1DJOA

Crystal structure of pseudomonas 7a glutaminase-asparaginase with the inhibitor donv covalently bound in the active site
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
330
structure length
330
Chain Sequence
KLANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMVAMTKTQDSKELQRIFWEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords GLUTAMINASE-ASPARAGINASE
publication title Reactions of Pseudomonas 7A glutaminase-asparaginase with diazo analogues of glutamine and asparagine result in unexpected covalent inhibitions and suggests an unusual catalytic triad Thr-Tyr-Glu.
pubmed doi rcsb
total genus 114
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.5.1.38: Glutamin-(asparagin-)ase.
pdb deposition date 1999-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1djoA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 1djoA01
5I48A 3PGA1 1JAZA 5F52A 4R8KA 5CBPB 4RA9B 1AGXA 4NJEB 4R8LA 5K4HA 2OCDA 2WLTA 2HLNA 3NTXA 1HFJA 1DJOA 5K45A 4RA6A 5DNCA 2HIMA 1HG0A 1ZCFA 5K3OA 1HFWA 2JK0A 5DNEA 1NNSA 3ECAA 1WSAA 1HO3A 5HW0A 2WT4A 4Q0MA 1O7JA 4ECAA 1HG1A 1WNFA 5I4BA 4RA6B 5CBPA 4RA9A 1IHDA 1HFKA 4NJEA 3NXKA 5K4GA 2GVNA 1DJPA 1JJAA 1JSLA 1ZQ1A 2P2NA 1WLSA 5DNDA 2P2DA 2D6FA 5I3ZA 1JSRA 4PGAA
chains in the Genus database with same CATH superfamily
1GSHA 1KY3A 3PVCA 4NMXB 1Q0HA 2JK1A 4MVJF 1FXSA 3BS4A 2VT7A 3AZOA 5K8VA 4R68A 1GDTA 3R6LA 4E5MA 1R6AA 3IS3A 5A5EA 5ICGA 4FEGA 4PPGA 1K2WA 4REQA 1H8HD 1R0XA 3OEHA 2JA2A 3EIHA 5M3BA 3P45A 4PZLA 3QUQA 2GZ2A 1WU7A 5ALSA 2D00A 2Z04A 3EEIA 3CH5A 4UOEA 1E2BA 3GP5A 1WXHA 4YP5A 2WTAA 4WAUA 2OCBA 4JQOA 1CHDA 3KELA 1T1RA 3JYOA 3FNBA 5LZ5A 3JQGB 4IHAA 3V7NA 4LFAB 5LQMA 2I6UA 3Q41A 5DNDA 1KDYA 2XGJA 4LS3A 3WYBA 3RFVA 1GD1O 2K7FA 2IWHA 1LTQA 3HBJA 3RRFA 3UK6A 4RTNA 1BZYA 3ZBUA 3L79A 3TLKA 2OFFA 1BDHA 2OD2A 1UMCA 4FWIB 2BI7A 3LIIA 3THYB 3DEHA 3WJAA 5JH7B 4EW3A 3IODA 2J4CA 3PUZA 1KDZA 4XARA 1TMGE 2DHCA 4XKJA 4BC0A 4L76A 2AMFA 3DYVA 1H9AA 2BC9A 2ORIA 2PL3A 3SZ3A 4Q4HB 3VYWA 2XNKA 1NR1A 2PN1A 5HK8A 1HDXA 4DTCA 3QVTA 3AHEA 1CR4A 3GGJA 3HBLA 1GAJA 1ULAA 4Q9AA 5A04A 3ABOB 3ESQA 3VOAA 4LRUA 1K5DA 2GBPA 2IGTA 2Q99A 3G13A 2JHGA 2HIAA 1V3QE 2I1LA 3OPXA 5P8WA 5TQJA 5DM1A 3P0HA 1IUNA 1NJ8A 3FGPA 4N7RA 3GUVA 4IXWA 4U7TB 4MOWA 1B26A 5IDQA 2OAEA 2KYRA 1LB1B 4PX9A 2V8OA 5DRYA 1N0HA 3HY6A 1T91A 2X7JA 3H1GA 2V55B 3VU1A 3EZ7A 4CVNA 5JMOA 2AXEA 1MVNA 1JLKA 1Q1EA 2WV7A 3HHPA 3HY4A 2ZS9A 3CX6A 1AU9A 2E82A 1TOAA 2HA2A 2PKXA 2IXBA 4GQAA 2VF4X 1BMDA 3LLUA 4N6GA 3FDFA 3Q8XB 2I1QA 4RESA 4Z9XA 4E5DA 1Y6QA 2GFQA 4D0NA 1UXKA 1NE2A 4G36A 5K0BA 1GKKA 4NHEA 4UBLA 2Y2UA 4Z86A 2HRQA 4EPTA 3DLHA 3V8PA 4NAUA 4AL4A 4HRAA 3EGDB 2Q8PA 1OWOA 1G5PA 4B4UA 4BNIA 2G8LA 4IV5A 1ECJA 3L18A 4M4SA 4QGFA 4X63A 4UHJA 4XGRA 4JMPA 3CX3A 5EIBD 5ARCA 2H08A 3K9WA 3OF3A 1COWA 1CUZA 1QX3A 4WX2B 4L5BA 3X1XA 4AZ3B 4DCSA 2XTJA 1QHIA 3GELA 1CUHA 2VDOB 3OE1A 1KAEA 2P30A 3R7FA 2ADOA 1SD5A 4ZQIA 4PC7A 1NPYA 2Q3LA 3WGJA 2XF8A 2F48A 3X2EA 2Z2JA 5A4IS 5LXTF 4AMVA 3SICE 2BKXA 1T8YA 5AUOB 4P1ZA 5FL3A 3LOPA 1M6NA 2P6MA 2GA9A 2ZATA 3DPUA 3DYIA 1MC4A 1YCFA 3N7UA 1XKQA 2JLSA 3PGJA 4NKRA 1L5NA 4ZZ0A 3KQPA 3PVZA 1J2JA 2PMFA 3FTPA 4WINA 3HZRA 1X9GA 4MLCA 3I9MA 4K0RA 5TGTA 3W5SA 5JD4A 1GZ7A 1Z5NA 1E4OA 5CIYA 1BDIA 1EUQA 3F9CA 1I6KA 3STWA 3D3EA 4LXIA 5KYTA 3TSYA 1Z4LA 2GJ9A 4K6KA 3SZGA 1KZ9A 1PSWA 2WHRA 2NADA 3C39A 1S8AA 1S2DA 1PW5A 2WIJA 2ZBDA 3FSJX 3P5SA 1J25A 1D0SA 3IAS6 4JJEA 5CLHA 4AYWA 5BVGA 4V1CB 1KGDA 1U5BA 3AYZB 4REMA 3WXBA 3SEZA 2IH2A 3UIEA 4P4GA 3M49A 2JAUA 4TSFD 1E7SA 2I2WA 1P9WA 1U8UA 3HQ4O 4ME6A 1XTTA 5LP6B 1GRNA 4M9XA 3UJ7A 2ZTSA 1DC4A 2QN1A 2PH7A 1ORVA 2IDJA 2OCIA 2WSLA 4N0MA 4P5PA 4P81A 5B64A 1MU0A 1T34A 2CLMB 2QVZX 4Q4LA 1V1RB 2Q5OA 2BZ1A 2I29A 2W2LD 4ERNA 2FWMX 4Z2AA 4WT7A 4XVUA 3HJAA 3D6HA 1J09A 3L9WA 1MAVA 3F2IA 1V39A 3I0NA 2PX4A 1GP2A 3LCMA 2ZJYA 4M83A 1V47A 1A5AB 2H3HA 1AS3A 4Z2YA 2H1HA 2OCYC 2RAVA 1F2TA 3IUJA 3O6VA 1FRQA 1MRSA 4J1TC 3VKFA 1IXRC 3GL9A 3BRSA 5LZ9A 3OZEA 4LDNA 3HYRA 5AQ1A 1AQYA 1I30A 4ZEWA 4HX2A 3PZBA 3A6EA 1ZN7A 3AKEA 5AJXA 1LK5A 5CIQA 2EBHX 4U5XA 4Q82A 3EEBA 4DDMA 4GKKB 1BJRE 3LGSA 1V8PA 1HLDA 4NBWA 3ZY5A 2GQ0A 4XFJA 3V8QA 4I6GA 1USGA 2IZ7A 4BLVA 1WULS 4G5SA 3PNQA 5H16A 3NGMA 3TXXA 1JQ3A 2HA3A 2HJHA 2WU3A 1T5TA 2YFKA 4YLYA 3E27A 4JJ4A 2MYPA 2PZBA 3B7PA 1Y82A 4L8GA 2IGBA 4GYWA 1Z5UA 5F4BA 1DRUA 5ED0A 3ZDEA 2LDXA 4R9SA 1KMIY 3A6LA 3LLVA 3N3BC 4TKMA 3RVDA 2X6QA 4EF4A 4J1TA 1AKYA 1VSUA 1PE0A 1T8UA 2R6CA 1L4GA 3R09A 4JOSA 4MCAA 4R6WA 5AMXA 4BB9A 3SGLA 5B3KA 4F2HA 2Z6UA 1GYPA 1IBMB 3A6PC 2JLWA 2Z98A 4BXOA 2AOUB 5HM8A 1WWKA 2ONYA 1P77A 4DABA 4J0JA 4IO0A 3OM8A 4KNYA 3B6KA 1E77A 4UD2A 2X5KO 1U2RA 3QVMA 2D3TA 1KAMA 1Q50A 2XVZA 4TL9A 2HRZA 1U8ZA 5AT1A 1E5XA 5J4KA 1WB9A 1L7NA 1U0OC 1U80A 2EAUA 4K2AA 3RS2A 2Q1WA 1W30A 3TTWA 4DJDC 1EK5A 1M7GA 2B1QA 3DG9A 2D1FA 4RVOA 4N12A 4WDRA 2GD1O 5AKHA 3VNAA 1YAHA 3MXOA 3E8MA 1Z25A 3RPEA 1RHKA 1SGWA 2RHLA 3I8OA 4OK5A 1C3OB 4YAEA 3WHLA 2F9FA 2VF5X 5L3RA 4YUVA 4F8YA 4Z4QA 5JNWA 4EH1A 1VQ1A 3QBEA 4FSHA 4IMRA 2QN3A 4IQFA 2HIMA 4XQEA 2O2GA 1RWXA 4O4JF 