1DJOA

Crystal structure of pseudomonas 7a glutaminase-asparaginase with the inhibitor donv covalently bound in the active site
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
330
structure length
330
Chain Sequence
KLANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMVAMTKTQDSKELQRIFWEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINASE-ASPARAGINASE
publication title Reactions of Pseudomonas 7A glutaminase-asparaginase with diazo analogues of glutamine and asparagine result in unexpected covalent inhibitions and suggests an unusual catalytic triad Thr-Tyr-Glu.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 114
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.5.1.38: Glutamin-(asparagin-)ase.
pdb deposition date 1999-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1djoA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 1djoA01
3NXKA 2HIMA 5HW0A 5K4GA 1NNSA 2D6FA 4RA6A 4R8KA 2GVNA 1WNFA 2WLTA 3ECAA 1DJPA 5I48A 1IHDA 5CBPB 1HO3A 2HLNA 4NJEB 1DJOA 5K45A 1JSRA 2P2NA 1JAZA 1HFJA 5CBPA 5K4HA 4NJEA 1HG1A 4RA9B 5DNCA 5DNDA 5I4BA 1JJAA 2WT4A 5I3ZA 5K3OA 5DNEA 3PGA1 2OCDA 5F52A 2P2DA 1ZCFA 4PGAA 1HFWA 4RA9A 2JK0A 1WSAA 1WLSA 3NTXA 4Q0MA 1HFKA 4RA6B 1HG0A 1ZQ1A 4R8LA 4ECAA 1AGXA 1O7JA 1JSLA
chains in the Genus database with same CATH superfamily
5LLTA 4MV0A 2VEOA 4GI5A 3VOSA 5LBTA 3PEUA 4AS2A 4DCTA 2BCEA 2GWRA 4L0QA 1EFTA 3LU1A 2EF0A 2ZWIA 3HVKA 1IJFA 3TW8B 4D57A 5JAZA 1KEKA 4E4RA 5IMBA 4D6PA 3F49S 5F12A 1TRKA 4R71A 3LPMA 3FZYA 4PG5A 1U0GA 3ZN2A 2UU9B 3R76A 1QTRA 1DAKA 2HRRA 1G4AE 2XOKA 2JDIA 1PJCA 3FPAA 2WM2A 3N6XA 3P0IA 2BISA 2ZM5A 4TKLA 5AESA 4CQNA 1Q0SA 1XXLA 2VSXA 1E1RA 3OPVA 4N76A 1L7VC 3DNMA 2ZRJA 3DOEA 4EO9A 4ILKA 3S8MA 1JQ3A 1KO8A 1UEIA 2F1OA 2FUG1 5BNTA 1Y8RB 2OUKA 2YV1A 2W2LA 4OPMA 1OB2A 3G2JA 1EAYA 4I9FA 5B2FA 1ZC4A 1ZKDA 2P2YA 3PQ4A 3S99A 3VO2A 4IMPA 5EPEA 5KWEA 2X6QA 5FR1A 4TMYA 3HV0A 2MINA 3OZEA 2C98A 2FMTA 2V4ZA 2HF2A 3PXAA 4G65A 3KLBA 1BE1A 2GO1A 2K2QB 3TGPA 3ORFA 4CI9A 4WFQA 4JOCA 2WZBA 4HEA1 1XAJA 1VDZA 2X5NA 3K70B 4PYJA 4PZYA 2GWHA 2RCYA 1KDYA 3DMNA 4FGJA 2BDUA 3WZMA 3F73A 2VBIA 3CVWA 2EARA 3B7GA 2OECA 4D8VA 4EY6A 1NRWA 2ZIEA 1F4VA 1K1EA 5JE8A 4MRRA 1M6HA 3L8FA 2G25A 2WTEA 3KZCA 2XDQA 2D3WA 4C1BA 1C3VA 4XWWA 1PLLA 3A4TA 2WZCA 3B6KA 4JB3A 1V8FA 2KE5A 1R0ZA 3VAZA 1IBSA 1EWRA 1KJIA 1M6NA 2WJIA 5JH7F 1IRIA 3N0RA 3F2VA 2PLWA 4ICIA 1XNJA 1P9OA 4F38A 2PUBA 4F4UA 5EHXA 4YRMA 3BL6A 4B6JA 3T0IA 5AVUA 4ZWNA 2FPUA 1SD1A 4G5YA 3MWKA 1F60A 2VPYA 1FYEA 1P4HA 4OM7A 3C8ZA 3CF4G 2HT1A 1TX4B 4EATA 1CLEA 2Z8YA 2VAMA 1XBTA 1JAYA 