3UWKA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
205
structure length
202
Chain Sequence
GLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARAAARDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 87
structure length 202
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uwkA00
3A4MA 1TX4B 4MKIA 2EFEB 4QBGB 1OYWA 3VHXA 1S4QA 1GAJA 3HYTA 1MT0A 3OHMA 2CE2X 2HXSA 5JCPA 1YZTA 2CJWB 1G3QA 3ADDA 1XTKA 1NG1A 1OXSC 2IBMA 3LVQE 2F1IA 2VH5R 2J0QA 4A4DA 1GUAA 1SVSA 3Q3JB 3R9IA 3OESA 1S9DA 2WKQA 4FI3C 5DN6A 2DBYA 1EFRD 2ERYA 4Q1EA 3SYLA 3SFZA 2ZS9A 3WMFA 2LKDA 2Q9BA 5FTMA 3K0CC 2ZE8A 3TAHA 1W5SA 4A0FA 5SZKB 3WBKA 3TJZA 5FOUA 4RSGA 5CJPA 1H8EA 1XTQA 3N2IA 3HJNA 4EPVA 2G0NA 4L9SA 1MH1A 2B92A 4UXJA 2X8AA 3R7WB 2OAP1 3QBTA 2ZI4A 4JVNA 5LPNA 3T1OA 4JVMA 2DYKA 2OXCA 3CNOA 3PITA 1WBBA 2ZEJA 4GP7A 3DM5A 1GKUB 5FPSA 4QM6A 2VSFA 1UFQA 4JLBA 4ZCLA 2ZRGA 4ACBA 4DCSA 2IHYA 1FPMA 1W1WA 3LLMA 4LPKA 2VL7A 3T34A 5AUNB 3AF3A 1PLJA 4FMCF 1MOZA 2CXXA 2XAUA 3KUDA 4OK3A 3GJ8A 1W4AA 4QGHA 3B1VA 1DAEA 1N6HA 4DLSA 4LYHA 4DDUA 3FMIA 1KK2A 1NI3A 5B57C 3OIVA 5K8LA 4A2WA 4BPBA 3O47A 1VDZA 4FIDA 2QP3A 1NIPA 1FUUA 2ZSAA 1J99A 2RGNC 3EIEA 2ZSDA 3QNUA 1M74A 3UMSA 4YXWD 2ZJZA 3U3KA 4LBWA 3O8RA 1B0UA 3REGA 4BLPA 1CJVC 5AWFC 1E99A 3C4JA 2FEOA 3UMRA 4JL5A 2ZRMA 4C4PA 2JLSA 4MGZR 5GVSA 2MSEB 4FWIB 2AL7A 2K5UA 3VTKA 3RC3A 2UZIR 3MFYA 5C4MA 1MO3A 3HDTA 1T0JB 2XTMA 3GJ6A 5DSZA 2IF0A 4ZCMA 4GL2A 4M9QA 2IYRA 4QBHA 2WHXA 1I4LD 3PEYA 3B1ZA 4GZMA 3QI2A 4YDSA 4D6PA 1OH5A 1QHYA 2WM9B 3L43A 4CT5A 1LVGA 2GZHA 4FCTA 1RRPA 3GJ0A 1NN1A 1ODFA 4KFSA 2DY1A 4AKHA 4M1KA 4C0QC 4DWJA 221PA 3QPVA 2YC4C 4MYTA 1EX7A 4Q7MB 1JQLB 1HY3A 2ZRKA 2BDTA 2ERXA 3K9GA 4QJ5A 4I1UA 3DVLA 4Z8YA 1G6OA 4HZUB 2ORWA 1N6RA 4B47A 1N5JA 1OW3B 1KDTA 4BLTA 4BEJA 3CF2A 3FOZA 4DLYA 3KX2A 2QQEA 3RWOA 3OFNA 1N6PA 1W5TA 2C9YA 2QTFA 2QSYA 2FDCA 3RNLA 2QE7D 3Q72A 1N3BA 3SDZA 4KYUA 5L3QA 3LV8A 2ZIAA 4E5UA 4WA7A 4Q1CA 1EG7A 2ZAMA 1D9XA 1IXRC 3HPRA 5H70A 4CGZA 3KZ1E 1L2TA 4DCVA 3SC3A 1GRQA 1ZC3A 1IN6A 3ASYA 1OFUX 4QNMA 4II7A 4A2QA 4B3DA 1IM2A 1XBTA 2ZR0A 4JT4A 1X1SA 1P72A 1TPZA 4DLUA 3DMNA 3CONA 4Q66C 5KOYA 1XD2B 1KK3A 3DPUA 5HCNA 3A1WA 5KSOA 121PA 4EFNA 2W0SA 2OG2A 1YR7A 2JIZA 3U2QA 4LYAA 4PHFA 4OQMA 1TTTA 3LNCA 1WRBA 1GP2A 2Z4RA 1E2EA 3FFBA 2Q21A 2XJ9A 5CK4A 3UK6A 3AGPA 1HT1E 4LBVA 2QGNA 2ZS8A 3LWNA 1SHZA 2FMXA 1W0KD 1FX0A 5FL7A 1NKSA 4YMWA 3SJCA 1Q3TA 4YONB 4QM7A 3X1ZA 2ZUDA 1S3GA 1OF1A 1CU1A 1Z29A 3HR7A 3TIFA 4HEJA 2BIFA 3CF0A 4IVPA 1COWD 1I4DD 3B9QA 5FR1A 4HSEA 4C7OA 4MRNA 1GRNA 5HCIA 1NG9A 2NGRA 3EARA 2J59A 3RS3A 1NN3A 4DXAA 1JQJC 4XWAA 1KZGB 2O8BB 4ASUA 2GHIA 2QT1A 3FFAA 3R8CA 4Y0VA 2QM7A 1KAGA 3B6EA 2C5LA 1JEEA 2RGEA 4TYQA 2WV9A 2EFHB 1D6JA 5AJWA 1OLOA 1BH2A 3KKMA 1OIXA 3KB1A 1XD2A 2QT0A 3AKDA 3GP8A 4TYPA 2V4ZA 5FPHA 2WAYA 1CIPA 4H9GA 3CM0A 3FMOB 1Z0FA 3H4MA 1XP8A 2XX3A 2ZYVX 3BGWA 4I81A 4RCZA 4LHWA 5FPKA 5JECA 1TL7C 3GEHA 821PA 2ZJOA 1AZSC 2ZE7A 3LDAA 3PFIA 3P20A 3EWAA 2H18A 2GF0A 3QKTA 4IFBA 3BERA 1K6MA 1WMSA 5KO2A 1ESNA 2GNOA 2R44A 4HLCA 5TMPA 2QEQA 1HUQA 2JGNA 2KJQA 3LBIA 1BMFD 4LV6A 2JJ1A 5G40A 4IVRA 1FMJA 4GFDA 2GK6A 2W6ID 3WRYC 2O5VA 2WBLC 3K53A 3TSZA 1IY1A 4ERNA 2BM0A 2IX3A 3MAAC 4DDTA 1N5IA 3K0FA 2VRWA 3OIUA 2GBLC 3W34A 2HT1A 5BYJA 1NIJA 3AKYA 5CLQA 5EP4A 2VP0A 1OKKD 4HUQB 1QVAA 3U3MA 3K70B 2J0SA 1KI6B 1M2OB 2HUPA 2GBLA 2WWXA 4RCYA 2O52A 4KSCA 1X8JA 4LC1A 1XEWX 2GKSA 4JLDA 1ESMA 1SKYE 2P5SA 4JLVA 2JDID 3AKCA 4JLKA 2HLDD 3TAUA 1RZ3A 2HF9A 2NG1A 1FOEB 4LJAA 4Q4AA 4B3GA 2AKAB 5BN3A 1KO4A 3A37A 3GEEA 1L8QA 1UEIA 5FBQB 2JIZD 2QAJA 4P4TA 3RLFA 2FSGA 5TVKA 2JLYA 1P60A 1NVVQ 1ZU4A 4KHZA 4Q9IA 3SYNA 2RAPA 4DUGA 1DARA 5JHGB 1LF5A 1VCNA 1G3UA 1E69A 2JLQA 3RS4A 2Z83A 4Q9JA 2BBTA 1MO4A 3E70C 2VYFA 3EC2A 2AD5A 4Q19A 3SJAA 2JLRA 3RANA 3DZDA 2QRZA 5B64A 1Z28A 3A1SA 1PLLA 4ZO4A 3DM9B 2Z5FA 4C0HA 2G6BA 4MGYR 2IW3A 3NDBB 3K70C 4PX9A 2NPFA 4NCNA 3T06B 4BFXA 5E3HA 2GCPA 1AQUA 2C98A 3CPHA 4MH0R 3AVOA 4HUQA 4RD1A 1KI6A 1DTSA 2QPAA 4LWZA 2OFWA 4BQSA 1W46A 1VG9B 1Q20A 1JJVA 1US8B 2VSXA 3QENA 3ZQJA 1NP6A 2PZFA 3VU9A 2O8EB 2Q3MA 1AA9A 3NXSA 2ZXUA 2JEOA 2WJYA 1QG4A 1Z0JA 4BFWA 2ZI6A 1E2HA 4XSHA 3QF4B 3EA5A 4PSKA 4NYIQ 4DB2A 4S35A 3DO6A 4M1OA 3NBYC 4TL8A 3VR6A 3AVUA 3LXXA 3EA0A 3KKPA 2ATXA 2EFGA 3V4RA 4ARZB 1NVUQ 2UZ3A 2D2EA 1KSFX 4MKFA 2PJZA 4TTQA 4ABYA 4ESHA 4V0NA 1MABB 2ODEA 2QPTA 5AUPB 1YZLA 3QQ5A 5EE3A 3KQNA 1WA5A 4B76A 4PC1A 1ZRHA 2DFNA 1XMJA 2BBOA 4UNQA 1XJQA 3ADKA 4JLPA 3EZ9A 2Q3HA 1KTVA 3TMKA 1M7GA 4BLQA 3REFA 2IXFA 3T1QA 1WE2A 1ZD9A 4A1FA 2ZI7A 3ZGXA 1G1MA 1E79A 1E4YA 4V03A 1JJ7A 2VBCA 3ZD6A 1DEKA 1O87A 4C0KA 2FPMA 1NJGA 4EPTA 5EQTA 4MRRA 3IO5A 2IXGA 4JKIA 2J7PD 2BMJA 2QI9C 1US8A 1VG0B 2OE2A 4KITB 5FPTA 1Z6AA 3PUZA 4O25A 3A6PC 1F5NA 1T9HA 4YMTA 3W6NA 1VCOA 1W48A 3TRFA 4MYCA 4O2RA 1KI8A 3M1IA 2R65A 3G0HA 5DYIA 2P3SA 1RJ9B 3QF4A 3I92A 5BW8A 3K0SA 1G7SA 2UKDA 4BFUA 1GTVA 3EPKA 4NTZA 4MKHA 5IF9A 1E9AA 4NCKA 2A9KA 4DT1B 3KXIA 3RYTC 2BKUA 2C9CA 1DPFA 2OILA 4IDHA 5EP3A 3RRYA 2QMHA 3C16C 4FW9A 