANA 5BSEA 2PX5A 2PX6A 1GQYA 1S8FA 2O2XA 3LM8A 3OI7A 2IHYA 4CN8A 4ZO8A 3GXOA 3HDVA 2VRCD 4C0HA 4C6RA 5LD2B 4J2TA 4UC0A 3HMKA 1M8JA 4J16C 1JVNA 1P5JA 3ANLA 3VPGA 3NHWA 4OMCA 2Z57A 4XYMA 4I55F 1PL8A 5LB4A 4AQ7A 2EFCB 4O4JA 2AFHB 2A9OA 2ZYHA 3KZNA 5KQRA 4AQYB 4PYNA 4LY9A 1EK0A 1M75A 3EXHB 4FNAA 5SY4A 3ENNA 5EPEA 1G3IA 2CL0X 3WZMA 1N0WA 2QM8A 1ZOPA 3DMTC 4BCCA 4H1TA 3HCDA 4RTLA 1JFSA 1XMPA 4NNOA 1R0YA 4H2DA 4MPTA 2WUWE 2II6A 5JY6A 1VE1A 3CH6A 3TLEA 4BJ6A 1E4EB 4WCVA 2QB5A 2QUIA 3PPWA 4PCLA 3WDSA 4OGGA 2R1UA 4KMMA 5BVHB 3OZUA 1VMDA 1R6BX 2EP8A 3IV9A 2FZCA 2P69A 3E9QA 4UXJA 2Q5LA 4AB1A 1I4LD 3FUCA 2P62A 5GY7A 3SJBA 3ZC3A 3RLIA 1CX9B 4ZYZA 3BE5A 4MYSA 1NN0A 2BPOA 1G2QA 1XCMA 3GDFA 4RV4A 3IR5A 1IBRA 1PE0A 1RMTA 2A88A 2Q9BA 2QN8A 3HLYA 4RX1A 4DDWA 5KKCA 1KSFX 3DAFA 3EWIA 4ZT3A 2XF2A 1ZN7A 2Q4TA 3ZIUA 1YK1A 4E33A 1EUQA 1EX1A 4OSOA 1JAYA 2C88A 1M1YA 1G7RA 3KAPA 2ZLBA 4QO8A 2J9XB 3MWKA 4UZEA 1TTPB 2NV6A 4ZCMA 2BGMA 2WYOA 3WL8A 2GK4A 3O92A 4WASA 2FK7A 3NDJA 2WQ7A 2NIPA 3AF5A 4LPKA 1FSZA 4XQ9A 4WXPA 5FUMA 2RGRA 1AZWA 3VOAA 3P4XA 4E3WA 3DTVA 2ILTA 3WNQA 3ZCPA 1PR1A 1Q0QA 3FVQA 1EA7A 2F9LA 3JZDA 1QR2A 4R9SA 5DBFA 2GN1A 3DAOA 3OEHD 4MI6A 4I9UA 3KJXA 3KQOA 3GYBA 3E9MA 1WB4A 2XVMA 4JI8B 2DWCA 4G23A 1LXCA 2ROQA 2PGNA 3ETEA 4OYYA 2DX7A 1BHQ1 2GSDA 5DNEA 1DKNA 1RVDA 1VBKA 1USKA 3INTA 3LJKA 3S8YA 2HK9A 3CEPB 4AW9A 4CETA 1SXQA 3LSYA 1Y9DA 3PNOA 1K6EA 4OLJA 4AXXA 1QGZA 1UWKA 4W9NA 3QEMA 1P2BA 1ZG3A 1ORRA 3SKXA 4DKJA 2I4IA 1H2AS 1LPBB 2MMGA 1RRFA 1XL0A 3MTEA 4BQOA 2B1IA 5B1DA 4EDHA 4FXPA 2JL1A 2OD7A 2IBSA 3EBPA 1ICEA 2YVAA 3N0XA 2ON6A 4JCCA 2VYND 4ZVOA 2OHHA 3IVMA 1SCIA 4JLAA 3WWZA 5EESA 4LF5B 1OZ0A 2PKQP 2XLBA 1W1UA 4KACA 5E6SB 1DKMA 3SEQA 4JFRA 4IMJB 2I3ZA 5IFKA 1J7JA 1WCIB 3MJVA 4HWTA 1GNVA 1FA9A 3IAS6 1DAIA 1MH9A 3TF5A 1MEJA 2FW0A 1MTZA 2FSSA 1QHNA 3HJNA 4AJHA 1L8OA 2RHRA 2FPIA 5JYDA 5G53C 1KEWA 1NJ5A 1XQ9A 3H19A 4Z1OA 5KWSA 3L8YA 4DV3B 2PEYA 3N70A 5FFFA 1Q1ZA 4HRAA 4Q7KA 4YIKA 3ZWMA 4K6OA 3COWA 2FSUA 4DC0A 1W5BA 4EO4A 1WE2A 3C70A 4DDUA 1WO8A 1Q74A 1NVGA 4O5OA 4NYIQ 4BFCA 3I64A 3OKAA 2P1ZA 1A27A 2VZEA 2I2DA 5ERYA 5SYNA 4E5UA 1IL0A 2C20A 1PG0A 3PPVA 2B9VA 2BFCB 1GTZA 3KKPA 5B2ZA 2M9MA 3MD9A 3Q7PA 1PT8A 1RM4A 3H5AA 3TTXA 2WAYA 1I3NA 3G9QA 3KXPA 1UP6A 4E7PA 2XGMA 3WB2A 4G9BA 3EVBA 4RA9B 2PT6A 3TL3A 3ZLTA 3GLHA 2C99A 1OWPA 3RJTA 3I9V6 3K3PA 4L6CA 4CWAA 1AMUA 5LA6F 1G8KA 2P0EA 4GOKA 1PR2A 3CPHA 3U3ZA 1WJGA 4EP1A 2YIDA 1SG9A 1VMEA 5CCBA 1VHQA 2WUGA 1QQBA 1VPDA 3ZY3A 2I3DA 4BVFA 1L7PA 1YZLA 4EITA 1J2RA 4JP3A 3M6UA 4MCAA 4N18A 4DXDA 1MB2A 4IDQA 4KQWA 5ADWA 3THXA 1ZGHA 1POXA 4OB8A 5AVUA 3PUXA 3RIXA 5ICSA 1ILWA 4E3ZA 4WXRA 1XQYA 5B53A 3S55A 1U0EA 3H1BA 3LDGA 5LZ8A 5DBOA 5HMMA 1PNOA 5AVJA 1Z9BA 3VVMA 1JAXA 2KW5A 2E49A 4A5SA 4NBKA 4UDXX 2QMHA 