3H18A

Crystal structure of este5-pmsf (ii)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
296
structure length
293
Chain Sequence
b'AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
molecule tags Hydrolase
source organism Uncultured bacterium
publication title The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads.
pubmed doi rcsb
total genus 100
structure length 293
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h18A00
5AO9A 2J4FA 3WZLA 4OB8A 1AZWA 1E8NA 4PSDA 4FNGA 3PF8A 1WM1A 4DYHA 3F9CA 4BZWA 5DTIA 2BUCA 3LLCA 4FBMA 1XLUA 3IURA 2ZYIA 4N8SA 1OXMA 2JEZA 1TCBA 3HI4A 4QDXA 1FFDA 5LIPA 4W1SA 4B83A 3C70A 3A2MA 1BROA 2H1IA 3NUZA 3I2IA 5EHQA 1TCCA 5EHNA 3FBWA 5HF6A 2XMQA 4P92A 5LZ4A 4MQLA 3NGMA 2GBIA 3H1BA 3DKKA 5DWDA 2O7RA 3QPAA 5HCUA 5K5EA 3KWJA 2JGFA 1XZLA 1G42A 4MYDA 3ESCA 5FKJA 4H18A 5HKBA 2AXEA 5C7YA 4Y2YA 5SYMA 3SK0A 3S8YA 4UBLA 2C58A 4V2IA 4L3WA 3U0VA 5T4BA 1U8EA 4AZ0A 5IKXA 4ZI5A 1H2YA 1GQSA 2Z3WA 3AZPA 1GPLA 1WB6A 2RHWA 3ESBA 4IH4A 1ODTC 5EIEA 1GKLA 3N0TA 5D3KA 5ALZA 7YASA 4Y2QA 1MO2A 1MNQA 2QXUA 4FNMA 1A8UA 3PFCA 4M0MA 1MNAA 5K3EA 2WJ4A 2WIDA 4CCYA 1K8QA 1A7UA 2DQZA 4LXGA 5LZ8A 4X85A 3DYIA 1ZJ4A 1TKRA 1QO7A 3OG9A 2PSEA 3WKEA 3KXPA 1DTEA 3WWPA 1ZD3A 1CUXA 5ESRA 1U65A 4LYDA 2AJCA 1DX4A 2BJHA 3QMMA 4B85A 4AN0A 5A7HA 1XZKA 4J03A 5HZGA 5AM3A 2WUDA 3VKFA 5D3ZA 2WIKA 2CB9A 4GW3A 3STUA 5FXMA 1R9NA 3QH4A 3F67A 4HVTA 3F96A 3R3YA 5BV7A 5KBYA 4UHEA 4X00A 1E3QA 3BF7A 5CBKA 3TRDA 1EK2A 4Y2RA 4HZGA 4TVKA 3WKDA 4U2EA 1X2BA 2ONCA 2WJ3A 3EBLA 1O6GA 5T4FA 4AZ3A 5FPQA 4G4IA 4U2CA 4UHBA 1C7JA 1JT2A 3EF3A 4BC0A 3G9XA 2HFKA 3HSSA 1N5MA 4E11A 3WMRA 1RWQA 1SCKA 5ALDA 1P0MA 4WDQA 4UHDA 1Q83A 2W22A 5HFAA 5AK6A 2VJAA 2C0QA 2GYWA 1JU4A 5I7UA 1RYYA 3WJ1A 1JJBA 2ZSHA 1LPMA 4BRSA 1VKHA 4FTWA 4RPCA 4GDMA 4FWBA 3B5EA 2FUKA 4JYPA 1ZICA 1E89A 1LLFA 4LHEA 1MX9A 4Q3OA 4AX4A 3C6XA 4W9RA 4PQEA 3STXA 3L1IA 2XE4A 5AM5A 4HXFB 1JMKC 1XZIA 3ZLVA 3CXUA 1RP1A 5ALMA 3PICA 5ISMA 2XUKA 4X6YA 4OPMA 4UHHA 2XMZA 3C8DA 2HA5A 2VJBA 2JBWA 3WIOA 4YPVA 4DMFA 2AJBA 1ACJA 5SYNA 2GBGA 1HQDA 1EB9A 3G0IA 4FFVA 2H7XA 4YASA 4B0OA 1CV2A 5IVHA 4C87A 3ESDA 1QTRA 5ALPA 5JARA 5F4ZA 3D2AA 4C88A 3QITA 2QJRA 1QFMA 1YB6A 3FSGD 3VVLA 2O2GA 1FFCA 2PVSA 4EA6A 3HC7A 2HFJA 2I03A 1W1IA 4KE7A 4Q05A 2DHCA 4G8BA 4DLNA 5CT9A 3C45A 1EH5A 4NZZA 3M83A 3AIMA 5AI0A 5BWBA 3BJRA 3E4DA 4HTAA 3SX4A 3EQ9A 5ALIA 4J0HA 1FSSA 1WPRA 4CG2A 2HA6A 5D7BA 4G4GA 2G5TA 1EVQA 3PE6A 4QDUA 4EY5A 3QMVA 4DSAA 2JGKA 3AZOA 2ES4A 2D5LA 3WKCA 4QEKA 1QO9A 3WWDA 3C87A 4WJLA 2GYUA 1JJFA 4BB0A 4HXEB 1QIDA 2QR5A 5AH0A 3M3DA 4PW0A 4KAFA 3IBTA 5AK3A 3FVTA 5AKIA 2PM8A 2I3DA 4UUQA 4UBMA 4Y2VA 2ZJ7A 4GECA 5HK9A 1WB4A 1NU8A 3RK4A 2VAVA 1E8MA 4NS4A 3VVMA 2BCEA 3O9MA 3K6KA 1XRRA 2Z8XA 1H23A 1UZAA 3GFFA 4UBOA 1CLEA 4LKOA 2YASA 1W76A 5JAHA 5ALJA 5JALA 4ZWNA 4JUIA 3TJMA 1EXWA 1R3DA 2PX6A 3FCYA 1B41A 4BCCA 3CN7A 4B0PA 4RE5A 5JATA 3O4JA 5AHXA 3QPDA 5JD4A 4H7KA 2J3DA 3LP5A 1AURA 4FDMA 2Y2UA 3WQHA 3V1KA 5HKAA 2ECFA 1HPLA 3OURA 3I2JA 1MAHA 5T4EA 4KAAA 4IH9A 2JF0A 5FLKA 2GZSA 4L9AA 3OM8A 5HQ3A 4LXIA 1XROA 2C5GA 2PBLA 2YH2A 1E66A 2IX9A 3O95A 4YK7A 4QWMA 3O4GA 2XMCA 4S0XA 4N8EA 2C7BA 4X6XA 1HBJA 4IQ4A 1AKNA 5AOAA 4MQMA 3KD2A 2OPHA 4DNPA 1XZMA 5DNWA 3R0VA 4WFJA 3OTQA 5T4HA 1W75A 1CUAA 4GWLA 3MUNA 3WL8A 2Z5GA 4WFKA 5AKHA 1UKBA 2E3JA 1TCAA 5DYTA 3WK8A 1A8SA 3D7RA 2HU7A 3KWFA 2WG2A 2XUPA 2K2QB 3W06A 4G5XA 1G4HA 4J0CA 2QXTA 2QZPA 4ARAA 2QT9A 4B6GA 4W63A 2D0DA 4OUKX 3I2GA 1WB5A 2H7CA 2RAUA 2ORYA 1E5TA 2RONA 5CT8A 2PUJA 1CR6A 4JEIA 2BGRA 2XQIA 1CUBA 4EY6A 1EI9A 5AI6A 2V98A 2XQJA 4BAGA 5I8PA 4K2AA 4ZV7A 1H2ZA 1HKHA 3BXPA 1QIFA 5AKKA 4JNCA 3I2HA 1R88A 1DT5A 2VTVA 4C4YA 2XQKA 1F6WA 5FPPA 4FKBA 1VXOA 3AUKA 1OCEA 3R41A 5LZ2A 2B4KA 4GBGA 4H7JA 1IZ7A 5I9IA 5D6OA 2DHEA 5FV4A 1XZGA 2J4CA 5CRIA 4E15A 2JGMA 4BE4A 2B61A 5FDFA 2JGEA 2VSQA 1LPPA 5AI8A 3FLBA 1YS1X 3WK9A 4E46A 2WFMA 1QJ4A 3I2FA 1R1DA 1X70A 1BRTA 4G9GA 2AJ8A 4BC1A 4KEAA 1XKLA 3JW8A 3QVMA 2OGZA 2XUFA 1A88A 1QE3A 3O4IA 3QZUA 3W04A 3T52A 4F60A 4QA9A 2XUAA 5HF9A 3VDXA 2OLEA 3LCRA 4IO0A 4Y2SA 5JD5A 2VA9A 2VT7A 1XLWA 1BN6A 2WU3A 4UHCA 4XVCA 5A6VA 3BE8A 3PI6A 3AIOA 2XUDA 5FRDA 4X6UA 4ITVA 3STWA 3IUMA 4BAUA 1AUOA 1HLGA 4FMPA 4UBIA 4UHFA 1QTIA 1XZHA 5CH3A 2HA4A 1ZI8A 4KAJA 1R50A 5AM2A 1WOMA 2BUBA 1D07A 3C8HA 1QGED 5K3FA 1XZAA 1EK1A 5A71A 3X3HA 4Y2UA 3IVMA 1K5PA 2OCGA 3PDCA 5ALKA 1OILA 4H77A 3FLAA 4B82A 1DT3A 3FSGA 1HL7A 4QLOA 2QJWA 1ODCA 4AXBA 4OYYA 1IZ8A 2IITA 5A62A 5E4YA 5JAOA 1MU0A 3ZV7A 3T4UA 1VOTA 3H2JA 4Y2PA 5ALYA 1UFOA 1VA5A 4WY5A 5E4TA 4I19A 3Q8WA 5JZ9A 4XWGA 2V9ZA 3BDIA 3SC2A 3FNBA 1P0IA 3C5WP 2ZYRA 1ORWA 3V1LA 1SCIA 4OD0A 4AMYA 6YASA 2VQ6A 3V1NA 4ROTA 3HABA 4BVLA 5AKXA 3O9VA 2DCMA 1KEZA 5JAUA 3G0DA 4P9NA 4J0IA 4A16A 2YXPX 4ETWA 4BP8A 4ZV9A 4RNCA 2RGUA 1ZGCA 4OSEA 1IUPA 2XUGA 4PF1A 3WYDA 4CG3A 3E3AA 3DOHA 4CIAA 2Y2VA 5CXUA 3WL5A 1K4YA 4FHZA 1M33A 4BTLA 3I1YA 4OB7A 3H2KA 2X76A 4QWWA 1DINA 4DMKA 5HF5A 1Y7HA 4J0DA 4QDZA 5HK8A 1VA4A 3GUUA 3EQ8A 3TGLA 2OXEA 2WM2A 2DQYA 1CUUA 4X91A 