5EXXA 1U98A 3FDIA 5CK5A 3KJGA 1W4BA 4BFYA 1X3SA 2VTKA 4M4SA 4MYHA 1G20E 4B3BA 3LFUA 5BN5A 2D62A 1KOFA 2YHSA 3MMPA 1E2DA 4OKSA 4AY2A 2WPDD 3PR1A 3EPHA 1Z8FA 2DB3A 1W44A 1NVXQ 2IUSA 3PQCA 3WRXC 4PZYA 1RRGA 4LBYA 4G5QA 3THXA 2XGJA 4ZI3A 2WOOA 1YRBA 1OH7A 4P4SB 5GJCA 3DHWC 4DEYA 1NY6A 2C2HA 1OB2A 1QVRA 1OXXK 2QAGC 5EZ6B 4HB4A 4CVNA 2XNSA 1HTWA 2BMDA 5J4YA 4KU4A 2B6HA 2QAGA 1GNPA 2OBLA 2AR7A 2ZJYA 3NTUA 4DLTA 4Q01A 4EQ6B 1S96A 5CLLA 2H57A 2ZREA 4FMBB 2JJ2D 4PSAA 1SZPA 1YR8A 1XCGB 4KLZA 4IW3B 3BAFA 1KI9A 1E2JA 3LW7A 2NZ8A 1SVKA 5P21A 1G3RA 2ZJ8A 4LI0A 2OLJA 3ZH9B 1LFDB 2CHVA 1UF9A 2E9SA 3CX6A 1GIAA 5DISB 1XFAA 1E9BA 2AXNA 2X2FA 4DT1A 5KDDA 2ZQ5A 3THOA 3IQXA 1PJRA 1DAMA 4PHTA 5JSZB 3GJ7A 2F3RA 4BASA 1UBEA 3QKSA 2DPXA 3I8XA 4Z1MA 3EIQA 3PUWA 4A36A 2FWRA 5L3RA 1XWIA 2R2AA 3RSOA 3EZFA 4IOLA 1XRJA 3QXHA 4RD3A 5FUWA 5JHHB 3LBHA 2B8WA 1XXHB 1U8AA 2O8DB 2EW1A 1KNQA 1AS0A 4PC3A 2C78A 1VYTA 3G82C 5KTYA 1N6KA 1L4YA 2CHQA 2OXRA 3IKJA 3T12A 3U3RA 1FL9A 3VX4A 4DC9A 3K8YA 4GP6A 5KNBA 3OF5A 2FEMA 3RRNA 4P4SA 2KWIA 4QC2A 1K5GA 4TSFA 2WJHA 4B71A 2OV2A 2IEZA 3AQ4A 1E98A 4PPFA 3CWZA 2FFHA 3UG6A 4E22A 3UWOA 3MJRA 5H68A 4ZV4A 2CNWA 5AUQA 1G41A 4UNSA 2PLFA 2RH5A 2ZRJA 3A36A 4D4MA 3JVUA 5FOVA 2DFTA 3LAWA 2N46A 2ZVPX 4PQFA 4W7SA 2XZPA 3ZZUA 1VG1A 1EXMA 3PEUA 2V55B 621PA 2VF8A 2O8FA 1TEVA 1W4RA 3P26A 3U4QA 2FG5A 3OEHD 2CLCX 5DLQC 3TNFA 3ADBA 1A4RA 2GZDA 3CH4B 1GVNB 4NH0A 4DJTA 2A5YB 1Z2AA 2OESA 4B44A 1PLKA 4QFMA 2PX3A 1WF3A 5EP1A 2EYQA 1BYIA 1OXVA 1QRAA 1ZM7A 2ZRPA 3B1XA 3N70A 1P2TA 2VSOA 4RZXA 4BZPA 3AUYA 3IQWA 4JLOA 2Z4SA 5EXTA 2NZJA 2GK7A 3RDPA 4RD6A 2PCLA 4FINA 3KXKA 1JECA 4GBMA 1U9IC 2QBYB 1E2FA 3AVWA 3EIHA 2A3RA 1X6VA 5A4JA 3TSOA 4RD4A 5JJKA 1DE0A 1GFIA 3BE4A 4Q4LA 4P31A 5F9HA 4IDQA 4IDPA 1KO7A 4JBXA 3WY9A 3L0OA 1C9KA 1Z6XA 2HCBA 3I32A 5JWRA 3UKDA 4AWXA 5KYKA 3QKUA 3TVDA 1CRQA 4XWKA 3B78A 2WWWA 3QE0A 2P6UA 5B30A 2SHKA 4LJYA 4L8GA 1P61B 3QPUA 4IVQA 4JIMA 2XXAB 4ZKEA 4HYYA 4DDWA 3OEED 3FMFA 4IHQA 2GETA 1IN8A 1G6HA 1PUIA 2HT6A 2J87A 2WIAA 3MG9A 4I1SA 4C0BA 4DLXA 4XD7D 5ELXA 4LC0A 3TH5A 2R6GA 3NHAA 1M7HA 4UNRA 2P5TB 2QL6A 2W0MA 4MA4A 4YLGA 5EE1A 1W36B 4JVLA 1Z08A 4FCWA 1CJUC 3CZPA 4D81A 2DFKB 1KI7A 1ZBDA 3HWSA 1F3OA 1EWRA 4AC9A 4OHYA 2P0EA 1I2MA 1KMHA 4LGMA 2CVHA 1XTJA 4RJLA 2MSDB 2XZOA 2F1JA 2QGZA 2H8KA 1ZMXA 3QVVA 3E2IA 3IBGA 2XTNA 5KDLA 3CPJB 3DDCA 2PLRA 5UKDA 8OHMA 3THYA 3A1UA 4LK2A 2ZROA 3LX5A 3RRZA 3U7HB 3P1JA 2J46A 4YDHB 3IBYA 1T91A 2XSZA 4TMZA 4NPHA 2O0JA 1T3SA 5CYPA 1SXJD 2B21A 4GOKA 3W6OA 2GESA 1C1YA 3A4LA 4DCNA 1R7RA 1VMAA 4LCBA 4EPXA 4XVRA 3IIJA 3NC0C 2QUZA 1IJFA 4BFZA 3KQUA 1R5NA 2IS2A 1MV5A 3GD7A 5K8UA 1W2GA 4Q7JB 4KYIB 3BB3A 1W36C 3VMFA 3TLXA 3QG1A 1NSTA 4WW0A 1JEDA 1FNMA 5IHPA 2J0UB 1KSHA 2DFLA 2EU8A 4ZCIA 5FUXA 4QGAA 1OXTA 2OLKA 3K0CA 3LBNA 2F3TA 2JLVA 2F1RA 3HU3A 3BC1A 4A8JB 3A1TA 4Z54A 3AF4A 5JEDA 1RW4A 1YE8A 2KE5A 2R6CA 3BWDD 2PJRA 1XZPA 4DSTA 3OIWA 1R2QA 2VHCA 3CH5A 1VPLA 2WIBA 3OE7D 4KJZA 4LSGA 2QY9A 3K9HA 2YZ2A 4XVUA 1CRPA 4V0ME 1P9RA 5JEEA 1XEFA 5B2ZA 4PTLA 5HKKD 1II8B 2B8TA 2ZSFA 1QG2A 2OZEA 1IY2A 4MGIR 2CK3A 1A7JA 4KCGA 4NMMA 3T1TA 4IXMA 1Q0UA 3PIRA 5J40A 3NVAA 3MJHA 4TLEA 3MRSA 5G3ZA 1KJWA 2J3EA 2VP4A 2BV3A 2CDNA 1OFTA 5L8VA 1KZ7B 2PZEA 5KPJA 1U0JA 3IHLA 5JRZA 2CJWA 4X8OA 3TKLA 2I4IA 4IDOA 1YVDA 3TK1A 1D2NA 3UPUA 4KODA 5A5GA 2RGNA 5AK0A 3BH6A 2QM8A 3MWLA 2R6FA 1E2PA 1TNDA 5FUYA 2ODWA 3T5GA 4NCJA 1PVOA 2KBFA 3ZVRA 2P65A 1F2UB 3B5JA 4PC7A 3K0EA 3SE0A 4A8JC 5HE8A 1E0JA 1JR3E 4PZLA 4TMVA 1NLFA 3MGCA 4LJ5A 3Q85A 3R7WA 4BE7B 1KGDA 3M6AA 1B23P 4OI0A 1IY0A 1Q3HA 1UPTA 2VQSA 3LQQA 2NTYC 5SZIA 1TU3A 4WIAA 1VECA 1LNZA 2FA9A 2ZJBA 2NO9A 3KDSE 2PH1A 1U2RA 1ZC4A 1DADA 1E0KA 4LZZA 1Y63A 3NHBA 5DNYB 3X1XA 2V6JA 2HF8A 2X1VA 2I3BA 1II8A 2FV8A 1G8HA 4OHXA 5A0FA 4P32A 4LX0A 3Q5DA 3U6BA 2GJAA 4MDFA 1G7TA 4Q7KA 4XVQA 1NRJB 2ZSEA 2WWHA 3T5DA 2RHMA 3X1DA 4F91B 3U7FB 5CIWA 2QP9X 1PV4A 1BYUA 1OIVA 5FOTA 2FPKA 1ZNZA 2RGAA 2XJ4A 4L5BA 5LB4A 4LBZA 4XWOA 1OHHA 4BGDA 4CEIB 1LTQA 2RKOA 2REOA 3Q9LA 3EC1A 2ODNA 4G3XA 4KBFA 3WNDA 4HLUC 2X19A 3MD0A 4B6EA 1N2CE 2JAQA 3BBPA 4M9ZA 1JNYA 3RRMA 1HH4A 5KNDA 2F9MA 4HLUA 1XTRA 1G5PA 5DHFA 2HYIC 3UMFA 1EWQA 3GLFE 3OIYA 5DN6D 1F2UA 4TYNA 4BFSA 1Z6GA 2GCNA 4RZ2A 4F38A 4D4LA 3W5IA 4PAMA 1CR4A 4DLZA 2C95A 4M1SA 3MUFA 2NMVA 1XJCA 1G16A 2FZ4A 4EJSB 4XIGS 1XJ0A 1ZIPA 1H8ED 4P0TA 3ICQB 1F48A 4BFTA 2G9NA 1DG1G 3TQCA 2GEDA 4Q1DA 5FPYA 2MMCA 4HB0A 3U7EB 2AHOA 2OFOA 5C1BA 3WYFA 2ZTSA 4OHZA 1OSNA 3RHFA 3RVBA 4F4IA 2ZR7A 4FCVA 2BOVA 1NN5A 1J8MF 1W0JA 2HCJB 4M22A 5HZKA 3VR2A 3CUEF 2WSSA 2KI5A 4F93B 3VR3A 4Q5IA 2MSCB 1EGAA 3CB4A 1FMLA 3BD9A 2I1VB 4UJ5A 2ONJA 2WMOB 4HZUA 3P27A 4LJ4A 4CEIA 2VP2A 3EPJA 1ONBA 2QPOA 4PR0A 2W83A 3L82B 5G53C 4B43A 1FNNA 2A5GA 4MGKR 1DAFA 1E4VA 3KUCA 3SYKA 5AR1A 3NG1A 4HLQB 1SGWA 4WBSA 1OYYA 1G8PA 4PPNA 1G21E 2IYVA 1Z6YA 1TF5A 1KDOA 1P5ZB 5FOXA 4ACAA 4ZI2A 1G8YA 2W00A 3EZ2A 3K9NA 1XXHE 4EJSC 2D3WA 2WOJA 4XTCS 4CRWB 3Q8XB 2FGJA 3CR8A 3SBEA 3K09C 4NDZA 5C2JB 4TT3A 1S1MA 1T4GA 3RAPR 