2X0JA

2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
294
structure length
294
Chain Sequence
MKLGFVGAGRVGSTSAFTCLLNLDVDEIALVDIAEDLAVGEAMDLAHAAAGIDKYPKIVGGADYSLLKGSEIIVVTAGLARKPGMTRLDLAHKNAGIIKDIAKKIVENAPESKILVVTNPMDVMTYIMWKESGKPRNEVFGMGNQLDSQRLKERLYNAGARNIRRAWIIGEHGDSMFVAKSLADFDGEVDWEAVENDVRFVAAEVIKRKGATIFGPAVAIYRMVKAVVEDTGEIIPTSMILQGEYGIENVAVGVPAKLGKNGAEVADIKLSDEEIEKLRNSAKILRERLEELGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALATE DEHYDROGENASE
publication title The 2.9A Resolution Crystal Structure of Malate Dehydrogenase from Archaeoglobus Fulgidus: Mechanisms of Oligomerisation and Thermal Stabilisation.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Oxidoreductase
total genus 104
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x0jA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2x0jA02
3WYBA 4CQLB 1PGJA 3D4OA 4RDIA 3WFIA 3ST7A 4PLZA 1C0KA 1Q0QA 4Q3BA 2GR9A 2C54A 4N5NA 2O23A 3PYLA 3HB5X 1NP3A 2AA3A 4ALMA 2VZ0A 3MJSA 3VKVA 2IZ1A 1VSVA 2FP4A 3IL2A 1YVEI 4LK3A 3ZU5A 3KETA 1XGKA 4UUPA 1ZMTA 3CSDA 1GYPA 1QXSA 4E5MA 3KXDA 2EIHA 3LLVA 2PV7A 4BQPA 1HDXA 2YFQA 1FDTA 1C0LA 2EG9A 3C1TA 4XEHA 5B4TA 2ZATA 3C7DB 3T4EA 4EW6A 1BGVA 3FD8A 3N74A 3U4HA 3VAZA 3IJRA 3LT0A 3PTZA 4WKGA 4IY1A 4BV8A 4CMBA 1WMAA 4YB8A 4KUGA 3W4KA 4Z6KA 1BDBA 5A04A 3ZWNA 1M67A 3ZWOA 5G4KA 3OHSX 4N7RA 1J6UA 1EQUA 1U3TA 4F45A 3OIDA 3HG7A 1M6HA 3WTBA 5L4SA 1P31A 1Y1PA 3OP4A 3H6KA 2P2SA 3UH1A 1J49A 4CLHA 1E3WB 1E1NA 3GZNA 1U4OA 2V6FA 3OEYA 2Y0EA 4K28A 1YL5A 1GYRA 3KOUA 4GWKA 5TF4A 4CM7A 1Q7CA 5COQA 3INRA 4RCVA 3ETDA 4HX5A 5DBIA 1OBFO 1SB9A 1HE5A 2WD8A 1ISHA 1YQXA 1XWFA 1P1JA 1GV1A 3TFOA 3FR8A 5GY7A 2QG4A 4CMCA 3AU9A 1L7DA 3FNHA 4R3NA 3M2PA 3GDOA 3CMCO 3D5TA 5ER6A 3SJ7A 2UAGA 8LDHA 3P7MA 1KVTA 3GC6A 3VPHA 1GCUA 5JC1A 5CHEA 1CF2O 4OMUA 4YJFA 2YYYA 5TNXA 2WD7A 3RFVA 1PZGA 3JV7A 1YDEA 2PH5A 1I3LA 2OO5A 3KLMX 3Q9NA 5EMHA 4CMIA 3VH2A 3GVXA 5L7YA 4DLAA 5CEFA 3VVBA 5TT1A 5KJEA 4JIGA 1XCBA 4M8SA 5TS3A 4JROA 4Y98A 1YWGO 3CIFA 1YONA 3DBLA 4HNHA 2Q4BA 4DPKA 1C0PA 1O0SA 2Y1DA 3RI3A 1B8PA 1FDSA 3OJFA 4DQXA 1UP7A 2J3JA 1GU7A 2VTDA 4CLEA 1U3UA 1RWBA 1E1MA 3ZW8A 2YW9A 1ZJZA 2ZTUA 1DJNA 3WICA 4PZEA 2ZKLA 2PA3A 3DBRB 4CR6A 4TZTA 2UYYA 1LRJA 2QZZA 4EJ6A 3ADOA 9LDTA 2J6IA 4CMJA 2PLAA 4Q3CA 5L4NA 2IDZA 2EWMA 4YAIA 1UDBA 4K1LA 5B37A 3E03A 4CM1A 1IPFA 1PS9A 1YL7A 2FZEA 4HXYA 4OO3A 4BNIA 1JTVA 1PS8A 1NR7A 4NDNE 1A7AA 1PS0A 2CVZA 3W4JA 3RUHA 5KOIA 4D41A 5JMPA 5IDQA 2C7GA 4WEOA 1ZJYA 4IQ8A 1GZ3A 3VZQA 1R4NA 4EBFA 3BTOA 5T6BA 4U0JA 2ZYDA 4KZPA 3AFMA 3LT1A 4Z9XA 4P22A 3KRTA 3RIHA 4CQMA 3QHAA 4QSMA 1N5DA 2POQX 4QTZA 1DC5A 4YEDA 4EGFA 4XYBA 3HWRA 4XYGA 5JBIA 4J49A 1C1DA 2O7QA 2FSVA 1ENOA 3F1LA 3GGPA 3NKLA 3AM5A 3IP1A 2PKQP 1PQUA 1EE2A 1GUFA 5FFFA 3SX2A 4FDAA 3AOEA 4E6PA 4XYLA 1HSOA 2PD6A 3LT2A 3N58A 2GZ2A 2QYSA 5JFOA 3DMTC 1NQTA 2FSSA 2PD4A 3C1AA 1DPGA 2EGHA 4YT8A 1C14A 3C8MA 3EC7A 3IIEA 5JXWA 1EVYA 4I1IA 1CIVA 4ITUA 3WOHA 1Q7BA 2CDBA 1MC4A 2JAPA 3EVNA 4XYMA 2E82A 1G1AA 1P33A 1YOVA 1WXDA 5TQVA 1VL0A 4QUKA 3ZWYA 2H6EA 4NU6A 1DB3A 1EFKA 3ZNNA 3R1IA 1JWAB 1KERA 1PR9A 1GEGA 3GHYA 4M1QA 1VI2A 2A94A 1EBFA 2AHRA 4FJ0A 2X0RA 1UXJA 3VZRA 4BO8A 5FI3A 5AXBA 2R00C 4I5GA 1WWKA 5DULA 5HS4A 2VYND 1HWYA 3QQPA 3I9KA 4AFNA 5GZ1A 1EVJA 4GL4A 3BHJA 5ILOA 3DZHA 4B79A 3PP8A 1R0SA 1O94A 2ZB4A 4FFLA 4I8XA 4KDFA 3PI7A 1YBVA 1I10A 4BOYA 1EUDA 2HLPA 5A1TA 4GMFA 2WSBA 3GUYA 4WJZA 4JLWA 4R01A 3EZLA 2PD3A 4E5YA 4PLGA 3WLEA 4BQRA 3PXXA 4UEKA 3AM3A 3JQAD 1LSUA 3GZNB 2PFGA 3U0BA 1QRRA 1LQUA 2VWPA 2HMSA 3GG2A 1ENYA 5JLAA 1B8VA 1PIWA 4ZJUA 5I8WA 3PDJA 1F12A 2GF2A 3ASUA 3FPCA 3KYDA 4EITA 4ID9A 2JCYA 3BMCA 3QJ5A 1IULA 3PQFA 1U5AA 2FPIA 2Y99A 3ZH2A 5BSGA 4JNKA 2B4TO 4F6LA 4JX8A 4TKMA 1MX3A 3ABIA 2V65A 2W98A 1EEHA 4R1SA 4Y9DA 1E7SA 3F4LA 1ONPA 2EP5A 3IUSA 1LDBA 2GN9A 4EYEA 3FSRA 4O0LA 3ZNOA 1I0ZA 3K96A 1PGPA 4WCDA 3HZZA 4PZCA 4FS3A 1Y9AA 3OM9A 2EKQA 5G0SA 3UFXA 2NM0A 1LDMA 3GN2A 4WLFA 1JN0A 4YJFB 3TZHA 2DC1A 4ZA2A 1HDGO 2PGDA 4CR8A 1P45A 2GGSA 3ZN2A 3ZU4A 5HRUA 1O8CA 3GF4A 4U6QA 4A0SA 3SXPA 1R12A 2E48A 2YDYA 3AY3A 2F00A 2OZPA 4DQVA 5DNAA 4D0SA 3RROA 3UGKA 1DAOA 2PKQO 4J7UA 4F46A 2WMDA 3KSUA 4RVHA 1I24A 3FHLA 3RJ5A 3CEAA 5I7SA 2E37A 3CUKA 4NK4A 4AJHA 3MJ4A 3IQDB 4DA9A 4WPGA 4BVAA 1DFGA 2HCTA 4XQEA 4YYZA 1ZK4A 4J16A 3GVHA 5C5IA 1Z75A 2NV6A 3BHMA 1LDGA 3VC7A 1ZXBA 2ZTMA 4NMHA 1IZ9A 1ADBA 1LLCA 4FR5A 3KLPX 3PPIA 1OZAA 1MV8A 3T7CA 3PHLA 1RM4A 2D59A 1A27A 3ZWMA 2OP1A 4BV9A 4YJGB 1KS9A 4IZHA 1X15A 4RJTA 3M2TA 3GVIA 5KJCA 3EY4A 1TT5B 4WNIA 1I2ZA 3ANNA 1H2BA 4PG8A 3BMOB 3MJCA 3WGYA 4D42A 1GDHA 3I23A 4RPKA 3ROQA 4E31A 6LDHA 1T2DA 4PLWA 2ZB3A 1ULUA 2PZKA 5IAAA 3FR7A 4B4WA 3W8EA 1XDWA 1EDOA 2ZB7A 1KY4A 3HQ4O 3KB6A 4CQMB 1I5RA 4GQAA 8ADHA 1P1IA 1IB6A 4XGIA 1KBZA 3ZHXA 2A92A 1KVSA 2Z95A 3U9LA 5L95A 4HV4A 1FK8A 1GADO 4MP3A 1BWSA 2QZ9A 3PLRA 1Z73A 5KVVA 4E2XA 1U4SA 5CEJA 3WGGA 2J5RA 2HSDA 2O3SA 4NBVA 1K6JA 4R69A 5A9TA 2DFDA 1LDEA 1TT7A 3K2BA 5DBFA 1MB4A 1NWCA 3OIGA 1EQ2A 2ZTVA 4AJ2A 4KWHA 4MVJE 1J0XO 4MVJH 1ONNA 4L74A 1EE9A 4YBZA 4YAEA 4AJJA 3VTZA 4AJIA 