3UWKA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
205
structure length
202
Chain Sequence
b'GLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARAAARDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 202
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uwkA00
4EPXA 1II8A 2C9CA 1UDXA 1OYYA 2VA8A 3AVYA 4M9SA 1M2OB 5FBLB 3BFVA 1YRAA 5FUXA 4B76A 1KDRA 4UKDA 1UKEA 3GQBA 3CF2A 3VX3A 4DSTA 1XCMA 4W5WA 3X1DA 1GNQA 4Z51A 4P4SA 4PHTA 4JKIA 2WWXA 4DDWA 4DSNA 3QBTA 1G5TA 1NMXA 3RS3A 1KNXA 2CLDX 3GCGA 3U6KA 4HDOB 4FD2A 3LD9A 4O2LA 1KO8A 3RS0A 4G5OA 5JSZA 5JECA 4H1UA 3B13B 3K0SA 4AC9A 2PEZA 2QTVB 4N1AA 4TL8A 4LWZA 2JJ8A 2QY9A 2PEYA 2IYLD 2LWIA 5FUYA 5LPNA 4WW0A 1XXHA 4ACBA 2CE2X 2N1BA 3TK1A 1NKTA 1OFHA 4XVRA 3W8RA 1G5RA 2HLDA 1R0ZA 2OM2A 1XPUA 3AB3A 2Q9CA 2JGNA 3EZFA 1G17A 1SVSA 2A2ZA 2ODBA 3EA5A 3CRMA 2GXSA 3LRPA 4OI1A 3THXB 4DLXA 2JJ1D 1YVDA 2GJ8A 1Z07A 1YZLA 4BFXA 1W4BA 3BXZA 2WZQA 5AJYA 2WJIA 4GRAA 1XTQA 1M1YE 1IY1A 5DISB 3TGPA 3VHLB 3K9NA 3LH5A 3D7MA 4TT3A 1G8GA 2XAUA 4Q19A 2QU8A 4D0NA 2FSIA 2DBYA 4A2WA 4AKGA 2VP5A 2FNAA 4LJ7A 2FZ4A 2G3YA 4P32A 1G7RA 2RAPA 4Q00A 3ZVLA 2A5FA 1IJFA 4TLCA 2IK8A 2ZRPA 1L2TA 2XITA 5EXXA 1ZM7A 4LK2A 1EXMA 4DLSA 3GJ5A 4IOKA 3NG1A 4Q9HA 1RYFA 1CULC 2CXXA 6Q21A 4IRUB 1UKVY 2Q3FA 2WHXA 4RVCA 2GXUA 2Q3MA 2Q21A 4IDQA 2ZR9A 3OEED 2A5JA 1W4CA 3AVTA 1VKJA 3BBPA 3P27A 3WYAA 3KJIA 4RKEA 3I92A 2LCFA 2XJ9A 2QP4A 1ZAKA 3QXHA 4IW3B 5AJWA 1XZPA 1E32A 4CYMA 5IF9A 1E4YA 1JAIA 1GP2A 3Q9LA 5EE3A 5E7JA 5GJBA 1ESNA 4B2IA 2IEYA 2XNDD 2QP3A 3B6EA 3W8NA 1ZP6A 2QROA 3Q8XB 1OKKA 1KK1A 3RLFA 4UXHA 3TVDA 3ZVRA 5DSZA 1G5PA 2H16A 4IXNA 2ONJA 2ASEA 3CZPA 4IJMA 4L16A 2FFQA 2BHRA 3NBXX 3QXCA 2WIBA 1H8HA 2YHSA 3B1YA 5JJLA 1M8PA 3A4NA 3K9GA 4HLCA 1CLUA 1F48A 1KO5A 3E5HA 2W58A 2GAAA 2JIZD 1Q1QA 1NBME 1ELOA 2IXEA 2PBRA 3JZAA 3G0HA 2ZS9A 4TYNA 1W4AA 1EK0A 3U3KA 4A4DA 1I2DA 2FSGA 4ZKDA 3OIVA 3THXA 4AY2A 4QM6A 4JL8A 4EFNA 3K9LA 4CT5A 3SHWA 1Q57A 2J7KA 5KDLA 4KO8A 2VHJA 4M9ZA 4EFMA 2FJUA 3G5UA 5TMPA 5SZIA 5F2EA 2BKUA 2WKQA 1MRSA 1BO6A 4NYMR 2BKEA 4NHOA 1OW3B 4B6FA 1IONA 3QJYA 3TW8B 121PA 4DEXA 2ZJOA 4QHYA 1H65A 4MGKR 4XWAA 1D9ZA 1PZNA 1Q20A 2J0QA 2OILA 1Z3IX 2QMOA 3PQCA 1HE8B 4DJTA 2GF0A 1Z5ZA 2ZU0C 5G53C 2YKGA 1S8FA 3ZDQA 1EGAA 5FOTA 5KUTA 2P6UA 1ZD1A 3JVUA 3AF0A 1JPNA 3GJ4A 3WXMA 4TYYA 4QNRA 2FEOA 1UDWA 1IN7A 2W0SA 5JRZA 1JPJA 1PLLA 3QG1A 1SHZA 3DKVA 1D9XA 2FG5A 1DBSA 4QNMA 5E7IA 4GSYA 4TQ9A 5EE1A 4YXWA 2NZ8A 1U9IC 5CDFA 4D2IA 4KFRA 5J40A 1QHNA 2YWHA 4OBEA 2BWJA 2ZE7A 1J70A 3PUXA 4LJ9A 4EPWA 4Y0AA 1MH1A 4K81B 4PZLA 4BFUA 4C3ZA 2ERXA 4IOLA 3LDAA 2O8FB 2HEIA 1KHTA 3CWZA 4Z1MD 4M9XA 1JQLB 4OK3A 2F43B 5C1BA 2AKAB 3L0IB 4JZKA 1C4OA 3WYFA 4JLOA 1GVNB 3VTKA 4RZ3A 1OJLA 2QE7A 5L8VA 3ZZ0A 2AL7A 1NY6A 2XB4A 4QRHA 5DHFA 4O2RA 4CDGA 1G16A 3C4JA 5GVRA 2XTNA 5AJXA 3CONA 2ZRBA 1KSGA 2W2TA 4UJ5A 1GAJA 4I1SA 1XFAA 3T1QA 1XU4A 3LW8A 3GLGE 2ODWA 1W36D 5TY0A 1G9XA 2G88A 4ZV4A 2VP2A 2GVDC 4LPSA 1GOTA 4TYQA 4B2PA 1F5NA 3K0FB 4M2LA 1HYQA 4A6XA 3BD9A 4AIIA 5KTYA 2TMKA 2C95A 4IVQA 3EZ7A 3HYRA 2ANBA 4IDOA 1KY3A 2G83A 1ZD8A 2QPOA 2QORA 1X8JA 1E2IA 4RCYA 3NEYA 5CM9C 2RGBA 1P62B 5GJVC 3A6PC 4B3CA 5H1YA 1IOZA 1Z6YA 1OXSC 1YZKA 2EU8A 1NP6A 421PA 5LB4A 3B7GA 1YR9A 2NO7A 3A1VA 5A5GA 4LOAA 5CLQA 2PCLA 1RJ9B 1DS6A 1R8QA 2I1QA 2DYKA 1T0JB 3B1WA 3PIRA 2XJ4A 2Q9AA 3L0SA 3L2OB 4A9AA 4EQ6B 4B3BA 5F9HA 4ON9A 1AQUA 2F55A 1A82A 2AXPA 5FTNA 5FOSA 2QGZA 5EJEA 1KMHB 621PA 5TVKA 3I3SR 3GPLA 2OSBA 2ZI7A 4RD6A 1XXHE 2WTUA 3REGA 1WB9A 3EZ2A 2JDID 4LHVA 3QENA 3DHWC 4TTQA 4WOPA 4MGZR 5DLQC 5HZKA 5KSOA 2JLQA 4LJYA 3GFTA 3ZJYA 4DB4A 1OH8A 1ONBA 1Z29A 4KAXA 3GLFE 5CB6A 3BB1A 1W44A 2O8FA 4CEJB 4URWR 5G3ZA 3ADBA 1KDTA 2F43A 3B1ZA 3QPWA 4UJ3A 3U7FB 2FPKA 4G5RA 2LKDA 3L8YA 1DADA 5HE9A 3VQTA 2VSFA 1XEWY 2A5DA 4MH0R 4OHXA 1W5SA 4PAQA 5E7MA 3UMFA 4B73A 2WJVA 3C5HA 3QIAA 2OLJA 4PHGA 2AN9A 4NBSA 4U02A 4ZKEA 3EC2A 4LSGA 1ZW6A 2ZE5A 2KE5A 3UXMA 3ZLJA 1GM5A 1HY3A 2P65A 3RHFA 3WNCA 2CDNA 1DPFA 1NJFA 1B0UA 5GJCA 3K0FA 1TQDA 1N6RA 2BC9A 2H18A 5AWFC 3DO6A 4PFSA 1RKBA 1D5CA 4JSYA 3VMFA 1PJRA 2RH5A 1ZM9A 1XEFA 2MSEB 4RZ2A 3T61A 3HU3A 4DUGA 3EPKA 3I8SA 2GEDA 1P6XA 3FFBA 3DMNA 4BLTA 3PEYA 3PUWA 1JBKA 5EXTA 4YDHB 2FF7A 3Q5DA 1S1CA 5HCNA 1RIFA 2FWRA 2O0HA 3W5JA 1T91A 1VG9B 2RGAA 3E1SA 4CW7A 4PO9A 4LJ6A 5DN6A 1RJ9A 4GFDA 2J3EA 4Q1BA 4IXMA 4JBYA 2BEJA 2QRNA 1S9DA 3QSYA 2CMKA 2CVHA 1CIPA 3N70A 4Y0VA 2BMJA 4PZZA 1C9KA 3HR8A 1NF3A 3KB1A 1Z28A 1RVDA 2ZUDA 4WA7A 4B43A 3BFXA 4Q4AB 1FNNA 1FMLA 5EE9A 5GJWC 1KMHA 1Q1BA 4M21A 4OJKA 1ZNZA 2E87A 1RW4A 4PC2A 3KJGA 2IBMA 2ZRJA 4L5BA 1G3QA 1SQ5A 3FKSA 1US8B 3CBQA 2VQSA 1Z2CA 4G0NA 2CCGA 1DO2A 4BFSA 3SR0A 3LVRE 3M6AA 4CEJA 1E2NA 4LC1A 2OXRA 2R6FA 4L15A 1P73A 2IXFA 1QF9A 1P2UA 3SDZA 3SYKA 2XSZD 1RFLA 3SJZA 2ZRAA 3HU2A 2WJGA 2CBZA 2O0KA 1W0JA 3CRQA 2DY1A 3V4FA 2O8DA 2RHMA 4F93B 4DLTA 4F4CA 1E2JA 1MV5A 4POAA 4LJ4A 1Q1EA 2QT0A 4F91B 5CJ2A 4DCUA 4TSFA 1J99A 1II0A 2V1XA 3H2YA 4HLQB 2IS6A 2GESA 2VHQA 1G18A 1JR3D 3EZ6A 5L3RA 3FB4A 2BBOA 2ECKA 