4H7PA 4C4XA 1XMQB 3ZV3A 5EMJA 5KSZA 3DZ8A 5E6RA 4H7JA 5CNKA 3SSNA 3CR7A 4YRMA 2RHOA 4GLJA 1T35A 2EZ9A 2Q5OA 4LBZA 4IHJF 3PKJA 4MB6A 1XV5A 3HZZA 3KT0A 1AKMA 4QU0A 2WUDA 4OHVA 4DLVA 5NULA 4L8YA 1KGSA 5E8RA 1GPDG 2PD4A 1SUWA 3NRCA 3OO1A 2D1RA 1DIRA 2A0WA 4YXWA 1XRNA 1OUMA 3EIQA 3PZBA 3ZCXA 2JAXA 1JBKA 1S01A 2VJYA 4ONEA 1IAVA 3RWBA 2XNJA 3UOGA 4LDPA 1XYGA 1YC2A 1Y63A 3V9PA 2Q28A 3ZZ1A 4UEOA 1XTBA 4JSTA 3B89A 5K3AA 1Y7TA 2RGUA 4AL4A 4IWYA 4GRAA 4NCHA 1JH8A 4XIYA 4Y2TA 2C84A 3IELA 1E89A 4WKBA 4FEAA 2E89A 2OT3B 3I6MA 4C7XA 3KO8A 3CLVA 3G2OA 4QL3A 2NUAB 4F4UA 4ZCTA 4J4BA 5REQB 3C6XA 1PSDA 3I2JA 1E2JA 3L8MA 5F2EA 4PO8A 5C46F 5ARDA 3WK4A 3N74A 5KHAA 3ZJ4A 4QBGB 3OJWA 3HXQA 2Y0PA 3ZCSA 3T5MA 4OQMA 3RHTA 1XD2B 1TTTA 2NSJA 2REBA 2ZRGA 5CK4A 3DTTA 1QC5B 1U8AA 4Y6RA 2O7NA 1PR4A 4HDMA 3QIAA 1Y81A 2P77A 3I2HA 3MTDA 5BRAA 4TZ0A 1MA3A 3PGLA 4Q3KA 3WDKA 5F7JA 2VKTA 3K8OE 1PVOA 1KMQA 3VC1A 3CH4B 2VPPA 2R1VA 1US8B 1KL7A 3PA8A 4F4CA 1A9YA 1ODFA 2E4XA 1KYTA 2G82A 2VH1A 1JRLA 5EGNA 2P4UA 2ZBQA 1N92A 5DI9A 4EPTA 3ZWWA 1NMYA 2P65A 3LLMA 4FT4A 2F9MA 4RK0A 1BVRA 3DBLB 4N0DA 2CWDA 3JQ9A 4BLPA 4JDUA 2J32A 4QTZA 3IKTA 3HDYA 4WNAB 4CG2A 8LDHA 4E0BA 1QVRA 5JS7A 7MDHA 2CDRA 3NMUF 1EGMB 4LQ4A 4DR3B 1WPRA 3IBGA 3R9XB 2AJLI 3VKGA 4QFMA 1RPAA 4UPDA 4ALMA 1UBOS 5JI3E 2C7RA 2MYTA 4HATA 5HIAA 4O4LB 4W5HA 2G17A 1HQYE 3SX2A 3SNKA 1QFYA 1NC1A 2XT0A 3RVDA 3CR8A 3ZJ5A 3HBFA 3H2YA 2WF8A 4RM3A 1GA4A 5DE3A 4P53A 4A8JC 4BQPA 3EGWA 1DP4A 2RH5A 2FWRA 3BL8A 2GD0A 1F5SA 1BDMA 3LCJA 1Y89A 4ERXA 4ZJPA 1K7CA 3PFGA 3EODA 4C7VA 3FNQA 3UK7A 5DHUA 2BZSA 4B85A 4AG3A 5B12A 4HDRB 2KHZA 1AQUA 3A1FA 5KTRA 3KBBA 1RADA 4ZA2A 1IE3A 4JYBA 3GELA 6REQA 3SQXA 1GFZA 2OBNA 1B8UA 4IW3B 1OI7A 2HU2A 2ODEA 5JZVA 5EWLB 3W79A 1ISRA 4D5EA 3EGXA 4KLRA 2ZWVA 1ACJA 3TVDA 4DB4A 3H8VA 2M32A 5LZ9A 4DV7B 2O05A 4GVLA 4RIHA 5ICGA 1MAUA 1Q0LA 1N8KA 3ZQKA 4KRFA 1I10A 2CLSA 1AQ6A 4A6EA 1FTYA 1JW9B 1P17A 2C96A 3AEUB 3BD6A 3EE6A 2ODBA 2YWXA 2Y4NA 1J06A 5DI3A 4LJAA 5KTMA 4WN9A 3GG9A 4JWKA 4ED9A 3I3SR 3S99A 3ZTYA 2D0OB 1P9RA 3AGQA 5J58A 2HXYA 4CHTA 2Q6VA 2YWBA 2AR7A 5CW1A 1XZHA 2PFKA 4DCPA 1YVEI 4OD0A 1AUPA 2ATVA 4MS4A 4X8OA 2V9PA 2V0CA 4PFQA 1AD2A 2VK8A 5CPFA 2DP4E 3B7GA 3JW8A 1C3LA 1M2OB 1TGYA 2IRWA 2NWQA 3VR4A 5LQNA 3DTVD 2KWIA 3CVOA 3GT4A 3LGXA 1KI6B 4LRUA 4CW7A 1W6RA 1XNGA 4B73A 5JR3A 3C6BA 3N8KA 1RLMA 2IZOA 1U2GA 1E1MA 5JTUA 2Q8NA 4LK2A 3UA3A 2C3MA 4YT4A 4BVLA 3E35A 1B26A 3AQIA 3K0EA 4QARA 5KYWB 2JC3A 5L6LB 1YS6A 4ARIA 1ARZA 2HUNA 1BXGA 3JQGA 3VZDA 2ATEA 3EF1A 1I4OA 1Y9EA 4GI5A 4HSEA 1P73A 2Y9MB 4DLUA 5K8IA 3AEXA 1UFVA 2P75A 2XUOA 3JQ7B 1OI3A 3AEQB 4DR7B 1JT9A 4XJTA 1FE8A 1LJLA 5F23A 1NVTA 3UMYA 3VR0A 1B76A 1Q3TA 3AL0C 2CHQA 4HPWA 4RY9A 1I9GA 3K4PA 1EBBA 5IJAA 2C9ZA 5EC8A 4PLGA 2PUJA 3PVZA 3TNDA 1WU7A 