2X0JA

2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
294
structure length
294
Chain Sequence
b'MKLGFVGAGRVGSTSAFTCLLNLDVDEIALVDIAEDLAVGEAMDLAHAAAGIDKYPKIVGGADYSLLKGSEIIVVTAGLARKPGMTRLDLAHKNAGIIKDIAKKIVENAPESKILVVTNPMDVMTYIMWKESGKPRNEVFGMGNQLDSQRLKERLYNAGARNIRRAWIIGEHGDSMFVAKSLADFDGEVDWEAVENDVRFVAAEVIKRKGATIFGPAVAIYRMVKAVVEDTGEIIPTSMILQGEYGIENVAVGVPAKLGKNGAEVADIKLSDEEIEKLRNSAKILRERLEELGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Archaeoglobus fulgidus dsm 4304
publication title The 2.9A Resolution Crystal Structure of Malate Dehydrogenase from Archaeoglobus Fulgidus: Mechanisms of Oligomerisation and Thermal Stabilisation.
pubmed doi rcsb
total genus 104
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x0jA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2x0jA02
1RM5A 4RDIA 1HYHA 3BZUA 2DTXA 4CV1A 2FN7A 5JBIA 3NV9A 5K6AC 5JY1A 1GEEA 1U3TA 3FNHA 4UVHA 3VDQA 4LMRA 2X23A 3IMFA 4XYBA 3RSHA 1GPJA 2ZB8A 1ZK0A 1ULSA 4XDZA 3JD2A 4YJFA 4DPLA 4ZQGA 4GVXA 2I6TA 1ENPA 1T2DA 4HXYA 1VJ0A 1N2SA 1QYCA 3ON5A 3TZQA 1YO6A 2X9NA 3N58A 4Y9DA 3S2GA 1NQOA 4RVHA 2EKQA 2HK8A 1AHHA 4ZHSA 3P19A 5AXDA 1S7CA 1X15A 4OAQA 3UGKA 3TSCA 2PKRA 3INRA 3HHPA 5C5IA 1WWKA 1T4DA 3D0OA 3ZHBA 3BMOA 4CQMD 4BNHA 3KM0A 1U2DA 3RC2A 4ZVVA 4NIMA 2CDBA 4D3SA 3DC2A 1ZJZA 1Y5RA 4NG5A 5FYDA 3QWIA 4JQCA 2Y05A 1WZIA 4DREA 2YQ4A 4G5HA 3DHNA 4BGVA 2DFVA 4B4WA 4BV8A 1IUKA 1B14A 5BQFA 3DZIA 4BKQA 3M2TA 4BO9A 2BGMA 4INAA 3F3SA 4GGPA 1FK8A 1LLUA 3PJDA 2DKNA 5T57A 4F6CA 3GAZA 2ZTMA 4YVFA 5A3JA 2O3UA 4S1VA 3KB6A 1T2CA 2OP1A 5BNFA 1SAYA 2GYYA 4W7IA 3L77A 4PG8A 2V6MA 3IS3A 2E37A 4HUJA 1JDJA 5G0UA 1KEPA 2QIOA 1HYEA 4MINA 3VPGA 2HJSA 1ONPA 1WXDA 1ZH8A 5F5NA 3L6OO 4OSPA 3GN1A 3BA1A 3QVOA 3EZLA 4IBOA 1HYGA 1FDWA 1I33A 3UVEA 1XU9A 4YT5A 4HBGA 5T67A 2HMVA 3O4RA 3HUDA 4ALKA 4GVLA 2WSBA 1K6JA 1HXHA 1HEUA 1GR0A 3KUXA 4CQLA 1DC4A 3E9MA 4TMFA 1NNUA 2DVMA 2FZWA 4FW8A 1PZEA 2E48A 3IC5A 2C2YA 2YFHA 3KSUA 4KWIA 3N7UA 4LVUA 4YWJA 3OJLA 5COQA 1E7RA 5TJ9A 2YUTA 4AJKA 1ZEJA 5I7EA 3JD3A 4LRSB 3Q9NA 2X5KO 3JQ8B 3JYOA 2HLPA 4NZ9A 4DIOA 4A27A 3WNVA 3SLGA 3GRPA 1GZ6A 2WTBA 4IIUA 1NM5A 5ENDA 1NAIA 2I3GA 4BKPA 3JQFA 1WNTA 3U4DA 5KKCA 1KVRA 3OJ0A 1Q0LA 4M89A 4XQ9A 3KOUA 4CL8A 4D3FA 3I9NA 5CEEA 3NTOA 3O38A 3RC1A 5BSFA 4MIOA 1ZXLA 3PZRA 1Y81A 4BO1A 2D0IA 3INGA 4MKXA 4PLCA 1ENZA 3AOEC 1QV6A 3QA9A 1O6ZA 3SJ7A 3X2FA 4KUHA 3V8BA 4RORA 3H5RA 2CVOA 5F21A 4GLOA 2PWZA 3COSA 3OP4A 1Q7BA 3UKOA 3WJ7A 3L9XA 1EVJA 1IE3A 3K73O 4J7XA 1PR9A 2X0RA 4IQ8A 5I7FA 5THKA 1F14A 1HF3A 3VAZA 4XJSA 1OOEA 2LDXA 4FC7A 4PLGA 4GPD1 1AXGA 1MX3A 3EK2A 3I83A 3RQSA 2A35A 4IGFA 3I9OA 3FWZA 4MOWA 4DIBA 1A71A 2BF7A 4TVBA 3QVXA 4UVGA 3OIFA 1PGNA 3WIEA 1H0KA 3VPXA 3D5TA 4IM7A 1B8VA 4L0QA 4R16A 5T8KC 4K1LA 1YDWA 3JYNA 4H16A 2JHGA 5A3VA 3VDRA 4RVDA 3VOSA 3LC2O 1DDOA 4YRDA 4LN1A 2GUGA 4ONEA 2VRCD 2DLDA 4GSKA 1DIBA 3K9QO 1A9YA 3PDJA 1E6WA 3H2SA 5G4KB 1T1RA 4FOOA 3EW7A 4OM8A 3GNTA 4AJHA 4DYDA 1BHSA 1GTMA 3DZFA 1HE3A 3GGGA 1VC2A 3SEFA 2EF1A 4ZJUA 4IQGA 3NGLA 4WLFA 4WK6A 2GN4A 2Y1EA 2IZZA 5KJEA 4JROA 2IEBA 1VKOA 3EVTA 4Y6PA 1U3WA 4ID9A 4RV9A 5KKAA 1O89A 4D0SA 2JCVA 3NDJA 2NU6A 5HBRA 1U4OA 1R4NA 1KVSA 1RJWA 3F46A 1XGKA 1EVYA 3DAGA 3GR6A 2G76A 3I9KA 4M86A 4R9RA 2JCYA 1OC4A 1SMKA 4TQGA 4HV4A 2EIHA 3LT4A 2X9VA 1BW9A 4AJ4A 4N5NA 2OXIA 1JWBB 2ZKLA 2GR9A 4GI2A 4WASA 1VM6A 3TN7A 5DCUA 1Z73A 2ZTUA 1ZBQA 4FN4A 4ZRMA 1J4AA 1N92A 1WMBA 2NUAA 2Z1NA 1M6HA 3RU9A 1V0JA 4BNGA 4BNMA 2W2LD 3AWDA 4QQRA 1GADO 5KJCA 4HFRA 3ZWMA 2O2YA 4O63O 4N18A 3LK7A 3WJAA 2B69A 2ZATA 3K5PA 5CFZA 3GH3A 3OETA 4AJLA 3D3WB 4II2A 1P31A 4DQUA 4CUJA 1X0XA 2HRBA 4P8RA 3D3EA 4QFCA 4HFNA 3OM9A 3U49A 3E18A 3NX4A 4LSWA 1GPDG 4CL3A 2SCUA 4LSMA 3TPCA 2HCTA 2V6BA 1E7QA 3I4FA 5DDIP 3SC6A 4W82A 2BD0A 3WR5A 1SB8A 3SVTA 3O03A 4I08A 4PLTA 4PRKA 4UEKA 3TZHA 4CMHA 2P9CA 5DBIA 5EMHA 1LI4A 1E3IA 1E5LA 3DOOA 2OP0A 3E03A 1WW8A 3WICA 3VPHA 4L4SA 4RF4A 3HDJA 2PNFA 3GNQA 1KC1A 2HAEA 4I9HA 2VT3A 4D3DA 1TI7A 2J3HA 3H6KA 1DJNA 4CMAA 2UDPA 3DQPA 5KVQA 5TGDA 5HRUA 3TL3A 1GQYA 4PCVA 1C1DA 3GY0A 4QO7A 4BGIA 2VZ8A 3ZN2A 2VT2A 3ETGA 1PL6A 1NVMB 5JYDA 1XQ1A 3JCZA 3H4VA 3GZ4A 5AXCA 2RAFA 2P9EA 2ZB4A 3G49A 1OAAA 3L9WA 3WFJA 3T4XA 4YRBA 3A28A 4IIVA 4IPTA 1MG0A 3OH8A 4BO2A 3BIOA 4D45A 1TLTA 3PTZA 1UXHA 2BRUA 4DC0A 4YT8A 4WUVA 5CDSA 5A9SA 2GZ1A 3AI2A 2Y1GA 4N5MA 5JC8A 3BYZA 4BNZA 3ASUA 2CDAA 3P7MA 5DBGA 3MJTA 4YAJA 1B8PA 1ZK4A 2FWMX 3UXYA 1D4FA 1Y6JA 3TF5A 2Q45A 2VUTA 4Q3AA 2IZ0A 1I2BA 2C7VA 4MKZA 3ZNPA 4F46A 3OBBA 2YFQA 3V5NA 2O48X 3GG2A 1RM0A 3A06A 3GVCA 1E7YA 1JAYA 2EP7A 2VWPA 2OUIA 3VZPA 3WYBA 2ZB3A 3UW3A 5DP2A 5IZCC 4JN6B 3MEQA 2X22A 3VPSA 4LCEA 4KDFA 3C7DB 2Q1SA 1YL6A 3KV3O 3GFBA 4PIVA 4BGUA 1K6XA 6ADHA 3MJCA 1UJMA 3ZWPA 4K6FA 3LT1A 3GG9A 3GFGA 4L75A 1CQJA 4GL4A 4NPCA 3TRIA 5C7IO 5F5LA 4Q3EA 4AFNA 3GVPA 3I3OA 3I6IA 2VRBA 1N8KA 2X0NA 3EGOA 5HM8A 1GFSA 2GN6A 2HK7A 3JYQA 3K30A 4PN3A 5LCXA 3OMLA 1EMDA 4GKBA 1C14A 1DRUA 1P74A 1PQUA 4C4OA 4TKMA 3G1TA 1EBUA 3PI7A 4NFHA 5JLAA 2AQHA 1O8CA 3ZU2A 5L7TA 3KYDB 4EDFA 4B8ZA 2AEMA 4ALLA 4BGEA 2H63A 3FNGA 