2XYPA

Caspase-3:cas26049945
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xypA00
5LUAA 1I51A 4D3ZA 5IARA 4ZVOA 1RE1A 3PD1A 1RWWA 2HBYA 4EHDA 4I1RA 2H4WA 4JJ8A 4ZVUA 5IABA 2J30A 4QUBA 4HQRA 1KMCA 1RWPA 3BIJA 4ZVTA 2C1EA 3GJSA 5I9TA 5IANA 1SHLA 2H65A 2CNKA 5I9BA 1SC3A 3V4OA 2H5IA 3E4CA 2QLBA 4QUJA 2QLJA 2XYGA 3H0EA 2CJXA 2P2CA 2J33A 3NKFA 2XZTA 4IEFB 5H0IA 5IAEA 5IBCA 3EDQA 3H11B 3PD0A 3V3KA 3DEIA 1RHRA 4JR1A 1SHJA 3UOAB 4JB8A 1NMSA 4QU9A 1PYOA 4PS1A 3P45A 4JQZA 4N7JA 2C2OA 1I4EB 3H1PA 4EHHA 4NOMA 2WDPA 3R7NA 3R7BA 1GFWA 2C2KA 2H54A 5JFTA 3KJQA 4FXOA 4D3XA 4DCPA 1RWVA 3R6GA 5IC4A 1RWOA 3D6HA 2H51A 4EHNA 4IYRA 4N6OA 4LSZA 3KJFA 2HBZA 4PRYA 4QUHA 5IBPA 2CJYA 4HVAA 2FP3A 4QULA 3IBFA 5LUBA 4N6NA 2XYHA 4NOJA 1RHQA 4QU5A 2QL5A 3SIRA 1RWXA 5IAJA 1QTNA 4QU8A 2AR9A 3UO8B 4EHAA 1ICEA 1GQFA 4AWAA 1QDUA 2FQQA 4QU0A 4QUEA 3R6LA 4EHKA 1SC4A 5IAKA 1IBCA 2DKOA 2HBQA 1CP3A 3IBCA 3ITNA 3V55A 1BMQA 1SC1A 3EDRA 5LU8A 4JQYA 4ZVPA 5IAGA 1I4OA 3GJQA 1RHUA 1NW9B 4JJEA 4N6GA 4HQ0A 4AWBA 3NR2A 4ZVSA 4NBLA 1F9EA 3KJNA 4N7MA 3V4LA 4QUIA 3GJTA 4M9RA 2CNOA 4EHFA 1K86A 1PAUA 5LU9A 4QTXA 4JR2A 2H4YA 3QNWA 3DEJA 3R5JA 3S70A 2HBRA 4DCOA 2XZDA 3V6MA 1I3OA 2CNNA 4NOLA 1K88A 2J31A 3DEKA 4NBKA 3K7EA 1QX3A 1RHMA 1JXQA 3R5KA 3GJRA 4FDLA 4ZVQA 3S8EA 4NOKA 4FEAA 4QUAA 4FGUA 1M72A 2C2ZA 3RJMA 3H13A 5K20A 2J32A 4JJ7A 5IBRA 1NMQA 4QUDA 5IC6A 3D6MA 1RWKA 1NMEA 4D3YA 4NBNA 4QUGA 1F1JA 2XYPA 3NS7A 4QTYA 1RHKA 1CVRA 4PRZA 3SIPA 1RWNA 4PS0A 4DCJA 3D6FA 1RWMA 2C2MA 2CNLA 2H5JA 3PCXA 4AW9A 2NN3C 3V6LA 2FUNB 4EJFA 2CDRA 3P4UA 2H48A 2QL9A 4ZVRA 3R7SA 5IASA 3DEHA 4N5DA 4I1PA 2Y1LA 2K7ZA 4JR0A 4EHLA 2QL7A 2QLFA 2Y0BA 1RHJA 3OD5A 3H11A
chains in the Genus database with same CATH superfamily
3FLAA 4L3OA 2A0YA 3KOWA 3LC0A 4OAOA 3RAGA 5B1EA 1YFJA 3AETA 4AI6A 1XCLA 2QRVB 3AY0A 4RHTA 5DXAA 1KWGA 1UDAA 2BBTA 1U65A 2OC4A 1MO6A 1DRUA 1E2LA 2QX7A 2ZTLA 2GERA 4HNGA 3IV7A 4L57A 3WGTA 3DB2A 2PK3A 3LCCA 4XRGA 2RG1A 3MWLA 3K70D 1HK7A 2WSIA 1MNAA 5I9BA 1J1ZA 3ZZUA 2DWCA 3E4CA 3A9CA 5I4CA 1DO0A 2TS1A 1FE8A 1V1MB 7AT1A 1R0CA 3MB8A 1NRWA 2AFVA 2XY4A 1XU7A 3GL9A 3JY6A 3BA6A 2BW0A 2P0AA 3NC1C 5LA6B 4A5SA 4BCBA 2Q46A 3DWEX 3JS5A 4O33A 2AX3A 2L17A 4IDFA 4W8HA 3QEBZ 3SM9A 1ZRSA 1N2EA 2ATCA 3N2EA 4CKZA 4AXXA 1YIDA 3G68A 4OJTA 3UKJA 1HOTA 1IH8A 3HWX1 1IY0A 3AVYA 3TW8B 3RTGA 3L93A 3PGXA 3R0VA 4FTWA 1KI7A 4ZFNA 1CEEA 2FX3A 1R66A 1NTOA 3M70A 3WGVA 4KXUA 1GL6A 4E08A 2YW2A 3A32A 1XEXB 4U2DA 3X1KA 3WHLA 2TMKA 4BGIA 2AL7A 1A9YA 3A6DA 3ICPA 5DIFA 1DTWA 4TQAA 1YBFA 2XUHA 3HKDA 3LV8A 4EENA 3IBFA 3A25A 1E3SA 2NZJA 1OGJA 1LI5A 2ACWA 4DMKA 3AUKA 2GVDC 3HJRA 3P52A 4BUJA 3ZJYA 2IU6A 1CB0A 4PIVA 9ABPA 4RKFA 3U3JA 4UW9A 4MRMB 3R6LA 3WB9A 3VO1A 5DNDA 2ZYTX 5KOHA 5KNDA 1L5VA 1KMQA 3BD7A 4ZGWA 1CP3A 5BN4A 4MUNA 2H31A 5LP1A 5AI0A 4KAFA 4V0SA 1BXKA 2OCPA 4ZODA 3KQWA 2WM3A 3DV2A 4U39A 4Z9XA 4RD4A 1U28C 3GT0A 4L5AA 5I9NA 3VGJA 5EJEA 3GDWA 5JAUA 3ADPA 3QUSA 1XNRB 3SICE 2CD7A 2VHEA 1SG9A 1KJQA 3X44A 1ZOPA 2VJBA 4K6MA 5EQJB 1GYPA 3ABQB 3P9SA 5BSRA 1E69A 2PLFA 2PSSA 2GUWA 4DNXA 3H5NA 4HNAB 5DM0A 4DKXA 3TFOA 1UKCA 4H1VA 3KAQA 3GH1A 1DAEA 3LXUX 3QFFA 5EP2A 2VP2A 4DDKA 5E0OA 2VAMA 2ST1A 5K0JA 3IB3A 4NOKA 4O1IA 4BKRA 4EWLA 1FYXA 3QVWA 2DOKA 2G63A 4OQPA 3SI7A 4R2HA 1DHTA 1ONOA 1G5RA 1CLUA 2UDPA 1ZHFA 1Z6QA 4RNDB 1MP0A 4DLRA 4KZPA 4BNFA 2REQB 3FF1A 2ZTSA 1W44A 4KQJA 4JKYA 3B13B 5NULA 4GKBA 3KKKA 4KQMA 3MJFA 4RZQA 4HXFB 3U31A 1X39A 5EYPA 2PWBA 3FOWA 4GXTA 4ALIA 3AP2A 4A03A 3I05A 2O5VA 1ZNQO 4LXIA 3TSOA 2VK8A 4BEBA 4ASUA 2GTPA 1ONBA 1OYVA 3LGXA 4QQKA 4F3NA 1A9QA 3K6KA 1VLQA 1AXRA 2YCLA 1I51A 1IN5A 1YR6A 2YR0A 2I6GA 1L9XA 4ZREA 3H4TA 1GA6A 3A2MA 4MJLA 4MV8A 1TJPB 2XWBF 2J3IA 3KT6A 4ZVUA 3LH5A 1PWZA 1QBKC 1YA8A 3HQ4O 3LQQA 5AW2A 1PJBA 1WPXA 2JGNA 2R8ZA 3BJRA 3R3XA 4IKEA 4AKGA 1VG1A 3D3WB 3X1WA 4F38A 1E6MA 3DZ8A 3ODGA 3QP9A 1QR2A 4DLSA 4BJ5A 2JFOA 2QQFA 1WW2A 5I4IA 1KKLA 2FVYA 3C6BA 2HIMA 3PTZA 4TYQA 3FZNA 2JAXA 3DEIA 4D4LA 3QBEA 2B2NA 3FVQA 4DJ5X 3ABZA 1P7ZA 4HTAA 3VDXA 2C97A 3GT7A 1J8YF 5KTSA 2PH3A 3ZWPA 4A8TA 3JD4A 5HF6A 1KNXA 4DSNA 2FMXA 2W00A 1J6UA 2AE2A 2PX8A 4HWRA 2BKUA 3TD9A 4GKKB 2B34A 3K0CA 3VYRB 3LVRE 3WL6A 4LOHA 2DLNA 4GOMD 4MKRA 5JSHA 1BEEA 3GGGA 3HZHA 1QB7A 1TIBA 2YCBA 5ALKA 4N3BA 3ZE6A 5ITWA 2GHTA 2NZ2A 3BJIC 1PR6A 2H92A 2JAPA 4BO1A 3WZMA 1H22A 4EAQA 4LE2A 3LW8A 1XP8A 1I2MA 2O4CA 2VNSA 4GUAA 4G5SA 4QUEA 4M7OA 1NQWA 4AJJA 5KYKA 2XUDA 4IS2A 4BECA 3A28A 4JQSA 1WXEA 4NMWA 5B4VA 1HMYA 1T1RA 3HV2A 4PCAA 4C6RA 1Z17A 2EW1A 1N4AA 1KH2A 5BQFA 5C7LO 4CBVA 3JARA 1X13A 1J21A 4UBNA 1SA0A 4LZPA 1BX3A 5HR5A 1OH7A 2E5LB 3QM1A 1UXGA 2A94A 2GA9A 4CV0A 1L4KA 3Q9LA 3VPCA 1ZU4A 1YCGA 3AY7A 3FKQA 1N5JA 3GFSA 2LVBA 2QR5A 2C07A 4OSEA 4PAGA 3EEBA 1RD4A 3UCEA 5F98A 1GUFA 4I4TF 4D8TA 4DG5A 1ONNA 3NHYA 4LSMA 2O2XA 4NK5A 3WKAA 4B3FX 4X84A 2BDUA 3EWNA 5K6AA 4KDFA 4WWHA 4O02B 4R2IA 3JQRA 4YR7A 1RIIA 2CXOA 3MUNA 3KUCA 3H5VA 4EFDA 5T7BA 1CY6A 1DMRA 2B99A 4PINA 2NZVG 3GJRA 2XGMA 1XMSA 2O7NA 1OZHA 4GKJB 1ZG3A 