2XECA 3HU3A 2JRLA 1DC6A 1VLJA 3IIMA 3NVDA 1C9DB 3LFHA 5EG5A 3T9AA 1SZCA 3W4IA 3VYSB 4PG8A 4F97A 3IRVA 3NI2A 1WDWB 2BR5A 1G3IA 3KOYA 3ZV6A 3BE8A 5ALWA 5CAEA 3AB8A 1UWKA 1R0WA 3IOCA 1P1HA 4QUHA 1IM8A 4QOFA 5HF8A 5FP0A 3U13A 1Y6GA 3AF2A 4R7ZA 3GLFE 3TDKA 3AKEA 5CIWA 2CLLB 2BFNA 2SHKA 3CBGA 4ZK2A 4W5TA 2AJ8A 3B38A 3HQ4O 1M34E 4R2XA 1M2GA 3H7AA 2VUIB 3VA7A 2J7KA 1CRPA 1TVKA 4FFSA 4Q16A 4NBWA 4DKJA 4B2PA 3I04M 5M29A 2VLBA 3MT0A 1T9DA 2FZWA 3VAYA 3SHWA 1U2QA 3VR4A 1B3RA 4DMGA 2RHHA 2D2VA 4AROA 2IEYA 2WIKA 3GMDA 3IHLA 5K0GA 1AN9A 1KJ8A 1CUXA 1W5SA 4BGVA 4G0UA 4GGMX 1WBBA 4O1HA 4CL8A 3BYZA 1DEAA 2QOEA 3X1XA 5KB3A 2IW3A 1Y42X 1V41E 4GOJA 4P8RA 2B2CA 1D2HA 5CFZA 3NNDA 3JZMA 4QATA 2H85A 4TVSA 5F5LA 4O4IB 5IMSA 2ZUTA 3J81k 4RXUA 1K8RA 4Q37A 4DIFA 2GUGA 5KNBH 4KXVA 1EB9A 4W6ZA 1VZ2A 1TTTA 4QKQA 3H2IA 2XQFA 1OPXA 5KNBD 1JFFB 2W8BB 2NXWA 1GA4A 4WBXC 5CB4F 4HTFA 2WDZA 2YV5A 3T9EA 3P19A 5LWHA 1VG0B 1S2DA 4JQSA 1UPTA 1C30A 4P3YA 4RH0A 1R4MA 4Q9KA 5EIBD 4K88A 1BXZA 2JI7A 3N8KA 3TEMA 3TIGA 3TLZA 4C7XA 3BKWA 3QFRA 3HYRA 1PYGA 3AUTA 4Z86A 5BSTA 5JXWA 2XQGA 1Q20A 3D4OA 2WVHA 4D45A 1MZPA 1RZUA 4KK3A 2HV8A 4MQFB 2ZSAA 1E8NA 3ZIAD 1RAAA 1AGYA 4XAQA 3Q12A 1ZAKA 3C3BA 5ERGB 1SIUA 2AMLA 1DIGA 5IT9A 3EAFA 2WE7A 3LX5A 1XNQB 4MW0A 5I51A 1RM0A 4UNQA 1GGJA 5JMPA 4ZTUB 4JX9A 5C8YB 2V6FA 5HF6A 3ULKA 4HNHA 3TG8A 1W0CA 3CLUD 3EWIA 4GZMA 1V5FA 3ZCVA 4U9UA 1K7FB 4LOLA 1KY5A 4C43A 5E3HA 2DC1A 1R0SA 4B3CA 4OX9B 2B92A 3LQQA 2FEXA 1DDIA 4IDFA 1X8KA 1Y7PA 2QRMA 4AJLA 1KGSA 4U2FA 4IGIA 2FXVA 5HHTA 1GV0A 4FDLA 4M98A 2I7DA 3QEOA 1RXWA 4WSOA 2XCUA 2NU9A 1DAEA 1QFJA 3QBDA 4QGFA 1TEHA 4D79A 3AUXA 1SXGA 1QGED 2I33A 4YQEA 1N2CA 1EX9A 5K4AA 2GK4A 2V5VA 3Q2OA 1O0SA 3QVOA 4FDTA 1K0UA 2REOA 1LRLA 4TM8A 1LI5A 2YQ5A 3F74A 3EYAA 5DP1A 3O5AA 2IE0A 3AUSA 3RVMA 1J8VA 1CNMA 5CM2Z 1UINA 1RC0A 1N2HA 2WHEA 1BNCA 3OQBA 4MMXB 1RSZA 1VE6A 2OG2A 3KT6A 2L0XA 5BN3B 1LSJA 1W9MA 2OD9A 2QLBA 4Q7MB 4GPD1 3ZC3A 1QAQA 4DFDA 4X7BA 1PNRA 1H66A 4DT1A 5BNIA 1H1LB 3QKSB 2QSJA 4YN3A 2PEZA 121PA 1JF8A 2XE7A 4FM9A 1ISRA 1TM2A 2C2ZA 4U7TB 4HGYA 5IKEA 2EKZA 5CX4A 2NU7A 1CIVA 1DO2A 3H5TA 1H4SA 1E4VA 4F8EA 1I6MA 1NKTA 2CBGA 2VSQA 2VDQB 1CS0B 1U0LA 1D07A 3E6AA 3K0BA 4OHYA 4KPUA 2VNJA 5JSUA 2ZRAA 2G9UA 3NORA 4GR9A 3WMFA 2O8BB 3A9VA 4GGOA 1QP4A 1ZIPA 3JASB 4JZYA 4UBMA 1IN8A 2JRCA 4LDPA 2AXPA 1FNDA 1T2DA 3B36A 2IYFA 1Z4MA 2ZBPA 4KWCA 1YXMA 1G6HA 4U9IS 1YULA 3DGEC 2HCFA 2QT1A 1KE1A 1UAGA 3BHJA 3KCNA 3TOCA 2RHDA 4YQYA 3C6MA 3LX4A 2JLVA 5CDHA 1JVBA 4ARUA 2VFAA 3ORYA 3T41A 2GPYA 2WBLC 3VO9A 2FPOA 1J7KA 4ETWA 4UMDA 4D9NA 5I7VA 1QFMA 2WF7A 3R5JA 1N5LA 5KDDA 