1E20A

The fmn binding protein athal3
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
185
structure length
185
Chain Sequence
RKPRVLLAASGSVAAIKFGNLCHCFTEWAEVRAVVTKSSLHFLDKLSLPQEVTLYTDEDEWSSWNKIGDPVLHIELRRWADVLVIAPLSANTLGKIAGGLCDNLLTCIIRAWDYTKPLFVAPAMNTLMWNNPFTERHLLSLDELGITLIPPIKKRLACGDYGNGAMAEPSLIYSTVRLFWESQAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Structure of the Fmn-Binding Protein Athal3 Provides the Structural Basis for the Activity of a Regulatory Subunit Involved in Signal Transduction
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Flavoprotein
molecule keywords HALOTOLERANCE PROTEIN HAL3
total genus 57
structure length 185
sequence length 185
ec nomenclature ec 4.1.1.36: Phosphopantothenoylcysteine decarboxylase.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 1e20A00
1SBZA 3MCUA 1P3Y1 1E20A 4ZAFA 4ZALA 4RHFA 1MVNA 4ZAGA 4ZAWA 1QZUA 4ZAXA 1G63A 4ZAYA 3QJGA 4ZAVA 4MWGA 3LQKA 3ZQUA 1MVLA 2EJBA 1G5QA 4RHEA 3WISA 4ZANA 4ZAZA
chains in the Genus database with same CATH superfamily
3BA1A 3IFSA 3M6AA 1NSYA 4II2A 5TARA 2W6NA 4KIUA 2HIGA 1IL0A 3N07A 5FDFA 3T1OA 1T2AA 4KXWA 1IWOA 3A7EA 4QUJA 4L8YA 3Q8LA 2YN0A 3HKDA 2N1MA 2IUYA 5CA1A 2HH9A 4OSPA 1IOVA 3KYIB 2REQB 4UOEA 1W0CA 1CY1A 4B9EA 4ZIRB 3PNLA 4GMXA 1OIVA 1R9NA 2B94A 3VPGA 4W9RA 1XWIA 2XVXA 5ALOA 5C4MA 3QPCA 4IUYA 3PNQA 4A0QA 4GL2A 2OKCA 4FFDA 3L46A 4FDLA 2GASA 3A9WA 4UDNA 1VE1A 4FTWA 1KNQA 1QO0D 3LC2O 3MHTA 5FLEX 3A6JA 2GPYA 2GD6A 1FMFA 1EB9A 3HYSA 1UJBA 1UXOA 1RHQA 2OYCA 4GRDA 2W71A 4PYQA 3ZIAD 1PHPA 4V2UA 1HOXA 4HVCA 5TIIA 3IP8A 2VSQA 4ENWA 2CYBA 4XW2A 4ZCRA 3O75A 1E1QD 3LKZA 1V25A 4D8TA 4RIGA 2AWOA 4ZDWA 3WLSA 9LDTA 1PL8A 4HGOA 1FP1D 3L0OA 4RGVA 5LQKA 3BILA 2EV9A 4FHFA 4L5JA 3IS3A 1KY2A 4U7PB 4JHLA 1TYEB 3LBNA 4UNSA 5LDGA 3VR6A 1SG9A 1MJHA 2ODAA 3EVEA 3ORRA 5F5NA 3ZX5A 2WYVA 4Z4IA 3H99A 1TAHA 2PMDA 2V9CA 1FDSA 4AQDA 1TTHA 3GLKA 2NU6A 2R7AA 4FMBB 2B5WA 4TLDA 4DZZA 5BT8A 4KFSA 1TEZA 4KU4A 2X14A 5IVPA 3QLEA 2CCJA 4G86A 4PWZA 1EVZA 4D3XA 5CLIA 1U1DA 3QGMA 5BUQA 4CETA 4MPTA 3MPUA 3IEPA 1EGMB 2XDAA 4LFAB 5JZ9A 3RABA 4N3NA 3U0VA 3DDOA 5E8JA 1ULHA 3GZNA 4HADA 4TTTS 1E59A 3RC3A 2OB2A 5FI5A 2QZ9A 5CFZA 3PUWA 2FUCA 2PKRA 3OCYA 2YH2A 1F5SA 1U0TA 3K53A 2HDWA 2E82A 3PB3A 4NV3A 1TZBA 4ZEVA 3HKEB 4IQGA 5LA6B 4UQPA 4KE9A 4MULA 2QMYA 3I8OA 1NUQA 1ZW1A 4ZCTA 4B6OA 3RE1A 2CNBA 2LXNA 5D01A 2BV3A 1G7RA 1KI6A 2AFHB 3FSEA 4TZTA 2HSEA 4TSKA 1ODIA 3QKSA 2HYDA 1MQSA 4TLCA 5T4BA 3K05A 2G7ZA 1HEYA 1ZWKA 5K8JB 3FLEA 3MAJA 4C7VA 1XLVA 3PKJA 5ARDA 2KBEA 2QTHA 2A88A 1T9HA 3D3JA 5FOTA 3TEFA 1KTIA 2EYQA 2A35A 1WF6A 4U6QA 4IF6A 1P5JA 3A70A 3WGTA 1U7PA 1W4AA 3MJCA 4OAPA 1K6XA 1BEZA 4HC4A 4B35A 4BQEA 2W8BB 4DEYA 4NBWA 5AVUA 4JYCA 5C53B 5JE8A 4KPUA 2WSSA 1CU1A 5JXHA 4UUMA 4QLOA 1CPYA 3EWIA 5CM8B 2OXCA 1NIJA 4HHEA 3HZZA 4HP8A 4FLFA 4K1XA 4OK5A 1Y63A 4ARZB 4BRSA 4GU5A 4YUVA 4B3TB 3FMFA 1J56A 3K0CC 4LA4A 4HDNB 1RJ9A 5JJBA 2VAXA 3EF3A 2H6EA 3PHGA 4V0KA 2RG1A 4FC6A 1S1CA 3VOSA 1C4KA 1P7CA 4IDNA 2XCLA 1WW8A 4NZZA 2D13A 2J9YB 2BMJA 2JJMA 3HZRA 4D96A 5JV5A 3CSSA 4UM8B 2VQFB 1G5IA 5AVSA 1GRCA 4MIOA 4A92A 4D81A 2PFSA 3CVVA 1E58A 3WBBA 4WEQA 3NEAA 4IUCS 4WDRA 2P0EA 3RVSA 4XGNA 4Q1AA 1WO8A 3OG9A 3GUHA 5FR1A 1PL6A 4HBGA 3FKQA 4KLRA 3WYCA 3TSZA 2RAVA 5EPOA 3ZI7A 2ZSAA 4Y67A 5IJ0B 1P80A 1YRHA 3S81A 2WSLA 2BCGY 3CONA 1U8YA 1VKOA 1X13A 2HZ7A 1SXJD 1XVIA 4D74A 4PN3A 1YQWA 5F9MA 3L82B 3MBKA 4QFDA 3M3HA 4ZOBA 2MR5A 3C5WP 3TJRA 3VQTA 2W6PA 1VI5A 2V03A 2VTDA 3FHJA 1H8HD 1GRRA 2XNDD 4HXFB 4IV5A 3K2BA 1U1IA 4RGBA 3RFUA 3WADA 2PZMA 3ZOKA 2GM4A 4MI3A 1BWRA 1OOEA 2PT7A 1RW4A 3KR1A 1C3VA 4DSNA 2H00A 1HFKA 2XWJI 3O8OB 4RKEA 4RORA 5JWOA 3AILA 2Q7DA 1N6RA 3EPHA 1EX9A 1O6CA 3IKMB 3FUCA 3ZQUA 2PQ0A 1B26A 4ND4A 3C3CA 5TNXA 4ALJA 5J2TA 4N5IX 4X62B 4BNFA 4RX1A 4MVJD 2VDVE 3C4VA 3NDPA 1U8FO 3ZVLA 2ZLBA 3BICA 2XCSB 4Z6KA 3Q8XB 3Q0EA 4Y2YA 4US2R 1E20A 3RRZA 4HGNA 3KU4A 4Q3CA 3VZRA 2A2ZA 1T91A 1UM9A 4WCFC 1H8HA 1C30B 1S9DA 3U56A 2WHRA 1ZGGA 3HU3A 4B48A 3WLQA 3BIFA 5HWSA 3TN7A 3ZPXA 3FBGA 5KNBD 4RSGA 1N5RA 3GARA 4NH4A 1OKKD 3DMGA 3W3ZB 1FF9A 1EUDB 2RK4A 3AP3A 3RRBA 5BP7A 4Z5XA 4RZQA 2B98A 2QW0X 2IPXA 1Z8HA 1ZAKA 3IHKA 5HVNA 4QEKA 3OPXA 4NYIR 3PRYA 3CB2A 3I2YX 2VT7A 3ROQA 2A5LA 3B85A 1KBOA 1NFFA 1ZBQA 1XXHB 2FW0A 3OLCX 3G23A 4IJKA 5C0OE 1Z28A 2AZDA 4EMTA 3WGMA 3ECAA 1VRWA 2W37A 1M2EA 4IIUA 4M9SA 4JY7A 4HYYA 4CTOA 1LPPA 4YQFA 2EFEB 5CK4A 3R9IA 2WM2A 1F9AA 1C3EA 1DEOA 4QXAA 1OKKA 4B7CA 1ZUWA 5C37A 4H6PA 1SXJC 4MUFA 3WIEA 4UPEA 4MUIA 3HCEA 4WKGA 4RPHA 2Q6KA 1QF9A 1G21E 2BP7B 4K40A 3FSGA 3AUFA 3GFOA 4R2WA 1XELA 3C6ZA 4XFKA 3ESRA 3EW9A 2CMDA 2G04A 1IDOA 1V9LA 2C9YA 4UXHA 3R4VA 3HFSA 3RSFA 2HMAA 3C48A 4WLFA 4INJA 2OXIA 1FMCA 3DP7A 3KFVA 3L3BA 5DGDA 3KUUA 4BB5A 3ZGOA 1Z0IA 3RASA 2RGRA 4RJ2A 3SQWA 1NJSA 1UR5A 4CIAA 3EY4A 1NX6A 3UFXB 1CQWA 4QVGA 3D2LA 4AXBA 5K03A 2CV1A 1P5ZB 1UDBA 2MHCA 2WKQA 3GFPA 3GPIA 3H1TA 3QKRB 5EWLB 1DCTA 1FZQA 2V7WA 1RYHA 1VPVA 4MIKA 1I2BA 2JD0A 2SKEA 2WD9A 2YIDA 3EEQA 1W73A 1CS0B 3DDZX 4GDMA 3IXLA 1VHWA 1U3WA 1FYXA 1MC1A 4QRDA 4WNAB 1M1YE 