4IZHA 2VZ0A 2RH4A 5FEUA 3M6IA 4BO6A 3NAQA 3FSRA 3VHRA 3VVCA 5KTKA 4ZRNA 4KTVE 2ZQZA 1T2FA 2IDZA 3GVXA 1YOVA 2QZZA 2WJPA 3A4VA 4WNCA 1BSVA 4TRJA 4QO8A 4R69A 1DFGA 4L4XA 3TZCA 2Q2WA 1LBEA 4JJFA 4E5YA 4B7XA 2Y66A 3C85A 3EDMA 4CUZA 1I32A 4GX5A 4FBGA 2Q1UA 2PZJA 4OIMA 5ADHA 1E7MA 1OMOA 3WGQA 1Q0QA 1I3MA 3MOIA 3PQFA 1NX6A 3DZKA 4IDEA 3L0DA 3ENKA 4HY3A 3OEYA 4BNKA 1GV1A 4QT0A 1JVBA 4NMHA 4QECA 4N54A 3FN4A 2FP4A 5G4LA 3DZBA 2G17A 4NU6A 2QYTA 4DIFA 5JMWA 1PGQA 1VSVA 2I9PA 2X7HA 3E1KA 3Q3CA 4RPGA 3PEFA 1DO8A 1NVGA 1EQUA 2RCYA 3F4LA 2GPTA 4WOJA 3K31A 5TT0A 3UFXA 2PGDA 1G0NA 1IPFA 1E7SA 2PTGA 3R0IA 3OEWA 4ZN6A 4NK5A 5JAMA 4M8SA 2C07A 3ADOA 3DTTA 4IJUA 3CEAA 2G0TA 4MVJI 2CSUA 4OKNA 1I3LA 1R0SA 1V35A 3PPIA 3NDIA 4I5GA 4DVJA 5L4NA 4IDBA 2FY8A 1QYDA 3AM5A 4D46A 1PX0A 4YA6A 1LSUA 1DJQA 1YL5A 2FPGA 1ISMA 4J6FA 1P1IA 4K26A 3RASA 1VJTA 1U5AA 4RVFA 2CFCA 2ZYDA 3GGOA 1E3WA 1E7WA 5KVVA 2WEKA 1QORA 3GEGA 4WCFB 3CZRA 5EQDA 4IJWA 1JKFA 1LSSA 4NBTA 4MIEA 1P33A 1L1FA 3DHYA 3RUFA 3SX2A 3ZWYA 4D43A 5IDQA 4UUPA 3RCBA 4QFDA 1H93A 3Q6IA 3LZ6A 3OA2A 4BNUA 1UXJA 3PWKA 2BI8A 1YB5A 3TQHA 3FTNA 1NPTO 1EUDA 1ML3A 3ANMA 4KQXA 3E6AA 2W2KA 4MKRA 3BHMA 2BLLA 5T64A 3TOXA 4BVAA 3GT0A 1W0CA 4U0JA 4AJEA 1Y5MA 3UN1A 4WCFC 1GUFA 2EXXA 2FPIA 2Y67A 3NEPX 5BR7A 1KC3A 4R68A 1EZ4A 2I67A 1PU2A 4EJMA 2GCGA 2F00A 2JJYA 1PR3A 2C2XA 3H9UA 2DPHA 4CLHA 2NVUB 3OFSA 1XKQA 1A5ZA 4PLPA 1YDEA 2EP5A 1S6YA 1QKIA 1LSJA 1Y8QA 2VHXA 4BNXA 4BQPA 3IP3A 3QIVA 1XHLA 4FFRA 4L76A 2H1SA 2AE2A 1M2WA 7ADHA 1D7OA 4J7CA 4MO2A 4RZHA 1VKNA 4CV0A 2EGHA 3PVZA 1MFZA 1LC0A 2B83A 3OJEA 3ROKA 1JWAB 3PLNA 3JQGB 3VTZA 3MOGA 5C3MA 1Q2XA 2VWHA 3RUEA 3JQ8A 2W98A 2UV8A 3C1AA 5DF1A 3MTGA 2H5LA 2FMUA 2AG5A 5I9MA 1HETA 3GAFA 3HZZA 1YH3A 3UCEA 3HDYA 3JYPA 3M2PA 5CP8A 3UCXA 5CDGA 4BO4A 1E5QA 3RUDA 2X8LA 4P22A 3V1UA 1I8TA 1TXGA 3T7CA 2UVDA 2VOEA 4CLOA 2O3JA 1MFPA 4J4BA 1UZNA 3VH4A 1VRWA 2IXAA 4RPLA 1Y8RA 7MDHA 4K6CA 2OHXA 3F4BA 1Z74A 1XU7A 4YAGA 5IF3A 1I36A 3O8QB 5TNXA 5G0TA 4YCAA 1NHGA 4NDNE 1WVGA 4FR5A 5G0VA 3Q1LA 3CKYA 5DCWA 4U7WA 5AXBA 4WLNA 3FBTA 1VSUA 3X2EA 3SXPA 2NU7A 1RM4A 2GZ2A 5T8KA 2IXBA 5KWEA 5JDCC 5LDGA 1GZ4A 3L07A 4XIJA 3UICA 4EUFA 4RGBA 1PL7A 1VL6A 2VWGA 3OICA 1HT0A 4WCFA 5T5QA 2NLOA 3K2EA 5JE8A 4BL5A 4A5OA 3PFWO 1FDVA 1ZK3A 1XWFA 3F9IA 3DR3A 4LVCA 3HDQA 3FNFA 4AJIA 2YJZA 5A9RA 3M1AA 5CG1A 5G0WA 1JW9B 1LLDA 1PJ3A 1ZSVA 2ZCUA 4ND4A 3FPLA 1P3DA 4PLWA 2BMAA 4D42A 4J0FA 4XGIA 3I6QA 1NFFA 4GGOA 2P5YA 3INTA 4ESOA 3OQBA 1B16A 5TT1A 3QLJA 4LGVA 1IZ9A 2JAPA 3ANLA 4O6VA 3WTCA 1C0LA 3AY3A 4WLEA 4FJ0A 2EV9A 1O95A 4DPKA 3A9WA 3VPFA 3WMWA 4Z0TA 2A4KA 2IODA 1MV8A 2DBZA 1RYDA 3QVSA 3TWOA 3ASVA 3HQ4O 3JQBC 2Y68A 4GQAA 1PJ2A 1EUZA 4XCVA 2ZIZA 1KEUA 1G6KA 4XYGA 3WQSB 3H2ZA 3WDSA 1YS4A 1JKJA 4CV2A 4YXFA 1E1KA 2BFAA 1I0ZA 2OFPA 4UUMA 1UP4A 4I1IA 3OSUA 1I2ZA 3DWFA 1DXYA 1MXFA 3JV7A 4PG6A 5DOVA 5GY7A 1GEGA 3WWYA 4AVYA 4CMIA 9LDTA 1O0SA 4R5HA 1R37A 1LQUA 3DMTC 3NT2A 2E6UX 3PP8A 3BMQB 3U09A 1IY8A 2FZEA 3JYLA 5DZSA 3G3EA 2BFMA 3DMTA 4PZDA 1XYGA 3FHLA 2VRCA 8LDHA 3G17A 2JL1A 1UP7A 3LF1A 1MGOA 4CLDA 5A4DA 3JQ7A 2QG4A 4ALJA 5MDHA 2NU9A 5JSFA 1GDHA 1I2CA 4RVUA 3IJRA 5A06A 1H6AA 3BMOB 3NUGA 4RDHA 1PGJA 4E4YA 4A0SA 2DAPA 3AJRA 4IMRA 4F45A 3ZU4A 1SEVA 3QQPA 2H9IA 3WYEA 3E9QA 1P0CA 1GU7A 1YL7A 1CDOA 3G79A 3DBLA 3KEOA 1ONNA 4O59O 4JP3A 3EMKA 3O8QA 3VZQA 2BI7A 1VL0A 1H6BA 1C0KA 2DT5A 2WYUA 3PJEA 2JHFA 1GCOA 1HKUA 1PZFA 1VI2A 3P2OA 1DHTA 1KOLA 4CM8A 5IZ4A 2ZTLA 1GCUA 1P1JA 2HSDA 2TMDA 1BW9B 4WJZA 8ADHA 3LT0A 3LU1A 3CUKA 4PG5A 3JTMA 3EAGA 2PY6A 1NAHA 5JW6A 4NBRA 3UUWA 3GUCA 3NRCA 1EE2A 2C29D 5EERA 4ZGWA 4CLRA 2BKAA 3DBRA 4MP8A 3ONFA 3UF0A 3GOHA 4FB5A 1F12A 2O4UX 1EE9A 1HLDA 4CR8A 2JFGA 3QY9A 4CM9D 1U8FO 5IDWA 1YWGO 3PRJA 3U4IA 3WBFA 2DTDA 2DUWA 2X1HA 1HDYA 3Q2KA 4B3HA 2RHCA 2FR1A 4B3JA 1HDRA 1ZKMA 2CF5A 2VNAA 2NQTA 3JQAA 2EGGA 3KTDA 4XEHA 4RLHA 3CSDA 2NACA 2NTJA 3ZWCA 4CMCA 3F1LA 4IJVA 2GNAA 3NGXA 4YTEA 1DC5A 4ZQHA 3H9JA 3DFUA 1X7GA 2O3QA 3AOEA 1ZUD1 1GUYA 3ZNNA 2TMGA 5JNLA 1H2BA 4XR9A 4GX1A 2BGKA 2O4CA 2XXBA 3GNSA 1HZZA 4XDYA 2G82A 2HO5A 2HMUA 4XWYA 1BDMA 2B36A 3IP1A 3B1JA 2BH9A 1OI7A 2JD2A 2XAAA 4YJDA 4RQUA 4WE3A 1DFHA 3NJ4A 3ST7A 2ZJ0A 2I66A 3DZGA 4BOYA 1ZVMA 2WD7A 5ILGA 4YJGB 1I5RA 1L7DA 1UDCA 3ENNA 3LC7O 3AUTA 2AQ8A 4YJHB 1QG6A 4EITA 4WECA 2FRDA 4IDCA 1IULA 3OJOA 5L4SA 4TSKA 3I9LA 2JCXA 2D2IA 4J0EA 1X0VA 5IXYA 3IAHA 4GBJA 3ITKA 5I7SA 3NTRA 4PG4A 5JFOA 3PIIA 1NFRA 4J49A 1N5DA 1H6DA 4HFJA 2J3KA 1XEAA 1MUUA 2BFPA 3F5QA 5EN4A 3JQ9C 5TSDA 1K89A 1J49A 3H7AA 4E2WA 2HMTA 2HDHA 3C8MA 1HSZA 3MZ0A 1UUFA 3ZW8A 3PHLA 3KLPX 2FOIA 4RO0A 3VVBA 4OL9A 3U62A 4MVJD 2CUKA 1ISFA 5B4TA 3GEDA 3C1OA 1PZGA 3ZU3A 5EJ2A 4J1SA 2O50A 3WXBA 1FDUA 2R2GA 1ZZEA 2HU2A 5J23A 5G0SA 2NWQA 2CDCA 2WE7A 4OO3A 5B4VA 4O0LA 2W2KB 3ABIA 1ZSYA 2PKQP 2EKLA 1H5QA 4AICA 1CRWG 3AM4A 5IG2A 1IHXA 1YKFA 1GQQA 3GN2A 3AU8A 2X5OA 4JBIA 3ZGYA 4OOEA 1ZK2A 4R51A 1YBVA 5A03A 2PFGA 1SEPA 1JLLA 4QX6A 1F06A 5IAAA 4DBVO 2VHWA 1K0UA 2YHIA 4NJOA 4E5NA 2OZPA 1E92A 2VNSA 4XA8A 1OBFO 1UDAA 3ZWNA 1HSOA 2IYOA 4EI2A 4MP6A 4JK3A 5TIIA 3U5TA 4JGBA 