1NLUA 4BBZA 3KXKA 3N0RA 4XGNA 1DAGA 1YU6A 3OZRA 5DTQA 3MRXA 4ZVVA 5AJWA 4KFCA 3CWCA 4IZIA 1URPA 4NI5A 2I99A 3ESQA 3J80A 1VJ0A 2HRQA 4YDRA 3L2OB 4P92A 3RNLA 5GGYA 4F7DA 1CJMA 2YKGA 1J90A 2P2SA 4MW1A 4Y2GA 5FOXA 3DJFA 4XR4A 2CBZA 5LYJA 1ZVJA 3S2FA 4WECA 2Q1SA 4IH4A 4K9PA 2CNLA 3OQJA 5TRTA 5IVPA 3LT4A 4F6CA 5DLEA 2D2IA 1P4AA 3PT5A 2BIFA 3L1HA 3OY7A 4ZVRA 3MXOA 3DEHA 3BOSA 4O63O 1ZUHA 2H3HA 2ERYA 5LYYA 4IJKA 4A36A 1MJHA 1DV2A 3A3KA 4J1TA 2XVMA 1X9HA 2JW5A 1E7RA 1XZMA 3IEPA 3UTCA 1EUZA 1UKZA 5IARA 1L4GA 3H42B 1Z4PX 3PYMA 1DT3A 4ILKA 2VPIA 5TQ0A 1GXSB 3TL6A 2JFUA 2EX0A 2QVGA 2Y3IA 3Q7QA 2W83A 1A8HA 4G9EA 2WM2A 4NMLA 3QJGA 2BONA 2F8MA 2PBFA 3TIGA 3NTRA 3RRBA 3QKRA 1GNLA 1B23P 1J0BA 5CEEA 1VMIA 3BH7A 3WLLA 1UOQA 4G1CA 5J5AA 1CY8A 1V2GA 2J3HA 2IOQA 2WU4A 2VUHB 4YMWA 2KQUA 3G0GA 4IM7A 2Q62A 1J2JA 1XRPA 4M6WB 5ED4A 2FP4B 1DBSA 4FVTA 4CTJA 1ZW6A 2DR3A 3R7DA 2IPOA 2GK3A 4BU0A 4CW7A 1CRQA 4DG9A 1SHZA 3E3NA 1L5KA 3BIOA 4D98A 2YNMC 3Q10A 4ICIA 4DSZA 3NTQA 3UENA 5ESXA 1GPAA 3OECA 3PENA 4AY5A 4K81B 1RPJA 2PIDA 4Z6KA 1CJSA 3IKTA 1LRLA 3IQXA 4RKWA 2JFVA 3VSEA 4B4DA 2XQKA 3HZRA 4QHYA 4MPDA 4B73A 2RDMA 1XR3A 3I2KA 1JG1A 2PV7A 2ZUDA 4NOJA 5IM5A 2RD2A 1R6AA 1T4GA 1VLHA 2R68A 2YH2A 5FR1A 4GBMA 4X91A 2K7FA 2XXAB 3OIYA 4HZUB 5KNBD 5LZ9A 3MJVA 2PXAA 2B4KA 2A6PA 2HWKA 4NMHA 4BRUA 2ODNA 3NUGA 2R8YA 1F2TA 3LCJA 4X45A 3UGTA 2ACVA 3OIDA 2DFPA 4TT3D 1V3VA 2N0SA 3EUWA 2VYVD 2XSZA 2HQSA 2QDXA 4LQCA 4RD3A 1JG7A 2C5HA 1Z6XA 1G98A 2ID9A 1G1AA 2QUBA 3GUCA 3V8NA 3BS4A 2ZYWX 3OUTA 3FCAA 4AWBA 3D6JA 1Q1EA 3P4XA 4LVUA 4QGAA 4LUCA 1JR2A 4E0BA 5T8KC 3EZLA 4J0QA 1VCIA 3KOZA 3TZBA 2NQTA 2WG1A 4G0MA 3VOBA 1EP1B 1Z36A 3WZLA 4ON9A 1ZK3A 3B7GA 4OCZA 3ASYA 4QQNA 1BXZA 3B3GA 3ZUGA 1W36B 2UYOA 5IX8A 1KI9A 2O1WA 2MDTA 3SG0A 4TLEA 1IEQA 5KQMA 2DFNA 2IS1A 4AU1A 2J48A 3LD9A 1ORDA 1VJRA 2F7SA 2Z2YA 3HKCA 3Q12A 4IMJB 4NR0A 3G8CA 4ER5A 7REQB 5L3QB 3VFDA 3EX7C 3KXLA 4BC0A 1CDZA 1YTLA 3L7OA 2EHJA 1TCAA 3MWYW 1GN8A 4LZOA 4CM5A 1CUIA 1L4HA 3G8YA 2WSYB 3NCHA 2EU8A 1KO1A 3BWYA 4OHXA 2PY6A 5C8YF 1XBTA 1VJGA 1QGDA 1WXXA 4H27A 5CK5A 5JD4A 1WHSB 4OBBA 5CEFA 1AH2A 1HH4A 1UKAA 1GCOA 4NZYA 3W2IA 3F96A 2V7QD 4PLTA 2Z2XA 5C9ZA 1XHLA 1PSZA 3ZY4A 2FWPA 3E22A 3WHKA 5FPQA 3F74A 1RMQA 1A1VA 2X5KO 1AQUA 1GP2A 1H6BA 2AYYA 4U7WA 1U6IA 4QBIA 2QJTA 2YX1A 1HNZB 1MC5A 1NUQA 2P7IA 4HZGA 1VYVA 4U8GA 1CUZA 1ICIA 1N3BA 1QRDA 4KX5A 5EPEA 4PN3A 1S3SA 1Y7HA 4J0EA 3KLMX 2WPDA 4RXMA 1ETHA 4LTNA 5DTMA 1LFAA 2O8DA 1HEIA 1V9LA 2P30A 1NX9A 2EKZA 2QMOA 4O2LA 5BQOA 3LUAA 1B26A 4Y1RB 4Z8YA 5B37A 2AZDA 2FSHA 4FT4A 3UAGA 2PFGA 3WC4A 4CQLA 4EKGA 1CZOA 3WGMA 3IUBA 1B76A 1L4UA 4F56A 3G1UA 3TLKA 1ZWLA 1FMCA 5TVGA 5A3RA 3N8HA 3OQNA 4EI2A 4LF6B 4M9UA 4K0KB 1H2YA 2XTAA 4A6XA 4ETNA 5KYXB 4ZOLB 1ZM7A 1ODLA 1Z18A 4GYJA 4OUDB 4EKYA 4BO4A 1ZJWA 1W4AA 3SE0A 4EG3A 1T2EA 2FI1A 4L5JA 3ZU4A 2F17A 2I7DA 3L04A 3MTDA 1JDZA 4M87A 1N9KA 1WW8A 1WB4A 2CBXA 2G07A 2GD2A 2NO9A 4QOJA 4RQTA 4QBHA 5ERGB 2QTLA 1PGNA 1RYYA 4L72A 4MUGA 2EP8A 2ZSBA 1JZTA 3KEGA 4N5LA 4U3JA 4MGHA 5MFPA 5FL7D 4NULA 5L40A 4GYKA 3HWRA 1IC6A 2QXUA 3BB3A 2ABWA 4GSKA 4GX1A 3IILA 3B6MA 1KYVA 5D84A 3RBVA 2GASA 4TKUB 4CQMB 4JUAA 3RUEA 3X1JA 4KW7A 1MUUA 4KYTA 4LV8B 2JIDA 1AK1A 5EEHA 3JTEA 1V37A 1GO2A 2P1RA 2EIHA 3AEQA 1ODCA 2O3SA 5C18A 3VAAA 3C24A 5JJBA 4A9AA 3R5SA 5B2FA 1DWPA 1FP4A 1Q1BA 1CZKA 2GR9A 4N0EA 5E2IA 4LYAA 4MWEA 2OA0A 5FV4A 1V7PC 3DVAB 1XJ5A 3LKDA 4KFTA 3CVVA 4LDAA 4KRGA 1RHUA 4NQRA 1E9AA 2B4RO 1YSCA 2FMUA 2M9MA 5G02A 2JD2A 3VZQA 4CDMA 3AEUA 3HVKA 5DYTA 2V03A 2DFTA 3Q6IA 2C3MA 3O03A 4D25A 2I1LA 4MV0A 5EUQB 4XPZA 2ZEJA 1G7RA 1N3YA 3E5HA 1OXBB 2HGSA 4Q4HB 4TYMA 1U04A 3EH2A 5CT4A 1LRKA 3DEJA 3HCPA 1V8OA 2VH1A 3I2IA 2FMHA 3CUUA 2DFLA 3PNOA 4LJ8A 5KWJA 3U4CA 3GCXA 4YCBA 2ZZMA 3OZVA 3H86A 1PGPA 3ONWA 1NNEA 3HSSA 4JA0A 4QL3A 3NHUA 3JWIA 4P38A 1XF1A 5FDFA 3GV0A 4I8XA 4G0VA 4PLGA 2FK8A 1NBWB 1WSBA 2ZJ1A 3W1EA 5AKIA 2RGYA 2VRCD 2CXNA 1XDZA 1YRQA 5E8RA 4C06A 3T5MA 5JV5A 1T36B 4OLFA 1RWKA 2OLKA 4RIFA 3V2UA 4YRIA 4XGKA 5LOVB 1UH5A 2P11A 2P6PA 2G9ZA 3ADDA 1FX0B 1Q17A 1X14A 3ONEA 1PJLA 2BGNA 4EZIA 1J25A 1PT7A 1KC1A 3QYFA 1EKXA 1T43A 1RM5A 2ID4A 4IQ4A 2QZ4A 4I1VA 3LDAA 3ENQA 1AQ6A 4JLJA 2P9CA 2Y1KA 1JR3E 4EJFA 3KTFA 1KY2A 4MINA 3OUUA 1J9EA 1G2QA 4IHAA 2IH5A 2JBHA 2UAGA 5HK8A 4BRSA 4ZOQI 2RH4A 1GRNA 1XDGA 2HA3A 2C98A 3H83A 3H8JA 4PYMA 2YJ5A 1KTIA 4OSOA 1PG2A 1I30A 1QNFA 4RE5A 1OLOA 4AO7A 4EJ6A 1EQUA 2MSNA 4CTNA 4LJAA 3NHJA 4ZHSA 5AKHA 2OGTA 2ID8A 1P7WA 4NHOA 1ISPA 1LSSA 1SKMA 3DXYA 1OWPA 5CIWA 4W9MC 1C1XB 2H8GA 5DTIA 1D4AA 3NKFA 2GSWA 3AOGA 4FYHA 3EWSA 3RLFA 1L5NA 1CQXA 1NOKA 1Y63A 3O9VA 4BFSA 2IIPA 1Q21A 5AM5A 3UMCA 2FR1A 5GV7A 3CE9A 3GPIA 3CC8A 4Z5XA 2F67A 3BXGA 3SX2A 4YYEA 1CQZA 2QUAA 2R8XA 4H6WA 3W06A 3EXEA 3CF2A 1T34A 4JBLA 2HSZA 3RS9A 4CLRB 4B6EA 2C92A 2B61A 3KJXA 4H9GA 4M54A 4CR6A 2ZS8A 1TQ4A 1XKLA 2MHCA 3D6HA 4BP8A 4HGZA 3T5AA 4UQPA 1KOLA 1ORWA 1U3TA 1NP7A 2AXNA 2BMDA 4JJKA 4GWKA 1NG1A 1XRMA 3OQOA 1AM4D 4LX8A 3G79A 3UANA 2AC7A 1E7QA 2PWPA 3EXIB 