3UWKA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
205
structure length
202
Chain Sequence
GLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARAAARDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 87
structure length 202
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uwkA00
1JAIA 1SULA 4TTPA 3RVBA 1P7CA 2QG6A 1O87A 3AP2A 3LDAA 2GZDA 5JLJA 2QTHA 4NCJA 4XWOA 1Z6AA 1OH8A 1MR3F 1W46A 1XEWY 1E2GA 2O0JA 1GG2A 4XD7A 2XITA 4ASUD 3HR7A 2V9PA 3KL4A 4IEIA 5EUMA 2ASEA 4B3FX 4EJSB 4RKFA 2QE7D 3QEOA 3TSZA 1A7JA 2R6AA 3WMGA 3T1OA 2F7SA 1KGDA 2JJ1A 1UDXA 4I81A 3TMKA 1SXJC 2ODNA 1OXUA 4V0OA 2L0XA 4KYUA 3PUWA 2W6IA 4DRZA 1ZJ6A 1K5DA 2G0NA 4MITA 1IJEA 1DS6A 3GJ8A 1KZ7B 3GFPA 2PEYA 3EIHA 3B7GA 4LJ5A 2GCPA 521PA 1T5LA 2NQ2C 1IQPA 2IT1A 4GRAA 2YWHA 1W4RA 4Q4JB 3UG7A 3VR2A 4Q4JA 4QG7A 4B6FA 3SJZA 4KVGA 4A2QA 1NMYA 4NYMQ 3NHAA 3QSYA 1MT0A 1VG1A 2ORIA 3QUSA 2O8FA 1XEWX 1KI3A 4ZV4A 2H92A 4DBLC 1TAGA 1FQKA 5HPYB 2GDJA 1ZM9A 2ZSBA 3AKEA 3MLEA 1XZPA 1OKKD 2PJZA 1P2VA 2QMOA 1KZGB 2YOGA 5CB6A 3P27A 3TAHA 3OZXA 2WAXA 2ZJ2A 5KDDA 1OSNA 1R0WA 4IOKA 1MABB 1E32A 3PG5A 4UNPA 2PEZA 1N6RA 2VHCA 1Z29A 1GFIA 3HR8A 1E69A 5FBLB 2ZM5A 3THWA 4A36A 1W49A 4DLRA 2QAJA 2ZRMA 4AD8A 3ZVRA 2ZE7A 4TWZA 4HB3A 4QGHA 4DUGD 4NHOA 1E9EA 3LA6A 3TGPA 1OXSC 2OFWA 4NBSA 1NIPA 4OKSA 5ANRB 4B74A 3D7MA 3QG5A 3JZAA 1G3MA 4NCNA 1EFCA 1NVWQ 4JSTA 1OFIA 1NRJB 3E5HA 5D3QA 4BFVA 1YR7A 1OIVA 4QGFA 3LW8A 2NO0A 2GJ9A 1MO6A 1PUIA 5DI3B 3RRYA 4MRRA 2J0SA 3ADKA 4LHXA 3I32A 721PA 3U61B 4HAXA 3U60B 4NCKA 1PVOA 4OHVA 3NG1A 1TX4B 2ZS8A 1G20E 1N5JA 3A8TA 3FGNA 1JPNA 4C0AC 4D25A 3U4QB 1CKEA 3LQRA 1TF2A 3KJEA 1WMSA 4HUQA 1HA3A 1Z0JA 4HLDA 1KO4A 1PLJA 1KK2A 3AEZA 3A58B 3FPAA 1U99A 2ZI3A 2ZROA 1WCV1 3BB1A 4LV6A 3FHCB 1EX6A 2OAQ1 2IYSA 2QENA 3SI7A 3T1VA 4PSAA 5K8IA 4XVRA 5BYJA 6Q21A 1FL9A 2IF2A 3KTAB 5FOWA 3R7WA 4AKHA 2UZIR 4GOJA 2J41A 1X6VA 3K1JA 1U8YA 2GZHA 2ZRJA 3TNFA 2DY1A 1ZNWA 1JBKA 2EVWX 4KVAA 3CONA 4MRVA 1E2QA 1F3OA 2AD1A 4E07A 2H7VA 2VP4A 3V00A 2HXSA 3FDIA 2WJYA 1CP2A 5EXSA 1OW3B 3I73A 3C8UA 1G8YA 1RW4A 2CL6X 4AYTA 4FIDA 4RJLA 3QKRB 2VTKA 1T9HA 5GVRA 3KFXA 3OIWA 5FH9A 5KSZA 3T1TA 2GWHA 4US1R 1E9RA 1CR1A 3NIBA 4C0QC 2ZRNA 4D80A 1L8QA 4G5QA 4X8OA 4Q19A 2WVJA 2WWYA 2CL0X 1E0KA 4GMXA 1ANKA 2QZ4A 4NU0A 5JS8A 4CZ2A 3IIJA 4DVGA 5KSYA 2GCOA 3LAWA 4HDQB 2A5FA 4MYHA 4BLRA 4DWJA 3VR1A 3WYFA 2JJ2A 4Q21A 4CIDA 121PA 2AWOA 1SVIA 1T0JB 1AQUA 1G18A 1MRSA 3V4FA 4E5UA 2R62A 2XX3A 1VECA 3EWSA 4L9SA 3FHOA 2JLUA 1KK3A 1MO4A 3F8TA 4IKEA 1Z2AA 2WWIA 1HUQA 4MYUA 3PVSA 2QY9A 1AJEA 1UAAA 1R2QA 1I4TD 5E4FA 4DZZA 2ZJOA 2JLVA 2ZRCA 1UPTA 2JJ2D 3LO5A 1KI6B 5C4MA 5G3ZA 2GF0A 3B2EA 4M9QA 3W6NA 4ARZA 3B1ZA 4ARZB 4OHYA 2BHRA 5EXPA 3CRW1 4X8LA 2OUKA 1RRCA 2AD5A 2VH5R 2X19A 4QJ3A 1SKYE 3CRQA 4WXRA 4US2R 2WPDD 4DDVA 5CB8A 2ORVA 1VCMA 1BMFD 1NIJA 4B6EA 1ONBA 2IL1A 5EE3A 2EFCB 2GBLA 4CYMA 2J45A 4D4MA 2QMEA 2HLDD 1FNMA 2IYZA 5B2ZA 4QKQA 1JJVA 2ONKA 2RCNA 3CR7A 3KJHA 1XMSA 1QHIA 1M8PA 2P5SA 3GEHA 3L8YA 3NH9A 4M8NE 4Q00A 3QBTA 4BGDA 2D7DA 4GL2A 1G3UA 1P3JA 3CNNA 221PA 4KSCA 3PFIA 3REGA 2IEZA 2ZUDA 4P0TA 3GLHA 4JBYA 1KYIA 4E22A 1WBDA 4B3BA 3KZ1E 4UKDA 3FKSD 3I4LA 4Q7MB 3PQCA 1VDZA 2NOAA 1G17A 1NG1A 1SKQA 2BMFA 3HPQA 1YZNA 1Z08A 4I1OA 4U5XA 1GIAA 4DLUA 1Q1QA 2QMHA 3IO3A 3VR4A 4TQAA 5LPNA 1XMJA 2AN9A 1YRBA 3OE7A 2GXAA 2CCGA 1E79A 5FL3A 2R2AA 5AJZA 1R5NA 3R8CA 5DISB 3I62A 3P32A 4H1VA 3S1AA 1YRAA 2FH5B 1GL9B 1GNRA 3ZGXA 1J90A 2GILA 1R8SA 1XXHA 1RFLA 3HJNA 2ZAOA 2ZJYA 1DVRA 2XNDA 1V43A 1IN5A 2BMDA 2JLYA 3W34A 2QTVB 1KDRA 3AVUA 1NL3A 2OHFA 1A2KC 2NG1A 3MJRA 2RHDA 1H8ED 3DKPA 4EPTA 1YZGA 1YR9A 3QXXA 3H4MA 3U4QA 3PUZA 4F4IA 2J46A 4DLVA 3ZZUA 5EP4A 1II8A 4RZUA 2BKEA 1II8B 4F7WA 1Z83A 1OHHA 3DDCA 4K81B 5E95A 4TL8A 2HEIA 3EZ6A 4Q01A 5J4YA 1JECA 1E2DA 2D06A 4O2RA 5C4GB 4QGGA 1E9CA 4M1KA 3MG9A 3RC8A 4JLJA 3CRVA 3U3KA 1ZW6A 1SHZA 3FMFA 2I3BA 4URUR 4LBZA 1TUEA 4NMMA 1F60A 3W90A 4ZDJA 3LX5A 4JLMA 4DCUA 4M1WA 1F2UA 4BASA 2OCAA 3RWOA 1QHYA 3AQ4A 1XX6A 4TLBA 2QAGA 3RS0A 3J81k 4M1MA 1E0JA 2C04A 4A1FA 1KAOA 4L15A 3AVVA 3LVRE 1T8TA 4M53A 2MSDB 1ZIOA 4MYTA 3R7WB 2Z43A 2QP9X 1SHKA 4P4TA 2PH1A 1J2JA 5IK2A 1TUIA 4EQ6B 2A5JA 2HUPA 3EAQA 5FUYA 4XH9B 1OFTA 4TYQA 2REOA 2AK3A 2PLRA 3AGPA 3QNUA 4TLAA 5IDVA 1COWD 1ZUIA 2O0KA 2UZ3A 2RMKA 2ZYUX 4BLQA 2N42A 4YMWA 3VFDA 1NVXQ 1M1YE 2Z6VA 4BECA 2BIFA 2FFQA 2WIAA 1G5TA 3TK1A 4PFSA 5HZKA 4PPGA 2QEQA 1HE8B 2H8KA 4XVQA 3RYTC 2H16A 2EU8A 1OIWA 3SJAA 4V0KA 3A36A 5TARA 3BOSA 2NMVA 2VSOA 1DG1G 5CIQA 2AL7A 4TMWA 4C0HA 2VP2A 4LHWA 2IWHA 3ETLA 5C18A 2V3CC 3KTAA 2ZR0A 3RSOA 3U2QA 1ZD1A 1N3BA 4AG5A 1IY2A 4DCVA 3O8RA 2X77A 2ZSDA 2PT5A 4G0NA 2GNOA 1RYHA 2ATVA 1L4UA 3FKSA 2Q0HA 3WNDA 4ZPXA 4W9MC 4PX9A 2VA8A 2O8BB 3GQBA 4UNQA 4B34A 4DLTA 2V6IA 2N46A 3KJIA 3PUVA 3IPXA 3QKRA 4IOJA 4JIMA 2XB2A 2QU8A 2WKRA 5G41A 2JEOA 5J40A 3C4JA 4IDPA 4PSKA 1NBMD 4DIDA 4LYAA 5FOXA 5JECA 3K0CA 5SZKB 2CNWA 4BWYA 1KJYA 4OK5A 2E87A 4CEIB 3QE0A 2GJ8A 2J59A 3P4XA 1OIXA 3V9PA 4YDSA 5HKKD 1UKVY 3C16C 2FZ4A 2NZ8A 4KXFB 2RHMA 