2VTDA 3ZHXA 3E3LA 3M6UA 3U0VA 3ZJTA 3AF3A 3CLHA 5INTA 1YL7A 1B43A 2XUIA 2IXEA 4PU0A 4UVEA 2IV3A 2YHBA 4NBUA 5HM6A 2CMHA 2Q5EA 2RGNC 1G0NA 3WBFA 4F56A 5BSGA 3TIFA 1RJ9A 1NQWA 2VDKB 3UA3A 1KEZA 3BXFA 4B84A 2YJNA 1U31A 5DU2A 3EGIA 4KXVA 4FVTA 1YRHA 2M6RA 1FDOA 2XRMA 3NH6A 4Y2SA 5DM0A 3SYRA 1OTXA 2BHSA 2HF7A 4ZICA 1MB2A 3TLYA 3A3PA 4M6WA 4G6ZA 4HEA1 3R6GA 4KNVA 1FMJA 1UP6A 4B8YA 5TLSA 3JALA 1PNQA 2ANCA 5FTMA 3RAEC 1C7RA 1YQQA 4LDQA 2O7VA 2RHBA 4RMJA 5E7MA 1FRNA 1T4CA 3UJBA 3C5CA 4RKWA 4OAQA 5KOHB 3HZZA 5DNUA 1WQ3A 4URUR 2RGNA 1DQNA 1LBTA 2M9MA 3PNVA 4KJXA 4NDZA 2OHXA 4HAIA 3IP1A 4B4DA 4WZZA 3Q7EA 2A9OA 4E5KA 3TRKA 3BRQA 1J23A 1BO6A 3THWB 2UXDB 1MQ9A 2NW6A 2WABA 3PFNA 4KH1A 3T95A 4G56A 3DZFA 4MEJA 1BG6A 3KQHA 5ALUA 2YVKA 1A8SA 1CW2B 3GQBB 4EB6B 2BOVA 3P8ZA 1DL5A 4HNAA 2A94A 3MPOA 4OYYA 4Q03A 4R2LA 5FOVA 3JAKB 5DTQA 1J99A 1TVCA 4MKFA 2X0DA 3N5KA 4CNBA 1L7QA 3C3PA 5DH9A 1G8SA 4BNGA 1ZCAA 2WM3A 2PH1A 1TJ5A 3USES 1MB3A 2DC1A 1U90A 4NY1A 1OHHA 4JJ7A 1UINA 1UWLA 2ZUVA 3TUJC 3K6RA 5J2TB 3U6BA 1FXUA 3C24A 4LV5B 4R1SA 3V4VB 3RVKA 4BCDA 2EX1A 3H9QA 2NM0A 1VRWA 4IZ6A 4D6XA 2VEOA 2PGNA 3U4DA 1JLLA 4RY0A 3FLBA 1T3SA 1JIUA 3LY5A 2ODNA 3OE4A 4FT2A 2ZM5A 4PQGA 6PFKA 5EVCA 2JLZA 1U02A 3LYUA 2L82A 7MDHA 3D02A 3C16C 2W2MA 5K7SA 1A4XA 3NX4A 4BTVA 1YIDA 1ZCFA 2EF1A 1TRHA 2R8EA 2ZANA 3BWDD 3NVMB 3S99A 3OU7A 3VR4D 4UHKA 3SBEA 1V6SA 5B53A 3O2JA 4OHRA 3UYLA 2ZRBA 2C1EA 2VWQA 5CTAA 4ZI7A 4BY9E 3LE8A 1XWFA 4NE7A 3LX5A 2AQHA 5AM5A 3TZCA 4AFNA 4DG5A 1SUCA 2WJIA 3ROTA 1EMDA 1WDMA 3GJ6A 1MAWA 1PJAA 1QG4A 3GZNB 2V5VA 1OYVA 3I9OA 4UMDA 5FT9A 4KQGA 3T5DA 1QHSA 3RC3A 5JZBA 5I7WA 1E9BA 2HWYA 5KVQA 1NUQA 1I4LD 5B7PA 5BMVA 2H7XA 3IHLA 4INZA 2Z1NA 3ZX4A 2ZRQA 3GLFB 3MWLA 1OZGA 1BGWA 1PJLA 2JARA 5JMWA 1GUYA 2OCPA 2WYUA 4IW3B 4JOCA 3R76A 3H6GA 1M2OB 3B1WA 2XUOA 1ST3A 1UP4A 1KAHA 5F7OA 1H4QA 2FPMA 1PJ2A 1H5UA 2CFIA 1XVIA 1ECCA 2K6GA 2ZRFA 3RVPA 1VTKA 1RFGE 1BX3A 2OVFA 2YW2A 3FETA 2WF8A 4NEHB 3SZMA 1VCOA 3TRJA 4ZEVA 5A4FS 3U4MA 2X5JO 3BFVA 1KZ1A 2G0AA 2B98A 2X9VA 3SR3A 1FLNA 4I9GA 1J2EA 1DBWA 2GCNA 4LOAA 2GXQA 1H2FA 1KO8A 1W5EA 1DEKA 1QFMA 4FFDA 4YUWA 4RTOA 1K68A 4KE9A 2XCTB 1SCNE 3CIFA 2D1QA 5JS2A 1RT9A 2A92A 3EXEA 3KX2A 1FUYB 2WD7B 4O8CA 1OC4A 5CT8A 4JLAA 4EGFA 4PZZA 4MWCA 4H9GA 7REQA 4UE6A 1WAMA 1KKUA 4KRGA 1GILA 3I83A 1TC1A 2O0KA 4WE3A 5FA5A 2Z6AA 1NF8A 1Y6ZA 1PEDA 2NZYA 3F1KA 1KFEB 4Y6OA 2P3OA 1P7ZA 2ONKA 5EQFA 5FWDA 5DNYB 1PFYA 2FN8A 3FNIA 4PLZA 3FTCA 3HU5A 1GQSA 2ATXA 3K30A 3QLUC 1RBZA 5HRUA 2HYIC 5EZYB 1C7ZA 2VH2A 5DBEX 1TJ3A 4MZXA 3O82A 3UANA 2ZRGA 4CTNA 4NI5A 2IHKA 2XWQA 3QXSA 2IKQA 3RODA 2WF7A 1O95D 2BGMA 2NXCA 3GFTA 3RTDA 2B92A 3CUTA 5AQEA 3QE9Y 4W9RA 3PDIA 4YV7A 3EUFA 2G5TA 2P91A 4R81A 2NTVA 5AW9A 2FZ4A 3QVKA 3RQIA 5KJ6A 4B81A 4F9GA 5BN4B 4HN9A 5F1YA 1DOZA 3IAM6 4H7PA 4D3FA 2VF7A 1ZMTA 3TI7A 2I2CA 3BXHA 4P4SB 2O0MA 3DT9A 3VZQA 4X3OA 5LLTA 1ZIPA 2WT8A 4HAUA 3TOXA 5FFNA 1YWGO 1I3CA 1PBNA 3JARA 4I9FA 5FRDA 3GHYA 3T8YA 4AJIA 4C0XA 2X8JA 3QLUA 1SUPA 1GRCA 2HK9A 1RM4A 4C6TA 1NY6A 1PR3A 5DI3B 3HNOA 3G1TA 1SUSA 1LTKA 1ZVKA 3L05A 3D6NB 2WM8A 3LX8A 4I5DA 1F3OA 1WUHS 2C5SA 5EUCA 5JXHA 3DNFA 3DYBA 1Q0UA 1TO6A 3H2JA 3MT9A 4CR7A 1XRSB 4UZEA 2V4UA 3O93A 4C88A 3CZRA 3GFQA 2CNOA 9GPBA 1QLHA 4ETWA 1ZD2P 1UBFA 2YJGA 2ZRCA 1JZQA 2WMDA 1RI1A 2WYVA 1G20B 1WU8A 4KUEA 2VNKA 4B6OA 4US2R 2BEWB 4JP8A 3DTYA 2GYUA 4CZ2A 4DJJA 4TUYB 2BHNA 1Z7WA 1A98A 4S1VA 3KO8A 4FYPA 3HXMA 2YJZA 1USIA 1N6HA 1WNTA 1G6Q1 2GD2A 3T5GA 1PJCA 4LBWA 4PRKA 3ANSA 4FONA 3P9ZA 4BUJA 3B48A 3D8NA 3X1ZA 3N7AA 2XHZA 1MNQA 1MR3F 1EUCB 1KR5A 2DUJA 2CHVA 3FGOA 4Y9TA 4JYBA 3RYTC 2RI1A 1M7HA 1KKMA 4CI0B 4CIAA 5JAUA 3NT5A 4DXHA 4GGMX 3K6JA 4YAWA 2OO7A 2GZMA 3KPWA 5JFGA 2OCDA 4JBXA 2HU2A 1NLUA 4DANA 5CFMA 3N05A 1P1KA 4EKGA 3C3CA 3RVLA 1RM5A 3T7IA 5IN4A 2VAMA 3OZBA 3EFBA 3Q11A 2QJRA 1D5WA 1VCHA 4L4YA 4WKPA 1M6HA 4ECAA 1YL5A 2RH5A 4Y0VA 2OZLB 2ICAA 2DFLA 2YASA 1NLMA 3G79A 3PE6A 2JGAA 1D9ZA 3AY7A 3QTBA 3BICA 4L5CA 3G23A 4F6RA 2BFBA 1TYCA 3OFKA 4BJ3A 4J43A 3TTXA 2C2OA 4L78A 2A0KA 1OXUA 2PZKA 1KJJA 2QL5A 2ZP1A 2FDRA 3OTWA 5LDGA 3I0MA 4G2NA 2GVZC 3H8JA 3UUGA 1CUXA 2AXNA 2V45A 3IBFA 4Z9YA 3V48A 4A82A 4ZCRA 3C7KA 4HNVA 3OX1A 3DXYA 3EQ2A 4BVLA 4AC9A 2SBTA 4PCVA 2JVIA 4W6ZA 2H07A 5J1SB 4U7WA 3LHFA 4I8DA 5HQ3A 2PZEA 3R0XA 3BMQA 3GJ8A 1BE8A 1KETA 1A9OA 1OF1A 1C9NA 2DQZA 3E1KA 1C4KA 4QD3A 2IIBA 4LGVA 2XVXA 5HFJA 4GI3A 1Z4JA 1Z75A 2PIAA 2VI5A 3FF1A 3OQIB 2G63A 4IJVA 1BHJA 2CYBA 2F43A 2HHCA 3IAUA 4NMHA 4RU1A 4NJMA 5EHXA 4LOLA 5AI0A 5AVWA 1Z6ZA 3GCDA 2XXJA 3LTEA 4WL0A 2EDAA 1KTIA 2UZ1A 5KNDA 1RI4A 1OREA 4MWOA 1NYRA 1BXKA 2XNSA 4XDHA 2C1ZA 2QJFA 2PSEA 1DO0A 2IYLD 1FFYA 3KZXA 2MSNA 3CT6A 1CJBA 4REOA 1DAOA 1IM5A 2IOHA 5AVVA 1MIOA 3B3AA 4MNTA 3HVHA 3C3JA 1YR1A 1O3YA 4JODA 4ZOLB 4A7PA 1E6MA 3QWIA 4RHEA 3P9YA 1UOEA 1Z83A 2REXB 5D8DA 1AN9A 2E9SA 4CM9A 1KYVA 2G06A 1WOYA 2OY0A 3HSYA 4OFWA 4U2FA 4LBYA 4WOCA 3SHOA 1R9GA 3HP1A 3ZW7A 4YRFA 1U3DA 3DD1A 1YZQA 2Q8QA 2CUZA 4D8WA 1QP0A 2BH2A 2VK8A 5EMHA 3CTMA 2I6XA 2CMGA 4RZHA 3REOA 4A26A 3RVRA 2NTEA 4PAQA 4QAQA 4Y2HA 3RABA 3PQ4A 3I9V1 3QOYA 3T3PB 3VKGA 2RKOA 