2XYPA

Caspase-3:cas26049945
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CASPASE-3 SUBUNIT P17
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xypA00
1RWNA 5IAJA 1RWMA 3H11A 3RJMA 1M72A 3KJQA 4QUAA 4QULA 2C2KA 1I4OA 3PD1A 3P45A 3IBCA 4N6OA 1QDUA 5LU9A 2CJYA 2H65A 3PD0A 4EHFA 1KMCA 4QUHA 3S70A 4QUBA 4HQRA 2HBYA 3V4LA 1CVRA 4DCJA 4D3XA 1I4EB 4QU9A 2DKOA 1SC4A 5IAKA 4N6GA 5IAEA 2XZTA 4QU5A 5LU8A 1SHJA 2Y0BA 1RWOA 3E4CA 5IC6A 3UOAB 3D6MA 3H1PA 1RWXA 4QUGA 2P2CA 1NMQA 2CNLA 4N7MA 4ZVQA 3GJRA 3V6LA 3H13A 2FP3A 2HBQA 4QU0A 4NOMA 5IARA 4QUIA 2C2MA 1GQFA 4D3ZA 2CNKA 2XYHA 5IASA 1RHJA 2CDRA 3K7EA 4N6NA 2QLJA 4NBLA 1F1JA 4AWAA 1NMSA 3R6GA 3V55A 4AWBA 4DCPA 1IBCA 1RHUA 1K86A 4I1RA 1RHKA 2WDPA 3NKFA 3PCXA 1BMQA 4FGUA 4I1PA 4PRZA 2C2OA 2FQQA 2K7ZA 4D3YA 1RHMA 2HBRA 4NBKA 3DEHA 3QNWA 5IC4A 2XYGA 4JQYA 4M9RA 2CJXA 3BIJA 4ZVTA 1I51A 1RHQA 4QUDA 5LUBA 4JJ8A 2CNNA 4FEAA 3P4UA 5LUAA 2HBZA 3D6HA 2H51A 2CNOA 1GFWA 3H11B 3KJNA 4LSZA 4QU8A 1RWWA 2Y1LA 4HVAA 4ZVOA 4N5DA 2QL9A 4PRYA 3GJQA 4IYRA 4JQZA 3R5KA 2H5JA 3SIPA 3EDQA 3KJFA 4NOJA 4QUEA 5IABA 5JFTA 1CP3A 2C2ZA 3ITNA 4JR0A 4ZVUA 4EHDA 2QL7A 1NMEA 5I9BA 3R7SA 4ZVPA 3NR2A 1SHLA 5K20A 4DCOA 4EHHA 3S8EA 1SC3A 5IBCA 1RWKA 1PAUA 2NN3C 1F9EA 2H5IA 2XYPA 4JR1A 5H0IA 5I9TA 3R7NA 4EJFA 4NOLA 4FDLA 4QTYA 2C1EA 4HQ0A 4QTXA 5IAGA 3GJTA 3SIRA 5IBPA 4NOKA 2J33A 1ICEA 5IBRA 2FUNB 2J32A 4IEFB 2QLBA 4JR2A 4EHKA 1NW9B 4JB8A 3V3KA 2H48A 3NS7A 2H54A 1RWVA 2QLFA 3DEKA 3R6LA 4EHNA 4FXOA 2XZDA 3UO8B 1RWPA 4N7JA 4ZVSA 4ZVRA 3R5JA 4JJ7A 3IBFA 1RHRA 2H4WA 4EHAA 4NBNA 3H0EA 3EDRA 3V6MA 3DEIA 1I3OA 5IANA 3D6FA 1QTNA 4QUJA 1K88A 2J31A 2J30A 3V4OA 1PYOA 3OD5A 3R7BA 1RE1A 3DEJA 4PS1A 2H4YA 2AR9A 4EHLA 1SC1A 4PS0A 4AW9A 4JJEA 2QL5A 1JXQA 1QX3A 3GJSA
chains in the Genus database with same CATH superfamily
1CDEA 1R27A 4ER0A 3HSKA 3DZBA 5AHRA 2A9OA 2DPYA 1VHTA 3W2TA 1AS0A 1DIGA 1R5NA 4NAHA 5EKDA 3Q3VA 3PG5A 4B82A 1GZ7A 2DUJA 1JIUA 4QXRA 1Q12A 1SQ5A 4NIMA 4ZOLA 5CDFA 1IYZA 4GI5A 3RDPA 3WWCA 4GUDA 5ALNA 4X84A 1YZYA 4YUVA 4XUEA 3DZGA 1CJKC 3BRWD 3TNLA 3U48A 1Z2PX 2A0FA 4CTNA 2OO7A 1OX4B 5FFNA 2ODQA 3F7MA 4ESOA 2JIBA 1IOLA 1T9KA 3EUAA 5KC8A 1Z4OA 3GA5A 1NMQA 4URHA 2GWRA 3O91A 2IVZA 6GPBA 4DCTA 4WK6A 3H13A 3CZPA 4B6SA 4KGZA 1E4YA 2FN8A 4MAAA 3B70A 1KVTA 1Z33A 1F9AA 3FFBA 4M6WB 3Q3GE 1T5IA 3U40A 1PEYA 3ETDA 1KJWA 2JHGA 3NIDB 1ZK2A 3JQRA 5AKIA 5KQGA 1WY5A 2GMWA 4A1OA 4YRKA 5C52B 1NULA 1X13A 1R8QA 3QLVA 2HR1A 4NJMA 5B37A 3SOZA 1GCAA 1MVOA 2O5RA 4TV8A 3ZU3A 5ARBA 1A9PA 2UYOA 2VPZA 1RHKA 3FCYA 3HKCB 3NKFA 4WKCA 4HPXB 1HORA 1S89A 1VJ5A 1S3GA 3L5KA 5EHNA 3G3EA 2G09A 2I6TA 3NRJA 1XALA 2GFIA 1VLHA 1NXVA 1VKZA 4RACA 4LYGA 2Q3BA 4GM1A 3UW1A 1GKLA 3CRW1 3HCWA 1FS6A 5DNDA 4Z51A 2ZSJA 4ZOAA 1E0DA 1KQNA 2DBZA 3OA2A 4H59A 5DLPA 3FVRA 4BN4A 2VTKA 2G6TA 3HJNA 3S99A 4WV3A 1ZMBA 4CLOB 1Z39A 3LECA 1C9NA 2ACVA 4LSZA 3B1YA 4OF4A 4WRRA 4YMSA 1CIVA 1II0A 1RXVA 3K0CA 1FSGA 4IDFA 3BMNA 5CDUA 2FJ0A 2EOAA 2C7OA 1M6EX 2H4FA 4D82A 3IXQA 3ZJYA 3ZHRA 3HJCA 3SE7A 1T9ZA 5BQ3A 2NN3C 1GL9B 1UZLA 1ZO8A 4N4AA 5FULA 3KUUA 2WKRA 1E0AA 1RPAA 2Y27A 5ALIA 4FCWA 4QTUB 3SZMA 1YKSA 2REBA 4YPVA 4KR6A 2EHJA 2G5PA 2VJPA 3GLIA 5AT1A 1NC3A 2DJIA 3E70C 4FFRA 2QLBA 1PFUA 4GMXA 3CY6A 1PS9A 4PONA 3RHZA 4KGDA 3V4VB 4JLWA 1OR8A 4NDAA 3A9TA 3PUXA 1F12A 1RAAA 2QPAA 4FFDA 3WGTA 5E0OA 3LKDA 5E6RB 1DHRA 1HT3A 1EDEA 1RAEA 3X0DA 1JEQA 1KDTA 5DGXA 5FKJA 4BMOB 2NZVG 4FB5A 3DD1A 4DJEC 3VX3A 1KU6A 2BEWB 3CZRA 3MGCA 5EMLA 1UBTS 1ZD1A 2XMSA 1HLGA 4JELA 2RAVA 2EV9A 3F2VA 4CM4B 3G9XA 1AT1A 1KMMA 1G21A 1X39A 2ZWAA 5DNWA 5FLYA 2PX8A 4HDKB 4URUR 2R65A 2R00C 3RSZA 2DFVA 3FUTA 4HGQA 2WYHA 3L40A 3BD6A 1COZA 1DZIA 2WUVA 5JAIA 1FX0B 4XASA 2A1UA 3IVXA 1U2QA 3A1TA 1XJCA 1UKAA 4G5FA 3JQPA 1JB9A 5CW1A 5DXJA 5GONA 4Q3LA 1EUZA 2EZ4A 2GGSA 3DGFC 1H1TA 3MW8A 1FUKA 4GL4A 4N8DA 3LPDA 1JQ3A 1X7DA 1PJ4A 5FEMA 4ENQA 1S8NA 1CV2A 4FT2A 4DDTA 1GNRA 3KEMA 4C07A 3EDCA 4EF6A 4EK9A 1ZA2A 2VJMB 4MW2A 1Z7WA 5BSUA 2GAAA 4BYGA 1VHJA 1PGQA 3Q7QA 5GV7A 2C83A 4ZDWA 2BRUA 2FGKA 2OE2A 4IOKA 4E21A 3AQIA 4NXNB 4G37A 1NRIA 1Y6QA 2AJBA 4CIWA 1L5HA 3RFUA 2ZK7A 5GJWC 3AT1A 5TX7A 2AI1A 3JQGA 4NF2A 4Y6PA 2JARA 1X3SA 4Z9FA 3LSTA 3C15C 3TLBA 3AYZB 4US1R 4ARSA 1HSOA 2IHJA 2R60A 3AFOA 3FM9A 1HDXA 2CMDA 4WNCA 4RY0A 4MW1A 3VHQA 1ID1A 4KREA 4NLLA 2FEXA 5CX4A 2MYUA 1A8HA 2IYOA 3C4JA 3EG9B 3A9UA 4LY9A 4DW8A 4EMBA 5HTOA 2XSZD 2YHUA 4NAUA 3TH5A 1JPVA 2P6MA 1KVUA 3GFGA 5KEIA 5AVJA 2C3UA 5E1MA 5B7GA 5K9ZA 2A0UA 2OBYA 1BMQA 1I3KA 1A4IA 1CHDA 2H4XA 3I72A 3C6YA 1L5RA 1KC1A 1ZIDA 3BE4A 2F67A 3L6DA 3QXGA 5HMLA 3BL5A 1UKYA 3ESRA 5KPDA 1PFVA 2QW8A 4FDVA 2HEIA 5JAUA 3SJBA 2C29D 3LGAA 4UFNA 2X58A 1ONNA 3E4DA 3T8YA 4QUDA 3FNHA 1OZGA 2H2HA 1C4WA 4GAEA 1E3SA 2XQIA 4EPRA 4YMWA 3GT7A 4WXMA 2KHZA 2VAPA 3A2MA 4DDUA 3WB1A 3P9QA 1ADCA 1WUKS 4X97A 1K6EA 3G9ZA 3VAZA 5KAMA 3W1WA 4O2BF 2QBYA 2W22A 4HH1A 3K53A 4QQRA 1V16A 5EIBD 4TL9A 3AP1A 4PZUA 5I9SA 3SX2A 3DCNA 3DUWA 4DGSA 5I4BA 1ECFA 1JR3A 1TF2A 3MGKA 1JTFA 3EGXB 2ONJA 3VTKA 4B43A 