3AF2A 4W5JA 5BWMA 5IK2D 1AK2A 1I4DD 2YWEA 2GAAA 4A8JA 2JIZD 2Q9AA 3TKLA 4L4UA 1QHHB 2GTPA 2MMCA 1DG3A 2ONJA 1GSIA 2HCJB 3TW4A 3A1SA 1WQ1R 2JLQA 5DSZA 2DHRA 2R44A 4MUAA 3GJ0A 3OEHA 5CLQA 4OQNA 5FPTA 1S1MA 4X8HA 3VKGA 1W5SA 4KAXA 1K6MA 1JEDA 2VO1A 3KKPA 4Q7KA 4TQUS 4C0BA 2NO7A 4BZPA 3A37A 2GXSA 1EESA 1Z0KA 3THXA 3THXB 3MJHA 4MGYR 2CDNA 3TLXA 4D26A 4BFYA 3IQXA 3KKMA 3O47A 5GJWC 2GXUA 1JNYA 2WSMA 3LV8A 3VR5A 1UBFA 1XDBA 1UJ2A 3WP0A 2IXEA 2XSZD 4QOSA 2JLSA 3FFBA 3OFND 4DDWA 2BVNA 3OIYA 3BXZA 5FOTA 2FEOA 2IYUA 2G9NA 3O8BA 1U9IA 4TYNA 2K5UA 3RS4A 1ZIPA 3T34A 3GLFA 2G1JA 1CJUC 4D81A 3B78A 3N5CA 4OQLA 3GLFB 1VCOA 3GLIE 1E2JA 1D5CA 3ZS9A 2I1QA 3LVQE 4UNRA 4YQFA 1CU1A 1S3GA 4LJ7A 4C0KA 4UJ5A 5FR2A 4B3XA 2ORWA 2XJ4A 5KHOC 1SVSA 3R9XA 2IUSA 3DM9B 1KDTA 3GEEA 4R7ZA 5FTNA 1ZCAA 4QNMA 5GJCA 3SN6A 3NWJA 4PAQA 2AK2A 4KITB 3EZ9A 2AFHE 1E79D 4NL4H 2J9RA 2WOOA 4DCSA 1GKUB 4R2IA 2GKSA 2QRNA 3AP3A 3D6TB 1YE8A 4XWKA 4KYIB 4AYWA 4HZUA 4DLXA 1Z0IA 4I1UA 4LJ4A 4DLYA 2WWHA 4MH0R 2HCBA 1QG4A 4OHZA 4TMKA 4A0RA 1TQ4A 4C30A 4JKIA 2XAUA 1Z07A 2Z4RA 3QEJA 1AKYA 4DSOA 4TYPA 4X8MA 4QM6A 3BFXA 3KKQA 4R71A 4C2UA 2JASA 4GI7A 3DO6A 2IYRA 4B32A 2NO6A 3Q5DA 2FOLA 3ICEA 4N1AA 1XZQA 4RKEA 4CDGA 2VHJA 1IY0A 4BLOA 4P4UA 3EPHA 5J4VA 3PCRB 3CPEA 1KJZA 4V02A 1KSGA 3QXSA 1UADA 2ZUCA 1NNEA 5EUQB 2BJVA 1XXHB 4PHFA 2ZS9A 2HYIC 1CJVC 2NIPA 4Q9LA 3K53A 1G7RA 2ODEA 4JLNA 1LV7A 1T3SA 1F2UB 1KO5A 3MSXA 4EQ6A 4ZDKA 3GJ4A 5JCZA 2VIIA 2WIBA 3VMFA 4EFNA 1W4BA 1GTVA 3QKSB 5CLLA 1CR4A 2AKYA 2BKUA 1FUUA 2RGBA 4G01B 1XTIA 1NN1A 4IFBA 4PZZA 1KMHB 1IN6A 1JB1A 1OPXA 2WWWA 4PHHA 2IBMA 2Z83A 3P4YA 3X1YA 1BYUA 4WAUA 4O2LA 4OQFA 1NG9A 4FI3C 4B43A 4GZLA 4GDFA 2J0QA 1F2TA 4M1SA 4U02A 5FPYA 4DSUA 2OAP1 2CLSA 3MWYW 3CWQA 5BW8A 3OEED 3SDZA 1E6CA 4OK6A 1G9XA 1G4UR 3D8BA 1CRPA 4PSVA 4TL6A 4NONA 1O3YA 4Q02A 1GVNB 1LS6A 5K8LA 5J4LA 2GVDC 3AVOA 4DXAA 2PLFA 1S8FA 3L0SA 2UVQA 1AS2A 4FW9A 5CK5A 4DSTA 5E3HA 2ZS7A 4LBVA 1E2KA 1I2DA 1BH2A 1FTNA 2F43B 1AGPA 5KYKA 2WOJA 3IBGA 4A9AA 1QHSA 3KUCA 3RABA 3ICQB 1AS3A 1JR3E 2NO9A 3NBFA 2EFDB 3WBKA 3T35A 2IS1A 3TJZA 1VYTA 4IDNA 5EXXA 2P6UA 1RJ9B 3LFUA 5J5CA 2ZYTX 1RRGA 3K0AA 2BEJA 4URXR 3U7FB 3DMNA 4Q18A 1Y3AA 3ZYCA 2PT7A 3OEHD 5AJWA 2VL7A 1UEJA 5B64A 3K09C 3VU9A 3G5UA 3BAFA 2RKOA 2CK3D 4IRUB 4U00A 2J3EA 1E2NA 4LRWA 4RZ2A 4TLEA 1C1YA 3AH8A 3BD9A 1FOEB 1M34E 4FCVA 4M9SA 5HCIA 3WMEA 3P20A 4Q4AB 5B58C 2DWPA 4PC7A 4RZXA 2BCJQ 2DYKA 4LC0A 1U9IC 5EE0A 2RGNA 3B9QA 3I92A 4JLDA 4L5BA 4LJ9A 4EPXA 1Q1EA 4JVSB 4V0LA 2BBWA 1JXOA 2XJ9A 4O3MA 821PA 2CBZA 4NH0A 3CZQA 4RD1A 1OH6A 4M2LA 4JL8A 1JEEA 2J0VA 3DMDA 3L0OA 2FNAA 4EPVA 1F48A 4UQOA 2YOFA 4D4LA 3U6KA 1UBGA 3UANA 4KJZA 3BFKA 4EKDA 3EARA 1NJFA 2ZSEA 4CVNA 1ETUA 3AVXA 2XZLA 1IXSB 1JPJA 1W1WA 2W6JA 4A4DA 2ATXA 5JI2E 4LGMA 4HEJA 1DAEA 5EE1A 1XJ0A 2XSZA 3FB4A 3KKNA 3RHFA 2GEVA 4NDZA 4TYYA 5LBIA 1NP6A 2NPIA 3GLGB 2ZQ5A 3UMSA 1XD8A 1P62B 1R0XA 4OQXA 1A4RA 1KY3A 2B8TA 1KJWA 1AA9A 5A4JA 3CIOA 1G7CA 2A7QA 1P2SA 2GAOA 5KPDA 4ZDWA 4S35A 4GFDA 1NSFA 4BFSA 2R9VA 1WDTA 2IYXA 1BO6A 2O8EA 1CLUA 1FTSA 5CK4A 2PCJA 5KSPA 1IJFA 4DDUA 4F92B 2R6FA 3F3YA 1II9A 3ZVMA 5H70A 4OHXA 1GITA 4EPWA 4ZI3A 5CDFA 2BBSA 1VMAA 5FUVA 1VTKA 1N2CE 4IVPA 3SBDA 1R10A 3VTKA 4URVR 1ZU5A 4Q66C 3VNUA 1J8YF 5FI1B 2F3RA 4YMTA 2EYQA 1ZU4A 1CR0A 4EJSC 1G3IA 4PHGA 2IYWA 2QUZA 2Q3FA 1Z0DA 4B76A 1TNDA 1CRQA 3FHTA 4ZCIA 3WBJA 4TMVA 2J7KA 4IOLA 4HLUC 4MKIA 2CLDX 4AG6A 3VR3A 4B2IA 1P5ZB 5JWOA 1NMZA 3AVTA 2BEKA 3TW8B 4FMCB 1NSTA 4RVCA 1ZD9A 1XCPA 3E70C 4WBSA 3RRZA 2G1KA 1QHGA 2JJ8A 2WJIA 4IFEA 3KQNA 1SXJD 2V6JA 4A0FA 1NJGA 1G8GA 2ZRPA 1KMHA 4EAQA 4M1OA 5DGXA 1HTWA 3U7GA 1E9AA 4JVMA 1J8MF 3PITA 5KUTA 3B1VA 2LKCA 4AKGA 3A1UA 2C98A 2WPDA 3CNOA 2YVUA 2D7CA 3SR0A 2F1IA 2GEDA 3GLGE 2WSSA 3TRFA 4Z1MD 3C41J 2KI5A 2ZU6A 2XZOA 5FTLA 2ZRIA 3EPKA 2IYQA 2OCPA 4NKRA 2BBTA 1IHUA 1M7GA 1F2TB 1KTVA 2F3TA 4C0JA 2YWFA 3BWDD 1TTTA 1GRRA 3PR1A 2RGDA 4A2WA 3SOPA 1E0SA 1SXJB 1YR8A 4Q1CA 2GHIA 4G5OA 5SZJA 2WKPA 4RCZA 5DH9A 3FKQA 3BIFA 5HR5A 1P9WA 3BK7A 4CT4B 1XB2A 2QQEA 2KB0A 4P32A 5AUQA 1RJ9A 3ZDQA 1KAGA 4MGIR 4JLKA 2BOVA 2ZITA 5EP3A 2DBYA 3VQTA 4TT3A 1EGAA 3ZH9B 5FPKA 1T3LA 4NYMR 3FYHA 4TMXA 1MOZA 3GLFE 4BPBA 1S4QA 2V7QD 3MD0A 5BQ5A 1T8UA 1X86B 2KSQA 4OQMA 2AXPA 5UKDA 3KQKA 4Q4AA 3OHMA 4D4JA 4YC7A 1NVVQ 3TVTA 3GEIA 4EIWA 4B2LA 1Z8FA 3EXAA 2RGNC 5FOVA 5GJBA 2QL6A 2HLDA 2V55B 3WHLA 3W5IA 2JJ1D 1XU4A 2QMUA 4B44A 1E9DA 5TV2A 5F9HA 4TTQA 5FUWA 4G5GA 4AI6A 3NXSA 1XEXB 1L2TA 2OEPA 1DO2A 4LJ8A 4PZYA 1MO3A 4JLAA 3AF4A 2D4HA 3W3AA 2JDID 2CE7A 2ZE6A 5M04A 1RC8A 2PBRA 1G1MA 1L7VC 5AK0A 4L16A 2OFOA 2PJRA 4CEIA 4MRNA 4H1UA 2QT1A 3AF3A 4JZKA 2VF8A 4Q5IA 1HV8A 1E1QD 1TF5A 1RIFA 1R6BX 2ZI4A 3NKVA 3TUJC 1AS0A 2O8CA 1G3RA 4G5SA 4MGZR 1M74A 1M6NA 3ZJYA 1RYFA 1A2BA 1DEKA 1HQYE 2J87A 4MUBA 4RD6A 4F93B 3V4RA 1E1RD 1Z0FA 5JRZA 2W0SA 2N1BA 5FUXA 2IS4A 1H8EA 4AWXA 1JI0A 1G8FA 4YXWD 1XP8A 2CE2X 2FE4A 3CB4A 1TADA 5BXQC 4D2IA 1XRJA 4FINA 2W2XA 5TB5A 2NPFA 2PMKA 2DWQA 2XNDD 2O8FB 1F5NA 1Z6TA 4PR0A 2ZJ8A 1XD2A 