1X1DA 3CYFA 3O38A 1KP3A 3VHRA 1GGNA 3E18A 1UXOA 1KERA 4H3HB 2AA3A 3ASUA 2I2BA 4DCGA 1KYZA 3BTUA 2H5EA 2XLBA 4OF4A 5TQ2A 1ZKMA 1PDVA 1L6IA 1F14A 1KR2A 3IRUA 2G80A 3H1TA 1VSTA 2FLWA 5EHZA 2IVZA 5AM4A 2OCAA 2I2DA 5KYUA 5L4SA 5HCUA 1HT0A 3ILVA 2ZRHA 2OPHA 3IIMA 1RWWA 3KUCA 2V3VA 2VRCA 1JPJA 1DRVA 3IOYA 4MGEA 1JEOA 4DMKA 2CLLB 4Z9AA 4RTKA 1RNLA 3WRWA 3P9QA 1CE8B 2Q9CA 1FVOA 4CR6A 2ZQ5A 4M21A 2BJHA 4S2UA 4TXJA 2OMEA 1TVKA 1Z37A 2ZIXB 2QD1A 2YX1A 3ED1A 1P6UA 2FMKA 5AWFC 5T4FA 3FYTA 4F0JA 2K4MA 2C9YA 2D5CA 2H6EA 3WKAA 2H18A 3QLVC 2O1XA 5EG5A 1H4SA 4M22A 1SVWA 3DP9A 3KLBA 4D79A 1ZMXA 2PV0A 3ABZA 1H9BA 4KQJA 4YTEA 3KQKA 3OFVA 2R11A 5FUBA 1RQNA 1UIMA 2DKOA 4M3NA 3N3AC 3ICOA 3EVBA 1SK9A 1OMOA 2CJFA 3IKVA 1Z5ZA 3ZK8A 5MF6A 2GPTA 4GPEA 4JA0A 4MGZR 1B14A 1XQ1A 1CS0B 1EFVB 3DNPA 1VPTA 3OF5A 1VBKA 4XLTA 4NABA 2ZYDA 3HUUA 1U7TA 2IDZA 1W5FA 3UAXA 2IHZA 4V39A 3GMSA 3AJAA 3ZWMA 4NX2A 4MSUA 2JFGA 3N76A 5IABA 4C14A 1UC5B 2OC9A 4DR2B 1SC3A 2VJMB 1A9ZA 2A5GA 4ZOAA 3INTA 4MPRA 3H2YA 1BCRB 2BEVB 3QF4A 4TV8A 1PF7E 2OR3A 5LD2C 1T6YA 3QLVA 4P4UA 3ZCPA 1JNXX 1Y1KE 1D1PA 4I4LA 4ZTZB 1R4MA 2WICA 5ICCA 2GXAA 2GYVA 3DDOA 5C1IA 2TMKA 3EFOA 4N3AA 5EP1A 1T2AA 5I3CA 1PQ4A 5DMXA 4NENA 1TO1E 1NQTA 1XQVA 4KR9A 5K8IA 3T5AA 4QJ4A 1SVOA 3S44A 3UJ3X 3BK7A 3L46A 1ETUA 5F73A 1NMSA 1NI4A 4DXDA 3JQ8A 4MJ3A 4WBNB 5HKKD 3QBTA 1DWQA 2Q5HA 4PLTA 1G8AA 3GG2A 4F60A 5JCXA 1HFJA 3MJEA 1XZLA 4Y2UA 3SQDA 2X15A 1DIOB 2CL7X 3GZJA 4K86A 1L5KA 4CEIA 1BDMA 4CHGA 1NVKA 5SZJA 3IO5A 3DUWA 3K20A 2B8EA 3OZCA 4EHLA 1GTSA 3OPYI 1SIWA 3I37X 4UNPA 4W1RA 3UKJA 1HMYA 5DBIA 2XCOA 4L4UA 5JANA 1BC5A 1OXTA 3D31A 4YCDA 2W8ZA 4KAJA 4A27A 4TYWA 5EP3A 1ZD1A 4NU6A 1T0BA 3A4YA 1JSLA 3LDHA 3SY8A 4BX8A 4IKPA 2BV3A 3G0IA 4D80A 1J70A 2QY9A 3MG9A 1VE6A 3U4HA 4AKEA 4XEUA 5ICEA 5AUNB 1X7HA 2IHJA 1C0KA 3W2HA 4Z3KA 1AB5A 4CIWA 1J7KA 2H2HA 2WSSA 3L7MA 1CP2A 4ZVPA 1PZNA 1XAHA 1JJIA 2FPXA 2Q27A 3JZFA 3N8HA 3JQGA 1L3BA 2PIDA 2DKNA 3DS8A 1DT3A 5BQOA 2Z6QA 5AW1A 3OWHA 3VISA 3KZCA 4C4AA 4YRQA 5KC9A 1EX6A 1HL7A 5J47A 1T10A 3JQQA 3VU9B 4POOA 4FFBB 4I1PA 1VHQA 1QVRA 1UDAA 3B70A 1NOJA 1XRPA 4BVHA 1C5KA 1V0JA 1FFBA 1JRLA 1RYEA 2J48A 4QOFA 3UQYS 3ELYA 3THYA 4WGFA 4QAJA 1NSFA 5JH7A 3DNMA 3L6OO 4TN5A 4N0DA 1O5IA 3O7MA 1Z47A 2F3UA 2EJBA 2HO4A 3A27A 3CUUA 3P20A 1WZUA 3PC6A 1V6AA 3K16A 4IRXA 2C94A 4J8PA 2C2XA 3BF8A 3IPXA 3OA2A 4Q4HA 5D3QA 1YS4A 1KWGA 1L4BA 5AKIA 1PK7A 1QOQB 2OXFA 4HB3A 3HJFA 2P3SA 4MVJI 2GN2A 4FZVA 2AN9A 4PYLA 2B8JA 2GBFA 3PCXA 4XRRA 2NZ8A 3QU9A 1E94E 3BERA 4G65A 4O29A 1JFLA 1Q7TA 2EG9A 2FPWA 3HFRA 4NFYA 4YRPA 3SXUB 2CMKA 4KV9A 4X84A 5DBHX 4R40A 1OI7A 4RKRA 1YZHA 4U6SA 3WICA 3ILSA 2R96A 5CDHA 1R15A 3C45A 2ET6A 2ZUBA 2FWBA 5BWOA 1O03A 4IHJB 3TXAA 4DG9A 1NNEA 5K5EA 4R31A 2HXSA 2O3RA 4NH0A 1ZXLA 5CP8A 2JCVA 3VU8A 1V3VA 3HCWA 1V5WA 2ONCA 4C29A 5CVDA 3JD3A 1KVQA 3KT0A 3L84A 1T2VA 2ZJ5A 4BOYA 1KQ3A 1FA9A 1Q57A 2YXLA 3ER8A 3IV9A 3ROGA 2E7ZA 2WKWA 5KNBD 5HS6A 3OCWA 1GFZA 2G08A 3UAWA 3KYBA 3T9DA 2QVXX 1GVHA 1SZPA 3K53A 3NWJA 3WHKA 4BVFA 2ATEA 3E5RA 3ORYA 4WLNA 4DQ0A 2PKWA 1XTRA 3E61A 5FA8A 3EGDA 1EQUA 4UBJA 4X54A 2C5AA 3FNGA 4HVLA 1JI3A 1CUGA 3ZY3A 2CJWB 4ICIA 2WQ7A 5JNLA 4TVKA 3KJXA 2AZTA 4AZ3A 4AN1A 2QUJA 3EJ6A 1PQYA 3ENZA 1EIZA 4XWKA 4PHHA 1JSZA 5K51A 1IULA 2QUBA 1JX6A 5K6AC 3KLMX 4R3UC 4AK9A 4R9NA 2QB5A 4BV8A 2ES4A 4XFKA 5LP6C 3MWDA 2XOEA 2K2QB 4PNZA 1HLPA 1OXBB 5T5QA 5FHRA 2RGEA 3K4PA 4EHBA 2CWDA 3Q2KA 3MQFA 5C8XA 1YJ5A 2ERCA 3G88A 3NG1A 3WRXC 4DUPA 4EHAA 2WOOA 4JOBA 1Y7LA 1XAJA 1FPMA 1KO4A 1IU9A 2PJRA 1U2ZA 4CLDA 1YT5A 5F3WB 4I4IA 3KV1A 4N01A 3A1TA 5EFOA 4EM6A 3ZEAA 1DLIA 1QUFA 5HBGA 3GGDA 5JS1A 3EODA 5CJPA 2VPPA 2DPLA 1IWPB 3D0QA 5IDWA 1ORDA 1E79D 1N0WA 3U1TA 1ISGA 4V1CA 5E9AA 4JV5B 3T0GA 5K6AA 3FYCA 5JARA 1WSDA 4NC9A 5AH0A 1GU0A 1VIMA 3S8MA 1QP7A 2OBBA 4OXIA 1U8AA 1CUCA 2P2CA 3OIUA 1H94A 5AJUA 3VR6H 5LP6A 3I61A 4R9RA 1U9IC 3SBDA 1EVJA 4RVDA 1G2OA 2QLNA 2LR0A 4F46A 1VJCA 1AS0A 1V1RA 2BW0A 2ZRAA 3OU6A 4GX1A 3VR6D 3WRXA 4KQ2A 1FDIA 2ID8A 4N3NA 4UNRA 1TK2A 2BL4A 1N8TA 3BREA 3NC4A 3LQ1A 5ILGA 4O0MA 3WMGA 3WGUA 2H00A 4BE9A 4S1NA 5UKDA 1HYGA 4HPJB 4ZQBA 4GKVA 4RIFA 4BX3A 2IYNA 4G81A 2V58A 2XMQA 2AJDA 2EKQA 3AY3A 4FZ5A 3L82B 3GEBA 4JBLA 2Z1DA 5F9HA 2Z5GA 1RYYA 4NYMQ 3EWIA 1T3TA 3PC2A 1ZH8A 2NQ2C 3L8YA 4AO7A 1LVUA 4MCIA 1O9HA 2PH3A 4MW9A 1U9IA 4GL4A 3DKKA 1VRVA 2WHXA 4TMYA 5CT9A 5EE0A 2SKEA 3WBBA 1E6EA 3FNRA 3WWCA 5J4YA 2BR3A 1W9MA 1XXHE 2W5UA 4MUIA 3MLAA 2EKBA 1K97A 1CLEA 2YYZA 4L8YA 4F4JA 2CHQA 3IOCA 4A5SA 5KSZA 5KZMB 2IUSA 1G8MA 3E8XA 4MV1A 5LQSA 4KN5A 5JSFA 5KDDA 3EPLA 2ZDGA 1P4JA 3JRXA 2IYZA 3SSNA 4YXWA 4KR2A 1FOEB 4RV4A 3BILA 3CLSC 1PT6A 1C8BA 1JKJB 2AYXA 3KWJA 3D64A 2CXRA 3GFFA 4OQFA 2AOUA 5DT2A 3IUQA 2ZCVA 1D0IA 2W2OA 4IILA 5DYIA 2FKNA 3REQB 3V80A 2A0YA 3G6WA 3IE2A 3I09A 2FAXA 3IFSA 1P72A 4YP1A 1QHFA 3A31A 5ERXA 5GJCA 5D01A 4AY3A 1SB9A 1XMVA 5IJAA 3LC2O 4E1BA 4UTRA 4Z7QB 3PUVA 3FHOA 4YVFA 5C37A 1O6GA 4JI0B 3QKTA 2O7RA 4RMHA 3H1AA 2DKFA 4UATA 4ZT2A 1RBYA 5I9BA 2B0JA 2P6PA 2C84A 3M6AA 3R8CA 4EYKA 1QYWA 3DDUA 4UU1A 1O97D 4RZ2A 1C3OA 3MGCA 4AY2A 1UBOS 4GRIA 1KU0A 1L8AA 