4QGGA 2I1QA 5C18A 1Q1BA 3TW8B 3RS0A 1UKYA 2FFAA 4LOAA 1UDXA 4HDQB 2QZ4A 1Q44A 1EFTA 1RYFA 3KL4A 4TMWA 1RIFA 3SJBA 4B74A 3A8TA 4N1AA 3HR8A 5HPYB 1G8GA 1KKLA 5L3VA 2IUUA 4BLOA 1Z47A 2C03A 4L15A 2L0XA 2YOFA 1ZNWA 1YJ5A 3ZQ6A 3L8YA 4TL6A 3CRMA 4E07A 1J70A 4B75A 1CULC 2RGDA 2NIPA 3UATA 5TXGA 1H65A 3QEJA 1NBMA 2PEYA 4TMXA 4EFLA 2HV8A 1RPZA 3AB3A 4Q4HB 1FFHA 4LJ6A 3ASZA 3CIOA 2KBEA 4NCHA 5AJXA 3KQLA 3WNBA 2OEPA 5J5CA 4DIDA 3B1YA 4Q03A 1KAOA 4Q18A 3QKRB 2G3YA 1N6LA 3OFND 4JKYA 1EFHA 3I8SA 2GF9A 3QXCA 1CKEA 2BVNA 1J7KA 4Q02A 4JJZA 2ZUBA 3QPWA 2WJIA 1Q1ZA 1DBSA 3ND8A 1SVOA 5EE5B 2CEAA 3FKSA 4FMCB 3R20A 1QF9A 1CJTC 1G17A 1CR1A 2O8BA 1G18A 2V1XA 3H84A 2GJKA 2Q3FA 3CRVA 3PG5A 3QSYA 5FR2A 2AK3A 2ZETA 2IXEA 4M1WA 2G1JA 4QHSA 3ZLJA 3U61B 1P2UA 2VLIA 1IHUA 2WKRA 1LF0A 1XTIA 5CYOA 3SR0A 3QVUA 4PC2A 5BYKA 3AVQA 3O8DA 3W5JA 3QXSA 3PUVA 1XD9A 3KJHA 5F3WB 1G5TA 4X8MA 4DCUA 4BFVA 3WYAA 4D2IA 3JZAA 4LRWA 1VKJA 3L0IB 3AKEA 3C8UA 1LW7A 2YINC 3VKHA 1SVWA 1DAIA 3IIMA 3ADCA 4CZ2A 2V8OA 3D3QA 2F7SA 5JWHA 3CW2A 5LD2B 4LHYA 2ZRAA 1E2KA 2C8VA 2FH5B 4PQYA 2WICA 2D2FA 4LHVA 1XNJA 4Q4HA 3U6KA 4W5WA 5L3SB 1KI1A 1ZUNB 4A6XA 4O3MA 1IONA 1Z06A 5FL7D 4JZKA 4HI0E 4MUAA 4FMDF 3TUIC 2FFBA 3I3SR 2YOGA 5AUOB 4DIEA 4CF7A 1P6XA 1E2NA 1XMVA 2CL0X 3WHKA 3ZZ0A 1NL3A 2VHQA 2W6JA 1HT2E 3KFXA 2RB4A 1RE0A 1HA3A 2ZITA 1T3HA 4Q21A 1CR2A 4A6PA 4GDFA 3AM1A 4MITA 2BM1A 4GMXA 2ZU0C 3VR1A 4KXFB 3ZVNA 1E2IA 2ZRFA 1RYHA 2R62A 3CO5A 3SQWA 2YWFA 3UXMA 4ASUD 3GCGA 2OCYC 1UEJA 3TSWA 3T61A 2ZR9A 2VHUA 1Q57A 4FWTA 1KI3A 1G19A 1Z07A 1V43A 1D9ZA 5FBRB 4JBYA 4OJQA 1N6IA 4B73A 1IN4A 4IOJA 5F98A 1GL7A 1ZP6A 2J45A 4CIDA 1TMKA 1XZQA 1BIFA 4OJKA 3SBDA 5LD2C 3BFXA 3MLEA 2GXSA 3AGQA 1N0UA 2PT5A 4EPYA 3AVPA 2X77A 3U44B 4C30A 1TQ6A 3FPAA 5TB5A 5IDVA 1R8QA 2YVUA 3ZS8A 5L3SA 3MCAA 4KSBA 3SEAA 4JYCA 5EXSA 4ESVA 3ZYCA 4Q9KA 3QJYA 1UDWA 2F43B 5JI3E 4CEJB 1S9HA 4EFMA 4N3NA 1IN7A 4M8NE 2A5FA 4XJXA 2AD1A 2JJ1D 3WMEA 3L0SA 4RZUA 3FWYA 2FOLA 1HE1C 1XU4A 1ZIOA 1U81A 4WXRA 3RABA 3B9PA 4EAQA 5HZHA 2CCKA 3CX7A 4RD0A 2DWOA 4B34A 1AS3A 3S1AB 4JL8A 1YZNA 1Z2CA 4IEIA 4D82A 2EFCB 4NYMR 2P6RA 3NWJA 5KSPA 4V0MA 4NBSA 4TYYA 2P6NA 2PBRA 2XOKA 2IS6A 2O8EA 4PAOA 1Z5ZA 2BEJA 2IS4A 2CCGA 4JSYA 1AIPA 4HAUA 3N5CA 3PUYA 1TQ2A 3MWJA 3ETLA 2RGBA 3AF0A 3FVQA 2H17A 3LO5A 4KVGA 4QGFA 3SI7A 3SZRA 2GXAA 3IEVA 3NDPA 1N6NA 3LLUA 2ZAOA 3VAAA 3W3AA 4HLDA 2IYYA 1ZINA 4ARZA 1DG3A 4NYJR 1EFUA 1Z0KA 2IEYA 4AKGA 4L4UA 4PO8A 1MABA 4DUGD 2ZRLA 5FBLB 5DO9A 3F5FA 2DWPA 4P4UA 4TQAA 2JLUA 3C5CA 1P7CA 5CDFE 2GWHA 3NBFA 3GLFB 1T5IA 1VYVA 1JXMA 3HU2A 4L16A 1E2LA 2WMNB 1JR3A 3IILA 4PHHA 5AJVB 3FHOA 3M4YA 4PQRA 3GEIA 4GT1A 4NHOA 3BORA 2KB0A 421PA 1LV7A 2QTVB 5EXPA 1P2VA 3CPEA 4HAXA 5G3YA 3S1AA 3AVYA 4D0LB 2BBWA 2H1LA 4M1YA 4TL9A 4GSYA 4LYJA 1Z63A 4NYIR 3QOFA 2JASA 4BRWA 4YQFA 2O0HA 4EDHA 1Z0DA 5IK2A 5KSYA 3K70D 2GRJA 2XNDA 1TADA 2BJVA 2EWWA 5HTKA 3UANA 2EVWX 1X86B 2DCUA 4A9AA 4Q1AA 2A78A 1RJ9A 2ZYTX 3JZMA 1ZU5A 1KHTA 2W58A 2ATVA 3VR4A 1H8HA 4DHEA 1KJYA 1FUKA 3CR7A 4GRAA 4PO1A 4Z51A 1GG2A 2BKEA 721PA 1N0VC 3N2EA 2D4HA 4KAXA 1LY1A 1TUIA 1ZAKA 4BLSA 5G41A 1NLYA 2WZQA 2YWGA 1SKQA 1AK2A 2O8CB 1VHLA 4G5SA 3A1VA 3TVTA 4QHYA 3GLFA 2PT7A 2YJTD 3QF7A 2V7QA 1ZW6A 3P4XA 4AYWA 5JJIA 4MKGA 4B3XA 1T8UA 4TMKA 1BOFA 1GL6A 3TBKA 1II0A 3A4NA 3EG5A 2V54A 3ZIAA 3NEJA 3R9WA 3AVXA 2QROA 1YHNA 2N42A 2BBSA 4QJ4A 1UM8A 1JPNA 1YRAA 3BIFA 4G5RA 1E79D 4O2LA 4B6FA 2E87A 1GKIA 4URZR 2A2ZA 3H1TA 5C46F 3GLHE 1N6OA 2O0KA 3FHCB 1LS6A 4DLVA 4R7ZA 1QHGA 4EQ6A 3CZQA 4G5GA 5E7IA 3GLGB 4TMTA 3VHLB 2V1UA 2EYUA 1TU4A 4OHVA 4FMDB 4A15A 3F8TA 5BN4A 1QBKC 1NBME 4D0NA 4U00A 2EWVA 2JLWA 2IUTA 4CYMA 1JALA 2ZRNA 3W6PA 3AEZA 4JYBA 3LD9A 4HDCA 5BWMA 3FMPB 1RFLA 5E7MA 5JSZA 1KI2A 4XH9B 3QBVA 1S3SA 3LX8A 1P9NA 2WAXA 1M8PA 2DR3A 1CP2A 4OHWA 2C77A 2QMUA 1CF4A 2O8DA 1HQCA 4OL0A 1XXHA 3RS2A 2J0VA 5E95A 3UIEA 4M9XA 4KO8A 4HAVA 4DZZA 3E5HA 4R2IA 2J1LA 1EFRA 2D06A 3VX3A 1F2TB 3BOSA 1ZVQA 5GJVC 1ZD1A 2Z43A 1U9IA 3AP3A 2VEDA 2MMGA 4KBGA 3C7KA 5JZVA 2CCJA 2FNAA 3D31A 2XB4A 4BZQA 4AYXA 3LVRE 4E03A 4UJ3A 1HV8A 1LB1B 3QUSA 4JLMA 4DB4A 2YWHA 4LV8B 4C9BA 2NQ2C 5EE0A 3L2OB 2J7KA 4NKRA 3EW9A 4OQFA 1U90A 3IPXA 4GOXA 3W3ZB 2IYTA 1KY2A 3AF2A 2F6RA 2ONKA 2JCSA 1JB1A 3AV0B 1D8TA 1G5RA 3QIAA 4Q4JB 2V3CC 1XPUA 1UBGA 4G01B 5BXQC 2REBA 3RSLA 1QHHB 2NO1A 3FB4A 1SVLA 2GTPA 1KDRA 1WCV1 1WBDA 2RMKA 2Q6TA 2LWIA 2NO7A 4Z1MD 4A0HA 4LJ8A 3NBZC 1UBFA 1MRSA 1X8KA 4TN1A 5TDHA 2ZJAA 1V5WA 3QY0A 3CWQA 1F2TA 1Q22A 1M34E 2QBYA 5JS8A 5E4FA 3U3OA 5IRCD 3ZIAD 4DSUA 2VPPA 3CBQA 4TLDA 1XPRA 1VIAA 5HR5A 4K46A 1U0HC 2ZSBA 5FBWB 1YQTA 1R5BA 3B2EA 4I1VA 3RS5A 2F55A 3W8NA 4TSFD 1G7CA 4OBEA 2REXB 4OI1A 2BJWA 4MRPA 4LY6A 4URYR 6Q21A 5LDDC 3U60B 2QSZA 3BJIC 4EKDA 4TQ9A 1S1CA 1JAHA 4ZPXA 2Z0MA 1KKMA 1TQ4A 2CNWD 4F4JA 1AJEA 1FTNA 4WZ6A 4TLAA 2XXAA 1X8LA 4AKEA 1BKDR 4DLRA 3LY5A 1R5OA 2GEVA 2PL3A 5JRJA 1JAIA 1KO1A 3A58B 1A82A 4JL6A 2ECKA 2W2XA 4GNKA 4AG5A 1G3MA 1W47A 4CT4B 3B60A 4MRSA 1YZGA 3PV0A 4IFEA 1Q1EA 2VF7A 4Q1FA 4FD2A 3ONWA 2W2VA 1E2MA 