2FA9A 3CPJB 4IFBA 1A1VA 4BZQA 2EYUA 4ARZB 2ZRLA 4IVRA 4NYJQ 2V7QD 1GNPA 1U0HC 3CKLA 3NHBA 5KYKA 1E94E 2ZYTX 5CITA 5KPJA 2JJ2D 3SJAA 4W5HA 2YOHA 2ZI4A 1LNZA 1SXJB 3QXXA 2QM7A 1KYIA 5C18A 3L0PA 1YHNA 3EX7C 4GZLA 2HYIC 4BEBA 1PUIA 4FINA 1D2EA 2WM9B 2J0SA 1SVKA 4FN5A 5P21A 1KI6B 5EE0A 4WXPA 2BCJQ 4KVGA 3AVXA 2CEAA 4C7OB 2GJSA 4RFSB 4PR0A 4MRPA 3GFOA 4US0R 5CIWA 5H70A 1CJKC 2A5GA 5CDFE 1DAHA 3OEHD 4XTCS 2ZVQX 4NONA 4HATA 3K09C 1E2DA 2FPMA 5LB2A 5IRCD 3U4QB 5FOWA 3P32A 1GWNA 1OHHD 4KJZA 5IK2D 4Q4AA 3WMFA 1KI1A 1DVRA 2IYXA 1XJCA 4R7ZA 4FIDA 4P4TA 1GRRA 2OEPA 3UMSA 5IHPA 1IJEA 2OBLA 2CNWA 5FPSA 2OE2A 4MGYR 1US8A 2ZSAA 2ZSFA 3UWKA 4I1UA 1T4GA 2FSHA 5TDHA 5KOYA 4EAQA 3Q72A 4TZ6A 3AVUA 2IUTA 3NC1C 1XX6A 4LHZA 4QGHA 2YWGA 3MJRA 1SVWA 3GJ3A 4Q01A 1E99A 2WSSD 1M74A 1VYVA 3OAAD 2UZ3A 2NGRA 3A1UA 4AKEA 4B3FX 1G1MA 4FCTA 1GL7A 5F98A 5AJVB 1VYTA 5HTKA 1N6HA 4E07A 1G3MA 1NMZA 2WWGA 4JVSB 1GILA 5K8TA 2KSQA 1W0KD 2ZI5A 2IX3A 2ZVPX 5FPHA 5BN3A 3KQNA 3WMEA 5FBRB 3MCAA 5SZJA 4DLYA 5BXQC 2JLXA 4QG7A 3KDSE 3KKPA 5FBVB 4ARZA 4TMZA 5KHOC 3W90A 1OIWA 1HQYE 1T9HA 2I1VB 4LJAA 1DAMA 4X8LA 2QQ0A 4DLVA 4FMDB 5FFMA 1CKEA 4X8OA 1SXJA 4BRUA 1Q1ZA 2QAGA 3B85A 3BB4A 4A1FA 3SBEA 1IXZA 1KKMA 5D3MB 3KFVA 1XEXB 1ANKA 2QRZA 1G20E 5EP4A 3ZVNA 1NMYA 4KXFB 3UK6A 1EFHA 3X1YA 3H86A 3ADKA 1KI6A 1H8ED 3NHAA 721PA 4PAMA 3PUYA 4RFSA 4TN1A 1AKYA 1DAGA 1NLZA 2FDCA 2AFHE 2QT1A 2DWQA 3F5FA 3LY5A 1RRGA 4GDFA 1CJUC 2O8EB 2HF9A 3P1JA 3H4MA 4PSVA 3QF7A 4PXAA 2RGXA 1VCIA 1HH4A 3PENA 2P67A 4LBVA 2PMKA 4EPYA 4FWTA 1JXMA 3LLUA 3CWQA 4CIDA 2OCYC 1NKSA 2HJGA 4PQYA 1CU1A 2DFKB 2PH1A 2IA5A 5J47A 2FX3A 4V0KA 2MMCA 1Q44A 2XGJA 2JLUA 5CIQA 3QG5A 2J7PA 2WPDD 5B30A 1ZUHA 4I99A 5JS8A 3RANA 1ESMA 1LTQA 3GP8A 3PEVA 2I3BA 3NDPA 4BFWA 4M4SA 1X6VA 2A9KA 4LBYA 4R2HA 4Z8XA 1EFRD 5JSZB 2QENA 2NO1A 5AUOB 4KLZA 1VECA 3H84A 4D4LA 2PJRA 4EJSB 1GL9B 4RFVA 3OESA 1GDDA 2G6BA 1EWQA 4NYIQ 1RYHA 3I4LA 3SFZA 3UANA 1EWRA 2OBMA 3K0CC 1E2HA 1Z83A 1JI0A 4HUQA 4OHZA 4ERNA 5FUVA 2ZROA 3GLFB 3RSOA 2ZI3A 2FE4A 4JBXA 1P72A 3EA0A 3M0EA 3TNFA 5AJZA 4DXAA 1GRNA 3D31A 2RGGA 2YOFA 4G5GA 2IWHA 4QC2A 2IS1A 1MKYA 1DAKA 3BORA 1AKEA 3AVVA 1ZNWA 2QAJA 1M6NA 1AZTA 2D4HA 1R0YA 4C0JA 4D81A 2ZQ5A 4GOKA 4UNQA 2WJHA 5K8IA 2DR3A 3O8RA 1R6BX 2GEVA 2X2EA 4A0FA 1F6BA 4URZR 2VL7A 2PT5A 3X1ZA 2AK3A 2ZU6A 1O3YA 1F2UA 4Z1MA 2F1JA 1I4DD 3QKTA 2QNRA 1SKQA 1E2LA 2OCPA 2VHUA 2AK2A 3QPVA 4E5UA 2ZSBA 2IS2A 3TSZA 3ONWA 3QOFA 4B47A 1MO5A 3QXJA 4OQMA 3B1XA 3K0EA 4HDQB 1L4YA 3U5ZB 3ZVMA 1E2EA 5FL7A 1OLOA 3B60A 4NCKA 1HE1C 1TF2A 5ELXA 4PPGA 4IEIA 3R9XA 2FEMA 4US1R 5CM8B 4TLAA 1E2QA 4U7DA 1W5TA 4KCGA 4D4KA 3FMPB 4XVUA 1YZQA 1JAHA 3IBGA 3AUYA 3HU1A 4KBGA 4RZXA 1HUQA 3U2QA 2ZTSA 2F9MA 4ZO4A 5B57C 4QOSA 4CZ2A 3UMRA 5DHAA 3L43A 3KB2A 4ZCLA 5L3VA 1Y63A 1SULA 2RB4A 4LHWA 5KNCA 4JYBA 2IUUA 2D06A 2Z4SA 3RS5A 1R7RA 4A15A 4BECA 2QP9X 4EJSA 1DG3A 2E1RA 3IQWA 4PHHA 2FGJA 1E1QD 2EWVA 3IHLA 3AF1A 2OZEA 2YINC 4EPVA 1XTJA 4URYR 2HCBA 4D82A 1ETUA 4DSOA 3U7GA 3LAWA 1IXRC 1WP9A 2AXNA 3GLFA 2W2VA 4U5XA 4TL6A 4PC3A 1P2SA 3BERA 4WIAA 3A4LA 5BYKA 4A0HA 2N46A 1TU3A 1XF9A 2VSXA 2EFEB 2I4IA 2XOKD 4H1VA 3LNCA 4NCHA 3Q5EA 3IO5A 2HV8A 1ZMXA 4YDSA 3WYGA 5FOUA 1S1MA 2DHRA 5JRJA 3ADCA 3CW2A 3PCRB 3R8FA 1ZCAA 2B6HA 4LV6A 3B8HA 1KSFX 4W7SA 5HZHA 3L8ZA 2GDJA 1G8FA 2CCJA 2JA1A 1FMJA 1G4UR 4HAYA 3IEUA 4DDTA 5FTLA 4FWIB 5JZVA 2FSFA 1UAAA 3EZ9A 2ZJ8A 4MGIR 3UPUA 4M1YA 3RRMA 1QHGA 4UQOA 1R10A 1K6MA 3NH9A 3NC0C 2ZJAA 1Z06A 2V1UA 2Q9BA 4QBGB 2C78A 4DIEA 3GEEA 4DZZA 2Q6TA 3IILA 4IDHA 2DPXA 4AYTA 1N6OA 1KK0A 4BRWA 2B8WA 3CNNA 1ODFA 4LHYA 2PT7A 5G41A 2XXAA 1NRJB 4PANA 1OXVA 3GJ8A 4URVR 5JFGA 2G0NA 1SZPA 1RRCA 2X2FA 1D2MA 3O8BA 4ESVA 2F6RA 5TB5A 3V9PA 3VAAA 2REXB 1J90A 4BLPA 3Q7PA 3W5IA 4TYPA 2XX3A 1AQYA 1P61B 3SZRA 3KL4A 3SJCA 4YONB 4PQRA 1T8UA 2C9YA 1E79A 4LBZA 4AWXA 3SHFA 2WWFA 3RS7A 4GZMA 521PA 1RC8A 2GEUA 1OE0A 4A0RA 5JLJA 1I4TD 1NN5A 2YWEA 1UF9A 1A2BA 2XNSA 4UNPA 1SXJE 4G5QA 3AKDA 1ZIOA 3C14C 4AI6A 3OFND 2HT1A 2O8BB 1NBMD 4FMDF 2FV8A 2RCNA 4B35A 2ZRGA 2C96A 1R4AA 1QHYA 4QBIA 5JBQA 3VNVA 2B21A 2OHFA 2WWHA 2PCJA 2ZUCA 4HB2A 4DCTA 2WJYA 3QKSA 2WKRA 3R9IA 4GNKA 4YMSA 1XRJA 2WWYA 2VP6A 2G1JA 4B33A 2BMDA 2DFLA 1VDZA 1BIFA 5J4VA 3IPXA 1TUEA 3B82A 1YZGA 4LRWA 3WP1B 2VF7A 4KSCA 4RCZA 3ECCA 2HUPA 3I72A 1G291 5JEDA 4BFTA 3BH6A 4GL2A 4MUBA 5UKDA 2BVNA 1ZRHA 4KVAA 5FBWB 2ZYWX 3VR3A 3K70B 2NO6A 2G9NA 4B34A 1LB1B 1TL7C 1SKYB 4EKDA 1WBDA 4JKYA 1VHLA 2DB3A 5JJKA 4I4LA 1YU9A 1JR3A 4KLNA 3HDTA 4JVMA 1KNQA 2LKCA 3U7EB 1AS0A 4WXRA 3E70C 3TBKA 4ASUA 2OFOA 1W7AA 2G77B 3RSLA 3PR1A 2A5YB 4K46A 4TLEA 2ZE6A 4PC6A 2JJ2A 4OYHA 2PX3A 4UNRA 5J4KA 2IT1A 5C46F 2D62A 1C1YA 1HTWA 4QJ3A 4GP6A 3RVBA 4YMUA 1TF7A 2IXGA 4W5JA 3ICQB 1CBUA 5JI3E 4N0DA 2ONKA 4PAOA 1G3UA 1NSTA 1N6NA 2WAYA 3NKVA 5HKKD 1MR3F 4Q7MB 2ZRCA 1NNEA 1U90A 5TV2A 3B78A 1TNDA 1U99A 3V4RA 3B1VA 4B3GA 3TSWA 2QSZA 2ZRDA 4GBMA 4NCJA 3DZDA 1Z0FA 1NY5A 2DCUA 3U61B 4LHXA 1U2RA 4ABYA 4DC9A 1Z0KA 3SYLA 2OXCA 1UPTA 4QHTA 5K8UA 2O8BA 4DLUA 5FTMA 1GUAA 