3LF2A 4Q39A 5EPOA 4DPMA 3RUHA 1CETA 1Z7BA 2ZQYA 1X14A 4JCOA 1F8FA 4WLUA 4LK3A 2CVZA 3W6ZA 9LDBA 1O94A 4B7CA 1QSGA 5CHEA 1FMCA 1DPGA 1KVTA 3WB9A 2HQ1A 2GASA 1DB3A 1LDBA 1Z7EA 3ZHZA 4BMNA 5KJ6A 2QQ5A 5BSEA 4E6PA 4LCJA 4M87A 4KWHA 1AXEA 3AFMA 1RM3A 4QUKA 4J9UE 2AMFA 1YQGA 3ORFA 4U6SA 3W8FA 4W4TA 3FR7A 4FGSA 2D3TA 1NYTA 3ZV3A 3I9MA 3NKLA 3AUUA 4M1QA 5CPFA 4NFSA 5IZCA 5DULA 2XXJA 4GMGA 3JQ7B 1DIGA 2EJVA 4MVJA 3BTSA 4ZQFA 4CQLB 2AHRA 3UCFA 2X6TA 4UULA 1FDSA 1YJQA 4ND1A 2FPPA 3PYMA 1CQIA 4YQZA 1GYRA 5A5EA 1WPQA 3ROMA 1DLIA 4CMJA 1HL3A 1QYWA 4FSHA 2BGLA 4TWRA 4PLFA 4NHEA 3JD0A 4R1SA 4U0KA 4H15A 4XRRA 5JS6A 1FJHA 1LQTA 1PIWA 2EJWA 2WYWA 1QLHA 4YYZA 3L6DA 4Z3KA 4YEDA 5CG2A 2GZ3A 4K28A 2I3AA 2YY7A 1SBYA 1A72A 3BMCA 1C0IA 4WGGA 3ICPA 1YQXA 1AE1A 1YB1A 2HMSA 3DEYX 4I5EA 1V3UA 1N7HA 3QHAA 4CM8B 4X54A 1I3NA 3O9ZA 1WAMA 5DNAA 4P38A 5COAA 5BNIA 3L6EA 1CYDA 1QYXA 3MWEB 4ITUA 5DT9A 3F6YA 4JBGA 2Y1FA 2OMEA 1X13A 3WIDA 5B12A 1ENOA 3BHJA 2WD8A 2DPGA 2OORA 2JKVA 3OA0A 4E2ZA 5TLSA 4M49A 4P4NA 4Y6SA 3GPDG 4WEOA 3GHYA 3GGPA 2CF6A 4ZD6A 3PHIA 1GUZA 3OECA 3A14A 1D1SA 2BHLA 2NVWA 3OJFA 3LDHA 3MCVA 3KYDA 1OZAA 5FWNA 3G0OA 1U9JA 5CDTA 1PS0A 3BTOA 1JQBA 1BDBA 3NT4A 4ND2A 4GX2A 4IDGA 1F8GA 5A1TA 2X5JO 5A9SB 1M76A 4TROA 4IXWA 4ZQBA 3JQAD 4HWKA 4J43A 3S2FA 1P1FA 4B4VA 5DP1A 5TQVA 4NBVA 1CERA 1B0AA 4RL6A 2HUNA 1V6AA 3CMMA 5U9CA 1BXKA 1P9LA 2OBNA 1P1KA 3CH6A 4M55A 4BUCA 4A73A 3FR8A 1IPEA 2I5PO 1U2GA 3EYWA 4J16A 1SB9A 3K2BA 4YAIA 2YW9A 3FF4A 4QTZA 4WEQA 3W4JA 1PL8A 2Q4BA 2W2LA 3DZHA 4DLBA 1X1EA 3RWBA 4KDEA 4TZTA 1XG5A 2PD3A 3IQDB 4TRNA 5EINA 3RUAA 4OXKA 3TNLA 5FFFA 1NVTA 3IUPA 4YQYA 3JQFC 4E12A 3L4BC 1J0XO 5T6BA 4MVJM 1R4NB 1F17A 1PWZA 1H94A 2GO1A 1MXHA 4CPDA 1O5IA 1E3SA 2RHRA 4PZEA 4RF2A 2QYSA 4Z0PA 3C3XA 4CODB 5K0ZA 3ZWOA 1JTVA 1ZW1A 5U1PA 2FR8A 3DB2A 1MC5A 5K9ZA 1M75A 2A9FA 4CJXA 4NNJA 1B2LA 2BFOA 1HZJA 2PD6A 1LXCA 3S8MA 4E5MA 1ZFNA 3BMQA 4UVDA 3FRJA 3U0BA 1BVRA 1MLDA 1UH5A 3GDGA 3JQ6A 2A92A 3KVOA 4PZCA 1GD1O 2QRLA 4B7UA 1P1RA 1NFQA 2W8ZA 3MJSA 3RROA 2AG8A 3DONA 4LMPA 3SC4A 3ZZNA 2J5QA 3JQGA 1FXSA 4OXYA 4MP3A 3VTFA 4L4RA 4CM1A 3GEMA 4CM5A 1SOWA 3UAGA 2R6JA 5JY6A 4CMEC 3DBHA 2VCYA 3CE6A 3R3JA 5ITWA 2B35A 3U3XA 4S3MA 3BMCB 1W8DA 3RVDA 1YB4A 3ZDFA 4BIIA 1LDNA 3B20A 1H9BA 5CDUA 1CEQA 2Y0CA 4I5DA 4J91A 3WLEA 3WWZA 4B8WA 5BSGA 5TS3A 4OKIA 4TRRA 5JYEA 4YJFB 4JP2A 1EFLA 1AGNA 4CLOB 4J2OA 2C0CA 2B37A 4GKVA 4CM4B 5IN4A 1QXSA 4RF3A 5JC1A 4AJJA 4BO3A 4L74A 2OBYA 5G2OA 5KJFA 1SZJG 4TRMA 1XSEA 3WS7A 4OJNA 1RKXA 3EHEA 3PGJA 2NVUA 4KZPA 1HWYA 3FD8A 4FS3A 1O9BA 2ZYGA 3WGTA 1GV0A 3MWDB 3D4NA 1V9LA 4GH5A 1P0FA 3DOJA 4GAEA 1ZIDA 3PDUA 2J6IA 4AJPA 4FCCA 1ONOA 1J6UA 2WYVA 4BO7A 1D8AA 3NT5A 1Q7GA 1ZJYA 1ZMOA 1P44A 1KS9A 3BXXA 3D7LA 4MVJF 3H3JA 1DBVO 3GZNA 2VWQA 3PGXA 2QX7A 1BVUA 5HTOA 4IDAA 2O3TA 1QP8A 1Y8QB 2PGJA 3D4PA 2O7QA 4Q3BA 4ZA2A 1DSSG 5F1PA 3B1KA 4PLVA 2P68A 4UEJA 4NFYA 3OIGA 1C1XB 4R3NA 1PQWA 3GMSA 2ZJ1A 5ENVA 4BKOA 5KIAA 3EZYA 4EGFA 3QWFA 2H6EA 1UDBA 1E0DA 4BNTA 3NTQA 4BKRA 2B5VA 3RI3A 3RUCA 4D79A 1MB4A 1QRRA 5BT9A 1TT5A 2IRWA 1DAOA 5TX7A 1W73A 4MDHA 3FCOA 3KYCB 3SBOA 4NJMB 1D1TA 1LA2A 3LC1O 1Y8RB 5I7VA 2GDZA 4XX0A 2CVQA 1JN0A 3EUWA 4JLWA 1PJLA 1WP4A 1WZEA 1ARZA 1HDZA 2C59A 2PV7A 1ZEMA 2JFFA 1WMAA 2P5UA 1PGPA 4OHUA 5C7OO 2P2SA 1HTBA 3GK3A 3PZBA 4B79A 4Z9YA 2OGUA 3KEQA 1UXGA 3RFVA 4L9RA 2AXQA 3ITDA 4IS3A 3AI3A 4IDFA 4CR6A 3QRWA 4ALNA 3IL2A 1DOHA 5ES3A 1BXGA 1ZXBA 5CDYA 4L8VA 1ZK1A 2AEJA 2FHSA 4CM3A 2W90A 4UUOA 3H5AA 3RKUA 1NPYA 2J5KA 1KERA 3ETDA 1KVUA 5GZ3A 4OSOA 1TEHA 3CMCO 3RC9A 3BTUA 4XD2A 4CQMA 4DQXA 4PLYA 2Q99A 3CIFA 5EESA 3JD4A 3ROQA 4PRLA 4TZKA 2Q1WA 4WKGA 3DBLB 2HK9A 3DFZA 3WOHA 1D3AA 4WLOA 5KVCA 3HE3A 1U7HA 3WYCA 2P4QA 1DIHA 4OXNA 1HE5A 3S2EA 3SLKA 5B1YA 2DBVO 1KY4A 3PWSA 1N1GA 5IJZA 1NQAO 5AYVA 5ILOA 4U5QA 3DOCA 1ZNQO 3CINA 3EC7A 1Q0HA 2AQKA 2J8ZA 1H6CA 1XLTA 3WGOA 2Z1MA 4E13A 2VYVA 5KCZA 1MC4A 2EWMA 3WX0A 4Z6KA 4DQVA 1LLCA 3FTPA 2FSVA 4LISA 4WPGA 1BTOA 3HADA 2VHZA 1PTJA 3BMNA 4PGFA 3WQQA 5JPIA 4YJHA 4CM7A 3DDNA 2E4AA 4LW8A 2C5AA 1ISGA 1ISIA 5L3ZA 2GSDA 2VOJA 4GWGA 3GDFA 1UAYA 4DGSA 3G1UA 4KQWA 1UZLA 3CPSA 2NVBA 3AM3A 1XIVA 2NNLD 2Y0EA 3WGIA 1NPDA 4BNNA 3IOYA 4RZIA 4D0RA 1GYPA 1ZO8A 5BNTA 1VPDA 4BO8A 4EUHA 1R66A 3EY4A 2PZLA 3RAJA 3UOGA 4EZBA 4YT2A 2YV3A 2ZYAA 3K8ZA 3F1KA 1B3BA 3MJVA 3PHJA 5EQFA 4Z0HO 3TFOA 1MA0A 2YDYA 4KTTE 4UVIA 1LUAA 1M67A 3H3FA 2V65A 3DTYA 3AY7A 1NR7A 3R3SA 3JQAB 4FFOA 4J9VA 5KOIA 5JCXA 2ILTA 2ZTVA 5JDIC 1DC3A 4ILKA 3WLFA 5ER9A 4O1MA 4QEDA 1DAPA 3ZHXA 1A7KA 3QWAA 2WD7B 1I01A 4YAKA 3OHSX 2EEZA 4BNIA 4J4HA 3QV1A 4JXKA 4NU5A 4BO5A 3LVFO 1FF9A 4CMGA 1YGYA 3IUSA 1SCUA 2VZ9A 4EW6A 3I5MA 2V6GA 4R41A 4F3YA 2BELA 5H83A 4G2NA 5CPBA 1EK5A 2B0JA 3GPIA 3JD1A 2NV6A 1T4BA 2I65A 3QP9A 4TKLA 2R00C 1I24A 1R4MB 1Q7CA 4BNFA 1U28A 3Q11A 5LDHA 2NQ8A 3GVIA 3IJPA 3S2IA 4IZIA 3WG9A 4W7HA 3W8EA 1EUCA 1LJ8A 3GF4A 2V6FA 3HFGA 4WCDA 3BHIA 4EBFA 2IZ1A 1ID1A 4CMBA 4XYLA 3GC6A 1N9GB 1BGVA 3ZV4A 4BNLA 4Y98A 5ICSA 2PA3A 4FIZA 1E3JA 4RPKA 1E3EA 2LDBA 1R6DA 3HN2A 4I9NA 3AUAA 3DBVO 4YB8A 4QSMA 4ZU3A 5L53A 