5LP6C 5EERA 3HR8A 4LRWA 3W8EA 4EJFA 2H1OA 4X8LA 1IOVA 2ZPUA 3CX7A 5HF6A 2Q27A 2WYOA 4D8XA 4TM7A 3OOHA 4F5EA 1FFEA 3FDXA 4HLUC 3KSBC 3BT7A 1XTRA 3L0BA 3NYQA 3UK2A 4MITA 4J91A 3X2SA 1RZVA 5LYJA 1H42A 3JD3A 4F3KA 3LCCA 3JQBA 1XELA 2PTHA 3E2MA 3W1VA 2PWYA 1PJCA 2IOQA 3EUEA 2DSTA 1IAVA 2C0CA 3KKNA 4RLSA 5F77A 1I33A 3L1JA 5KVQA 4FEGA 2OR3A 5A5DA 2KW5A 3KKZA 2I7TA 3K1JA 2M32A 4N5HX 3WMWA 1MFPA 4PX2A 5DYYA 4TLEA 4UNNA 4AURA 2YWXA 1KRWA 4WCFB 3WFZA 5CK5A 2PHZA 4CV1A 4OUDB 3GFRA 1E3QA 5C31A 1N34B 4C5CA 1ZJ6A 3H2JA 1SJ9A 2CHGA 2C58A 1D2HA 2ZBEA 4X90A 1NSFA 3EF3A 3IOMA 4CIBA 5L45A 3HCFA 4CHGA 4GR5A 3REGA 3R3WA 1GZ5A 3QY9A 3RF6A 2JFVA 3B7PA 2Y66A 1VPVA 2H5LA 5KYKA 1I5OA 1N2XA 2XMRA 3UH0A 1JDBC 3SVLA 3HWRA 3I05A 2J3HA 2H65A 1KMCA 1IY1A 5EMHA 2GPBA 3HHEA 1W35A 5BOSB 2RHCA 4DAEA 5EMNA 2RHOA 3CW8X 4N12A 3VJMA 3F73A 4HDMB 1XKQA 2OG1A 1T25A 4Z0HO 4J2HA 1HYGA 4YUXA 3VPCA 3NH9A 1MABA 3ZK7A 5BV7A 1XHLA 1ZEMA 1X1SA 2Z04A 3KD3A 5LA6F 1K5PA 3AH8A 4BNWA 1K5GA 3IGFA 3LK6A 3RE1A 4OGFA 4WZAA 3OJ0A 4KI7A 5MGNA 3BBPA 4AY5A 3U3RA 4NOMA 5DRTA 3V97A 2CC2A 3BFJA 3EPPA 1BEUB 1CY6A 2CVPA 3DXZA 3HDGA 3NFRA 3QKUA 4IIHA 4NZZA 2FEMA 1A8IA 4MR9B 2A14A 5EZ5A 2WWFA 4G1EB 5LYYA 3KT0A 1Q3KA 3U4CA 1ESZA 2X8WA 4N47A 3F9RA 1P5JA 2HRBA 3NM5A 4IQ0A 1YR2A 2DCUA 1JYSA 2Z3ZA 4Q01A 4M38A 4AX4A 5K3BA 4C3VA 3DT9A 3EEBA 3VOTA 2PZBA 1DTWA 2D4HA 2HA5A 3FWKA 3I1IA 3LCVB 1A5TA 3K2BA 4LHYA 1CR2A 4IFEA 4AP5A 3N0XA 3QUSA 1BMFD 1BN6A 4FYYA 1V43A 3GMIA 1N0HA 4YRNA 5ITVA 4YCCA 4L72A 1E4EA 1ONBA 2JVKA 5AO9A 1G21E 1JFFB 1JSLA 1K68A 4Q82A 2IY7A 3D7LA 3O1HB 4Q4LA 3I2YX 4K9SA 3AWIA 3TTVA 3WK6A 5DNAA 2DBRA 2ZSHA 3WICA 3ZX5A 1P6XA 3CUKA 2PCLA 4O2BA 5EESA 5HKLA 3OT1A 2ONYA 4XSHA 2BSAA 3TGPA 1N7HA 2C8LA 2RKOA 3AJAA 1FMFA 4M8LA 3KWMA 1ILWA 3BXPA 3TTUA 3W5JA 3S1AB 5WRFA 4HQKA 4AMGA 3S8EA 1SAYA 6LDHA 2C4NA 3GZTB 5KWVA 3DM9B 3ZW8A 4WASA 1TTTA 3BULA 4MR7A 2WHXA 1DSSG 1WXDA 1STOA 1OX5A 3A1NA 4KK3A 1AKNA 4L8LA 5B7PA 4M0FA 2QTVB 1V1MA 1TYDE 2O2GA 3K0BA 2I55A 5KCZA 4FNMA 4U00A 1QG0A 2R96A 3BSWA 2WVHA 1NUSA 1JSZA 1WPXA 2NO7A 3DO6A 4IEFB 1MQ8B 1R2QA 5E38A 2V7BA 1Z5NA 2ZQYA 1XMSA 4AUMA 3H84A 4CCYA 4E7PA 1GDTA 4HS9A 1AMNA 1Y0BA 3ESXA 1Z07A 2FSPA 1U02A 1C8VB 2NAPA 2IYPA 3O0DA 3DDHA 3F1LA 1F14A 5CFLA 2Q1WA 2CV0A 2BHLA 1X70A 1M10A 1CUXA 2E4VA 3QJGA 2HQSA 1E2HA 4URYR 1E7WA 2ZJ3A 1XLTC 1KI6B 1HUQA 2MMCA 3DBVO 3DEJA 3BCUA 4X91A 4LVOA 4Y9UA 1ADFA 1U4OA 3B2QA 1KI7A 4N9QA 2CUTA 4JSTA 5T3YA 1P0FA 3S5JA 2QROA 1YL5A 3N2EA 1NKTA 5KYTA 5F64A 2XBUA 4OFXA 5CFOA 1U5CA 2JIPA 5J2TA 2XUPA 3G1TA 4U2BA 4U7HA 2YS6A 3L0IB 1IBMB 3IELA 4JVMA 4E12A 1MDBA 2CGEA 2E37A 2QTBA 2YL2A 3BWYA 1JAIA 4Q3DA 2P91A 2O3QA 2DKOA 1PGOA 3TIIA 4P5DA 3HRIA 3I0MA 5ECGC 4MV7A 5EQTA 3E4CA 2R6ZA 2QUZA 1GQ2A 1SBQA 3EZYA 3NX4A 3OWXA 3PQ6A 4O3FA 4EW2A 1ZGBA 1AB5A 2OV8A 2YICA 1F0KA 2HCBA 3HMKA 2HA3A 3P8ZA 3R3JA 4LE1A 1SOWA 1SCUA 2ZZMA 2W2XA 2HCFA 3EZNA 3OQVA 3MM4A 2CYCA 4E03A 1E9VA 4MPTA 1UPXA 3VSBA 4D3ZA 4DNOA 2FPPB 4OV6B 1NF9A 1HURA 1TNDA 2G28A 4G89A 4N6NA 4ESEA 1ZM7A 3DTVA 2ZRCA 4M1SA 3V8NA 1EVKA 4F2GA 2SCUA 5LMCA 4B0OA 1I13A 2P9CA 3OLWA 3FR7A 3AUKA 4MS4B 1OJLA 3U26A 5JAOA 3RYCA 5C81A 2P6RA 3D8TA 3QXXA 3FCEA 1VJCA 1ZI9A 2MSEB 1EJ2A 2RAUA 1XJ5A 1XNQB 1MX1A 4G01B 3PB3A 3VR6D 3MT7A 3CA8A 4UHJA 1KEEA 2NU8A 2FWIA 5DT2A 1FVFA 1CQJB 2HHAA 2ZBUA 3AEZA 5JJCA 2MIIA 4MMZB 3PHBE 5DX1A 5ENDA 2ZRQA 2JI4A 1H6AA 1KIMA 1PEDA 2Z8YA 3DWGA 4MLCA 4DY4A 5LUBA 1PLKA 1X1AA 1E5QA 1CBUA 2A5DA 2FRDA 3KSZO 3RKRA 3C48A 1E2QA 1G1AA 1G8HA 2AS0A 1XLTA 2AWOA 2XF2A 3PC4A 3T1NA 3TQOA 4J94A 2GN9A 3KJNA 5DNYB 3WBBA 1TD9A 2C57A 1BXGA 1R8JA 1V6SA 2H0AA 2Y1LA 3HSSA 3V1NA 1P75A 2VSNA 5CYOA 2D59A 2DC1A 4B1FA 5BSMA 1CUWA 3D6TB 2BHSA 2HWUA 1J8YF 3PEVA 3DLBA 1GO2A 3AUTA 1DT5A 4J16C 1BMFA 3JVDA 3M6UA 3U31A 1G5IA 2CL7X 3EZLA 4XIJA 1ULBA 2J5RA 5FFFA 3OCUA 2H8GA 2BDEA 3TLGA 2ZWIA 4DB4A 4HX2A 1YVRA 2VPWA 4GQBA 4CQMB 1E6CA 1X9HA 3CLUD 2NU6B 2PLWA 1JA1A 1EDZA 4PZ9A 4WEOA 2JBAB 4QX6A 1N4AA 4D99A 5HM6A 1RLTA 2N46A 4MB6A 3EDMA 4XUGB 4QDZA 5D3MA 5HDQA 2H4HA 4O2AB 1IEXA 3PQDA 4KEAA 1WP4A 1W46A 3R6LA 1ILEA 2RGRA 1FY2A 4G0VA 4M6WA 4A2QA 4B5KA 2XTJA 3O75A 5EYPB 3UO8B 4DMRA 4PVDA 3RCBA 1QYIA 3TQCA 4FHGA 4L1KA 4Z4FA 2XVYA 1MB0A 4LCJA 5H3CA 4L02A 4Q9JA 3IYLW 5AW1A 1Q77A 2HF2A 3P9PA 4YRLA 1R6TA 5TGZA 2Q62A 4CQMD 3ZHXA 2C99A 3AR9A 3PPWA 2WHYA 1QPBA 4ACAA 1R4MB 3NHKA 1CY7A 4NYJR 2NXNA 3SKXA 3WYEA 1P4HA 1R8YA 2FFBA 5KJ1A 3G9TA 4GYJA 4Z3DA 1RQLA 4CL8A 4AUNA 2QTMA 2E7ZA 2Z8YM 3DDZX 1BQ4A 2I33A 1TF5A 1Z45A 3H19A 3UJ9A 3H11A 1BHO1 1NJ6A 2R8RA 5DHPA 3ROQA 2JEZA 3OO1A 4JJKA 4BVKA 3ZIUA 721PA 2VTBB 3ZV7A 3DMFA 1ECLA 4L27A 3SJUA 3AG6A 1GGMA 1AKUA 3QBEA 4N0PA 3VR3D 1H4QA 3CT4A 1Y80A 1THTA 4WH0A 1U0FA 3MJVA 3OEEA 4HXFB 4IQ8A 2D0OB 4V2IA 1KI2A 1M34E 2EIHA 2JFNA 3FOCA 3N8DA 4KMMA 5TEWA 3SG0A 3N39C 5T64A 3EVGA 3LOQA 5FUBA 1NW8A 3PGKA 3NNNA 4LBVA 4OK5A 3KVVA 3W6NA 6NULA 3ZU4A 1MT0A 3GLGA 2BE7A 3EJ6A 2MTBA 3T4UA 1IN6A 5KU7A 1VL2A 3OU7A 2W2KA 3JQ9C 2CL5A 2VSYA 3BORA 1KVSA 1Z7BA 2IUTA 3RABA 3VNBA 2ID8A 5H83A 