2A14A 3PJGA 4BX2A 1M2EA 3H42B 4EY5A 5LWQA 1EXDA 1ISSA 1MFPA 4I1VA 1M1YE 4OQXA 3DR5A 4RLFA 4CT5A 4NECA 4HMQA 1OX6A 5HSGA 4KWIA 4L6IA 4N65A 3V6LA 3IC5A 4BKRA 3TE7A 3T99A 1MVLA 1FXWA 2OMKA 4OIFA 4ZHQF 1WY5A 1LH0A 3PX7A 2A0FA 3EYWA 4P2BA 1FSSA 1ZMBA 3MCUA 5FQNA 3RUHA 2CV2A 3UZUA 1FJXA 4I08A 4QXRA 1B8OA 1A1VA 2DETA 5AJTA 2VF8A 2KB0A 1EFRA 1P5FA 3AWIA 3AM3A 3GB9A 3TKLA 4QATA 3SDZA 3W78A 5B1EA 5ITWA 3I1YA 3L0YA 5AOAA 4O25A 2KBFA 2VH1A 1DAFA 5IP5A 4GM0A 1D2NA 5E4FA 1X1RA 1ZOSA 5CB8A 4RCZA 5IF9A 4DLUA 2VZ0A 3ZXXA 1YE3A 3IR7A 1C3LA 4CKBB 5HKAA 1X70A 2OECA 2QL9A 3PUXA 3ML1A 5KOHA 1ZJWA 4O6VA 3OQVA 1SVKA 2A67A 1XF9A 3FPKA 3KC2A 4PZEA 4BVKA 1DIHA 1AE1A 3O3OB 2JLRA 3U9SA 3OOWA 1BH2A 4FFWA 1CUIA 1ESCA 3KUXA 4GR4A 3THSA 1ABBA 3THWA 1TA9A 3OX2A 4NMWA 1MHTA 4DA0A 3E9MA 2R44A 1KYYA 2II6A 1NHWA 3GQBA 4FDVA 1N0VC 4EB6A 2E37A 1XCMA 3CVWA 1XTSA 2XB8A 2ZRPA 1EP3B 3V5NA 2NUTB 3JAKA 4ATNA 4JGBA 4BEBA 1X39A 2QTZA 3F6SA 4B9AA 2BVNA 2HDOA 2SECE 5ALIA 4QYWA 1AO0A 5I8WA 2BR4A 2GARA 3EVCA 2XQVA 3TVYA 3DV2A 1NI5A 1QFYA 2HJGA 5EA2A 5J2TA 1T9CA 1SWWA 4BCBA 2VYND 2ZBQA 1QRRA 5EEHA 2WWWA 1MRZA 1V8DA 2X0IA 1RQ7A 1SU4A 4HK4A 4QTXA 5A1JA 1N77A 4QICA 2YWBA 1KZGB 1UBCA 1IY0A 2OGZA 3A9VA 3BCSA 2NV2B 4HAXA 2XE8A 4YRAA 5JCJD 2W42A 2GMWA 2D5BA 5KQGA 2C04A 1ZOLA 3LKVA 1F6WA 4I50B 3FUXA 2C7RA 4YAOA 1QWSA 3A9SA 5EKDA 3KHTA 3T3EA 1AG9A 3LKDA 2NV6A 3MJDA 3BT7A 2FJ0A 4ZALA 3AYXB 4K1XA 1CERA 3A9TA 4JYMA 3OJEA 3BMXA 1XWIA 1I51A 4BU1A 1EDEA 1D0VA 3LT2A 4JC5A 4HPWA 2C78A 1DS6A 2B9VA 4MP8A 3WGTA 5J1TB 3GRFA 3BD9A 3QFHA 3TM5A 3Q3HA 3GZNA 5HR5A 4DEYA 1RXUA 4HAWA 1P1RA 2DQKA 2GEJA 2WF5A 2A4MA 4KO4S 1KIFA 2VPIA 2I1WA 1GIAA 5DNVA 1LBIA 1UADA 1XQ6A 5AM1A 4LFCB 3JRNA 1VLVA 3AF2A 4C5BA 1HDIA 2DUNA 3U1BA 3GLFA 2PUGA 4CV2A 3EGXB 4CCAA 1C4OA 4YB8A 2YIMA 5IBRA 2CN1A 4ZI2A 4JR0A 3AT1A 3FWZA 4E7PA 3NYIA 2HMVA 5D7NA 3C8HA 3PUYA 3EF0A 4YV0A 1W5AA 4H7KA 3RS5A 1XPRA 2BI4A 3QX8A 5CW2A 2ETXA 3H4IA 1ZR2A 2XUGA 1R18A 3WGHA 1WBJB 3NBAA 5K6RA 1B73A 2YOHA 3EVGA 5DM4A 1CY7A 1P0QA 5DSZA 4LJRA 3O8NA 1NL3A 3U7QB 1XMXA 2YTZA 4N41A 2EGUA 2VDLB 1U2TA 1F1BA 3QXJA 3CPSA 1Z45A 1E1RD 3MIZA 3N2NA 1RZRA 3FCOA 3AV3A 5EWMB 3EGEA 3DW1X 4W5NA 4V38A 2PUCA 2NQTA 3EB9A 2WD7A 3HRIA 2B4KA 2R4TA 4TMTA 4UVHA 4DQLA 4EHHA 2XPCA 2P41A 1B00A 4DSTA 1S1CA 2AJCA 1E4YA 1JU4A 1U9ZA 5CUQA 1E99A 1XCBA 5AK3A 2IHVA 4BO5A 1K1EA 3SG0A 4DIOA 3W8FA 2QQEA 2E89A 4EVQA 3M4YA 4RTSA 5BRAA 3EC1A 2FP4B 4FI3F 5D00A 4FNAA 1BJKA 4OQPA 5JQGB 4BWGA 3IUSA 5K0NA 1OI2A 2QY6A 3KSRA 3D1LA 3KT3A 4WKGA 5EPUA 4K8RB 5GP1A 3TBFA 2RGDA 4MZDA 1CG6A 2IPXA 1S1MA 1T6BY 1QO0D 4Y6SA 1N2CE 4XUCA 4YJFB 2BHLA 4JC8A 2EFYA 3UJCA 3FLAA 2QZ9A 2NVWA 4QDOA 2LNDA 2Z83A 4YP0A 5LPNA 1S8FA 3ABSB 1PL8A 2WUFA 1WXEA 3DF7A 3EVNA 1LK0A 1K8ZB 3WLEA 5BN4A 5JBQA 4TV9A 4KQ9A 1ZGZA 3RRMA 1EXWA 1FQOA 1Z6YA 3MPUA 4ZQEA 4MHOA 1JG3A 4P4SA 2GXSA 4U7PB 1II8B 2HBYA 4X6XA 1XRJA 1GPKA 1RWNA 3DOCA 1MJHA 2QLTA 3KB1A 4I99A 4IDBA 3KOYA 1PNRA 2QRMA 5CMLA 3BIOA 4HQ0A 1GTRA 3CR7A 1G18A 3RYFB 1W0JD 4EGCB 3O8DA 3CKKA 3HADA 3N0TA 3BWYA 4QUDA 4XASA 5DI3A 4HH4A 4UM7A 3GBPA 3SIPA 1Z4PX 3A3YA 1QS0B 1V8BA 3KOXA 2FF5A 4CFZA 1FMFA 3P0EA 3MQ2A 2QRGA 3VX3A 4G01B 2PTHA 2QSJA 2B25A 4L5YA 3WK4A 1RSZA 1QU3A 4K6CA 5AVQA 3IV6A 1NXXA 2E4UA 3I12A 4LWPA 4CEJB 5LB4A 2BDEA 4LKRA 3AIKA 2NPIA 1U3GA 1KQNA 1G20A 4YCLA 4TYPA 2BEWA 4FMDF 1XRQA 1M2KA 2B4AA 1S2GA 2I3ZA 4TUYA 2WIDA 3T06B 2DU8A 5LQJA 1K5GA 3PVSA 3QPWA 1GAQA 1Q1BA 3BGOS 1DJOA 5C32A 2FQWA 1ZO8A 4FU0A 4DR3B 2R87A 1KBZA 3ZU4A 4DZRA 5B6PA 3EDOA 4DQKA 4QUAA 3A1FA 4LJAA 3VQTA 2QYSA 3P2EA 3RH0A 1EUCA 4WFJA 1OH7A 1YO6A 2R5NA 3GP8A 2QRVB 1GGHA 5JU6A 4PY2A 3GD7A 2B3DA 4MW0A 4RJJA 1MNAA 1JHAA 3D5TA 1E5TA 2FEKA 1S7GA 3MB8A 1WUIS 4R3NA 2WTBA 3NVKI 3JD0A 2FUNB 4K9KA 2VNHA 4CR8A 3OMLA 4Q3LA 1Y37A 3C3BA 4ZXPA 5K03A 1D2EA 3HKCB 5FP0A 4QXMA 1I24A 1CUBA 3LDAA 3AKDA 1NBAA 4Q7LA 1Q14A 4QBGB 3VVCA 2ZSBA 1XXHB 3D0KA 3Q9LA 4UKDA 1CVIA 4ZV9A 5JAQA 2W22A 3TUIC 5HQTA 2IYXA 3ZVNA 1JIQA 3ETJA 4DMHA 5A62A 1AK1A 3EN0A 3SWWA 3RIMA 4PFSA 4F21A 2ZSUA 1DX4A 3F8SA 3OOJA 3LT1A 1N5OX 3PC3A 4HR7A 2ZI6A 3H2BA 3MYYA 4XQ9A 3U39A 2FY8A 5A03A 1NA5A 4B3GA 1SPBS 1EWQA 4NLLA 1IUKA 1KDTA 4WKOA 1YFJA 3GCZA 3MFQA 4GSYA 4XD2A 3S2UA 2DZDA 3HYSA 4JELA 5G3YA 2Z08A 3CRVA 4Q01A 3BGIA 5AJHA 2QUHA 3IBYA 3HVRA 2IY9A 2XYHA 3KJEA 3ANYB 2V54A 1CYDA 4QQKA 5HCIA 4AZ0B 1IK6A 2XIJA 3LJKA 3CWZA 1C7EA 3FSGD 3ITKA 3OQIA 4H3KB 3E9CA 1E9RA 2QLLA 5HGXA 1N0UA 1YAJA 2I7TA 2ST1A 2A33A 3H0EA 2QD3A 1DBRA 4XUEA 3RTEA 2V6FA 3K0SA 5H70A 3QP9A 3U56A 3U7JA 1M1YB 1VFPA 4R2IA 5BWCA 1AGPA 3NCHA 4F3YA 2VCYA 3TZEA 4N8EA 3L1JA 3W7AA 3IXMA 1QRAA 2A58A 3EZYA 4XD7A 3R7NA 3P2IA 3MOSA 3JPYA 3VTFA 1XJWA 2RSLA 3U3MA 5KNCH 2PMCA 5JSHA 2ZU6A 1P2BA 1PLJA 3KEFA 4FDLA 3AGQA 4WCDA 4G0QA 1IZZA 5AHXA 4ZOLA 1VPVA 3UO8B 5CG2A 2DVMA 1IBSA 1KEWA 2ID7A 2HWXA 4JBWA 1TZJA 3DDNA 2CZGA 1CQWA 3FWHA 4IIYA 3MAGA 4L8FA 1FNBA 2H65A 4OOEA 3GLIE 3T4UA 4RELA 5EJMA 1LK7A 4YBZA 1NWCA 1RLIA 2Q0QA 3UK0A 4CLRB 4K1LA 3AY0A 1PJRA 3RFFA 2CVQA 4MGKR 5L53A 1M8KA 2E87A 2IEBA 2V5UA 4IV8A 1EFCA 3A0RB 4IGKA 9LDBA 1A5SB 2CFOA 1KBQA 4LY3A 5ERGB 5AR1A 1UPBA 