2XYPA

Caspase-3:cas26049945
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
b'SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xypA00
4LSZA 1SHLA 2WDPA 1RWNA 3DEKA 4EJFA 1RWXA 2QLBA 4PS0A 2C1EA 2FUNB 3DEIA 2HBZA 2H5IA 4IEFB 4QU9A 2AR9A 4JR2A 4QUEA 4QUHA 3V4OA 3GJTA 1QX3A 2Y1LA 3OD5A 5IBCA 3BIJA 2P2CA 3E4CA 2Y0BA 1GQFA 3H11A 4PRZA 5IAJA 4FXOA 5LUBA 3SIRA 3R5KA 4ZVTA 3UO8B 4EHDA 2CNOA 3KJFA 4N7JA 5IARA 1GFWA 1SC4A 5K20A 4JR1A 1RWKA 5H0IA 5I9TA 2QLFA 3KJNA 4EHHA 4PS1A 4QTXA 3D6FA 1RHJA 3DEJA 3H1PA 4JJ8A 1RHRA 2CNLA 3IBCA 2DKOA 4JQYA 3NS7A 3GJQA 3RJMA 2C2ZA 5IBRA 1RHKA 2CNKA 1RHUA 4D3ZA 3V4LA 2C2OA 4DCPA 2H5JA 2HBQA 1QTNA 3H13A 2XYHA 1F9EA 1RE1A 2XZTA 4N6GA 3DEHA 4NOMA 4QU0A 1CVRA 1RWPA 2J33A 4FEAA 4IYRA 4D3YA 4EHLA 3EDQA 1M72A 2H48A 1RWMA 1SC3A 2H4YA 4NBKA 4EHFA 5IASA 3NKFA 3GJRA 3V55A 5IC4A 4QUBA 1NMEA 2CJXA 3P45A 4QTYA 3S70A 3K7EA 1SC1A 5I9BA 1F1JA 5JFTA 1JXQA 1SHJA 2K7ZA 4JJ7A 2CNNA 4FDLA 4JQZA 2H51A 2XYGA 4N7MA 4PRYA 4DCJA 3H11B 3R6LA 3D6MA 2H65A 5IC6A 4AWAA 2HBYA 2QL5A 3PCXA 2CJYA 1RWOA 4HQRA 5IAEA 3R7SA 4HVAA 4NBLA 2H4WA 4AWBA 3PD1A 4N6NA 3V3KA 4N5DA 2C2KA 2FP3A 2NN3C 1RWWA 4EHAA 3R7BA 4EHKA 1I3OA 2XYPA 1ICEA 3V6MA 4QUAA 4ZVSA 5IBPA 1RHQA 4DCOA 1K88A 4AW9A 1QDUA 4QUJA 4D3XA 4ZVRA 2QL9A 1I51A 1K86A 2QL7A 3QNWA 3R6GA 4ZVQA 2CDRA 2J30A 4NOLA 1BMQA 3SIPA 5IABA 3KJQA 1PYOA 3GJSA 2XZDA 2J31A 4JJEA 4ZVOA 3UOAB 1CP3A 1NMSA 2HBRA 4JR0A 3EDRA 4I1RA 5IANA 1RWVA 3PD0A 4QU8A 3V6LA 3H0EA 5LUAA 1KMCA 1IBCA 2H54A 4ZVPA 4NOKA 1I4EB 4I1PA 2J32A 3R7NA 4NOJA 5IAGA 4FGUA 4QUGA 4ZVUA 3P4UA 1NW9B 4HQ0A 5LU8A 4EHNA 3NR2A 1I4OA 1NMQA 4QUIA 4NBNA 2FQQA 2C2MA 3D6HA 4M9RA 5IAKA 4N6OA 4QUDA 4QULA 1PAUA 3IBFA 2QLJA 3S8EA 4QU5A 1RHMA 3ITNA 5LU9A 3R5JA 4JB8A
chains in the Genus database with same CATH superfamily
1K9SA 3NIDB 4GUAA 3OKAA 4EYOA 2OQIA 1FYXA 3K9CA 4IX1A 5EXDA 5JNVA 1WD7A 1U6JA 3E2MA 3L0BA 1QFZA 4G24A 4KAXA 3U4GA 4WFJA 3G0HA 2GSWA 3ICPA 1M6WA 4PVDA 3PA6A 2QVZX 1VOTA 4HB3A 5DNVA 5EG5A 4G9BA 1Q16A 2OT3B 1NVBA 4M46A 4WDRA 4IJMA 3B7GA 2ZSJA 3LV8A 4G3XA 4PG6A 4AG3A 2GJ9A 1Z62A 5ALKA 3Q9NA 4G4SO 3H9CA 1ULTA 2YVQA 1X70A 3LHFA 4MULA 3KVVA 1DAPA 4GOOD 2YRWA 4YP7A 4C29A 4RVHA 4UZEA 1JQEA 4OQQA 3JTEA 2ZUVA 5HUJA 1J56A 4JBWA 6AT1A 2FUEA 2XB2A 1F0PA 1TUIA 5KQLA 3IBCA 3ADPA 1P9LA 2F48A 1KEZA 3C3XA 1T9GS 3ZQ4A 3KQYA 2PGNA 3VAAA 2VHUA 1CQJB 1O6FA 3TH5A 3VPBA 3HVIA 2ACVA 3NX4A 3FUVA 1KL7A 3M3PA 4IRXA 4R0NA 5M34A 5JJLA 1UOOA 1MO5A 1B73A 2X15A 2HBQA 5IXJA 5KQGA 1U6KA 5JIBA 1TPZA 1M1XB 1NSYA 2Q5OA 3L3BA 1IBRA 2HCBA 3L8HA 3L6RA 5DGHA 3TKYA 4F96A 2WV7A 4F4HA 4U3JB 4EQ6B 2JI9A 2DSNA 2GHQA 5DM0A 2OLEA 4OSEA 1NGSA 4AX8A 1ULSA 3KK0A 4C0XA 4CQNA 1JWBB 3CZPA 3EE6A 4EMSA 1S0UA 4LVUA 3EUAA 3UMVA 3DDNA 2VKQA 4TLMB 4ZMSA 1OMOA 1UXIA 2JB9A 1R7RA 4N5IX 4Q1AA 5C1IA 1P8JA 2K2QB 3EIUA 2IW3A 2YDXA 5ES3A 4EWLA 1Z6XA 2H4XA 3PXXA 2F59A 3LQQA 5CAEB 5L6LB 3A10A 3N6VA 1Y0BA 4AROA 1X8LA 1U0JA 2O1XA 2R65A 3OMLA 2P79A 2OFWA 3ZV6A 4MSUA 3H2IA 1RI5A 4BYGA 3CJRA 1P0FA 1YKSA 3KZ1E 4Q6WA 1DFGA 1C3JA 5F12A 3B2NA 4E88A 5KYXA 5SZHB 2F3UA 2ZUTA 5G40A 3GNSA 4MP3A 4MJXA 3L7BA 1DX4A 4KI0A 1L5FA 3HKCA 3MILA 4QGBA 4FBMA 1MX9A 3AETB 3O95A 1F2TB 3ED1A 1HEIA 4R1UA 4U7JA 1SVUA 5FUQA 3SM3A 2XDQB 4RSRA 3BB3A 2CLOB 3CB4A 3TZHA 1NVAA 1PYOA 2OLJA 2SHKA 2NV6A 3HWSA 2VRCD 1UWVA 3O4GA 4MHSA 5FWXA 2OILA 4LDZA 2PR7A 4MAMA 4GMDA 4O2BA 4EL5A 4Z4IA 2BV3A 2R1VB 3T7CA 1UAGA 1Q2XA 1NJFA 4BVFA 4RMJA 3TDNA 1NYTA 5A2QA 2PK3A 2WUWE 1NC1A 1ZXLA 4C7KA 3NETA 2ID7A 2WMOB 4G1MB 2WIGA 4MR7A 3TVDA 3P94A 3BWYA 4NCNA 4LYFA 4RESA 4D8VA 1ENOA 4PTYA 1QORA 4D9EA 3FSGA 3QF7A 5TGDA 3B36A 3OJWA 4NF2A 4OKSA 1NRIA 1YHYA 3ZHYA 3E7DA 2DWCA 5LXTB 1RQPA 2BI8A 2E87A 3C3AA 4J9VA 2VK1A 1ZW6A 3FZGA 1F06A 1PZEA 2PRYA 3PQ2A 1UEXC 5BOSB 4X84A 1MUUA 1FP1D 2OSBA 4XA8A 1C41A 3WJAA 4BB0A 1QYCA 4CUJA 4R1TA 3Q8XB 4JI3B 4Q24A 1CUZA 3V8RA 4JV5B 4X60A 4DWVA 3RKSA 3WR5A 4I3FA 1I6KA 4P7GA 2O14A 4AZ0B 1XRLA 4X5OA 3HKBB 1EPUA 4D1YA 1MO4A 2C7BA 3A9CA 3D0KA 4B4WA 1JG4A 4PQYA 1XZNA 1DEAA 3NHBA 4KWCA 3NTXA 3T7JA 5DISB 4B6JA 3FG9A 4BJ5A 1LPAB 4Y3UA 1V16B 2AF4C 3L93A 4TV8A 1YIDA 2ZJ2A 4B3DA 2BJHA 1IN1A 2ZYTX 2JEOA 2Z95A 5FPYA 5IXSA 4IDHA 1YJBA 3WL8A 2YW9A 3ZDXB 3BT7A 4LQLA 1BXKA 2ZRGA 2VUUA 4ZRMA 1M54A 4JI8B 2QAGB 5K3AA 1BEUB 2OV3A 3E8SA 1ZL2A 2BTQA 4TVSA 4NYJR 3H2KA 4MKZA 1A4UA 2ZE7A 2R1UA 2G6BA 3PGJA 3V7UA 1R12A 1EVYA 1ZD4A 4O1MA 1YFKA 5BQFA 3HR4A 5KU7A 3KNZA 1SCIA 2HV9A 2O8EB 2Z6QA 2X4IA 1X3LA 1XXHA 2F3SA 3DMRA 4MA5A 3FMOB 4BJ1A 4RH3A 1QNLA 2DPMA 4RGBA 3SGLA 3G0DA 3VPCA 1GPH1 1FNMA 2H0RA 3RS7A 1T2VA 2C77A 1MJ5A 4IIGA 1SOWA 4DQXA 4YV2A 4RTQA 3T7KA 3RQSA 4E1BA 4HD8A 3HSYA 5K0NA 1F1JA 1SULA 5KREA 3RT7A 2O1WA 2BHTA 1PVVA 2HPZA 4HSGA 4R9VA 2I0FA 4QD3A 3ZGXA 4DTIA 6Q21A 4ZTUB 4WOBA 3R6LA 1CE8A 3MRTA 1FSSA 3WNBA 2AKEA 3ROGA 3JD2A 1NIPA 4ID9A 3AIIA 1K8ZB 5C35A 4GP6A 1DRWA 1Y7PA 3O73A 1TZJA 1HYQA 4YR9A 2O0LA 5DBGA 4TZ0A 3W9BA 4ZVSA 2H0QA 3HP7A 3M6MD 1DVRA 4EG8A 4F9GA 2VDLB 3KWJA 1O95D 4NJMB 1WG8A 2O07A 4HEHA 1TCCA 2COKA 2W70A 