3H18A

Crystal structure of este5-pmsf (ii)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
296
structure length
293
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 100
structure length 293
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h18A00
4YPVA 4V2IA 5ALIA 3P2MA 3WIOA 2H7YA 5IVDA 1EINA 1XZGA 6YASA 1ZOIA 4GDMA 5KWJA 2ES4A 1UK8A 1O6FA 4FFVA 3DQZA 4DSAA 1S8OA 1Q84A 4IH1A 1WPXA 1HLGA 3TEJA 1G66A 4C87A 2E3JA 1RYYA 2VF2A 4QDZA 1P0PA 3RM3A 5AKXA 5T4EA 1XKLA 2XLCA 5DYWA 4X85A 3ESAA 5AKGA 4AQDA 5AKYA 2ZJ7A 5EIAA 2WKWA 1JT2A 2ROQA 3CXUA 1CQWA 1IUOA 4WFKA 2WUFA 1BEZA 1ACLA 4P93A 4JYMA 4B9EA 1TCCA 3V48A 4BP9A 1CVLA 2OCGA 3WJ2A 4PSDA 4G8BA 2PL5A 2HFJA 4RPCA 2EDAA 5ALHA 2C7BA 5DLPA 2OPHA 1EK2A 3GUUA 3E4DA 3WL5A 5BWBA 4IO0A 2B9VA 4BYMA 3IDAA 5JZ9A 3QMVA 5ALFA 1XQYA 5LZ4A 4BATA 5LZ9A 3DEAA 2WIKA 3T4UA 4U2BA 1XLVA 4LXIA 4QNNA 4B80A 2RGUA 4B0OA 4FKBA 4MWTA 1DX6A 4BVJA 4CFSA 3L1JA 4EZIA 1R4ZA 3G9TA 1EDDA 4X7BA 1CUSA 4Y2PA 1VZ2A 2Q0XA 4L9AA 2JGFA 4LXHA 4AN0A 3STUA 5C81A 1DT3A 2VJCA 3RK4A 1THGA 1K6EA 1BN7A 3WWPA 2YH2A 2BUCA 3CCCA 5LP1A 1UFOA 4RE6A 5EGNA 1UOPA 3AZOA 2BKLA 4G1FA 1XRLA 4QEKA 3WK9A 1SOMA 3PFBA 3PUHA 3D5EA 1ZI6A 3ZI7A 4BCDA 4Q3OA 4EY4A 3GBSA 5D6OA 1X2BA 4AO7A 2XQIA 2WG2A 1XQVA 1BCRA 1U8EA 3Q0TA 5ALZA 2Y2VA 3FVTA 2CB9A 4KEAA 1UKAA 3OPMA 1EA5A 4BDSA 3W05A 2QR5A 4YASA 5ALGA 2ACEA 5ALWA 3LIIA 1ZI9A 3HC7A 2HA4A 5JATA 4F60A 3O4GA 5ALLA 3G0CA 1ODTC 4DNFA 2HHAA 1XZJA 4H77A 5CH5A 2WJ3A 2QVBA 4D9JA 1JKMA 2H7XA 1MAHA 1E8DA 1ZJ4A 4L72A 3V1MA 3OOSA 3VVMA 3I6ZA 2VAVA 1AQLA 3I6MA 1UKCA 2AJLI 5HF6A 3O4JA 5FPPA 5LZ5A 2VJAA 3OM8A 4O08A 1NU6A 1YA8A 1AUOA 1CR6A 1UOQA 4BVKA 3IB3A 4X6XA 2XMSA 4P92A 2J4FA 5JAHA 4FWBA 5JD5A 5ALEA 4U2FA 3N2ZB 4N8DA 4X92A 2OGZA 2Z5GA 1XRMA 1N1MA 2AJBA 4LYDA 4BC1A 4C01A 1AX9A 2XQFA 1XZIA 1VA4A 4KAAA 3A2LA 1LPSA 1IVYA 4DTCA 2BUBA 3DD5A 1JMYA 2QZPA 3IUQA 3QBJA 4ZREA 3FSGA 4QDXA 2WG0A 1WB4A 4QDUA 1T2NA 3O0DA 2B20A 1A8QA 3KXPA 1TRHA 2JF0A 2VA9A 3AZPA 5YASA 3WK4A 3HJUA 3QYJA 3W9BA 3DDUA 4OU4A 5LLSA 4ZV7A 2Y2UA 2CMFA 4GECA 5JAUA 4J0KA 1AZWA 1DWPA 5AICA 4I19A 3W04A 2I3DA 3DKRA 2QXUA 1XLUA 1U4NA 4U2GA 5HCUA 4EBBA 4J0CA 4BCCA 2WTNA 2QJRA 3GFFA 3I28A 1RWQA 3IVMA 3E3AA 3JWEA 3M82A 4S0XA 4UBLA 4ZGBA 1WB6A 5AKEA 3L1HA 5ALOA 3BDIA 5D7BA 1JI3A 1L7QA 4ITVA 4DIUA 1OCEA 3NWOA 2PU7A 2G5TA 3NUZA 1LPMA 1ZJ5A 5DTIA 4Q05A 3AZQA 4UBKA 3HRHA 4OUKX 1BU8A 3LLCA 4X00A 5LIPA 2Y1KA 4ZRDA 2HIHA 1K4YA 3FCXA 5CH3A 1GPLA 4BAZA 4C6HA 1A7UA 1NU8A 4DGQA 3FYUB 2BGRA 1VE7A 4W1SA 1R3DA 5AI4A 5C8XA 4ETWA 3R41A 3PICA 3WKAA 1QOZA 1MJ5A 3AUKA 1FJ2A 3D2BA 3JW8A 1ISPA 4L3WA 2FJ0A 1LPAB 4WY8A 3C45A 2CKMA 4AZ0A 3H17A 4G4JA 4P9NA 1DQYA 1K5PA 2QM0A 2JEYA 2XMZA 1GXSA 2VQ6A 3H2IA 2AJ8A 4FLMA 3ANTA 3KD2A 4HXFB 1GPNA 4H7IA 3R3UA 3H2JA 4EB0A 2HA0A 3QPDA 2VJDA 4DLNA 4Q3LA 3BF8A 2QOEA 3DL4A 4MEAA 4WCVA 4BAUA 1ZD4A 2HU8A 4C4ZA 4K2AA 4QDTA 5AKJA 3AJAA 2HA3A 1PJAA 1E3QA 3ESBA 4PF1A 5FP0A 4BZZA 3QITA 1P0IA 2QMQA 5AKLA 3BXPA 3GA7A 3WMRA 3ZV7A 3ANSA 1UK6A 3BJMA 4WDQA 5ALTA 4BRSA 5A71A 2XUPA 5DNWA 2D5LA 5E4JA 2WIDA 4XIIA 1TKRA 2PSJA 2HA6A 2C0PA 2ONCA 3VISA 1QIKA 5AM3A 5JD6A 2OQIA 4W1QA 2DHDA 4W1RA 3C5WP 4GWLA 5EIHA 3H19A 3G0GA 1XFDA 3IBTA 2VTVA 3FCYA 4GW3A 3V1LA 2WFLB 2HL6A 2WQZA 4YX9A 4B82A 2WIGA 2WIFA 5AOBA 5JAPA 3W06A 4KR0A 4LHEA 3SK0A 1J07A 3QM1A 3F9CA 4W63A 2WIJA 3R3XA 3A70A 5ALRA 4TPKA 1CIJA 3SWWA 2DHCA 4J03A 3K2IA 4PNZA 5LKAA 1XRPA 3ICWA 5LYYA 2DR0A 2X8BA 5AO9A 4H7EA 4B0PA 4X90A 3WKEA 3TRDA 2FJPA 5E4TA 1CLEA 1FFCA 4BC0A 4B81A 4RE5A 2ZJ6A 3QPAA 2HM7A 3PF9A 4W1PA 1IZ7A 2XUFA 4B6GA 4LIPD 3G9XA 3A2MA 1JJBA 4KAJA 5K5EA 3WLAA 2O7RA 2IIVA 1EVQA 3WL6A 2WTMA 4FMPA 2JGMA 5A7GA 3KWFA 3I2JA 1GGVA 1H23A 1J1IA 2XUJA 3C6BA 3G9UA 4OB7A 5JADA 2PVSA 3FWHA 1YR2A 5EHNA 4FTWA 4AB1A 3I2HA 2B61A 1DQZA 3PUIA 5FRDA 4PSCA 1W6RA 5HQ3B 3KOOA 2JGEA 5IVKA 1DU4A 2DQZA 2R11A 3WK5A 3D3NA 4E11A 3WJ1A 5K3AA 4KE9A 4AMZA 3WQHA 4DNPA 2Z8XA 3VDXA 1XZLA 3B12A 4N5IX 5JANA 1Y7HA 4C88A 1X2EA 1CUEA 1UXOA 2DFPA 2OAGA 4G8CA 2W6CX 1FFBA 5DYYA 2QS9A 5DWDA 4QZVA 4GEGA 1F0NA 1LBSA 5LZ2A 4MXDA 4I3FA 4HTAA 1EB8A 4MQMA 2ZYHA 4AO8A 4B7ZA 1WM1A 2Z3ZA 2H1IA 1B41A 1EX9A 4Y2JA 5AH0A 2HRRA 5ALPA 1CUGA 1G5FA 4KE6A 2EDCA 2CEKA 3QVMA 1HKHA 3DCNA 3QZUA 1YAJA 4B9AA 1F0PA 2IITA 3WWOA 2PPLA 1MU0A 2XQGA 3V1KA 2HFKA 5A7HA 1QTRA 1M33A 4J7AA 3DS8A 1XRRA 1J06A 4QLOA 1QO9A 3H1BA 2UZ0A 3H04A 3HXKA 1HDEA 4KRYA 2CUTA 5JD4A 2I3ZA 4DMKA 3HLKA 1XQWA 2CZQA 3GELA 1NX9A 2XUDA 1YS1X 2AXEA 2VAXA 4BVLA 2JGLA 4Q3KA 2XUGA 2C58A 1QFSA 1GZ7A 1IUNA 1H2ZA 1CQZA 2HADA 2VT6A 5HZGA 4UBOA 4GI1A 2WUGA 1IMJA 2XT0A 1QIMA 4BRZA 4Y9SA 3BE8A 2OGTA 2JEZA 5IKXA 2LIPA 4I4CA 1E5TA 1SCKA 1UZAA 3ESDA 1TCBA 5A62A 3STXA 1N5RA 1AURA 4PQEA 1EH5A 4LXGA 4EHBA 4AZ3A 1LPBB 1W75A 2BGNA 4CCYA 1H2XA 2WUDA 3U0VA 4DYHA 5AK6A 1G4HA 1CUXA 5JIBA 3OURA 3WKCA 4U2EA 3I2GA 1R1DA 1TCAA 4KJXA 2PU5A 3IUJA 2HU7A 1RP1A 2BAGA 1EXWA 2J4CA 1XROA 3FYUC 5FDFA 5CBKA 1QIIA 2OG1A 3DOHA 2VEOA 3AIMA 1UT6A 3UMJA 5ALXA 3O4IA 2AJCA 1XZKA 3C5VA 4AN1A 5CT6A 5AIBA 2QUBA 3I2FA 