5FR2A 3KFXA 1TTTA 3OIUA 4XD7D 4OI0A 2VHTA 2DFTA 3T06B 4M1MA 2Q3HA 3K70C 1CR0A 1IXSB 2RGNA 2H5EA 4JLAA 3LA6A 4X8HA 2YYZA 1DTSA 4J0QA 1KJZA 2CLCX 3PUZA 1JECA 1GSIA 1NI3A 2GRJA 3FHCB 3TLXA 1AGRA 1OXUA 1G64A 3VU9A 3R9WA 2OCAA 4F4IA 1MOZA 4DVGA 3WNDA 1GKUB 3HPQA 4JL5A 2JLSA 2YNMA 2XTZA 4C0BA 2WJJA 3C16C 3K9HA 4Q1AA 4BZXA 4S35A 3KXIA 1OF1A 2C8VA 1W0KA 4D0LB 4HLUA 2ZS7A 2CLSA 3PEUA 4FMBB 2OLKA 2WV9A 2WOJA 1U8ZA 2ORWA 4D6PA 3TUZC 4MKFA 4B44A 4XTRA 1DAFA 1KI7A 2KWIA 1W47A 2IYYA 3FE2A 5EE5B 4OHYA 1UKYA 3L0OA 3X1XA 1YQTA 2H17A 4JT2A 3VHXA 1XJ0A 3EPLA 4BFZA 2A3RA 3BWDD 4M8NE 1M7BA 4HB0A 1WA5A 3MSXA 4JIMA 4XVQA 3EWAA 1JNYA 4JLBA 1U0LA 4JL6A 2NPIA 4YQFA 4AYWA 4JBWA 3SEAA 1N2CE 2IYRA 3CRVA 2SHKA 3IIKA 2H57A 2F1RA 1FTSA 3MJHA 1H8EA 4MQBA 4QGFA 4LYFA 4AKHA 1ZBDA 3PVSA 3GJ0A 2V6JA 3BH7A 2PZGA 3PITA 1RPZA 2NTYC 4FCVA 4LUCA 4OQXA 5DGXA 1NN3A 4N0EA 3AQ4A 1JALA 4E03A 2AD1A 1UBEA 3TUIC 4BWYA 4C0HA 5JHHB 5TXGA 2OAP1 3S1AB 2ZPTX 1PLKA 4HDCA 3WBJA 2O8DB 3MWKA 1HEIA 3T5DA 4EPTA 2B7BA 4II7A 1CP2A 1PV4A 4JLKA 1R5OA 4URXR 4LDJA 2ZAMA 1XZQA 4BEJA 1FOEB 2PLFA 1QRAA 2IF2A 4TT3D 3BIFA 3GLHB 5K8LA 5DH9A 4OK6A 2C5LA 2AWOA 1CR1A 3N2EA 2CVFA 2F1IA 2JATA 4PO1A 3EIEA 5EUMA 5F3WB 1N6KA 2L0XA 5BW8A 5JMTA 1RE0A 4YLGA 1AS3A 2WMNB 3TVTA 1SGWA 3IGFA 4LZZA 1ZU4A 3DM5A 1GG2A 1W2GA 1TX4B 3U7HB 4WZBE 1KK2A 4JJKA 4LBWA 4MRSA 5EZ6B 2BM1A 1CJMA 5KU1A 3K0AA 1E98A 4KI0A 1KO7A 2CL7X 1SHKA 4Q1EA 4O3MA 1P9WA 1D2NA 5B2ZA 3FGNA 4LYAA 3GEIA 3IKJA 1EESA 5GADl 1BMFA 4D25A 3DVLA 4KFTA 3ZH9B 4ZDIA 3TIFA 1DO0A 4XWOA 1EFCA 2RHDA 2WWIA 3AVPA 2QA5A 3HPRA 3RNLA 2CL0X 2J5XA 1OXTA 4OHWA 3UIEA 3F0TA 3T35A 3IO3A 4GT1A 3NBZC 4LJ8A 2DFNA 1CJTC 4HLDA 1G7TA 1OKKD 2GHIA 3KQLA 3VKGA 4GMDA 5IDVA 1OH6A 3FOZA 1XPRA 3SQWA 1AZSC 4HZIA 4Q9IA 1CS4C 2VF8A 2BJWA 2BM0A 4ZPXA 2BOVA 1AA9A 1VCMA 1P9NA 3AM1A 4OL0A 5JWHA 4KYIB 1NIJA 3OIYA 2QG6A 1JEDA 4TQAA 5EUQB 4B75A 2W6IA 4NYIR 1DARA 2REOA 2OO7A 1KAOA 2WIAA 4TMVA 1AGPA 3HJNA 2HT6A 5FOVA 5SZHB 3AV0B 3F3YA 2ZRHA 4R71A 2GZHA 1V43A 1YZUA 2IUSA 4KV9A 3S1AA 3FMIA 3TAHA 1W1WA 3RS4A 3W9YA 1YRBA 1G6OA 2J46A 1PLJA 1T3HA 1ZNXA 4R9UC 4U00A 1KSJA 5FPTA 4OI2A 4TTPA 3P20A 2GAOA 2PLRA 3BJIC 3EG5A 3BOSA 1LFDB 1GKIA 3BGWA 3GLHA 3R8CA 4DKXA 5AUNB 3V00A 2P2LA 5C4GB 2J87A 5KPDA 2QTFA 3A1TA 4NP6A 4M22A 3RRNA 4CGZA 3I73A 2RKOA 4Q7LA 1XNJA 4S2EA 3NDBB 3MUFA 2IYUA 2IEZA 3DEFA 3EW9A 3VR2A 3CH4B 2QAGB 1JR3E 1E9EA 5KDDA 1F2TB 3C8UA 2J0UB 3KKQA 1KI3A 3AP3A 4OQFA 4PSKA 1P9RA 4R2IA 2QUZA 1IN8A 1VIAA 3B9QA 1CTQA 2HF8A 4DCNA 1YZTA 2ZXUA 4IVPA 5JWOA 3THWA 1KJWA 1XD8A 3AP1A 4FXPA 1NLFA 3P4YA 3AGPA 3ZIAD 1GZSA 5DO9A 4CVNA 4YXWD 3G82C 4CEIA 2JJ1A 5H8WA 1P2VA 5JCPA 1TEXA 4OK5A 1R5NA 1E0AA 4RY2A 1IY2A 4Q47A 2C04A 2IYVA 2W6JD 2F3TA 2Z83A 4Q9LA 3IUYA 1ZYUA 1G19A 5AK0A 2V4ZA 2ORIA 4AKIA 2J9RA 3EPHA 3A4MA 3GFPA 3U3OA 3GLIB 1TU4A 2R8RA 4HUTA 2KBFA 1Z47A 4PPFA 1E2KA 2MSCB 3NVAA 4CRWB 5LD2B 4MDFA 4RJLA 1TEVA 3OIWA 1DAIA 2QE7D 2PMDA 2CHQA 3I32A 1YE8A 2VSOA 2OAQ1 4B6EA 2BBTA 1JJ7A 1E0JA 3MWJA 3SE0A 4A0GA 1OB2A 2QBYB 3LBNA 2CCKA 1PVOA 3BE4A 2AWNA 1YJ5A 4M9QA 1W49A 2RGCA 1Q22A 3TMKA 3TR5A 1ZC3A 3ZS9A 3OEEA 1EG7A 2C77A 2W00A 3LXRA 3W3AA 5JJIA 1SXJC 1OYWA 2QAGC 1UADA 3AH8A 4HUQB 3PUVA 2R6GA 3LO5A 1BOFA 2EWWA 1OH7A 1WF3A 2XNDA 3C15C 4A82A 1N6IA 3RWOA 3T1OA 5FPKA 1SKYE 2X8AA 4QM7A 4QGAA 2O0JA 1Z22A 1E9DA 3AP2A 5DIFA 1F2TA 5KNDA 1MRNA 4D4JA 2BMFA 2J0UA 2ZR0A 4V03A 3MMPA 3THYB 5KDOA 1F2UB 4Z8YA 4DDVA 1T3SA 4BZPA 4V0NA 1T6NA 2JIZA 2P5SA 3CR8A 4D80A 2ZJYA 4ILEA 5FL3A 1P7CA 2R6AA 3IEVA 2NQ2C 2ZETA 4HB4A 1AN0A 4TLDA 3VR5A 1N25A 2GCOB 4LX0A 4G5SA 4M1TA 1LW7A 2FU5C 4JVLA 2JLVA 3NH6A 4DEYA 1KMQA 4M53A 4L9SA 4UNSA 4B74A 1T0HB 1W36B 2CK3D 2FN4A 4BFVA 2YV5A 4RD2A 2H92A 1FW6A 2GJ9A 2GVZC 4MRVA 1QHXA 1Z0IA 3KXLA 1KZGB 4IHQA 2PX0A 1T5IA 1ZIPA 5BN4A 2GZAA 3TUJC 3KUDA 4ZI2A 5LDDC 2IS4A 3GLIA 2QMUA 4KSBA 3B2EA 1UKZA 4TMKA 1NVVQ 4A8JA 2UVQA 3DL0A 2W83A 4OI4A 1QG4A 1Z6AA 2FH5B 4LI0A 3U3JA 2ODNA 3A8TA 2FFAA 2WWWA 5B64A 4PPNA 4AD8A 4QBHA 2QBYA 5ANRB 5LBIA 3QQ5A 2UKDA 3LW7A 1GITA 2J41A 5L3QB 4D26A 4WZAE 3I1FA 4BE7B 3MWYW 3IQXA 1QVRA 3HR7A 4NE2A 2D3WA 1WE2A 2HJVA 2R44A 4TMWA 3T1VA 4BLOA 4ZDKA 4WZ6A 1EX7A 4QL3A 4G1UC 4QFMA 4MA4A 5JCZA 1TMKA 2R65A 3CH5A 2EVWX 4TQUS 1BYUA 2WAXA 5CB8A 4BPBA 1LF0A 4MRRA 5AR1A 1CXZA 3IPYA 1OT3A 4FMCB 1G7CA 5F9FA 1ZM2A 1LY1A 1DELA 1W2HA 1OFIA 1X86B 2BV3A 1Z2AA 2AKYA 4ESHA 3NXSA 4NL4H 2BBWA 4IFEA 5E3HA 3CRRA 4TL7A 2X19A 4IEEA 5HKKA 1YZNA 3THYA 3AVOA 5EXSA 2UZIR 1UFQA 3BS4A 3SOPA 1NVXQ 5DN6D 1YR7A 1DG1G 3U3MA 1CJVC 3HWSA 1N5JA 4DBLC 3ND9A 1E4VA 1W36C 1XCPA 1CF4A 4IDPA 1WBBA 4XSGA 5CJPA 2YOGA 3AVQA 2GCOA 1EFUA 2Z4RA 2KJQA 2RGDA 4LYHA 1JB1A 2EFGA 4PZYA 1NG1A 4YMTA 2EFDB 4XOIA 3EC1A 1E2MA 1HV8A 3AF3A 1F3OA 2X77A 3X2SA 3CB4A 3PV0A 4H9GA 4C30A 4NTZA 1QVAA 2XTMA 3CX6A 1IM2A 1QHHB 3OF5A 1GRQA 1HURA 4QJ4A 1UBCA 1KIMA 2ZAOA 4DWJA 2JLWA 3J81k 1DOAA 2H8KA 1FP7A 5CYPA 4EJSC 4MKHA 1WCV1 3GD7A 2GJKA 2HXSA 4WAUA 4DLRA 1WDTA 3QBVA 1T3LA 2QGNA 2XXAB 2PZFA 1U8YA 4ZI3A 3VNUA 1WXQA 2ANCA 2J45A 4QHSA 1UJ2A 3CNLA 