3MRVA 1B00A 4F06A 3WAJA 1Z7BA 1QGYA 3CLRD 4HBGA 4I1RA 3BK2A 4G1BA 3P5BA 5C4GB 2GN9A 5ALOA 5EIEA 4N48A 1CLEA 5G0WA 1B74A 1WAMA 4UUQA 2JGIA 4CV1A 1U0JA 1VKRA 4R8RA 2C3OA 3UA4A 3NCTA 3F6SA 3MTIA 4BAZA 1W4LA 3ABOB 4Z7NB 1QRDA 2ACEA 2V5UA 1QO0A 2QQ0A 3C48A 3EXFA 4O5AA 3SZMA 3VR6A 3ZD8A 5BWOA 3J81A 1S0UA 2YXEA 4Y2RA 3ZK9A 3F74A 4C4YA 4P5DA 4BVJA 4R2XA 4FHEA 2XVYA 3CFYA 5CDYA 1UUFA 4PN3A 4HKTA 1UJ2A 3NDRA 2IITA 5KOHA 4JB0A 4PU0A 3T9AA 3USZA 3C41J 2CT8A 2PZGA 1ZEJA 4NDNE 4OVKA 5IZCA 4DS3A 3T95A 2IW1A 4FYPA 3BTUA 2O59A 2WUEA 3NGMA 1YACA 2GUGA 2X0EA 3AYXB 1R15A 1M67A 1UM8A 3H18A 3JVIA 4LZPA 2WHXA 4YRBA 1FJXA 4OI0A 1FDSA 1CJVC 1L5GB 2A3NA 4JFAA 5GADl 2HIHA 3LFHA 4ZEOA 2KB0A 3PQ5A 1LRLA 3B3FA 2VP5A 3OCVA 1NP3A 5A7GA 1XXLA 3DZFA 3AHDA 2OV3A 4LRYA 2Q8PA 3RLFA 2H7VA 4HDSA 5KX5F 1UFRA 2DH5A 3U7QB 2G5CA 2QLFA 1SMKA 1YJ8A 2PNFA 2HRDA 4CODB 5C1BA 2CJYA 3DM9B 3G0OA 4HGYA 5EWMA 4H7HA 2FSPA 4EJ6A 2DBVO 5DW3A 1DTWB 1PLKA 4D0SA 3M3HA 5AKGA 2I3GA 1R66A 2FF5A 2R8YA 3VU1A 1TF7A 2VZ8A 2VF2A 3VI3B 3GVPA 5JCXA 1KKLA 2ZRMA 4QSMA 1UM9B 3WWEA 2I1LA 4WGFA 2HSDA 4ZYTA 4U9IS 3STXA 2V98A 3B12A 1WCXA 5CLJA 4YJGB 1WL8A 2ZB3A 3KUUA 4WL0A 1Z4LA 3PXCX 3UAOA 4CLRB 1JXQA 1SQSA 2YQ5A 3H4MA 4YP7A 2OCKA 3UWMA 5EL0A 3EIFA 4YXWD 5L3VA 4G5QA 1RI1A 2O4UX 4LMRA 2CLCX 4R8KA 4E08A 1VMKA 1KRWA 3ITNA 1YZVA 2ONZA 2D0IA 3NBZC 4HLCA 4RK1A 3TQCA 3O82A 3HVRA 3W5HA 4LYAA 1S8OA 1HEIA 2JLBA 6Q21A 2PR2A 2H4ZA 1R0KA 1R1DA 2ZT8A 3QYJA 4UJ5A 3ZX5A 2MR6A 4F0JA 3PC8A 5C32A 3I83A 3NHMA 1KI2A 2PAFA 1AM4D 2PGDA 1IG3A 3KTAB 2NNWB 1ESDA 3IODA 2G07A 4LW8A 4P58A 4HHEA 4KLCA 5B1IA 5FI1B 3BIFA 1KK0A 4L57A 1NMZA 4KLNA 2PXAA 4J6FA 3WYNA 4AJNA 3KKNA 3QX3A 1BRTA 3IQIX 1NSYA 1X1EA 4Q7EA 1FP4B 3S2FA 2QT0A 3D7SA 4B5LA 2ASEA 3PXEA 5J4VA 1ZW1A 2B98A 1Z5GA 3EWSA 1C5KA 4K81B 1IPEA 4HWOA 4G0VA 1UFOA 4RVCA 4TTSA 1Y4DE 4QUDA 1FNSA 4W82A 3OLXA 1Q1GA 5ERGB 3MMSA 4O2AA 3K32A 2F3QA 2QGZA 2Z9CA 3CG4A 4PZZA 3VPCA 3IXLA 2WWIA 4H0NA 5C80A 1X7GA 3NAGA 3PUIA 1Y1TA 4GI2A 4TMFA 4YBRA 3AUYA 3FCYA 2HL6A 4GR9A 1U4SA 4XLTA 4A8JB 1PS9A 2CWWA 2W8BA 1HL3A 3D7KA 2WB4A 7REQA 2A33A 3GUYA 3GZNB 3IP5A 1N3LA 2BZ1A 1GT6A 2F3UA 3E48A 4GX1A 1Y33E 1SUSA 4BB6A 1GG2A 1JFFA 1EJBA 2PLAA 3RS7A 3EA5A 3KJNA 3PUVA 3R3YA 3UOWA 4DIDA 4DUPA 3ZWAA 4GEGA 4A8TA 2GPWA 4DRXA 5CIQA 3UWDA 5EJFA 4MB0A 3QG1A 3SFZA 4DWVA 5BQFA 4AUEA 4TWIA 3SQOA 1PQWA 2A7QA 1LDBA 3JYOA 3LT2A 4JC4A 1Z2CA 4JBHA 4KR0A 4F6RB 4X24A 1SQ6A 4ZGGA 5JMWA 3TDMA 1DKUA 3CE9A 4RK7A 2OXRA 3H11A 3G88A 4PFJA 3OTWA 3M3DA 5FOUA 4BMNA 5I4IA 5I9TA 4RPIA 3F6CA 1JDVA 4K0KB 4OQQA 1TF2A 4CDRA 4YV1A 1FFDA 1JYEA 3ED1A 3T7AA 3I34X 5DOZA 4QIHA 3WK5A 4BVEA 4IEEA 4CT0A 2BYTA 3QHPA 3AONB 1GGKA 3ZJUA 3OEWA 4TKUB 5TMPA 1NURA 3DDHA 3JQEA 4M22A 5AQ1A 1CZKA 1Y3IA 3TUIC 3BMOB 3L0ZA 1DCTA 2YVUA 2NYRA 4IJVA 