1NXOA 3O26A 1UF9A 1GTVA 5IM4F 5LQRA 1TGVA 2IXBA 3SP1A 2W37A 4QOEA 2R7MA 5TGDA 3RIMA 3Q0EA 3E9ZA 4M9XA 3K9QO 3U49A 4R9NA 2VDJA 1JN0A 4A0QA 5C7IO 5JR3A 1NMXA 4I5GA 1EE2A 1Y89A 1H3NA 5GAJA 3TW8B 2JCBA 4O4JB 3W4KA 4KXQA 2ZBGA 2UZIR 4J0FA 1HT1E 3TR5A 4UFPA 4DR4B 2IS6A 3SR3A 5BRAA 1M2OB 4H7PA 3UA3A 2BR3A 4N9WA 3CWZA 3OX4A 2GLUA 5D00A 2ASEA 3ZC3A 1SK8A 3N74A 2VJYA 1YVUA 2OFWA 3E5NA 3K32A 4J0EA 3TEJA 2PL1A 4B8YA 1VDZA 3WLOA 1YNSA 3I2GA 1FFCA 2OECA 4QA9A 5H9VA 1K8RA 2NUPA 2VN8A 3N6XA 1E9EA 5K3FA 3T5BA 5EJEA 1T2VA 1V9CA 1EX9A 5T4BA 4MTCA 1OFIA 5DZSA 1U3UA 4PBSA 3RIYA 2JGNA 3BH0A 1HTTA 2CFCA 2QMQA 2XODA 3B6JA 2HLNA 3KLBA 3HFRA 4WIAA 5HILA 4CEIB 2PGLA 1SOUA 1LLDA 1RLUA 5T7BA 4CPDA 1U0HC 4ZN6A 1G63A 5BN5A 3KD2A 3MMSA 1OKKD 5JASA 2XYPA 4NYMQ 3OQPA 4N0DA 3RTEA 4LFBB 4C4RA 1MJFA 3E22A 4HADA 4IIVA 4DNXA 3T15A 3HEMA 2A67A 3KAQA 4JI5B 3G23A 5K0ZA 2BAGA 3I09A 4XRGA 2N1BA 3UMGA 4K6HA 4CM8A 1UK8A 2VHEA 3MWGA 2ZUFA 1ZBDA 1LZLA 2GJAA 2LDBA 1G19A 1WW8A 1CRZA 3F98A 3TI7A 2X3FA 3KSMA 3MYRA 3SF8B 5C1DA 2BSXA 4IVQA 5SYNA 1J07A 3QKIA 4RFLA 2XOKA 1ML4A 3DLTA 1QHHB 1AHHA 2D8MA 4UBMA 3HC7A 2VHTA 4QT0A 4G07A 1RXIA 3PX7A 3TINA 1N1DA 1JKIA 5IZ4A 4FJ0A 2YXNA 1A88A 2EQ5A 3A7EA 3L7YA 4YRAA 1GN9A 1W2HA 1IRXA 2AUMA 3K1TA 1PYOA 2I6SA 3L43A 3STXA 3UGQA 4OY3A 3ICEA 4BBAA 4HFNA 1XPOA 2I3DA 5LOVA 4RK6A 4CV3A 4W8HA 4PO9A 3NIGB 3GLUA 3TDKA 1XNRB 1AA9A 1QX3A 3MJRA 4BB0A 1RWNA 3LVBA 3TTWA 1DAOA 2B2XA 1VB5A 2AW5A 3B8EA 4RF2A 4EI9A 2R7LA 4IW3B 2GS9A 2C2KA 1XTPA 4E5SA 1A5AB 1NJFA 2DY1A 2OHVA 2OILA 3EDOA 5BXYA 2YHBA 5I51A 3BWDD 3M4JA 2FWJA 4PLPA 1IG0A 2C0PA 2Y0EA 1VFNA 2RHJA 1I2CA 4ALNA 1L5LA 2QX8A 2NUTA 1NN3A 1AXRA 2GEVA 2JD0A 3DE5X 3OJFA 4BNUA 4JLUA 2H1SA 5DHAA 1WXEA 3PNPA 1QVWA 2AG8A 4JL6A 4TQ9A 3WDSA 3ZTYA 3NEJA 4ZC1A 7REQA 2G8LA 2NMVA 1CZOA 2RB5A 5DK4A 3PXDA 4AP6A 3CVUA 4D0RA 4J0JA 4UU1A 4Q02A 1DXOA 3B2NA 4TGLA 3KDPA 4E15A 2ZRJA 3V4FA 4IS2A 1L7AA 2CXQA 2ZTSA 3GC6A 4WBNA 5ITWA 1MHTA 4HDRA 2XWSA 1FP1D 3AUSA 3THYA 2FK7A 1Q1BA 1T26A 1OC4A 3U7RA 3FTEA 1VHLA 3EWNA 4URWR 1ADBA 1V95A 4Q05A 4D80A 3NIFB 5IXSA 4R69A 4GX1A 2I4NA 1TXGA 2NU6A 4XCVA 2PMKA 1RQPA 4WA7A 1A1VA 1YDEA 2BVNA 3D4LA 4DPMA 3V7UA 3I9KA 4MLDA 1WLSA 1VECA 1OH8A 3RVPA 1ZONA 2GPNA 3KWFA 4G4IA 1TK2A 5BSKA 4D0LB 4X62B 2BFCA 2P3OA 3IIJA 1U1GA 4J0CA 5KYGA 4FU0A 2WJPA 3GPIA 1ZICA 2OL4A 3IMFA 4FK8A 2EX4A 5FBVB 1EP1B 5JSYA 2AMVA 3NYWA 3EA4A 2F4NA 4BS9A 3MB5A 4J1NA 1US8A 3R7FA 3VR2D 4QU8A 2B4KA 1ISGA 4M7WA 2JRLA 2PJDA 5CRIA 1GG9A 3EQ8A 4C78A 2ZT8A 3STUA 2A1TS 4M9SA 3J81k 2WWVD 3WMEA 4YV1A 3LT2A 4RLFA 1ECPA 1PV4A 2JK1A 1B23P 1GTSA 3BOSA 3GG9A 4EZBA 1RWBA 2FX5A 4W5HA 1TA4A 4ARIA 5CEEA 2CMGA 3VX4A 2EP7A 3I30X 3S1LA 4IFTA 2A92A 4JBYA 2ETXA 3VVBA 1WKCA 2II6A 4DBVO 1ODSA 2QM3A 4PO8A 4GQAA 4DR7B 1M34A 1M75A 5CAEB 3ZE0B 1FMTA 5ERGB 3VHXA 3LDHA 3FOZA 3KYIB 2ZR8A 3EC1A 3SS7X 4BP1A 4C2TA 3KT6A 4PC7A 4NNPA 3PXBA 1OX4A 2VPQA 1OKKA 2B9VA 3MA0A 1H93A 3NHLA 4OAQA 2MT9A 5ESWA 2IU0A 1LSUA 1G0NA 3R5JA 3QU9A 4F9GA 2FMUA 1IDN1 2P5UA 3OKAA 1AGXA 4RC9A 5SZKB 4S24A 3AJRA 3ROEA 2Q1TA 3WISA 5A4AA 1YJ8A 3FPLA 5LZ2A 5FWYB 1T35A 4FHZA 1PEKE 3VU9B 4RJJA 1L5VA 2VDOB 4YJHA 1XHFA 4NBTA 1SRRA 4PS0A 2YWHA 5B4TA 4MVJM 4R83A 5YASA 4ARAA 1VLQA 4MB2A 3STTA 5JSZA 4JH0A 1K92A 3N70A 1RXEA 3UHJA 4E5UA 3W5CA 5KYXB 4F12A 2PZJA 3CONA 4QBFA 3QFRA 4AY6A 2V7TA 3O4FA 5K8JB 2I8LA 1ZRHA 3ETHA 1LVGA 4MDYA 1QV7A 4D56A 4Q1DA 2BSQA 4A10A 5H70A 4QXQA 4Q4CA 3UJPA 3K05A 1QH9A 3JQ8B 2XWQA 3ZNPA 1Y8RB 4LHEA 1LH0A 4CKYA 5KVCA 1JQEA 4DG5A 4N5NA 1PZEA 3QVSA 3R8CA 4CCAA 1PRYA 1DWUA 4P53A 4BZXA 3LDUA 1Q2XA 1TM1E 3PXCX 1EDBA 1Y98A 4MGZR 1T0JB 2FR8A 4D96A 5B36A 2NZJA 4D6PA 3TLAA 3AF2A 4MP8A 2ZROA 5CXSA 3W7AA 4CM5A 4G0OA 4JFRA 4ZK6A 5JNUA 4P35A 2RI6A 1QGED 3AL2A 4AF8A 5JH7B 2IYTA 1OC2A 3HPQA 3DOHA 4FI3F 1Z28A 5J58A 2VUTA 2FKNA 4CCYB 4L8FA 4JNCA 1PNVA 1G5FA 3GFFA 1JEYB 2ZANA 4OXQA 3DWEX 3JYNA 2C9OA 3GEBA 3B48A 5FHRA 4D02A 5FPHA 2RK4A 3H65A 3N58A 3T1YB 4BXOB 2NZ2A 1KI6A 2VF8A 3EMKA 3ZLJA 4MQMA 4DLWA 2WHPB 2J0QA 1C3OB 2FSUA 3BYZA 3AUYA 4RJKA 2GPJA 1D0VA 4ANFA 1NN1A 5HKBA 3AI3A 3I0ZA 3ZHUA 4IXTA 1VL6A 4YMGA 3NATA 2IHUA 3SIPA 3BTOA 4Q6BA 2D5CA 2BEVB 3JAKB 4GS5A 1WOYA 2VYQA 3KR2A 1QVZA 3N3BC 2XD9A 4BASA 1PZMA 4C7OA 2ZB3A 2C1ZA 3CF2A 5MHTA 2AMJA 2FPGA 1A5ZA 1RW4A 3LU1A 1F60A 5FBLB 3HDQA 2PM8A 1XE3A 4XWKA 4L7QA 1JG1A 4CLDA 3SYNA 3EJWA 1YZGA 2OCGA 1ODFA 2RB4A 3DV9A 2BKAA 4YP5A 4AKTA 3UT0A 3G0HA 3JRXA 4URZR 3JU3A 1FU4A 5DGCA 5IBRA 4EHKA 2BYTA 1PTKA 3AKDA 1ODJA 4MS3B 1AQLA 3S5UA 1XU9A 4HNAB 4UPVA 1Y4AE 3F3SA 4IYJA 3KVRA 5JO0A 1P0IA 2K5UA 1JHDA 5HGJA 1L8AA 5MGBA 2GHRA 1DB3A 1PFWA 4H15A 1XHEA 5ALTA 3K5IA 1VKNA 1C7EA 5FI5A 3JWPA 4P7KA 2JGRA 4C43A 3JVUA 4EW6A 3FR8A 4RULA 2JCXA 3F6PA 3QKRB 1RVV1 1S8AA 2ZS8A 5HJ5A 4G0UA 2ZR0A 1U2ZA 1YQQA 3NBFA 4JBXA 1RMYA 3GJSA 4JQOA 2X4LA 1UK9A 2W93A 4BO0A 5I5EA 2WKWA 1K3FA 4LK2A 4HUJA 2QTZA 3FHJA 1K9SA 4KR3A 3ZE1B 4CRWB 5HIAA 4PBTA 1UMBA 3AM3A 4XM2A 2O50A 3AETB 1SUCA 3IDAA 3HBMA 1PZNA 2ZDGA 3CE9A 5AQEA 5FNVF 3SR4A 3WY9A 1W1IA 1P74A 3DWFA 