2PBLA 4H7JA 3DLTA 3R3YA 5CT8A 3TJMA 1MN6A 1DT5A 3V1NA 3QH4A 4Y7DA 3I2IA 4HAIA 5DNVA 2DCMA 1ZIYA 4WDRA 3FLEA 5AK3A 5KBYA 4B84A 2HA7A 3BDVA 2V97A 3I6YA 1CUUA 5LZ8A 3OTQA 1KU0A 2JGIA 4BP8A 3M3DA 4DM7A 2XDWA 1CV2A 1UWCA 2OGSA 2RAUA 1ORVA 3ZLUA 2HDWA 3MUOA 2V9ZA 4BE9A 1D07A 5K3EA 1VLQA 1CUAA 1T4MA 4EY5A 2X76A 3VJKA 3WL7A 5T4HA 2BCEA 5FPQA 1R50A 5A7FA 1AKNA 4HS9A 2O2GA 4H7DA 3MGAA 4BE4A 3T52A 3Q8WA 4ROTA 3FOBA 4H7KA 5EHQA 4UHBA 1DWOA 4UFOA 5AHXA 3G8YA 5K3CA 2O7VA 4N8SA 1H22A 5CH8A 3AFIA 5T4FA 2WHPB 3WK8A 4OB6A 5JZSA 3HYSA 3F8SA 3WIBA 3MUNA 4WJLA 4ZWNA 2PSEA 1MX5A 2OCIA 2JBWA 4G9EA 2QXTA 4OB8A 3C6XA 1CFJA 4KE7A 1EHYA 2GBIA 3G0DA 4WFIA 4BAGA 4B85A 5EFZA 4J0JA 2HA2A 1ODCA 4KACA 5IVIA 3N0TA 4OPMA 4F5ZA 1BROA 2RHWA 4NZZA 4GHWA 3WA6A 2GYUA 3RARA 3S2ZA 1KEZA 3CN7A 3F97A 4WFJA 2H9YA 4IH4A 2D0DA 3LCRA 5ALJA 1FSSA 2FX5A 4ZV9A 1A88A 4G4IA 3C70A 2I03A 3ESCA 1E66A 2XUOA 2WG1A 4LKOA 2EEPA 5KREA 4CI9A 4K6GA 1XLWA 3DNMA 3V9AA 4X3CA 3IIIA 3SC2A 1YSCA 5HFNA 2XUIA 3NGMA 1PV1A 4GLBA 1ORWA 1C7IA 2H7CA 1F8UA 3WWCA 3B3QA 2WM2A 4FNGA 1K8QA 1CUJA 1Y37A 1OILA 1W52X 4X91A 1E89A 1LZLA 2QKYA 3STYA 2GYVA 5IH7A 4K6KA 4HXGA 2WU4A 4HRYA 5AM4A 5JALA 5LZ7A 5JASA 1VXOA 1LBTA 1JJIA 3EIOA 4HVTA 4TGLA 4OCZA 5SYMA 2YASA 5DYTA 3ILSA 3G02A 2HRQA 4X6YA 5CXXA 3KWJA 1JU3A 2Z3WA 2O2HA 1MAAA 1TAHA 2R8BA 2P8SA 4X94A 3SX4A 4N5HX 5AJHA 5HK8A 1J2EA 2XMGA 2Z8ZA 1XZMA 5AI9A 1TIBA 4FBLA 1XRNA 3ZWQA 1SFRA 1W76A 5CT4A 4DNOA 1G42A 4UBMA 2VATA 1TQHA 4UHEA 5JAOA 1QFMA 1BE0A 2CJPA 1H2YA 1UK9A 4CG3A 4C4XA 4PW0A 1MT3A 4Q1VA 3B5EA 1VKHA 3R3ZA 4MWSA 2K2QB 5FXMA 1JFRA 1SCIA 4MEBA 4QWWA 5K3BA 4X95A 1WHSA 3A2NA 5CT9A 1HPLA 3LP5A 4HZGA 1YB6A 1BN6A 2XE4A 4UHDA 4RGYA 1IUPA 5FLKA 1HBJA 2VSQA 1L7AA 5K3FB 4FLEA 5EHXA 3IUMA 5LKRA 1KU6A 1LPOA 5FV4A 3BJRA 2I78A 3C8HA 1CUCA 1XZDA 2ACKA 4G8DA 2YXPX 1QIFA 2QRUA 3D2AA 3STVA 4UPDA 1ETHA 1MNQA 1E8NA 5E2IA 4YK7A 1CUVA 4DSZA 4TVKA 1EDBA 2AJDA 4X71A 3FYTA 5A6VA 4CIAA 1H2WA 5KWIA 3WKDA 3IULA 5AKKA 5C7YA 1LNSA 1VE6A 3PF8A 4A16A 1P0QA 1XZHA 3R3VA 4GXNA 2W22A 3PE6A 1ZIXA 4J0GA 5CURA 3DYVA 3W9UA 4ZXFA 4L0CA 1GKKA 1LPPA 1GT6A 3HSSA 4XWGA 1QIDA 3G9ZA 4H35A 1IZ8A 5AKIA 2HU5A 3E1GA 5ALSA 1XZAA 5AM1A 3GROA 2GZRA 1QONA 5C8VA 4Y2UA 5ALMA 3RLIA 4Z49A 4AMYA 4X93A 1DWQA 5E4YA 3RKSA 1U2EA 2ZVDA 3UUEA 5A2GA 1MO2A 4F21A 3VJLA 5C8ZA 3DOIA 3R0VA 3FLBA 3C8DA 4A23A 1UK7A 4FFWA 2V98A 3A6ZA 1LLFA 2J3QA 2DHEA 1YCDA 2BFNA 2WFMA 2WJ6A 4ZI5A 2QJWA 1QO7A 2X5XA 4A5SA 2GZSA 1ZICA 3I1YA 4ARBA 4FOLA 4INZA 5HF5A 1ZI8A 2PM8A 1E8MA 3H18A 3HABA 5CW2A 3UUFA 1QGED 4KE8A 3EF3A 2RONA 3BIXA 5I8PA 5JZBA 3WI7A 1Q0RA 4UBJA 1X70A 2RI6A 7YASA 4EA6A 3WYNA 1UKBA 1CUWA 2DQYA 4XX1A 1F6WA 5HF9A 5I7UA 4BZWA 2FUKA 2XUHA 1BRTA 4DMHA 5ALDA 5CXUA 4PSUA 2BJHA 4QLAA 3ICVA 3D59A 3JYHA 2WHQA 4C4YA 2IX9A 1XZCA 2PUHA 4QDOA 2PKYX 3STTA 1YB7A 4BBZA 3AIKA 3WWEA 1UOOA 1THTA 3WK6A 1LGYA 1MPXA 3S8YA 1A8SA 4NS4A 5CT5A 1HQDA 1ZGCA 2ZSIA 2OCKA 1AGYA 1DINA 2OXEA 4EY8A 2WFZA 4FBMA 4IH9A 4DMFA 4UBIA 3YASA 4EY6A 3X3HA 5IVHA 2JIDA 1CPYA 4UFNA 3WZMA 2G4LA 1CUIA 1WCYA 4N8EA 4FHZA 3DKKA 4PV7A 1CUZA 1WHTA 2Y6VA 3CCBA 2BUAA 3R40A 5DJ5A 1Q83A 3AIOA 4AO6A 4IQ4A 1CUFA 5AI0A 2ECFA 3D0KA 1WB5A 5EIEA 1BEEA 4KYVA 3ZLTA 2VJBA 4Y2TA 4NMWA 1QIJA 3H0CA 5FUMA 1GQRA 4DMCA 1C4XA 1CUDA 5DNUA 2HA5A 2WHPA 3O4HA 1MX9A 1W1IA 3OC0A 2XUQA 3BF7A 2ZYSA 4UFPA 4UHHA 2DSNA 2XB6A 3PFCA 4U2CA 4U2DA 1WPRA 4EY7A 1USWA 1VOTA 5ALYA 1TK3A 2G5PA 4E15A 4B83A 3FNBA 4JUIA 1P0MA 3VKFA 4X6UA 5AIAA 3FSGD 1LZKA 1MX1A 4HRXA 4X97A 1U65A 1B6GA 3F96A 2ZYIA 3WA7A 5BOVA 2OCLA 4BTLA 1VZ3A 4JH0A 4UBNA 4Y2YA 3MVEA 2XQKA 3O95A 4EUSA 3FYUA 4FLFA 3ED1A 3IUNA 1VA5A 4H7HA 3WL8A 4JEIA 4WY5A 3LS2A 3DYIA 2C5FA 1Q0ZA 5D3ZA 4K5QA 1DTEA 1AMNA 5AOAA 2Y6UA 4UUQA 3QMWA 3TGLA 1N5MA 5ALQA 1JMKC 1I6WA 4RNCA 4MJ3A 4ARAA 1EVEA 4OYLA 3STWA 3L1IA 5ALNA 2QT9A 4CCYB 5ALKA 5K3DA 5HK9A 3G7NA 2JGJA 1CRLA 4MYDA 1A8UA 3F67A 4Q34A 3BIWA 4Y2QA 1QZ3A 1YA4A 3M81A 1JU4A 3EQ9A 4E14A 2XMBA 2QTBA 3E0XA 1QIEA 2YYSA 3VJMA 1N8SA 5AI6A 5H3HA 1EB9A 3W2TA 3EQ7A 1FFAA 5DTJA 1GKLA 1FFDA 5CRIA 1ZGBA 5HFAA 4J0IA 4KAFA 4XJVA 2XLBA 2QUAA 4UHFA 1CUHA 2C4HA 1R9NA 3F98A 3HACA 4OD0A 1XRQA 3I2KA 1MNAA 5JYCA 3WKBA 5FOQA 2OAEA 1XZEA 5F4ZA 4JNCA 4H7FA 1Z68A 4FNMA 3H2GA 4CIBA 4J0HA 4AX4A 4CG2A 3M83A 3C43A 1GQSA 2XUKA 1GPKA 2XMRA 1OXMA 5EHZA 2O2IA 2GBCA 1CUBA 3H2KA 2WFLA 4G5XA 5D3KA 2V96A 1XZBA 1XKTA 2GBFA 1BS9A 3EQ8A 4M0MA 2XMQA 4MYSA 3D4LA 3VVLA 3K9BA 3NOXA 1PFQA 2WU3A 1SCQA 3EBLA 3PI6A 5AM2A 2RIPA 1VXRA 2WHRA 3H2HA 3AINA 4G9GA 2OQVA 1C7JA 1K63A 2RHTA 1EI9A 5J3JA 5JARA 4KRXA 1Y7IA 5AK4A 4Y2SA 2C0QA 1LPNA 2JGKA 2GBGA 4CCWA 3FAKA 5SYNA 2PX6A 5HF8A 5BV7A 5ALUA 5K3FA 4NVRA 3LIPA 2CBGA 1QE3A 4OSEA 3U1TA 1YASA 3CN9A 1CEXA 3G0IA 3BL8A 4OYYA 2ZJFA 5T4BA 1ZD5A 1QIGA 1JJFA 2WJ4A 1L7RA 4Y2VA 4J0DA 3KDAA 4QA9A 3O9VA 5AM5A 4E46A 3C6YA 2PSDA 3D7RA 2PUJA 5AP9A 3GZJA 4C89A 5AKHA 4Q82A 3K6KA 4UHCA 4W9RA 4H0CA 4JYPA 3VXKA 1SC9A 2WUEA 1QLWA 2XI4A 3ZPXA 1DX4A 4FDMA 3HEAA 5ESRA 2PSFA 5CTAA 4K6HA 5HQ3A 1QJ4A 1YS2X 2ZYRA 4MQLA 2XMDA 3BWXA 5CMLA 2WILA 4OU5A 2OLEA 1YAHA 2WSLA 3ZLVA 3C87A 4GBGA 1MTZA 2WLSA 5ALVA 4Y2XA 4G4GA 4BDTA 5AM0A 4QE3A 2ZSHA 4LYEA 1FFEA 4BCBA 2G63A 1R9MA 3IURA 1EDEA 1O6GA 5ISMA 2XMCA 5HKAA 2J3DA 3I1IA 2VT7A 4CG1A 1EK1A 1ZD3A 3WK7A 4DNQA 5BWCA 4J3JA 4BB0A 3AILA 4P08A 1XZFA 2XUAA 3OG9A 3DL7A 3HZOA 3HI4A 1HL7A 2XQJA 4HXEB 4M0FA 4F0JA 3WWDA 1W4LA 1ODSA 1WOMA 4M0EA 1AC5A 2B4KA 4H18A 2PSHA 5AOCA 1BCSA 4AXBA 3FBWA 1QTIA 3KSRA 1QIHA 3PDCA 3R3WA 4QWMA 4XVCA 3WZLA 3C6ZA 5I9IA 2NW6A 4PO3X 4Y2RA 5FKJA 4IHAA 1CUYA 3H1AA 2ORYA 3IA2A 1R88A 3DJYA 3FVRA 3FLAA 1XQXA 3QPCA 1ZD2P 4BTVA 3G0BA 5HKBA 3D2CA 3O9MA 5AI5A 3WYDA 5EI5A 5AK5A 1VJ5A 2C5GA 2GYWA 3QMMA 1ACJA 5AI8A 5AKZA