2PQ6A 2AJBA 2QPAA 3GPDG 1GL9B 2O7NA 4M21A 5F33A 1LV7A 4HN4B 3EQ6A 4KSBA 2ZYTX 2XTJA 2EDAA 4QT4A 4JZYA 1C0KA 5EVCA 5EJ4A 1ZJZA 2DTEA 1FTYA 5CJPA 1J8DA 4YA6A 5I8WA 2AVNA 5DN9A 1Z4KA 3F7TA 3URKA 4CMKA 4BNDB 4PX9A 4ZTUB 3UH0A 1RR6A 1Z7BA 4B81A 4A26A 1CEYA 3HVJA 2VFAA 3QEKA 5KO2A 4RTPA 4N41A 2F3QA 2J0UB 2OQRA 4KLZA 3FR8A 2VCYA 2JI7A 3GDGA 1FYFA 1L7MA 1M8JA 1ZL2A 2FOXA 2WIKA 2YJGA 5EKDA 1HLFA 1RQPA 2RBGA 5AK3A 5GOZA 1MAUA 3LF2A 1NG9A 4LMBA 3OX3A 3TOZA 2SBTA 3VDXA 5IC4A 4P98A 2QXTA 4CMCA 1WVMA 1ULTA 1YR6A 2FPGA 4RULA 1XPRA 2QIPA 2N46A 4E15A 1N2JA 4YUAA 1RRMA 2PMCA 1P1HA 2VJQA 1MIOA 1OAOA 4NCNA 4FOLA 1TVKB 2PKXA 4B3JA 4FDTA 3ADOA 4I9HA 3IDFA 2VI5A 3HU5A 4QJ3A 4M9UA 1Q84A 2ECFA 3PE6A 3ESYA 4BFVA 3BC1A 4EG5A 2BDUA 2R79A 1Y3DE 4BGIA 1E3WB 1KMNA 1OFIA 2C96A 2XVMA 3BMCB 4U0KA 4EYQA 4CCYB 5GJCA 1GQSA 4XTRA 5BMVA 5B7PA 4MRAA 1I80A 2JATA 3LC1O 5L9AA 4Y6SA 3VTZA 4V3CA 4XX0A 2AC4A 2XTMA 2QRQA 3KDSE 3NM4A 2FUEA 3CEJA 4V0LA 4YP0A 1DLIA 3G0IA 4URVR 2X7JA 4GOKA 1IAVA 4UMFA 4HS9A 5MN4A 1RABA 3X2FA 4UUNA 5ALVA 1KU6A 2WYOA 4CMBA 2HNAA 1G5TA 4UU7A 2OESA 3BMNA 1ISSA 5F78A 3RF7A 4CV1A 1HRKA 3VO1A 3IHTA 2AG8A 4YJFB 3N75A 1QLHA 4K0RA 3FLBA 4DZTA 3B1YA 2GEBA 2Z3ZA 4JI2B 1KVUA 3IPLA 4NJEB 2D7JA 1JJFA 3KEGA 3U6KA 3QENA 3U9SA 3B1ZA 3ZGXA 2GYVA 5T57A 2UZ4A 3UMYA 3AVVA 4TV9B 5I7AA 4OQNA 3DFKA 2BGKA 4YPOA 1C7QA 1OJLA 3I45A 4BE4A 5JVDA 2JZOA 1DXQA 1E4YA 2G06A 3ZZUA 4RCZA 4UEKA 4URYR 3ZTWA 4BQQA 3P52A 1DJLA 1QP8A 4H60A 4JOSA 3OM0A 4Q01A 1SMKA 1FP4B 2VDQB 3IX7A 1Y4AE 1W7AA 3DONA 4LE1A 4DPLA 1FUEA 4GRIA 1EZZA 1CY4A 1KJ8A 1TYCA 1YOVA 1Q1GA 3BMOA 1NBWB 4NAHA 5CPFA 3VNBA 1WIWA 3VGPA 3WBJA 4YONB 1AHNA 1ZIPA 5KPDA 3QEJA 1R0XA 2IDJA 4H16A 2XT6A 1JXAA 1I8TA 1LSUA 1D0VA 1KAGA 2F1JA 2RGWA 2V7QD 2X41A 4G84A 4U8HA 4DB4A 3E7FA 1VTKA 3ER6A 3VR6D 2SECE 1J22A 3DBHA 3H9UA 2Q41A 5CDFA 2DKFA 4LFCB 1JR3E 3DZKA 3HLYA 3PYXA 3TXYA 4G4JA 4RANA 3B9QA 1UZUA 3VYSB 3PVZA 3VPSA 4E1AA 1WSBA 2ZRLA 4FWBA 3S2YA 5JBQA 4WGGA 3UT0A 3VV3A 2PXCA 3SSNA 5MGBA 4ABTA 1JLKA 3TDKA 4NF2A 1F17A 3HPRA 4LI3X 2B4KA 3JZIA 4HTAA 3C1OA 3M5PA 4L85A 3UJCA 4A36A 1GCAA 4M88A 2PK3A 2GJ9A 4N0PA 4JU9A 1A5ZA 4DM7A 3AEKA 3P9ZA 2A9VA 5IASA 4ZU1X 4BMYA 4EUFA 5LP1A 1Q22A 2BZ1A 2IYYA 2NT4A 3SQNA 4N40A 5T67A 1PNTA 4BKUA 1DV1A 5T4HA 3WBKA 1A8SA 2FV8A 4EW1A 1FFXB 4AZVA 5G1PA 1GM5A 4PLGA 1YS2X 2C3OA 3PNBA 1PJLA 4TUYB 1TQ4A 4Q00A 3LCRA 1E2GA 2IXFA 1SKYB 4Q4DA 1SAYA 4PAWA 2CL6X 3PX7A 4WL0A 1JTFA 1R15A 3LX6A 4JGBA 2QPLA 4XQCA 4ZT2A 3ELDA 2IPOA 4MYDA 1C1XB 1Q3HA 4TKVB 4DFDA 3WJ7A 1LJUA 1M1NA 2XCOA 4ZT6A 2I2AA 2WJAA 4KUHA 4G5SA 5C5IA 3D8RA 2NTYC 2X7XA 4XASA 3D8HA 5D3MA 2FEXA 4KR7A 3U5TA 3M82A 3X1WA 3AXSA 1PCXA 1PNVA 1Z5PA 2YBDA 3K72B 3PIIA 3I4CA 2QLNA 3GA5A 3K94A 3A6EA 4HDKA 3GH3A 4IO0A 2OQIA 5ALLA 2ZSUA 5A7HA 4DLZA 5K8LA 1ABBA 1DDOA 1PN3A 1M5TA 1R50A 1T4BA 4WPGA 3WB1A 4BO3A 5KDDA 2JLXA 4DLSA 3M4YA 3MJTA 1I13A 2LGJA 2ONYA 2WT4A 2XKJE 1YVUA 5U4QA 4J2HA 5JADA 1Q0SA 1IB6A 4XSHA 2QR2A 4H6VA 1GP2A 1W88B 4I9GA 4PZDA 3V9PA 1O8CA 4N5DA 5FLYA 1JSZA 3KEOA 3ESDA 1DI0A 3ZHTA 1UH5A 3V1YA 2QW1A 4YRCA 3TCNA 1ECPA 4LRXA 4MV9A 3T4PA 3HJHA 4FPXA 1KEPA 5BWBA 3R4CA 3MC1A 3PNOA 2I7CA 4RHEA 1ODFA 4DGQA 2GCNA 3GLIA 5AVJA 5E9WA 3NT2A 4OHRA 4O2AA 1KJ9A 4G89A 4ZGWA 5LN1A 2L82A 4C2BA 1E79A 1X1BA 4N49A 3BWEA 4LRYA 1S7CA 3E1SA 2ZBQA 4US0R 3D2AA 2O5RA 2C04A 1PG0A 3CQ9A 1TF2A 1SBQA 2UYGA 2Y71A 1KZ1A 5BQ3A 3Q12A 1B73A 2PLAA 4IIJA 3RT1A 3ZCQA 1XPUA 1FXWA 2FQWA 2BTQB 4LKRA 2FE4A 3B36A 4HFRA 1HY3A 1ZOIA 4LVOA 4RY2A 3N2YA 3SLKA 8ADHA 2UYHA 3TI9A 4I66A 4EJFA 1IOWA 5ECWA 1T35A 3EQ2A 2VNAA 3AJEA 3W2GA 1ZVQA 3QX9A 3P9YA 4P3KA 2JKYA 4MW6A 4LHVA 3TQQA 4BQSA 4C03A 3ANYB 1H6CA 1RP7A 1YDGA 2DWUA 1KH2A 3K1ZA 3QUBA 4HDKB 4KBFA 1IY9A 4MQ4A 2OCKA 4Y7CA 1G20B 3DGEC 1O6FA 3GWGA 4EJMA 4ZZIA 4NY1A 3H5LA 3P9XA 4IVQA 3H97A 2XIJA 4FZRA 3C3JA 3CZ5A 2ZJ4A 1QRTA 3MJ4A 3WFZA 3V4RA 3B6JA 5C51B 3CWCA 3MK31 4JSYA 4JJ7A 3WL8A 1QRSA 3H2JA 3OZVA 2VDPB 1P7ZA 1U98A 4LZOA 5AJWA 3JR7A 3IKJA 2PEZA 3QBEA 1HKHA 2D3WA 4CL8A 2A1UB 4D02A 5FR2A 4C4RA 4EHDA 3B12A 3IMFA 1BX3A 2WU8A 3AERA 4K3UA 5JLJA 3SQXA 2YYAA 3CYFA 3RUAA 1E92A 5A1TA 2OG2A 2HK6A 2VJNA 1TO6A 2Y8EA 3H1BA 3CNEA 3N2ZB 2MU1A 3K7EA 2LDBA 1NC3A 3QKTA 1HQYE 1FRQA 2YHUA 1C3OA 2FRVA 3KQTA 3SM9A 3F5QA 4V3BA 1KZ4A 2G4CA 3VSDA 2WVGA 3O90A 4WI1A 4C3OB 3STXA 1RZRD 4QTTB 3PLAE 3OQMA 3JQAB 1SELA 3WYGA 2DGDA 4YJ3B 5KYUB 3Q8WA 2JH9A 4FGWA 1UBEA 4GNRA 2POCA 4RO0A 4U1RA 1NF2A 5J3JA 3PFBA 4ZHQF 4UVGA 2WE7A 1OYVA 4UTZA 1M75A 4V0ME 1QU3A 1NPTO 2C9MA 1NXTA 2I2XB 2JZCA 2YY5A 3K0BA 4QUIA 5B1SA 4A8TA 4GSLA 1PGOA 3BK1A 1PEAA 3I9V1 3R6TA 2CEAA 1V9CA 4QUEA 5ADHA 1SC3A 3O4GA 5IT5A 5IZCC 1M5RA 4Y9UA 1OR8A 3G6KA 3ITNA 1GV0A 4UHFA 5G40A 2F8MA 1JMYA 1TAGA 3NG1A 3FSJX 4C29A 1J1ZA 1VMKA 2G72A 4PS1A 1T5TA 4C6TB 4LOLA 2PYZA 2EGHA 3BUSA 4S04A 3NBYC 3IAM1 3MRTA 1PO7A 1ZN8A 5HJEA 2VJPA 4D9KA 1E3TA 2YX1A 2QBYA 1H2FA 4PM4A 1Z8NA 3LQYA 3LAWA 3PFFA 4UQLA 1XUOA 2RGYA 3K0KA 1EM8A 2BR5A 2Y0CA 4UVHA 3R9KA 1JU9A 1IN1A 4LZZA 5HIJA 2QJWA 3H9CA 4WJKB 2VK4A 2NXJA 3JQDA 3PE4A 1XRNA 3TE7A 3NVMB 2I6GA 3MT7A 5DYTA 2Y6VA 1YMQA 3SZLA 3NOVA 1WB9A 