1J1IA 5LZ5A 2R11A 3A6ZA 5ALRA 1P0QA 1ZD2P 1YB7A 2G5PA 2H9YA 3AZQA 4EBBA 4U2DA 1ISPA 4J0KA 1ZD4A 4Q34A 3ILSA 2GBCA 1UOQA 5A7GA 1CVLA 3RLIA 2BKLA 4WFIA 2WFZA 3DS8A 2V96A 5JANA 1DWOA 3R40A 4ZGBA 4MEAA 1ZI9A 3G9ZA 5AK5A 4RGYA 3C5VA 5ALLA 4B9EA 2YYSA 1H22A 5EFZA 2WSLA 2C4HA 1GPKA 2FJPA 4U2BA 1GKKA 3ANSA 1A8QA 4XJVA 4LIPD 3L1JA 4AMZA 5EHXA 4BATA 2QM0A 3V1MA 5AKZA 2WUEA 1KU0A 2JEYA 2WJ6A 4U2FA 2QVBA 3VJLA 3IA2A 4DNQA 3ZWQA 4P08A 2CJPA 1G66A 2CKMA 2WFLB 3G02A 5BOVA 5DLPA 3I1IA 4RE6A 1TRHA 1XQXA 4JYMA 3WWOA 5J3JA 3ZLUA 4BZZA 1MT3A 4G8DA 5AI9A 5LYYA 4DMHA 4K5QA 3IUQA 2CMFA 2XMDA 1MAAA 3W2TA 3AFIA 1XQVA 4W1PA 4H7EA 1ZOIA 4B80A 1UK9A 2X8BA 1CUEA 4W1RA 2WU4A 2DSNA 4OB6A 4C4ZA 2RHTA 4KRXA 4K6KA 4IHAA 5JZBA 2OCKA 4B7ZA 5HFNA 2BAGA 3D2BA 1XQYA 5CXXA 3YASA 3HYSA 1C7IA 1Y37A 1CUZA 1CUGA 3C6ZA 4DIUA 2OAGA 4F0JA 3DL7A 2WUGA 1P0PA 2QMQA 3FYUA 4Y2TA 3A70A 1CFJA 2JGLA 4X3CA 1XZCA 1ORVA 4GEGA 3C6YA 4KRYA 3ZI7A 4X90A 2OGSA 4QNNA 1VZ3A 4H7FA 5HQ3B 3ZLTA 3I2KA 4BCDA 2Y1KA 3WL7A 1BEZA 2HM7A 5CURA 4WCVA 1FJ2A 1Q84A 3IUJA 3PFBA 4FLEA 1CUFA 4BE9A 2PSHA 1CUVA 2JGIA 1GT6A 1KU6A 4KE9A 4BP9A 3PF9A 5DYYA 5JASA 1O6FA 4N5IX 2Q0XA 1S8OA 5IVIA 1DWQA 4X93A 4HS9A 5EI5A 3MGAA 1GXSA 1Z68A 1JFRA 5ALVA 3AIKA 3KDAA 3WK6A 4X71A 3V48A 4M0FA 1SC9A 3ED1A 4CFSA 2GZRA 2RI6A 4QDOA 5CH5A 2HU8A 1LZKA 2BFNA 1X2EA 1DU4A 1WPXA 3OPMA 3G7NA 3ANTA 3LIPA 3CCCA 3DOIA 3DEAA 2WIGA 1THTA 4H7DA 1TK3A 4Y2JA 1QIMA 1THGA 1CQWA 2WTMA 4UBJA 1CUSA 3BJMA 1VE7A 2XUJA 1IMJA 4LYEA 3D4LA 1XRNA 1HDEA 1ZIXA 1W52X 5C8VA 2WHQA 3G0GA 4XIIA 1LZLA 3G8YA 3PUHA 5HF8A 3HXKA 2CEKA 4EZIA 4EY4A 1UWCA 3BIXA 4UFPA 1MX1A 2HA2A 3I6ZA 3KSRA 3W9BA 3O0DA 3D59A 1CUWA 4H0CA 4K6GA 2HRQA 3O4HA 3STTA 1CQZA 1NX9A 2H7YA 3FYUC 1QIKA 1MN6A 1UK8A 4C89A 3WKAA 5IVKA 4HRYA 4I3FA 2CUTA 3OC0A 2B9VA 1C4XA 1XLVA 5DJ5A 1YCDA 4OYLA 4AO6A 4EY7A 2EDAA 2DR0A 1EDEA 5CTAA 1CUIA 4WDRA 2DFPA 4EUSA 5KREA 3DJYA 1MPXA 1Q0RA 3WA7A 1VXRA 4Y2XA 4C6HA 3IUNA 3QBJA 2GBFA 2IIVA 5YASA 3N2ZB 3RARA 3Q0TA 1QIHA 3WK7A 1J07A 4EY8A 2XMSA 4X7BA 3UUEA 5A7FA 1CUDA 5AKLA 3TEJA 1DX6A 1WHTA 5ALWA 3I28A 3KOOA 4H35A 1G5FA 1H2WA 1ODSA 5AM0A 3HRHA 1XZFA 4Q3KA 2WG1A 5AM4A 1QIEA 4Y9SA 1XRQA 2G63A 3STVA 1EX9A 4QE3A 3JWEA 2OGTA 1TIBA 2I78A 3I6MA 2JIDA 2PSFA 1YR2A 3D2CA 4MXDA 5CH8A 1CUJA 1JMYA 4G4JA 1BCSA 1UT6A 2Z3ZA 3G9TA 4HRXA 3FCXA 5JZSA 2HDWA 3ESAA 1ZJ5A 3FYTA 5AIAA 3EQ7A 3EIOA 1XFDA 1LPNA 1QLWA 1W4LA 5ALSA 1FFBA 2WQZA 2V97A 4B9AA 2WIFA 3FAKA 3F98A 2LIPA 3B3QA 3R3ZA 3AILA 2G4LA 4UFNA 3H0CA 2OCIA 4WY8A 5FUMA 1VZ2A 1QONA 2XUOA 3H04A 2PL5A 1F0PA 3DLTA 5IVDA 1USWA 4BTVA 1LBSA 2PKYX 1N8SA 3VXKA 5AOCA 5JD6A 2OCLA 2ZJFA 2XUHA 3JYHA 2JGJA 2QTBA 5DYWA 4B81A 4PNZA 1L7AA 1K63A 5E4JA 3D5EA 3DNMA 1F0NA 2ROQA 3FYUB 4CIBA 2WUFA 4Y7DA 5DTJA 1JKMA 2VJDA 4AB1A 4BVKA 5AOBA 1YASA 5JADA 5ALQA 3DYVA 5H3HA 1XRMA 4BCBA 5AIBA 4GI1A 1CUCA 1DWPA 1XZEA 2C0PA 4J0JA 3U1TA 3H17A 4O08A 5C8ZA 2UZ0A 5LKRA 4GXNA 2OQVA 2Z8ZA 5DNVA 3PUIA 1QIJA 2PSDA 4FOLA 3W9UA 3SWWA 4F5ZA 1AQLA 1JJIA 4KJXA 1EINA 4Z49A 4KE6A 4GHWA 2O2IA 2O2HA 4G8CA 4HAIA 1XZDA 3MVEA 2QRUA 5AKEA 3OOSA 4H7HA 4N5HX 5CW2A 5K3DA 3DDUA 4FLMA 2HHAA 1ZD5A 2VT6A 1N1MA 4AN1A 3K2IA 3BF8A 3WI7A 4QDTA 2XMRA 1CRLA 1UK7A 4UFOA 2XUIA 4INZA 4L72A 5JAPA 1SOMA 1SCQA 3WJ2A 1AGYA 3S2ZA 3GELA 1IUOA 1QZ3A 1NU6A 2R8BA 5ALHA 1IUNA 2CZQA 1W6RA 1L7RA 1TQHA 1ZGBA 1J06A 1JI3A 3G0CA 5ALNA 4JH0A 3IB3A 1L7QA 3HLKA 1EDDA 3H18A 4DNFA 3ICVA 1LNSA 4M0EA 1LBTA 1EVEA 1F8UA 1BU8A 3GZJA 3VISA 3R3WA 4J3JA 3F8SA 1QIGA 4PSCA 3QYJA 3FOBA 4G9EA 1WHSA 4F21A 5K3FB 1CUYA 1R9MA 1QIIA 1BEEA 1I6WA 5C81A 1WCYA 3CN9A 3BIWA 5AM1A 3HACA 1VLQA 5CT4A 3ZPXA 4J7AA 5FP0A 1AC5A 2J3QA 2XQFA 3P2MA 4PSUA 4CI9A 5EIAA 1MTZA 5EIHA 2QS9A 2RIPA 1XKTA 2OAEA 4KACA 4DM7A 4NVRA 4Q3LA 5K3BA 4QLAA 2AJLI 4FBLA 5A2GA 1SFRA 4BRZA 5ALFA 1UOOA 1QOZA 2XB6A 4DMCA 2XDWA 1U2EA 3WA6A 4UPDA 1UKAA 4H7IA 4BBZA 2ZYHA 2NW6A 2Y6VA 4L0CA 1UKCA 4X97A 3WL6A 1XZBA 4TGLA 5K3AA 4YX9A 1CPYA 2EDCA 4MJ3A 1EB8A 2FJ0A 4QZVA 5KWJA 4OU4A 5AKYA 3H19A 4ARBA 4A23A 4A5SA 3M82A 2VF2A 2WG0A 4B84A 1ETHA 3K9BA 2HA7A 1YA4A 4W1QA 1YAJA 3DL4A 3H2HA 3NWOA 2ZSIA 4X94A 3GROA 4ZRDA 2QUBA 4FLFA 3H2IA 2WHPA 1VJ5A 3WIBA 1VE6A 4DTCA 2VATA 5BWCA 2XLBA 3WLAA 2XQGA 3HEAA 5AI4A 1QFSA 3A2LA 2XT0A 4MYSA 5AI5A 2VJCA 5LP1A 4G1FA 1YAHA 3GA7A 2QKYA 5IH7A 3C43A 5EGNA 1TAHA 3IDAA 2GYVA 1XQWA 3WZMA 3QM1A 5JIBA 3C6BA 3H2GA 4MEBA 4OU5A 4PO3X 1GPNA 2W6CX 1UXOA 2EEPA 1BE0A 1DQZA 1CEXA 1UOPA 2I3ZA 2PPLA 1LPSA 3AINA 1DQYA 1YSCA 5CMLA 1EDBA 4UBNA 4BDSA 5ALGA 4MWSA 3LS2A 1FFEA 1LPOA 1BS9A 3WK4A 2HL6A 3V9AA 2XMBA 4P93A 3UMJA 2B20A 1MJ5A 3MUOA 2HADA 3G9UA 2XMGA 3CCBA 3R3XA 4N8DA 3NOXA 1K6EA 1BN7A 2BGNA 1ZIYA 2HA0A 2ACKA 1PV1A 1XRLA 3R3VA 4BYMA 1FFAA 3VJMA 2VAXA 3D0KA 3FWHA 4KYVA 2OG1A 2CBGA 2XUQA 4LXHA 5AKJA 1CIJA 5EHZA 4E14A 3AJAA 5E2IA 3IIIA 3DQZA 4FFWA 3HZOA 3B12A 3E0XA 2HIHA 1YS2X 3RM3A 3ICWA 3WWCA 5KWIA 3QMWA 4CCWA 3DD5A 4MWTA 4I4CA 3STYA 2C5FA 4GLBA 4KR0A 3LIIA 2ZVDA 1GZ7A 2WHRA 4DGQA 4X92A 3BWXA 2X5XA 3FVRA 3FLEA 2WTNA 1AX9A 5AP9A 1LGYA 4Q82A 2PSJA 2ZJ6A 5K3CA 4AQDA 1BCRA 