4AXBA 5AUNB 3LQ4A 4N3AA 4Y1EA 1LX6A 2WJGA 1TCVA 3AEKB 5K3SA 4JJZA 4C2AA 3RANA 4EKIA 1SU8A 2VL7A 2HSJA 1B8PA 1XP8A 3JR7A 4LSMA 4GMGA 3WLEA 5CA0A 2QRVA 1VMDA 3E53A 2D8AA 3GLTA 4HAVA 3WK9A 4MUYA 1RJDA 3TL3A 4RXMA 4WNIA 2ZTVA 3DZFA 2WB2A 1TQ4A 3V3TA 2XYHA 3QLUC 4Z4IA 3KT8A 3KFXA 1NW6A 1N2JA 3RLFA 4U63A 2M1XA 3DF7A 1IB0A 4MRSA 5LQSA 2RI1A 5D3MB 2ILVA 4ZK2A 1NNUA 3VH3A 4A0SA 2XVAA 1MEOA 5E2AA 5BWMA 2C4TA 1HT0A 3RWOA 1H6CA 1Z9BA 2ZPTX 2OCXA 3KKQA 4TTRA 4XWWA 2PJRA 2PS9A 3HJBA 1CWUA 1JIXA 3E8MA 2OENG 1Z3IX 3VBEA 5LLSA 4ZQEA 3VYSB 5A0TA 4KBGA 1ZQ1A 1Z5WA 4ND4A 3MHTA 4RVCA 2R8BA 4V39A 4AJ1A 5DP2A 3A6EA 4FI3C 1Z22A 4JXXA 1T1EA 1KDOA 4DMGA 4X6XA 4OI0A 2NO5A 4DLZA 3DMGA 2ZYHA 3IRVA 4AKEA 4GOMD 3W3ZB 4OB8A 4BUZA 4E5YA 4M60A 4EL5A 3ZYZA 5HA5A 5JQWA 2IEDA 1GAEO 1KMHB 5D3QA 3ZZNA 2VZ9A 3M6MD 1OTHA 4TS4A 1A9YA 5AJTA 3RRJA 4IP0A 4IS3A 1ADGA 4XD7A 3MXOA 2ID7A 4YCSA 2QVLA 4LF7B 3H2HA 1XV5A 4ISBA 2ERCA 3C7DB 3PJDA 3REQA 2VHXA 3D8NA 4HSGA 3F9CA 1F9EA 1AHNA 4O4LF 4C4TA 1GSHA 2DJ5A 1GPUA 3AR8A 1O57A 3F3YA 1L3IA 3LXMA 2VUUA 4CM9D 4CT5A 2JD2A 3AR2A 5BYAA 3RR2A 2PAAA 3ILXA 5GJBA 3SEAA 4TYWA 1K3UB 2F8MA 4NX2A 1N25A 3E5MA 4QM6A 1IUOA 1OTYA 2HV8A 4JUBA 3B38A 2Q2WA 2TS1A 3GVHA 3M6IA 4JLSA 3BA6A 4BNDB 2B8JA 4NPAA 2QUJA 4K2AA 1XVTA 2W2KB 2XB6A 4I4CA 1FW6A 4I55A 1Y1PA 2ZULA 2HREA 1UJMA 4ILEA 1MD9A 1UOEA 1QAQA 2PGIA 4ND3A 4QGAA 2OCYC 4G1CA 1JP7A 2E1RA 1X7HA 3GZNA 1IPFA 1U2RA 3OHMA 3ISVA 4UE3S 4P4TA 4OH1A 1JTEA 1ZVJA 2UYYA 5CM2Z 3GVXA 1A4UA 4IV5A 1ISFA 2ZUVA 3RYHA 2XZOA 2VK4A 3E2PA 5F1KA 4EQ6A 1T4DA 1EDOA 2P1DA 1HV8A 2JLAA 2BIFA 1Z25A 1NVMB 2G06A 4GZ3A 1MG5A 1QE0A 1A4RA 3ZD9A 3ES9A 3ER8A 2O2CA 1PR3A 1WZCA 2VP9A 4BVEA 3HABA 3R1IA 1GZ6A 4FZ5A 4H1HA 3MJ4A 4IO0A 1YHYA 3IBCA 2IXFA 1NVTA 2QTFA 2WJWA 1KNQA 1OH6A 3SX0A 5CDTA 5J47A 1RU3A 4DXAA 3WE7A 1TM7E 1ZH6A 5TMEA 3ZK8A 1TTPB 2Q5EA 4QNNA 4QWWA 4BX3A 3B3AA 3CZ9A 1QC5B 3ORFA 4PG7A 4WCVA 3RC2A 2F48A 1SZCA 1TK3A 4QUGA 1PT5A 1NYLA 2IZ0A 2VDLB 2YNMA 3NONA 4OYRA 3GUYA 1GNPA 3O74A 3G2HA 3ZQJA 2HWXA 3DQPA 2Z2IA 4QPDA 2YS7A 5FD8A 4DMKA 1WB6A 4XUDA 3TG2A 4RTSA 1LDMA 1KZ1A 3JYLA 2FX2A 4JP2A 3NM4A 4AVYA 4F3NA 1RD4A 2AX3A 3QFFA 5AW6A 1J97A 2NV0A 3QE0A 1XWIA 4WINA 3GFOA 3KKEA 1OQAA 1BCRA 1ONSA 2OB1A 3Q3HA 4RZHA 4UATA 4XLLA 1D1TA 2EL7A 5HMMA 3LDAA 4TLMB 8OHMA 1JDJA 3IBGA 1DI0A 1XZJA 1IZYA 1V1MB 3H9UA 3MYYA 2PPVA 2WYWA 3D4NA 3CISA 3JWIA 4KQIA 4NEGA 4DLUA 1FVXA 1WZ2A 4Y6RA 1QCYA 4LQDA 5E4YA 1TI7A 2I99A 2QTTA 1YJ5A 3D6AA 3ET4A 4R2LA 4Y2PA 3SQMA 4AYXA 2W83A 5LNK1 2O8EB 3PWSA 4LZAA 3HYCA 1BW9A 3TTYA 1SD5A 1Z18A 2ZRIA 4OYLA 2QZZA 2E89A 5LOVB 4DV7B 3EIOA 4ZRNA 2YY7A 2O2XA 2UAGA 2ZI3A 4FFBA 5LBIA 3SS8A 3IP3A 3FYUB 5IT0A 1B2RA 1CJUC 2BBTA 4IIEA 3I3SR 1DIBA 3A2KA 2QJWA 3HEAA 3FGNA 421PA 2FDXA 5C7OO 3QKRA 1B74A 1U8FO 3EGVA 3L46A 1SO8A 3UWSA 2KB0A 1ORVA 4G1VA 3DYIA 3KX2A 1O89A 1SGWA 5JXIA 3NBMA 2OXCA 1RC0A 1JXOA 3GRYA 3ZU5A 1Z17A 2CJWB 2W6OA 2J5XA 1SKBA 3DOJA 3M5DA 4LEIA 2C8JA 3W04A 3WZLA 4EPYA 13PKA 2JGDA 4LTMA 4MQFA 3RVRA 4ES6A 4A15A 3NOXA 1VLZA 2A9KA 5KTPA 2JCVA 2B1JA 3MHPA 4OMCA 3WK5A 3HPRA 3DTYA 4B7ZA 3U3JA 3ELUA 3I52A 3H5WA 2JBWA 1YBVA 4KXLA 4I6JA 3ZWOA 1YCGA 1BH6A 4ER7A 2PV7A 1XZAA 3PGLA 4X5OA 1RM4A 4DKJA 2WUFA 4YT4A 4Y2HA 4C7BA 1LA2A 1UWCA 1YZLA 1MVNA 2GASA 4L4UA 4ZOQI 4P4SB 2R47A 1WM1A 1L6RA 3WKCA 1XBTA 3DEIA 5E95A 3CURA 3V6MA 4BFUA 2GO7A 4JP3A 2YBEA 1V5FA 4KIWA 2CFOA 2W6NA 4DANA 3IAHA 3LP5A 2QW1A 5LLTA 3FGPA 3TLXA 3QG5A 4WE3A 3W0LB 4HJXA 3GELA 2XWJI 1E8DA 1I7PA 4PCLA 3I4CA 1YS2X 2GN1A 3MIZA 4XJSA 1LBEA 2M9MA 4AP9A 4DIDA 4AI6A 4PHTA 1HE5A 2VATA 4HTAA 5COQA 4ENRA 3QVMA 4A8TA 5BV1A 3RNOA 1EVIA 1YRBA 4UHEA 3U4AA 1OWLA 2UZ1B 4HGPA 5KTSA 1VYUA 4KR2A 3LOUA 1SKYB 2PMDA 3MPUA 2MHCA 1CE8B 2OZVA 1D9ZA 3I2IA 4N8EA 5J2UB 3B5JA 5F7XA 4F93B 3JAMA 3ROKA 3WKDA 1Z0JA 3F5QA 1U1IA 1X14A 1ZP6A 3KOZA 5KDDA 5L3VA 3A3YA 1C9KA 1YJCA 1NQAO 3IRUA 5J63A 1QH1A 1M6VB 3DJFA 1TDJA 4F4DA 2QN2A 1SBTA 2VK2A 3AHHA 2H63A 3G2NA 4GLJA 2GRJA 4UARA 3G2OA 3L7JA 4YRZA 3HH8A 1X94A 1J1UA 5CT4A 5KOJB 1JR3E 3COJA 1TW3A 3LWZA 3MAJA 4TKVB 1N3LA 3CLKA 5DM60 2CLCX 2FMXA 5HWSA 3IPRA 1JAZA 1IVNA 2QN8A 4KQ2A 4F3RA 3W6ZA 3VDRA 1AUXA 1E0SA 2F8LA 4OO3A 2X7HA 3RJ9A 1GGJA 4OKNA 1LQTA 4AF6A 1K63A 4DEVA 3NJ4A 4JBIA 1JAYA 5THXA 2WVGA 2HQRA 2Y3IA 3EVCA 4TMWA 4MICA 1QLHA 3NCTA 1HWYA 3Q8KA 1C7ZA 2O0JA 4V38A 5TJ9A 4P82A 2V8BA 2BD0A 2XT6A 4TLLB 1UINA 3DEHA 2UXDB 3EZ7A 4JQYA 5F33A 2CJXA 3ISJA 3TIGA 2JLVA 1K7XB 2JFUA 3ED5A 3GRUA 5AW4A 3MCWA 1XOIA 2C7VA 2J8ZA 5B53A 2PH7A 2UVDA 4FFSA 4B35A 5EJ4A 1ES9A 3R77A 1IRIA 1UJ2A 3HUFA 2HF7A 4OXRA 1EAYA 1CQWA 4YN3A 4AZWA 3WXBA 4EABA 2AFRA 4J4HA 3WTBA 2WABA 4K9MA 1NBHA 4CMIB 3DTVD 3G5UA 4ON9A 2OPBA 4TSFA 1YR9A 3AC0A 1IHXA 3LAWA 1PFYA 4F4CA 3TIXB 3VMFA 4FUQA 3CEHA 5EE1A 1NXSA 1Z5ZA 4LVNA 4S0XA 4ZT6A 1VHQA 2HXSA 1CZLA 2C97A 3CPJB 2GHQA 2YN2A 3OEHD 2GN6A 4HDQB 2RE8A 4GI7A 1CUDA 2G6BA 3K20A 3ICVA 2KBFA 3DBRA 3GRKA 1DQNA 3GARA 1PS0A 3Q41A 3VZBA 3ZDQA 1OGYA 1EIZA 1L4MA 2JFYA 3AI7A 3BHNA 3Q7EA 4GWLA 1UZUA 1N1EA 4D1YA 3F96A 1CR0A 4R7GA 