4C2TA 2BEKA 2C96A 2XTZA 5HE9A 1YZKA 3D8BA 2QE7A 4B33A 1YZUA 4MDEA 3ZVMA 3FYHA 5KDOA 2CHGA 4GMDA 3TR5A 1T6NA 4ILEA 4NP6A 2XZLA 1ANKA 1F60A 2IYUA 4ZIRB 2CBZA 5EJEA 2ZJ5A 2IYWA 4BEBA 1YZQA 5D3QA 3ICEA 4WXPA 4RFVA 3UG7A 1D5CA 4M1TA 1AS2A 2OFXA 3BFKA 4B48A 3HYRA 4HAZA 2EQBA 3ZS9A 3TQFA 4BRUA 3DMDA 4A82A 3LW8A 4XOIA 2XB2A 5K8IA 1M1YE 1TEXA 1GILA 3TUJC 4UNPA 2RCNA 1Z3IX 2H16A 3NC1C 1NKTA 1W4CA 4M2LA 3B7GA 3GJ4A 4YC7A 4OQLA 4M53A 3X2SA 3GMTA 3AVVA 2J0UA 1JPJA 1BO6A 4PO9A 1KK0A 3VKWA 1XPOA 2ZS7A 4Q9HA 1NNEA 1E9FA 2GZAA 3IO3A 1W0KA 4A8JA 2J9RA 1Z0IA 3I1FA 4QJ3A 1NJFA 3I5XA 2JATA 2HDNB 5GJBA 1ZCBA 3I72A 2RGCA 3MSXA 2B7CA 1VIYA 2KSQA 3AVTA 1U8YA 1Z83A 2GJ9A 4C0JA 1COWA 1PUJA 5DGXA 4NCIA 3IDQA 3Q5EA 1ZNYA 4GPTA 1G7RA 3NH6A 4ZIRA 5FBVB 5L3QB 1R6BX 3WXMA 1S2MA 3EPLA 1E9DA 5DYGA 3M0EA 4PSVA 1A1VA 1QHSA 1J90A 1OE0A 4Q48A 1UJ2A 4R98A 1GSIA 4OK5A 4KLNA 2FE4A 2HJGA 2V6IA 2YNMA 1E9RA 3K1JA 3THWB 3GFTA 5B58C 2XITA 2XSZD 1JI0A 3T1VA 4URVR 1KSJA 4URXR 5JWOA 1ELOA 1R10A 4D4KA 5LB2A 1IXZA 4XSGA 1P3JA 3IPYA 4PXAA 1KYIA 1UBCA 2XEXA 4D26A 1CBUA 2WVJA 4QHTA 5J4VA 1WXQA 2GDJA 4OQXA 4QNRA 3CRQA 4QKQA 2GILA 4URUR 1MKYA 1XMSA 3EZ7A 2ZI5A 4RKFA 5CDFA 1VCMA 4D4JA 4M9SA 1L7VC 3QXJA 1ZM9A 2IWRA 3SS8A 3LA6A 3AF1A 1NMYA 1W36D 5F2EA 2ZRIA 1OFHA 2A30A 2A5DA 2OBNA 4CDGA 3CNNA 5FFMA 1MR3F 1G4AE 5EP2A 1CXZA 4DDVA 1BMFA 1KNXA 4POAA 1FX0B 2D74A 3P32A 2AWOA 2ZJ2A 2GJSA 4PZZA 5SZHB 2ZYUX 1XCMA 1E0SA 2FSIA 2UVQA 2W6IA 4DVGA 4LYFA 1WQ1R 1R8SA 3GLHB 4H1UA 3VQTA 4C7OB 4ON9A 2FSFA 5LBIA 2WWFA 2CLDX 2OCBA 2CK3D 3KQKA 3FHTA 1OT3A 4NONA 4RY2A 4US2R 3THWA 3NH9A 4AYTA 1OKKA 5JFGA 3FGNA 1U8ZA 2G88A 4Z8XA 1R0XA 1GOTA 1YKSA 1S0UA 3GLIB 2GVZC 4HUTA 4I99A 5KPDA 1E2QA 4KFUA 2JDIA 2HLDA 5CJ2A 3SQXA 3Q7PA 2AKYA 3WHLA 1E9SA 4BLRA 1SXJE 4TL7A 1AGRA 3QXXA 1P4SA 3UWKA 1C4OA 2GEUA 5FTLA 1GNRA 4R2HA 5DE3A 2GA8A 2JJ8A 4PC6A 1VCIA 4UNNA 3PEWA 4C2UA 4Y0AA 2AK2A 4EJSA 2FF7A 1XMIA 1SVIA 3SFVA 1IOZA 1FP6A 5JMTA 1GWNA 3K09A 3V9PA 1OPXA 2WJGA 1GNQA 4E09A 2CVFA 4UQOA 2NOAA 1P73A 1YU9A 1P2SA 1XF9A 3PVSA 3X1YA 4JT2A 2QP4A 4HDOB 4F92B 2FJUA 1T8TA 2BHRA 4NL4H 1T0HB 2R6DA 3F0TA 2HJVA 4R9UC 4A2PA 3GLHA 4X8HA 4EIWA 4FN5A 4BUJA 2IYQA 4AD8A 1WDTA 5AJYA 4BECA 1CS4C 1GZSA 5ANRB 3SHWA 3GLGE 3ND9A 1NSFA 1DS6A 4LV5B 5KUTA 1LS1A 3RWMB 5DI3B 1IN5A 3K0FB 2JLXA 1IAQA 5C4GB 1KK1A 3GLIA 3BS4A 4KFRA 1DO0A 1G9XA 5EUMA 3KKQA 2IYSA 4HAWA 2IYZA 2H92A 1OHHD 2PMDA 4UXIA 5GJWC 2YC2C 3CNLA 4A0GA 2OUKA 1DO2A 1XB2A 3W8RA 2QTHA 5KU1A 2Y8EA 3KKNA 1GL9B 4Q4AB 3SNHA 2Q0HA 2A5JA 3CX8A 1N0WA 3ZZTA 4IJMA 3SU8A 4AKIA 3U5ZB 3WMGA 1OB5A 3VKGA 1IXSB 2AXPA 4LPSA 1KSGA 4ZKDA 2YKGA 3LQRA 1VHTA 4U7DA 3C5HA 4URWR 2VP5A 4WVFA 3KQHA 1GKYA 2H5EA 4GOJA 2QNRA 5GVRA 2YYZA 3NEYA 3BH7A 3TGPA 1Q21A 3EAQA 2ZPTX 3RC8A 2VP9A 1FZQA 1ZNXA 2RHDA 4OQNA 3CRW1 5DI9A 2ZRHA 3FKQA 2IYLD 4ITRC 4LHZA 1FW6A 2IF2A 2ZI9A 1AGPA 4PAQA 2ASEA 2ANCA 3AP2A 2VP6A 1W0JD 3C15C 1U94A 3KTAB 2WSSD 4U02A 5JS7A 1A5TA 1FQKA 4IEEA 4JS0A 5DI3A 3O8CA 2WSMA 4DRZA 1MO5A 5CITA 1JR6A 1VG8A 3GQBA 2J7PA 4D0GA 4KFTA 5KSZA 5F9FA 4LHXA 4EPRA 1ZUHA 1G3IA 4WZBE 4ZDIA 1CTQA 2WJVA 5JCZA 3VFDA 2ZI3A 5EUQB 4TLCA 3QKRA 2IYXA 3VU9B 3E1SA 1AKEA 1OJLA 3I73A 1M7BA 2AFHE 4M21A 5TARA 1E9CA 2OCPA 2NO6A 3CF6R 3QEOA 4W5HA 3PEVA 2IS1A 1A2KC 4R71A 4NYMQ 2ZU6A 3D7MA 3NIBA 4V02A 1IBRA 1U0LA 2EFDB 2QORA 5FOWA 4PFSA 1II9A 1ZCAA 2OM2A 1I4TD 1TF2A 4B32A 1E3MA 1TUEA 4J0QA 2J5XA 2GXQA 2NO0A 3B8HA 1UKVY 2DHRA 2QN6A 4TT3D 4I1OA 1NMZA 3U7GA 3VNVA 3QG5A 4P3YA 3OAAA 3WNCA 1R0YA 2N1BA 3NKVA 5FI0B 1J2JA 1NF3A 4KVAA 1E6CA 2VA8A 5CIQA 2AX4A 1G4UR 1XD8A 2HYDA 2RGXA 4QXAA 1OV4A 2WPDA 4Q1BA 4OI2A 4QBFA 1RKBA 2C99A 5DHAA 5KNCA 2Q9AA 4CEHB 3B1WA 5JBQA 2C04A 1SULA 4NYJQ 3KTAA 2H7VA 3IHWA 4MYUA 1RRFA 1E1QA 3DL0A 4JLJA 2HXYA 4JBWA 4TQUS 1SHKA 4AK9A 1D2MA 1Z6TA 1O3YA 1HE8B 4HB2A 3KKOA 1Q12A 5FH9A 4AG6A 1CJKC 3RS7A 2AWNA 1GM5A 3DOFA 3O8BA 3PXGA 5J4KA 1KJZA 1E32A 1NBMD 1XX6A 2VHJA 1GITA 3C14C 4LDJA 3I5YA 1QDEA 2JJ2A 4BZXA 1S8FA 4OI4A 5FTJA 1CJMA 4K8OA 3OZXA 3GFOA 3W9YA 2YOHA 3L8ZA 1WP9A 3DKVA 1E96A 1A2BA 3H86A 2ORVA 3H2YA 3X1WA 2GAAA 1NY5A 3SJZA 2IL1A 2GVDC 1RRCA 1CEEA 1GDDA 5DH9A 2YV5A 1ZM3A 1BS1A 1SQ5A 3FKSD 4C3ZA 4CW7A 4A92A 3DKPA 2P67A 4BWYA 3IIKA 2JA1A 1NVVR 5FTNA 1VYUA 2BC9A 1T3LA 1OIWA 1RC8A 1P62B 2FU5C 3T15A 2GAOA 4JJKA 1W2HA 5FUVA 4CEHA 3B82A 4TTPA 4C0SA 1KDPA 1NN0A 2CL7X 3TR0A 3H0KA 1R4AA 1KY3A 1YR9A 3GJ5A 5H8WA 3LXRA 3KXLA 3AUXA 4TWZA 3V00A 1ZJ6A 3U44A 3THXB 3GFPA 1E1RA 5IT5A 2RGGA 2NPIA 4X8LA 2QMEA 4YMVA 1FTSA 2CLSA 4NE2A 2LCFA 1K5DA 1ZM4A 4TTRA 2F43A 2QAGB 2FN4A 2G1KA 3F3YA 5SZJA 3ZDQA 1F6BA 4CEJA 3BB4A 1DAKA 1YR6A 1N25A 4TZ6A 1AN0A 3PUXA 4Q7LA 4D80A 4Q9LA 5CM8B 2BCJQ 2Z6VA 4TYWA 2FSHA 5D3MB 2IWHA 3OEHA 5K8TA 1E0AA 3KB2A 2B7BA 1G64A 2QG6A 1R0ZA 2OT3B 2OHFA 2W6JD 1QZXA 2CL6X 3BB1A 2C9OA 1D2EA 3EXAA 1R0WA 1Y3AA 4B2PA 1XDBA 4DEXA 3WP1B 3L0PA 4O0MA 4B35A 1Q1QA 1Z22A 1P75A 1E2GA 4PPQA 1G8FA 4S2EA 3QKSB 3CLVA 2ZRCA 5TV2A 3BFVA 3OAAD 2IT1A 3ZD7A 4OYHA 1HURA 4F7WA 3DZ8A 3PJRA 3Q7QA 2Q9CA 1XEXB 4G0NA 4PHGA 3V4FA 