3AUAA 4BHTA 2FZWA 4DIFA 1DOHA 4JBGA 4CM3A 1E3IA 1YOVB 2O3UA 4QT0A 4J9UE 4M86A 4NH4A 3B6ZA 4E5KA 1BHSA 3BZUA 4NBUA 1K0UA 1IPEA 5K0ZA 3U09A 3L4BA 1KEUA 1SOWA 3SLKA 4RDHA 4TRRA 1CYDA 3OICA 3FNEA 4DXHA 3PGJA 3VZPA 2Q2VA 4D79A 3FTPA 5AXDA 3JQ6A 2D4AA 3D3WB 4UUMA 5JDIA 4WCFC 3TZQA 2I67A 3QVWA 2UUPA 3RC1A 1Q1NA 2WE8A 4E32A 5U9CA 4HADA 1HDRA 3EUWA 4BNFA 4MVJF 4BO9A 2P4QA 5F5NA 1EZ4A 4MVJI 5DF1A 2HO5A 1SMKA 4FC6A 4RPLA 1E6EA 1JDJA 1OOEA 3WGQA 2VQ3A 3DQPA 3PYXA 1BXGA 3I6IA 4R4JA 3DTTA 3G1UA 4NJMB 2WYVA 5L9AA 4CQLA 3RUEA 3F6YA 3OECA 1SB8A 4RF5A 4WK6A 2JCXA 3CH6A 3KYDB 2DTXA 4BMNA 1NXQA 1ML3A 2ZYAA 3ZWXA 3BMCB 3ZWPA 1KETA 4BNWA 2B69A 3K73O 4J43A 1NHWA 3K8ZA 4IMRA 3UICA 3VPXA 5KTKA 2DBZA 2VUUA 1V35A 2O2YA 3GZ4A 3W8DA 2QQ5A 5ILGA 3GFGA 4JP3A 2AQIA 4IDEA 3HNPA 2PZLA 5DDIP 2I76A 2X5OA 1MXHA 4CMAA 3M6IA 2O48X 4PG4A 2UVDA 4QFCA 3GT0A 1KY5A 3KHUA 1S7CA 4OSOA 1QYXA 5CDYA 1X7DA 4MP6A 2GSDA 3QWBA 4CM6A 4WOJA 1R66A 4JJFA 3GPDG 3OEWA 2I65A 3G49A 2GLXA 1YKFA 3QWFA 2GN6A 1MP0A 1MA0A 3GG9A 5GMOA 4J9VA 3WSWA 4FIZA 4MKXA 4OOFA 1Y8RB 2J5QA 1H6DA 3PJDA 4H15A 3DZFA 4TQGA 1PL6A 3D4PA 1H6CA 4R9RA 3VDRA 1QR6A 2VNSA 1G6KA 3JQFA 2Q1UA 4OH1A 4OYRA 2JL1A 1GQQA 3FPLA 3JQ9C 4N5LA 2NQTA 4O6VA 3VHRA 2OGUA 4QXMA 4WCFB 3TOXA 1UH5A 3H5RA 4PLPA 3F4BA 2DUWA 1QG6A 3H2ZA 5F1OA 1WDMA 1T2CA 2WM3A 2H5LA 4ZQEA 2A9FA 4NR0A 2PH3A 3WGOA 3ZWAA 4CMGA 4GGOA 4OQYA 3DBHB 2AG8A 3H8VA 4R5MA 4A5OA 1AHIA 2QHXA 3PK0A 4CMEC 4E5NA 4KP7A 3VDQA 2ZK7A 4IS2A 3EMKA 3TQHA 4BB5A 2BFAA 1VKNA 4OXKA 4ZQBA 1HYHA 4IJWA 4OQZA 4A2CA 3AY6A 3I4FA 4BO1A 3TOZA 3EW7A 4M54A 4ZHSA 5CPFA 4BNJA 5TJHA 4ALJA 1YRLA 2RBEA 3GLQA 4U7WA 4Q3DA 1DHRA 2GNAA 1UP6A 2OUIA 3I3OA 1UAGA 2JHFA 1IUKA 1ONOA 2EGGA 3PIIA 3H3FA 1CETA 3S2IA 2Q1TA 5A4DA 4CM4A 3PIDA 3A14A 2FMUA 3CINA 3V1TC 4J4HA 4P4NA 3SJUA 1X1TA 1DIRA 3U5TA 1AXGA 4DREA 1PEDA 3UCXA 4J0FA 2PGJA 3DBRA 1O95A 2Y1OA 4CM9A 6ADHA 4NZ9A 5HS6A 2VOEA 1T2FA 1DAPA 4MDHA 2VHZA 1ZEMA 2NTVA 1UZMA 3RC2A 4AL4A 4E12A 1A9YA 1NBOA 1PR3A 1TXGA 1ZIDA 1ZUD1 3LSYA 4IINA 1PJ2A 3E6AA 2BI7A 4XB1A 3B20A 5A05A 4HFJA 5JAQA 1DSSG 9LDBA 2AXQA 4D43A 3FBTA 5BQFA 1VJ1A 2IXBA 5JAZA 3IUPA 1H6AA 1UXIA 5DCYA 5KJ1A 4ZQGA 3RBXA 5G0VA 1LLUA 1F0YA 2W2KB 1V3VA 3WYCA 3JQBC 1PL7A 2NTNA 2CF6A 3D0OA 2TMDA 4GPD1 3FNGA 4IQGA 4NFSA 2HMTA 4AJKA 3HFGA 1D1SA 3LF2A 4D3DA 3JQGB 4FFPA 3N7UA 4B3JA 5A5EA 4RF4A 1AXEA 1H94A 4BNVA 1UAYA 2IEBA 2E49A 3G79A 2Q50A 3KO8A 4RO0A 3PLNA 4YCAA 1WLYA 4W4TA 4E2YA 1I3KA 3H9EO 3T7EA 1WP4A 1CERA 4TKLA 5IFLA 2ZQZA 2VYVA 1XQ6A 4AJ4A 5AXCA 3HADA 5AYVA 3IMFA 3B70A 1I2BA 3VTFA 2QX7A 1LJ8A 3IP3A 2VTEA 1PQPA 5ES3A 1ZMOA 1OC2A 4ZGWA 3BMQB 4CLOA 2OP0A 3UCEA 2IE0A 1E7QA 1MXFA 2CDCA 7ADHA 1Z7EA 3WTCA 4BNUA 4OKIA 3S2FA 3WNVA 4CJXA 4PLFA 4QO7A 1SOVA 2QRJA 3SC6A 2NACA 4J90A 4GBJA 3CKYA 3D1LA 4NU5A 3JQAB 4JQCA 2RHCA 4MIOA 5JDCC 3F1KA 3ICCA 4BGIA 2Y1EA 4LISA 2V6BA 1ZNQO 4IDGA 3HDJA 5JO9A 2I3GA 5G0UA 5IN4A 1B26A 3LLSA 1UXKA 4R9SA 3UUWA 3WXBA 4J4BA 4S1VA 5F3RA 4KTTE 2P9CA 3DDNA 1PZEA 2JD0A 2AE2A 3PQDA 4FFOA 3M1LA 1Z6ZA 4JCOA 1HETA 4PLYA 4RORA 4BO7A 2JCVA 3GGOA 1I32A 3Q11A 1BW9A 4WLUA 2CD9A 2HK8A 4XX0A 5JS6A 4BNZA 1E7RA 2XXJA 1ARZA 3GQVA 3HDYA 5COBA 3V1YA 3PHJA 1VJ0A 4RLSA 4CUJA 4PIVA 4XQGA 2C2YA 2D3TA 1P0FA 5H82A 4BNYA 3LF1A 4L4SA 3V1UA 1ZK0A 2GERA 3GY0A 3RC7A 2O7SA 3LQFA 4I5DA 1EFLA 4TRJA 2C5EA 4TROA 4G5HA 1GUZA 1O9BA 1V8BA 1MLDA 3ZWVA 3ZHZA 3WBFA 2XXBA 2RIRA 3RWBA 3DAFA 4L76A 4IXWA 3JYOA 3WIEA 3E48A 3E9MA 3PYMA 3WWYA 1PZHA 1JKFA 4RF2A 5FEUA 2X5KO 5G2OA 2AEMA 2G1UA 5CPBA 1ZO8A 4UUNA 3H3JA 5HBRA 2E4AA 4EDFA 4PG7A 3I9MA 4KTVE 5EPOA 1B16A 2GPTA 1R0KA 1IYZA 1E1LA 3LT4A 5A5FA 5JCJD 3M1AA 3GRPA 3LDHA 4PCVA 4ZRNA 1Q0LA 3HE3A 5C3MA 3MJEA 3UW3A 4DYDA 2HMUA 3WQSB 4DWVA 2DBQA 3WMXA 5DZSA 4RZIA 3DMYA 4CM4B 4TRNA 1LRLA 1HDYA 3MZ0A 3QE3A 4C7JA 4BO6A 3CZMA 3WR5A 2EV9A 5JYDA 4GX2A 4OM8A 4WE3A 3QY9A 4XDZA 4OXYA 2R00A 5TT0A 2IYPA 3I9OA 3NT2A 4BO0A 3TRIA 4BMVA 1U28A 3PWKA 2Q1WA 4D44A 4TVOA 3IOYA 4YJGA 3GNTA 3JQ7A 1UXGA 5I9NA 2RH8A 4IJVA 4MVJA 4UEOA 1TT5A 2VOJA 1B8UA 4NIMA 3BMOA 3E5RA 4ZQHA 5K6AC 3ZNQA 5KJFA 4Z0HO 4MIYA 4B3IA 4BNTA 4JK3A 3GRKA 5K9ZA 1BXZA 1DIHA 4LVCA 4DIBA 3F5SA 1LDNA 2VWQA 4YT2A 1YQGA 1P1KA 2UDPA 4AICA 4R3WA 1Q7GA 4OHUA 2JFHA 5C7LO 4AJEA 4GLLA 1NVMB 2D2IA 3L6DA 3PHHA 4W6ZA 2GN8A 3WIDA 5I9LA 2BFMA 2CVQA 5AXAA 3ONEA 5F1KA 1OI7A 1W73A 2HK7A 3UOGA 4D45A 5AQ1A 3PWSA 3LK7A 3ON5A 1NAIA 1ZW1A 3GNQA 1JAXA 1LC0A 4J1TA 4IJUA 4FSHA 1PJCA 1H0KA 4CLRB 4ZN6A 3RSHA 3DOCA 3B1KA 1X13A 5A3VA 3WS7A 2O4UX 1TEHA 1DRUA 2ZYGA 1IL0A 2AQ8A 1XLTA 4K9DA 2HUNA 3G3EA 2DTEA 2Q49A 2D0IA 3STHA 4XR4A 4CLOB 2CVOA 4A10A 1AHHA 4E30A 3MWDB 1Z45A 3W4IA 2YV3A 5C7IO 2A4KA 4MVJG 5A06A 1VC2A 4HY3A 1HKUA 3UAGA 2WYUA 1HLPA 4CUKA 4CMHA 3ZHBA 2X9NA 1PWXA 3AWDA 2B35A 3NX4A 1BMDA 2OFPA 4FOSA 3RD5A 4S3MA 1UP4A 1HLDA 1SEPA 5FF9A 4Q3AA 4EI2A 3D3WA 3I83A 1YH3A 4W82A 2V6MA 2WDZA 4M55A 4YJHA 2G0TA 3DTYA 5LCXA 5CDTA 4OAQA 5JPIA 4NJOA 3GN1A 1HDZA 1N7HA 3HJAA 2JD2A 1JW9B 2P91A 3L07A 1E3SA 4U0KA 1Y9EA 3ETGA 4LMPA 3FBGA 3E8XA 3GVPA 2BHLA 2P68A 1ISIA 2BD0A 4NJMA 1BW9B 2BGLA 4HBGA 3RC9A 1GQ2A 3JD1A 5FI5A 2GCGA 