3WYNA 1PFQA 5DNUA 3W05A 3BDVA 5ALTA 5AICA 3WKBA 2WFLA 5AK4A 2HA3A 4TPKA 1IVYA 5JYCA 1UK6A 3R3UA 1GGVA 5AJHA 2WILA 2P8SA 3E1GA 4DSZA 1ZI6A 1MX5A 2WHPB 4OCZA 1EHYA 3GBSA 5LZ7A 1XZJA 3IULA 2QUAA 5ALXA 5ALUA 4CCYB 3L1HA 3RKSA 1AMNA 3DKRA 3A2NA 4U2GA 3UUFA 4BDTA 4PV7A 5ALOA 2Y6UA 5ALEA 2ACEA 1T4MA 1GQRA 2XI4A 4NMWA 4K6HA 1Y7IA 2ZYSA 4EHBA 1PJAA 2BUAA 4X95A 1EA5A 2WIJA 5CT5A 1ACLA 2WLSA 4BAZA 1H2XA 4AO7A 1LPBB 2PUHA 3QPCA 1B6GA 1J2EA 1CUHA 4XX1A 4DNOA 3HJUA 3D3NA 3BL8A 5CT6A 4KE8A 5LLSA 5LZ9A 5AKGA 4CG1A 4ZREA 2XLCA 1JU3A 2AJDA 2DHDA 2WKWA 1N5RA 5LKAA 1R4ZA 1T2NA 2QOEA 2PU5A 2HRRA 4IH1A 2VEOA 4C01A 4AO8A 4Q1VA 3DCNA 4C4XA 3VJKA 2HU5A 3H1AA 4BVJA 4J0GA 3WWEA 1U4NA 1YA8A 4HXGA 3G0BA 2PU7A 3F97A 1LPAB 4EB0A 2FX5A 5FOQA 2OQIA 4ZXFA 5C8XA 3I6YA 1E8DA 1Q0ZA 4UBKA 3WK5A 3M81A 1XRPA 4D9JA 2O7VA
chains in the Genus database with same CATH superfamily
3RF7A 5CHYA 2WWIA 1HDXA 1E8NA 1XIVA 1UBHS 2GGSA 4RJIA 1O6ZA 4RH1A 2MCFA 2FW9A 1P5ZB 3HLYA 3KFLA 3PF8A 4XGNA 3BTOA 3CSUA 4DYHA 4MUYA 2H18A 3W3AA 5FL7A 2OP0A 3D8UA 2UZ4A 3FDZA 3PX3A 3AL2A 1U0EA 2H54A 2N3ZA 2W70A 3T7KA 2DUJA 1N6IA 1O77A 1RI5A 1XZNA 5FAXA 2JLVA 2ZYIA 4AS3A 1D0IA 3P20A 3TQQA 4KYIB 3N3AC 2JEZA 1JVSA 3Q9LA 1O89A 1R6XA 5ECWA 5EWLA 4GLLA 4ARZB 5LIPA 3S2YA 3ECCA 1C14A 1QHIA 3FETA 2G5GX 4PLYA 2DP4E 1U9ZA 2Q9UA 4U39A 4DSOA 4F4FA 1G21A 3LUPA 4JR1A 5C7IO 2GK6A 2FUG1 4L8GA 4U3JB 4OXIA 1WF6A 2FZLA 1USUA 4PNPA 2F90A 3EARA 3HR8A 2NZUG 1QG0A 4NNPA 4YJ3A 5B3AA 2I7VA 4OHPA 1M6VB 4Q39A 4DLBA 3SF0A 2SCUB 2E87A 3PC2A 4LMBA 3IL2A 4QUBA 5KAPA 1QOPB 3IJPA 5F73A 5AXBA 2ID4A 4WACA 2LWIA 3PPVA 3VSAA 3DKKA 2OM6A 3A6GA 9MHTA 4Q3AA 3CX7A 4WL0A 1RPZA 5AR1A 3QPAA 3UCFA 4C6TA 3CLRC 1HYHA 4CDGA 3P9RA 3OFVA 4OGGA 3FAZA 1L1EA 2FN4A 1EWYA 4LZAA 2CDAA 2J45A 4K9LA 3IDZA 4EWLA 1G42A 1H1LB 4MYDA 1EVIA 4J29A 1M72A 1SVOA 4DCOA 3VSEA 3ZKAA 4KX5A 3NW9A 5HKBA 3GLGA 2OCBA 2AXEA 4IILA 5J5CA 2FEAA 4YRLA 3UN1A 4BL5A 2EIXA 5AYVA 4CODB 1GUBA 1V8ZA 3N0XA 3MPOA 1VJRA 3ITKA 4OREX 2QIOA 3N8IA 1MVNA 4H60A 4Y2YA 1T0BA 4G24A 5K01A 3S8YA 4UBLA 1K98A 5C1PA 3A10A 5I7AA 1JDBC 2Q1UA 3GGCA 2DBQA 2IYLD 3MS7A 1UP4A 1DKMA 3DNFA 4L57A 3SFVA 5C3MA 5KTMA 3SR3A 1E9EA 2ATXA 1PQPA 1JZTA 4TV8A 1U8EA 2IYQA 4G0PA 1ESMA 4MUIA 4MVJA 1EUCA 1G7TA 3FNFA 3B51X 3K2QA 3R4CA 5F5XA 3QNWA 1XBTA 2CLMB 3BJIC 5J2TB 3O8LA 2B4TO 5DX8A 4TV9A 1I5RA 2D0PB 1GPLA 3LC2O 1WB6A 3LY9A 5EG5A 2V6BA 4J4HA 1PWYE 2O8DA 1I4EB 2H63A 3OUZA 4NJEB 4DABA 4GX2A 5ELMA 4IH4A 3RC7A 4C0BA 3LTNC 1FP6A 1BFKA 2DQKA 2XVZA 1SD2A 5EYPB 2Q7OE 4B74A 5KSPA 2HWWA 2COEA 5ALZA 4ZEVA 3HCRA 4LZNA 1UP6A 1MO2A 4CF5A 4YV0A 2OFWA 2XCTB 3HJFA 1AS2A 5B64A 2Z2KA 3MTJA 1MNAA 3HJAA 4KVAA 5K3EA 4UDYX 4KH1A 1U0JA 4JBHA 2PLNA 1A7UA 2XE8A 2DQZA 3PRKE 4LXGA 3JX9A 2I1VB 5TR9A 1AHIA 1R0SA 3SXJA 3K70D 1SKMA 1TFRA 4AKGA 4YYZA 2FE4A 2ZZKA 2E18A 2O5EA 1GFIA 1ZM2A 1YUNA 3Q3IA 2DTXA 3ONDA 5F7ZA 2IYYA 1JTEA 3EPKA 2ET6A 8GPBA 5IBQA 3PUWA 5IX8A 1DTEA 3MGBA 3FTEA 5GP1A 3OFND 5GV8A 1KVTA 1QDUA 4GLFA 5ESRA 5IARA 5A4FS 2PUAA 1U65A 1NW9B 5H5JA 4B8WA 2AJCA 4WLOA 3JD2A 4NCNA 2XBLA 3LC7O 1WQ3A 4DSNA 2V6IA 2H52A 4KGVA 5BPHA 4TXMA 4V39A 5B4UA 2HJRA 1MXFA 3F6BX 4Y2GA 4YNBA 2V6JA 1TEZA 4TVSA 1Z5OA 2Y1LA 4NBTA 4PHFA 5IC5A 3STUA 4DUGA 2DR2A 1Z4JA 3OOJA 5FXMA 1KQ3A 2XIQA 3QOFA 3BAZA 3QWIA 5IFKA 3QH4A 4QPZA 2I4OA 3F67A 1BZYA 4HVTA 4JC8A 2O3QA 4MRPA 3VC2A 2C5AA 2Y71A 4UM9D 5JDIA 4UHEA 4M99A 5THXA 1ZR4A 1N0UA 4RV4A 1DC5A 1E3QA 1D6MA 3M2TA 5EQTA 4PZ0A 2G70A 4YRNA 1GAXA 2OV8A 2H2AA 1HE4A 3UHJA 4RZ3A 4EKNB 2O8DB 2O8VA 2P0EA 1LRKA 1JR4A 1X2BA 1EP2B 4FFMA 1J97A 2FFJA 3LRPA 2ONCA 3UUGA 1PV4A 1C0PA 3R76A 3SOPA 1E2MA 2E21A 2WJ3A 2Y77A 3EBLA 5T4FA 1S7GA 4AZ3A 1VMEA 2JGDB 4DEXA 5FPQA 2EEZA 3D8RA 1K88A 3PNOA 4FKMA 3QXCA 2J9XB 4OH1A 2NQ8A 3VTAA 4CQMA 1BAPA 3ID6C 1LS6A 2P27A 4OYHA 5EPEA 2J33A 4IG9A 4UHBA 5KTKA 1JHMA 3KUDA 4AJJA 1BG6A 3LDUA 4IPTA 3CR3C 5IASA 1C7JA 1JT2A 1YZHA 5IHXA 3O4RA 3OQBA 3HDHA 4BLSA 5T6MA 3WQQA 5L7WA 4X66B 1T1EA 3G9XA 1DMRA 1Z38A 3HKBB 2HFKA 1TUBB 1EEHA 2HO5A 4GMFA 5H81A 4CTNA 4O2AB 3U6KA 1T29A 4YJGA 1NFRA 5FUXA 5M04A 2PNFA 5ALDA 3IOYA 2CXOA 2GN1A 4UHDA 2CDRA 2KWIA 4C3UA 2PT6A 2FX3A 5HS6A 3MTAA 5J4YA 1G3RA 3OP1A 2DLDA 4JIGA 4Q3CA 4JA2A 2XYPA 1ZN2A 2VJAA 5B1HA 1ZEJA 3OT5A 3C3WA 4HD8A 4QIHA 4BKMA 3T15A 4WASA 4Z2AA 3LQYA 4MYUA 4FT2A 4QASA 4MRNA 2ZJ0A 1LPMA 4CQLA 3B6ZA 1ZN9A 3SYKA 5C8DA 4BRSA 3NU1A 4IZIA 3RR2A 4L15A 2KB0A 4WIAA 1OD6A 5F2KA 3KETA 4B8ZA 3THXA 3GJ7A 2QTAA 5LP6B 1NMSA 2V0GA 1QUEA 2FQXA 2ZJBA 3B5EA 2FTKE 2ZITA 3EN0A 4P4UA 1DZIA 1U1IA 1UC4B 2H2DA 4MWCA 4U5XA 3NOQA 3RGGA 2ZLBA 1T1RA 2PFSA 4JYPA 1AK2A 4HMPA 4GOND 1GGKA 2Q2OA 1H8HA 4ARZA 4YRBA 8ADHA 4K81B 3BPSA 3H0EA 5FL3A 3PNBA 5D5PA 3TMAA 4XPZA 5BQOA 1TJPB 2YWHA 1FW8A 4IMRA 2XODA 3N0RA 5JMOA 3KZCA 2MT9A 3LUJA 3Q7PA 3ABZA 2JIZA 5KYWA 1RLJA 1JFLA 2XTMA 5FBVB 3L1IA 1WPQA 4TRRA 5AM5A 5DVZA 5T8KA 1ZGAA 1ML3A 1KI1A 2EF0A 2QLNA 5ECGC 3ZY2A 3ZGXA 2WZBA 4FXOA 3R75A 2JFHA 4BLTA 4TN1A 1JMKC 4MCJA 3TIXB 4GMKA 4KREA 3ZLVA 3EIEA 4YRMA 3ZE8A 1FMCA 4HRAA 1RP1A 3HWX1 4YROA 1YHZA 3OTIA 5AVSA 2PGDA 