4HZUB 1ZNXA 3TSOA 4RCYA 4GP7A 3B1XA 2WSSD 4Z1MA 4OI0A 1KHTA 3BGWA 1Z6YA 2WZQA 3N2IA 3U5ZB 1KI2A 3WY9A 1IOZA 2VHTA 4PC3A 1W44A 2VP5A 3THWB 1SVWA 1U0JA 2F1RA 1AKEA 3TUIC 3U44B 1E2PA 1Z06A 1R7RA 3HU2A 4FN5A 1WXQA 3PXGA 2ZJ5A 4JVNA 3T06B 2NGRA 4PPNA 4WZ6A 4MDFA 3I8SA 4WXPA 3X2SA 3U6BA 4DHEA 1K5GA 1B0UA 1CIPA 2D74A 3C15C 4M1TA 1JQJC 4PZLA 4AC9A 4FMCF 1YR6A 1Q0UA 2CVFA 4JS0A 4LYHA 3TR0A 3IO5A 1XTSA 1G7SA 2QTFA 3W8RA 5FL7A 4BFUA 1N6KA 2ZE5A 5KDLA 3PEUA 1W4CA 2ZRGA 1TQDA 1EFRD 2QP3A 3EIQA 1DAFA 2PZEA 5GADl 4TMZA 3Q8XB 3ZZ0A 2HYDA 4C0LA 4HB0A 2O8DB 2KBEA 1EFUA 2GJAA 3QVUA 1X8JA 4LBWA 1VKJA 3T5DA 2QM7A 2I1VB 2ZETA 1ZNZA 4Q1BA 3QJYA 2VHQA 1E9SA 2OT3B 4A6XA 4JKYA 4WZAE 1ZM3A 1G6OA 3GLHE 3H84A 2E1RA 4JBXA 1EFTA 3A1VA 4JVLA 4P4SA 1OT3A 2QE7A 3CNLA 3WXMA 2V4ZA 3UMRA 4DLZA 4BLPA 4U7DA 2WAYA 3RS2A 1KI7A 2ZEJA 1OYYA 3AKDA 3H1TA 2VF7A 2YNMA 3DL0A 3NC1C 1XD9A 2C9CA 5D3MB 2A9KA 5E7IA 1D6JA 1XJQA 2IW3A 4KLZA 3A4LA 3HPRA 4D0NA 1XTJA 1E2MA 5AJYA 2DPXA 3IKJA 1GWNA 1TF7A 1IONA 3VHXA 2OLKA 1IY1A 3QQ5A 1JJ7A 2KE5A 5GJVC 3DVLA 4B35A 5BN4A 4Q4LA 4RZ3A 2FFAA 1HEIA 2RB4A 4M0LA 1ZNYA 1ZINA 2XOKA 2LKDA 1SVKA 2FZLA 2C8VA 3WP1B 4NYJQ 1XWIA 3L8ZA 5KOYA 3LBNA 3QF4B 3KQUA 5H8WA 5L8VA 4CEJA 1L4YA 4OBEA 4JLVA 1BMFA 1DO0A 5L3QB 2JLWA 1SVLA 2J0UA 3LD9A 5CIWA 5AWFC 3TQCA 1QG2A 3K0CC 5AJVB 2DR3A 4Q1AA 3GCGA 5A5GA 2RGEA 2XXAB 1Z28A 3K70B 5CM9C 2GF9A 2FSIA 5KNDA 4GOXA 3WMFA 1LVGA 2GBLC 3JVVA 5EQTA 5H68A 2QM8A 4LPKA 3IIKA 3T1QA 4OI2A 4CGZA 2V7QA 3I72A 4LZZA 4W7SA 1TPZA 2WWGA 3M6AA 4UXJA 3SYNA 1BIFA 1OV4A 5E7MA 3MFYA 5EE9A 2GVZC 4ZIRB 3BFVA 4A15A 3GJ3A 3NDPA 3AVPA 1X3SA 3SEAA 3BERA 5LB2A 3THYA 1DELA 3VKWA 4LYFA 4YMSA 2IA5A 2IHBA 2HJGA 4NTZA 4TSFD 3K70D 4HAWA 1OH5A 4ASUA 3CX7A 1N5IA 1E1RA 4Q9HA 3EA5A 2HJVA 2ODBA 2A5GA 2OV2A 3FVQA 3RSLA 4HAVA 2QN6A 1Q12A 3FTQA 5KO2A 1FZQA 2KWIA 2WKQA 2IS2A 4ACBA 4JYBA 1E2IA 1G41A 2ZVPX 2ZI5A 5KSOA 1KO7A 1KOFA 1MRNA 4S2EA 4Z8XA 1OYWA 1OKKA 3F0TA 2IYTA 3QXCA 1SKYB 1NN5A 3LRPA 2J7PA 3OESA 2BCGY 2R8RA 1OFHA 4M1YA 4RFVA 4HAUA 3AUXA 5JZVA 3GLHB 4EPYA 3AV0B 4XJXA 1KI4A 1P4SA 4LOAA 2SHKA 5CM8B 1FW6A 1W36D 1A82A 4RD0A 2GESA 5IF9A 3VR6A 2BWJA 2RGAA 2WMOB 3C5HA 3N70A 2PX0A 4AY2A 2QORA 1S9HA 3Q7PA 2QP4A 1T5IA 4NE2A 5JWHA 3MUFA 3RS7A 5JMTA 1Z63A 3PJRA 4N0DA 4RY2A 3WRXC 3JZMA 3B13B 3T5GA 1KI9A 2QI9C 4MRPA 1U2RA 2BMEA 2P0EA 1E98A 1XPRA 1C9KA 3B6EA 1US8B 3TVDA 3FOZA 3S1AB 3L2OB 4IXNA 4POAA 3Q72A 2Z4SA 3CRMA 4CEHA 1ZM4A 1N5KA 1KSJA 2OE2A 3KXIA 2GZAA 2TMKA 2YC4C 4QHYA 5DI3A 1R5OA 1KIMA 2C95A 5F3WB 1FNNA 3NBYC 1H8HA 1ZC4A 1DARA 5KNCA 2CJWA 4LUCA 4URWR 3OIVA 4O25A 1TU3A 4UNNA 1GKYA 1WRBA 4FMBB 3PENA 4GP6A 4PANA 3WNBA 3WRYC 1IM2A 2ODWA 4NYJR 3BORA 3GFOA 4PC1A 3NEJA 3GJ5A 4ZCLA 2A30A 1N6NA 1TQ2A 3NBXX 3U3MA 2KBFA 4E09A 4C7OA 1IXZA 5JCPA 1ZYUA 1S3SA 5FTMA 4WZBE 1IN7A 4B2PA 4K46A 1WF3A 3W6OA 3Q3JB 2CXXA 4GMDA 4II7A 3SHWA 2ZRFA 2RGGA 2DFKB 3B60A 1OJLA 5JHGB 1NVVR 2BBOA 3QPWA 3GJXC 2WJGA 2FMXA 3EWAA 4OK3A 2ZI6A 5B30A 2WMNB 4KO8A 4A8JC 5IT5A 2H57A 1ZMXA 4D4KA 4PPQA 3ADDA 3UMFA 5JBQA 1Q1BA 3QKSA 4LC1A 3U3OA 2IC5A 1J99A 1Q57A 3H86A 4GZMA 1LF0A 3OIUA 2B21A 3LXRA 1VCNA 1LS1A 1DAHA 3TBKA 1OXVA 4DB4A 1PV4A 4B48A 3CLVA 3SBEA 4AYXA 3LBHA 3CH5A 3EPLA 1P60A 1N6HA 2QBYA 3PV0A 3I1FA 4KFSA 5LD2C 3SS8A 4HYYA 4KODA 2DWOA 3CPHA 1P2TA 4QM7A 1U94A 3U7EB 4CEJB 1J70A 1QBKC 2G83A 5HZHA 4EPRA 2WJVA 3RWMB 2D62A 1BS1A 3EX7C 1MO5A 1WB9A 3P26A 3WYAA 3A1TA 5KDOA 4E03A 1MH1A 1QHHA 1W4AA 1WBBA 1KI8A 1T3HA 3QIAA 4RSGA 1VHLA 2ERYA 5KNBA 2QSZA 4IW3B 2BDTA 5FI0B 2AXNA 1UFQA 4LJ6A 4XSGA 4P31A 4XTCS 1AN0A 3RLFA 4PQFA 1N6PA 3DZDA 5EZ5A 3IDQA 5FTKA 1AZTA 1TMKA 3C5CA 4JL5A 2IX3A 2WICA 5K8UA 2RAPA 1DTSA 1U90A 4Q9IA 2W6ID 2Z5FA 1NKSA 3QKTA 4ZIRA 1EG7A 1U0LA 4DCTA 4V0ME 3LLUA 5SZHB 1NBMA 1XEXA 3PEVA 3ZQ6A 1YZTA 2QAGC 5LB4A 1N6LA 2EW1A 2ZR9A 2Z0MA 3FE2A 3MWKA 1D9ZA 5JJKA 2O52A 2J7PD 4CW7A 3OAAA 4M9XA 3GLIB 1NMXA 3K0AB 4NP6A 4UNSA 4ZO4A 1ZBDA 4B3CA 3M4YA 1QHXA 3ZVNA 4LX0A 2A78A 3OFNA 1N0VC 2YWGA 4XWAA 5DN6D 3K09A 4OI4A 3QPUA 2XTMA 2F1HA 1E99A 3BB4A 4A6PA 4TSFA 3MWJA 3EW9A 4IVQA 1VIYA 2VHUA 3OAAD 5JJLA 3CF6R 3EZFA 4Q4HA 2QGNA 2ZJZA 3ZQJA 3VNVA 4BEBA 2ZAMA 1JAHA 5DE3A 2WV9A 1OB5A 5FBWB 2OBNA 4N3NA 3OEEA 5GVSA 1FP7A 1P2UA 5HE9A 2XB4A 1KKMA 1I2MA 1RKBA 2FFBA 1YU9A 1XD2B 2VPPA 3B5JA 4QBFA 2UKDA 4HAYA 1FMJA 4CF7A 2CCKA 5JS7A 4Z8YA 3AM1A 3Q7QA 3QY0A 4B47A 3TSWA 1GZSA 2CHQA 3U3RA 3CF0A 1NF3A 4BZQA 5CDFE 2IEYA 4HLUA 3SFZA 2P3SA 5FTJA 1D9XA 2ZRHA 2MSEB 3EC2A 2YHSA 3TE6A 4JMPA 2CK3A 4LY6A 3QVVA 1H8HD 2C9YA 3LX8A 4O0MA 3QOFA 4C0SA 5FBVB 1M7HA 3DOFA 3C14C 3FMPB 3MWLA 2A2ZA 1UDWA 5EZ6B 3QENA 1ELOA 2GK6A 2OG2A 4DLWA 3I8XA 1GP2A 4DT1B 4CEHB 4NPHA 4W5HA 2KJQA 4FMDF 1JQLB 1XMVA 3VKHA 2YYZA 4WIAA 1RZ3A 3E1SA 3UXMA 3KFVA 2IK8A 1LNZA 3CF2A 3AUYA 2XTZA 1AQYA 2O8DA 3HU3A 5BN5A 1II0A 2YJTD 4W5WA 1OHHD 4LV5B 1Z22A 2XTNA 3BH0A 3ASYA 5TXGA 1NLFA 2IYVA 4JYCA 3GFTA 1KK1A 2OXRA 1YKSA 5JEDA 4ACAA 5E7JA 4TQ9A 2WJHA 2FDCA 4QBIA 1ZM2A 1B23P 4JLPA 1E2HA 4C4PA 5LD2B 1T6NA 4HUQB 4HB2A 1HT2E 2LCFA 2JAQA 1G5PA 1P6XA 1WA5A 