2RI1A 1I1HA 3V48A 4NYIQ 1KQOA 4IXDA 2AXNA 2EWVA 3DXYA 4BP3A 3CVJA 1R64A 1W1IA 3MAGA 1D8TA 3GFVA 2XOEA 2XMGA 3A2NA 2DCUA 3FPBA 2VJMA 4RK4A 1STOA 3ELDA 1BGXT 4DV6B 4KMOA 2J67A 4RD1A 4E88A 2C5AA 4DCUA 2Z8YM 1XTQA 2KBEA 5LQCA 1PEDA 2HSZA 1OIXA 1NUAA 1EM6A 1MABB 2QP4A 3QE2A 2MSNA 2VYNA 4JMLA 1BS2A 3FRJA 4KP7A 1ZNWA 3NONA 3R5TA 4EF5A 4F2WA 3H87A 4KO2S 1NAHA 1HYGA 1F2UA 2RGBA 1KZGB 3BXFA 1FMTA 2UV8A 4MA5A 4MRAA 5I7HA 5IANA 3REFA 4OOFA 5EJ7A 2DU8A 3DP9A 4KV7A 4MV4A 3DW1X 2Y8EA 3EGEA 4DUPA 1NBAA 3IQIX 4LNAA 4OGGA 4RKWA 5FLKA 2X7HA 3HGMA 3V8EA 3H18A 3PVSA 4LOHA 2WFAA 3PYXA 4AYXA 2HTFA 3T5DA 1N5KA 2GZMA 3NDRA 3RSHA 3UUFA 2F3UA 2PJZA 5TGZA 3PQ3A 4Y67A 3OJ0A 3Q11A 2IX9A 4OKIA 4EHLA 4LTDA 5EIEA 4RSRA 3JQRA 1L3BA 4G97A 4C01A 1R9GA 9LDTA 5AJVB 1JQBA 2PFGA 5AOAA 1XGKA 3UFXB 1TQ8A 3EXHA 4GVPA 3UMSA 1JL3A 2GPSA 4LE1A 1JR3A 4MI3A 4XIIA 3U49A 1AKRA 3DEHA 1ZUNA 5TRTA 4BMSA 2IY9A 5KU7A 1RWWA 3SAJA 1XEWY 1R9MA 5LLSA 2GHTA 2DQYA 2VHJA 3INTA 4JJEA 2C99A 2VUTA 3GAAA 3N3AC 1Y3AA 4CETA 4TSFA 4FDVA 4DA7A 4F06A 5EMMA 4EKYA 3ZE6A 4CG0A 2N1BA 4AJIA 1SPXA 3URMA 2JIZD 4L9WA 5EIBC 1B0UA 4X91A 3R7SA 3BCUA 2KI5A 1RWPA 4MDHA 4LF7B 2GHRA 4CMEC 4DV1B 1VMDA 3HWRA 3SQLA 3CA8A 4IOMA 5FBQB 3QLTA 4LV6A 2OCKA 3BGDA 4S12A 4EA9A 5B3JC 1P31A 1V8OA 2C7GA 3FGZA 3RS5A 4HDRA 1SKAA 5DKFA 1ELOA 2Y92A 4UUOA 2P9BA 1G8SA 5L3QA 3IA7A 3RYCA 3ANMA 1C9MA 1O95D 1PKEA 1LF0A 2I03A 3PC2A 3UMBA 4YV7A 2AD5A 4IHKA 2IEAA 1H6DA 1RPAA 1E9DA 5CNKA 3L0BA 2BF7A 5F4BA 5THKA 4ABYA 5KYXB 1KYZA 4ZAZA 3UJBA 3CLUC 1SIBE 4D3DA 2R84A 3WK5A 3M9XA 1EJ6A 2FJPA 5LJLA 4Y2GA 3WLAA 4DN6A 2NSYA 1NW9B 1G20B 1RXUA 1YZVA 2PV7A 2D3TA 1O0BA 2SKDA 3FYHA 2GA9A 2JLYA 4MKFA 3TJRA 5BW5A 3GLRA 3KU4A 2YNMA 3DOFA 2E4ZA 4Z8YA 2C3MA 5JSZA 4WA7A 5C7YA 4CTJA 3FYTA 4GZ6A 1PR6A 1J8YF 3ADCA 3NXKA 1N7GA 3DOJA 3WGTA 4AMYA 1IQPA 1J70A 2XVYA 4Y0NA 3PDCA 4H0FA 1SHLA 1ZH2A 4NAVA 1UKZA 1ZVMA 1KDPA 3M82A 4B31A 1JHMA 4DSZA 2JGDA 4EJSB 5B36A 1NIJA 1DBIA 1C2YA 1VE3A 4BLSA 1VJTA 3N75A 4GM0A 4MK4A 3NTQA 3V2HA 4UPEA 3QWBA 2IXEA 4FPXA 5CFNA 1W4RA 1N2IA 2MT9A 3HBJA 5EQDA 4CL2A 3O8RA 4RTSA 2C57A 2YDXA 4D0RA 3KUUA 2X41A 3THOA 4RZIA 3WGLA 3RUHA 1OZAA 4I4LA 5FWDA 3UMCA 2EDCA 1A5SB 1OTHA 3Q9UA 4AO6A 4PWZA 5JI3E 2PUFA 3K1AA 4HB3A 2MCFA 1U2TA 4YRFA 5IARA 5I8ZA 3GCWA 5IJ9B 3H11A 1A4XA 3O94A 4UBKA 1SZPA 2GYYA 5AHRA 3AIIA 2QTVB 5HE9A 2FPRA 1ICEA 1Z07A 2H0AA 4O0MA 2VPTA 1E79D 5BWOA 3CNOA 3DMTC 2WWVD 1ZY2A 2I55A 2ZWAA 5H80A 1QH1A 5JTTA 1RWXA 2YMQA 4ZI3A 4XWGA 2ONZA 4NYMR 2M9MA 1WIWA 1EZ4A 1U3WA 4FIZA 1O5IA 4K9MA 2FSVA 1PDOA 1QG2A 3NS7A 1Z35A 3OAAA 4HNAB 4PLHA 5DTMA 3WAKA 4HLCA 5LLDA 2XNDD 2N42A 