2X0JA

2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
294
structure length
294
Chain Sequence
MKLGFVGAGRVGSTSAFTCLLNLDVDEIALVDIAEDLAVGEAMDLAHAAAGIDKYPKIVGGADYSLLKGSEIIVVTAGLARKPGMTRLDLAHKNAGIIKDIAKKIVENAPESKILVVTNPMDVMTYIMWKESGKPRNEVFGMGNQLDSQRLKERLYNAGARNIRRAWIIGEHGDSMFVAKSLADFDGEVDWEAVENDVRFVAAEVIKRKGATIFGPAVAIYRMVKAVVEDTGEIIPTSMILQGEYGIENVAVGVPAKLGKNGAEVADIKLSDEEIEKLRNSAKILRERLEELGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
publication title The 2.9A Resolution Crystal Structure of Malate Dehydrogenase from Archaeoglobus Fulgidus: Mechanisms of Oligomerisation and Thermal Stabilisation.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
total genus 104
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x0jA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2x0jA02
2QZZA 1TB4A 1P1KA 4RO0A 4R1SA 4UUOA 4INAA 4EUHA 5ILOA 5A5EA 2QQ5A 3H9UA 5F1PA 2ZQYA 2NVWA 4WLVA 4D46A 1CWUA 2JCVA 5I7SA 3BMQB 3RUAA 2QHXA 2Q1TA 4QO8A 1QYCA 4MIEA 2RHCA 1T4BA 3JYPA 4AL4A 4IJWA 3ZHYA 1T26A 2FZEA 1V8BA 2WJPA 3L6EA 2CNBA 3GRPA 1PJLA 3JD0A 2LDBA 1HSOA 3LF2A 2DC1A 4RVFA 1LLQA 2D3TA 2DBZA 3WS7A 1C0PA 2P91A 3OEYA 2D5AA 1QKIA 1E7MA 4OGWA 5JAQA 1JAYA 2WYWA 2XF8A 5AYVA 3LZ6A 2PKQO 1GQ2A 4ND5A 3JQAA 3JQGA 4A03A 3KEOA 2IYPA 4J91A 1HE5A 4OKIA 1FDVA 1HXHA 1ZMOA 5IG2A 5A3VA 3I23A 1VL0A 5IN4A 1ZK2A 3ZI0A 5A03A 1P3DA 2FN7A 2JL1A 1VJ0A 3RFVA 4CM6A 1S7CA 2C7VA 5T8KA 3ETGA 3S2FA 2PH5A 3PK0A 2FPGA 4BMVA 2IXAA 4R41A 2VRCD 3MJVA 3P2YA 5JBIA 4MIOA 2B4QA 2DTDA 5DZSA 5TC4A 4LRTB 5IDXA 3W6ZA 1XU7A 2I6TA 4LMRA 2FR0A 2HUNA 4D3FA 3U49A 4KUGA 1SCUA 1PZFA 3EDMA 2HQ1A 2PKQP 4FSHA 3LF1A 1X1EA 1F14A 1SO8A 1I2BA 5COQA 3DDNA 1H93A 1PGPA 1I3MA 3WLFA 4Z9XA 2FY8A 4GLLA 2H9IA 5A05A 4ALKA 3RBXA 3Q2KA 3GFGA 1DO8A 1DPGA 1P33A 4GLOA 3ZCXA 1U8FO 2E82A 5DP1A 1PWXA 5T57A 1N1EA 1E5LA 5TRTA 5HWSA 2C0CA 3ADPA 1QSGA 1XWFA 3DBHB 4L75A 4R4JA 2Y0CA 3RSHA 3HFGA 3O38A 4PVCA 3W8FA 3DXFA 2JHFA 5JLAA 1N92A 4F3YA 5IZCC 4JXKA 1VRWA 1J4AA 2PGLA 4AJIA 4CM4A 3S2IA 4YXFA 4Y9DA 3KYBA 4RGBA 1AHIA 4AICA 1DSSG 1VJTA 5JCJD 5JFOA 4EEZA 1YB1A 3KVOA 1ZMTA 1HDZA 1JWAB 2DTEA 3DOJA 3NYWA 1JKFA 2B4TO 2YQ4A 3D3EA 3VDQA 1EEHA 5CDSA 4IPTA 1GL3A 1YONA 2Y99A 3K2BA 8ADHA 1IZ0A 4KWHA 5BSEA 3DWFA 3WNQA 4FJ1A 1ISFA 3MJTA 3AM3A 1NAHA 2PGJA 3BMCB 1E3EA 3ENNA 1LQUA 1UXIA 2B4RO 3QVXA 5B4TA 2PZMA 4RDHA 2Y05A 3BXXA 3ICCA 1MXHA 3RUHA 1DIGA 1BHSA 1X0VA 5IAAA 1GEEA 1MG0A 4U7WA 3ULKA 3VZQA 3SBOA 1KVUA 2W2KB 1I01A 1LSJA 3CH6A 4M55A 3AU8A 2C5EA 1ULSA 4CMHA 4J7CA 1DHRA 2GLXA 1VE9A 1HDXA 2OUIA 3HHPA 3MTGA 3VH1A 4D43A 1PS8A 4CMEA 1M75A 4EUEA 3JV7A 4GAEA 4L4RA 4OKNA 5DDIP 3W4IA 1XG5A 1YDEA 3C1TA 3OH8A 4J9UE 1ZK0A 2WMDA 1GUZA 4LN1A 2NUAA 2QYSA 3RFTA 3WGGA 1PJ3A 5JYEA 4FQ8A 2EV9A 1Z73A 3FF4A 5T67A 1HE3A 3UCFA 2NVUB 4BV8A 2UUOA 5A06A 4RVUA 5B4VA 5F5NA 3COSA 4JJIA 2ZQZA 3C7CB 1MC5A 4XGNA 4EBFA 2Y68A 3GAZA 4GX5A 1IYZA 1GY8A 3ZU5A 4OM8A 2GN8A 3QWFA 3LT0A 4R68A 3GGOA 3WGYA 2Y1DA 1GPJA 4FOOA 3FNEA 1VLLA 3GT0A 4GWKA 4D3SA 1LXCA 4IBOA 3LU1A 3U4HA 4YT5A 2O50A 3UCXA 1CIVA 1R12A 4XR4A 5BNIA 3RC9A 5I8WA 1C1DB 1U5AA 1W6UA 4TRMA 1PQPA 1GYRA 2NWQA 1Q0HA 2OBYA 3H9EO 3KETA 3DBLA 2DKNA 1NXQA 1DEHA 4QO7A 2BKAA 2J3IA 3NUGA 4ALNA 3ZWCA 1E7SA 1GZ4A 2R6JA 3O9ZA 3JQAD 3K92A 1VJ1A 4PG6A 4RQUA 4W9NC 5BT9A 1XR3A 4J1QA 1YQGA 5TGDA 4CM8A 3GY0A 4CR7A 4MINA 1NASA 3RBVA 9LDTA 5T64A 3QVTA 3ZW8A 1Y1PA 3U9LA 3UH1A 4E0BA 1PL8A 3NV9A 1TT5A 3DO5A 3WIEA 5JDIC 1ZFNA 4K6CA 1WNTA 1QORA 4B3IA 3WGTA 3DZJA 3WGHA 2C54A 3FNHA 3TZKA 2DAPA 3G1UA 4LVUA 4GSLA 1D1TA 3GQVA 3WMWA 4ZA2A 1ISGA 2EERA 2XPCA 1CJCA 1YDWA 3GZNB 3GOHA 4OL9A 1YJQA 1E3WB 2XAAA 1YOVA 2A35A 4FBGA 4CMIA 2QIOA 3QWHA 4Y6SA 4CM9D 3O8QB 3VZSA 4E2WA 1H2BA 2DUWA 4ITUA 4W4TA 5DBGA 1RKXA 4NBTA 1J49A 2PNFA 3VPXA 3ROPA 1UDBA 3ZHXA 4OMUA 4FCCA 3U4CA 3L6DA 1CQIA 4K26A 1PEDA 3G79A 4L74A 3NEPX 3OA0A 1GU7A 4FGWA 4P8RA 3CPSA 2X6TA 3FR8A 3IUSA 2CDBA 3ASVA 1XHLA 4AJ4A 3SC6A 3KXDA 4N18A 5CEFA 2Q99A 4BKPA 1M66A 2W2LD 4B4OA 1T2EA 1QLHA 3PXXA 4BQPA 2ZATA 2HK7A 1ZCJA 3WSWA 3RWBA 4DC0A 5FI3A 1DRUA 1FMCA 1Q0QA 4ZHSA 1MFZA 5A5FA 3BMOA 4R51A 4J0FA 3RIHA 5LCXA 5J23A 2WEKA 4KP7A 1RWBA 5JAZA 1Y8QA 4GVXA 3ETDA 1KETA 2O23A 1YGYA 5U9CA 3CMMA 4E2XA 2IEDA 5G0WA 3TOXA 4DC1A 2VWPA 5JO0A 2Y0DA 1GYQA 3AI3A 3OJ0A 3RI3A 5DN9A 4AJJA 4D41A 5LDHA 1D3AA 4W99A 1O0SA 2YY7A 2ZKLA 3LC7O 3WQSB 1V3UA 4PG8A 2VHXA 2JFGA 4WKGA 4F46A 4R3WA 3ROQA 2I66A 4M49A 1IZ9A 3I4CA 5HRUA 4NBRA 1QLJA 3D7LA 3GF4A 4DQVA 5CEEA 3I9JA 4MVJA 3IMFA 1UXHA 1KVQA 1PJ4A 1QYWA 4OXKA 2JAPA 5F1OA 1WPQA 4BNUA 1IPFA 3QA9A 1WZEA 1B26A 1UP4A 1GPDG 3NDIA 1N2SA 3OJFA 3KYCA 4AJNA 4GGOA 2VNAA 4GSKA 3ITKA 3L4SO 3JD2A 2YDXA 4ND4A 3RROA 3H8VA 1HKUA 4GBJA 4TWRA 4J1NA 1Y9EA 3ZWYA 4IS3A 3K9QO 1DC4A 4UEJA 3LSYA 3OETA 3VTZA 4DIFA 1JU9A 5KJCA 3L4BA 2CMDA 5FF9A 1NQAO 1R0KA 2PZJA 2VOEA 4NJMA 4XQGA 4HFJA 4P4LA 4ZICA 3SX2A 4DBVO 3ANLA 3TF5A 2VT3A 1P9LA 5DT9A 3P7MA 3RKRA 1PJ2A 4HV4A 3PWZA 4IMRA 1HEUA 1WW8A 1QXSA 5HBRA 1X7HA 4ZJUA 4PZEA 3EGOA 4B3HA 2GSDA 1WVGA 5HA5A 5TJHA 3KTDA 5COBA 4PLWA 3DZFA 4YRBA 3AFNA 2ZJ1A 2PWZA 1BVUA 2AG5A 5K6AC 1JKJA 