chains in the Genus database with same CATH superfamily
4LGMA 3U60B 1Z5GA 2BR5A 3KT3A 3I9FA 4OA5A 3COPA 1PFUA 4XUCA 1UBHS 1WX1A 2PZFA 2YWFA 5BRAA 1L1EA 4RHUA 3BXOA 2OAP1 1E5XA 5KU1A 2VWQA 4MP3A 3HUEA 3Q6MA 4KO4S 3SC3A 4F5EA 3DO6A 4LE2A 5FAKA 1RKVA 1T24A 2H0AA 3EWIA 3KTFA 3L92A 3AVVA 1DTWA 2IZ0A 4GDMA 4R5HA 1BU5A 1HV8A 1FJGB 5EMLA 3R3JA 2LPMA 4KODA 3UA3A 2DHQA 3IPAA 3WX0A 5JAZA 4HF7A 2BLNA 3SVTA 3IMFA 1V16A 1UZNA 3EUWA 2GK6A 2D7JA 4RQAA 2EYUA 4MR8B 4N6GA 1GVHA 1BJRE 1TUEA 1Z8NA 2IS6A 8ABPA 4OHYA 2VJQA 3ZHXA 1OROA 5B3JC 1F6DA 4UVEA 1FFXA 4G0UA 1W73A 2W2LA 1QRRA 4Z4QA 4DXDA 3MTGA 4HDOB 1WZNA 1P44A 2BEJA 2Q50A 2X8AA 4OBXA 4QDZA 2XTAA 1AOXA 1XAHA 1XKLA 3LO8A 1AHNA 4HRVA 4WLFA 5TDHA 2PUBA 1A9OA 2ZPAA 3ZGXA 3ZY3A 4I9HA 3ZJUA 3DMRA 2IH4A 3FJYA 2PIAA 3ESAA 1Z4KA 5KDDA 3DBRA 1GILA 1EE2A 4H6PA 1AIPA 2YHIA 3G6WA 1ZCBA 3QUTA 5JMOA 5BR4A 4DJAA 1JEYB 5EIAA 3F2IA 3OCYA 2O5CA 3ZD6A 1M2OA 3CXUA 2PKWA 4GPBA 1PN3A 1DRVA 5F3RA 1U8ZA 2WUFA 4KGZA 1U7OA 1W5EA 4BEJA 2XH8A 1FW8A 2BW0A 2GDZA 3KYIB 4ZYWA 2D4HA 4AICA 2L0XA 1F8XA 4II7A 4B9EA 1O94D 2X3FA 2QZSA 3TMKA 5JNLA 3NM5A 5B7QA 3GLIA 3D31A 5F33A 1FVHA 1T36A 3E9QA 4PR3A 3GMIA 1SPBS 2VQFB 2BP7A 2ZJ3A 2J5BA 3DP7A 1IHOA 3TNJA 2P2CA 4BZXA 3Q3VA 5FQOA 4BGDA 2QP4A 3IEMA 2JJMA 4Q3DA 3WB2A 4KDCA 5JI3E 2EDAA 2PMWB 2PMFA 2QM8A 5ALHA 1PJTA 2I7VA 2HU2A 1FCJA 3ZWXA 4R16A 2NZUG 2YV2A 4KLNA 2I8AA 1YJAA 3E4DA 1U5CA 3KTAB 2Q9UA 3AT1A 4XX0A 1XRJA 4XIFA 2V3VA 3OOJA 4TLCA 2B9VA 3F2VA 3DP9A 4BYMA 3IDAA 3VPGA 1UMKA 2J6HA 3TNLA 1S1CA 3AR9A 3EVZA 3QMVA 1CHDA 2HR1A 1XQYA 1M0WA 2K87A 5DSTA 4XM2A 3NHWA 3BSWA 1RJ9A 4CL2A 1EWKA 5LZ9A 1HE3A 1AV7A 3T4UA 1A3CA 1G5QA 4MTLA 4ROSA 3I37X 1EM8A 2AQHA 4GL4A 3RJTA 1NAIA 1BGVA 1SXQA 3E5NA 1ZBQA 2HDOA 3TBHA 2FLVA 3QK7A 4B80A 2HN9A 3GB9A 5DRTA 4EGJA 1WQ3A 5A1TA 1AG9A 3PEEA 2R3SA 2X2OA 4IBOA 3VZQA 4EI9A 4BVJA 4E33A 4EB8A 1MW9X 1NQTA 1T3GA 2Q5FA 4CFSA 3L1JA 4P33A 1PYOA 4R69A 3PC7A 3DHVA 2AG0A 2D2IA 5DOZA 4CM9D 1R4ZA 1X8XA 5FTKA 1OB2A 3G9TA 1TTTA 3CW8X 4X7BA 3WBBA 1CUSA 2X19A 1O94A 3OPNA 4PC3A 5A4DA 4FCCA 3OU7A 4L9AA 4M98A 3KEQA 1ZNXA 2HLHA 1T5TA 1WCXA 2ZSJA 3GT4A 3IQHX 3JARB 4I9FA 3N75A 4KYIB 3MTBA 3FKQA 1DAIA 3LUBA 3RBVA 5WRFA 3STUA 5C81A 3VV3A 4EHHA 1JYSA 2XTJA 3JQRA 4TTJA 7MHTA 4UASA 3NRJA 1P4GA 3CF4G 3UFXA 2QGZA 4HAOA 3R7BA 1MC5A 1YCFA 2J0SA 1DPGA 1FU4A 1Z06A 1NV8A 4G65A 4X41A 5LP1A 1L6RA 5JS7A 2J33A 3HKDB 3RRBA 4FGUA 4YI5A 1W19A 2A86A 4KXLA 1RLOA 1HKUA 2CL7X 2P11A 2VP4A 4WEOA 3TCNA 4US2R 5EN4A 3ZOZA 3DKIA 3LP8A 1N2CB 3JAWA 1L7PA 4MI6A 1A96A 3QVLA 4D96A 4BCDA 4IJKA 5KO2A 4LHVA 3NT5A 3P5SA 4Q3OA 3DBHA 5E8JA 4ESHA 1C9YA 4DPKA 3K1ZA 3GBSA 1RLJA 1ZOPA 2AOTA 2INGX 3LV8A 1JHRA 4EJFA 1DAKA 1Z6PA 3MCVA 4CM8A 2JJ2D 1X2BA 4GC9A 4ZYXA 1JZQA 3DR5A 1TAGA 1RLTA 4RV5A 4CLRA 4N48A 1U8EA 1XNHA 1WXIA 1I7LA 2F1HA 3N53A 1IWPB 2BHNA 2NSLA 4YJGB 2CB9A 1PJCA 3Q1LA 1WULS 2XNSA 4M2LA 5J59A 3U31A 4OX9B 5CEJA 1WBBA 1YR1A 2WJVA 3L7CA 4IDEA 4BKUA 1CJCA 2PRZA 4RHYA 3NTOA 1C9DB 1ISRA 4BDSA 4HTFB 1EPUA 3V4LA 1YZQA 2AN4A 2PRIA 7REQA 1EFUA 5GJVC 5IANA 2ACEA 1T4CA 4RS3A 4NWIA 1XMJA 4LGCA 5ALWA 1XNRB 1LV8A 3MLBA 3EPRA 3OKFA 3O4GA 4RIIA 3P8ZA 1MZPA 1Y4UA 1MO3A 4YI3A 1A77A 1OFGA 1SUFA 4IDQA 1QPBA 3JZMA 4DNFA 3MMNA 4WV3A 4A27A 2R0QC 5CH5A 3QE2A 2QVBA 4ZCMA 2VSNA 4YGXB 1VPTA 4BMZA 2PUTA 3QLUC 5FOSA 1Q14A 1Z47A 1FUUA 4ZTBA 4OY3A 1BXRA 3AK4A 2F3QA 4QHSA 4UD6A 1OVMA 1A7AA 2VBCA 5LQNA 1I7PA 3VVMA 2BFEB 2BMJA 1SCDA 5M2QA 5DMHA 4CFYA 2CJWB 3DE4X 5FI3A 1FL9A 2Q4EA 2AJLI 2OD2A 3L7DA 5JSFA 2JCGA 5LOVA 1LS1A 2W2OA 4KFTA 3TEFA 4EH1A 4L4UA 1YZ3A 1YCGA 1PD1A 2JJ2A 3HXLA 1FA9A 2WTAA 4X24A 3ROXA 2AQ8A 5AR1A 1TB4A 1IY2A 2DWOA 2ZJ2A 3A4YA 3P20A 1RAIA 1KO1A 1KXZA 4M1SA 5K0BA 1DFGA 3IXLA 3O75A 3URMA 3K53A 2VJAA 4XJTA 4WNAA 2YQ5A 4I08A 1TVCA 1NU6A 3SIPA 1CRZA 1CR6A 2QTHA 1OKKD 4OG2A 1V8PA 5TQJA 3QVUA 1RMTA 1E5VA 1MG5A 3CINA 4II3A 4ZOLB 1HT3A 4KIWA 3AJEA 3OCUA 1QE0A 3RIEA 2VDMB 4HO1X 1R10A 2X9VA 2J4FA 3GPIA 4N65A 2ZJZA 5BSGA 2JDID 1P1KA 4K03A 4UNRA 3FNHA 4HQOA 2BBWA 3GY0A 3UMSA 1KC3A 5LXTB 3PHJA 4S1VA 4YT4A 4U2FA 2I87A 3N2ZB 1W4RA 2G8LA 3BHJA 4N8DA 1IK6A 3RODA 4LY9A 5I7SA 1J00A 4RA9A 1Y9AA 4C7KA 4JI8B 2OBFA 4I1VA 5CFNA 4JXZA 2BI7A 1JJVA 1WNFA 3BMNB 1S8FA 4ID3A 3EZYA 1VCHA 3F3MA 2O6LA 5GONB 2QLMA 2D5CA 3BB3A 4FJ0A 4U63A 4BC1A 4OUDB 5IUKC 1O08A 2ZYUX 2A9QA 3DE5X 1PR1A 4MUFA 4N7JA 3OA2A 