1SBZA 1SXHA 3CCBA 3AXTA 5A5GA 1ZESA 5B1HA 4C2TA 1W5FA 2I7DA 4ZKEA 4KGZA 5A4AA 5K6RA 3MT0A 5EGSA 1HPLA 3WMGA 3WLTA 3EX7C 1QPZA 1QYXA 3MWEB 2GPWA 3V6LA 5C7IO 3E9YA 4RK1A 1FEZA 2PXHA 3EZYA 1KOLA 5CLLA 4A2CA 4DADA 3P9PA 3RRXA 2H1VA 1GFIA 2CYAA 1JIJA 2D8MA 1CF9A 2IPNA 2AZMA 3KKOA 3MGGA 1JEDA 3WAKA 1N7IA 1T9BA 3ICCA 3GCGA 2VPPA 4DQUA 4OHCA 1VJ5A 2CEKA 2E49A 3L1KA 4Y2RA 3HS3A 1H4TA 5AM1A 3HLTA 1QO7A 1AF4A 5JRZA 1F4VA 4ASUA 2VDWB 1HRKA 2EGHA 4FCTA 3REGA 3WY9A 4PHFA 3P5SA 3F5MA 4EG0A 4D3DA 1NBWB 3R7FA 1HLPA 2WVGA 4YDSA 3I0MA 1PR0A 3NGXA 4HXYA 1EX1A 3OOWA 5LQSA 3ODGA 1EZ1A 2OB2A 3OE7A 1TF7A 4ENTA 1NN0A 4Y7DA 4CTNA 5LWHA 4LJRA 2W0MA 4INJA 1EE2A 4OUDA 4JBLA 3RSQA 4KMSA 6NULA 1E6LA 1IG0A 4JROA 4IIBA 3SI7A 4L0QA 4B44A 2FPKA 1DQPA 2GAIA 3CZ4A 3LMKA 4NE2A 5E9JA 1WTAA 1J9ZA 1QSGA 1YCGA 3N0XA 3TKLA 3CF6R 1MDFA 3KUCA 5BR7A 4WXYB 5KVSA 1XF9A 2HYIC 3ADBA 3O7WA 5JWRA 2WLSA 1U2GC 1REQA 1P9RA 3CF4A 2PKYX 1R0ZA 2OPBA 4WN9B 3QUTA 3GT7A 3PL5A 2RH9B 4D3ZA 1XHFA 1P6XA 3DAFA 2RI6A 3HDGA 3KJIA 2VDQB 4NBTA 3IJEB 4J3JA 4RD6A 3PLRA 3EGIA 1N1MA 2O50A 4HX9A 4NBUA 4BVGA 4F3CA 1Y4AE 3KXKA 4LNUB 4OHRA 1ZX1A 2CK3A 3HCFA 4N5MA 5JQWA 3NUZA 1NQUA 3NC4A 4TLAA 5A3VA 1GWNA 1XEWY 4LY9A 4TWAA 2BMWA 2ZETA 3WRWA 4M1YA 1N8TA 4FBLA 4B7AA 1YJ5A 3Q8LA 1SOAA 4CEJA 1GZDA 1LW6E 1TZBA 4UJ3A 4CFZA 1VKHA 3HYRA 3LKDA 1X7DA 4F5YA 2UZ3A 1E2QA 1TC2A 2IP4A 4MUHA 3RU9A 5FOTA 4DWOA 3WAGA 2C83A 3KSRA 3GLFB 5EMMA 1ID8A 4JYAB 2UZ1B 3PC8C 3KCQA 3LPNA 3T3MB 1OB5A 3FA2A 4GKKB 4KXNA 3RS4A 4BNHA 4EHBA 2OYRA 1Q1AA 4MV9A 4MVJG 3R7SA 3UB2A 3QITA 2PVPA 4YRSA 2NO4A 4YJHB 4ZYUA 2GCGA 5AW2A 4I50F 1JEEA 4MEBA 1N2IA 4PSUA 4PGHA 3FNIA 3UFXB 1G8YA 5GVRA 3X43A 4ZQBA 1P0PA 3H17A 2GNOA 4JEIA 3DAYA 2SKCA 4M8IA 4V3CA 5HFNA 4DCOA 5JQGB 2BW0A 2NSYA 4E2YA 4BFZA 1EBBA 4KDRA 3L46A 5C5EA 1BIFA 2YC2C 2D1FA 4NJEB 3R75A 2FZKA 4IJUA 4FNGA 3CRQA 5HDQA 1JT9A 5K09A 1RPNA 5I7OA 5BSHA 4X71A 1KI2A 2CCKA 3UJ6A 2AHRA 3SIWA 1FW6A 1QGYA 2F3QA 2YHAA 3DWEX 3ZNNA 3EWIA 3NNDA 3IKTA 6ABPA 2C4MA 1VHTA 3ESQA 2GPTA 3PWZA 3CT4A 1CR1A 3SKVA 4WY8A 1YL5A 4MMZB 4LJ6A 4UPDA 2Z9BA 3TD6A 4DJAA 2B5OA 4W8OA 3T15A 4UTNA 2F3PA 3ENWA 3AKEA 2QWXA 3OPNA 2PEYA 4PSDA 2IXFA 1T13A 3DZBA 3K8YA 2EWMA 2GYVA 2GSDA 4HTAA 4RLHA 5EC8A 4QFMA 4CLDA 1UBLS 2PL1A 4DRYA 1FJXA 4HDMB 2PQ6A 1M5UA 2ACEA 5EJGA 4E0BA 2BR5A 4GT1A 4DVJA 1OA1A 3HA3A 1ZEMA 2ADOA 1V11A 2UYYA 5LP6A 4YXFA 1C30A 5EY5B 4TLLB 2YQ4A 3MS2A 2JIPA 1WUIS 4J7AA 5KTSA 4RD1A 2AC2A 4BKMA 4GLLA 2FW1A 2FUNB 1C8LA 3DZJA 4LZNA 4YV0A 4RHEA 5EMNA 3BRWD 1J90A 1D2HA 1XD2B 3VU9B 1KDRA 1W48A 1YR3A 2B94A 2VBIA 2WYWA 2FEKA 2CB0A 4RKEA 3U37A 2BEWB 1NVVQ 2Y0BA 3ZS9A 3L6UA 3FCYA 5DXJA 3W6PA 1KZYC 2POQX 5REQA 5KNCH 3JQAD 3H1TA 3RAFC 4GLFA 2JLVA 4C7OA 1P4HA 1NQXA 5K8TA 2V98A 1E4OA 3TVYA 4KREA 1JAXA 1NBOA 2KBFA 2LIPA 3R8XA 4J91A 2PZ8A 2JJMA 3BL6A 4ETWA 4IIVA 1CERA 4XVCA 3Q9LA 3G3EA 3R23A 4NABA 3LLCA 1DDOA 1ZISA 2GK6A 1JLKA 3RJZA 3TVTA 2CWWA 2W00A 3DGFC 1FTGA 1QK5A 1AGPA 1JFFB 1WL8A 2WJPA 1T91A 1L4MA 4WY5A 3VDXA 4U2EA 5J23A 1I8TA 1GLGA 2DHQA 4OHPA 5CTAA 3O4IA 3QLVA 2WABA 2B37A 5KHAA 2G5PA 3CBGA 3AG5A 1IBSA 1B6GA 4G84A 2DERA 3F97A 4WJLA 2RHRA 1KI1A 3HGQA 2ACKA 4HGZA 1G6Q1 2JAUA 3THYA 1G8MA 4PLWA 2H4YA 1NF8A 2FSHA 2G25A 2Z5FA 3PE6A 3RK0A 9GPBA 2KB0A 3IP8A 1KBZA 1NUSA 2GX6A 2RFLA 2ZQZA 5E6UB 2JLZA 4GEKA 4XJTA 1ZITA 2IDKA 2CFTA 2RAFA 5CNKA 2VJLA 4LJ7A 3V7WA 1J8FA 1F8GA 1SO8A 1SC1A 3TRIA 3LHDA 3D2BA 4HT3B 3RIHA 3IAS6 1BKDR 3P7MA 1K8QA 3U62A 3CLTD 1S8NA 2IQIA 2FW9A 1YFZA 3R7BA 1SRRA 2Q7OE 5DU2A 3HK2A 3BILA 2H65A 4U7DA 4PNEA 2A59A 5ALGA 3W8RA 3ZWWA 5BXYA 1UMBA 1M6VB 3PCXA 1RWOA 7MHTA 3B38A 2VF8A 4RIGA 4BJHB 3RK1A 4IXTA 3S6JA 4J76A 4RQTA 1K06A 3OMXA 2FP3A 4YRMA 3L84A 3BH6A 1UQRA 1MJGM 2C92A 2HDOA 1CDOA 3A1DA 4HNGA 1C0IA 4RTKA 1SKYB 2I1WA 4AJJA 3NONA 3K53A 1C7EA 2O9JA 3LQ1A 3JQFA 4IUBS 5CH5A 4NV1A 1TF2A 1K3UB 1Y1KE 2GUGA 1Y4UA 2PGLA 2XVXA 4R9RA 4M8KA 3QA9A 4ZCTA 4MR9B 5COQA 4GWGA 3IC5A 4LZJA 1CP3A 2WY2D 4A26A 2HA2A 4GVPA 4M1OA 3K4HA 3S2SA 1KMCA 3V2UA 4KZKA 3PBKA 1NKSA 1DDIA 2FR8A 1TD1A 1V45E 3Q2IA 5DDIP 5IUKC 1F20A 1RXSA 4JI7B 3LX6A 3NBQA 3PGLA 1ZDMA 4KKXB 4PIVA 1GAWA 2WJ6A 2ONJA 1B2RA 4DCTA 4ZI7F 1KIMA 2RARA 3VJRA 2DB3A 4CCSA 1RYMA 2DBQA 2NU7A 3WK7A 6YASA 1QV6A 2QX7A 3E9EA 3ZJ4A 5FNZA 3RBXA 1U7HA 3DDZX 2C2MA 2PZJA 4Q5IA 121PA 3VZCA 4YRIA 5DTEA 3TTUA 3SQDA 1SCKA 2G17A 3G13A 1VC2A 3PYLA 2P6NA 4FLEA 1MX3A 5AHOA 5JLAA 3AHGA 4C21A 1Z2NX 3F6BX 2JKZA 1T8TA 2WWXA 3G8DA 2NTNA 1CWUA 1PJRA 2IF2A 2PXAA 1SVIA 1ZCBA 3V4OA 4EK9A 4FLFA 1US8A 3G2HA 1GGEA 1VYUA 2N0SA 4B84A 2OFPA 2YXDA 1RC1A 1JU4A 3DMTA 5E8JA 2UUCB 2JFQA 4S1PA 4V39A 2H1IA 3E4CA 4F1KA 5JATA 1KQGA 2PUEA 4FJ2A 4NZ9A 3ONDA 3WWEA 2HPHA 4FC6A 2UVPA 1G19A 3OT1A 4JSTA 3F49S 4JL5A 1S2NA 1XTVA 1E79A 1L8QA 5JMOA 1JDZA 4TRRA 3QOXA 3KEFA 4IIHA 1JEOA 2YYYA 3WYNA 4R9UC 4W7SA 3EXAA 2YY6A 2OYCA 3DBLA 2V3VA 1NL3A 3ND8A 5DH9A 1DO0A 3CLSD 3KQSA 2HCFA 2VC2B 3ZHZA 3B82A 5HM8A 1VDMA 3AH8A 1N0WA 4GPEA 1C9YA 1Y9AA 2RJNA 2VI5A 4ZD6A 4URXR 5CD1A 1MORA 2JANA 3JZDA 3Q7QA 4OXKA 