2J3HA 3RFXA 3O38A 3HHPA 3OQ1A 3VVCA 2VZ8A 3RUFA 3AM4A 7MDHA 3O9ZA 1O6ZA 4I5EA 2Q2WA 2ZTLA 2XOXA 2ZB8A 4DQUA 4AJLA 3ITDA 3AJRA 1YL6A 4IZIA 2HMVA 1VLLA 2UUOA 4J7CA 1SO8A 1PJQA 1CDOA 2JHGA 4I08A 1LTHR 3JQEA 4DGSA 1PX0A 1MFPA 4Y8VA 1H9AA 5FYDA 4A26A 1MG0A 3S1LA 1OMOA 2VRBA 5DOZA 3GMSA 4HP8A 1K3TA 4HFNA 3TL3A 3PJEA 4TMFA 2NSDA 5T64A 1QV6A 3DXFA 3NDRA 5H81A 3H2SA 3PDUA 3NGLA 5A9SB 1D8AA 1B15A 1M76A 2EKPA 5TSDA 2X22A 1XA0A 4IGFA 4R68A 5THKA 4GGPA 2P4HX 1N9GA 3LYLA 3OA0A 2O3RA 4DTIA 1EBUA 2ZCUA 3NV9A 1DEHA 1ID1A 4G2NA 3JYLA 3IAHA 3HN2A 1Y8RA 3QVSA 1PU2A 4B7XA 3GHHA 1ZVMA 2B36A 1GPDG 2DTDA 1J4AA 1Z7BA 1D4FA 1Y81A 4F3YA 2O4CA 2O3JA 1HXHA 4FFNA 4II2A 4D0RA 4YWJA 1KEWA 1U2DA 3I1JA 2WJPA 1NFFA 1O89A 4N18A 4AG3A 4QECA 2EP7A 3GA0A 1E3JA 1L1FA 1MFZA 1V3UA 4RL6A 1LRKA 1NNUA 4DVJA 1LQTA 1P0CA 3GAZA 4PFJA 1W0CA 3Q9UA 4J6FA 2FWMX 1C0IA 2PKRA 4IIVA 4WCFA 2DPHA 4RPHA 5CG1A 4WUVA 2H1SA 3GOHA 1WDKA 4CL3A 3JQ7B 3G1TA 3RQSA 1CEQA 1NPTO 1NQAO 5MDHA 1GAEO 4UEJA 3DBHA 3ZNPA 3EHEA 5ENDA 4C4OA 4DYVA 4OGWA 1NFQA 4J1SA 4J91A 3F9IA 1X7HA 4PLTA 2D8AA 3IS3A 1V9LA 2CMDA 4FJ1A 4E5PA 2I6TA 5AOVA 1HSZA 4YQYA 1K6IA 2R6JA 4D3FA 4HFRA 1B3BA 1N92A 3Q2IA 3FN4A 4JGBA 2OXIA 3RUAA 1B3RA 4Q39A 1ZSVA 5I9MA 2IEDA 3D5QA 5JE8A 2C20A 1N2SA 4MPDA 3DFUA 3ROMA 4BNMA 5IF3A 1W6UA 3WGIA 3BMNA 4XGNA 2I9PA 1YB1A 4BNNA 3AFNA 1GD1O 5JAMA 2GZ3A 4MKRA 4F6CA 2X86A 2GYYA 4DBVO 2WYWA 3S8MA 4O5OA 3GGGA 1KVQA 1I30A 4B7CA 5TC4A 3P2YA 3PWZA 5TJ9A 3EVTA 4FGSA 5A3JA 1XEAA 2JD1A 5L7TA 1ZK1A 2O2SA 2Y93A 1T1RA 3JD2A 3MCVA 4NK5A 2Y1GA 1LLDA 1JVBA 4MO2A 1ISFA 2B37A 4K6CA 2V7PA 1P9LA 3JCZA 4BNKA 4OOEA 4BKOA 4CODB 2YUTA 3AUTA 2PNFA 1P1FA 3PZBA 4OJNA 1R0LA 4D7AA 1CWUA 2ZJ1A 1A5ZA 5KNLA 1XG5A 5MGBA 2NQ8A 3OFSA 4AJ1A 3OJEA 1C1XB 3L9WA 4Y67A 2NNLD 3CE6A 5ICMA 5KVQA 1I01A 3FF4A 2W2LD 3JYQA 4BKUA 5EIOA 4G65A 1R6DA 2DUUA 3PQEA 4RPJA 1GFSA 4XQ9A 3WGHA 5H83A 1YE3A 4BGUA 3CTMA 2P5UA 2E6UX 4E0BA 3INTA 3DZKA 3OH8A 3DBVO 3O8QB 1P3DA 4IIUA 3NJ4A 4RPGA 3K9QO 5G4LA 2VRCD 2W2KA 4J1NA 5A03A 4UVIA 4YJHB 3IKTA 1E3EA 1DJQA 2DBRA 5CDUA 1NPYA 4PGFA 3BYZA 5I7FA 1UJMA 3JQ9A 2HU2A 1R37A 1B14A 1IOLA 1QP8A 2PTGA 2Y05A 1E7WA 3VZSA 3DFZA 4TVBA 5BNIA 1PL8A 3JQGA 4Z0TA 3K5PA 3ZV4A 5COAA 4L0QA 3MOIA 3B1FA 3A4VA 2B5WA 3DWFA 4BO5A 1WW8A 1ZCJA 3DOJA 2SCUA 3SLGA 2VYNA 3KSZO 1UDAA 1XIVA 3Q3CA 4YJDA 3SEFA 1BVRA 1DLIA 3R3SA 3MTGA 3PZRA 4J1QA 4PLVA 3BMQA 4BNLA 3UF0A 1M2WA 4NFYA 3NGXA 5EERA 4IGEA 4W9NA 2F1KA 1BG6A 4IBOA 3D64A 3G17A 4XCVA 4PVCA 1EUZA 4ZRMA 5BSHA 5DT9A 4ND5A 4PZDA 4XA8A 3ZWWA 2IRWA 1C3VA 2BGKA 2DAPA 4CLDA 3ZV5A 5JCXA 1UDCA 1H9BA 4ND3A 5EESA 3RASA 3X2FA 3ZWCA 4DPMA 2NVUB 3JQAA 4NBWA 4EUEA 3L6OO 4LGVA 4ZU3A 4U6SA 2C5AA 1OC4A 4P38A 3PRJA 3I6QA 3JQ8B 4GX1A 4P4LA 1SCUA 3OQ6A 3ZW9A 1D3AA 4W7HA 4DMLA 1OAAA 4B4OA 2JKVA 1N9GB 3QVOA 5IDXA 1ENPA 1E77A 3L6EA 5KIAA 4M87A 3COSA 3AOGA 1YDWA 1AGNA 1Q0HA 4XRRA 3VPSA 1ADFA 1E5QA 1PTJA 4PG6A 1DC3A 4E2WA 1N8KA 5I7VA 2W4QA 5CP8A 5JMWA 3RAJA 1FXSA 1GCOA 1O5IA 3ITKA 1QLHA 3INGA 2QRKA 5GZ3A 1U3WA 3KYCB 3K31A 3PJGA 5T8KA 2TMGA 5DOVA 1YBMA 4BNHA 3ASVA 4CL8A 5BR7A 2FR1A 4FBGA 3QA9A 2VNAA 1U1IA 3JQBA 3V5NA 1IE3A 4IDBA 5CDGA 3OA2A 4KUEA 4XB2A 4NI5A 4GX5A 4FD3A 3WMWA 2FY8A 2C0CA 5JY1A 1IHYA 3B1JA 4L73A 3TSCA 1EVZA 3EDMA 3H9QA 1DBVO 3EAGA 1ZKMA 1RYEA 2PK3A 3V2HA 4PRKA 1HDCA 2Z1MA 1JA9A 4LSWA 4NPCA 5EN4A 4Z3KA 2JFFA 4BMSA 4ROSA 3SVTA 2CY0A 1E5LA 2W90A 1DRWA 2Q46A 4WASA 2PWZA 4LRTB 5JYEA 3FCOA 1FMCA 3QW2A 4GAEA 3W1VA 3BMNB 4DL9A 4A73A 5KVSA 3F46A 5KJ6A 2VHXA 2YV1A 2VT2A 3JD3A 2VHWA 1A7KA 2X23A 3JYNA 3RBVA 1JU9A 1P1HA 1MUUA 1BRMA 1Z74A 2ZQYA 1NX6A 3EGOA 4UVDA 2QW8A 4GSLA 2RAFA 3WFJA 2Y68A 4E2ZA 3MJTA 2AW5A 1LSSA 1M6WA 4FFRA 2FR0A 5CAEA 1XQ1A 5JDCA 2HQ1A 3WWZA 2CZCA 5HTOA 2X4GA 1X1EA 3WBBA 4AJOA 2BI8A 2X5JO 3R6DA 4Z9FA 1R4MA 1X0XA 3LC1O 1DIGA 5I8ZA 3KM0A 4EJMA 3RFTA 4CM8B 3UHAA 4I9HA 4J4TA 4BGEA 3L4SO 3MTJA 3E82A 5L51A 1DO8A 1E7MA 4IPTA 2O3QA 4IS3A 3UN1A 4BNXA 1K6XA 1WMBA 3I9NA 3KSDO 4RF3A 2FRDA 3RBZA 1GQYA 5B4UA 4E33A 4EZBA 2WTBA 3TZ6A 3MWEB 1X7GA 1XELA 5I7EA 3RKUA 1NYTA 1T4BA 4RVUA 5BNFA 4I9UA 2EF1A 4CQMD 3GK3A 4R51A 5JC8A 2NWQA 1V0JA 1QV7A 3WQRA 4A27A 3NRCA 3I52A 1N1EA 1YB5A 3L77A 5T5QA 5AVOA 2H63A 4K26A 1LEHA 1V3TA 5HA5A 5A02A 5L45A 3JQFC 3WJAA 4DUPA 1HT0A 4AVYA 1PWZA 4CLRA 2J8ZA 3TN7A 5LC1A 2I3AA 2WEKA 2BLLA 2PZJA 2YQ5A 2G5CA 2HRZA 1DC6A 3DAPA 4UVHA 1T4DA 3AUUA 4YVFA 4DLLA 2YY7A 2EERA 3ZU3A 5DCUA 2BFPA 2Y1FA 4ILKA 1T24A 3ETEA 5IDYA 3HDQA 1N1GA 2VN8A 2R2GA 4R5HA 4ALIA 2Z5LA 1WZIA 2H9IA 2XPCA 4TZKA 4JN6B 1YBAA 5FWNA 1BDMA 2Y0DA 4IMPA 3KEOA 1PSDA 3PEFA 4GKBA 4OIMA 3DZIA 4WECA 4PN3A 5ICSA 4G81A 3E1KA 4RV9A 3LZ6A 4CV0A 3TNLA 4BKPA 4W99A 1EVIA 4O63O 3JYPA 4FPXA 2GD1O 2HRBA 1ZSYA 2LDXA 3DC2A 2X0NA 3QIVA 3L9XA 3CZRA 3S2EA 3SC4A 2RH4A 1U8FO 4CR7A 5IJZA 2EKLA 3BXXA 1MC5A 1VL6A 4EUFA 4J3FA 5JO0A 5JY6A 2BGMA 3FI9A 3VH4A 1A9ZA 3AI2A 3KZVA 1ZH8A 5TX7A 2G82A 1G0NA 4BO4A 2YJZA 2UV8A 5IZCC 4B7UA 1NQ5A 4Z3DA 1T25A 5K6AA 4ALKA 1SZJG 2HAEA 1BTOA 4PRLA 4ZQFA 1ZZEA 1I3NA 4KOAA 3ZV3A 4UULA 3Q6IA 1V6AA 3LC7O 1KVRA 1DC4A 4RLHA 3GDFA 1B7GO 2G76A 2BFOA 3ADPA 2AEFA 3W6UA 