5IYZB 1G7RA 4KPUB 4ALMA 1IC6A 3L0SA 4CJXA 4E14A 1SJ9A 3NIDB 1H4TA 2CXNA 2DJIA 1E4EB 1VL6A 3C6KA 1LLDA 3E5NA 4PC3A 3SQOA 4C78A 1B0ZA 3Q0IA 3V00A 1TEHA 3UK1A 3Q7PA 5JTTA 4LJ5A 2I87A 4BNZA 4MVYA 4ENSA 2FGKA 2X8BA 2HRDA 4NCNA 1VHLA 2C4NA 4P4LA 1W35A 4RK7A 1QSGA 2YZ7A 2JASA 3EQ8A 4H3SA 1QE5A 2G82A 1TZMA 4OU5A 3NFYA 3OPQA 1H8HA 5AKEA 5EMNA 5IM4A 4Y6QA 3GLGB 2PUHA 3SP1A 4MQBA 1KDRA 3ND9A 1FNMA 1FZQA 1IDN1 2PLRA 1Z62A 1B76A 1TLFA 3DE2X 3FDZB 1Y6RA 1ZM3A 4OLHA 5G40A 3UMSA 1CE8A 3NHAA 1Z15A 1DG3A 3FJYA 4MINA 2AFIB 4DNPA 1VL8A 1JAIA 1A7AA 2XMZA 3WLLA 2WHEA 2ZIXA 3FB4A 3GH1A 4NOJA 3FKSD 4F04A 4QZVA 1L3IA 1L6RA 1U3FA 5CCEA 2WHYA 2XUAA 5BQPA 4KDEA 2CJYA 2ZYWX 1W34A 2RK3A 3CWQA 1ZNZA 2CD7A 3L7KA 3GNSA 3SHWA 1CR6A 4EDHA 3F96A 3CF2A 3FBWA 2FOXA 4XCVA 3DKIA 5DV9A 4CCWA 4DUYB 2Q2NA 2I3BA 3HA3A 4NS1A 1YRQA 1G1AA 1M8PA 1EFVA 1CS0A 2FE1A 2PL1A 5AW5A 4DYHA 3V8RA 2OWDA 4H2DA 4PIMA 4QL3A 4O3MA 2RCYA 4OKSA 4ZAXA 4M8NE 2QJWA 2W4MA 3I42A 3QXXA 3DTNA 3FFAA 5DP2A 3GGPA 3FOFC 2VJMA 1FY2A 2VHJA 4Z8XA 3GA0A 4HTAA 5JI3E 4YMLA 1BCRA 4NAVA 1DCTA 1M34B 1GU1A 1PV2A 2BEVA 2SNIE 3AI1A 5JXJA 5J23A 1L8LA 3ZU6A 1Z0FA 5F52A 2WJHA 2WZBA 3NIGB 2PQ6A 2WG2A 1WXXA 2J3IA 4KZKA 5TQVA 4AKTA 3K5PA 3GJTA 3G8CA 1OWNA 2JI6A 2FZLA 5EIBC 1QNFA 2MR5A 3DLTA 4L28A 4XOUA 5C1DA 4LNAA 1I7SB 3A70A 4QXAA 1ZJ5A 5IMBA 5GTDA 1SN7A 1L5SA 5GINE 2YHIB 3DZGA 4Q9NA 3RVNA 2YIDA 5JROA 2ZWOA 1VDZA 3CPEA 4YV1A 1UODA 2AZMA 4WBNA 1J22A 2VXOA 5ENZA 4DCNA 1R0LA 5B1HA 3FOCA 4QOGA 3A2NA 2EJTA 1FDUA 3GN1A 2JLCA 4I81A 2XEDA 4PPQA 4QXOA 2GN6A 3LWNA 5HFAA 5LYJA 2HKIA 3R5KA 2CUKA 3FW1A 3G8DA 3MUOA 4OQMA 3UWDA 5K0EA 5HJEA 2FK8A 1G59A 4KYUA 1E8NA 3R44A 4OJYA 1Q7BA 3KWLA 4MGYR 1HXHA 4R98A 4Y67A 2WF9A 1ARZA 2O52A 4DM3A 1ODJA 3AR5A 2J32A 3TOCA 5I7UA 1UFKA 3ZWOA 2CCGA 4MDEA 3TQFA 4H7HA 3H4TA 3TKAA 5JJCA 4DCOA 1IHOA 2F3SA 3WK5A 5AVOA 4TVSA 3OTGA 3QELB 4YX9A 2OHHA 3D7MA 1QDLB 1YBVA 4LWZA 3IULA 1UZNA 5DNCA 2QW8A 4P86A 2OKGA 2FPOA 5SYNA 4CIYA 3VU9A 1GG2A 3B8EA 4A2PA 3AQIA 4RH0A 3GNTA 1JXAA 1ZYUA 5LQKA 3CH7A 4N76A 3C8UA 4FOTA 5F35A 3G5MA 4PWZA 2QRJA 2X9QA 3DBHB 2UZAA 3RB8A 1HYQA 2JANA 2C2BA 1E7YA 2PD3A 5GWXA 4F6CA 1C50A 1J8VA 2BMAA 1E2NA 4C89A 1XZHA 2YKGA 3NH9A 4RTLA 4ETNA 4K9SA 2IYRA 2ZYSA 4TSFA 1QQ7A 4ZGBA 2F8TA 3KWFA 4FZ3A 1WP9A 2E55A 2IY7A 2JHCA 3ABRB 3F4KA 2ORVA 4ZI3A 2GPBA 2IP1A 1WPXA 4JMLA 2GCPA 4LYJA 1IONA 3ZWCA 3CT4A 2XH8A 1E3JA 3Q2OA 2W2LA 2X41A 3CUKA 3A6HA 4H4EA 4HNGA 4LWQA 4E1AA 1QUEA 4KACA 1KAGA 4U63A 2QZJA 3DE3X 3R0VA 4GLLA 4NEGA 2O2YA 4MQLA 4U2CA 4BWYA 1I4DD 3PS9A 4H1UA 1ZK4A 4OHYA 4IHJA 2CB9A 3SLKA 2Y05A 3VC2A 3O3NB 4QOEA 1KTVA 2RH9B 4KQHA 5B2ZA 3KNZA 3TD9A 1GVNB 5CFZA 2I65A 3FMFA 2ZI7A 4M7OA 4M49A 3Q98A 3RAPR 5FBQB 1RP7A 2XYPA 3P26A 4HH3C 3QX7A 3T9EA 3UUWA 2DBRA 1WCWA 4PS0A 1JJAA 1CBUA 4TZKA 4DV0B 5ITVA 2Q9BA 2ARKA 4RTRA 2OG1A 3ORFA 3GEGA 3GA7A 4QTUB 3WMXA 3ZUPA 5MN4A 4KMRA 3JX9A 4QA9A 4D3YA 3DWEX 1I6LA 1HY3A 3P2YA 1SFRA 3E05A 4EKEA 2CJWA 5HKOA 1CEQA 1SVIA 4BNJA 4CG1A 1OJLA 2N46A 4FSDA 4HB4A 2Q5IA 3S0JA 5AVYA 3G9QA 3GT4A 3W5VA 3GFVA 2L19A 3RJTA 2FH5B 1TW2A 1VBMA 5EIXA 4JFAA 2O2DA 3VOBA 1GT91 2QN7A 1BE0A 2X22A 2AYYA 4P3NA 2ZJ7A 3B1FA 4L9WA 3NJRA 1SUWA 3HDHA 1WA5A 4YH1A 1JBEA 2VK1A 4RMGA 5C5EA 3FTNA 3LH5A 2NSDA 4NG5A 5CXSA 1H6CA 2NO6A 1L9KA 4IR7A 2ZYRA 3V1KA 2CD9A 2WJZB 3P0RA 1LLFA 1SA0B 1XU9A 2J67A 4IIDA 2FW7A 2C3PA 4BE4A 2AJTA 3ND6A 3P5BA 3WLIA 2C9DA 1CD5A 4R05A 1CB0A 3VTZA 5A9RA 5DGIA 4FUTA 3IKLA 1ULBA 4URFA 3PIDA 2FWAA 2W43A 3NNDA 3P0JA 4JZKA 4KQEA 2CKDA 2W2NA 4U2DA 3KXDA 3KOUA 3MJTA 3C3WA 4FCVA 4FNOA 1C3EA 5B6IA 5CBKA 3CHYA 1QP8A 3Q5EA 1Y3AA 2ZTVA 4EG7A 1G8PA 1RHJA 1KP9A 4MPJA 5CVUA 4BZWA 2HT1A 4CF5A 2O6HA 3OIGA 1KJYA 2Z43A 3BGVA 4I8IA 4P5DA 3G2LA 4UHFA 2V7TA 1TU3A 4DA9A 3DXXA 4PC6A 4QKQA 3SR4A 2J31A 1Q7EA 1W73A 2YRWA 1L5LA 2C82A 1GG8A 1E2JA 3R5HA 2I9KA 3MS7A 1GQFA 3DAYA 5AJWA 5FTLA 1YMUA 1YUBA 4QUJA 4RHUA 1AGYA 2DHRA 2IXAA 2W6JD 3KSDO 1XA4A 3QUSA 3VM6A 2BP7B 1V5IA 2WAMA 3SF0A 2H29A 1IYZA 3PFIA 2G4LA 3AUYA 1JWBB 1QIGA 4BFXA 2GTIA 4ZOCA 2PT5A 3MAJA 2PUJA 3BIJA 5EFZA 3WDSA 3NDBB 2J09A 2Q2OA 3SKVA 1LLUA 4BZZA 5H7XA 5ALYA 1UK6A 2F3QA 3KKKA 4G5RA 1LNZA 1USUA 1SKMA 2GZRA 3RI3A 3FYDA 3KUKA 3NTVA 1W49A 4BQPA 3AG6A 2OP1A 5JAPA 1YR8A 2BGRA 2F6RA 3O90A 3S68A 4I4NA 1VMKA 5LWHA 3Q40A 2XR1A 5BWLA 2BFEB 1LSSA 3A3OA 2D0OB 2ZVDA 5ENVA 2VK2A 3H7AA 3NBMA 4BUCA 4CV0A 1G9TA 4MTLA 1TD9A 4U6NA 1F20A 2QQ5A 3AI7A 3GLIB 1E6KA 4W4TA 4EGSA 2BFWA 3QEMB 2A5YB 5LNK6 1B1AA 1YC2A 1JR3D 2ZDHA 4HDAA 4EI2A 1FNDA 3OC0A 4AZTA 4S05A 2BGTA 4UDOA 3BXEA 2CT8A 1JKJA 4D92A 3R5FA 4PSAA 3QPUA 5F2EA 3W6OA 4ARZB 4E12A 4EBFA 1NF2A 3ZXIA 1IH8A 3REQA 4YJDA 3HMQA 1XD2B 3IOEA 4MA0A 3A6GA 3OTHA 5C51B 3JS5A 1DV2A 3ZGYA 3EQ7A 1GPH1 4NCIA 4PIVA 4W5HA 4LF9B 1G7SA 1M83A 1U6KA 4LKOA 1YDWA 2YJTD 3MBKA 4ZO4A 1QZTA 2P65A 2BAGA 2P69A 1C7FA 1QX4A 2HJVA 4XGQA 3VSBA 2BDUA 4JT8A 1YK0A 2XECA 1FCJA 5B1YA 1R0BA 4FHGA 2ZB4A 3HJRA 3VI4B 4PIPA 4EUNA 5AW6A 3NR2A 5AVTA 4J9UE 1DSSG 3QOFA 4GYYA 3AB8A 2KLBA 4XM2A 1XAIA 1QQTA 2AXPA 1ZUIA 1BWPA 2E4YA 4PGHA 2PXCA 1L7RA 3COJA 4UEQA 3EFEA 1RE1A 1W6UA 1ZK2A 3INYA 3VZSA 1X3LA 1L1QA 4WIAA 