2C4TA 3FNHA 3QF7A 6Q21A 2O8EA 1J24A 2XUKA 4OPMA 3HFRA 4HK4A 2XOXA 2GPBA 3H75A 4MUFA 3E81A 2MINB 2VJBA 1DUIA 1JQAA 1DAIA 2JBWA 5JRZA 3WIOA 1US8A 5DTEA 1YBAA 4DIDA 5EJGA 5EYPA 1EYZA 2C61A 4RHCA 5SYNA 3ZU3A 4CMBA 3AX6A 2GBGA 2ISQA 2C88A 2ZAYA 2H7XA 3UJ7A 1N25A 1G20A 1PU2A 3EQ2A 3HB7A 1I6MA 2FETA 3EXG1 3KEGA 1E2HA 4MPRA 3QLJA 3OZXA 5K51A 3S1AB 1T5TA 4B0OA 1NR5A 4M0DA 3H11B 1ONNA 2TECE 4PLHA 1TZKA 5ALPA 5JARA 4FGLA 3UIEA 2TRSB 2P9ZA 3FTPA 4E5MA 1A1VA 1W8DA 1Z82A 3PD0A 4QARA 3GT3A 2QJRA 1VMKA 4A4DA 3LLUA 1W46A 1BKSB 1QCYA 1QFMA 1YB6A 2JI7A 1RJEA 1PR3A 1U0OC 1WZCA 3FSJX 3JVEA 2VFAA 3FPSA 4JITA 4XD7A 4TZTA 5H59A 2Q2VA 3BG5A 3X44A 2BKXA 4QQNA 3P52A 5IT0A 3CEHA 3WGZA 4EYEA 1C81A 4X6LA 3ZXSA 1FQOA 1QYXA 1VG8A 2PVSA 1TQDA 2VNAA 4OHVA 3N9IA 4B3BA 4DA7A 4BMVA 1QTQA 3VNQA 4YCJA 3PJDA 3VZBA 1CB7A 3T0GA 2HFJA 2QSYA 3ORRA 3QFHA 4R81A 1I4TD 4Y9DA 4OUDB 3RUHA 3PXXA 4OKSA 4P4LA 5DNDA 4PC6A 3LH5A 1XTVA 3Q87B 2JAWA 1XA4A 5A03A 4JL5A 4BO3A 2ADOA 2UXDB 3U3OA 1E5QA 2IDMA 4MINA 1PJQA 4IMIB 4Q9DA 5JTTA 4BLUA 1GHTA 4XASA 1PRYA 3G85A 5LU8A 2FPXA 3SY8A 4OHYA 2VDRB 1V9LA 2RGNC 2VLIA 3M83A 3ZW8A 5BPFA 1QMGA 1VFPA 4A1FA 2I4NA 1IFXA 1QFYA 3EWIA 2ANBA 5AW6A 1AH2A 2WHYA 2UYOA 3A1EA 3FF1A 5K0LA 2Q0SA 1EG2A 2IXDA 1T0PA 3LU1A 2EWMA 1GSHA 2YFYA 1NATA 5ALIA 5HRUA 4EJSB 3KAJA 5C7LO 2HA6A 1OB5A 4RC9A 1UDAA 5CM2Z 4QM7A 1AQUA 4L5CA 3K6RA 3BRWD 2H00A 3C6KA 3HDVA 2HJHA 2W4MA 1C3JA 4JEMA 1XQ9A 1X19A 2G71A 4JJZA 3DDSA 5AT1A 2EERA 4UTVA 2CHGA 1FYEA 3GW8A 1JHQA 1M8PA 3VR0A 4EFLA 4GBJA 4EY5A 5DP2A 3EDQA 1EFLA 1ZCAA 3F3MA 4DWOA 2JFNA 3DBRB 4FCTA 5LDDC 2I4TA 1KE2A 3U3KA 3R44A 5KJ1A 2GS9A 2YRFA 3FN4A 3KXLA 1HDZA 2G1AA 3KQKA 1BKDR 5G41A 4IICA 3WHPA 4XB6B 3GLSA 1V5GA 2GQ0A 4BO8A 1ZKMA 4I50A 4I8DA 3PWKA 4RVFA 4D99A 2GYUA 2A5YB 4WJLA 5JMWA 1N36B 1JJFA 1M0TA 3GCWA 4HXEB 4XJXA 2HHJA 4IO1A 4MGIR 5AH0A 2OZVA 3G5MA 2AG6A 2ERCA 3NNNA 3JQ7A 1ND6A 4DMGA 2E49A 3V80A 5AK3A 5TY0A 2P7HA 2Q9CA 3FVTA 4A82A 3O8NA 3RU9A 1CZHA 3Q0IA 3TNLA 5MN6A 3DJFA 4RLSA 3VPFA 4ALNA 4M7PA 1WB4A 1LLCA 2E1RA 1TQ2A 2G9RA 4IUCS 1WE2A 3LGAA 1E8MA 3RK4A 1R27A 4LVCA 1ZSYA 1T2VA 1YS7A 1T4BA 3ETNA 3TTTA 3VVMA 1O9GA 1ZK0A 2B3TA 2BCEA 3R5XA 3ZN2A 3THSA 3S7TA 1EKXA 2JDIA 3D0OA 1V7QA 1FRQA 2V7XA 1PS0A 2WYWA 2WZDA 4F85A 1G2PA 3PEUA 2OBNA 3GLRA 3HG7A 3LCMA 4UBOA 4Y1EA 3LF2A 3WADA 4EJFA 3O75A 3E22A 2YASA 4LDNA 3U4QA 1OSNA 3UAYA 1S2MA 4RENA 4MNTA 4R8MA 1W93A 1UKZA 3LLMA 1AT1A 3JQ9C 5CGZA 5JALA 3QBEA 3W8DA 3TJMA 2IHJA 2VJKA 1FBTA 2I87A 1R3DA 2BRUC 4DLKA 2PX6A 2QD4A 3JVUA 1H5NA 4ZMRA 3JQCA 3BGVA 4N0DA 1W87A 3V2GA 2F1OA 1SA0B 3PUZA 3RVSA 5JYBA 1G21E 1FQKA 3O84A 4CM3A 3L8HA 2JHFA 1ZH8A 2BFMA 4QT4A 5E9QA 1ECGA 3A9SA 4XYEA 1IQPA 4H7KA 1YL7A 4JI3B 5JDCA 5JXHA 4RYLA 3TLGB 1W1UA 2ECFA 3ZY4A 3ZWAA 2F67A 3OKCA 3LFTA 3IYLW 3NBAA 2OXTA 1QS0A 3W6UA 2CD9A 3I2JA 5T57A 1IAVA 1Q3HA 1H66A 1D7AA 3P94A 2O06A 3ZGOA 4OJKA 3EAGA 3KLOA 1N2SA 1U28C 4KAAA 2GD0A 3VBCA 4C2TA 3UA4A 4WJZA 2BELA 2BEVA 2WSBA 3OHPA 1NF9A 2GZSA 2NU6A 3OM8A 3ENQA 3V6LA 1OZ0A 2HEIA 4OIMA 4OHOA 2GCPA 2GBLA 3WV4A 1XWWA 2L0XA 4LXIA 2HWXA 1E3JA 2BN4A 1XROA 1E0SA 3O4FA 4B87A 1D2GA 5K1ZA 3AJEA 1ONOA 1OF1A 3MTDA 4JJ4A 1TRKA 2EG9A 5GTDA 1VPDA 2PIAA 1C9NA 1TAUA 1J8FA 3EGVA 2PT9A 1WDWB 3K0FA 1GTG1 3O95A 1M2VB 1NSYA 5C5IA 3EGXB 5J40A 1Z0IA 3FPEA 5EP4A 3ZI4A 1ESZA 5LP6C 1SD5A 3O4GA 4BKOA 1H6CA 4XVHA 2FAXA 2I3BA 2GTHA 1DG9A 2XMCA 3D31A 3KVRA 3R0IA 4PTLA 5JD6A 3OIVA 1XTBA 2B1RA 3MJFA 3PYMA 1SXQA 3DEIA 2AZTA 1GITA 3GX1A 1X9HA 3DBHB 4FDUA 2GWHA 1JFSA 1P77A 3MHPA 4QL3A 2GAAA 1M2WA 1HBJA 4LZJA 5TQ0B 4BJ3A 2OKCA 3FGPA 5EXDA 2H48A 1BFDA 3O0TA 2IL1A 1VJCA 5CX1B 1Z6XA 4BQPA 4G0UA 3DM9B 4Q12A 3SHVA 2HRBA 1P6QA 4IJQA 1XNRB 2IOHA 2RGRA 5FOTA 1G8HA 3N2GB 3OSUA 1XMVA 1W75A 3OE1A 2QL9A 2XOKA 4M55A 3TCXB 1XR3A 1BXGA 1T24A 3OX1A 4M0LA 3VQTA 3ZHCA 3MUNA 1GGNA 3D2LA 4WZAA 3T7IA 2Z5GA 1YO6A 1YHYA 2I6SA 5DV9A 3WX0A 5A06A 4IHKA 1EWQA 1Q0UA 3BWDD 2E3JA 2ZBFA 4QGBA 5DYTA 3SYRA 1KEEA 5B12A 4KR9A 1NNEA 4MV9A 5BQFA 2CFRA 4RTSA 4GKAA 1FDRA 3HXPA 2J0UA 2C3PA 3TRIA 3E2PA 2HU7A 1IZ0A 2P6PA 5GOTA 1PL8A 4BX8A 5THKA 5MHTA 1Y4DE 1XRJA 5D6NA 1R4NA 1AUQA 1JGTA 5FLYA 3IE1A 1FFXB 4PR0A 1OXKB 1B2LA 2P1DA 1BDHA 1G4HA 3F5QA 1UWVA 1RVDA 1R8QA 4PFQA 4UXIA 3RJMA 1PSZA 4GKBA 2QXTA 4KFUA 4CPDA 2QZPA 2ZU6A 3EH2A 1QR6A 3ZWYA 1T9GS 2F1IA 3RVRA 4E51A 2B9EA 5CYOA 2H9IA 4PGFA 1GP2A 4EUEA 3VNUA 1SXIA 5I8WA 2ZRJA 1T26A 3N8KA 5TT0A 4PO1A 3HCEA 3IT2A 4OXRA 2PH1A 1I7NA 2GA9A 3GRCA 1J39A 3C15C 3I2GA 3NBXX 4RCZA 3HBNA 3MWKA 5K8CA 3EVFA 16PKA 3B1VA 3ZZ0A 3OM9A 1E0AA 1WB5A 1U2GC 2ORYA 5LR6A 2YICA 3NHMA 4E7OA 4XSVA 3VU1A 1KJQA 3LQ2A 2WDZA 2XOEA 1IG0A 3T9AA 2G67A 4L51A 4JQYA 2CMDA 3DUWA 3CW2A 2D0OB 1VBNA 3EQZA 3A6DA 4A0HA 6REQA 4HDMB 5DBFA 1CUBA 1LDBA 3R8XA 5AI6A 2WE8A 1N9GB 1TX4B 1UH5A 2V98A 3FSEA 3GRAA 3IVRA 4D1YA 3D4OA 2P67A 4IIHA 4NPHA 2HRCA 2ZI7A 5I8PA 1XHFA 2FG7C 1S2GA 1OLSB 3K5IA 4K2AA 1G16A 4GC9A 3R7DA 1YVUA 1NJFA 1W581 1Z6AA 3G17A 3KUCA 4PCAA 1RADA 4S04A 4P0TA 2Q7DA 4RMIA 2XD4A 4DM4A 1ZQ9A 2FW6A 2ZRIA 4JJGA 1A5ZA 1VBMA 2O2ZA 4B4OA 1YVDA 3INNA 