4U5QA 3HUDA 3DZBA 5EL0A 4FCCA 1GTMA 1WPQA 2X9GA 4E21A 1YJ8A 1EUCA 4BL5A 4U8GA 1G0OA 1H6BA 4YACA 3AI1A 3GPIA 3ULKA 3QP9A 1RM0A 4LSMA 3QSGA 5IDWA 4XR9A 5G0TA 4ZD6A 1UZNA 1I2CA 3U3XA 2VUTA 3I9LA 3OQBA 4BGVA 5J23A 1PZFA 1PJLA 3A1NA 1NM5A 4UVGA 3BHIA 4GMGA 2BRUA 3GH3A 4LVUA 3ZGYA 1QYWA 3DMTA 4JJGA 4Q9NA 5T67A 4X54A 5A9SA 4YAKA 2O3TA 3DZJA 2P9EA 5HWSA 2GN4A 1VPDA 4KQWA 5G0WA 2HJSA 1GL3A 3AY7A 3P5SA 1XSEA 2HKIA 1ZXLA 2X8LA 4FN4A 4R54A 1R15A 1TVEA 3CPSA 4JP2A 4IM7A 5IXYA 5TGDA 4PLHA 1HL3A 3ANLA 2QIOA 1E92A 3O4RA 1A4IA 2NLOA 4MP8A 4KDEA 4MIEA 3OETA 4NFHA 4LRSB 4IQ0A 2J5KA 4HUJA 1E1KA 2EW2A 3V8BA 4J7XA 1R4MB 4NBTA 3WB9A 1U9JA 3HN7A 5IN5A 1EMDA 2X0JA 3TFQA 3QV1A 1DDOA 1W8DA 3W8FA 1MGOA 3DZGA 2PZMA 1YJQA 4HWKA 1LXCA 4KQXA 1NVGA 3BA1A 5BSFA 4XZ3A 4MVJM 2P5YA 3CMMA 2YV2A 4JBIA 5IG2A 3P2OA 2YZ7A 4CV3A 1DLJA 1LLQA 3ENKA 3MOGA 1PJSA 1R16A 3PHGA 5CG2A 3C7AA 1YB4A 2RCYA 4YAJA 4E4YA 1A4UA 4ND2A 2G17A 1ZEJA 3U49A 4OL9A 4R16A 3RUDA 2OORA 3OBBA 2Y0CA 3K6JA 2Q3EA 2EJWA 4UUOA 1JAYA 3QWHA 4LMRA 4YRDA 1LUAA 3UKOA 3G0OA 1JVSA 2PY6A 4XYEA 4BIIA 4YQZA 2YDXA 1H2HA 3UXYA 1TLTA 2I99A 4B4UA 4GVXA 1QLJA 4JBHA 4LW8A 3ZHYA 3S55A 5KKCA 4DRYA 3LC2O 1DRVA 4KMSA 1NQOA 3P19A 2GDZA 3D7LA 4Y6PA 5LDHA 3T4XA 2DM6A 2X0IA 1ISMA 2B83A 1ZSNA 5IXSA 1SBYA 2QRLA 1C1XA 4P4GA 5ENVA 4XDYA 4B4VA 4A03A 2P9GA 1AE1A 1LC3A 1T2EA 2JFGA 1GY8A 3PJFA 4QX6A 1IY8A 4UREA 4ZICA 4XGKA 5TIIA 3FNFA 3GDGA 4L75A 3NTRA 1U7HA 3O8QA 5L40A 2CDAA 4YPOA 4BNGA 4YA6A 2VHVA 2X7HA 1D1TA 1Y5MA 1ZK3A 2GASA 4M89A 3X2EA 1I33A 2EW8A 2BMAA 2VCYA 3ZV6A 2C07A 3AI3A 1VRWA 4HKTA 4B3HA 3IDSA 3DR3A 3IJPA 1I3MA 3KUXA 1H5QA 4UVEA 1ADCA 2C2XA 4D46A 2FPPA 1DFIA 2I66A 4J2OA 2D5AA 4XIYA 4RVFA 1ZBQA 1VSUA 5C7OO 4R1TA 2CF5A 1LSOA 3FTNA 2ZCVA 2X1HA 3DHNA 3WSVA 2DQ4A 2FHSA 4DLBA 2EXXA 1K5HA 1KEVA 3LVFO 2Q1SA 3WGTA 5L7WA 2DPGA 2RHRA 3TZCA 3ZWBA 1ZFNA 2VWGA 5THQA 2GRAA 3BTUA 3ROKA 1Y5RA 2EEZA 2V6GA 2X58A 3PVZA 4BKQA 3RU7A 4J0EA 4LN1A 5G4KB 3UVEA 3LU1A 2YQ4A 1U3VA 2LDBA 1JKJA 5BSEA 4FQ8A 1PQWA 3H7AA 1ADGA 1E6UA 4RQUA 3ONDA 1ZK2A 3Q0EA 4J2HA 1E7YA 4NBRA 1E3LA 1TB4A 4WLOA 2VHYA 5KKAA 3TPCA 2AQHA 2DU8A 4EEXA 1HE4A 1XU7A 2NVUA 5GZ6A 1HYEA 3U4DA 3W6ZA 4ALLA 1PGQA 3E9QA 3GMDA 1EDZA 4TRMA 3KV3O 5L4LA 2HJRA 5B12A 3JQ8A 2J3KA 3VOSA 2DKNA 4ND1A 4XD2A 1XKQA 1CJCA 4QFDA 1QYDA 3GVCA 5DP2A 3V2UA 3BAZA 5CDSA 4MJLA 2CFCA 1NWHA 2AQKA 3AOEC 2DLDA 1AUPA 2IXAA 1ORRA 2OBYA 3DHEA 1RM5A 3OF2A 1BXKA 3KEQA 5TRTA 4CV1A 4D3SA 2NUAA 1QORA 3H9JA 3DOOA 4XKJA 3H9UA 3O26A 4YRBA 3EYWA 1P1RA 1KEPA 4DBZA 2OBNA 3HB4X 4URFA 1WZEA 4XRGA 1KYQA 3GEDA 2WD7B 1DIAA 2C29D 1K89A 2W8ZA 4PVDA 4CMIB 2CUKA 1SPXA 4YT5A 3VH1A 4RVGA 1W4ZA 3KYCA 4INAA 3C1OA 3DEYX 2ZIZA 2QYTA 3EZYA 5DCWA 3DBLB 4Q3NA 5JCJA 5CFZA 1VM6A 3PFFA 4GI2A 4OKNA 4QQRA 1JQBA 4YAGA 3F5QA 3BTVA 5IZ4A 1F17A 1WAMA 1QYCA 4P8RA 1FF9A 2NVWA 3WYEA 3DL2A 4EUHA 4PG5A 1E6WA 1NAHA 1P77A 3QRWA 4IXTA 1WDLA 1KC1A 2HDHA 3NTOA 1A71A 3WQQA 1Y7TA 4IDAA 2PR2A 3WGZA 3NDJA 4GLOA 4MINA 1QMGA 1U7TA 1ISGA 4LCEA 1RM3A 1TI7A 4BS9A 1ISJA 3I4CA 2BELA 1GUYA 3ANMA 1YGYA 4YRAA 3NJ8A 1EK6A 1H93A 3E9NA 1HTBA 3I5MA 4GKVA 1OFGA 2AG5A 1I8TA 1GEEA 2BKAA 1LX6A 4DIOA 3JQCA 1TA4A 3OJLA 3IC5A 4FW8A 2FR8A 2YHIA 2B4RO 4E13A 1DIBA 1U2GA 2IYOA 1R4NB 3D4NA 4GSKA 3C24A 4CM9D 4ONEA 4MKZA 3O03A 1MG5A 1UZLA 2CNBA 2J3IA 1E0DA 4OXNA 4XQCA 3PGXA 3QWAA 4MOWA 2ZJ0A 5EQFA 4HFMA 4YT4A 1C1DB 2XF8A 4CPDA 1JLLA 1CRWG 3A28A 3TDKA 3KBOA 3C3XA 4CM8A 4AJNA 5F5LA 4W7IA 4IDDA 1K2WA 3NT4A 4FGWA 2FOIA 1EK5A 4CUZA 2BF7A 1M75A 2ET6A 5JAIA 2OHXA 1F06A 1J5PA 3BIOA 1RPNA 3AUSA 3JQDA 4DMMA 1YS4A 3I9JA 2NTJA 5A9RA 3NAQA 1LBEA 3DB2A 3WG9A 2NU6A 2D5CA 4O59O 3C85A 3KVOA 1GR0A 1XYGA 1GYQA 4PLCA 5KCZA 3GAFA 3TL2A 4TSKA 1N7GA 3H5AA 4RVSA 4I5FA 1UUFA 1PGNA 1UR5A 3JSAA 3ZZNA 1Y8QA 4L4RA 1QKIA 3TWOA 4DC1A 3HDHA 1GZ6A 2DT5A 1YQDA 3L0DA 1SEVA 4B8WA 1PJ3A 1D7OA 4JXKA 1BSVA 1HEUA 4O1MA 2OMEA 3ZCXA 2Q99A 2NU8A 1LNQA 1F14A 2VYVD 4H7PA 4BO3A 2GZ1A 4BUCA 5U4QA 4CMEA 3NUGA 1NASA 4L4XA 4WLNA 3RKRA 5DBGA 3ICPA 2IODA 4CV2A 3H4VA 4N5MA 3S2GA 5KWEA 5ADHA 2VT3A 3C7CB 3U4CA 4WNCA 3V2GA 2C7VA 4L9RA 4R1NA 1S6YA 1GZ4A 4DC0A 4FOOA 2I5PO 4BKRA 1U8XX 4L8VA 3GNSA 4RVDA 1XHLA 3OMLA 2BH9A 3A9WA 5CEEA 4QEDA 3IKVA 2Q45A 2IZZA 4XJSA 5HM8A 1YO6A 1T1SA 2XAAA 4IUYA 1SC6A 2Y67A 5B4VA 1HZJA 4C7KA 3KTDA 5KVCA 1QSGA 2VWHA 4XJTA 5C37A 1LA2A 3QVTA 4FB5A 1FJHA 1Y6JA 3DHYA 4BO2A 3HFSA 1HF3A 4IJKA 5ITWA 1QYVA 1DFHA 3GUCA 1VKOA 3OJ0A 4XIJA 4Q3EA 3R3JA 5LDGA 4WEQA 4NG5A 4IDCA 3TJRA 2B4QA 3BTSA 3H65A 5U1PA 1GV0A 1DXYA 1LU9A 3F3SA 4HNGA 3SBOA 2AMFA 5T57A 3NTQA 3GEMA 2WWRA 3JTMA 4H3VA 4WLVA 3HSKA 3ENNA 5EJ2A 1X14A 2Q2QA 3AK4A 3E5MA 2DFVA 4WGGA 1IHXA 3FWNA 3WNQA 5BNTA 3GEGA 3A06A 4CM5A 5JNLA 5F21A 1KVUA 2EJVA 1KIFA 2VZ9A 4NQZA 1CQIA 3L4BC 1KOLA 3WX0A 3QWIA 4NHEA 1IZ0A 2VUSA 3NT5A 3RU9A 3R0IA 1RYDA 4YTEA 2Y1CA 3ORFA 1LI4A 1JWBB 1NPDA 1E3WA 4UAGA 4JJIA 3RJ9A 2AEJA 1U5CA 5JDIC 3OSUA 3NDIA 1NVTA 1VJTA 1ENZA 2D1YA 5TLSA 2B0JA 1KC3A 3Q2KA 3F47A 4AJPA 4A7PA 3RUIA 4CLXA 3GFBA 3WLFA 3ONFA 4FJ2A 1GPJA 4QO8A 1Q2XA 3CXRA 1F8GA 4GVLA 3TF5A 4LCJA 3OIFA 4EJ0A 1YXMA 4Y6SA 1P74A 3MEQA 2OL4A 