5DISB 3CEJA 5FTJA 1DAOA 1DQZA 4Q4AA 5HE8A 5KTKA 3VPFA 1DAHA 1I7QB 3H1AA 1NNI1 4B7ZA 5CB4A 1VPWA 2GASA 1T9ZA 3KE9A 1Q7CA 4J7CA 2GBIA 2IV2X 3N7TA 3LPMA 4HAWA 4N5NA 4KYVA 5LP6F 3L6OO 3LCVB 4DB2A 2BFOA 2GPTA 1DFIA 1HPLA 2I7CA 3D3JA 3TBHA 1JEDA 2PJDA 4QUGA 2OCGA 2XCTB 4RZ2A 4C5AA 1L1QA 2OO3A 2Z5FA 3WWPA 2P5UA 2CFOA 2VL7A 1UPXA 2H07A 4QPZA 4JEIA 5FNVA 4V1CB 4FCTA 2O7SA 1IBLB 1XT6A 1Q1QA 3M9XA 3A8TA 1TT5B 2GZMA 2L17A 2PX8A 4HS9A 3W9SA 2BGWA 1KA9H 4PR3A 1Z12A 4JAVC 1D6SA 2V45A 1ZVJA 4DR5B 3EZ6A 2JD0A 3DQZA 2JJYA 3QGMA 4EJSC 3GT3A 2LDBA 3GRZA 1ZMOA 3PI6A 4KQ1A 4NLLA 1H4TA 2NUPA 1QFMA 1TMGE 3F2IA 4P80A 3T9FA 4RTMA 3I9OA 2D06A 4PO9A 3VR4D 1Z2EA 2NQ8A 1NYTA 2WAAA 5KYNA 3MHTA 1T5DX 4BMSA 5AFSA 2AOUB 3WQHA 4BRWA 4QQFA 2PKRA 1ZY2A 4KBFA 3WYDA 3N6VA 3DP7A 2IHVA 1FFXB 5L53A 4XR9A 2OHXA 1UBNA 1CRZA 4NC9A 4B9AA 3WRXC 1U81A 3RVQA 4QGFA 3MELA 3F3KA 3BCRA 4N6GA 2DR0A 4CMAA 3FLMA 3C98A 3D9QX 2ZWPA 3MCVA 2W71A 1Z5UA 4GKVA 4QQNA 4QSHA 4YUAA 5A7FA 4KR6A 1QRSA 1ECJA 2ZIXB 3GA7A 1E7MA 1KQ3A 1Y6RA 2G71A 4K9MA 4V0LA 2Q0SA 1IZ7A 2Z95A 3DOOA 4MVCA 3OIUA 1KVSA 5BVGB 2NAFA 1KY2A 3PICA 3AUUA 1DOZA 3RUEA 1BOFA 4IXDA 3VOTA 3U7HB 2JHCA 3M1AA 5KDDA 1XKXA 3N8IA 5DWDA 1EDBA 3KAQA 2QAGA 2OBLA 5F3WB 4JC5A 4ZODA 5EINA 1Q1EA 5I6DA 4I19A 4A0GA 2XVZA 3HNPA 4C7MA 4CKXA 1NQOA 5KC9A 3M34A 1CYEA 5LR6A 3NNDA 1JIJA 3SXJA 1JDNA 1RWPA 3C5VA 2DPHA 1V96A 1P9WA 2R66A 1IEQA 2ZDGA 3AV3A 3PLNA 4MK4A 1KP9A 1NJ8A 1JXAA 1P29A 1Z4KA 2YBEA 5LXTF 1FDVA 4FSXA 4OK3A 1QO0D 2PD6A 4X6LA 5WRFA 3VR6D 4DLBA 4EB6A 2C3PA 5E4YA 3ECSA 4JXKA 4RHEA 3H9QA 4B3FX 1OLUA 4AMZA 2FPLA 4KEAA 4QJIA 2D13A 1ZONA 5BSKA 3A26A 4XCVA 3Q9UA 3ICQB 3ROKA 2Z3WA 3CIOA 3G02A 1J97A 4P4SA 2Q6IA 1KSHA 2BWJA 3LUCA 5F1PA 1JMKC 1R5BA 2HWUA 3T7SA 1A4IA 1YCDA 4CCWA 5HBRA 1FS5A 2AVNA 5KOIA 3Q2KA 5KYXB 1P4AA 2FX2A 3HL4A 5AKKA 5EE1A 4D4MA 4LKRA 4HQNA 3GBVA 1X92A 1I2ZA 2AXNA 2YWEA 5ADVA 4R7ZA 4X41A 2ZUVA 2D1QA 1KYVA 2REQA 1GRCA 3TZQA 1XJWA 2EP5A 1RAAA 3NBAA 2RK3A 5IT5A 1V16A 1TZKA 4L9WA 1O8CA 2DULA 3CW9A 1TQ4A 1WTCA 2ERYA 3T9DA 1J8YF 2O6HA 5D7NA 5AJVB 3QVTA 3VPAA 1W96A 4CMKA 4CJXA 4MH0R 3W5UA 1JDUA 1RACA 3C3PA 2BFWA 2VEDA 4IKEA 1Q91A 2R6ZA 2YWCA 2Q0QA 2ZBRA 1X7ZA 1RT9A 2GEJA 3PLAE 3QVGA 2O2SA 1TM5E 4YI5A 5LUBA 1E2LA 1QOPB 2PGOA 1FLNA 2A6PA 1MABB 3EIOA 1EE1A 3V32A 2FSVA 4KR9A 2E2WA 1JDZA 4TPKA 5JZMA 5AM5A 1YBVA 4F1WA 1ISGA 1STOA 4KGVA 5K3DA 3UJ8A 4S1WA 3CVVA 4WQMA 2I67A 4QPCA 3SKVA 3UMFA 3LHIA 3DL7A 1DV2A 2HXGA 1JLHA 2OORC 2QTFA 2X19A 4IHJB 4WGGA 4Q9HA 3RT1A 2OHVA 4TXLA 3SBOA 4MMXB 5FV4A 4CQMB 1FU8A 2XUZA 5I7AA 2I6UA 1KPIA 1K2WA 2FHSA 1HETA 1NP7A 2G08A 2IPNA 4AJ1A 4DABA 4IEIA 2QY9A 3S0JA 1IZ9A 3QFTA 4MMZB 1Y4ZA 2BGKA 5KVAA 5M34A 4CIWA 1SELA 1FUYB 4YCAA 3TIIA 4IHAA 4Q4JB 3WS7A 1ULSA 4ARSA 4PSAA 4DXAA 1TW2A 4FBMA 2G09A 1QZZA 