2XYPA

Caspase-3:cas26049945
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xypA00
1GQFA 4NBKA 4PS0A 2CNNA 5H0IA 3H0EA 3R6GA 5IARA 4ZVSA 4NOLA 4JQYA 2XZDA 3QNWA 5IAGA 4NBNA 1I51A 3KJQA 5IC4A 4I1PA 3V55A 1F9EA 1SHLA 3H11B 3R7BA 4EHNA 4N5DA 1I4EB 4NBLA 1RHUA 3DEJA 1I3OA 2FQQA 4ZVRA 1NMSA 1PYOA 3K7EA 2XYPA 2HBRA 3R5KA 5I9BA 4HVAA 4JR0A 3S8EA 1M72A 5LUBA 2CNLA 2FUNB 2H5JA 2H54A 2WDPA 1SHJA 2CJXA 4HQ0A 2K7ZA 1NW9B 4FXOA 2H65A 4N6GA 2C1EA 1RWXA 2Y1LA 2FP3A 3OD5A 1QDUA 2XYHA 3GJQA 3KJFA 4EJFA 1CP3A 4D3ZA 4N6OA 2CNKA 4NOJA 3UO8B 4QUJA 3PD0A 4DCJA 2XYGA 1ICEA 1PAUA 2Y0BA 5LU8A 3V3KA 3DEIA 4JR2A 2C2KA 4JJ8A 3P45A 4QULA 3UOAB 2J32A 2H48A 1RWMA 3R7SA 4ZVPA 4DCOA 3H1PA 3PD1A 2HBYA 4N7MA 3DEKA 1K86A 5IBCA 2QL5A 4QUHA 4JQZA 3D6MA 4EHAA 5LUAA 2HBZA 5I9TA 3H13A 2H4WA 4FEAA 1SC4A 4IYRA 4QUDA 4EHLA 1RWVA 4IEFB 1I4OA 3E4CA 1RWPA 2DKOA 4ZVQA 3NR2A 4ZVTA 2HBQA 4QUIA 5JFTA 2J33A 1K88A 1KMCA 4QU8A 1RWKA 3V4OA 4QTYA 4QU0A 4LSZA 4DCPA 2QL7A 4AWAA 3D6HA 5IC6A 3NKFA 1RWNA 2AR9A 2CNOA 4AW9A 2H4YA 3GJTA 4N7JA 5IANA 3ITNA 1JXQA 3NS7A 4FDLA 3EDQA 3R5JA 4AWBA 3R6LA 1RE1A 4QUEA 4EHKA 4QUGA 4EHHA 1RHMA 5IAEA 3D6FA 3IBFA 4JB8A 3V6MA 2C2ZA 4EHDA 4NOKA 5IAJA 2CJYA 3V6LA 4PS1A 1IBCA 2H5IA 2QLJA 4QU9A 4ZVOA 2C2OA 2J30A 4M9RA 4NOMA 4ZVUA 2CDRA 5IBRA 5IBPA 3RJMA 3SIPA 3BIJA 1F1JA 3GJRA 4QTXA 3P4UA 4QUAA 4D3YA 1SC1A 1NMQA 5LU9A 4N6NA 3IBCA 4I1RA 5IAKA 1QTNA 1RHRA 4JJ7A 3GJSA 1RWWA 3R7NA 1RHJA 2H51A 2NN3C 4PRZA 3SIRA 1BMQA 1RWOA 3H11A 4D3XA 4HQRA 1QX3A 1NMEA 5K20A 3KJNA 4JR1A 3EDRA 4QUBA 1CVRA 5IABA 4FGUA 5IASA 1RHKA 4PRYA 3PCXA 1GFWA 2P2CA 2QLBA 2C2MA 3DEHA 1RHQA 4JJEA 3S70A 3V4LA 1SC3A 2QLFA 2J31A 2QL9A 2XZTA 4EHFA 4QU5A
chains in the Genus database with same CATH superfamily
3HWSA 3OECA 1VE3A 2XF8A 1RLMA 2B1RA 2OYSA 1SFRA 2ZIVB 3BJEA 5AVSA 3JQPA 2PKRA 4Y2YA 1P4JA 1JALA 4DKXA 5A4DA 5FL7A 3DZBA 2GM9A 3M4ZA 2V5UA 3AF6A 3VDXA 1E4OA 5JFGA 3B53X 3AX6A 4II2A 1AH2A 2OHGA 3JWEA 2BMJA 3RV3A 3A4VA 2AUTA 1RRGA 2VDUE 1PJ4A 2LTAA 1ILWA 1R0CA 3H11B 2WJPA 2J5KA 2Y3IA 3ID6C 3L7DA 3TLZA 3CEJA 2VHEA 4DUPA 1RR6A 1C4KA 4FX5A 4ENTA 1T3TA 3PV0A 1H3EA 1RI2A 5DYYA 1V6AA 2VWQA 3RFXA 4H4DA 1S8NA 4BP1A 5B7GA 2VC2B 2H8KA 4BXOA 3NJ4A 2AC7A 4O6VA 4GF5A 3MT0A 3OEYA 3WLOA 1RTKA 3HJUA 1T3GA 5K2MA 5IWCA 2VWHA 3LUJA 1CVIA 3TVTA 4GBMA 2BHLA 2IEBA 3TR6A 3SDSA 3EXHC 5LJIA 4LZAA 4MRPA 2QVGA 2CXSA 3UAGA 1OBHA 2OGSA 3A14A 4ZT7A 3W6PA 3ZWYA 3DP7A 4FMCF 4K03A 3DDSA 3Q2OA 3BRWA 4JAVC 4UHHA 5DGHA 1MQAA 3L0SA 3M4XA 1US8B 5EWMB 3COPA 3UJ6A 3TIIA 1HFKA 3EJWA 4JNCA 1M0SA 2ZITA 3QOXA 1F8FA 3CTMA 4L6IA 3FZYA 1YZUA 1C3XA 3NTVA 5HJ2A 3S4YA 1E1KA 3DBHA 3FSRA 1QC5B 2ZUBA 3W05A 2PGOA 3PVSA 3JQFA 4HLNA 4UDNA 1KP9A 1WXXA 2ECQA 2JHFA 3EGVA 4RZ3A 1SCUB 1I4LD 2M1ZA 3L77A 1IXYA 2FLWA 1H2AS 3AO0B 4K2AA 4NPAA 1O08A 2VSNA 3PQ5A 1M54A 1Q1QA 2OHVA 3ZDXB 1G3MA 5T8KA 1KVTA 3GMSA 3VSAA 1ULBA 2HMWA 5J4KA 5KMGA 1J8MF 3RDPA 4EG3A 2Q2NA 3EMKA 4MO9A 3ZXXA 4QHYA 4Z1OA 1IVYA 1XK7A 1O54A 2GF2A 4E1BA 2EF1A 1KMIY 1YBMA 5IJ9B 1U28C 4QUKA 2FRVA 1D1TA 3B3QA 3I2KA 3BK7A 4RJTA 5JOQA 2MYNA 1SZPA 4F4DA 2OG1A 3RYHA 4XLZA 1ZVMA 2PT9A 5C8VA 4YLGA 4E4RA 1WZIA 1NLYA 1GG5A 3PEVA 3EJ6A 1HSZA 1PT7A 2HIGA 4YK7A 4AS2A 3A36A 3CGGA 1C7QA 4N40A 2HSJA 3ESCA 4H1VA 1A4IA 1NI4A 1RM0A 3A4TA 1AV7A 3KKKA 3KTAB 3PWSA 4FIDA 5GTDA 2B0CA 1MJGM 1PIWA 2VNKA 2RK4A 3F6RA 5A3SA 4Z5XA 3HBAA 1IRXA 1XI2A 4LDPA 4ZCQA 5TGZA 3WIVA 3ZWNA 3LCMA 4KQMA 2ZUEA 5A3VA 3SQOA 2FW8A 1UPTA 4AY3A 1NMZA 1Z0AA 2YV1A 3HYTA 3HB5X 4MWOA 4MR7B 4P93A 5ECWA 4JBIA 4X1IA 5HZGA 1MC8A 4FGJA 4QSHA 5T4EA 1AU9A 4B2PA 1G8JA 2WNIA 3C3AA 3EZXA 4PWZA 4S2EA 3ZWCA 3UPTA 4P0QB 1C4XA 2J7PA 3LT2A 5KDLA 4ZGBA 2QNRA 5FWDA 1LDEA 4KUEA 4DDUA 3PUYA 4LJ5A 2QRVA 1MX3A 3WL3A 4P4SA 2B4TO 1Z0IA 4FDTA 5DEOA 1Y8QA 1EJ6A 1OVGA 5BVHA 2FZWA 3I9JA 3NNDA 3WL5A 3OPVA 3OE7A 1Y9JA 2DG2A 1JIUA 3W8FA 4E7OA 1Z13A 1SIWA 4CI9A 3DYIA 4WASA 2C9YA 1H5NA 3KPWA 2CMGA 3KAKA 5I7RA 2W6NA 5DTJA 1OI2A 4LC0A 3L02A 2ZE8A 3DAYA 2P35A 1QIKA 2YIMA 5K0ZA 1O5OA 2H1CA 3H1TA 2FUKA 4NCIA 3RTBA 3KVRA 1KS2A 2QM7A 2VDWA 3OJCA 4DN6A 2BBSA 4NULA 3VDQA 2AXPA 4AJ9A 3IR6A 3C7CB 4EA9A 4D6XA 5HS4A 1T5OA 2HA0A 4FB4A 3FZGA 2VJQA 5ED0A 2EP8A 2XMDA 1AKVA 2VNSA 4AXBA 5KNBD 1U5BB 5AUNB 4LFCB 3UWSA 3WGTA 5A3RA 2NVOA 4K86A 1MOQA 2KBEA 4GI2A 4TSKA 4LOJA 1Z29A 4HD8A 2GK3A 3CF0A 4ZHQA 4C01A 2OLJA 4II3A 3PNOA 3BGSA 5AW3A 4QEKA 1DBIA 1K68A 4WESB 1W5TA 4X90A 3VZCA 3SMVA 1ORDA 3E15A 1ZICA 2PL1A 3BL5A 4LNUA 1CU1A 4ZARA 2HBYA 3U48A 3CNOA 3QLVC 3Q85A 4KRFA 1X7WA 3ZGVA 5CG2A 2Y0DA 2XDWA 3J7TA 1U7HA 2AOXA 4I50F 3AHGA 3KYDB 2DPHA 1WZUA 3KTOA 1HDIA 4GQBA 1YB2A 2CVHA 5M34A 1T8YA 1RJGA 2B7LA 1Z74A 1GTZA 1EWQA 1DXOA 2IYXA 3FIUA 4L3OA 3D0KA 2I5PO 3AEKB 2V7GA 2QTFA 1PR1A 2O8FA 3F49S 2W70A 5CD9A 4H0CA 2Z6VA 1XR3A 4P82A 4MA4A 2OVBA 3N0RA 2ZRPA 2J0EA 4HEJA 5TC4A 4F2GA 4R1UA 5L4NA 1WXQA 2OESA 4PO9A 5C3UA 2A9QA 2FW7A 5T5QA 2O6LA 4C21A 1QIEA 4Z0NA 2I03A 2BUAA 2JHPA 1WUJS 2OO5A 2GX6A 4JOSA 4PLPA 4ZCLA 2XQGA 1I01A 2GBIA 3GWZA 3VKHA 2X5XA 2ZT7A 1MB0A 2ETVA 