4N12A 5L3RA 3U7HB 4F3KA 1BS1A 2HB6A 4L08A 2Q8PA 1W47A 3DVLA 1K4MA 4U9IS 4ZU3A 1W0KD 3NI2A 1QG6A 3ZJ5A 1PQUA 1IOLA 1ODIA 2JA2A 3EGIA 3FUTA 3RYFA 4YAOA 4DUGD 1M10A 4ZRDA 1G9SA 5IKPA 3G9ZA 4I50B 1E18A 5E9JA 2WYWA 4WADA 1K6MA 1WW3A 1GAEO 4HLDA 2JKYA 3I58A 3GLGE 1NW8A 1ETUA 3JD1A 2ZSHA 4YTEA 4KSCA 3K0FA 4FGZA 4GAEA 4WV3A 1P19A 4FR2A 1P1JA 1YB6A 4KCGA 5GONA 4RC9A 2B8TA 3PHLA 4IRXA 1FDIA 1Y1QA 2GUGA 3OX1A 3F9IA 3U39A 3WLFA 4EVIA 3K7EA 3HBJA 1O95D 3AKDA 3QEJA 1MABA 1Y6QA 1JSRA 3EZ7A 4YGXB 2WWYA 1NHGA 5FOQA 1U7OA 4IWXA 1RQGA 4KO4S 3LSTA 1DBIA 4IMRA 5AHOA 4EG1A 2F43A 3AHIA 3H5LA 5GV8A 5LWQA 3O8NA 3N2GB 4HXGA 1IULA 1N8NA 2IBTA 3MXTA 1NIJA 1OGIA 3L43A 3KWFA 1OW3B 3TRFA 3QMVA 3W7AA 3MJEA 3I9NA 5D5PA 2VHJA 4PTZA 3VPAA 2PPVA 2D7JA 4I4LA 2RKWA 2AVNA 2X8JA 4IL5A 4DNOA 4DZTA 1KP2A 3KPWA 2FRDA 2P6OA 5G1OA 3QXSA 1Q6ZA 2GCNA 4P53A 4J75A 4UM9D 4BFZA 4DAEA 4DWOA 5C81A 2XF8A 5JXIA 4BKUA 1X7ZA 3AT1A 2GAOA 2RH9B 1C3OB 3C3XA 1CP2A 3NVMB 4R6WA 5F5XA 1LBIA 2PIAA 1UBHS 1F9AA 2BVNA 3K0SA 2HFJA 2D6FA 1MEOA 3SFZA 2KPOA 2PZKA 1FYWA 3KE8A 2K2QB 3FNBA 2NUBA 2QIPA 2RB5A 4M4SA 4MVJI 3REOA 4NAUA 2YMLA 4A2CA 1RKUA 3V4FA 4RANA 4N0DA 3ZI4A 1V96A 1VIVA 4DNFA 3OQBA 2C95A 2X0JA 2X6TA 2D74A 4HNVA 3LVFO 3T99A 2NAFA 2J0UA 4BNKA 5C4GB 1G6HA 1CVIA 3CZRA 5TXGA 1K9SA 2NV2B 4B87A 2EKLA 2A0UA 2A1TS 3ED5A 4CEJA 4BVEA 4UFPA 3MCUA 3OCJA 3MLEA 1PYOA 2FPKA 2H9IA 3IUMA 1DELA 4GOOD 4WOPA 5TPZD 1MW8X 4AKTA 5A0VA 1A4UA 2D1FA 5B64A 3I1FA 3QUTA 4WKBA 3TE6A 4HBGA 5EHZA 4CHTA 1CUGA 3IAXA 4W5TA 5L3SA 3CLSC 1CYDA 4TN5A 4IXMA 2DYKA 5AUQA 2IT1A 2I9PA 3L7MA 4UUAA 1HQDA 2FA9A 2WHQA 4BO7A 4CIVA 4E21A 4OTZA 3FYTA 3M5PA 4KVZA 4R98A 4NHEA 4CKBB 4UVDA 4V03A 2QLNA 5K3FB 2VWQA 4ZYVA 4ZANA 3TSCA 3M9WA 1JDJA 1H0RA 4C7OA 3MWGA 4R69A 4GL4A 1BDIA 3KBBA 4LHEA 4RV4A 4ZICA 1J99A 1JZQA 2J5XA 2P41A 1ZN2A 1UPAA 2Q5OA 1TJ5A 4BNHA 1KEVA 5IT5A 1P62B 5EKSA 3KG2A 1COWD 5AW8A 3UICA 1QH8B 2Q4DA 1QVWA 2OYRA 1LPNA 1XO1A 3ZD6A 4YUAA 3LUKA 4TLAA 3MGCA 1N5LA 1NPYA 3IE0A 2WWRA 3PQ8A 2XDQB 4Z3DA 3SDBA 3BXOA 5AW4A 1NBMD 2CK3D 3E8MA 5BUZA 4PFJA 2AG0A 4Q7LA 1PAUA 1PS8A 3PGMA 2RHMA 1AT1A 2JAWA 3RVQA 3KFLA 2Q27A 2XUIA 2AH5A 3AXSA 4UHKA 4XWAA 4YJ2A 2FN8A 3UJHA 5AWFC 1N1GA 3E3MA 5BYJA 2FPMA 4BL5A 4BDTA 4RTNA 1M0WA 1MEEA 2JDID 1FYFA 2C5LA 4KNWA 3A10A 4JMPA 1FLAA 2GO7A 4A1OA 1QZZA 2BCGY 2WHXA 2ZS9A 5DLPA 4DARA 3QYJA 5CFOA 2HREA 3CKLA 4ZTBA 2JIPA 1P18A 5EKTA 2VSYA 3EMDA 4RKRA 1KH3A 4PCUA 4MI3A 4KPUA 4C88A 3U61B 3LA8A 4YAEA 4Q1AA 3WNQA 5KQGA 4TTIA 4ZCPA 1SB9A 1M6HA 4F5ZA 4QTYA 2WBLC 2CVQA 4WXEA 1V4VA 2Y76A 5FTMA 3INTA 5DSTA 3TLZA 1YI8A 4B48A 5DM60 1Q44A 2HR1A 1QO7A 1MZPA 1SOUA 4H4CA 1WUIS 3RKRA 4OAPA 1KJ9A 1TVEA 3HJUA 5CLQA 1LQUA 5EVJA 5HW0A 2VRWA 3NRJA 1DC8A 1W8IA 1A2QA 3HACA 2G71A 3JQ8B 4OGWA 4RX1A 4D9CA 4I8DA 2DXIA 2QVXX 4F46A 3MBKA 3PE4A 4KXWA 1O03A 3JCZA 4PONA 3WQQA 4ZVOA 2FETA 1CEQA 4FYIA 4H7KA 4N48A 3AOEA 1RI2A 3UKDA 4DRXA 3P1JA 3BG5A 4B79A 3PJRA 4RVOA 3P9ZA 5B3JC 1G8SA 2SICE 3AU8A 1EUYA 3ORQA 4NP6A 1ZPDA 2FZCA 3DDOA 1PTJC 1DEAA 3OP1A 5EFOA 4CIAA 4I46A 3IJ5A 1TO2E 2FEAA 4LQLA 3W2HA 1TT5A 4MW7A 1HQYE 5UKDA 3O8RA 4NBUA 1BHSA 3X2FA 1BJKA 3VQTA 2C4UA 4EA8A 3L8FA 4MMYB 2G1KA 3RJ9A 2XBLA 1YDEA 1Z75A 1R0XA 1OFHA 2V9CA 4XTCS 3TEJA 4ZI5A 2I33A 5EIBC 3TEFA 4BAGA 3JQBA 1CRZA 3X2EA 1LPMA 1KVTA 3DFKA 2DGDA 1GPWB 1FS5A 4POAA 4UM5A 2GN1A 1R4MB 4RF4A 2EV9A 3IHLA 4S2EA 4F8YA 1N7HA 4LGCA 3RT9A 5A9SB 4H3VA 2I3AA 3OH8A 4RJLA 4LGYA 4ALMA 5DW0A 2JJMA 1II0A 4HRXA 4QLAA 4ZC1A 1BW9B 5GM1A 1KOGA 2QNBA 2YXDA 1YV9A 1C29B 2ZWAA 4MGKR 1QTNA 4U1RA 5C7OO 3TQQA 2Z6VA 5EKDA 2QRLA 1L5HB 2EAUA 2FTKE 4FC6A 5TPWA 5HQ3B 4D97A 1Y3CE 1BX0A 1UEIA 1CQJA 1IBCA 4GOKA 1DBPA 1OXSC 4H0CA 5DNEA 3TB4A 4A8JC 2O8EA 1K7XB 2VWHA 1IZ0A 5BMVA 1BU5A 1RBMA 2HA6A 2HC9A 3COSA 3D4IA 4H08A 3T0IA 3GK3A 3M4ZA 2ZBGA 4L8LA 3W5BA 5AVKA 4Y2YA 4KXMA 1ISSA 5EWLB 4MS1A 1CR6A 3IAEA 4L50A 3SXUB 4LJ4A 1QRAA 4CMKA 2QT9A 3TO5A 3T9BA 1WD7A 3RIYA 3F0TA 3QHQA 3KZOA 2G72A 3F6YA 1GGKA 1L8OA 2QQ0A 2QMQA 3SX0A 1L7DA 3MN1A 4R1MA 5DTEA 2O7VA 1VTKA 3KKLA 2RHOA 2FN4A 4AP6A 5G0SA 1CXZA 1RQPA 5LMUB 1KXZA 1NR1A 2OL4A 5BOSB 3A6PC 5DYGA 4PYRA 1RM0A 2RHLA 1OI2A 4A15A 3MINB 1T29A 2WAAA 4JQOA 3ZQ4A 3LZ6A 2IEYA 3RRXA 1QIJA 3F9CA 3PFKA 4ZEVA 5F73A 4LHSA 4OQFA 2A30A 1WL8A 2K4MA 3EGDB 4ZT4A 3RIHA 4BKOA 3KQVA 2CDNA 3MMSA 3HJHA 2IYFA 1QHGA 3IULA 4MARA 2PUVA 2WIBA 5BNZA 2E82A 1RRVA 1CYEA 4YJKA 4AN0A 3LHSA 1JJIA 1ZIOA 3M2PA 3PUVA 4H7DA 2J67A 5A9TA 4NU5A 5L6MB 3EQ9A 2ZIXA 4A92A 3ACDA 4CKEB 5BRJA 2UXBB 3WDKA 2BGKA 2HU5A 5C5DA 2BFBB 3TNDA 1J56A 1MBZA 4AW9A 2W8BB 2PM8A 4ALJA 1GDTA 2Q7OE 4IDHA 1BGWA 2GFIA 2ZDQA 2J4FA 5C7IO 1RXEA 3LCVB 2FEOA 3A4LA 3MHPA 5JZVA 1X2EA 2PGJA 4Y0VA 3CCFA 3O74A 3CLHA 3DAFA 4AKSA 3TOSA 3VUFA 5EMMA 4B3BA 2QN8A 4JD5A 3O92A 2ORED 1VKOA 1G6Q1 4IIBA 4I1RA 1V3TA 4YN3A 1ECJA 1XN4A 3DP7A 3CJQA 3H65A 5CDUA 3V8BA 1EZ4A 1W36D 3D7SA 3QV1A 4KUHA 1WX1A 1SHLA 4UU7A 4FYVA 2GFHA 5AW5A 4IZOA 4J16A 3ZWAA 4FW9A 1N1EA 2HJRA 4FC7A 2YRXA 3D3NA 3L8MA 1J00A 3KUKA 2DPGA 3BT7A 2FU5C 3FYSA 