2EQAA 1W59A 4NK4A 1J5EB 2J0EA 1XZIA 2VLBA 3PEFA 3KYJB 5D1HA 4IRMA 4IZHA 4D9GA 4ZXPA 3UOGA 4GRDA 5ESWA 1LPSA 2FETA 4MLDA 1N2EA 4AG6A 2QUKA 1QMGA 5KX5A 1M8PA 1QC5B 1VLZA 4X9XA 5EWLB 2GD6A 2BUBA 3D5TA 2VRCD 2W48A 1F2DA 4CMAA 4UTRA 3RAJA 5JVDA 1H8ED 1BWSA 3BEDA 3IUQA 5A03A 3OZTA 4CM7A 3FGPA 3KQSA 2XVYA 1OKKA 3LRTA 1Q57A 1N3YA 3B13B 1TD9A 4MQ4A 4RA6A 4LZWA 2BRUA 4H7PA 1VGVA 2ZE6A 1E0SA 4JUCA 3OC6A 3NWPA 2WG0A 4R2LA 4ZVRA 2JDIA 2QV7A 5LN1A 3MB8A 1Q1GA 5BN3A 2C2WA 4LOJA 3ZWWA 1E3WA 4Q4DA 4DBLC 3A6HA 3Q7RA 2FSUA 3O0DA 4W9MC 2UZ1B 2ZVPX 4A8JB 1Q77A 3OT1A 4XPIA 4C3UA 1RZRA 1TRHA 3TR0A 2FG6C 2EKLA 1DQSA 2OV4A 2PH1A 3AZPA 3QKRB 1Z63A 2OM6A 5IYZB 1T8PA 1Y34E 1ILWA 3GLHA 1HT1E 2FZVA 3BRQA 3RU2A 1E3JA 2IV3A 3A4NA 5JH7A 2OG2A 4E2WA 1UBSB 4N39A 2ZBQA 1G3RA 2BT4A 2EFEB 2OWEA 3KLPX 4GZ6A 3ZDQA 1E9EA 2YWGA 3BXHA 1GCUA 2P4SA 3GRFA 1T34A 1NP6A 4GECA 2UVDA 3CGGA 2AR7A 3SM3A 3EZFA 4J0KA 1ZJWA 1SGWA 4LV6A 4LZAA 1V3VA 1MB2A 2PKQP 2PXAA 2CLSA 3HYNA 3Q0IA 4HB4A 5E2BA 4PPQA 1U0FA 1SBYA 4Q1AA 3Q8MA 1X80B 2R6ZA 1H8EA 4UM9B 1U4NA 5HCUA 5TPWA 3V7NA 4DILA 2UKDA 3HR7A 3UJPA 2V8BA 5AVTA 1XP8A 2EG9A 2ISSD 3K4PA 4HDKB 4O0LA 4OIMA 2VYFA 3DOOA 3GWGA 3LXUX 3HCAA 2B98A 2WTNA 3GLFB 2QJRA 2CVZA 3GFFA 3HJNA 3M6FA 2CC2A 3I28A 4KRGA 4F1JA 3L01A 1CJSA 3PUYA 4TXLA 4DDUA 1NBWB 1YJBA 1X92A 5F7JA 1OX6A 3IVMA 2O23A 2YQZA 1XDUA 2IOFA 3S1SA 2MDTA 1SBQA 3GAFA 3JWEA 3K92A 2GASA 3Q5EA 3QA3E 3VC2A 1BE6A 4IR7A 4L0QA 3N07A 1XTRA 1CZHA 1JSLA 3CUVA 5REQB 5LYJA 3TVYA 3W4KA 3M6UA 3S70A 1NPDA 2AYYA 2D1SA 1GG2A 4PFJA 2NO1A 1VIDA 4INJA 5C32A 2Y9MB 3FE2A 3TSYA 1RNLA 3NWOA 2CNOA 5DO9A 4AJNA 1H6AA 3RS3A 4JCOA 3NWEA 2XCTB 1TYDE 3SQNA 1YACA 1D1PA 4ZJPA 3Q8LA 3MXOA 2IQ5A 4DDVA 3WFIA 4DBZA 3C3WA 3EIFA 4D9NA 3QFRA 2AXNA 2DP4E 4KIJA 5AW7A 3RC3A 3TVTA 5DTIA 1X8LA 4M9QA 4CKZA 4Q05A 4UBKA 2ATXA 1X19A 3WRXC 1BU8A 1PJZA 5DHRA 4BJ5A 2AGVA 3KT6A 5LIPA 4ZRDA 4I5GA 3RRZA 4E4TA 1U0TA 2DERA 2BFCB 2D2FA 1PV4A 1X1RA 4F6CA 2C8VA 2CYBA 2NXEA 3OX4A 5BORA 1L5WA 1ZCFA 2VPYA 3DZCA 4BAZA 2OXTA 1NU8A 3R23A 1FUEA 1JUDA 4DGQA 4Q03A 2F8TA 4E0BA 2OA0A 1G9XA 4CKYA 1YZTA 2BGRA 1GYRA 5CLFA 4N7BA 2EAUA 3W2GA 3GEBA 4DR6B 2KX7A 2Z0MA 3QELA 1NJ2A 4GPZA 5KSOA 5IKPA 1U9IC 2BEWB 5AI4A 1HMPA 2BMAA 2G9NA 3ZXXA 5CDGA 1PQ4A 1Z34A 3VPBA 2V7VA 1JKXA 3R41A 3K6SA 2ATVA 4B4DA 5IJ9A 2GWRA 2F9LA 2VYQA 1EGVB 2NZYA 2CLHB 1MXHA 2LE0A 1CKEA 5C7LO 2DVMA 1ISPA 1PGNA 4E6PA 4G5SA 2FJ0A 1AKWA 3GFPA 3JZIA 3UJ8A 1Z5VA 4WY8A 3SNKA 3UJHA 1CR0A 4EJ0A 1ST3A 3DMTC 5D86A 2AZXA 4BEWA 3E5HA 4HFJA 5B2EA 1N6IA 1OJLA 3I52A 4AZ0A 5B7PA 4PBTA 3H17A 2GKOA 1WOYA 2QAGC 4EGCB 3M4JA 1K5PA 4WLVA 4B44A 4BMCA 2XMZA 3K72B 1ZGGA 4PYLA 2VQ6A 4ETNA 5TS2A 1GL3A 1UJMA 3I76A 1UKVY 3PFNA 3H2IA 1WTAA 3FFBA 2LKDA 2A14A 3U3OA 1I5OA 2V3CC 3S1LA 3ZHYA 3ZS9A 4BFUA 1ZRSA 2WTUA 4YR7A 5L3QB 4HGQA 1F1JA 1GU7A 3ZCXA 4HXFB 4ZOQI 3UHOA 5C7IO 1AO0A 3T1OA 2VDUE 3DOCA 3QPDA 2YCBA 5KYGA 4IIHA 3KJZA 2GZDA 2V9PA 4GRIA 1P1RA 3BF8A 2QOEA 3FKSD 4WFQA 1ZD4A 4I50B 1TMKA 2VAMA 4C9BA 1E2UA 3PITA 5F5XA 4OQEA 3HDYA 4KQFA 1T9KA 3ZC3A 4QC2A 4MIOA 1XR3A 3P4YA 1PJAA 1E3QA 3FA2A 4FGWA 4HPXB 1ZHHA 5G41A 4OVKA 3WFZA 2G0NA 4XKJA 3JQFA 3MWEB 1P0IA 4TZKA 4XA8A 1P61B 3BXPA 2HMTA 1AE1A 2QNBA 3UPUA 5FULA 2YVAA 3QY0A 4BN4A 1TJ3A 3DVRX 1B8NA 4PZAA 2GF9A 1D1TA 1YFZA 2NM0A 5HDQA 2DCUA 3TQOA 5BNWA 2CMDA 3E1SA 5DGCA 1KK1A 1M6YA 3ZDEA 1VM6A 3PNMA 1I4LD 3DMNA 4PHHA 3QE9Y 3ZE6A 4BRSA 3O1LA 2XUPA 4MJLA 5A71A 2V3WA 5CVVA 4MKZA 5DNWA 2ST1A 3CLHA 4MUAA 1BQEA 3U37A 2DZDA 1NMSA 2HHCA 3L8DA 2WM9B 2EWVA 2ETXA 2B3TA 2D74A 3ZJTA 1L3BA 5CIYA 3V4PB 1KKMA 4DA6A 1NHGA 1UCFA 4EYQA 1OLUA 5FA6A 2PSJA 5HOEA 2EU8A 2HA6A 1YOBA 3UUGA 3DLIA 2G76A 2R97A 3V8MA 1AK1A 2BL4A 5I9TA 3GLIE 4OGKA 3SQWA 3SR4A 4KFUA 2XY4A 4FMDB 4F2DA 5AM3A 1TAUA 3O90A 1QOPB 1JS1X 3FKSA 1ABEA 2FSSA 3MJVA 3M6LA 1VIMA 3O3CA 3R4VA 5TNXA 2DBVO 4MV0A 3U7QA 2OQIA 1FLDA 3ZWNA 4D3DA 4MMYB 2COEA 3H19A 1PDWA 3G0GA 1YK1A 1PHRA 2FWAA 3IBTA 4ND7A 4MIYA 2I1WA 4NFLA 2V7QD 3IVGA 2EOAA 5E9WA 3O82A 4GPIB 2ODNA 2YY5A 4S04A 1KFKB 4DR3B 3PP8A 1P2FA 5IT9A 1P39A 2FFRA 2ZSFA 4WK6A 2WFLB 5DEOA 4HNGA 5L3ZA 3CVUA 4II2A 3UM9A 4PQGA 4KPFC 1KMHB 2WQZA 2I29A 4WNIA 4ZMRA 2ZJ1A 4OMDA 4B82A 4GFDA 2V7XA 3KSBC 3M5PA 4J1TA 3DHEA 3FMGA 5JAPA 4JBHA 1U6KA 3W06A 1SZCA 1G6HA 5ALFA 4NP6A 3BORA 4QREA 5KVCA 4PR0A 1B0PA 3QM1A 4PFSA 3IHWA 1J23A 1MA3A 1SBHA 2HWYA 3NANA 2HQBA 3ESXA 4I5IA 1S01A 2WIJA 4OHUA 4UPVA 5EQDA 5TGDA 3TGWA 1Y5MA 3EODA 3TZQA 1BGXT 4PLWA 3GVPA 3SBXA 2NIPA 1BA3A 1MEOA 4EJSB 3BJIC 3GMDA 3B1ZA 3QOFA 1RAGA 4MB2A 4HFNA 4U6NA 1UJ2A 1DCTA 1IY1A 4MCAA 3DXYA 1A0OA 2XOKA 1XRPA 3L04A 3QXHA 4GR5A 3ICWA 4LJ4A 3RIMA 1FJHA 4B8YA 5E7IA 4B87A 4NQRA 1V6CA 4LVCA 5AO9A 4H7EA 2EFYA 3G89A 4WK0B 2FV8A 5AMXA 3WKEA 3U81A 2X41A 3RYFA 4DRXB 3BREA 4G0MA 3TRDA 5CFZA 2F48A 5HRAA 5LJLA 1FFCA 4FMBB 1W2HA 2V7QA 1FMTA 3GPBA 4YWHA 3H0KA 3DWFA 3IEKA 3OD5A 5AUOB 1ZN7A 3B6MA 4OKSA 2XB9A 3AUJB 3F6SA 1QJCA 2IOHA 2KYRA 1S8NA 2A30A 1SKUA 1RXYA 1W4CA 5KYUA 4A2QA 2AMJA 4RE5A 4BUJA 3HN2A 1XUOA 2R68A 10MHA 4GQBA 2H4ZA 3B7PA 