2FMXA 3NUGA 5HRCA 4FYMA 1O6BA 4G67A 2VP6A 4KN5A 4MTLA 1H65A 4R05A 1H2WA 3R41A 3SFZA 4E21A 3B3GA 1ACLA 1ENZA 1G2OA 5LQNA 1FSPA 1PFGA 4EG0A 2J3HA 1L7MA 2IHKA 1CUHA 2ZZKA 1EWKA 3VR4A 2QAGB 3MZ0A 5G0UA 1FFYA 3PUIA 4MKXA 1DHTA 5IM5A 5BRNA 2SECE 3ZY6A 1E4YA 1VBKA 3OJLA 2H2DA 1ZMBA 5ALJA 1Y8RA 3PG5A 2LWIA 5L51A 5FNZA 3KSRA 4QICA 1LJ8A 1C4OA 1U0FA 4LXIA 4IVRA 1WSWA 2HAEA 1H8ED 3ZZMA 2B1QA 2BMAA 1RVV1 1QBKC 1H1TA 5L95A 2J9FB 3WTCA 2QG9A 1KEZA 1ZK3A 3BBLA 3O73A 3TB6A 3V2HA 3W5SA 1M34E 1QZXA 4CM4A 5L4SA 1XG5A 1X9HA 3IC5A 3LC2O 3MJVA 4KSBA 1DKLA 4I1PA 2PCLA 4I2NA 4W7IA 3V55A 3ADBA 3PS9A 1EWTA 1M2HA 2YWFA 3DNMA 3D43A 1Y3BE 2IPMA 1JYFA 3FG9A 5DWVA 5K6RA 1M6EX 1M6VA 2HZBA 4EFLA 1OZ0A 4DQ0A 1JE1A 4LSGA 1O97D 4OFZA 5T3YA 2ZDHA 1MJ5A 3VR4H 3W6NA 3WR5A 2WJZB 4BQRA 1R64A 2WJGA 1D2MA 1PO7A 2H1VA 3GRRA 3LE8A 4XYMA 3Q40A 2ZJ2A 1QPZA 3KT8A 4YO8A 2P5TB 4WGGA 4WY2A 1VHDA 1PK8A 1Y5IA 1JHYA 2XUZA 3VNVA 2Y1FA 1V8BA 1X9GA 3P8ZA 1DCTA 3VOBA 2GO7A 1A8IA 1ID1A 1MTZA 2EX0A 2ZM6B 2HF7A 2WWGA 1R8XA 5LU8A 2VH1A 4I66A 4KEAA 4NONA 3TL2A 1XLUA 4DYVA 5K0EA 1VHLA 4Z7QB 1RQPA 4UEQA 4WKPA 1KZ7B 5CU7A 5IDWA 2ZJZA 4NMWA 1EE1A 1VRVA 2AQ8A 3ASVA 1O8CA 5K8IA 3B5JA 4DR3B 2IHYA 4P2BA 1HV8A 4RSMA 1RJ9B 2JLXA 3K70C 4UOZA 5IEJA 5FA5A 1XTQA 2XCRB 4EHBA 1CRLA 4L27A 4ZT6A 1LZLA 3JYQA 4H7FA 3HN7A 3WHPA 3VR5A 1JVBA 5B37A 4PBTA 4ZHSA 1KY3A 3R7WB 2JA1A 1EHYA 3EQ2A 1U0TA 3QXGA 3VAAA 4P3OA 4DCPA 2CMFA 2VNJA 4NG5A 3GEBA 3AF3A 3NJRA 3ZWVA 4PN3A 3QVWA 2ZBGA 5F21A 1JHDA 1RAEA 2WUFA 1EGMB 5J5VA 2V4UA 2IA5A 2IYVA 3N0XA 2AYZA 3P9PA 1BHSA 4UM5A 1PWXA 1PS0A 5ADVA 5EXSA 5LPNA 2CUNA 4ZYWA 3LGAA 3DA8A 3K94A 4YJFA 3NTXA 1VPEA 4W1PA 2WM3A 1OXUA 3C8UA 3FCAA 3G9QA 1E3QA 3GRUA 3MD0A 5F9MA 3WOHA 4EKIA 6YASA 3P9ZA 1YF3A 1S4QA 1Z6GA 4YMSA 3S7ZA 4E2XA 1GQ2A 3IIKA 1WDTA 2Q29A 4EO9A 2EKDA 2NIPA 1QZZA 3KDSE 2UYOA 2BJWA 2DWUA 3CX7A 1FXWF 3GOQA 3ZV7A 4A82A 5E2BA 1NYLA 1XCLA 1ST3A 3AR9A 1SWVA 2JLSA 2P4SA 3BERA 1EP1B 4EY8A 1HTWA 1U2ZA 4TWAA 1R4AA 1HX7A 3GXBA 5AW8A 3BYZA 3OQOA 1LPSA 2GXQA 3E03A 1G9SA 3EFOB 1Y82A 2QE7D 2VCHA 4FUQA 3W0LB 4D4MA 3LUHA 1H4QA 2GYUA 5DK4A 3BGVA 3IUMA 2EZTA 3KUCA 4P6VF 4EQZA 2Y2UA 3S40A 2GT1A 1CHNA 1I3LA 1R6TA 2VYFA 1DJOA 1M8JA 2VUSA 4IZIA 4TZ0A 2ZLBA 5JV5A 3NTUA 5B5SA 4EGAA 5T57A 2VEOA 4UBKA 4MKFA 2X5KO 4WY8A 2OXTA 3UJ9A 4FFOA 4UTRA 1L3IA 3I5YA 5LMUB 4DR5B 4OQYA 3UTCA 1ZCZA 5LFAA 4GKVA 2D2FA 4JB3A 5LLSA 1NVBA 1YC5A 2HRCA 2HX1A 2VHJA 5K8UA 5LOVA 1IZYA 4ISBA 2PNJA 1UWKA 2XAUA 3I4FA 4J4BA 4CT4B 2HADA 1SKUA 1XZ8A 1T0PA 2P91A 3DP9A 2CXNA 4RQTA 4XIJA 3TB4A 1USUA 1U8UA 1M1ZA 1OFGA 4ASUD 2WC1A 1EUQA 421PA 1K98A 1AC5A 2PMWB 5H3CA 2ZM5A 1KDOA 1BU8A 3IILA 3P20A 1MAWA 3EX7C 4ITUA 2QE6A 1Y9DA 4FFBA 3A4MA 4AT1A 4I5GA 4JLMA 3FMIA 2ZIZA 3T5TA 4Q4AB 3K6SB 1SUPA 3OFND 1OXTA 1M34B 2GRAA 2KE5A 4N6GA 4O1MA 3TECE 1FVFA 3HO8A 3O2NA 3Q11A 2WD7A 2HSZA 3AMVA 3E9RA 3V7FA 2H2HA 4OY3A 4YFVA 5DWQA 1N32B 2PLWA 1U9YA 3P9YA 4N54A 1U1CA 2NXCA 4K6MA 4YMWA 1R8SA 2XTZA 2JL1A 4ZT5A 5D8DA 4TRJA 2NQTA 4F4IA 1NBEA 1V3UA 1KI7A 1QFYA 2AJTA 3BMQA 4JU8A 4KUGA 3S1LA 1W0JD 2V96A 4ROTA 4TLAA 1SCBA 2VYVA 3P5BA 3I2FA 5CT8A 3CFYA 4RV9A 2ID4A 1IAVA 1E2FA 2C3YA 4KOAA 4W7SA 2PEZA 4RIGA 4ALKA 5L3QA 4KGVA 3BMCA 3RUHA 2YCLA 1DTWA 2FFQA 4FHGA 5CVUA 3IYLW 1SBYA 3EXG2 1BFUA 2OFPA 4Z4CA 3EBOA 1ENYA 1R8JA 4OP1A 4QECA 4FFRA 4HP8A 2CLLB 4LBVA 4WOPA 1N25A 4KR2A 4X41A 1Q1GA 2EEPA 4BEVA 4J75A 3GCDA 1Z4NA 1YJXA 4J91A 1QHYA 3O92A 2R0QC 1KMCA 1JTVA 1TDJA 3DOUA 3EFEA 3NTRA 5A1TA 5BV0A 4B47A 1L8AA 4GWLA 4PZYA 3T5DA 4DLRA 2WEKA 4KIJA 5HCIA 3VZQA 1DX6A 1EUDB 5CA1B 4U5XA 2BSXA 4CN9A 3WIUA 1M2OB 4HPXB 4PWYA 2GCGA 2IH4A 5FB3A 1YVEI 1XTKA 4NR0A 5EE5B 3B2NA 4QATA 3FLAA 4ZRMA 3WB0A 2NT3A 1CYEA 4G1VA 1RRKA 4ML3A 3CZ4A 2QSJA 2X4GA 1P18A 3E5HA 3HLKA 5J58A 1PUJA 1A72A 3ZZNA 1PW5A 3ETJA 4CKCB 2OZLB 1ZXLA 3KK0A 4IX1A 5L6LB 1BWRA 5G4KB 2CEKA 1CC1S 3K0FA 4B83A 3ROKA 3A70A 1AXEA 3IPRA 1NXXA 4WI1A 2IIQA 4EKNB 4UAVA 1U04A 3R9KA 3VV3A 4RXMA 1NVXQ 2EWVA 3EEFA 1G8HA 2H06A 2HOQA 4NZ9A 4UAJA 4D0NA 4LWZA 2GAIA 1LDNA 4D74A 3ZQKA 3RKRA 1GL6A 3ORHA 1K66A 2A92A 4JVMA 4D4IA 1LSOA 2WYUA 3W2IA 3HMKA 3VYSB 1ZGAA 1I7LA 4MUKA 3D64A 2C4KA 5GY7A 3EYWA 2ONKA 5BN4A 2C1ZA 2JVJA 2XBUA 2P6MA 3PDHA 3VFDA 2ZUWA 5FPYA 1A71A 4YX9A 3NH6A 3ONWA 3DAHA 3WBBA 2QVXX 3F97A 2QJOA 1KI1A 1CY6A 4RK0A 3ZWBA 1A9TA 3V1LA 1EKXA 2OO3A 4FPXA 4I1OA 3JQAB 3WL8A 4C4YA 3D81A 3K2QA 3LWZA 2AKAB 2YXLA 2ZYWX 1KC1A 1MX5A 4IVQA 1LD3A 3HXKA 3RH0A 4M60A 2WSBA 4F85A 5JWRA 1NMSA 1KJYA 4F3KA 4ZTUB 2VK1A 4HEHA 3S8EA 4EECA 2KBFA 5D5QA 3L7AA 3WLJA 3K9CA 4CV0A 5DKFA 1FNSA 3J81A 4ENSA 3UJCA 4L3WA 2FX2A 3TSOA 2H7VA 3OOEA 1HE1C 4YRIA 2DJIA 1GKUB 1O96A 3D6TB 3HM2A 4JJKA 5DX8A 4B0PA 1OLOA 1PGOA 1JZQA 4ZAFA 1E99A 5DN6A 3ZWOA 5KYWB 1Z5OA 8MHTA 1E8MA 1GN9A 1NL3A 1WABA 2O0LA 1XQ1A 3HE3A 4X00A 2JJ8A 5KVSA 5C53B 4K9RA 1QZ3A 1TRHA 3F7MA 1IVNA 4LF9B 1O6CA 4X8LA 2XMRA 3EG9B 2QJRA 2L82A 1RRMA 1QSGA 2Q4TA 5FLEX 4Q21A 1KAQA 1KI4A 5AJVB 1R0SA 4OAPA 5LP6B 2G0NA 2J3QA 1RXVA 1Y5MA 1LS6A 4C2UA 2P9HA 1HDEA 3H1PA 4GE3A 