3GHHA 1GUFA 5A9SA 2I76A 2VWQA 2HRZA 3H9QA 1P44A 3GG9A 2NU7A 4JBIA 1O6ZA 3I1JA 4RLSA 4H3VA 1UZMA 4NR0A 3GEGA 3WBBA 4ND2A 2YV3A 1YB4A 3DZGA 4EI2A 5A3JA 3QY9A 4NQZA 4URFA 5L53A 5DBFA 4B7CA 4F6LA 1ZK3A 3ZWXA 1XU9A 3SJUA 2POQX 2FSSA 3L77A 1WDKA 1QYXA 3JQBA 5ER9A 3GZ4A 1IOLA 1H9BA 2FMUA 3WB9A 4IM7A 3O4RA 2F00A 4YJHB 1I3KA 4DIOA 4IUYA 3VVCA 5CG2A 2QRLA 2ZK7A 3K6JA 4MP3A 1HE4A 2V6GA 4IZHA 4KUEA 1SEVA 1YB5A 4FFOA 3H5RA 3WGZA 2HMVA 4WCFA 1U4SA 1X0XA 4D44A 4NFYA 2ZYAA 3KM0A 3JQ9C 5TF4A 4ZQHA 1B7GO 1XYGA 3JSAA 3QP9A 1C1XA 1I2CA 4II2A 2Y66A 3NGXA 4Q3CA 1BWSA 3INRA 3GA0A 1IULA 4OSOA 4XJTA 1LQTA 3ZHBA 4E2YA 4EZBA 4NMHA 3RUEA 5KNLA 2B35A 1UZNA 3E48A 4WECA 3FWZA 3INTA 1NR1A 1VSVA 4MP6A 1LX6A 3OIFA 1T2CA 3BHIA 3JYQA 1MC4A 3VC7A 2X0JA 1B2LA 5FWNA 3WMXA 2QYTA 1JVBA 5H83A 3KEQA 7MDHA 5G0TA 3QIVA 2P9GA 3QJ5A 4KDFA 1DJNA 1LRLA 1NAIA 4AJPA 4FFLA 1UZLA 3TFQA 3ZNQA 5JNLA 2O3UA 1YBAA 1R0LA 3KV3O 4JGBA 5B37A 3W8EA 1ZSYA 1ADBA 4LSMA 4R69A 4Y6RA 4WGGA 4Z9YA 1YL5A 2GN4A 1JDJA 1I5RA 1OAAA 5EMHA 5CPBA 5G4LA 3ROMA 3U3XA 3UKOA 1WMBA 1U3VA 2BRUA 4E12A 4OHUA 4Y67A 1C14A 3D4OA 4I5FA 3GPDG 1SMKA 4CL3A 2C07A 1PS0A 2O7QA 3LK7A 4TKMA 1SNYA 4DREA 3AW9A 4BOYA 4K9DA 3CXRA 4FJ0A 3I9LA 4JP3A 2Q4EA 4R1TA 3BHJA 5TS3A 4FN4A 3LDHA 2ZB8A 4XQ9A 4BIIA 3OFSA 5TT1A 1JA9A 1H0KA 3M2TA 3ZWVA 3DAFA 5KJ6A 3BYZA 4WEQA 4W7HA 3GMSA 2VWHA 4H7PA 1XCBA 1H6AA 2B5WA 2VT2A 3KRTA 3Q0EA 3ZWWA 1OZAA 4D42A 4OIMA 3ZN2A 1Z7EA 3GDGA 2DFVA 4YPOA 1E1MA 3GEMA 3NDJA 4IGFA 2X5KO 3KB6A 2E48A 2RH8A 3WG9A 1JWBB 1U1IA 3ZGYA 4CMAA 3D1LA 4UREA 5F3RA 2PK3A 4FOSA 3FCOA 1HDCA 5HS6A 1P31A 3KZVA 1KOLA 2WE8A 2IXBA 3R3SA 2IEBA 1PJBA 5JO9A 1BGVA 1B14A 3D5TA 2FR8A 2EP5A 3PHJA 4BO0A 4EJMA 2I99A 1GFSA 4BB6A 3N7UA 4TVOA 1MXFA 5IXYA 3MWDB 3EW7A 1NVTA 2Q3EA 4WLOA 2Q50A 3PP8A 1LU9A 2VHWA 5JMPA 1ISJA 2IZ1A 3IJRA 1ENZA 2QX7A 4DMMA 1AXGA 1N9GB 3F3SA 1E3JA 4S1VA 4WNCA 4RF3A 3VPSA 3JQ8B 3SEFA 4A73A 2QG4A 3WYEA 1V3VA 1E6UA 4IQGA 4IQ8A 1K0UA 1I2ZA 2EKLA 1NVMB 1LNQA 3I9MA 4NFHA 4WOKA 2ZYGA 1I0ZA 2VQ3A 4PLVA 4BKUA 1P77A 4YJFA 3TJRA 1KY5A 1UUFA 4Z0HO 2E4AA 2B37A 3VKVA 3OQ1A 4DRYA 1IL0A 1UR5A 2OHXA 1AE1A 2G82A 2Y93A 3RASA 1LRKA 4U0KA 2C2YA 2CVOA 1ZXLA 1T24A 5GZ6A 4PFJA 5KVCA 3ZWAA 5BSHA 2CUKA 3BTUA 3F1LA 5JY6A 3H7AA 2VUSA 1LLDA 4L73A 2DQ4A 3LLSA 2QRKA 3JQFC 8LDHA 3HFSA 3KSUA 4RVSA 3CSDA 3PJGA 4J4BA 4FFMA 4TRJA 1RJWA 3GN1A 2FPPA 5KIAA 1MV8A 2OMEA 2WD7B 3PHGA 1KS9A 3QHAA 1A72A 3FBTA 3Q2IA 1PQWA 4E30A 4ND3A 3DMYA 3UN1A 2AEJA 2X58A 3VOSA 1DXYA 1VL8A 5CFZA 3V5NA 1YQXA 1NHGA 5DCWA 4CLOA 1HLDA 3FRJA 3PJDA 4KQXA 2VHVA 4YAGA 5H81A 3FR7A 3ANNA 5A1TA 4B4UA 3HG7A 3UGKA 5DOVA 2PV7A 1E3SA 1R16A 2O3JA 1C0KA 3JQ7B 2ZCVA 1E3LA 3GRKA 3L6OO 5KVVA 5B4UA 4OJNA 4R1NA 3VTFA 2NM0A 2W90A 3FPCA 1JN0A 5L95A 2BH9A 3WJ7A 3WICA 3ABIA 2C2XA 3DBHA 2BGKA 3PIIA 3ZU2A 4NHEA 4BL5A 1MA0A 3RJ5A 1ZK1A 3RU7A 3S1LA 4BO3A 3TFOA 4R01A 1BXGA 4IDFA 3AOEC 4H15A 3DOCA 1NR7A 1EUZA 4B8WA 1HE2A 3KLMX 3DHNA 1O94A 4EJ0A 2X0NA 3WYCA 5K0ZA 2X22A 3EHEA 4YJGA 5T6BA 2AHRA 2HK9A 2GZ1A 3V1UA 1K6XA 1UH5A 2NU8A 1H9AA 4ID9A 4OQYA 1R4MB 1HDGO 2AE2A 5IDYA 1M2WA 4NBVA 3UCEA 1LDYA 4BVAA 4DMLA 1NWHA 1OC2A 2X86A 2EW8A 5ADHA 4XCVA 1OI7A 1F06A 5A9RA 1PGQA 1ZEJA 1LDEA 4HBGA 1CEQA 3BTOA 4DL9A 3ZNPA 3A14A 4U6QA 3BMCA 1XLTA 2Q49A 3KYDB 1X14A 3TSCA 3LLVA 1H94A 4HNHA 3ENKA 2JKVA 1ADFA 3JTMA 3W8DA 3UHAA 3DAGA 1SZJG 4N5MA 2YHIA 4I9NA 3HNPA 3RUCA 3TQHA 3WSVA 2CY0A 4R54A 4ZRMA 2GD1O 2O4UX 4BGVA 1XIVA 3VH2A 4NPCA 3FNGA 1T2AA 5EINA 4D0SA 2W4QA 4BNTA 1HWYA 1M76A 2GYYA 3A28A 4OSPA 5G4KA 1LI4A 3I9OA 1D7OA 4MVJM 2J5RA 3PJFA 2C59A 2O3RA 4CL8A 2HO5A 3E82A 1GR0A 3BIOA 3S2EA 1A4IA 4J7XA 1ARZA 2I3AA 3ONDA 1TT7A 5KCZA 4IDBA 4RPGA 4YR9A 2X9GA 3CKYA 3TDKA 3IC5A 2EP7A 4CQLA 4E5KA 1EVJA 2YDYA 3BA1A 2CF5A 2G0TA 3BZUA 3V2GA 5ITWA 3VPFA 4D0RA 3B20A 1A4UA 4MVJH 3FWNA 1C1DA 4XQEA 2C20A 4B8ZA 4GI2A 4X54A 3VZRA 3F4BA 2O3TA 4KTTE 1ZK4A 1PTJA 3QLJA 2GDZA 2O3QA 4RL6A 2B36A 1PSDA 5JPIA 1AN9A 3GG2A 2IZ0A 3H9JA 3RC2A 1NHWA 2JJYA 1R4NA 2JFFA 4MVJF 5IDQA 3Q3CA 3FD8A 5EPOA 3JD4A 3AI2A 3ZV3A 3B1JA 1E7RA 1P1IA 2JFHA 3CINA 3AM4A 4M1QA 2Q2WA 4YAJA 3NRCA 4UUPA 4ALJA 1I32A 4DPMA 3V8BA 3QVWA 1Y8RB 1X7GA 5I9MA 4UVGA 4WNIA 4ZU3A 4NZ9A 3GFBA 4FPXA 2Z95A 2YW9A 1PWZA 3DBRA 4IS2A 3EMKA 3RC7A 4JBGA 1A5ZA 1A9YA 1C3VA 1QV7A 4YAKA 2UVDA 3KO8A 3Q9NA 4KDEA 3GZNA 3FI9A 4I8XA 1FDUA 4BMSA 4CV3A 1LJ8A 3DEYX 4CQMA 2BELA 3FTPA 4JJGA 3RC1A 1TXGA 2OL4A 2X4GA 3DZBA 3GVHA 4XGKA 4EITA 4TQGA 4WLEA 1HETA 2IYOA 3OQ6A 1EK6A 1JQBA 2I67A 2FRDA 4NIMA 1BVRA 1JW9B 3JQAB 3GUYA 2TMDA 2EGGA 3IIEA 3JQGB 4BO1A 4XGIA 3T4EA 4R9SA 2R00A 5CDUA 1E92A 5EIOA 3AUSA 2IODA 4OQZA 3ZHZA 3F6YA 4D45A 4YA6A 5DBIA 4BUCA 3HWRA 5DF1A 2X9NA 2A4KA 4CMCA 2FPIA 1VI2A 3IAHA 4NBUA 5FYDA 4BNFA 1H2HA 3WFIA 5I9LA 4M87A 4NNJA 3QQPA 1GADO 3F1KA 2I5PO 3U62A 3L9XA 1BW9A 4NJOA 3GUCA 3JQCA 1E1NA 4YTEA 1K6JA 1K2WA 4PG5A 4RPLA 1U8XX 4JP2A 3DR3A 3E8XA 3NX4A 2NQTA 2HJRA 3C1AA 3CZRA 3EZYA 3QSGA 3AI1A 1I8TA 4YRDA 3V2UA 4CUJA 4XB2A 3KLPX 4GKBA 3C85A 1YXMA 4KQWA 1B8PA 2CVQA 4AJKA 1LSOA 3PFFA 4J90A 2Q1UA 4XDZA 3W6UA 4N5NA 4GVLA 4RDIA 4PLYA 3DMTC 4BKOA 4M54A 