1SAYA 2HK9A 2DBVO 4ALNA 4R1UA 2NADA 1Z82A 1T2AA 4GWGA 4H16A 4ZVVA 3TZKA 4B8ZA 5B1YA 3U4IA 5BT9A 2Z1NA 1HZZA 3PFWO 4YDRA 2NU9A 1CQJA 2B5VA 1JKIA 3QVXA 3UCFA 3KYBA 1AN9A 3RVDA 3VH3A 2YHIB 5ER9A 4E3ZA 4RGBA 2JJYA 4IDFA 1XU9A 5DN9A 2NU7A 4N54A 4BB6A 4YR9A 1BVUA 1SNYA 1WNTA 2FPGA 1HE3A 4MVJP 2PGLA 3E18A 4W9NC 5EQDA 2ILTA 2NVBA 4WLEA 2C59A 3FWZA 5DP1A 1PGOA 3DONA 4GX0A 3K30A 4MVJD 1DHTA 3NEPX 4FC7A 2A35A 3WJ7A 4RZHA 4Y6RA 4TWRA 1RKXA 3U62A 3QLJA 2X9VA 4II3A 3GR6A 5ITVA 5L53A 2GUGA 1NFRA 3AU8A 2Y66A 2X6TA 2C82A 3H9GA 5IZCA 4NNJA 1X0VA 1HYGA 4KUHA 4R41A 2JAHA 1HDOA 1VL8A 3ZDFA 4EEZA 4ND4A 3ZI0A 3DO5A 1NR1A 1PJ4A 3ZU2A 1HRDA 4DPLA 1HE2A 5L3ZA 2AE1A 2YHUA 1WVGA 4FFMA 3RUCA 1Y8QB 3VPFA 1LSJA 1LDYA 3D3EA 1L7EA 5F1PA 2OOSA 3PHIA 5EINA 4XWYA 2W2LA 4RQTA 1NTOA 1A72A 5JSFA 1P44A 3JD4A 4Z9YA 2WE7A 4K6FA 3EK2A 3Q1LA 1M66A 4KWIA 1ULSA 2O50A 4GH5A 1I36A 3K2EA 3JD0A 3NYWA 4I9NA 4OSPA 5T8KC 3WDSA 2HMWA 1T26A 2EHDA 3VKUA 4ESOA 1XR3A 3ROPA 2IZ0A 2GO1A 1PJTA 2VRCA 4WOKA 3VPGA 4YXFA 4M49A 2CSUA 1F8FA 1FDWA 1PJBA 4Z0PA 1VE9A 3K92A 2DVMA 3H5NA 1RJWA 3MJVA 3OJOA 2YFHA 1UXHA 5JW6A 1NHGA 2FN7A 2Q4EA 3AW9A 1B0AA 3RCBA 4CMKA 1BXGB 3DAGA 1FDVA 1FDUA 1B2LA 3FRJA
chains in the Genus database with same CATH superfamily
1N0HA 3MAGA 4S1NA 3N7TA 1TMGE 1PGJA 5EI5A 1YCGA 2VBCA 4YHBA 3CGGA 2GRJA 3TPFA 5C46F 2CFIA 2HSZA 5E2IA 1PYGA 3K70C 1I4WA 2GX6A 3LMKA 2C4HA 5FDFA 2F17A 2ATIA 2C5GA 2V3WA 3QU4A 1NP3A 1KDPA 1A9QA 1DWUA 2PRZA 4C03A 3QFSA 3SQNA 4I4CA 3RYFB 2VZ0A 3QFHA 2FWAA 4HDNA 3IE0A 4M8KA 3E9YA 3HN6A 4IYRA 1QF9A 1J20A 1MQ9A 2C4UA 3MCAA 1OXBB 3IP8A 4WIAA 4Q7LA 4RHCA 5TGZA 2IYZA 4HPWA 1TZJA 1GNTA 4RIHA 1A96A 4FT4A 5K6RA 5IM4A 2PWPA 3CSDA 4XM0A 3LDGA 4MV5A 5CYFA 3RODA 1FB5A 3EWAA 3NYRA 3VVLA 3KXDA 2YOHA 4AMBA 5C1PA 4AZWA 1L5VA 5DHFA 1O95C 3ZCXA 4RFVA 1HDXA 3AUJB 2A1TS 3T95A 1WV0A 2YC2C 2EG9A 5TS2A 5I8PA 1NMQA 3T4EA 4GS5A 3W5CA 3B82A 1BGVA 3FD8A 5E1DA 4CQNA 4RADA 1ZWKA 5FT9A 1FMLA 1E2NA 2O54A 1LI5A 4IY1A 2YWRA 4BV8A 1QS0A 4RFLA 3CZ9A 2QS9A 1JHUA 3H2IA 2IYVA 3OFND 4W5OA 3O82A 3FVVA 1G4UR 3NBZC 2RE8A 4JHXA 2GPJA 5G4KA 1ZGHA 2FDRA 2GYWA 1U3TA 1CQIB 1P31A 2FRDC 3FYUC 3MT0A 3OP4A 1RZRA 3ZGLA 4L5IA 3AHDA 4GR5A 2JGDB 1K63A 4DM3A 1EFRA 4LJ9A 2V6FA 4Q9LA 3SKYA 2Y0EA 1FX0B 1Z9BA 2KSQA 2PFKA 3UB3A 4D57A 1W5BA 3KOUA 2ATCA 1XD9A 5TF4A 2PRJA 1Q7CA 5FL7D 4RVCA 2PUJA 3INRA 3KZMA 2CJWA 4E3WA 4RK6A 3ETDA 4HLUA 4HX5A 5DBIA 5EXEA 3WZLA 1H5UA 1GG2A 3F98A 5GGXA 1FYEA 3DDWA 1FP6A 1RWMA 2WHRA 1RKVA 2L18A 2UYQA 2WLSA 2C7BA 2B34A 1E2PA 1RQXA 2VF5X 1SVLA 3EA5A 3FSGA 3ZLTA 4CMCA 4C01A 2E4UA 4R3NA 1YZLA 4DSZA 1ZKDA 4INOA 4GP9A 2Z56A 3GDOA 3CMCO 3D5TA 1EFCA 3NHPA 1YMQA 1FC0A 2UAGA 4KIJA 2OZEA 4P3KA 8LDHA 1KVTA 2FPOA 3P9CA 1J2RA 4JUAA 5B3KA 4LV5B 3VPHA 2IEYA 1GCUA 1I3OA 3NEYA 4I6GA 3UMCA 5JC1A 3FIJA 3MCUA 1XA3A 1Q1GA 4G9GA 3BICA 5IT9A 1VKZA 1ZHOA 1GPH1 2YYYA 4ZCLA 1TCVA 3T3HA 3BSFA 4F0JA 4QQKA 3FUCA 1JEOA 4OJYA 1YDEA 1PRYA 4LZZA 4LX0A 1F3OA 3DCNA 3Q9NA 4BQFA 4EIWA 3GVXA 3LCVB 2J3DA 4QQNA 4UQLA 2QNBA 1FTGA 4R9UC 2WWFA 4WKPA 5FCDA 3M3DA 2JIZD 4JIGA 3R7WA 3EOAI 1SBNE 3TUJC 3ZCPA 2RGEA 3ICEA 1C7QA 1YWGO 3CIFA 3LPNA 1ZN7A 2FHPA 2G83A 4OLHA 3ZCSA 3REFA 3P0HA 3KYJB 1CE8A 5LQNA 2W42A 2HDWA 2WYOA 3E7XA 2EWVA 3OJFA 4HRYA 5HP4A 1NDHA 3F5FA 2ZSEA 3RIXA 1GU7A 2IHUA 2XOKA 4RD2A 3S40A 4A5SA 2IW3A 3HJRA 3HI6A 2B78A 4CLEA 1E1MA 2YW9A 3OG9A 4Q4JA 1ZJZA 2Q6TA 1EJ2A 4WXYB 3DA8A 5CM8B 1VJDA 2PA3A 1GPMA 3DBRB 3IQHX 2C00A 4M0MA 4RVNA 3LUJA 5B55A 1W46A 4RWEA 3I12A 3URMA 4GOND 3WBJA 2NZUG 2DQKA 4U7GA 5HZHA 2OXRA 3OBIA 4I14A 4FHCA 1NUSA 3E03A 4CM1A 4ZYLA 1L3IA 3DAYA 3KOZA 3A9VA 3NRBA 1H2YA 4JQOA 1LZLA 4BNIA 1NKVA 4WAUA 3ZVLA 1PS0A 4YP7A 1QZXA 2F67A 3EDOA 5BYKA 2OBXA 2HY7A 4YP6A 1EWYA 2IF2A 1ZJYA 4TXNA 4Y7CA 2ZCJA 3V4OA 3LCRA 2O8DA 1G7SA 1Q92A 2A1UA 4LGMA 3IDOA 3U7FB 4BFTA 2SKEA 1PT5A 4IGKA 5IM5A 2XD9A 5EFOA 3FFXA 3BTOA 2VSXA 5IAOA 1YI0A 2YOFA 3TSZA 2C2OA 4I46A 5CB4B 3RIHA 1KSGA 1ZBDA 4BZWA 1RC0A 3VC2A 3GQBB 5CCBA 1Q0ZA 1KE2A 3EGWA 1QF6A 4LTNA 4A4DA 2EATA 4GZLA 1JTFA 2JHAA 3FVRA 3HXPA 1N7IA 1NZFA 3NC4A 4YO7A 3NKLA 3AXTA 5A62A 5IWAB 1JI3A 1EA7A 1PQUA 1KARA 4AKIA 1YS1X 1GPYA 1PAUA 3LGSA 4FDAA 5FFFA 4XYLA 1M2VB 5BRAA 1FYXA 3N58A 4EQ6A 2J1LA 4FFBB 2AJLI 3N05A 2JI6A 1FNSA 1MO4A 4IH1A 1V7CA 3L1JA 4G23A 4PFQA 5HIKA 4ZVQA 1KJIA 1JFRA 4YT8A 1P5HA 4BZPA 2Q3FA 1C5KA 3BWCA 3NOOA 4HYYA 3R7FA 4DJDC 1S8FA 2I33A 2V9PA 3WRYA 1GWNA 1NVXQ 4C9BA 3W9BA 4LHYA 3K1AB 1FSZA 2XB9A 1OVGA 1M8FA 2XTZA 4OD0A 4YS6A 1P91A 2BMWA 2CDBA 2O1WA 3DTNA 2I03A 1MJ5A 4AO7A 2UYCA 1DJMA 1WXDA 2OG2A 3IFSA 5TQVA 1JAIA 1FYWA 2IX9A 2H0QA 4QUKA 3ZWYA 1KHHA 4NU6A 4RKQA 2H2DA 1DB3A 1EFKA 5H59A 1G21B 3ZNNA 1PR9A 1RAHA 3D3NA 3G7NA 1R8SA 4OGKA 3R6GA 3VZRA 4BJ1A 1EBFA 4KX3A 1FY2A 2X0RA 1UXJA 2DCUA 5FI3A 1F8YA 4I5GA 2QBYA 1LLFA 3KL2A 1OE0A 4PZYA 5AHOA 4EKNB 5HS4A 3IBCA 3IQWA 5LLDA 4DA4A 1FE8A 1NVBA 4JGIA 1BKDR 3KAQA 5GZ1A 2FMFA 4GL4A 2VJMA 3K5IA 5ILOA 1GO2A 3DZHA 3KZXA 3PP8A 5HMMA 1HL7A 1GHTA 1P4JA 2GJAA 1O94A 2RGWA 1SU7A 2ZB4A 3OO0A 4FFLA 4H7JA 1ILEA 3EZ9A 1D2EA 2L82A 4UNQA 2WIFA 4EGQA 1SD2A 2YINC 4X1YA 4OX9Y 1YBVA 