1XK6A 1Z39A 4O02B 2HA4A 1W5FA 2WE8A 1ZLXA 1CY0A 1T4DA 3DJYA 2PXAA 1SHUX 3KDAA 3GB9A 4NULA 4DCSA 1PZMA 5IUJC 3V4LA 1X2EA 4EAQA 3LWBA 3HA2A 3KSMA 4EA8A 3D0RA 3W6PA 2O8EB 2CKDA 2F9FA 3L02A 2CFTA 4MYSA 1LF5A 3WK8A 3GFGA 5FI1B 1QFYA 1CTQA 3OECA 3GI1A 4TUYF 2RC5A 1ULZA 2QVYX 1YBAA 4X24A 3BPSA 1S2NA 2W5UA 3HJTA 1OYYA 4P6VF 1V8BA 5DGTA 1E9BA 3GLIE 3LBHA 5AMXA 5B3LA 1QQTA 3HFRA 1HEUA 2PSDA 4PZ0A 4CN9A 2DPHA 2XGMA 2P9CA 3RYIA 1XR3A 2WYHA 4OA8A 1NX9A 2R84A 2BUCA 5EIEA 1OXBB 1ITZA 1GGHA 3HCWA 1A82A 1F2TA 3WGQA 3WKEA 3ETGA 1C3LA 4MR7A 4CMIB 3B1KA 4L28A 3C70A 2X9LA 2Q27A 3AHJA 3O8LA 1P2SA 4FQ8A 1JEYB 3WIOA 2QVXX 5EJAA 5TPZD 3TBHA 2AMLA 5CNJA 1ZC3A 1H3EA 2QL5A 2PZJA 3HBFA 3OM8A 4CV2A 2Q1XA 4DF3A 4J75A 4YB8A 4MRMA 4BY9E 4H3VA 3H04A 4UBIA 4X93A 1OVGA 1V4NA 1Q11A 2JZNA 3RWMB 4W7HA 1JU4A 2C4WA 2X5JO 2QRJA 3COYA 3GJ6A 1QP7A 2YC2C 3K31A 4BFXA 2CXQA 2JEYA 2OFOA 1A5AB 1UPTA 3KYJB 4GGPA 1ZH8A 1X1SA 3EAGA 5DH9A 4O59O 2MSCB 4OMDA 4BJ6A 4Q12A 3E7PA 2H85A 1MC5A 3GEEA 3LIIA 4HYEA 4NBLA 3USZA 4F1KA 621PA 4R8MA 2E37A 3PF8A 2BI8A 2PGIA 2QX6A 1SQSA 3NATA 4M54A 4Z9XA 4MVJP 1IN5A 2CBGA 3NBZC 3OCWA 521PA 5A6SB 2P6RA 2I80A 3GCDA 3O9ZA 5EIFA 1DAKA 3A04A 2QM0A 3P94A 1DC4A 1IK6A 2GCOA 2ORED 4DSZA 2J9GA 3FF1A 5JTUA 5FTLA 3D5EA 4OFBA 1ATIA 3DFIA 3K1TA 4AX4A 2QMEA 3D6HA 3FCXA 4Q3DA 1UMCB 4CM4B 1TJPB 1EIWA 4YRJA 4ZQBA 3BA6A 3ZKAA 2BEUA 2I4IA 2DOKA 4JQOA 4R51A 5AM4A 2ZZKA 1DG1G 1O8BA 4L4RA 1G7SA 2RCYA 2RGGA 2BBWA 3NRBA 1E66A 2B8NA 3SKYA 3DLBA 1FYEA 4Q5IA 1JT9A 4QYTA 2XLCA 3AIKA 4YCBA 1TEXA 1A7JA 1IY0A 3HU1A 3LH5A 3EZLA 2OBLA 2PV7A 2ZSKA 4OFXA 1A77A 3UK0A 3A6FA 5HFNA 3HB5X 2QT0A 2OV2A 2FW8A 1ARZA 1E1CB 5JH7B 1MFZA 5BNZA 1DOHA 2Y0EA 3KQHA 1D2CA 3V2IA 1AHHA 3MTQA 4GPZA 5BQOA 5J4HA 1Y9AA 3ZE0B 1RU3A 2IX9A 3W2TA 2YCLA 1Q1QA 3MS7A 3SIXA 4EO4A 1I01A 3GT3A 1M2WA 2IHZA 4ZJUA 1P9WA 4MVJE 2FPIB 3AF2A 5SV2A 4EARA 2WYWA 4XVRA 4AYTA 5KKNB 4ZALA 2JK1A 2IOHA 4LJKA 3FX2A 2J41A 4R8VA 2GEFA 2G67A 3T7EA 2CVOA 4RVCA 3BIOA 3LT4A 4PS0A 3VZPA 4TV9A 3U39A 1CJVC 2GZAA 3ESXA 3HN2A 2ZBRA 1KR2A 3V6MA 2NAFA 4ZVVA 1LBHA 1RMQA 1YR2A 1FLAA 1V8DA 2ERCA 5LFAA 4O5OA 1UOEA 4XM1A 3W4IA 5BV1A 5TJHA 3CH6A 1GZ7A 5JCOA 1ZGHA 3L5OA 2R7MA 4U8GA 4JR1A 3TBKA 4AKGA 4GD3Q 4RHTA 4KYTA 1M8KA 2GM3A 3CF2A 4MMXB 1F4LA 3LY5A 4NU6A 4RIEA 1LLCA 1U9IA 1YZQA 4LC0A 1H2EA 4WK6A 3DZ8A 1AUVA 2WTEA 3O84A 4XDHA 1NW9B 4FOSA 3UJHA 3ZI0A 1R5OA 2ZIVB 4BRZA 5BSKA 3CW2A 4HAZA 3PEEA 2J6CA 1YJXA 1OZFA 5C4IA 3Q5DA 5KNCA 4C3ZA 4I8DA 1XX6A 2PZFA 2GN2A 4HNTA 4C7OA 2CCGA 1R1DA 5IWCA 3AW9A 2PLWA 1Y5MA 1GG8A 3DBLA 3KV1A 4HWPA 5ERYA 3BREA 2WJWA 3SMQA 5AXAA 5TQ0A 4D6PA 4YV1A 3F97A 3NYWA 1ZK0A 4NPCA 1UMDB 4WADA 3RSLA 2YXBA 1U2ZA 2H0QA 3CPSA 3JASA 3RBVA 1KC1A 4P8RA 3SQOA 4N01A 4PAGA 3O6VA 1AX9A 1QGDA 2PSSA 2CT8A 2X0NA 1VDZA 1WE2A 4QFCA 4BFLA 2Q3EA 3DXZA 3PR3A 2FPMA 2YWGA 3AJDA 3NUZA 5KSZA 1SRQA 2D5CA 5LZ9A 3TTTA 3GYBA 1BMDA 1N5MA 2IOYA 4G1EB 1CE8A 2EF1A 1JWBB 1QX3A 4NZNA 1VRVA 3SSMA 2P7IA 1AVTA 2AN1A 4DNFA 1XNQB 1NI3A 1F3LA 5DLDA 3QUSA 1DUIA 4ZV9A 2VR1A 3PJRA 2W8ZA 3KM0A 5DLPA 2P5SA 1SXJA 1DEHA 1FSGA 1U3GA 3DNFA 3NJ4A 1CR0A 5AJZA 5BQXA 1NVUQ 2HMUA 3AF0A 1ID8A 1MHTA 5BNIA 3UJ9A 4M0MA 3MUNA 1NWHA 1SR8A 4OXQA 2RGBA 3I6YA 4QOFA 1VPEA 1QH0A 3HDTA 1N2HA 1Z73A 1Z75A 1RHUA 3BRCA 3GELA 2XUPA 4M37A 5ES3A 3WMEA 1X1QA 5B3KA 2FSFA 1PBNA 2IXDA 3I04M 4ND1A 1JYFA 3WLTA 3LPMA 3WGIA 2PO5A 2H7YA 2ZBDA 3QXJA 2PD6A 3L8DA 4PG6A 1Q14A 4W1PA 4GQAA 4IMRA 4X5OA 4I1PA 2G70A 1DDIA 3DM9B 2J0UA 2YV1A 3GYGA 2Z8YM 2QVCA 4NMMA 4NYJR 1K7SN 2B5OA 3DBVO 3DZJA 4OQZA 3LVRE 5LUBA 3WHPA 3ZI4A 1MP0A 3BG5A 3MRSA 4MRRA 4OU4A 2DQZA 1WUIS 4Q4HB 1VP3A 3IEIA 2BIFA 1AQYA 1SU4A 1ZA2A 3GLHA 1BVUA 3K1YA 4FR5A 4HGPA 1UUFA 4N7JA 2C20A 1RYMA 2UZ3A 5TC4A 1DIGA 4IX1A 1Z4IA 3SZOA 4X3PA 1BHSA 1VHTA 2UAGA 3VZSA 3LXRA 3OJCA 4E2YA 4BLOA 2VXBA 1HQCA 3PQ8A 1YU6A 1JHRA 4RHFA 5E4YA 1P62B 1QIMA 1TKCA 2XUFA 2EXXA 1EG7A 1XRPA 3E9ZA 3EIXA 2YWRA 4MGYR 1RM4A 2ODEA 4RESA 5EERA 1R00A 1T4MA 1WDLA 4DNPA 3QEBZ 3ML1A 5KSPA 2NO6A 4KN6A 3K1AA 3OBIA 3TQTA 1Q6YA 2OK8A 4EVQA 1L1QA 3ASYA 4HUJA 1XALA 2DT8A 3TMYA 1W5EA 3S2GA 4OY3A 1RLMA 2ID7A 3ETJA 4IDPA 2WHYA 3ILYA 4D3FA 2R0QC 2GK7A 3ZBPA 1WCXA 4ZV4A 1YULA 4QYWA 3S2ZA 4G5HA 2EJBA 3BORA 4DJTA 1I4WA 1OAOC 4KWIA 4FFMA 1WBBA 3V2HA 2LCQA 1OTYA 2BWJA 3I72A 2OAP1 3O26A 4JZKA 2G9QA 2C5LA 1NSFA 1JQKA 1L5SA 1UOOA 2DLDA 3PPWA 2PRZA 5JOQA 1IPFA 3EZNA 2ZBPA 3RS5A 4DCUA 5HKOA 4F5EA 1VSTA 1PV4A 4JLNA 3Q88A 3E4CA 1IFXA 2LCIA 4J03A 4BHTA 3LUGA 1AKWA 3K09C 3ZK9A 2DCUA 2ID8A 4X94A 1P0FA 5K1ZA 4DCGA 1UMCA 3HABA 3F96A 4R1OA 1XRRA 4CR7A 5H80A 4OI1A 1NW6A 4DQKA 3L6EA 3SBDA 4B6GA 2F00A 4H0CA 3IRVA 1G3UA 3B2NA 1XZJA 1ZMBA 4FJ1A 3H6KA 4YT8A 2PIDA 1C1YA 2QLTA 4MKZA 4OXNA 5IBRA 1BAPA 3ESCA 5J2TB 1HO3A 1K7YA 3IOCA 2DP4E 2AZTA 1Z6AA 2V6MA 3B7GA 2BFCB 1NOIA 4LGVA 3KJEA 1O4VA 2NUPA 4AN4A 2JGKA 3G5LA 2JB9A 2QG6A 3AGQA 3Q4GA 1FVFA 4A91A 1PNOA 2C57A 4II3A 1HMPA 3HKCA 1UJCA 2H2GA 1JSXA 2WVJA 1X94A 2JGLA 4IKPA 3NHFA 5F12A 4IFTA 5AHKA 4CLEA 5JJLA 1CUXA 4IVNA 1O6GA 5JHGB 2ZAOA 4F84A 4EL5A 1PNRA 4WDQA 3KDPA 3BK2A 4BGUA 2P5TB 1PGJA 1ZUIA 3O3NB 4H4DA 2F1OA 1S8AA 