1XTSA 4K81B 5JI2E 1OH8A 1UADA 2PCJA 3K9LA 4GI7A 3CKLA 4NZYA 1EK0A 2CE7A 1XCPA 1TF7A 1E1QD 4DSNA 4GZLA 2QENA 1IJEA 3TUZC 5FI1B 3VR5A 4QG7A 4DSOA 2YWEA 1X1RA 4RZ3A 5CB8A 4C0LA 4D25A 4U5XA 1MO6A 2IA5A 3G5UA 4G1UC 2R9VA 2F1HA 5FOSA 3ZJYA 2QQ0A 3JVVA 2ZRBA 2HEIA 2WWYA 1SXJB 4RD2A 3DOEA 4US0R 1DOAA 4RKEA 5J4HA 4IKEA 4A0RA 1T5LA 4N0DA 3OEEA 4L9WA 4QRHA 5D3MA 1N5LA 3IGFA 3LH5A 4IOMA 1GRRA 3KFVA 2O8FB 2DWQA 1AKYA 3LRPA 4XD7A 2R8RA 2OBMA 3U4QB 4B3FX 5J4LA 4Q47A 3I4LA 1NMXA 4DCTA 2G77B 2P2LA 4B2IA 1EESA 4XTRA 2E1RA 4WAUA 1W49A 3BK7A 3IUYA 3SHFA 3EASA 4P33A 3R8FA 4M1MA 5H1YA 2ZRDA 1W7AA 1KMQA 4US1R 1JBKA 2PX0A 1I2DA 1XEXA 2F9LA 2QMOA 5DIFA 2XOKD 3CRRA 3KJEA 4IOKA 4G5OA 1JXOA 5TY0A 2IK8A 1QHNA 1FQJA 2BMFA 2GJ8A 1TQDA 4JSTA 4V0KA 3J81k 2AFIE 3WP0A 1RVDA 2D7CA 1PZNA 3GLIE 3BXZA 1HEIA 1KO5A 2PZGA 3EWSA 1OFIA 2OAQ1 3AP1A 1ETUA 1G291 3NBXX 2ZE5A 1M6NA 2VO1A 4UXHA 2OSBA 4HB3A 4QOSA 1L4UA 4DKXA 1E1RD 4N0EA 4B3CA 1SXJC 2GCOB 5J47A 1UAAA 3VNUA 2WTUA 3SOPA 2O8CA 4F4CA 3P4YA 2QA5A 4B2LA 1WB9A 1SXJA 4PANA 3PCRB 1ZYUA 4AIIA 4WOPA 3GJXC 3AH8A 5CM9C 2ORIA 4MQBA 3TE6A 2OO7A 1DAHA 1N5KA 3GJ3A 1DAGA 1ZM2A 2WJJA 3ECCA 2FFQA 2TMKA 5JJLA 4TLBA 4EPWA 1JR3D 1E9EA 3TW4A 4W9MC 2V9PA 1J8YF 2ZUCA 4V0OA 1UKEA 1QHXA 2GXUA 4ZDKA 2R6AA 3B85A 4C0AC 3EX7C 4AI6A 4DLWA 4HAYA 3PENA 4OK6A 2ZM5A 2ZANA 5M04A 5FL3A 2D7DA 1KIMA 4IRUB 4YMUA 3I61A 1CR0A 5IK2D 2BWJA 3BH0A 2XNDD 4EUNA 3OE7A 2CMKA 2IC5A 4YMSA 3GLGA 4V0LA 3ZVLA 3I62A 2WKPA 3IEUA 3EZ6A 3W90A 1CLUA 1KO8A 1KMHB 1ZD8A 4UKDA 4H1VA 4W5JA 4AURA 5GADl 4PPGA 1EFCA 2W2TA 4IDNA 1DVRA 5HKKA 3K0AB 3MWKA 1P9WA 3FTQA 1H8HD 4DBLC 1OH6A 4I4LA 3DEFA 1SVMA 2PMKA 2QU8A 3KJIA 4HATA 4JVSB 4LJ9A 5EZ5A 1OXUA 2GCOA 2WWIA 3GPLA 1QHIA 3HU1A 3THYB 1SKYB 4MRVA 2LKCA 1EX6A 4JLNA 4JLAA 1U99A 4RFSB 1HYQA 3MWYW 4WZAE 2G0TA 2VHTA 1Z0AA 3B13B 2ODBA 2FZLA 4YXWA 2BCGY 5KHOC 2V7QD 1FP7A 2A7QA 4QBIA 3BRWD 2FGKA 3HP1A 1NVWQ 3FE2A 2X2EA 4LJ7A 3SN6A 4RVCA 4FXPA 2IHBA 1E94E 4QL3A 4KV9A 4NU0A 3T35A 4IXNA 2FX3A 1K8RA 2WWGA 2ANBA 4KI0A 3WYGA 1AM4D 2PEZA 3U3JA 1DELA 1HQYE 2FPLA 2JLZA 5CB6A 4HZIA 4ZDJA 3C41J 4MUBA 4Q00A 3WBJA 2OCAA 1AZTA 2J41A 1XEWY 5FTKA 1MRNA 3HPQA 2VIIA 2G83A 1KI4A 3D6TB 1ZUIA 4JMPA 3K0AA 4TZ0A 5BQ5A 3R9XA 521PA 5EE9A 1IQPA 5AJZA 2ZYWX 5JLJA 1AQYA 2AN9A 2BMEA 2QRNA 5E7JA 1UKZA 2ZVQX 4Q4JA 4ZDWA 1TAGA 1VTKA 1NLZA 4RFSA 4M0LA 2ZE6A 4LUCA 1QHHA
chains in the Genus database with same CATH superfamily
4LRTB 1TX4B 2Z2ZA 4OB7A 4HDSA 4H6XA 3V6MA 1M1UA 2NNWB 4QU8A 2B61A 1WW8A 2JAXA 5EZSA 5JAQA 3IUJA 3VHXA 3HYTA 1I2ZA 1MT0A 3OHMA 2CE2X 1USIA 5A3JA 1YZTA 4CF4A 1Q11A 2CJWB 2HV9A 5FQOA 1A4IA 3ZN2A 5JAMA 5KYYB 4FPXA 5EWJB 2AT1A 2J0QA 3ILHA 4O4HF 3BTVA 3R9IA 3AX6A 1RBZA 1S9DA 2WKQA 3OWOA 4C4SA 1AKUA 1SC3A 2PAAA 3TBFA 1R0SA 3UJHA 1QIDA 2PH7A 2ZS9A 2NTVA 4GC5A 1W5SA 3QGMA 5K0JA 3GLVA 4F8YA 5CJPA 3NTQA 5K4HA 3CYFA 2FP4B 3LO8A 3N2IA 4M0KA 3HJNA 2BM9A 1PL0A 2D0IA 3EGOA 5T67A 2QU7A 2B92A 3I04A 4DQVA 2DU8A 3QBTA 5JZOA 2ZI4A 4JVNA 3PXAA 4JVMA 5U4QA 3CNOA 1P0PA 4X6XA 3PITA 2ZEJA 1U0GA 2C3MA 1T9AA 4GP7A 1M6HA 1FRNA 1MV8A 2X4IA 4MZDA 4Z9AA 2CYAA 2RB5A 4EJ6A 3H13A 4JLBA 4EX7A 3RVLA 3V7UA 4EHKA 1UWCA 3JQ9C 1TK3A 2ZAIA 3T34A 1CE8A 4CQLB 5AUNB 3ETHA 4E31A 2FWNA 4DR2B 2E1PA 1MOZA 4FMCF 2XMGA 3JYOA 1GY8A 3IE0A 3AJDA 3ONDA 4FHCA 2EW2A 3RSZA 2Q6KA 2VHYA 1VC2A 5DGDA 5HK8A 2PK3A 4QGHA 4U7PB 1N6HA 1O0SA 4DLSA 3CNBA 4H7IA 1X70A 1NI3A 2XF2A 1FTQA 1TA4A 3NV7A 2DLCX 1T24A 3A4YA 4FIDA 2QP3A 1LQUA 1GKKA 1KJJA 2RGNC 3CW8X 5K0TA 4MMXB 4Q3EA 4JI3B 1GNSA 3UMSA 3U5TA 3NR2A 3X2EA 2HD4A 2AEJA 3U3KA 4YXWD 4RGQA 2CLHB 3W78A 1PJ3A 5BR8B 3AESA 2WA1A 1BRTA 1LLDA 3UMRA 2ZRMA 2X9QA 2BI7A 1Q0QA 2GZSA 4U0JA 4C4PA 1MTZA 2P2CA 3II6X 5H59A 3T4UA 4N6GA 4U39A 5IM4A 3K6RA 3MA0A 4AZ0A 5CA1A 1PNQA 4FWIB 3RU2A 3RC3A 1K5HA 2OBBA 3MFYA 4DNPA 3H8WA 1KDVA 5DSZA 5GONF 2AKEA 4LZAA 2PUDA 2IYRA 4QBHA 2FMTA 1I4LD 1MB4A 3D1JA 2EEZA 3MVEA 1NNLA 3QI2A 1NFRA 3OP1A 4D6PA 1QHYA 3W2GA 3LL4A 5H4GA 3MWFA 5TIIA 3W5UA 4LY3A 3CTPA 1ECJA 3AETB 1LVGA 1M0EA 2GZHA 1QIKA 3D4BA 4EJ0A 1T1GA 1RS0A 3KLOA 1CUCA 4KFSA 4KI7A 4RADA 2NYVA 4G1EB 4K86A 2WF6A 2YC4C 3H5NA 4MYTA 4RE6A 5EG5A 4LNUA 3EN0A 1EX7A 2AZTA 3OMWA 3UG6A 1HY3A 2ZRKA 4QE3A 1DCMA 1HYBA 2Y76A 4YAOA 3K9GA 4WEOA 4W9NC 4Z2YA 1YBFA 5H68A 5A5EA 3N7UA 2Q62A 4EUNA 4CI0B 1N6RA 2QPLA 3VSAA 5EOVA 2H4JA 3WVNA 5T3UA 5C3UA 1INLA 1Z74A 5DYYA 1KDTA 3BMQB 3DOJA 1WPQA 2M6KA 5JAPA 4MVJF 2IV7A 3DTVB 3OFNA 1EJ2A 2WIJA 3QVGB 2QSYA 3A6ZA 1RTTA 4CTJA 4EZEA 2F90A 2PSJA 1YNSA 1JQEA 1V8BA 4IH9A 3SDZA 4F3NA 3HBFA 1LCIA 2WZDA 4KYUA 3FPLA 3R23A 1JDTA 3EFBA 4RELA 5L3QA 3TZEA 4H59A 4BCDA 3ZE6A 1WXXA 2PPLA 3QHPA 4NHEA 5JXIA 1EG7A 2RHOA 2ORYA 2UXDB 2H2FA 2IYOA 3H16A 1TVMA 3HPRA 2ATEA 4AJPA 4RY9A 3HVUA 4C7BA 4CGZA 3MS2A 2PM8A 4UOQA 1L2TA 2BUBA 2A1TS 2OHGA 3OTWA 4ATNA 4DCVA 3PCXA 2WD8A 4MUXA 4GO1A 4I5EA 4JI7B 4Z4FA 4FS8A 1V8PA 3BXHA 2ZW9A 1OFUX 1P1IA 1V39A 4QNMA 3WO0A 3RCBA 1IM2A 3QV1A 4B3DA 1BX0A 4E30A 1WSDA 2YJGA 1M8JA 3MHPA 5AW9A 4AZWA 5ERXA 1SD1A 1TPZA 1VOTA 5HFAA 4XLTA 3I6MA 4Q66C 