3C8UA 5BSHA 1WPGA 2J3LA 3IUJA 4CU5A 3AEKA 2IYXA 3JAMA 4MKIA 3BCUA 3QBJA 1USUA 2EQBA 2P8JA 1PV1A 4P7JA 3L3BA 3RC9A 3VZSA 3ZUPA 2GRJA 1EFVB 4LBWA 4CM9A 2QDXA 2IHJA 4H1UA 1KR5A 2CDCA 3AESB 3D7RA 2BMJA 4RMNA 1IN4A 4DM3A 1O0BA 2NPIA 4ENPA 3LPDA 4I8DA 1EFUA 2GM5A 3K71B 3BBPA 3RKSA 5B7QA 1UKAA 5L3SA 2MINB 1XCJA 4X64B 3EGEA 4I5DA 1MB4A 5ALSA 3H65A 3I5MA 3G49A 4I6JA 4GR4A 5INTA 4EGCB 1NW7A 1IBSA 1YZTA 3PEEA 2RGEA 2XWQA 1KO5A 4RZXA 4UBKA 3TG8A 1EP9A 4GD3Q 1LI7A 2OQVA 1OSNA 2VK2A 3TD2A 5DPMA 3JWIA 1NQAO 1HA3A 3Q7RA 3VPSA 2YQ4A 4MW1A 3EVAA 1NQVA 2I03A 2FZ5A 3NWJA 3TXYA 3TQHA 3AETB 3L4BA 2UZIR 4IHQA 4Q93A 3F2VA 1NTRA 3RR2A 4JI0B 5D5PA 2FWAA 3PHCA 4EGJA 1CT9A 4QGAA 1UANA 4X8HA 3M9WA 1A9PA 1F4VA 2WINI 2C5SA 3EZ7A 3RVJA 3NEAA 4OUDB 2HMAA 1JSXA 1WBDA 4M4SA 4XWWA 2C2BA 1JR2A 1OVGA 3RV4A 4FC6A 3JYPA 2ESRA 1OA0A 4EKEA 1FTNA 1MBZA 2HHHB 1M5UA 1NV9A 3DWFA 2P68A 4DCTA 2ZQ5A 4W1SA 1U0NA 2ZSHA 1I36A 2V65A 4WUTA 1FVXA 1P5RA 2VTDA 2WM2A 1XNHA 1TVCA 3B1FA 4HZGA 3IURA 5I47A 2A86A 5TQ0A 3PEVA 1RWMA 1B1AA 2VQDA 4AI6A 1G3MA 1K0UA 1MC8A 1D07A 2QUJA 1ISHA 3MAJA 4GGPA 4PZPA 1TLTA 3GUCA 3EXIB 3AF1A 5EHXA 5EWJA 3Q40A 5D00A 5IT0A 1E2PA 2LRHA 2O0HA 4GX2A 1Z8DA 2BGTA 2GFQA 2VNIA 1XVAA 4FMPA 4JI6B 1DEKA 3JD2A 1QZXA 2GEVA 3GJZA 5L4NA 3NO4A 3EB9A 2FQ1A 4OMUA 3LT5A 2YRWA 3LGAA 1E2MA 3L1UA 1F0NA 3LAWA 3PFBA 5EA2A 3RIHA 1W88B 4MUXA 5I4KA 5EMHA 1OFUA 3WRYA 2WNSA 4ZANA 3VAAA 5BYJA 4YJKA 1VSQA 2HLHA 2OG1A 1YS1X 2PL9A 3G8BA 3HCCA 3KSDO 2FF7A 2IEIA 3MGGA 4M3NA 3NPMA 4KXFB 4OXRA 5TMDA 3J81k 2NVOA 1G3RA 3EXG1 1AE1A 2P2DA 2ZR9A 3TW8B 3RDPA 3Q5EA 1N1EA 2R62A 2PKYX 3U4QB 1RQPA 1Y7IA 2W2KB 3MTBA 4MQEB 4DMGA 2C2ZA 2H1HA 1WDKA 4EG7A 5IC6A 2ZCJA 5ICCA 5F3RA 3NATA 4CEIA 3Q3CA 2FLVA 3OJCA 3OQNA 1FDWA 2YTZA 2YINC 3IQXA 1RHRA 1YRHA 3G59A 1OBCA 1N2IA 5BQXA 1QP8A 3O74A 3ETGA 4MRAA 4HNSA 4AG6A 3JS5A 4BRZA 4MRNA 1BDIA 3T5GA 2PUGA 1K8RA 5LP6C 4LYDA 5BUCA 2XCIA 3QKIA 4PC2A 5ALQA 4RJTA 1DG1G 2K2QB 3JZAA 4CCYB 4DEVA 1OZHA 3C6KA 4KUEA 1SBTA 4B75A 2Q3MA 4LI3X 4KXVA 1HRKA 3GO4A 3LCUA 3T34A 5KU7A 1LKZA 5SZJA 5C1DA 3G0HA 2DWUA 5E1OA 1N7GA 1A8HA 1T13A 4LGVA 4BYMA 4YMIA 2DTXA 2WF6A 3HSYA 5CX1B 1R4MA 3B6ZA 3QH4A 4ZVNA 1ZITA 3A0UA 1C3EA 2R79A 3K8YA 2WJIA 3MWFA 4ZVMA 1QQ6A 3OQPA 3PKZA 5KTYA 4H1WA 1DQNA 1PL7A 2NU7A 2JFBA 3OTIA 4NOJA 2ZJ2A 3ZIDA 2X8LA 5C37A 2LGJA 5TPWA 1SVWA 2BY4A 3LUAA 2C2MA 4H6VA 3WZLA 3ZLJA 1XOIA 1IZYA 2CGEA 4EG8A 2DJ5A 5JADA 1RM3A 1WQ1R 4G5XA 1SG6A 4QUAA 2NZ2A 5IK2A 3TDNA 2WFZA 3TGPA 3VR5A 2HSEA 1Z35A 4UE2A 5H59A 1YVPA 4E30A 2CLIB 2QT9A 4OQXA 2UYHA 1TXGA 5A4IS 5SZIA 3W4KA 4DGQA 2XUGA 4B7XA 1H9AA 1SUPA 3A10A 1W9HA 3R0VA 1ZGAA 2J1LA 2J7KA 4IIDA 3FSRA 1BHJA 4TXMA 2V5AA 3FWHA 4F5DA 4O6VA 4LTMA 1ZC3A 3VO8A 1VJCA 2Q62A 3J7TA 2HYDA 4JA0A 3CLSC 4MUIA 3RSCA 4C1NA 1L5QA 1XAHA 3WLFA 2APJA 