4JCOA 3PDWA 4C76A 3KK0A 3JQAA 4E15A 2EFCB 3AI2A 3OE1A 1YE8A 1T36B 2AWOA 2C9ZA 1GILA 1CY6A 3OFNA 3COVA 3W8FA 1BS9A 1SJ9A 1H8HA 5AFSA 1KH1A 4DV2B 4C0SA 2AJDA 4MAAA 2E4UA 1CZRA 1H2EA 1NFQA 2OZVA 4ISCA 3S27A 2O8NA 2PUEA 4FYWA 4OJNA 3WKEA 2QX4A 2I3BA 3K6JA 4ZQCB 4ZIRB 2SCUB 4QUBA 2C4KA 4PN3A 2ZGVA 3GXBA 4OU4A 2Z08A 4EG7A 5HKLA 1GZDA 1DEXA 4ROTA 4UDNA 2IXGA 3K4PA 2H11A 5DHSA 2H2HA 4QGSA 5B5SA 3ZQUA 4FEYA 1QRTA 3L01A 4TXLA 4DA0A 3L1JA 3EH2A 3EPKA 3SYRA 3EEBA 5E6RA 4YMIA 3CX4A 3A31A 1KFJB 3SF8B 3MT7A 3Q3HA 2I7CA 1FJGB 3QVGB 5FL7D 5EXTA 1CZKA 2JLCA 2PUTA 5AM1A 3T12A 4P93A 1Z5VA 1QYWA 1MO6A 1D2NA 2OYRA 1HDXA 3RFUA 5CVDA 2CK3D 2BFPA 1AV6A 5A7FA 2QJWA 3Q6MA 5HUQA 4RK1A 1RYZA 2B1JA 3UH0A 1X19A 4DR1B 4DSUA 1KZHA 1OX6A 2ERYA 4Z9AA 1BCSA 3B9BA 2YRWA 1GNSA 3OLCX 3MAJA 5AM5A 3OU7A 3MC1A 1L4NA 4LSZA 4DA8A 4N1AA 4MVJG 1FNMA 3GCZA 4R8SA 2BR3A 1MW8X 5CA0F 3HB9A 2H31A 1W0JD 4NFSA 1V3QE 5DU2A 1AA6A 5CFPA 1NC3A 4IDDA 3G9XA 3GLGE 3V00A 4C21A 1JH9A 4B9EA 5KI6A 3EGDA 3FMFA 2EJTA 2GCOB 4N3BA 2R00C 1Z26A 4C6SA 4O2LA 5DW0A 4ENUA 1XK7A 3FJYA 1C7JA 2I65A 3JRWA 3RRYA 2I5PO 1JJIA 3FGOA 4PX2A 1P3JA 4QQ8A 1X7ZB 2W98A 3N2GB 4KXFB 4O1MA 3GFSA 4WH0A 3LIIA 3CRVA 3JRNA 4Z0TA 1WSAA 1C1HA 2PUVA 2Q21A 1SWWA 3A9CA 3WWPA 4DMRA 3E5HA 3JW8A 2YL2A 1YUBA 4E4TA 4X3OA 2IKQA 4CM6A 1M83A 2HQBA 1N9GA 4Q1EA 3NHLA 4JUFA 5ALDA 3UXYA 3U16A 4NICA 1UZNA 3OM9A 2BFBB 3K30A 4I4CA 4WPGA 1G291 1Z2DA 4B47A 1KI6A 5A3SA 3I2FA 5E7MA 2W93A 5IRCD 1YDHA 3KYCB 4MS3B 5E9QA 3BF7A 3ZVLA 4MUIA 3CRNA 4AP5A 2QAGB 1ODIA 2J3JA 2O6HA 5K45A 4JUCA 3KHKA 1J2TA 2IYQA 1MQSA 3AUKA 1CUDA 3K2IA 1DKUA 2II6A 2TMKA 3KTAB 2SICE 3QBJA 4Q3CA 3ZV4A 4BNWA 5A0VA 4KQWA 2AN4A 2BOVA 1L7MA 4DG8A 4FE3A 3AVTA 1UMKA 2GLTA 4OXXA 3STYA 4A6PA 5JCJA 1JWBB 2BJVA 3M4YA 4CLEA 4JBWA 4K6KA 1Z5OA 4W5QA 2N46A 2XB8A 5DNWA 2NAPA 1THTA 1LW7A 2EEZA 1VLHA 3EXG2 3OF2A 4WQMA 3QLUA 3BWBA 2QRVB 4PY2A 5A4FS 2G6TA 1NP3A 3ZHVA 4F56A 5CK4A 3ANYB 3IUQA 3UGKA 3WGQA 3GT3A 2H5LA 3AOEA 4MR9B 4J91A 3H1EA 1NMQA 3VJRA 1YFZA 1WVGA 4BO8A 2J5BA 4EIWA 5HS4A 1J25A 4KVFA 1J0XO 5DXAA 2ZS7A 5KU1A 3KETA 1EXWA 1IUKA 2YBDA 2YOFA 3KZMA 3L9XA 1YHZA 2FSHA 5I9IA 4TZ0A 2W6JD 1NBOA 4Q19A 1E3IA 5FIUA 2ZRCA 4C87A 3DTVB 5ECWA 3ST7A 3BXPA 1V0JA 2BZ1A 4B6FA 3LTNC 1CYEA 1RRKA 3HDQA 4KIUA 2Z6UA 2OC4A 3U4HA 4ARBA 2R96A 1G20E 3A26A 3KFLA 1FPQA 2W2KA 3CH4B 1RRGA 4HFRA 4XVCA 2QROA 1F0YA 1FP7A 2BHNA 2ODPA 1W48A 3MT9A 4CQLB 4YGYA 5LZ4A 3F8SA 4G81A 3M6LA 2JARA 3AHFA 3BDAA 1EUCA 1OLUA 2IZ7A 4DLXA 4G1BA 5KC9A 1QYXA 1A7UA 3RCBA 2D2EA 3TINA 4WCFA 4LZJA 4EITA 5LU9A 3T1TA 3ND9A 3HU2A 2OORC 5A0TA 3EZ2A 5DHQA 2WSMA 3K5IA 2JEYA 