5KOYA 2B4AA 1RRKA 1XD2B 5HCNA 1AK9A 3A1WA 1TUBA 3JW8A 5TPZD 4N8EA 1SQFA 3GRRA 2B83A 4JYZA 2BTEA 2PQ2A 3N7AA 4M36A 3M6MD 2CSUA 3LNCA 4R8RA 4B9AA 4GEGA 4PYJA 4PSDA 1TTTA 1WRBA 4FGZA 1O6ZA 4TV9F 1Y8ZA 2PTHA 3UK6A 2VYND 1HT1E 4QU9A 4M98A 4UUQA 4YCMA 1SHZA 1C0EA 2IDKA 3P2IA 1ECCA 3KKZA 4KPEC 4YMWA 1TGVA 3TRDA 5JCXA 1Y7LA 1R15A 4UHFA 2HZ7A 4J16C 4BTEA 4HEJA 2BIFA 4KRYA 2FX2A 4NG5A 3JARB 4EK9A 1VFPA 3PGXA 4QATA 4ZVLA 1MW8X 1Y1PA 4CMKA 3ZDXB 1GPNA 3KQYA 1QFMA 1NAIA 4DXAA 1CUYA 4BO3A 1UIMA 2W2PA 3AU8A 1WV0A 4ECAA 1KZGB 4JXKA 1ND5A 2QT1A 3R8CA 4CN9A 1JHXA 2YH2A 4Y0VA 1TECE 3NAGA 2QM7A 1VJRA 2Z9DA 1CFJA 1QK3A 2ZYRA 3LKDA 1U8XX 1QU3A 1DQRA 2R8OA 4KYTA 5HCUA 2EFHB 3A6JA 2XUPA 3LNTA 1J1IA 4L5CA 1FVFA 3KKMA 4HNRA 3CN9A 4NJEB 3KUXA 2X9LA 5FWYB 2YHIB 2P40A 1DP4A 1MEEA 3EMKA 4QGSA 2YFQA 5LQNA 3GP8A 2WJAA 2VYQA 3OD5A 1OGJA 4HDNB 3H2KA 4O4HB 4U7WA 4PONA 1TAQA 4Z4HA 4JP5A 3YASA 4KP7A 2IIVA 3K1AB 4QUEA 2P79A 2ZJ6A 1T8YA 4XDYA 1Z0FA 2DSTA 2X0JA 4F3YA 1Q95A 5GOTA 5NLLA 3LYLA 1XA4A 1P1KA 1X13A 4EY5A 3BGWA 4I81A 1FC0A 1Q1AA 1T26A 4P7KA 1ISRA 3LDAA 2GPJA 5CNMA 1E3EA 1TCBA 3TS1A 2F8SA 2PUHA 2PL5A 3IODA 1LA2A 4RF4A 1ESNA 2R44A 3CNHA 3COZA 1OLXB 1PHPA 2FW8A 4P4NA 5EKXA 3LUBA 3QVKA 3R8XA 4E2XA 2KJQA 3LBIA 1BMFD 4KZKA 5EEGA 3WB0A 2HIGA 5E2AA 3FH0A 3AOEA 4E2FA 5BY2A 1U3FA 1N3YA 2NU8B 3GRVA 4DQKA 5G40A 4I4IA 3WDSA 1PBNA 3G1UA 3JD4A 1A0OA 4GFDA 4PM4A 2O3JA 2WBLC 5LMCA 3DE5X 1YJQA 1YBAA 5P8WA 1ZK0A 2W2KB 4ERXA 1DDOA 2V5VA 3D6FA 4KPFC 3OT1B 2PZ8A 2BM0A 1ZCFA 2QD2A 4LTNA 5LA6A 4RK5A 1DJMA 2VRWA 2GBLC 4ZC1A 1I3NA 3C3MA 3W34A 5JPCA 3WGKA 4F2HA 4MUIA 3D7KA 4KIJA 1YZ3A 2GBLA 4I4CA 2VDOB 4X90A 5K0NA 3CPSA 3GT3A 1XEWX 4P7JA 2OSVA 1DG9A 3H1GA 2DHQA 4KDCA 4ZZ2A 1XELA 3TYXA 4BNFA 5HNKA 9ATCA 2VHXA 4FQ7A 4Y2SA 2HGSA 1AN9A 2Y9MB 2YIVX 4JLKA 5TMEA 3QYFA 2EX1A 1WVIA 1I6MA 1YJCA 4LJAA 1U8CB 5JXJA 5D3KA 3G1WA 3GEEA 2AEFA 1EIZA 1UEIA 5FBQB 1YXMA 4BLWA 5JD4A 4P4TA 1JTVA 1ZJ4A 1T1IA 2FSGA 3OZRA 4RFLA 5B2EA 5K01A 1OU4A 1YS2X 4HQKA 4KHZA 1NV8A 2JFQA 2RAPA 1HL7A 3B6ZA 4YQZA 1DARA 1ZGZA 5D6OA 4BX3A 4DUGA 5JHGB 1ZCZA 2WKWA 2W4QA 2PUAA 1VCNA 3FYDA 3OM0A 2XDQA 3UJNA 4YK7A 3PHLA 3TXAA 4R4JA 5EHIA 3MCZA 3B1FA 1ONSA 2Z83A 1GZHB 3G2NA 3GJQA 1XROA 3E70C 2VYFA 2K2QB 4HWGA 4F6RB 4CIYA 3EC2A 2V74B 3RANA 2R25B 3SG0A 2RBEA 3C6KA 1HE4A 1TIPA 4DIFA 5CD1A 5FNZA 3W77A 2P2ZA 4BZZA 2D2IA 4C0HA 2QXTA 3FNEA 3U4IA 4O0LA 5KX5B 3M89A 1NW8A 2QD4A 1QNFA 2NPFA 4NCNA 5E3HA 4BDTA 3L7JA 1JYFA 4QQFA 3JR3A 3CPHA 3GDWA 2O2GA 4HDMA 3AVOA 3N7TA 4KQJA 4MH0R 4DABA 1KI6A 1DTSA 3HZZA 4AMYA 2QPAA 3WGLA 4LWZA 5FJJA 4DDHA 3L4KA 4BQSA 3R3YA 4GEKA 3ZQUA 4ZT5A 2VRBA 2VSXA 3QENA 3ZQJA 5IC5A 1C14A 1ODTC 3LCJA 5CU7A 1YUMA 2JFXA 3T52A 3ME5A 3S2EA 1PR0A 3GFSA 3EA5A 4M38A 4LX8A 4D96A 5HS4A 3G2HA 3FJ1A 3VR6A 3IBTA 3RYHB 2Y93A 2N9UA 2E49A 2ATXA 5KINB 3AR7A 5LQJA 2D2EA 1GPAA 3K5HA 4HG2A 4ESHA 2ENWA 3DNPA 4V0NA 5CD9A 4WFIA 2GO7A 3DBHA 2FPRA 5AUPB 1C0LA 5EE3A 4ETWA 2K4MA 2VXOA 2VWGA 1QUEA 3LUPA 1Q0TA 1L7XA 4LRUA 3E1KA 4KQ9A 3TG8A 3BSWA 1PFKA 2BBOA 3DFKA 2J08A 1RKVA 3ADKA 4ME6A 3EZ9A 4F3KA 2R97A 3P5BA 3F49S 1TO2E 3O95A 3PC7A 4BLQA 3REFA 1WZCA 4FKZA 1WE2A 1ZD9A 2AB0A 3ND5A 3PFKA 4MAFA 4A1FA 4M0FA 3VKUA 5F51A 2HL6A 5K3AA 1VE3A 3OFKA 3B20A 2A4MA 3DB2A 3FOWA 3HVHA 4WDRA 5LM3A 4JUAA 3RKSA 1NT2A 2FPMA 1D7AA 1NJGA 1RLJA 1ZIDA 2G08A 4BBJA 1BHSA 4GM4A 2IXGA 4FGWA 2XUIA 2R6ZA 2J7PD 4JKIA 4Z9XA 1US8A 2OE2A 3ZQ4A 2UZ1A 1YVUA 4UC0A 1DJOA 2W2QA 3GQVA 3DO8A 4O25A 4B82A 2GK4A 1T9HA 3DZBA 3PQ7A 3W6NA 1VCOA 4BMCA 4Z9YA 4E33A 1D6SA 1W48A 3NCTA 3TRFA 3HKCA 3PE6A 2VZ9A 4JYAB 2CVOA 4RZQA 2OBFA 3M1IA 2G80A 4AULA 3TTUA 3JTEA 4MUEA 4P35A 5DYIA 3S44A 1RJ9B 1HDOA 1V3TA 5LSAA 4AMBA 2GWRA 3I92A 5BW8A 2ZG6A 5THKA 4NR0A 3LCMA 3W9SA 1QB8A 3NAZA 4MKHA 4DXHA 2OAGA 5ABPA 2YYAA 1X1EA 1PQ4A 2A9KA 3NTVA 4ZV7A 3FIJA 4A23A 3VNSA 3RYTC 4P7BA 1DPFA 3IVMA 1U2TA 4F97A 5DBEX 1I7DA 4ND8B 4RACA 3W5BA 1U98A 4JXXA 4OQPA 2JFNA 1O9BA 4C4RA 4FM9A 4BFYA 2EARA 1X3SA 2H1VA 3K94A 4M4SA 4MYHA 2YWRA 4DV0B 4B3BA 2C2XA 1O03A 2AYXA 3LFUA 4ZMRA 3BMOA 4O2BB 2D62A 1B00A 4IS2A 3ZWWA 3ZIUA 2YHSA 3MMPA 3G6KA 3RG8A 1WZNA 1FX1A 2XYQA 4JB2A 1OR8A 1PT5A 4V2UA 4ZP1A 5ER6A 3IMCA 4EZIA 1Q92A 2F8TA 4K28A 2DB3A 2HWYA 2I3ZA 3BFJA 4GVXA 1NVXQ 4PZYA 1ZPDA 3UAZA 1AF4A 3AIKA 2PY6A 4LBYA 2VAMA 4G5QA 4TTTS 3V7NA 4D4IA 3CO0S 4F72A 4ZI3A 3THXA 3OWHA 1OH7A 4M9RA 4MJLA 4P4SB 5GJCA 5IJ0A 1X1BA 3I9KA 1CD5A 2C2HA 2ZB7A 4ZAGA 2Z2JA 3RVPA 4DEYA 3R7NA 4E4TA 1QVRA 1OXXK 1XVTA 2QAGC 3DXZA 1HDZA 2HF7A 4LWPA 1HTWA 1R6DA 1X1DA 1VSBA 4KU4A 3MBKA 5A9TA 4BUZA 4P0PB 5AVTA 2QAGA 4WRRA 2OBLA 3IRUA 5DXAA 2WYWA 3JAWB 3MTGA 4E4YA 5KTOA 4ZHQB 1G55A 1HL3A 2JJ2D 2OCDA 3DEYX 4GPBA 3RC7A 5A3QA 5KTRA 3B3QA 2VDNB 1IZYA 1SOMA 4ZMBA 1DKUA 1L3BA 5BSGA 1G3RA 4LI0A 3L07A 5HUQA 4HQOA 1DBWA 1XZFA 5DGCA 1PRYA 1UF9A 3ZEAA 4EY7A 4IV8A 2VHEA 3CX6A 5DISB 4QQ8A 2X2FA 4HNVA 5LP6F 3EJWA 3EPPA 3WC4A 1VFNA 4PTYA 2X4DA 3UA4A 1PJRA 1T6YA 4PHTA 4Y18A 3K2IA 3GJ7A 4D9GA 4BASA 5L6LB 5PGMA 2WNSA 3E03A 4U9IS 1VI2A 3O73A 3ACBA 4CKWB 3EEIA 2DPXA 5I4BA 