4A2CA 5A05A 1A27A 3ZW9A 3H8VA 1IZ0A 3JSAA 4R1NA 1Z6ZA 4A10A 3ZU5A 3UHAA 2DQ4A 4AJ1A 3OQ6A 4J7UA 3RKRA 4GLLA 2FSSA 4R54A 4N7RA 2YV2A 5IN5A 4GSLA 4E5KA 2NTNA 1CIVA 4MJLA 4NH4A 4E32A 1K5HA 3E5MA 1HE2A 1PS9A 4BB5A 2EHDA 4EYEA 5JAQA 1J5PA 4UAGA 1N1EA 3WGGA 1T2AA 1JKIA 3ZNQA 2Z5LA 1Z45A 1PSDA 3AK4A 3W4IA 1LDEA 2GD1O 3HB5X 4D41A 2Q50A 4DLLA 3AW9A 3AI1A 4R01A 2XF8A 2G1UA 4EEXA 3ADPA 2J3IA 3AUSA 2GRAA 4RQTA 1SO8A 3LYLA 4XQCA 4BV9A 4E33A 3PQEA 5U4QA 1U4SA 1HDOA 2X9GA 3CZMA 3ONDA 4B4OA 3TJRA 1WLYA 1UP6A 2V7PA 4IDDA 1NWCA 1KY5A 2ZB7A 3GVHA 4FJ2A 4RPHA 3C7AA 1HLPA 3HB4X 4RF5A 5JO0A 4RJTA 4YAEA 2IEDA 4GX0A 1MG5A 3PJFA 5DBFA 2JD0A 1XQ6A 3V1TC 1R16A 4CV3A 1NWHA 1GY8A 3IIEA 1YBAA 4R4JA 3VKUA 3LSYA 5ITVA 2AEFA 2VHVA 4EJ0A 4MVJE 1HDXA 1WDLA 1QMGA 3W8DA 5I9LA 4CLRB 1B7GO 1DHRA 4Q3DA 2VTDA 2Q3EA 1LC3A 1U3UA 3TZKA 2F1KA 1L7EA 4CMKA 1A4IA 2DTEA 5THQA 2UUOA 3O26A 2VUUA 2VYND 4Q9NA 4Z9XA 1YJ8A 3JQEA 1NQ5A 1TVEA 2NM0A 1TB4A 1AHIA 1I3KA 4NBUA 3Q0EA 2VTEA 4MVJG 3JQCA 3QWHA 4MPDA 3UH1A 1IB6A 4H3VA 1YBMA 3D5QA 3HN7A 5C7LO 1T24A 2GGSA 2HRZA 4E3ZA 2I99A 2YHIB 2NTVA 4J4TA 4W99A 1QYVA 4RLSA 4FC6A 1T25A 2E82A 4AJ2A 1W4ZA 5JMPA 4XB1A 3WNQA 4J1TA 1I10A 5H81A 3ZI0A 1EVIA 4IXTA 4NI5A 4CUKA 4UREA 1EEHA 2J3JA 4PG7A 5LC1A 4U8GA 2I76A 3ROPA 1LDGA 1CWUA 1U5CA 3TDKA 1WDMA 1YONA 2X4GA 4CR7A 5HWSA 2C20A 3LQFA 3V2HA 5KVSA 1UZMA 1PJCA 4FDAA 5ICMA 5JDIA 3QW2A 6LDHA 1LDYA 4XIYA 4ALMA 2A94A 2WMDA 4YDRA 3DMYA 4JBHA 5A02A 2X0IA 1KEVA 4RVSA 2IE0A 5JAZA 3C24A 4TVOA 1R15A 1NQTA 4JNKA 4N5LA 3VZRA 3V2GA 2D5AA 2DUUA 5TC4A 4CLEA 3ETEA 4FFLA 4ND3A 1BXZA 3E5RA 2OOSA 3MJ4A 5G4KA 4BNVA 3WQRA 4CMIB 4BKUA 5BSHA 4DTIA 4YBZA 5JXWA 3RFTA 5GZ1A 5L95A 2VYVD 3PIDA 3QWBA 5L7WA 3IKVA 3FI9A 4Y8VA 1ADFA 3AY6A 4GMFA 3B1FA 1ZSNA 1EFKA 1T26A 1OFGA 2VHYA 3JQDA 4K9DA 1IHYA 3BAZA 4RCVA 3WBBA 2EERA 2P9GA 1GAEO 3PFFA 1Z75A 3U4HA 3S55A 4R1UA 1IYZA 2IYPA 3VKVA 1M66A 4A7PA 4DXHA 2ET6A 1KIFA 1H9AA 5B4UA 3PLRA 2XPCA 4E5PA 1NHWA 3D64A 3HWRA 3ZH2A 4P4GA 2QRJA 2D1YA 1C1DB 4R1TA 1JVSA 1HRDA 1LRJA 4HADA 3H9GA 3VZSA 3E9NA 1W6UA 4J2HA 4URFA 4Z3DA 5L4LA 5IXSA 3B6ZA 1P77A 1Y7TA 1PJQA 3I23A 4IY1A 1B3RA 4Q3NA 1ADGA 1K2WA 4JJGA 3U4CA 1PJBA 1JA9A 1NASA 2YYYA 3ZNOA 4IMPA 2B4RO 3FPCA 1MP0A 2HMWA 3RBXA 1U1IA 3KSZO 3TL2A 1T2EA 4IGEA 3D3WA 1EK6A 3GQVA 3OQ1A 4AJNA 3QVWA 4R3WA 4YACA 5A5FA 1LLQA 1SC6A 3TFQA 1X7HA 2D8AA 2PLAA 3ANNA 3E48A 3B70A 1BXGB 1PEDA 2Y93A 1OC2A 4DMMA 3KHUA 4FOSA 1ISJA 4FFMA 1U8XX 1UR5A 4YPOA 1QR6A 4OH1A 4CM6A 4DBZA 3AU9A 1BMDA 4XJTA 5A04A 1V3VA 2UYYA 5I8WA 5IDYA 1K6IA 5I8ZA 3PJGA 3SJUA 4KP7A 5L40A 4HFMA 1Z82A 2OO5A 3D1LA 3HJAA 4UUNA 3ULKA 3DAFA 1UAGA 2B5WA 4Y67A 3A1NA 5H82A 2VUSA 3RBVA 3RJ9A 2O7SA 4XKJA 5JDCA 3ZWBA 2YHUA 1GL3A 3LLVA 1LX6A 5HS6A 4DMLA 3WFIA 3LT2A 1EVZA 4BNJA 4W9NA 1G0OA 4L73A 3DHEA 3H9QA 4HKTA 3FBGA 1E3LA 5ER6A 5CEJA 3WSVA 1CJCA 3QSGA 3T7EA 4NQZA 1ZCJA 1LSOA 3DO5A 4W9NC 4NBWA 4PLHA 1DC6A 4WOKA 3U9LA 1T1SA 3Q2IA 4HP8A 3I52A 4DYVA 1AUPA 5IDXA 1E1LA 1KYQA 4J90A 3IDSA 4J1QA 1E1NA 3ZWVA 4R5MA 2X86A 3KYCA 4HNGA 2Q1TA 4M54A 1ADBA 3GZNB 4NJMA 2WDZA 1Q1NA 4DL9A 4E31A 1ZMTA 1A7AA 4XYEA 5CAEA 4XB2A 1ULUA 2W4QA 4CMEA 1C0PA 3ONEA 4PLZA 3RU7A 5L9AA 3K92A 5JO9A 3V2UA 5CEFA 3P5SA 1M6WA 3QVTA 2GN9A 4P4LA 2CY0A 2D4AA 3K6JA 2XOXA 3K96A 4YR9A 4RVGA 5K6AA 3STHA 1C1XA 2Q46A 2PH3A 3KSDO 4EJ6A 1PWXA 4CQMB 3I1JA 1X1TA 5EIOA 2JFHA 2NU8A 5C37A 4I8XA 2CNBA 2GF2A 1ISHA 2QRKA 5JCJD 5B37A 1P1HA 1YE3A 3CXRA 4PVDA 3GMDA 2GLXA 1U3VA 4DC1A 5DCYA 5AOVA 2P4HX 4B3IA 4EEZA 3L4BA 4PVCA 2X58A 3H65A 4BMVA 1EBFA 3PYXA 1QLJA 4PFJA 4Q3CA 1VE9A 5JAIA 1E6UA 2Y1OA 1E1MA 2NSDA 4II3A 1TA4A 5I9NA 5L7YA 1KEWA 1R12A 4FFPA 1BG6A 2J5RA 3RIHA 3D4OA 3MTJA 4A03A 2OL4A 2RIRA 1DLJA 4ROSA 1B8UA 4JX8A 2EW8A 5F1OA 4U6QA 4BNWA 1EDZA 2O3SA 5KJ1A 1RYEA 1R4MA 1N7GA 2VN8A 3P2YA 2Y1CA 3KRTA 4OQYA 1NXQA 2X0JA 4XRGA 2PGLA 2NADA 3HFSA 2C5EA 1LDMA 4IJKA 1X7DA 3T4EA 5AVOA 1UXIA 1EQ2A 3KO8A 1A9ZA 3PYLA 3HDHA 1I30A 5FI5A 1PJSA 2PKQO 5GMOA 1AN9A 3VH3A 3VH2A 4OMUA 3IKTA 4DA9A 3ZHYA 3NJ8A 5GZ6A 2Y1DA 4XGNA 3WGYA 3GHHA 1DFIA 4IS2A 3HSKA 2GERA 4BS9A 1A4UA 2QW8A 4KUGA 3M1LA 4OGWA 1DRVA 3TZ6A 4MIYA 1SPXA 4FFNA 4DRYA 3PWZA 1WDKA 4JJIA 1FDTA 3GA0A 4KMSA 4DUPA 2RBEA 3RJ5A 3ZV5A 3L4SO 4ND5A 2C82A 1DIRA 2PZMA 4E30A 4IINA 5JCJA 1YVEI 4FD3A 5TRTA 3HNPA 1PZHA 3W1VA 1G1AA 2EG9A 4YT4A 1B26A 2Q4EA 4A26A 5DOZA 2GN8A 2CMDA 2JD1A 1PS8A 1VJ1A 4OOFA 1QV7A 2E49A 2G5CA 5COBA 2VYNA 3WSWA 3ZCXA 3VH1A 2AA3A 3RUIA 3FWNA 4IUYA 2B4QA 4UEOA 3W4KA 1GQ2A 1XCBA 3KLMX 2DFDA 5DN9A 4I5FA 4ZQEA 1NR1A 3JQ9A 2EW2A 3CTMA 4YRAA 1Y9EA 2DBQA 4E0BA 3EVNA 3OIDA 2DU8A 1KVQA 3Q9UA 1YXMA 2B4TO 3PHHA 1N9GA 3WMXA 3PHGA 3KXDA 3NDRA 1K3TA 1HDCA 2O2SA 5KNLA 4XR4A 4KOAA 2PK3A 1SNYA 1LRKA 2Y99A 3W6UA 3I4CA 4CM4A 2DBRA 3E8XA 1HE4A 3QJ5A 4WLVA 5MGBA 2CD9A 4UVEA 4DWVA 4D7AA 3GRKA 3PQDA 1DIAA 1JAXA 3F47A 4G81A 5TF4A 5L51A 1E3WB 1PJ4A 1XELA 2JAHA 1ORRA 4MVJP 4ALIA 5TJHA 4CLXA 2PZKA 4JIGA 1RWBA 1ENYA 4FJ1A 3BTVA 2ZCVA 1YQDA 2P91A 3WGZA 2WWRA 2EKPA 4OYRA 1EDOA 4ZICA 1C3VA 5EL0A 3ZWWA 4I9UA 3DL2A 1V3TA 2DM6A 2Q2VA 3QE3A 1E6EA 3V1YA 2YQ5A 3RD5A 2QZ9A 3OF2A 2UAGA 4RPJA 