3N8NA 5G3ZA 2NVBA 1UXGA 3IAEA 3GK3A 4KR0A 3K96A 2YWEA 4DUZB 1K6IA 3ANTA 5EIEA 2FXIA 2F1JA 2HF9A 3OIVA 4XR9A 4YS6A 1SBNE 1GL3A 3OOSA 5EJ2A 4AMYA 3ZHVA 5I45A 2R8BA 1H5NA 2VDNB 2RB5A 4BFZA 1E6UA 4B4WA 1YRWA 3HYCA 4KTTE 5TMPA 4BV3A 3FUWA 3BJEA 4J29A 2GM5A 2NU6B 1I2DA 4ZGGA 4ZYYA 3HL4A 1V35A 3HYTA 4ILKA 2A3RA 1ZDMA 2EHJA 2NG1A 4ZZ2A 2IS4A 5DSTA 1T9GR 5FAXA 1OV4A 4BFTA 3DT8A 3TW4A 3MTEA 5IRCD 3BIXA 3K71B 4LF8B 1LX7A 5KO2A 1ZS9A 1QG0A 3QVVA 4D25A 3HKDB 3JTEA 1NVWQ 4OB8A 3CKYA 1H2WA 2ABWA 5G02A 1T0PA 1BX1A 3M9WA 3WV4A 3GRAA 4JEMA 5ADUS 1NBOA 1TMKA 1E5LA 4LZLA 1LBEA 1O95C 3EXHB 4LOIA 3AEZA 4ND6A 3ZHZA 3H2GA 2VL7A 1RLMA 2WTEA 3W1WA 1X1TA 4EL5A 4YJ3B 4GG1A 3TJMA 5F7XA 4DUGD 1UWVA 3IVRA 1RXSA 3CB4A 1ISMA 3TW0A 4TMKA 1PK9A 3OQNA 2Y77A 2NUTA 1SBTA 2BE7A 2Y3IA 4ENWA 4LNUB 1X7XB 4FMBB 2W48A 3MGGA 1F7VA 1XK6A 1T8SA 9ATCA 1ZRMA 3DOJA 1ZRSA 4K9OA 1EJ2A 1WB4A 1MV8A 3TUZC 2J45A 2OCGA 2BCEA 1DFIA 5ECDA 4QQFA 2MSKA 2IXGA 1P45A 1YH3A 5G4KB 1CJSA 1O95A 3M83A 1I9GA 2DFDA 1KAOA 2C3OA 2IU4A 4QDXA 3AKZA 4EUHA 3EXFB 1CNFA 1YONA 2QZZA 4S1WA 1RABA 5J63A 1L5YA 2O8FA 1IVNA 2QYHA 4I50A 3U6KA 1R10A 1TPYA 4RD0A 1DDGA 4NSNA 3KSZO 4K40A 4Q1DA 4QSHA 4ZI7F 3V3TA 4QEZA 3UJHA 4CMBA 1RI3A 2CK3D 5THKA 1NOKA 5EOVA 3VPXA 3W06A 4G24A 1DKMA 2P6NA 2WVGA 2R6DA 3QFRA 5F1PA 2CVZA 1R4ZA 1Z5WA 2VTVA 3B53X 1ZOIA 4OIMA 4QUHA 4LIPD 5DTEA 1Y8CA 5BMVF 1JIXA 2ODQA 2D74A 3GCGA 3RSLA 1V7QA 4RDCA 2HSJA 4JSRA 3SQMA 2PUDA 1TA4A 1Z5PA 1QTQA 1CZRA 4RNCA 1PUIA 3DEFA 1CKEA 3E0QA 5B4VA 4MR9B 5HZGA 4LV6A 4HGPA 4HLNA 4N6NA 3EGXA 1LPOA 4D9FA 1G8GA 4EKNB 4IJ5A 5IKXA 1IFXA 4CV1A 1Y8AA 3C87A 3UICA 3TL3A 2IEZA 4QDTA 3AETB 4YO7A 1HQKA 3FUVA 3C5WP 4OQQA 2G28A 4FOPA 5KCMA 5D1NA 3ZK7A 4OAPA 3K9QO 1Z9BA 4EYGA 1PW7A 1JT2A 3HVUA 1NUUA 3DAHA 2GF0A 1NVBA 1RJEA 4K88A 2ZJAA 2H2AA 2ZT7A 3U7QA 5BNIA 3H2IA 3O94A 4LC0A 1LNQA 1PSDA 2COUA 4YO8A 2QTTA 1CJCA 2ZTLA 1FP4B 3O2SB 4L4ZA 4J4TA 1I4TD 4TRJA 5EWMA 2QGFA 1VLJA 4U2EA 3UGTA 1ID8A 1KSJA 3U7IA 2A2ZA 3FI9A 1FB5A 3NHMA 2HDHA 5DCWA 4A0SA 3EFHA 4RF5A 1ACLA 3UMCA 3DOUA 3WDLA 3TR6A 1N6NA 1V3UA 2AFHE 2NZUG 3HG7A 1MO4A 3CSSA 3ENQA 1THZA 1K7CA 1NBMD 1RZUA 2FP4A 3H86A 4BBZA 5JQGA 4UEKA 2YN0A 3QYJA 4I1IA 5C7OO 2Q9UA 4Q34A 2AOXA 4EKYA 1YU9A 1ZPDA 2WUEA 2YZGA 2GEVA 3OMXA 4ZT7A 1ZL2A 3LAWA 4YJFA 2O06A 2PBZA 4R8KA 1U5AA 5H0IA 3SBOA 4YMVA 4CKZA 2BSAA 1S3GA 2E4XA 3VZRA 3K4HA 4EAAA 3DVSX 1QBGA 3WJ1A 4JVNA 2REQB 3PL5A 4F6LA 1I1NA 1YC5A 1XA3A 3ZDXB 2EP5A 4C0HA 3IEVA 1FJHA 3CH4B 1E59A 2VUHB 4QLOA 5ALRA 3WRVA 3BUSA 3NBFA 3W1VA 4EG8A 1RVV1 1JHZA 1II8A 1MG0A 2HH9A 2TMGA 2YOFA 4PSCA 3FPAA 5AO9A 2Z95A 3U31A 1A2OA 1LSJA 3QVJA 3NIFB 4GU5A 2ZYUX 4NBSA 2A9RA 3QMMA 1N1MA 3UENA 2AWNA 1L7AA 3RYFA 1F2UB 1F5SA 4EATA 2LCQA 1E2MA 2DFNA 3DGFC 4G0NA 4IIJF 3BOSA 3NU1A 2C4HA 1G60A 3C6YA 4D3SA 1NATA 1QS0A 3I6IA 5LZ8A 3LWZA 3UGJA 4MUAA 4YWJA 3MJFA 4LRSB 3FRHA 3C8ZA 1WCYA 2YXDA 4W8OA 4AYXA 1RYNA 2EL9A 4QREA 3A6ZA 2R1UA 3SS7X 4DAOA 4R1MA 3K4QA 2QD5A 1K8QA 2G04A 2J3MA 3ICVA 3PX2A 2DLDA 4H7DA 2X86A 4MDYA 1KMMA 4GOXA 4KOAA 3DAPA 5C34B 4XRGA 4K3VA 3LP5A 5HIKA 3LNTA 3CVYA 1DCMA 4BO9A 3SQXA 4RZXA 3AG5A 1RPNA 1M2NA 2ZUUA 3EF1A 1RQ2A 3FZYA 1F4LA 4J76A 2CGEA 3BXGA 3U81A 2ASEA 3IQZA 3K73O 4M0FA 3SSAA 5CLLA 3EXG2 1RHMA 4ZREA 4DMUB 3LY8A 5AVKA 1ZVVA 2NUBA 1DJLA 4UE3S 4V0ME 5U4XA 3ZCRA 2X1VA 2R47A 1G9SA 3AP3A 3NEPX 4G4SP 1QTNA 3P52A 1ULUA 2H9AA 2QRVA 3P9KA 4Z7OB 3RYHB 3TN7A 1K7FB 5E9QA 1FFGA 1JR3E 3EWAA 3IKTA 3EIQA 2YQ5A 4D6PA 3KUDA 1UPAA 3AVQA 3IP7A 4ESHA 4AWBA 2G1JA 2P1ZA 1E9DA 2W2TA 3DCNA 4UFPA 5FKJA 3CGWA 1V1JA 4EMBA 2OZEA 3HKCA 5ITZB 3F71A 5MFZA 1N2SA 1SXPA 1T5IA 1I10A 4PLPA 3UMGA 4TS3A 3PNLA 5EZSA 5BNTA 4R01A 5L6MB 4LW8A 3QKRB 4PN7A 1P7PA 3ZWDA 1XXHA 1X2BA 3WFIA 4DT1B 2B1IA 3AO0B 4PQFA 4UJ3A 1E0AA 4D9MA 4YUXA 1XTUA 4QEKA 4PF1A 3A37A 3FKQA 1QYVA 3T12A 3DDZX 3T9BA 3KEOA 3V46A 3W9BA 2GN4A 2WKPA 4EF5A 2Q21A 4K9DA 2X2EA 3BIWA 4X62B 4CPDA 2F1KA 2NO0A 3PYLA 1MZVA 4X95A 1T6NA 1HTWA 5COBA 4ZWNA 3WYFA 1W5BA 4D9GA 4DM7A 3UJPA 3IH5A 5AK0A 4JENA 5JNUA 1YA6A 1XJ5A 5IBPA 1JA0A 4OXKA 3V8NA 2ZSAA 1W19A 4L8WB 1QHEA 3H0KA 3KR0A 1Y4DE 3L5OA 3QTLA 3ZV4A 1SU6A 2JGJA 3CSDA 4IQ4A 3ZU3A 3INNA 4IICA 5ALHA 2D2VA 2ZXUA 4YMSA 2DHEA 3Q7QA 5AJVB 7ADHA 1GG5A 4AZ0A 4RSMA 4AJEA 1L5RA 3EOBI 4UFNA 4D8XA 3AM1A 3NBQA 2Q1YA 4B6RA 1Z8FA 1OLXB 3TD6A 3TCXB 2CFRA 4E2ZA 4NP6A 3AKYA 3I3SR 2C99A 2ZZKA 2OLKA 3RWOA 2C2MA 3TLAA 1ADFA 3H9EO 1XMPA 5DGHA 1LDNA 4DV2B 4MDFA 4RSGA 5JMPA 3DDWA 1O87A 1M1YA 4KXMA 1NDUA 1NVFA 3ISJA 3L04A 3KKNA 5AKKA 1PX0A 3E5HA 2QW1A 1N8KA 2JZNA 1AUXA 2VHZA 4L72A 2EJCA 3RYCB 5B3LA 4AECA 1S4MA 3RE1A 2Y1FA 3K05A 4AO8A 1BHO1 3RUAA 2ZIVB 4ZMRA 5KBYA 1K2VN 1KGSA 2V97A 3VSDA 2WD8A 2HZ7A 2WIGA 5E0OA 2FHPA 4P7BA 1IHXA 4ARCA 3EAGA 3S8YA 4DR6B 1SBHA 3LLMA 3Q3GE 4FQ7A 1A7KA 4OA8A 4R83A 4WLVA 3THRA 4CLRA 4MRRA 1W4LA 1Z74A 1QNLA 4GRDA 5ELLA 3QITA 4IGIA 4RK5A 3UT0A 2P9CA 2QU7A 2VR1A 3ETEA 1YRLA 1WW3A 5IYZA 2O1SA 3V2GA 4JL6A 4KPUA 3O8RA 1LW7A 3UMFA 5A3RA 1Y1PA 5JO0A 3ULKA 4YIHA 1J8DA 1E4EA 4ODIA 2J33A 3TNLA 1V2HE 2E5FA 5ALFA 4C05A 3BMNB 3RVBA 1JFTA 3BJRA 4LMAA 2QTAA 1E3QA 3UPTA 1U0FA 1DTWB 2RJOA 1B6TA 