5FA8A 2C9DA 4Z0TA 1Y80A 3N8HA 3NUGA 4RNDB 4TT3A 4YRIA 3WG9A 1KYZA 1A1VA 2Q3DA 5KOIA 2OCBA 3GD7A 3WMGA 4QJ5A 3DDNA 4KV9A 3TNJA 1MJNA 3UUFA 4Z4EA 5E3IA 3UAWA 5CDGA 2AF4C 5A0FA 3FUXA 2O06A 3ON5A 5IMSA 1C2YA 2G71A 2GR9A 3OFSA 3G02A 2IW1A 1DARA 1FX0B 5H81A 2O7SA 4BWFB 4C2UA 3OOYA 1K8QA 1XC7A 1VMEA 2BGWA 5KYYA 2XZOA 1A04A 4K46A 5IEJA 4M0UA 5M04A 2CLLB 2J9FA 3G1WA 1T5OA 4PO9A 5EPUA 2FQYA 2ILTA 1DBQA 1EBUA 4IIGA 4YRPA 1RPNA 2DERA 2PZGA 4ENRA 1R9JA 2J46A 1IZYA 1E6WA 1GQFA 1M6NA 4O4IA 2NO4A 3K96A 3A3YA 4E1VA 4WOJA 4CLOA 5LQDA 1DKMA 1O95C 1RAAA 3WLPA 5MGNA 3UMMA 4PYOA 3U3MA 3IUPA 3H4MA 3KJFA 1T6BY 4UW9A 5DCWA 3ZZNA 2IEIA 4J43A 2JLZA 1XHFA 4ZGBA 2AE1A 2XXBA 3NTOA 4KYIB 2XADA 2GBGA 3C16C 2YNMC 4RFSA 5FUQA 5DMHA 1U28C 5BOSB 2IGTA 2ACKA 2IUFA 4JP8A 1B76A 5AH0A 4B8WA 4NDAA 5ADVA 5JQGA 1V6CA 2H5JA 1TVCA 1XQVA 4LYJA 5EKTA 5IM5A 4M36A 4E5DA 3B70A 2CNLA 1Y98A 4J0FA 1Y7LA 1OC2A 4O4JA 4Y9DA 4YECA 2WTMA 3NEYA 4MNTA 1XJ5A 3BFPA 4RK5A 3PLNA 2D1YA 1RVV1 4DBLE 4OJKA 2NPIA 4G5GA 2WBLC 2QZSA 3TQSA 1HEIA 4EYSA 1E9CA 2P8SA 1IQPA 2H5EA 3D8TA 3HFGA 2W4MA 1XMIA 5TPZA 2AEJA 1OFVA 3N58A 4QGHA 3HPQA 4AJPA 2IS6A 1PTJA 1UC9A 1BIFA 5GZ1A 4ZDKA 1YBMA 2WF8A 4QNNA 1NUUA 3SEZA 1UL1X 4Z7QB 2XMZA 3WXMA 2QGNA 4PR0A 4IVPA 1OXXK 3UPDA 5K6AA 2Z3VA 2AOUA 3DH0A 3LHKA 4RVSA 1KKLA 1Q12A 5JR3A 3FIJA 2GERA 2ZDGA 4N9WA 2HFJA 1FVXA 3CKKA 3C97A 4WECA 3QE2A 5BR8B 4ZVLA 2VIIA 2XV1A 3GU3A 2DFDA 1QS0A 4CEIA 5E9JA 1KDOA 2XXJA 2DE0X 5DDIP 4LE2A 3ZLTA 5LUAA 3OX1A 3HKEA 1CHDA 2Q0XA 3NHMA 3AB7A 4I2NA 1JFFB 2ZVJA 4XRRA 4C0HA 4QASA 5E3JA 4MWCA 3HUDA 3EF1A 1IH8A 3PK0A 4L0QA 4LSZA 1EK0A 1GPYA 3K16A 3VI4B 3GNSA 1G9SA 1USGA 2X23A 4A73A 2DH5A 3D6TB 4RK1A 1R6UA 3L7LA 4RZIA 2QTNA 3JX9A 1J49A 1GGFA 1L1RA 2Z56A 2ZB3A 4U00A 4KDFA 3MEQA 1E2QA 8ABPA 3NQ41 5I6DA 3SQLA 3EISA 1YZFA 4FLEA 1ENPA 1J07A 1Z22A 2VZ0A 1ZR2A 3UAVA 1GTMA 5B5SA 4UDYX 2FMHA 3ZWKA 1AKNA 5JNUA 2PCLA 5AIBA 4MR8B 2Y1CA 5CURA 4F96A 5JH7F 1E0AA 4HQ6A 2HZBA 3AI2A 4EQ6B 2LIVA 4AI6A 1J2UA 1U1CA 2IOFK 1NF3A 2JIZD 4G85A 3WO0A 1R2QA 2HMVA 2J45A 4IEIA 3N2NA 4FFPA 3EIUA 4BX3A 4Q1VA 2RHHA 2KM1A 1ZMRA 3FAKA 2A30A 4HF7A 5KYWB 3WBFA 5C9ZA 3FTEA 3NDIA 2G76A 2H4HA 3B3AA 1FFWA 4CEHA 1AN9A 3WGGA 1JIKA 1OFUX 4AF8A 3AF6A 1JDNA 2IBSA 1X3SA 2BE9A 2P9BA 3A05A 5JMOA 3A31A 3U4QA 4RE5A 1CUSA 2B0CA 4TWJA 4KVFA 2KWIA 2IZ1A 3ZKWA 3TR0A 4D57A 4DE5A 5F7OA 2ZUVA 4CQLB 3AL3A 1SU6A 1W4CA 3BZBA 3OF5A 3PDJA 1W88A 1Z83A 3HDYA 4MV4A 2B99A 4PBRA 5K4HA 4J0CA 3DR3A 1USWA 4N0MA 3EXFB 1F60A 1K2VN 3KEQA 1KMHA 2XOKD 2R2GA 2WMDA 4R1NA 2A58A 1LWOA 1W4RA 4PCVA 1A5BB 4OMFG 4W7SA 3QG1A 2HR1A 2J3EA 2I87A 1K8ZB 3T5BA 2HLPA 3PGMA 2C8KA 1ZD3A 2VYCA 2IYSA 2YHBA 1XCGB 2J31A 5HF8A 4XVQA 4COKA 5I48A 1X14A 3EOZA 3V6LA 1OPXA 2FP4A 3O91A 3ZWNA 2H4WA 4R8KA 5FWDA 5J4VA 4FDUA 1J2RA 3AH8A 4ZO9A 5LIRA 2X2OA 3SXJA 3T52A 3IPCA 1P3Y1 5ALRA 2POQX 1F2DA 4HDNA 3UAOA 4DIMA 4QE3A 5HMLA 4ENQA 5I7EA 1YTLA 1UMBB 1L5NA 3E6AA 5B1HA 4G36A 1DKPA 2ODPA 4M6WA 1AURA 1JDUA 4QWMA 4BJ3A 3ZCXA 4ZYUA 2PS9A 5FPHA 3OTHA 2QN1A 5JAPA 4Q3LA 2VUUA 2Z6UA 1FLVA 1P2TA 4G5QA 1U2SA 4GICA 5ALNA 5EIXA 2W43A 1RC8A 1TA4A 2F9LA 3AETB 3PC3A 1L6IA 5JS8A 5L6LB 3AEXA 3B1FA 3QQPA 3BL5A 3MGGA 4YAGA 2I6TA 3CBGA 5LLDA 2I3ZA 2O8BA 1E1KA 2C1EA 1T13A 2CBXA 3ZY2A 1ZVVA 1LQUA 1RWKA 1L8LA 4BAZA 4URHA 5GQSA 4RS4A 4JWTA 4L0MA 2FSUA 1TIKA 2VJAA 3B9PA 4Y6PA 2YC4C 1EVQA 1IAQA 5A2QA 2F17A 2NV6A 4IIHA 4UHJA 1XJWA 2VDWB 1RT9A 2TRSB 1MEJA 3GLTA 1A96A 5K6TA 4CCAA 2OQ2A 1NP7A 3KB2A 3KQWA 2AJLI 3RUCA 5C1BA 5D84A 2WD7B 2VBGA 3H5WA 4GZ3A 1VI2A 4MQUA 3TLXA 5TT1A 4YCNA 1E7YA 2X0JA 5AK6A 4HUQA 3AI3A 4CTJA 5G41A 4NVRA 1OWLA 1FU8A 4ESEA 4JLJA 2Q5LA 3HVIA 3NHBA 1Y9ZA 4GM0A 3EEOA 4BP1A 5A04A 3W2IA 3NS7A 1CIJA 3WX0A 1H1TA 4F4UA 2ZTUA 3DKVA 2WJZB 2B1GA 1ID1A 3FNFA 4OGFA 3EY9A 4ZCSA 4AMYA 4BC0A 4GI7A 5KJFA 4OV6B 1AXGA 1Y3FE 2Q5JA 3K5WA 4FIDA 3JQAA 3M7IA 1VECA 1WY5A 2IP1A 1GG2A 1B41A 3FZQA 5AK5A 2CLEB 3WI7A 4FZJA 4C6RA 3H86A 5HNKA 4UMDA 4HWGA 5JQWA 5IRCD 1W2GA 5JBIA 1EWVA 2GPNA 1K0UA 1U3VA 4V1CI 1GPMA 2L0XA 4LJSA 1L5GB 4PC1A 2WAXA 4O63O 5H1YA 1KJYA 3M49A 4MUAA 1QO0A 1XJQA 5DX0A 1WF3A 5ELXA 3WGJA 1N2GA 4LJ7A 4G8BA 2O4UX 4GPD1 1A0OA 4LZAA 2F59A 4MP6A 3K5IA 4RGQA 1GFSA 1YS9A 3ELBA 4JD5A 5K3CA 4BZXA 5REQA 1ZU4A 3BFVA 2VWHA 1P9RA 2FY8A 2CL7X 3EVAA 3JSXA 3KK0A 3OCCA 2RBKA 5JSZB 3IVMA 3HA5A 3IIJA 3U1VA 1T15A 4NENB 1O4WA 2APJA 4Q3KA 4UNRA 1PJ8A 4GI5A 4NC9A 1CRPA 3FUTA 3K8QA 2CXRA 2R1ZA 3K9QO 3QOXA 5G4KB 2B4RO 1QE0A 2GJ8A 4KR6A 2NUTA 2J5XA 2Q07A 3KOYA 2B3DA 4AJ4A 2VRNA 3OU2A 4NSNA 4DIOA 2ESRA 4L5CA 3P32A 1VJ1A 3BTSA 4R31A 2EKDA 1NVXQ 4IYJA 3RWOA 2V7VA 5DP1A 3ZQ6A 2FPPB 4D8XA 1I9CA 2Q5CA 2IUEA 2JI6A 2UZ0A 4OM8A 4UE2A 4ZJYA 1FX0A 5BVHA 3T3NA 3EQ8A 5CBKA 4YJHB 3JAWB 1R3UA 3ZD9A 4DB2A 3BE5A 3QF4B 4R83A 5ICFA 1QIDA 1Z4OA 4S1VA 3ZBUA 3QSGA 1SOMA 4H0FA 3FJOA 3RYIB 1P81A 4R2MA 1P91A 3CNLA 3UGTA 2FPGB 3WGOA 1V2GA 4GOXA 2ZT8A 2QTVB 4FSDA 2JGMA 2OHJA 5IAEA 3FDIA 1QM5A 4FJ0A 3L43A 1U2GA 4DWOA 1BXRB 2D0DA 4KRYA 2XF8A 4H08A 3OMLA 5GGYA 1J9ZA 2CJWB 1U7WA 2NPOA 2Y76A 3IUYA 3ST7A 5BRJA 1A4UA 1XB2A 2A9KA 3RVKA 1DC5A 2D2IA 1PSZA 4LV8B 1AO3A 2DPMA 