4I3FA 4B2LA 1D4OA 4D45A 2B83A 5F73A 2F3SA 1Z36A 2ZI9A 2QQ5A 4BVFA 5IYZA 4J7CA 4EAAA 4KXVA 1CUWA 2JW5A 1RACA 1SC4A 2MYUA 1O87A 4IDAA 4NZNA 1HG0A 4WRRA 1GZ4A 4J2OA 1XROA 1P2BA 2GFQA 4KPUA 3X1DA 3NTQA 2BFMA 3GN1A 3LLMA 1K88A 3FF1A 3O47A 4JP5A 2PR7A 2O8BA 2H59A 3PIDA 1U28A 2XKAA 1T5IA 4X97A 4Q9AA 4IJMA 3MWYW 1JLLB 2Z95A 5F3WB 3IQWA 1QZUA 3NHWA 3WX0A 4DGSA 3M49A 2R1TA 4DIFA 3COSA 3K5PA 3AVYA 3R9WA 3O4FA 4AWBA 4MQ4A 4EYSA 1VM6A 3L05A 1JILA 3BRSA 1JE0A 1CR2A 1Z34A 2E85A 1KK1A 2R66A 3FCYA 3B9RA 5EVJA 5F1PA 3ULKA 4F3YA 5JZMA 1J22A 3UNXA 4L75A 1A9YA 2H0AA 3PHHA 3QMMA 2GETA 4RGQA 2OL4A 1OC2A 2IXDA 3OP4A 3B1XA 4AG3A 1U9IC 1OZGA 2ID8A 2C20A 2FEKA 1FSSA 2P1DA 1QHNA 5I4KA 1VJDA 1XA4A 2W2KA 4R71A 1YUNA 2EDCA 3M2PA 1IQUA 3L43A 4Q3AA 3GT3A 2ZSBA 3GQBB 3W5VA 1T2UA 1P9NA 4BLQA 5C5DA 3ZJ5A 1J1ZA 2APJA 4PSVA 5LYJB 1FQWA 2NN3C 2A9JA 2G67A 3T99A 3R0ZA 5KOHB 1E1MA 2XWQA 3MVEA 3AVWA 1JJAA 3KD2A 1MLDA 4JASB 1V6CA 3L6RA 4LXUA 2UZ4A 3VO8A 3LA6A 3VO1A 3WYBA 5C32A 4EY4A 1PFQA 2QZSA 2Z83A 4HGQA 3L84A 2CEAA 1CPYA 3DZFA 4Q1AA 4QGAA 2QJWA 4MVJA 2Z1NA 4RVSA 4IV8A 3I1YA 3UIEA 3TTXA 3G9UA 3WWOA 5FL7D 3EAFA 3MERA 4FS8A 3PQ4A 4FWBA 5D51S 1B76A 3HJFA 3BGOS 4IIVA 3TRKA 5F9FA 3V8EA 2PJZA 3HDHA 3RRNA 4A2CA 3HCFA 1MB3A 1S5PA 1ZMTA 4P33A 1E58A 4AYWA 2IVFA 2ZSEA 2EFGA 2G40A 3GBPA 3JD3A 1GG8A 3JS5A 3OC6A 2VPWA 3CW9A 4JLPA 4XI9A 4BB0A 4BLWA 3UANA 5KYYB 1X7ZA 3PENA 3HP1A 3NT2A 5CHEA 3REOA 1PYDA 2MWMA 3Q0EA 4MI6A 4B3FX 1K89A 1SQFA 4ZAZA 4XDZA 2B36A 1O2DA 1QK5A 2EW2A 2ZUTA 1D8AA 5IXSA 4ON9A 5EERA 3DE0X 2I8CA 4FYVA 3BXHA 3C45A 2C8LA 4BFCA 4OIFA 1FVXA 3DFFA 1QLWA 3SHTA 4E4YA 3SEFA 1DCMA 2W22A 3GFBA 4MV6A 1RIFA 2J87A 4ZOLF 2OCYC 4MGIR 3O3MB 5KWIA 2P4UA 2WU3A 1L8XA 1H6BA 1KBZA 4WX2B 2WINI 2M6KA 5FTJA 2BM9A 2C00A 4K6HA 1NN0A 4EWLA 4WKOA 3WYCA 1LZKA 1NT4A 4PEVA 1JDSA 4MVJH 4P4GA 4DIBA 3ED5A 3V8VA 5KNDD 2A30A 3UY4A 4YVFA 1BJTA 2I65A 4HB2A 3F0TA 3IAM6 4A8HA 3KQLA 5EYPA 1FUEA 2ZR9A 4EKGA 1YI1A 1GL3A 2BGMA 5F2EA 4AN1A 1ZN2A 1YS7A 1E1CA 2J5RA 1XAGA 3T7JA 3COYA 1W1WA 3NBXX 4KMOA 1I4WA 2IK8A 1NXQA 4OQNA 4RCVA 1T2FA 1RZRD 4RMJA 4DJ5X 3IBTA 1N8SA 1Z0UA 3JSXA 4WERA 3T3PB 4E6EA 3B1KA 4IY1A 4MKZA 4FT2A 5FO0A 1U3CA 2A4KA 1OTHA 5KYUA 5K3CA 5AKHA 1NR7A 1GZSA 3WHLA 4DXAA 1HKUA 1EM6A 2FUG1 1Z28A 3GJTA 1NHWA 1QK3A 3GUVA 2EOAA 4KO8A 4RIFA 5FOWA 3T7SA 1W96A 2C0QA 1JHUA 4JH0A 4MVJP 1NQ5A 3OESA 1Y1RA 2ACEA 3CLRC 1T5LA 2X1LA 4O59O 1E4VA 4MYRA 1ZUNB 1LJLA 3DMGA 3G23A 4LDAA 2WRZA 5EXEA 3A2NA 3C3BA 3K32A 4YA6A 2DWCA 4PS1A 4QU9A 4WZAA 1FOEB 2A5YB 3ZR4B 1TYCA 5K0BA 4JYAB 1ACJA 4LJ9A 4NZOA 3TZHA 3QLJA 1FYFA 4Y2QA 4F5WA 2Q7DA 3LPCA 1B0UA 4S1TA 1L1QA 1FFCA 2DB3A 2QRKA 2GASA 3DV9A 2BGRA 4RXUA 1XU7A 2WFLB 3UJ7A 2VAMA 4DV6B 4FQ5A 2IDMA 2WPNA 5BW5A 4YDSA 1CXZA 1RI4A 3VOSA 5KVAA 1A9RA 1BWSA 4M46A 4IF4A 3UKOA 4LF8B 2YUIA 1P6XA 2V7VA 2DPLA 3AL3A 3L4EA 3LUKA 4JL5A 4Q7LA 1M1XB 2C7GA 5EIWA 5HZHA 1ISFA 4H7DA 1HM5A 3CQ9A 3NBKA 5DULA 2QT9A 2QYHA 1B3BA 2PXXA 3IRUA 4QAQA 3OJ0A 1CWUA 2MSNA 4DYDA 1UBKS 1QO0A 4ZZ2A 5DNUA 3FCOA 3Q7EA 4WWHA 3KOYA 3REFA 3AERA 5HMLA 1H4TA 5E1OA 5HK8A 4EA8A 5BN3A 3O8QB 2VTEA 5I7HA 2Z5GA 5KPJA 4XX1A 4FFDA 5DYTA 1E9VA 2BTOA 4FEYA 1NFRA 2D5AA 3WE7A 2O57A 5GIPE 4HAUA 1LQTA 2UAGA 3PBKA 1U2SA 1E6EA 4OJTA 1EQUA 1M8FA 1NTRA 2CXRA 1E1LA 3BMOB 5KNCH 2H1OA 3FTCA 4LF7B 2PL3A 5FTWA 1H23A 1BXKA 3SJUA 2Z2IA 3VM6A 5J2TF 3AR4A 1D1QA 5FQOA 4CT5A 5KDDA 2PTGA 2RIRA 1VJRA 3ADOA 3OU7A 4G37A 1NASA 4R1TA 1SY7A 1Q14A 3BBPA 1GNRA 1IJEA 4BP9A 4JC4A 4CM1A 3U61B 2FJ0A 3LKBA 3VTZA 4IDHA 1RJWA 2CYCA 5FPQA 3JPWA 4D8YA 1E7WA 1SK8A 3PNKA 3LY9A 4HBGA 5KKAA 1HTTA 1LEHA 1H85A 4GPD1 1VGRA 4KLRA 4ER5A 1Y6JA 2WA2A 3CG4A 4D4HA 7MHTA 2D8MA 3E61A 1RS0A 2JIZD 4EAQA 5K3OA 5HQTA 4KNVA 1K8XB 1TW3A 1FSFA 3R7SA 1QP7A 2Q27A 4CUZA 4L85A 5CIWA 4E70A 4YAGA 1HLPA 1E98A 1ZCBA 3T3OA 1DEXA 2HQ1A 3KKQA 1VYTA 1I33A 5FWXA 3KYBA 1PJZA 2GZMA 2QPAA 3IPXA 1GPDG 3LVQE 3R5TA 4JXJA 2FUEA 4PTLA 2Z8YA 5CNJA 1M0TA 1PR2A 1V48A 2OCLA 2VUIB 3IV7A 3U7QA 3V7YA 5KYNA 5J1SB 4WOKA 1YNOA 5H8WA 3D3JA 3RARA 3WSTA 4CZ2A 4YRPA 4LZNA 3VUEA 1AKWA 1T2NA 1IY2A 1CUCA 1OBVA 4KP7A 3AVVA 1YJBA 1UDCA 1EGVB 3T1NA 4DMUB 1E2UA 1AGPA 1ZIOA 3VU3A 1LFAA 1GZHB 1ODJA 5IUJC 3GGPA 4HJXA 1VG1A 3H9GA 1W52X 2J0QA 3HVUA 1FFXA 2ECFA 1J00A 1U0GA 1NN1A 2JGKA 2O2CA 1XCJA 3DBHB 3E0XA 3D0RA 3GFQA 5IDYA 2FW0A 5ELXA 1J2YA 4HEQA 3RFCA 4JNKA 1CUSA 1J8FA 1QIIA 2QW1A 3H6HA 3UOGA 4B3SB 3IEIA 3C3WA 3G2PA 1TZCA 3E7DA 3PUVA 3DJYA 3C1OA 3SHVA 4KODA 1U8FO 3NCHA 4KNWA 1EAYA 5KMGB 3EULA 4HPJB 3F4KA 4EL0A 2D5LA 3F6BX 3KB1A 1NI5A 5ARDA 1DIAA 1WSBA 2R86A 2R84A 3FGNA 4OOFA 3BXGA 4UJ5A 3UYKA 1SXQA 1YDFA 2GJ9A 3OBIA 4H1TA 1JJVA 4AROA 4LQ4A 5J4VA 4TQAA 3PKJA 1CR0A 3DOFA 3NWOA 5K8CA 3D8NA 3W4JA 3NB0A 1TW2A 3RYHB 4M9UA 3O8BA 1QKJA 3NJ8A 1IEQA 5J9FA 3U4GA 5ICCA 4LRUA 3IODA 3FOZA 4IQ0A 2IS2A 1T6BY 5T67A 1R4MA 3DYBA 4JMLA 4DCUA 4OUDA 5ICFA 2FFJA 3P2IA 3H0CA 5JH7F 4TPKA 2IQ5A 2OFXA 1QRDA 1NI4B 3OWHA 2UUCB 4TKZA 3ZHXA 1KFJB 5C52B 1ZU4A 1L5YA 3L7CA 2IYWA 1Y4UA 2NQ8A 4XM0A 3VPGA 3ZHRA 2X13A 