4XYMA 4O5OA 3R1IA 1IL0A 3ZV6A 4C7JA 3DAPA 1JU9A 3GUYA 2D59A 4H7PA 5FI3A 1H2HA 1TT7A 3PK0A 2DC1A 1XA0A 2C7GA 1Y9AA 3AFNA 3DZJA 2Y0DA 1HDGO 3TOZA 3ZWAA 1CF2O 4AL4A 2YZ7A 3RC7A 1SOVA 1LTHR 2HKIA 4XGKA 4BHTA 2ZK7A 4XQGA 4W6ZA 3AOGA 4E2YA 1E77A 4BB6A 3F5SA 3DBRB 1GYQA 3C1TA 1DEHA 1R0KA 4AJOA 1BWSA 1PGOA 3JQBA 1NBOA 2FR0A 2QHXA 4J1NA 4B4UA 5AXAA 5HS4A 3NYWA 2C54A 2O3RA 3R6DA 1VLLA 4J3FA 3RFXA 4D44A 5IFLA 3H5NA 4FPXA 3GLQA 4HNHA 1LEHA 1XR3A 2VQ3A 3KBOA 3FNEA 4MVJH 1DRWA 1PQPA 4GWKA 4E21A 4HX5A 1U7TA 2PH5A 4LRTB 5F3RA 3BMNB 2Q49A 3KZVA 3WGHA 4NR0A 1F0YA 4WNIA 4DLAA 3PXXA 2YDXA 3H9EO 4FGWA 1NP3A 1XDWA 4XQEA 4Z9FA 4R9SA 4E2XA 1IOLA 4F6LA 4G65A 3WTBA 3VC7A 4EUEA 1BRMA 1LRLA 1YOVB 5A9TA 4OQZA 3S1LA 3ZWXA 4AG3A 3RBZA 1B15A 1R0LA 2AW5A 2POQX 3GDOA 3MJEA 4FQ8A 5AQ1A 4XZ3A 2CZCA 4BO0A 1P45A 2Z95A 3HG7A 2AQIA 2R00A 2HJRA 3I9JA 1RPNA 1KBZA 2D5CA 2Q2QA 3E82A 4CM9A 2PD4A 4BNYA 4QXMA 1YRLA 2WM3A 4Y6RA 1NTOA 4NK4A 4C7KA 5L45A 4YJGA 3N74A 5HA5A 3C7CB 3ICCA 1Y1PA 2O23A 3LLSA 3KYBA 2RH8A 1PJTA 4BMSA 5F1KA 4BQRA 1TT5B 5FF9A 1UXKA 3DBHB 1V8BA 2WE8A 4IQ0A 3KETA 1ADCA 1VL8A 1GZ3A 1LNQA 3DXFA 2UUPA 4KUEA 2AE1A 1LU9A 2PR2A 2YV1A 1KETA
chains in the Genus database with same CATH superfamily
3R4VA 4L3OA 5DW0A 5E6RB 1O9GA 4N8EA 3P1JA 2FN7A 5JBIA 3PG5A 5K6AC 3FNHA 5LWQA 1YF3A 4TXJA 5E38A 4TSFA 4EQ6B 4LMRA 3SHOA 3NO4A 3BJZA 3RSFA 3VO8A 2ZAYA 1GPJA 1JKXA 3IH5A 2ZB8A 4H6WA 4XTCS 2QUIA 1WZ2A 1JTEA 3L8YA 1W0KD 2C5SA 4HXFB 3HYTA 1T2DA 4FXOA 1W85B 1V26A 2QXTA 2G3YA 1JDTA 1QYCA 2F1RA 4GBMA 5CH5A 5ALUA 4C1NA 1YO6A 4M0FA 1VCIA 5HFJA 1E69A 4M3NA 3B3GA 1JB9A 3TCNA 2EKQA 4E46A 4ZHSA 3P19A 3ZXSA 1S7CA 4G56A 1X15A 1YVUA 1CY0A 1XJ0A 3B3FA 2QL9A 3IIIA 3THYB 2PKRA 1NW3A 3INRA 5BWNA 1OZFA 2INGX 2P6PA 1EFHA 1WWKA 1V16B 2YMLA 3NVAA 4MJXA 3ZHBA 2L19A 3FCAA 4RTNA 2VH2A 5AI0A 4BNHA 3A11A 1W29A 2F8LA 3LRXA 4KXYA 1L5MA 3OHMA 4Q34A 1RXSA 4O3FA 3IXMA 2QYHA 4EJFA 1OKKA 5FOSA 3SZGA 1QRAA 2CDBA 4JGGA 4L3VA 1AO0A 4D3SA 2DR2A 2CJFA 3QWIA 2H18A 1RYHA 5FADA 1WZIA 3K32A 4G5HA 5ESWA 4BGVA 5FUMA 4QU0A 4HNAA 2PBRA 8ABPA 4AKEA 2YWFA 2F64A 2ENWA 1Y1LA 4ZOLA 1MHTA 5BQFA 2O07A 2Z6AA 3M2TA 3S1AA 4BO9A 3F3SA 3FDJA 3KL2A 3QEJA 1GARA 1UMCA 4KIFA 2DKNA 3K94A 2FI1A 2ZTMA 3COPA 3WP0A 1SQ6A 2O3UA 2GS9A 2ZVPX 4BZXA 2YCBA 3VR4A 3BEOA 1CRQA 3PE6A 4R2JA 1CLUA 5C7YA 5IKMA 3RS3A 4W7IA 4WVLA 1ZONA 3I6ZA 1WMEA 4ZMRA 1EP1B 1N0UA 2E37A 4KODA 4XFJA 5K0BA 1IY1A 5G0UA 3R3XA 1PDOA 1XK7A 3BB3A 3M6FA 1NBIA 3VR5D 1VXRA 4DFDA 1ONPA 1WXDA 3ZK9A 4YX9A 4OKSA 2WFZA 3PI6A 3OP1A 1SG6A 3H18A 3L6OO 2JI4A 2V7QA 4G0PA 2WWVD 5M29A 3TX6A 4LYFA 4N7JA 3HL4A 3UVEA 2GCOB 3LCUA 3OMXA 2FLKA 4BUZA 3NEYA 4JQYA 1XU9A 4HWOA 5AW5A 2UVPA 3TXYA 821PA 2RE8A 1AKRA 2IGBA 5T67A 5LBIA 1R7RA 2HHAA 3CNNA 3A4LA 4XJVA 4EABA 3G7SA 2MMGA 4OQ4A 4LFAB 1YJAA 3C8ZA 3A3NA 1DT5A 4TKVB 3L4EA 2W71A 3NR2A 3FOZA 4P93A 4LDPA 1DC4A 2WM2A 4B6FA 1ZGZA 1OLOA 1R0XA 1U0SY 2DFTA 4R2LA 4RH0A 4IG9A 2GBIA 1PZEA 3IC5A 5KBYA 2CDNA 5JUWA 4B3GA 4LVUA 3DCIA 3OJLA 3QNUA 5COQA 1Q0UA 3EC2A 5KQGA 2XSZA 1GAWA 5TJ9A 3W6NA 3X0DA 4AS2A 4LRSB 4N3NA 3JQ8B 1Z4PX 5DBEX 3BC1A 1EINA 3Q7RA 5LLSA 1UBJS 4DV0B 3G6WA 1VTKA 2BUCA 3MXTA 4QA9A 3GRPA 4DA7A 1NE2A 5LQJA 1NF3A 5ENDA 1S2IA 3A2KA 4JMLA 4BKPA 3VR5H 1M2KA 3SC2A 5KKCA 1VLMA 2OZEA 1KVRA 1S8AA 2XDWA 3O7MA 1JGTA 2FV8A 4LYJA 5BT8A 1RYNA 2NO6A 5SYAA 2ORVA 3NTOA 5C4IA 5BSFA 2IV3A 5C52B 1I5EA 3FNIA 3QBJA 3PZRA 4QTTB 3INGA 3M6AA 4DLNA 2XE4A 1GCAA 4MKXA 4NMWA 2VF5X 4L0MA 3MLAA 1P7ZA 4LZPA 4YIHA 2AFHB 2JEOA 2SECE 1QU3A 3RNOA 4ZDKA 1VHDA 4B32A 2QOEA 3HI4A 4H6XA 2OCIA 5F21A 4GLOA 1CNEA 2QR3A 2PWZA 3CB2A 4QLAA 3N75A 3W8RA 1J8QA 3LUGA 3UKOA 4JZKA 4JJEA 1IE3A 1MHPA 4J7XA 3S8EA 3BFPA 3EUFA 5E9WA 5J4KA 3R8FA 1ND6A 1CUFA 1NMYA 2C9CA 6REQA 3AETB 3M83A 4XJSA 1OOEA 3ZX5A 4ADSG 3H2YA 1HOXA 2GM9A 3GT7A 4PLGA 5EUQB 3URKA 1C9MA 3QEMA 3RQSA 3TCKA 2XQFA 5BMVA 2A35A 3PEWA 2XGSA 2WPDD 4LS3A 4IJMA 3RARA 4QOHA 3QVXA 5CM8B 3QFSA 2EFDB 4YN3A 1XZIA 1SQGA 1B8VA 3H5LA 4R2HA 5T8KC 1YZYA 1HQDA 1VL1A 5A3VA 1Z15A 4E5DA 4YQFA 4BCCA 1A5BB 3BVPA 4UTXA 1IUPA 2BCGY 2CHGA 3CEJA 4W8HA 2HA7A 2E4WA 4YRDA 3SE7A 4LN1A 2GUGA 2WTXA 4QQNA 1Y3HA 1DIBA 3PUWA 4OQPA 2Z57A 4RX1A 3WLTA 1CEEA 3DYIA 2WF7A 4KN8A 5A4KA 3QVLA 4MW4A 4FOOA 1E3DA 1QGYA 2E4UA 4Q4JA 4U3JB 1NSFA 1S0UA 2J7PA 3GNTA 4OM8A 5L3RA 2EYUA 4DYDA 1GTMA 1NN5A 1IQ0A 4XUCA 1VC2A 3HV2A 4ZJUA 1H23A 3G2KA 4G0NA 4WLFA 1BGXT 2BFDB 4WK6A 2H4ZA 4AG5A 2Y1EA 4NENA 5B30A 1SFRA 2IEBA 4Y6PA 1U3WA 3AF6A 1QNFA 2HRDA 1DC8A 1GTJ1 3HCBA 4FFBB 5CURA 4ZTBA 1O89A 2C3YA 2ZE7A 3LBNA 3ND8A 2BBWA 2OK7A 3CKLA 4B81A 5EJ6A 1U4OA 1PEAA 3DAGA 3KPYA 2G76A 5H7XA 1KQFA 3U1TA 1JFSA 1ZOPA 1V48A 3K05A 1Z5VA 4MLZA 4NS4A 1P29A 2QMEA 2XY4A 4R9RA 2WU4A 4TQGA 2EIHA 4M6WB 2X9VA 2ZIGA 5JMTA 2JJ1A 4UAUA 1HG1A 3L0CA 4CIDA 2ZKLA 2JIPA 3NANA 4FCWA 5ENZA 4CU2A 3I04A 3O1IC 1GLGA 5TQ2B 3JZMA 1OH6A 2DT8A 4HZGA 4RXMA 4V2UA 4LF8B 3IESA 1ZBQA 1J4AA 1N92A 2CFOA 221PA 3QKTA 3OCCA 3LOQA 4CKEB 1PYOA 3NBKA 4Z1MD 2PH1A 3N2KB 4Y6QA 3USCS 4BN5A 4BNGA 5DLQC 3AWDA 3ILVA 2OV4A 4MLDA 3SS7X 3KJEA 5B5SA 3KKPA 1AQUA 4EHDA 2C2GA 4O63O 4P2BA 4QPDA 