5T6BA 3ICOA 1RI1A 1UFVA 3CNEA 2FWMX 4LDQA 4LMPA 1EUDA 2QUAA 4M0DA 2DERA 4QODA 3E48A 2AI2A 3U3XA 2Q2QA 3ABSB 3SX2A 6AT1A 1BW9B 2JFGA 3HYCA 3LP5A 3EZXA 3HDYA 2BFOA 3LGAA 3P94A 4NBSA 1TC2A 1A9SA 1XRRA 3UB4A 4B3IA 2OXTA 2C77A 2QTLA 3LY9A 5DEIA 4R98A 3OT4A 1KBZA 2WTXA 4YDSA 2AR0A 3PQCA 3V7UA 1XMOB 4KZPA 1QH8A 1PWZA 3IT0A 4IQ0A 3AY0A 1YU9A 1QOPB 4GBED 4GLOA 3WICA 4OHXA 1A9QA 4ATNA 2JH8A 3KP1A 4TWBA 1B26A 1U98A 3EGWA 3JR3A 5AIAA 3BSYA 1ZK2A 3C24A 4BVHA 1CY4A 3B85A 4EARA 3BMCB 3L2OB 3U6BA 3F7MA 3LY5A 2V65A 4A3SA 1Y1LA 2DPYA 3PA8A 4PLCA 3T1NA 1FVXA 5JDCC 3B1ZA 3V2UA 2EJUA 4LG1A 1QQTA 2FZLA 4JLNA 4RJLA 2HFKA 1J39A 1V95A 1HE3A 2PKWA 3BS4A 3PEFA 4X64B 2DG2A 2NO9A 5IF3A 4MQEA 5KYUA 4FR0A 3W2EA 3HA5A 1G64A 2EFHB 5EJMA 2NV6A 1J23A 5DN9A 4W1QA 3W7VA 4BTEA 4HAZA 1ONSA 1QGDA 3BPSA 4ZO8A 3ZQ6A 3UCXA 5JCXA 2VTBA 1JAXA 1KY2A 1G66A 1ISGA 1RAFA 1ZH4A 1OLXA 4F8YA 1IVYA 4FU0A 1JJAA 4YECA 3O21A 4P5EA 1XCBA 2EFEB 2CE2X 2P0YA 4XEUA 3ANNA 1Q74A 2ECQA 4JV5B 7ADHA 2QZ9A 4IFIA 3ZGOA 3GD5A 2O57A 2ZB8A 3KEGA 4E03A 3AI7A 5CCEA 4OB6A 2H7CA 3SBOA 5LSAA 3QX7A 2OB2A 4Y1EA 3NM5A 1N2JA 4Z99A 1JKXA 4E70A 4NYJR 2AV6A 2YWXA 3RC8A 1IM5A 1PT9A 1CXZA 1EM8A 4P31A 1BKYA 1I1NA 4Q9HA 2H8KA 1AXGA 2IYEA 1NM5C 3QKRB 3B3GA 5EMHA 2J09A 2C84A 1T1SA 2HJWA 2JVKA 2NUAB 1GQSA 3LO5A 3M2TA 1A1SA 3I6ZA 3F2IA 1CR1A 1BXRB 2C1EA 4P2BA 4Q47A 5IZCC 5JAMA 2NLOA 4ZT7A 5ALNA 2A4MA 3L7DA 3N0WA 4BB9A 3RNLA 4AO7A 4BFTA 3LRTA 4DLKA 1JEYA 1E2LA 3FNHA 1U4NA 3GT7A 4FNGA 3WJ7A 3U4QB 5K51A 2Q3BA 3TOSA 3ZI7A 3E82A 3NBZC 4A0QA 4DIKA 5LZ2A 2HDHA 1PW5A 2GN0A 3HHPA 4IMIB 3ADKA 1V2HE 3ABZA 4WFIA 4ACBA 1YOVB 2CEAA 3ZDZB 2C7VA 1DPGA 2MSWA 2Q4TA 4XFJA 5A1TA 3AUJB 4Y6PA 3IMKA 1B2LA 4A8JC 1I0LA 4WIAA 1VI5A 2WF5A 3U4AA 2PX4A 3PRJA 4EPVA 1IY0A 1Z8HA 1N2GA 3QU9A 4UEWA 2FZGA 3WZ2A 5ICFA 5I4CA 1SGWA 1R6DA 3OIYA 1J09A 4B79A 3A4NA 3AR2A 4ASUD 2QENA 5DI3A 5ADHA 4RQAA 3OIDA 1FDIA 2GX6A 4UREA 3EXIA 2WIGA 5AUQA 3TSZA 3TNLA 1IONA 1QHXA 4CLXA 3WL6A 4YYEA 3R7AA 1D9XA 2AFRA 1HDGO 1NF8A 3MRVA 4JOQA 1JKFA 3KQOA 3QOWA 4U7FA 1W5TA 3KSAC 1GYQA 4B4UA 3GLUA 1OHHD 4DANA 4E11A 1Z4OA 5B2EA 1K4YA 1U7UA 4UM9D 1ZI9A 1CVIA 1UZAA 3NGMA 3A1UA 2OO5C 3IEPA 3O93A 1Y1SA 1T35A 4ZCMA 4QSMA 1XYVA 1KYVA 3RC9A 3LWDA 2PD6A 2MJLA 1PTKA 5HIMA 4U0KA 1TCCA 4UZFA 3EQZA 1W4CA 4NBNA 1GKLA 2BF4A 2X4IA 1LLCA 4ZA2A 5HEKA 4G8JA 5LC1A 5DGHA 5ICEA 1E8DA 3HCBA 3EXFA 1RMQA 2Q7XA 2YW9A 1R8JA 3TSOA 3U3DA 3UG7A 3WLQA 4O2AA 5BMVA 1PP4A 3H5OA 2PFKA 2Y1KA 4HNVA 1CB7A 1SXJA 3SHVA 3ONVA 4DBZA 5E1DA 5EWMB 5EVCA 1G2PA 1H2BA 3DULA 3NOOA 3DEZA 3RK4A 2PMFA 1W2GA 3HWWA 1YZLA 3JARA 4KO1S 3PGVA 3L04A 2GILA 5ALEA 4EI8A 