3MCAA 2PRYA 3R1IA 1N3YA 3FPLA 3LHSA 4NKRA 5LXTA 3JATA 3DDNA 4I3HA 2Z6AA 2UXBB 4JZKA 2HRZA 3FWYA 3PYXA 4B76A 4X1IB 2PQ2A 2QIPA 5HQJA 2Y27A 3ROMA 2HDNB 5TVGA 3AIMA 4JODA 1PWZA 3FJYA 2WIKA 1TA4A 5GJVC 1X80A 4DRZA 5JNWA 5E2AA 3NBUA 5TGDA 1A1SA 2C31A 4HH3C 4P4SB 4YC7A 5AI9A 4W9MC 3THXA 1Y8QB 4NBVA 2ZU6A 4NSNA 6REQA 2Z2YA 5BVHB 2N0SA 2AF3C 1KOLA 3RRYA 5H59A 2XCLA 3OD1A 1JH9A 3OZGA 1MV5A 3PUXA 2FY8A 2R8XA 5TPZD 2BT4A 1ONOA 3CVYA 2YBEA 4FOLA 2QJTA 3HDGA 4KVGA 4OQLA 3A6FA 1UKBA 5D1HA 1T91A 1H6CA 1YDMA 2WSIA 4J7AA 4MQMA 1T9KA 3KXIA 2WIBA 4DMFA 4BX8A 3MWLA 1Z0KA 2PYIA 4Z7JA 1GA4A 2YVQA 2VDQB 4Q4JA 3A6EA 1OWOA 2I55A 4B8ZA 1R9JA 4HNHA 3L0ZA 3SQMA 1YIAA 2WVAA 3RTEA 1T0JB 4WD3A 2VDWB 1DADA 1MDFA 5ADUS 4TSRA 1U1DA 1XRJA 5EZSA 4B3CA 3PHIA 1SUWA 4PC7A 2J9RA 4QOIA 4E5KA 3OPXA 1U0SY 4V0LA 1H0HA 3VC3A 5KTSA 3TSCA 1DDOA 1WCWA 3WB2A 2J4FA 2YC4C 3QHQA 3VR5D 1RYDA 3FUWA 3Q7QA 5DF1A 5ALZA 1KP2A 1RWVA 3GBVA 5CDTA 1YQXA 4O2RA 1H8HA 4DCMA 5A62A 4HWGA 4TKVA 4HTFA 3LXRA 3H9BA 4MDHA 3ZV5A 2RGWA 5AIAA 1ZOIA 2BUBA 3I83A 2PWAA 1MDBA 3RTCA 1N6OA 4UAUA 4MWGA 1LWNA 4ZHQB 3ROPA 4YRBA 2OKGA 3CRQA 3LBHA 4HXEB 1VXRA 4LNUB 3OBBA 1QHGA 5I3CA 3DDUA 1JNXX 1X7WB 4JJFA 1EU1A 1LI4A 2JLCA 1G3UA 4I3GA 1C7JA 1ZRNA 2OAGA 3ENNA 1DWOA 1IWOA 1MEEA 4H08A 3LXUX 3P9KA 2IQIA 4OF4A 3X1YA 1JV2B 5G1NA 3HGTA 3HUFA 3TJZA 4BFWA 4DILA 3PX3A 3KEQA 1U90A 4I7EA 4R40A 4KK3A 5DVZA 4R9NA 2X0KA 4OYYA 4D2IA 2ZR8A 3FMOB 1ML4A 2YXBA 4L4UA 3INGA 5DCLA 2VPPA 4M9XA 3SYNA 2CFOA 5L3ZA 3IBCA 4BRSA 1JBKA 4GPIB 2O8FB 2EQ5A 3QPAA 2IC5A 4A8JA 1U9CA 1TUEA 2BWJA 3LF1A 2FSHA 3N86A 3MTAA 4HCJA 1QORA 3T0IA 3TM4A 2JAWA 4MJXA 3QY9A 1PZGA 3AGQA 3KB8A 3KEOA 2EBWA 3OQ6A 1CY0A 3OLYA 1EVQA 1VL5A 1KBOA 3R44A 4CQLA 1DC4A 1OI7A 5EKXA 3DFMA 3HV0A 1G6Q1 5EKDA 3UJNA 3ETNA 4BLRA 5AVJA 5T6MA 3GJ3A 3HWWA 2UZ3A 3LL4A 1X8JA 3NGMA 1QBGA 1AURA 2VZ9A 4WDRA 4RS3A 1IN4A 1IM8A 3NORA 4BLVA 4MPJA 1PNVA 4RWEA 2G5PA 2Q9UA 4NU6A 3QSGA 3K6RA 3TOVA 2DE0X 2ZBQA 3HACA 1PJSA 2PZAA 4TL7A 1F9EA 5FTMA 2IOFA 1WB9A 3SZLA 3VNBA 2IEZA 3UB2A 4CYMA 1XVUA 1FRFS 3N3BC 1Y8RB 2VRCA 1NSFA 4IKOA 3R9IA 1DO0A 4HEA1 1V39A 3U3KA 1H3NA 5CFQA 2JARA 1V5EA 1Z7BA 1NUTA 3ZK7A 5HXAA 4FHDA 3FMVA 1OV6A 5I7WA 1WU7A 1QH9A 2DETA 2PZMA 5C34B 4LHYA 3S28A 1EVKA 1P3Y1 3DZJA 3R4CA 4L73A 4B71A 3K9HA 3L6BA 2HHCA 4P7JA 1MRSA 1JSXA 1DCFA 1OYYA 5D00A 1TEXA 2I78A 1TMGE 4CM4B 2PQ0A 5KC9A 2RK3A 4PLWA 1EMDA 3OETA 1SCKA 1Z4LA 1E2KA 1HDYA 2VYVD 1ICEA 1QYRA 1YUBA 4FOOA 3N6RA 3TQOA 1PN3A 1N5LA 3SZMA 4D4GA 2O2IA 1ZW1A 2IZOA 3CZPA 4MHOA 4XIIA 4NU8X 3RRMA 1M6VB 2XDYA 1C7IA 5TR9A 4KIGA 3VYUB 4CMJA 1HC7A 1UF9A 4JL6A 4A2WA 1KYZA 4UDOA 3RUDA 1IY1A 3B3FA 4YLEA 5FUQA 3DMNA 4ZXFA 4BNLA 3L5KA 5CH3A 5AQ1A 1P0CA 3N6XA 4IJVA 5FBKA 1FF9A 3TCXB 1Y98A 2C2YA 1DO8A 3ISTA 3VPCA 4DCSA 1B14A 2ZJOA 2R7NA 2Q6IA 2AF4C 2G83A 1XKLA 2TSYB 4JI8B 4Y9DA 3TX2A 5CLFA 2ISSD 2Q8PA 3PFWO 2ZZMA 1VIAA 3HCNA 1PJLA 2DTDA 1L4KA 4P4NA 4S24A 2UYYA 2H4FA 4EGSA 1MD9A 2E4YA 3AUKA 1KEKA 1VJ0A 4WZZA 3SR0A 1I4DD 4O4JA 5ETJA 1YZLA 2Y1KA 5AXBA 1CJBA 1WXEA 1C4WA 3D6FA 3MGBA 2JIBA 1LCIA 2WHYA 1NBOA 1Y5NA 2H2AA 1DAEA 3AHEA 5F4ZA 4DM7A 3ILHA 2XTNA 1FRVA 1L7PA 2BBWA 1U9IA 4Q66C 5HF8A 3EXFA 2HYDA 2DECA 2FHPA 2YYZA 4HDOB 2YWJA 4BIIA 3MJRA 4EA6A 4LMRA 2BGUA 4LJ4A 2ZWAA 1CZUA 5KYXA 2OSVA 3JQ8A 3NBZC 4KDRA 3HCDA 1P7ZA 5EJAA 3V7NA 2WDZA 4JHXA 1IRIA 2JFNA 4G85A 4I99A 3LPAA 1UFOA 2GN1A 5ILQA 3TIFA 4S1WA 1A2KC 3EBLA 4MVJM 1DAGA 1I2MA 3BDAA 4YDRA 4NYMR 4G4JA 2PE5A 2GN0A 3WSVA 2Z2JA 3K8OE 3PE4A 4ZU6X 1UAAA 4NK5A 1V8OA 3JALA 4WOCA 4YJFB 5AXCA 1NBHA 2PMCA 2X3YA 2F1JA 3NIWA 4GC5A 5DNAA 1TGVA 1O95C 3R3XA 3OIYA 1UEJA 4F9FA 3RHZA 3G7UA 1RYZA 1LBSA 2QLNA 3IVCA 1WY7A 3RB8A 3VPDA 1PR5A 3EODA 2NU8A 1KR5A 1ESNA 1I5EA 2P4QA 5KB3A 1KJIA 1W5AA 3Q88A 5K8JB 5D1NA 5TQ2A 4WK4B 3REGA 1EX6A 1U2PA 2X4LA 4WFJA 1QE0A 2ONZA 4PLCA 4ZT2A 4K28A 4BFZA 5CMLA 5G4LA 4JT2A 4UJ3A 2XY4A 4KMMA 1UWVA 2NO6A 1QIFA 3WK7A 1U6JA 3O2JA 5DCUA 1FYWA 2FUNB 3ABRB 1CUAA 3GBSA 1RABA 2HN9A 1UL1X 4E13A 2WVJA 1ZM2A 3CLSD 3HCOA 4JV5B 1DC7A 1QTRA 3FOCA 3PA6A 2PWBA 3UA3A 1CY1A 2P2GA 5LOVB 4ZI2A 2VUHB 3BL8A 4RV4A 5IMSA 3DLCA 5KOIA 4MPRA 4N6OA 1ZYUA 2CB9A 3ECAA 1CQXA 3VSDA 3PDCA 4DJEC 8LDHA 1GPNA 1Q1EA 5ALNA 1OH8A 4X6YA 3ROXA 3FX2A 1ZH6A 3IUYA 1PGNA 1Q1AA 2IIVA 5JNTA 5DHUA 3ZCSA 2E6UX 4JXKA 3F1KA 3KFLA 3SCZA 1MPTA 4CV1A 1ZR2A 1ZVQA 2R8EA 3HRKA 1SN7A 4FJ0A 4FFBB 1UDXA 1TVEA 2ZDGA 3CN7A 1KQOA 3EQ9A 3FUUA 3LKDA 5D5PA 4NMLA 2FN9A 3D4PA 2P1RA 2DSTA 2P7HA 2XAAA 3MRXA 5EG5A 3G6WA 1ETHA 1E60A 4NV0A 3FNGA 4U2FA 1K8ZB 2WD7B 3T6KA 4HRAA 3GLHA 1PWEA 1YL6A 2ZW9A 1P61B 2JIDA 2ZRAA 4UDXX 5KQPA 1QUEA 3ILVA 3CVUA 1OT5A 4NTZA 1S2GA 4P5EA 4GOND 3R7DA 2WJYA 3I09A 5EVCA 5CXXA 3BMQB 5IS2A 1JU9A 5K05A 5CD1A 4ARZA 2OCAA 4HI0E 4PR3A 2VAPA 5HGXA 5DW3A 4X63A 4CG2A 1NUSA 4ENQA 4G1FA 4MQLA 1J70A 3A6KA 4WXRA 1H2FA 3N6VA 2XV1A 3F67A 4EJSC 4F21A 1Y5RA 5L3QB 4G5QA 3BMCB 2PG3A 2OECA 1EXMA 2FMKA 1DTWB 3T15A 3N8DA 4BCBA 5ALHA 5JAOA 3NKVA 1UPFA 2GVZC 5KWEA 3BQMB 1F9AA 5IAJA 5DM1A 3LWNA 4MV9A 4Q1VA 1V8ZA 