4ER3A 4NHOA 5D2CA 5DYWA 5GTDA 1FSGA 5B4UA 1AIPA 2FP4B 3URMA 2WF8A 5BW8A 3H2BA 3GNTA 1QH8B 3IALA 1GUZA 1MH9A 3OCUA 2QSJA 1BDBA 5K6AA 2FE4A 3OLQA 1WXFA 3BMNA 3LZDA 1T0IA 2EP5A 3QVWA 1V1MB 1IY9A 4ZJYA 1SKUA 3AKZA 1CB0A 3HP1A 3JWEA 3MD0A 1TCUA 2IK8A 1P4RA 2AEJA 2JA2A 3O84A 5IHPA 3W5HA 5C81A 4DDUA 5F73A 1SCAA 2JIOA 4HWOA 4ZCSA 1G1AA 4JQZA 3M3DA 4BN4A 3KB2A 4CF3A 4F12A 2BT4A 2CF6A 1JP7A 2F17A 2VJMB 2PU5A 2YWXA 4R5MA 4O3MA 1V7QA 5JSFA 1N5DA 4CMIB 3EULA 1TEHA 3FGNA 4DXHA 4FMDF 2Q1TA 1YZUA 1I3NA 2YR0A 4LHWA 4AJKA 4Q16A 2J6CA 3GDGA 1PU2A 2HMWA 1F8XA 1P7ZA 2FPWA 3O0DA 5CYFA 4FPXA 3WNDA 1P73A 1D4ZA 5F5XA 4CVNA 3NDJA 4ZCRA 2A7QA 1PJQA 2W83A 4OH1A 3RKUA 4MS4B 5KOHA 3FOBA 5JZBA 3QHAA 1Q1ZA 1IULA 5LYJF 5ILOA 1PUJA 5K3EA 2Y93A 3OWHA 3PUWA 4PYOA 4AJLA 1TMYA 3ETEA 3U81A 1SC6A 2WUVA 2PWZA 2XE8A 2C2BA 1RLMA 3F9CA 3I5UA 3O26A 4G37A 4GH5A 1C1DB 5BSTA 4US1R 1ADGA 2MWMA 2VUTA 2XYVA 3OZWA 4EAAA 1M1UA 1EAMA 4Y2UA 1N0UA 3H6HA 4DL9A 1H9BA 4OMUA 3OU2A 1T5DX 1NV8A 3F9IA 2WU4A 2DETA 1PFVA 1SVLA 3W3AA 4XWTA 4ZO4A 3C1OA 1UDBA 3BGIA 1KK2A 4WNAA 5BNFA 3EHEA 2YN4A 3FX2A 4GE3A 3D8NA 1HDZA 5HOQA 2G1PA 3W06A 1COZA 3PX3A 4ZHQB 1P0CA 5CB0A 2R96A 5JJIA 1PAUA 1RZ3A 2XUPA 4PFQA 3ZU6A 2J3DA 4QATA 5HKKD 3TN7A 4XX0A 3DD1A 1EE1A 3Q72A 4V0OA 3I6QA 3RBZA 3HY6A 2D0DA 4JY7A 4NCKA 1GUDA 4NFYA 3TLXA 4CIAA 4KXWA 1P0MA 5EZYB 3AEZA 3ZWPA 1GAQA 2OCPA 1XC7A 2PD3A 2NQTA 3GIDA 3I72A 3IR5A 2QE6A 3NH9A 3LCJA 3CUWA 2PSSA 4X20B 3CA8A 2HXGA 4KGXA 4Q4LA 3U3KA 3OZSA 3Q12A 4HYQA 3T06B 2IS6A 3DMHA 1DOAA 4E94A 3DO8A 4JNKA 1EDOA 2PSFA 2XEDA 4J03A 4MV1A 4DILA 3QMMA 1ODTC 5IU6A 5LA6F 4LDPA 4ESEA 3F67A 3FM9A 3O8CA 1G3QA 3OOHA 1K6JA 3J7AC 1RJFA 5MF6A 2HHLA 4O4JA 1CR4A 5THXA 2B61A 3RJMA 3AF1A 2ZM6B 3C45A 1DEOA 2G1AA 4QBTA 2OMEA 2CZGA 5BT9A 3BERA 5DNAA 4AO6A 1IU9A 3H8WA 4MNTA 4POOA 4P7FA 1G7TA 3E9ZA 4YJFB 2HMAA 1TW3A 5C9ZA 2RCNA 3C3DA 4BP3A 4PCUA 4Q4AB 1GVHA 3GUUA 4GMFA 4Z8YA 4YJ3F 3U3RA 3I39X 1JHXA 2WF7A 3I23A 5CCEA 2FCAA 2XD9A 3UWPA 3LO5A 1SKAA 2FPIB 5IYZA 3GRAA 1VE1A 3BC1A 2UUAB 1CG6A 3IT0A 4IRUB 4IIFA 3S2UA 4ACAA 2FPRA 4WFKA 4AZWA 1UDWA 1BW9A 4FX2A 3U44B 3U3ZA 4Q9LA 2I6UA 1NXWA 1D0IA 1XVVA 2PGAA 4B0OA 3B5IA 3HPRA 4QYIB 5CHYA 1SCNE 3LQ2A 4U7HA 1FRVA 1TW2A 3LNTA 1XYYA 1DB3A 2G1UA 3DP9A 3E0QA 3K09A 4RV4A 3L7CA 5H83A 2PZLA 3D2AA 5ICSA 1B6SA 2ODEA 1G18A 1Q91A 4FI3C 4DXAA 4WFIA 5ICGA 1M0EA 3FOAA 3HE3A 5A9RA 5AW4A 1XRPA 4NZMA 1FRQA 1YHZA 4LHZA 3RSSA 1HQKA 4OMCA 4DR6B 3SNKA 2OHIA 2W6IA 1GG8A 4XGNA 5H81A 1CYEA 4R1NA 2CBXA 2I4NA 1HM5A 2JKVA 3GEGA 2A92A 1F8UA 3QLUA 3T4PA 1LSOA 3V34A 3EH1A 3LLVA 5AXDA 5ELXA 1ZUHA 3QVJA 5FBZA 3E5HA 5DCUA 1XSEA 2NM0A 5AUQA 3TR6A 4F11A 4QHTA 4ETNA 4BHTA 3OFVA 4EB3A 5EIHA 4TVKA 3PFNA 2CUTA 1LPPA 1N57A 2PCJA 2PFGA 3G9UA 3QX9A 2PRZA 3NYIA 3ZTWA 2ZIVB 5JLJA 2GZMA 2WIAA 2YQZA 2ZK7A 3UPTA 3N7TA 3OQNA 1UKVY 3MWFA 2DYKA 2XADA 1EQAA 2C9ZA 1FP6A 1YZ3A 1ZSVA 1QH1A 2PS3A 2QP3A 3BIFA 3EWSA 3I05A 1DBQA 4MIYA 3TZKA 2R8ZA 8GPBA 4MQFA 5IEBA 5B1IA 3BK2A 1SK8A 3PPWA 5LQMA 4M7RA 4JI2B 4TWJA 2FFRA 2B8WA 3TW4A 1DEHA 4ALJA 3S8EA 2W2TA 3H8JA 3SMQA 2LVBA 3I8SA 5DBEX 4KVFA 4FYWA 2FVXA 4MV7A 3G2NA 4JUDX 1DZ3A 3GJ0A 3K6KA 1WCXA 1DQYA 3BGOS 1QGAA 3ZCVA 2FF5A 2O3QA 5EVJA 1M6NA 3QWIA 3DBVO 1EB8A 3ETGA 4CPDA 4TM7A 4YP6A 1MVLA 2ARKA 4I14A 4XIYA 4NIMA 4GAEA 4DABA 3M0EA 1WHSA 1RRKA 4S0ZA 2PA0A 1HG1A 2VNJA 5GIOE 2Q4TA 5AK0A 4K6KA 3RVSA 3UMBA 2QNIA 4FNMA 4HADA 1UFVA 2OCAA 4X93A 1L9XA 2GWRA 2D5CA 3C6ZA 1DUSA 3NJRA 4Z4FA 4NQRA 1YB6A 4BCDA 2PX6A 3ZI4A 1EUCA 2YN2A 4Q1CA 1JF8A 1QTIA 5BR4A 3USZA 3EQZA 5J4HA 1SUWA 4KXQA 3TLYA 4BO0A 2O52A 2JZCA 3AK4A 1I1OA 5FBLB 5A7FA 1G3RA 2XRYA 4YMWA 4PZPA 2BH2A 2C5HA 2B3TA 3AR3A 3K9GA 4P8RA 5FOQA 2VR1A 1SM4A 3TAHA 4ETIA 3N87A 2WTEA 3ZKWA 4GMXA 4MV6A 1MHTA 4KPUB 5J47A 1QIDA 3UPDA 3O1IC 4C0JA 3FW1A 3QVVA 4BV2A 1LNSA 2EXXA 5F1KA 1JEQA 1R4MB 2Q5IA 4HNSA 4DC9A 3AP1A 1UXOA 4P4SB 2BGKA 1IAVA 4D8WA 3WE7A 4P5PA 1D7OA 1GN9A 2JGRA 1X80A 2FEXA 1S8AA 3U5TA 5C52B 4G0VA 3RC8A 5CBPA 2XIJA 5BV8A 3QPCA 1X94A 3PUJA 4G0UA 4MVWA 3QWFA 1EVJA 2B99A 3EGXA 4HMQA 4B47A 4AMYA 4QKQA 2N42A 1YZVA 4B7CA 4Q18A 5ETJA 2CFIA 1Z5PA 4M1QA 1X42A 2SBTA 1NT4A 5K7SA 1Y8QB 1Y63A 1SZCA 4ML3A 4CUZA 4DHEA 1GRQA 2Q4DA 4AUNA 5EXXA 4AYXA 1U2DC 3GUCA 3PTLA 4ZN6A 3AWIA 1NVDA 3CONA 2JIZA 3KBBA 5KTMA 1JJVA 3FNQA 4QUAA 1HFEL 4LF7B 3KYDB 2C20A 1DI0A 2OB1A 4DDVA 3KB6A 2JGJA 3SSNA 1C7ZA 4BLPA 2AOTB 1IHXA 1L7QA 2VHXA 3PNMA 2NO9A 5FTNA 3NNSA 1I0ZA 5CT9A 1WZEA 2A9FA 2QQ5A 2XB6A 3A4TA 1N33B 3LVRE 3VMMA 5K03A 3WLAA 2IY7A 3EXIA 2K87A 1S8OA 1FNSA 2L82A 3HYLA 3H1BA 4G0OA 5IDWA 1L5QA 1UDRA 2AEFA 3DFKA 5MHTA 3CG0A 3K1TA 4OL0A 1ZRSA 1U9CA 1IE3A 3PGVA 1L7RA 1J24A 2C9MA 3AGQA 1CUWA 3DMPA 4ZVPA 3WOHA 3CVVA 5C32A 1RC8A 1YR7A 4XWOA 2JGFA 4YASA 1HDXA 3JD3A 221PA 3RS9A 3ERCA 3G82C 1IG3A 1KETA 3AOEA 3G9ZA 5AIAA 1DT3A 3DDOA 3FUXA 4GW3A 4YCBA 5J5AA 5TX7A 4NCAA 1G6KA 3GMTA 3IQGX 3TXAA 3WIUA 3L8YA 4J94A 4LJKA 4YT2A 4KHZA 3KJXA 5FNVF 3TYXA 1Z56C 1H2XA 5AW9A 5LXTA 3PQ8A 5TQ2B 1CJBA 1Y48E 1Z6GA 2CMDA 3EDOA 4M8LA 1Z88A 4OXIA 4PGGA 