3OBBA 1MUUA 1QYDA 1Y6JA 3DZKA 3MJ4A 4FW8A 2QRJA 2C7GA 2G1UA 4ROSA 4CJXA 1P1FA 2CD9A 2FSVA 4LISA 2NSDA 2I3GA 5L7TA 1JAXA 1YVEI 3DONA 1CRWG 3WJAA 1LC3A 5FEUA 4HP8A 2ZIZA 4DYVA 2Q2VA 3G17A 4CM4B 4B4VA 4J9VA 1E6EA 5IF3A 4DXHA 2Y67A 3JYNA 3PZRA 5IN5A 3AUTA 3CZMA 3A1NA 3WQQA 5TX7A 3PQDA 3ST7A 1U7TA 1UXKA 5JC1A 3OM9A 1UDAA 4U6SA 1OFGA 1AXEA 1R6DA 1YO6A 1IUKA 2V7PA 4NBWA 1DC6A 3KBOA 3HB5X 3WLEA 1JKIA 1N5DA 2DT5A 1E0DA 3MJEA 1FJHA 3OP4A 4YB8A 3VPHA 3OIDA 4JQCA 4JJFA 1BTOA 4ZQBA 3EZLA 3EVNA 4BKRA 3H4VA 5CAEA 4FR5A 4IXWA 1WLYA 1HZZA 2ZYDA 1IHXA 5JW6A 5THQA 4XYLA 3F4LA 4HFNA 1LDGA 3TWOA 1E77A 2Q46A 3GVCA 2O2SA 3K2EA 3PQEA 3WQRA 4FDAA 2HMWA 1GQYA 1PJSA 3LC2O 4MVJI 3LQFA 4BQRA 1VKNA 4Q3DA 3H2SA 5AXBA 3X2FA 5A4DA 3U5TA 1GDHA 3I9NA 4NDNE 3MJSA 4OXNA 3SXPA 4D7AA 3ANMA 1T2DA 2IRWA 4FJ2A 1DFHA 4DUPA 5ILGA 1R37A 3PEFA 2JD0A 3TZHA 1EDOA 4L4SA 3S55A 5TLSA 4J4HA 4WLUA 3TZQA 3QW2A 2GN6A 2GGSA 2B69A 5BNFA 1I10A 1P0CA 1ZXBA 2Q1SA 4MIYA 3ZW9A 2VUTA 4UVIA 4FD3A 5KKCA 3TPCA 1W0CA 4J0EA 4IDAA 3WFJA 1K89A 4GX0A 1O95A 4P4GA 2WD8A 2B5VA 1FK8A 1YKFA 3AU9A 3DBLB 4WPGA 4Y8VA 2AQKA 3RVDA 1A9ZA 3GHYA 2RBEA 3E5MA 3VH3A 1BDBA 4ZQFA 1B16A 2P5UA 5IZCA 3BHMA 1HRDA 4CM8B 2AE1A 3QWAA 3E9QA 4ND1A 2H63A 3S8MA 5KTKA 2J3HA 5BSFA 4WUVA 4EGFA 1TT5B 3IDSA 4FC6A 4B7XA 1BXZA 1V9LA 3DHYA 3K30A 2PZKA 3DTTA 3VH4A 1SOWA 4DYDA 1P74A 4J4TA 2AEFA 4CLDA 2ET6A 3UICA 1RM4A 4ALIA 4WLFA 2TMGA 4RF2A 2NTJA 3PI7A 4NK4A 3UAGA 3NDRA 2UV8A 4HX5A 3K73O 3M6IA 5FFFA 1YOVB 3E5RA 4B3JA 4CMIB 1GQQA 4FFRA 3K96A 4QECA 1MB4A 2CF6A 4XYMA 3ETEA 1DIRA 1SPXA 1T4DA 4I08A 3WWYA 1YS4A 4RZIA 5CDYA 4U8GA 3PVZA 1KIFA 4G81A 2EHDA 4H16A 3WBFA 1GEGA 1CDOA 2HU2A 4QFDA 5JAIA 3U09A 2PFGA 3NTOA 4Q3NA 4DPLA 4JBHA 2D2IA 1L7DA 3PYLA 1ZUD1 3LT1A 2GCGA 3DL2A 2WDZA 4KZPA 4A5OA 1EE2A 1P1HA 1Y5MA 1DRVA 3VKUA 2YJZA 3FPLA 3TN7A 5BQFA 5JYDA 5ITVA 3BTVA 1CYDA 5L45A 1UDCA 3BMNA 4O0LA 2OZPA 4CUZA 4IDGA 4TKLA 2VYVA 4TMFA 4O1MA 1D1SA 1H6CA 2H6EA 1KY4A 3HDQA 1A27A 3ICPA 4FS3A 1LRJA 2AMFA 4PLPA 4EJ6A 4PLTA 3ZWMA 4KMSA 4CR8A 1N8KA 3VPGA 1ISMA 1L7EA 1PGNA 3MWEB 4IDDA 3ZNNA 2DVMA 4LMPA 4TROA 3TRIA 4RJTA 2QW8A 4XIJA 5KJ1A 4XD2A 1F12A 1O8CA 4E33A 3U0BA 1K5HA 2VCYA 3JQ6A 1UXGA 4G65A 3SC4A 4W9NA 4HNGA 4HFMA 1GZ6A 3JYLA 2HJSA 5A04A 1QG6A 4PLGA 1BXKA 1DFGA 2E6UX 4WE3A 1KEWA 4Y6PA 3TL2A 3D3WA 3PFWO 3WGOA 4CM5A 4DWVA 1MX3A 2OGUA 3NTRA 1FXSA 2Q2QA 4Q39A 4ONEA 1N9GA 5JDIA 4K28A 3DFZA 1O5IA 3B1KA 4NG5A 2HMUA 1E7WA 4NI5A 1YQDA 2AEMA 4GQAA 4W7IA 1RM0A 2J8ZA 4D3DA 1XGKA 3KYCB 4MDHA 1VM6A 1U2GA 3OJLA 4NH4A 3SJ7A 2EEZA 2LDXA 4B7UA 2DUUA 3OECA 3IP1A 4FC7A 3HSKA 1HDRA 4PG7A 1QMGA 4YAEA 2CDCA 1KYQA 2GERA 3MCVA 3VDRA 4L9RA 2Q4BA 4BGIA 3D5QA 4N7RA 3KSZO 1IE3A 1MP0A 4DPKA 1SEPA 1EVZA 3GH3A 1DIAA 5T8KC 4NJMB 4P22A 3I52A 3T7EA 1DAOA 1Z74A 3IS3A 4PG4A 4ZRNA 3UUWA 2VZ0A 4MVJD 3CIFA 1Z82A 3CMCO 1CETA 2XXBA 4HXYA 1TEHA 1DC3A 1E7YA 5L4LA 3WR5A 2D0IA 2NTVA 3D64A 5TQVA 1IPEA 1R66A 1Q7GA 4QX6A 4R3NA 4IXTA 2GF2A 1IB6A 4W82A 3UW3A 4GWGA 5JY1A 4J49A 3GGGA 4XR9A 5GZ3A 4PN3A 3ZH2A 1DLIA 4CLRA 4I9UA 4BKQA 5A9SB 1EK5A 1HF3A 2CZCA 3H65A 4YT2A 1GUYA 4TRNA 1EUDA 2GUGA 3D0OA 4YRAA 4PRLA 4E31A 2JCXA 2PZLA 2X23A 2ZTUA 5LDGA 3UF0A 2EW2A 2YV2A 2Y1EA 3UFXA 2G76A 1NPTO 1NVGA 3PLRA 4GX1A 3JQ7A 4GKVA 2HDHA 4I5DA 1DC5A 2SCUA 2UAGA 5B1YA 4BNGA 3GNTA 5EN4A 4XIYA 4E4YA 5EQFA 2OP0A 1WAMA 5FI5A 4GGPA 4UVHA 4B4WA 1DAPA 1ONOA 1XELA 5EERA 1EFLA 4XX0A 5HTOA 1KVSA 2BFMA 2VRCA 3ZWNA 3BMQA 4IZIA 2P9CA 3EUWA 3CEAA 1JVSA 4GX2A 3EAGA 4J6FA 4RCVA 1NFRA 1R15A 4BMNA 2J5QA 4WCFB 3E18A 4BV9A 5B12A 4JK3A 2FOIA 3PTZA 1MGOA 1S6YA 4R1UA 5KKAA 4R5HA 3K8ZA 1C1XB 4GMGA 1G0OA 4AJEA 4Q9NA 1HDYA 3TZ6A 4I1IA 1PZHA 1OMOA 2BMAA 1ONPA 1I3LA 4JN6B 2V65A 3NTQA 4RVHA 4P38A 5EJ2A 1A71A 3F47A 4B79A 5JXWA 3H3JA 4XYBA 3OF2A 2PD4A 1PL7A 1N7HA 3CE6A 1F8GA 1JTVA 3IOYA 1NPDA 2FP4A 4XKJA 1PU2A 1GAEO 1EVYA 4CPDA 2VYVD 1ML3A 4K6FA 3VVBA 4IDCA 4E5PA 1HZJA 1PZEA 4Q3BA 3V1YA 5L7WA 1YE3A 3BTSA 1DDOA 5LC1A 3E9NA 2J3JA 3VAZA 3M1AA 4CMEC 4TZTA 4F45A 5IZ4A 1TI7A 4IGEA 2WTBA 4YT4A 4WCDA 1LEHA 2H5LA 4MJLA 5I7VA 1ZSNA 3RD5A 2VZ9A 4HY3A 4WOJA 1J5PA 1B3RA 4Y98A 4DLBA 2EXXA 3JCZA 3WGQA 3I6IA 4UUMA 4FGSA 4A0SA 2EGHA 4RVGA 1WZIA 4Z0PA 3RBZA 2BGMA 1B8UA 3C3XA 5K6AA 2DFDA 1X7DA 1XSEA 1Y7TA 4UVEA 4XQCA 4QFCA 1KVRA 2P4HX 1P1RA 3H2ZA 4XB1A 2BHLA 3HJAA 1VC2A 5K9ZA 1MLDA 2J3KA 2VHZA 5AXDA 5I9NA 1PIWA 3K31A 3PZBA 2VTDA 3NT5A 2GNAA 1MG5A 4GMFA 1H6BA 4TVBA 3OEWA 4BNLA 1Z7BA 1G6KA 4UEOA 3R6DA 4CR6A 2AXQA 1EQUA 2FR1A 2PD3A 4LW8A 2JD2A 4QEDA 4Z0TA 4YDRA 3RQSA 1Y81A 2D5CA 2EKPA 2GZ2A 1ENYA 1XKQA 2BFPA 1NYTA 4NFSA 3ON5A 3QVSA 3CTMA 4TSKA 2WYVA 1HLPA 1HTBA 3GDFA 3RAJA 1Y8RA 4OO3A 1YRLA 3JQ9A 4ZD6A 5C37A 3I3OA 3ZWPA 1HYHA 3AWDA 3T7CA 3ZV5A 2HKIA 3DFUA 1OC4A 2GZ3A 2CFCA 5TT0A 3JQEA 3PWSA 5G0SA 2VOJA 4AJ2A 5BNTA 4RF5A 4DA9A 3PLNA 4BO5A 4CMGA 1QRRA 1XA0A 4ZVVA 1G0NA 3AFMA 3PYXA 4I5GA 4CMJA 1D8AA 1HDOA 3L9WA 3NT4A 2X9VA 3W4KA 2PD6A 5G2OA 3GDOA 1NP3A 3FSRA 5MDHA 1PGJA 3RJ9A 4E32A 1PJTA 2X0RA 2RH4A 1EE9A 2W2KA 4LCJA 3PWKA 5JDCA 3ITDA 2B83A 5THKA 4BNVA 4CMBA 3QRWA 4DQXA 2DLDA 2DPGA 3GN2A 4M8SA 2Y1GA 3FNFA 5DCUA 