2CVFA 2BEWA 1ZK0A 1GUBA 2E1RA 1ZUNB 1QYXA 5DP2A 3QV1A 3DZJA 4IRUB 1S89A 4BO0A 3EX7C 1T6NA 4X7PA 1KS2A 3QE2A 1E5VA 4MQFB 2NU8A 3T61A 2ZKIA 1HKHA 3MIIA 5EPOA 4A6DA 3WIDA 3UUFA 1EVLA 2YXLA 2E87A 2H2FA 1ZJYA 4K26A 3F46A 2GLUA 5BN3A 3W5AA 2VJMB 2XY4A 1YI8A 2J87A 3CLTD 4L73A 2IXBA 2JFPA 1QYRA 4N7JA 5TF4A 3SMQA 1NBOA 1Z7WA 3QVUA 2BFBB 2VWPA 4LA4A 4ME6A 3UW1A 5JS6A 4ZYVA 1BU8A 1NW5A 4AZ3A 2AMFA 4N3NA 4BFZA 1YUNA 1EK1A 4IILA 1DOHA 1WMBA 4GECA 4N8SA 5KYYB 3JQRA 3M1IA 3EEFA 4U7DA 2EZ8A 1HH4A 1ZS9A 5LOVB 1L4NA 1YQEA 2P2LA 5LMNB 2EBWA 3EXAA 2D3WA 3H3JA 4YQFA 4J0IA 3JPYA 3VSBA 2J45A 1XELA 1SXGA 1H6DA 1ZSVA 4KRGA 2X5JO 3C8DA 3V8RA 1K6JA 2QENA 3EQ6A 1YR6A 1H5QA 4IGKA 4TTVA 4WZBB 1WXQA 3T5TA 5B4TA 1IQPA 4F46A 4Q03A 1Q16A 4PZDA 1JKXA 4L8GA 5I7FA 1NWHA 2JAOA 1VA4A 1SQ5A 4JYMA 4HXGA 1QRTA 4DREA 1KRXA 2HFKA 1CE8A 1R37A 3B8EA 1AB6A 3N0VA 5B4VA 2NQTA 3HJBA 3L0YA 5KO2A 3R24A 1BVHA 3O31A 4ENSA 3LL7A 4YDQA 3FFXA 1M83A 2ZYSA 2GLTA 1C29B 3IAM6 1TE2A 3KYDA 4FYVA 4RNCA 3TGWA 4EY4A 3CTMA 4RHXA 4PYOA 3NBYC 3H2KA 5ER9A 2FAXA 2ZRLA 4JVSB 3VNRA 1RWBA 2CCJA 3O1LA 4UNPA 3SLRA 4WXMA 2AD5A 5JJLA 4CLHA 3TQOA 1SIBE 2JEYA 1O9GA 2O5VA 2WJ4A 3JATB 3LBNA 1P0FA 4QEZA 4UXIA 3TLGB 3TX6A 2AZDA 4OLBA 1ZX1A 4X20B 1UXHA 4KXXA 3RBZA 2YRXA 3CUVA 1ZJZA 2P5SA 2A78A 2WSIA 5HG0A 2L69A 1Z0JA 1NVKA 5C3MA 4ZCQA 4MUHA 4EI8A 1J7KA 3CWQA 2BFDB 3C7DB 3DCIA 3CF2A 1G64A 2C4VA 3KKMA 3O03A 1JHUA 3QU5A 4G07A 2IU6A 2Q4BA 1NDUA 2QTCA 5TQJA 3V2IA 3O8RA 5F5LA 3TD9A 1XDGA 4NU5A 1E7RA 2OFWA 3PVSA 1YZHA 5DTEA 3VU9A 2FV8A 1JJIA 4INZA 5DVZA 4LI0A 2IZ1A 1WETA 1AUXA 4BQEA 3ADPA 1RXEA 1S2MA 1TYDE 4HUJA 3TE6A 5JFOA 1CSEE 4TQUS 1W93A 4FUTA 4POAA 4WK6A 1DFGA 4HNAA 2FFHA 1ZQ1A 3TLJA 4EYSA 1IRXA 2UYOA 1XAJA 1D1QA 4BE4A 3C4QA 4Y2JA 1FMLA 5GWXA 1WX1A 2LZ0A 5GM1A 4BGDA 2GJ9A 2B5WA 1VP3A 3PBKA 2W6QA 1OX5A 1UZMA 4G9GA 5H5JA 3H97A 1OIVA 3D6FA 1NRJB 2CVHA 5DHPA 4TTQA 3LK7A 2PO5A 4ZC1A 2QLBA 1XN1A 4C3UA 4F56A 5C7LO 5EXDA 2YJGA 5T41A 1TQ6A 1DAGA 1PWEA 1Q7GA 5BSVA 2H1IA 4D0GA 1CDEA 5ERXA 2J67A 2Y1OA 1EWRA 4PIPA 1DWPA 5J2UA 4TKMA 2VBCA 2AYZA 4TLMB 3V8QA 3A9WA 3RSHA 4PQFA 4DIBA 3N2IA 3A6PC 1UPAA 2H4FA 5CRIA 4C2BA 1K3UB 3HKEB 3CRQA 3FF4A 1B7GO 1I1OA 1M1UA 2I2BA 5AH0A 1XZAA 5DHTA 3L5KA 3W5SA 2NLOA 3OQHA 4MO9A 4UOEA 5EQTA 2GEUA 3A28A 3AR4A 3FKJA 3ICVA 3O1IC 3R5FA 3QELB 4M1TA 2P2SA 2MDTA 4FYMA 4EA6A 2O54A 2IYZA 1TD9A 1P9LA 1TCUA 2ZE5A 3RW9A 3D64A 5DW0A 5KVVA 1YVRA 3BFJA 2QUHA 2OQ2A 5GPBA 2V1UA 2QNBA 3ZDYB 3S2YA 1KHHA 2VRWA 3CF4G 2FRVA 4MKZA 2GDJA 4WKGA 2GBLA 3LQ1A 3T9CA 4JT9A 4DNXA 4EUNA 4DUZB 1ZI9A 3C5CA 1Q2UA 4HS4A 4YP6A 5G1OA 1N6OA 5AHRA 1K89A 4RZUA 3SJAA 3KBOA 5D3MA 4KW7A 4HQFA 2Z2YA 1LV7A 2KJQA 1I5RA 1FFSA 1ZH4A 2FN3A 5E9QA 3TW4A 5IWAB 1G8MA 1KYQA 1ZK4A 5G0TA 5EPUA 1QK5A 5EKSA 3UT5A 3I6BA 3CRVA 4LF9B 2UYCA 