1CEEA 3PFIA 1W0JD 4DIDA 1FQJA 1JEEA 3CF6R 3GLHE 2NZJA 3UG6A 1FUKA 2OFXA 4DLWA 1KOFA 3LX5A 1VYUA 1II9A 1L7VC 4QKQA 2FZLA 4QJ5A 4TSFD 4XIGS 5BQ5A 5C2JB 5L3QA 2QMHA 1KTVA 1V5WA 2GCPA 1E3MA 3KKMA 2GWHA 1XMIA 1YR6A 3DOEA 1TADA 4TYWA 1N5IA 3QXSA 3RAPR 5IT5A 4LV8B 1LV7A 5HCIA 3R7WB 1SVIA 3SN6A 1KDPA 2P3SA 4EIWA 4BFYA 2OV2A 3RABA 1OH5A 1AJEA 1QDEA 2ZJ2A 2VLIA 1OB5A 2JDIA 1EFTA 1QBKC 3ICEA 5GVSA 4PO8A 5KSYA 1IN6A 1E1RD 3KUCA 3BH0A 1AK2A 3QKSB 5J5CA 1Z8FA 4DCSA 1OIXA 1U98A 2NMVA 4PC7A 2A7QA 2HXYA 2ZANA 4JLVA 4Q21A 5AUQA 2D74A 1JXOA 1TF5A 2F1HA 4MYCA 5TARA 4ZDWA 1KI8A 1Z6TA 2GCNA 2N42A 1M34E 3M4YA 3TSOA 1G41A 4FI3C 4RZUA 1A5TA 1S9HA 4EUNA 2EQBA 4DB2A 5EZ5A 3K53A 4MITA 4LJ5A 4KHZA 3VKHA 5HE8A 1Q21A 1P4SA 4LYJA 2Q0HA 3QKUA 3BFKA 1MABB 5KO2A 1N0UA 4ITRC 5FOXA 1R8SA 3FMOB 1AIPA 2CNWD 1J8MF 3ZZUA 5C4MA 2C98A 2BDTA 3GEHA 3OZXA 3Q85A 1QHHA 3VR1A 1VPLA 4HZUB 1KGDA 5BYJA 2A78A 2B92A 1ZU5A 4LV5B 4C2TA 3LBHA 4ZDJA 3VR4A 3DOFA 1J2JA 3JZMA 4HB3A 4DDUA 3QE0A 4Q5IA 3LBIA 3FKQA 2ZRIA 3O8DA 5DYGA 3O8CA 1KI9A 3CX8A 4JMPA 3QEJA 4HAUA 2IYTA 5FI1B 3FHOA 3OHMA 1FQKA 3FPAA 4TMXA 2IYWA 5SZKB 1NL3A 1CRQA 4XJXA 1VIYA 1FUUA 1J8YF 1UEIA 2DWPA 4Q9KA 1OFTA 1ZVQA 2ATVA 1IQPA 821PA 2BMEA 1RRPA 5JEEA 1KY2A 2HYDA 4HAVA 4DHEA 4OQLA 1KAGA 1Z0JA 5B58C 3B9PA 4DCVA 1Q3HA 1JR6A 2YWFA 2EW1A 3R7WA 2OG2A 3C41J 4JLDA 3TE6A 4P33A 3I5YA 2IWRA 3HP1A 3DMDA 1SXJD 2GILA 3BAFA 3RRYA 1N3BA 1R2QA 1KZ7B 3SJBA 3WRYC 2BIFA 3NEJA 4M1SA 2R2AA 3D8BA 2K5UA 2ZS8A 5CK5A 2B7CA 2V55B 1NSFA 1YR8A 1GNRA 3VU9B 2FOLA 2OBNA 1W4RA 2QM8A 3H0KA 3I8XA 4AG5A 5EP1A 4PSAA 3W34A 1BS1A 2CL6X 4A36A 1G6HA 1FZQA 2XSZA 2ZYUX 3CPHA 2XZLA 4TZ0A 3VX4A 4N3NA 1B23P 1FP6A 5CK4A 1DEKA 1KSHA 2J1LA 1U94A 2C2HA 3KKNA 4EDHA 1MABA 3RWMB 1XP8A 1KDOA 4V0MA 3R20A 3GLIE 5FR1A 3SU8A 3WHKA 2KBEA 1AS2A 1T5LA 3RC3A 1U8AA 2ZM5A 5FI0B 4HZUA 2GXQA 4Q02A 1HT2E 2VH5R 4MKGA 1IBRA 3FYHA 3EPJA 4HI0E 4D0GA 2YC4C 1HA3A 2GK6A 2V7QA 3FVQA 2XEXA 2D2EA 5BN5A 1GFIA 2J7PD 3KQKA 1XBTA 1N0VC 1TQ2A 5G40A 1ZINA 3SQXA 5BWMA 4TLBA 3SFVA 2CE7A 1CR4A 4AK9A 2AX4A 1G21E 1S4QA 4LC0A 2WVJA 1Z6GA 2ZJ5A 2VP4A 4C0KA 1COWD 1VG1A 3AKYA 1A7JA 1VCNA 2IYZA 2V54A 2GTPA 2VRWA 1XTSA 3HYTA 3QKRB 2REBA 2DWOA 2QI9C 3OE7D 1XTIA 3W6PA 3EARA 4Z54A 2O52A 3WNBA 3MAAC 3OEHA 4DLZA 1ZUIA 3C5CA 3ZQ6A 3U60B 2WKPA 3ZIAA 2BEKA 4Q4LA 4FMCF 2RGNC 1O87A 1OHHA 5IK2A 4RD3A 3FTQA 4NYJR 5FUWA 3O47A 3A37A 2CHGA 3VR6A 4XWKA 3AEZA 3H1TA 4JLJA 2W6JA 2QN6A 4JS0A 5L3SB 4QGGA 2EFCB 4O25A 3PXGA 4NDZA 3NTUA 2IYQA 4IOJA 2XB2A 2JLZA 2GJAA 3BK7A 3EIHA 1A2KC 1U9IA 3MWLA 4JVNA 3SS8A 1Q0UA 2P6RA 4NZYA 2FMXA 4B48A 1ZNYA 4OHVA 4BLRA 4HLUC 2WSSA 8OHMA 3OAAA 3N2IA 2CJWB 3P4XA 4Q1CA 1XD9A 5FL7D 3X1WA 3K0AB 5G3YA 2ORVA 3A36A 4AYXA 2E9SA 1IY0A 1XMVA 3N5CA 2D2FA 4GPTA 3IBYA 1Q3TA 4GP7A 1S0UA 4KFUA 1NN0A 1MT0A 2AD5A 2C99A 2D7CA 2ZJBA 3MGCA 4Q1FA 3W6OA 2OCBA 2FFBA 1CRPA 1P75A 2ZJZA 4BLSA 4PX9A 4A2PA 2AHOA 4RD1A 1MO3A 2RGEA 2ZREA 3C7KA 3I5XA 3AGQA 2V6IA 4TL9A 5DI9A 1MO4A 2QSYA 2ZSDA 2QPAA 1E9SA 1D6JA 1E9AA 1VG8A 3ZYCA 4MUAA 3TKLA 3W3ZB 1KO4A 1R0WA 4M1OA 1S2MA 1FX0B 2QEQA 3TW4A 2ZYVX 4A6PA 3QKRA 1E9RA 2G1KA 1KKLA 1XJQA 221PA 2J59A 2P5TB 2Z6VA 3LX8A 4JT4A 4WBSA 3ZD6A 4F4JA 2HLDD 2QZ4A 3CO5A 2JLRA 5J4HA 1S3GA 3QF4B 2ZEJA 2R6DA 4HEJA 4MKIA 2VIIA 1G3RA 4BGDA 1E0KA 4MRNA 4C0SA 1W46A 1N6LA 3IIMA 4KYUA 3Q3JB 4PHFA 2CK3A 4P4UA 1JQJC 5L3SA 1L8QA 3KKOA 3T15A 1ZCBA 3WBKA 1SVOA 1XTRA 1GKYA 4DSUA 1HQCA 3CF0A 3CNOA 1E96A 3AVWA 2OFWA 2BJVA 5FTJA 1ZM3A 2ODEA 3EASA 3QEOA 3TQCA 3ZZTA 2HDNB 1TAGA 3E2IA 3QY0A 4CT4B 4BQSA 4KU4A 3UWOA 5FBQB 1KJYA 4GMXA 4HSEA 3FFAA 2WPDA 4CF7A 1M7GA 4C0QC 2ZRMA 3WRXC 4EFLA 4Q9JA 2C03A 2V8OA 1OPXA 4RSGA 3FWYA 1EFRA 1W48A 2IHBA 3K1JA 1Y3AA 4Q03A 4MYUA 2CJWA 4Q1DA 4DT1B 3MFYA 1P3JA 4L4UA 4JLMA 1TPZA 4JLPA 2NO9A 1ZC4A 4US2R 3NIBA 1KO1A 4YMWA 4Q18A 1IN4A 2IL1A 2ZI6A 1KI4A 1QZXA 4BASA 4M1WA 4Q4HB 3REFA 3THWB 4ZCMA 3GJ6A 2FFHA 1E2GA 2IYSA 3QUSA 3JVVA 1N5KA 2ATXA 3FHTA 1XD2B 1WQ1R 4O0MA 2KI5A 2ZRKA 4CEIB 1NVVR 2QQEA 4TMTA 2X1VA 2VHCA 2VYFA 3DKPA 5E95A 3ZD7A 1LS6A 1GTVA 1QHSA 3A1SA 3UATA 3TRFA 4NYMQ 3TJZA 3A1WA 3TQFA 4GOXA 1T8TA 4A92A 3WHLA 2YC2C 5CYOA 4UNNA 2NIPA 4KITB 5EXPA 1H8HD 4NCIA 1E79D 1FX0A 4JLNA 4DRZA 4I1VA 4XH9B 3CM0A 2VP9A 4V02A 2MMGA 1XB2A 3WY9A 1LVGA 4UXIA 3A58B 4WVFA 4E09A 1XWIA 4EQ6A 1MO6A 4Q4JB 3QI2A 5DE3A 3CZQA 1ZD9A 1IHUA 3QF4A 3T12A 3KQHA 1P2TA 2ZI9A 4B3XA 1NIPA 3DPUA 4RKFA 3RDPA 5J4LA 2V3CC 2PJZA 1E0SA 5EP3A 2OUKA 2GKSA 4FCWA 2F9LA 4G01B 1ZJ6A 4URUR 1E6CA 3CRW1 2XZOA 3ND8A 4HAZA 3LXXA 4PQFA 4EPRA 3BB3A 3QNUA 4NMMA 1E2FA 2VBCA 5FPYA 5D3QA 3KTAB 4R98A 3RRZA 3FMFA 3VKWA 2IC5A 4LCBA 2WSMA 4JJZA 4NPHA 1I2MA 1OSNA 3SYNA 2Z0MA 2VPPA 3ADDA 3U44B 2JLYA 3GJ7A 4Q66C 2MSDB 3PEWA 1G3IA 3AKCA 4V0ME 5DNYB 2RMKA 3KZ1E 1E69A 1G8PA 2YZ2A 1BYIA 1X1SA 4DT1A 3QPUA 3LV8A 4CEHB 2Z5FA 1E1QA 1EX6A 2NPFA 3SBDA 5AUPB 3DM9B 2Y8EA 1TQ4A 4B71A 5J4YA 3ZS8A 2QTHA 1KK3A 4MYHA 4ASUD 2VEDA 4Q4HA 4V0OA 4B32A 3B5JA 3KQUA 3PG5A 1FTNA 4ZIRB 2VP0A 3GMTA 4MYTA 1XD2A 3KJHA 4X8MA 4E22A 4I81A 4KFSA 1GIAA 2XOKA 