1GRQA 1GL7A 2LWIA 5KTYA 3E2IA 1S96A 1XTRA 1D8TA 2QGZA 3BBPA 4I1VA 1UKZA 3JVUA 2VBCA 4GPTA 2VSXA 3ZIAD 1JXMA 1G5RA 4V0NA 4URYR 4DSNA 5KU1A 2CVHA 3ADCA 1K8RA 4I99A 1EXMA 1IN4A 1LW7A 4RD2A 4BEJA 2QAGB 1X8KA 1W0KD 2J5XA 1SXJA 2ANCA 1GAJA 3L0PA 5EE5B 1RRPA 2EFGA 2F1JA 1W0JD 1KK0A 4Q48A 1NY6A 4YONB 1VYUA 3CPJB 4Q1DA 2FJUA 1H65A 4LJAA 3KKOA 4ERNA 2G6BA 4QXAA 5DYGA 3PEWA 2RGXA 1GRNA 4QHSA 3SZRA 5TMPA 1TQ6A 4Q7JB 5TDHA 3QG1A 2YC2C 1KI1A 1YZQA 2VP6A 1U8ZA 3H0KA 5FL7D 4WOPA 4TTRA 2QPAA 4PO8A 2QBYB 4P4SB 3QF7A 2C99A 4M4SA 2IYLD 1DAGA 1CXZA 1MKYA 4C3ZA 1FFHA 1U98A 3KB2A 4GOKA 2REXB 3RS3A 4YMVA 5L3VA 4GBMA 2GJKA 3QXJA 2FU5C 1MV5A 1CJTC 2PMDA 2ZU0C 1OFUX 4XSHA 2FEMA 4HSEA 4JJKA 2Q21A 3ZVLA 2WWFA 1XPUA 1YZKA 2GK7A 4WVFA 3NVAA 1XEFA 4PQYA 2B7CA 2O8BA 1R5BA 5HKKA 3AVYA 2X2FA 2AHOA 2VLIA 4RFSA 2AWNA 3T15A 3GP8A 2V54A 4TL9A 2HT1A 1Y63A 1Q22A 5L3RA 2PX3A 5J4KA 5DNYB 2ZRKA 2DCUA 2FSGA 2HXYA 2X8AA 1BYIA 3LW7A 4FMDB 4Q9KA 1G8PA 3WHKA 2C96A 4KU4A 2ZTSA 2I4IA 2OO7A 5FPSA 3BB3A 2JLRA 2GJSA 3IEVA 2XZPA 1KDOA 4G1UC 2VRWA 3VU9B 4OYHA 2IWRA 2W6JD 3Q85A 2W58A 5L3QA 1SXJE 2OM2A 1S2MA 1E3MA 2ERXA 1KMQA 1LTQA 4WW0A 5HCNA 3ZS8A 3K9HA 2IXFA 4DKXA 4QJ5A 2DFNA 3CX6A 4B3DA 1DBSA 3HP1A 1G19A 3GPLA 2W2VA 1I4LD 1A5TA 1DAMA 3BH6A 4UXIA 2EQBA 1D2MA 4F4JA 4TLDA 5EJEA 1OH7A 1JR3D 2O5VA 1TEVA 4LV8B 2C5LA 1ESNA 3DEFA 1RVDA 4CT5A 4DC9A 1FX0B 1Z3IX 5J47A 4DJTA 5CITA 2C78A 1EWRA 2PZGA 5L3SA 3LH5A 4YMUA 2JLXA 5L3SB 4P33A 2B8WA 3HYTA 1ZM7A 2F9LA 4ITRC 3LQQA 3TQFA 3PIRA 2A3RA 3I61A 4PQRA 4Z51A 3MCAA 4QFMA 4KFRA 1IXRC 3VHLB 1QRAA 1Q20A 4OJQA 5JSZB 2FWRA 4PHTA 4HI0E 3REFA 2OBMA 4MDEA 4AKEA 3FWYA 2G0TA 2NZJA 3CH4B 2XGJA 4QHTA 1VG9B 2A5DA 1S9DA 3KQHA 2O8EB 1QDEA 4G5RA 3Q9LA 1KKLA 2NO1A 3RDPA 4I1SA 4KHZA 3ZD6A 1DAIA 2G88A 1XNJA 4F4CA 2XEXA 3UKDA 2F55A 1EFHA 1D2NA 1W2HA 3EC1A 3ZLJA 2GRJA 2H1LA 5EP2A 2F6RA 2WWXA 5CJPA 2WM9B 3WYGA 2IHYA 2YINC 2GXQA 1NN0A 3T12A 3NDBB 4NZYA 2OZEA 1ZRHA 1GDDA 1QVAA 4B75A 1CS4C 3KQLA 3FMOB 2P6NA 3ZIAA 2QT0A 2PL3A 1Z0AA 4DEYA 3UPUA 4TL7A 4BE7B 5JWRA 3I5YA 4C2TA 1Z6GA 2ZANA 3LBIA 1N0WA 2C03A 3X1WA 4QBHA 5F98A 3A4NA 2P67A 4G3XA 3P1JA 1ZUNB 3WNCA 3O8DA 1US8A 3I5XA 2VP0A 1CEEA 3GD7A 1PZNA 3MGCA 2O0HA 3HDTA 1P72A 5FFMA 3R8FA 3CM0A 5DYIA 3AGQA 4YXWA 1G3QA 4BFTA 3RNLA 3K9NA 2G3YA 5SZIA 1CF4A 5G3YA 4BZXA 5BYKA 2BC9A 3FMIA 4MRSA 3L0IB 2HV8A 2YKGA 1CR2A 2CHVA 4HB4A 3B1YA 1E96A 4C7OB 5ELXA 2BM1A 1KY2A 5DHAA 1YHNA 621PA 2CEAA 3MRSA 3TUZC 1R0YA 3NTUA 3HYRA 5EXTA 1XBTA 4XIGS 2JDIA 3IUYA 3X1ZA 421PA 2ZVQX 3BH7A 4TYWA 1VIAA 2G77B 1GM5A 1Z2CA 2W2TA 1R8QA 4HLQB 3N2EA 5TVKA 2GETA 4MGKR 4ON9A 1QVRA 4BQSA 1AGRA 2MMGA 3A1WA 4EFLA 4QC2A 2P65A 2PZFA 5AUNB 3IBYA 1UBCA 2CMKA 1JALA 4RFSB 3KB1A 5G40A 4B33A 2F43A 2CNWD 2ZSFA 1ZP6A 3CWZA 2W83A 2D3WA 3AKYA 1HURA 3F5FA 1E94E 5FOUA 3UIEA 3D31A 3W5JA 2C77A 3IEUA 3PEYA 2FSFA 3THYB 3GLIA 4TT3D 3K0SA 1XPOA 2ZUBA 1P9NA 4QRHA 3QPVA 2D2EA 4MKGA 4LSGA 4RD3A 1W47A 2ZYVX 4IDHA 4QL3A 4Y0AA 1TL7C 4N0EA 3IHLA 4LI0A 3NBZC 3GJ7A 4IEEA 5H1YA 4A8JB 5DN6A 4LWZA 1DAKA 4OHWA 1W2GA 2NTYC 2R65A 4YLGA 4B71A 1KO8A 4IJMA 4TN1A 2FV8A 4J0QA 1U8AA 3CZPA 4EUNA 4FXPA 4IVRA 4Q4HB 1NY5A 4ZKEA 1N6IA 2YV5A 4PTLA 3R9IA 1PUJA 4LHZA 3R20A 4FCWA 3LNCA 1RRFA 1G16A 1DADA 1F6BA 4FCTA 3W6PA 3CO5A 3GJ6A 4R98A 4HATA 4FWIB 4R9UC 4DCNA 3LXXA 1T0HB 2QROA 4R2HA 4EJSA 1XJCA 3K9GA 1S0UA 2WBLC 3TIFA 1NLZA 1QZXA 1Q44A 2FSHA 1CJKC 3MMPA 4BFZA 2CLCX 1RPZA 1X1RA 1KNQA 1XFAA 2IUTA 4Q7LA 2OESA 4Q47A 5JRJA 1J7KA 1GL6A 2B6HA 5JSZA 1PJRA 2ZE8A 3EASA 3QKUA 2X1VA 3SHFA 4LYJA 1WE2A 1QHNA 1UKYA 4QJ4A 3I3SR 1GILA 1G8HA 2EYUA 4D0GA 4URZR 1P75A 4L8GA 3QBVA 4HUTA 3THOA 4KBFA 3IHWA 1DE0A 3SJBA 4LHYA 1VYVA 2Y8EA 4PAMA 2QSYA 1FPMA 4PO1A 3X1DA 4KLNA 1G7TA 1VG8A 2ZRDA 1ZAKA 5FBRB 1EFRA 1KSHA 2ZR7A 3K8YA 2ZIAA 4V0MA 1G4AE 1LF5A 4D0LB 5IHPA 3LLMA 2ZI7A 1HE1C 5DO9A 1VCIA 3U44A 2VYFA 2ZREA 2RGCA 5JJIA 1Z47A 1LY1A 1RE0A 1CJMA 2ZJAA 4B73A 3CKLA 1TU4A 4ZKDA 4FD2A 1VHTA 4BFXA 4KBGA 5JFGA 1XF9A 3B9PA 5AR1A 5CYOA 2ZRAA 2P6RA 1ZCBA 5C2JB 3SQWA 3NH6A 5K8TA 2IXGA 2QPOA 1SVOA 4AK9A 2ZI9A 3BS4A 3SQXA 2H5EA 2ZPTX 1Z6XA 4JSYA 4DT1A 2E9SA 2R6GA 3KX2A 3SNHA 2JATA 2QA5A 3L43A 2WTUA 1OF1A 3R9WA 1E9FA 2AR7A 5KPJA 4US0R 4AIIA 2ZYWX 3ZZTA 2EWVA 1GOTA 2OSBA 1YZLA 2VSFA 3K70C 1U0HC 3QI2A 3DHWC 3IGFA 1N6OA 2C9OA 4PC2A 5DHFA 3CBQA 3HU1A 2H17A 2OFXA 3W8NA 2OCYC 4JT4A 4MQBA 4ILEA 3TR5A 1PLLA 1N0UA 3H2YA 4DEXA 2P2LA 2R6DA 1YQTA 3UK6A 4PO9A 2FGKA 3OE7D 3ONWA 1G64A 1Q3TA 1E2EA 3U3JA 4PAOA 5FBQB 3W9YA 3O8CA 1W36B 1P61B 3EPJA 3VAAA 3CR8A 4Y0VA 2CHGA 3DOEA 3ND9A 4IXMA 1P9RA 5DIFA 4KFTA 2ANBA 4D82A 2CCJA 4ZCMA 5JHHB 4MA4A 2IS6A 3UATA 2WHXA 4BFWA 4GNKA 1XTKA 4QGAA 2CL7X 2IYYA 2PCLA 5EP1A 4JLOA 2FG5A 4B3GA 5F2EA 5C1BA 1BOFA 3K0FB 4MYCA 2XXAA 1SQ5A 3EIEA 1P73A 3NC0C 3FFAA 1W0JA 3IILA 4C9BA 4HDOB 3A6PC 4A2PA 1LFDB 5HTKA 1TEXA 1NLYA 2D2FA 1BKDR 5IRCD 1LB1B 1XXHE 4UXHA 2W0MA 3NEYA 3KXKA 4I4LA 3AKCA 2IF0A 3LWNA 1M2OB 4BRUA 4HLCA 1G21E 1PLKA 4IDQA 3A4MA 3QXHA 2Q9BA 3C7KA 3CRRA 3UWKA 4DIEA 2FN4A 1KDPA 4ESVA 1SVMA 2R6CA 3ND8A 