4MP8A 3NT2A 4YJFB 3LYLA 1M6HA 1XQ1A 3G1TA 3IUPA 2VN8A 3W4JA 1O89A 3RKUA 4IIUA 3W1VA 3P19A 3R0IA 1U3UA 1T1SA 3JQDA 4S3MA 4CM1A 1PS9A 6LDHA 5CPFA 5JE8A 3GVIA 4EEXA 4CLHA 2C29D 3HN7A 3NKLA 1J6UA 4MKXA 1GCUA 2WWRA 1EVIA 2NVUA 4RPHA 1D4FA 2OBNA 5BR7A 3GK3A 5CDGA 2X1HA 4JX8A 2O2YA 4I9HA 4YYZA 3DOOA 5KJFA 4BO9A 3PHLA 1ZVMA 1FDTA 5ENVA 2W8ZA 5JAMA 2Q1WA 1ZIDA 4BNYA 4XZ3A 4CV0A 4CM9A 5IXSA 2V6FA 1E7QA 2DBQA 4AJOA 4D79A 5GMOA 5G0UA 2VHYA 1CERA 3KSDO 3PYMA 1RYDA 2P5YA 1I33A 1YBMA 4CLOB 3QE3A 5AVOA 3HB4X 3ZV6A 3C7DB 3ZV4A 1BDMA 2NTNA 3MZ0A 5TIIA 3HDJA 1LA2A 1ZO8A 3RUIA 3WIDA 1BMDA 2W2LA 4GPD1 3RUDA 1V3TA 1UP6A 1CF2O 2YFHA 5ENDA 1K6IA 4CM3A 3TNLA 1EBFA 5AQ1A 2PR2A 1PZGA 3DTYA 2WYUA 3AM5A 5TJ9A 3WTBA 4YQZA 2YUTA 2ZB3A 1E3IA 2ILTA 1BRMA 1DRWA 4J16A 3H5NA 3AK4A 4J1TA 1RYEA 1UJMA 1BXGB 3DHEA 3ONFA 2RHRA 1BG6A 3PQFA 3UXYA 4PLCA 1E3WA 1GCOA 1AHHA 3UVEA 4YJGB 5I7EA 3O8QA 1ZJZA 3SLGA 4XWYA 2ZTLA 4BGUA 3PIDA 5L40A 2JHGA 2EJVA 1PX0A 1YL7A 2A94A 4A2CA 1NNUA 4BHTA 3ZDFA 1ZH8A 2GN9A 3DAPA 4PCVA 4Z3KA 3L4BC 1EBUA 1X13A 1RM3A 2HCTA 3GNQA 4YAIA 1XDWA 3DBVO 3C8MA 3E6AA 3ORFA 1DFIA 3IJPA 4HFRA 2O4CA 3GLQA 4PVDA 3H5AA 1KERA 4BB5A 3GVPA 4QQRA 2DBVO 3P2OA 4KOAA 2EG9A 4WLNA 4L8VA 4J3FA 3IL2A 2XOXA 1T1RA 5C7OO 1B3BA 1LLCA 1ONNA 4I5EA 4OH1A 2AG8A 3G0OA 1WMAA 4K1LA 5KWEA 5KVSA 4EDFA 5DNAA 3FTNA 2ZJ0A 3QV1A 4EUFA 1N1GA 4QSMA 3F46A 5CHEA 5DCYA 4UULA 4MKRA 3M2PA 3I6QA 3WOHA 1LDMA 4J43A 2YHIB 1EQ2A 2JD1A 2Q45A 3JQFA 1SAYA 2OP1A 4PGFA 2A9FA 1QR6A 3UOGA 1E1KA 4MO2A 2I9PA 1RPNA 4XYEA 1N7GA 4HKTA 3JD1A 5G4KB 3AUAA 2O7SA 2NQ8A 4CLEA 5CDTA 4E5YA 5G0VA 2O48X 1DJQA 4TRRA 2VNSA 3KUXA 3RU9A 2PA3A 4LVCA 3OQBA 1I3NA 3JQBC 2OO5A 2ZTVA 2XXJA 4UUNA 4MOWA 1U9JA 4CQLB 4U5QA 3EK2A 4IIVA 1HSZA 3IQDB 3E1KA 1X1TA 4C4OA 4BO4A 3EY4A 4WCFC 3I83A 1U28A 4DIBA 1ZSVA 4E2ZA 2X5OA 4CV2A 3OMLA 4E13A 3GC6A 4CMKA 4NK5A 4NU5A 5ES3A 1R4NB 3AOEA 5EL0A 4LK3A 4RQTA 4DQUA 1OBFO 1E1LA 1XQ6A 3WXBA 1O9BA 4M86A 2Z1NA 2BFAA 4AG3A 2NU6A 3I9KA 4YCAA 4G5HA 3ZZNA 1Z45A 2BGLA 3JD3A 1ZZEA 3KOUA 4PZCA 3O03A 2R2GA 3DBRB 5L4NA 4J1SA 3MOGA 3TL3A 1W4ZA 4E21A 4MVJP 1KC1A 3D4NA 1LDBA 3PDJA 4MPDA 1PR9A 4PLHA 3WWZA 3N74A 3Q6IA 3LC1O 2GASA 2OOSA 4XRRA 4RV9A 4FIZA 5H82A 4CQMB 2BFOA 2RCYA 1L1FA 4C7KA 1DIBA 2VUUA 3MEQA 2YZ7A 1NQTA 2AQ8A 4E6PA 1T2FA 5JMWA 3ASUA 3Q1LA 2VYNA 2HLPA 4YWJA 5JC8A 5L7YA 4F6CA 3AUUA 3QWBA 3GPIA 4N5LA 1TVEA 3WDSA 1C0IA 4CUKA 1T25A 5L3ZA 2PKRA 5ER6A 4PLFA 1UAGA 3VHRA 3GVXA 5A02A 2DM6A 4L76A 1A7AA 3EVTA 4KUHA 2ZTMA 3IP3A 4CM7A 1EZ4A 2CSUA 4IJUA 4IMPA 4M89A 5TNXA 3SLKA 4E5MA 3L0DA 1ZEMA 3LT4A 4J2HA 3U4IA 1EDZA 3DB2A 2YHUA 1DOHA 4AFNA 4AVYA 1BW9B 4O5OA 5L51A 1GV1A 4BNKA 1GZ3A 1K3TA 3S2GA 1HL3A 5EQDA 2J5KA 4QT0A 4YJHA 4CQMD 4ALLA 4BNXA 1V6AA 2OXIA 1W73A 4ZGWA 4P4NA 4C7JA 3F9IA 9LDBA 1VKOA 1NFFA 4J7UA 1U3WA 4JNKA 4EW6A 2OFPA 1KC3A 4UVDA 3OA2A 1DBVO 3RCBA 1M6WA 2YYYA 3Q11A 4YBZA 4JLWA 1PL6A 4OAQA 2Y1OA 3WGIA 4ALMA 3GMDA 5L4SA 5F5LA 2EWMA 1BSVA 1KBZA 1Q1NA 3HADA 1E6WA 4BS9A 2GPTA 3I5MA 1F17A 1XEAA 1Z6ZA 1V0JA 1LSUA 2FWMX 1RM5A 1M67A 2ZB4A 2H1SA 2CVZA 5TSDA 1HT0A 2AQIA 2D4AA 1SC6A 2Y1FA 4JROA 5T5QA 2RIRA 2HMSA 2OORA 2DBRA 3R1IA 4ESOA 5I8ZA 1ORRA 3F5SA 1YBVA 2P2SA 5KOIA 4WJZA 4LRSB 5U1PA 2QZ9A 1EUCA 4U0JA 5IFLA 4Q3AA 3HZZA 2Y0EA 3PPIA 3MOIA 1B0AA 2YFQA 1G1AA 2PTGA 4BO6A 2DPHA 3RFXA 1LTHR 4BNZA 1PQUA 2IE0A 3E03A 4Q3EA 4R16A 2D59A 4TZKA 1B8VA 2FHSA 4ILKA 5C7IO 3V1TC 4OOFA 4OXYA 4OYRA 3BAZA 4IINA 3PHIA 4QUKA 3IKTA 4YQYA 3A9WA 3H3FA 1WP4A 1V35A 3PRJA 4YJDA 2CDAA 2EF1A 1F8FA 3WTCA 1W8DA 3L07A 4WK6A 3ZWBA 1PGOA 3DC2A 4NU6A 3E9MA 2Y1CA 4DVJA 2DTXA 5JCXA 1QV6A 2WM3A 4WEOA 3BMOB 3D4PA 3MJCA 3NJ8A 4PRKA 5C3MA 2VWGA 1GV0A 4JCOA 2YQ5A 4BGEA 3DZHA 1UAYA 4XEHA 1Y8QB 1I36A 2E49A 3HE3A 2W98A 4KTVE 4RPJA 2NLOA 1KEVA 3OHSX 1TA4A 4PLZA 1VSUA 4A27A 4IY1A 2VTEA 2WSBA 5ICSA 1Y5RA 4CV1A 1DLJA 4J2OA 1DB3A 3H9GA 4HADA 5IDWA 2ZCUA 4GL4A 5BSGA 5JSFA 3NJ4A 5C5IA 2BLLA 4YVFA 3B1FA 5AXAA 4BO2A 3NAQA 4AJLA 3GAFA 1A7KA 2Z5LA 4IDEA 5HS4A 1ADGA 4DTIA 2PH3A 3ZNOA 3PHHA 2E37A 1CQJA 1ULUA 2BI8A 2YV1A 3G3EA 3INGA 4OOEA 1ID1A 3DQPA 2C82A 1U3TA 1B15A 6ADHA 2D8AA 1ENOA 3C1OA 1HYGA 1YH3A 4MKZA 3DMTA 2I65A 5AOVA 4PZDA 4CODB 4RVDA 1NFQA 1NQ5A 2HK8A 5IJZA 3RUFA 1ENPA 3IKVA 3K5PA 3TOZA 5C7LO 2VRBA 3OJOA 2VYND 1NPYA 3C7AA 3JQ8A 1GD1O 4BNJA 2PGDA 5L9AA 4XJSA 5COAA 1LBEA 4R9RA 3A06A 4O59O 2X0IA 2JCYA 1GYPA 2RAFA 5CP8A 1ADCA 4BNHA 1P0FA 1PR3A 2DU8A 2UYYA 1U7HA 4BO8A 1R0SA 2NADA 3HQ4O 1PJCA 2B0JA 1Q2XA 2A92A 4RZHA 1KVTA 3VZPA 4AJHA 3GEDA 1ZJYA 1YL6A 4R5MA 2HRBA 5JS6A 1VPDA 4W6ZA 3HUDA 1KEPA 4LCEA 4MVJG 2IDZA 5JDCC 2VZ8A 5EESA 1SBYA 4UEKA 4RLHA 1U4OA 3MTJA 4QXMA 5A9TA 2AA3A 1WWKA 1P45A 4DGSA 1Z75A 4BNMA 1FDWA 4LGVA 4Z3DA 1LUAA 3HDYA 4AJ1A 1ZW1A 2X8LA 5AXCA 2EJWA 2AQHA 2IZZA 2WD7A 1C0LA 4O6VA 5I7FA 4HWKA 5KJEA 2JAHA 3OIGA 3B70A 1JLLA 1LLUA 2ZB7A 3OSUA 2P9EA 1Q7CA 2Z1MA 3M1LA 4YEDA 4E5NA 2UUPA 1DHTA 3P5SA 4YACA 5CEJA 4FFPA 3R3JA 4QTZA 4A7PA 2NACA 2X7HA 3B6ZA 3V2HA 2NVBA 1FDSA 1IY8A 1AGNA 5GZ1A 1QP8A 1I30A 2GO1A 1NBOA 2HSDA 3CUKA 1I24A 2PY6A 4O63O 1OOEA 1NTOA 2NNLD 3BMNB 2P68A 2GRAA 1E5QA 3SVTA 