1PJ4A 1VPWA 4UHKA 2XTJA 1JQBA 5IP5A 3W77A 1XZCA 3SHFA 4EDFA 1ECFA 2F1HA 1QTQA 1Q84A 5IC5A 1HNZB 1K6IA 4BRZA 3ZCPA 3TE6A 1FY2A 1E5VA 1XD9A 3CB2A 5HS4A 1SZPA 3RYCB 1XRQA 1XTRA 2CHEA 4JXXA 1VRCA 3LFUA 5K0SA 2CXNA 3R5KA 3BDAA 1PKEA 2VEDA 3JYNA 4WY2A 2W6ID 2J7PD 2KPOA 2ZYGA 4QYMA 5CXQA 1FNNA 3EXFA 2EWVA 1G98A 5CEJA 2W4QA 3GFFA 2UUOA 5H0IA 3FNRA 3LT1A 1CJSA 4MZDA 4FWBA 1JHUA 4CFYA 4GGPA 3AW8A 4KSCA 2HJRA 4AKEA 2A0KA 4AM8A 4NBWA 4UM9B 1Z45A 1KC3A 1D2CA 1Z8FA 2EFEB 2H2FA 1KEEB 1FX0A 2YHSA 1E3SA 1MA3A 1NP7A 2OCBA 2QTLA 2YVKA 3IDSA 4V0RA 1QLHA 3AVUA 1YDGA 1V6AA 2CFCA 3Q9SA 5AXBA 2CLCX 2JJ1D 2P41A 3OCYA 1EX9A 2EIHA 3INYA 2C94A 4L4ZA 3W8NA 2EFJA 3IRUA 4RH0A 4DYHA 2NU6A 2ZQ5A 2CLIB 3G1TA 2F4NA 3HY4A 1CQPA 2XKJE 2ORED 2WI8A 1QKIA 3KV1A 3LUAA 1FU7A 3OAAD 4JLDA 4ZI5A 2W2LA 2HAEA 2P69A 3OICA 3RH0A 3U39A 4PAQA 2C9YA 4OIFA 3IUNA 4M53A 1XNJA 3I04A 3TG8A 3B1YA 2QX4A 3MS7A 4ARZB 3ROZA 3VYRB 3AUYA 2VAWA 3GJ7A 1E8DA 3DL0A 2YRXA 4LCEA 2RKBA 4L5JA 4LRTB 1Q0UA 1JR3A 3U4IA 4OI2A 2O2IA 3AB8A 2FLWA 2QTFA 2V7GA 4JLVA 4LJSA 3KEMA 1UUFA 1RW4A 2PLAA 3IDZA 4O3FA 1H2RS 2IYRA 3HRKA 3NBXX 1XWWA 3P9IA 1V0JA 4QQ8A 4S2UA 3DZIA 1VCMA 2A5DA 3RANA 2EJVA 3UJDA 2OC9A 2R7KA 2GK3A 1WVIA 2WAAA 3DE5X 5F9HA 1JJFA 2GETA 2NNLD 3GMDA 4L76A 4OAOA 4UZFA 1R3DA 1IZ0A 4HMOA 5DM1A 5EFOA 2WYOA 5L3SB 1HY3A 2Q6KA 1A9PA 1QGOA 1O03A 5J2UA 2AB0A 2H3EA 2X3YA 5C2JB 2XCSB 4BZXA 2GYWA 1Y1SA 4M9CA 1L5RA 4O63O 2YN0A 3TXYA 3VPXA 2P9CA 1H1DA 1YS2X 5AQEA 1QC5B 1KFCB 4R4JA 4UOZA 1M2GA 5KSWB 2HCJB 1LDYA 2HUPA 3D7SA 3HKDA 5JFGA 3DUFA 3JZFA 2NIPA 4FB5A 4C87A 3KTFA 3C15C 1U0EA 2I3ZA 2PH1A 3K31A 3BXFA 2C1XA 4EKIA 2DCMA 4EB6B 1R0LA 4MV3A 4KP7A 4WOJA 1CNFA 3EMVA 4FGUA 4DLBA 3VJMA 2ZT8A 1Y89A 5JJBA 2MINB 2PLRA 3LE8A 3BGVA 3O83A 1FQKA 1KAMA 3QBEA 1BA3A 1E3IA 3MOGA 4RA9A 3IQXA 4O29A 5AJYA 4COOA 2HTFA 3EASA 1QFJA 1G16A 3HDQA 1W47A 2OPHA 3K9QO 2GN9A 4A82A 1HK7A 2PGDA 4GR4A 5AQ1A 4ESVA 3LQ4A 1E63A 1JFSA 2VRNA 2X0RA 3EBLA 3CWZA 3QWBA 2XE4A 1Y8CA 4GNRA 4YI3A 5IKPA 1SG0A 1BVUA 4A8TA 4TWZA 5KJ1A 3NOVA 4WVFA 1XCOA 1CS0B 1TVMA 2CXRA 3DKRA 4N54A 2QUIA 4NNPA 1SCBA 3DF7A 1EXDA 4EJMA 3UWMA 2JBHA 1DIRA 3NTQA 3EF3A 3OPXA 2R6JA 1LFAA 5BNWA 5DLPA 2WUDA 1V5GA 4IMJB 5AK4A 1FDUA 4MGYR 5CLJA 3QE0A 3S29A 2ADFA 1FYEA 1GPYA 1YC2A 2FEWB 4U0JA 2ILVA 5L7TA 4UNPA 1FUUA 1KARA 1KZ4A 2HWWA 1IUPA 4PC6A 4YAUA 4UHBA 2Z08A 4JGIA 3V2HA 3B53X 2QRQA 3LXUX 4X92A 4YPOA 4MRAA 1T8PA 2V3WA 1ECCA 4XQCA 2X5NA 3GEMA 4RF3A 2XCLA 1CJMA 2HFJA 3PXEA 1XEXB 2DCUA 3TR5A 3LPMA 3IP9A 3HUUA 2BFFA 2O7NA 3NFRA 4D4IA 2X1VA 3BE4A 3FZNA 1NBME 4BWGA 1LVGA 4L6IA 4TKVB 1TVKB 1ZCFA 4NBKA 1VZ2A 1TU0A 3I3SR 3LHSA 4BJ3A 3QF4A 5JHHB 3UW3A 4YDHB 3SHOA 4F5DA 5K99A 1CULC 4B17A 1L5OA 2A9RA 3ROPA 4DPMA 1XCJA 1Z4IA 3WS7A 1P19A 3IBGA 5ALHA 3S81A 2GZRA 2H51A 4KJZA 4RX1A 2OHFA 1BN6A 4HQFA 4XRRA 3K0CC 1WB5A 5E1OA 2XLBA 2OZPA 5K8VA 5K3OA 2Q4OA 3O8QA 1UR5A 5BSVA 1IIBA 1ZM7A 2GESA 3GQBA 5AOAA 4EHKA 3LUGA 3LHIA 3ETLA 1UPBA 5DYYA 3SFZA 3ZKAA 1Q0TA 1GGJA 2GZ2A 1M8GA 4O4LA 4AL4A 4WVLA 4GR5A 3LBFA 4RPIA 1CQIB 3FNHA 1O5OA 3DTYA 1QIFA 3EOZA 3ZR4B 2ZJ0A 2NUBA 3ZEAA 4BE9A 4QBKA 1PR4A 3F7OA 3FYUB 4TKZA 2W22A 3R7WB 1C1HA 1NMSA 3W7AA 5LP6F 3H9JA 4RFSA 5K8UA 4BQSA 3N58A 3ZQ6A 4PO3X 1C5KA 1U3VA 2GCOB 1LPSA 2Q62A 4NPCA 3P96A 4LAFA 4LF6B 3OQ6A 4QL3A 1PR1A 2PFSA 2DP4E 1T3ZA 2X6RA 2IIPA 2OCIA 3K9LA 4JVNA 4ZIRB 1KBQA 1KP2A 2WSIA 2IPLA 1KZGB 4X1KB 3RAPR 3AC0A 1W2GA 2QMQA 3QEMB 1Z16A 3PCRB 5GONA 1C8KA 1SBCA 4KIGA 1IATA 4OLFA 3EZLA 3MRSA 2RD2A 2M98A 1TZ2A 4J1NA 3GRYA 3NAMA 4CXMA 1R00A 1O5TA 1UF9A 1ZIPA 3DOUA 2VYVD 3SOPA 2AT1A 4WX2B 3EZ9A 5SZJA 2C84A 4X95A 1ZGCA 1N3YA 1ISFA 1MB2A 4WRRA 5HCNA 3SG0A 1SIWA 4HH3C 4OHMA 3HJFA 1RCFA 1MNAA 2HRQA 1I2BA 1V5FA 2VNIA 3OH8A 2YVLA 4H0CA 1QCYA 2X4GA 3LP6A 3QX7A 1SNYA 3K5PA 1JMYA 4LMAA 4YI5A 5TJHA 1DJQA 5IH7A 4JUBA 3IDFA 1CRLA 2PX4A 3ZXIA 1JR4A 2GN2A 4YLGA 2ZB8A 2ZRDA 3LDHA 1JHVA 4G63A 2QUHA 5KJFA 3SC2A 3K2EA 1GN8A 1T8RA 5JTUA 1LNQA 3BCRA 4Q7JB 2VPZA 3UANA 5L3ZA 5DKFA 2XYQA 4A0QA 5ER9A 5C0OE 2DFNA 1A4XA 4BNNA 1BA2A 1QG0A 4KWHA 2WFAA 5TRTA 3K9FC 3L4KA 3HM9A 1UP7A 3D1VA 3MF4A 2YFHA 4I2NA 3DHNA 4O4HA 5TQVA 4ESHA 5JZ9A 3EF0A 2OD2A 4Q9NA 5IJXA 3W8EA 3T1TA 5K2MA 1AQUA 1E9RA 4QBHA 4B4KA 1WUJS 4MGEA 4CMAA 4QGFA 3L0DA 4AJ4A 2YWJA 2Z1NA 1CHNA 3BD9A 1M2EA 5BQ5A 4U5QA 3NH6A 1KR5A 4BMZA 3RVJA 4E13A 1D1TA 4LZLA 4QYXA 4XJSA 3REQB 3WK8A 3P2OA 4EUEA 2VPXA 4HDSA 1ONBA 2E89A 3IIMA 1LX7A 3K92A 5TMDA 3GLKA 2IZ0A 4L07A 3THSA 3SVLA 1ZVMA 2W6MA 3JR7A 1WW8A 3LLSA 5B2ZA 5AOCA 1MGPA 2IU4A 3HXPA 4GI3A 5K0LA 1A5AB 2G9RA 2FZEA 2NU9B 2I6QA 5ELLA 1QRDA 4Y2YA 4E2FA 3NC1C 3RHFA 4D5EA 3I6MA 4HH1A 3ZDZB 3WB9A 1DXYA 3IKLA 4MX8A 1PGNA 2NO1A 4UARA 4F0JA 1Z2OX 2WICA 1SBHA 2CNWA 1QVRA 4XGRA 1OFUX 1AHNA 3AERA 4IIJA 1N5RA 4WZ6A 3WADA 3OJ0A 1W87A 6REQA 2WYVA 3HSKA 3I30X 1V25A 3LT4A 3KKLA 4EKYA 4FMCB 1AE1A 3RAJA 4C04A 2XAUA 5DBHX 2IYLD 3DHEA 4PHCA 4Z0HO 4X6YA 1A9RA 5IVPA 3MT7A 3ILXA 4NRDA 3IELA 1VJ0A 3TPZA 4HZIA 2AL7A 1FP7A 5HE9A 4AXBA 2J5RA 3PQCA 4HBZA 2IUFA 4KG7A 2ETXA 2VZ0A 3O7MA 