3SS7X 1MOZA 3TZEA 2HM7A 1C30A 4I3HA 4BNJA 3DFZA 4DREA 4LJAA 2EQBA 4RMGA 1U2DA 4ZT4A 1CB7A 1CU1A 1M8JA 3N70A 1H94A 1MENA 2CMGA 2FSGA 1O9BA 3CEAA 1JSXA 3DONA 5HSGA 1XMVA 4A8HA 4ALKA 3DJFA 5KX5F 5LDDC 4EPVA 3QX3A 3R4CA 2GZAA 4XFJA 2OESA 5T67A 3WLAA 2FVYA 1P9OA 3W90A 3N7AA 5JVDF 1N5DA 2M6SA 5TT1A 3VX4A 2WABA 1QZTA 1EVQA 1QH8A 1L4BA 3KWLA 4AJJA 5EWJB 4XGIA 1P1JA 1QK5A 1MFPA 1CETA 1RHQA 3G2LA 5F7XA 3ZLJA 2Y0CA 2ZBEA 2IU0A 1GYPA 3K94A 3CXRA 4AUEA 2J48A 2D7CA 4FMPA 2JGMA 3DE2X 4L02A 3I23A 4XDYA 3TBKA 2QN6A 4YP1A 3GX1A 3I2JA 4OF4A 2FN4A 5AVRA 1GEEA 3UT6A 3TZHA 1J1IA 2J5XA 3E5MA 2QRKA 5K3OA 1XA3A 1G38A 2WKPA 4NYJQ 1R0XA 1S96A 3CTMA 4N4AA 2AD5A 2SKDA 4JUAA 3QX7A 1Q6YA 1K0FA 3HDTA 5L7YA 3HP1A 2ZWOA 2NV6A 4LDAA 1T15A 1JAYA 2LKCA 4MJXA 5SZHB 3AVTA 4GKKB 1CY6A 1XTJA 2RGEA 4GGPA 5FRDA 1ZIOA 5BYJA 4YHHB 1KP2A 5EXEA 2ZXFA 1CZRA 1PLLA 1JNYA 2O1XA 1YV9A 4G84A 3KOOA 4FUTA 3BD8A 2JGEA 2AK3A 2Q6TA 3UJ9A 3UMVA 5HR5A 4G3XA 4NC9A 4JMLA 3I5YA 4F5YA 2WSMA 1GQ2A 1ZMBA 3TVDA 4C5BA 1J97A 1PLJA 5I47A 4LYJA 4P5DA 1WXEA 5TPZD 2AX4A 5TLSA 4RTRA 4KP7A 5JMWA 1DG9A 1DXQA 5CLQA 3WK5A 3D3NA 2P6RA 5K3AA 2H57A 1VL1A 1IJBA 3PD1A 3NT4A 1W9MA 1G41A 1E7MA 2NXCA 1P9LA 3EXHB 1X8KA 3MRVA 3RJ9A 1QRSA 4JJ8A 2HAEA 1DJNA 3CPJB 4TWZA 4EF4A 2FPGA 1I6MA 5JDIC 1ONSA 1KDZA 4KQHA 1M8GA 3VHRA 1VE3A 3NHZA 1Y7HA 2XBUA 3E18A 1OE0A 1CQJB 1X2EA 1N3BA 5L3RA 4TXMA 4KLAA 4YGYA 1B1AA 4JU9A 3PQ5A 1T10A 1SVIA 1PKEA 2GN0A 2NU9A 1NW9B 4BP1A 1NF8A 3FRHA 3LDFA 3BERA 6REQB 3BFVA 2HX1A 5DWDA 4DA4A 3P2YA 2FLWA 3PKJA 3OEHA 1RAFA 1T2DA 3DBOB 1CZUA 1Y3FE 3GK3A 1OT3A 4D8WA 2A5JA 2H0RA 4FOPA 4QGFA 1TMYA 1F0NA 1XCLA 2GPBA 2GS9A 3QWHA 4Z7QB 3AUXA 5TR9A 4DSUA 5LYJF 2ARKA 4GSLA 3RT7A 2IS1A 1LBEA 1CP3A 1PEAA 5CP8A 4P4TA 5GTDA 3O6VA 2PIDA 1SHKA 3CF0A 2P3LA 4RF5A 2XNJA 3T5BA 1UPBA 3NMUF 1S7GA 1Y4AE 3CH4B 4RK6A 1NN5A 2OP1A 1KIMA 1IOWA 2V7EA 4MQMA 3V55A 2DAPA 3MS4A 3WV5A 4DIFA 4CFZA 3L2OB 1GPDG 3MJFA 2MMGA 1QGUB 2HV8A 2OCYC 1VJCA 1WM1A 1N9GB 1S02A 3NOVA 1EYZA 3LT5A 1QANA 4PN3A 1A9XB 4PGAA 3EVCA 3CNLA 1QCZA 5AH0A 1W1WA 2R48A 2XB2A 2JI7A 2VPZA 4KJZA 1GNQA 1OGIA 1CUGA 4WXPA 3TFQA 5FTMA 1S7CA 4JB8A 1M72A 1BCSB 1I1NA 4H1WA 3HYRA 4LN1A 2CEKA 3D54D 3M3HA 3DCNA 3K96A 2YS6A 4O5OA 5HGXA 5IEJA 1W5TA 2BE9A 4ZVUA 1X7XA 2QL6A 2PPLA 3IAM6 1MU0A 2G9ZA 3NAMA 3SZUA 3V1TC 1I4EB 4AKIA 4D02A 1ISJA 3ZI4A 4M0DA 2X6RA 4E94A 2HFKA 3WJAA 1X9IA 3DS8A 2O20A 3BWVA 4M9CA 2YFYA 4ZAWA 1L8AA 5K0NA 4DA0A 3EIWA 4O33A 3X1KA 4LDJA 2WF6A 3U3MA 5IM4F 5L51A 4I1SA 4KB5A 1WPGA 3OEYA 1N4AA 5AW3A 4CHTA 2MINA 1L3IA 3JQCA 5GZ6A 3H04A 2WHYA 4QAJA 2ZBPA 2V54A 4U0JA 1V2GA 4XVQA 3PGXA 4MGEA 5JS2A 3V2UA 3VOTA 1F20A 2IYRA 1KO8A 2AYXA 3IA7A 1TA9A 1ZRNA 4HN4B 4DXHA 4V2UA 1C0EA 3GLHE 1IN1A 3S7TA 4IGAA 1VSBA 2Q5JA 5BMOA 1LRLA 3NASA 4HQ0A 2UUBB 3FZNA 1WNTA 4XWKA 4YA6A 3SBEA 1H1LA 5FO0A 1XQWA 3VSEA 3PWTA 1RPTA 1U02A 1IQRA 3MGKA 4MVJM 4JFAA 3ROGA 1N0VC 3EUFA 3RTBA 1RSZA 2W4MA 5CJPA 3HY4A 2XUDA 2X7HA 3PKZA 1YS1X 2A0YA 3EIUA 1Z0IA 2E82A 3FZGA 1NJ6A 1NIJA 2J9FB 4ZMSA 1ESEA 4KFSA 4BVLA 3OPYA 1Z3IX 3PYMA 3V00A 4V0SA 1YNOA 1BKSB 3SEAA 2GLUA 2OV8A 1W93A 3K2EA 5JYBA 2XUGA 3NFYA 2IYYA 2C58A 2VNJA 4MQUA 1GZ7A 1UC4B 1H2ZA 2AKYA 3MAGA 4NFYA 5EXXA 5P21A 3KR1A 4K9LA 2CHFA 2WP0A 3SYLA 3Q9UA 2C8LA 3ACDA 4RIFA 1P3Y1 2ZRLA 4P31A 5CLGA 3RS2A 1YU9A 4BRZA 4BKOA 1QHIA 1PR9A 2B8WA 2K4MA 3DKVA 4QFMA 1KH1A 1QWOA 4JROA 3GL9A 4JBIA 3KSUA 2OGTA 1LY1A 1AA9A 1B74A 2JEZA 2YVKA 2AL7A 3D1VA 4D99A 4U7DA 1ZVMA 1G2OA 1H1TA 3OWXA 4FXPA 2P4QA 3EDQA 1RAHA 4I4CA 4UAUA 3IAEA 1WMAA 5ER6A 5FBRB 4DABA 1J7KA 2D0OB 2H1HA 4HWTA 1SCKA 2QYSA 4FDTA 3HUFA 4IW3B 3IYLW 2ATEA 2WW8A 3ESDA 2OORA 5J4HA 4Q7KA 5A62A 1CT9A 1JL3A 1X0XA 3FNEA 4K81B 2DWCA 4BN0A 4JJ6A 5ICGA 1VB3A 1E99A 4LXGA 2O5RA 3DF9A 3PK0A 5CFPA 5DHPA 1M8KA 3VR4H 5FPYA 2XWQA 3WFJA 5JPCA 3L1KA 1XCJA 2O57A 4L9RA 4MPTA 1ARZA 2JCVA 2PH3A 3C5EA 3LW8A 1IE3A 3O1HB 1QGZA 1YQTA 1Y8RB 3O8DA 1TT5B 4CV2A 1JFSA 1MC4A 2P4UA 3WGJA 5JIBA 3K09C 3OURA 3WKCA 2WDZA 3QVKA 2DLDA 1M54A 2IIPA 3S68A 4BWGA 4U2EA 5K6AA 3OE7D 4EB3A 1XWFA 2OOSA 5AXCA 1BNCA 3SJZA 4Q9HA 2VCYA 5A02A 1TCAA 2ZK7A 4G5RA 3PHIA 4KJXA 2Q7XA 1IJKA 1D2MA 2MSNA 3D81A 4IXMA 4BKRA 4C2TA 2BAGA 3GNSA 5DMXA 1XROA 3FYUC 4BQFA 2P8JA 1V26A 1XQ6A 2B1JA 3AM5A 2GRUA 3B1WA 3MT9A 3TUJC 1Z62A 2F55A 1RHMA 4EUFA 4JOQA 3TJRA 1HQKA 2J85A 1VSVA 3GHHA 4EPWA 4MQFA 3THYB 4M7PA 4N3NA 1OB5A 4YS6A 3CLUC 1KGDA 4H3KB 3A27A 4BV2A 2FUCA 5JHHB 2D2XA 3GW8A 2X4GA 3CJQA 2BBOA 3O4IA 3H5WA 3WE7A 3ZV4A 5ESDA 1XF9A 1XZKA 4AM8A 3SZ3A 5K8CA 2ZUEA 3C5VA 3SGLA 4AN1A 3LUFA 4JR2A 2PYDA 4YMWA 2R00A 1ECBA 4TWJA 5IM5A 5SZIA 4HFMA 3UCFA 1RR6A 4ZVLA 1ISIA 2JHGA 1IN7A 1P6QA 1R6AA 4MW6A 3LQFA 4G2TA 3PX7A 4Q1BA 5U4XA 3DOFA 4XXHA 1BE8A 1ZRMA 3MHTA 3LVFO 5JI2E 2FPKA 2Z6VA 1COZA 4MCIA 5G40A 3ZUPA 5ETJA 3RVRA 4DUZB 1KVQA 1GAEO 1GNSA 1EFPB 1II0A 3PNSA 4GWGA 5JDCA 2J45A 3L0DA 4PPFA 3S5JA 3TJMA 1XTKA 2V0NA 1MN6A 4XGRA 1AKYA 4BVEA 1DT5A 2JJ1D 5KSPA 1KRXA 4MW4A 5LMUB 3GLVA 4HAIA 3DAGA 4LBWA 3EFOA 2R47A 2DCMA 1R5NA 4MV3A 3OE7A 3H5LA 3QUQA 4JLJA 1ZM3A 