3C1OA 4RCVA 2GBLC 1P9OA 2Z8YA 3D1JA 4LDNA 2IU4A 3PIDA 4LRSB 3RUFA 4MKXA 3UJDA 3JZIA 3N8KA 3ZY6A 4AIRA 4E30A 4C5CA 4ZJYA 2YIJA 3WBFA 4OLHA 2F00A 4MOWA 1RM3A 2YIVX 4QYXA 5AJHA 3NDBB 3C6ZA 4FQ8A 4R3UC 1K3FA 3HJCA 3PXEA 4LAFA 4Q1DA 1CFZA 5CT8A 5C51B 1FQWA 1RADA 1XZEA 2I8AA 3NIGB 1NLMA 5ICSA 3X0DA 5AKGA 2FW0A 1X7XB 4Q39A 1KZ4A 2O52A 2P35A 5JDCC 4AY6A 1E99A 2A33A 3ZGVA 4O4JF 4DMLA 3EXHB 4OQQA 2PL1A 2XV1A 1VIAA 3BL6A 4ZOAA 3RV3A 3SF0A 3AP1A 2A84A 5HF9A 5TMPA 3DCNA 1JWAB 1O2DA 4IXNA 3ROQA 4DC9A 1K6EA 1KBQA 2I6QA 2Z9BA 2H1CA 1MF7A 3K2IA 3HADA 3KT0A 4FK8A 3BE6A 3AQIA 4FHCA 3L7LA 1C9MA 4GMDA 1DG1G 2NV0A 4QQ8A 1XMXA 4RK7A 3WICA 3ZE9A 1A9SA 3HCCA 1YIAA 5ALQA 3U0VA 3KV1A 3C7AA 1M34E 3FGNA 3BBPA 3C3BA 3DLAA 4ALLA 3W1VA 2WJPA 5BWMA 5JEEA 2JL1A 4BCCA 2FUEA 4LW8A 2BGTA 4BRZA 4DQ0A 3OTIA 3B20A 4YR9A 3DOFA 3UZUA 4LF9B 3IV6A 3DBLA 3DE3X 3PP8A 5KQRA 3U3DA 2GZSA 1A0OA 4HO1X 3WI7A 4FE7A 2EEPA 1T6NA 4X97A 3DUWA 1A8SA 1M2VB 5KAMA 3X1ZA 4BGDA 2H17A 1KMHB 3C16C 3UAYA 3HL4A 4ZMRA 4NYIQ 3R5KA 3AERB 1R8YA 2CWDA 3O4RA 4RMIA 4TV8A 4ZVQA 1M9NA 1DAOA 4P81A 1E4YA 1A1SA 3ETHA 3KPVA 4FXPA 4LRTB 1SD1A 2IOFA 3C5EA 4P0QB 2PO7A 5DXFA 1NLFA 2WTXA 1CHNA 1G7CA 4HAYA 1DT5A 2V6FA 1NVTA 1SBTA 5FCDA 1C7FA 4TV9B 1JAIA 2JLCA 2XLBA 4PLHA 2C96A 2ZBQA 3JRNA 2EIXA 1J70A 2F3SA 4EECA 4MJXA 1UKEA 4O2AA 4R2XA 2ZE5A 3PX2A 2OG1A 3HCNA 3TG8A 3AVUA 2H2FA 3EIFA 1A9RA 3FDZB 1KJZA 3O4JA 1SVWA 1NXVA 3S0JA 4DCJA 4YJ3A 4PEVA 3TDMA 1SRQA 1IQPA 2Z95A 4K6KA 5DGIA 4RTQA 3OFND 3V6LA 3B85A 3OTOB 1NNI1 3PXXA 1IZZA 1H42A 2PZEA 1PFQA 1Y3FE 2ZIGA 4J4HA 4E4YA 5FEUA 1AO0A 3LDUA 4QDOA 5JTTA 2JGLA 2GPSA 3BMCA 1KQNA 1RHJA 1NYTA 4XWWA 3JRXA 1YJQA 3VV3A 1BYUA 2W90A 5IJ9A 2ECPA 4K26A 5FIUA 3SOZA 2VYCA 3LK6A 5LZ5A 4A27A 4B83A 1DGQA 1J0DA 4EI9A 1GGNA 2RGCA 1U2DA 1KBZA 3KZMA 4S1VA 5E3JA 4BIIA 4DV1B 1SWVA 3SC2A 2CDAA 2BEVB 1SR8A 3KOMA 4HWGA 1SC3A 1YVDA 1WMAA 3EEFA 3FNIA 3JVVA 1E94E 2VL7A 3NFYA 3NXSA 4FZ5A 4MV4A 4ROSA 5T4FA 4ZTZB 4RV9A 2NVUB 1IEWA 2B4AA 4MVJM 3ZCSA 2VXYA 2IEBA 4HWKA 1K68A 3RDPA 2P0EA 4YDQA 3GT3A 1PTKA 1Q92A 2FPOA 2LGJA 3R0IA 5THQA 2QX4A 3Q2OA 2HDOA 1Q0PA 3K1TA 2II6A 3OX2A 5IU6A 4KQCA 4LXTA 3CVYA 3SIWA 2AD1A 3HKEB 3WJ1A 3AR3A 4E12A 2WDPA 1YR8A 1KFBB 2NU7A 4AT1A 1SUCA 1UDWA 4EMBA 4JH0A 3LTNC 1I94B 3GNQA 4PY2A 1WXDA 1U0RA 1XKQA 1U99A 3W5SA 1TYAE 3ICQB 2I76A 3OZFA 1A77A 8ADHA 4ZQBA 4JFAA 2TSYB 1G5PA 2VT6A 3AESA 3D8UA 4TTSA 4WDQA 3DNFA 1B74A 1UXOA 2JHCA 2XJ4A 1KI2A 4KVAA 4QU5A 4JWKA 1ODFA 2NO6A 1V1RA 3PJGA 1U0BB 4WOBA 2OPBA 5LZ4A 2XLCA 2VJMA 3NDPA 1J2YA 1G8FA 2INGX 2JK1A 4G86A 1G6KA 5DRTA 2MSKA 3SDSA 5LDDC 3BXFA 3PC3A 4W5RA 2AJLI 1SVMA 5CFNA 1WUHS 1DOAA 2NTJA 1N36B 3PC8C 5HQTA 4FYXA 2DEUA 1XUOA 2GM3A 2E89A 2FWNA 4B43A 4CR7A 2A2ZA 4N0QA 3VH3A 4DIBA 1II8A 1R10A 3KCNA 1STOA 1V9SA 4ZO9A 3RFVA 4BFCA 1MOZA 2NYUA 8GPBA 2YN4A 3V9AA 2M2IA 2ZBPA 1B8NA 4RH0A 4WN3A 1QE0A 3RQSA 4HYEA 2ACEA 1ZKDA 4RWZA 4KJXA 1OX5A 4UXIA 2ZWOA 3PZBA 4KSBA 1I6KA 1H2EA 3O1HB 4Q9KA 4KN8A 2QI9F 5F52A 4AY2A 3B6JA 3KAJA 4NFYA 4TSFD 3R5JA 1JFFA 1GGMA 2F64A 2NADA 2ZPTX 4GR9A 1OFGA 3I64A 4G1EB 1TAUA 1ORVA 3RUAA 1PS0A 4PYKA 3P94A 4WNAB 1IPEA 4RF5A 1Z13A 1EQ2A 2OM2A 3N8GA 2FZEA 5FL3A 2X8WA 1Q1NA 2Y9PB 3I9KA 1TUGA 2N75A 3D3QA 3RJMA 3V8RA 4CEIA 4YQFA 2J3EA 1ULSA 2WJYA 2ZRPA 3H2GA 3KXPA 1ZOSA 3AC0A 1JN0A 2IZZA 1KC3A 2R00C 2WVHA 3ES9A 1OF1A 1DCKA 1ESMA 3L8HA 3HUDA 2BCEA 5LQCA 4G5YA 1U1EA 5DWDA 4CE6A 2NUAA 3HGTA 1H6CA 2OCGA 5EQFA 3RS0A 1G20B 4E07A 3EGCA 5KNBA 1LTQA 3CXUA 3D31A 5M2QA 3TTSA 4F71A 4KK3A 1SXHA 4EB6A 2C5GA 5IK2D 3LYAA 3NX4A 2ZVPX 4TT3A 5E7QA 2OPHA 1QYCA 3SN6A 1O5OA 2MINB 2BISA 3DV0B 3MT0A 3UV3A 5KVCA 3DPIA 3ESRA 3VAZA 3BDIA 1MC4A 4FM9A 1PJRA 1JQ3A 2BFNA 1IM8A 1UMCB 1LB1B 1EM8B 3C3JA 3O7MA 3QMWA 4G8CA 4M38A 1QKKA 1Q1AA 4IQFA 3LXRA 4O8CA 2ZJBA 1TI7A 3JALB 4EPTA 1E3EA 2NVWA 4FYJA 1DJMA 2TMYA 5E6SB 3FCYA 1HZZA 5AXDA 3RVLA 4R1OA 4EJMA 1YUNA 5DHSA 3LWNA 3OD1A 3SF8A 1NX6A 2GJ4A 5GVRA 1G8HA 3IOYA 4WDRA 1P91A 4Q7EA 5A3VA 2CNDA 2R5FA 5CX1A 3A70A 2XYGA 3T9EA 4F9GA 4HLNA 1UQRA 4BQIA 2ID7A 2MYUA 4HDRB 4O4LF 4ZAYA 2Q4RA 3E2PA 2JFNA 1R00A 3IR5A 5IYZF 4GRAA 2UU9B 3HLTA 1S01A 4FGJA 2PAFA 3Q7EA 5KNLA 2QRQA 1B3BA 5HX7A 1UEJA 1SWWA 3MFQA 4M1WA 3CCBA 2WP0A 4TMFA 3KPYA 1I7PA 1LRJA 1QFSA 4JXKA 5BSFA 2V7QA 5HS6A 1N32B 1SUDA 4XFKA 3H75A 1KARA 2OXFA 4MKZA 2Z5GA 2R44A 4XYBA 3UWPA 3R9XB 2XVYA 2JI6A 4HMOA 3L40A 4A2PA 1QGYA 4LRWA 2FJ0A 1EFRD 1P6QA 3OCUA 1XHEA 3RYHA 5FLXA 4KKXB 1CULC 3HCEA 2EBHX 3MT7A 4P7KA 3M7IA 4XEHA 1D1TA 5IPFA 5I6DA 1LA2A 3CF6R 3IMGA 4R1LA 4CCAA 4GE3A 1KH1A 3TZHA 4Z9FA 1A8PA 1C50A 5K0ZA 2H7VA 1JPNA 2O57A 3FGOA 2D0PB 3EXG1 2IPMA 3HV0A 1Z34A 1RC0A 1XTIA 2QTGA 2V6JA 3Q3GE 2CUTA 5CA0B 1Z88A 3F7MA 1X19A 1MOSA 3UB2A 4UDNA 3U7IA 2X2OA 1UMDB 5AJVB 3QU5A 1CIJA 3QTBA 5J63A 4IH9A 2WKRA 1Z82A 4NENB 3RTCA 3PXCX 5GQSA 4L3WA 1CQIB 2ANCA 2YWEA 1XD2A 2O4UX 1KDRA 1FDRA 1P1KA 3BX1A 4CMGA 1II9A 1WLYA 2FMTA 2V7EA 1VCMA 2J5QA 1NPTO 2WF8A 1NLZA 1R2QA 4EX7A 1PZHA 4GQIA 1GA4A 5DNYB 4WXPA 4EGFA 1JLSA 2BEJA 4NYIR 1C9EA 1Y1PA 