5DP2A 2WE7A 4DLLA 4ZQGA 1SB8A 4BNWA 3QWIA 2J6IA 3NGLA 5F1KA 3ZWOA 2G5CA 2PLAA 3AY6A 5CG1A 2HMTA 1H5QA 4E3ZA 4Z9FA 3STHA 4YT8A 1AUPA 1SB9A 2BD0A 3N58A 4FFNA 5GY7A 3FBGA 3ZU3A 1R4MA 5MGBA 1QYVA 5KVQA 1WXDA 1IHYA 3OICA 1VL6A 1U5CA 3KHUA 2V6MA 1EMDA 2HAEA 4UAGA 1YWGO 3H6KA 4IJVA 4Z6KA 3D3WB 4BNNA 3QVOA 1X15A 1UXJA 4EYEA 3OJEA 1TLTA 2BF7A 1EFKA 2BI7A 3U4DA 1FF9A 4BO7A 1NWCA 3KYDA 1SOVA 1LDNA 2GR9A 2NV6A 3I4FA 4IJKA 1Y9AA 5DULA 4PIVA 4WASA 3AOGA 2P4QA 2O3SA 2V6BA 4A10A 1P1JA 4HUJA 1LC0A 3JYOA 2R00C 4G2NA 1H6DA 1MFPA 3LT2A 4JIGA 4XDYA 1UP7A 3PDUA 1NM5A 4XRGA 3C24A 3HDHA 3O26A 7ADHA 1GTMA 5DOZA 3T4XA 5JCJA 4BNIA 4RORA 4KWIA 4DLAA 1J0XO 3PGXA 2NU9A 4LSWA 1ISIA 4RF4A 1U2DA 3TZCA 1HYEA 1WDLA 2AW5A 1Q7BA 1Q0LA 3ADOA 3AY7A 3DZIA 1ZKMA 4ZQEA 3PGJA 3G49A 3WX0A 3GR6A 3WNVA 2EKQA 3FHLA 4DBZA 3HN2A 5F21A 2FZWA 3FN4A 4RPKA 1WDMA 3ONEA 2UDPA 3Q9UA 3ZU4A 1PJQA 2EIHA 1ISHA 4N54A 1KEUA 4ZN6A 3ROKA 2F1KA 4XA8A 4GH5A 3A4VA 1F0YA 3F5QA 4CLRB 4XYGA 4A26A 3PJEA 4CLXA 1NQOA 1ZNQO 1NX6A 2X5JO 3EYWA 4IQ0A 4MVJE 4FB5A 4L4XA 3LVFO 3AJRA 5U4QA 2G17A 4L0QA 3WYBA 3GNSA 2D1YA 1DIHA 3AY3A 1ZBQA 3GGPA 5ICMA 2C5AA 5HM8A 1YJ8A 3EC7A 1LSSA 3X2EA 4II3A
chains in the Genus database with same CATH superfamily
3V8NA 2REBA 3KNZA 2PX3A 1P4AA 5E1OA 2FSVC 3VU1A 3EX7C 1E2KA 1RSZA 1T3LA 2OV6A 4FT2A 2X0FA 3TTXA 1OB5A 4M7WA 4TS1A 5GP1A 2QQ5A 4RIIA 3ORQA 3G0HA 2QDKA 3F4KA 5I7SA 2FEPA 3RUAA 4MV4A 4CZ2A 1R74A 2IHUA 2QHXA 4AZ0A 1QYCA 1N5IA 4MIEA 2J3MA 3IBGA 3JYPA 4OREX 4R9NA 2H7VA 3LPAA 1H2YA 2YV4A 2VDKB 1U99A 3ZZUA 3EGIA 2CNBA 3LHDA 1DE0A 4PQEA 5JI3E 1UAAA 3IESA 4RVFA 5EIAA 2AZXA 2WIGA 1A8IA 3FGPA 3FOZA 2ZZMA 3C5CA 4MK4A 3MK31 2P91A 2RKOA 3OPYB 3RVJA 1SXJE 2WTAA 4MI3A 5JSZB 3WGVA 4QPCA 3QJGA 2JHCA 1DT3A 2WYWA 1PW7A 1N2OA 2AVDA 4GT1A 4R84A 5AYVA 4JOSA 1UJCA 1R5NA 3W3AD 4ND5A 4RIEA 3JQGA 1ZHOA 1V7ZA 4I99A 1RJEA 1ZQ1A 3K94A 2IH4A 3JASA 1HE5A 4OKIA 1HXHA 3HI4A 4ABYA 1RABA 5J2UB 4QYIA 5EYPB 1BEEA 1VL0A 5IN4A 2OQRA 2WW8A 1KZ6A 4PV7A 1B00A 4UD2A 2IVZA 3C4QA 1JYFA 1HZZC 4JD5A 5A03A 3ZD9A 2FP4B 4FGJA 4DZZA 3FBWA 5F7ZA 5B2EA 3KAPA 4ENRA 1LW7A 4QL3A 2P8JA 1ZAYA 1X39A 2FPGA 4CW7A 5BSTA 2HZBA 1ATIA 1Q0TA 3M6VA 4C87A 3W6ZA 3L82B 1KA9H 3EFOB 3F7OA 3RGGA 2PH1A 1QHNA 4KUGA 4LDJA 3AF2A 3I5UA 1SCUA 3P94A 3A1EA 2OGZA 3QYFA 4WK0B 2HWWA 4K46A 1LJUA 2V7VA 4XARA 4CG3A 4URVR 4DJEC 2J85A 5K8CA 5AW0A 1XZDA 2HTEA 1SBHA 2Z9BA 3ER6A 4MQUA 4OQQA 4LTDA 5NLLA 4DUGD 3EGDA 3IFSA 1G291 2L69A 5A05A 1N5LA 4OB7A 3RBXA 3Q2KA 1MAVA 3H2BA 3KB8A 3W5UA 1P33A 2ZJBA 3ZZ1A 1E9VA 4PTLA 3D0KA 1DO2A 5T57A 1WF6A 4DA8A 5TRTA 5HWSA 1W1UA 3C8ZA 4RJIA 2C0CA 4Z0NA 1TAHA 3P96A 4HGPA 1QPBA 5AHKA 3T7JA 1IQPA 4PX3A 2G7ZA 1X8LA 3RSHA 4X20B 4S1TA 1RRFA 2ID8A 3IA2A 4WKOA 3O38A 3EOZA 2MSNA 3DXFA 1WCV1 5HXAA 2BC9A 4JXKA 1J4AA 4JLJA 3Q7IA 2R96A 2VXBA 1YVPA 2PXCA 4CM4A 1ZONA 4XSGA 4JZYA 4LYYA 1ZJ6A 2P77A 3H8SA 5AJYA 3KYBA 3EG9B 2I1WA 2W2MA 4BU1A 1Y4AE 4AICA 1JXMA 4TV8A 4EO7A 3R9XA 4QQNA 4EEZA 3UW1A 4ZODA 4RD4A 1YB1A 2ERYA 4TLDA 4GXNA 3AG6A 1AF7A 3R5XA 2O19A 5KYXA 1NX9A 3KVOA 1HDZA 3NYWA 5CDSA 3TFOA 1IBLB 4HWSA 1L5WA 4NZNA 1WKVA 1GL3A 1YONA 1GPLA 1QM5A 2HNBA 2ZXUA 3WOVA 5JTTA 1XNJA 3TR6A 3KJFA 4WN9B 1OYVA 1S2IA 4ZKEA 4TT3A 3VAAA 2QJOA 5BSEA 3SF0A 3EXHC 4GF5A 3OU7A 1RWNA 3HP1A 3MJTA 3OEHD 1NYRA 3DO8A 1Z17A 3B5IA 1Z6TA 3IE2A 4OATA 4IHQA 2AN5A 4QFMA 5A7HA 4DR2B 3QE9Y 2B4RO 5DN6D 5B4TA 3A6FA 4DR7B 1DDIA 3ICCA 4ATNA 1WOYA 1SU7A 1X0VA 3ZD8A 5CYFA 2F1OA 3REGA 3VZQA 3SBOA 1KVUA 1TMGE 4WZAB 1AS3A 1I01A 2QE6A 4MWOA 3AU8A 4TOIA 3KJXA 2GK7A 1V11B 4ASUD 1MB9A 3QG5A 4CMHA 1UM9A 1ZGBA 3PA6A 4JWTA 5TE9A 3AB8A 1PS8A 2ZYHA 1M75A 1TCVA 5GJVC 3TM5A 4CIWA 4UTOA 2VHCA 4LC9A 2BSQA 1XG5A 4Z4CA 4J9UE 4JC5A 5JARA 1Z3IX 2NUAA 5G1NA 2HLDA 2QYSA 3QKIA 4JR1A 5HTKA 3RFTA 3SMQA 3WGGA 4F4IA 2BZSA 2V8OA 3SSNA 3EF3A 5D5HA 3LNCA 1Q1AA 1TZJA 5T67A 1HE3A 3UCFA 3RS2A 3ZHCA 4CFYA 1OJ7A 2R6R1 5J59A 2Z58A 1JZSA 3EEOA 4H4DA 1PDVA 2ZQZA 1II8B 2GKGA 1Y0BA 1YBFA 3FFXA 3DAYA 1JWLA 3PPYA 1RCTE 3AVOA 3JVDA 3ZU5A 4PQGA 1R8JA 3FCCA 3LT0A 4L72A 1FYDA 2P2YA 2P2ZA 1BS1A 1OHHD 1CDDA 3A9SA 3CJQA 2I33A 3WGYA 4IUCS 1T5IA 4QXAA 2OYCA 3OWXA 3FNEA 1VLLA 3GEIA 4GWKA 2FUEA 1AOXA 3DGFC 4RPIA 2PMWB 4XGQA 3H2JA 5KNCH 4YT5A 4XR4A 2MMCA 5I8WA 3RC9A 3CF6R 3SVZA 1GYRA 2ZSAA 4X1YB 2IFTA 4PC3A 2DKNA 2G9RA 2R2AA 1MRSA 2O59A 4YRNA 1YI8A 2IE8A 1DT5A 3ODGA 1C0EA 3ZWCA 4HWPA 3H8JA 1M8PA 4N3BA 4ZDWA 1VJ1A 1CDEA 4FYPA 3CUWA 4IO1A 4J1QA 4EM6A 2JLQA 4EW3A 4MINA 2CNLA 2QN6A 1KK1A 3WSTA 1Z25A 1EVKA 1QG4A 1M0WA 2ODEA 3A6KA 4MI1A 1S5PA 3U9LA 5GTDA 1X77A 1EJ6A 4E0BA 1PK9A 5A3QA 3M6LA 1PL8A 4PHFA 3TKLA 3R6TA 4Z1OA 4P3PA 4EMSA 1QVZA 1HTWA 3UMGA 5LNK1 1ZFNA 4DR3B 1O2DA 2AJTA 2YJ5A 1BD3A 1L5VA 3OWHA 4D2IA 1JIQA 4B6OA 3BH0A 3C3EA 1CHDA 2P67A 4TX1A 1D0SA 4G67A 1UXOA 1A2QA 1J09A 4LVUA 3RK4A 1NU8A 3HA5A 5DPMA 5AI0A 4MNTA 5D01A 5EWMB 1RPZA 3OT5A 1CJCA 5IVPA 2A35A 4JBYA 3FAZA 4UASA 4B1FA 5KCZA 3H11B 4FOTA 4H59A 3O8QB 5HKLA 1H2BA 3N28A 1R0XA 3EASA 4HJXA 2KS6A 4NBTA 1J49A 3O1HB 2P3SA 4X45A 3VPXA 3ROPA 4JUAA 1JG4A 2GZRA 3WZLA 3Q8LA 4LF6B 4TTAA 3AVXA 3CPEA 4K26A 2BFDB 5C8XA 