1KNXA 1P7PA 2EF0A 5AK3A 4B84A 1G5TA 2CFIA 5LPNA 3CZMA 4CDRA 2MR6A 2V97A 2ZE8A 3FMIA 2RJOA 3HCEA 4QSMA 4REMA 4N6OA 1CUUA 1H6BA 2E4YA 4FMCF 1XJQA 3FI0A 4NYMR 4RWEA 2JGIA 3CX8A 3QWBA 4L6AA 1E1KA 3D7MA 1DV1A 4BP8A 1PUXA 5BN5A 2X8LA 2OXFA 1U5AA 3DOJA 5DHSA 4LE1A 4G1CA 5CNJA 3DUWA 4L8YA 1RC1A 3S81A 1BX3A 1FPMA 4KO2S 4L85A 1GLVA 2WF8A 2OBLA 4EI7A 1Y4ZA 3EVEA 1NXVA 1XDSA 2Y1GA 2ZRIA 4NBUA 4M1TA 2XWSA 3OOHA 4UUBA 5FB3A 5IBQA 5SICE 5BOSA 5BSKA 1YRQA 3N3AC 4YRGA 3PE3A 1TFUA 1HE4A 2NZXA 3VSDA 2Q5IA 3CRRA 4L28A 3T41A 2GXUA 3PI7A 4DCTA 1SNYA 2HPAA 4KQMA 221PA 1TC1A 5F7ZA 5A5GA 2JJ1A 1U0GA 1VLQA 1VYVA 2R7AA 4PEVA 1J21A 2GAOA 4QHYA 1T4MA 3R74A 4PAWA 4O25A 4QPNA 5BWNA 5BYAA 4OHCA 1EXNA 1SXJC 5EEGA 3IEUA 2DWPA 4YREA 1NXXA 3CEMA 3OZEA 5T4HA 1ISHA 1V6AA 1JG7A 2ZR8A 1KAEA 3CRQA 4BMVA 4RDHA 2X7XA 1AKNA 2ZWVA 1QYDA 2YMLA 1A95A 3H4TA 3NGXA 5GJCA 4H7DA 1LB1B 2XNDA 4XYLA 2VHZA 4AY2A 3OQIA 3VZPA 5DM2A 4NTZA 1RW4A 3ZCSA 4BP3A 1WMBA 3GCDA 4BE4A 2RCNA 3QXGA 5T5QA 3Q8WA 4IFEA 1NR7A 4FYIA 1K7SN 3UYLA 1NG1A 1Q5PA 1WTCA 2QPOA 4UHBA 5EHQA 3KO8A 5C4GB 3R9KA 3WDLA 1RWXA 2E1RA 1ZH2A 1ZITA 3MMXA 4KSBA 1VBFA 2X7JA 3OFND 2G9VA 4PZLA 3ZJ5A 1SU7A 3BE5A 1MRSA 1NZDA 1SBCA 4UHKA 5JLJA 1G63A 1II9A 1GLGA 1ISGA 4WMLA 5LA6B 1RYEA 4YAOA 3CIFA 1AUQA 3EFHA 1EP3B 3NIDB 2HNKA 1M1NB 2ZJ0A 4NQZA 4MPPA 5DCYA 3MTEA 1UJ6A 2Z6AA 3BWCA 5DVZA 3I61A 2X2FA 2QY6A 2PQMA 2AMYA 1J1ZA 4ZWNA 3DPSA 3ND6A 5BSUA 3KLOA 4CMBA 4FS3A 5GJBA 3HS3A 2VUIB 1KI8A 1YS7A 4LOHA 4PHTA 4A1FA 2HPZA 3RIYA 3OMLA 4P32A 2NU6A 2PMEA 5IDQA 2PZJA 2JKVA 2JBWA 5JCXA 1I6LA 1XQ1A 3GD5A 3M3PA 5LC1A 4OKIA 2WVJA 2C1EA 4YJFA 4UC0A 4WESA 2P6UA 5CB4B 3DBLA 5EHGA 3F6PA 4E32A 2QXTA 4DMRA 4N5MA 4OB8A 1UXIA 3C6XA 3R9XA 2EW1A 3U13A 4LGYA 2Y4NA 2JVIA 1J99A 3GVCA 1T8UA 2VPIA 1JA0A 4TMTA 2WZCA 2ZTSA 4WFIA 2ERCA 1F06A 2VOEA 2WSYB 5IARA 4BAGA 4WTOA 2R751 2HA2A 1JT9A 5P8WA 4R71A 2QE7D 3G2KA 4CIXA 1L4YA 2ID7A 3OFNA 2FW7A 4JLOA 5IVIA 3E2PA 3L6UA 2CGEA 2I62A 3BIFA 4HH4A 4PLPA 2A5FA 2C2HA 3I12A 4L5AA 3QVJA 1PZNA 2GN1A 2PGOA 2VPTA 1JR2A 1KVUA 1BDJA 2PWAA 2PLRA 2QMZA 3A37A 3FCAA 3INYA 3N0TA 3DEIA 1BVRA 4LCEA 1JQKA 1T8RA 1OLXA 4NZZA 4ZCSA 3TDKA 1E58A 5EKXA 1Q6ZA 3ZD7A 2H8GA 4I8IA 5A9SB 1UBRS 4BMDA 3RYIB 4KL8S 2PJUA 1KEZA 3OY2A 4BLSA 1P1IA 3CN7A 3WICA 3DV2A 1EFDN 3SFVA 2GJKA 4N82A 4WFJA 2GLTA 3N7UA 1KS2A 2Y1FA 3LCRA 3MN1A 1PZGA 2Z8YA 2D13A 4YDRA 1VGQA 4ZV9A 3HSKA 2B8NA 4FT4A 2F90A 5L4LA 3IP6A 3AW9A 1A88A 3OQ1A 4FB4A 2XB8A 4QU0A 4HUTA 3C70A 1NI3A 1CS0A 1UC8A 1X1CA 4OHZA 1PJRA 2D0IA 2CXTA 1IG0A 2XX3A 3SC6A 5JSZA 1UP7A 1RYNA 2XUOA 3WGOA 2WG1A 4LKOA 4KQJA 1P73A 5K0TA 4L07A 3C4VA 4Y3UA 1GGKA 4FNAA 4AS1A 3MTAA 1JNXX 5KTYA 1E2PA 2V74B 1UAAA 2XA2A 1GEGA 4K6GA 1XLWA 1JP7A 2CJFA 1TYBE 3ND9A 3DNMA 2OMEA 2AC4A 1Z45A 2QE7A 2C95A 4JVLA 5FL7D 4BNHA 3PHCA 1NG9A 1G6KA 2BFMA 4S1TA 4EB6A 2W2XA 3PVSA 1T0JB 2NYRA 3B3GA 1E1RA 2I6UA 1CEQA 2DF8A 2I2XB 2NSJA 2QQGA 2ZLBA 3IIIA 4ZU3A 4ZCRA 4X1KA 1RRVA 1RMYA 4RV9A 1TJ4A 2B4YA 3NUGA 1N6HA 4YAFA 5HE9A 1XYGA 1NGSA 4QG3A 3UAGA 1OY1A 3TDMA 3QFHA 2XF8A 3JAMA 3NJ4A 2FMFA 2M2IA 2ADMA 3GDHA 3UWOA 2WQ7A 3GJ7A 3O83A 3JRWA 1PG2A 4BVHA 2CXSA 2H7CA 5B5SA 2PLWA 4ZKDA 1NBAA 4FNGA 1BD4A 2WM2A 4E5DA 2NYUA 3PDHA 5KQPA 1ZVQA 3FX2A 2HRZA 3U40A 2E89A 3GFQA 4NLLA 1Y37A 4NPAA 1HZZC 3WXMA 1PSDA 1OILA 4DFDA 5MF6A 1FLAA 2V58A 3KSDO 5ICEA 4TUYA 2QX7A 1E89A 1FTQA 1XWIA 2QKYA 1EBUA 2WHXA 3I45A 4HNRA 4K8OA 4PZ9A 3KPYA 1GLNA 3CE6A 3WLQA 3AFGA 4EQ6A 2PMBA 1X9HA 3GPCA 5DBFA 5JASA 3N6XA 2C8KA 3DGEC 1VXOA 4MICA 1LBTA 3SYRA 1JJIA 1T3TA 1I0LA 2QBYB 2EJTA 3CBGA 2PH7A 4HVTA 1JJ7A 4IHQA 2W2VA 3LUGA 1L7NA 4K8RB 2H5JA 5SYMA 1KZGB 2YASA 2QN7A 1ZGAA 1Q91A 2GI4A 3LFUA 4OGWA 5B37A 1HE1C 4DYDA 4AUNA 1IRIA 1P3JA 1RHJA 1Y8AA 1D9ZA 2F1KA 2GCOB 2W2NA 3ACCA 5DYTA 3SJAA 4EFDA 5FL7A 5GVSA 4XYGA 1WE2A 5FBHA 3TPCA 3CZRA 3I6QA 3R0QA 3VH1A 3OKCA 4MR7B 1J2TA 1AJEA 4TT3A 4EFMA 3KJHA 2IKQA 1JYFA 3AVQA 3S1AB 4N5HX 3K8OE 4BE7B 3R8CA 3KJNA 1T0PA 5HK8A 2J3JA 3GJ5A 1J2EA 3L0CA 4DL9A 3AUYA 1XB2A 2Z8ZA 3E58A 1XZMA 2BMDA 4DVJA 1T8YA 2LCFA 3O1JC 4DWVA 1LWOA 5IAEA 5LQSA 3RFFA 4XEHA 1RI4A 2JLXA 3QWFA 4Q00A 4TS4A 4UUPA 2CLCX 3LG2A 4IOLA 3PPWA 5JR3A 2OO5A 2BDUA 4HX9A 4EA9A 4HKTA 4FD3A 4GBJA 1KPIA 4DNOA 2B2XA 4W5RA 4UBMA 2GJ9A 4Q16A 3CH6A 3PPXA 3L8HA 1Y33E 3WGUA 4E07A 1I7SB 1QFMA 2IYNA 3SDSA 2VO1A 2A7QA 5B6JA 3MIZA 3A6GA 4IY1A 4DCPA 2MJLA 1UK9A 3ISJA 3DV0A 5J63A 4C4XA 4IL5A 2QEQA 4NBSA 2ZRKA 4U7HA 1SR8A 3U44A 4Q1VA 4Q3CA 1ZKDA 2MWMA 2ZTLA 5KPJA 3KL2A 1GGFA 1JEOA 2VCHA 2ZR7A 1OQAA 3LDAA 4GOMD 4R7ZA 4UZSA 2FN8A 4J3NA 2B2CA 3SYKA 3H5IA 2MHCA 3V4ZA 4XFKA 4Z1MA 5J2TB 4ECEA 2NGRA 2GAAA 1IULA 4K9OA 5FXMA 2OPBA 1B6TA 3DMDA 3V3KA 3GG9A 4QWWA 4X0EA 1PW7A 5K3BA 2RBGA 3AL3A 4E5MA 2HBYA 4FR5A 5EE9A 5BNFA 4X7PA 1KORA 1YB6A 2GM5A 2XE7A 4HZGA 4ZCQA 2XE4A 4RAQA 1L5GB 3W8RA 5E6RA 5BR7A 1VCOA 3O1IC 1EXDA 2JI9A 5FJJA 4ZVPA 2YXBA 2I6GA 1A5SB 1N6RA 1XDBA 2ZI6A 5JSKA 2NU8B 4RGYA 3OZGA 4TVOA 2H48A 4ERXA 3JQQA 1JDJA 4TL8A 1JEDA 4Q9JA 4UVGA 4Z8XA 3G68A 4NHEA 5K3FB 4EATA 2Q1UA 4FLEA 2WZBA 1NASA 