2V9CA 1TM2A 5FBRB 1VE6A 2EZ4A 1N2BA 3VPSA 5K0CA 1AUPA 3I6ZA 3LZ6A 2OWEA 4MROA 3HEBA 4MSUA 3KZCA 1Z26A 3DHYA 5CCEA 3RG8A 1V5IA 2BJVA 1Z5GA 5CFMA 2V7PA 5I4CA 4AQYB 4L78A 5E1BA 1J49A 5T4FA 2YJ3A 1HDRA 1YA6A 1YJ8A 2Y1OA 3SDZA 3IQEA 3B1YA 3OFVA 3WGOA 2B4KA 2BDEA 1I1QB 2GZSA 3U3DA 2VUUA 4R16A 3O84A 1IUNA 3I34X 4HATA 4C89A 1GVNB 1WG8A 2ZB3A 3N53A 4N18A 4YALA 5EHZA 2YFQA 4LE2A 5A4IS 4RX1A 1VTKA 3NM4A 5HW0A 1Q0LA 4JUAA 3RUIA 3TW6A 4HWSA 5A3QA 3SY8A 2WOOA 3GLKA 4MVJD 3GLGA 5TV2A 2EWMA 1GRQA 4JI0B 2FWPA 2Y0EA 1NW7A 1NNSA 1Q7GA 5DMXA 3VHQA 2COEA 3QPUA 4GI7A 4TX1A 3OZXA 1NWHA 2JFPA 3R6GA 1PVDA 3K0FB 1IDOA 2WWVD 4O3MA 1KH2A 4MVJE 5FLYA 4AUMA 4WLNA 2NV0A 2OE2A 2H1SA 4IMPA 5J5CA 5C18A 2ZXUA 2QB5A 2WTBA 5C7IO 1FJXA 3JARA 2EHJA 4BC0A 3RYCA 3ZXIA 3CE9A 2D7JA 1K9VF 4YPOA 1EXWA 2C59A 4W6QA 3ACCA 4A0HA 2AZXA 1A4XA 1OAAA 3WK4A 3H83A 1WRBA 3WA7A 3WGKA 4ZN6A 5JZOA 2XKBA 1T5DX 1B0ZA 1V45E 3EVGA 4XWGA 2CJXA 3GY0A 4OG2A 5BN4B 3UPUA 3ABSB 1NNEA 3DBVO 4QXQA 3MFQA 1T34A 3FGZA 3KCNA 4Y9SA 1XLVA 4Z1MA 1J06A 1W5SA 1KYQA 3S1SA 1E66A 3DFUA 4PLFA 3JVUA 3LG2A 5BWCA 4ATNA 1CUIA 3K1YA 2X6RA 3LW7A 2WB2A 3OQ1A 5CDGA 4GBED 2QVYX 3S5UA 2F17A 3MTBA 4FQ8A 2Q8QA 3DQZA 4JB2A 3LHFA 3AEUA 2GD1O 2B21A 2Z8YM 3P2YA 4ZO8A 1FPQA 2P65A 4DCNA 3NBMA 4WT7A 1ULHA 4CIVA 4RXTA 1HE8B 4LXXA 3WGNA 3W3AH 1K5PA 4OQZA 3LC1O 2PAFA 3W79A 3H19A 5A3JA 2DYKA 4GZ3A 4RNDB 5F98A 1JA1A 3OIGA 3KUUA 1WTCA 3R40A 4NZZA 4K0KB 1AJEA 5JE8A 1SIUA 1XRMA 4JVNA 4Y0AA 1A97A 3CVOA 1O96B 4K6GA 4Q0MA 1DKQA 3H2KA 3HEAA 5F64A 2OHOA 3C6MA 5U1PA 4F2PA 2AOWA 5ICGA 3PFHA 4U2BA 4WK6A 1L7BA 3OJXA 4Y6QA 4ZVTA 5LQSA 4S1PA 5EHNA 2WG2A 1TF7A 1AKMA 2QRZA 1SAYA 4X3OA 5EQJB 1PEYA 4OHFA 2TYSB 2AXEA 3C3JA 4B3HA 1GPLA 1HYEA 5DYGA 3PHBE 5DN9A 3KR9A 4R0NA 1EDZA 1H42A 3DHNA 5DT2A 1RAIA 3ROFA 3E53A 4EW1A 2FZ5A 1CJKC 1ZUIA 1U8AA 3EDQA 4Z0HO 1FFEA 1S8FA 1KJZA 1YNSA 2E3JA 2H8GA 2P3SA 2O6HA 3PX2A 4DLUA 4JLDA 4MWDA 5ENVA 1CUYA 2W6QA 5B55A 3X0DA 2XITA 3GEIA 4MUYA 3RU9A 1Y6QA 3FPEA 5IYZB 2C3OA 2W2LA 4OK6A 4AO8A 2CL6X 1AA9A 1V7ZA 2GHTA 2WAXA 3K30A 4ENVA 1W9MA 3PWTA 5B64A 1H1LA 4L57A 5HP4A 1FYXA 4KKXB 3G8CA 4KPUB 5I9IA 1E1DA 1UC8A 1V1JA 1KZGB 2BHTA 3GYBA 3LP8A 1B3RA 4GVXA 3W8DA 1OW3B 3WQRA 4GOOD 4PYNA 4ZIRA 2O8BB 1OXVA 3L8HA 4WZAE 4I1SA 1CQPA 1EFRD 3K9NA 1NULA 4M36A 3L7KA 4U6NA 4INAA 3T54A 4D3YA 5LMNB 4ZVLA 1YKFA 4DY6A 1XTVA 1Z16A 2R1TB 1L5NA 1RWWA 4B0OA 3WVNA 3W1EA 3F71A 2YBDA 3K8ZA 3T5BA 2EGGA 1NMEA 2GHIA 2ZI7A 4JR1A 4KWIA 4RETA 4XWOA 4F3TA 3W6ZA 5BQ3A 2FQ1A 1JQKA 1IB0A 2BHNA 3AP3A 4PIPA 3LI2A 5EGSA 4EUSA 1JEAA 4D80A 3EZ6A 5FFFA 2ZIUB 2DLCX 1TECE 1MFZA 2VG8A 5EJMA 5SY6A 3AOEC 4RE6A 1Z6ZA 4ZQIA 2LCQA 2K2QB 4TWJA 3SEZA 1U1GA 1RFGE 1LU9A 2D0PB 4JI2B 2KJQA 2Y1XA 3U4CA 4ETWA 2W2KB 2RGYA 3QU9A 1NUHA 4DDWA 1Z5WA 2WT9A 4MI9A 4U1RA 2F8LA 4KFRA 4HMOA 4UU8A 4CF7A 3SJCA 3U7RA 5LP1A 1HDCA 3W5IA 4I4TA 1W94A 3ZKWA 4UULA 2AKEA 1VPLA 4G5FA 2OTCA 2CDNA 4ZVKA 4US2R 1KAOA 4X92A 5KJ6A 4RULA 3B6MA 3DEJA 2O0HA 1QRAA 4HAWA 2ZUVA 4NU0A 4KZPA 1OFUX 4BN0A 4JUDX 4OBXA 2GPJA 2UUPA 4W4TA 1JXAA 2XLBA 2K7ZA 4M0MA 3OO1A 1OCEA 1ONPA 1RWXA 1AK2A 3FYSA 4CEJA 1KEVA 3VNAA 4HUTA 1FFBA 4EM6A 3L40A 5LWHA 1WDLA 2I2DA 3LUCA 3TO5A 1ONBA 3U49A 3T0FA 4B32A 4C4SA 1AKYA 1EFVA 3PVCA 4GI1A 2IIBA 2XOEA 2REQA 1Z88A 3HJTA 4P58A 3ES9A 4JVSB 2EGHA 2EU8A 1EBBA 3ESDA 1EX9A 1OKKA 2BP7A 3I3SR 4JGBA 4OL9A 4BBAA 2BJHA 3OZRA 3T0GA 4JR2A 3PI7A 4AJPA 1N3IA 1KYIA 2YW2A 2GN4A 3C7TA 2MDTA 1X7ZB 2ALJA 4RIHA 4C0QC 4CUJA 1NYQA 5LDGA 2A35A 3IELA 4C9BA 1SVKA 4B4WA 3PD1A 4ALMA 4ENUA 2EW1A 1Z2CA 2VEDA 1U4SA 3W2TA 3EIHA 4A6PA 3O0DA 5IBCA 2OEPA 3P5SA 4E5PA 1OWLA 2HLDA 1V7CA 4ESOA 1ULAA 4M8LA 2OFWA 1HFWA 1XVTA 2AT1A 2IYAA 2VQ3A 1MQ8B 4U7FA 3VRHA 2C9DA 1JQAA 5A7FA 1GAJA 2ZJ3A 5HFAA 1U7XA 2QX9A 3UFXA 5LDHA 2OHFA 4C07A 4O08A 3WAKA 5KJEA 4UQLA 3HPRA 4NPCA 1HNWB 2CNOA 1UBNA 3L9WA 3DKVA 3LUBA 4N82A 4U00A 2QPTA 5FR1A 4Q9NA 2IITA 1CUJA 1DUIA 3PQ6A 4RD0A 3VX3A 1M2FA 2M2IA 3IXMA 1EDEA 2DULA 1K6JA 4QUGA 3LZDA 1E6LA 3DLTA 3UTDA 1U98A 2GUGA 5EYPB 1GR0A 4PM4A 3FCUB 5SYAA 1PG5A 1QK4A 1E1CB 4HWPA 4FGWA 4BMCA 4KYTA 2C2OA 2H7XA 2IZ5A 2VHQA 2BUCA 3IT0A 4M9RA 4QBFA 3IESA 3F3SA 1ZCFA 5AOVA 3VZRA 1FFGA 5KYUB 2BMDA 4V1CA 1JAZA 2XNJA 3QUSA 3ZV6A 4HDQB 4DQUA 4XR9A 1M8KA 1LVHA 4B3DA 1ID8A 3EC2A 4I8DA 1YK0A 1E5QA 2A0KA 2G0AA 1EUYA 3MTIA 2CL0X 3I0NA 3EPKA 4V0RA 1NQOA 2IXBA 1RWOA 1BDBA 5EIAA 2VJPA 3R7LA 4ITVA 4I4IA 3C1TA 2AOVA 3JZAA 1YONA 3AB7A 3NANA 1CFJA 4TKLA 3ZLUA 1FU4A 3BCSA 4KPEC 3B7PA 4WZAB 5TQ0A 4P32A 3VTAA 4UHBA 2YNMA 4L02A 4BB9A 4PLHA 1SVSA 4MCJA 2XECA 1QJ4A 4E94A 4KXUA 1J20A 1U2QA 2VDLB 5JO0A 3VHXA 2IYRA 4EYQA 2OKCA 4ZFNA 1SQGA 1YB1A 5DE3A 4LDNA 1KFEB 1OGJA 2QYTA 4ZQCB 4NEQA 3OX3A 3INRA 1BHO1 5IJAA 1XVIA 2C9BA 3EHEA 3NYIA 4Y2HA 5JCXA 5IJ0A 3IQHX 2Y67A 1NJ6A 3ML1A 3OEEA 4YJGA 1BFDA 5EE3A 3I64A 3NDIA 3I39X 3LMKA 2Z6UA 2EJCA 2VXBA 3G7NA 4MB0A 1NU6A 2A67A 1O5IA 1RPTA 2JLBA 2ZSUA 2L19A 1NNI1 1AIPA 3SS7X 2AOUA 5U9CA 3FXAA 4N4AA 1JAHA 1E5VA 1MAHA 4MUEA 2B9VA 3GUCA 4P53A 4U7GA 5HBRA 3CR7A 3IMGA 3Q7TA 