2JZNA 3CLTC 3HB7A 4MWZA 2R7MA 4OKIA 4WUTA 5BNWA 2W4QA 4EEZA 2BMVA 3EQ8A 4L95C 3RS3A 3TWOA 4QFDA 2B1QA 3QE9Y 2GN2A 3PXDA 1K6JA 3EULA 4QOEA 4ZYTA 3OTHA 1KR5A 5FL7A 3R40A 4FIZA 4K2AA 1U9JA 4PQFA 3TCXB 4B2IA 2BEUA 2G8NA 1KDPA 2GHIA 4KE9A 5IKOA 1GKYA 4ALKA 3NM4A 4CIBA 3AHJA 3U37A 5HKAA 1WD5A 1XVVA 5KNCD 2V6GA 4KAAA 4UUPA 2OECA 2MSCB 3AFNA 3KOOA 1RCTE 3L18A 2C4NA 4NVRA 5REQA 2H5LA 1EGMB 3ZDDA 1Y8RA 2IXTA 1YAJA 1Z2PX 5EAIA 1KYXA 4E09A 4KREA 2QDKA 2Q3JA 1BDMA 4J7UA 1FRNA 3AV0B 1M2GA 4ES6A 1QQ5A 2VXOA 4ER7A 2WAOA 4C4YA 4OVKA 3STVA 4AQYB 4B6FA 4HGRA 3RYCB 3EIUA 1SD2A 3BXEA 3ISTA 3LZDA 3N8NA 3EF1A 3T3DA 5ALWA 4DCVA 2AKAB 3ZHUA 3GHYA 2R79A 3LWDA 5BRNA 3HWWA 4ZYZA 2FWJA 1AA6A 1WDTA 2GF0A 3WLHA 4DLXA 3HY3A 3M1YA 3Q9UA 3NHLA 1T15A 1X1QA 4ZCTA 3CR3C 5KJEA 2A59A 4X85A 1Q95A 3RJ5A 2JI7A 3F8WA 1N9GA 4Y67A 2J3KA 3I28A 4F91B 1O0BA 3FGPA 3IAUA 4RA6A 1OBFO 1CCWA 4KODA 4D41A 3OM1A 4IJUA 1SG6A 1VHDA 2CC2A 3CJTA 3GRZA 4NU8X 1FYEA 4PSAA 5LP6F 3GLHB 3AILA 4KACA 2D1YA 5LZ7A 1CZHA 4URXR 1EFAA 5AHXA 1ADBA 2EARA 4J7AA 1GA1A 1ODSA 2HK6A 2IE0A 3BMQB 1WMDA 1YK0A 2EQAA 5CVJA 5EZ6B 2PRYA 3ESZA 1XA3A 3G2MA 3EA0A 2BKXA 1V5WA 1PP4A 1M2KA 1Y5RA 4Y6RA 1F8YA 2AMLA 2E4XA 3BMOA 1BMFA 4GP9A 1F3LA 4ESHA 1SCUA 4FUTA 1F2VA 4QVKA 4DSAA 3S1SA 5G2OA 1KYIA 2IKSA 4HSGA 3Q3VA 3LGAA 1C1DB 1DPFA 1F6DA 4Q3LA 5H80A 4LMBA 4B47A 5A06A 4N49A 2I2BA 2ZRGA 4Q1VA 2FDXA 3O90A 4I9NA 4PZAA 2C57A 3JSAA 4ZCRA 4E46A 4Q4AB 3DFUA 3IVGA 1XXHB 2IXAA 3HDJA 3ZY3A 3QVGB 4J76A 4PX2A 3BUSA 1K8XB 4K03A 1CY4A 1I0LA 3SQWA 2FQ1A 4G3XA 4QM6A 3OE7A 2I1QA 4IUDS 2IEZA 3W6PA 4ARZB 2H0RA 4DEYA 1UXJA 3E2MA 4XR9A 2QE6A 3FW1A 3T3NA 1N4DA 3QUCA 2O3RA 1M1XB 1XDUA 3LHIA 3OUZA 1W1WA 3GJ6A 5JXGA 1M7GA 3ZDQA 4TTPA 1XMVA 2XD9A 3HCFA 4GOLD 4JGGA 4NIMA 3ROFA 1TZMA 2OCDA 4MA5A 4S1WA 5HHTA 2WSMA 4YAFA 2Q6TA 3EOZA 2UZ1B 1DADA 4F4FA 3MMZA 5CGZA 4OF4A 1TUEA 2VHUA 3IKJA 2LRHA 3UGKA 1ZW1A 2PMKA 4JUBA 4UM8B 2HGZA 5J47A 1L1QA 4PZUA 2OENG 3F9RA 4MWGA 2R25B 3KQHA 4HN2A 3GRFA 4AJKA 1Y1KE 1ISHA 2Q2QA 1GZVA 3QVTA 3DBOB 1OE0A 4QUGA 5JRDS 3L7CA 2QRVA 1I7LA 3UHPA 5DCWA 2AEMA 3RAFC 5JY6A 2YIDA 3EVAA 3MTBA 1B8PA 3OTQA 1G8PA 2F3QA 1WDMA 5AOVA 4CF7A 5FTWA 4X62B 1RWMA 2C2MA 4X92A 2BKEA 2HRZA 3COJA 5AI9A 3S2YA 5L53A 4JJAA 5B1IA 1EWTA 2I6TA 3ZYCA 1V1MA 1Y8ZA 2V3WA 2OHXA 4K7JA 3TBHA 5A3QA 1FA9A 3KKNA 5TV2A 1UAYA 4AQDA 2H85A 1R27A 3I09A 1SXQA 1UK7A 4ZT7A 3TQTA 3UJ7A 3HVIA 2OD2A 3DLIA 1W2HA 2QAJA 2WTAA 3GPDG 3LC1O 3U5ZB 4PWYA 1GILA 1SHUX 2FFQA 1DFIA 1OAKA 2JFXA 4DT1B 3TW8A 4JP3A 4YMUA 4DJTA 1ZGCA 4R3NA 4PLVA 4NFLA 4XSHA 4DCSA 4YRSA 1O95A 4CM4B 4NFHA 1XEXA 5FOVA 4S1OA 2CJFA 5SYAA 2JEZA 2YZNA 4V0LA 3RBAA 1SKYE 4JR1A 2Z5FA 3BDAA 5EXEA 5K0SA 4WKCA 2QA5A 1RFLA 4DIEA 1ACLA 1VGQA 2MYNA 2YVQA 1RRFA 1XZNA 2JKVA 3CSUA 3PHCA 2BEKA 4BKPA 3JZAA 3PFCA 2FCRA 5TQVA 5IWAB 1U9ZA 1W88B 4MRMA 4KMSA 1WRBA 1P74A 3DXFA 4G0ZA 1UR5A 1Z6AA 1Z0UA 1X0XA 3WA7A 5C46F 1SG0A 1TZBA 4X90A 1J24A 4BMNA 5JHGB 1NHWA 2CT8A 1YQUA 1NURA 1KQFA 3VYSB 5CTAA 1N2IA 1WNTA 3GFTA 4IICA 3MS7A 4OXIA 4WFIA 4DV2B 2PRSA 1FDVA 4E14A 4NC9A 4F5YA 5CP8A 3GWGA 5GONF 4P4TA 3U2QA 4UQLA 2XAAA 3K0AB 3ZD9A 3KEQA 3OQVA 1Y82A 2VKTA 2FW8A 1LFDB 1APBA 5DOZA 1TLLA 4HH0A 4KQ6A 1QIKA 1J0EA 2D3WA 2YUIA 2WTEA 4OV6B 3TECE 3GAZA 1ISGA 1JHOA 3WDMA 2GWRA 4HNAA 1OH6A 3VDNB 4IP0A 1D3AA 1E2HA 4GGMX 4H18A 4QXMA 3ND9A 2I1WA 4K0RA 1MAAA 3MMXA 4LY3A 5AKYA 3WKEA 1HMPA 2ROQA 5MFZA 1NW4A 2MIIA 4TUYF 1FFXB 1PR0A 4EZBA 4DBLC 3RTAA 3CZCA 4UJ5A 3TIVA 4M21A 4JA2A 4W8GA 1UDCA 1JHPA 3SQXA 1RXIA 3O84A 4GIBA 2XE4A 3DGEC 1QPBA 4TL8A 5K6AC 5FUVA 2MSLA 2REQA 2ZJOA 5JS8A 4MX8A 2YWFA 4FI3F 4JLBA 4QQFA 4A0GA 4W5QA 4DUZB 1K88A 3ZWMA 3DKRA 1FFSA 2H1VA 2H4JA 2OM6A 3LM8A 4IIJB 3OZBA 1TM1E 3GUUA 1QNLA 3TSWA 1FBTA 1GQQA 1JQKA 1A96A 1L1EA 3AL3A 2W11A 4EJ0A 3B6KA 4YO7A 2V6BA 3QLUA 1SOMA 2O9JA 1NWHA 3GDHA 2PLNA 3W4IA 2G1PA 5HZMA 5DGTA 1RYHA 1LZKA 4BAUA 3EVNA 3NYRA 4G5OA 2HLDD 2B35A 3C4VA 1CERA 5AVYA 4DPLA 1Z8HA 1ISMA 4IV0A 2AQKA 2UZ4A 4I8IA 3KSZO 3Q72A 1SCIA 1TRHA 4P4SB 5DN6A 5FLKA 2XB6A 4LVOA 4D56A 3K9HA 3NFRA 2ACKA 4KXYA 3WX0A 4AN1A 5AYVA 2ZBEA 3D3WA 3GOHA 3WYNA 4C1NA 4M1ZA 1GQYA 2XUPA 2JBWA 3KQYA 3NIBA 4J1TC 2Y1LA 3I32A 3KEOA 4LHWA 3U4AA 1ZM4A 2I9KA 5I7RA 4CM6A 5DNCA 3LX5A 3SLGA 1JHDA 2PUCA 2XCIA 3WFZA 2CK3A 4W9NA 1PNOA 5IH7A 4OGLA 2XT9A 4AL4A 4G67A 1Y7IA 3QG1A 2IH4A 1LX7A 2YV4A 4CFYA 2JI4A 2PUFA 4H7HA 3OLCX 1L7VC 5JIBA 3IQFA 1ZIXA 2FR0A 5EY5B 5HKLA 4DE5A 4DHEA 4JSTA 3G2PA 3O94A 3BF8A 1QYDA 4F1JA 3FPJA 1F17A 2PGXA 3ZDFA 3VHRA 3QMPA 2FH5B 3VU3A 3VVLA 3JQQA 2QTNA 5C5IA 5ALIA 3RVKA 2OD9A 3I30X 3DDCA 4KQIA 2E37A 1N6HA 1VKHA 2I6FA 4JBHA 3UMVA 2YDYA 1TCVA 3OHMA 4DJFC 3QKIA 4PG4A 4OLBA 2J85A 1OY1A 4P86A 2VF8A 4YASA 2PVCA 3AG6A 4EW1A 4IOKA 4IILA 2C2WA 5HTKA 1RWVA 1ADFA 4QYMA 2IXFA 3EARA 4B2YA 4UU8A 2VJYA 2CJPA 4JCOA 4K5QA 1YS7A 2KE5A 3FCXA 2X14A 2DKFA 4IYRA 5B4TA 1ECFA 4R9SA 1HE4A 2EZ4A 4HEHA 1UJBA 3H5IA 3UBMA 1A7UA 2D54A 4N6NA 3CRRA 3GA0A 2ZYDA 1XRSB 4FMCF 3TKLA 1ZVKA 5B6JA 1FOEB 3ENVA 4A8JB 3ZGZA 1M8FA 2Q5FA 2PZGA 3PUYA 