4EHFA 4EVSA 2FQYA 3U61B 3CEMA 2LDBA 4QGGA 1BSVA 2R60A 4AX4A 1E4YA 4A15A 3SX4A 3GRPA 3BZUA 3HJRA 4U9HS 3O4GA 4GRDA 1BCRB 1IZ7A 1H9CA 2GSWA 1ZEMA 2DFPA 3GEPA 3W2HA 4RF4A 3PEEA 1N4AA 1CY8A 2XYRA 4QQFA 5ALJA 1IEXA 1SB9A 3KOXA 3EGXB 1PFWA 3HY6A 1FEZA 4XVQA 2POCA 1NVMB 1E3SA 2XMBA 3W34A 2CBXA 2VBFA 3RFXA 4PHHA 4HVLA 2I2BA 1RABA 1WF3A 2YZ2A 3KDPA 5DWQA 4CG2A 1JZQA 1S02A 1I30A 1YQQA 2CJXA 2DKOA 3FCYA 3RU3A 1T5BA 4F2PA 4LC9A 7GPBA 3D0KA 3PHBE 4WNYA 1R6AA 1A77A 3PJRA 2VP9A 2DFLA 4HZUB 1QE5A 1KAMA 1JALA 3I6YA 3ICPA 4I1SA 1DWUA 5AH0A 4HK4A 3U39A 5LWQA 3CSDA 1HE2A 3I92A 4NH0A 4E12A 1QNFA 1RXYA 1AY0A 3MT8A 3WA6A 4UPVA 4YV1A 5T8KA 1PGJA 2BMJA 2BY4A 3O38A 4OXKA 4BBPA 3E3OA 3HCNA 2DQZA 1EE1A 1JLLB 3PR1A 2H1OA 4B45A 1QH0A 2B5VA 5AHXA 2OUIA 4UDOA 3FCOA 2C4TA 4IS2A 3IE2A 4IBOA 2RGEA 4JQOA 5KHOC 3QYJA 5KTMA 1GT91 2BE7A 4PS0A 3CT6A 4EFDA 1SQ0A 3AEZA 4HNTA 1E5QA 4BKRA 2WP0A 3PJEA 4G07A 3W05A 2CD9A 1ISSA 4R8MA 3VVMA 8ATCA 4CKEB 2RK3A 3K1TA 3BQMB 3ZQJA 3EODA 1OBHA 3WAGA 2VNSA 5H16A 3VZCA 4L7VA 3B5JA 1CUAA 1XMPA 3LXMA 4NMHA 2CUTA 2WK1A 2VEDA 1AKVA 4HXYA 4ETMA 2HV9A 2KW5A 4AMVA 1DCKA 2OCYC 3DEAA 2COEA 3RFFA 2WIDA 2XCOA 4Y6GB 1VIAA 3KOZA 3OKFA 2FMKA 5CH3A 3ZKAA 4A0HA 3ZY4A 1RHKA 2GBLC 2R6DA 3PJFA 4CFZA 1EHIA 2DP4E 2X4GA 4IDAA 4NFYA 4IH9A 4J2HA 2A7XA 1PU2A 1V1RA 1LKZA 2BRUA 1FDVA 2FDRA 3A8TA 1J2UA 3GNQA 3NT4A 4Q12A 5FORA 4ZD6A 3AVYA 3WZLA 1YB4A 4RD6A 4MCHA 3DBHA 3RIEA 4YMLA 3SJUA 2BJWA 3DO5A 1E2BA 5K5EA 1BU8A 2Q07A 1LJ8A 5C4GB 4ZRNA 2W2TA 5FLEX 4II3A 4URFA 3ESBA 4CTOA 4I50B 3GT0A 3WGZA 3CN9A 3HG7A 2WU3A 4B35A 5KYYA 4AI6A 1HDRA 3EPHA 1HDCA 3H05A 2J8ZA 4L50A 4P6VF 2X4DA 1MXHA 3H8SA 1B6GA 5IVDA 1S8FA 4RVNA 3DNPA 4ZO9A 3JQPA 3QFSA 1YS1X 5JD6A 4I4TA 3I01A 2AZTA 4GAEA 4TLAA 5K3EA 1HX7A 4KWEA 3UWSA 2V7GA 4PFJA 1DX9A 1UDAA 1ZJJA 1H42A 2P9ZA 3HXLA 4G5OA 1GVHA 2P2CA 3ENNA 4XUDA 3T3MB 1HT1E 2Q5OA 5FYDA 1JFTA 2RB4A 3LSTA 1IG3A 4D4JA 3HMQA 2IHBA 3ZWCA 1UK7A 2XVAA 2HZBA 1P4GA 1ZHFA 2IUSA 3HWX1 3V1UA 4BLTA 1CVLA 1VL5A 4DV0B 2MDTA 4ETNA 1LEHA 4FEGA 4OCZA 1I5RA 4D5GA 2Q50A 2DCMA 2B7LA 2CVQA 1EFVB 2GM9A 2OPBA 4N3CA 2O0KA 5EHGA 1ZW6A 4CM9D 3WJ2A 3S2UA 4D98A 1OXBB 2EBUA 3PUYA 3L82B 4IVRA 4Z4HA 4ND6A 3MXOA 1CJTC 2Q2OA 5CNIA 3THWB 4MDFA 3IMGA 4HLUA 5H1YA 1E66A 3PDIB 3UAZA 5GIOE 4GUDA 4KQXA 4EY5A 3GPLA 4ER0A 3IE0A 5E6SA 3UMFA 1E3JA 1XOIA 1E0AA 3U3KA 1W25A 1VMAA 4CF5A 1WHTB 5CK5A 3UBMA 2PS3A 3WSTA 1JKJA 3IBFA 4EFLA 2WM3A 4JEHA 5M3BA 5BQ3A 1JEEA 3BMQB 3H3XA 1L5KA 5JSFA 2YFQA 5CITA 2EGHA 1K7XB 4BBAA 1TUBB 4AQDA 2O2JA 2IYYA 2EKQA 4DMKA 3AXSA 4I55B 3ZDQA 4B2IA 1FFYA 1FUEA 4ZALA 1AE1A 1YVEI 3SOPA 2XSZA 3WL7A 1RBQA 