2CLEB 1BX3A 3Q7TA 2R60A 2X8JA 1QSGA 3HA5A 5F1KA 1HEUA 4UAUA 1O94C 4IVRA 2DVMA 2BEUA 1HL7A 4YECA 2WTAA 5BSMA 1QZTA 4OSEA 1K7XB 5KJ1A 4ND6A 1E20A 4MDYA 1K6XA 3I37X 2PGLA 3W6UA 2RHJA 1RE0A 1YOVA 4LBVA 1E1QA 2QP3A 2BAGA 1X7WA 4WDRA 4OHZA 5K7SA 4N39A 3KZXA 4EFKA 4TTAA 1COWA 2W90A 4UUPA 1M0SA 1Z4QA 2PS3A 2PH1A 3AFMA 3IB6A 4OP1A 4GR5A 1JLLB 2RBEA 4C0AC 5A9TA 3IIIA 4XYEA 2IYYA 1XLVA 3F4KA 2Z6QA 4E5MA 3P2KA 4BVBA 1CUJA 5LWHA 3R3UA 5FUWA 5AOCA 1Q11A 2RE8A 2QD5A 1GTJ1 5DKFA 1AV6A 1OTHA 1AUVA 4MYUA 2EDAA 1AA6A 3HADA 1BXRB 1T10A 1FVHA 3D0RA 3W6ZA 2EJWA 3PDWA 1I6WA 4MO2A 4ML3A 1YS2X 2V7PA 3SE7A 1U0GA 1DAPA 2OAEA 1NXQA 3AR3A 1HZZC 1U9IA 2G76A 4GKAA 3T7RA 4AROA 5IFLA 2RH4A 5HP4A 1SKMA 3NYIA 1OQAA 4HX9A 1JDSA 1EGHA 3JQBA 4M0CA 4Q21A 5E7JA 4J7AA 4GPBA 2WHEA 1YA8A 3MJTA 2YJ5A 2C7VA 1BE8A 3D5EA 1FFBA 4P2BA 1U7PA 2J0UB 3ENVA 2G8LA 3G0GA 3HCWA 1XHFA 3PX7A 1Z37A 2C42A 1T3ZA 3K0AB 4WE3A 3P9RA 1XDDA 5CFMA 2JBAB 1Q15A 5M5BA 1ZKMA 3VC7A 1K5GA 4EEXA 4KAAA 1K1EA 5F5NA 4HDQB 3S70A 4ZT7A 3K94A 4O4JF 5FIUA 3RYCA 3DYBA 3SK0A 3IAFA 2IHBA 3UXEA 1JNYA 1PJTA 4PAOA 4PFKA 4XQCA 3VR5D 1KMNA 2WOJA 3K09C 1KNXA 5CVJA 3MJHA 3TSAA 2X8WA 2Z2KA 5ALYA 3CF4A 4FB5A 4PIVA 4D92A 4AMVA 3H0CA 1KMHB 3UXHA 2RHWA 1DARA 2Y2UA 4NYIR 1KAQA 3LWNA 3BGDA 1L5NA 3RS2A 2VDJA 5T4EA 4FE3A 2B30A 2DPYA 4B2PA 1A3CA 1L8XA 1Z62A 3ZI0A 1NBHA 1Y5LA 3G8YA 4PQGA 2Q4OA 3MGCA 4CI0B 4BJ5A 2B92A 3ZU5A 3DAGA 1GZ3A 4XQGA 1KAMA 4DL9A 1BNCA 2RCNA 3D31A 4JYZA 2L18A 2ZG6A 1OOEA 2FZ4A 1QO9A 2OWEA 3MBKA 4HFRA 5JSUA 2A5FA 1FK8A 4IDHA 1JFTA 4U8GA 1UEXC 4DMLA 2W4QA 3SOPA 3M6VA 4REMA 4BPRA 1REQB 2A1UB 3PNMA 3ZNQA 3N39C 1ZMXA 2PYZA 3BAZA 2PQ2A 3MWJA 2HT1A 3SYNA 3WXMA 4CLDA 2NZUG 1T8RA 2ONKA 3I0MA 3NUZA 1UOPA 4ZPJA 4J07A 4C2AA 1GGNA 3RF6A 3AR5A 1YR7A 3PIDA 2Q5JA 1JU9A 4N47A 3A6LA 2QN9A 3OHMA 4H3SA 4P4TA 3CKMA 3Q5DA 3QJGA 4RENA 2OBXA 3NVKI 1KFEB 2IOHA 4WPGA 3QBEA 3CO5A 1E63A 1JDPA 3LKVA 4MUBA 2HM7A 3W78A 4CKEA 3LK6A 3OIVA 3OOYA 3FHTA 2WICA 2Z5VA 5BW5A 1SQFA 3GFFA 2COKA 3F0TA 1CKEA 2JI4A 1GZ6A 2W2NA 4QHSA 3ANMA 2JZOA 3VVLA 1E6WA 2W6OA 1YA6A 5F73A 5E7QA 1MEOA 4HGNA 4MRRA 1YNSA 2IIVA 2X2FA 3NBUA 4ADSG 1XTUA 1FTSA 4UW9A 1JQAA 1E4VA 1EFHA 1HTWA 2AWOA 2RG1A 2WUVA 4IXNA 1BWSA 4BDSA 2A57A 4CNBA 4UU8A 4DDTA 1EFDN 4KTTE 4A0QA 4PSKA 1K06A 4HP8A 3LT4A 1OXVA 4XM2A 2X8AA 2CBGA 4GOMD 3DHVA 4JZYA 5KB3A 2VP3A 5U9CA 4U02A 1XNQB 3WMXA 2ORVA 1KP3A 3KC2A 2AOTA 1EDDA 2GYWA 3BYZA 1BG6A 3CUWA 3F7NA 4LECA 1N5RA 1TPYA 1DQPA 1SBYA 1DOAA 5L4SA 2LE0A 2WC1A 3I6ZA 4RSRA 4R83A 5BR8B 1X8LA 3OKCA 2GJKA 4V39A 1BRMA 1QAOA 2G4VA 2XR1A 2GMWA 4XSHA 4Q7QA 2B3DA 3MCTA 3DMRA 2JFOA 2W6MA 1SVUA 1H2YA 3IT0A 3QQ5A 4Y6LA 4HWSA 3SZOA 2VLBA 3VAZA 3VKFA 3IP9A 3FGZA 2WTBA 1JILA 3HRHA 4DLRA 2DUUA 3LXXA 3SE0A 1ESEA 1W1WA 3OQBA 2HA0A 4IUCS 5LZ4A 4Z8XA 4YAIA 