1Z5ZA 3RRNA 4FWTA 3IPYA 3CX8A 2J0UB 3AVQA 4UJ3A 3K9LA 4PXAA 3W3ZB 4PPFA 4NYIQ 4Q1EA 1VPLA 1XCGB 4IDOA 3SFVA 1YZUA 4AURA 1E0AA 1T91A 1XTQA 4XOIA 4HZIA 5JEEA 1NVUQ 3SU8A 2FPMA 4LDJA 2JLZA 4DB2A 3AP1A 1Q1ZA 4MKFA 1FUKA 5FR1A 4KFUA 2V8OA 3SE0A 1E2FA 4LPSA 4BLSA 1KSFX 2OILA 2JCSA 3CW2A 2V1UA 1FX0A 3G0HA 2QQ0A 4Q03A 4P3YA 4WA7A 2HT6A 5FPHA 2V1XA 4NYIR 1OXXK 1XMIA 1QF9A 1W0KA 1HY3A 5FOSA 3X1XA 1EK0A 1OE0A 1UKEA 5CYPA 1CTQA 3IIMA 4EDHA 4JL6A 1KI6A 4QBGB 4F91B 3ADBA 4LK2A 3DKVA 1FMLA 4OJKA 5AUOB 2REBA 5G53C 4ZI2A 3AVWA 1GNQA 1S1CA 3EA0A 3EZ7A 4A0HA 4LBYA 2MSCB 4HAZA 3DZ8A 5TY0A 4KI0A 5B57C 2O8CB 4JJZA 1IBRA 2DFLA 1ZUHA 5AJXA 4DDTA 5J4HA 3G82C 3GLGA 4TLCA 2BJWA 1W7AA 4KV9A 2FPLA 4ABYA 3BC1A 2VQSA 1SGWA 4A82A 3RS5A 2ZJBA 1UM8A 2BV3A 1OXTA 4H9GA 4OL0A 2OCBA 3ZD7A 3M1IA 1UEIA 4NCIA 4XTRA 3TH5A 2ECKA 3RRMA 3AB3A 2B92A 2XOKD 2QPTA 1KO1A 1R4AA 2YZ2A 5DLQC 2FF7A 1E4VA 4PC6A 3BJIC 4V03A 5CJ2A 1UF9A 3SJCA 1YJ5A 1EX7A 3IQWA 1KNXA 1CBUA 3K0EA 3GMTA 1YVDA 2OBLA 2XNSA 1AM4D 3CUEF 4AKIA 2DFTA 3KXLA 1X1SA 3Q5EA 4D6PA 2QRZA 1T4GA 4M21A 1WP9A 1ZVQA 2FX3A 4YDHB 5A0FA 1AZSC 2ZRBA 2GCNA 2WJJA 1MABA 2W00A 4A0GA 3EZ2A 1VG0B 3NHBA 1UBEA 2DB3A 4MKHA 4OI1A 1HQCA 4BUJA 1W5TA 3KDSE 4LJYA 2B7BA 4ESHA 1HT1E 2BM0A 2Q3MA 2OXCA 1FQJA 3AF1A 1EWQA 4RD4A 3MAAC 1NKTA 3SYKA 1SZPA 1G291 2OLJA 2AFIE 5BN3A 3VX4A 3PUYA 1Q3HA 2EFEB 2ZSAA 1IN8A 2F9MA 3KJGA 1E4YA 3DPUA 3LY5A 3RAPR 4F38A 4Q9JA 1A1VA 4TZ6A 1COWA 1W48A 1X8LA 2FA9A 1DOAA 1N5LA 4BLTA 5C46F 3PUXA 2JGNA 3EG5A 8OHMA 3SYLA 1ESMA 3RC3A 1DPFA 2BMJA 1NN3A 3SC3A 1FP6A 3UG6A 2JA1A 1E1QA 5P21A 1GUAA 4IOMA 1ZC3A 2AKAB 2CJWB 4JLBA 3BE4A 4XVUA 4ZDIA 4TZ0A 1W36C 3B8HA 4LHVA 2X2EA 2FFHA 3HWSA 2HF8A 4TMTA 1E9BA 2A5YB 4GSYA 5AUPB 1OB2A 1IAQA 2EFHB 1Q21A 2Q3HA 2VEDA 1D2EA 4A92A 4EFMA 1N25A 5F9FA 2VP9A 1HYQA 5LDDC 2HDNB 1CULC 3ASZA 1NBME 3K0FA 3OF5A 1JR6A 4KSBA 4LCBA 1NI3A 2P5TB 5D3MA 2H18A 1OLOA 4M22A 4CRWB 3VX3A 3RANA 3U7HB 2ZXUA 2RH5A 2ZRLA 3KUDA 3B85A 4JT2A 3TAUA 2JIZA 1GNPA 3D3QA 5HE8A 2GEUA 2HF9A 3M0EA 2Q9CA 1C4OA 4GT1A 4QNRA 2IUUA 5DI9A 3ECCA 4M9ZA 3BRWD 5JI3E 2YOHA 1V5WA 3B1WA 3UWOA 1ODFA 4BRWA 3T61A 1E2LA 1ZD8A 4DLSA 1R0ZA 2C2HA 4DUGA 4L9WA 2GA8A 1M7BA 3DM5A 4HDCA 3L82B 4JBWA 4K8OA 1XCMA 2Q6TA 4KCGA 4XD7D 3B82A 1HH4A 1U81A 4Z54A 2FGJA 1G6HA 2FPKA 3QF4A 4IHQA 4Q1FA 4NCHA 2GCOB 2QNRA 2J1LA 1AIPA 2EWWA 2AX4A 1JR3A 3AF0A 1GKIA
chains in the Genus database with same CATH superfamily
4TTPA 1SULA 4R3NA 3G7NA 1P7CA 1O6ZA 2WF8A 4Y2RA 1GG8A 2F67A 2HPAA 3OZIA 3S7TA 3WIVA 1EM8B 3CVWA 1P3DA 5ALJA 1T25A 3RRXA 3S2GA 1BU8A 5KJFA 2VK2A 3QMWA 3W3AD 4X1KA 1W46A 1XEWY 1E2GA 2O0JA 1GYRA 1M2WA 4ZANA 4F4FA 1ZK0A 3A1NA 3D4BA 3VOSA 2V58A 2QD1A 3KL4A 1N7IA 4JT9A 5LA6B 5AD1A 2QE7D 4NOJA 1XQVA 3ASVA 4FKMA 4P82A 1EDDA 2QX6A 3BWCA 2D5AA 3OZVA 3KU4A 1SY7A 4C20A 1DX6A 4MYDA 1KGDA 4RTSA 1UDXA 4Q39A 2LBPA 3TMKA 1RC0A 4TRNA 2M6KA 3VYVA 3T3NA 1OXUA 2G5PA 1A97A 4WK0B 5KYUA 4C14A 3CUTA 4L22A 1ZJ6A 5HRUA 10MHA 4C06A 5THKA 5A04A 1GDTA 1K5DA 4MITA 2A94A 1IJEA 4E5NA 1GZ6A 2PBFA 2VTEA 4TLMB 1VA4A 3GJ8A 1G6KA 1GCUA 1J5XA 1KXZA 4KWCA 4DE5A 3V42A 4LJ5A 2DUMA 5A2GA 3BGDA 1IQPA 4UCQA 1JSLA 1W4RA 3M4JA 4Q4JB 2WJWA 3P9ZA 4IIEA 3OIFA 4B6FA 5JALA 1DP4A 2FK8A 3DAYA 4TYMA 4A2QA 4EGCB 1L5LA 4KDFA 4ESEA 1YAHA 3ENKA 3QSYA 1O4WA 1R0SA 3NTXA 3CLUC 1IOWA 2DQKA 3LWDA 3EXEB 2QV0A 3WKEA 4A2CA 1WZUA 3GAMA 4OOEA 1Z2DA 2H92A 2WJ4A 4RIGA 1XG5A 4JGGA 4DBLC 4Y1RA 4GX5A 1QIIA 2GYVA 3DGEC 3FZEA 4HXEB 1LEHA 1ZM9A 4I5IA 2WM3A 3LSTA 2R4QA 1L4KA 2PJZA 4ZAVA 1A9PA 1KZGB 1I3OA 3V1NA 5CB6A 4FFOA 3V4OA 5KDDA 4KNYA 4C5CA 1E32A 2PEZA 3GROA 3KT0A 3SJ7A 1LI7A 5EIBD 3HR8A 1HOXA 5AKLA 1E69A 1CDOA 4IG9A 1FFXA 2H4WA 4FS3A 1EDEA 3QYFA 3W2TA 3ZWPA 2ZRMA 4XWWA 4L5YA 1KYQA 3ZVRA 5AVWA 3HVRA 4KDEA 2JK0A 1F14A 1SHJA 2XUJA 1RHKA 3HVIA 1J2TA 3IXLA 1P19A 2P9QA 5HKAA 4B6JA 3HB9A 3T41A 3QG5A 2OQVA 5BN5B 3O2QB 4XGQA 4R3WA 5BSHA 2BKLA 2ZM6B 1Z35A 1NDHA 2A58A 3DHVA 3NV9A 2Q28A 1OIVA 4QGFA 1QK3A 3SPXA 1CF2O 3HCBA 2NO0A 5DI3B 2WA1A 4JI0B 4Z0PA 1D6MA 1U7WA 3NORA 3PJGA 4J6FA 4LHXA 4MLZA 1XC7A 4RJ2A 1IQRA 3TG8A 1Y1SA 1FYXA 4HAXA 3DOUA 3U48A 2EF0A 4DCGA 3AUSA 3V80A 4XJVA 5GONF 3AIKA 1AUQA 3EYAA 1TTHA 1JPNA 3C5EA 3FUXA 1NW5A 3O1IC 5F7JA 3W9SA 5CFLA 2Z2YA 3DVAA 2BI8A 1TF2A 2E7ZA 1FTQA 3KJEA 4AG3A 2Q29A 3IBCA 4UEJA 1Y4UA 1CUFA 3E7DA 2VQ3A 5A6VA 1TZKA 2QLNA 3PUKA 1XPUA 1LFAA 2CZQA 2PS0A 1T4CB 3GUVA 1Z0JA 3HO6A 3JRXA 4H7EA 3DZCA 2E6KA 4JC8A 2O3QA 2DQYA 4IH9A 1V7QA 3IE0A 1R74A 4CU5A 1PI3A 1WCV1 3BB1A 3FHCB 4I9NA 4LV6A 1U0SY 2Q2VA 2IYSA 2R47A 2QENA 1HLGA 3V6MA 1CY2A 4XVRA 1P1BA 2GUWA 4HGNA 4QSHA 5C31A 5EQJB 3MA0A 4KR2A 5E0OA 3NIWA 4TKLA 3T7DA 1ZHHA 2I71A 3HFSA 3K1JA 2ZRJA 4XKJA 5ALOA 2DY1A 4BLWA 3IUMA 4CCYB 4E07A 3FDIA 2ZDQA 1OBVA 1ZVVA 2YJGA 4CM9A 4GUAA 2HU5A 1XXLA 1G8YA 2J9GA 3AXSA 4HMPA 8ABPA 1R3UA 5KQSA 4JC4A 4LRTB 4WRRA 4FIDA 1T9HA 4CTMA 2I4LA 3KWJA 4PYLA 3TYXA 3C3PA 4DV3B 1HFKA 3T54A 1RLJA 4MICA 4H6WA 1E9RA 3GRYA 3NIBA 4US1R 5I9LA 4X8OA 3L8HA 4Q19A 1VJGA 2WVJA 2I3GA 4TXNA 2Z08A 1SG9A 4AROA 1MG0A 4IMJB 4NU0A 