3RI3A 5LUBA 5KKNB 1RXWA 2YWDA 1MPTA 4M49A 3PJFA 5LKRA 4FEGA 4MW2A 4KQ2A 1KU6A 3ROFA 1NW6A 1H1DA 1NM5A 1TIKA 5FV4A 1QH1A 3IAUA 1E64A 3C8HA 3TKYA 3DQQA 2ZCUA 3H1PA 3LCCA 4PIPA 4B4OA 1TTPB 4EG4A 2YNMC 5EJ4A 2K7ZA 1XDGA 2H5IA 4G8DA 3EOBI 1OVGA 1J39A 1E3MA 3NYRA 2PLFA 1SHTX 2H1WA 1VG8A 4LWZA 1QIFA 4V3BA 1PX2A 1PGQA 2ZJOA 3D2AA 2ZJBA 2GHRA 3BGSA 4WZBB 5SY4A 3EGWA 3LT4A 1M0SA 1TU4A 4IV8A 1JQAA 2QX4A 3AHGA 3LFHA 4L76A 1RRKA 4HADA 4RYDA 1AGNA 3AL2A 3ESZA 3VBEA 1H4TA 4TVKA 1FMJA 3A1EA 4X71A 3PTLA 4RHCA 4B4UA 4PHFA 2JASA 4NPHA 4OQQA 2PKEA 3DXZA 3W8FA 4OXRA 4J2OA 3WKDA 1KVSA 3IULA 3NHFA 3O8NA 3VR3A 1Q19A 5KSZA 4A5SA 1LNSA 4BECA 1JLHA 2EZ8A 2VTDA 4WGFA 4A16A 3M2TA 3UAVA 4PTLA 2VWPA 2GWHA 4AS3A 1UT5A 3GARA 2OHHA 1P0QA 2SCUB 4RZIA 1XZHA 3R3VA 4D0SA 2QLBA 4UU1A 1D8TA 3SG0A 1FSGA 2XOEA 3JASA 4NFHA 4YP5A 2Q4BA 3EGDA 2DBRA 4Y9UA 4J29A 4URFA 3EGEA 2FMKA 1QHXA 1UMDB 2I4RA 5DTRA 3TZKA 3LSTA 1W8IA 4FI3C 4RQBA 2WD7A 3C41J 1GKKA 4L0CA 4ZXFA 3FJOA 3D1LA 2FUG6 4ZOEA 4AJKA 2FZEA 1P81A 3CNQS 1N0IA 3EHEA 1QCCA 1WF3A 3JD2A 1K3TA 5K9ZA 4XWGA 1QIDA 5IC6A 2HF9A 3WV4A 2JVKA 3G9ZA 1IN5A 2VTBA 4H35A 4MS1A 2Q1YA 3WYCA 3BYZA 2VZLA 4P82A 5AKIA 4CQJA 2E2WA 1AHIA 4G0OA 2FP4A 3IGFA 3E1GA 2ZU0C 3OKPA 1V8BA 5TT0A 1AF7A 3ENWA 2ZJAA 2FEPA 3F3SA 2GTIA 4O2BA 4NULA 2VF5X 1RYFA 2VPPA 4LJKA 5K09A 4TTAA 4G5HA 4GP6A 4HN9A 5DHAA 1DAFA 3VU1A 3JV7A 4Q1DA 4FSDA 3V8EA 3TF5A 4J16A 5CLHA 3D43A 4DQKA 3E05A 3L43A 3AY7A 4TXHA 3GYBA 3AP1A 3ZHTA 2RHBA 2HIMA 4ERNA 5C18A 2JH9A 4HWKA 5LWHA 3I0NA 4RDCA 4Z49A 3C7DB 4AMYA 2PS9A 1I2BA 3GCGA 2ESRA 4OYRA 1BMTA 3AUAA 3N2GA 5FPTA 2FZ5A 1X15A 2NYVA 4ZCIA 3PNBA 5E4YA 4Q3NA 4EKDA 1Y7LA 5EKSA 2R8EA 2BEUA 4JBGA 4R41A 3NV9A 3UUEA 3LBFA 3JXEA 3EJWA 4A0SA 4BLOA 5L8VA 4NCHA 3UMCA 2Q3JA 5CTJA 5F23A 2H2GA 4C0WA 3FLBA 2IX3A 4KQ6A 5FWYB 4I99A 2UXBB 1E1CA 3NIFB 1Y6FA 2G3YA 1DI0A 2GEVA 3DHYA 3F9RA 1RPJA 4QRHA 3RTAA 3EZ9A 4BL5A 3EVNA 5TIIA 4RORA 5IFKA 1NVVQ 3VR2A 2FEAA 3EMVA 1EWVA 1YS4A 1YI0A 3WTCA 1YIDA 1KI2A 1U8FO 2DHEA 3SX2A 2BVNA 1ZU4A 3RHFA 3UK7A 3IJPA 1AO3A 1PJ2A 4ZI5A 1MIHA 1CZNA 3NAQA 2JHFA 1WCIB 2A57A 1E0DA 1OGYA 3E9CA 1LSSA 2X5XA 2IV7A 2GZSA 1F12A 2JANA 1L4EA 2JFYA 2J30A 2NYAA 3HB1A 4PG7A 4ZQBA 3FPEA 4ZEMA 3VYRB 1K2WA 4FOLA 4ARBA 2ASVA 1DIAA 1EP9A 1HC7A 2N42A 5HF5A 2R4UA 2HDNB 1D4AA 1KOLA 3PQFA 2OBNA 4R9RA 3RFUA 3I64A 2UVPB 1DP4A 4GI7A 3CSDA 1R6TA 2Q6KA 5HZHA 4IRXA 4DLPA 3AUTA 4BJ3A 5CW2A 2P69A 5DFAA 1QGED 3RUPA 3KT0A 2BGTA 4RQTA 3K8YA 3I34X 3JQEA 3L82B 3QLEA 4JC8A 5U9CA 1U0BB 4BJHB 1ZHFA 1WXDA 4G9BA 5FOWA 5I8PA 3UPTA 3KLBA 3EG9A 5BT8A 5JYEA 5BQFA 1Q16A 4L6IA 2PTHA 5ADHA 3ML1A 1ZVVA 1IPFA 1PDOA 1KSHA 4FPXA 3DTVD 2V6IA 2GBLA 3BK1A 1UFKA 2WJZB 1UMCA 1IZ0A 4DCVA 1U0EA 4EA6A 7YASA 2Z6UA 2G9UA 1XU9A 5FR2A 1UKBA 4HG2A 1RM3A 2PRKA 3GMTA 4Q21A 1M2VA 4MA4A 1F6WA 2BONA 3FZEA 4RIGA 5HF9A 1W8DA 2VYVD 2BYTA 3E82A 4BZWA 5I7UA 1DGQA 1FYWA 4LHYA 3TK1A 2M6KA 1LNZA 2WBLC 4XGQA 4JI3B 2W6QA 2YIDA 1BRTA 3C6MA 4LHXA 4ND5A 4P0PB 2FPUA 3GEDA 1NQXA 2Z30A 3QHQA 5DP1A 5CXUA 3KQLA 2VUHB 1O89A 3FGZA 4IUYA 3RHTA 4CDMA 3BAZA 4H31A 4WIAA 5EGSA 4CMCA 4FKMA 3CLSC 4Q1CA 1Z39A 5F21A 3D59A 3JYHA 4F7WA 2PT9A 3V4OA 4EG7A 2P7HA 4C4YA 3KJQA 5KDLA 4DZZA 4AJOA 1JTEA 1LF0A 1B2RA 4R1LA 1X1DA 5IS2A 1PL6A 1TLFA 3MCUA 4LC0A 1T1SA 2G5GX 3STTA 4DCGA 1SIUA 2J9YB 1UOOA 1THTA 2XECA 1YU6A 1LGYA 1NQAO 2REQA 1SA0A 3UWSA 1MPXA 4CODB 4ZD6A 4TYQA 4HNAA 4FGLA 1OFVA 1NTRA 1SZJG 5TGTA 1IK4A 2ZVQX 4A3SA 2VT3A 2JARA 1GAJA 1FFXB 3L8EA 4KVFA 4LECA 4ZVOA 1BQ3A 1L4GA 1OZGA 3NBFA 3JQ8A 4E2ZA 4TUYF 4UBIA 5JQGA 2GUGA 1DIGA 3D3KA 4KCGA 4KQEA 4NDZA 5EE0A 3BHMA 5BVGA 4N9QA 5TF4A 3X3HA 3CX6A 4UFNA 1DB3A 1HFWA 1CWUA 2IPNA 2C00A 4KPUB 4MCJA 4CMKA 3KQUA 1CUIA 4GNRA 1DX9A 2YHIB 3DKKA 1Y8QA 2FPSA 3H16A 1ZYUA 4NY1A 3R3SA 4XB1A 1S6YA 2IEGA 5B12A 1PK9A 2Y6VA 2VH1A 4YRNA 1YBVA 3CCBA 3LL4A 3A1TA 4EGQA 2WP8J 1PL0A 4FW8A 2X5JO 4TKMA 3H5AA 3RVLA 1TVKB 1Y3AA 2JCYA 2AI3A 3HBLA 3MK31 3P0JA 5BUZA 3H5TA 4IGEA 1NFFA 1C9NA 2G36A 3CNBA 4FYMA 4MIKA 4C06A 4L57A 4Z4EA 1R37A 4KVAA 2YL2A 3FFAA 4N7RA 1CUFA 3TE7A 3HK2A 4QJ4A 2WJHA 3D0KA 2WJAA 4IF4A 1DKNA 2JFQA 2ZIZA 4GZMA 3M6XA 2JZCA 1MZVA 2G6TA 2VJBA 2OV2A 3P4UA 4NZ9A 1IN8A 3RD5A 1SCAA 2ZR0A 4BUCA 4NXMB 4BLQA 3GZNA 5A4MS 4B6RA 3H0CA 4EHLA 2KW5A 4XX0B 2I7TA 3EVBA 5LMZA 1C4XA 1E2MA 2R8PA 4TROA 5F64A 5DNUA 5EXSA 1ID1A 4HQ6A 4O4LA 2FKAA 3RBAA 5JRDS 5IDVA 4ALLA 3O4HA 4HAYA 1MX9A 3A6DA 4YO7A 3OC0A 2UYQA 2Z2ZA 4NV0A 1EM8B 1E1MA 5B1DA 4UFPA 4UHHA 3KFXA 3QSGA 1MH1A 2DSNA 2XB6A 3FTPA 3OAAD 2FRVA 3PFCA 4RLSA 4U2CA 3U62A 1PEYA 1T9DA 2HKIA 1WPRA 4I5FA 4UAVA 4U7GA 5TVKA 1XHEA 2NVUB 4EY7A 3D4IA 2QX9A 3A4MA 4PPGA 4REOA 4IV0A 3ENKA 2AZMA 3BXGA 1HLFA 4U39A 4E15A 2BMVA 3VYSB 3AX6A 1EHCA 1NTOA 1Z22A 2FHPA 1H3EA 3LJKA 3COSA 4NBLA 4B2IA 1NBIA 1ORIA 1XLTC 1RQNA 1Q7GA 1Z4OA 3F74A 4DG9A 1WABA 1EZ4A 2HPVA 1P80A 5AIAA 4CT0A 4C07A 3EQ2A 1QS0B 3CF4A 2RIRA 4KXVA 4R1SA 4UCXA 4Y98A 3UMFA 1MX1A 2BLLA 2P2LA 1G0NA 3G1UA 3L7IA 3AWDA 4NE7A 4X97A 4YRQA 5C5DA 5LUAA 1M73E 1B6GA 2PT7A 4IJQA 5U4QA 4G63A 3GRUA 2O7NA 