3GPIA 3K20A 4LQLA 4Q4DA 4Z1MA 1EUZA 4G97A 4EB0A 1EDZA 4IJ5A 4YAGA 2ORED 3G0BA 4IOLA 3SY8A 5EJ7A 1W59A 1XRJA 2OYRA 3E3OA 3IA7A 4WASA 5FUWA 1UXJA 1XXHB 2GPYA 4PFQA 3UWDA 3CS3A 3ZU3A 3FOAA 2IEGA 3AEQA 3MOGA 1A8SA 2JIQA 1W85A 1N2JA 2P90A 1ZR2A 3S8EA 3U3RA 3T12A 1YS1X 1XTVA 1EBFA 2VCYA 2D5BA 3ILSA 1HE2A 3GDGA 4NE9A 3TZ6A 3VX4A 2FEMA 1CYDA 4TSFA 3LKZA 1Z15A 2WJHA 4B71A 2XKKA 4B9EA 4MAAA 2C1EA 1XAHA 1FS6A 4L8FA 2A86A 4D45A 1TQ8A 3CWZA 2FFHA 3H18A 5DNDA 2O1SA 1ESEA 2QJRA 3L7CA 4DCCA 5CDGA 3D6HA 1CUJA 4MB6A 3O8QA 2C2OA 1ZGJA 5C31A 2CNWA 5C3MA 1CETA 1KS2A 3ACCA 3WK7A 4HFNA 4KN9S 2PU7A 2GSWA 5FA8A 5C37A 1ODKA 5JIBA 2IXDA 1R0CA 2XZPA 4W7SA 5HM8A 1J33A 3OZWA 3PEUA 621PA 1RYMA 1UBKS 1A9ZA 1P0QA 1TEVA 3HDJA 3LX4A 2FG5A 3TNFA 5IDWA 4CMIA 3L5KA 3AM3A 5DYTA 1W1UA 3GXOA 3I2JA 3QU2A 3WTCA 1D2AA 3BDVA 3LJKA 4ZOBA 3EEBA 1NASA 1KH3A 1KETA 2C5HA 2R5NA 3KIPA 2P62A 4DY4A 4QFMA 5JLAA 4LDPA 3W5AA 1ZM7A 2ZRPA 2PMWB 3B1XA 4GP9A 4LS3A 1ECGA 5TPWA 5CPBA 3ORHA 5F2NA 5TQ2B 3AUYA 3HB5X 4NPAA 1VZ3A 4M0EA 3KK0A 1ZGBA 4JOSA 1L5LA 3WK5A 1U8UA 4HF7A 3O92A 3VMMA 3CLUC 2XRMA 4U7GA 2Z4SA 4A2CA 3ASVA 4Y1RA 4BC0A 2B69A 4F2PA 4V38A 4CLRA 3RAFC 4JODA 3MYYA 1I0LA 3ZDZB 3AVWA 1ABFA 2QBYB 1E2FA 3B48A 3F98A 1NAHA 4ZCRA 1PFUA 1V8FA 1WCYA 5A4JA 3BE4A 3ST7A 4Q4LA 4UE2A 3A4IA 4XQ0A 1UIRA 5EUBA 1MX5A 4P31A 2Y92A 3OQVA 4GYWA 5DTJA 3MJ4A 5F9HA 4QODA 5I9LA 1Y8CA 4ZFNA 3VR5D 1Y1QA 2LP4Y 3WFJA 1A69A 1USWA 2XWPA 4UMEA 2AZMA 2HCBA 2CXHA 2ID9A 4XGNA 5G0UA 1QIJA 3PNQA 5IAJA 1RBMA 3UKDA 1N1MA 4XGQA 3FF4A 3TAXA 1FE8A 4CLXA 4OLAA 3QX9A 4OHUA 4XGIA 4HAIA 4PZCA 5HQ3B 5HS6A 1ZRSA 2SHKA 5SV2A 5B30A 5G0SA 1E3DA 5LMNB 3NT4A 4JEIA 4ZKEA 1RSZA 2ZYHA 3ET4A 3JWIA 4I55F 5AW0A 1QIGA 1Y5LA 2SKCA 3ORSA 1IN8A 2DBQA 2J87A 2VRNA 3DE0X 4I1SA 1OI4A 2EX4A 4XD7D 1H2FA 3R76A 3SS7X 4LC0A 4R51A 3ANTA 1M7HA 1RI5A 2P5TB 2QL6A 1BG6A 5KNDH 2YJ5A 5EFZA 5B3AA 3ZX5A 3PFWO 4BWVA 2NSLA 3DZCA 3I2FA 4B17A 5IN4A 1W36B 4JVLA 1Z08A 3CZPA 1PGNA 1S8AA 4QWWA 3S8MA 1ZBDA 2JA2A 2FZ5A 1EWRA 3MC1A 4AC9A 4CLOB 1QLJA 5FA5A 2GKOA 2P0EA 4OMDA 1M8KA 4C04A 3BKWA 1Y6GA 4QTUB 4HVTA 4JP1A 1JBQA 2G67A 3E61A 3FJOA 1DQNA 3DMRA 2MSDB 1XUOA 3MZ0A 2XZOA 4L02A 1PFGA 1OC2A 4GR5A 3NV9A 2VFAA 3EVZA 3VC7A 1ZMXA 1GR0A 4OB6A 4NATA 1C5KA 4FFOA 2XTNA 3M4JA 3P19A 2I4NA 4F6LA 1QV7A 3FZGA 1DIHA 3RU3A 2V7XA 3B7WA 3ZLVA 1T2CA 2FEKA 2ZROA 3RRZA 1NNSA 3U7HB 1DPGA 3DCIA 2W6ZA 1T91A 1WHSA 2HK7A 3LXMA 4NPHA 4Q3BA 5CYPA 3OFJA 4BKUA 3OKCA 1YC2A 3HLYA 2YJZA 3EGXB 3WLKX 3T9DA 1KRXA 1WWKA 4R8SA 4PG7A 3ZGYA 5CDUA 1GCAA 3BXEA 1T1RA 2VJCA 3OC6A 1JEAA 3LHIA 4BCBA 4ZGGA 3H17A 3VH2A 3A4LA 1ORVA 3FGOA 3VPGA 1R7RA 3N3BC 1WDKA 2OKCA 2VOEA 2VYVD 3A4VA 1H3FA 2PZBA 1V47A 5K20A 1W2GA 4UHJA 1SIOA 4LE1A 4TKMA 3TLXA 3AMVA 1C1DA 3SDSA 1G9SA 1YJBA 3FYSA 3NWBA 1KSHA 1M72A 1RWXA 2DFLA 3PXXA 2PFKA 3FETA 2OLKA 3OZUA 1QJCA 2F3TA 3ZY5A 1SPBS 4A8JB 5JEDA 1J24A 2IZ5A 4TWRA 4MW2A 2R6CA 3C39A 1TVEA 3OOHA 3SZGA 1B74A 1WXHA 4GM0A 1DC8A 3GPDG 1R2QA 2J9ZB 3BXOA 2WIBA 3CH5A 2QNIA 2AYZA 3OE7D 3SHVA 3K35A 1UEXC 4UHHA 2ZSKA 4UTXA 2FUKA 2YZ2A 3AOGA 1W34A 4LRXA 2C5FA 1CRPA 2ZDHA 3SQOA 2B94A 5CT8A 4D99A 1P9RA 3P9YA 1TT5A 1XEFA 5B2ZA 2B8TA 5EQJB 2ZT7A 1G38A 4FYIA 5M3BA 5JH7A 3H9CA 5EZYF 4NMMA 3D4IA 4WGFA 4DJJA 1H2AS 1NR1A 3L1UA 3WNZA 2CDCA 2ZGVA 1A5SB 1E3IA 2WZBA 1Q0HA 3LOPA 5G3ZA 3WGVA 2WG2A 5F2OA 4MP3A 5LA6B 2UDPA 3DHNA 5KPJA 1U0JA 3L8DA 2I2DA 4MQFB 5D8DA 1RXIA 3IHLA 2CJWA 1VHQA 3D5EA 3PHIA 4LWQA 3TKLA 2EJWA 2I4IA 1QK4A 3MJCA 1YVDA 1THGA 3BKXA 4IDOA 4J0IA 4R8LA 3JZIA 3ETDA 5DM1A 5EWJA 4YWHA 5IVPA 3UPUA 1Y1RA 2A0YA 2VDVE 3MWLA 3PZRA 1BCRA 1C7JA 1MW9X 2R7MA 4MUYA 4V0RA 1TNDA 5DP1A 5K0ZA 5AQ1A 3AIIA 1T2VA 2C8JA 2Q5FA 3VNAA 1PVOA 2BI8A 5FJIA 5I8ZA 1YO6A 2V97A 4K03A 5HE8A 1E0JA 1WY7A 3R2JA 4TMVA 2E3JA 4LJ5A 3AR2A 4B84A 3Q85A 2P4SA 4BE7B 2JFFA 1IY0A 1C7EA 4R1NA 4CN8A 3PC3A 1BSVA 1TU3A 4WIAA 3N39C 3IJPA 3KDSE 2PH1A 3LG2A 3QVLA 2Z58A 3R4VA 4DJ5X 1ADCA 1U2RA 1ZC4A 1DB3A 3FRHA 5AXBA 1Y63A 2XUZA 5MF6A 4CQLA 1JFSA 1Y3FE 1ZRNA 5DNYB 2V6JA 3ZCTA 5KB3A 1G8HA 1R8XA 4X71A 4WERA 4Q12A 1A95A 2X42A 3LLSA 3Q5DA 5C1IA 3UMBA 3WJ1A 5DGIA 1G7TA 4Q7KA 5BR4A 1NRJB 5EHXA 2WDPA 1R12A 1U2QA 1W5EA 3LKVA 4RA9B 3X1DA 2Q29A 3SSNA 4D02A 1RDFA 1JDZA 4EGQA 4F91B 5SY6A 1MTOA 3O7MA 3IV9A 2DHDA 3EAGA 3C87A 1OYVA 3ETGA 4RETA 4HWRA 4AY3A 1HQKA 3NWOA 1TFUA 3VV3A 5AVZA 3KLNA 3LC0A 4LY9A 4R41A 3CF4G 1FJGB 1D6MA 3Q9LA 4HQFA 1QZZA 3EC1A 1HX7A 4WY8A 3M6UA 1N2CE 3MILA 4PQGA 1R6UA 4LDZA 3V33A 3L6UA 4UMDA 1MF7A 3HXLA 2NO4A 1XTRA 2WFAA 1G5PA 5C51B 2CV0A 2HYIC 3FYCA 2IPOA 3AL3A 1E18A 1M6VB 1SCDA 3OIYA 5DN6D 1F2UA 4OUDB 4TYNA 3PLAE 1G20A 1Z6GA 5ALYA 1N2ZA 4F38A 3W5IA 4PAMA 1CR4A 2IHUA 1RYNA 4ONEA 2C95A 2Q2QA 3UXHA 4DY6A 3MUFA 1EUYA 1A9XA 1N8KA 2NMVA 4GH5A 2IYAA 4EJSB 5FWXB 2Q49A 2AX3A 1H8ED 3LZCA 2MCFA 1GO2A 1MZVA 2XMRA 5K0EA 1JZSA 1LZKA 2YS6A 2FPWA 3FSGD 4BFTA 1CRLA 2IUYA 1Z56C 3ZKAA 1QGUA 1KE1A 2MMCA 4G37A 5K0GA 3F96A 4NNPA 1DBIA 2AHOA 2R1VB 2FLWA 4ZREA 1OSNA 4OHZA 3RVBA 3F3SA 4EBFA 5JU6A 2DM6A 1U3VA 2BOVA 2HCJB 3HBMA 5H80A 4EW1A 