2QZ4A 1Q6YA 1CZOA 4J76A 3U7QB 1SO8A 3ZK8A 2IW1A 2UDPA 2C8JA 4MUKA 4Q4CA 4XQ9A 3D8RA 2PO5A 1MAVA 4HDQB 3ANTA 4BLRA 2JAPA 2XUOA 4AY6A 2ZIVB 4QM6A 4CIDA 5KVAA 1SVIA 4F2HA 4A7PA 3K16A 4FQ7A 1SZDA 4QOGA 1KRHA 4RPCA 1G18A 3R7WB 1TC2A 2R62A 5LMUB 2XX3A 2QN9A 3EWSA 1UMDA 4HXYA 5I7UA 1GXSA 3D8TA 4C7KA 2HDHA 1FUIA 1Z2AA 3OTWA 4IKEA 1T13A 4F3CA 5JJBA 2Y3IA 4RY9A 1U2DA 4J2TA 5BQOA 3KPUA 4D79A 4Y2GA 1M2VB 3V2UA 2QY9A 1AJEA 3QTLA 1MJGM 1JPVA 2CXQA 4K9PA 1TTQB 3PQ8A 5U1PA 3V1TC 2CD7A 3FRIA 4MUMA 1GLGA 4BMVA 4OQ4A 1A9XB 3NNSA 1C8BA 3TI9A 2JLVA 2ZRCA 3TD2A 1D1QA 1WXEA 4C4AA 1KI6B 4FZRA 5C4MA 5JMPA 3B2EA 4CMBA 1VRVA 4OXRA 3GP3A 4ARZB 3EBLA 1I7SB 5IPFA 1AF4A 1W5EA 1PR9A 2Q5IA 1JTEA 2WIJA 3N87A 1TJPB 3ZCRA 1U7PA 1D4FA 2OUKA 4KYVA 4L3VA 1H2WA 4S1WA 2VH5R 2IITA 2FLVA 1SKYE 1PJQA 3QKIA 3UH0A 1G66A 4WKBA 2BPOA 5F7OA 5LP6F 1P1KA 2IU0A 3R3JA 4BP8A 3RGWS 3OD1A 1DSSG 4QYIA 1NIJA 1RBQA 1VL8A 3C8ZA 5FWXA 2CKDA 1Q7RA 2WD7B 2J45A 4B7ZA 4CYMA 2CSXA 1KJQA 3CX4A 3TPZA 5BT8A 5HP4A 1A7AA 4OFBA 5TQJA 1QR6A 1JJBA 4ZTUB 4R6WA 2RCNA 3CR7A 2G63A 3RVPA 1YGPA 2BEVB 4KAFA 2VEOA 1Y9AA 2Q8PA 2H1VA 1V4BA 2ISSD 3NH9A 1X8XA 3QBTA 2PY6A 2ZBUA 4J0FA 4ARUA 3F5QA 4YAOA 3ZTYA 221PA 4KSCA 4M54A 2IEZA 2ZUDA 3GLHA 1WUYA 2OBBA 4G1BA 1KH1A 1PIWA 3UEOA 4AZVA 4B6OA 4E22A 2HHJA 3GGJA 5I8PA 3ZHBA 4Q7MB 1UFOA 1YB5A 2EDCA 3K32A 3L4BC 4ZAGA 2L42A 2O7NA 5ICFA 3H2SA 4UU7A 1G17A 1NG1A 3DC7A 2RE8A 3E0XA 3QE4A 4G84A 4RDIA 4GPBA 5HJ7A 4TSKA 5GONA 2BMFA 1DBWA 1GIAA 3N6RA 4Y9DA 4GXQA 5CBKA 5BUQA 2G9RA 3KJFA 3AHHA 5JAZA 5AM5A 3DE2X 3QITA 2J5BA 2CLFB 2VDUE 3OE7A 1MXFA 2CCGA 2OBXA 3O26A 3P52A 5FL3A 2ADOA 5AJZA 4L5CA 5C8XA 1XN4A 1KJIA 2GZMA 4MB0A 4K8RB 3R8CA 4IS3A 3P32A 5EHNA 2ZVJA 4Y7CA 2RC5A 1FTWA 2D7JA 4EO9A 1BDBA 1VMEA 1QNLA 3R6LA 1J9EA 1LJUA 3F7TA 4E6PA 1Z6ZA 2HSEA 5TVGA 2DH6A 4Q3LA 4FK8A 3F6PA 5K0BA 3BRWA 4CM3A 4BX9A 2YMQA 1DJLA 1IN5A 1SU4A 3OJEA 1OYOA 4N7BA 3M6UA 1S01A 2OXEA 3MUOA 3VU1A 1NL3A 3B3JA 2OHFA 1A2KC 3HMKA 4FLMA 4WPGA 3TDNA 3SSMA 2YXBA 1RQGA 2A59A 2EERA 3HJRA 4B7AA 1YR9A 1V8FA 3GGGA 1Q1GA 3BF7A 4MUYA 4E15A 2N0SA 1V1MB 4S1PA 4L5IA 1PR4A 3CLTD 2PU7A 4LOJA 2PRKA 5JQGA 1T6ZA 1II8A 4RJJA 4RZUA 5JVDB 1II8B 3GCXA 1Z83A 1MFZA 1OHHA 2JBHA 3DDCA 4GOND 1QCZA 1L5FA 1R37A 2PN1A 1EVYA 5GY7A 1N4AA 1FSGA 1VBFA 1P4JA 1HG0A 5I9TA 5E8RA 2Q62A 2QG9A 3NP7A 4J0IA 1T5DX 4QGGA 4M1KA 5C4GB 4PM4A 5D01A 2AOWA 4PLFA 4XLTA 1ZW6A 4J0KA 1S2LA 2HA6A 2TECE 3EN0A 5IEBA 1NVEA 1U0EA 2BHLA 4UM9B 4OG2A 1T36B 3DZGA 3UT5B 4NQZA 2X5NA 1QO9A 2HXGA 4BGIA 2PRYA 4JJ8A 1JAYA 2QAGA 2V98A 1GZ7A 2C4TA 3ISTA 4M1MA 4ZT6A 3AVVA 1I7NA 4XQ0A 1XZEA 1QFYA 2JI7A 2XLBA 1RAGA 4IJ6A 4AYWA 2A8YA 2QP9X 2VJMA 2Z43A 2PH1A 4IGIA 1GCOA 1TUIA 2FPIA 1DT5A 3QEKA 5FUYA 2C9DA 2DJIA 2QLFA 4TYQA 4LFBB 4QXMA 2REOA 4QATA 1Q19A 1Z8NA 2H8GA 2VDRB 3AR3A 3N39C 3QNUA 1E1YA 4JGIA 5CVUA 1AO3A 3SF0A 3REQB 3W0LB 1ZUIA 2XPCA 4OI0A 3AF5A 1F8UA 2JW5A 3WJ1A 3PKZA 4AXBA 4C7VA 5BN4B 3BWBA 2J3DA 3QE9Y 4ARIA 2HRDA 3DOJA 3JQCA 4BECA 1NLUA 2Z8YA 3W2IA 4QDUA 5K20A 3TK1A 4CL8A 3U7JA 4PFSA 1GDHA 5HZKA 4OSPA 4RLQA 2H8KA 3GUUA 4FHZA 4XVQA 2O23A 2Q6KA 1OIWA 1YR2A 2VPQA 1BXGB 1L4NA 2YN2A 4TRMA 2VSOA 4PICA 4ND8B 5ILGA 1U28C 1VRCA 2FFRA 3KQOA 4X1OA 2VP2A 2IWHA 3BGVA 5K6TA 2H1OA 3RSOA 1GCIA 1DC8A 4FX2A 4ZYLA 2EP8A 2AOUA 1KKUA 1J5PA 3LVFO 1PBNA 3EULA 3N2GA 4G0NA 5CH8A 4EAAA 5LYJF 1E2BA 4EHJA 4W9MC 4ZYTA 2V96A 1EU1A 3AIMA 3BMNB 1AURA 1IULA 3QP9A 5DOZA 4M60A 4BVLA 1ODJA 3OPMA 3KJIA 3PUVA 3IPXA 4JIMA 4YP9A 3LQYA 4R0VA 4BIIA 1HE5A 3RC9A 3HCWA 3CMCO 1K8XB 5IC5A 1CRZA 2GO7A 1AY0A 5HCUA 1CVRA 3C4JA 4DIDA 3N7AA 5F64A 3ZV3A 2ZBRA 4C78A 4DG5A 1VSUA 4EJ0A 4KTVE 1KJYA 4MVJG 3DFMA 1SB8A 3PQFA 4GMFA 3QE0A 4ALIA 3P4XA 3HCEA 1OIXA 5GQSA 2XB8A 5D51S 1GPDG 3SM3A 4DZTA 4UUPA 4N6NA 2JGAA 2H08A 2P69A 1SHLA 3LF2A 3QEMB 5HKKD 3FVVA 4ZQCB 5IK2D 5DYWA 1AK2A 2YWEA 4XB2A 2XOXA 1P5FA 4A8JA 4DGSA 1SBYA 1L6RA 2JGIA 1MJHA 3Q7SA 3AWIA 5BVGB 2J67A 1SHUX 1JG2A 1GSIA 3SQOA 1GUYA 3TCKA 4BNJA 2I2FA 3A1SA 3UGKA 1WQ1R 2JLQA 4RY0A 5KNDD 4EZBA 3OEHA 4R8LA 1N2BA 2P9GA 5FPTA 4KXYA 4FQ8A 4X8HA 1W5SA 2B94A 3V1KA 4BVEA 3VKGA 1IWBB 4UCFA 1CRWG 1XALA 4E70A 4KAXA 3IPRA 1JEDA 1O94D 4Q7KA 4EEXA 3WAKA 1EESA 2O9JA 4HYTA 1YQUA 4OBXA 1NWHA 1FU7A 4I5FA 3IQXA 3KKMA 5GJWC 3WGVA 3IBTA 1V8OA 3LV8A 4RU1A 3VR5A 4YQYA 1QCDA 1O1YA 4D98A 3EFEA 5KJ6A 2XVYA 4DHWA 4EKEA 1PDOA 3AT1A 4EL0A 3CA8A 4QJIA 4I4TA 1YQGA 2IXEA 3SEFA 2G1PA 1F8GA 3FFBA 4JA0A 1PDWA 4OREX 4NNJA 1B6SA 3A11A 1XZKA 3BXZA 3OIYA 4M9CA 2FEOA 4RMNA 2OXIA 3VR6H 1PD1A 2G9NA 1U9IA 3L6OO 2R00A 1N2HA 1E1CA 1DC3A 1R18A 1W87A 4AJEA 2PYIA 2YWJA 3PXXA 4P3NA 1VP9A 5E1MA 3B78A 2PLNA 3N5CA 1D5CA 1EX1A 1W94A 4HQNA 1S3GA 3TXYA 4WASA 4B3XA 4D92A 2ORWA 2NP7A 4R1UA 3R9XA 4HRYA 1XL0A 3HB4X 1KDTA 2BFNA 1XJ5A 3L7MA 4R7ZA 3MUNA 4LW8A 4XCXA 1SUBA 4CDNA 4DWWA 1F0PA 4Z4HA 3Q1LA 1BWQA 4IL5A 2AFHE 3HM9A 3RU3A 3Q2KA 4QU0A 2ODTX 4O59O 2G28A 1EE2A 4XYGA 3HZHA 2P3LA 2BAGA 4KPUB 3D6TB 4II3A 4OXQA 2CXPA 4CV3A 5JNTA 3IPCA 4HTFB 4B3MB 5AW8A 1OREA 1UM9B 4Y2SA 3UKJA 4KDCA 2HCBA 4OHZA 4YUAA 5LWHA 