1C2TA 1OILA 1EUDA 5G40A 3WA6A 4GMFA 1VLZA 3WO0A 3PI6A 3GUYA 4D99A 4E1AA 4HXGA 4JLWA 4Y2HA 4MUXA 3TM4A 3RS0A 1A5TA 3KOWA 1DKLA 3BRWD 1L5SA 2WU8A 3ET5A 4P3OA 1CSEE 4PLGA 1SCIA 3WLEA 4LZPA 4DLZA 5AW7A 4TYWA 2WJHA 3IUJA 1U99A 1G20E 1N5JA 3AZOA 5JLAA 1VG1A 2PXAA 1NR5A 1YU9A 2K4MA 3UA4A 1F12A 3FPCA 3ASUA 1TU3A 4R2LA 3E9CA 1KOGA 1L5WA 1N8SA 1NBHA 3K09A 4PGHA 1M1UA 2ODWA 3GRFA 4DIUA 2OC4A 2AFRA 2J41A 5BSGA 4K6MA 2O8CB 2ZIXB 4EYOA 1XNHA 2I22A 4TV9B 4F6LA 1Q15A 1F8UA 3QU5A 3Q8LA 4UHKA 1Z16A 3ABIA 4N3BA 3UJ8A 3WAKA 4XVUA 3UHFA 1E7SA 2X0KA 3UMMA 4QBTA 1LDBA 2X4DA 1MIOA 2VG8A 1MJGM 4O0LA 1E9CA 2QUAA 1SVWA 2HD4A 3BEOA 2P9TA 4BV3A 1RAFA 1F9EA 5A2GA 4FS3A 1BCRB 3Q5DA 3UFXA 3GN2A 4WLFA 3TZHA 2XGSA 3A0UA 3ACBA 2QPOA 1HDGO 1M6VB 2PGDA 3B1VA 1Y1QA 1EQAA 1VGVA 2GGSA 3LBAA 1O8CA 4PRZA 3GUHA 2GN2A 2E48A 3GLFA 1MQSA 1OKKD 1VQ1A 2DUNA 2OBBA 2BKUA 3VMMA 1N6LA 2W6MA 3TTTA 2GVDC 4C0KA 4CKWA 4FX5A 2PKQO 3PCRB 4J7UA 4TS1A 4F46A 3H8SA 3EA0A 2B6HA 3TINA 4PINA 2A30A 3KSUA 1WVMA 3RJ5A 3CEAA 4EBBA 3MA0A 1YR6A 2BMEA 3DW3X 2E37A 3C45A 4NK4A 1EFUA 4HQFA 4X8LA 4AJHA 4OFXA 4UXIA 1LVHA 3BZWA 2HCTA 1JLHA 5FLKA 3ZWCA 5IBCA 1XMOB 2GZHA 3PA6A 4OREX 1Z75A 5C34B 1AZTA 2O0JA 1LLCA 3PPIA 2EZUA 1JXAA 4RENA 4RACA 2QRZA 1OZAA 2Z04A 3DTVB 1T29A 4G5OA 4ISCA 4JFAA 5CW2A 3T7CA 4BNDB 3K70D 1JALA 2OP1A 2E5WA 3L8YA 4YJGB 3CUTA 2PZAA 5EG5A 2HLHA 3UJ6A 5FA6A 1A95A 2LIVA 1TEXA 4RJTA 3I9V6 1N0VC 4MW4A 2LR0A 1TT5B 1D9XA 4WNIA 5E8RA 1NA5A 1I2ZA 2OUKA 3ANNA 3SS8A 1Y7PA 1SKAA 3MJCA 1I2MA 2Q0SA 1CRPA 3SPXA 5JI3E 4O4JA 2XYRA 5D3ZA 1F2DA 3BWBA 1N0IA 4RPKA 2AXPA 3GOQA 1E9BA 1KI6A 1T3HA 3ROQA 2V7UA 4JX9A 3HXOA 4LOKA 2ZB3A 3RVNA 1AF7A 4Y2RA 4RKRA 4UDOA 4G0PA 2ZJFA 3L05A 1W2GA 1UJ4A 1QC5A 2IPXA 1XF9A 4AD8A 4E5VA 4JB0A 3T3GA 5B1DA 2QZSA 1VPEA 1Z0SA 4PSKA 5L6MB 3OU7A 5BNWA 2QPLA 1MW8X 1XDWA 5DWDA 2EL7A 1RQRA 4C3OB 1KY4A 2JDID 8ADHA 1I5RA 1UKEA 4TLMB 1KH1A 1ZAKA 2VSFA 4DAEA 5FUWA 3QYAA 1J0AA 2BGJA 3ZD9A 4FDMA 1RLMA 4NCKA 1G2IA 1KVSA 2MYTA 4NCHA 3MBOA 1NJ8A 1B6GA 1BOFA 1TU0A 2QZ9A 3EUEA 5KVVA 5BMVF 5FTKA 3WGGA 2O3SA 3ANYB 4KAXA 1FRVA 3VR2A 1U9ZA 2F9FA 2RI0A 5A9TA 3K2BA 5CDFA 1HC7A 1HE1C 1QHHB 1NWCA 1YS7A 5HE9A 3VI4B 4KR7A 3B13B 3NASA 4MVJE 3GLRA 1CT9A 4X8OA 1STOA 4L74A 4TTRA 5LN1A 2GHRA 4YBRA 5AVSA 4YBZA 4DUZB 1FLNA 4YAEA 4QRHA 1JLKA 1H1LB 2IUYA 5FNZA 5BWBA 2I6GA 4DIFA 2ZJ4A 3GJYA 1V43A 1DOHA 3AUFA 3QVVA 1QIJA 1AKYA 1X74A 3JQRA 4RFSB 5EP1A 2O3UA 1T8YA 3NHAA 4J9UE 4RV5A 3AV3A 3B6ZA 4E5KA 3CZQA 3JVEA 1M34B 3LHFA 1BX0A 2ID4A 1W88B 3TMKA 3WL5A 1K0UA 1IPEA 1C3JA 3WY9A 4ENSA 3J81A 5JZ9A 2R79A 2I4LA 3VNSA 1SOWA 2XEDA 4V0LA 3SLKA 4B80A 1A8HA 4RDHA 5GPBA 5LQRA 2H0RA 3WLPA 3FNEA 4KIFA 1NBMA 4MKFA 1CULC 1GRCA 3NC0C 4Y6LA 3R9XB 3E7PA 3FPJA 1FNNA 3LBIA 4ZHQA 5SY6A 2FK7A 3HA5A 3DDHA 3E15A 4BZZA 3WYGA 2UVQA 4LCBA 3OTWA 1Y80A 4FILA 1PV1A 2C4VA 2HF8A 1XQXA 3EYAA 4O4HB 2FDXA 2ZTSA 2UUPA 3MCZA 1XXHE 3TUIC 5CIQA 1OGJA 2OK7A 1SK9A 2WE8A 3DFIA 2C4KA 3ZWDA 1O58A 3GJ4A 1S2NA 2YJGA 4OTZA 5U9CA 2F48A 2XRFA 4Q9JA 3F7NA 4NZPA 5F5NA 4M1ZA 1EZ4A 3LHKA 3S4YA 3MWKA 5DF1A 2VNKA 3V4SA 4QARA 1JDJA 5JNWA 5DXAA 2V74B 3TSWA 4ZO4A 3INNA 4PPQA 2VQ3A 4I9FA 1NULA 4U7HA 1KFEB 2ALJA 3ZNPA 3M83A 3F90A 4NJMB 4PRYA 3CLTC 5L9AA 1C9KA 3VJLA 5KSZA 4HDCA 3MW8A 3TAHA 2B8NA 1M74A 1YD7A 1P0PA 2ZWOA 2J0UB 3CH6A 3N5CA 2DTXA 4JYZA 1NXQA 2CFTA 1KS2A 5MFPA 1ZD8A 1RQ2A 2DULA 2CV1A 3ZE6A 2B1RA 3QLVA 4O2AB 3DFFA 3K73O 4DT1B 4J43A 2P30A 3K8ZA 1ATIA 4IMRA 4YLEA 3IILA 4IV5A 3C48A 4XVQA 2CDRA 3Q0IA 3SEZA 2DBZA 3SXJA 1ABFA 1MAWA 3KSMA 4IDEA 1GG5A 3PUVA 3VR6H 1BU5A 1DMRA 3IHLA 4LWQA 3WWCA 5CFMA 3LXRA 1EK1A 3OQJA 2Y0PA 1IJKA 3B8HA 2Z4SA 1GNVA 2O48X 1GSAA 3GT0A 1JA0A 3ILVA 1VHQA 1L5MA 3MGAA 4IIGA 4Y6GB 2HHAA 4XD7A 5FOXA 3SX4A 3VNUA 2H07A 1QYXA 3DMRA 1X7DA 4FK8A 4JJAA 3WO1A 1JYEA 3G02A 2GSDA 1SRQA 2X9QA 2YQZA 3FWHA 3FCXA 3ZHCA 2NUPB 1PFYA 3KPWA 3WL3A 3SSMA 4Y3UA 3AH8A 5FUXA 4XM1A 1YKFA 5ALWA 1MP0A 4C4RA 3KXPA 1MA0A 4LXUA 3U7QB 2HJ9A 3MOSA 4FIZA 4D1YA 4ZQIA 3DDCA 1TKAA 3VR4H 1ONBA 3GD7A 3PJDA 5CH3A 1O87A 3TMAA 4EFKA 4NOKA 3H6GA 2LE0A 4H7KA 2JGDA 4KQGA 4MCJA 2QVCA 4EELA 2QI9F 2WKSA 5C8XA 2ENWA 3VDRA 1ZUHA 1QR6A 4PR0A 1ESEA 1YZNA 5EJMA 3JQFA 4IH4A 4RDXA 4EW2A 1GQQA 1LI7A 1I4TD 1L9KA 3PTLA 3BVPA 3T54A 3KJFA 2OV6A 5LZ8A 5AM2A 2NQTA 3VHRA 3E5NA 3HVHA 4G1BA 4KWEA 3AR8A 4QODA 4WCFB 4Q3KA 4X90A 4TKVB 5IVDA 2VHEA 2CJFA 3M34A 2DUWA 2QL9A 3ZBQA 5F1OA 1SXHA 3II6X 4WZAA 3DXZA 3S2YA 3M5CA 4FEAA 1EWRA 4BX8A 2VJDA 4KEAA 2BCEA 5EQJB 3DS8A 1CK4A 3WGOA 3NZEA 2O9JA 4OQYA 1NVUQ 1RXUA 1GSIA 5BSKA 3KV1A 5TV2A 4CWAA 1CFJA 3BAFA 3PK0A 1MW9X 1P2BA 2PGIA 3VDQA 3I58A 3QVKA 5AESA 2J59A 1OB5A 4OQZA 3AY6A 1ZQ1A 4MQUA 2ZE5A 4R2KA 2CXHA 2H51A 3KQOA 3PSHA 4URYR 4DXAA 6CHYA 2AZ4A 4IIJF 1Z2EA 4BNJA 1WQ4A 2O5VA 3NIGB 4GNRA 1H69A 1N5OX 1YRLA 1CHNA 4H3SA 5J1SB 1D6SA 1MC1A 3ZDYB 1KI1A 1DHRA 2YOGA 3ZZ1A 2GNAA 5HZKA 2OUIA 1V9SA 3CURA 2JHFA 1IUKA 1OV6A 3RSSA 1CETA 1ZCFA 4X66B 2V7QD 1TPZA 1EKXA 3A14A 1PHPA 3V1TC 4J4HA 4NYIQ 1J9GA 2P7HA 1RMYA 3ND8A 3B8EA 3EG5A 3T06B 3WJ2A 2VDPB 5ALKA 5DX1A 1N77A 4A82A 3ZHQA 1JNYA 5J2UF 2QSZA 3RHZA 1VYVA 4WOBA 1PEDA 