1VRCA 1D8TA 2IYYA 1BH2A 1CKEA 1E5XA 3QJYA 2YDXA 3FFWA 1WEHA 4JR2A 1C3JA 1XJ0A 2EKLA 2JEYA 3MWFA 2QLFA 4Q5IA 1RMQA 4R1MA 1JH8A 2NXCA 2ZFUA 2G36A 3DBLB 3SI7A 3VMMA 3VU3A 3OQIB 2RK6A 2RHRA 4LDZA 1DG9A 4WZAE 2Z3WA 3PNLA 3ZCVA 1ITZA 4CKCB 1ZVKA 3AJEA 5BV0A 2KYRA 4IGEA 1M5TA 4K5QA 2W0SA 3AF4A 4FT4A 4GI3A 1LFAA 3R44A 4LOLA 5ADWA 1CF4A 1JLLA 1XEWY 2DBQA 4HNVA 1E9CA 1PFQA 5ETJA 4MV6A 3C6QA 1Q0HA 4AW9A 2XOEA 4I5DA 3FTDA 4IRMA 4IIFA 1DO2A 1MOQA 3PT9A 4Z9AA 1K3TA 3GCDA 1ESEA 5AJXA 2VZEA 2DHRA 4RVHA 4FC6A 2O0MA 4Y6QA 2O2HA 3WQRA 1NJ8A 4PWZA 3EB9A 1XA3A 2R85A 4FILA 1L5WA 5I9NA 1J22A 5K4HA 1Z8HA 3BUSA 3PFIA 3JWJA 2GBIA 3GNSA 3QK7A 4NCXA 1FFXA 1G18A 2WF9A 1L5MA 3EOBI 2V45A 2ZIUB 3CNOA 1M1YB 1R0SA 1SC4A 2QUKA 3ZU6A 1KE2A 1V25A 3GCZA 4H1TA 3QEBZ 4OXIA 2R7AA 2GEKA 4PINA 2HU5A 3FIJA 2FLWA 3PF9A 4LZZA 3W6OA 1L9XA 1P4GA 1PK7A 1SXHA 3ZY4A 1FIUA 1GUDA 4L51A 3ZK9A 4EVIA 4JNKA 1SVOA 2XT0A 2EGHA 4O33A 2G9NA 1DQZA 1T4CB 3QOYA 5E6RA 1SKQA 1ECGA 1MBZA 3A4IA 4O6VA 4UU7A 5DGTA 1YB4A 5T57A 3WQBA 3U61B 1ZN8A 5JY1A 4XPIA 1UKVY 2XR1A 3DHYA 3INNA 1EFUA 3M3DA 3ZWDA 2C82A 3FUWA 3WA6A 4BC0A 3GGPA 3TPZA 3V1MA 4X64B 1YBMA 3QQPA 4A5OA 5ALVA 5F5XA 5A04A 4QTTB 4Q39A 2ZR9A 1WDLA 4JKOA 3DS8A 1KIFA 1P61B 2XUFA 1B8NA 3B1WA 2HIHA 2Z1NA 4NBKA 1QO9A 1WJGA 4QL3A 3QE4A 3SF8A 4PSVA 3VQTA 1JR4A 4ECEA 5B3JA 5DCLA 2IIPA 1SUEA 1JKMA 1DOAA 3TQQA 4NH4A 3C3AA 4TWJA 4RNCA 3EVBA 1LPOA 5AKXA 3CMCO 5BWBA 2WC1A 4RE6A 1Z8DA 2PX4A 3DFFA 1SOMA 4FINA 2VBCA 4HVAA 3SBXA 3U6KA 5LZ8A 3D7MA 1NTOA 3EODA 2H5EA 4JOSA 3LPCA 2B7BA 2CXHA 4HWKA 3RVKA 1CSEE 3LXXA 4EFKA 3ZGXA 3LUKA 3FPAA 3IMCA 2A58A 4LVCA 3K94A 1SBHA 1HTBA 1LC3A 4IZ6A 3TRIA 4FWIB 3UT5B 2YZMA 6AT1A 1SZJG 4RH1A 4YRCA 2OCBA 2AQIA 1KJ8A 2W6MA 5LD2B 1J0BA 1NQVA 4ZYXA 2DWOA 2XA2A 2QTAA 1GTL1 4ZOLF 1XDSA 3FA2A 2VHQA 3LSYA 3PUJA 4MIYA 2YRFA 1D2RA 4MUGA 5EQJB 3VXKA 4ZWNA 3TCNA 2D1QA 1VOTA 2IIQA 2PKRA 1DEAA 1Q7RA 1DMRA 1JDPA 3L0PA 3Q1LA 4KL8S 3MJSA 4MYCA 2IDJA 5IH3A 1LPBB 1GQOA 3EH1A 4N7JA 1DTWB 2QY9A 4M7OA 2GRUA 3KM0A 4B3HA 3NHPA 3OUZA 2IQ5A 5CT6A 3UYKA 1OLSA 3EIUA 3IUBA 4MVJI 3HXLA 2Q5LA 4MJXA 5DW0A 1EVEA 1YS1X 4M1OA 2A1IA 2VRCA 1QKIA 4O5OA 1Z16A 3RSLA 5L3SA 1QFJA 3ONDA 3COYA 1G4UR 2HQ1A 4DSOA 1XTUA 1K7CA 1KJIA 3AI1A 4M1YA 4MRNA 1WLYA 4JJIA 2OYRA 1OUMA 3ENKA 3I01M 1QFMA 4KXFB 1RVDA 4X95A 4QUAA 4RL4A 1SVSA 4MWEA 4RCZA 2QZSA 1XYYA 3URMA 2EFGA 1WQ1R 2GAOA 4MUJA 3WZMA 3FWZA 4N5IX 4XCXA 3PTLA 4WACA 4IHQA 5K8LA 1XDZA 3U56A 3UUWA 3QVVA 1U2EA 2CXXA 3I6YA 3MJHA 4FHCA 3LE8A 4LOHA 1BU5A 3GMSA 5CURA 1EEXB 4A36A 1UBHS 1QYRA 3A26A 1C0KA 1DADA 1M2KA 1DG1G 2XDAA 2ZW9A 3IIKA 3QMWA 5LU8A 5IM4A 1JF8A 4CKEA 2QTVA 1WKBA 2JLSA 3D81A 3GNTA 3ID6C 3BTUA 3OCYA 4X61A 3B7WA 3U1VA 1N8KA 3JVEA 1J8VA 4MIKA 4I3GA 2ZAMA 2Z3VA 5CFRA 1I0IA 4I9HA 1EUQA 1A76A 5BURA 2O06A 1VBNA 3OEYA 1ZU5A 2XMZA 4I19A 4OJNA 2G5CA 3H3FA 1BU8A 3BC1A 3AP2A 1M6YA 1B93A 2OBLA 2FUG1 2XYVA 3MF4A 3CX8A 2FP4B 3KJXA 4ZI2A 4I08A 1SWVA 1K2VN 1NY5A 5JQGF 2GF0A 1DRVA 4PU0A 1RJWA 1D2GA 3HWX1 3WC4A 3QELA 1QCCA 2XE6A 4LXHA 4XYMA 2CBGA 3ZY3A 4LDPA 4BB5A 1X0XA 4FGUA 4J43A 4AY4A 4QEZA 1YQWA 3N87A 3NP9A 3KQYA 1VCNA 3DOUA 1OWMA 2ICAA 3KO8A 3P32A 3UTDA 3IC5A 3EEOA 3JD2A 1OV6A 3USES 1RI5A 4YYZA 1SUPA 2VTVA 3IKLA 4ZZ3A 1K4YA 3M33A 3EPRA 2OPHA 1AMOA 5EKUA 1A9XB 4RMNA 4W5QA 4N3BA 4B31A 2X40A 3LQQA 2BFEA 4KXMA 3KQHA 3H11B 4I0WB 3MWLA 4ZYLA 2J09A 4HDMA 4B5LA 4DR1B 1HLFA 1DEOA 2QYHA 3NP7A 3UPDA 3HXOA 3DE7X 1SH7A 2QPOA 4H4EA 2J3EA 1UPCA 2FR1A 3EG9A 2KS6A 4FN5A 2EEZA 5FOXA 3D1LA 3NR2A 1VG8A 3T52A 4F2HA 3PQ5A 3TQHA 3HGMA 4RHYA 5HSGA 4I4TF 4RE5A 2NW6A 1NPDA 4RYDA 1PO7A 3BEOA 4FYJA 4QOFA 3RBVA 2VH5R 1WV1A 4XQ0A 4HATA 1HQYE 4YJ2F 3VR4H 3ZZUA 5ICSA 1USIA 3MJFA 4FS3A 1NYRA 3F4BA 3GRZA 2ZSAA 1XMXA 4RIGA 3T0IA 2QRJA 4UVEA 3A8TA 1P4JA 4GYWA 2C4MA 2OYSA 3KJGA 3O83A 5AWFC 3GLGE 1SWWA 1UJNA 4BLUA 1SVKA 3A1WA 1CVIA 1OXVA 2HRCA 1JDNA 3TVYA 5FWDA 3RU3A 5CDSA 3OJEA 5CDHA 1NI5A 3DWIA 2GVZC 3KB8A 4A27A 1O9GA 4X44A 1U9ZA 3TW8A 4NONA 3HM9A 4F8JA 2BUBA 5KTYA 3NTUA 3OQ1A 3TSOA 1FS4A 2JAWA 1Z4PX 2A9PA 3OQJA 3ZIDA 1IATA 3CLUC 3R09A 5EXXA 3I37X 3OT1B 4JZYA 3X1YA 3U4MA 1YOVB 3Q40A 4L0DA 2VG8A 2WOJA 2MU1A 4IEEA 4L0QA 5LJIA 1HMYA 1FYDA 4EUHA 3IVCA 4I1UA 3TM5A 1GGKA 1Z2DA 1Y5LA 4HQNA 4RDXA 2VAVA 5G4LA 3MK31 4LBZA 2HK6A 3PDIA 4E32A 1NBME 3DKIA 5GJVC 2FHPA 2PT7A 5E7IA 4JBGA 4YDRA 3O4RA 5JLAA 5BNWA 5JY6A 1EXDA 1M73E 2PEZA 4PPYA 1E2EA 4U4AA 3ICQB 1BX1A 2WINI 5K3EA 5TPWA 2WU1A 1TM5E 4FOLA 4Y18A 5CXXA 3VOBA 1Z38A 4C4PA 4EKGA 3U17A 4EY7A 5JPCA 5FPSA 3L4KA 4Y2GA 1KO5A 2NXEA 3IVRA 2YZKA 3QEMA 2WYUA 3MG9A 4O8CA 2RAPA 4R5HA 1TTQB 4E3WA 4ZCIA 2R7NA 5HK8A 1D1QA 1E3IA 2F43A 2WSSD 4MPDA 5K0TA 3DOEA 1H2HA 2B4YA 1KERA 2QZ9A 3AKCA 3ITEA 4QNMA 2NTJA 1IOWA 1J6UA 3DC2A 2DKNA 2UKDA 5HBRA 4KQ6A 1N6PA 2DH5A 2GN2A 4JP8A 4LHZA 3HDJA 5ALHA 1XAJA 2XQVA 2JH8A 4HDNA 4ZI7A 2WWWA 3DL4A 4QAJA 5K0SA 2K2QB 3LZCA 2O52A 4R3WA 1F3LA 3AVOA 3AIOA 3JQAA 3WGQA 2G63A 1GQQA 2CNWA 2PO5A 1NVGA 4EF4A 1RHQA 1LKZA 1BGXT 4GP7A 3AUJB 2JGJA 1FUYB 1HYEA 4MW5A 3AVTA 2XW6A 1KU0A 