4A0RA 2NV2B 3H2JA 4HS4A 2JFOA 4JKIA 4C30A 2WPNA 4CCSA 1VB5A 1J2UA 2BFMA 2H2IA 2Z4RA 1MJNA 3MBOA 5DV9A 1L4LA 4JP2A 2GAIA 3ORHA 1KOJA 1C0EA 1WDWB 2JASA 3VXKA 3QLUC 3ENZA 2GGSA 3DO6A 1JBQA 3T0IA 2FUG1 1SC4A 2F1OA 1ZJ5A 5JVDF 1PSDA 3MRXA 4IRXA 1XZQA 4N1AA 4NXNB 4RKEA 3UM9A 3JAKA 1Q0TA 2VHJA 1IY0A 4BLOA 3EPHA 1JGTA 3SMVA 4BO1A 4FD3A 4E2ZA 3WLFA 2RFLA 4H4CA 2O2XA 2VWGA 4AZ3B 3PEEA 4CKWB 1UADA 1NP3A 9ATCA 3DMRA 2ZUCA 1GD1O 1ECFA 1U8EA 2WQ6A 3PUJA 1M1NA 1PQ4A 3AFGA 3N76A 2BJVA 3FOCA 3V8VA 4JUIA 1M6HA 1CJVC 2BLNA 4YACA 5DGCA 1IL0A 2XE6A 4JLNA 1AGXA 1GUFA 1DL5A 1F2UB 4RMIA 4KG7A 5IJ0A 2WIBA 3DT8A 4LI3X 4XPZA 1W4BA 3VMFA 1GTVA 1U04A 2BKUA 4G01B 1B8NA 3U4GA 1SCNE 4KQWA 1Y8QA 4QQNA 4IFBA 5JFOA 3WWCA 4P36A 5E1BA 1RWBA 1IN6A 2OP0A 3IAAA 2P8SA 3PIIA 2IBMA 3LTEA 5E9AA 4BUZA 4EY7A 5BUZA 5B4UA 1IUKA 4RTOA 1BYUA 2FMFA 5LOVA 4WAUA 1NNUA 4O2LA 2NXWA 4CKYA 3KPYA 3KQVA 2G7ZA 4OQFA 4PU0A 3B2QA 4FI3C 1JLSA 5ENDA 5JD4A 1ISPA 1L7XA 1P2BA 3KZXA 4INZA 1I94B 4JC5A 2UZ4A 1D2RA 4F86A 1FFWA 2DFDA 3BILA 1F06A 5AMXA 5DDIP 5BW8A 5KWJA 4IICA 4PSCA 4PSVA 2CLKB 1QKJA 2PSHA 1XE3A 4TL6A 4UQPA 3UJ8A 4CM5A 4KWHA 2WJ3A 4YK7A 3HZRA 1KJ9A 1T36A 4PAWA 2DR2A 1LS6A 3EH2A 3QH4A 4HAIA 5K3FA 1OXKB 1Z2OX 1KVUA 4DQ0A 3C3WA 3NT5A 1QPZA 1A9TA 3X2EA 3L0SA 1AS2A 4JNKA 1RSZA 4EH1A 4DR3B 3NOVA 4DSTA 3SEZA 3KETA 2JVJA 2ZS7A 4J43A 2GUGA 1FTNA 1K7CA 2PA0A 2F43B 4GICA 5CLFA 1BOOA 5EJMA 3V8EA 2XVMA 3IBGA 2XBMA 1QHSA 3JSXA 3KUCA 3NAQA 3TKAA 4EG3A 3LWZA 3AG6A 3STVA 5AVRA 1IATA 2PS1A 3DTTA 3JD0A 3WBKA 4F6CA 3FDXA 3ZWWA 5I7VA 4OGLA 1V8BA 3GEPA 5HQJA 2ORED 3FYCA 3TJZA 1VYTA 4IDNA 5ES3A 3WGOA 4IV5A 4B8ZA 3NHZA 1RJ9B 1YIOA 2W48A 4HK4A 5F7ZA 3TDKA 5LN1A 2BEJA 4LY0A 3U7FB 3EF3A 1Y3AA 2Q4OA 3I5MA 4ZHQA 2PT7A 3QU9A 3VU9A 1J07A 4DNQA 5BV1A 5ILOA 2YZMA 1MGOA 1V8PA 3BAFA 4EG0A 4REQA 1U3WA 1ONNA 2Y71A 3D9QX 1N8TA 1P2DA 4OQQA 4UEKA 2BGWA 2J3EA 3NGXA 3T4XA 4DW8A 2FZKA 2VJDA 4DDHA 3AEQA 1B3RA 1YI1A 1Y3FE 4K88A 2WD7A 4KIGA 5HCIA 3S2UA 3P20A 3WMEA 4B4UA 5G4KA 3QUTA 3VSCA 4PC7A 4RZXA 5G4KB 2DYKA 2IXDA 3DBLA 3ZGZA 1HDZA 4OLAA 1U9IC 2ZT8A 5EE0A 5IM4F 4JLDA 3FFWA 3C0KA 3IQFA 4OHUA 4PYKA 3CVOA 4WDQA 2JCGA 4MVJH 3OE5A 3R40A 3DWEX 4EGSA 1S4MA 1DKRA 1K3TA 3WWYA 4BS9A 2CBZA 1R0BA 821PA 4NH0A 3CZQA 3IP6A 2HPVA 4M2LA 3ZU3A 1E1LA 2YV2A 3MWDA 3UJDA 3Q9SA 4DR2B 3FVWA 4PYJA 1RJEA 4YJ3A 1DIGA 4MKZA 1T5BA 4YJ3B 2FNAA 2HADA 2IX9A 4LOHA 3KM0A 3EA4A 4ENVA 2IRWA 4UMDA 5IHXA 4PLVA 4HN9A 4KJZA 3LK6A 3I39X 1LVUA 2I6FA 1EQ2A 1K4MA 3U4DA 1G63A 1WJGA 4DQLA 1M2NA 4IUBS 4F8JA 4O2BF 1IXSB 1JPJA 1USKA 3AYZB 2GKOA 3GUHA 1KYTA 2HSWA 5JI2E 2NYRA 3UPDA 1AUPA 4OL9A 4B7UA 3FB4A 3TFWA 4KR3A 3KKNA 3AOGA 3LUGA 4ISBA 5IWAB 5H9VA 5LU8A 1PUXA 3C6MA 2ZJ3A 3K96A 1P62B 1R0XA 3M83A 4OQXA 4U63A 2J6HA 2JGMA 4D41A 5MGNA 3D5EA 2DKNA 1KJWA 2PXXA 1AA9A 1QV7A 2WU0A 3CIOA 3L93A 1G7CA 3VO9A 5HQ3A 3D6NB 2G07A 1KXJA 1RJDA 1KWGA 4AMVA 3ZU6A 5CXSA 4ZHQF 3QFTA 3MM4A 4MJLA 5ELLA 4ZTBA 1FTSA 4PXYA 1NNI1 4FKZA 3GARA 1EWKA 1FXWF 2YHIA 3FR7A 4L4SA 4E32A 2A84A 4DMUB 4E33A 1GPMA 3OA0A 3NAMA 1II9A 2GFHA 4BVKA 3PA8A 3ZVMA 4NZ9A 4OFZA 3R3WA 4YREA 3VR4H 1U2EA 1XCJA 1N2CE 3COSA 3F9CA 4WMLA 5JD3A 4BEVA 1UDAA 5JZSA 4M86A 4UMFA 2OQRA 2ATCA 4Q66C 3VNUA 1J8YF 1Y8AA 4HNGA 5A5EA 1XAHA 1C29B 2OR3A 4YMTA 1NE2A 1ZU4A 4AJPA 3RREA 4EJSC 1G3IA 2OHHA 3CTPA 1E1DA 4OHRA 1MH9A 2WYWA 4M7WA 1OBOA 1XU9A 4B76A 3FHTA 1Y8RA 2B4QA 2FXVA 3BHIA 4M0KA 1Y8RB 4TMVA 3WBJA 2C2YA 2IZOA 1DXHA 2C4KA 4HLUC 4IOLA 4MKIA 2QTCA 3L40A 5CPFA 3SNKA 1P5ZB 1WUJS 4AG6A 4B2IA 1ORHA 4C08A 4AY3A 1UXOA 4RVCA 1RLIA 1ZD9A 3C3KA 3D3NA 2POCA 1Y3HA 1FDWA 4ZC8A 2TMGA 1NXVA 1EBUA 1XYVA 3L4BA 1KP3A 4TS4A 5FWYB 1ZW1A 2PS3A 4KWTA 4A0FA 3TNYA 4BJ6A 1NJGA 3B1JA 3L6DA 1DX4A 4KKVA 2EZTA 5E1OA 2D0OB 4OX9Y 1N2GA 1YFZA 2YXLA 1WCYA 1KEPA 1KC1A 4KXQA 3K1AB 3WJAA 1E9AA 4EA7A 3I1JA 4YMHA 3QHAA 5GPBA 5BORA 3QX8A 1F4PA 3HBLA 5T4EA 3JR7A 3A1UA 3BICA 3SR0A 2D7CA 3T9CA 1UQUA 4HY3A 3IA7A 4KXNA 4Z1MD 3OI7A 2XRFA 4XR4A 1VSBA 4FYPA 3WIUA 8MHTA 4E11A 1LC0A 1MP0A 1V5FA 4G24A 2JC3A 1A50B 5G0UA 5JAOA 4MW1A 3TVYA 3UV6A 1QTRA 4N9WA 1IEQA 1KTVA 2JBAA 2F3TA 3JYPA 4ZI7A 5A9SA 1FMFA 3BWDD 1G2PA 2R8YA 1HT0A 3STHA 3D6JA 1GQSA 2QTRA 1TJ5A 2RGDA 5HOQA 2ENUA 3QPAA 5DM4A 4LRYA 4AO7A 1E0SA 2VQDA 3ER9A 4DMHA 3HCFA 3HV2A 2Z95A 3IP7A 2F90A 2W43A 1KMMA 3AJ8A 1DWUA 1KF0A 5F35A 3OOJA 1UJBA 4HWPA 4LXXA 4YECA 4PLCA 2XTJA 4I2VA 1DGQA 1U4SA 1MJ5A 4XDHA 3ID6C 1E77A 2JBWA 3LWBA 1ZWLA 4I55B 2QQEA 3EAGA 3ISJA 1JYEA 2X2OA 3TSCA 4YJ2A 1Y9DA 1W6RA 3AV3A 1RJ9A 5AUQA 5EWLB 2AUTA 1RZUA 4OGWA 3TLZA 2RHCA 3KAJA 5I7EA 1E7RA 4EHNA 2ZITA 4YASA 2PMEA 3WLLA 4ZMSA 3URMA 3FPEA 1QO7A 4NZNA 2ZYGA 1SWVA 1BDHA 1VIVA 2JKVA 1RXEA 2XIQA 5F78A 3FYHA 4TS1A 4XDGA 1E7WA 3BTVA 4P22A 4MB6A 3RPEA 3NLLA 5GM2A 1H66A 4PNEA 2KSQA 2C1ZA 3KQKA 4Q4AA 3B9BA 3OD5A 2OB2A 5CD9A 3PRJA 4S0XA 2PL1A 2QL7A 1UCFA 2C5BA 3EGCA 4U4AA 3TVTA 3RVNA 2FMIA 4B2LA 3WL8A 3EXAA 3UGJA 2RGNC 1LCIA 1WV0A 3GZTB 1FPQA 5GJBA 2O59A 1O95A 3RK0A 2HLDA 3SDBA 3F7MA 1GLNA 5KC9A 4DIMA 3ILXA 3T3OA 2PG3A 4HDKB 1IBCA 2MYUA 4U7WA 2IDKA 