4C5BA 3WJAA 5CFZA 4DMRA 2OESA 3TBHA 3U61B 3IB6A 3OETA 2W6ID 3D3WB 4HF7A 5H59A 3EC1A 4JP1A 1X0XA 4DQUA 3O8CA 1EBBA 1KYXA 1Q7TA 1TO1E 4P8RA 2WNSA 1BWPA 2PO7A 2QNBA 3EVBA 4BLQA 4F3NA 3AZQA 2HU8A 4KK3A 3KHTA 4G1BA 3V4VB 3KVYA 4LSMA 2FJPA 2V6BA 4H7PA 4PC6A 1Z0IA 4D8YA 4DWJA 4KQCA 4C7OB 1CUXA 3EGXA 3FOBA 3K1YA 3N1UA 4JAVC 2CCJA 3O03A 3PRKE 4PLTA 5JWHA 4UEKA 4CMHA 2PZGA 3SVTA 3O5AA 4NV3A 4HNAB 4YJ3A 3EWNA 4KLRA 1E3IA 5TE9A 2BLNA 4B5KA 3WICA 1N77A 4YJKA 1G6HA 4HUQA 4TM7A 5JHGB 1RWOA 2OHOA 5IM4A 3D0KA 1EX1A 4QUGA 4EEKA 4PBTA 1X7YA 3I1FA 4JC4A 4KMRA 2R7MA 4U8HA 5IKEA 2J3HA 1CZHA 1NVUQ 1CR0A 4C4ZA 1DJNA 5DTIA 2GJAA 1D6JA 4URZR 4DV2B 1SKBA 2UDPA 3KSBC 1MQ8B 2P62A 3G5LA 5MN5A 3TL3A 1GQYA 5FAXA 5HRCA 4PCVA 1BFUA 4XIGS 1C1DA 3KT8A 4QO7A 1YFLA 4IGKA 3RYTC 2X76A 4K9RA 1NVMB 2WFAA 2XDAA 1XQ1A 3JCZA 2RAFA 3OEED 1P4SA 2ZB4A 3T1YB 1W8IA 3THWA 1UMBA 1Q22A 3L9WA 1WL8A 4IFTA 1P9WA 4KX5A 3WFJA 1M1YE 5AW0A 4U9UA 2WY2D 4GPZA 1EAYA 1IVNA 4K0KB 5BW5A 4BO2A 1XZQA 3BIOA 4JUFA 5KYWA 4KC0A 4E6EA 3W77A 3O8RA 2X3YA 4TKZA 1V8PA 4D80A 1Z5OA 4HDNA 4YT8A 2Z98A 4MMZB 5A9SA 4GPEA 2V3WA 3UYLA 2Y1GA 3OQHA 5B53A 3WHIA 2VQEB 1R9MA 4J29A 4N5MA 3VO9A 1CEYA 4QFMA 4BNZA 4I99A 4MUAA 3O74A 3FCCA 3N2EA 2VDQB 3MJTA 3VJLA 3V4FA 1ZK4A 4LYEA 4MUKA 3TF5A 1WF3A 2GX6A 2MSCB 2Q45A 3AC0A 3H2GA 4BKMA 4IIJB 4Q3AA 2NO1A 1BE8A 1I2BA 2KW5A 3VR3D 2C7VA 3FHJA 2BFWA 2R4UA 4F46A 2P0AA 3PS9A 5CU7A 2DSNA 2YFQA 4NU8X 4EFMA 3EVZA 5ARBA 3GG2A 3QE0A 4CQJA 2ACKA 3QVKA 2HDNB 5AK0A 1PFVA 3CISA 5H4GA 2OUIA 2Z2YA 5DHRA 2Y0BA 5CVCA 3LIIA 4OGFA 4AXXA 2FRDC 1YNOA 4HDSB 1QK3A 4M83A 3UW3A 4IXMA 5AJZA 1G7RA 4JN6B 2WYIA 1Y6QA 4LCEA 4QRDA 2B21A 3C7DB 3ZV7A 2WAAA 3GLHE 4HDRA 2P1DA 1E18A 1RCTE 1AUVA 1V7PC 4X1OA 1K6XA 1EFRD 3GX1A 1UJMA 3KT3A 1YRBA 3GG9A 5E6UB 1TO2E 3LY9A 3TB6A 4GL4A 4NPCA 2R7KA 2BC9A 4WKBA 3GVPA 1RXUA 2WNHA 4WZ6A 4DIUA 1RVDA 3K53A 1Q3TA 2QJWA 3I01A 1N8KA 3KU1A 2G09A 1Z2PX 1BE1A 3EGOA 2CL7X 3ETLA 4YUVA 4BLTA 1Y5LA 2HK7A 3JYQA 3H3XA 2HF9A 3K30A 1N2CB 1GN8A 4PN3A 3IJ5A 1EMDA 4GKBA 4AZ3B 4DUGA 2VDWB 1P74A 4TKMA 3PI7A 1EBUA 1M1NB 3ZU2A 5L7TA 3IODA 1V1RB 1XDSA 3EZGA 1BKYA 3IDOA 3QGMA 4IRUB 3NNSA 2GHIA 1L4KA 4Q05A 1C9DB 5CJ2A 4B8ZA 2H63A 1P6XA 4IZHA 2BEVA 1KJYA 3UA3A 3IKMB 2RH4A 4TKUB 3U13A 3NAQA 4QQKA 1BE6A 1FUIA 4IMJB 1XPOA 4MW1A 4NAHA 4F3TA 1FRZA 4Y0AA 3GCXA 4EH1A 5CNJA 1U31A 1CB7A 1J39A 2ZQZA 2NT3A 3GVXA 5IK2A 1OHHD 2HX1A 5KU1A 2YX1A 3ONNA 2IEIA 3A4VA 5BN3A 2JW5A 1J8FA 4C4XA 2HFKA 2ZSIA 1BSVA 4WNCA 1QF6A 1TD1A 3E1GA 4L4XA 1ZL2A 3FIJA 4BTVA 1FY2A 1IN8A 1JHRA 3HCEA 4E5YA 2I8CA 3EDMA 3T06B 1MT0A 2B92A 5AICA 4OQNA 2JFPA 2X3UA 3V7UA 2Q1UA 1GTG1 1CHDA 1E7MA 1NC3A 3WGQA 1Q0QA 1N5MA 1RT9A 1I3MA 2ONZA 5ALPA 1P5ZB 3DZKA 1V6SA 3G8YA 4KQGA 5E1BA 3JAWB 1JE0A 4JR0A 1Z38A 1Z6AA 1TA0A 3T1QA 1JVBA 1KU0A 2O8DA 4HWRA 3BD6A 4M38A 4E08A 5YASA 1JHUA 5J1SB 3AFGA 4V0MA 1IB0A 4OM7A 2XMSA 1V8OA 1EXVA 3HFJA 5JMWA 2HJHA 3FRHA 5KC9A 1UT5A 5E2AA 3E1KA 2C8VA 3Q3CA 4QJBA 3NYRA 1U0BB 2O0LA 2Q3LA 1DO8A 1U0FA 4KGXA 2ZS8A 5CLQA 3HCDA 1CVRA 4B17A 5KNCA 5AW8A 1VMEA 3LO8A 3CCBA 1M6EX 4G1EB 3ZUPA 3M5CA 1IPFA 1E7SA 1KJWA 3A70A 1N8SA 3KFXA 4RY9A 2GMWA 2JKZA 4ZN6A 2C07A 3P9ZA 1N6HA 1FTNA 4XWGA 4KE8A 4NZNA 2FW6A 2BMFA 1TYDE 4BECA 3EGCA 2QD3A 2ZWIA 5JS7A 4PYOA 4O2BA 1U1DA 3PHBE 1R0SA 2JFZA 4OXXA 1P9RA 1KK0A 1P8JA 3WYNA 5L4NA 1M9NA 1NI4B 2FY8A 2R44A 3OZFA 1OXXK 1UADA 3IAUA 3EAQA 1E79A 4YA6A 4JITA 4K5QA 4DDVA 2SCUB 3EIWA 3S44A 4B85A 3RBAA 1H8HA 1QMPA 3V7NA 3ICWA 2D5BA 1J1ZA 2B98A 4ZO9A 4LJRA 4GG1A 3VV3A 5CNIA 5FBVB 2PZFA 1QORA 4HHEA 2YZ2A 3ZBTA 4CMBA 5EQDA 3GLIE 3SSMA 5F98A 3CZAA 4GI5A 4IJWA 2BDTA 1LSSA 1OZHA 4Z4HA 1AJEA 3A6KA 2XUIA 3D8HA 4MIEA 3KZNA 4CKYA 3PUVA 1QCYA 4HUQB 3T4UA 3ZWVA 3A6DA 4AKHA 2CXXA 2O6LA 1D0SA 4HWGA 4BNUA 3PWKA 2BI8A 3D3NA 1GRVA 5J43A 4YFVA 3E9DA 3TQHA 3VX4A 1N6KA 1ML3A 3AYZB 1BQEA 2B34A 3E6AA 4WKNA 4EKDA 3X1MA 3FHTA 1EWYA 4B82A 3BHMA 2BLLA 3NP7A 4IOMA 5F3DA 5T64A 3OFNA 2FPLA 3TOXA 4EFDA 1W0CA 1BWRA 4IIGA 1G2OA 1CR1A 1MC8A 3I6BA 3ORQA 1IUNA 1GUFA 2FPIA 3NEJA 3P45A 2J31A 2FA9A 2GBPA 2Y67A 4ZKEA 4DY6A 2A59A 4YPVA 4GKJB 2P6NA 4LX0A 1KC3A 1PTJC 4R68A 3DOUA 3BE4A 2DFLA 1MB9A 4ETIA 2JIZD 2O5EA 3TI9A 4FYPA 1PR3A 2BFEA 2C2XA 2X9QA 4KGVA 4NG4A 4TMVA 4WZBA 4XLZA 3CKMA 2PUBA 4ZOEA 1CR4A 3H9UA 3IMKA 3LIPA 3P9YA 7GPBA 5EQTA 2BBTA 5EJAA 1DAFA 1XKQA 1XKXA 1P91A 1ZCAA 4PLPA 1BJKA 2HWYA 4JWTA 1LSJA 4YECA 5C4MA 5MFPA 3N86A 3QIVA 3R7WB 1XHLA 1QTIA 1VECA 1RMTA 5GM1A 2DHEA 4R1OA 5JECA 3NTVA 2AB0A 4L9WA 1JP7A 2VA8A 1YQ9A 3VNVA 3RTCA 3SDSA 1VHWA 2PXHA 5E0OA 3TTXA 4D9FA 2EGHA 4QDTA 3UHJA 4IVQA 1MFZA 3GJ7A 3OJEA 3SZMA 3G2JA 3JQGB 2XTNA 3ZX4A 3MTIA 3NCTA 4U02A 1Q2XA 2QSYA 3JAKA 3RUEA 2W98A 2UV8A 4B1FA 4F4CA 3MTGA 2HCJB 4MZDA 1JR4A 3VOAA 4BQIA 4LUCA 2H59A 1WCWA 5J40A 2AG5A 1KFCB 4I1SA 3GUVA 2GZRA 3GAFA 3NH6A 2VJOA 4IH1A 4UMEA 1B74A 1YH3A 1W30A 3GELA 4IQ4A 3OZGA 3UCEA 1SBNE 1VMIA 5AKKA 1U1GA 3IVXA 1CDDA 1GU1A 2ZE8A 2L18A 4QU5A 3GIWA 4TUYB 5F4ZA 1TAQA 2HB6A 4CXMA 5CDGA 4BO4A 2VNKA 2YZGA 1QLWA 5FFNA 3ML1A 3E3MA 1Z4OA 4IFBA 5IKXA 5IC6A 3LV8A 3QX9A 5KOJA 1BN6A 1ZD2P 2J7KA 1WSBA 2WU3A 