4DCGA 4M1OA 1A27A 1UZNA 2XWQA 5IEJA 4KV7A 1VRVA 1I7DA 4D99A 1HOXA 1GCIA 2X5NA 2QRMA 3G88A 1RIFA 5J2TF 3FSRA 1AMOA 4AVYA 2HJWA 3FRIA 3X3HA 3O82A 4ZMSA 3RGWS 4CL0A 4NBLA 1HDRA 3F90A 1OYOA 4EGQA 5HP4A 5CW1A 2YNMD 3R6DA 3TW4A 3EY9A 1N1DA 4MUMA 4YCSA 5I7AA 3DPUA 3D7RA 3FHCB 3FFAA 2HAEA 2H16A 1PZMA 4NABA 3B1ZA 4JXXA 1KPGA 4TKZA 3ND8A 4ZCMA 1JFRA 1ZGZA 3KHKA 2O2YA 4EJ2A 1T4CB 3B1KA 4URZR 4TMYA 5A4FS 1O9HA 1W8DA 2WW8A 2W37A 1T13A 1SQ6A 4ENSA 4E13A 4IQ0A 3PICA 1K98A 2PVSA 2R2AA 4M7PA 1TQDA 4OA5A 2ZAYA 4B84A 1OI3A 1SZCA 2VQSA 1KAOA 2VPWA 5J58A 5LSAA 1U8YA 1JIQA 4DMCA 5DISB 2IODA 4PYJA 1CPYA 1WKBA 4MB6A 1DJNA 4HQ6A 2B8EA 2P68A 1EP3B 2WTNA 5DMXA 5KYVA 3SD7A 1OAAA 3SSOA 1GXSA 4MKIA 4DXHA 4R0MA 3LRTA 3MILA 5FTKA 2GBCA 5AJYA 1T9ZA 4UUBA 2PZMA 4TOIA 1QS0B 2VDKB 2ZTHA 1U2TA 3LW7A 3OHSX 1W7AA 2BKLA 3NLLA 1WETA 4ZZ3A 1R6XA 3GG9A 5U4QA 1BQEA 1TF5A 4C7KA 4DMMA 5J4YA 1DLJA 1MQSA 2OAP1 3HN2A 2PS1A 4IOJA 2DBRA 1H2HA 4MJ7A 1C0IA 4M6WA 4OQXA 1AUVA 1KPIA 4OHCA 2VDWB 4RABA 5HUJA 2CEAA 1C2TA 2YJTD 1CUUA 2PPLA 4UHEA 4V0MA 4IR7A 5FO0A 4F11A 4X6UA 1T0HB 3JQ9A 1EP9A 4P83A 1FNNA 1LDYA 3HCWA 4PO3X 5EZYF 2Y1OA 1N6PA 1MAUA 2QM3A 1PCXA 3E70C 3N53A 4JL8A 3BHIA 4NBRA 3KZKA 4LA4A 4ND1A 1DQNA 3T1TA 2V7UA 5IDWA 5JJIA 4HP8A 1FXWA 4PZ0A 1HM5A 3T1VA 4UHFA 3IJEB 3VR1A 5KX5A 1QZ3A 3S2UA 1TO6A 1RHRA 3EB9A 5DM4A 2G9VA 2P6MA 1CF9A 1VMAA 3FVWA 1LLQA 1B0AA 3MG9A 3TR0A 4ZIRB 1RRGA 2XYQA 1AS2A 1ZMRA 1V7CA 1HDEA 4HZUA 4CM3A 5BMVF 2XXAA 3HXKA 1S2LA 3FJ1A 4LS3A 3EEQA 3D0RA 5F2OA 4I99A 1BH2A 1THGA 4MI6A 1Y3AA 2RONA 3OICA 4Y2QA 1D4OA 1P8JA 3DW1X 1NVVR 3ML1A 3ENWA 1O94A 1MPTA 4UXJA 2WUVA 1I6LA 2DBVO 3T3EA 2XUKA 4ID3A 2DKNA 3EPRA 1CNEA 4UCXA 4TKMA 3UXEA 3VH1A 5GTDA 1F7UA 1T8SA 3BCRA 3V4SA 3TUZC 3ZDXB 3FBGA 3K8OE 4GLJA 3IQZA 3T7RA 3HEAA 1AKVA 3OJLA 2PKEA 4IEEA 1FQKA 3AB8A 4DGSA 1XRJA 3IXMA 3UHFA 5BT8A 2W6ID 4M76B 1DC6A 3WIDA 3I53A 3GLFB 4EYGA 2D5BA 2PXHA 3DB1A 1QK5A 2AMJA 2QN6A 3FPHA 3RC9A 4JJ4A 3E15A 5FBLB 4RPGA 3A7EA 1DS6A 2I2CA 5K8IA 2FYTA 3NRBA 2Q1TA 4K1LA 4OK3A 4YFVA 2AEEA 4G0QA 4ENPA 5L3QA 7REQA 4E5YA 1AURA 3FWHA 4I14A 1DQSA 4ZP1A 1V7QA 1V8BA 2LR0A 1I4DD 4RK5A 2A57A 1VIYA 5D6NA 3RRMA 1A82A 4F96A 1T5OA 4CEHB 1IBSA 1QKJA 2Y9MB 4G1VA 3AYZB 2Q6VA 2IDJA 1ZX1A 3IJPA 1WHSA 3CO0S 1KAEA 2JJ1D 4PM4A 3RC1A 4RVSA 4YIHA 3LX4A 4HDOB 2A14A 2YXLA 1M1UA 3RCBA 1VG0B 3CEMA 4YMHA 1JLRA 3ZXYA 1NKTA 3ZDEA 4JBNA 4WLEA 2OV8A 4LNAA 5JYEA 4YB8A 1C2YA 1NOIA 1Z28A 3ZBPA 5JZMA 1Q19A 3FCEA 4HPWA 5JNWA 4BXOB 2RKOA 4WBXC 1XTVA 3NHAA 5M3BA 2R4TA 3PX3A 4WJZA 4R8VA 1UP7A 1HL7A 2X8LA 4LJSA 2YHAA 3H8VA 3N3AC 1SVKA 2GEDA 3FB1A 1F0KA 3PPVA 3GG2A 2EVWX 4YAIA 2JKZA 4LZNA 4Q16A 4UE2A 4RHFA 4Y98A 5GIPE 4Y1RA 3NYIA 3DXZA 1ZGGA 1J7JA 1DJOA 4F2WA 1UJ5A 5T64A 3KQLA 3VC7A 4AUNA 3A1SA 3HU2A 4ZRNA 1H0HA 1P2BA 3EIXA 4I4IA 2H48A 2HHLA 2HMVA 1RZ3A 2CLHB 5J5VA 3PWTA 4O0LA 3ZN2A 3MC1A 4QOFA 3DO5A 3OOSA 4XA8A 2DY0A 3DDSA 4L85A 1HY3A 5KYXA 2P7HA 2XMGA 3B36A 4ZOLA 4JT9A 2YHBA 5IM4A 1BU8A 2WIGA 4L6CA 2SKDA 4OUDA 4YROA 1TVCA 2C4HA 1YBVA 1E61A 3TD2A 3GD5A 1B42A 3ZWXA 2VDNB 3OCWA 4J29A 1C81A 2PS9A 2XMPA 3C74A 3IKLA 4K1XA 3GROA 3OPNA 5F7OA 5EINA 4M0KA 3S99A 1N92A 1XVAA 4MVJP 5IH3A 1HNWB 4BQOA 1KQGA 4DUPA 4K86A 2J0SA 1HFKA 4B3TB 1NXSA 4OD0A 1RVDA 2CZQA 2HJGA 4XVCA 3FOBA 4OYRA 1ZZEA 2YXBA 3ICOA 3CKYA 4G5FA 2NOAA 4PQRA 3SYKA 2CV1A 5CG2A 4TKUA 1PD1A 4CQMA 3DWGA 4PFSA 2WU1A 4ERNA 3GAAA 1QQ6A 2DRIA 2P2GA 1UT6A 2QXYA 4P5PA 2QTTA 3SZ3A 3CX6A 4F06A 5HGXA 1KRXA 2PKRA 2OORA 1E2GA 1LS1A 1KZ6A 1TIKA 2VBFA 1BYIA 3WL4A 2QKYA 3B5IA 1PWYE 1D2EA 2C4WA 1TQHA 3HHPA 4D92A 2YWDA 3DVAA 3R6GA 3KKQA 3OPVA 3F2IA 4B0OA 3OFNA 4F92B 4HT3B 4I81A 4JDUA 3KBOA 1XSEA 2VOJA 1UQTA 4PLWA 3LT1A 3L4BA 2JIOA 3W3AH 1N78A 4JLDA 2CFIA 2OOKA 2X9GA 1T2AA 3LY5A 2W6ZA 2WMDA 4Q4HA 1E5XA 5HIKA 1WIWA 1EFLA 3IP1A 5KX5B 1Y4UA 4JOCA 1ZEMA 4CLRA 4PBTA 2CSUA 4WT7A 5BSEA 1D09A 4ZCIA 1FXSA 1KAHA 1SC1A 4HK4A 3LBHA 4YCAA 4DADA 1EK2A 1C9JA 1L5SA 1VLZA 3MNFA 4KAJA 1W85B 4LXQA 3IC5A 1TZJA 1LGYA 1NSYA 1CRPA 3ZTWA 1MA0A 2R48A 4O2AF 3ON5A 2NPFA 3T0GA 3FBTA 1T36A 2A58A 3AEKB 4MPTA 4JVNA 2HBRA 3DLBA 5LOVA 1ENPA 1LK0A 1QH1B 2B6HA 4ITUA 4JI3B 3RVBA 3T7EA 1FX0A 1W4CA 1ZXXA 3B89A 2V0GA 5DK4A 1NATA 1TL7C 2P9ZA 4P33A 4BX9A 1VE7A 2ADOA 2XQJA 5AHKA 3H8WA 1D1SA 2CLKB 3NOXA 1XGKA 3OJWA 5AW7A 4TM7A 4AG5A 3L6RA 2AVDA 4FJ0A 3DONA 5JDIA 4HX2A 2YRWA 3H9QA 4YRMA 1WV1A 2P1DA 5IWCA 1ENYA 5I9IA 1L7EA 2DPXA 3NUQA 1POWA 4RS3A 1JHQA 1M1YE 3OIGA 4UNNA 4XVUA 2H1OA 1RI5A 3IPCA 2O0KA 3S2SA 2PJUA 4KDEA 3H4VA 4B45A 1UBLS 1JHRA 4M1MA 4FFVA 5F76A 1C1XA 3K4QA 3I9V1 3M1LA 4V39A 3PQDA 4YP5A 5ALSA 1B16A 4C4AA 1JQAA 1XZAA 1W4RA 1FFBA 1K7YA 4D3ZA 1UDXA 4YFYA 1TK2A 4Z1MD 1YTUA 3A05A 4FSDA 5C4MA 3A6KA 3AVQA 5K3EA 4A0QA 1DAPA 3AHEA 4TTRA 4BMYA 5BN3B 3FYDA 3FLEA 4ND5A 4TSFA 3QU7A 4WVFA 1LF5A 2QNRA 1EHIA 3QFTA 4FFBB 4NWIA 5AVJA 2HRDA 1M8GA 2ZDHA 2IP1A 1PV4A 3OHPA 3D43A 5EZSA 3WRVA 4AKIA 2VP0A 3PSHA 3T7CA 1SK8A 4LRUA 3EXFB 1XK6A 3DULA 4Y6GB 3WADA 2PCJA 1XFAA 2Q9BA 1N2SA 3M83A 1A5SB 1TAGA 1TGYA 2H8KA 