3UJ3X 3GRYA 5FPPA 5DEIA 1PTJA 3DBRA 5EHIA 2PUFA 1E2GA 2VTKA 2XEXA 2JHCA 5AK0A 4AUMA 2G08A 1VXOA 3OPYA 4M7OA 1AG9A 3RPEA 3P2KA 2AB0A 4TZKA 3JALA 1QK5A 3QWBA 1RZRD 1OFUA 4GBGA 1VL5A 4H7JA 5H9VA 1IZ7A 4WK0B 4BEBA 2R0QC 2O6HA 1KVSA 2WWVD 4BLPA 1OREA 3NATA 2DFNA 3EG9A 1TUIA 5FYQA 3UVEA 2AFRA 1XMOB 2YJ4A 5JJBA 1OW3B 2D2EA 5CRIA 3B70A 1TYBE 3DE3X 1U3TA 5A2QA 4DQXA 2JGMA 1J20A 2XCIA 5FI0B 2EBFX 2HBRA 2M6RA 5HVNA 3U44A 2WYOA 4E5YA 1ZPDA 3JASB 4PTZA 2Q45A 2OEPA 1RRMA 3F74A 3LG2A 3OD5A 2GEJA 2ID8A 1YH3A 1JHVA 2VAPA 5CA0A 4BMSA 1YZTA 3OKPA 4FMDB 5K0JA 1W4CA 3P9KA 3QXSA 3FZQA 1X70A 4LOIA 4O0MA 4C0SA 1BRTA 3CX3A 2E48A 4BC1A 3VV2A 2BFCB 2GZDA 1YRYE 4TQGA 1EFKA 1LRJA 2UUPA 1A88A 1RPTA 5BMVF 3PYXA 1X74A 2QYSA 4PRZA 1U8YA 3AHCA 3EDCA 1QE3A 1WDMA 4ND1A 5JSYA 3V4SA 2H1OA 3WIDA 3W04A 3PQ6A 5FWXA 1W4AA 4QA9A 5TF4A 5KDOA 1PEYA 3VDXA 2CFCA 3M5DA 5LQUA 3A3NA 1ODLA 3GLGB 1U0TA 1E6MA 1GZ3A 5J2TA 2SKCA 4G65A 4Q3NA 2QRNA 3DUFB 2FZCA 3M2PA 1Y5IA 3GFBA 4AJEA 2VOJA 4K9OA 3AUSA 1JL3A 4H3SA 1V6SA 5JD3A 3PKZA 5JSZB 4Q15A 1WWKA 4UHCA 2VYNA 3GYBA 1EK0A 4WKNA 4XVCA 3NAZA 4RU1A 4Y1RB 3TQFA 3MG9A 4AKEA 2ZRHA 3DAFA 4HNSA 4XX0A 1Y6RA 1QOQB 4Z3OA 1VJGA 3N07A 1N2OA 5FRDA 1JJ7A 2EGGA 1O94D 2QQEA 3BB4A 4ITVA 4XSGA 3STWA 4OLBA 3GRUA 1FS4A 5E8RA 5G3ZA 1RZVA 3PGA1 1DAHA 2F6RA 2XYQA 1AUOA 3DVRX 2ZBGA 4GM1A 3ZU6A 1UC8A 4GMHA 4E4TA 1N0IA 4TTSA 5JECA 4KIGA 5I7VA 3DGEC 3B2NA 5ENZA 5A9SB 4NCAA 3DMRA 4R7GA 3WRVA 5U4QA 5KCZA 3OIUA 1JSLA 1HRKA 2FFBA 4WKPA 3NWJA 2Q07A 1VSVA 4KAJA 4D4IA 2HK8A 3EHDA 3GT7A 3JAMA 3AB8A 3MGCA 5EMKA 5FBQB 1KDYA 1HGXA 4W5QA 4NBRA 1EK1A 1RLIA 1PW7A 2GH1A 2JBAB 3EFBA 4Q93A 1NW7A 4JP3A 3T12A 1ATZA 1PHRA 2JA2A 3EXHA 1Z5GA 2WYVA 1BTOA 4M7RA 1USIA 1SB8A 4RLQA 4L8YA 5ALKA 3X0DA 4BLOA 3JQ7B 3ZW9A 2YR0A 2I1WA 2G9QA 1AKEA 3WL3A 1K1EA 2UVPB 2I99A 4UVGA 3V4PB 3PEWA 2A6PA 4G85A 1DTWA 3W78A 2CNBA 4V0NA 5CDHA 4JKIA 2VHYA 4Q6WA 4HGQA 3RH0A 5A9RA 1XTKA 5ELXA 4QLOA 4FI3F 5DMXA 2QJWA 2WINI 3TBHA 1QHYA 4RK7A 4B3FX 2XB8A 2B1QA 2C9OA 1L4FA 3ONNA 3G2NA 5E4YA 5C1IA 1MU0A 1NIPA 2JGRA 3LK6A 3T4UA 1V3VA 2C20A 4C4SA 3UGTA 2ZXEA 3I6IA 2YQ5A 3IIKA 2V7UA 3TFWA 2GJKA 4H27A 4W6ZA 4ZO7A 1I3LA 4DCSA 4JR2A 1Y48E 4RTRA 4GXQA 4EKIA 3IEUA 4Q9KA 5ALYA 1UFOA 2DHRA 3EHEA 1ZK2A 4XVUA 2IUTA 2NUPB 3Q4GA 2KBFA 4A91A 5I4BA 3BE5A 3UHPA 3OX4A 3LT4A 5JYEA 4D5EA 2EP8A 1L7VC 1DNPA 3MFQA 4PAMA 2A1TS 2XSZD 1K06A 3TZKA 2GM3A 5EJAA 4DWJA 1QVVA 3C5WP 4ZTBA 1CZUA 1ORWA 1N5DA 4MPPA 1U2TA 3CS3A 1LW6E 2XF2A 3EBPA 3CEAA 3M49A 4S35A 4P7FA 1ZNXA 4RYDA 2JI6A 3LCJA 2CJWA 3H5TA 4AMYA 2XWPA 4F93B 1L9KA 1Z12A 4G0XA 1S89A 4YP0A 1J5PA 1VL0A 1K8ZB 1H4TA 1X77A 2O0HA 2VYND 3E9YA 4XZ3A 2WQ7A 5LMNB 4PBTA 3IILA 4HGRA 3HYNA 4Y0NA 1QYIA 1T8PA 1U9CA 3PHHA 1KPHA 4OLHA 5JI3E 4BVLA 1SC1A 1X42A 1ZUD1 3B9BA 1NG1A 1KEZA 1FTNA 2C03A 2JCXA 4RF3A 4TRNA 5JAUA 1OI7A 1ZESA 2AFIE 5E95A 4QRDA 2VSXA 2H1CA 4DY6A 2PMCA 2R4TA 3QTTA 4J07A 1JXQA 4BFWA 4MW4A 3X2FA 2QSUA 1G55A 3A1NA 5EMMA 4L4XA 4BZXA 2IH2A 4KQIA 4KCGA 1ADJA 3LTEA 1RJDA 3E3AA 1ABEA 2Y2VA 4K86A 5F5NA 3LDHA 2FDXA 3NJ8A 4GP9A 3RU2A 1BGVA 4F9TA 4PZUA 3I1YA 3RS2A 2IEBA 3QVOA 3ZY6A 1N1EA 1U0SY 2OCDA 4ECEA 1N6PA 2Y1DA 3EUAA 3I8SA 4HS4A 3A6PC 5M7EA 1YU6A 2RHJA 1LJUA 2XRYA 3O5AA 3EJ6A 4HNAA 3ZS8A 1YRLA 1L4UA 5HQTA 5FNVA 3WGTA 1IHUA 3DZIA 5JAZA 5HK8A 1IOZA 1GZUA 3A9RA 2ZAOA 1GU1A 5L3QA 2NN3C 5KQMA 3HKEA 3ESZA 1KYYA 3KPWA 3PPXA 1TKBA 4KTVE 5EXPA 2WSSA 3NP7A 4AS2A 4N48A 5B6IA 4X62B 3CWQA 3DFZA 3QA9A 1OH5A 4ND2A 1LVUA 3JQ9A 2NPFA 1WP4A 5I3ZA 4CDRA 5KQPA 1VPWA 4EKYA 4Z5XA 3B6KA 2PGIA 3GAAA 4URYR 2ZI3A 2ZJ2A 3AT1A 3SJBA 1ZD2P 3GLFA 1EAMA 2FFAA 1BIFA 1DXQA 3D4NA 3DDWA 3FUXA 3R5TA 3K9WA 2VT2A 3AEYA 3K8YA 3ZDQA 1AKVA 4EBBA 4JELA 2W6NA 4U2DA 4LXXA 3ILSA 3Q7QA 1J8QA 2GBCA 2IQIA 3VM6A 2A14A 4G36A 3ZWNA 4REQB 3RLIA 2BKLA 1ZGGA 2VDKB 1WLYA 4JI1B 4PONA 4LHVA 5FPSA 5JANA 3ZHTA 1YQTA 1E9BA 2CK3A 2QTGA 3Q2IA 1N6KA 2DF8A 1HETA 2XT9A 4BKUA 3LBHA 1ZI9A 4B7UA 2YWBA 3I30X 3ZDAA 1RABA 2P2GA 4MR8A 2CVPA 3SJUA 4UNNA 4DRYA 4NESA 3R0QA 2J3IA 2R84A 4JAVC 2W2NA 4RJTA 1W9MA 3DLAA 2IOQA 3HU1A 5ALLA 1I7PA 1OBCA 1ZXXA 3KUKA 4R40A 5BYBA 4CLHA 4N5LA 4XUDA 4OK6A 1ZC3A 3D81A 1Q57A 1FUUA 2WSLA 5IW8A 4BQIA 3ZLJA 2HDOA 4TTPA 1U04A 3L4SO 1GPKA 4HDRB 2FPGB 4YS6A 3F90A 5K0TA 3E61A 2P7IA 1PDWA 2F8LA 3EZYA 1A8QA 4IRMA 4B6QA 1QORA 4LIPD 4JI4B 4HWSA 1FFSA 3VR4A 4BATA 1SHKA 1SJ9A 1XB2A 3WNQA 2WJ6A 3T7DA 3EOAI 3GFPA 3OLWA 1KWGA 2JLRA 2ON6A 1GD1O 1O57A 4U2FA 1KZ6A 1WBBA 1IHOA 1SK9A 3JAWB 3DPIA 3LHIA 4HLCA 1KYQA 2J41A 2EZ9A 5CXSA 5EVJA 5A4IS 4EFKA 2WQ6A 4HN2A 1CW2B 4G2NA 4MYHA 1BHQ1 3Q88A 5I9NA 4ZEMA 4L22A 3HUEA 5FOSA 1LBIA 4B1FA 1FIUA 5FQOA 3TTYA 1FLNA 5FUWA 3LUBA 1NXWA 3FMPB 4GYYA 4J7CA 4UAUA 3RANA 3G02A 1P19A 1DIRA 4NS1A 5I9BA 2FMTA 3H97A 2BGIA 3C6MA 5BOVA 3SSAA 2EKZA 4RE6A 4EECA 4WH0A 1TRHA 4NYIR 1I6LA 2BEJA 3EDMA 4K9QA 1U7XA 1TVCA 2QGNA 2VRCA 5IAKA 3WHIA 3QEOA 3WWOA 4O4LA 4YJ2F 2CMKA 2X19A 2QSZA 1OXSC 1DDGA 2ZE8A 4JSYA 3K9NA 4MDYA 3BK1A 1X15A 5JSHA 4OHZA 4UDXX 1BE8A 3QKSA 1QH0A 1SC3A 2J0UB 3FPGA 3EIHA 4NSNA 2KPOA 2MMGA 1Z35A 4IIEA 4MA5A 