2G72A 2WTEA 2IUEA 3EULA 3VFDA 4RZQA 5DLQC 1AJEA 1W19A 3P9CA 3FPFA 2J6IA 4LNUB 1P1CA 1TYZA 2QRMA 1PJQA 2GZMA 2XQKA 3EXFA 3OZBA 1APBA 5GGYA 5A4FS 3Q0IA 1GAWA 1L2TA 5IBQA 3T5GA 2DSNA 4EDFA 2OQIA 2FEKA 5LSAA 2P5YA 3ZWMA 2JCYA 4QBIA 2NOAA 2GA9A 3LY7A 5H0IA 5J2UA 3M4ZA 3O4VA 4JLNA 4DWOA 1X7YA 1UMBB 4D0GA 2W2TA 2KX7A 4WGGA 1KPIA 1ECJA 5JVDB 2QAGB 3M49A 5AKGA 4L4YA 3DKRA 4X1KA 4RANA 3PTZA 4LJ6A 2AL7A 1MJGA 2W58A 1FW8A 1ZL2A 4XA8A 1HEYA 4ZEWA 2IC5A 3DMPA 1GVNB 4G1BA 2PFGA 3NOVA 1S7CA 1TVCA 3KUXA 4EEZA 5E1DA 2YHIB 1N9ZA 4FE3A 4MPJA 3NALA 5F2EA 4UHCA 3SYKA 1KJZA 4RPJA 4JJGA 1S01A 3BPSA 2M6RA 3H0EA 4NBNA 4C6HA 1DEXA 5I7WA 2HO4A 2HGSA 2CK3A 1LD3A 2F00A 1ETUA 3GT3A 1I94B 2AEJA 3FKQA 4PSKA 3HLTA 2W6PA 4YK7A 5BSEA 2PK3A 4PYRA 1Z5VA 2GERA 4CDMA 2E82A 2JHAA 1NN0A 2QE6A 1BD3A 4I6EA 5L51A 2Q9CA 2C4WA 3JVIA 5JO9A 4AECA 4BYMA 1AUPA 4PBRA 5ICMA 1L7XA 1J5XA 1Q5PA 4RTJA 3IQFA 2POCA 4Y2QA 4YYEA 3QOFA 3WLSA 4ACBA 2HLHA 3GY0A 3QRWA 4PX5A 2JLZA 1U1EA 3R0VA 4K1XA 3VZSA 3NVAA 1TA0A 3ZDDA 3NV9A 1M6WA 2G7ZA 4KYUA 3TMAA 4NV1A 5ILOA 1E5VA 3VZRA 4E5DA 2R84A 1U7DA 1Z06A 1Z29A 1BMTA 1QOPB 3A28A 3KHTA 4C6TB 1V7ZA 1UOOA 2BZ1A 4L5CA 5EE0A 4BQQA 2AI3A 1L7EA 4MV8A 5A1TA 1XJWA 3SVZA 9GPBA 3D7NA 4QFBA 4I36A 1U63A 2J0EA 2P9QA 2X0DA 1U94A 1YRLA 1I7NA 4AJ2A 2C3MA 2HIGA 1W5BA 4ZJUA 1MJNA 4GEKA 5CH3A 5FORA 5EWMB 1DIOB 1JW9B 1HDCA 3QXHA 3RVMA 5B30A 1AKWA 1JDUA 2GKOA 2PKEA 3N53A 4LYJA 2V7GA 4RD0A 4CR7A 2DUNA 2ZIZA 1U7XA 1J9EA 2EZUA 4O4HF 3NTOA 2I2BA 3O3NB 2MSNA 2VXOA 4B33A 1F8YA 1NIJA 1K7FB 3CLTD 4IDPA 3BH6A 1IZ8A 3HJGA 1V0JA 2IA5A 4IHAA 5AK3A 4S1TA 1Y9EA 4DZZA 1P9NA 2I65A 3OLCX 1E2KA 4O0LA 1WHTA 5J2TB 3NH6A 3DOOA 3DUFB 2RFLA 3DYBA 1MQAA 2PQ0A 4J29A 4B74A 3HN2A 2AHOA 1YAHA 3KOYA 1G20B 3ZDBA 1VL8A 4PTZA 1UP6A 5KNCD 2F4VB 2BGGA 1PBNA 2C9CA 3UN1A 2KSQA 4UBLA 1GRCA 4BVGA 2D5BA 3V9PA 3IQXA 5ALLA 4XDYA 3GWGA 2CJPA 3OE5A 4Y1GA 2VPIA 4BKUA 2QQFA 3P2KA 1M2FA 2FN9A 4X8HA 4FFNA 4R05A 1SK9A 2WICA 4QUEA 1N5LA 1GKIA 2O2IA 4WN9B 5ABPA 4CIAA 1MTOA 2RHDA 3I1YA 5FOQA 2YMMA 2OP0A 1T29A 3RYFB 4F86A 3GROA 4P36A 4FKMA 5HJEA 3DE2X 3KLNA 1QANA 3FNEA 2GEJA 4FGLA 3SU8A 1SXJC 2VP5A 3ANTA 3JQ8A 1L8OA 3D6UA 2W2VA 2BP7B 3KOOA 4M83A 5I7FA 3I64A 3AERB 5CHYA 1S3IA 4PYKA 1CHNA 3EFEA 2A0WA 1XNGA 2C5LA 1A9RA 2PEYA 3NTLA 4NJOA 2DFPA 3PICA 4MUEA 4PLFA 3P94A 4IZOA 4Q19A 2YJ6A 5HS4A 2BFDB 1O97C 4ND5A 2FPIA 1FLDA 1GG8A 1UDAA 2IOFK 2XQJA 2CN1A 3KYJB 3QBDA 4QG3A 1UMDB 2JB9A 4GKJB 2P4HX 2XTNA 4ZVSA 4CODB 1GDDA 3MBKA 3BB4A 3TKYA 1G41A 2C5HA 4AMYA 4MUNA 2P40A 1XMJA 3DP9A 3HK2A 1NBOA 3CR8A 4XM1A 5HJ7A 1W5EA 2XCQA 4RS3A 1DBWA 1N57A 3E8XA 1S9DA 1CB7A 1XZEA 4R41A 5EWLA 4L3WA 1PWZA 1YJAA 3BZWA 3H5TA 1JXQA 1YRHA 2I2DA 3QEMB 3ZQ6A 4Q6WA 1NG1A 1XDWA 2JZNA 3G79A 3HJAA 5H1YA 2LDXA 3Q3EA 1P2SA 1HF3A 3UHFA 2FQXA 1EX7A 1FSFA 1T6BY 1VE6A 3H1FA 3LVRE 2E1PA 3PUZA 3TRDA 4B7CA 4BN5A 1AS3A 1QLWA 2IYUA 1YRWA 2PT6A 3CH4B 4V0LA 3SZLA 5JALA 2Z30A 1ZNZA 2BEKA 1E62A 5HCUA 1PTJA 3WRWA 1S1CA 3BJZA 3JARA 1K27A 1SNYA 5DCWA 2WJHA 5EKSA 4GBGA 3LC2O 1AO3A 2DQYA 1YBHA 1ZCZA 1KJ9A 2JATA 3AONB 2Y1XA 1U2PA 4LXTA 5EJ7A 1XEXB 1KORA 4ND8A 1BXZA 5C32A 2IEAA 3JQQA 4MYTA 4OAPA 3T38A 2FSIA 4YXWD 1P29A 1B0UA 2YYSA 1VLJA 3RUEA 4KMSA 4EB6B 1CR1A 1I4DD 2UZ3A 3WG9A 1RXWA 2JLWA 4UEWA 2JJ2D 2VUSA 4MGYR 4UNQA 5FPKA 1CUZA 3BL8A 3EGWA 2YV1A 3QPCA 5ADUS 3DV0B 1QFZA 1IZ9A 3ZWBA 4TN5A 2YIMA 3MMZA 4ZU6X 2D5AA 5FWYA 3MAAC 1MW9X 1DEHA 3I9V6 3AW8A 4YQZA 3H5NA 3L8YA 3DA8A 3K0EA 4FSDA 3C7AA 1M9NA 3SXJA 3LK7A 5JVDA 3PVSA 3RVQA 3QUQA 3TM4A 3U4QA 2QNIA 1FYVA 4CGYA 2JIQA 5ALGA 2E4WA 1EVJA 4CUKA 1H9CA 4QPCA 4YLYA 4ZCTA 4QPNA 3DZIA 3EPJA 1FMJA 2IU6A 4I7EA 4BU0A 2XCUA 2Z5FA 1P2FA 2QLTA 2V4UA 3OC6A 3MS2A 1E1CB 4G4JA 3UC5A 4QLBA 2IZ7A 3GP5A 1FVHA 4IM7A 2FFAA 4S1OA 4P0QB 1UBRS 2YUTA 4HRXA 1SPBS 1R0WA 1NRWA 2WM9B 4Z8YA 4B6QA 5AVVA 1EBUA 2JGMA 4X3CA 1TM2A 2CL0X 5A5GA 1PNTA 3BMXA 2ZXEA 1I4TD 4YT5A 5ERXA 1V5WA 1UT6A 2ATVA 3MCZA 4NEHB 5KDLA 2C92A 2I1LA 3O73A 1ZRSA 5T8KC 4BJHB 5A4MS 1DJOA 1JQJC 5T6MA 1UEIA 4LMBA 2VIIA 5EFZA 2JIZA 5JANA 4JCOA 1W0JD 3M9WA 2WIGA 4O0MA 5HG0A 5CA1B 2OOKA 4Y0NA 3UK1A 1NR7A 1Q7EA 1Z2EA 2P8SA 4YJ2A 5CHEA 1CUAA 4V0OA 4G1UC 1GQSA 3A9RA 5CB4B 2VJLA 4MW0A 1SXPA 3F5FA 3L18A 1P73A 1YZKA 1DEKA 2IZOA 1K6JA 1H0KA 2WSYB 2W42A 2VH1A 1E5DA 4INAA 2MSKA 2J32A 5FAXA 1WCXA 3T3DA 2WU8A 3A9VA 3NBKA 5REQA 3ELDA 3IQIX 3GWZA 5BPFA 3SQWA 2WWIA 1NT4A 4HKTA 3MBIA 4LDAA 4P3NA 5CMLA 1K6IA 1KXJA 4DLRA 1NXPA 4F0JA 1CJSA 1KR2A 4F56A 2C7QA 3SSNA 3C5WP 1OLUB 1ISIA 2DWCA 3GL9A 3Q11A 4OP2A 5HX7A 4NZNA 2ZI5A 1DO8A 2BUAA 3WIOA 2JNWA 3L8GA 4MGKR 4EZIA 3DVSX 2VTBA 1GCUA 1IQUA 1USGA 1EBBA 1PR0A 1ZUNA 1SC1A 4LY3A 1QKKA 1E5TA 2OGTA 1E2BA 1LJ8A 2PQ2A 1J70A 1BVHA 1O96A 1WW3A 1JFVA 2VK8A 3DHVA 4K9OA 4JVNA 3E22B 4LYHA 2ZDQA 1W88B 2AZTA 2AFVA 2V9CA 3BGVA 4OCZA 4Z7QB 2WG0A 2YJGA 3KQPA 2NU9A 2JFZA 2WG2A 1WXHA 7ABPA 2J67A 1KKLA 2QRZA 3GA7A 4V0NA 5FLKA 4JLVA 4TYMA 3BEDA 3JAWB 2J3DA 3GGJA 4GH5A 1H5UA 3TNDA 3SDBA 1Z4LA 2ECKA 4HOYA 1NUTA 1QYVA 4XE5A 1AU9A 3ZVMA 5DHQA 5L4NA 1JPJA 1RPNA 