4ALLA 1DT3A 1O5OA 3AP2A 1F6DA 1JPUA 4HDNB 4HYYA 5TIIA 4EZIA 3NTLA 2GCNA 1XVTA 1WSBA 1TQ2A 4NAHA 3ZU3A 4Z4GA 1DDGA 4BFWA 5ERXA 1XMXA 2NSLA 2O0HA 5EZYA 2IS2A 5JAPA 2AKAB 4MJXA 4YFVA 3PUIA 3ER8A 5HBGA 3IKTA 2VYQA 3JYLA 3M4JA 2ZUUA 5E4YA 4BZPA 1L5QA 2AB0A 2WAXA 3L4BA 2IU3A 5ES3A 1UJCA 4NX2A 5HKAA 4UJ5A 1G8HA 4UHDA 1B16A 1JDUA 2PRJA 3AERB 2RHLA 3HRHA 3LDAA 2C20A 2XTZA 3FKQA 1EGHA 2I3DA 2OSVA 3GLVA 3R3SA 4J0FA 4TQAA 4ZQHA 5C0OE 5GTDA 4DSOA 1X94A 1PBNA 2FSIA 3FPEA 1FE8A 3QWHA 4CM1A 2BMDA 4QJ4A 1QKKA 4N3AA 1U3DA 4S35A 4WBNB 2PJRA 3HTXA 4PO8A 4KR7A 1T2VA 2X7JA 3AZPA 5CH8A 3LBIA 2PTGA 5MHTA 4ENSA 4UBOA 4M0MA 4F3CA 4E2YA 3G17A 5D3MB 3VV3A 4AAYA 1P9LA 1Z0JA 3GDGA 3NDPA 1SH7A 2W00A 2H9AA 4OSPA 5KVVA 1FXWF 1Q1ZA 3L7MA 1QB7A 4R1PA 5EPUA 2XWBF 4JP8A 4R05A 3MS2A 3N1UA 2F1JA 5ECYA 2JD1A 4IUCS 4QDOA 3IUEA 3H0EA 4P4LA 3SP1A 2QUKA 1V16B 1NQWA 3HM2A 2ZXUA 4DV4B 1NL3A 1W76A 3O4RA 4JJKA 3R74A 4TSKA 3GLSA 1IOLA 1N6OA 3RIYA 1ADGA 4HYEA 4FMCB 4XCXA 1Z0SA 3SFVA 2W9XA 3CTMA 4P3KA 4XSHA 3GFGA 3UHAA 2IU4A 3URKA 4RDXA 5EVJA 4Z4EA 4LMBA 6NULA 1PHRA 3W78A 2WUFA 4MR8B 3H65A 2ZE8A 3AUYA 3MGBA 3K72B 4IMJB 2GNOA 4FHCA 4QM6A 3KX2A 1I2ZA 3O91A 2ZTLA 4ABTA 4JWTA 1F8GA 3R5XA 4JWKA 4IDBA 4M8KA 4MUNA 4O4HF 3P0HA 4TM7A 4U7GA 3ZOKA 3I2YX 5KSZA 2I8CA 4K6GA 3TFOA 4WLNA 1COWD 4ZOQI 1DIRA 4FCVA 4IH1A 4HQKA 2CXUA 2ORYA 3PHHA 2QN7A 3RROA 3V8BA 1K68A 3QF7A 1M2HA 1A2OA 2E85A 3FKSD 3LNTA 3QNUA 4LRQA 3KOMA 4HI0E 2NPFA 2O2HA 4F3NA 3BTSA 3JQFA 3Q7IA 1I4DD 3W5BA 1L7AA 4N41A 2QW8A 1P81A 3MINB 4WKGA 1RAEA 1WHSB 1TM7E 4G1MB 4N82A 4F92B 3LCRA 2OBBA 3GJ3A 2C94A 2QXUA 1KSJA 5A71A 1Y5LA 5BQXA 5CM8B 1L5HA 3CX7A 3OOWA 2JLAA 3OQIB 5AJTA 1LPSA 3ANLA 2C4MA 5DM2A 5LQJA 1PS9A 3OZIA 2XHEA 3BMXA 2GESA 3MWDA 1U28C 1JG3A 5B6JA 4MW6A 2IX3A 1CUJA 4AMBA 3T9FA 2CVHA 3AETA 2XCSB 2XB9A 1FX1A 2XE4A 2B83A 1DRKA 1GLNA 2JKYA 3NMUF 5LIPA 3CUEF 2AQKA 3ENKA 3ZE9A 5BSGA 1DUIA 5K09A 1HQKA 1AB5A 1ST3A 3N0TA 4O4LF 1XPJA 3IUJA 1NBMA 4Z9YA 1RLTA 2C4HA 2QK4A 1XEXB 4KN8A 3G59A 2PK3A 5FD8A 5IWAB 3IDFA 3JALA 3TQQA 2QSYA 3KYDA 2WTBA 1XLTC 4YK7A 1IBKB 1KC1A 4F71A 3STHA 4BMNA 2ZJ7A 5JQGF 1Z6TA 2UZIR 3AR6A 1E1MA 4FUTA 3O3OB 4N01A 2DTDA 1J07A 1S8NA 4CL3A 3UUEA 1FRVA 4BLUA 1PGPA 3U37A 4LBVA 4UVIA 1MJHA 1GTMA 4JLBA 3C4JA 2V97A 3PTZA 4RD2A 2EQAA 4LJ8A 1W0KD 3WYEA 5K9ZA 2AUTA 1U0SY 2VDPB 1W5AA 3OEWA 4L1KA 4QULA 1HQDA 2A92A 4L6CA 3L41A 3ZHZA 1VL8A 1Z16A 3JCZA 3TLXA 5GJBA 3EGCA 3G8CA 2XAUA 4QXPA 4MGKR 2VHXA 1C9JA 1J2EA 3I6IA 3RWMB 3ZUGA 3FRIA 3OQOA 3GGPA 4DIBA 1O96A 2PD3A 1IUNA 3TD9A 4CEJA 1GG8A 4PE5B 5D1NA 4OAOA 2FN7A 5JYBA 4ZHQF 3UUGA 1LDMA 1K66A 5ALMA 4DYVA 