2NGRA 3IYLW 3GDOA 4MOWA 4MVJH 4QPJC 5BNWA 3GUZA 4PZ0A 1T9HA 3A11A 4Z7OB 4IOLA 4AKEA 3LHKA 4DA7A 3D0KA 3SZLA 3GJ4A 2XAUA 1XLUA 1CJSA 3EQ2A 2AK3A 2C54A 3HLKA 4JUBA 4KQGA 5D84A 5H83A 1J25A 3RVLA 3WB1A 3RK1A 3NWEA 4D96A 1QK4A 2IDZA 2YZKA 1MW9X 1MKYA 2XWSA 3SS8A 5F35A 5D5HA 1DRJA 5DNVA 4BFSA 1ZYUA 3WFIA 4YHBA 1BCSB 4PR0A 2TMKA 4DLPA 4ARAA 3P52A 2R6DA 3FDFA 5CR9A 1CC1S 3NAQA 4DILA 5M04A 3EUFA 1RAFA 5A4AA 1HDEA 4ZGWA 5I7HA 3TD6A 3PEWA 5AESA 4NARA 4QREA 4NAUA 4BNWA 5HM6A 1CF9A 1DX4A 2F1JA 3SXUA 2G0NA 1YH3A 2BKXA 3T0GA 4EL5A 3LS2A 4TUYA 4CMEA 4YJFA 5HRCA 2ZYWX 1ODLA 3PUKA 4PXYA 4R1NA 2YXNA 4DXHA 4E51A 2YJ4A 4UM8B 2XTZA 2FFAA 3LBFA 4GO1A 3ITKA 2VXCA 1P5HA 1AZLA 1GU1A 1H2EA 4QVKA 5ES4B 1S7GA 1GNQA 1ZD3A 3S3TA 2NYAA 3AL2A 2P4HX 2H0QA 4OV6B 1UFKA 4XPIA 2A5JA 4EA7A 1VOTA 2NVUA 3AR6A 4GX0A 1CUDA 1I2DA 3KEQA 1G21A 4YCBA 3SIWA 2NXNA 5ALFA 2BR3A 2H3HA 4TYNA 4ZYYA 4DLZA 5CEEA 4DDHA 4YMUA 1QIKA 3H6KA 1BO6A 2DCUA 4JL6A 4FN4A 3SQLA 5JXHA 3QLVA 2J8ZA 1NYRA 4MGKR 5SY6A 4C7KA 3HM9A 4IJ6A 1QH9A 4XVCA 5LYJF 1Z25A 3V1TC 2Q5FA 5DP1A 1XMXA 2CUZA 4M76B 3V4OA 3O4VA 3MJCA 4NXMB 2WJWA 1LBEA 4XVQA 4XVUA 3ZXIA 3R3JA 1H1LB 4QOGA 2F3TA 1JX6A 2OAGA 4LDAA 5FWYB 1PGNA 3QF7A 5IKMA 3TSOA 2B8WA 4W5NA 3AFOA 1P0CA 4YT2A 3KETA 1GUDA 2ZKLA 2RGDA 5A05A 2V8BA 4A16A 3R3SA 1DKQA 4F1JA 4JIMA 4Y2PA 1LH0A 1NJ6A 4GC5A 4Z4GA 1X7YB 3VPDA 3ZDDA 1K3TA 4BP1A 3QU7A 5LDDC 2VOEA 3LDUA 1HFJA 1JAZA 4KIGA 1QDLB 4C4ZA 2NU9A 4DUGA 4Q7LA 1A98A 5IVPA 1E1QD 4M8KA 4NZMA 1MUUA 2X22A 1BKDR 2ZS9A 2Q5QA 3AUTA 4ZOAA 5DBEX 5I5GA 4AULA 4BKQA 1DBVO 1COWD 1RHQA 3U62A 3UC5A 5D7BA 5DRYA 1NVWQ 3I6IA 4ZTUB 1CUCA 2EJTA 2X9QA 4UUMA 5AVSA 4F04A 4JNCA 2VBFA 3R09A 3AP3A 1V6SA 2BC9A 4QUKA 2ATXA 4BFLA 5CT8A 1DVRA 2PWZA 4FGJA 5ALDA 3PI7A 5HF9A 1E2HA 2H1VA 2LUOA 3URKA 4C5CA 1KO1A 4LF6B 3AEYA 1QX4A 1RJ9B 3DT9A 3JQ8B 1NMXA 1H1TA 2HEGA 2B8NA 3ZWYA 5ALWA 4J2OA 4NZOA 4CL3A 1G6Q1 2C9BA 4CCSA 4FDVA 3VDMA 3ADBA 4BAUA 2WD9A 1SCDA 1DV1A 2PL5A 4BIIA 1DJPA 2BTOA 1W5FA 1VZ2A 1W94A 3QMPA 1UKZA 4ZJZA 3CNOA 5DTJA 4AS1A 2Y05A 2VJLA 3BGWA 3VYWA 4EZIA 5EMMA 5I9SA 5CAEA 2UUAB 2CVPA 2WJPA 5IN4A 4KQJA 3M5DA 3MB5A 4RLHA 5A6VA 5GIOE 3L4JA 3DCYA 4MJ3A 2R84A 1IHDA 5CNJA 5DYWA 4AZWA 2PV7A 2B3TA 2AIRA 4TSRA 4L4XA 3X1XA 4FJ1A 3R7WA 1I5OA 4B79A 3UJNA 2H5LA 4CMJA 2ZAGA 4ZHQA 4XYGA 3WOVA 3WQQA 2DRIA 1DAKA 1YT5A 3BMNB 3EAQA 3PWTA 4H15A 3ENZA 4HBZA 4A73A 4DBZA 3DL4A 5KSWB 5DJ5A 2R8EA 1SZDA 3EIEA 1MJGA 3ZVMA 4BO1A 4AMGA 1EWKA 2OV1A 2O3JA 1YZNA 2ZRCA 3ESCA 3KD2A 3PEYA 2VG8A 4AWBA 4YRKA 1RC8A 2WQZA 4Q6WA 1WNTA 4YMVA 1TK9A 3REFA 4CKWB 4WI1A 4IX9A 3UKJA 3K4HA 3DD5A 1QRAA 4UM9D 3L7KA 1MVLA 2ERCA 2QF7A 4DPMA 1EFRA 4YC7A 3IBTA 1YA4A 4UDNA 1W36C 2H9AA 4FN5A 2F9FA 3ZD6A 1W35A 4FOSA 4OHKA 3B7PA 4CGYA 1WXFA 2A3RA 5H1YA 4CG1A 5JJCA 2GTHA 1B8OA 2XND