4ID9A 3AERB 4Z53A 5BN3B 3WC4A 3RG2A 2JEOA 3GJ6A 2CHQA 3LX5A 5ED4A 2HGSA 3EIEA 4E1VA 4L5CA 1J8YF 4N9QA 4QWMA 4RGBA 3UATA 1O0CA 2YX1A 4OQ4A 5EJ9A 1JIVA 1KH3A 4BO4A 3KBOA 1JJIA 1UBEA 1WV0A 2HU7A 4O2LA 4H7PA 4TT3A 4ZMSA 2HLPA 2NYVA 3B78A 3NYWA 5DXAA 2RB4A 1IOZA 3A1FA 1Z5PA 5AKEA 4ZDJA 5SYNA 4KB5A 5ABPA 4B2YA 4OSPA 2C7BA 1GAWA 3AU9A 1QB8A 3WK6A 1Y89A 1R0KA 2RHRA 4EUHA 3QVLA 3RASA 2EFCB 1D04A 2PUJA 4QGFA 3SJAA 4PX3A 2JLWA 3HU1A 2VFAA 2Q1TA 3M5WA 1COWA 2OCKA 2WAYA 3MCWA 2Y99A 1GAEO 2PUVA 3VVMA 1UCFA 1EFTA 1P39A 3CWZA 2C98A 1N1GA 4FP9A 5EFOA 2J6IA 1IZ9A 4MV7A 4LJAA 4MYSA 3JSAA 2GI4A 3H2SA 4JKOA 2X7HA 1INLA 3NEPX 4DA0A 1FS4A 1JPNA 4IIEA 4B31A 4KDCA 5IJWA 1IN5A 1C3VA 1QUFA 2JPDA 2JLAA 4IINA 4KAAA 4OHPA 3K70B 2BH2A 1J0BA 1L9KA 1U0JA 3NBAA 3UJ3X 5FWXB 1NVAA 3DKRA 4G5SA 4ZCMA 2I4LA 3V6MA 1ZCJA 4ME6A 3DDOA 4FZVA 2XB9A 2H6EA 1SCDA 1GNTA 4L15A 2NZXA 2B69A 3DZKA 2XIQA 1WDKA 4NOMA 4WNIA 5FI1B 5NULA 3TZ6A 3SNKA 3KQNA 2X22A 3R3HA 4UNRA 4UNSA 2ZI5A 2Q07A 4Y6RA 5AJTA 5LBIA 1ZZEA 5JLJA 3DDZX 3NH9A 1L5QA 4IQFA 2C58A 4AY2A 3O1LA 4E12A 1FFXB 3PFFA 4D0RA 2ZSJA 4KVFA 4OQQA 1R8YA 2D54A 4IS3A 5G41A 3ZNQA 3VJRA 3IOEA 4EGFA 4IV0A 3KKOA 4G0PA 5EY5B 1K08A 1UKYA 2QN9A 3RSFA 3TD2A 2JRCA 1DC6A 2GPYA 2QLBA 1X6VA 3IAUA 1O95A 2H18A 5IVPA 3AI3A 1PDWA 2QG6A 3E9ZA 1KJJA 1E5DA 2ZEJA 4RENA 3OU2A 5EPEA 5H16A 2HC9A 3G59A 1JN0A 4QX6A 4V2IA 4BV8A 4XWWA 4HRXA 3AIIA 4LNAA 4MYCA 1L5SA 2AB0A 3AQ4A 4MDFA 2EARA 1U0OC 1ATIA 1T3HA 2GDJA 3NHAA 4XVCA 1QYVA 1QV6A 1NJSA 821PA 1QHHA 4J1TC 4JA2A 1OGIA 3SLKA 3EWIA 2GA9A 3ET4A 1K5DA 1UBTS 4KREA 1NRXA 3PSAA 1H5UA 1E3JA 1R4MB 4AJOA 1DS6A 1WB4A 4OUDB 4M0CA 2QY6A 2P1ZA 1WLYA 4RGVA 3TFOA 1M8GA 3BULA 3H42B 4HVLA 1KAEA 1Q6ZA 3QVMA 3HB1A 4XR4A 4U9HS 3SG0A 2B4RO 1ODCA 3G5AA 4DJJA 3O9MA 3C70A 4XUCA 4A23A 2VXOA 4NC9A 4JI5B 1L5FA 4P5DA 3UFBA 5LXTB 3JATB 5AYVA 5L7WA 1YRAA 1GYQA 4QEZA 3JX9A 3OIFA 4PG8A 3T9EA 2C2BA 5BUSA 4URWR 4U2CA 1ONSA 4MW1A 4S1VA 4N7RA 1KI3A 4BKQA 3PUJA 1X80B 3FDFA 1NRJB 3ANXA 4RH1A 1Q77A 2ZZNA 1QGED 2VWPA 3I04A 1WX1A 1YTLA 3ZN2A 1XV5A 1T13A 3FUTA 4LGYA 4AUKA 4RPCA 1TJ4A 2E4WA 4Z4EA 2C07A 2DQ4A 2VTKA 3THXB 1LBIA 3VR0A 4IS2A 2JKYA 3EOAI 3O3NB 2FSPA 5H4HA 1M83A 1DBPA 5BQ5A 3RGGA 3LPNA 6REQB 4LQLA 3U26A 1OH7A 1FRNA 3HA5A 1ZGHA 5AD1A 1USKA 1L7AA 1O9GA 2D4AA 3K1AA 4TRMA 4EHIA 2XOKA 4JL8A 1CDZA 1CT9A 2B9EA 3NGLA 5FA6A 5JI2E 4CL8A 1YVDA 4J3FA 1E20A 2ZB4A 3L8ZA 2OFFA 3TN7A 3TQHA 5JYDA 4YRNA 4YH1A 3TLAA 1Q3KA 3BXOA 1X13A 1LF5A 2OVFA 3D7NA 4Q4JB 1NY5A 2ZIWB 4EJSA 1RYNA 1IPHA 1VKRA 1UR5A 2YQZA 3ETCA 5E7IA 4IFBA 2VNAA 1Y6ZA 1DG3A 3BJZA 3DQQA 3DE2X 3QFFA 4M86A 4UXHA 4WLFA 2AI3A 3LWBA 4EPXA 1Q83A 1ZGCA 1BROA 4DIDA 5JDIA 3IPLA 4N0QA 3AOGA 4PYKA 1JKJA 1G6KA 1BWQA 1I7QB 4RTNA 4QBIA 1WF6A 5L3VA 4AO7A 4FU0A 2FPKA 3H6GA 2O8NA 4H60A 4NK4A 4PGAA 1BA2A 2HSDA 4TKVB 1TUIA 1X1EA 4HTFB 2CNDA 3A04A 5T4HA 2HM7A 3D1VA 1GRRA 4IXTA 2JBAA 4LHXA 4X3CA 1BHJA 1W85A 4UM9B 3MLEA 3SVLA 1OAKA 1TM4E 1GDHA 5JBIA 5C1OA 1PJBA 3PHJA 3NIBA 3QX7A 3I9KA 1J7KA 3OJEA 1JECA 1M73E 1WW8A 4FMCB 5GPBA 4DANA 4JUBA 3IDAA 5ALIA 1MT3A 3AKCA 2V74B 1TYAE 4DQLA 4Q9IA 3HVHA 1YR3A 1DRVA 1R88A 5FXMA 3AM1A 3OM0A 2MSLA 1SK9A 2EIXA 4KXYA 4IJUA 2B8NA 2J6CA 2P75A 2IZ0A 2FZGA 4QQFA 4X5OA 4XPZA 2QN3A 3AJ9A 3E7WA 3R6WA 4J0IA 1RPZA 1SG6A 2QTTA 4C43A 3D1LA 4XOIA 1GEGA 2FVYA 1P4SA 1YV9A 2E4VA 2QRMA 4RIEA 1QIGA 3JW8A 1C8LA 2QQ0A 3OQIA 3PQCA 4HUQA 4UCWA 4WNYA 4PZLA 1RWQA 2G9RA 3P9SA 5E6RA 3V34A 1ZMRA 3EZFA 4D46A 3IP9A 1PK7A 3V4VB 5DV9A 3HNRA 4DMLA 4A8JB 1OREA 2W6JA 3B6ZA 3FBWA 4INOA 3AVOA 2YQ5A 3K05A 1PR4A 2ZTSA 3DOCA 4G97A 4PAQA 5KDOA 4RVHA 2XBMA 2VHTA 3RUAA 4YIHA 1XQVA 3EPRA 1VCHA 4EJ2A 1UBCA 4BN4A 3TEFA 4A15A 4NF2A 4WLEA 1IXZA 3ZWMA 4KLNA 2UYCA 4CQLB 4NCXA 2ZK7A 5AKJA 2PUCA 4HYYA 2B2XA 3DPIA 4BO9A 2EV9A 2JFQA 1LC0A 4LCJA 4PTZA 2IZ1A 2IIPA 4P35A 1W0CA 5A2QA 1PV1A 1U1IA 3EGDA 5AM5A 1WV1A 2I4RA 2YJGA 4WE3A 3UMGA 3QEJA 1XDBA 2IYNA 4TMTA 1JHVA 3UAYA 1M7GA 1FJGB 2C4UA 4YRFA 2VNIA 4IJWA 2BGIA 3PXAA 4OO3A 1J2UA 4GEGA 5B7NA 4IJ5A 3BH7A 3I8SA 3TE6A 4OHYA 5CB4B 1VE1A 1P0QA 4G9BA 5F7JA 1L5HA 1YI0A 3F6SA 1HT3A 1JU3A 2B4QA 4U9IS 2HCBA 4N7MA 1C29B 3D02A 3EDYA 2XLCA 4R7GA 3RT7A 4QUHA 2X23A 4X44A 3VV2A 3WP0A 3Q1KA 3N58A 4C2BA 1EVIA 2AIRA 2ATEA 3BPSA 1Z0FA 5IW8A 2JIOA 1DWPA 3GDHA 4UKDA 4K6CA 3MJHA 4D8XA 3WWDA 3ZHOA 3Q8KA 3WL6A 3ZHCA 3T5AA 5K3FA 5CK5A 5EZQA 3SBOA 2IFTA 3EEBA 3GLHE 1RWKA 2Q8NA 1LK7A 1Y6RA 2ZJ5A 3KWJA 5IC6A 1PE0A 3SS9X 4S1OA 2NT4A 3FNQA 3LYUA 4IH1A 4TOIA 5KOYA 4QBGB 2JH9A 3DMRA 5AO9A 4J8PA 4M0LA 2QBYA 2G6TA 1YRQA 4MUFA 4CMGA 3CSSA 3SC2A 4ALIA 1IL0A 1Q22A 3L7MA 3FWZA 5DNCA 4GL2A 4WJKB 5JSHA 3RVDA 1E4EA 4M38A 2J48A 3JCZA 4B6SA 4DDMA 3AUUA 2PM8A 3IDQA 4KQ6A 3RVJA 1GNPA 3UV3A 3GMIA 5JQGA 2AQHA 2G1AA 3EMBA 3NHPA 1VL8A 5DI9A 1G41A 2FCAA 3ELWA 4FCWA 3A4NA 1N0UA 2WF7A 2WM2A 4ZAWA 5JS7A 3GPLA 1ZGBA 2CDCA 3DFIA 4Y2TA 5K7SA 3JVDA 1UKEA 4XD7D 1P60A 1HTBA 2HEGA 4JP3A 2JD1A 4JSTA 5BXQC 4NFYA 4YECA 4O4JB 2K5UA 3P2OA 4V2UA 3DC2A 3IMEA 4AVYA 1DPFA 2DBZA 4HYTA 4CPDA 4LBWA 5E1MA 