3ZWOA 4C5BA 4FGJA 4DPLA 3U1BA 4I4TF 2RI6A 3PXDA 5LYJA 3DNPA 5F9HA 4X90A 4TTQA 2WF7A 3WGJA 5L4SA 4GSKA 3PFWO 5FUWA 5GAJA 3TLAA 3NXSA 1JHUA 1WXWA 3QVMA 4JITA 4MS1A 4Y9TA 4MV9A 5J43A 4RHEA 1RM0A 4X7PA 3VVMA 1EB8A 1N9GA 3SX2A 4Q15A 3WMWA 5E2BA 1QS0B 3AF4A 3FIJA 4MRMA 1CV2A 1QS0A 4MRMB 1RC8A 3B6ZA 2Y0CA 4PVCA 4RHTA 2OFOA 3W7VA 1UT5A 2PJRA 4CEIA 3EGIA 4H1UA 3EWNA 4IFIA 4BC0A 3D81A 3Q3HA 4Q5IA 1QX3A 2I3AA 1HV8A 1E1QD 1T15A 4ML3A 5AVXA 3VHRA 2NP6A 2PAFA 1VGVA 1I1QB 1X15A 3EEOA 4F71A 4WK6A 1G3RA 5IZCC 3C85A 1QJCA 4NVRA 2IYPA 1M6NA 1ENPA 3ZXUB 2ZR8A 4MQMA 3UCXA 4MUBA 3V4RA 2HBQA 4UBMA 2VDMB 2BKVA 1PJZA 2JJQA 3IS3A 3KYIB 1ZJ4A 4Q0MA 5FUXA 1XMOB 2GA9A 1JI0A 4YXWD 5JSHA 4IKOA 5AM1A 3ODPA 2Z6UA 1GTG1 3CB4A 2CWDA 4D2IA 2P3QA 4FINA 3AG5A 4IAOA 2GAFA 5SYMA 3I45A 2IP1A 2FR8A 4OXIA 3FR8A 2O8FB 1RE1A 1TKBA 2WABA 3L0BA 1B23P 1D1PA 1EUDB 3R74A 2EZ4A 3TSOA 4GP7A 3C4VA 3KYCB 4ZEOA 2WSSD 5J2UF 2DT8A 3E9MA 1UXKA 4R7GA 4YWJA 1KI2A 2VQ6A 3LRTA 2QRMA 1N7GA 2W2OA 4J1TA 1J21A 3PNYA 4P2BA 4PC3A 3OT4A 1UP6A 3C3XA 3THWB 2JD1A 1BD3A 5BWCA 5DLDA 1ZN9A 3GGDA 7ABPA 3GFRA 2W8BA 3HA2A 3KVVA 5EI5A 3WRVA 3WLKX 2W37A 3I76A 4URFA 1JDTA 3W7BA 5JH7A 3Q8LA 1WU8A 4NDAA 4BP1A 3PXGA 3P9CA 4YRCA 3WISA 3ZDEA 2K4MA 3I8SA 1YA8A 4WXPA 2WYHA 1K5GA 1CIPA 3D8UA 3TKYA 1T2UA 2XE4A 4DT1B 4FMCF 1YR6A 4I6EA 1K4KA 3WB0A 3TR0A 4ED9A 5M2QA 1G7SA 1JFTA 4GLOA 5FL7A 3CSUA 3W8RA 4EG4A 1CUGA 3P2OA 3DOOA 2ZE5A 1H9CA 5KDLA 3PEUA 1D1TA 5CGQB 1D04A 3F5SA 1ULHA 3OHSX 4GI5A 4I7EA 2B83A 5ALSA 5F73A 1I30A 1U3GA 4HH3C 1SIWA 3EIQA 5GADl 4TMZA 4JGBA 4C0LA 1LK5A 2I6XA 1YCDA 3ZE2B 1H2XA 2OAEA 1TIKA 3PZBA 1XZAA 4HB0A 4QARA 5FO1A 1EFAA 5B7PA 1DJMA 1D07A 2B8JA 4K9SA 3T5DA 5BRAA 2VA9A 3JX9A 5EIOA 4RTNA 3HO1A 1UPCA 2FAXA 3ETNA 4UU0A 2DHQA 2HFKA 4RVDA 3QJYA 1Q1NA 4KXXA 1E9SA 2BR4A 2C57A 4RLSA 4A6XA 1Z4LA 2Q1UA 5CX1A 3MERA 1AKNA 1GYPA 2CZGA 3Q8KA 2QVLA 4ME6A 1JFRA 1D5WA 4RTJA 2Q5JA 2BGKA 4G97A 4W99A 1FF9A 3H84A 3LP5A 4D02A 3AU8A 4JBXA 3JQGB 4YQZA 1Y1LA 3A1VA 4JVLA 3NWEA 1OT3A 2QE7A 3CNLA 13PKA 3UMRA 3WXMA 3TB4A 1CQPA 3DMPA 4U7DA 1Z8DA 2HUNA 3BIXA 4LOKA 4CI9A 1K6JA 2ZLBA 3PC8A 3T9BA 4AMUA 5EPUA 1HGXA 5GM1A 2A9KA 3IUQA 1D6JA 1OOEA 3N0TA 3KU1A 4OP3A 2QRGA 3A3NA 3LGAA 5JC8A 4D0NA 2P9CA 5B7GA 4CIAA 1JFLA 3GVIA 4H17A 3ZBTA 3KYDA 4U9HS 1S3IA 3IALA 3A2MA 2J9FB 4LISA 4RGVA 2W2PA 1I6KA 1RI3A 1P9OA 1JN0A 1PK8A 2ACKA 4IBOA 4BAGA 4ER0A 1MJGA 1GPBA 2BT4A 2O2SA 1XDUA 3MBIA 5GJVC 2JG3A 1LJLA 4IUDS 3PJFA 2Y66A 4BNKA 3ETCA 4F45A 4YJHB 4RZ3A 2FFAA 3JQ8A 1UK8A 1Y98A 3Q2OA 1ZNYA 2X4IA 5KS2A 4L8VA 3H5LA 4CIYA 2RG1A 2LKDA 5AI9A 3IAS6 3SY8A 1SVKA 3HKEB 2FZLA 2EGUA 3ANNA 2G6TA 1LVHA 3Q11A 2OD2A 3R3YA 1RM4A 3VH2A 1A96A 4HX2A 1XWIA 3L8ZA 1EVJA 5DBFA 3MTBA 3WDLA 3UK2A 4XUCA 1JZQA 3JS5A 2EIXA 1M2VA 4Q3EA 4WKNA 3VPHA 1WDMA 4MXDA 4D0SA 4OFXA 3LD9A 2J0UA 1YNSA 4GNRA 1LDYA 4HDAA 1M2FA 2RGEA 1QZZA 1Z28A 2SNIE 4G0VA 3PF8A 3B5IA 5KNDA 1GHTA 3RIMA 3PHGA 5HVNA 5C53B 3IIKA 5DHQA 3RV4A 2OHGA 2FQQA 2X2PA 3V6LA 3CMMA 1TXGA 4S3MA 4N5IX 1SCDA 1IEWA 4UXJA 3SYNA 2NADA 4YRZA 1IJKA 3B12A 2JI8A 5EE9A 2JD0A 3GJ3A 3KD3A 4Y9UA 1X3SA 4UAJA 1JEJA 3FDZA 1CD5A 4FX5A 2ABWA 1I7PA 2HJGA 1BCRB 4LA4A 2ZVDA 3RVMA 3MBKA 2HR1A 2AC7A 2ODQA 4TSFD 5AT1A 1HYBA 4Z4QA 4HAWA 4AS1A 2AYXA 3AHCA 3K94A 4MZXA 3U1TA 4ZJYA 1BMDA 1PN3A 1JDZA 2A5GA 3FVQA 4HL6A 1FZTA 4HAVA 2ZB3A 1M9NA 1KEUA 1PFYA 2QN6A 4PW0A 1LDMA 4WNCA 1SD5A 1Q12A 2YFQA 3FTQA 4CQLA 5KO2A 4BOYA 1CC1S 5EMMA 4ACBA 4PPYA 2HK9A 4CL3A 4DL9A 1W30A 4NENA 4UAVA 2ZWMA 4O6VA 5ELMA 1YBHA 3QJ5A 1OYWA 1SOUA 4LGVA 3HEMA 4H2DA 5EIFA 3HU5A 3QXCA 3LRPA 2ARKA 3HXMA 2WYVA 3RRJA 1Y48E 1XK6A 1OFHA 1NNSA 2W6NA 4BQOA 3BSSA 5A4MS 1CZLA 4K6FA 4YHHB 3DV0B 1QRUA 4B84A 2HMSA 4RFVA 3AIOA 5J1TB 4A27A 4RKWA 3S81A 3H65A 4K0KB 7MHTA 3DMYA 3GLHB 1XZFA 4CIVA 4XYLA 3A2KA 3G59A 3CZ4A 3Q6IA 3V7FA 3VZBA 5K1ZA 3V8MA 1I6LA 4ARAA 3UMYA 4RD0A 2J3MA 2GESA 5BYAA 3FSRA 3VR6A 2BWJA 1X39A 4ZCQA 2WT9A 3PT5A 1JKFA 3PBKA 3KHSA 1OBFO 5EJ7A 2V0GA 2PX0A 1DDOA 4JCCA 5EQFA 1MDFA 1ZD5A 4JNCA 1YT5A 1FRQA 2QP4A 3I5AA 3P4UA 3ZWMA 6CHYA 1CE8B 4NV1A 2IPAB 4NE2A 1LPOA 2GFIA 3RS7A 5F33A 4EG7A 3VR5H 4M9UA 2QLMA 2XUGA 3LE8A 1OLXA 4CGYA 3NJ8A 1PBTA 3PPWA 4OATA 2HC9A 2I54A 3OVMA 1OX4B 2J3QA 5BOSA 1PR1A 1ZPDA 3L7KA 1RACA 3ZX4A 2BN4A 4WN9B 1E98A 4EMSA 1HE4A 3V8BA 1C9KA 3TVDA 2XMQA 1SUPA 3FWPA 2IOQA 1ZS9A 2P79A 3A06A 4YWHA 5LZ5A 2YMLA 3L46A 3SYTA 4CTNA 3CRMA 5FP0A 4KXLA 1N5KA 3NAGA 5DK4A 4KMRA 3V33A 3P9PA 3OEYA 3GR6A 2CMGA 2TMKA 3A28A 4O5AA 3L8FA 5CT4A 3EMBA 3BWXA 3GUZA 4OGKA 5M29A 1R5OA 2C95A 4WINA 4JBLA 4CG3A 1H8HA 2FB9A 1DARA 2IOYA 4X41A 4DXHA 1IBLB 4OTZA 1YRYE 1TYCA 1U6KA 4X97A 3SK0A 4TTAA 1WRBA 4PANA 4MQ5A 1DBIA 3DEJA 4ZZ0A 2ODWA 5K8JB 3L8CA 4NOMA 4GE0A 3PF9A 5EVJA 5EMKA 3V1YA 4XW2A 2A30A 1E9VA 1K7YA 2KBFA 3AEKB 1AQNA 4C7OA 4Y2TA 3K1AA 1PKXA 3BZWA 4M38A 3RUPA 4NABA 1Z4NA 2OO5A 2RJOA 1R8JA 1S3SA 3O8QB 2QTGA 4J7CA 4EKNB 2R6JA 5C7YA 2D4AA 4HQ6A 2VWQA 3UC5A 2L18A 2JLBA 2OHIA 3GV0A 3MF4A 1ZMTA 4FFBA 1ZN8A 4EBFA 2PX5A 2ZRFA 1YU6A 3B60A 3G6WA 4YJGA 1NVVR 2FWJA 2BBOA </