3DZKA 4UU7A 4XR9A 1DCTA 2HWUA 1T3LA 5CLJA 3A32A 3N1UA 5LYYA 5D7NA 1XLTC 4JMLA 5I9SA 1PJRA 2D5BA 3MCZA 4AYTA 3H1GA 2WKRA 3IUQA 5FBHA 2CMFA 2YV3A 4HBGA 4N5MA 4BQEA 1CRZA 1MAAA 1BJRE 3GJ8A 2HWKA 3N86A 4L8WB 4CM4A 3MTQA 3BREA 1H8ED 4TLDA 2XWSA 3EVCA 4Y6GB 4O59O 4P3OA 5JWHA 1Z15A 3SDSA 1E61A 2LNDA 4B80A 1PT8A 3KOUA 5GZ1A 5J4KA 2PCJA 2P5YA 1E59A 1UK9A 1Z83A 4KZKA 1QAMA 3PX2A 1JPJA 3JQPA 5LXTB 1HORA 2I2CA 3E9RA 5IM4A 3QHAA 2DSNA 3R7AA 1A8PA 1UWKA 4FCVA 1Q1AA 2AT1A 2RHTA 2WK1A 4LG1A 5ESXA 5ER9A 3HM9A 2VHWA 4IHAA 5LYJB 2AMYA 4UJ5A 3KJHA 3Q12A 3F7NA 1N2CE 1E1QA 1BMQA 3P9SA 4IWXA 3DZFA 3LOQA 4F56A 3D2BA 1UJMA 1XQYA 1SK8A 3P4YA 3YASA 2WF8A 1OAKA 2DWQA 3HYSA 3PE3A 2OGWA 3G1UA 1Y37A 4K2HA 5BSUA 1CR2A 3NRJA 1M2NA 4INOA 4X8HA 1WD7A 1M10A 3C85A 3KBBA 1DAFA 1CNFA 1WXHA 4POAA 3CNLA 4PRYA 1Y3BE 1U5BB 3UMVA 1C8KA 3T1NA 3DL7A 1E9VA 2QMQA 4C2AA 1U8ZA 2PLWA 2ZJ4A 1G1MA 4QQRA 3TE6A 5TJHA 4MRSA 4ZCTA 3OE5A 4YAJA 2WKPA 4TMFA 1JYSA 3F78A 4L5BA 1PWXA 4CFYA 3WTCA 5JNTA 4MPJA 4YMIA 3G2PA 3H2SA 2HLDA 1XZCA 3MS4A 4GYWA 1JHZA 1VJ1A 3V4LA 2EOAA 1NBWB 3AYXB 2NSDA 4KGZA 3AVPA 2JLCA 1UMKA 1IQUA 3U3RA 4C04A 1B0AA 1PTJC 3ZI7A 4E94A 2C2YA 1FPQA 2XIJA 2I80A 4FMCF 4JJAA 4P81A 2PRZA 2X3FA 1L7XA 3C3BA 2BGMA 3PHJA 4BFSA 3DLBA 5CK5A 4CL0A 4G86A 5CNKA 4GPIB 2F43A 2QTHA 3LYLA 1KJYA 4H7FA 5HGXA 2XV1A 3EFEA 1L4YA 3LMKA 4BB6A 3W5VA 4D97A 4BU1A 1XMIA 1M6NA 5CNMA 1K7FB 2H29A 1X1QA 4E09A 5C4MA 3K6JA 1Y4AE 2Y1KA 1EUCB 4L3VA 3SHTA 1N0WA 1XE3A 3ZNPA 1OLXA 1FYDA 5IJ9B 1MOQA 3BH0A 2XZDA 1XCBA 2A1IA 3ZVLA 4FYYA 4MQUA 2H16A 2LUOA 3IP9A 2GDJA 1PBTA 1W5BA 4WBSA 4ZT5A 1P1FA 1VKZA 1JKFA 1VYTA 1AOXA 1JDUA 3V8EA 5IZCC 4W7HA 3G2OA 2DAPA 2Z98A 3U4IA 3RTEA 3T7JA 1PBNA 3PC7A 2ZM6B 4CKBB 1K3FA 2CDBA 2YNMC 4MVJP 5IZ4A 2CLCX 2L19A 4TV8B 4UTPA 3T3IA 4CIDA 4OBWA 3FPHA 4OHUA 5L51A 5ITZB 5CDTA 1JQLB 2RFLA 1PR6A 2A9VA 1O9HA 2E0IA 4HATA 3G49A 1MF7A 3WGQA 4ACBA 2IOYA 4KP7A 1Z7YA 1AS3A 1ARZA 2FOXA 2IPNA 1OLUB 4ID9A 3W4JA 3KTAA 2C5HA 1C9YA 1GXSA 5EI5A 4E5DA 5KTNA 1GRRA 4EI2A 3T5PA 1TZ2A 4C2BA 3AP3A 2C29D 2RHCA 5M34A 3KDAA 3H1PA 5KOHA 4D56A 4DDHA 2SCUA 1WB9A 1KR2A 3TSZA 5L8VA 1PIWA 1WDKA 2HF2A 3WLIA 3DTYA 4LZWA 4QDOA 2N42A 2AW5A 4TM8A 3QX9A 1BC5A 1X2EA 3BWBA 3KDPA 2W98A 1R6TA 4I3GA 4LZLA 4D9GA 1BDIA 3OZ7A 4ZQFA 3N2KB 4H31A 1IZ9A 1DC8A 3G7NA 2QN1A 3TFQA 5EZ6B 3MCUA 3NBKA 3DA8A 3KT8A 1L5MA 1NVGA 1PT5A 1C9EA 1P2GA 1NQUA 2XTZA 4L4YA 5IYZF 1V7ZA 3S0JA 2VCEA 1Y9DA 3IR6A 1XCJA 1ES9A 2LGJA 3MTIA 3EZ7A 3EY9A 5KOIA 5DX0A 5TRTA 4H7DA 4XM1A 4A27A 2V4MA 4Y2JA 3SQLA 1C41A 3FUVA 2AV6A 2OCXA 1KFJB 2WTMA 4I9FA 1KKLA 4TTIA 3AFGA 4WVFA 1CUSA 4RIGA 5L40A 3BJMA 2XRMA 5C5EA 2RGNA 4QUEA 4F6LA 1QHXA 3SIRA 2WAYA 3FXAA 5JHGB 3I9LA 5CFLA 1TF5A 1B15A 1RJ9A 4NZOA 2RHBA 1E7QA 4LYEA 1NV9A 4NDNE 4TMTA 1IVNA 2NZXA 2QZJA 5FOWA 2A5DA 1XRNA 3C97A 4COKA 2GN9A 4M88A 1XJ5A 2Q41A 1G8JA 1W52X 4F86A 2RH5A 3KOWA 3DKIA 3C41J 1B7GO 5DTJA 1HWYA 3GFOA 1QF7A 3HDGA 5AJWA 3SKXA 5U9CA 3U5ZB 2I9KA 5GIPE 1KS2A 4L4UA 3HADA 4OUDA 3TTXA 2QUJA 3PKJA 4GOJA 4IDEA 4A9AA 3I32A 2FPUA 5JPDA 3HXKA 4E5UA 4XOIA 1UMBB 4B46A 3ZHUA 4YRAA 1FJXA 3AMVA 2WD8A 3OU7A 3C7KA 4NCIA 1UWCA 3RSCA 4ZYVA 4W5NA 1FVFA 2QG4A 4FUQA 3D0QA 4L6CA 4XJSA 4LF6B 2Z56A 2C2XA 1XHLA 1M75A 1GFWA 1O7JA 3HCOA 3LQ4A 2HMTA 4CN8A 1CUWA 3INYA 4YAEA 4OMDA 2FLKA 2ORVA 3AV0B 4KXLA 3FMVA 4QBKA 3AR9A 3WAGA 2VPPA 3A6FA 1Q7BA 3LSTA 3OP4A 5JSZA 2QL6A 3QYPA 1JKXA 5FTWA 2IUUA 4W8GA 5CR9A 1RWWA 5TT1A 2C1XA 2P2NA 2CLIB 4WNYA 2IHVA 1IUKA 2OQRA 2ZU0C 1RM4A 4WOCA 3T3HA 1H94A 3FYUC 1K97A 3I12A 4CI0B 4IG4A 3GEMA 3CZCA 3K35A 3KTAB 3ETHA 2FWRA 4FOTA 1A5TA 4QBIA 4EW6A 5IWAB 4KO1S 1NRXA 5C18A 1F51E 3E9CA 1DOZA 3W5HA 2Y1FA 4I3FA 1OZGA 4JDUA 2CUTA 4PAWA 4KV7A 1HURA 2V7GA 3KSZO 4MAAA 4YR7A 5CA1F 1YCFA 2I1LA 4BN4A 4KWEA 2AH5A 4FX2A 3II6X 1WL8A 4OYLA 4EY7A 1VKNA 3GZTB 5DGCA 1Y3IA 1TZCA 5KS2A 4JWTA 5CTAA 5F2EA 3IP5A 2P6OA 5IG2A 2VF5X 3UWDA 4I50B 5DIZA 1LFDB 3E7PA 4HSGA 4DZZA 3DJYA 2COUA 3I58A 2B8JA 1QHGA 1MO3A 2FCAA 2L42A 3PHCA 1DHRA 3R23A 4HH4A 1V9CA 2B78A 3E5MA 4YP7A 3RYIA 1DKLA 1MRNA 4F1WA 5HILA 1U2PA 5E3JA 4TTJA 4FFSA 4F2DA 4QOGA 3JY6A 1N8TA 3WNZA 2IYTA 2GBFA 4CETA 5YASA 2PRYA 3OQJA 3V97A 2IPAB 2RBEA 3PHGA 1CETA 2O7NA 1V1JA 2O8EB 4E5KA 4EATA 2IU3A 4GL4A 3S4YA 3LY7A 3QYAA 1F5NA 4LHZA 2C2KA 5AW3A 2C2HA 1Y34E 1KXZA 3HBLA 4EBFA 1XP8A 5IRCD 3HXLA 2HOQA 3UJ6A 4YUVA 5BT8A 2JCYA 5AKLA 5DSZA 4EMTA 4HDOB 1UJ4A 2NUBA 1CE8A 4M0UA 1DX6A 1OZAA 5D86A 2PGXA 2V5UA 2DMRA 4IGAA 2OAQ1 1ZH2A 3ADPA 3L8FA 3KOOA 3ZWOA 3RUIA 4UOZA 1SHLA 2B37A 4GNKA 3M6IA 4YT4A 2P9JA 1IHXA 1EBUA 4CDMA 3R6GA 2QZ4A 1XNQB 4KL8S 3OQPA 4BJHB 4C7BA 1J5EB 2R1ZA 2D2FA 3IE2A 1XZFA 3OAAA 3OQ1A 3ADBA 1Y1RA 2WJZB 3K8OE 2WG1A 1T15A 1J22A 3T9FA 2QPTA 1KL7A 4Y9SA 3CLSD 1UJ6A 1TIKA 4IDPA 3ZWVA 3PCTA 5THQA 2IOFA 2GZ3A 5FADA 3STVA 2FPLA 1P29A 2OSVA 3FI9A 3JWEA 3KR0A 2GXAA 1STOA 3F6PA 4B3JA 2OWDA 3WBFA 1YDHA 2OHIA 2RHHA 2OGTA 4QG7A 4XGKA 3WMWA 4PX2A 2I78A 1KPGA 2QGZA 2JIDA 4QSMA 3TQCA 2NMVA 1CBUA 4H59A 1KP9A 2E4ZA 3EEIA 3EUFA 1QR2A 1Z4QA 4Z3KA 7REQA 1A9SA 1BHO1 2F1HA 1O54A 2P5SA 1CUJA 