5B3KA 3UAVA 2RONA 4KITB 1P72A 2ZUSA 1VE6A 2QPOA 3PYMA 3I2IA 1LK0A 2NU8B 1VPLA 1W34A 2JK0A 3RB8A 4DV4B 3KJQA 3V32A 1FP4A 1U99A 1L5HB 3PB3A 4NMLA 3ZN2A 2QG4A 3D31A 1A71A 2NYAA 1NI4B 2ZKIA 5FD8A 1N6RA 3MOSA 4DMHA 1DG3A 1SXIA 3VSCA 2JD2A 1B76A 3QTBA 5JAHA 5CNMA 5TARA 5FR1A 3P2EA 3CTMA 5KYVA 4V1CA 4QPCA 4CF6A 4D9MA 4TX1A 3ABQB 3ZW9A 3QELB 3R3XA 5BSWA 3A3KA 5F21A 4JI4B 2Q1XA 3PKIA 2BLNA 3M4XA 4CDGA 2JCYA 4JX9A 4MMXB 4MKXA 1Q0ZA 1MLDA 1THTA 4AF8A 1WW2A 4DNPA 3W5IA 5LQDA 3W90A 4DMLA 1XZLA 2QSZA 4WLVA 2EQAA 1MQ8B 5JARA 1KIAA 1SKBA 5T6BA 4ZAVA 2Z6UA 1GNSA 4AUMA 3JPYA 4BX8A 1UT6A 4FGSA 2QUZA 3FTCA 1W6RA 3EH2A 1TIPA 1Y4DE 5I7FA 4M76B 3AQ4A 4GSYA 1KNXA 2QTGA 1IJBA 5E1BA 4KAFA 3WJ1A 1NXQA 2FF7A 2ZDGA 3ZD7A 4C6SA 3CVJA 3TQHA 4MLCA 1C7JA 3B3AA 1TTTA 1Q92A 4ZYXA 3QBTA 4RKYA 5P21A 1T5OA 3SIRA 3ZJ5A 3OOSA 1K75A 1YKFA 4CM1A 2QV0A 2YDYA 2XUQA 2AE1A 4CMCA 4A9AA 2QJWA 4HQNA 1P7YA 3M4NA 1UPFA 2JH3A 4MPTA 2BKEA 2ID8A 4ERNA 2XDYA 4K26A 5A4DA 3GLFE 4D4LA 1QRUA 3RFFA 3MWDB 3WYAA 1KRXA 5ER6A 2R1TA 3UHOA 3WDLA 4CQJA 3LAWA 5C1DA 3NW9A 3H5IA 1H1TA 1FDIA 7REQB 5KTPA 1J0AA 1AGYA 1PCXA 4JUCA 4PBSA 5JEEA 4QPJC 4UDOA 5AR1A 1OAAA 3ZC3A 1GOTA 3H9BA 3HVRA 4IFEA 1ADCA 2FRDC 5D5QA 3AEYA 3LVFO 3GFBA 2Q3HA 2XMGA 2AG6A 4IIDA 2GCNA 1L3IA 2NSHA 2MJLA 4MYHA 3N2ZB 5EUBA 3T5DA 1E7QA 4XFDA 4X6UA 4DG5A 1VQ1A 2IBTA 4BLTA 2EAUA 3V4RA 3IAHA 3JQCA 1BFKA 4AK9A 1Z4PX 4X64B 3BGDA 2G4CA 2EV9A 2G7MC 3NHPA 3O9ZA 4GI7A 4ZCQA 2OA0A 1UIMA 4C07A 2ZKLA 4KJXA 4AMBA 3K7EA 3DLIA 5ALEA 3M81A 4R2KA 1O2DA 3U40A 1AZSC 2FU5C 2V6FA 4RCZA 3K15A 3K96A 4B2PA 1YFJA 3VSAA 1TO1E 3SC4A 5JH7A 2IUTA 1TRKA 3I4LA 4PX5A 3TIFA 2EQ5A 3VR3A 3UK2A 3N6XA 3LP8A 1KQPA 5CFZA 5EESA 2J0QA 2OBBA 1AZTA 5ITWA 4P2GA 2Q9AA 4BO8A 3TSZA 1KEKA 5GIPE 4X9XA 2JFUA 3QJGA 3QU9A 3FHCB 5GQSA 1PWEA 1SH7A 2BGUA 3UGTA 4DLZA 3P2MA 3PGKA 5I9MA 5YASA 5BURA 4H08A 3LH5A 4BV3A 5BRJA 4BDSA 2Z43A 1H69A 2BHNA 1FBTA 2QQEA 3VMFA 5EXSA 2VXOA 5BWOA 1DBPA 1FVFA 1OW3B 4UPEA 1UJ4A 5B30A 1H9AA 3P97A 5IABA 1YGYA 4RZSA 1SGWA 1WNTA 2ORVA 3L41A 4JR0A 4KQ9A 3N76A 1ODFA 4KCGA 4HYTA 4OQXA 4PO8A 4YROA 1CYDA 4A8JA 4RTMA 3V8EA 1BN7A 1NVUQ 3NI2A 3RSGA 2EU8A 1GAJA 2Q50A 3T9AA 4G8CA 2RGNA 2X4LA 5H7XA 4J49A 4XXHA 1INLA 1Y3HA 2XUKA 3LQKA 3K6SA 3QRWA 4WT7A 2CBGA 2XCIA 4WK6A 4JI5B 4S35A 4XM0A 1UQUA 2I4IA 2QJOA 1CEQA 1H23A 1TD9A 3AKDA 2F1JA 1BRMA 2YXEA 2G3YA 5ECYA 5FPKA 3GLHA 2X5JO 1XT6A 2W58A 3U1BA 4I8IA 4AY3A 1NQTA 4M22A 3WICA 3B1XA 1QVWA 2A84A 3BHNA 4AB1A 3RM3A 1RR6A 3ZW7A 5K4GA 2GASA 4O02B 2Q6LA 2R6ZA 2CV2A 4KV7A 1Y3CE 4FGKA 4O4JF 5B3JA 4ZVLA 1TT5B 2OVFA 4R7GA 4D2IA 3QU2A 1ESDA 4RFLA 1Z6PA 2FMKA 2KHZA 4NBSA 4BGUA 4YRKA 2XA1A 3WX0A 1JJIA 1GKYA 1WOMA 2QD1A 3AZPA 3R3WA 5IZCC 1UBHS 2QTMA 1PEKE 3DFIA 3FHOA 5DSZA 2GM3A 3U0VA 2F3TA 2I1LA 1ZI9A 3OM9A 4U39A 2OXIA 3SYMA 4DUPA 1LJLA 2DPYA 2LKCA 3IDAA 4BYMA 4K3VA 1U2QA 4JT9A 2ZI4A 3DQQA 4ZXFA 2HMYB 3FMPB 4MWSA 3W7VA 4RPLA 5AH0A 4A6PA 3GGDA 1RHRA 1YVDA 1DMRA 1YSCA 4BNMA 2C3UA 4EI8A 1BFUA 1OI2A 4HJRA 4F97A 3E82A 1ST3A 5A3QA 3GOHA 2XSZA 1DG9A 2GJ4A 3ZE2B 2P7IA 2FN7A 1UFRA 2XAAA 2REQA 3ABZA 4YA6A 1J8MF 1ESZA 2BEUB 4JCOA 1JG3A 4HPXB 2ES4A 4UUAA 2RHTA 4AUKA 3PC7A 3ZUPA 4F3TA 1JNYA 3D8TA 1SKYE 5EUCA 4MQBA 4BNIA 3RUPA 3EEYA 3OEED 3EPPA 3OFNA 4JLBA 2W6JA 5EJ2A 4A2PA 3ZV3A 3PICA 3R7LA 3CZMA 4W6ZA 1U2SA 3TD9A 5A3RA 2BJVA 2BL4A 2X2PA 4JU9A 2WTUA 3N07A 1NBMD 3E7PA 4JL8A 1R8YA 2F67A 2I55A 4MEAA 1NVMB 1SCDA 1M2HA 3VI4B 3VZRA 1LY1A 4GS5A 1ZY2A 3AF3A 3PQDA 4PSAA 4WKPA 4B79A 3NMUF 4AN0A 1JIIA 4RA6A 4ZVVA 5LOVB 2EP7A 2Z1DA 5SY6A 2EL7A 5FEUA 3V1UA 1U7ZA 3OAAA 1RCTE 2C5AA 2XWJI 2L42A 1BJRE 3K0HA 5KOYA 1G2OA 1QF9A 1HL7A 2XNCA 3A6ZA 2IHKA 2AE2A 3DE4X 3GGJA 3FUTA 3ZWMA 5JJKA 4QE3A 5HDBB 4IDPA 1XWIA 4LOIA 2HK8A 4EJ0A 2CBZA 4FK8A 2I4RA 4NESA 3V1TC 4M0LA 2GVNA 3W5VA 3RLIA 4CCAA 1WXEA 5IBPA 1P1BA 1RQLA 2BCJQ 1ZOSA 3QY0A 1Y7IA 2I4OA 4GWLA 5LKAA 1ENPA 3VKWA 3T5AA 4R8SA 1JPNA 2I33A 2VUIB 4Y6GB 4IYJA 4R2HA 2C29D 4QQFA 1TEXA 2O7QA 4GE0A 2CNDA 5B58T 3C85A 4MAAA 4TTIA 4M7OA 2Z3ZA 3MCTA 1PVOA 2W6NA 3S55A 2CJFA 3QA3E 4K6CA 1GFZA 4UCFA 3PC6A 1MEEA 3C3YA 2JW5A 1DBWA 3HB4X 3SHQA 2GI4A 2O48X 4GR9A 4LKRA 3PVCA 1RYZA 1LNZA 2W2KB 3D43A 2NT3A 4MUFA 2KMLA 1T10A 2H5EA 2ODBA 2Q07A 3DT9A 4IJVA 3R76A 2ZU6A 4L0CA 3WLMA 1RT9A 2XUAA 1PT6A 1K4MA 4MJ3A 5K0ZA 4CU2A 2BGRA 1B0ZA 2YIDA 2FOLA 2WEKA 3N3AC 4U1RA 5EJ5A 3WWZA 5ED4A 4G4GA 4L4YA 3RBAA 2QLJA 1JBKA 3KAQA 4FEGA 2OZEA 1XMOB 1EK5A 1JA1A 1Z5WA 3VR6A 2DHEA 2Y67A 4D9IA 4BUZA 3DE3X 3D6JA 5LZ9A 3LRXA 1RWNA 4OK5A 5ITZB 3H99A 4TYMA 3GPIA 3AEQA 5EEHA 1PV4A 1PSDA 4KSBA 1BMFA 1DAMA 4EG6A 3ABSB 3H65A 4O4IB 2Y2VA 4EF4A 4ABTA 5IUNC 3KOXA 1GADO 4IR7A 4RDCA 4ZOLB 1XNRB 1CQXA 1DQSA 1GQFA 1IOWA 5DBFA 1RCUA 4RF2A 3EXHA 3AZOA 4HVCA 3CNHA 2XQGA 4PRKA 2YJTD 1JLLB 1QHHA 5FF9A 2D1YA 3IEKA 4CE6A 2M1ZA 4OA8A 1E2BA 3A6EA 4YH1A 2O8DA 3DTNA 4ZU3A 5JI2E 3K0SA 1TJYA 5F23A 1KU0A 1TTHA 2BFPA 2ZP1A 4O25A 4E5MA 4CLXA 3IP3A 5FWAA 3O47A 1PJBA 4YMHA 3O9MA 1ULHA 3A6JA 3FZQA 2P27A 3EAFA 1NVWQ 3T3PB 3OX3A 2PL9A 4IVQA 1W49A 4QBIA 