2OKGA 5DEIA 1XZFA 4R6XA 5G0SA 1FS4A 2RK6A 2PJDA 2HL6A 1KE2A 4LNUB 3BJEA 3RQSA 4WK4B 3WJ2A 4ARSA 4BNZA 1VB3A 1XNJA 2OZLA 3LLUA 4MYRA 5JZVA 5TPWB 5FLXA 4J0GA 4WZBA 4Q34A 3T1NA 2VVTA 2R8ZA 1X7DA 1MQAA 3QRWA 4TV9F 3UNXA 4DVJA 4IHKA 1XMPA 3H8WA 1SCUA 2M1ZA 4L16A 1SVUA 2FW9A 3HCFA 2P4QA 4FP9A 4TL7A 2CZGA 4DV0B 1E1DA 1OJ7A 3AXTA 4URWR 4UTVA 2JAPA 3ICPA 2PX2A 5TXGA 2H1WA 3BWMA 3KE9A 4JUBA 1REQA 1ESDA 1PJCA 4WSOA 2HK9A 3H1AA 3N7AA 2IEBA 3PFHA 4J1QA 4O3FA 2AI1A 2RHGB 4BQRA 1XQYA 1FNBA 4QBGB 3ZZ1A 3LHDA 1H1DA 1PVOA 3G2LA 3WQRA 2IDKA 3BD8A 3KT6A 1KOFA 4Z9FA 1T1EA 4X1YA 1PT6A 4R3NA 1V0JA 2XB6A 4JEIA 1V3VA 2XXAA 4A82A 1ONNA 4OHXA 3UYKA 5KQSA 1GSAA 2IPNA 1W4BA 4XYBA 721PA 3F8WA 1ZH2A 3TVYA 1JBEA 3MCAA 4TV8B 3ICCA 1R9MA 2BEWB 2X8JA 3FVRA 4FMCF 1ZONA 2UZIR 1OLXA 2JFPA 4GKAA 3TRKA 2X76A 4BNYA 4I1YA 2BHNA 1ISFA 3VKVA 2VYNA 4NE2A 2DY1A 1KI2A 2F7SA 3TTUA 3FWNA 5HGJA 1R4NB 2IDZA 3OKPA 1RPTA 8LDHA 2PU5A 3T1TA 3U4AA 2IODA 2C2OA 3O8CA 4CNBA 2VYVD 2HN9A 1WHTB 3M1AA 4DLNA 4HAXA 3B6IA 1YZKA 4BVLA 5HRAA 2B4YA 4GOLD 2W4IA 3DLAA 3H11A 3N3AC 2J0EA 4HLNA 1WAMA 3HN6A 4O0LA 4XD2A 4YR9A 3W9SA 2BISA 5BV2P 1CC1S 4J1TA 4GDFA 3OOHA 1Y9EA 2G08A 1QV9A 3JVEA 1L0BA 4P4TA 4PSAA 4DGSA 3F3KA 1C30A 2QN7A 4FMDB 3ADCA 2QG4A 4J1TC 1HDGO 4TTAA 2YOFA 3FBTA 1VL1A 3B13B 5FIUA 3BSYA 1EVKA 3I39X 1I7DA 3WLOA 2CJWA 5JECA 3W9YA 3CRVA 2ZXUA 1LSJA 2W0SA 4U5QA 5LYYA 3KSUA 2OL4A 2QQ5A 3O3MB 3LLVA 3HXTA 4RZ2A 3N87A 1T8RA 1JHAA 1I7PA 2V4ZA 4JBXA 1MW9X 4XJSA 3RG2A 1L1EA 4D99A 1OA1A 5CD1A 1D07A 3WRYC 4MARA 2BZ0A 2YINC 4FFOA 1ZOSA 5AK4A 4YJFA 3JQGB 2VUTA 3VHQA 2BSQA 2GD1O 5I47A 4GLFA 5JI3E 1ISPA 1US8A 3UEOA 1B0PA 2VXYA 4QARA 3H7AA 3QYAA 4MWTA 1KVTA 5THKA 3CRMA 4QGAA 3AESA 1M83A 2A5GA 2ANCA 4HNHA 5ER6A 1LLFA 1VIYA 3CLTC 2FZLA 3AYZB 2IV7A 5BNWA 4BU1A 1UFRA 3TL2A 4G0ZA 3E03A 3ZWYA 1MVOA 4H1TA 1BKDR 4LYGA 2A0YA 2UUOA 1AV7A 4W7IA 4Z0HO 4PSUA 1P9LA 3W05A 4AL4A 5IJZA 3TTSA 1QGZA 3QTLA 1S96A 2NSLA 2C92A 4OYYA 3SQDA 1AHPA 2BMDA 5JSZA 1MZVA 1N5KA 3IBFA 4N0DA 1R6DA 2BEKA 2YZMA 1JBKA 3F1KA 2HTEA 1DQRA 1PR5A 2QR5A 3L84A 2KMLA 1QDLB 3IBTA 4EKGA 1XPOA 2OGWA 3CX3A 3MGKA 3KJZA 4FX2A 4E5VA 2HMTA 2NUPB 4YYZA 4UVIA 3PXBA 3LT2A 1IE3A 4R1LA 4DIEA 2JGJA 1RWVA 4UUBA 4W99A 3AL0C 2Z2JA 2XQKA 5K2MA 3M3DA 4HNVA 3ZE2B 4E09A 5ALPA 4WA8A 5FCDA 3GP8A 2WHQA 1YA8A 4YJKA 3CBQA 2P5YA 1PK9A 1ZD9A 5C8XA 2D2VA 1EK1A 2P3LA 1YMUA 4IBOA 4N6GA 5IYZB 4EVIA 4UZEA 5F1YA 3AGPA 1PJ2A 1U0HC 1WABA 3ZJ4A 1RZRA 2WJ4A 3EXAA 3S40A 1CUIA 1W6RA 2HYIC 3OU6A 4GG1A 3FYHA 4CKEB 2EZ8A 5EWJB 1UWLA 1VE9A 2Q2NA 3GJYA 4CKWA 1PL0A 3NW9A 3D6JA 4EHKA 2UV8A 1T3SA 1KU0A 2UU9B 4LOAA 1KA9H 4BFZA 2H2IA 4FC7A 3IAFA 2Q2VA 1N2SA 4B46A 5KHLB 4DIFA 3KVVA 2J9ZB 1V7QA 1XLWA 2ZETA 3RGWS 5HKAA 4WKPA 4MA5A 5EWLA 3OE1A 4O1MA 3W5DA 1X7ZA 4FS3A 3JALA 1JQ5A 1FDWA 1UOQA 1KGDA 3L0DA 1FP6A 1KFBB 3EEYA 3NT4A 2JDIA 4X8MA 2RKWA 2WHPB 4AVYA 1LCIA 1BRMA 2GN4A 1WW2A 1GYRA 3KVOA 4TS4A 1BHJA 1IXZA 3TEMA 1UXGA 1EHIA 2VJYA 5DSZA 4DG9A 4Y30A 3RUPA 3H0CA 4K7JA 3VR2A 3O4FA 2OFXA 3PUIA 4P08A 1N2XA 4ZHSA 4NYMR 5JAIA 1EFTA 1EWYA 2B20A 4YCCA 4PIPA 1FSSA 3FCOA 4I6GA 4O0MA 1Z06A 1T2DA 3NH6A 4GF5A 2RARA 5DHAA 5E38A 3H8VA 2E0IA 1OFHA 1UC4B 4IRXA 2LE0A 4JI5B 3MJHA 1G7CA 1ATZA 1TMGE 4YV2A 5CB4F 1U9IC 3CRRA 2OHIA 5A4AA 2A4MA 2JIMA 3CEPB 2R5WA 3OOWA 3QFFA 5LCXA 5K0TA 3TW0A 4EB0A 4R2IA 2XE8A 3V97A 3U60B 3KTFA 2ZCVA 4ZMBA 3BWYA 3KQUA 2VTBA 3EC2A 1B16A 3KOZA 4XB1A 5L3ZA 3Q3GE 3CLHA 3P9QA 4QGGA 4OK3A 1Z07A 1WCYA 3F46A 4EELA 4BPRA 5CMLA 4ETIA 5EHGA 4DUPA 3CM0A 3LA6A 2MDTA 1VLMA 3H84A 5KOJA 3DDUA 4E70A 3OZWA 4UBLA 1E9EA 4MYTA 5C18A 4K6HA 3WKCA 2IXGA 4O4IF 2UXBB 1RHMA 3H4TA 1CJSA 2O1WA 2GZ1A 3A9CA 1G6KA 5C3UA 4D9GA 4Y2XA 2UYCA 1GSOA 4CM3A 1EXWA 2Q3BA 3HB0A 2C4TA 1AO0A 4OJYA 1FFYA 1VJCA 2HBQA 4AKIA 1P0PA 2VRBA 3DMHA 1DAIA 2PBFA 3WRXC 3ZE1B 4PRYA 4YJHA 1T0HB 4OMUA 2P1ZA 4ZIRA 3U6BA 4BLRA 3PS9A 4L5BA 3L0ZA 4EABA 1E18A 2NTNA 2VAMA 1ESNA 4WT7A 3JARB 4FKMA 1EX1A 1PD1A 4PW0A 5GONB 2IYOA 3WWOA 4AF6A 1FFBA 1PJQA 2PQMA 1JQEA 1JFRA 4JUDX 4GE0A 1NQVA 4Y2SA 1UBNA 1T6NA 4XAQA 1SQ0A 2PUJA 1WXIA 2FH5B 4OQQA 4EG4A 3NWJA 4D26A 4P54A 2ZE5A 5JYCA 5KWJA 2IY7A 3BCUA 3PNKA 1U63A 2D1QA 5IG2A 2XVYA 3VTKA 2IE8A 1U2TA 1YI1A 4ZEMA 1CJTC 3L49A 4GR9A 5AHOA 5GOTA 3S8EA 2C2HA 4J3FA 4E14A 1NN0A 3IT2A 2RKBA 4HPJB 1RJFA 1XYYA 3S4YA 1TGYA 1RHJA 2O6HA 1CJKC 4ARUA 2ZIXA 1EWKA 3LNTA 5C8YA 4F04A 4S2EA 3E9YA 4KAXA 2HREA 4MV6A 5I7WA 4RVGA 1HETA 2DUUA 3SE0A 3TSWA 5KAMA 2HW8A 1E9DA 1FE8A 2C2YA 3R3VA 4EPXA 1T2EA 4X7RA 3NJ8A 3AKYA 1Y34E 2JRCA 3IELA 5ALYA 5T6BA 1B2LA 3HVUA 1XTSA 1HC7A 2V5UA 5TGTA 3TEJA 1OTHA 2O0MA 4IOJA 2ZJ8A 3FFWA 1C1XA 3CW9A 5CPBA 3X1KA 1BVYF 4AJLA 4CPDA 3JD1A 5KWEA 2BN4A 1XWFA 3DPIA 3JYPA 3QY0A 4ONEA 3Q6MA 1PUXA 3NDBB 2EKLA 2BFAA 4FM9A 4U3JA 3NX4A 4NNPA 4FD2A 4JXKA 4JI4B 1N2EA 5K8IA 4BUZA 2C9OA 4IMPA 3RYCB 4DPKA 1OILA 3OTIA 4O4HF 1SFRA 1QB8A 1P2BA 3MVEA 4KG7A 5FHQA 2G5PA 3UW1A 3WV5A 2QNRA 3CH4B 2C4VA 4J3NA 2ONZA 4OHKA 4B3BA 1FVOA 4EHIA 4JI8B 5MFZA 5F1OA 1J00A 4D42A 1VBFA 4QHSA 3Q5EA 3I61A 1FQKA 4S3MA 2VDWA 2W11A 2RB5A 1GRQA 3GJ3A 3JZAA 3PR1A 2WWRA 1SHZA 2K4MA 4YQYA 5KYUA 1GAQA 