2ZYIA 4RH3A 4AKHA 4XTRA 4EWLA 5AJVB 2NLOA 1CIPA 2BHLA 1S2LA 4FYYA 4IDOA 4RK5A 3MBKA 4KXNA 4MWCA 4JH0A 2CNLA 1RKXA 3QLUA 4QYIA 2VDWB 3FVQA 3E8MA 4N18A 1E61A 3CNNA 5KZMB 1E4EA 3O2QB 3ROPA 2XQKA 2EBUA 4KH0A 4EUSA 5AW6A 1DELA 1N78A 3TX2A 1E2GA 3ED1A 4RFLA 1VA5A 3EZ2A 3HLYA 1E0JA 3UH0A 3OAAA 1WR8A 1SZPA 4JQCA 4R2HA 1VKZA 1LLCA 4H1UA 2EFHB 5EYPB 4B6EA 2PV7A 2N3ZA 3RRJA 3A04A 4AZSA 2AOTB 1GZ5A 3KYCB 3O2NA 1XJCA 2O6HA 3E2IA 2WWTA 1R0SA 4L74A 3WL3A 1FDWA 4I4IA 4K5QA 3SR3A 3WOVA 5AOAA 1XEWY 1PL7A 2RHJA 2OCXA 1TM5E 2ZBVA 3WIVA 1JR3A 3WWYA 2UV8A 1N5MA 1DJPA 1U2ZA 2CJYA 2CSUA 2BHTA 1W96A 2HJVA 2NZ2A 3AY6A 1JMKC 3OQPA 4GC5A 2AMVA 3LNTA 1RFGE 4INAA 1YONA 3FHOA 4E1VA 3AEUA 3HB5X 4P58A 3L1IA 1AKEA 3MA0A 3OZRA 1VI2A 5ALNA 1V4BA 1XMSA 1U7UA 3UENA 2ZSUA 4CCYB 1T4CB 1GA4A 1XTUA 4A36A 4MVJH 1D09A 3QEOA 1MO6A 5HK9A 2BKXA 3QSYA 1EWRA 1VB5A 3JVVA 3K70C 4OJTA 2GVZC 1KAGA 2CNBA 2VH5R 3OLQA 2VRBA 2XJ4A 4J49A 4JP3A 1E2LA 4Y2QA 4YMVA 2G0AA 2P6MA 1IOVA 4I2NA 3SDZA 3WGVA 3OO1A 1K4KA 3H2YA 3SF0A 1QQBA 4DRYA 4LF7B 4FFNA 4F4IA 2H07A 1CDOA 1PZHA 2V6BA 3IVXA 4RFVA 4Y67A 4M55A 1YO6A 2BGGA 1FDIA 4R0NA 2AG8A 3MAJA 4OXYA 3F90A 5FOVA 3KQKA 3VBCA 2VXCA 1G7SA 4HEA1 2J31A 3LQYA 1OH6A 2RBKA 1RM0A 3PXXA 4GEKA 5LOVB 4MMZB 1JQLB 2RI1A 1E2EA 2W2KB 2BFDA 1USGA 4OREX 2C7PA 2CT8A 5HGJA 4BO0A 4JSRA 5CRIA 1N0WA 1XTPA 2X6TA 4RZSA 2HCJB 4QQRA 1QFJA 2A1TR 5G2OA 1M2JA 3AR8A 4KITB 4I5DA 3R2JA 5GIOE 1WDTA 1JHPA 1YL6A 3FOWA 2FW9A 3MJHA 4WVFA 2X4DA 1VPDA 5AWFC 5EC8A 3IT1A 3ZDXB 5DW3A 1F6BA 1FSPA 1N9KA 1W0CA 1G21B 2OC4A 2VUTA 1FP6A 4YIKA 4QT0A 4RS4A 4CQMD 5H3LA 5LLTA 2E5WA 3QNUA 2Q3MA 3T9DA 2ZANA 3V34A 4F86A 1ZD8A 5GOZA 3LHDA 2WUWE 4OFZA 3WKBA 5JY6A 4M0KA 2PYZA 5CW1A 4Q19A 2GEBA 3GVHA 5EPOA 4RA9B 4TV9B 4V1CA 3FNIA 4TMZA 1LA2A 3ADPA 3PX3A 4HB0A 2PH5A 2C2OA 1Z75A 4B71A 3IUYA 3H2GA 4YJHB 2C7OA 3CZQA 5E1BA 4L22A 2AR9A 3W5IA 4AX4A 4CG2A 4R1TA 2E18A 5GJWC 4X63A 4ZDJA 5DDIP 1U5BB 3ET5A 2PUDA 1G6OA 2QRPA 3C43A 3M83A 4LOIA 5DGHA 4MAFA 1OTHA 1RWVA 4WRRA 1JDUA 1G3IA 2A92A 3UXMA 3V46A 4D3YA 1W36C 3B53X 4WAUA 3GEMA 2VNAA 3ND8A 3ZN2A 3KK0A 4V0QA 4OLAA 9ABPA 3ASZA 2XMRA 5D00A 1OXMA 1V5GA 1YUMA 4ZHQA 4KIFA 5JVDB 2XTZA 4GXQA 5ICMA 1CUBA 3HCOA 4XTCS 3KVRA 4Q9IA 2Q2NA 3DMGA 1XEWX 4HYTA 4OEHA 4QYXA 4ZGWA 4JIGA 1XZBA 3ZNPA 4XR9A 4DC1A 4N6NA 1YQWA 4MB0A 3EQ8A 4W82A 1T9ZA 2WIAA 2LD4A 2RH4A 3UB3A 4L8FA 1JRLA 4CVNA 3H3JA 3QEBZ 4P1ZA 5ELMA 2XMQA 4MYSA 3VVLA 4C22A 1SRQA 1ULUA 1O9HA 4FJ1A 5BNZA 1AZTA 1PFQA 2WU3A 4HS4A 1XRSB 2LVBA 2CXNA 1QF9A 2RIPA 1TO2E 1TI7A 3BRWD 2F1JA 1ZUNA 4TTRA 5DISB 1BW9A 3H2HA 5K4AA 2N75A 2A0WA 4PC6A 3U3KA 2RHTA 4RTQA 5J3JA 5JARA 2HIAA 3IDQA 3V42A 4OQMA 3MWJA 1M5TA 1GPAA 3Q87B 1B73A 2OC9A 1A82A 3T9EA 2J6BA 1GKYA 1THMA 3DGFC 3FUUA 3FYDA 4F06A 5JH7B 2CL5A 4PICA 3CX7A 4EKNB 3E7FA 5E0OA 5FNVA 2JGKA 1XMIA 2CLMB 3CM0A 3ABRB 3E84A 3I9KA 5DI9A 3FAKA 3LSYA 1KSJA 5SYNA 3W2IA 2IP2A 5BSHA 1FMLA 4YFYA 5KYKA 2BHRA 4LSWA 2HK8A 4NYJR 4Q9LA 4TLMB 4AIRA 4NXNB 3TSAA 3TJZA 3DDSA 5BV7A 4C08A 4FHFA 2NPIA 3EN0A 3PNPA 3Q41A 4B3MB 2AB0A 2W0SA 4IVNA 4NX2A 3ZTWA 1WLYA 2B69A 3KD3A 2XJ9A 2REXB 1QE3A 3QHPA 3C5CA 3GQBA 2QMEA 1F2VA 5FPHA 4XZ3A 3FNRA 3Q9NA 3FMPB 4PLTA 5TPWB 2V5VA 2XUZA 1C9JA 1UKEA 3EEYA 1CP2A 4R9VA 1BKYA 3ZI0A 1MOQA 4XSGA 1C1DA 2OZVA 2HRBA 2PD4A 2NU7A 2FA9A 3I92A 1U9IA 3N9IA 4F12A 2BI8A 1VKRA 5KSYA 1C3OA 2H9AA 2IVZA 2FWJA 1A2BA 4Y0VA 3GEEA 5T4BA 3SXPA 1QBGA 1L1RA 5TQVA 4D0RA 1Z83A 1DRWA 2ZYGA 1SG6A 2YZNA 3G5AA 1J5XA 3MC1A 4AC9A 2AXPA 2RFLA 3HJGA 2UUOA 5IUNC 1EUZA 1ZG3A 3K4HA 4E70A 1TQ6A 5ENDA 4UNIA 1FNCA 2ZSDA 4QA9A 4RL6A 5EL0A 3TNYA 5EZYB 4EZEA 1YJCA 1SHZA 5JQGF 4A10A 2PSDA 1G4AE 2GEKA 3GVIA 2QM3A 1U80A 3R5SA 3WXBA 3NONA 2PUJA 5AP9A 1S4QA 4RNDB 1DRKA 2QAGA 5LB2A 3ISTA 4YXWD 4Z7NB 4F3NA 3VXKA 1OFHA 3AESA 2ZM6B 1IU9A 4BB6A 1MQAA 3QLJA 1NW4A 4XVRA 2PL9A 2GQ0A 2FZGA 3IQWA 4NU6A 4GX5A 2NQ2C 1CY8A 3J81k 2XI4A 4FOSA 3ABOB 3GLRA 4O2LA 2C5HA 1EEHA 9ATCA 2FPPB 2QRGA 3A3OA 5CNIA 3HEAA 3HPQA 3PXCX 3TL6A 4K6HA 4I36A 1QJ4A 3DDCA 2PKRA 2VBIA 3EXG1 4FNOA 4MQLA 1ORTA 2JLCA 3VO8A 3QOXA 5BV8A 1A4IA 2GD1O 3C2QA 4XLTA 5JS8A 3RU7A 1LK0A 1SKYE 4OU5A 5JYDA 1HYEA 4ZEOA 3LGAA 4WHMA 3ZJ4A 3BGDA 2ZS7A 4EG3A 1MTZA 2WLSA 3FCUB 5J1TB 4Z3DA 5ALVA 3EZ6A 3D4NA 5FF9A 1TYEB 4BDTA 3W3AH 4UUMA 3RWOA 2I9PA 2FE4A 2VJOA 2QJOA 4WK2B 1FFEA 1T1JA 3AHCA 3KBOA 3UT5A 1HR0B 5C5CA 3SN6A 4QJIA 4LFBB 1R9MA 3L6BA 1DNPA 2YDXA 3IIJA 4O4LF 2EJUA 4RXUA 3ZNNA 1O6GA 4E7OA 1ZC3A 3MF4A 4UOZA 3NDIA 5CBPA 2J3DA 1NOKA 2NVBA 3G1WA 1XL0A 4BPBA 4AULA 3QGMA 3D4OA 1YNSA 3ENVA 3V8PA 3BKWA 1N2OA 3IC5A 2J1LA 4RKRA 2VWGA 3BXEA 1YKGA 3KKEA 4YRTA 1M75A 4DMGA 4BB0A 5CM9C 5IJAA 5HIAA 3TI9A 2MOKA 2Q5CA 3U39A 1GU0A 3DLBA 4C4OA 4BX3A 2WR8A 2Z3VA 3EVFA 5EWMA 5FO1A 4R05A 3ZGZA 3WB0A 2OXIA 1HL7A 2VG8A 2WJIA 3NTQA 4JEMA 4M0FA 2XWBF 2DTEA 4RADA 1X74A 1Y6JA 2NT4A 1FUIA 4RX1A 2XCSB 3EXAA 3AB3A 4XASA 5I3CA 1YKSA 1TUBA 3ZLBA 1JR4A 1YHNA 5JTTA 4KNVA 3H8SA 4PG5A 1UMBA 1AC5A 1BS1A 3HN7A 4BLUA 3GRYA 1GNLA 4CTKA 1NUPA 4BNLA 4C29A 1M0EA 1OV4A 1V35A 1ZC4A 5B6IA 1TVMA 2ZRO