1X14A 4XVCA 2OHXA 3RFUA 4NICA 4A0SA 2XB9A 3OQNA 3BIJA 4MARA 1JG6A 5AJTA 5K6TA 1FMFA 4BKOA 1UPBA 4C6HA 3FCAA 3QUTA 4HGQA 1OBCA 2H31A 1YS7A 3PQ6A 5F76A 1EVIA 1V0JA 3EF3A 3TEJA 2DH5A 4CEIA 1H4QA 2YQZA 2VP2A 3QNWA 5ALSA 4DUYB 2QPOA 4RESA 4CM4B 2XQJA 3VM6A 3DTVA 4MLZA 3KZXA 4B43A 1CB7A 4M8KA 3QVGA 4YMGA 5EIHA 3W4IA 3H0CA 4QECA 3FYUC 2P9GA 2CXRA 4M0CA 4QEDA 2VNAA 3HDYA 1DOZA 4PTZA 1G8PA 1T6BY 1ZRMA 2EKLA 2X4LA 3FVWA 2WF5A 4P93A 4Y8VA 4MROA 4EX6A 3L6OO 1Z6YA 4YBZA 2IH4A 1KDOA 3HCCA 1P5ZB 3I04M 2HB6A 4FE7A 4G89A 5FOXA 3EZ2A 2W00A 3ZHVA 1BFDA 3L49A 1GFSA 2D3WA 4ZJPA 4CRWB 3Q8XB 2FGJA 3RASA 1GG8A 3K09C 4BB5A 5IXSA 5C2JB 4TT3A 3KT3A 2SKEA 3H2SA 4P86A 4BVGA 1P8AA 2I1QA 2FZWA 1CF9A 2H5IA 4G4SP 4MW5A 3RS0A 1UKYA 1S4MA 5FA6A 1YMUA 3RSQA 3CLRC 4MHOA 1RRVA 4HDQB 3CLSD 3KSUA 3NVMB 1WULS 4BQIA 4JFAA 2IHJA 3A8TA 3DEJA 3RIXA 4HPXB 5J23A 2OO3A 2XNHA 2DULA 3PP8A 4L15A 1WMEA 3HHEA 2L0XA 3ZQ6A 1FFXA 4M7RA 4EWLA 4G0VA 1V7PC 1SQGA 3A1FA 2RGDA 3UATA 5JD5A 2Y68A 5KNLA 3UMJA 3WNVA 4FLFA 1DTWB 4B80A 4OX9B 2HV8A 1RI4A 5JVDF 3CIOA 5KJFA 4NCHA 5AJXA 1BJRE 2JFVA 4KQHA 4PCVA 3UYKA 2I9KA 4CF3A 2C8LA 2NP6A 3O4HA 1PYOA 3TINA 3ZWXA 3CSSA 3EODA 4YT2A 2RC5A 1P29A 3QXCA 5IEJA 3DOUA 1KOJA 2QD3A 3EZYA 4JJZA 1RQ7A 5SYAA 3RTCA 3WL5A 1O97C 3SX4A 3FCSB 1J7JA 4TGLA 3E22A 1JWBB 5EE5B 3HXOA 3JWJA 3VU0A 2R68A 2CEAA 1ZR4A 1T8PA 3S70A 4KW7A 1KBQA 1QF9A 4EG8A 2E37A 2P1RA 5CNIA 4BNZA 2RGUA 3PG5A 3Q6NA 1XJWA 1M34B 4M1WA 2IXEA 5FR2A 3IAFA 3TW8A 3I9FA 4NMWA 4B4WA 5LL6P 4O2AB 4M0PA 2PR7A 4YCDA 4RTSA 1EU1A 2V96A 3O74A 3W5JA 3EVTA 1N3IA 3BRQA 1JQBA 4NJEA 1SA0B 3L1VA 1P7PA 2GAJA 1RHJA 1SQ0A 4B46A 2A6PA 3KJHA 5CB4F 3W04A 2YHIA 5FWYA 5J43A 2O5CA 2IRWA 3P9IA 2PR2A 4DCUA 2NU7B 4Q9AA 4HDNA 5A4FS 3TLMA 3NDJA 3L0IB 4O4HA 1PE0A 1ENPA 1DUSA 1AKMA 1EVEA 1O9HA 3Q6MA 1C3JA 1P3Y1 4RNCA 2R4QA 5WRFA 3SOZA 3UKOA 1W2WB 1PEKE 5JWHA 4DM4A 3MERA 3AV3A 5LD2B 1L4EA 4M7OA 4PQYA 3OLVA 2D2FA 2CVPA 1XNJA 3FBTA 4Q4HA 4F3CA 4OGKA 5AI6A 2FSSA 2DQKA 5A4MS 2AC2A 4UVIA 1E5VA 1KI1A 1OLXA 5L3ZA 1ZUNB 4DPLA 4E6PA 4EYSA 4O3MA 3HKDA 3KAPA 3VYRB 1V7QA 1ZKDA 2XUGA 1GA1A 4MUAA 2NU8A 5F3DA 4K9PA 1MX3A 3NXKA 1GAQA 4MI6A 1P6XA 2IH2A 2A9PA 4R84A 1ATIA 3UAGA 3PF9A 3QEAZ 2VHQA 4UZFA 4FYVA 5IJ9B 5F2KA 3AK4A 4Q21A 3AM1A 5TT0A 5AICA 3AF5A 5LZ4A 4QO8A 1ZEJA 1ZOPA 2CNBA 4GMXA 3WMRA 1GG9A 1AKTA 1YK1A 4JBIA 1LLCA 3HL0A 3V8RA 4DG9A 4E7PA 1ABBA 2YXDA 3ZVNA 1SCIA 4UTVA 1RYHA 2OO5C 3AFMA 3V2UA 5A3RA 3K9FC 2WWTA 3GRPA 1SN7A 2OCYC 1HFKA 1UEJA 1XHEA 3TSWA 4L6AA 1IM8A 4MVJG 2BRUC 2VH1A 1W73A 2GJ4A 3QE2A 5AKLA 4FWTA 1KI3A 2DHCA 1G19A 4OXKA 1Q0PA 2BRUA 2PDAA 5FBRB 4JBYA 2JKYA 3U4HA 4J8PA 3ZXSA 2Q1WA 4IOJA 3TB6A 4B73A 1L4MA 1ZP6A 1AKRA 2AJLI 3T5MA 2O2YA 4NJMB 4ZALA 3ZU5A 4CIDA 1XRRA 1XRSB 2VQEB 5KTTA 3VDQA 2R8XA 3AGQA 1N0UA 2PT5A 4EPYA 2EAUA 3AVPA 3TGLA 3DE6X 3HP7A 1SCUA 1LSOA 1E2UA 2OUIA 3BCSA 4C30A 5AVQA 1TQ6A 3L4BC 4PLWA 1LPNA 5LZ9A 1PJ4A 4OAQA 2HM7A 4WQMA 3ZS8A 5L3SA 5AKHA 3MCAA 5CCXA 1OI2A 4HBZA 1UC9A 3JZFA 1CB0A 4KE7A 4TUYF 1MQ8B 2I6UA 2Z2XA 1YUNA 2NU6B 5E6RB 4XM2A 3V1YA 4F6RA 3HGMA 3OQOA 4EFMA 3KPYA 5K3EA 2L42A 2FQYA 8LDHA 1IN7A 4EMSA 1CNEA 4CODB 1U0SY 2YWJA 2X13A 5LQMA 1XMXA 2DGDA 1U5BB 2JZOA 5B2FA 3FWYA 1ZIOA 1Z37A 4X3CA 2MHCA 2QTZA 4I1RA 4E5VA 1O4WA 3W7BA 2W6OA 1AS3A 1Q7TA 2VUUA 1L7RA 3I76A 3RR2A 1F2VA 2IEIA 1JSCA 1Z2CA 3X44A 5I3ZA 1UR5A 4NYMR 3WISA 5KSPA 2RBKA 1X74A 4KLAA 4V0MA 3UXYA 4QUDA 2E5LB 2YXNA 2DR0A 2IP1A 2P6NA 4DVJA 3HACA 3MWEB 1LBSA 1AKNA 4X85A 3RSCA 2HTEA 2A1TR 2JANA 3PKJA 2IS2A 1AIPA 2QRVB 1CG6A 4JEMA 2VF5X 3LO5A 3AF0A 2VA9A 2CLLB 1ES9A 3SI7A 4HH4A 4RC9A 3NDPA 4FI3F 1O6GA 3IUNA 2C4MA 4MRMB 5JANA 3AO0B 2AG8A 3QUCA 3RYHA 4Y6SA 1B2LA 4PN7A 4HLDA 1M0SA 1ZINA 1NW6A 3ZCQA 2OENG 2WE8A 3HY6A 3CUTA 4PBSA 2TS1A 2I7CA 5K3BA 1B3RA 4BC1A 4UM9D 4HDAA 6CHYA 1ULTA 3F5FA 2DWPA 3LHSA 4JJAA 4EMUA 2B98A 2VAVA 4TQAA 2JLUA 3EBOA 5AK4A 2CN1A 1T5IA 1VYVA 1JVSA 2Q0QA 4PYKA 1JXMA 3O9VA 3V32A 2V98A 3HKEA 4V2IA 2WP8J 4IJVA 3N2KB 4L5IA 4X92A 1U31A 2WMNB 3IILA 4ZOLF 2LDXA 5AIAA 4QASA 1VPTA 3UHPA 3MGKA 4GT1A 2Y1DA 3I4CA 2C7BA 4N5HX 3QTBA 3PICA 3UHAA 1JEYB 2DTXA 1P2VA 1CQJB 1NW5A 1YFKA 3KQMA 4HAXA 3S1AA 2XHZA 2H1LA 1T2DA 4M1YA 4GSYA 2LZ0A 1X94A 4HXFB 2HMYB 1W581 3WRXA 1T3GA 2I6FA 4U6QA 4D9JA 2XGSA 5JPDA 4HXYA 4MGHA 5CLFA 5FTWA 4TKUB 1Z0DA 3AJEA 4TV9A 4EDHA 1B6SA 3F4KA 1N32B 3U6BA 3UANA 3OPYI 3B2NA 3LYUA 4MVXA 5JVDB 4RPHA 4A9AA 3GARA 3PWZA 5IVDA 4EGAA 5BWLA 4QPZA 4RF3A 4COKA 2P0AA 1RJ9A 5KJEA 5DMXA 3VV2A 1A9OA 1ZU5A 4D43A 2R86A 2W58A 5L7YA 4EI2A 1ADGA 5JARA 5HTOA 2H59A 2D1QA 3HB7A 4J1TC 4W5NA 1OTYA 1M1XB 5E4TA 4ED9A 3FPCA 3R4CA 1L5FA 3AWDA 4J1TA 1YDWA 2WTXA 3H97A 4S24A 1GG2A 2CD7A 4G1BA 4ZQBA 1LJUA 2JCGA 3H5LA 2ZSUA 1FTWA 3GUCA 3SHTA 4JASB 2FR8C 1VCHA 2GAIA 4YCLA 4BN4A 4F1WA 4AXXA 5G41A 1NLYA 1IH8A 2FR8A 3MGGA 3T7CA 1L5NA 5F73A 1C9DB 2ENUA 2AZXA 4CL2A 3H5AA 2J5RA 1RBYA 2AN4A 3A1VA 3HG7A 3NPAA 5J9FA 3TLCA 5BNIA 2YJTD 4BTLA 2XBMA 2WEKA 2RGWA 1XC7A 3OQIB 2NUTB 3P4XA 4QUHA 4YJHB 5JJIA 2WHPA 1V6CA 1T8UA 2WHYA 2XQVA 4IV5A 1FFSA 1U28C 1I1OA