4HWKA 1MC5A 2R2AA 3KJGA 4XUGB 5EMLA 1UT6A 4M1SA 2X0FA 1K92A 4HQNA 4DY4A 1MMFB 1JLKA 3LXXA 3CJRA 4HRXA 4JN6B 1CEYA 3KQPA 3LK7A 1CZNA 3HB9A 2G1JA 2G06A 2HDWA 2BF7A 1X1CA 2JB9A 3FYTA 5G0VA 1TIPA 5K09A 4MX8A 1Z2OX 5L7YA 1XEFA 1T3GA 3EQ7A 3EIOA 4S1VA 5H16A 5D3MB 1KK1A 1LUAA 3UGJA 1JEQB 4I66A 3AY7A 4URWR 1NWCA 1QLWA 1W4LA 3S2UA 4FGWA 4C0KA 5JAMA 5JRDS 2WB2A 4Q3DA 1FPMA 4DR7B 2FZWA 3WNCA 1VB5A 3DP7A 4Z6KA 2WIFA 3MA0A 2PZMA 3K16A 4MKFA 2JLZA 1OR8A 3G0OA 5KNCA 5H1YA 1WV0A 4DS3A 3B78A 3NIDB 1NF3A 3FZGA 5K0FA 2H7VA 1QONA 2XUOA 2JFFA 3GGSA 3NFYA 5DGTA 5D5QA 3TGWA 2RH4A 1HOXA 1XXLA 3KNZA 4D9NA 1SB9A 3C6QA 5LMUB 4OGLA 2F43B 1YWGO 3H3JA 2PKYX 4LJAA 4D4HA 4IF4A 1E2EA 4I7EA 3GZNA 5HEKA 5HRAA 1X7ZB 4J49A 3VO8A 4WXHA 2CFIA 4PNEA 3KLBA 4K26A 3IBYA 4TLAA 3AUTA 5C3UA 3RRXA 2ZIUB 4E31A 3IKVA 5DYWA 3R9WA 4RFVA 5JY1A 3MMXA 3QOXA 4PNZA 3GLIA 4C4AA 1APBA 3CH6A 4EEKA 1ID8A 5JAIA 2ZQ5A 1VGVA 1PQUA 2BSXA 2BM0A 2PRKA 1KDZA 4EPWA 2NO0A 1QCZA 1F0NA 1Y4SA 1YZUA 5KHOC 1FP4A 1P3DA 3IQFA 1C30B 2NPIA 3LT2A 4KQ1A 4J2HA 1TQ4A 1JDZA 3BWVA 3ES9A 5AQ1A 1QQTA 4OOEA 4MKGA 1PEDA 3VHRA 2OOKA 4AB1A 4FM9A 4BVKA 1A97A 3M6UA 1G7SA 4D41A 2FX2A 1W36C 3BZWA 1J90A 3MAAC 3GLIB 4GI1A 3FIUA 1G7CA 1CUCA 1O03A 2VSFA 3TSOA 3EGDA 4WCDA 3P5BA 3N2IA 1ZISA 4P3NA 4ZDWA 1MCZA 2C0PA 5HNKA 4AJHA 1F7VA 1UJ2A 2RAVA 4JLWA 3SQOA 4DV0B 1Q3KA 3TCNA 1Y5MA 3RYFA 1JIVA 3PXGA 1WCIB 4WK4B 4BGVA 5FH9A 4R2HA 1WOYA 1JIQA 2ZG6A 4CMEC 5GONB 1BH6A 1AXEA 1GUFA 5KNBH 2B4AA 1GZ5A 5LKRA 2WFAA 1NMZA 2C1ZA 4X3PA 2IE8A 1ZXBA 2RGGA 3FRJA 5E1MA 3SJ7A 1E6WA 1F1JA 2H51A 2BPOA 2PR2A 1QX3A 3ZBUA 5BVHA 1ZGJA 2YMLA 3D7MA 5EE0A 3PUIA 4W9NA 1E9SA 3BL5A 4K28A 3U62A 1QIJA 1T6NA 3LZ6A 1EXDA 2O19A 2Z83A 1TL7C 3QFCA 1KZ1A 3DFIA 2QN9A 3SWWA 4CTMA 1Z5NA 1R18A 4OHBA 3ZDCA 2B8NA 2O2XA 1ZN7A 3R9IA 2PMEA 5KTSA 3H9JA 4S1PA 2GVDC 1MJNA 1EWKA 2HU2A 2YWXA 3A4LA 2GPNA 3H6KA 3X1WA 1G8GA 2I6QA 3OEHA 4YAGA 3Q8LA 1M8KA 3ZCTA 3NDBB 5DHFA 3NCTA 1A9OA 1BA3A 4FYPA 4NOJA 1TMKA 4ZTZB 3A4YA 1X7GA 3H1TA 1JWLA 1NN5A 4OQFA 4ZPJA 3AGQA 4HAIA 3WLMA 2EBUA 3ESQA 3LY5A 4AIRA 4UVEA 1TF2A 2IUSA 2AC4A 2CL5A 2VZLA 4QQKA 4F12A 2EJUA 2Q28A 5ITVA 2PDAA 3NHPA 3JQQA 2AR0A 1G59A 2V7VA 2TMGA 4EP1A 3BC1A 1U80A 3U9SA 1JEDA 1UKEA 2ORED 5E9AA 1ENZA 1ORRA 4RHXA 2HBYA 4IEIA 3G2HA 1RMYA 3IO3A 5DU2A 2VT6A 4AG5A 3NTQA 1KAOA 3UJHA 2HXYA 4EENA 1R6AA 2YJ6A 2Z08A 4F2GA 4ZO6A 4A8PA 1QG6A 4RJKA 1F8FA 3QXJA 3WI7A 1QX4A 3ZDBA 3QOWA 1B42A 4OLAA 1FNCA 4J75A 1E6KA 1LX6A 3IHWA 3L4BA 1BE1A 2IXEA 4H6XA 3ZDDA 4HB0A 1GPMA 3J7TA 1MLDA 4QUHA 3H1FA 1SOMA 3BRSA 5JAPA 1QB8A 1SCQA 1S0UA 2QF7A 3CZRA 1M1UA 2I6UA 4KKXB 4H4EA 1D2HA 1R64A 3HSKA 2OVFA 3QHQA 2Q50A 1IUOA 1AV6A 3F71A 4OHXA 3CPEA 1NLMA 4AJLA 2WWGA 1QZ3A 1ZRMA 2QM7A 1CY8A 4HDRA 5LMZA 3S1LA 5ALHA 2A35A 3JVIA 2G17A 3RSOA 1KHTA 3CX4A 5EIFA 5TE9A 1ITZA 3D4BA 1EJ2A 3DM5A 3KEMA 3MLAA 1ODKA 3NC0C 1JI3A 3G0CA 1ADGA 1FSZA 3GJYA 1T6BY 3I4LA 4R16A 3K0FB 2Z3VA 5DGIA 4D9BA 5KSWB 1KY5A 1QV6A 3W7VA 3QY9A 1NULA 3K7EA 1EUQA 2BHRA 3L1KA 2P4UA 3EZ6A 1IL0A 2D6FA 3GWGA 3QSYA 3JYPA 1YA6A 5FFMA 1XPOA 1C9MA 2ZI9A 1HMYA 2VP4A 2ZWOA 4ZOBA 3ICVA 3A36A 2ODAA 1LNSA 1L5KA 3W5BA 3WIUA 2OWEA 5CDUA 1RQNA 2O48X 1A9PA 1C7FA 2NUPA 3CUTA 3GDFA 4NDAA 4D82A 5A0TA 2G04A 2ZPTX 2ERYA 2HRDA 4IUYA 5BURA 1E7RA 2C97A 3ISTA 3VISA 2DBVO 1CE8B 5L6MB 1KETA 1QS0B 3GUZA 4N41A 1F9EA 4HZIA 4HWGA 4I1IA 3T3PB 2Z2JA 2VNKA 3WS7A 4OJQA 4KNVA 5FB3A 1UFVA 4DQKA 4QTTB 3OT1A 4XDYA 4IEFB 5CEJA 4UQPA 1M6HA 3AQIA 821PA 2H1VA 1IY9A 2YWJA 1IXZA 2A92A 3AL0C 1R9MA 4H1VA 1KC1A 2BJVA 1DE0A 5LOVB 4ADSG 5J2UA 3GR6A 4E13A 4ND8B 3PGLA 4ZDIA 2YFQA 2YBEA 4CIXA 4X20A 5C81A 3CN9A 2ONYA 2GA8A 4BEVA 2RGCA 3TPCA 3VR2A 3RUCA 4GX1A 4JLJA 1GZ4A 2FPRA 5COQA 1XNJA 3VX4A 4DXHA 1JR6A 2QTCA 2FOIA 4QPJC 5AM1A 3CF4G 1AK9A 3OQMA 3CINA 3ZPXA 2NSYA 4LZOA 1SIWA 3PTAA 3IQHX 1P1IA 2IY9A 1IZYA 3C3YA 3HDJA 3U4QB 2IHYA 1WZEA 2VRBA 5T5QA 2QQGA 2J7PA 1Y8AA 3T7EA 3P2MA 4PSUA 5EIAA 1YRAA 4TROA 1KTVA 4CT0A 2VPTA 3IPAA 3K1AB 4J1SA 3HM2A 4NK5A 3FOFC 1H4VB 5FA8A 1BDJA 2CL0X 5HGJA 2JKYA 2ASVA 3K6SA 1I2ZA 1M2OB 3QEAZ 3ZV3A 2F3TA 2FG5A 3GP3A 2X9NA 1KQFA 5JVDB 3GJRA 1J0EA 8OHMA 4HYYA 1VE9A 3H5VA 1J8VA 2PUGA 4DLXA 4BMDA 3OBIA 1MV5A 3O8OB 5IABA 3KVNA 2M98A 4GLJA 4OQPA 4IX9A 1MIOA 3QPUA 3S55A 5T64A 5A2GA 1L5YA 3RF6A 1NN1A 3OLQA 1LKZA 4IDNA 5TQ2A 2ZZNA 3IQZA 4I1SA 1UOOA 1XQ6A 3ZTTA 3EZLA 1QOZA 1XTRA 1GPAA 1TTHA 4IXMA 4C7OB 4PG7A 4CMEA 1F17A 2GZMA 5TS3A 1ZY2A 1KO1A 3J81k 4OG2A 4E4YA 2RK3A 1C3VA 4UPDA 3DGFC 4YGYA 3WLFA 4DILA 2ODPA 1HMPA 3TOXA 1XZBA 3RU7A 4TGLA 4C0JA 4D80A 1AY0A 4TWAA 2H85A 4G1UC 2NT3A 3FE2A 3SQMA 1VTKA 2QIPA 4GT1A 5KDDA 2H1WA 3Q10A 1GZDA 3O8QB 1PR4A 1U7OA 4OK5A 4OQYA 1HSOA 1ONBA 2XNJA 1EB8A 4CLOA 4HXYA 2FJ0A 4QZVA 3I62A 1Q77A 1YZKA 4CR8A 4OU4A 7AT1A 5KYUB 1ZL0A 1EQAA 2WG0A 2FHSA 3BTUA 4DJAA 1L4LA 2DPXA 2Y0BA 3AR6A 1YA4A 1U2RA 4W1QA 3DL4A 3EIQA 3F7MA 4EF4A 1R0CA 3H5NA 1I14A 2J08A 4KN6A 4UVIA 2X14A 2IBSA 1FP2A 1GU7A 1M7GA 1HDOA 2H11A 3C14C 2HB6A 5G0WA 4KN5A 1WDLA 1B2RA 4FLFA 4TSFD 4U8HA 5DPMA 3UB4A 2QZZA 2GJ4A 4B7XA 1ZNYA 1Z37A 2H07A 3C5EA 