2X1VA 2WHEA 1XU4A 3CONA 4E3WA 1SJ9A 4EI7A 5AESA 5LPNA 4BLVA 4FFMA 1NAHA 5F5LA 3DBVO 3CW2A 4ZT3A 1POXA 3KDSE 5DULA 1B0UA 2B30A 4II2A 4M60A 3P45A 1EGAA 1QK4A 2IK8A 3EXIA 3PDUA 4HQOA 4PX9A 1ZL0A 3V2HA 1H69A 2Z56A 3IRUA 3QF7A 4X7MA 1Q0LA 5CDFE 1DAIA 5MF6A 4PR0A 5J2UF 4MXDA 3SEZA 3FI0A 5ALPA 2EYUA 2JC3A 3KR9A 4GX2A 4KJZA 1G3MA 2ISSD 4I50A 2R8RA 1WXGA 3WQHA 4INOA 2OHGA 5IK2A 4MVJH 2HA4A 3GLIB 1HYHA 1M7HA 3MBOA 4KQHA 4MO2A 4CI9A 3FWKA 4BO6A 3OQMA 2ZAIA 1SKQA 2F3PA 3FPSA 2BCJQ 1USUA 3NIDB 5KTRA 4P4LA 1FTSA 3A14A 3D1LA 2IP2A 2ORYA 2VHQA 4FD2A 4J1QA 4MUYA 2A78A 4PGMA 3NV7A 4GI2A 4YRDA 4C14A 3P9YA 3C0KA 1QVZA 4GECA 3L7NA 3MJCA 3DA8A 2C9CA 4MPPA 3AR4A 2WWVD 4RTLA 3BREA 3ZR4B 5IF9A 5IAAA 3MJHA 3RSOA 4HQ0A 4HAOA 4UPDA 3ICEA 4ZD6A 2XX3A 3R24A 1M73E 4KH0A 4YT4A 2Q99A 3ILXA 5LU9A 5ITVA 1PL6A 3HCRA 4LJYA 3N2GA 3PNBA 4WAUA 4DFDA 1VE1A 2IC5A 2IYYA 3AU9A 3CLSD 4Q1FA 1OA0A 2VH5R 2ZZKA 5AK5A 3SJZA 5HMLA 3T4EA 3Q1KA 5JAPA 2X9LA 4NBKA 3QQ5A 2YJ6A 4XX1A 4L0CA 1E92A 3IB6A 3PA6A 1YR1A 3CLVA 2IOYA 4ZU6X 1EGVB 3DNPA 2GAAA 4QVGA 2YY5A 3BWXA 3H9GA 5H1YA 2Q21A 1V3QE 2I29A 2PX5A 1DDGA 1JAXA 2GPYA 1LSJA 2QRGA 3F5QA 1MW9X 3LUBA 3K9BA 3QGMA 3LUFA 2ORVA 4W8OA 3QW2A 3Q8MA 2BTEA 3LMKA 4NMMA 1C3OA 2BMJA 2FOXA 2O7SA 3IAHA 1NNUA 3KXDA 1NMEA 4KV9A 3DZIA 4PYLA 2A5DA 5C8ZA 1JEJA 2HYDA 2XMZA 3EEIA 2VG8A 4Q37A 4BUZA 4DR7B 1JHMA 2VP5A 3E48A 4K40A 1RC1A 3WK9A 3DTVD 1QGUB 2Q0XA 3CRZA 3DQPA 1FSFA 2PH5A 1YACA 1YGYA 2B94A 2ZW9A 5IBQA 3IESA 4BZXA 3PUHA 3CR8A 5EMNA 1VPLA 3STWA 5F21A 1IVSA 1K4KA 2LDBA 3ZV4A 2MYTA 1NVMB 4JP5A 2ZRLA 3B3AA 4X6XA 3ZC3A 2PEYA 2HMAA 3HMQA 5KSOA 3AOEC 2W2LD 5EA2A 4G4JA 1I2BA 4YRQA 1H0KA 4B17A 4I3FA 4HD8A 2G5TA 3WQSB 1I24A 3OZTA 3L8DA 5D01A 4MB0A 4Q00A 2XOEA 1VGVA 2XCSB 4GOND 5C4IA 3AUTA 3GNSA 2PD6A 3HL0A 2R47A 1VXOA 4Q19A 1G21B 2YASA 4X9XA 1IXZA 3UWMA 4WZ6A 3L1VA 4G4SP 2IUFA 1MRSA 4MW9A 3RIEA 3QLJA 3ZU2A 4NMXB 4WINA 1O6CA 2IXGA 1KIAA 1U7TA 1Z5NA 4OHZA 1EX7A 5A71A 4OG2A 1VE3A 2R4UA 3KJHA 3SIXA 4ITRC 4CKBA 4TZ0A 2YYSA 2JNWA 2H07A 2DHRA 5K3FA 4OHYA 1J23A 1MGOA 3JQBC 2IVZA 3P9KA 3I0ZA 3PV0A 4QO7A 3HNPA 1WABA 1YRHA 2I5PO 2LBPA 1KQ3A 1Z7WA 3BVPA 4LJKA 1IPHA 3CR7A 3V33A 1VG8A 2PUGA 2JVJA 2ZYAA 3W9BA 2I67A 2HW8A 2PQMA 3H4MA 2WNIA 2FSVA 3UMJA 1V25A 5KNCA 5KB3A 1CV2A 1FUIA 1QH8A 2H08A 4HLUC 3Q5GA 2IYQA 4DR3B 4Z9YA 1WDKA 3NNDA 2I0FA 4FNGA 3U09A 1TEXA 1TM4E 3QVOA 2XDQA 3C3KA 4G5QA 4US0R 1H9AA 3VDQA 2QYTA 2H1IA 3U6KA 2TMGA 2AN9A 1XN1A 3ENNA 3QY0A 1SB8A 1DKUA 3Q3CA 5T6BA 3WGNA 1P0CA 4BB9A 4ZK2A 5KBYA 4IOLA 2CKDA 4PFQA 2JGIA 3H9EO 2DQSA 1JKJB 1WLSA 2G67A 1AKQA 1W30A 3ZKWB 5B1YA 1EHYA 1T1JA 1OTYA 1ZL2A 3ENKA 2CWWA 3G8DA 3HR4A 4OXQA 3ZLUA 4HRVA 4NH4A 2OP0A 4BLQA 3PEYA 3K2QA 3LLUA 1UWKA 4EW2A 3NHFA 5EIBD 5D51S 3AIMA 2W6JD 4RY8A 3DHVA 3RYIB 1XCMA 3VR5D 2BKVA 4QUIA 1CY7A 1JDSA 3M3PA 4PLZA 3W3AD 4N4AA 4QSHA 3T41A 1F4VA 1PEAA 5CEJA 2PTHA 1NZDA 3CXRA 5KO2A 3ZPXA 1XD9A 1BRTA 2I54A 4ZOCA 4A8PA 1EFCA 2J9ZB 4KRYA 4LK3A 4C78A 3I52A 4WJKB 4ETMA 3O7WA 4LNUB 3T7DA 5JUWA 1B41A 1LSUA 3DOHA 1VKNA 4PPYA 1Z7YA 2RHJA 1MHPA 1D6JA 1P2FA 4E3ZA 1XMQB 4K8OA 4FEAA 4RLQA 3VNBA 1USGA 3P2YA 1U2PA 3NGLA 1G63A 5K3SA 4CRWB 3PUIA 1A7JA 3BRSA 1HXHA 2IXDA 4F45A 2J6HA 3KZCA 3C6XA 1EYZA 3H2HA 4RMGA 1JHXA 1NUHA 3JQ8A 3NDJA 2ISCA 3LE8A 1G9TA 3FHLA 3BCHA 1K27A 1T9GS 3HHEA 1L2TA 1NUPA 3DZCA 3L0IB 2EFJA 3Q3JB 1EE1A 3GVXA 4QJIA 5C3UA 1KVUA 2FX5A 4HN9A 2G4CA 3COPA 1MGPA 2WKWA 4FMPA 2PA0A 4YCNA 2C00A 4HRYA 1IYZA 1F20A 1A7AA 1U7XA 2BRUA 2DC1A 2DE0X 2WJJA 4ZVMA 3RPEA 2UVQA 4IWYA 1R4ZA 1AUXA 5H59A 2ZB4A 1F5NA 2AQHA 1QZUA 4QC2A 2XCOA 3SBDA 4W5OA 1MDFA 2FZGA 2JATA 2WR8A 4Y2TA 3AF2A 4L27A 2H0QA 4AWXA 5JFOA 5JAHA 2H4HA 3U0BA 5K8VA 3P32A 4JJ6A 4UHDA 2NU8B 5JNSA 4D74A 2NQ8A 4PNHA 2R8OA 3RSZA 1YVRA 2H2AA 4NZMA 3AUFA 3UNXA 5A7GA 3W2FA 1G9XA 2NWQA 4QJ3A 2F1IA 2CLOB 2WOOA 3I9JA 1CF2O 2G04A 2IHUA 3VUEA 1X9IA 1JJAA 3NYWA 1R4MA 1OZ0A 4KQ2A 2WF6A 5A9SA 4ROTA 4QDJA 3AWDA 3IDQA 4Y1GA 3LWZA 4B6GA 1DINA 4NEGA 1X8KA 1MG0A 4BVHA 2ZT8A 3R1IA 4O6VA 4V1CI 1BW9A 1L7RA 4MVJG 3ID6C 1SXPA 5A6VA 2J3LA 2GRAA 2FOIA 4AS1A 2V7PA 2ATEA 4U5QA 2O2ZA 3OZAA 1Q20A 3A2NA 3U26A 2CKMA 2QX8A 5F9HA 4MP6A 1L5HA 3ZQJA 4ND6A 3ACCA 1Y6ZA 5HQ3A 5ULLA 2XHZA 4C5AA 1QHEA 2PYZA 1RRKA 1WSWA 3ANSA 1O77A 4BZQA 4CUJA 3G17A 4AYTA 2B7CA 1U28A 3B1VA 4MAMA 3ZIAA 2OWEA 4IUYA 2GD1O 5JATA 3E27A 2WUDA 2B2XA 2ZREA 1KIMA 3GRVA 4Y2VA 4OHVA 3VTZA 2IW3A 1U3UA 1TFRA 1Q74A 5DOVA 5EWLA 4P32A 2ZULA 2OVFA 3P9PA 4OATA 3SXUA 4E5MA 2EW2A 4R31A 3UF0A 3SLKA 5H9VA 1G16A 4KHPB 2H2WA 3NAMA 1YS1X 4QKQA 3GLRA 2N1BA 5HE9A 3DMHA 3H99A 3NONA 4UBJA 2DHCA 3W8NA 5C7YA 3NHSA 1E8NA 1GCAA 1EVJA 5K3CA 2GARA 1PR3A 3PXBA 3RSFA 3U9LA 3UG7A 5BOSA 4DEXA 3NKLA 2FEMA 3H6KA 4ZU1X 1T9CA 3RGGA 4E2WA 3E9MA 3MINA 5JMWA 1A8UA 1DX6A 1JMKC 4JBYA 2EL7A 4JZKA 4RPKA 4EHFA 1PZGA 3EGDA 3A6ZA 1O9GA 1IK6A 3C8UA 1L6IA 2CXPA 3SFVA 4DM7A 3VBCA 4LF7B 2I2DA 1SRRA 4G84A 2G88A 2DUMA 2IUYA 3AUYA 3K8ZA 621PA 5F3WB 2C3PA 3O31A 4M8NE 1JEQB 2W43A 4N03A 4BN5A 1M54A 1FPMA 4CKEA 4JVMA 3QHAA 1TKAA 