2FF5A 4D4GA 2JLCA 2YJTD 4ROTA 1I3LA 2PWYA 1NU6A 2LRHA 1RI4A 1D4FA 2NUBA 2W2KB 4IUDS 4UAUA 4PCUA 10MHA 1GPAA 1GFZA 3W7BA 5IUNC 2EJVA 3LNCA 2VWGA 5FA5A 1ECBA 1BU5A 3HSSA 3TSYA 2X8AA 1XZQA 3ICEA 1WDWB 1ES9A 3Q87B 2D2XA 4EY6A 1YS1X 2E49A 3BL6A 2WSSD 1ZNXA 2JC3A 2WZCA 5E6RA 1EAMA 5IANA 1NKSA 1UMBA 3VMMA 1IRIA 1CCWA 2WUEA 2YZGA 3QW2A 1JYEA 2R1VA 2HMWA 4WY2A 2ZRFA 4H59A 4M8LA 5FV7A 1A8UA 3DMFA 3G2QA 3GT7A 3QZUA 3FJYA 2Q0QA 4XJVA 4JI1B 4DIDA 3PR2B 5CEEA 3RADC 3CEMA 3R5FA 4F9FA 2A1IA 3FPEA 3K0FA 1SCUB 4MDHA 1W1WA 4PQFA 2EP7A 4ALLA 5HTOA 2C42A 3C6XA 3GLRA 3GT4A 1KZHA 5ALWA 4AZSA 4U2KA 2J3DA 1KK2A 4CQJA 2QUBA 1TCUA 3R44A 4TN5A 5K9ZA 3ER9A 4B7XA 4FFNA 1LLUA 4I08A 1AGXA 4K6CA 1E1QA 3VNQA 3QJGA 1WZUA 5SYNA 1L5KA 1ZA1A 5CCEA 4NQRA 5DFAA 2ZJBA 1TKRA 3CUYA 5EZYF 2DECA 3S70A 2NU7B 5IJWA 3WTCA 4YUXA 3H5AA 3ZGLA 2IS2A 5B7NA 2WABA 1GTJ1 3AHIA 4ZO8A 3AOEA 5DRTA 3O1HB 3DE3X 1OAAA 3KPJA 4ZP1A 3FZEA 3IHLA 4HDQB 1Z26A 4IL5A 2QTWB 4WZAA 1V3TA 2RK3A 3OQPA 5E2BA 3DVRX 4D1YA 1G3MA 3S1AB 1KJIA 4Q4JA 1JW9B 4QJBA 2O23A 3JPWA 4AFNA 2J4CA 3UAGA 2G1JA 5JXIA 2DBZA 1I36A 2BEVB 3GLQA 1F0KA 2VHEA 4WXMA 1EFLA 1TD1A 2P4HX 3UJ8A 3H3JA 3PUKA 4JKOA 4INOA 3M8KA 5KYWA 1DBPA 5I7OA 1NR7A 3P5SA 2QT1A 1TVEA 2CLDX 3B38A 4M9RA 1ZNYA 1UQRA 4UEWA 3A9SA 1ZVKA 3KKQA 1H0HA 4GWGA 4HO1X 2GS9A 2IQ5A 5AJYA 4LIPD 3DZCA 5EQFA 5FB3A 4JKIA 1U5CA 2W2QA 2ZJZA 2I1LA 4A6XA 3Q3IA 4DMFA 3PC8A 3PBKA 3S29A 4BMOB 3TAXA 2ZUBA 5FOSA 4Y6OA 4P5EA 5K8TA 5KYXA 3LV8A 4KOAA 1U90A 1WY7A 1N78A 4P4SA 4R1TA 4MH0R 2LD4A 2RHBA 2VDMB 3PKIA 3MWGA 3GEHA 1FZTA 3MQ4A 3U80A 4PY2A 5EHZA 3OLXA 2B30A 2IY9A 4KX5A 2HCBA 2WM3A 1VB5A 3OPQA 2R00C 1P1RA 4FVTA 4EHJA 3K4PA 5HE8A 4ZZ0A 5LJIA 2QRPA 3G5TA 3LKVA 1R0BA 3G9XA 4Q15A 5IKOA 2PT5A 2ZIEA 3KE8A 4WH0A 3DA8A 2R6ZA 3EYAA 4M3NA 4RXUA 1JQJC 3A4NA 2QM7A 4LY6A 2MYUA 4DY4A 2VA9A 1E6UA 2WAMA 2XQJA 4JJ4A 4F71A 4PC6A 3PDHA 3AY6A 4MQ6A 4MVCA 3OQBA 1T1JA 5CGQB 4B7UA 1ND6A 1XZNA 2OBBA 3K73O 4U63A 2WSMA 4WNCA 4XGQA 1NJGA 3VR4H 2XJ9A 4RTSA 2JGFA 3GJTA 5HZGA 3OICA 1RKUA 4NPHA 4I36A 2CDBA 1E5VA 2NO1A 3F6SA 3F5MA 2HU5A 3PFCA 4FKZA 4MYUA 2C88A 4PNZA 3WQSB 5I8PA 4Z86A 2EFCB 4D9MA 4L74A 4F3YA 4JFAA 5GV7A 5CA1F 5AVRA 4O6VA 2AXEA 1T8PA 4DR4B 1C8KA 1RQRA 2O8FB 1G1AA 1Z29A 4CEJA 2ZPTX 1WG8A 1EVEA 1C9EA 3DZIA 2QTBA 3IMKA 3ANMA 4L5IA 2H5LA 4LISA 4F4DA 4IH4A 1JJBA 5TRTA 3ITDA 3VKFA 2QJOA 3GNLA 4XVHA 5A4KA 2YVKA 3M6WA 2ZTSA 4MGHA 1DKLA 1R8XA 2GAJA 2YQZA 4FUQA 3EZXA 4K9PA 3HBNA 2GD2A 3ABZA 5D5PA 3DL4A 5T8KC 2AG0A 4NCKA 3H2HA 1WRBA 4YJ3A 1IN6A 2AG6A 3KQNA 1KJQA 4FGLA 4UNIA 4YCJA 2BJWA 2YV5A 4AJEA 1QIFA 2XOEA 5E2IA 5IAGA 1G8YA 4Q9DA 2Q9CA 2ZRDA 3BWCA 1BCRA 3WLKX 4AO6A 3X1ZA 2XZTA 4O08A 4EA7A 1FJXA 1M3SA 1Z3IX 5IM4F 5DHQA 1HFEL 2I76A 3JQ9C 5DM1A 3VPDA 1J99A 1I30A 5FADA 1KQNA 1ILWA 3BXFA 5DOZA 2JVJA 4YMLA 1M74A 1KIFA 1UPBA 2OZLB 3NIWA 2WIJA 4LV6A 3FKSD 3AKCA 4D3SA 1I10A 4P36A 4UBMA 2G9UA 1WQ1R 4BV9A 3RBAA 5AESA 4BBJA 1GTRA 5AYVA 4A0GA 4EB8A 3NC1C 4Z0NA 5IULC 3S7TA 1KZ6A 1RI5A 3DM5A 3HMQA 5BWNA 4P4SB 2IYFA 2JLSA 4MRSA 4LJ6A 5J4KA 2B36A 2PBRA 2C3YA 2E21A 1ABEA 5AI0A 3TIGA 3HB9A 3GQBA 4XWWA 2NXCA 3SYNA 3VH4A 2G9VA 2V7UA 4D8UA 3UM9A 1COWD 3H5RA 1PS0A 1J0XO 1DG9A 3OJ0A 4K5QA 1E1RA 2D7CA 2PX4A 5B36A 4PLFA 1JVSA 3KZ1E 3RYTC 1VJDA 4LOKA 4X20A 1N3IA 3WVNA 3IVXA 4TMVA 4F9EA 4PFQA 5GM1A 1JZTA 2HBYA 2L18A 1DVRA 1PTKA 2ENWA 3A28A 3TKLA 1Q0PA 4KQMA 1AB6A 3RU7A 2F43A 4DCJA 3QUQA 2KPOA 3VDMA 1MFPA 1VKZA 2JHFA 2B1RA 2Q0SA 3BGWA 4X7MA 3TGWA 3PGA1 4WCFA 2H4YA 4JT9A 3HJAA 5KX5F 4Z53A 2I6SA 5LOVA 4ZAZA 3A0UA 2J0SA 1E6EA 3RM3A 4L08A 3SZUA 1MQ9A 1MX1A 2PRSA 3OEED 2G88A 5EESA 1VL2A 3UBTA 1FNNA 3VXKA 4ECEA 4YV7A 1TL7C 4Z9AA 1F0YA 4IMIB 1XQWA 2ZTLA 1BE6A 4TKZA 3PI6A 3VZCA 5T64A 3C74A 2H1LA 5P21A 3WNVA 4TZ6A 4E22A 1Y7PA 1UK6A 4X7PA 1A9RA 2PM8A 2DHRA 4TLMB 5CK5A 3UWKA 3EPLA 1G2PA 3NBKA 1T6ZA 5AUOB 1R6TA 4C89A 1POWA 2CFSA 3PJFA 4EMBA 2QLBA 4NJOA 5AR1A 1CQZA 3OIFA 3RVBA 4TQ9A 4AMBA 2EQ5A 2V8BA 3F6YA 1R0ZA 1X7XB 3HCCA 1UBHS 3MJVA 2JFZA 3BWDD 4PCLA 4A2WA 5AVTA 4D9EA 1NLYA 5K45A 2HHCA 4DJAA 2AEEA 4HWTA 4KVAA 1CFZA 2AUMA 3OT4A 1USUA 4TXLA 5FBHA 2PKQP 2RGCA 5FUBA 4BFTA 5A2GA 1EM6A 4PQGA 3ND5A 4MGIR 3IR5A 3ZW7A 4YCLA 1T26A 5BQFA 3ZC3A 5EHXA 4ZVUA 1M0EA 3ZHOA 1SXIA 7YASA 3AJRA 5M34A 4B7AA 3YASA 1CEEA 2W2TA 4Q3AA 5EJ9A 4LAFA 5EIHA 4JT8A 1WQ3A 4NR0A 1JHQA 3ROZA 3HVRA 2VPTA 2AYZA 4LBWA 2IYUA 3A1VA 4G4SO 3OM1A 3DOCA 4MI1A 3GA0A 5I01A 4RTMA 3PRHA 1JEQA 3BFXA 5GZ3A 1W52X 2GBIA 5EYPA 3SJZA 5I4IA 2HXSA 3K4QA 2ODWA 1BHQ1 3IP6A 3O9VA 2VKTA 1YRAA 1GGKA 3HJUA 1S2IA 4LC9A 4UOQA 1SU8A 2G0AA 3L0IB 4Q05A 4N47A 1M8FA 4BX0A 4ODIA 3THYB 2ET6A 1QONA 2BEUB 4QPCA 3L0BA 2C54A 1J6UA 2D00A 4M9CA 3KR0A 5DB4A 1JP7A 3PWZA 5H3HA 3O83A 5CYOA 4DMCA 5I4CA 2PUVA 1ESZA 1XN1A 2QRGA 5CVCA 5LB2A 2Z4TA 3BXZA 2AQIA 3CH5A 4UE6A 1YC5A 3ZX4A 3QLUC 3IPYA 4TM7A 2NXEA 2ZTMA 5FOXA 2H8GA 2HUNA 2FCAA 3FGZA 2IYTA 3FDJA 1Z15A 3HB1A 3ISVA 3OC6A 4MKHA 5FBWB 3MINB 8AT1A 2J09A 1KWKA 3TFQA 3SXUB 2NN3C 1KKUA 3I34X 3O4HA 4U3JB 1F38A 4C0LA 2HMYB 3QNWA 1WS6A 4Z1MA 2PPLA 3DV2A 4NICA 1F6BA 4BO4A 1Q57A 3FA2A 4E33A 1MNAA 2G0TA 4RMIA 4X3CA 