1KOGA 2ZPUA 1PFGA 1EP9A 4YHBA 1YWGO 1JB1A 2EJTA 2R97A 4BATA 5KWSA 4ZT6A 1NVGA 1W9MA 1N1EA 2FGKA 2IXAA 3RS0A 4KXVA 1X74A 2PX5A 2Y71A 4ND7A 1WZNA 3KS9A 3AHJA 4GZ3A 4L50A 1M34B 4JASB 3K0KA 2BY4A 5CVEA 3BOSA 4NK5A 1SQGA 3LX5A 1PZFA 3GD5A 3FBGA 5A62A 3NEPX 4K2AA 4DCMA 4TV9A 3W6NA 2WAYA 3CH7A 4BKPA 3RFXA 2FZLA 1E7WA 1EZ4A 2JGDB 3L7OA 3GL9A 4JIMA 2J9GA 2H7YA 2CD9A 3AL2A 3A3YA 3N8GA 4MPRA 3R6DA 3P4XA 2GZHA 2ZBFA 3IVXA 2VKTA 3CKLA 4MV4A 4Y98A 1QF6A 1H0SA 2DWOA 2D5LA 2B4TO 4QJIA 3V80A 3UT0A 3AEUB 4G8DA 1WP4A 1NYQA 3H3FA 3RIXA 1F14A 3BD6A 2CMKA 1OTYA 5GJBA 2Z2JA 3PD1A 1PR5A 4KQ2A 4TQAA 3C7CB 3M4JA 1I80A 4OH7A 1EEXB 5DNEA 4RL4A 4FC7A 1B2LA 2PS0A 3IIIA 4BNWA 1R0BA 2C2WA 1K3TA 3D8UA 5DRTA 1EDZA 3NWPA 2EJCA 3G23A 1I4LD 4M1KA 4WZBB 2YASA 1D4OA 2HRDA 1GDHA 2QL9A 3PVSA 3TZ6A 3TRDA 2XSZD 2QUJA 4WLOA 2HIAA 1Y4SA 1ULBA 3BQ9A 3MYYA 2AGVA 1BYUA 1SA0B 1NJ8A 1H3FA 2QVCA 4TZKA 5CM2Z 1G5QA 2W8ZA 1LVUA 4P08A 5FI0B 2LCIA 3AHCA 3D1LA 3F74A 3CZ9A 4E46A 3GARA 3GB9A 4Y2XA 4ECAA 3TM4A 4E09A 3OFND 4K7JA 1IIRA 3LVQE 3C48A 3EVAA 5JBIA 3FOFC 2EJBA 2PMKA 4LS3A 5E6RB 2HIHA 4W1RA 4XARA 3U60B 2E6UX 3HV2A 1YR6A 1V9LA 4NG4A 2UYCA 2JVKA 3EXG1 2BELA 1VE5A 1W4ZA 1SBNE 1WMAA 4XDGA 2PR2A 3F8WA 1YQ9A 1CIPA 5AJVB 1QCZA 1MAVA 3F78A 4JHLA 4B3JA 2YZMA 2GFHA 3EIFA 1T5HX 4AP9A 2PT5A 4W9NA 1AXEA 1JG6A 4OXYA 2BEVA 5K3SA 4LY0A 4EJFA 5JY6A 4LE2A 1UMKA 3R0QA 1Z4NA 3TNJA 2NNWB 5LFAA 1ESEA 1VKRA 2D7CA 1Y3IA 1GTZA 3IE1A 3RSOA 1EWQA 1UODA 2ECFA 4JOCA 1JHPA 1OT5A 3BE8A 5KC8A 4I46A 1EJ2A 1HT1E 1EVQA 1ONSA 4W5WA 4UBIA 2NVBA 2YV4A 5AJUA 3RADC 3GC6A 1P3JA 3LU1A 1L3BA 3A4MA 4NX2A 2OUIA 1YS7A 3ES9A 4EF6A 5LLTA 1QE5A 4R7ZA 1VG8A 1UJBA 2IXDA 2Q3DA 3VYVA 4A8PA 4Q3NA 1QPBA 3Q6IA 2X9QA 5L6MB 1OFGA 1DQRA 4DLNA 1NURA 3G17A 4R1MA 3OFSA 2GLTA 5LD2C 2BN4A 2PDAA 1G4HA 3LCRA 1UBKS 3AEKA 4J6FA 3UICA 2IOYA 1RLIA 2I80A 2PJUA 3F5SA 2QTZA 2W7TA 2FH5B 3FYSA 3MXOA 4R05A 4X00A 4DNQA 4EEKA 3O8BA 1E0SA 5HIAA 1A9XB 4TTQA 4LI3X 1TYAE 1Q11A 1TGYA 2JIBA 4XM1A 2EERA 3W2EA 4KUEA 2Z57A 4ZYYA 3HXMA 1PTKA 3I2KA 1ID1A 1VBFA 4NECA 2IHVA 3GOQA 3OWXA 4D99A 4WNCA 1NHWA 1RBZA 1U5BB 2ZROA 3C0KA 3E22B 3HBFA 3KSDO 3QKRB 4PR3A 1L5LA 3EMKA 1LJ8A 1C9DB 1OD6A 4CMEC 5JCJD 5CCBA 4DA8A 2QMUA 5J2UF 3MJCA 4B2YA 3DMFA 3KTAA 4O6VA 4V0MA 3LX8A 1P7CA 3LY9A 4F4IA 4TQUS 4HRVA 4Q4CA 4PCLA 3ANSA 1JXQA 3F7NA 3FDXA 4O2AF 4PRYA 1N92A 4F1JA 3C5CA 3U09A 4YXWA 1OY1A 3EGOA 3TLEA 2H1HA 2OSVA 1M2OB 2QR3A 3QFFA 3T1OA 3TX6A 1UAYA 3WQBA 4B7ZA 2Y1GA 2XZOA 1JQLB 4MUNA 4EG5A 2DUWA 1H05A 2IZOA 3RIYA 3JZMA 1MAAA 1OXTA 3W8DA 1IK4A 3B89A 2H06A 4GOKA 1QDUA 2JI4A 1USUA 2QTNA 1R0CA 1W1IA 2XH8A 2I2WA 4R0MA 5JNRA 2CDRA 3MCWA 4FFLA 3A1FA 4GPIB 4K9QA 1SKQA 4EY8A 3DEYX 1AY0A 1DPFA 4GQIA 1O6ZA 1XFAA 2WAXA 2Q28A 3ACBA 3BXXA 1TZKA 3W5CA 1WD5A 4L9AA 1M5TA 1Z2DA 2OG1A 3C97A 2JAQA 5FL3A 3R3SA 3AG6A 4E1VA 5J3JA 2X0EA 4CQMB 2PNFA 3P20A 2PFKA 1J2UA 4GGOA 1VGVA 3B5JA 1RFGE 2TMGA 4HWSA 1JBEA 1CHDA 1XA4A 1FPMA 4F2PA 3DLBA 3VTKA 4QGHA 1DMSA 2DTXA 2EWWA 1ULUA 5E95A 5HF8A 2DM6A 2ODWA 3VKFA 1JW9B 4N9QA 2JLXA 3IGFA 1N9GA 6CHYA 4PU0A 1NTOA 4DRXB 1RDFA 1IBLB 4CRWB 3B1KA 1W0CA 3N2EA 3E61A 1J00A 3G88A 1MCZA 2FX3A 4HH4A 4QU5A 4B33A 2PRKA 1CB7A 3UF0A 3IP5A 3PQFA 5FLEX 3OCJA 2Q4BA 1OBCA 3UJ3X 4WFQA 2IJGX 5IVKA 3ZY2A 1LK5A 2IYTA 3BXHA 4OGFA 4P5DA 3N0VA 2HBZA 2JF0A 1BC5A 3KR9A 4JR2A 3U7EB 1E2JA 2QGNA 1QX3A 1FC0A 2BZGA 5HF5A 4I9FA 1X7WA 4IHJB 4K9KA 5FEMA 1CUUA 4Y2TA 4FGJA 3AB7A 1GQRA 2FWJA 4OXXA 2UXCB 1MB9A 1E32A 2HIMA 1XKXA 2IE8A 4LBYA 1DXHA 1FFGA 1Z73A 1HNNA 4EGAA 1ZMRA 1RZVA 2W71A 4CDNA 4REMA 5E4TA 4N40A 3TCNA 2CKDA 3H0CA 4PZEA 5B36A 1V4NA 1RQRA 4UEJA 3MBKA 1EX7A 3CLSC 1QGUB 1EG2A 3GZ4A 4FU0A 4G89A 1IHOA 2Y1DA 5AI9A 3O8OA 4ARSA 3IYLW 4MHTA 4AZTA 3GT0A 2GHTA 2QUBA 2RGBA 4QT4A 3R9IA 3T5CA 3KUXA 3SDSA 4YGXB 1SUFA 3BD7A 3JQ8A 2HW8A 1KO7A 1U65A 3ZTTA 4JDPA 3WC4A 3HYTA 2O2JA 5IW8A 1LLDA 2H1CA 3T12A 3OBIA 5SZKB 5B4TA 4UHCA 1KDPA 3BJMA 3DDCA 4IKOA 4PC1A 2Y2UA 3GFGA 3Q8KA 4DQ0A 1K98A 1EQUA 4M0UA 5ADWA 4HQ6A 3HEAA 3PXCX 1AKEA 2VLIA 3CR7A 4V0SA 5JANA 1KMNA 1T3HA 1STOA 4QDXA 4UNIA 4AQDA 2H18A 4B4VA 5K0JA 1BHQ1 2VK4A 3H5RA 3HU2A 1USGA 4JMPA 3N2IA 2EX1A 4KO2S 5TXGA 4AI6A 1HEYA 4LI0A 1DWQA 5M3BA 2RAVA 3RIMA 4EFLA 2V7EA 1RI4A 3FF4A 3K05A 1UWLA 5DHAA 4YP1A 1L4UA 2BUBA 4MS3B 1MEOA 4MVJH 5H4GA 3L7IA 2FEPA 2ZR8A 1EXNA 5DTMA 1SU7A 2O8FA 4X7RA 4CLOB 2WHQA 3T9BA 3C2QA 3WIEA 3ZCXA 2D4AA 3P1JA 1XDGA 3V1YA 4ND3A 1OZ0A 5AKXA 1LI5A 3FCXA 4NYMQ 3QVLA 3X2FA 1FJGB 4OI4A 4WBNF 3HJTA 1DRVA 4YCCA 1UM9B 3AHDA 1YRBA 2D2XA 4IILA 3R3JA 1MRNA 3KRTA 5HA5A 5JY1A 2ZCJA 2P78A 3AUSA 5AKKA 5AW5A 4QUKA 3RASA 4N01A 4MVXA 2D74A 2CCJA 3QLVC 4P36A 3GRKA 3UIEA 1E3WB 1U28A 2RE8A 1IXYA 2CV0A 3E48A 3STWA 4LFAB 3EPHA 2E48A 4RTJA 3BDVA 3I5YA 2C5EA 3IHWA 1EFKA 2E55A 4KH1A 2V7XA 3D64A 3GJ3A 4IW3B 5J5VA 5JWOA 3CZRA 3FDZA 4CKBB 1M2FA 3K0AB 2ERCA 1EFLA 1M1NB 1SR8A 4CHGA 2O0KA 2HI0A 4XKJA 1DUVG 2ZYSA 3SZRA 3P4UA 2G6TA 4OY3A 5CJPA 1TZCA 5HKLA 3VR5D 1ZRHA 4JQOA 1I4OA 1WQ4A 1IXSB 2WBLC 3OEHD 1BQEA 1CJKC 4H7FA 1T4MA 5I9SA 3ZCRA 