1E9CA 1YKSA 1E1RA 4KODA 3AF4A 3LQQA 4LGMA 4MDEA 1R0XA 3F8TA 3IHWA 4C2UA 2PZEA 3K8YA 2P6NA 4I1OA 2IW3A 1WRBA 3CLVA 1UEJA 4LPKA 3D6TB 4W9MC 2B8TA 1D8TA 4P0TA 1G8HA 3M1IA 4A8JB 4Q4JA 3EWSA 5CLLA 1HT1E 1R5BA 3MG9A 3T34A 4M0LA 2XZPA 4F92B 2YJTD 1E9BA 1Z63A 1SVMA 1G4AE 1X8KA 1N5LA 1XMSA 2QMEA 3TR0A 3CUEF 1J7KA 1XCGB 1LF5A 4PC1A 2EYQA 5HPYB 1RZ3A 3K09A 2O8CB 1G8YA 2ZR7A 3BRWD 3CX7A 4B2LA 2GK7A 4Q7KA 5E4FA 2HCJB 2C9OA 3T5GA 1XMJA 3KTAA 1UBFA 4GOJA 2QPTA 4P31A 1L4UA 1WMSA 4OKSA 3EXAA 5KSZA 3U44A 1BH2A 2A30A 5FTKA 4XSHA 4HYYA 4NKRA 3BC1A 1OXXK 4IOMA 3K70D 2EFHB 3NWJA 4JYCA 4PPQA 1K5DA 1M7HA 3KJEA 3QVVA 3VFDA 3LQRA 2NG1A 2V9PA 2ZRFA 3RC8A 4OJQA 1FFHA 2R9VA 3TAUA 4CEHA 2GF9A 2BCGY 4TWZA 2FPLA 5DI3B 3FDIA 5JWRA 2J0VA 5JI2E 4L9WA 1Q12A 3SI7A 1DAEA 1N6PA 3ZGXA 1OFUX 4NH0A 1LS1A 2VO1A 3GJXC 4TTRA 3LWNA 1NVUQ 1S96A 1GL6A 5M04A 3IDQA 1E2PA 3OFNA 5EQTA 1FNMA 4P3YA 3RS2A 4BLQA 4FW9A 1NBMA 4ZIRA 1BKDR 1VCOA 3KX2A 1U81A 1NVWQ 1P5ZB 3D3QA 2WBLC 3AUXA 3MD0A 1NJGA 2GA8A 4RD0A 4BUJA 4HAWA 4A8JC 4YMVA 5LD2C 1XPOA 1X8LA 4L8GA 4ACAA 1X1RA 3NBYC 4K8OA 4C7OA 1F60A 1NG9A 3WMGA 1VMAA 3GLGB 3I62A 2WOOA 1FPMA 2ZITA 2JASA 3LVQE 1VG0B 3EAQA 1Z08A 4Q48A 3PJRA 4PTLA 3KXKA 5KSPA 4IDNA 4RD4A 5A0FA 1IAQA 1A4RA 2ERYA 5H68A 4F7WA 4AURA 3SC3A 1I4LD 1QHIA 3DDCA 1Z0AA 2Z43A 3U4QA 3UG7A 2ZSEA 4KBFA 4C9BA 1II8B 2CHVA 2D7DA 1UM8A 2P0EA 3MRSA 2JCSA 2QL6A 1XDBA 4NCNA 1UBGA 5FH9A 3SNHA 3W6NA 3IIJA 3ZQJA 1ZM4A 3AKEA 3EIQA 2H1LA 2GZDA 5DYIA 2NO0A 4C0LA 2O8CA 2G0TA 1NLYA 2AR7A 1KI2A 2IF0A 4G3XA 1U0JA 4P4SB 4IKEA 4C0AC 2OT3B 1E9FA 4AG6A 1XTKA 2GXAA 1Z6XA 3MLEA 2F3RA 3WP0A 3ETLA 4V0LA 5JS7A 1AM4D 1X3SA 2IHYA 4DUGD 3L82B 2JEOA 1Z0DA 4QBFA 2O5VA 2FGKA 2WMOB 2ZUBA 5HR5A 2F7SA 1COWA 4QXAA 1P60A 4UXJA 4JSTA 4Q7JB 1XXHB 1DE0A 2JAQA 3OE7A 2KB0A 4LY6A 3CR7A 3Q7QA 1XEWX 5DI3A 1BMFD 2H7VA 4GI7A 3LFUA 4HAXA 2NOAA 1VTKA 4F38A 1N0WA 4YC7A 4A2QA 3TH5A 2AFIE 2W0MA 2GETA 4C4PA 1FL9A 2YVUA 1NN1A 2R6CA 2ZE8A 3AF2A 4M1KA 3THOA 1JJVA 3T1TA 2VTKA 4XD7A 3K0CA 4NU0A 2GBLC 4B3DA 1PUJA 5D3MA 3U3RA 3DZ8A 2OESA 1OV4A 1XEXA 2ZIAA 3LLMA 3RYTC 5A4JA 3ASZA 5KNBA 1OIVA 2BBSA 1K8RA 1ZUNB 3U6BA 3I61A 5EP2A 3FKSD 1VHTA 1CR2A 1IN5A 1G7SA 1SVLA 1TUIA 2ZRNA 3P26A 3GLGA 2GNOA 2WICA 2R62A 2W2XA 4ZCIA 2W6ID 2O8EA 1RRFA 2GBLA 1QG2A 3CIOA 2PL3A 3CPEA 4OQNA 3UKDA 1K5GA 3ASYA 3NBFA 5JHGB 3QVUA 4D4MA 1S3SA 1TQ6A
chains in the Genus database with same CATH superfamily
5FA5A 3LNTA 3T4PA 1II8A 5KS2A 1LLFA 1UOEA 2JRLA 4ZGGA 3D54D 2QG4A 1EGVB 1M2OB 1Q5PA 5FBLB 3R09A 3FI0A 4NC9A 4B76A 1VFNA 3E84A 2HB6A 1UKEA 2LBPA 2YBDA 4O02B 1J1ZA 2PKQP 5TPZA 4DADA 1IMOA 2R8OA 3F67A 1FTGA 4W5WA 1GNQA 3UH1A 3W3AH 4DSTA 3ZDCA 5JS2A 4HJRA 5LUAA 1U7TA 4JKIA 2WWXA 4YRAA 3RIYA 1XAJA 2H9YA 2X7JA 4Z7NB 3FG9A 2IZZA 3RS3A 1YONA 3LKVA 2CLDX 5FA6A 1MAHA 2VDOB 2NTEA 4XOUA 4JFAA 1NZJA 1NT4A 2XCUA 4UTVA 2FY8A 1TVMA 3IT1A 2JZNA 5JSZA 4P3PA 3C3MA 3V33A 1T2UA 1M1NB 3FYCA 4DR5B 2W5UA 2NUTA 4AC9A 3D6UA 2IE8A 2QTVB 4TL8A 3GMIA 4YJ3A 4X97A 1XXHA 1Z16A 2PANA 8ATCA 3TK1A 5G1OA 4KMSA 3D6AA 1OFHA 3RRJA 4XVRA 3D6MA 1G5RA 1PW7A 4TVOA 5GOTA 4DA8A 5LP1A 2GN9A 2IGBA 2Q9CA 2JGNA 3WGNA 4BFLA 2DAPA 2WTBA 2CXUA 4K1XA 4UAGA 5K0SA 1R4NA 3LRPA 4RGVA 3QLUC 3RUPA 4BIIA 1QG0A 1AHPA 3LHSA 5GONF 4DLXA 4PG8A 1QUFA 1RBMA 4HWOA 4KE8A 1L7NA 2JJ1D 3MTQA 4L76A 4MGEA 2FUKA 4PHCA 4D97A 4RLHA 2WE8A 3KT8A 3V8EA 1Z07A 1DX9A 1K92A 1I1QB 1KFEB 2WZQA 5CCBA 1JYEA 1OLSA 2WJIA 3CUSA 1XTQA 2R85A 3EHDA 2C2MA 1YK1A 4X54A 5DASA 3WHIA 3LH5A 2XIQA 4Z9FA 4C5AA 1G8GA 1ZUNA 4Q19A 4NV3A 4UQPA 2FSIA 5JZBA 1ZVMA 2EEPA 3AR7A 4ZEWA 1YGYA 4WL0A 3WLIA 4MW0A 4AKGA 2VP5A 2O7RA 5B4TA 1XZAA 3MGGA 2G3YA 3U37A 2WAMA 4QICA 2CKMA 2RAPA 3AFGA 2NPOA 1TGVA 1Y3HA 2A5FA 1IJFA 2Z2JA 2IK8A 3VOBA 2XITA 1IZ0A 1K98A 3IR5A 4FD3A 1X38A 3LUCA 4N39A 3RG2A 4AG3A 4IIBA 4EI8A 4LK2A 3PWSA 4LJRA 3GJ5A 1M72A 1QKJA 3HMKA 4Q9HA 4EHIA 1CULC 2VYVD 4P08A 4UOEA 2KYRA 2Q4OA 2HPHA 1UXOA 2WHXA 3FN4A 4MVWA 1V37A 2C9ZA 1DUSA 1I6LA 4BJ1A 1KMCA 2ZR9A 3BF7A 2MT9A 3EFEA 3OEED 5U1PA 3M6UA 3W3AD 3AVTA 3FHJA 4PU0A 3WYAA 2H31A 3PNOA 1WHSB 5KHAA 2JFPA 2XJ9A 3EY9A 3FUWA 1E32A 3G9XA 1BXZA 2G04A 5EE3A 5E7JA 4W5TA 4OHRA 2RHBA 1P2DA 2IEYA 1IFXA 1JBQA 3EYAA 4MQEB 4B2IA 3N6XA 1JA9A 1O94D 2FZ5A 3FPGA 5EJMA 3WGJA 2ZB8A 4O29A 5A3QA 2A59A 3RB8A 3Q8XB 5T8KA 4R05A 2K7ZA 3ZVRA 5IASA 5TGTA 4JV5B 4UU0A 5DSZA 1FUIA 2ZT7A 2PKWA 5LZ7A 2ASEA 3CZPA 4J75A 4Z0TA 2DPMA 1ZH4A 2FRDA 2WIBA 4AMGA 1H8HA 2YHSA 3K5PA 3MRXA 5JJLA 4C7XA 3HFGA 2XWBF 3PE6A 1RXUA 1Y5NA 4NOLA 2VHYA 4UHJA 4YMGA 2WTEA 2F3UA 2J6CA 2W58A 1S2LA 2E3JA 3WI7A 4YRPA 1E64A 1NBME 1ELOA 1ZL0A 2BP7B 3JZAA 2YVLA 3KSRA 1UQRA 2EDCA 4AQDA 3OM8A 1UUFA 4TYNA 3LCUA 4N7BA 1LD3A 1EK0A 1M3SA 5IYZF 1I2DA 5T41A 2R84A 3U3KA 2FSGA 4CKXA 3OIVA 1L7QA 3UHPA 1YA4A 4BO2A 4F96A 1A5BB 1NPDA 3Q41A 2OOSA 3HKBA 3IELA 3UBMA 4KDEA 5KDLA 3EDQA 1PSDA 3S44A 3CW8X 2OXEA 1APBA 4P6VF 1JQ3A 2FB9A 1ND5A 4D46A 2VXBA 1SCDA 3LL7A 1D2AA 1D4FA 1BO6A 4TWRA 3HZZA 3I42A 1QMGA 5AQ1A 4J91A 2QTAA 2F8TA 5IU6A 3WWYA 1RADA 4RMNA 1OW3B 1TLLA 3HI6A 