2DFLA 4OBXA 1MNQA 3TL6A 2PGJA 1GITA 3DBRA 1YBHA 4RANA 1VJGA 5HS6A 3PEWA 2VOEA 2XH8A 1T2FA 3QTLA 2QLFA 3JR3A 4MDHA 4MLPA 3ZHUA 1EP2B 5F3WB 1EDDA 4W1RA 1XQYA 4GKAA 3G0HA 4LPKA 2PFSA 2V5VA 1J90A 3VV2A 1TKRA 3LSYA 3RYTC 1ZIDA 3SYMA 4IINA 1EHYA 3TIIA 3ZHOA 1PJ2A 4F3RA 1XLWA 3EJ6A 3I30X 2YN2A 2AOXA 3C5EA 3B20A 4MICA 1TW2A 1QU2A 1QUFA 2QLMA 4U4AA 3L5KA 2AXQA 3EEOA 1FZTA 4D43A 1IBCA 2HV9A 2IXBA 2W71A 3LCJA 4N3NA 5BPHA 1M1XB 3IUPA 1UXIA 3K6SB 2V4MA 5KJ1A 2XOEA 4Y9RA 4ZQGA 4RGQA 3X1XA 1F0YA 5DHQA 3VZDA 4PS0A 1Z3IX 1USUA 1GSHA 5CB4A 2HK6A 1V2GA 3Q5EA 4YJ2A 1V3VA 1WSBA 3FGPA 1D07A 4LZLA 2NTNA 3JATB 1NURA 5M5BA 2NPOA 2ZRCA 3D0OA 3GQBA 3GU3A 5TQ2B 5EKUA 3T12A 2RGNA 1VL1A 4EEKA 1P2FA 2HMTA 1MPXA 3LF2A 4HJXA 4UOQA 3UPDA 4AROA 4YR7A 4BX2A 4F12A 2HN9A 3SIXA 4JB8A 4C7BA 5LKRA 1UAYA 1YR1A 1M2VA 4DIMA 4B3MB 3U4MA 4FFBA 4RO0A 3NWJA 3V7WA 1WLYA 3P9ZA 1L7XA 3BX1A 1WP4A 4P4TA 5CCDA 2SCUB 4KW7A 3N86A 5IFLA 3UKJA 3H04A 2ZQZA 2GJ9A 4PYIA 1CCWA 3EDCA 1TZBA 3PX3A 1U7UA 3IMFA 4MRNA 2QX7A 4D92A 4XEUA 4LF8B 2GK7A 1QQ5A 3K1AA 1ZMOA 2BFNA 3IA7A 3BMQB 4RQAA 4CLOA 1U2QA 3DYVA 4C3VA 4O1HA 3CW9A 4R0MA 2X15A 4HHEA 1T15A 2AHOA 1L7NA 1ZHFA 4CBVA 2UUCB 3UWDA 5J4YA 2ZI6A 4ABTA 1G21A 1SC4A 1SOVA 4YK7A 5FOQA 1N6RA 2QRJA 2SNIE 4HAIA 1JEAA 2IE8A 2EX4A 4Z5XA 3LUDA 2C98A 2DWPA 4HMQA 3OTOB 3BIWA 4E4TA 2CL0X 3QW4B 4MIOA 4JZYA 5JDCC 4HAVA 1KMCA 4BVFA 3LY9A 1KYYA 2Y1EA 1CIJA 4AECA 3QY0A 2JFYA 1V7PC 3TEJA 2R97A 2V6BA 2X14A 1TOAA 3W5HA 4NV1A 4EY4A 3KKKA 2Q5FA 5AQEA 5JO9A 3IGFA 2I3GA 4IGAA 2ID8A 4GQIA 4DRXB 1QR2A 2GOYA 4C6HA 1B26A 4H9GA 4R9SA 3KJIA 4DA7A 5EJ5A 2WQZA 5FBLB 1Z6TA 4ZT6A 4B40A 5FTMA 5GIOE 2P9CA 1ESNA 5E3HA 2JD0A 4ARSA 3M1LA 1AQYA 4S2EA 4BO7A 2JCVA 1RLOA 1QHIA 1SWWA 2YTZA 5I9TA 2EFCB 4CF3A 3GGOA 4BVGA 4WLUA 5BO5A 2CD9A 1E5VA 4HLNA 5JS6A 2HR1A 1NXXA 1WOYA 3G8AA 2PYZA 3HDYA 5F7JA 5MHTA 1T8TA 3C6BA 4R9NA 2BZ1A 4AN4A 5BRJA 1YMUA 1P0FA 1LPMA 2W2NA 2YWBA 3P2JA 4GOMD 1E59A 4RD6A 2BGWA 2J6HA 3I2HA 3MD0A 1ODIA 2B2CA 5ALOA 4FYJA 1B6SA 3L8HA 3RSZA 1E9DA 1LV7A 3KPVA 3LQFA 2ZIXA 1EFLA 3NHWA 2C5EA 2DH6A 1J8VA 1GUZA 1O9BA 4G5HA 4QU5A 5HM6A 4LOJA 3WBFA 4BCBA 3PNSA 4L16A 4OAOA 5EWMB 5F98A 4L76A 1G6OA 1Z35A 2PH1A 3RTEA 1YGPA 3OZBA 4UFOA 2JA2A 5DM70 3V3TA 3HV2A 1VSTA 2PGXA 4JR2A 4RF2A 3RRMA 1LX7A 1XHEA 4PC6A 4RE6A 5BV0A 5FEUA 5G2OA 5KSWB 4CKCB 1TA9A 5HBRA 5DB4A 1XK6A 1B0PA 5LZ7A 4HDKB 4MA4A 3KVYA 4G01B 1T9CA 1M6VA 3BH7A 2EW1A 4KTVE 5EPOA 1F4VA 1PR2A 1U2RA 3QF4B 5DXJA 3ORQA 3IPCA 1Y3BE 3A10A 3ZLVA 1B76A 1R0KA 1KJ8A 2IHNA 3X44A 3M6VA 3Q6NA 2G7ZA 2ZRDA 3BSYA 4D80A 1PFWA 3GRPA 1VOTA 1MAVA 2Z30A 3EZ7A 4I3FA 4UBMA 3R76A 3T9BA 2EL9A 2ZJBA 4AUMA 4ZVKA 3WMXA 1MO3A 1QTRA 4M7WA 3SQOA 3TLAA 3I5YA 1EB9A 3K6KA 4S04A 1UBGA 1AH2A 3HCBA 2GXSA 4D8UA 1T6NA 4R05A 1LQ2A 2YXPX 4LJ7A 2OCGA 4WZBB 1C50A 2DHCA 4WE3A 4ER7A 1RW4A 3LC0A 1KNXA 2VH5R 2R00A 3CVJA 2HU8A 2J0VA 5TT0A 1WZ2A 3HCPA 1HT1E 1C8VB 4OKSA 4BNDA 4MAMA 3DTVA 1L4EA 2I2AA 1U28A 1G5TA 1BQEA 1E79A 1XTUA 1YCFA 2JIBA 2ZUDA 5CT8A 3NUZA 3VU1A 3P94A 2O8BB 3E4CA 3ZS8A 3JSXA 1XNRB 1J7JA 4YJGA 3ZDBA 1XZBA 3DM5A 1CPYA 1UXGA 5A6VA 4IJVA 4UEOA 4XIFA 5KX5A 1TT5A 1XROA 3MILA 1BWRA 4K6GA 8GPBA 5HF9A 4MDYA 4S24A 4BN0A 1M8KA 5F52A 4BTEA 4ZQHA 3PNLA 3ZNQA 3PE6A 1EFHA 1KQPA 2H31A 5C1IA 4Z0HO 5P8WA 5C1DA 2JLUA 2IHYA 3A26A 1VIVA 2H16A 1KKMA 4MIYA 3EPHA 5KYVA 3ETJA 4BNTA 3GRKA 3HR4A 5K9ZA 1BXZA 3KHSA 4DIBA 2WJYA 3F5SA 3AKEA 5P21A 9MHTA 1QVAA 1YQGA 1P1KA 2UDPA 1BKYA 1T5OA 3QXCA 5DTQA 3AKZA 3BWDD 3RRYA 4ZMRA 1Q7GA 3EPJA 4C76A 1WCYA 4ZOCA 4DA6A 3JWIA 5EZ6B 3AC0A 4BWYA 2ATVA 2GN8A 1N6NA 3ONEA 4KACA 3JW8A 3GRCA 1VMKA 3V55A 1BS1A 1KMQA 3TR6A 2BR3A 4OHRA 2JI4A 3IV7A 3OURA 4ZYUA 2OLEA 4KBGA 1VCNA 4GP7A 1JT2A 3ON5A 1Z0IA 1B1AA 1SCDA 3TIVA 5D7NA 4ACBA 4CG2A 4KPFC 1WKCA 2J48A 3IDAA 1PJCA 1H0KA 3DCYA 1TAGA 2FPXA 2IK8A 2QTWB 4IVNA 4KXUA 1EDBA 5FLEX 5AUOB 1OH8A 3D59A 2BRUC 1I94B 2KW5A 3C0KA 3Q7IA 2PGNA 5B3JC 3MWJA 4JT2A 3FMOB 2YBDA 1ZJWA 1DRUA 1R64A 2ZYGA 1NOJA 1BMFD 2IPNA 2AX4A 2W00A 4XQ0A 2QF7A 2PUCA 1H1LA 2Z08A 1A8PA 2KLHA 4EJSC 1C80A 1Z18A 4LWZA 5E95A 4EGCB 4BMYA 3BBPA 4KOEC 4E30A 1N9ZA 1Z45A 4NCJA 2YV3A 3W4IA 2A4KA 2Y1LA 4HWPA 4TL6A 2CT8A 4RHXA 2CV2A 4HN2A 5GWXA 5E9QA 1VC2A 2IQIA 2H06A 1HKUA 4HAWA 1ZAYA 2HRRA 1HLPA 3QNMA 4TXJA 1VE5A 1HOTA 4FXOA 4ECEA 2ZI3A 2OM6A 4HBZA 1ZESA 2CCKA 3BXZA 4NAVA 1ZD3A 3NX4A 1UDRA 1ESMA 3PNQA 1BMDA 1KAQA 1JLMA 4OQDA 4F11A 2XECA 1XJ5A 1FZQA 3NC1C 4LRWA 4QYWA 5AVTA 2R5FA 1SEPA 1PLJA 1R5BA 4EI2A 1E1YA 3LV8A 5LCXA 4O4HA 5A0VA 1RLIA 2G77B 4N0QA 2J9RA 2KWIA 1E5XA 2OC9A 1M1ZA 3GN1A 1P72A 1N7HA 1RZ3A 2QGZA 2QL7A 4L6CA 5DVZA 1GKIA 1OA0A 3C3EA 1U6JA 2WM9B 2P91A 3O3OB 4R40A 3PSAA 3S8YA 2AS0A 3L07A 4U0KA 1D1PA 2QP3A 4X5OA 1Z0AA 1JQ5A 4ENQA 2JGNA 1AK1A 3HA3A 1ZUWA 2FWBA 1BMTA 3QVLA 3RNOA 3KSBC 2P68A 5DGIA 1IJFA 1ISIA 3QG1A 2BD0A 4NJMA 1NZDA 3AZPA 4I1PA 5I7RA 2BGLA 4HBGA 4XX0B 2ZQ5A 1T9GR 3JD1A 1JDBC 1ZMBA 1RACA 4EHHA 2PQMA 5EC8A 3O38A 1RHUA 3MC1A 4OQXA 3RUFA 2DUJA 3H13A 4D96A 4KXYA 2ZTLA 3KWMA 4Q34A 4D3ZA 4O2AA 3ITDA 4PPGA 4DT1A 2HHCA 1Y6ZA 1YL6A 4IZIA 3GMTA 3NHYA 5CYPA 1PJZA 1VLLA 4J7CA 3T3OA 1V48A 3R09A 