3LBIA 3OFND 2KJQA 3RFUA 5EJEA 2RHMA 2FPWA 3FR8A 1WDTA 3SSOA 2BONA 3KXDA 2QT9A 4N18A 1LBTA 5CLLA 3ETNA 4KI0A 2F43A 1SZDA 3L6UA 4RKWA 1HG1A 5E1MA 1YI1A 4ZHSA 1KPIA 5ARDA 3RWBA 3VNVA 3PLAE 1FMCA 1DXHA 5HR5A 2D1FA 1EFRD 2EF0A 1UWCA 4GYYA 3VFDA 7YASA 1Y34E 4F2GA 4DG5A 3GWGA 4CCYB 2I6FA 1GGEA 5A5FA 3PNSA 4ZJYA 2CNOA 4J0FA 5J23A 2H2FA 1XPUA 3FFAA 1UK8A 2VF7A 2WEKA 4KP7A 3NWBA 1RRPA 1Y8QA 5FTWA 2D2EA 3I92A 3I32A 3IRUA 4WXYB 3RK0A 1XI2A 1YGYA 3KG2A 3QXHA 2C7PA 3AVUA 5U9CA 1TF5A 1F38A 2BFEA 3I1IA 3I6BA 2EARA 3PB3A 3OIYA 3EMVA 1ZRSA 2B2NA 2OTCA 2Q3LA 4DC1A 2VWPA 1KP9A 5DSZA 3HY6A 5HMMA 1QH0A 5JO0A 1IUNA 1GYQA 4YIHA 3OJ0A 4FNOA 1KK2A 3KSMA 5CFQA 4C03A 1W48A 2NZ8A 2JC3A 1VE6A 1GTG1 1X94A 5IBQA 5LDHA 2Z30A 4DE5A 4PG8A 2ZKLA 2BP7B 3Q6MA 4MTLA 3SHVA 1UZUA 2JFGA 4BN5A 4QUEA 4NH0A 2X13A 5K0SA 3UHPA 3LTNC 1P0PA 2GAFA 1TZBA 3AO0B 4M49A 5TQ2B 1YJAA 1CNEA 1E3DA 2C3OA 4I50F 4JAVC 5BOSA 2PT6A 3BB1A 1EINA 6Q21A 1X3SA 3ICEA 1QLJA 3TIVA 3UOAB 3WYGA 2M6LA 4M8IA 3ONNA 1S7GA 1DCKA 2B9EA 4YO7A 4FONA 4F2WA 3IMFA 4AMGA 2A9VA 4BQOA 4FHCA 2NP6A 3FZYA 1QYWA 4G41A 4YUXA 3QQ5A 5IJ9A 2GBLA 3UUGA 4BNUA 1IPFA 3QA9A 1TJYA 1JJBA 1HE8B 1CC1S 1GPDG 5AJHA 5LWQA 4BX3A 1X7WA 1XQ9A 3TSWA 2XTMA 1SPBS 1PEAA 2EC5A 6AT1A 4EKYA 1ZH2A 3R40A 4GSKA 3CG0A 2FEAA 3QMWA 3ZZMA 4UM9B 1AUVA 5A4KA 3EF0A 4RAQA 5AMXA 2V9PA 1Y7PA 2YDXA 3PEVA 2HLDD 2Q9CA 3FUTA 4GBJA 4ND4A 4OFBA 4P9NA 4TV9A 1W88B 4UQPA 2OCKA 1SG9A 2VAVA 3N70A 4J1NA 5SY6A 4WZAE 4ZOQI 5BXQC 3ZWYA 1DC4A 1D2MA 2R8EA 2B7CA 3QKUA 4RABA 3BWCA 5HF5A 4R2JA 2PM8A 1EGQA 3OTHA 3O8OB 1H69A 5H4GA 4MV9A 5BMVF 3CW2A 4OJQA 2CMDA 3LM8A 4NJMA 4BWYA 2BGTA 4E70A 2DF8A 3SDSA 3Q0IA 4ZICA 1TYEB 3ZEAA 1Q0RA 2V7XA 4D4KA 1O57A 1XC7A 2R3SA 3SHWA 1E1QA 1SXJA 1O97D 1PJ2A 2J45A 2WKPA 3JRXA 4IMRA 4IV5A 1KP2A 1M7HA 3QLVA 3AL0C 3T5BA 1G3UA 2B4AA 3W34A 1VPTA 1B73A 2WAOA 3LZCA 3QOFA 3HEMA 3EGOA 4P6VF 1G4HA 2CL0X 1WVGA 1WHSA 5M3BA 3KTDA 1RLJA 1YE5A 5CVCA 5COBA 1QC5B 1XZHA 2BZ1A 3TBKA 3UK0A 3RE1A 1Z63A 1YR7A 4YRBA 4QAJA 1WETA 3FH0A 2Y9MB 2ZJ1A 3A3PA 3ORSA 5AJZA 4AY3A 1AQLA 4M9QA 4V0NA 2AOUB 2F8SA 1PR6A 1X8XA 1E66A 2I76A 2QTZA 2RCNA 2DYKA 2HRZA 2VWQA 3MC1A 4JOCA 4HYTA 3WA6A 1PNTA 3PR1A 4AZSA 4ZYUA 3CQ9A 3U7FB 1P44A 2NU7A 3X43A 3VU9B 2W11A 4JBIA 3GAAA 4IDHA 2L2QA 4HAZA 4ZYTA 3FLAA 4MYSA 2FSFA 2V7QA 3IXQA 4DV0B 1YRHA 7MHTA 4Q4LA 4KMRA 1AV7A 1FUYB 3BIJA 4DSTA 2BFCB 1ZR4A 4HAWA 3DZGA 4KQFA 1SU8A 2VDNB 1V9CA 5L53A 4MAMA 5DBFA 5DO9A 4XDGA 3O93A 3R5JA 3X1JA 1IBKB 3EH1A 1SVWA 3I2YX 2OAGA 4HGQA 2FWAA 2POQX 3L77A 1QYXA 3EG5A 3JQBA 4NEHB 5DLQC 1IOLA 1H9BA 2XW6A 3M6MD 2WG2A 3MS2A 4IM7A 1ULHA 3WMEA 3ZS8A 4QUHA 3FCXA 3O4RA 4L2IB 2BZ0A 3ZDCA 3BK1A 2IEYA 1DI0A 4ARUA 1G2IA 1K1EA 4ZU1X 5KOYA 2A88A 3A6LA 4HEHA 4KRGA 2WHYA 4IWNA 2V6GA 3AR3A 1DKMA 4Q9KA 4DNQA 3BF7A 2ZUUA 4FFOA 1EUQA 1NP6A 3H5RA 1JEYB 1QP0A 5DK4A 2HMVA 4MS4B 4WCFA 1Y9ZA 1MGPA 2XUZA 3JQ9C 1Z12A 3KQSA 1B7GO 3S27A 1XYGA 2J3QA 3FHCB 4NF2A 2Y2VA 1I2CA 2FN8A 1FZQA 3ILXA 3LH5A 3RRYA 4I6GA 4Q3CA 1W36B 2C61A 4BZXA 3INRA 4MZXA 4J3JA 3WB1A 1IULA 2FPRA 4XJTA 3DB1A 1NUSA 1QOZA 2N42A 1Z6QA 3O8BA 3RUEA 4RY8A 4TT8A 5HKOA 1UZNA 2VATA 3NORA 3INTA 1C7RA 1LX6A 3OIFA 1T2CA 4H7HA 1P2UA 3UB3A 4V39A 2QSZA 1MC4A 3QUSA 2QJRA 3JQPA 1IMJA 2ZJ3A 2OXRA 2WFLA 4RSRA 1JVBA 1CUGA 2WG0A 1Z9BA 1WEKA 3KDPA 1UFOA 3QIVA 1JALA 3V8EA 3WYFA 5C51B 4Q4DA 4KDFA 1DJNA 3MIIA 3ES9A 3VKWA 1NAIA 3LCRA 5MN5A 5JNLA 1SD1A 3QVGA 4NZPA 5D8DA 3KV3O 4M1YA 5GOTA 3W8EA 4B3RB 4M36A 3G6KA 1WD7A 4LSMA 5C8VA 3D4IA 4U9IS 5LLTA 2IU4A 1T9HA 4HDNB 4LECA 4WGGA 1JFFB 2CSXA 2Z5GA 1I5RA 2I1VB 4E12A 3OTGA 4RKQA 4I2VA 1QH8B 4Y67A 2FJUA 1FTNA 1OVGA 1UDWA 2ZIEA 5JD6A 2C07A 1K88A 2WSIA 3LK7A 4NC9A 1GILA 1X92A 3OOHA 4Q15A 4DREA 4F3RA 2HCFA 3FTEA 1IN5A 1RBMA 4BOYA 1R6BX 4K9DA 3UB4A 4AF6A 1U8EA 3I9V6 1H4VB 2PJZA 3N8HA 1QB8A 5J1SB 2JLXA 3K71B 4N3AA 4R1TA 3BHJA 1GM5A 3DF7A 3NEJA 1UQRA 2NUTA 1Q0SA 2B1IA 3PQCA 5TT1A 4MVXA 3M2TA 4KXXA 3ANTA 1XE3A 4TSRA 2C77A 2DOKA 5CIQA 4D99A 5I3CA 1E9CA 5JD5A 5KDLA 1C9DB 1QONA 2BEUA 5IJ0A 2X9LA 4LV5B 2N46A 1XCBA 1TM4E 2IJGX 4I3FA 5L6LB 2GAAA 1WV0A 1VIMA 4HQOA 4OFWA 1WHTA 2X5KO 3K05A 4ZHQB 2XB6A 4K87A 1CF9A 2E48A 2QP3A 3C6QA 1W35A 2X8AA 3AT1A 3PNQA 3A2MA 4P4SA 3F90A 3OZBA 1U65A 3FE2A 3WG9A 4CKEB 3HJCA 5KQSA 3D1LA 2HK6A 1KAHA 2ZITA 5BW6B 3GDWA 1BCRB 2BCEA 2IX9A 1MBZA 1WXIA 2TS1A 3L49A 2OHFA 3A58B 5IC5A 1XZKA 1AQJA 1MENA 3D2LA 4G25A 4H1HA 1G6Q1 3UY4A 5C53B 4FFWA 4P4UA 3WZ2A 1J21A 3E8MA 4N0PA 4G85A 5AOCA 2AMVA 2EP5A 3IIJA 4J1TC 3V32A 3R41A 2XD4A 2YIVX 2FLKA 2BBWA 1MXFA 4NU0A 1I4DD 3GARA 5CNMA 5F23A 1X2BA 2YXNA 2GRJA 2Q3EA 2MYNA 1LFDB 4TV8F 4WLOA 1JA0A 2PSEA 1KORA 1U63A 1ENZA 5IHXA 2EFDB 3MWLA 1AUQA 3A1UA 1M5TA 4NJEB 1AXGA 1N9GB 5IYZB 1E3JA 1Z39A 3EVCA 3PE4A 1A5AB 3L93A 3DYBA 2YVQA 3JQ8B 5DMHA 4CIXA 2J6HA 2J0EA 2REQB 3ZVNA 1QVVA 2QG4A 3DFFA 3RFFA 3B1YA 1JAIA 3S40A 2XHEA 2IUFA 3MSCA 3OPYA 4WACA 4E7OA 5JSZA 1WPGA 2XGJA 4FLFA 5CFLA 5J47A 2PUEA 1MEOA 1SUSA 1NVMB 1WCWA 3KYIB 4X3PA 5BVGB 2XITA 1ODSA 1YJCA 2VJOA 2ZYGA 2VQ3A 1LVHA 1P77A 1JJVA 1L7MA 1THZA 2GQ0A 3W3ZB 4GVPA 3DKPA 3L7LA 4O8ZA 3A1FA 2V7QD 3AMVA 1R8XA 