2PYIA 3SSAA 1Q2UA 1PDVA 4BNNA 1F51E 2CZGA 2VAMA 3DP7A 3TW8B 5HKBA 121PA 1UL1X 1AC5A 3ELBA 3VPBA 4YAEA 5DRTA 1E92A 3E3LA 2DBVO 2VBFA 3MTGA 5AK6A 1ZDMA 1K97A 3OOJA 3G3EA 1Q20A 1KJIA 1Z3IX 3ER6A 4OGLA 2E4VA 1YQUA 1FNBA 3EVGA 1HE8B 4RAOA 2GF0A 3QFSA 5I51A 3TZEA 4WLUA 5JNVA 4K0KB 1DC6A 3D5TA 1A7AA 3HCOA 4GX2A 1WD5A 1X1QA 2FW1A 2P6UA 1EK6A 4MS3A 2RHOA 2EEZA 2L17A 3O4JA 3WXMA 2FEOA 2W0SA 5P8WA 1ONPA 1F06A 2GI4A 3WDLA 2GEFA 2HBRA 5H0IA 3DKVA 2HHCA 5SYMA 1JMVA 1DBSA 2ID4A 4OG2A 4DMRA 7GPBA 2H4WA 3M33A 3ETJA 4QNMA 2OO3A 2X13A 4YXWA 2NZ8A 4P5PA 1PNTA 2Y1WA 4CIVA 3H19A 5J40A 3ROQA 3IDZA 3RUIA 2NM0A 1NUAA 4FQ7A 4QFDA 1G2IA 1ZG3A 1S01A 1ABEA 2FRXA 2ZE7A 4ZA2A 2OOKA 2AGVA 5LA6B 2YZGA 4EPWA 1XRRA 4OXIA 4WADA 2ERXA 2HWKA 3QEBZ 3NHFA 2R751 1GT91 2E49A 2HEIA 2A7XA 1KHTA 3RV4A 3L8CA 2A1IA 3EEQA 3GU3A 2CLOB 2X2PA 1JQLB 5K3SA 4CR8A 3OQVA 5BR1A 4PGMA 3E3NA 1PHRA 4IJVA 3FROA 1HO3A 1C4OA 3BMNB 3QOXA 4REMA 4XVHA 1K0FA 4OKIA 3PRJA 5BWNA 3U5TA 1CRLA 5DHFA 3EGXB 3M9LA 1SB9A 1BVHA 1P3Y1 5AJXA 3CONA 2VKTA 2ZRBA 2JI8A 5BV7A 5BW4A 1NPYA 1XLTA 3FJ1A 3FNEA 2IYFA 5JXWA 3LW8A 1W36D 3DYVA 2KS6A 3IKVA 3EOBI 4ZEVA 1BQ4A 3ZDRA 1EJ6A 2FYTA 3LPNA 3NT2A 2G88A 5IJXA 3CZ4A 2P4SA 3IOEA 4FFSA 1JFFB 3TD6A 2GLUA 4LPSA 1GOTA 2Q8NA 3H9UA 3NAZA 2AW3A 2RHWA 3IR6A 4IX1A 4TYQA 3D0KA 3WGMA 3GJQA 4P86A 3TB6A 2AEEA 5ENDA 1UQTA 3BD9A 4AIIA 1WXEA 1NLUA 3BDIA 4RK7A 3T4UA 2MSWA 1DBVO 5KTYA 2IQ5A 3EZ7A 2O2YA 3OTOB 1F1JA 1AD2A 1KY3A 2ANBA 4FNAA 4IRMA 4YN3A 1YKGA 3GGSA 4AWBA 5C53B 3QUBA 4UCFA 3ZU5A 1YC5A 1X8JA 1GZ5A 4RCYA 1LC0A 1Q17A 1G2OA 2JAOA 3KCQA 4IQGA 4V0SA 5B5SA 2Q7DA 3A6PC 5FBKA 3CLRD 4JUDX 5DNVA 4MVJG 2VJOA 1YZKA 3ZCSA 3FOFC 1DIAA 4FLFA 3QMVA 3B7GA 1OI7A 2NO7A 5CLQA 2OHVA 5I9IA 1RJ9B 3LCCA 4R51A 2I1QA 3JZDA 1VBMA 3BREA 5SY6A 3MK31 1KZ9A 1PD0A 3DFUA 3K2EA 1T34A 2UAGA 4Q3CA 3PIRA 4C1BA 1YB7A 1I10A 2JK0A 2Q9AA 3DMPA 3H9CA 1Z38A 3O8NA 3UAOA 1VJDA 2MTBA 1X0VA 3AETA 2E4YA 1AQUA 4GP9A 4XARA 5FO0A 3WHPA 621PA 4RZIA 2AFHA 5D2CA 4D5EA 3I3SR 5BUZA 2ZI7A 3OLQA 4RHCA 3IMCA 4J3FA 5DLQC 4WOPA 2W2KB 4L1KA 4G65A 3LUKA 2HGSA 4LJYA 2G9ZA 3DVSX 4RMGA 3ZWNA 3ZHQA 3EXIB 3NM4A 3DV9A 1CX9B 2O5EA 5CEJA 2FLKA 1W85A 2IW1A 1WXIA 2CXOA 6YASA 4CEJB 2C2XA 4F6RB 3A6KA 3OBBA 2B8NA 2F43A 2GBCA 3QE2A 1P39A 2R7NA 2VPZA 2NSDA 2OG1A 3Q7EA 1XEWY 2X0JA 4MH0R 4GW3A 1H0RA 1PR9A 2H4XA 3GCXA 3OCYA 2PUHA 4B73A 2WJVA 3ZJTA 3EVTA 4OMDA 5K8CA 2OLJA 4CG3A 1OASA 3IP8A 4DE5A 2ZPAA 3NEAA 4HPJB 2ZSIA 4KK3A 4NBSA 1CF2O 3LYUA 3E9NA 1YNOA 2I1WA 3EC2A 4GSLA 1JHQA 1RRKA 4MJLA 3ZHRA 3C85A 1SC9A 3M6IA 3ZLJA 3TPZA 4I6GA 5F5NA 4JI0B 1HY3A 2P65A 4PYIA 5ES3A 4C07A 1QF7A 7MHTA 2CDNA 4F2GA 2WNHA 4KN8A 3KSDO 3N7TA 4NBRA 2QL7A 4INOA 2YH2A 4Q37A 3L6BA 1N6RA 5GJCA 3VMFA 2Q3LA 3DO6A 1P4RA 4QUKA 3VO2A 2GM5A 2BM8A 1BFKA 1BN7A 4DANA 4YJ2A 1DKPA 3HADA 2XWPA 3T61A 3C6MA 4RZ2A 1J9EA 3VJLA 3M6XA 5CVDA 1IEXA 4RE5A 1HDYA 4UATA 1SU7A 3OOYA 1NONA 4MROA 4HAIA 3PUWA 4KWIA 1F2DA 2HSEA 5EXTA 4TWJA 2FF7A 4K9RA 1R74A 1Q7EA 1S1CA 1X87A 1EU1A 2FWRA 4O2AF 4R2JA 1T91A 5D5PA 1L5LA 2CT8A 3E5NA 1VG9B 1HTTA 1SHTX 2RGAA 3NYQA 4OHUA 3HU5A 4AY5A 5DYTA 4IXMA 4ZJZA 2QUAA 1E3JA 3EEYA 4PQEA 3UZUA 2W22A 1V1RA 2YHIA 1PSZA 3L3BA 1NJ1A 2QQGA 4WRRA 3SX0A 1M2VB 5DJ5A 1T5HX 2B2XA 1Z4LA 4GR4A 1XMOB 1Z28A 3OKCA 4NEHB 4LXXA 3R75A 4WA7A 5ALNA 3RTEA 2K87A 4B43A 4B3HA 1YL7A 1FMLA 2DE0X 2EIXA 2V7WA 1A50B 4O4JA 5EE9A 2ZSKA 5K0EA 4M21A 1GU1A 2D0OB 3MC1A 4JITA 4QD3A 3UJDA 1ZNZA 4P81A 1V35A 4BVHA 3I23A 2V7PA 2IBMA 4EJ2A 1NMQA 2A5LA 5HPYB 4NMLA 4N47A 4FT2A 3NVKI 2VQSA 1JFLA 4QECA 3C8HA 3NHLA 3TMYA 3R1IA 4AZ3B 2CXSA 3OX4A 5B3KA 1Z15A 3ON5A 2W9XA 4XCVA 2ZJ3A 1JH9A 5HYVA 1E2NA 3BKXA 2OXRA 3FSEA 3PSAA 2VXCA 1VHJA 1TA0A 2IXFA 1QF9A 5ECDA 3I2YX 4U8GA 3PHCA 5K2MA 3D4BA 1KZHA 3RARA 2XSZD 3AUKA 3SJZA 2HJ9A 2ZKLA 3BSYA 3HU2A 2CBZA 5EHGA 4PN7A 1MFZA 2O0KA 3COVA 4LC9A 1W0JA 2VJQA 2XWJI 2DY1A 4CQNA 1V4NA 2O8DA 4YB8A 4ESOA 1CT9A 4Q9AA 1G6Q1 1TCUA 2CNDA 1MV5A 1Q1EA 3A4IA 3ZWCA 3A6LA 3ES9A 4IO1A 4TSFA 4FW8A 4PNEA 3FB1A 2GESA 1RJDA 3G2PA 3PT9A 1U0TA 2ZTUA 1CZNA 3FB4A 4F3RA 4F5WA 4R2LA 1NVAA 3CPJB 4HAOA 2HX1A 4BZQA 1TRKA 2EYUA 1D03A 1DUVG 2XUDA 4IVRA 1OT5A 5LCXA 1C81A 3HWWA 3NHBA 1EGQA 2OXIA 2F8LA 1QR6A 5D86A 3SJAA 2OHHA 3CV3A 5I8ZA 3WFIA 4HKTA 5FLKA 2P35A 2YV2A 1LNZA 2C31A 2ZI4A 5ALEA 4RJTA 3EX7C 3L0PA 5JFOA 2HYIC 4GZLA 1KRXA 4XR9A 3HCDA 4ZCRA 4RXMA 5DXAA 2D0IA 2WM9B 1HYGA 4LQ4A 4ZK6A 5P21A 3EOZA 4WXPA 4KVGA 3AVXA 3VZBA 2GJSA 5ES4B 1XRMA 3K9QO 2IEDA 5CIWA 5CDFE 5FNVB 2I2AA 2HY7A 3OEHD 4J1TC 4O4LB 1K2VN 2ZVQX 3GRUA 4LWPA 4EUKA 2CLEB 1DO8A 1XDGA 5LB2A 3FYDA 3M4ZA 1XA4A 3Q3GE 5FOWA 3U4QB 2AZTA 4H7EA 4KJZA 4MEAA 4E12A 1J0EA 1KI1A 3C5EA 3VR6D 3UMSA 1J9GA 3DZBA 5JD6A 4U2DA 3PTAA 3S5UA 1QQ5A 1VQ1A 3ZWYA 5FPSA 1SJ9A 3E9CA 3ZE2B 3QVGA 5HQ3A 1IBSA 1M0SA 3FBGA 4X20B 1IIRA 3DCJA 2JJYA 4I1UA 3IVRA 1C0LA 1OX4A 4K6MA 3IL2A 1I1HA 4ZHQF 3K5WA 4H7FA 2PA0A 3TSCA 3TXAA 1C0IA 4N7JA 5IBCA 1EM8B 2NXNA 1KS9A 4KMRA 3DS8A 3I37X 4QU9A 4TRMA 5I6DA 2XD4A 3MT0A 2YWGA 3ML1A 3AUFA 3AB7A 5DKFA 1L5QA 4PZPA 3A70A 4GE0A 1EE2A 