3BD6A 3KT6A 4FI3C 4PSUA 2PX3A 2QL5A 4MUEA 4LY0A 5AJXA 2O7VA 1THMA 3JQEA 2C77A 3DE4X 5FYDA 2QUZA 2ZUWA 1KF0A 2KI5A 1IXRC 1K7FB 1XCPA 3UWMA 1R7RA 2V1XA 2VRBA 4CZ2A 5BMVB 1DUSA 1OVMA 1ZRHA 2HT6A 4NMLA 2PUAA 3A4TA 1CEYA 5AKGA 1K3TA 3UMBA 3T8YA 3ZOZA 1TAHA 3TL3A 4V39A 4C3UA 1W0JA 5JADA 2JCSA 1QV6A 3DXFA 2M6SA 2EAUA 3ECAA 4Z54A 1JQEA 2AI1A 4L95C 5K3FA 3L8CA 3UGQA 4Z49A 1ORHA 6PFKA 4IGFA 4MDEA 2FMHA 3ZIDA 5ALGA 1XDSA 3U7QA 3W3AH 2I6FA 4PHGA 5FPQA 1Z12A 1R0CA 1OAKA 3N0WA 3NV9A 1ID1A 1NT2A 3OD1A 3PD7A 4YIHA 3HN2A 4MJXA 4TS4A 1OB2A 1PU2A 1XZ8A 1GPDG 1LGYA 1DQPA 1TUBB 4LNHA 4MPPA 4G36A 2JHCA 1K7YA 4UEWA 2J9FB 2O4CA 1HXHA 2O3JA 3K9GA 2PL3A 3KUUA 4P2BA 5DIFA 2C1EA 4Q6BA 3MMSA 1TVCA 1OPRA 1EA5A 5CNIA 2Z5FA 1L1FA 2IBTA 1L4LA 4LQLA 1QH9A 5BQ5A 1V3UA 4DNFA 4OBBA 5FTLA 1FL9A 1NNUA 4H17A 3GAZA 3GAMA 4PFJA 3IRVA 1ZXXA 4J6FA 3AIKA 2A1IA 1C0IA 1NN0A 1L4FA 2VJPA 5DGDA 4WCFA 5CG1A 4ZDJA 3OT4A 4LE2A 4WUVA 3A1FA 4TKVA 2F64A 5HFNA 2RAPA 2BONA 3HGQA 2YXNA 4PYLA 3EUAA 1UFOA 3L41A 3RT9A 4HF7A 1NPTO 3E1SA 4B6JA 1E5TA 3QEAZ 3PITA 3SDZA 1YVRA 3MFYA 1IVYA 4UEJA 1JZSA 4DCJA 3EHEA 5ENDA 3VSEA 3AHGA 3EWIA 2YN4A 4LRUA 4OGWA 4Q9IA 1X7HA 2FEAA 9GPBA 4HVTA 2XXAB 1OFIA 2QUIA 1VJ5A 1VBKA 1E9EA 1Z8HA 3IS3A 3MTQA 3OPXA 4WINA 1NC1A 2NUBA 4HGQA 1XMIA 4A91A 4AF7A 1PJAA 2ORYA 4X8HA 1TF7A 4OLBA 4LYHA 4BCCA 3O1JC 4KQJA 2XNJA 1VYUA 4F86A 1N92A 3Q2IA 3FN4A 1TPYA 2FUCA 2Q3MA 5I9MA 1YVUA 4KXFB 4DR5B 3IT1A 2FK8A 1N2SA 5IF3A 2FJPA 3BMNA 4XGNA 3E3AA 2I9PA 5DGXA 1USVA 4DARA 3AFNA 3DLCA 2Q5LA 3KQHA 1I51A 3BXPA 3E3LA 4YMUA 4V1CI 5TPZA 4F6CA 2OFXA 4MTCA 3B3QA 5KQPA 3SY8A 4L6IA 3G2KA 5HUJA 1XRSB 4XCQA 4Q21A 4PXYA 4B7CA 3BE6A 3C3WA 5KTYA 1XEAA 1U5BA 2C5LA 2HFKA 3ESQA 5IT4A 3DE6X 3JD2A 3MCVA 4RS3A 2QNRA 2Y1GA 4LDQA 1T35A 5HCNA 3UGJA 5J5CA 3FZNA 3RVQA 4K6CA 4CODB 3L79A 4P7KA 1FNDA 3KSRA 4BJ5A 2JGAA 1PT8A 3WLNA 4C3ZA 2PNFA 4K9OA 3PZBA 4OJNA 1R0LA 2P9BA 5AO9A 4D7AA 1CWUA 4M7PA 4C04A 1KMHB 2G6TA 4BLSA 5KNLA 4PSAA 1LB1B 2NQ8A 2ZIGA 4MLCA 2K7FA 2RAVA 4PSVA 3OJEA 1C1XB 4Y67A 4AJ1A 1CRQA 4B6RA 4RETA 5KVQA 2YMPA 2B92A 1NW6A 2PU7A 5H16A 4P31A 2H1WA 5CK4A 3JYQA 4DR6B 4I1YA 4QUGA 4G65A 4X7BA 2DUUA 5BR8B 2J09A 4M9RA 4XQ9A 4YUXA 5H83A 3O74A 4FFVA 3EVZA 3G1WA 3ESYA 3BKWA 1BGWA 3INTA 3I76A 4WESB 3RT1A 3DBVO 3O8QB 3MWEA 1P3DA 5FWAA 4OUDB 4MKIA 4TWZA 3T9CA 3K6SA 1KP9A 1AVTA 5FJIA 4CT4B 2RH9B 5A03A 1P7PA 3ZBUA 1CJUC 2F3PA 1P5FA 2XNKA 1DJQA 4ZP1A 3IKTA 1FFXB 1NPYA 1L5LA 4KWTA 1JDTA 1R37A 4ZT7A 5JEEA 3DO6A 1IOLA 2Y05A 1ZJ6A 5LBTA 4HOYA 3DFZA 1AKTA 5JAHA 2DR0A 4HX2A 4KJZA 1TFRA 1FTNA 3OUUA 2HF9A 2XB6A 1XU4A 1TJYA 1RXSA 3K5PA 4AO6A 3F5MA 4J16C 3TKLA 3SHFA 4KRYA 3VXKA 2YS6A 3DWFA 3ETHA 5G1OA 1IVSA 1I1HA 1P0MA 2SCUA 3EFOB 4QOGA 4UHDA 3SLGA 4DSUA 5EJ7A 3GCXA 2HBRA 2CNLA 4DCCA 5IKPA 1BVRA 3P2MA 2AOTA 5EPEA 1K92A 2FEXA 2IBMA 1MB2A 2YR0A 3F3MA 2JGFA 3BMQA 1EX6A 3M3PA 5B1HA 4RELA 4V0ME 4C5BA 1JKJB 2C8LA 1BG6A 4KCGA 1L5NA 3SZUA 4RIIA 4DCTA 2YMQA 4XCVA 4PVCA 1EUZA 5DT9A 3K2QA 5EMLA 1YDGA 4WFKA 4CLDA 5JCXA 1XZQA 5C8DA 4W5HA 5LB4A 4JDPA 2NVUB 1JQ3A 3FM9A 2N1BA 4IHAA 1YS9A 3L6OO 4C0WA 2PANA 4LXQA 4QVIA 1ZW6A 3MAJA 4LJ5A 1SFRA 5J2UB 4BX3A 1TEZA 3PRJA 4YY3B 1K75A 1WHTB 5HR5A 2XUQA 4GX1A 3K0AA 1V6CA 4X60A 4ENTA 2HB6A 3W6NA 1SCUA 3RJMA 2F4NA 3K9FC 3MB8A 5EPUA 1D3AA 3BS4A 3IPAA 4W7HA 1SKMA 4DMLA 1JFFA 1QZTA 1VHWA 3AESB 3QUCA 1SBQA 4B4OA 3D6HA 4N41A 1OT3A 3ELYA 3WL4A 1RXYA 3B1XA 5JQWA 4YHHB 1HKHA 1N6OA 2WAOA 4N3CA 1Y7LA 4QHSA 4XWGA 3WLTA 4Z4CA 1E77A 3L6EA 3U56A 2DLCX 3J7TA 4M87A 5AIAA 3ZI7A 5K20A 1ZJJA 2KHZA 3AOGA 5I4IA 4EECA 1YKSA 4ND7A 5LD2B 2I55A 1WDTA 2ZDHA 4LZNA 3EY9A 4A92A 2JG3A 1QG2A 1R0RE 4ZV7A 3O2QB 1Z88A 4JMPA 2W4QA 3T15A 1AKUA 5EEHA 4ZC1A 2QTLA 1W1UA 1CUDA 1DELA 1K0FA 2YIMA 2AK2A 5FOTA 1GCOA 1O5IA 3AFGA 4UZSA 4C7OA 4NH0A 2IZ5A 2H3HA 3INGA 4G4SP 5EFZA 2FCRA 3CX3A 1M54A 1DMSA 4HATA 1XJQA 5B36A 3HRIA 3ZD6A 2JC3A 3Q98A 4H6WA 3ZY3A 3OQMA 1Z38A 1SY7A 2HGZA 2DXIA 2O0HA 4ZANA 2HPHA 2C83A 4KHZA 4GX5A 2LCQA 5EWMA 1RRKA 3CJQA 4RPCA 3FXAA 4JL5A 4WXRA 3G68A 3L0ZA 1EVZA 2G08A 3TLZA 5I48A 3CVUA 2HQBA 3Q9SA 2D5BA 3U40A 3H9QA 3WP1B 2JBHA 2JIOA 3BFPA 1DBVO 1G2QA 1ZKMA 4CKCA 3V2HA 2QVBA 1JR3E 2VTVA 2Z1MA 3KT0A 1B8OA 1JA9A 1FRQA 4Z3KA 2FPSA 4HDKA 4OXQA 1YRWA 4GYKA 4ROSA 3SVTA 1SG6A 1E5LA 2W90A 4UMFA 5J5AA 1RJ9A 4E7PA 1B23P 1EXNA 4A2WA 4TX1A 2QN1A 3VKHA 1TVKB 4G1EB 3WWOA 1MT0A 3BIJA 1Z39A 3CKMA 4GAEA 2AG1A 3W1VA 5KVSA 1I4LD 1LTKA 1UBFA 2GVNA 4A73A 1MABB 2X42A 3QUBA 1BCSB 3UAOA 3FUTA 4RK7A 4CKXA 1XN4A 1A7KA 2GAJA 1COWA 2VHWA 3R3YA 1PWHA 4LDAA 2I1QA 4TWIA 5DTEA 4CTNA 5C8VA 5TPWA 3KZOA 3OCCA 4LY6A 2IITA 3PQ3A 1Z74A 2CJPA 2ZQYA 3EGOA 1NX6A 2RGAA 3IB3A 4EG8A 1YZFA 3MWFA 4XPIB 3E23A 5CK5A 1GZUA 4JP1A 4YPFA 2E87A 1VL5A 1HT3A 2AW5A 1HNXB 4OHPA 1M6WA 4WZBA 2BGGA 1ESZA 1X70A 1D04A 1VGRA 4F2PA 4LF4B 4DBLC 2HQ1A 4DWWA 4BFXA 2L2QA 3LFTA 2HF2A 1X1QA 4MR7A 3OPYB 1G8SA 3GLUA 2O8BA 1IQPA 2JZNA 2X5JO 3R6DA 3IHWA 1RBYA 3N07A 3FB4A 4BQQA 4DLYA 4ZYWA 1KIMA 1EGMB 3R2JA 3KM0A 3QE9Y 1NRJB 2WFLB 2WIBA 4I1OA 3W77A 1Z5PA 4DF3A 4M38A 3UHAA 4I9HA 1SXJB 3PG5A 3JAWA 4ID3A 3L4SO 4JLUA 5IKXA 3PL1A 2JI9A