1J2EA 1U0LA 2BFBA 2GZAA 2W8BA 3OIUA 4RD0A 3VPXA 3HXMA 1DU4A 4LTMA 4OMFG 1S96A 4U0KA 3RC7A 3LL7A 3Q4GA 2OV1A 3E7DA 4IJ5A 2O5EA 1MH9A 3TQRA 3O3OB 3H18A 4DM4A 2VQFB 2F9FA 4OXXA 4K9RA 4RU1A 4DR4B 1H9CA 4X61A 1KHTA 1TU0A 2CE2X 3UUWA 2WZCA 2AN4A 3ZHQA 2FGKA 4WOJA 5L8VA 3JQFA 4UPEA 1VBMA 4PZ9A 4WX2B 3GUHA 3GNTA 1NFFA 2BJHA 2Z2KA 4RVHA 4FGKA 4ED9A 5CU7A 3IDAA 4WXYB 5A4JA 2JZCA 1Q1ZA 2OK7A 4RBNA 1NY5A 2GYUA 3JZMA 4WH0A 5GOZA 4CMHA 4YCDA 2NNLD 5DBIA 4MAAA 4PGAA 4K8RB 3FOEC 2QPOA 3WNDA 1QWOA 1OXVA 1U2DC 1L8QA 3RRNA 5CLLA 4ZJPA 1FMLA 2RAVA 4C4PA 4PLFA 3JU3A 3SKYA 2G70A 2O6HA 3P71T 1V71A 3P2EA 4PGFA 1YRLA 3GJSA 2APJA 4LEIA 2X42A 1G4UR 4E5VA 1KO8A 1ILEA 1F4LA 4QUJA 3UUGA 1SBCA 3UMGA 1ZMTA 2QTWB 1MJFA 4DGQA 3FMFA 4PSUA 3GGSA 3KSMA 4OP3A 1FLDA 2BOVA 2QUZA 1X7XA 2CDCA 2ZKIA 4CFZA 3EEOA 4YWJA 4JB8A 3EXHA 2R6R1 4IX9A 4DA0A 4ZHQF 5CB6A 3WBBA 1OLXB 1DWOA 2FZVA 4MYRA 1DO2A 2AK2A 4RFVA 4C0BA 1N77A 4H7EA 3I01M 4J6FA 1WEHA 4ZGGA 1B6SA 4A3SA 2HLDA 1S9HA 4RESA 3E8XA 4YP0A 2G0AA 4IMPA 1LLDA 1E2DA 2EGGA 2HHJA 2P8SA 3D7MA 3FHJA 3GN1A 3ZWOA 4BLRA 1PHPA 1N2ZA 3TLBA 3K9FC 1Q1GA 2NTVA 2VK4A 3JVIA 4J0JA 5DPMA 3VSBA 4B4UA 4ENTA 4G0NA 5BR7A 2UVPB 1R3UA 1QZTA 4D4KA 4KE6A 1PGQA 1Q3KA 3UKOA 1YI0A 4WLNA 1NYRA 4FSXA 2XADA 2ZYUX 3SM3A 3FN4A 1YE3A 3H2YA 3B3JA 3Q7IA 3WIEA 1Y5IA 3ZZ0A 4RJIA 3REFA 3AIIA 2E48A 2NU9B 4Z49A 1GUYA 3QXCA 4EELA 1M2VA 2YOGA 3HP1A 5HJ2A 1KMHA 4Q7KA 4DLBA 2PUTA 4QXAA 6AT1A 5IF3A 1XTUA 3T3GA 3J7TA 3AERA 2O2JA 4OXKA 5FFMA 1JS1X 4ZVLA 4KXQA 2OAQ1 3EA5A 2PX2A 2GKOA 3EXAA 1AZLA 1S7CA 3IT0A 1CUWA 5ILQA 2WVJA 1EWVA 1NBIA 1THZA 5FPKA 3T7AA 1DWQA 3WP1B 1DCTA 2GAJA 2IIBA 1YMQA 2IV2X 4TV9A 5ADUS 2ZAGA 1AKWA 4CLEA 1RJ9B 4J0HA 4LGVA 4P7BA 4HNUA 4KXVA 3ROKA 1WDWB 3IPRA 4TRJA 4MYDA 3V1KA 1KDOA 1ZK4A 3IP8A 4RDIA 3FDZA 4JLVA 2ZJ2A 1EBBA 2O0LA 4NZNA 4U63A 1RQRA 2JCGA 5DH9A 2ES4A 4Z53A 2C0CA 2W6PA 3AY3A 3ZE8A 1D5WA 4Z1OA 3H13A 2RGUA 3NEPX 1AMNA 3SHWA 2AJBA 3PXUA 4K87A 4KQWA 1QORA 4M88A 5TC4A 2O3UA 1LW7A 4XTRA 4D8VA 5CCDA 4MA4A 1P7CA 1SBHA 1WXQA 3L8ZA 4A0SA 2ONCA 3W9YA 3MT8A 1AGPA 1U3CA 3L4EA 4P7FA 2RHRA 3AR5A 3FROA 4N8EA 5BXQC 4HNSA 2XE8A 4FONA 2ILVA 3UHAA 2X1MA 2Z1NA 1H3EA 2YV3A 3CX8A 2ZTVA 3N87A 3T52A 2BEVA 1U0NA 1QIMA 3PPYA 5KMGB 3L1IA 1FIUA 4QO8A 4FKZA 2AOXA 2QGZA 4OUKX 4YUYA 2NVUA 5I8PA 3QX9A 3GRCA 3U4HA 3MWFA 3X1MA 3D5QA 2ODEA 2HRRA 2FKAA 5EJMA 4BFLA 1HZZC 1TQ6A 3OAAD 2J5BA 2GDJA 5G0UA 5IUNC 3ZG6A 3BGIA 3F3YA 1IIBA 2ZJYA 1RBZA 1DLIA 2YNMA 4N1AA 4Q0MA 1KEEB 5DSZA 5MGNA 1W5BA 3HKEA 4UDYX 1RWPA 3ZGLA 4DY4A 3UMMA 3BKWA 4MIKA 4Z2YA 1LLFA 3V3TA 1Z6ZA 3RS4A 2X22A 4QXRA 1G5TA 2C2YA 3CRQA 2G8LA 3FZGA 1LBQA 4WN9B 2PG3A 4NBSA 3TH5A 4EY5A 2X4IA 1KR2A 5EEGA 4F4UA 3V7WA 1T3TA 2QE7A 1YDHA 1Z0KA 4IJMA 2G7MC 3EF0A 3H1GA 3W90A 2ET6A 4JL6A 3O2SB 4FYYA 1DCMA 1WMFA 1SHJA 2P90A 2HQBA 4Q1EA 4D8XA 4J7CA 3K96A 3QPUA 4MRPA 4S24A 1ARZA 4PYQA 1GZSA 1IOWA 1TCCA 2PYDA 5AHRA 1O8CA 1KMIY 2H4FA 3O83A 1JAZA 1R5OA 2GPBA 3H87A 4MQFB 1VLVA 4NOMA 1U1CA 1WG8A 3GVPA 3OT4A 2GO1A 2PGNA 2YYZA 1WCV1 1HURA 1JDTA 2QTFA 3GGDA 4HYTA 1PZFA 4ABTA 3DOOA 3O26A 1YDWA 4PWZA 2ODBA 2UUPA 4D9BA 3LS2A 1L4NA 3IOBA 3KQOA 1KYYA 1PE0A 2YN2A 2EF1A 4LMAA 4QPPA 5B53A 3DO8A 3TQSA 1RS0A 1Z35A 3EDCA 1Q0ZA 3WMXA 2NU6B 2GKGA 2FLWA 4M9SA 1L7XA 4WXMA 1KSJA 3EJ6A 4XM0A 4JKIA 3QELB 3F98A 2C58A 2OCIA 3D2CA 3FA2A 2VTDA 3II6X 3SSMA 1UBOS 1YBAA 4BNVA 1Y1SA 2P4HX 2ZWIA 2A5YB 5E7JA 2K2WA 5AT1A 4E33A 1GFZA 3ISJA 1U2EA 2QK4A 4WNAA 3ZW8A 1RMTA 2D2XA 3D4BA 2VTBB 3IEMA 3F8TA 8ATCA 3BK1A 5GOTA 4FINA 2V58A 3R5FA 1BXRB 2FZKA 1P81A 2QD5A 4JEUA 4L4YA 3NZEA 4LBZA 1KRWA 1X0VA 3IBTA 4UU1A 1U3GA 3DOUA 3QPAA 4E5SA 1GHTA 3MYRA 5CVVA 2X3UA 2ZPUA 3DFZA 3N07A 1XX6A 2XZLA 1L7BA 5KINB 1GY8A 5CFZA 3V6MA 3B48A 1IY9A 1XXHE 4E2YA 1WQ4A 4NJEB 1G20A 4ND8B 4GWGA 2FW1A 1H6DA 1Q3TA 1X1CA 5TR9A 3NOOA 2P5YA 4K28A 1FYDA 1TQ8A 4MVJF 1JNYA 1LPSA 4DILA 2DG2A 2YWGA 4PSVA 4DLVA 3OKAA 4FGLA 5DM2A 1GUAA 1JAHA 5JD3A 2MINA 1RLIA 3DV0A 2VK1A 1Z8NA 1NXOA 3MIIA 5IBRA 2O05A 3WJ2A 3K1JA 3DAYA 3QLEA 1EWYA 1U94A 2JHAA 2WTBA 3CPEA 1UMCA 2ZCUA 1EM8A 4JY7A 4KIUA 1PFUA 4RJJA 1QFJA 2DH5A 1Y3IA 4DCMA 2PH1A 3P9NA 1JG4A 3JALA 4Y9UA 1DXYA 4MJ3A 5E6SA 5JSYA 4ACAA 5EJ6A 1RAHA 2GEUA 1DL5A 2W6IA 1M8PA 2GF2A 2QVLA 2ADFA 1MCZA 2V5UA 2XQFA 4QVIA 3E53A 3QE2A 4WFKA 3UUEA 4C43A 2F1HA 3KXIA 3EIQA 2PKXA 4IOMA 3HJBA 5TQJA 4EVRA 4GPIB 1DKQA 2XEDA 4E1AA 3FTCA 4M3NA 4YP7A 2DBZA 3W5UA 4HDRA 4JI2B 2X3YA 1Q0QA 3PL1A 5DDIP 5KTOA 4D8YA 3CLTD 2L2QA 3VR4H 1W5AA 3ZK8A 4EG6A 2P27A 4HLCA 1LBTA 2O20A 2Y1DA 1HE5A 3KZNA 3KD2A 4D9IA 2LV8A 1OVMA 2V5AA 1UKVY 3HYTA 1H2AS 2XD4A 5K3OA 4A82A 1GPKA 1TOAA 1ZK0A 2JJ1A 2QR3A 3LOPA 3M6UA 4IZ6A 1H93A 3ROTA 1PEKE 3TN7A 3ZJ4A 3Q7TA 4BU1A 1L7AA 1T3HA 2J4DA 1FFCA 2W2PA 5FPSA 5BSUA 3M6LA 1BWSA 3RBZA 3ST7A 3R9XA 3A6EA 2Y1FA 1N8KA 3DDWA 5ALNA 5KTPA 5DMHA 5ARDA 3NEJA 4QECA 3V7UA 4IINA 3V4VB 4EW3A 3ZLJA 5M5BA 4PICA 3IVRA 5C1IA 3LK7A 2VJQA 4FFNA 2QGNA 1SN7A 2QN1A 1C7RA 1PK9A 1ZNXA 3IXLA 2PGDA 1SXJE 3L84A 5T41A 4YALA 2NV6A 2RARA 4DLWA 5BURA 1DSSG 1QGAA