3K70B 1JILA 4X71A 3NEAA 3GGDA 2XXBA 2VWQA 3PR2B 4FYXA 2GKSA 2JDIA 4KIFA 3OX2A 3CU5A 1UQTA 3DBHA 3KJZA 2MYNA 4L28A 1JLRA 2VDPB 3Q98A 5IARA 4DQUA 1EXWA 2IKQA 1U90A 4RZSA 3ZZ0A 1QP0A 2HYDA 3X3HA 1PIWA 1KSJA 2LCQA 5KSWB 5FV7A 5B58C 1DUIA 2YZGA 3WNCA 4Q4HA 4UVDA 3ZXIA 4KR9A 2X9QA 4GSLA 1AUOA 1SC9A 4LYEA 3CVWA 5DLDA 3U9TA 1C0LA 5CNMA 3SF0A 3QSYA 2B8EA 4GNKA 3AERA 4MVWA 3UWDA 3QMPA 4LHVA 5C3MA 5A05A 2C88A 3C1AA 1P3DA 4Y2VA 1VMIA 4NBRA 3AHJA 1YB5A 5CIWA 2HBRA 4DZTA 1T8SA 2Y2UA 2BM1A 1E2UA 5D01A 1TEXA 3WGGA 2X7JA 4DCCA 3DBLA 2Y92A 4Q7MB 1VZ2A 4GGPA 2J5KA 3TQIA 2QD1A 2NZUG 5JI3E 3FD8A 2C2WA 3MPOA 1T8PA 5H5JA 4DSNA 2GTHA 2OZKA 2ZZKA 4OOEA 1PJZA 2H51A 3ZJTA 2Q8QA 3GH1A 2W4MA 3PPIA 4G0WA 1NLZA 4M1TA 2E49A 2OVFA 2YBDA 3ROMA 1Z6QA 5H3LA 5HOEA 1SHKA 1IBSA 1K9VF 3KPUA 5EPEA 5AUOB 1TKCA 2H9AA 3DL7A 4MYRA 1TQ6A 3O1LA 2XUIA 1KI3A 4G41A 4L2IA 4GXRA 4LG1A 2V1UA 3R7NA 4D57A 3A05A 2FSGA 2YIDA 4BBJA 5JCJA 4YRIA 3VYWA 4MVJF 3WJAA 5C8XA 3TX2A 3SZRA 3UICA 2XJ4A 2GBPA 4K2HA 1V5GA 4LWPA 5FTNA 5KYYA 2XDQA 3IB3A 1HG0A 3GPCA 3JQCA 4MCHA 3IXMA 3PIIA 4HXYA 3LQRA 5FNVB 3RYTC 3AR3A 2D6FA 1U0EA 1RP7A 1XD2B 4J2OA 1N8TA 3QLJA 5C8ZA 4J3NA 1T6ZA 1W8DA 1XEXA 2IYWA 4ND8B 4R1QA 4DUGA 1E3MA 3AV0B 3LX4A 5TQ0A 1KKUA 3V8EA 4H17A 4KE6A 2R97A 2ZUWA 4Z4CA 4IO1A 3LDGA 2DR2A 1NXXA 3IHKA 3B1FA 2WNSA 3E7XA 4RD1A 1RZRA 3E5RA 1AIPA 1RLIA 3G82C 4IIJA 4UXIA 3T94A 1M3SA 1OA0A 3TJRA 1QO0A 2E5WA 2H4YA 5KKCA 1OH7A 1DJPA 4WCFC 4UTVA 4Q1AA 5JRJA 1NJSA 3K8OE 4Z8XA 4JT8A 1OYVA 2CLLB 1EFRD 2YFQA 3A36A 4QPPA 5SY4A 2IPNA 4LFCB 5EHZA 3IQHX 5IULC 5KHOC 5CPBA 3PCTA 3I6QA 4M0LA 3UHPA 4ESVA 4ZV4A 1PUIA 3OFKA 4FYKA 3TQTA 4YRSA 5CJ2A 5ER6A 4AJIA 5C7YA 2H4JA 4CNBA 4HAUA 2BWJA 4LE2A 4LXGA 4UXJA 4GICA 2Z98A 3EISA 4QFCA 5JS1A 4OD0A 3HKDA 3BAZA 1FDTA 5JSZB 3VHXB 2FPGB 3GLVA 1CIPA 2OP1A 3HUEA 3KTFA 4KWTA 2XZTA 3PHLA 3PGMA 1FNSA 1Q0PA 4NU6A 4DUZB 1A97A 4WOPA 4HK4A 4FBLA 1WB4A 5DTIA 5AXAA 3CO5A 4LC0A 5IJ0B 4B45A 2OKCA 2YUIA 4GE3A 3W5DA 2Q3FA 4Q3EA 4FOTA 4OP3A 4W8GA 3A6DA 4XQCA 4CZ2A 821PA 4IDOA 3FGZA 4LRUA 4PLYA 3OFNA 1GIAA 2GTIA 2OFXA 1V3QE 4HWGA 4IMJB 1UFKA 2W43A 3PNKA 5B12A 1P1IA 1CNEA 1UM9B 2NLOA 4Z1OA 1QB7A 4AS3A 1NXWA 5FTJA 1AOXA 5KYXA 5BNZA 1Y7TA 1T8UA 1FNDA 3FOWA 3IOEA 3B1VA 2QU8A 5FTKA 2FVYA 2VNJA 3HUDA 1OCEA 3FIUA 2X3YA 3H6KA 3H4VA 3PVCA 2HDOA 3GR6A 1N6IA 1ZM3A 4UOEA 3GPLA 4HEA1 4AJLA 5IDWA 1HA3A 4JT2A 5I8ZA 1JLKA 4FQ7A 4X1YA 3GUZA 4TSKA 3O9VA 3PFHA 3WGHA 5KTKA 3ZVNA 5TT1A 4QARA 4PEVA 3Q72A 2ZCUA 4LV8B 5K2OA 2W6ID 5F12A 3NUZA 3DZCA 4OQFA 2OQRA 4XX0A 1FLVA 2HLDA 3E5HA 1IZZA 2JI7A 5GMOA 1UXIA 3G8YA 4EIWA 4Z4HA 5CM9C 3OI7A 1NT2A 2IYLD 1ZGCA 2O3UA 1T6YA 1WMFA 3PTAA 1JEAA 3FJOA 4Q3KA 2JVIA 2ROQA 1I32A 1HY3A 3IO5A 4ZVUA 5ENZA 1NMEA 2ZTLA 3JXEA 3PJFA 1V48A 4M21A 4QEDA 4X00A 5DLYA 1C4OA 5D51S 2Z5VA 3OPQA 4FQ5A 3KB1A 1CZRA 1H8EA 5DTQA 4D9IA 2QVBA 1NV8A 2L19A 3LUAA 5CYGA 1J2RA 1V11B 1X0VA 4NS4A 1EK5A 1MAAA 2HF8A 3REOA 4B8WA 4NP6A 3HA3A 5IAGA 1DRJA 4JEUA 4LYAA 4X60A 5ULLA 3UNXA 1ZH4A 4FS8A 3TEFA 4GL2A 1AKQA 5G2OA 2DQSA 5FUXA 3EZ9A 4ETWA 3BJIC 3A9CA 1KIAA 1EWTA 3G5TA 2PZ8A 4EO7A 1YK1A 3NTXA 5KBYA 3WNBA 3TIFA 1I7SB 4BPRA 2WMNB 3ESYA 3E2IA 2YW9A 4FFWA 4P31A 2HD4A 2ZP1A 3TBHA 3VM6A 1YIOA 2DWQA 4FD2A 4P8RA 1MIOB 4RKWA 4PC3A 4C6RA 3LBNA 2FEPA 1U8ZA 3QKSB 2QE7D 3FFTA 5TDHA 2PMEA 3SHVA 2FWBA 1O8BA 3D6FA 3ZDXB 1K88A 2MOKA 4MDEA 5BP7A 1LTQA 4Y8VA 1KI4A 3WLTA 3U19A 1CRWG 1O0CA 2PR2A 3KEFA 4IAOA 1YZNA 2VWPA 4LRTB 4G5GA 4JJEA 2MSWA 1U3VA 4RQBA 2BR5A 4ITRC 3ENNA 1IHDA 4C29A 5KWSA 1IOZA 3O2JA 5JFGA 3GJZA 1C30B 3M6LA 3OU2A 2FSVA 3NAMA 4A2PA 4G36A 4RPGA 2CHUA 1RCUA 3LA6A 3DFZA 2FZLA 1V8OA 4HFMA 5IKPA 3FPSA 4HAWA 2ZIXB 4NV3A 1H2WA 4MQEB 2BF4A 3UB2A 2GQ0A 5K4GA 1NI4A 1PLJA 1VQ1A 3UV6A 2WU3A 4BNTA 1U8XX 3WWYA 1G17A 2ZIEA 4GYYA 3NT4A 1KZYC 2J6BA 3F8SA 2HJWA 3CYFA 1TMOA 1BNCA 3I12A 3ZW9A 1XXLA 5CVTA 4TV9A 2P6NA 5BOVA 4EI8A 4HNSA 1JR2A 4GPEA 5BO5A 3ZV4A 4G4SP 1LRLA 4D97A 5HK9A 4JLAA 1MO6A 3VVMA 3K0CC 4YAEA 2ZJAA 1DAFA 4I1SA 5JNTA 1H85A 1R0KA 4BNDA 1E1RD 1SR8A 1VCOA 4NFLA 4WA8A 3ENWA 1IQRA 1IXSB 3UK6A 2X9GA 2JHCA 4YP6A 3R9KA 1OXUA 4RA9A 1QTQA 2D1SA 1MC5A 3LQKA 5TF4A 2FMIA 3DAHA 4N39A 4RAOA 3RQSA 6REQB 1PZHA 2M2IA 4TXHA 3PT5A 2JI8A 4A6XA 5CD9A 1SOAA 1ZMTA 1EWQA 1XWFA 2GBFA 3HY3A 5AOAA 2DYKA 3AM4A 4G1MB 4OQMA 3WDMA 5BWNA 3LF2A 1ATIA 2BTQB 4G09A 3WKAA 2CCKA 3GOQA 1P0PA 2NWQA 2VPXA 4WMLA 2P9BA 1SBIA 3X44A 4RHFA 2Q4BA 1XJQA 4D3YA 1RHMA 5CBPB 5B5SA 3IMEA 4P38A 1K7SN 3F8TA 2XUZA 3F0TA 3OZ7A 4C3OB 4DLYA 3U60B 4N7RA 1YQDA 4TSFD 5H80A 4EW1A 1EGQA 5F51A 1CUYA 2W4QA 4BWYA 2CSXA 3OMWA 2ATCA 3B78A 1P7YA 1URPA 4IX9A 5CYFA 3VO9A 5BMVF 2X5XA 2WUGA 2Q0QA 1F48A 1RKXA 1LBQA 1KRXA 4GPZA 1LPPA 1N2IA 2Q5HA 3LGSA 4DVJA 5D1HA 3ON5A 1T3TA 1NQ5A 3OM0A 4PPQA 5FBHA 3TZHA 4F96A 4ICIA 1ARZA 3RS2A 3NC4A 1PW7A 3L6CA 1PJBA 4KNWA 4XB2A 4X1IB 5DSZA 3QJ5A 2FR8C 2VYVD 3KPYA 4DA9A 5IFKA 5JRDS 3F6CA 4MUHA 4TMXA 1XP5A 5KOHB 3GRAA 4KGVA 4EF5A 2FUEA 3OO0A 4IIUA 1O0SA 2H9IA 3GIDA 1QGUB 2VXYA 3ZG6A 1XGKA 4ZIRA 1I01A 3FMIA 5K0CA 3SKYA 2PSEA 