3ZTTA 1L3BA 3UAXA 1WOYA 1XTSA 2AWNA 2DEUA 1CW2B 2O1XA 1DMRA 5AP9A 3CZRA 3YASA 1VL1A 2FN7A 2GXAA 2H1RA 1TEHA 1PQWA 2MR5A 2RJ3A 3AOEA 4CF5A 4JDUA 4YHHB 3HRHA 3ODGA 3OZVA 3EXFB 5EXXA 4YQYA 3ZTWA 2IYOA 1TQ6A 2WILA 1D0IA 1GQFA 1TVKA 3VGPA 3E81A 5DASA 5KYXB 2AWOA 1SEVA 3O1JC 3GLGE 3JQ8B 2K87A 2VDPB 4OP3A 2XIJA 5TQJA 3PC8A 4H0NA 3T3EA 1L7QA 2DY1A 2Q5CA 1LLFA 3ANNA 4ILKA 2IV7A 4B3GA 5K0GA 4ETNA 3FOFC 1DMSA 2ET6A 3LCUA 4LC9A 1APBA 5GZ3A 2WD9A 2X58A 5H80A 1YUMA 3JALB 1XIVA 2FWNA 2XQIA 4Q9HA 1FDWA 3U62A 3PWZA 4FJ1A 2J3DA 4QQ8A 1TKBA 2D59A 3IS3A 4ICIA 4AFNA 4B7AA 3DL4A 3KUKA 4Z1MD 2EKBA 1LX6A 3NC4A 1BEEA 1GCUA 1N0IA 2HV8A 1W2GA 3K2BA 4FS3A 4KTVE 4N5LA 4YO7A 5IDVA 1SBCA 1UZAA 2AL7A 1YHZA 2F48A 2NU8B 3ZCTA 4TZKA 5EIEA 2BH9A 3JQ7A 1TYEB 5CCBA 2PGIA 5L6MB 1VKNA 2YL2A 3UENA 1JDNA 2XHEA 3N0WA 4QUJA 5TQ2B 4X65B 5G0WA 5IDQA 4JJ8A 4D9KA 1Z0DA 4X60A 3OUZA 1R0RE 1VPVA 3IIEA 1M33A 2BFNA 5M04A 2WG0A 3FVWA 3KDPA 2WJ6A 3HEMA 4G4SP 1FDSA 3LQ4A 1GQOA 2WG1A 4B74A 2J08A 2YS7A 3HXQA 4LF4B 3ETGA 3N74A 4C1BA 1B2LA 1V25A 1LVUA 2HW8A 4QXMA 4PCUA 3KSAC 3LUGA 3D2LA 3Q1LA 3QFRA 5FOTA 3WNDA 4W6ZA 1SUEA 3JVEA 4D41A 4AY5A 3V1MA 4XCXA 3TNJA 2PH1A 5CW2A 3W9SA 3EF0A 2B99A 2VJYA 2CJWA 1MV8A 4X7PA 1G6OA 1ZR4A 3OHSX 3MTQA 4FBLA 3FVRA 3BZUA 1RC0A 4RF5A 5FBZA 4B44A 3U37A 2G8NA 3A26A 3VPFA 2K6GA 1Z37A 3ZIAA 1AUVA 4DREA 2XZPA 3BWEA 4Q9JA 4XFDA 1JPJA 1C8VB 3D8TA 1GPYA 2JFHA 4GU5A 2G6BA 4QGBA 1R5OA 3GLHB 2DUMA 3IOBA 3KHTA 3RSSA 3UYLA 5JROA 1M2EA 3OH8A 3GRAA 2Z58A 5IBRA 5EQDA 3X2EA 3WB1A 5I7SA 4KR6A 2GWHA 3MHPA 4X0EA 4ARZB 2ZTUA 3C98A 1CEQA 2GK7A 1VIMA 2CBZA 2VDMB 2ICAA 3HHEA 4FDAA 2G4VA 2AC2A 4FNOA 2B98A 5D5HA 5IAKA 3TZLA 3OTOB 3KSDO 1MGPA 2Y68A 2RH5A 2ZSDA 3L46A 1F4LA 3ZU2A 2B5OA 2H51A 2PT5A 2G77B 2AVDA 1P1CA 5K1ZA 4CKYA 1VMDA 2G09A 2GN9A 1B15A 1P91A 2O2YA 3EDRA 3FDZA 4URZR 3U7FB 1Y42X 4DZTA 1QVWA 3ZW9A 4ACBA 1R5JA 4ARAA 1ATZA 3C87A 2NZ8A 3ENKA 1AKQA 4QDZA 1E69A 2ECKA 4KGDA 5EEGA 4WZBA 4Z4GA 4S05A 1TFUA 3ND6A 2W2OA 2ZJFA 1D1SA 1VYVA 3GJ5A 4POAA 5GOZA 2FPWA 3A4YA 2QENA 3MPUA 2QTVA 4FFLA 3QJ5A 4JP2A 2R97A 3IEKA 1NJ5A 3QOYA 3SFVA 3SYKA 3ZQUA 4PFJA 4RMIA 4UD2A 3LCCA 2XRYA 3TSYA 1WQ1R 4CF4A 4EHNA 2HUPA 4M88A 5EMNA 4DE5A 4NIMA 5HA5A 1ZHOA 2P9EA 3TD6A 1B43A 5FHRA 2BISA 1P3JA 3EWNA 3I1JA 3PF8A 4G41A 3ENZA 3JZMA 1PWYE 1M2JA 4RJKA 3PDUA 3GLGB 5ULLA 4MQ6A 3VZSA 3KQKA 3QMVA 3RRXA 1Y3CE 2CFCA 1UFRA 2N9UA 3AF2A 3DGFC 4KWEA 1CTQA 2C2GA 3IR7A 4RKFA 4J9UE 5EE1A 2HH9A 2WPDA 4XA8A 3HFSA 1EGAA 1FNCA 1ZK2A 3LCRA 4HGPA 2FB9A 2L69A 1OKKD 3THWB 2PVCA 2YXPX 1M66A 2XSZA 4P08A 4CIYA 3JARB 2JFGA 2O23A 3A3KA 3BZBA 4OHVA 4R9SA 3RYCB 5LD2C 1MC1A 2B3DA 5DBIA 4BQSA 3KC2A 2X9NA 3R6DA 4YDHB 2Q45A 3CMMA 4ACAA 5BNZA 3CIFA 2H4HA 2I4MA 2J46A 1I94B 1T35A 3QU5A 4GXNA 2XJ4A 2ZTMA 1OTYA 1GSHA 4ZYZA 2G08A 3HY4A 3OCYA 3UXYA 3ETHA 3K6KA 4TV8A 4ZRNA 2CV1A 4WTOA 4B6EA 1E79A 1KIFA 1OH5A 4C04A 2AE1A 3KNZA 2XUFA 5GADl 3MMSA 4TGLA 5K99A 1JEEA 2IF2A 5FTNA 1LV8A 3K09C 1Z22A 2I7DA 3EG5A 1V8FA 1E2LA 4PYQA 2OB2A 4K81B 3HB0A 2YFYA 2WIAA 3R3SA 3M8KA 3NRBA 2HCJB 3AEUB 1KY5A 4I4NA 1ORVA 1YZQA 1M2WA 2CC2A 4AJNA 1TXGA 4YAIA 3SSMA 6CHYA 5ILGA 4X54A 4FFSA 2X8JA 5JRDS 2DWQA 2HSGA 4U7JA 4YT5A 1CIJA 2W58A 3JZIA 3WYEA 4RDCA 1G5PA 4JGGA 1FTSA 1L1FA 2GPAA 5EIBD 1JAIA 2H9IA 5KQGA 1VYUA 2BPOA 3DNFA 3F90A 2QMUA 3EA0A 4L6AA 2HRQA 5BSGA 3FR7A 2Z98A 2CWDA 4F2DA 2I2AA 3FFTA 4KV7A 4TWRA 4YP1A 3AP1A 4QYXA 4D9GA 3G1TA 5I7FA 6AT1A 4LOAA 2Q41A 4YT2A 1MOPA 5A6VA 1XYGA 4FI3F 1ZITA 5CA1F 4ZOBA 3EUAA 4RD2A 4EVSA 1E9CA 2XXAB 1E3EA 2NSJA 1VJTA 1ISHA 2RJNA 1VJ1A 1JIJA 4TV9B 4LVNA 3FB1A 2O2ZA 3ADKA 3IALA 4M21A 3J80A 1C7EA 1NONA 1WP4A 2PQMA 1T9CA 4K87A 3SLRA 4L1KA 1P7WA 3EIOA 3ZVMA 4PQGA 2YNMD 2PZJA 2O59A 1H1LB 2IHTA 1IUPA 2FEOA 2X1HA 3KHUA 4GL4A 1UBMS 2RGAA 2IBTA 2VF7A 1KEEA 3TSWA 1U6KA 4MAFA 4ZIRB 5IZCC 1WB6A 1QYDA 4GYWA 5EJGA 2WUEA 4RVGA 3V8QA 3QMWA 4J1TA 4ZVSA 4DWJA 3MM4A 5KEIA 2E48A 1SD2A 3GOHA 1JLHA 3LBNA 3LU1A 1GKLA 4RESA 1SCQA 3DHWC 1QKKA 4YUVA 5FPPA 3OEED 3WYFA 2G9NA 3Q3HA 5FYDA 5J59A 1DAKA 2P2YA 3I1IA 2ZVPX 4OLHA 4Z3DA 2J4DA 1VZ2A 1YL5A 1DBSA 3AY7A 3BE8A 2A9FA 1EJBA 3GNLA 1II9A 4OA8A 3WGMA 1OFHA 2W98A 2ZB2A 4MOWA 1WMSA 3N8KA 2F2TA 4BNUA 1VZ3A 1C7FA 2YJ4A 1AXGA 4CKEA 4V38A 4DNQA 2E4UA 5HF5A 4TYPA 2V54A 2P27A 2Y66A 3DKPA 3O7WA 1GUYA 1R3UA 4HQKA 4QQKA 1TT5A 3W6OA 1CJVC 1SZDA 1NYTA 3I04M 4C4OA 3PEUA 4DHEA 5LZ5A 2PMKA 5E8JA 5TARA 3PDIA 4I4TB 3SI7A 2WU1A 4M1KA 4UD6A 3TIGA 3ZKWB 4EPTA 4ZK2A 2GILA 2A14A 2I4OA 3CUWA 3PD0A 4TT3D 2Q0SA 4UAGA 4ZJYA 1VJCA 1JYEA 1DKRA 3FWNA 1PCXA 1Z83A 3KQTA 4YRSA 5E9WA 1E2QA 4LOIA 4B4DA 1OHHD 3BIXA 1XEWX 4ZJUA 3A4LA 1JF8A 3KJEA 1NDQA 2V7BA 4FYWA 4RZSA 2F59A 1JDJA 4D0LB 3U44A 3VZBA 1WKCA 4N01A 3DOEA 4HNRA 4N0EA 4U3JA 1ZNXA 3QBJA 4B4OA 5K51A 2ZG6A 4CEJB 3H05A 1TA9A 3PXCX 5C5IA 4W8OA 1VLMA 2NNWB 4EHLA 1G4HA 1WW3A 1ZCAA 2ZRQA 3OIVA 3HCBA 2W43A 4BU1A 1EFVB 1UQTA 3C6QA 4X9XA 4Y30A 2REQB 2VP4A 3NR2A 5THKA 4BO0A 4FC6A 5KQRA 2V7XA 3FETA 3B60A 2QXYA 3MQ2A 2BP7B 3C24A 4KSCA 5NLLA 3AW9A 2ZAOA 3CGWA 