2ZSAA 3EMVA 4CNQA 4CLOA 4PF1A 3B6MA 3MWLA 1NSYA 1UZNA 3TLKA 2AOUB 5CB0A 3KHKA 1AGRA 2C5GA 4FGZA 2H1VA 2IXAA 3AEQA 3FFTA 3V34A 4MUJA 2RH9B 3GFVA 1SA0A 1VFPA 3ZWDA 1UK6A 1OH8A 1U9IC 1XU7A 5JNUA 1HR0B 1L4BA 1P7YA 2B2CA 1I36A 2ACWA 2RAVA 4K81B 1IM8A 3L05A 4OQEA 3ZHQA 1K92A 1TAGA 2ECOA 4MR9B 1WVMA 1QG2A 3EXG2 1TKCA 5K3SA 1FU7A 2P6UA 5G0VA 3QXSA 5DCWA 4NXMB 3MWGA 4ZI2A 4RJJA 4MGZR 3SJCA 2E6KA 1UPFA 4IIYA 1P2VA 4EI7A 1I4WA 3FBTA 4WLNA 3W2TA 3AKDA 4DLRA 4EAAA 5BV1A 4G5GA 3UY4A 2XUFA 1JAIA 1OTHA 2ERCA 3U80A 1DTWB 2PUAA 2AYZA 4XIJA 4JI1B 3UICA 1PL7A 3HB7A 4RGQA 4HAVA 1P61B 3RIMA 4QULA 1HT0A 3K1AA 5T5QA 4BPBA 2PT5A 4JELA 4A5OA 1FDVA 4YRFA 2WK1A 1NT2A 1ZVJA 3M0EA 1PUIA 3HDQA 4AJIA 1RQNA 1H3FA 2JVJA 4TTIA 5DMHA 3DEFA 1LLDA 1PJ3A 3LYUA 2ZCUA 4RKQA 5CG1A 3KSRA 3QEMB 4W5JA 3T9CA 1NG1A 1URPA 1X7ZA 3LCVB 4XGIA 2WB2A 1EX7A 4YMIA 1RIFA 3PC4A 4MCHA 1BHQ1 2IYZA 3QQ5A 1HV8A 1O95C 4OI4A 5TT1A 3QLJA 4I1OA 4R3UC 3DUFA 5ADVA 1X87A 3ANLA 2BBSA 3AY3A 2FVYA 4JSRA 1EK1A 3OBIA 4WLEA 2Q21A 4FJ0A 4DVJA 3MHTA 1CTQA 1MRSA 2Q6VA 2FN4A 1O95A 3LUCA 3PBKA 2XIJA 2NW6A 1V9CA 3BRCA 3F90A 3C7TA 4JDUA 3UHOA 3VPFA 3R9IA 1E2BA 2ECPA 1E1YA 2DBZA 2A3RA 1RYDA 3TWOA 1OGIA 2ZEJA 5G3ZA 4HQ0A 2C7PA 1EVEA 4DXAA 2Z8YA 1NZJA 3ZKWA 1EUZA 4GMKA 1ECGA 3MS2A 4UFNA 4UU7A 4EY8A 4UFPA 1G6KA 5AKHA 3ZK7A 4E5UA 4XYGA 1G59A 2D6FA 3WQSB 2JH8A 1G21E 1Z2DA 4QFBA 2C57A 5IBCA 5HMLA 5G1NA 4PC7A 4Z4FA 2BFAA 3PXAA 3SFTA 1MO6A 4F3RA 2H57A 3TVDA 5DNCA 5DYGA 3L7JA 4INOA 5DOVA 5HFNA 1GEGA 3KZKA 3TD2A 3KZXA 1PTKA 2YICA 4JYPA 4MV7A 1C9NA 5FOUA 3ADBA 1YRAA 5IVKA 5E1DA 2JLXA 4UAVA 3DMTC 2ZBFA 3CVVA 2E6UX 2ZRBA 3BMQB 3W6PA 3R9XB 2ZIUB 1WTCA 1C80A 3MBOA 1YI0A 1NATA 3JATB 3JYLA 5DZSA 3KAQA 3ZE0B 3GCGA 1N8NA 1Q21A 1IZ7A 4ZZ3A 1HPLA 1D5WA 1T36A 3DMTA 1WOYA 4PTZA 4PZDA 2DLCX 5HJ5A 2VRCA 8LDHA 3SEQA 5K8IA 5KYYA 4OL0A 1V5IA 3QYPA 1N6PA 1ZW6A 1USGA 1TQ4A 2KX7A 1PDWA 3AFHA 1P9OA 2NU9A 3BF8A 3FHOA 3ASZA 3MTBA 4MMYB 5A06A 1F3OA 1ORDA 3LXXA 4RVUA 3Q8LA 1AS2A 2I7XA 1VE3A 3CNHA 1IZ8A 3WLOA 3T5PA 4RDHA 5F3WB 2QE7A 1PGJA 2I3ZA 1XMPA 1XNGA 1K63A 4EB6B 3KKKA 5F4BA 1N4AA 2IY8A 1V9SA 1XQWA 2DAPA 4F45A 1GDTA 3RV4A 1ELOA 1MT3A 3C14C 4F1WA 3QFTA 5FI0B 1S3SA 1SEVA 2XUHA 3QQPA 3LP6A 4EGQA 2BP7A 1JIIA 1P0CA 3Q3EA 3ZCVA 1GU7A 1YL7A 1ZYUA 3AJEA 1PV2A 4E94A 2BGNA 4ZI7A 3BH0A 3VYRB 1ONNA 4O59O 2FUG1 2KMLA 2XHEA 3EMKA 1BQ4A 3GUUA 3HZRA 4FYWA 1VL0A 5AUNB 1LX7A 2F55A 1XCMA 1BO6A 2HRCA 5T4FA 3PJEA 3ZZ1A 4CM8A 3STYA 3EOBI 3KD2A 3OFJA 5IZ4A 2GH1A 2ZTLA 1KE1A 2QVCA 4JD5A 4GE0A 1G41A 3LT0A 8ADHA 1SKMA 1WB5A 1GLNA 4LBWA 1CS4C 1P72A 1XZDA 2RGEA 1YHZA 3EAGA 3UGQA 2DP4E 4ARSA 1L4NA 3GUCA 1SUEA 2FZ4A 2NXWA 2FDCA 2C29D 3C3EA 3AIIA 4FT4A 3KQWA 3N2LA 5EERA 3WYFA 4MYHA 1QB7A 1X77A 3DBRA 3TZLA 4UTVA 5JOQA 4FB5A 3GOHA 3QI2A 1GTVA 3U4MA 4FOPA 3PL1A 4M1EA 4D9CA 3P2MA 5A4FS 3T3MB 4B09A 1YWGO 4E15A 1GKUB 3M3DA 1SGWA 1B42A 2DTDA 3OEHA 3LP8A 1WQ4A 1I1HA 2RHCA 2FR8C 3VR2D 1HDRA 3GXOA 3KWFA 4DR7B 1ZKMA 4QXOA 4KR0A 2J1LA 5FFMA 2WAMA 3WLIA 4AUMA 1LTQA 3NWOA 5HK9A 3HJNA 4BJ5A 1R27A 4L22A 1DC5A 3DFUA 2OSBA 5HIIA 3AOEA 3O9MA 1GUYA 1TIKA 2R6FA 1YS1X 5GJVC 4H1WA 3A05A 2EVWX 1YUMA 2O4CA 2XXBA 3GNSA 4EHIA 1HZZA 1KMHB 2PQ6A 2G82A 3IPLA 5AJVB 2HO5A 2OXTA 1DBWA 3K9HA 3U40A 3UT5B 4XWYA 1BDMA 4D3ZA 4MUMA 2BH9A 5AJWA 1VMAA 2XAAA 5KSPA 4WE3A 5JYCA 1MKYA 2FZLA 1WULS 3ST7A 4AZSA 2I66A 2XE7A 3HVUA 3QH4A 3OAAA 1KWKA 3TMYA 1P2DA 1QP7A 5GV7A 3MTDA 3BWDD 2ARKA 1DV2A 1U6JA 2HK6A 1I5RA 1L7DA 1UDCA 3ENNA 2Y4OA 3RFCA 2DWOA 3LC7O 5ALRA 1N36B 2I2FA 3QEOA 4L6CA 2FRDA 4IDCA 3VR6A 1IULA 1RWQA 2OFOA 3SZ3A 1Q1BA 1J2JA 3BIJA 3ZDAA 2LPMA 3ISTA 4TZ0A 3OQIA 3I9LA 2JCXA 2R6HA 3H42B 1IN5A 3B51X 4Q7QA 4EPRA 5CJPA 3ELYA 3V4OA 1VG0B 2IWRA 4GBJA 3ITKA 2JGKA 4RYLA 1F1JA 5F78A 1T3TA 3F0TA 1NNEA 3PIIA 2JJMA 4J49A 4GI3A 4O4LA 5FIUA 1GTSA 5EIHA 1KFJB 2C94A 1BMTA 4WERA 4HFJA 4AZ0A 3SIRA 5EXEA 4DNOA 2C7OA 2Q62A 3H7AA 4E2WA 1AD2A 3BHNA 3PFNA 16PKA 3OM1A 1L8XA 2G63A 4MDYA 5E6UA 2DWUA 3C8MA 4BVKA 1UKVY 2FE1A 3OC6A 4CKEA 5ARDA 1UUFA 1IH8A 3PHLA 1PDVA 3KLPX 4L07A 2AFIE 2FOIA 3AR6A 4RO0A 3IP9A 2PT9A 2HLDD 4OL9A 3K72B 4MVJD 2W83A 4X90A 2CUKA 1ISFA 5B4TA 3U31A 5E7QA 1AX9A 3C1OA 1PZGA 3ORSA 4LY6A 5FBLB 3DKKA 3VXKA 3FXAA 2D5IA 2HA2A 2O50A 3CLUD 1ZZEA 1AHNA 4G84A 1N4DA 5J23A 2FGJA 4I4NA 1W87A 2NWQA 2WU8A 4JLKA 4ID3A 5AP9A 5EHQA 5B4VA 1XZNA 2W2KB 2WICA 1UC8A 2ZIEA 2ZIXA 1MEJA 3WAJA 5FBWB 2DEUA 1FFXB 2PKQP 2ATXA 1H5QA 2EKLA 4HATA 4UNNA 3AM4A 4UBLA 2KQUA 3X2EA 1QIDA 5FULA 5IG2A 1XVTA 1QX4A 1AKWA 3GN2A 3KV1A 4JBIA 2NN3C 4Q16A 4GOOD 4CDGA 1SZPA 1L1RA 1P0PA 1PQ4A 1YBVA 4ND8A 3B89A 3GJ6A 4OOEA 4S1TA 4XFKA 3RHSA 3ESBA 4NJEA 5HFAA 5IAAA 2DWPA 1K0UA 4NJOA 4Q4HA 4V0OA 1J97A 1E92A 4A6PA 2GVNA 4TTAA 4XA8A 3ICQB 1OBFO 2EKDA 5DHAA 3S7ZA 4O29A 1KTVA 1E9VA 4AECA 3WV4A 2RGWA 3FZYA 2C97A 3U44A 2R84A 1RU3A 3QUTA 4NPHA 4DNXA 2UUBB 1RPZA 3WLQA 3CCCA 2JATA 4DPMA 3C5EA 2ZQYA 5C3UA 1JIVA 2B25A 3PQ8A 3BJMA 2X1LA 4I4TB 4WLUA 4E7OA 4ZOBA 1THZA 5KTYA 4UAJA 4B7CA 1QSGA 3K9WA 1GNPA 4HS4A 4QDXA 4CKWB 4HDKA 2HQ1A 3IPRA 3V33A 1ORTA 4X8LA 3ZHZA 4DDMA 1RSZA 4Y1GA 5JBNA 2OENG 2EDCA 4OX9Y 