2QE7A 4LXYA 1IL0A 4LJSA 5EYPA 2Y93A 4YCDA 5KNDA 3CZ5A 1WUYA 3QU7A 5I01A 4D9HA 2EWVA 2WD9A 2QRVA 2P69A 2PEYA 3HJTA 1EX9A 3MMXA 4PFJA 5LA6B 3QMMA 4B3XA 1XX6A 1EK0A 4R8LA 2GFHA 4CKCB 5KVCA 1KZ9A 3BB4A 1H3NA 2VUSA 1LLDA 3K5IA 4HDRA 3WMGA 4BTVA 3JQFC 4QYXA 3HFSA 2JLZA 2O6LA 3I04M 4Q9IA 3SC3A 1WW2A 2GAJA 4F9TA 2HGSA 3JW8A 4JQYA 4J4BA 4C6RA 4TRJA 1TCCA 2XUGA 1RJWA 3KEFA 4TXJA 1F8UA 3WWDA 3C6MA 3ELUA 5M5BA 4NYMQ 3OKCA 1AA9A 1WXWA 2YMPA 1QIHA 3L8GA 3TBFA 2FK7A 3PHGA 4BJHB 1AGYA 2C2WA 2X4DA 3KZMA 4ER6A 2QD4A 4R7ZA 5JS7A 3FBTA 4U39A 2RGRA 1JDZA 4ND3A 3T3NA 5BSVA 2I62A 3UN1A 1GCGA 1GZVA 2XUPA 4G1EB 4P3OA 2DMRA 1FOEB 1DXYA 5BNWA 1N9KA 2QTGA 3P9SA 2X8JB 3V5NA 1FJ2A 1NHGA 3QV2A 5TMEA 1MC8A 2ZJZA 1NVAA 1OYYA 2VHVA 1VMKA 3L0PA 3ANNA 1WXGA 4B4UA 4D9IA 1E1CB 2ZS8A 3EEYA 4UBMA 1NUPA 3DMGA 5I4IA 4R05A 4LE2A 2D00A 1Q21A 3L6OO 2C57A 3GT7A 5EGSA 5HQJA 1W0KA 5B4UA 2GYWA 2NM0A 2W90A 3QUQA 5L95A 1I1QB 4M7PA 1MEJA 2BH9A 4TL6A 4EPVA 3WICA 2C2XA 3ESXA 3PIIA 4HRAA 3UMJA 4XWKA 1O58A 1MA0A 2IL1A 4GP6A 2YWXA 3TLCA 4OM7A 1J2EA 4CCSA 4EBFA 2FZGA 4GXTA 4ARZA 4N4AA 1Y8CA 1ZISA 4LRXA 4ZT6A 3LE8A 4LRQA 1VG8A 1Z5UA 2VL7A 1FCJA 5CM2Z 1HNWB 2JGFA 4C89A 4NCAA 4J0JA 1TDJA 2GZ1A 2P3QA 2CFOA 1GFZA 1K6XA 1QCZA 2V5AA 4MPPA 1ODJA 3THWA 1PUIA 3WLQA 1LPPA 4YY3B 3P9YA 2DWCA 5SZKB 2DWUA 4XFJA 4NPHA 5K0TA 5LN1A 3IAUA 3ROEA 5ADHA 3KJHA 4W8OA 3HBLA 1T3GA 3C39A 1H2AS 4QPNA 4UDXX 2PZAA 4WTOA 3W7VA 1ZEJA 4JLOA 5A9RA 2B2XA 2XVAA 1IU9A 1GKUB 4K9PA 5FPPA 2BH2A 4K2AA 1GNQA 2CC2A 1IPHA 3GBVA 3P97A 2NO5A 4M0UA 3HK2A 3LW8A 1T3TA 3LUDA 3E0QA 2QR5A 4RUKA 2Q49A 4AKSA 2Z4TA 3HL4A 1RBZA 4BQNA 2I80A 4JKOA 4HN2A 2EEPA 3DEKA 3F6SA 3GFPA 4C1BA 2F8LA 3W8DA 4CVNA 1G18A 1OWMA 1SZJG 3MTBA 3QPWA 4N5MA 5CDFE 2BY4A 1UPUA 4MUBA 2HQRA 2YHIA 4I9NA 3A4MA 3TQHA 3AB3A 5E7QA 3UT5B 5FUMA 2RG7A 2NO1A 3P32A 2HB6A 2O4UX 2ZJ2A 5EMJA 2FN9A 1P2GA 2VPPA 3QYJA 3TVYA 1XIVA 2JJ2A 4MAFA 1BRTA 3SE7A 1GU0A 3R3XA 3UG7A 2W4QA 3RT9A 5HEKA 5AIBA 1W75A 2GYYA 2KQUA 3UHOA 5EKTA 4HGRA 3C3KA 5JSUA 4MQLA 1UADA 3A1DA 1D7OA 1E64A 2PMDA 3QGMA 4ZAFA 5HUHA 5FJIA 3L4EA 2C3YA 1HH4A 2HO5A 4M37A 3E22B 4YAOA 1MN6A 4CFSA 3GJZA 5LOVB 1TNDA 3ELWA 4L5JA 1ODTC 3D2BA 1A4IA 1ARZA 2I3AA 3EDOA 3G2PA 4XWWA 1BNCA 1OFVA 1Q6ZA 2B1QA 2LUOA 4M1TA 4ZT7A 3C70A 4IDBA 4RPGA 3JR7A 1EG7A 3RH0A 3D6HA 3HVJA 3CKYA 4E22A 4EPWA 1UOPA 3KC2A 3LGAA 3TDKA 4G0UA 3MCAA 1NKTA 4NEQA 2EP7A 4QBHA 3UMFA 3BA1A 2KLBA 2YDYA 1Y42X 4WW0A 4EZIA 4FILA 2PPVA 1YR2A 2WU0A 1MRZA 3C1UA 2ZE5A 3KOZA 2A0XA 2FI1A 3B20A 1A4UA 4H1TA 5ITWA 4LEIA 4DDKA 4F6RA 3NHFA 1YZFA 3VZRA 2WQ7A 4X1YA 1R8QA 1TO1E 1ZK4A 3KJIA 10MHA 2O3QA 1SFRA 1MIHA 3BZBA 5K3SA 3AKEA 5KO2A 3I6YA 3PICA 2IZ0A 4BFZA 1I2AA 3RC2A 4NKRA 2RGUA 2G9VA 4DR5B 5E9AA 5CYGA 5ALYA 1RHUA 2ZJOA 1GZ7A 4TYWA 4ND8B 1RPTA 1Q11A 1V3QE 2I3BA 4UCFA 5EPOA 3JD4A 1TM3E 2H00A 1G5RA 2BGJA 2QE7D 3R76A 3ZV3A 3UC9A 1IUOA 1OT5A 1EXNA 3NRCA 1LPMA 2B1GA 4L50A 2IIQA 3RC3A 3TUJC 1Y8RB 2V3CC 5G1PA 1N6NA 2FPKA 1KYZA 1RIFA 4NZ9A 5GAJA 3BRQA 4IS2A 1PWZA 3K0CA 2ZBFA 5EAIA 1PTKA 3ZY3A 4IOKA 3ZCQA 3K6RA 1AS2A 1KMIY 1FTSA 4REQA 2QT0A 4UNPA 1Z56C 2BR5A 4XGRA 2QUJA 1E3QA 4I8XA 1KARA 3F5FA 4BMSA 2Y1WA 2M6SA 1XZ8A 5BRAA 3FA2A 2QIPA 2JATA 2ZRLA 2I22A 2QD2A 3DEYX 2QRUA 4JJGA 4CQMA 1N2IA 4BDSA 4IZ6A 4AG5A 4F2HA 2HJ9A 2X4GA 1N3IA 1DC8A 5ALZA 3WRXC 3ZX5A 2YOHA 5DHUA 1BCSB 4QJ4A 4C7MA 1HETA 3CEMA 4B6SA 2A4MA 1VG1A 3FY4A 1EXWA 1FRQA 2PYZA 3KLNA 5JAPA 4KK4A 2E9SA 1Z0ZA 1NXSA 4I55B 4LWOA 1JW9B 5TS2A 5I7OA 4Q9DA 2ZWPA 3IIEA 2E4YA 1R9MA 1K6MA 4KO4S 4R9SA 4WBNA 1E92A 1QTIA 4Q0MA 1NNLA 3AUSA 3ZGNA 2YY6A 2HHLA 4OQZA 2D1QA 4P82A 4YDQA 1XQVA 2JPDA 3ND9A 5DBIA 5EE1A 5G3ZA 5DF1A 3PS9A 4CDRA 1LS1A 3CWZA 2E21A 1VI2A 3FUUA 3OUZA 3MHPA 1H2HA 4HQ0A 3R3WA 2DULA 2C3UA 3LW7A 5TQJA 3MWYW 4NZOA 2J9XB 1GADO 4LXQA 4QBTA 3LTEA 5FADA 1XPRA 4GGMX 3U62A 3PEUA 3JQCA 4EH1A 1E1NA 4PFSA 2OGWA 1JECA 4QGFA 1JF8A 3BFPA 5EUQB 1EXMA 3CZAA 3DR3A 4B3TB 2QXYA 3BQMB 3NX4A 2NQTA 3TXYA 2HJRA 3OCUA 1RJ9A 2ADFA 3U3KA 3QSGA 2ZSBA 2O1SA 2M98A 3AI1A 3IAM1 4R8SA 4PO9A 1OV4A 4FT4A 2HY7A 5TPWA 4KHPB 3I04A 4WD3A 3HXQA 3HU2A 3EIWA 1YXMA 2V55B 4KQWA 1XQWA 1HFEL 3E5HA 3C3JA 1FNDA 4AJKA 3G7UA 1IC6A 1LSOA 3HCNA 1T9DA 4HPWA 4J90A 2YWGA 4XDZA 5KYGA 4OQXA 4KAFA 4N5NA 2IOHA 4PLYA 3M6UA 1BDHA 1NMYA 1DEOA 1YUBA 2ZKIA 4BKOA 1MUUA 1QYDA 2Z56A 3DZKA 2D7DA 4XWAA 2HCRA 5DYNA 1U5BA 2C7GA 2LIPA 3HCPA 4BC1A 3IVCA 5DHPA 3FI0A 4NBNA 5JAOA 3P2EA 3RDPA 3ROTA 3IELA 1OE0A 1YVEI 4NTZA 1F5SA 3BZWA 6YASA 1LC3A 2N0SA 4KVGA 4M98A 5FEUA 2ZIZA 3PC8A 1H2FA 4FKZA 4J0KA 4LHWA 5A1JA 4C7OA 5KTMA 2PWYA 1VPVA 4QHTA 1AZWA 2IEAA 3ID6C 2RGNC 5IF3A 3RVRA 3G2QA 4IOJA 4YBRA 4JGIA 4DA4A 2PV0A 1L7PA 3K72B 3ETLA 3A1NA 5T3YA 3WQQA 5TX7A 5FBVB 1SXIA 3PQDA 1S1CA 2WJZB 2I91A 3HDGA 5AM4A 5JC1A 3V33A 3OM9A 5F3DA 1JQ3A 4ZVUA 4U6SA 5TEVA 3VKFA 5H8WA 3FTFA 1YO6A 4Z9AA 3ODPA 1JIXA 4HOYA 4NBWA 2WOOA 5DH9A 1OAKA 3L7DA 5TMPA 1Q74A 2AX4A 2RK4A 2FSHA 1IY0A 3T1QA 3T3OA 3R7BA 3RSQA 2QLBA 4CETA 1FFXB 4KAJA 3IQIX 4M0LA 5CB6A 3HABA 3JWHA 4AY5A 4MMXB 3TLZA 4DCUA 4E09A 1RHMA 13PKA 3GRVA 1KR5A 1P7PA 4HPJB 1MX9A 3B12A 5JW6A 4XYLA 3O4JA 