1OYOA 1UPXA 4HH1A 2A14A 2QN6A 3EHDA 5J5CA 2QU7A 3AEYA 3RO7A 2V1XA 3AIIA 4K9QA 5A3SA 1XYVA 2AN3A 3IA2A 1T36B 4HGYA 4IIBA 5J2TF 2ZBFA 4IUBS 1PWZA 4ZDJA 2WKWA 4WCFB 4ARVA 1ULSA 1HDZA 3TIXB 5EJ8A 2D0PB 2HF7A 4QX6A 4R41A 3WWZA 4DYHA 4ERNA 5DCLA 1E1YA 2MSWA 1EE9A 4I5FA 4PVCA 3PE3A 1NFRA 3P2IA 5KNDA 1JG7A 2C00A 2XMDA 3N0WA 2HSJA 2JJQA 3QMWA 1T5LA 1E60A 1Q0QA 1Y4SA 3D43A 4LHEA 5F3RA 4WFKA 3FF4A 4B82A 2QB5A 2VNIA 2PRKA 2VDRB 4IIJB 4TRMA 4X41A 2OO3A 1R64A 3A4YA 2EKBA 1BD3A 1E2IA 2QUIA 2WD8A 5AM1A 2VT3A 1H69A 3AKEA 5KBYA 4RKYA 2MSLA 1NJ5A 2DRIA 5MN6A 2XE4A 2V55B 4U02A 4TKMA 1U8XX 1URPA 1U7TA 1Q92A 3KUXA 4UDXX 4CM1A 2AXNA 3G8AA 4I5EA 3L4JA 1J5EB 2ZR8A 2IKQA 1B0UA 4NH0A 1IUNA 1W59A 1WNFA 1U3DA 5TSDA 1NLMA 2PD4A 4F4FA 3WP1B 4AMGA 2XZPA 2CVFA 3O93A 3PGLA 1K66A 1X42A 3THRA 3R0IA 3F7OA 4V0OA 4R7GA 4YRMA 4M1OA 3QIVA 3FLMA 1SUAA 1AZTA 2WNHA 3LUBA 3VUFA 4ALIA 1RFGE 5AW3A 1DELA 1PGQA 1R6VA 3BXPA 3EFOB 1RWWA 3CMCO 3IQEA 4PX3A 4BVEA 3HO6A 1J1IA 1Y5LA 4BXOA 3DAFA 4WN9A 4EW3A 4JC8A 2XH8A 2VQEB 4DQDA 1F3OA 2YY6A 3NHZA 1TZKA 3ZDCA 1DSSG 4IZ6A 5CIQA 4XWGA 1M66A 1T3GA 1NQXA 1QK4A 2VJCA 1U2RA 2W8BA 3WGVA 4TYNA 3VR6H 1WCIA 4ZCLA 4LMPA 4PU0A 4X1IB 2FSPA 3H18A 3OZIA 2FPLA 2P79A 4X91A 2FUG6 3V80A 2X5NA 4RHXA 4NK5A 4Q9KA 3WP0A 3V2GA 4E6EA 4F7DA 5JJ5A 3G5UA 1M6VB 3KJIA 3LA8A 2BMVA 1T0JB 3STHA 2R62A 4MQEB 1WUYA 2PYIA 1S5PA 4TQGA 1NJ1A 3NR2A 4TVOA 4YQZA 3T7CA 4BEWA 4YDRA 1J25A 5ITVA 3C6BA 2Y1WA 1PK8A 3UJ6A 2OZEA 1AMUA 4TLLB 4J1SA 2GAFA 3IQXA 4M83A 1SUPA 1B7GO 3GCGA 3MUFA 1DZIA 4HNGA 1U11A 2QOEA 3I5MA 4PVDA 2I2BA 5H4HA 3IL2A 3CISA 2PUDA 5LQUA 3ROFA 1GO2A 4TXNA 1P7YA 4YLGA 3SP1A 4F06A 3H2KA 1X6VA 3QVUA 4JL6A 3GRYA 3HBMA 1KMIY 4PGHA 4G9EA 3ZCVA 3V4PB 4I1IA 1YDMA 3QYPA 4KP7A 4NFLA 1X7GA 2FSVA 2YIVX 3D8UA 5HQTA 5JC8A 1QJCA 1QRUA 4Z7OB 4DYDA 3DP9A 3TGPA 2UXDB 1P1BA 1M6EX 2Z04A 2GSDA 4GH5A 1T10A 1FSPA 1J09A 1Z5ZA 2Q5QA 4R4JA 4R2JA 2IHKA 2I5PO 5AT1A 5KVQA 2LV8A 3V8NA 1KI6B 2QL7A 3UMGA 1YCDA 4XRGA 4MCIA 4L75A 4QUHA 5JEDA 5HK9A 2C4NA 2QAGC 2QY6A 4OHCA 4ZT5A 4QXOA 3TUIC 1XZHA 1O57A 1PYOA 4BZPA 5K2OA 3EFHA 3TVDA 3S6JA 3C7CB 2SKDA 3JRWA 1C8BA 3UQYS 4PLYA 3V32A 4P3NA 4I1SA 4LSWA 2DWOA 4OL0A 2AKAB 1EXMA 1NVVQ 4BDTA 1L9XA 1N34B 4K86A 4MVJI 2V3VA 3L8MA 1E3MA 3WLAA 3AUKA 3HVHA 2PMEA 1P39A 1U8AA 5FFFA 1YA4A 5AKXA 3VZBA 1UPUA 4BGEA 3QI2A 4XD7D 3HZOA 5DXJA 2VO1A 1KJZA 4BCDA 3II6X 2VZ9A 1EUDA 4PQYA 2XGGA 4F4IA 5A9TA 1U8TA 1PWEA 3C45A 3QJYA 4GL4A 1M0WA 4C87A 1X1DA 3KLOA 3B5JA 5EQTA 1JG4A 2F1RA 2J9FB 4JBLA 2QPTA 3QNUA 3HA7A 2YY7A 5DXAA 5J58A 4IMJB 3OQ1A 3KKMA 1QYRA 4UCFA 1DADA 4LDRA 1N5OX 2CW5A 1VLLA 3HJNA 2CDCA 1GTL1 4JJZA 1H2YA 4OXYA 3SS7X 3DXYA 2B6NA 4G1CA 1QRRA 5D6NA 1QK3A 2XMGA 1XVAA 1J2TA 2VBCA 4LOHA 4LW8A 4CQMA 4HX9A 2P8JA 1NQTA 2QSZA 3JQRA 1B3BA 1QPGA 2F1KA 4NQZA 4TTRA 5EUMA 4W6ZA 4D7AA 4EI8A 4PLVA 1O6ZA 5LLTA 3EAQA 2OAEA 5L53A 3BB3A 2VJKA 2CVHA 3EIHA 3L7IA 4AMUA 3X1MA 4X6YA 1FPQA 3ND9A 2ZSBA 2QS9A 4FONA 3LWDA 2ZJ0A 4HDSB 2JFHA 2DLCX 4RTNA 4QOGA 1MIOB 1MA3A 2HCTA 2V59A 3H5NA 3O0DA 5KNCH 1DBIA 4E2FA 5ERXA 3C6YA 3GT0A 5I3CA 2WWYA 1Z4LA 1EK5A 4BFCA 3UB4A 4WERA 3QXSA 1YL5A 5KI6A 1EFHA 4OCZA 1YBHA 3E9DA 5BN5B 1TLLA 3P0EA 1T3HA 3WK6A 3OH8A 5DWQA 3RVLA 3H9QA 3P27A 4PRLA 3VA7A 3P0RA 2IZ6A 2MOKA 3I2IA 3FVTA 3ENVA 4Z8YA 4N8SA 3DC2A 4BB9A 4M8IA 3AR9A 3K0SA 1NMXA 3W1WA 2D5AA 2PUHA 2IXBA 4J2OA 2OHOA 4OQLA 4UCQA 1TVMA 2WJ6A 4MPJA 4X45A 2QL9A 5IK2A 1F6DA 1N3YA 1SGWA 2EZTA 3CNHA 3GBPA 2QRUA 3ZBQA 5AWFC 2IS4A 3LUCA 3UATA 2DLNA 1S2GA 3EQ7A 1ZOLA 1QFMA 1P75A 1XEAA 3GCWA 4JLOA 3MCWA 4Q9HA 2A7XA 1X8XA 1RM5A 3PD0A 3SJ7A 3WWYA 3PQ6A 4AZ3A 5AVXA 4KXLA 3K9HA 1VLZA 5CLJA 3HC7A 1BN6A 3O2QB 2FZGA 5CFQA 5BRNA 4I8IA 1UBLS 3F5FA 1UKAA 4Q1BA 2VSOA 4FHCA 5FD8A 3CZ4A 1NYLA 3IQWA 2HRZA 4KO2S 2WIDA 3D4BA 1GNTA 3WKBA 2V0NA 4NATA 3ZH2A 2NU8B 2GNAA 1IEQA 3F6PA 4NG5A 5KKCA 3ZH9B 5KJ1A 1CB0A 3B82A 3TAUA 3RC7A 2BJVA 3F49S 5AHXA 1ZIDA 3GGCA 3GUVA 1JG6A 3JALB 5CM2Z 4P80A 2ZQYA 4U2GA 1W76A 5JWRA 3GOQA 4RJJA 3GY0A 3UFBA 4EI9A 4J94A 3A1FA 2QUAA 2WJIA 4G0PA 1OUMA 1G16A 5FKJA 5HQJA 3WHIA 3HI4A 3PNVA 4RSMA 5ANRB 4IDAA 4QHTA 3AEZA 4ERXA 1SY7A 2VPXA 2VT2A 3SM3A 3PUJA 5THXA 4MQEA 2OHVA 4CVNA 3THXA 2GJSA 4MB6A 3K2QA 4I4TF 4R54A 5F51A 4KC0A 4L8WB 3U13A 3S2FA 2P65A 1WU8A 3RT7A 3UENA 2H8KA 4QEZA 4QIHA 1W5TA 4K8RB 5BQPA 4YXFA 4B3RB 1RIFA 2R66A 3MILA 1SKMA 2AC7A 4IQ8A 5L4SA 4D79A 1QGUA 4XIFA 4P4UA 1DIAA 1TZJA 3W79A 1EI9A 3HSKA 3Q5GA 3UHAA 5LZ7A 2WPNA 3ZV7A 3CKMA 5IDXA 2Q3JA 3D31A 4WBXC 4JSRA 1Q0UA 4WZBB 1FBTA 5CB0A 1MABA 2ZGVA 3A1NA 1L5OA 2OBFA 3GJSA 3H2SA 4FILA 4DY6A 2BTOA 2J32A 4UUPA 2A9OA 3TD2A 1DFHA 2AFIE 2YYYA 4TROA 5HM8A 1KO4A 3F74A 4BTEA 1I7NA 2A0UA 1RJEA 4KI7A 1TFUA 3EIWA 4FYIA 4N5NA 5D2CA 1N6PA 3T6KA 2C4HA 1EUQA 4NESA 4NZPA 1JIIA 3TX2A 1HYHA 5DN6A 4ZKDA 3UXYA 1M7BA 1JECA 1W4ZA 3OZ7A 1LPAB 1MB0A 4B3XA 4F12A 1IXKA 2FEOA 4JHXA 1J33A 1GQRA 4IDQA 3UXEA 2NPFA 4B3GA 5A0TA 2N3ZA 1RBYA 4BASA 2RONA 2MT9A 1CUCA 2WUDA 3DDWA 3ZIUA 2VZLA 3OEHA 2VRCA 5D51S 3DOEA 4KHPB 1UKEA 1Z0UA 3MWKA 5E6SB 4F2GA 1DOZA 4FCCA 2GXSA 2PIAA 5JUWA 3BBPA 3DCYA 1M33A 2GM5A 1UPFA 4JQYA 1JDBB 1GRNA 1YDWA 