2R48A 2UYOA 2P2DA 3EZLA 2UU9B 1TM3E 3LWDA 4B47A 2WT9A 3GLGA 5CHYA 3SMQA 1MOQA 1AQJA 1JDZA 3EDCA 3FDZA 4LUCA 1NJFA 2ZJFA 5A4KA 4F96A 3ON5A 2HWKA 3CU5A 1FIUA 1YDEA 1KF0A 2Y27A 3ZE6A 2PUBA 1VKZA 2VJQA 1GQRA 4GWGA 3FMOB 3LUHA 2OQIA 2V7WA 4X6YA 3OICA 3RDPA 3OZDA 2R1ZA 3T41A 1YS9A 3IT0A 4LMRA 3QTTA 4XWOA 1NJ2A 3GPDG 3LYAA 5DYYA 2XWSA 4ZXFA 1FSZA 3OM9A 3T0IA 2O4CA 5E2BA 3WVNA 1XC7A 3WWEA 2VP3A 4GMKA 5BV7A 1RYFA 4KRXA 4QDKA 2ZWVA 2DMRA 1YR7A 2ATIA 3V32A 2J3EA 2PX2A 2PZ8A 3C7CB 3N28A 4ISBA 4YC7A 3RC9A 5LZ4A 3OZXA 4ES6A 8ABPA 4BS9A 5LMZA 3HCNA 4RY9A 3G5TA 1PBTA 2X0FA 3GBVA 3PXBA 1QOPB 1IXSB 2Q2VA 1Z38A 2I71A 3HU3A 1TGYA 4DCMA 1E5VA 1RWOA 1OFUX 2R8OA 1V5FA 3ITDA 4URVR 1DAPA 3QZUA 4TV8F 2MIIA 4HD8A 2J7PD 5CX1B 4NOLA 4CU2A 1Y9EA 1PGNA 1J0BA 4JOQA 2RH8A 4CU5A 5CDFE 3CUVA 1M34A 4F9EA 1WHTB 4E5NA 3LHKA 3LUPA 5TMBA 1JG2A 3NWOA 1U7UA 5U9CA 4RVGA 4X6LA 1TVMA 4H3VA 4ZOEA 3THXB 4UTNA 4Y1EA 1ZJJA 2A4KA 4JUBA 4LRQA 1H0HA 3ET5A 4PXYA 4RBNA 5I7RA 2WFAA 2WIKA 4H1VA 4IH9A 1CY6A 4MA4A 5AHKA 1QR2A 4RVUA 4R1OA 2AYZA 4R2JA 4GUAA 5CBPB 4WZ6A 3BGDA 3M81A 3A1WA 1GUZA 1SR8A 1QGDA 2W58A 1QRUA 1XLVA 1L8OA 4C4OA 5GGYA 2K87A 1TTHA 2ENUA 4IYJA 4UM8B 3F97A 3P32A 1KH1A 1ZNWA 2AX4A 4LY6A 4ALNA 3UBMA 4EYQA 2E2WA 2Q2WA 2Y0CA 4K5QA 1ZLYA 4UJ5A 4XQGA 3R24A 1ZHOA 3NOVA 1UJ2A 4C3OB 3O9VA 3OIFA 3DE0X 3TSCA 2HEGA 3PLNA 3AHJA 2IZOA 4FDAA 3RSSA 2C3YA 2Q5JA 3V2IA 4RYLA 3JY6A 5IN5A 4UASA 4QYMA 1BS9A 2B7BA 2WHPB 4RQUA 1IRIA 2MMGA 4WK4B 4F7DA 4L15A 4MP6A 4O0LA 4I7EA 4C08A 1VKRA 1GPBA 3M2PA 4IJQA 4KQKA 1CTQA 3FLEA 4ZDJA 4LOJA 3NC1C 2CNLA 4WLUA 4BJHB 1VE1A 4IIFA 1KZHA 4DHWA 4BEVA 3EC7A 4UTXA 2CF6A 1MJ5A 2PGXA 2QX8A 1E32A 4GR9A 5GV7A 1DG1G 3UC5A 4OXXA 2DB3A 1C3JA 3QELA 3LXRA 4O2AB 4IVPA 1OSNA 4TZTA 3E4DA 4NV0A 3COWA 4Q3DA 3R6DA 4ZEOA 3HO6A 4A6PA 5DX1A 1KRWA 3WSWA 2XVYA 1DXOA 3REFA 1A4RA 1VZ3A 5B12A 4KR3A 2AZXA 3ZCXA 2ACWA 2XT0A 3NUZA 2CYAA 3D7SA 3ETHA 5JNTA 4Q3NA 1XKLA 2FR8C 2HPZA 3OECA 2IUEA 3ELBA 3KOWA 3QBVA 5JH7F 4GZ3A 2Q3HA 1E8MA 4QPZA 3DBHA 3K1AB 1B74A 4GZ5A 4KVAA 1WMAA 2V03A 5JAZA 1E79A 5F9FA 1P8JA 2CHFA 5ALXA 3VTAA 4CBVA 4F8EA 4PC1A 4ZDWA 2B4RO 1UOQA 1E20A 4FTWA 3JASB 1NULA 4YACA 4XYGA 2YHAA 5ALQA 3B6IA 5CDSA 3OBIA 2WWRA 4DKXA 2JLUA 4Z4EA 2VQFB 1GPAA 3M9XA 1RAGA 1CSEE 1L9XA 4V3CA 1P5JA 2XMGA 4WECA 3Q8LA 3Q3JB 2OSBA 4JJ8A 3VR6A 2J7KA 4R8RA 1TJYA 2IA5A 4IXMA 1K6MA 1TYAE 4UMEA 3W6ZA 3R3SA 3WOVA 1HDYA 3ODPA 1R3DA 1TT7A 2FR8A 5REQB 2J87A 3B9RA 4QGAA 4R7TA 4P84A 2H0AA 3LY7A 4UAGA 4RTPA 1FFWA 3M6MD 1FQWA 1RFLA 2QUAA 3OHSX 3AI3A 1MIHA 2Q7XA 3S2FA 3U7FB 1WP4A 2Y1DA 3G2KA 3LVRE 1Z8NA 2JIBA 3O92A 2NSHA 5HGJA 2F9MA 3OOEA 2BBTA 1NW8A 3L6EA 4QHSA 3M3DA 1Q83A 2EP8A 1FVHA 2AEFA 1CY0A 4EA7A 1N0IA 1MA3A 2GN9A 2WVHA 3F5SA 1BD4A 3VMFA 3LVBA 3TQTA 5FWYB 5KNLA 3RLIA 1W85B 3IKJA 4RMIA 4R8MA 2QE7D 1O97C 3SSOA 3V1LA 1YKGA 4LJ9A 1OX5A 1TM2A 2IKSA 1XTPA 4HFNA 4ZODA 4B0OA 1Z7EA 3L2OB 3VDXA 4EW1A 5AP9A 2BIFA 3DFMA 5K8LA 4OATA 3G2HA 3MD9A 4NJOA 4UEWA 2XCSB 1Z0DA 2BKAA 5DO9A 4HGYA 1C9YA 2XUDA 3CF6R 3UXHA 1LBQA 1JU3A 3ROZA 4HB0A 5K0LA 1I5EA 1BA3A 3A04A 1RQLA 1JHXA 1U0NA 2GOYA 1CT9A 3KYCB 4GBED 1K89A 2IYAA 4B87A 4C76A 3CJTA 4ENPA 3NRBA 1B8PA 1HEYA 1KO7A 1SA0A 4Q1AA 5IBCA 1L5WA 3GYBA 2OQ2A 1MXHA 1TM5E 2WK1A 1L7MA 3AW9A 1W4ZA 2YMPA 1GSAA 1KI7A 3HZHA 4ZRDA 5E2AA 3DXFA 3S3TA 2AEEA 4A0QA 2FUCA 4C7VA 4QFCA 5LP6F 1CHNA 1PV1A 1A2QA 3J80A 3KT8A 1IHUA 2IFTA 4MB2A 5IC6A 3NW9A 5A2GA 5LOVB 2I6GA 1G7CA 4IH1A 5FIUA 4ZYWA 4PO1A 3HM9A 1OWLA 2GSWA 4WA8A 5EPOA 1PD1A 1TYZA 1UEXC 3GUZA 1KS2A 3NQ41 3SMVA 4DLSA 1SBQA 1YDFA 3H6HA 4YRKA 3PXXA 4GMGA 1AQUA 2OL4A 4KFUA 1PSZA 1AY0A 4F8JA 2WJ6A 1XNQB 1QLJA 3HJCA 3KKEA 3QUCA 4JVOA 4LK3A 4MI1A 5K4GA 1I3NA 3RT9A 4A10A 4UXIA 1W4AA 1ZK0A 3ZJ5A 4EARA 2NYAA 3K6KA 5EMLA 4D9JA 3IBTA 1Q1AA 2YW9A 2C7BA 4HLDA 3WYAA 4BQSA 4EFMA 4BJ5A 1SQFA 1E66A 1ZFNA 2FG5A 2BP7A 3KJQA 1RKXA 4LOKA 5FNVB 4EG5A 4Z49A 5JJIA 3PKIA 4FFLA 1Q0LA 1R5OA 2CLFB 5JQWA 1NVMB 2Z9DA 4PX3A 4KREA 2IRWA 3HDVA 1U2SA 2XMBA 4P35A 2L2QA 1U0SY 4OGLA 1Q0SA 2GILA 4B3XA 3ISVA 5BT8A 3D1JA 3DB2A 3ZYCA 1TLLA 4IVQA 4BVEA 2H0RA 4RKQA 4J3JA 5FBWB 2JLYA 1QPBA 3O9MA 4RA6B 3M5PA 3KQMA 5CCDA 1DI0A 2D2IA 4K7JA 2BFEA 5GV8A 3E7PA 1BOOA 5DTRA 1NYLA 3AJRA 1BD3A 2ZIGA 4IIEA 2UZ0A 3DHYA 4MWTA 4OSPA 2FRVA 1ZCBA 3IAXA 3GLIA 3E84A 3UMBA 1T3LA 2PKYX 3BL5A 3QEMA 2ZITA 3SC4A 1X42A 4F4HA 1QGZA 2QE6A 4EYSA 1O4VA 3BYZA 4H1WA 4R2MA 2WLTA 3URKA 2O57A 4ARZA 2CHUA 3ORHA 5F64A 3KT6A 2RE8A 4JROA 1L3CA 4PV7A 4XQCA 1GTJ1 1XD2A 5B4UA 1BCSB 3GVIA 3PA8A 1U8FO 4F3KA 1DBQA 4WXEA 3IDQA 1P5ZB 4BLQA 5IWCA 3ICPA 3ONWA 5SYAA 2OZPA 5F9MA 5I4BA 2RIPA 1S3FA 2B5OA 2VYNA 3NNSA 4MITA 1B8NA 1SXJD 3IAAA 3QOXA 5CTJA 4RM2A 5TVGA 3ZY6A 3JQEA 5B2EA 2Q6KA 4L85A 2H4YA 3WQSB 1W48A 4RK0A 3OE7D 5JCJA 1K75A 1Q0PA 3PI7A 5IDYA 4IXTA 3S7ZA 1JA1A 1Y1SA 3NV9A 3DMHA 2P3LA 2MCFA 1KJZA 4FMCB 1GTMA 4M38A 2X2PA 4NBTA 3DM5A 4PHFA 4XJSA 1Y48E 1KVTA 2P27A 3E3AA 2JS7A 3PZRA 4I5IA 1U7XA 5D5HA 3DHNA 1V6CA 4KGZA 4WN9B 4B3DA 3FHTA 4EWLA 4LZZA 1LPNA 4JLOA 1WR8A 4UM9D 2WR8A 2HV8A 4TQGA 1MQAA 4DGQA 2R1TB 4GKBA 2X0NA 4J91A 2BKVA 3EXHC 5DI9A 1J8YF 2X5NA 4KUGA 5TR9A 4G8JA 