4M87A 3WKCA 2OV8A 1XTPA 4KWHA 1AXEA 1P1BA 4WZAE 5BVGB 1RM3A 4BLWA 4QUKA 4J9UE 4Y30A 4Y2PA 1MAUA 2JASA 3LPMA 3ORFA 3OOSA 4U6SA 4UBIA 2CBXA 3O73A 3SK0A 3FDZA 3DLPX 4D5GA 5ICCA 1KEKA 1UPXA 2C4VA 2Q3HA 4MI6A 4DLWA 5JEEA 4YAUA 4B3FX 1FUEA 3MLEA 2VKTA 3TG2A 5C1DA 2V5VA 3KCQA 3NKFA 2YNMA 3DWIA 4AWBA 2EFEB 5DULA 5IZCA 2XXJA 1R0WA 2HJGA 3PF9A 4OHOA 1A4XA 5HKBA 1YMQA 2B8EA 4CQLB 1F8XA 3AL2A 1COWD 3UCFA 2X6TA 1ZNZA 4UULA 3PUZA 3TR0A 3MCAA 1YJQA 4ND1A 2QVLA 4REOA 2C5LA 2GKGA 2G67A 4YQZA 3A6FA 4ZVQA 3ROMA 1CQXA 1DLIA 5ABPA 4L5BA 1NMZA 1LF5A 4FDLA 4FSHA 5LZ4A 1GG2A 4XIFA 4TKUA 3D6VA 4UMVA 2ATEA 1E3MA 2B7LA 1ESNA 3GYGA 1OB5A 1RWWA 4G09A 4L57A 4ENUA 5JS6A 4XRRA 5EFOA 2QAJA 1ZUHA 1OVGA 1POXA 2WYWA 1LS1A 3X1DA 4EQZA 3W2IA 3GLGA 3EWSA 3UJ6A 2AC4A 2YY7A 7MHTA 2BEJA 3RT9A 1YUBA 2ZKIA 1YQXA 1MH1A 3QHAA 2D74A 4FX5A 1RZ3A 2OV6A 1I3NA 1AZSC 4AWXA 4BMXA 5BNIA 1JMYA 1CUCA 1VFNA 4BMOB 3W1WA 3OVMA 2A4MA 2DR0A 1Q7RA 2BM8A 1L7RA 2P69A 3F6YA 4WY2A 3UWDA 1XTKA 5I4BA 1U5BA 3O4JA 4KXQA 2F3SA 1ENOA 1K68A 1NI4A 3BHJA 4FYKA 6GPBA 5AVQA 1Z0SA 2PXCA 1H8ED 1RRGA 1VHQA 2GPJA 4TTJA 3NHZA 4GPBA 4KWEA 4E2ZA 4M49A 4TN5A 1G20A 1YZHA 2YXPX 4P4NA 4P7FA 4M0DA 5IAOA 3GHYA 3GGPA 4Q9AA 3F9CA 3WB0A 4AY4A 3IQHX 2X42A 1U04A 1GUZA 3PHIA 1YZNA 3QF4A 5C81A 3BFXA 3EXHB 2P4SA 1ODKA 2QQGA 2IF0A 1KPIA 2WT9A 2F62A 2BHLA 2XB4A 3A14A 3MPOA 3OJFA 1SK8A 3W34A 4B9AA 1JHDA 1OZAA 4BPRA 4EG6A 5FWNA 4GOXA 1SHZA 2Y1XA 3TLBA 4WHMA 3JRXA 5IX8A 2PS1A 1N5OX 2H1LA 1I7NA 1Q5PA 5D5HA 1O5TA 4A5SA 3O9VA 4XTRA 3KTFA 5BQ5A 2C1XA 4ND2A 5JSHA 2H4JA 4HQ6A 4IDGA 3HKBB 1CDZA 4DDHA 5A1TA 5A9SB 2VDWA 1QDUA 4IXWA 4ZQBA 4PU0A 3KQUA 2G5GX 1XAJA 1CERA 4N5HX 1B0AA 1KSFX 5EE3A 1J33A 1BXKA 2CJPA 3HRHA 1UJ4A 2QV7A 4A92A 3STVA 1P1KA 4AMBA 5DN6D 2YWCA 3FR8A 4WH0A 2R1TB 3JAKB 3EYWA 3N3AC 1TK3A 4J16A 4RD1A 3ZXXA 4Q21A 4PQYA 4Q00A 2XOEA 5BRNA 4YAIA 3L7DA 2YW9A 3K7EA 3FF4A 4HNSA 4QTZA 3W4JA 4LZAA 2Q4BA 4RIEA 1C7EA 4Y9RA 2PH7A 2CV1A 3QYJA 2O8DB 1A9OA 2IYWA 2FH5B 4KDEA 4TZTA 5A62A 3GLFA 3H84A 4QU9A 3DLBA 3AR4A 3KC2A 5FFFA 4G8BA 2CWDA 2DH6A 1NVTA 2VO1A 3AERA 1GPUA 3EDOA 4YQYA 3OE5A 4E12A 4ZZ0A 3QEBZ 4X1IB 1SG0A 2NO5A 2ANCA 2XODA 1I2DA 3ZGNA 2AZDA 3SP1A 1NW6A 2LBPA 2GO1A 1T35A 1TVKB 1X8LA 3HYLA 3L79A 4C0AC 3ZY6A 2RHRA 5DLDA 3PD7A 2AZXA 2FG7C 3ZWOA 1II8B 3T5BA 5U1PA 2WSSD 4Z2AA 3ZCPA 3DB2A 1MC5A 1VKJA 4ARIA 1M75A 2A9FA 5LA6F 3VU0A 3MYYA 3IV9A 2BFOA 4LE2A 1OXVA 1LXCA 2O20A 1ZFNA 1IIRA 2Z5FA 2IYNA 2JH3A 4NYMQ 4AMUA 5I47A 2M6KA 2W48A 3DG9A 1UH5A 3JQ6A 1DUSA 1K9SA 2C4UA 2A92A 2XMRA 2DULA 4LWQA 5KREA 1YHNA 2VG8A 2ZR8A 2E0IA 3LG2A 3X1XA 1N25A 3RROA 1P17A 1F4PA 4OVKA 4YGXB 4XE5A 3WV5A 1V11A 1T8SA 2JEZA 5FR1A 2J5QA 3JQGA 1FXSA 4OXYA 4MP3A 4NXNB 1PG2A 2RC6A 3ZOZA 4DSNA 1J22A 1UPAA 4FZJA 2H4HA 1F3LA 3D6NB 3UAGA 5JI3E 4F6CA 3U6KA 4WX2B 5DTQA 1JPNA 2WT8A 3K5IA 1GUBA 5E7IA 5B3JC 2FPWA 4MHOA 3M9XA 2HW8A 2YFKA 2ZZMA 1U65A 3DV2A 1YB4A 5JD3A 4A8JA 3SQMA 3TJZA 1GSAA 3B20A 5J1TB 4IV5A 3INYA 1CEQA 4J91A 3NFYA 1AV6A 3SQWA 3IHLA 3W5SA 5EKUA 2WHXA 5TS3A 3HEMA 3ME5A 1M2VB 2XTZA 5GV8A 2AOTA 2YBDA 3PCXA 5LR6A 3AEUA 1L7XA 2FF7A 1AGNA 1SD5A 4YLEA 4Q9JA 4Z99A 2ICAA 4DCMA 4GKVA 4CM4B 3PNLA 2G8LA 1UK9A 4CF7A 1L5ZA 1DO0A 4RF3A 3W7BA 1JDSA 5JC1A 4L74A 2D1SA 2QWXA 2OBYA 5G2OA 1SZJG 2IY9A 4TTTS 5LDDC 1PKEA 1G18A 1XSEA 4XD7D 4D0LB 4P3NA 3VHXA 4HRYA 3AHCA 2AVNA 3TUJC 1V4NA 2VP0A 3FAZA 3HMKA 4X1YA 3EHEA 2OYCA 2Z08A 3QF4B 1A2OA 3A4IA 4AC9A 1HEIA 2ZYGA 3WGTA 4GMXA 1TUGA 3D4NA 1FOEB 2VUIB 2Y8EA 3NHAA 5HM6A 5FTNA 5D8DA 1RR6A 3I42A 3NORA 3FTFA 1E94E 2V4MA 4AI6A 1K6EA 2J5XA 2GBLA 2C4HA 2Q07A 2JGNA 4X7MA 3JWJA 1ZJYA 1KE2A 4Z3OA 4HEA1 2OZVA 2Y1LA 5E9AA 3E7DA 3FKSD 2ZWOA 3D7LA 3IVRA 3IYLW 3UUFA 2ERXA 4LDZA 3G9TA 1UJ2A 3DNPA 1XTQA 4MYDA 4P84A 2OCGA 4X71A 1M6VB 3HJFA 2QX7A 2FUNB 1DE0A 4K6OA 1YIAA 4L7QA 4A0QA 2XR1A 4Z86A 1TM1E 4Y2YA 3TTSA 5HTOA 4ZA2A 4HQNA 3DGFC 4ND7A 5KOJB 4QVKA 4GR9A 1IN1A 2GZHA 5JJBA 4BWVA 3MNFA 2WJ3A 3QU9A 4KI0A 1T6BY 1IHPA 4JYMA 4F06A 3AESA 4R3NA 1XMJA 3ITEA 2XTMA 3PDIA 4S12A 1P3JA 4Y2HA 3H1BA 4FZVA 4LC1A 4RCZA 3TIFA 3TLJA 3C5VA 5KIAA 4RLQA 4X1KB 4KQJA 4JCCA 4MPTA 5JS8A 3L4KA 4H7FA 4H3SA 3NTQA 3DVLA 2B5VA 1TM2A 2OWDA 4M37A 3RUCA 3FWKA 3AF4A 4X95A 1TT5A 4LRUA 1DUVG 3DA8A 2VPWA 3IV7A 2VF7A 2ZBQA 5JU6A 4MDHA 3FCOA 4MUGA 3W04A 5LZ2A 5PNTA 3BJRA 2B61A 2ZRMA 2PT7A 2X2FA 4NJMB 5LYJF 3BT7A 1PW5A 1V5GA 1M1ZA 2A2ZA 2JIMA 2VNHA 1AO3A 3F7TA 3QIAA 4G5RA 5I7VA 2CVQA 3EUWA 3GLVA 3OM0A 2BTEA 1WZEA 2ZSBA 2PV7A 3OZWA 2V74B 4YMUA 3M70A 2ZJBA 1PGPA 5KSOA 2QAIA 2WWGA 4IIDA 1TZJA 3K0SA 3GK3A 4EFNA 4Z9YA 2IIVA 3ZVNA 1UXGA 1JS1X 3N2IA 1SZDA 4Z0NA 2RGRA 3SR0A 3GJRA 3R4CA 2MINB 3TKAA 3RAFC 4AIRA 2AR7A 2AI2A 3LVBA 4WL0A 5KUTA 1W7AA 1GSIA 1G8YA 2QQFA 1BDHA 3DBIA 1ZK1A 1KBQA 2FHSA 1X8KA 2W90A 3NVMB 2JCBA 3CWQA 5K3EA 4R1LA 2WOJA 3L7OA 2VT7A 3RAEC 2RG1A 2B0CA 1OIVA 2QJFA 1K6MA 3LL4A 1Q1ZA 3NNDA 3R8XA 1EGQA 2O7VA 3EEQA 1ZY2A 4G25A 2Q5QA 1Y7HA 1Y6ZA 2BY4A 5FOVA 3HXQA 3ENZA 4NBNA 4DQXA 1OR8A 4A15A 1R6TA 3OLYA 4D57A 1SCIA 2BP7B 4ZVMA 3ROQA 4TZKA 4EHKA 4MHTA 3VI3B 3PQ5A 3KT6A 4IFEA 2CVHA 2BAGA 2IHTA 2HK9A 1K8QA 2NV0A 2ZFUA 3KEMA