2UZ3A 3TZLA 3GRAA 3FDXA 3TECE 4FCTA 5JS6A 1G5FA 1L5YA 2QXYA 5HTKA 3RI3A 2Z1DA 1BE1A 3EVBA 5DM70 4JODA 1G3MA 4JVSB 1VFPA 2WWGA 4ZGBA 4CMAA 1CY0A 2Y67A 4MW5A 4B2YA 2KSQA 1W0KD 2ZI5A 3GZ4A 4PY2A 4ZMBA 3KBBA 2GRAA 5FA8A 1NDUA 1ZOOA 5SZJA 2BZSA 3H75A 4AJJA 5TIIA 4QG7A 1U02A 4J3JA 3KKPA 4F56A 2DR2A 4ARZA 3W90A 1HOXA 4GPD1 4RORA 2HA5A 1L7XA 2B37A 2PUAA 3IDAA 4PZ0A 2VRCA 4G25A 3W8DA 1T9HA 4WQMA 5ICGA 1JLLA 4X8LA 4WECA 5FFMA 1CB0A 1CKEA 2JH9A 1SXJA 2LUOA 3CTMA 3DOHA 3B85A 4J7AA 1XRQA 2CMDA 4L4YA 4OJYA 2DCMA 3SBEA 1IXZA 3IVAA 5D3MB 1XEXB 1A7UA 2AJBA 3ZVNA 1NVGA 4BN0A 3HNPA 4K6FA 4BN5A 2WTAA 4IIJB 3X1YA 2VCEA 2YRXA 4DM7A 1KI6A 3BKWA 1VMIA 4OHBA 4GI5A 3Q9UA 4WBNB 4H3VA 1R0SA 3KOUA 1DAGA 1Z4PX 4W7IA 5AKIA 4AECA 8GPBA 3CVWA 3K4HA 1CDEA 4O4IA 2F4VB 4LK3A 3C3AA 3IAXA 3V4PB 2DWQA 1IYZA 3LC7O 2O8EB 1FSZA 4IQ0A 4CM1A 3LLSA 2FWNA 4L4ZA 4YH1A 2HF9A 1EP2B 4OHFA 1I3OA 5IXJA 3FKJA 2RAUA 1ACMA 1WEHA 5A6VA 1AO3A 2H1OA 4J4TA 1N1EA 3FHLA 1WMEA 1ICIA 1XALA 2X8BA 4U7GA 4LBVA 3A6EA 2O2EA 4W8GA 4YAOA 4UM7A 1K8QA 1DSSG 2QUKA 1RPTA 4Z9BA 3G8YA 4FNMA 3PU6A 5JQGB 4AS1A 4QXPA 1WZIA 3ICWA 2GN4A 2OCYC 2HK6A 4PQYA 5EKTA 2FEKA 2DFKB 2R25B 3EQ9A 3RGWS 3T3PB 5ITZB 2IA5A 5I4IA 2YYAA 1KWGA 4X7PA 1LDEA 3CNQS 4M98A 1Q44A 3LHFA 3CUWA 4QPPA 3ZJVA 2GM9A 3QG5A 4O4HA 4DWOA 2BM9A 5CTJA 2WPDD 1WUKS 4X62B 4OGKA 4FKZA 4HNSA 3NFRA 3RANA 2ET6A 2VPXA 4R6XA 4BGVA 3MOIA 5ALXA 1NBWB 3PNLA 1K6XA 4EA6A 3NDPA 1P8AA 1X6VA 4ARSA 2Q6VA 4G4GA 1C7EA 1P19A 2EZUA 2XCQA 4F06A 5JSZB 3PQ3A 1CERA 5AUOB 4KLZA 1TJ4A 3NJRA 3CIFA 2NUTB 1GTG1 3G13A 3H84A 1T4BA 3P45A 4KPYA 3QM1A 3I1YA 2JLAA 4XE5A 3FR7A 2Y99A 1GTZA 2G6BA 2JD0A 2QR3A 3I9V6 4NXMB 1F12A 3AIKA 4M3NA 2VN8A 3DMRA 3PNQA 3I4LA 5F4ZA 3THSA 3BMQA 4A91A 3SFZA 1WZ2A 4WVLA 2GSWA 3B53X 4ERNA 5CFOA 5B12A 3KQOA 6PFKA 4ND1A 2RGRA 4Y2GA 3E9DA 3RSOA 3I6BA 4Q16A 1JE1A 4MV7A 2JHGA 3TNFA 1KMIY 1SIUA 3WQSB 5LWQA 2H7CA 2RGGA 4G5GA 2IWHA 5TLSA 2DH6A 1M5RA 3BORA 3AVVA 1XZMA 4HDSA 1XO1A 2EP5A 2D4HA 4RUKA 2UYHA 1KU6A 1V8DA 2QTNA 3P0IA 4I8XA 4MVJE 4R81A 5K8IA 1XWFA 1Y3CE 2AN1A 4PLFA 1R6BX 2GEVA 4YRZA 1X39A 1P1RA 2A58A 5CHYA 3WICA 4A27A 3EZXA 4EF4A 3ZKAA 3CVOA 2HU5A 4URZR 2W70A 1A4IA 2DTXA 1GQQA 2DXIA 4ZO8A 3VI4B 1O3YA 4R69A 1F2UA 2HPAA 2FI1A 4FNGA 1JI3A 3JQ9A 3L4BA 2ROQA 2W6PA 4DMMA 2QNRA 4ZRNA 1SKQA 2B4TO 2WF7A 4J9UE 4DNQA 2NAFA 2OHGA 2Z8XA 1JAZA 1MAVA 3QPVA 4MAFA 2ZSBA 4A73A 5ALRA 5EIFA 3HLYA 2J3MA 5BSEA 4X0EA 2AUNA 4RIFA 3S40A 1A8UA 1HNXB 4XUEA 3OJXA 4OQMA 1FFCA 3B1XA 2RAFA 2WG1A 1JB9A 1L4YA 1NW6A 3IBTA 2AI1A 3GVCA 4G8CA 2YDXA 5FL7A 4EG3A 3VR0A 3U5ZB 4BL5A 5GGXA 3V3KA 3IVMA 3J7TA 1SELA 4H0CA 4HADA 1N57A 1LNQA 4US1R 5EPUA 1YQGA 4TLAA 4U7DA 1TUBA 2VZ0A 5ALFA 1W5TA 2BEVA 1T36B 2EL9A 4KCGA 4D4KA 3QVOA 4XLTA 3OM9A 1JAHA 4NFHA 4DCMA 4YCNA 1BZYA 1VJGA 3AUYA 4YQYA 1RWWA 5IJZA 3EQ2A 3GDWA 2R7KA 3H1FA 4MIYA 5BOSB 2UYCA 4UUOA 4JDPA 4L9AA 1EI9A 3TI7A 5D5QA 1FVXA 3S55A 3I9LA 4Q7QA 2F9MA 4N5HX 1SCUB 3CUTA 4MUMA 5LQMA 5MN4A 2RHLA 3UMRA 1E8MA 2D2XA 3KYDA 5L3VA 5HKOA 1SULA 2PTGA 1UODA 5BV8A 1E7SA 2RB4A 3WGOA 4JYBA 2Q0XA 4XX0B 3N59A 1R7RA 1XLVA 3AHFA 1FXUA 4HWKA 3UJ9A 3SHVA 4FIZA 3HO6A 1L7BA 4UDYX 3SXJA 3ICCA 1ZIXA 4Z7JA 1DG3A 1H1LA 4RDIA 4TKVA 2FGJA 1E1QD 2EWVA 1VJRA 3IHLA 1V4VA 2YXNA 2OZEA 1FDOA 5ESDA 3T99A 3T5CA 2QW1A 2CC2A 2GHTA 5GV7A 1R6VA 2XUJA 3LAWA 2ZIUB 3R2JA 4V3CA 3NHUA 3OU7A 2W2VA 4DCGA 2XCOA 1KYVA 2Q6IA 3BERA 1NHWA 4NK5A 1DDIA 1U7WA 4WIAA 5ER9A 3U7RA 5BYKA 1R1DA 2N46A 3HKBB 3LQ1A 5DM1A 5BSFA 3DMFA 3ELWA 3CJRA 3T4EA 4DJFC 1ZWKA 1SXHA 3KOYA 2BI7A 2I2DA 1L9KA 1P45A 1PYDA 1C8KA 1ZMXA 3WYGA 1RSZA 1BX3A 4KXNA 3PF8A 3CXRA 3ZTTA 4ETNA 3FPLA 4UUAA 3CW2A 1I9CA 3UJPA 1B6SA 4XQ9A 4EHKA 2LZ0A 2H5LA 4E7PA 3V1YA 3WMWA 1H0KA 1XHLA 3QNMA 3LYLA 4JDUA 4W7SA 4OXQA 3IVCA 4LRUA 3VBEA 1U3GA 3EOAI 3OCVA 5COAA 3SC4A 1G8FA 2CCJA 2EV9A 1HE5A 2ZIWB 4FFWA 3UK0A 4ZALA 1FMJA 2MWMA 4RA6A 3VAZA 1G4UR 3L7DA 4FEEA 3IEUA 4FFBB 4HAYA 4JJ7A 4AZ0A 1A9XB 2FSFA 5FTLA 4RVFA 4CLOB 2PNJA 4MGIR 1C7JA 1XK6A 4M1YA 3RRMA 4IINA 1JLRA 1K6MA 2HA0A 1NR1A 3O2NA 2JGMA 1XCLA 2W2NA 3MZ0A 1JPUA 4G9GA 2XUFA 4WGGA 1JGTA 1OREA 3SHQA 1I7NA 1QV7A 2ZT5A 2Q6TA 3H3FA 4G1CA 5CIYA 4AZTA 4BRWA 1N6OA 4DPMA 2NO5A 1L5WA 2P2YA 2V8BA 3CNNA 4HXGA 1ODFA 3LQKA 4U7FA 5TT1A 5JFGA 2G0NA 4ZWNA 1XZBA 5AVQA 3ZEIA 5IZCA 4ESVA 3IDOA 3UJ3X 2CXQA 2OO5A 2X0EA 5CLIA 3HZRA 1U5BB 4HFRA 4TYPA 5EJ2A 5GMOA 3VOAA 2XTAA 4R8LA 3LCJA 3ZWKA 1V7QA 4RYLA 3SJCA 3DWIA 1QKIA 3GUYA 2OB1A 2ZUWA 4I4TB 1MVNA 3SHFA 2NT3A 4ZOLB 3VZSA 4CCAA 2VK1A 3B51X 4CM7A 2V58A 3HE3A 1VE1A 4QJIA 4DNOA 5KX5A 1NVMB 1I4TD 1NN5A 2GD6A 4X1YA 2YWEA 2WQ7A 4HQ0A 1A8SA 2QN3A 2RAVA 4DA9A 5F1PA 4WMLA 1K86A 3SEZA 3FZEA 3OFND 4YCLA 4AI6A 4NH4A 2WU0A 3BHIA 5EWLB 1N2JA 3RSZA 2RCNA 4C6SA 2G40A 4Y98A 1VLVA 4B35A 2ZRGA 4OYYA 4QG3A 2C96A 2BY4A 4UPVA 1R4AA 1QHYA 3QELB 1JAYA 4N18A 2B21A 5FLYA 3JQ7A 5HDQA 5JNRA 4GICA 4KGDA 1SZCA 2PCJA 4PCLA 2OENG 3HG7A 5DM2A 1JU3A 2WKRA 3G1WA 3ND7A 4GNKA 3R9IA 1XRJA 2OCDA 2X41A 2V5UA 2UXBB 5CVTA 1GJRA 3ZHZA 4A1OA 5DYNA 5KVVA 4LRWA 3WNVA 2VF7A 4KSCA 