1GGMA 1T9BA 3LT5A 4HWPA 5E4TA 5EXTA 1VYVA 4OBBA 2AT1A 2GPNA 3RVMA 5KSYA 5LJLA 2OUKA 2VAXA 4ARIA 1KVSA 4RFLA 4A92A 3QYAA 1AKQA 1QE0A 3EK2A 2NU6A 5CB6A 3CWCA 5DGXA 4HDOB 1M54A 4MO9A 1T4MA 3EW9A 1YMVA 3LQKA 1YUNA 3W9UA 3WY9A 4XX1A 5K4HA 1JBQA 4GRAA 3HUTA 4BNMA 2DRIA 1FYVA 1THTA 2JJQA 2CLEB 2X77A 2BMJA 2G9UA 2Y1XA 4WTOA 2DCMA 4MUXA 4G09A 5EIWA 2Q1SA 4NTZA 3HKDA 1KEEB 1YQEA 1P2VA 3E4CA 1GKIA 4F4IA 3KWMA 1UOPA 3UB2A 5AI6A 1AK9A 1R50A 1O7JA 3WO1A 5BORA 2IBSA 2V7BA 1DWPA 3TH5A 1J1IA 1EH5A 2JFHA 3EXHA 4BO4A 4PFKA 5L95A 1HR0B 2BM8A 2PKEA 3BD7A 1H2BA 2BGJA 4YJ3A 1QHGA 3IEUA 5SZHB 1S8NA 4KEAA 4BO7A 3OIWA 2E4VA 2H0QA 2OESA 1QC5B 2COEA 2XJ4A 2UVPB 1VZ2A 1J1UA 3GT0A 3P96A 2H54A 1P0IA 4NFLA 1B6GA 4LNUA 1UJ5A 3I9FA 3RF7A 1X7XA 3TAXA 4J6EA 3HTXA 1Q7CA 4HYYA 1LJUA 1NTRA 3PQFA 5J2TF 2H85A 4G0PA 4G89A 3C0KA 1EZ1A 4JEUA 4LDPA 2PRZA 1OFHA 1XZEA 2W11A 5F33A 3BA1A 4RPLA 4ZO7A 1QO0A 5U1PA 4HMOA 4L51A 4GLOA 1KE2A 3DMPA 5G4KA 5IJXA 4MVJE 4OHUA 4Z7JA 4O1IA 2D0PB 3SNKA 3DZHA 4DR5B 4F5DA 3EXFA 1E64A 2KX7A 1KVRA 3KEMA 1W2WB 4PLCA 1MCZA 3IYLW 4PM4A 3S2ZA 1W1IA 3WK6A 3ZJYA 2ZJ6A 3WMFA 3AVTA 2DX7A 1I01A 3UK2A 1MC8A 4D98A 2H57A 2RAFA 3QSYA 1EI9A 4TT8A 1XLWA 1R64A 5HF6A 1IJKA 4Z0NA 3E9NA 1RMQA 4F3RA 2V7EA 1TUBB 5I01A 3FXAA 3RS4A 3PCTA 2ZSKA 3MMPA 1W0JA 3QQPA 4LV8B 2C4WA 3ELUA 4B48A 3VPCA 2O0JA 4ZCQA 5CPBA 1UQRA 3PSHA 1Q5PA 2G83A 1KOFA 2DR0A 3IEIA 1WDLA 1QIJA 4E31A 1YVDA 2J9FB 4RHCA 1VBNA 5M34A 3MXTA 2AI3A 4PZYA 5EERA 6Q21A 1E2DA 2IODA 4MR9A 3JQRA 1J0AA 1V71A 4JHXA 4BLRA 4C0LA 3T3OA 1SZJG 4CT4B 2Q0SA 2PWPA 5DB4A 3ROEA 4HCJA 1FYEA 4UMFA 3AETA 4JC4A 3GXOA 2VWHA 3ADBA 3HGMA 4B5LA 2XLCA 2JL1A 4R1LA 1C29B 4G07A 4CG2A 1BXGB 1TI7A 1FTQA 1FMTA 3AGPA 2KPOA 2P9ZA 1DQZA 1FP6A 3ENWA 3DM9B 1J7JA 1KA9H 2VRNA 4FZRA 2PVPA 1TUGA 2GASA 2V7QD 5LCXA 1FP4A 2C5HA 3UV7A 4C0WA 3U09A 4MV8A 2P9QA 2JGEA 1E61A 3ZD9A 1E62A 4YRMA 4YYEA 3ACCA 3MGAA 1YDMA 1Q91A 3HFJA 5HVNA 4L02A 1REQB 4ZFNA 3W5DA 5KYYB 4M89A 5JY1A 1PWYE 5K3AA 4L2IB 5ER9A 1NMYA 4G5OA 3NOQA 3RT7A 4M7PA 1RWMA 4M36A 2A0XA 4MS4B 3ED5A 4TWZA 3KS9A 3GLHB 3DO6A 3WQBA 2NO1A 2FVYA 3O26A 2Y2VA 4P7JA 1LCIA 4NK5A 5I9MA 3B1VA 1Z4IA 4K6OA 3IAS1 3X43A 3HDQA 3VNQA 3H5RA 4MRSA 4RLHA 3HWSA 4W99A 3LT4A 4C0QC 2JF0A 3JVIA 3DE4X 2NZ2A 4HQLA 1MTZA 2FU5C 4FS3A 4L4RA 3MTJA 1F8GA 2CJXA 3IB6A 1D07A 1IZ8A 4TV9F 4Y7CA 4AF8A 3PHBE 4AUKA 3ITEA 4ESOA 3SU8A 2E49A 1SCUB 3N0XA 4WNAB 4PHCA 1VHWA 4Z9BA 4RD6A 3DT6A 1FF9A 4BLPA 2EBWA 3JQCA 1NW9B 4P80A 3AWDA 2N75A 5KKAA 3HXOA 2BSQA 4LDRA 4QDJA 4EJFA 4HS9A 1QKIA 3KZ1E 2BM1A 4CM4B 2QKYA 1ISHA 4B32A 5L8VA 4Q93A 4DY6A 1V11B 2F4NA 1YB5A 2HWWA 4F38A 4BVJA 3OSZA 1PJ8A 1ZWKA 5ED4A 5AKGA 4KFRA 3IUNA 2VA8A 1TYDE 1I94B 3D5QA 1OUMA 4G5QA 3W1EA 3EVFA 5GZ3A 4Z5XA 4OQNA 2VQEB 1Y8ZA 2IXFA 3FSGA 4DWJA 3GVHA 4RPIA 5DVZA 4R41A 4KXQA 1KI6B 2F4VB 3LUBA 1A1SA 4IDAA 5IM5A 4PFJA 1IM2A 1NX6A 1P4SA 2VJYA 4MP3A 4YAUA 3VHXB 1I4EB 1NXTA 2G9QA 3Q88A 1QR6A 3I3OA 1WLSA 4JHLA 4V02A 4OREX 4AYTA 2RHMA 4ZOQI 4BP3A 2RB4A 4PGAA 1P9OA 1ZGJA 2IQIA 4HVAA 2DERA 2DE0X 3OPMA 2HXGA 2P9EA 5ALEA 3W3AD 3WGLA 4A8JB 1BIFA 1DZ3A 3URMA 1M1NB 1ZM9A 3VKVA 4RULA 2BDTA 1UAGA 3WB1A 1H2EA 2HZBA 5GOTA 5L7WA 1O4WA 1NOIA 4ILEA 1ZU5A 1UANA 5I9TA 5KNCA 3EDQA 3M7IA 2BR5A 5DEOA 5DGCA 3U5ZB 2OENG 2AWOA 3RFTA 1Z4QA 2QNBA 1LFAA 4X97A 3PNYA 5G1NA 2I78A 1Z2EA 3ZVRA 1W96A 3RYHA 2RI6A 3AMVA 3B1YA 3T7RA 3N0WA 1P39A 1P2UA 2V4ZA 1D6MA 3JSAA 2AB0A 4IYRA 1XNGA 2GJ4A 2A0WA 4D96A 2C2ZA 1NXQA 2G5PA 3TB6A 2GI4A 5CXXA 2RC5A 4XB1A 1QMPA 3W2TA 3WFZA 4UBNA 5ITZA 3QGMA 4JI2B 3LI2A 3OJXA 3HDJA 3HXTA 5CLQA 4QJ3A 3OCCA 2J5KA 1C0IA 3GNQA 2IYUA 2RHGB 3AVVA 4RHFA 1PR1A 2AKYA 3NS7A 3QKRA 4L3WA 5LC1A 3RSFA 5TEVA 3GJZA 4DT1A 5T8KC 1SXJE 4LRYA 4B2YA 5JAIA 4I0WB 1T1EA 4RS4A 2VPQA 2VXCA 1F12A 3KKZA 2EBFX 1BOFA 3W8DA 4G5YA 4X64B 3JATB 1Z6AA 4KWCA 1JV2B 1ZK3A 2WAXA 3FF4A 3KVVA 1TQHA 4L6CA 4MI9A 4ROSA 2IYFA 4C3VA 2UZ4A 1XYGA 4XB2A 3ZCUA 5F3DA 2G0NA 2DG2A 3FKSA 2ZRLA 4UNIA 2IPOA 2WC1A 1Q11A 4MVXA 5E9WA 4TGLA 1QF7A 2BI8A 4I9NA 2WY2D 4LCEA 3IQFA 1NGSA 1AVTA 3C3KA 1PDWA 3VH1A 2NWQA 4FCCA 2FEXA 4RL6A 3O4IA 2O19A 3MW8A 2DFPA 4FFPA 3EY9A 2OV2A 3GRZA 4BLTA 3LBFA 4KBYA 1OLXA 1KRHA 5T8KA 1TTTA 3WHIA 3NYQA 4BGDA 3LTNC 5COAA 1WEHA 3SYLA 3GAMA 3CBQA 1X77A 4CM1A 2FWNA 3MINB 3TBHA 3EH2A 3SYTA 5A7FA 1U9YA 2DFKB 1C8KA 4C0JA 4II2A 4OLAA 4CFSA 2IIPA 4MW6A 4OUKX 5KTPA 2HCTA 1E98A 4ZOLF 1EYZA 3GI1A 2D1RA 2R5WA 2BUAA 3IVMA 3OHPA 1OFUA 4YRGA 1O1YA 1BDBA 4GYJA 3CRRA 4ND5A 4QNMA 5J9FA 1TF7A 1V8ZA 3CUWA 3RYCA 3DAFA 1IEVA 2P9YA 2EZUA 3G02A 5HUQA 3B5IA 2W6CX 4D3DA 4NZPA 2IPNA 1ZIXA 3CW9A 3IDFA 3BXOA 3JQ6A 4PSKA 1JZSA 1YASA 4QYXA 3EZXA 3MJRA 3RTCA 1MOSA 2CLIB 2XA1A 2MTBA 4DPKA 4ENTA 1ZW1A 5FFMA 4WEQA 3ZI7A 3OPYB 1G0OA 4D99A 4NYIR 2GBLC 3CG0A 1ZAYA 1CF4A 2VP0A 2XCRB 5BRJA 1OFVA 4LRTB 4LRXA 4EHJA 3ESCA 2D2FA 2SHKA 3W6UA 3I45A 4G8CA 3WIBA 1U1GA 2WILA 3AILA 3WLTA 3FH0A 1Q0ZA 4BDTA 3KL4A 5JJBA 4GXQA 3BMNA 1M8JA 1ZI9A 2PMBA 4FD3A 5IM4F 2FN9A 3R1IA 3PQ5A 3GJ0A 4AROA 4XYBA 5L3QB 3DH0A 1AXGA 1DTWA 2IEAA 4ZQCB 2HRCA 2PAFA 3ZCTA 1JTEA 2LW7A 3WWPA 1RLTA 5KNDH 1N6LA 2PG3A 4RIIA 4BDSA 6ABPA 3HA7A 2P4HX 2OFPA