2YVUA 5K3FA 1K7CA 3PHIA 3DV9A 4DAOA 3MT9A 4F9TA 4ILEA 4XR9A 2WWRA 4FIDA 2P9JA 1T1JA 5ENDA 1YULA 3ZK7A 3OZCA 1LFDB 3CFYA 5CT6A 4B82A 2WWVD 5T6MA 4YUWA 1Q7EA 5ALLA 3EPJA 2OZLA 2PAAA 1W2HA 3F7MA 4JP2A 1RJEA 1GYPA 4NAVA 5BV1A 5C8ZA 1I13A 2JS7A 5AWFC 3D5QA 1A82A 1A9SA 3CEAA 3E5NA 3HO8A 3JU3A 2KWIA 1NAHA 1F8FA 1PW5A 4I4TB 2MCFA 4ALMA 4AJEA 3QG1A 1PK7A 4DDMA 2XKAA 3JQFC 3DA8A 4ZMRA 2FJUA 1I2DA 5FYQA 1XK6A 2I87A 1X1EA 4MUKA 4Q7KA 2RG1A 3IUEA 1GNTA 4U9IS 1IWPB 2X8JB 4ADSG 2GBPA 3IPRA 1AJEA 2P4EA 4LXGA 4TN5A 3ITEA 4EVQA 4RTSA 3DLPX 1UC8A 1EH5A 3D6FA 3L9WA 2EBWA 2R68A 3R77A 3M1LA 1LBTA 1AGNA 1RRVA 2FEAA 5HMMA 4AS1A 4ZOQI 1W44A 3K5WA 3Q10A 4XGQA 2H4JA 2XF2A 3ZK8A 5LMNB 2J0SA 4R83A 1DO2A 2OLKA 2P40A 5IBRA 2A8YA 3MJHA 4KLAA 4V0LA 3WGIA 4AP6A 1VECA 1MC8A 3AUUA 1BWRA 3EY4A 3TSWA 3TW8A 1R74A 1N36B 3TLAA 4MQ5A 3OI7A 4GMGA 4DCPA 1AUVA 3ZWVA 2WU1A 4J8PA 2DSTA 1M10A 1G8AA 3IOBA 4Y9UA 4AD8A 2GOYA 5AHWA 1CY8A 4CKWA 2YOFA 3A9SA 1KI6B 2RC6A 5HQTA 1YGPA 1AV6A 4UASA 1U31A 3BIWA 4OYYA 3QVOA 3TLGA 4EVIA 3JQPA 5TPZD 2OM6A 3DXZA 4DSTA 4KXYA 1UXKA 2ZIUB 4KZPA 1UZAA 4AYWA 2ZI6A 4CJXA 4YUZA 1OIWA 2ACWA 4C7MA 1TYCA 1EG7A 1SN7A 2BM0A 4M60A 3DMTC 4Y1GA 5I9BA 3S2EA 1UBTS 1LQTA 2ZFUA 3MTAA 5CA0F 1YS4A 2BE7A 5CB8A 1ECGA 2NT4A 4HDRA 3G8BA 2FFAA 3PXAA 1ZGZA 4XJVA 4DLKA 4F6RA 4BWYA 4JB0A 4GRIA 1I5RA 2FX5A 4LPKA 2HLNA 5DP1A 5KYWB 1K1EA 3ZVMA 1G66A 2EZ8A 2XCQA 3WIVA 4DC1A 5INTA 1U2RA 5ESRA 4M88A 1JFRA 1KR2A 1M0TA 3MAAC 3EG9B 4R1SA 2W4MA 3KAKA 1BKYA 4HUQA 2YHIA 2FPUA 3IV7A 4UCQA 2H17A 3PT9A 4G0WA 1N8KA 3FRIA 3SZGA 3QPUA 1RU3A 1CUYA 4X24A 4Z0PA 2HT6A 1OWPA 2X9GA 3SR0A 2OHXA 3RU2A 2QMOA 3GUZA 5H3HA 1WNFA 2D1TA 2G9QA 3FDJA 1L1FA 4CGZA 1W0JA 2IQ5A 4L9RA 1ZGJA 1YQGA 2HHJA 2C2GA 4B6OA 1NE7A 2DGDA 4BWVA 1HYEA 1Z0DA 1ZMTA 5K6AC 1GRRA 3CE9A 1Q74A 3O3MB 4XX1A 2PZGA 1Y4ZA 1WB9A 2BF4A 3K32A 2UXBB 1V48A 3UT5A 5HRCA 5JASA 4PG7A 4QXAA 4MKRA 4QASA 5KVQA 4M4SA 4L95C 1T5LA 3TTXA 3AR8A 4W5RA 1N75A 1EB9A 1SXJA 4DLLA 4EH1A 2V7WA 4OHFA 1I9GA 3IEUA 3WOVA 1FFWA 3BWXA 2F43A 3A2KA 2X3UA 4MDEA 4UNNA 1XCBA 2DFVA 2W2PA 3RSHA 2EKZA 2ZBVA 4G8JA 1ZA2A 3GFQA 3PPYA 5FOWA 1VZ3A 3FAZA 1PYDA 5KTNA 3FGOA 2H1RA 4J43A 2BOVA 5KX5F 3IAEA 4KYUA 1EKXA 1O6GA 4GXQA 4N0DA 1EUZA 3E9QA 4NENB 2OO5A 1ZK2A 3N7UA 1U9IC 3SF0A 3RQIA 4IOMA 4ND6A 2ETVA 1TU4A 2H6EA 3QVUA 2VJBA 3HN7A 5CDFA 4QM6A 4KX3A 2YV3A 2IP2A 4JA2A 3JPWA 2ZYDA 1J22A 5AFSA 3FY4A 3PTZA 1GLNA 4PX3A 1QZTA 1KDVA 5JNSA 4NU5A 4OM8A 1TIBA 3EOBI 3BMCA 3CEPB 3KELA 4OGGA 2B7LA 4O5AA 4YUXA 3UCFA 1YVRA 1AS2A 1DV2A 3RREA 1Z4MA 4D6PA 1SEVA 4BMYA 5JCZA 3F90A 5M04A 3R0VA 3ZU4A 5BVHB 2PUHA 3MGBA 2XT6A 1DWOA 1GZ5A 1KJ9A 2AFIE 2X0DA 4DT1B 3OT4A 2QM0A 2FSVA 4IDDA 4Q93A 4ZDWA 1QP8A 2VH2A 3HKEB 4BGEA 1RRMA 1P4AA 3ZVLA 1W29A 4JQSA 4REQB 1CDZA 1RYBA 1UC5B 3GJRA 4MQLA 3O0TA 2C00A 1XALA 2EZUA 3DMDA 3FR8A 1NF3A 3TXXA 3ZDYB 3LD9A 3EIXA 2JLAA 1M7GA 3P0FA 2DWUA 4I5DA 3GGCA 4WJZA 1AVTA 2IA5A 4DLPA 4FDLA 4NV3A 5CITA 1Q0LA 4DN6A 3D02A 2IZ1A 4YJ2A 3DNFA 5C8DA 2J8ZA 1Z47A 3A05A 1Q1NA 3N59A 5HM6A 3RNOA 1TUEA 1IUNA 1IY1A 2CNBA 3V8QA 1WPRA 4N6NA 4A10A 1AURA 4YT5A 3WRVA 2WHPB 2IV3A 2HH9A 1JKJA 4X3PA 1MF7A 3DP7A 3KPYA 1PD1A 4IAOA 3WZMA 3NJ4A 1Y3AA 1S2MA 4KWTA 4WASA 2X9LA 2IEIA 3OE1A 4DFDA 3FGZA 4M9XA 1E8MA 1L7PA 1SEPA 4JUFA 4DQDA 4HN9A 2ZWPA 5GP1A 1BX1A 1M76A 1XPUA 5AHRA 5CGQB 4BVHA 1H4SA 3LCCA 3HXKA 4R3NA 1WCWA 721PA 1I6MA 3QH4A 5DTIA 1L4EA 4H6XA 3SVTA 2CY0A 4QEZA 2ZI9A 3EA0A 2GH1A 4IIEA 5LBTA 2Q0SA 4HB2A 8LDHA 1NWHA 1L8LA 1N2CA 4BTVA 1QO0D 3BXGA 3R3ZA 4P86A 1ELOA 1H1LB 3OZDA 4KPFC 2GM9A 2WIJA 2QEQA 3AF2A 3OESA 3NEJA 4I5EA 2HMUA 4IV8A 3BL8A 2RG7A 3M89A 3NEYA 3GW8A 4RDHA 2P2DA 4CIBA 1R0SA 2JEYA 2OFFA 1I1NA 1W4BA 1FRFS 4QBGB 2I3AA 5K4AA 2VS1A 4EMTA 2IHNA 9MHTA 5B3AA 9ABPA 2H16A 3F73A 1JDBC 4ZXPA 5G1NA 5LIRA 4NNOA 1XZQA 4RACA 2D5BA 1NT2A 4TMFA 5T8KC 1OYVA 2GQ0A 2WD8A 3WJ2A 1ZQ9A 2Q21A 3C5HA 4EJ6A 4E2XA 4GOJA 1SVMA 4H7PA 3QPWA 3HBLA 5DEIA 2DUJA 3EMBA 3EGDB 5DNYB 1Z17A 3LBIA 3FPGA 1VBMA 4D56A 3EPLA 4TLBA 2J3MA 3ZU5A 1JH9A 1T1SA 2V8OA 4RPCA 2NSDA 5JAUA 1JIUA 1QR2A 3AM4A 1A7AA 3DT6A 1FTQA 3VO9A 1FFXB 5JG7A 5JVDB 2VDRB 4QO7A 3QLUC 3KJFA 1N1DA 3MHPA 3GLUA 2SECE 2CLLB 1EM8B 4EYEA 1A04A 3WGLA 1NI5A 2H0AA 2NTJA 4LX0A 4UTXA 4RLSA 1JR2A 2QVXX 4LFCB 1W19A 2OXEA 1W0JD 2LR0A 3V4ZA 4JITA 1L2TA 1PWXA 2ZIXB 1U63A 1CR0A 2PWBA 3G5TA 2CDNA 4E51A 1U7OA 2B4QA 1L7VC 1L8AA 1NKVA 1I36A 3L1UA 1FOEB 2QTVB 2F9MA 4PTLA 1E9AA 3NU1A 3GLIB 3R9XB 1LDNA 1KKUA 3LG2A 4XB1A 5IAAA 5K9ZA 2ZIZA 3AF6A 5HW0A 2I6FA 1E3TA 5DP2A 2VXCA 3D4LA 3TMYA 1UWCA 3PI6A 4DMRA 2AKAB 3IIJA 3PFFA 4B3HA 4D43A 2QE7A 3DGEC 2VHTA 2IV7A 4KOEC 2V5AA 2V03A 1B6RA 3A1CA 3CKYA 1FNDA 2J07A 4B6QA 3C3EA 4IXNA 4FEEA 2GKGA 5EIAA 3ROKA 1DGQA 2XWPA 4JC4A 4EEXA 3QWAA 2XY4A 4KXMA 3A4LA 4AY5A 2PH5A 3CRRA 3VOSA 4H59A 3I12A 4ER7A 4F4DA 3E6AA 1ORTA 2AF3C 4XUCA 2CGEA 5LC1A 1QRRA 3WWYA 2DTEA 2GXUA 1M8JA 2VJOA 5DT9A 3TGWA 1VIMA 3Q5DA 3ETNA 4OYHA 4U9HS 1E96A 2G63A 2J9XB 2W4IA 3PC3A 3S7TA 1X15A 2V0CA 2JI8A 1M7BA 4MROA 1KF0A 5J1TB 1FTSA 1M67A 