1ARZA 3MMXA 1XL0A 1DKNA 4UPEA 1IUNA 2N0SA 3K1YA 2AOXA 3STTA 4GL2A 1G8MA 5UKDA 2BVNA 2P68A 4KVAA 2QRPA 5FBWB 2O2CA 1SB8A 1DMSA 2G9NA 4AMVA 3LK7A 3HN6A 1TQ8A 5C35A 2M2IA 1YS4A 5G0TA 4EKDA 3ENQA 2AV6A 4JKYA 1DHTA 1VHLA 4I4LA 1YU9A 4KLNA 1WM1A 2FDRA 3HDTA 3OZAA 2HU2A 1C29B 1VMDA 3E70C 1QRUA 3D3WB 4RWEA 5KQLA 4BQRA 3SICE 3B6MA 3M5DA 5BMVA 2A5YB 2R1TA 1Y7LA 3OFSA 1TKBA 4O3FA 1LSOA 1QGUB 3BEDA 3HEBA 1UDBA 2OXFA 2LRHA 2PX3A 1Z8NA 1B1CA 4OYHA 5FD8A 3VHXB 3ZWQA 5B3JC 3FVVA 3G8DA 4P2GA 2IT1A 3S81A 2C2BA 1C1YA 2D62A 3VZQA 1HTWA 3PD7A 4BMSA 4QJ3A 2QPLA 4U2GA 1TF7A 3ZLBA 4DM3A 3AZPA 3AYXB 4W5JA 2NUAB 4LNHA 2XE4A 2DSTA 3RYFA 4XYBA 3TFWA 1CBUA 3HDQA 1Z7BA 1SCBA 1UBOS 2I0FA 2CDCA 1ORRA 4N0DA 3O3OB 4PAOA 1W5FA 2DUNA 4GEKA 3RU9A 4CU2A 2DHCA 2WAYA 5DBHX 5HKKD 5TS2A 1MRZA 3ED5A 1WDWB 3Q3IA 4ALIA 2DQZA 3UJ6A 2C88A 1S2OA 1W85B 3GFRA 2QUHA 4WFJA 3MD9A 3D3EA 1U99A 4KXXA 3QOYA 3B1VA 4RH3A 2WSBA 4DIFA 5HX7A 1FSPA 2Z04A 3TPCA 2I2BA 2ZRDA 4BVBA 1J2UA 5AM1A 1Z0FA 3FOBA 1H2BA 3KEQA 2YWXA 3U61B 4OLHA 4XYLA 3DR5A 1NZDA 2IEAA 1ZXBA 3S6JA 1C5KA 2OXCA 4J0CA 3P2JA 3L7AA 1GUAA 3AG5A 4TXHA 2FTKE 4HFMA 3CEJA 1CHDA 2VHTA 1PI3A 3KFLA 1RZRA 1IBKB 2DFTA 2WTXA 3T06B 1KYQA 3WK6A 4CTNA 2CSXA 2NTNA 4DIOA 2Q3HA 4XVCA 1HM5A 3T7AA 1ZIYA 3O1LA 4JLAA 2EXXA 5CAEB 4D44A 1GNLA 4BC1A 4F86A 2WWYA 1FE8A 2CLCX 5DW3A 3FTDA 1AGRA 5IW8A 3O92A 5CM2Z 1KVRA 1GA1A 3V8RA 2OP0A 3IUNA 4DVGA 1QIKA 4R0VA 1BHJA 1GEGA 5KYXB 1NAIA 3HPQA 2DQKA 4KAJA 1EWKA 3EGDB 5FV7A 5BSVA 4C0BA 1T25A 2YNMA 2XTZA 1ATZA 3TBFA 4QYWA 1WW8A 3C16C 3K9HA 4CKEA 4YJDA 1Q7RA 2PFSA 4BZXA 1H9AA 3KXIA 3ZGVA 3ZDFA 4DSZA 1GSOA 2HIGA 2QRLA 4HDRA 4HLUA 2CLSA 3KAJA 3PEUA 5E8RA 1OWNA 3C3PA 3I45A 4B81A 3PUIA 4DR7B 2WOJA 2YHIB 3TUZC 4GYYA 2P1ZA 3RFUA 4KP7A 4FFRA 4FHFA 4XTRA 5BSTA 4IGFA 4OHYA 4GRIA 3DHEA 1CDOA 3N2ZB 5J2TA 3LUHA 1EHIA 4S05A 4GXNA 4JT2A 1XJ0A 2GM4A 2Y1CA 5MGNA 4BFZA 2CUNA 3ENVA 3QX3A 5KVSA 1J4AA 1YQXA 5T4EA 5TJ9A 1X7ZB 3KB8A 4XVQA 3L6OO 4Z3KA 2NPIA 3GUVA 1TC2A 3EUFA 2EJVA 4AYWA 2D5LA 4U63A 4QE3A 2JFNA 2YS7A 3ASVA 4U7TB 3W1VA 2OYSA 2SHKA 3IIKA 2F1RA 4MQBA 5DT9A 1H8EA 1F8XA 5DWDA 10MHA 1ZUWA 1PJ4A 1W2WB 2ZBUA 3GAMA 4I2NA 2Z6AA 2ZOSA 1DV1A 2RC6A 2V6JA 3BH7A 2PZGA 5TQVA 2CNNA 4Q34A 1H4TA 3TD9A 1L3BA 2NTYC 5DGXA 3SFTA 1WXWA 4FGKA 1NN3A 1ZL2A 3KOWA 3M4JA 3KLMX 3AQ4A 2GDZA 4MJ3A 2WKSA 3AFNA 5H5JA 2CFTA 1OAKA 3TUIC 1RLUA 4GS5A 4V38A 3WGTA 3GMSA 4BWYA 4ZXFA 2AF4C 1L5KA 5JHHB 2Q1XA 1M76A 1PJQA 4D42A 2YMLA 1PLKA 5CA0B 1RBQA 2X4LA 5I7FA 3HUUA 2O8DB 3DE6X 1UKAA 3MWKA 4Y6SA 2ZYHA 1RZUA 2B7BA 2XI4A 2X7HA 4URXR 1R5OA 4LRSB 1RR6A 3W8FA 1V6CA 1IXYA 2GN8A 4X6YA 1RWQA 1DKMA 1HNWB 3NTQA 1KOJA 1NV8A 1UBJS 1T6YA 2JFYA 3GZNA 4GR5A 5DH9A 4CDNA 3D59A 3TAXA 3NRCA 1XDUA 2WUGA 3N2EA 5EUMA 2B5WA 3EIEA 1SUSA 1USVA 2N9UA 1WCYA 1XZDA 1AX9A 2JKZA 1OU4A 3O3MB 4GMKA 2WHQA 3NB0A 1P1IA 2WMNB 1UC5B 4GU5A 1Q83A 3IGFA 3M89A 3V2IA 4BGUA 1KZ1A 1ZU4A 4M37A 2XCLA 3N86A 4OM7A 4OHPA 4ANFA 1H2WA 1YC2A 2RSLA 2X4DA 2IOFA 3EZLA 2BCEA 3GJSA 3K6RA 3LIPA 2BM1A 1J8DA 3NVMB 1C8VB 2GPWA 2W8ZA 4HNQA 4UDXX 4XDGA 4KI0A 2CL7X 3PFHA 4MV1A 1SHKA 1FDIA 2P9ZA 2HRDA 4BO8A 5LQNA 4L74A 4IGIA 4EUHA 4DA7A 3K92A 4IV8A 4U39A 4LYAA 2B20A 1X7WA 5GADl 4IH4A 3DVLA 2IPAB 1OGYA 1A9SA 1GGVA 2IUFA 4KFTA 4JGGA 4EY7A 1DDOA 4IIYA 5C9ZA 3TLEA 1SK9A 1C8BA 4ZQGA 1Z5GA 4KDRA 2QA5A 3AY7A 3HPRA 1EBUA 3WLHA 1M34B 1IZZA 2H0QA 5F7ZA 1BE6A 4GT1A 4LJ8A 4AICA 3UXEA 2BHLA 2NYAA 1G7TA 2JAXA 2QQFA 5B7GA 3KQLA 3X2EA 3VKGA 3P9KA 4MQ4A 1XPRA 5TX7A 5LLDA 1GSAA 1UPUA 1QNLA 3DOUA 4XPIA 3OLYA 2XHEA 3MAJA 1MG5A 2BJWA 2QX9A 3JATA 3QVGB 1AA9A 1VCMA 3TM5A 4OKNA 2B2CA 1LJ8A 4XIYA 4OL0A 4RELA 1LK5A 1OX4B 1J0CA 1B41A 1JEDA 2RJNA 3JQDA 4JT8A 1AHHA 2W6IA 3SC2B 2WP0A 1DARA 1RLTA 1TMGE 2REOA 3KZXA 4RVSA 2OO7A 2GUGA 3QK7A 3IAS6 1KXZA 2MYTA 1F14A 4ZYVA 1OXKB 1IOVA 3OFKA 1PQYA 1GPMA 3RS4A 3PP8A 1BVYF 2UZ0A 5H59A 2J48A 4PFJA 3FTNA 2YASA 1WSWA 1T3HA 1ZNXA 3STUA 4IILA 5FPTA 1BG6A 2PLRA 4NR0A 3BJIC 1BXRA 1U8EA 5CA1B 1VIMA 3BOSA 3BGWA 3QMWA 1ORWA 1S02A 2XBUA 3NJ4A 1BEEA 2P2LA 3TL3A 4DMLA 4NI5A 1QTQA 2QTFA 3RRNA 5KEIA 2JVKA 2C7QA 2XRMA 4MCHA 3I73A 2RKOA 1BXGA 2GWRA 4MV9A 4LTDA 1UBUS 3C5WP 4Q3EA 4HVTA 1EGHA 2CNKA 2IYUA 4TUYA 2OPBA 4RIIA 3V8BA 5K05A 1CG6A 2IVFA 4F5EA 1TD1A 3K32A 1DFGA 1WOYA 2R68A 3LTNC 1B8UA 1E9EA 3CF4A 3DCIA 3CMMA 4DQKA 4WLOA 1RQLA 1QM5A 2K2QB 3ZZMA 1Z37A 3CRZA 3Q6IA 4KAAA 5IDWA 5I9SA 4NLLA 1QK4A 4Z86A 2YIDA 3ILYA 3PDWA 3BXGA 4IVPA 3N2GB 2ZXUA 3F8SA 4ZT3A 2O0MA 4MLCA 5HIMA 1BEZA 3THWA 3KC2A 1KJWA 1MH9A 3VDQA 3ZD8A 5C34B 4FXPA 1ZY2A 3X1MA 4A8HA 1BOOA 2PDAA 3AY3A 5AOCA 3NYRA 1GZSA 2PX4A 5DO9A 1N75A 3G82C 2WUDA 4KGVA 3WJAA 4B8WA 1EBFA 1TVKA 5HUQA 4KR3A 4RHTA 2RG7A 1QLHA 1SXPA 1IUOA 5JNLA 4F8JA 5D85A 3SF8A 3R9KA 3FOCA 5BURA 4Q47A 1HDOA 1SZJG 2ACEA 3QU2A 4CT0A 5J1SB 2F3TA 2B0JA 3K7EA 5JR3A 1ZYUA 4UBIA 4FDVA 2HBZA 3NTRA 1WVGA 4RHXA 5LC1A 3TOVA 1MDFA 4OB6A 2O59A 4D9NA 2BJHA 3U3OA 3N0WA 2Y1GA 2R8RA 1QQ6A 3N87A 1GARA 1T4DA 2KBFA 4LVNA 3ZNOA 1Z47A 4PPFA 5LD2B 3L46A 3L93A 1P6QA 4RJLA 1TEVA 2RHJA 3HGQA 4DR3B