6LDHA 1A2BA 1MU0A 4DLLA 4JLWA 1JHMA 4MR9A 4N7BA 3KTAA 4GMDA 1KO8A 1DTEA 1OVMA 4CIVA 2CMKA 2JGDA 3SJUA 2XHZA 3WDSA 1Q83A 3BIWA 3SF8A 5EJMA 4C5BA 2V4MA 3JQGA 2X2PA 3PC6A 2XZLA 2NZ2A 4EAAA 2CGEA 1C8LA 3FG9A 1SHJA 3L7JA 3AF3A 5CITA 1P4HA 3EJWA 4HYQA 2NP7A 2V5AA 2P6MA 3GLGE 5DHFA 3TNLA 1UDCA 1IK4A 2XHEA 4I3FA 4U2FA 2IUUA 3V48A 3WQHA 1IHPA 2HRBA 5LYJF 1W87A 3JQPA 1YQUA 4IXNA 2SHKA 2YUIA 1FY2A 2BKEA 3NV7A 4ZO6A 5BT9A 1TUBB 4HRYA 1OV6A 2NZ8A 1AKQA 4URXR 4DXHA 3RTGA 2A78A 4A8JC 1SHLA 2NQTA 2WFZA 3OQIB 2PX0A 1NBHA 2CB0A 2ZPUA 5IMBA 3EDCA 2WM9B 3S2SA 3QVVA 3SDSA 3WY9A 3BZUA 1OTXA 1SCBA 1LX7A 3NXSA 1BHO1 1E9SA 4MVJG 1UKYA 4PYKA 3U9TA 3W5IA 1LX6A 1T4CA 1EK6A 1FJ2A 1Z2AA 4MLPA 1DAPA 2NM0A 4P92A 5FBLB 1GNLA 5IFKA 5KU1A 2PUBA 5C4GB 1V1JA 5JZSA 3NGLA 2BUBA 1F4VA 4EGJA 4DXDA 3ESZA 5HJ7A 5FX2A 5K0EA 1W9HA 4JGIA 3FDXA 4IXDA 1YS4A 5ALKA 1KJNA 2ZEJA 4UD6A 2I2DA 3WAGA 1XN4A 1SIWA 1W0KD 4YQEA 4EH1A 1GOTA 1VA5A 2FG7C 3KV3O 3V00A 3CKLA 1Q0RA 1P9NA 3IXMA 5IBPA 4WESA 4XFJA 4V0NA 3FOEC 1SBHA 2FSHA 2RD2A 1XAHA 1QVVA 1HPLA 2GN9A 3D59A 3GIWA 4PAOA 4N18A 3RBZA 3V42A 5LQRA 2P2NA 5FNZA 4CQNA 1HE1C 3OHSX 1SRRA 1FJHA 3EYWA 1P2GA 2WMNB 4MCAA 5DWDA 2QN9A 4OJQA 2XAAA 2F8LA 4MWGA 3GFQA 3PDCA 3W0LB 3R5KA 2CYAA 1T9BA 2PAFA 2PWAA 4I55F 3H1FA 4YAIA 3DZGA 5BXYA 1KI1A 4HGRA 1R0KA 3FTQA 1HK7A 3NHPA 3DULA 4XPIB 2PZKA 3WISA 4D4HA 1ZXBA 2VNJA 1VE7A 1KZ9A 1FRNA 1I33A 1NJ8A 5ECYA 2R8RA 5FQOA 1GDTA 1GVNB 2VQ6A 2Y4OA 2XKAA 3DXXA 5AVOA 1WV1A 4JYZA 3GLUA 3WGKA 1YDFA 4DW8A 1O0BA 4ND8B 2NLOA 2ATIA 5FPPA 1ZKDA 2JDID 4A5OA 2PV0A 4FKBA 3QTTA 4O33A 4X1IA 4BE9A 3OKFA 1G2QA 3ZXSA 1QLJA 1Y33E 2A1TS 1MENA 3DBHB 4DSUA 4WKBA 3UMJA 3OX2A 3OPYA 5EUCA 1E62A 4XIYA 2PSEA 3ZHBA 4L5YA 3H8JA 5I7SA 5KSYA 2WA2A 1Y1LA 1AV6A 4OP1A 1ULUA 3P7MA 1ZNWA 3QVLA 2CXXA 2Q3FA 1EWQA 2AUTA 2YWFA 2UYYA 3GJ8A 4M6WB 1Y89A 1DB3A 2Y1XA 1B93A 4L4SA 2IXTA 4PZPA 1I1QB 5K0GA 2HD4A 3MWLA 4ADSG 5KSWB 3DKIA 4P9NA 5HG0A 4LYAA 2Z08A 2N75A 5AVKA 4B6QA 5IH3A 3DPSA 4X90A 5EE9A 1EEHA 1LEHA 1YCGA 2ZYWX 4MPRA 1CQJA 1KEVA 3A4IA 3U81A 2W6ZA 3IAS6 1I4TD 1RCUA 1HV8A 3NHAA 1MJGA 5CX1A 2XDWA 4M1KA 1MCZA 2I3DA 2NVUB 3T1QA 2O8NA 3IVAA 4I50B 4R40A 3HCBA 4Y7DA 4F3TA 3SKXA 2GILA 2IHJA 4IQFA 4CCYA 3EZYA 3SLRA 2HNBA 1WJGA 3GJ7A 1HE8B 4UJ5A 1S02A 2I4TA 3HJBA 3GGSA 4AF7A 4J16C 3FUWA 4B3HA 4G63A 5JCOC 3EODA 4X92A 2J8ZA 2ICAA 3KYDB 3G2IA 1H5NA 4FHZA 3C3BA 4DJJA 1OLUB 1CR6A 2D5LA 5CDHA 5CDSA 2BZGA 2NTEA 4B8YA 3ZJVA 1H93A 5A62A 4B0OA 3C7DB 4DR1B 2AXPA 3THWA 4MVJM 5LZ8A 1VGQA 5JG7A 3DF9A 2ZIFA 4FEAA 5B4UA 3LW8A 1DJPA 4IHAA 2I55A 3ZE9A 1C41A 1NDHA 1SCKA 4UTXA 1L4FA 1LQ2A 4KE6A 3Q41A 1CZRA 4G8DA 4KXNA 2PKWA 3MXTA 5ALUA 4B5KA 3B3QA 1KRWA 2O7VA 5K01A 3SHTA 1VC2A 2Y27A 3IMEA 4AMZA 1BQ4A 2Z2KA 7ABPA 3UJNA 1NVBA 3LW7A 2LNDA 2VJDA 2PUGA 3F98A 4OXXA 3G5MA 3RG8A 1RRFA 1TX4B 4N7MA 3WLRA 4U7HA 1MO2A 4Y2PA 4DLWA 1C9YA 3ZHVA 1Z35A 1WR8A 2ZRHA 3OJWA 1QZUA 4A27A 2MYTA 4V0QA 1WDKA 3DHWC 4PGGA 4UXJA 4QGFA 2ZSIA 2EKQA 3OLVA 4HNAA 2V96A 1MA0A 2C2MA 4PYLA 4LOIA 3GWZA 5FP0A 1JGTA 2Q5EA 3VYWA 5BN4A 1TA0A 2E89A 1VMDA 1UP7A 2CEKA 4JI0B 4RF3A 4HN9A 3I09A 3G7NA 5H5JA 2ZR7A 2UUCB 3R1IA 2EW2A 4F86A 1T2CA 4BZWA 1W25A 2ZM5A 1DRWA 3RR2A 3A1DA 3H65A 5C34B 4QJIA 1JEQB 3TLGB 3CHYA 3D6UA 3V1TC 4EECA 5D00A 3DEIA 5BN1A 1JXOA 3VHLB 4FYVA 3D6AA 2JFVA 3M1LA 2IITA 4DS3A 3KSRA 3QOFA 2P4EA 5EI5A 5E9AA 1IOZA 3H16A 4RCYA 1W5AA 2H07A 5JZBA 2HO5A 3IDQA 3COPA 4ZOEA 4I3HA 4N82A 1PV2A 1SC4A 5CNIA 5BSMA 2BDTA 5YASA 3LX8A 5IXSA 1BYIA 4RPCA 4M76B 5BUZA 1VBMA 1W0JD 4UUQA 4X61A 4IOMA 4NG4A 2QZJA 1T3LA 1L7PA 3K9FC 3DZFA 3DE4X 4X85A 3RIEA 1HDOA 1D6NA 2HF9A 1BJKA 4LJ4A 2IZ5A 3G2JA 4Y9RA 4X71A 2QN2A 5EJFA 3L04A 2ZROA 4Z7NB 5AD1A 2PL1A 3AETA 1Y1SA 4Q9NA 3ZHRA 4E2ZA 2Y1OA 1KOGA 3A3KA 2CWWA 4ZU6X 3SIPA 3M5DA 4IWXA 3UJAA 4ALKA 4PG5A 4CMEC 3HCOA 3DDSA 4NOLA 5L8VA 1XTIA 1YNSA 1H8EA 3A7DA 3KIPA 3LS2A 3ZE8A 2W00A 4LNUA 4CKEA 1VE6A 3GN2A 3JVIA 5JJCA 2P67A 3HDJA 4RFSB 3W2FA 5KZMB 1YUMA 4DIBA 3LUAA 1IN8A 2JASA 4JXXA 2P6OA 4CM8B 1L7EA 1P61B 1F6WA 4DC9A 3L0SA 3EDMA 4EJ0A 4NBNA 1UK7A 2A6PA 3GXOA 1I6LA 1DAMA 1ZFNA 2EG9A 1TEVA 4FOPA 3EBLA 1KZGB 1XOIA 5TEVA 2OXTA 2FVYA 2V7GA 4LX8A 3R75A 3WV4A 3W6NA 3BGOS 5KQPA 1WUHS 4CUZA 2FRDA 3DZHA 4DLAA 3GLGB 2ETVA 3NDRA 4CTMA 2R751 3A06A 4ZCIA 2QTCA 2C7BA 4NE7A 5HOQA 5FPSA 1G6OA 2D59A 2X6TA 1OBOA 1Y3HA 3AY3A 3CEHA 1KOJA 4FQ7A 5FEUA 3GH1A 2XDYA 2DFVA 2YMMA 3DGFC 2R6GA 4HS4A 4KLNA 4GLLA 1JPNA 1YZHA 4YTEA 2QI9C 2GFQA 1EFPB 2CLFB 2IEAA 1JXMA 1PFVA 3M5WA 3VKHA 2R6HA 3DKRA 2DFLA 4TVKA 4JBNA 4AWXA 1P1CA 2PKQO 3IDAA 1V7ZA 4H3HB 4INPA 4YAWA 3FZGA 5EZYA 3P2OA 3HS3A 3PNSA 5BSVA 2QM3A 1HX7A 4QQRA 4TTIA 3TYXA 3VX4A 5AUQA 5K4GA 1XVTA 2EJTA 3F4KA 1Z0ZA 2VCHA 3VNUA 3CRZA 1FLDA 3KFXA 2PS0A 5AFSA 3FMIA 1DINA 5EGSA 3ZWMA 2CDRA 4D0RA 4JJEA 1E64A 3N8DA 3NYRA 2EBHX 3MLBA 1H0SA 1LDBA 3MQ2A 4RMJA 1E0KA 1DBSA 5SZIA 1LB1B 2AF3C 3TRHA 2IHNA 4BIIA 2RIRA 1ECCA 2V1UA 1XAJA 2IFTA 3CUUA 1S3FA 1GTVA 4FGKA 4WMLA 4CN8A 1OHHA 4BKOA 2SCUB 3A26A 4HQOA 2OY0A 4D4KA 4D5GA 4X44A 2X6QA 2BFDA 2FCRA 4NMLA 1F1BA 4PAMA 4YASA 4DA9A 1KFKB 3EEBA 3WIUA 1C9DB 1ONPA 2F3UA 4H1WA 5BORA