2WWIA 4IDNA 2BM0A 1CUXA 5TY0A 1LDGA 3VZCA 4B47A 1JTEA 3KFVA 5K3BA 4W7SA 3K2EA 4B87A 4BLWA 1KEEA 5ECYA 1CLUA 2AOUA 3NKFA 2W2OA 2IYLD 3D7MA 1VKNA 2ZVQX 3IVAA 5K2OA 3WV5A 1L8AA 4BZWA 4C7XA 1GDHA 3I9NA 4NDNE 5C8YB 2Q2NA 2O9JA 3OQJA 4D8YA 3D1VA 4TZ0A 3EVDA 4L8LA 1GTL1 1OX4A 2ZYWX 3NUZA 4C6TA 4LTMA 1MO6A 3DLCA 2Q3JA 4YP0A 4GM1A 3ANMA 5I5GA 1OXKB 2HN9A 3G2MA 1RE1A 1R37A 4UD6A 5ILGA 4BMXA 1JDNA 4B3SB 3WGLA 2CL5A 5LP6C 1CUYA 5C80A 3VO2A 1EDOA 1R0ZA 4JP1A 1Z4NA 3M3HA 4L4SA 5CBKA 3S55A 1R2QA 1NRXA 4RS4A 2XYPA 4WLUA 3TZQA 1KP3A 1ZY2A 1C3JA 3CPJB 3QW2A 4KO3S 4ETNA 4JR0A 2OO3A 2BHRA 1JFRA 2Q5LA 4LOHA 3ZW9A 5K3FA 4TQAA 5DWDA 2VZEA 3C6XA 4RHEA 3DUFA 4LZOA 4OYHA 3L6BA 1K89A 1JHYA 2C8KA 4GOOD 4XX1A 3B1VA 2ZJ6A 1FK8A 2C8JA 2CZGA 3PXDA 1Y9DA 2HWUA 3VYTB 2R1UA 1VMDA 1JSCA 3WLIA 2MYUA 4UDYX 4G0OA 5TPZD 1A9ZA 3RVDA 4CT5A 1KAGA 3K9FC 3E5MA 3VH3A 1BDBA 4ZQFA 2P5UA 1GTJ1 3BHMA 4TMZA 2ZUCA 3QXCA 1M6EX 4IRMA 3TLGA 4YMTA 2WB2A 1BD4A 4LJRA 5BWMA 3Q5EA 3I58A 5K05A 5GJWC 2AE1A 3S8MA 3E9QA 2F67A 3HGTA 3HM9A 3UEOA 1B41A 4D1YA 3JQRA 1MKYA 4ME6A 1E9DA 2J3HA 1DU4A 3KZXA 3KWJA 4MDYA 2B9VA 1YZGA 4OL0A 2FEMA 4RMJA 3ZCSA 1JEAA 3GH1A 1TL7C 2B98A 1MW8X 4JVMA 4D9NA 3TEJA 2VDJA 2DPMA 1B76A 3DTTA 5HGJA 2ANCA 3JZAA 3DE2X 4FNAA 3T9BA 4DYDA 4LFCB 4J4TA 3G2OA 1KQNA 3NAGA 5KNDH 4OQLA 1RM4A 3FUVA 3EAFA 4YUVA 2X8BA 2XWBF 4WK4B 1FMLA 1YDGA 5JXJA 2NTJA 2R65A 3PI7A 3IT0A 3GFFA 3UAGA 4HX5A 5K9ZA 1OF1A 5FFFA 3E5RA 3K09C 4RFLA 3BKXA 1QHGA 2VZLA 3THXB 5J2UF 2XCIA 5F76A 4QECA 5F2EA 1UZAA 4E08A 1GGMA 4L5AA 3R3YA 5FA5A 4AROA 5JNWA 1DIRA 2IOFA 4PC1A 2ESRA 3GD5A 2VO1A 3PRKE 4HDNA 4LZAA 3T1NA 1YS4A 4RZIA 2R6ZA 3HUEA 3A31A 4GOJA 1T1IA 4U8GA 4FYIA 2QROA 2AF4C 3PVZA 1KIFA 4H7IA 4ZCLA 4EQZA 3U7EB 4Z8XA 5KREA 3EULA 3DTNA 3CX6A 1Q0ZA 3PDHA 1MH1A 4H16A 2O8CA 3PFNA 3IV7A 1VI6A 2IPOA 1BVHA 1UC8A 4F60A 4V02A 2DH5A 1ZCAA 3B3GA 1YZHA 2GBIA 5CDFA 4IJ6A 3SZUA 3PYLA 2ZPAA 5CJJA 3TOSA 2VJCA 3I1YA 3ZDAA 5DEOA 3DL2A 3U6BA 1JI0A 1F2DA 1GO2A 4G84A 2WDZA 2R6CA 3C2QA 3PHBE 4KO2S 5J5VA 4AY2A 1EE2A 1Q3TA 1DRVA 4A2PA 1QQAA 2XRYA 3BGDA 1SKBA 2GF0A 4KE8A 4OYLA 4P3NA 5AO9A 3C74A 5REQA 2PU7A 1YZQA 3BTVA 4JMPA 2Z2IA 2PGXA 4CEJA 3BMNA 4KQ9A 4IDGA 4EKDA 4TKLA 2IV7A 4TMFA 1MD9A 3NRJA 1ES9A 1Z6GA 4MHOA 4K9RA 1H6CA 5GIPE 4FCWA 1UMCB 4ZOBA 5D3QA 1XZFA 3W04A 4O4LB 3X2SA 3CR8A 3W5HA 3VOBA 3PUIA 4PYRA 1DQSA 1J22A 3HB7A 3MUFA 2A59A 4NOMA 1HI9A 3HBFA 5HVNA 4ZRDA 2AOXA 2GXAA 4EJ6A 1W93A 3DYVA 5D1NA 4UJ5A 5B3AA 1UPFA 5BN5B 2QN9A 4EX7A 1OFUX 1JP7A 1N8KA 4Z4QA 3CZCA 2NV2B 3FVRA 4LMPA 4WDQA 3TRIA 4XIJA 4HUQB 3U0BA 1K5HA 3ZXXA 3EJ6A 1MJGM 3EGWA 1IEWA 3FMIA 3BE6A 4QSHA 3H4IA 4X0EA 4QXPA 5A04A 1EGHA 4BFSA 1DFGA 2IS6A 4LY3A 3ZTYA 2QZ4A 3RAEC 2GLTA 2XMCA 3ISJA 2H4HA 3UV6A 4RH0A 3HI6A 3OT1A 4DWVA 2V5UA 3FDZA 5GV7A 4Q39A 3TTSA 1N9GA 2G25A 5AI5A 3DFZA 5IYZA 4OK5A 3K70D 4PYMA 1QAOA 4LZPA 2REQA 4NI5A 2AEMA 8OHMA 4RS3A 1CP3A 1S3GA 2RHGB 3OZSA 4K03A 1A7UA 3T4UA 3GUVA 3KQLA 3OECA 1NC1A 1FP4B 1B23P 4FC7A 5E6RA 4H0NA 1JT2A 2NT4A 3EQ9A 3CBGA 3NIBA 1G98A 1KYQA 3MCVA 1YQUA 3KD3A 3PD7A 4JX9A 3FHOA 5IKEA 2Q4BA 3MRTA 4BGIA 2OKCA 3D5QA 3VPAA 1MVOA 2EFGA 5HCNA 1IK6A 4A92A 1XAJA 3FTCA 4X84A 5BSMA 2PNJA 5A6VA 5J2TA 1OAOA 5K3OA 5TVKA 4CKZA 2OD2A 4CKCA 4MQ4A 4P5DA 2VUHB 2C88A 3E3NA 4YHBA 3RIYA 5DK6A 4ZRNA 2MU1A 4IQFA 4QJIA 4JVLA 1COWA 2N75A 4NMMA 4CIYA 4IG9A 1XAGA 5E95A 2PL3A 5CBPB 5JFTA 3CIFA 3S68A 1Z82A 3LBFA 3QPUA 4PAGA 2XXBA 4HXYA 1TEHA 1E7YA 1TQ2A 4PHCA 5AOBA 3RKSA 3ESBA 5DTJA 2HCBA 5DGHA 3AP3A 3KK0A 3T5TA 2UZIR 3F8SA 2NTVA 3AHDA 3D64A 4JFAA 5TQVA 1JBQA 1MOSA 1OY1A 2W2VA 1R66A 3WGMA 1YF3A 1U8UA 2RGCA 4LA4A 4EG7A 4AU1A 1T3HA 5JY1A 1QRDA 4KPFC 4JB0A 1QJCA 4HD8A 3UKDA 3VO9A 2CK3A 2ZYRA 1PEYA 2O2XA 3EQZA 5FUXA 2CZCA 1Z7YA 2TMKA 4KLAA 1I7QB 1AKNA 4TRNA 3D0OA 3PU6A 5AM0A 3KWMA 1TX4B 1YR8A 5CUQA 1LFAA 5LQRA 5ED4A 2X23A 2EW2A 1ACMA 5I51A 3ZLTA 4N5IX 4QBGB 3T3IA 4BATA 4TMWA 3UWKA 3OPYI 1CQZA 2SCUA 3BOSA 2C97A 4BNGA 3DTVA 1Y6GA 3AEXA 1SA0B 2LPMA 2P9HA 5EQFA 1G8HA 1YB2A 1R9JA 1X1CA 2XSZD 2Z57A 1YVDA 1JJIA 3I8SA 3PNYA 4IEIA 4OP1A 5EXPA 2PPLA 4GGPA 1IHDA 1J24A 5FI5A 1M33A 2AXNA 4GFDA 3DZ8A 1SJ9A 3G85A 4HDCA 1DAPA 1L3IA 4ZPXA 1ULBA 4B4WA 2I7CA 4E15A 1EXDA 1EFLA 3OE1A 2FPUA 1KVSA 2B1JA 1FFDA 2BFMA 5DNDA 4CHGA 1IJFA 1BHQ1 3Q15C 4WVFA 4D57A 4LXIA 1GL6A 1QLWA 1UWVA 2BE9A 1QFJA 1USWA 2VSXA 2MT9A 3DKVA 1UBGA 2QOEA 2P9CA 2JVJA 3J81A 1W4RA 4FMCB 3U9TA 1WSAA 4GX2A 3EAGA 3T1HB 3BXHA 1BMFD 2Q4DA 1WF3A 2BMVA 1HO3A 2D2VA 1V7QA 3LIIA 4INPA 4KO8A 2J5QA 3RK1A 4QUJA 1J2UA 2G88A 3ANXA 1CW2B 2RGEA 3B9PA 1QZTA 4JYMA 5KKAA 3R9IA 1HUQA 4KMOA 5E4TA 3TDNA 4E07A 3LUCA 2WNIA 4R5HA 2FX2A 3UATA 1Z4PX 3PXBA 4ZALA 4MGYR 5K09A 2I3DA 2D06A 4Q9NA 2R1TA 3TZ6A 4AIRA 4JBLA 4I3HA 1L4EA 1OMOA 3L5KA 2PGAA 1EFVA 3L46A 1VRVA 1SUDA 3EIOA 3Q3HA 4FK8A 4JN6B 2V65A 3Q7RA 3NTQA 4FKMA 4JVNA 1XPJA 3VOTA 3PNVA 4GOXA 4NATA 5JXWA 3A05A 3FW1A 3BX1A 1H0SA 3VZBA 2WQZA 1ZS9A 4LXHA 4YGXB 5A5GA 1VMEA 1PU2A 3F9CA 1E2PA 1WIWA 2ERXA 1NLZA 4IV8A 1KI8A 3AKCA 4IDCA 3CRRA 1HZJA 4IIBA 4WBNF 2GT1A 3BTSA 1DDOA 4QOJA 1ZUIA 3GJ8A 5LC1A 5DSXA 4ZVKA 1MHTA 2R8RA 2LVBA 2WSLA