2IIPA 4OX9Y 1VKRA 4N6GA 3SJCA 1RI4A 3RABA 421PA 4MA4A 2Y1EA 3CZ4A 5ICSA 1DTWB 3ICCA 3GO4A 1OLSA 4GH5A 1MOZA 4IVPA 1UQTA 2OLKA 4H3VA 1JDTA 3KTFA 5JU6A 3V8BA 4AULA 3PFGA 2EAUA 3THWA 5FLEX 1JQEA 2QR3A 3GDHA 1QFSA 1N57A 4G0NA 3OCZA 3B9PA 3G82C 1CCWA 4FJ2A 1N2IA 3JXEA 2QRQA 3LZDA 4R71A 5KTPA 3LWZA 3GA7A 3H5IA 2A9RA 2WSMA 3SLRA 2WU0A 5JOQA 1RYZA 4O63O 2J9FA 1CIPA 1Y9AA 2W5UA 3PQCA 4I1RA 4U0JA 3RAPR 4I8XA 4AJOA 3OZBA 4HL6A 4TLMB 3ZXXA 1JQKA 2XHZA 1ABBA 5JIBA 3DBVO 1R5BA 3DAHA 3H2GA 3NDPA 4OEHA 1FY2A 5C1DA 2WIAA 1OUMA 4OU5A 1NF8A 1EFRD 1NVVR 1OTYA 2YDYA 3D9QX 3LBAA 3SZMA 2QVYX 1KRXA 4H0NA 2CMHA 3IEXA 3VNRA 3TR6A 4K0KB 4Q24A 3CLVA 1RFLA 3TOCA 1P18A 2DT5A 1LPSA 3L04A 3Q8XB 4S2UA 3OICA 4DV5B 3DLPX 4F3NA 3AINA 2XHEA 3DEZA 4KFCA 1YSCA 1JPUA 4WV3A 2W2QA 4A8TA 1VE1A 3M3PA 3PPYA 1TLLA 3AKZA 1JH9A 3FWZA 4BDSA 2OO5C 1RRFA 5LCXA 3T7SA 3TJRA 2C7VA 9GPBA 4MWSA 1U9IA 2PE5A 5ER6A 4DBVO 1XMQB 1GEGA 2C9CA 2CDNA 3QKTA 3ZWXA 5AVWA 3CNNA 2P90A 3NG1A 2OYSA 4YXFA 2ZI4A 2HSGA 2ANCA 2I3GA 3WB2A 3OZDA 2R86A 2GILA 2NVOA 1O96B 1UEXC 2HL6A 5EIBD 4LYHA 5FUYA 2HO4A 3GGJA 3V9AA 3WK4A 5KQGA 1A5AB 2PJRA 1TYDE 3UMJA 2C8LA 3Q5EA 1XAJA 3W5DA 5J23A 1U7WA 4LW8A 3EXEA 1M7BA 3Q9SA 2Y67A 3ZU2A 3C1OA 2B20A 3B7GA 1MJ5A 4WADA 4XVQA 4YGXB 4MUEA 3U3JA 4EQ6A 4V1CA 2H31A 2Y9PB 3P7MA 4B4WA 4J9UE 1VLMA 2FVYA 4KTTE 2EX4A 4OQNA 4C6SA 1A4UA 1YKGA 2OBYA 4N8DA 1R0ZA 1K66A 2B1IA 1ZMOA 2V5VA 3I37X 2OR3A 4L8FA 5BW5A 2ODQA 3ZE9A 5DBEX 2YYZA 3WGNA 2FMHA 5CVUA 1KJJA 3RSSA 3UPDA 1FP4B 4YDQA 2B34A 3PQ2A 1HG1A 3K96A 3M6AA 1PJZA 1CF9A 4U7GA 1ZIYA 4QM6A 2WAMA 1X7HA 2E85A 2HA0A 4MLPA 5ARCA 1HXHA 1UM8A 1KGDA 4ALIA 2UZ3A 4UMFA 3LE8A 1ZAYA 3MJ4A 3TAUA 5F23A 2F3UA 2X0IA 3V8NA 1XRLA 2P9GA 3NTOA 4UPVA 2OCYC 3R3VA 4O6VA 5GGXA 3V1YA 4AG3A 1FFAA 3INTA 4GEKA 1QZZA 1OTXA 1XF9A 5FCDA 2CBGA 4GRIA 3RIHA 3PJRA 3DE6X 2PKXA 3N28A 5AKJA 2XZOA 4B31A 5JQGF 1CIJA 4US1R 1GTSA 3MJTA 1BHJA 2J0EA 3P96A 1F12A 2O9JA 4YFVA 3NBUA 4QYSA 5K3OA 1DGQA 2I2WA 3AHGA 5KYYA 3AJAA 3ZIUA 3IIIA 2FN9A 1EBBA 3ZG6A 1CS0B 1ZKDA 2VCYA 3NEPX 4EQ6B 4FFWA 4QBHA 4HHEA 4KB5A 5DT9A 2H9AA 5BRNA 1G17A 1C7RA 4HEA1 2P2YA 2AYZA 4IHJA 1H5UA 2HIHA 3W6ZA 4M0CA 2MMCA 2QLBA 4OL9A 1G3MA 4ILEA 1K6MA 3KKEA 3MTBA 3OQ6A 4TMXA 3GFQA 3LYHA 4EJ0A 1G8PA 1U8FO 5EJ8A 1YR9A 2DFLA 4IVQA 2QYHA 1W96A 4NJEA 4ZVTA 4MV7A 2QJFA 4E1AA 1SXPA 2Q3DA 1Q21A 5LXTA 3LVFO 1BD3A 5KQRA 4GLBA 4JHLA 4JL6A 1VGQA 2DE0X 2BSAA 3QVSA 3H2BA 4KR0A 1LBEA 1FXSA 3A1DA 4G26A 1ECBA 2NUTB 3ICPA 2NSHA 3VVCA 4BJ1A 1O0SA 1UJBA 3PQ3A 2QZ9A 3NVDA 1NJSA 3LCCA 3BJZA 2C5EA 3HI6A 4JODA 4YLGA 3VZCA 4DRXA 2NGRA 3E2IA 2GN8A 3EEYA 4FHCA 5KNDD 2X5XA 1RAGA 2C00A 3H0KA 2FRVA 1KYIA 4FFLA 5JFTA 5ARDA 2IV3A 3GLIE 1PNQA 1Q0TA 1AXRA 2UVDA 3KYDA 5CM9C 5G40A 4QYXA 4WNCA 3HN2A 1FTWA 3L6EA 1EG7A 4REOA 3C3CA 3WAKA 2DU8A 1RFGE 5ALTA 1NI4A 1CYDA 3A4VA 3VAAA 4DJFC 3IFSA 2WJJA 1ZA1A 4G0WA 2PZKA 2NTEA 2VBFA 4ZHQA 2ZDGA 2P9CA 4LZZA 4LYJA 4FOPA 1M0WA 3F3KA 2BWJA 1I7LA 3WKBA 4ZAYA 1GADO 3ADCA 1BA2A 3A3PA 3E3MA 4KLNA 3G5LA 4IIJB 4XYBA 2OC4A 3W7AA 1ZCBA 4ZANA 2Z6AA 3R3UA 3DT6A 2CCJA 2HIMA 4GE0A 3WGOA 4KQEA 1OFHA 1OYYA 3UNXA 2HPVA 2P8SA 5P8WA 1ZUNA 1DBQA 5SY9A 2PEZA 4GGPA 5E38A 4DMLA 2VDWA 3U7QA 1ZZGA 1QO0D 2WHPB 4OCZA 1K6JA 1WXQA 1QHSA 1JUDA 2O1WA 2WJVA 4QC2A 2Z5LA 5D8DA 4WBNA 2O2EA 3S70A 3COSA 3RYHB 3FFAA 3A31A 1FLAA 2BR4A 2VBCA 2Z2ZA 4ZZ1A 5IMSA 1ZLXA 5ALUA 4EFDA 2CV0A 2DR3A 2DHQA 5BOSA 2DUNA 3DDOA 4Q1CA 3X43A 2UKDA 1PR0A 1UEIA 1JSZA 1JF8A 2P5TB 2IGBA 3UV6A 4GMDA 4ZEOA 4C20A 1J0AA 1XVVA 2LP4Y 4P33A 5KYUA 1UBNA 1E2FA 5ALOA 3UK2A 4LGCA 5ADHA 4AWAA 2XDAA 4YRQA 5JXWA 1D09A 1TM5E 1GQRA 3IMEA 5E7JA 5IYZA 2XI4A 3FJYA 3V8RA 1TCVA 5CB4F 4A2CA 1B8NA 2QRVB 1JWBB 1W0KA 2NU6B 2ZYSA 4N0PA 5JCZA 3OU6A 4GL2A 4D25A 3AEUA 3WVNA 5BNWA 2D4AA 2ZBQA 1ACLA 2HRZA 1H2RS 4KQFA 3ZHSA 4DJEC 1H2XA 1PYOA 4HLQB 2QBYA 1TYZA 1EP1B 4H1WA 3WAJA 3D7KA 1H69A 2IBMA 4UMVA 1Y4ZA 4IF6A 1T35A 4DIFA 5JYDA 3C7AA 4DQ0A 5CB4A 5ADWA 3S8MA 2CXUA 2WKSA 4XX1A 3COZA 1E2IA 2X4DA 1C0EA 2D5AA 2XNDD 3GU3A 5GAJA 1NM5A 3I4CA 4BRWA 3HYLA 3MYYA 5A5EA 2EYQA 5BUQA 4KE8A 1RYMA 2F00A 1HI9A 1OA0A 2AX3A 3JQBC 3OIDA 2UZ1B 3LOPA 4BGDA 3FB1A 1VB3A 3FCCA 3HCBA 1HNZB 1JU3A 2OXRA 2XOKD 2XZPA 3KS9A 4BNGA 4PYIA 4BNDB 3DVLA 1AZSC 2Y1OA 4LJ9A 1CQIB 1BKYA 4XE5A 4N47A 2J3KA 2ZBEA 1ZNZA 5L3RA 4YRFA 3WY9A 2ZIAA 3ZJVA 1R4ZA 1ZHHA 5DBIA 3ZDZB 5JVDA 2RKWA 2QOEA 3NBQA 4Y98A 1E94E 1VPVA 2A0FA 3BE6A 4IH1A 5GQSA 3RBVA 3SZGA 3W3ZB 4Q1VA 3DCNA 2QAGB 4JB8A 4NFYA 4C4XA 4Q6BA 2FZEA 2GAJA 1RCFA 4KXYA 1XV5A 3VJKA 2E89A 1YZ3A 2HCBA 4DA0A 4CEJB 3IIMA 3RS8A 2X3YA 3FDXA 3QVKA 4XSHA 3D7LA 3ZJUA 1M6VA 2CUZA 1J2TA 1SXJA 4L02A 4RDCA 4O2AF 4M2LA 5F2OA 1QP7A 1GRNA 3H4MA 4XARA 2F1JA 1XDSA 1SXHA 2YRWA 2YW2A 1EPUA 3MW8A 4R9SA 2YWRA 2F4NA 3LDGA 3ZWPA 3EZ9A 3LKZA 3G0BA 2E5LB 2GAFA 1OH6A 3ZH2A 2PD4A 2HLNA 3AO0B 3LNCA 1Z26A 2PQ0A 3PXBA 4EB0A 2FX5A 2QDXA 4ZJYA 1QCDA 1ZN8A 5LQCA 3UC5A 2W58A 1GTL1 2CYCA 2WLTA 4KOEC 3SICE 4GOMD 3U3ZA 1A2KC 1I2BA 1V26A 3G8CA 1REQB 5EJ2A 4ZQEA 4JOCA 3WGVA 2ONJA 4DG8A 1R0LA 2QUIA 3E27A 4GIBA 5FJIA 1CDZA 4UUPA