4YAEA 5FBQB 4D7AA 1UBRS 3B3JA 1MAUA 2E0IA 2GM5A 3BFPA 3G2QA 4DA7A 4LBYA 2OXEA 3E3LA 4S2UA 2IPLA 1ZVKA 5CYPA 3V42A 3AJEA 3WGGA 3QG1A 1EPUA 3NRJA 5B1SA 2HQOA 4I9GA 2HTEA 2QT1A 4PNZA 2FDCA 1PGPA 4HOYA 1NVEA 4QUEA 2NAPA 4R01A 4AN4A 1GR1A 3IP1A 1D2NA 3CEHA 4CDNA 4BEBA 5IT4A 1WWKA 4RDHA 3QLUA 4I5EA 3OKPA 3OPYI 5G3ZA 3RS8A 1FMJA 4F92B 5CEJA 3D1JA 1GADO 4BNWA 1UC5B 3J81k 1E2GA 2W8BA 3GFOA 3TEJA 1D07A 4RY0A 2IGBA 4PIMA 3UFXB 4FXPA 1WMFA 3Q9SA 1OJ7A 2ZOSA 3ESRA 3FYUA 1NR1A 1VSBA 2AJLI 3CZMA 1OLXA 3U4DA 3HVRA 4M9CA 4HFNA 3U4MA 4C4XA 1V4BA 3CSDA 2WNSA 3EGIA 4EUEA 4RORA 1S3GA 5IUNC 3V1NA 5FWYA 2BFOA 3CYFA 1QYCA 3IIIA 4KQGA 1SXPA 4BNXA 2ES4A 5JAMA 1O95D 4N3BA 4EGJA 2ISCA 3MB5A 2HUNA 1AX9A 3SZ3A 1DRWA 1TA0A 2MMGA 1MAVA 1HL7A 5EUMA 5BQOA 2VP2A 2CHEA 2CNNA 3RWMB 3RNOA 1UPUA 2BVNA 2FSSA 2H29A 1JX6A 4V1CB 2FOLA 4PZZA 1E2IA 3E7FA 4P98A 2QDXA 3AH8A 5B53A 2XGJA 2H31A 3KOOA 1I9GA 3KV1A 1OBCA 1WCV1 2JA2A 4A0GA 3U7JA 4M8IA 4TTSA 1T3SA 1YSCA 4OLFA 1C9KA 4BYMA 3DO8A 4RVFA 4X93A 4OM8A 4BMDA 4FEEA 5DBEX 1FQOA 4DBZA 1KYVA 4CKBA 4BNDA 4KIFA 2NV2B 5HG0A 5A0FA 3TLYA 4UVIA 4X1YA 3DD1A 3VDNB 2UYHA 3F6CA 3DVAA 3K2IA 3U3OA 1G66A 1RLTA 3GUYA 3KAJA 2W6PA 4MS1A 1WPXA 3L8YA 1FTWA 3QKSA 4LKOA 1G7RA 5ALMA 3VHXB 1CUXA 4GZ5A 5EESA 1C2TA 2GBFA 4B6PA 5ALOA 4Z51A 4G63A 1W47A 4E07A 1SBIA 2CNKA 2COKA 3JTMA 3P9CA 3KZ1E 1UMBA 3BRCA 4FFPA 4GM1A 4PICA 1CJMA 5DCWA 3TW0A 2RBEA 2RI6A 1Y37A 5IJ0B 3GI1A 5IFLA 4MTCA 3EB9A 3CPJB 3OE5A 4YJGB 2J3MA 3F6EX 4JC8A 2PD4A 1PZMA 2R2GA 1N33B 1XDGA 1ZM9A 3LZCA 1CS0A 5I5GA 4CR6A 2DPMA 5KWJA 4XQEA 2AOUB 4M3NA 3S2UA 3D2BA 2V6BA 4HUJA 3S3TA 2DFKB 2Q4OA 2QAJA 2V55B 2V7EA 3V80A 4QJ4A 5TMDA 4V03A 2FKNA 2ODNA 4DADA 2V1UA 3HGQA 1YDHA 5COBA 1KSGA 2J33A 4X1OA 3FDJA 4GMXA 2PMBA 2DPYA 5K3BA 4O2AF 4I1YA 2NPOA 3CUKA 2JGDA 2VRWA 3E1SA 1KVSA 2XZLA 4HDKA 2BCJQ 3GN2A 4IV5A 1RJFA 2AN5A 2XQFA 2BEUA 4PCVA 1B8NA 3K5WA 4XUGB 3MC1A 3DFZA 3IP7A 4QBHA 4COKA 2F3RA 1U2RA 4IO1A 1WPQA 4JOBA 4QOGA 1IAQA 2I6GA 2QDKA 4MULA 1XCMA 3GFFA 3UMRA 3MJFA 3VPHA 3PF9A 1ISSA 2JAPA 4JN6B 3AFIA 1RQGA 2PBLA 4R2WA 1XMSA 2ORIA 4N41A 2G71A 1MQSA 2LVBA 4KH0A 4Y2JA 4ZZ3A 2NUPA 5K0SA 1WCIA 1Z7GA 3AFMA 1LVGA 4C5CA 4N5HX 1PTJA 4CQJA 1RNLA 2QQEA 5CYFA 1UADA 4CLOA 1UKZA 2P2LA 4OJQA 1KPHA 3O74A 1C0IA 3LY7A 3D8BA 4L8YA 1BX3A 4BBJA 4AJIA 2NX2A 2Z5LA 2ECOA 2JEZA 2XTMA 3EZYA 3KQYA 3PNQA 2R7KA 1Q20A 2QGNA 4P83A 4RC9A 4X64B 4ND8B 1D0VA 4C1NA 5GZ6A 1AQLA 2FFAA 2UYGA 3BXPA 1BN6A 3K53A 3OPMA 5A6SA 3SEQA 3U4QA 2WT4A 4CM9A 1ZM3A 3IVGA 1B73A 3PKIA 3VX4A 3EZ9A 2PKYX 4JEHA 4KI7A 4CV2A 3AW8A 3L0OA 2DQSA 4J29A 1N1EA 3UCEA 1F2VA 4KNYA 2F64A 5L53A 1PVVA 2PLFA 2X8AA 1JDPA 3ORQA 2I1QA 4J0JA 4NP6A 2QM0A 1AZLA 3X1ZA 3BWBA 2DH6A 4HVTA 3L79A 3NC1C 2PD6A 4KRXA 1VI5A 2AEEA 2XPCA 3K9QO 4FHFA 3H5IA 2ID7A 1S01A 5CYOA 1M10A 1YKGA 5AXAA 1RT9A 3WLIA 5SZHB 3ORSA 4HQ6A 1N75A 3EGEA 3AUAA 4N3AA 1WIWA 1CVLA 1XTPA 2H07A 3TX6A 2I6XA 2EBFX 3KSZO 3GAMA 3OTIA 4K2HA 1RMQA 2IPAB 2ZBPA 3PCTA 1JFTA 1L5RA 1QHHB 3A9UA 2D3TA 1VI2A 2YZKA 3F9IA 3OCXA 4XDYA 4H7KA 2OUKA 3FTDA 4QLOA 5JC1A 2JVKA 4TQGA 3WG9A 1DKPA 1QWOA 3HY3A 1DBVO 5HZMA 3ZZUA 1Y3IA 2RONA 1V7PC 5AJZA 1A7JA 4DNPA 1KVQA 1GRVA 3FOAA 3OLXA 2XNHA 5GJWC 2QD4A 2DR3A 3B9PA 4X20A 4BX3A 2L42A 4PX9A 2Z57A 3IAS6 1AHIA 2R5WA 2R8RA 3WK8A 5HKLA 1Q57A 1F8YA 4JBXA 1E9EA 2HMAA 4AIIA 2AXNA 4HWRA 4DB2A 5AICA 4WA7A 4P22A 4CIXA 4AI6A 2WQZA 1L4HA 3FTPA 3THSA 1ZISA 5A7HA 4XSHA 2GD0A 2PSSA 4FIZA 2H3HA 3PPWA 1E3WA 1FK8A 1JMVA 1P5FA 4ZQBA 1SU7A 2YZNA 3CHYA 4IOLA 3RIEA 3D5QA 5DBHX 4DLXA 5TMPA 4TXNA 2O3QA 2G9VA 5JS8A 3I5UA 1P74A 2PL5A 1HMYA 2IDZA 3HVIA 4LXYA 3ROGA 3UZUA 2IYPA 2NTVA 13PKA 3Q4GA 2X8WA 1TEVA 1L8QA 3ZWQA 4DV7B 4AF6A 4B3JA 1BYIA 3RD5A 2F9FA 5HE9A 4BZXA 2HIHA 3K1AB 3NBFA 2DLNA 4Z4QA 4DCJA 1MXHA 3AR5A 3I6YA 4UBJA 3ZU3A 4ZCRA 1V16A 4RF3A 2JIPA 2IW3A 2WSMA 3P2MA 1UPAA 4UXJA 3PEFA 4EJSB 4JX8A 4R7TA 1Z4PX 1TZ2A 1G2PA 1PT9A 4RM3A 4BC1A 2WSSA 1MH1A 5I6DA 3TAHA 2XCQA 4AN0A 3WJ7A 1Q3HA 4U4AA 3NOVA 5C81A 1V37A 5AI0A 4DV3B 3P96A 3GEPA 4TS4A 1JKJB 1L4EA 2GBGA 2HWYA 2QZ4A 5KBYA 3D4LA 1YJAA 2MOKA 3TJRA 2WQ7A 4JJEA 3RJTA 1UMCA 1YFKA 1XJWA 2HHAA 4MUAA 4OXQA 3RJ5A 4DXHA 1QB7A 1FDTA 1BMDA 1CZLA 2JBAB 4RZHA 1W85B 4G0MA 3VDMA 4EO4A 4GDFA 3LH5A 2O20A 4L7VA 5IARA 5IN5A 3VKGA 1PL0A 1PZNA 4GW3A 5CXQA 3A1UA 4CCSA 2EYUA 4D82A 2ZVJA 2XYQA 1M74A 3L1HA 4R8MA 5BOVA 4MK4A 3BEOA 1PD0A 1FMFA 3BHMA 3X3HA 3TIXB 5DB4A 3K0CC 3C3PA 1T43A 4OMFG 1QKIA 5J4LA 3U31A 1K8RA 5GVRA 2VLIA 3UH0A 4Q4LA 3B8EA 2CLFB 4LZPA 1QRSA 4B3BA 5DNEA 4CGZA 3M1AA 3EQ7A 1QYIA 3W7AA 4QDJA 4A26A 3OQIB 4B73A 3EZNA 2VKQA 5E6RB 5L8VA 3S2ZA 3OUTA 4JBGA 2DFVA 3SSAA 1JH8A 5BV7A 3FHJA 1Y0BA 3FVVA 5F1OA 2GK6A 5I47A 3VR6A 1RTTA 2LE0A 4EOGA 3GB9A 2Y0BA 8ABPA 1IBMB 2TMYA 5ADHA 3OCCA 3P45A 5DNYB 2I3AA 3ONEA 4L76A 4NYJR 2DJ5A 1EGQA 4HNVA 3H5AA 1P72A 2CD7A 3OFKA 2QM8A 4HS9A 2YJ6A 4IG9A 1WNTA 1R66A 3QHAA 3IUSA 2PRKA 4DNOA 5KCZA 1EEHA 1Y3AA 1ABBA 1AF7A 2X9VA 5G0VA 1JG3A 2Y1WA 3EGDB 4XGIA 5EJ4A 2GYVA 2CL5A 4AKSA 3K09A 5CH8A 4AMGA 2D7DA 3QTBA 5C31A