4JX8A 1MF7A 1DX9A 2CLMB 3O8OB 4RTPA 5T41A 2TRSB 5E6UB 2DFLA 3IULA 5EEHA 3II6X 3H9EO 1PWHA 3WQSB 3L02A 3HHPA 2XADA 2HFJA 3DMTC 5IH7A 4EGJA 3WSTA 1OSNA 1KZ7B 3ZTWA 3T06B 1GT6A 5BVHA 4MIOA 4B7XA 3OKFA 1R74A 1X74A 2OOSA 3BIXA 3CM0A 4QICA 1RE1A 3B6MA 5K2MA 1C3EA 4DUPA 1F20A 1R6AA 1V6AA 1MUUA 1XSEA 3ZCXA 4O3MA 2HKIA 4H4CA 5LLDA 4OQYA 2EG9A 4QXAA 2VT2A 2FB9A 4DT1A 5LDDC 5H81A 4BVFA 3RJMA 3DB2A 2J4FA 1DKUA 1BXRA 2RJNA 5AFSA 4NJEB 1XCGB 3ORHA 3ZWKA 4MX8A 1LTKA 3WS7A 3W2FA 1F2UA 1JX6A 5IDXA 2Z9DA 2EWWA 4MUFA 1G291 4HNQA 4W5JA 4E4YA 1N78A 2Q29A 4J9UE 3T1HB 2VT6A 4QLOA 5FPYA 4MHSA 4RS4A 2NSDA 1JFSA 1XRNA 3G2IA 3WRYA 5IC6A 3RWBA 1RBMA 4PN3A 2O8CB 1TZKA 3PC6A 4DRYA 2B5OA 1PN3A 4BCBA 3U4HA 2QF7A 1QPGA 1WIWA 1EXMA 4EA7A 1QP7A 2HNAA 5IJZA 1RYBA 2QX6A 1KYYA 4HEHA 4DCGA 3IT2A 3DMDA 2CT8A 1O94A 4EQ6B 1RS0A 2COEA 4GM0A 3BDAA 3GO4A 4WLVA 1Q3HA 5KSPA 3S3TA 3WL7A 4DB2A 4OVKA 1Z08A 2X8JB 1G6OA 1BQ3A 5P8WA 4DIMA 4HZUB 4PPFA 2JFWA 3PXAA 4N82A 3FTQA 1G6KA 1J8FA 4L50A 2OUIA 1TU3A 2EJWA 3HDHA 3LWBA 4RM3A 2NVUB 3SOPA 2O8FA 2EBUA 1U7ZA 1Z6GA 3S27A 1NZFA 2PX5A 3UJBA 4O4JF 2XUJA 5E4JA 1R9MA 1PCXA 4CCWA 5EHXA 1KTIA 2XD4A 1GNQA 1TU0A 1QTIA 3K9LA 3L8FA 1R37A 3OZIA 4I4IA 4LFAB 1GFIA 1NR1A 2FSSA 3OPXA 3GBSA 4BO3A 3O9MA 1JG3A 3IJRA 3U62A 1H5NA 1L8XA 4LDNA 5FTMA 1DWPA 2Z2YA 4YQFA 3JQGB 5B55A 4HHEA 1Q92A 1H2BA 3TLCA 4CF5A 2F1HA 1MB2A 1Z5GA 2A8YA 2JHPA 4IWXA 4FLMA 4BVLA 2OTCA 3G1WA 3JX9A 1J25A 1R0ZA 4J0IA 4KPUA 3A1CA 3BWVA 1BCRB 2KM1A 1QMGA 4TTVA 3SLGA 1JFTA 4GGMX 5TQVA 3I5YA 1JBKA 4CKWB 1DX4A 4PYLA 4UEJA 2IGTA 4Y9RA 4EHIA 4MV9A 4GLFA 2P41A 3RIXA 3PNSA 2I8AA 2AYXA 3G9QA 3PSHA 1NA5A 3MTDA 3QXJA 4M1EA 1Z7YA 5EE9A 4QBGB 1ZGJA 4JI2B 3EZ2A 4DDKA 4BJ5A 2OORA 1GU7A 1Z75A 4YAGA 5LN1A 5ALSA 2H7CA 3PNVA 4B3GA 4TMYA 3VKGA 4BO2A 1ZK0A 5CJJA 5ESXA 3I8OA 4ILKA 3UHAA 4RDHA 1AXGA 1S9HA 3UOAB 1JDVA 4RQAA 1N2HA 2PUEA 3CN7A 1B16A 1KBQA 4Q4HB 2PIDA 3U1TA 4KNVA 4FOPA 3WBKA 1XEWX 3OD5A 4DWJA 1WHSB 2BEUB 4HRAA 3ESCA 1E6MA 1MHPA 5JD5A 2V6FA 2B83A 1E5LA 4NL4H 3BFVA 5FA8A 3K30A 3A3NA 4TN1A 4KLNA 1J09A 3VU1A 1ZAKA 2A5JA 2NZYA 3OE7A 4NJMB 5L8VA 3WVNA 4BKMA 2WWRA 5JDIC 2AOWA 1TUBB 1IQ0A 3L41A 4WKPA 4YQYA 3ZV5A 4F3CA 1D4FA 1V3UA 4K1LA 2CB9A 4DV5B 1RXCA 4YR9A 2Y4OA 2A9RA 2VJCA 3F4KA 3PD0A 2XE4A 1GRNA 1CUEA 2YH2A 4E46A 1CDOA 3SYRA 1L7NA 4M0DA 3JWGA 2OCPA 4ND6A 3RT7A 5NULA 3L7IA 2E5FA 3UH1A 1SB8A 1IAQA 1I5EA 3WB9A 1L5ZA 1YC2A 1MNAA 4EP1A 5AJVB 2E87A 2XMGA 4N7MA 3AUXA 1ULUA 2NUAA 1WX1A 3K31A 1G5QA 3CINA 4FWBA 4C88A 2B1QA 3BGDA 3MWJA 4LV5B 2F8SA 4MYHA 4U2GA 4KQJA 5D6OA 4NNOA 1U0SY 5EJIA 4KLZA 2QGFA 4LZPA 5K1ZA 3K92A 3AVVA 1JJFA 3ETJA 3TZQA 4QSMA 4WKOA 1R10A 3MD9A 4PG4A 4YGYA 3VSEA 2L82A 4KE8A 2AQ8A 4LN1A 3WRVA 4EJSC 1H4SA 4BV8A 1ST3A 5FNVA 5GM1A 2CFTA 4L9WA 2ONKA 3CJTA 5K51A 2GOYA 3L6UA 4CTJA 3IR7A 2LV8A 5EKTA 1WXGA 3CUWA 3EXG1 3HJRA 3RW9A 1ZU4A 4R54A 1A27A 3F71A 4EX7A 4QG7A 3IMGA 3TXAA 2PQMA 1JEEA 4G5RA 2IBTA 2XTZA 3BRSA 5B3JC 1AQ6A 1LDGA 2J08A 3QZUA 4JITA 1LDYA 3WWDA 2GZ3A 1NFFA 4S2EA 5AW5A 4NBVA 1P18A 4MIEA 1TUIA 1RJFA 3KYDB 4RSRA 3ORSA 1UQUA 1XB2A 3FTNA 5J59A 4I50B 4AZ3A 4AKIA 1L7MA 2RCNA 5TVKA 1M2WA 3CKKA 5T8KA 1CW2B 4YIKA 3KJFA 1G8SA 4H18A 4HX5A 4CIXA 2HAEA 4DIEA 1F5SA 4X7MA 3ZY2A 2CHEA 2MWMA 4EG7A 4J16A 4ZOLB 1ULHA 1E6EA 3L8ZA 5ECYA 2YJZA 1A69A 4EGSA 1B1AA 2NVBA 4JB2A 4OLJA 4MGHA 3QFTA 2ZYWX 4GUAA 3BRCA 3PIRA 2C1EA 4D6YA 1L7RA 2AN5A 2WQ6A 1VPDA 1RKQA 3I01A 4LXUA 4TYQA 1A4XA 1M7HA 5FOWA 3PJRA 1NBMA 4TTAA 2V1XA 3TDMA 2ET6A 5CK4A 2OV6A 3CNHA 3BSYA 1NBIA 1CVLA 1H9BA 2H54A 2PLAA 4ZALA 3PA8A 4G0QA 5JLJA 3HDYA 4MWZA 2O8CA 4IGFA 5F78A 3CH7A 3UUFA 1KAEA 2NNLD 3V5NA 2JI9A 1QIDA 3K8QA 3R40A 5JYCA 4Z53A 1E4EB 3F6EX 4XWOA 4X94A 5AKZA 2B4AA 3TQFA 2YXBA 4ZICA 1QTNA 3MWEA 1PL0A 4XWAA 4BX2A 5A06A 3QBJA 2G8NA 5F52A 4BVHA 5LP1A 3OJWA 1WAMA 4PR3A 4OIFA 3DV0A 1KDPA 3QVKA 4MAMA 2F1JA 4HQOA 4MI9A 1FMLA 2BGLA 3JYPA 4IDCA 1R4NB 1YQ9A 2P9EA 5D84A 5DHUA 4X65B 1LF5A 3LT4A 5CUQA 4C0XA 3JV7A 4W5NA 2PRKA 3I61A 5LYJF 3LY5A 4EJMA 5HDBB 1Y6GA 1T9AA 2W2QA 4QOIA 2BBWA 1ZGHA 3OU6A 4GBJA 5ADVA 4EHFA 2Z6AA 2PUBA 4AXXA 1GZ4A 2F3PA 5JARA 4RMGA 2HRRA 4X6YA 1REQB 3FF4A 1SKYE 4LOIA 1IXYA 4ZAGA 1GSAA 2EHDA 2ODNA 1IVYA 2Y1WA 3CEPB 3FW1A 2ZYUX 4UM5A 5DEOA 5HZKA 5JQGA 3DZDA 4O8ZA 5IVPA 4MQBA 4DMUB 5ICFA 1EM8A 4WVLA 1RAGA 2NP7A 4NYJQ 4EVSA 4LBYA 2CNLA 9ABPA 5AVKA 3K5WA 1E9RA 2ADFA 4BFXA 3RHTA 3WWEA 4RXTA 2ZJ0A 2WHEA 3V4RA 1YRQA 1T5BA 3QY0A 4ENWA 2C2MA 2QUHA 2QBYB 1SU4A 4NZPA 1DHTA 1NW5A 3S7ZA 2FPWA 3O8QA 5IDYA 4IXMA 4CU5A 5CA1F 2BBOA 5JNVA 1LY1A 1YSCA 4QVIA 2DUMA 3B1JA 5LZ9A 3IV7A 4BIMA 3ROGA 3RUPA 2FWNA 5HFNA 3GUCA 3RFFA 2VJOA 1O9BA 4IDBA 1HEUA 3H1EA 3GVIA 4GOLD 4IY1A 4B6RA 2CFRA 2K2WA 4GKVA 4P7BA 3RC1A 2FQQA 3G5AA 4H7DA 4ZCQA 2I7CA 2O5VA 3PQFA 3BX1A 4OMUA 1AHPA 3EPHA 3S2SA 2AOTB 3I92A 1ISRA 4UCXA 2VAWA 2E4ZA 1HETA 4W1PA 1G7CA 4Z1MD 1N5OX 3ZHZA 2PFSA 1IHYA 3UJ6A 1OD6A 3IAM6 3RVNA 3D6HA 3W6UA 8LDHA 2PX0A 3DYVA 4QDUA 4KH1A 1OI3A 5FA5A 5CLGA 1B76A 4WY2A 3PEFA 4U2EA 3W7BA 2IPOA 1W36B 2P2GA 1OU4A 3EFOA 3RS8A