2ZS9A 3WGYA 2GLXA 1VIAA 4YWHA 1IM2A 3BXOA 3QUBA 2BFNA 3VA7A 3K3PA 4RADA 4G5OA 4HLUA 3STTA 4DF3A 8MHTA 2IVFA 4H9GA 3UEOA 3GJSA 4RKWA 4NH0A 4C5AA 5G4KB 1J42A 5T4BA 3S2ZA 3HO1A 3AKCA 2H8KA 2DBZA 4I55A 4LQ4A 4Q1FA 4CM7A 3AOGA 1RWVA 1HI9A 3TDMA 2F4VB 3KPJA 1MOZA 1IJKA 5DM60 1YRHA 1IK6A 4JLKA 1N78A 1PW7A 1LK7A 1IB6A 2NYUA 1R6AA 1VRVA 5G0WA 3B1WA 2AI2A 3QFHA 3B1JA 3WL4A 1X1TA 2YMLA 3ZGYA 2R1ZA 3H05A 1GKLA 1P1FA 1QHXA 4F8EA 3LM8A 4A0RA 2G67A 3RU7A 3UAXA 2Q3FA 1OLUA 1BFDA 3NXSA 4O08A 2WU3A 1I0IA 4P3PA 4UDXX 1PEYA 3NHYA 4LCJA 1ENZA 2CE7A 4F6CA 1KEUA 4L6CA 4FS3A 3TQSA 4BKUA 5SICE 3F0TA 1N5LA 3GLGE 3DDUA 4JJAA 1VL2A 3WV4A 2QR5A 2EZ9A 3WSVA 1DL5A 2P62A 4LSWA 2HIGA 3QXJA 4MUJA 1SD1A 1YS6A 1Z0ZA 4PW0A 3WBFA 4B6FA 1K89A 2JBAA 4YRAA 2BKXA 5HOEA 1IFXA 1C3OA 1DS6A 5KYXB 4P31A 4UBNA 3LCUA 5CVCA 3AWDA 3NHSA 1Q50A 3HKCB 3KXDA 4OHOA 5AW3A 3COJA 4DREA 5ADHA 2OQ2A 3ZZMA 1P1JA 2Q9UA 2C5SA 5EIXA 3HZRA 1LBSA 1P4SA 3IOYA 4XH9B 1X3SA 3Q7SA 2HU2A 1RXUA 4JI6B 3CH6A 5FWXB 4O2BB 1VCHA 3AIOA 4DQLA 5H68A 4Z6KA 3RUHA 3MM4A 2P0AA 4RZQA 4D97A 4TV9F 1M2NA 1NP6A 4L22A 4QJ4A 4TMVA 1PQPA 2GF0A 3SPXA 1GQ2A 1L4KA 3WO0A 4CN9A 1GPJA 5ULLA 4B83A 4MR7B 1BD3A 1HWYA 2ORYA 3DTVA 1B8VA 1QGZA 2MMGA 2VHZA 3KKKA 4ZZ2A 5B53A 4OSOA 4EUFA 1N3LA 1VPEA 2RHCA 3QKWA 5FQOA 3SQOA 3TO5A 3ANMA 4XIFA 2XYHA 1H6BA 3ZWOA 5F35A 1OC2A 1SU6A 4K9SA 1CXZA 5DLQC 5DSXA 3TMAA 3V1LA 4LXIA 3PFWO 2CHUA 4FEAA 1TLTA 2EF1A 3MNFA 5DM70 3FWHA 3OZFA 1AQ6A 1OKKA 4KR3A 2DQSA 1ORDA 3EYAA 5K51A 3STUA 3ZWKA 3NVKI 1QTRA 2WSBA 2WWGA 1NNI1 4Q12A 3ZBQA 3OUTA 4UTPA 4TQ9A 4IKEA 5TDHA 1MJHA 2B69A 3QEAZ 2PX3A 4PTZA 4OXRA 4DJJA 2J59A 1R9JA 3FPBA 3MOIA 4BAGA 1WXXA 4XSGA 4KQJA 2CFOA 4K9DA 3ZPXA 2HX1A 5BSUA 1Y5RA 1OWMA 4X63A 4YTEA 2ATEA 4YCNA 4RD4A 3HCAA 1W4RA 3KOZA 4DSAA 1E92A 2CCGA 1E1CA 5EJMA 5CB4A 4TV8B 4N5DA 1C4XA 1QHSA 2NUTA 3WSTA 4AZSA 3CNQS 4FKZA 1RLOA 1A5BB 4U9UA 3PENA 4RK7A 3N8KA 1PFKA 4LMBA 3OD1A 2DWPA 2BTQB 1HV8A 4L4XA 2BEKA 2A9JA 4AQYB 3PKJA 2AK2A 2VQEB 1LLQA 4WHMA 2ZE6A 2C2YA 4A27A 2XVAA 1U3TA 2W98A 1E1MA 2PSHA 5E7IA 2VZEA 3EC2A 2D0OB 5TE9A 1MKYA 1CUSA 3WKAA 5BUQA 2O4CA 1TEVA 1X1SA 3G2OA 3M9XA 4FR2A 1ZHFA 4WSOA 4RTLA 3DEAA 2GM4A 1B23P 4J0IA 1XXHB 3NBZC 5KDOA 1IM8A 1JDTA 3VGPA 1W0KD 4C4TA 1R5OA 2GT1A 2J3LA 3LDUA 4FYIA 3HVKA 3WB0A 5LJLA 4FD3A 4ZEVA 2ZRMA 1GIAA 3HJUA 5JD4A 3HU5A 2ZWAA 3BJZA 2FGJA 3JVIA 4J0CA 2BM9A 2OCLA 1ZICA 1L5ZA 1M33A 1MDBA 1NMQA 4XVUA 1G8FA 4CEHA 3QX3A 1LDMA 3MTGA 1V3UA 3PDCA 2YWFA 4BPBA 3L8ZA 4L4RA 2QENA 4YAKA 1CE8B 1W1WA 4QX6A 4GMHA 1VLMA 2CXTA 1KI4A 4TUYA 3IR6A 4ND2A 1GRNA 3DEFA 4JD5A 3WGZA 2H1OA 3DMYA 5A4KA 4L72A 4PS0A 1Q19A 4LSMA 2IBSA 4N3CA 2V7PA 3IUJA 1TNDA 4C7BA 4HNHA 3HDVA 2XR1A 1HUQA 4QGAA 4WCFA 1NYRA 5H3LA 2J9RA 4BGVA 3P52A 1MIOB 2P6OA 3JWJA 2C8JA 1L7XA 4MARA 4L85A 2ZEJA 2XVYA 1WXDA 3VHLB 3L07A 4BFYA 1I7DA 1ZHOA 4DA4A 5ENZA 3S3TA 5EFZA 3WGKA 4EY5A 3OZRA 1GZSA 1RLUA 2V7QD 3EQ7A 3N9IA 4P4NA 2HK7A 1F17A 4Y9TA 4DIBA 4DARA 3MLAA 3U7HB 3T9DA 5CJ2A 3U4MA 1FB5A 1YQXA 3OHSX 2CC2A 4F9FA 3ZDRA 1DC5A 3FOEC 3FSRA 2GDJA 1L0BA 1RAAA 3OA0A 4LXXA 3I0NA 1L4LA 4FNAA 4MIEA 1POWA 1T0HB 3FMGA 1OFVA 1SVNA 1CNMA 1T5BA 2VSFA 3OLXA 4P80A 4YNBA 5LZ5A 3ZX4A 1DAIA 1OYWA 2GHIA 1RE0A 1LJUA 2QSUA 4OEHA 1W59A 1MQAA 3RHZA 2WWIA 1X39A 3HN6A 1PG0A 3THRA 2W2VA 4AKIA 1C3EA 1QG2A 2BGNA 1FTWA 2O0HA 2E6KA 3BULA 4J0KA 3WQSB 4KPEC 5TMPA 4DR2B 2C54A 3EF1A 2BRUA 2QLNA 3GO4A 3GA5A 1QYIA 3K8QA 1G9SA 2D2FA 4X6XA 4EW1A 2KE5A 4ZDKA 2IH5A 2ZR7A 4GUDA 1IXKA 3WAJA 5IVHA 2FPLA 3F3YA 4CDRA 4KUGA 4XFJA 4LMRA 4PRLA 3RVLA 2WM2A 3OQPA 1CJTC 1L4YA 2A9VA 1BMDA 1W52X 2OGTA 4OUDB 5AM3A 3KXPA 3EHDA 4D92A 1P7PA 3JXEA 1WS6A 1EVLA 3C6BA 3P0JA 3OZXA 5L4NA 1LWNA 5B7QA 3G2LA 4ZALA 3ZQKA 4D8XA 1X1DA 4PGFA 3IAS1 2O59A 1M6EX 1SBTA 1E1YA 1JRLA 1ICEA 2DUNA 1U7DA 4MQMA 2C95A 2D6FA 2HLDD 4DXDA 2R62A 1JE1A 2V58A 1REQB 1VMIA 3FWKA 3KT0A 3FWPA 4DCNA 1EAYA 2JKYA 4K0KB 4IDFA 4RSGA 5B6JA 3C3PA 1H2HA 5G53C 3Q7IA 1WV1A 3W2GA 4DUGA 2XZDA 2VHCA 4M6WA 2QN1A 4O0LA 1U9JA 3HACA 5LLSA 5JMPA 4F4FA 1MT3A 2IYVA 2CFRA 2PL3A 2ZAMA 5FL7D 4MVJA 1K08A 1O9BA 2HSEA 5CRIA 4QXOA 4WBXC 3SS8A 4F91B 3GK3A 1H5UA 2NSJA 2Y05A 2ZPAA 2Y1CA 3EAGA 3M1IA 4MDYA 2FA9A 2PS1A 5DYGA 5L3VA 3IVAA 4CEJB 4W5NA 1PWYE 5FUXA 2P5TB 4A73A 3RV4A 2RHDA 3UMSA 3RFTA 4UXHA 3ZDAA 3G2KA 3QKTA 5EPOA 4BNJA 3NP9A 1F8YA 3HUEA 4R1LA 5BO5A 3R6TA 1KDZA 5SY4A 2ZJ5A 3C3CA 4ZP1A 4ZO7A 4I1UA 1TYDE 2P6RA 1A8SA 3A1EA 2J5QA 4WV3A 5K5EA 1NUAA 3DDSA 3T7IA 1L5MA 4D0SA 1HRDA 1OLXA 3K72B 2JLCA 2Z0MA 3GQVA 4YRQA 3P71T 3WXBA 2ZBUA 4BAZA 4NYIR 4EW3A 4RZ3A 2IHUA 1M34E 5HFJA 5HUQA 5KZMB 5H1YA 3HB7A 4Y6SA 1PEAA 3FTQA 2NX2A 3QTTA 1BWSA 2JATA 2OM2A 1HURA 1HSOA 1X86B 3Q2OA 1OGYA 2ZJZA 3FNEA 3SHVA 4BKOA 4Z7QB 2EATA 3VJKA 1T36A 5IHXA 2EFDB 3ZGOA 3JWHA 1P31A 2ZE8A 1FUYB 3PPVA 4WZAA 3AO0B 3UMFA 4WOCA 2QN3A 4WOPA 1KSFX 3LO8A 1T9CA 1A8PA 1BXRA 2C7VA 2G04A 2WU8A 3ESBA 5DK4A 1T2AA 2IL1A 4MB2A 2CNLA 4CODB 5EE3A 4ZCLA 2IKQA 3O8DA 2YC4C 1O77A 3JQGA 5FCDA 5HIIA 5I6DA 1HSZA 2A86A 4XTRA 4KIWA 5JCPA 4Z3OA 1ZYUA 8OHMA 4NATA