1DHRA 3BWVA 5TF0A 2O2DA 4QELA 1VP3A 2W48A 1CUCA 3QUCA 2PX5A 2ZJAA 4L08A 2E2WA 1KYYA 3EB9A 5GM2A 4RWZA 3PX3A 1Q0PA 2HRDA 2YZGA 3SEFA 5KYWB 3G7SA 4OB7A 2P67A 4UHJA 1MENA 2V1UA 1JH8A 4LN1A 1T5OA 3RUFA 4QTZA 3E2PA 1HTBA 3ELWA 1GRVA 2E48A 1KZ6A 1UKEA 4XQ0A 5BNWA 3K70D 1XT6A 1N6HA 4M4SA 3OF3A 4X45A 4QRIA 3ZVRA 5KVCA 3FVQA 3O9ZA 1NLUA 2ZVDA 4JLDA 1XNGA 3GLGA 4X1IA 4DKXA 3D6NB 4E5YA 3BK1A 1JLSA 4WKCA 8OHMA 4I99A 1J06A 1WX1A 1ZM7A 2P5SA 4MHSA 3U7HB 4ZDIA 1XDUA 3G5AA 1HI9A 3IUPA 2Y0BA 4KUHA 4ZRMA 5GADl 2AUMA 1W85A 3Q8KA 2LD4A 1JBQA 3S2EA 3USZA 4BC1A 3WLJA 4GGPA 2QM3A 4UAGA 2VTKA 1WV0A 4MS1B 5BSVA 3DKPA 5EZ6B 4TVBA 1VHQA 3TW0A 5AW8A 2BKUA 3K1JA 3KEFA 4RV4A 1ONPA 4ZQGA 3RSFA 3TAXA 4DABA 3GO4A 4N7MA 4DGQA 1NG1A 3HABA 2MYTA 3B89A 3DVLA 3AWDA 4M21A 3OKPA 1FP4B 3MYRA 5EXSA 3VYVA 1EX1A 1FDSA 2XRMA 3H19A 1EFPB 1U7TA 1XD2B 2IEGA 1FNBA 3DO8A 2VCHA 4HHEA 2Y2UA 4A5OA 2WD9A 1WP9A 1NMZA 3VSDA 2V7UA 3UATA 3B8EA 5JSKA 1LPMA 1FZQA 5CG2A 1L5YA 1X80A 2VXBA 5DLDA 4NS1A 4IV5A 1OZGA 4BMXA 1TLFA 4M0FA 4E5PA 2NMVA 2NYVA 3U4MA 5E4JA 2LWIA 4XGNA 2HWUA 4MWBA 3DPIA 4XYBA 4FLEA 1E3DA 3WSWA 5IC6A 4DPKA 3QKWA 3EBPA 2Y3IA 3Q72A 1L0BA 4FI3C 2I34A 3WNVA 5JLAA 5F35A 3SBDA 1WPXA 1JG4A 3SKXA 5IJXA 1GDTA 1OZHA 3B13B 2QBYA 1M1YA 4UU7A 1GPWB 3LLUA 3R23A 4YH1A 3ABRB 4TV8A 5DTEA 4ALNA 4KPEC 1GN9A 3VKHA 3OTHA 3Q2KA 4BNXA 4UUPA 4CLOA 4QVGA 3AR7A 3JZAA 1JPNA 5CA1A 2XYPA 1BN6A 1C7QA 1WZCA 4RANA 3ENWA 3A36A 1DVRA 1GIAA 4QFMA 2QE7D 3LHDA 1MX5A 2Z3VA 4KV9A 5CT6A 2PTHA 1IZ0A 1P7CA 3QXGA 3UICA 1KWGA 1DWOA 3IP5A 4LYDA 1M1NA 2NZJA 2R3SA 4JJ4A 1MJGA 5FR2A 3UG6A 3ILSA 3TOZA 3F7NA 3ANSA 5DT9A 2VJNA 2YMLA 3F6RA 2W70A 4MB6A 3T06B 5DLPA 1LTQA 3HA3A 4HPJB 5EEGA 3RAJA 4N03A 4A8TA 1O87A 4JGIA 2XMRA 3MJEA 4WNAB 1DIHA 4DLPA 3OCXA 2JIRA 2GJSA 2JLSA 3EDCA 3TLCA 1E9CA 3GJ8A 3HSSA 1TJ4A 3JQEA 4OQYA 4PIMA 4KNYA 3AGQA 4FQ7A 2V6BA 3C5EA 5TMDA 1SVUA 1QIJA 3DVQX 4V0RA 4DTIA 2CDRA 2PKQO 2XTNA 4X7MA 2FZ5A 4PN7A 2PV0A 5DULA 3SZMA 3TK1A 1OROA 2C59A 1ZN8A 2W2XA 3EOBI 4CJXA 5CTJA 3GRZA 3NKLA 1V8DA 1QCCA 3H5WA 1J6UA 3E22A 2ZT5A 2OCBA 3GRRA 3NAMA 4X41A 2JFXA 2M2IA 3A6KA 4GKBA 4Q6WA 1YMQA 1FRFS 5J9FA 1O89A 3K9NA 3MJCA 4ZVTA 3ZDFA 1IXZA 3OCCA 1KKMA 4NOJA 4WT7A 3TLYA 4DBLE 5IN4A 1DIAA 3PTAA 3W5SA 1CZLA 1ZK1A 1NI5A 1GSOA 2GVDC 3A2MA 5K0JA 4BZQA 3CC8A 2JF0A 1J9GA 3NATA 5LBUA 3UWMA 2BHLA 3CEJA 1M3SA 2QRZA 1YBAA 4Q1BA 4RXTA 4NNJA 6CHYA 2FPWA 4ZCLA 1E6LA 5K6RA 1KR2A 3KKZA 5A5FA 3QA9A 3E05A 1L4LA 2ADMA 1C8BA 4CNBA 1ISHA 2UYYA 2XNCA 2IHVA 3W2IA 3CVYA 3IQDB 4UHHA 1THMA 1HSZA 2EGUA 1GGFA 1EWYA 1MIOA 5CURA 4R41A 1TTHA 4P54A 2Z9BA 4LNUB 4AJJA 1NW7A 1WUIS 3TLGA 3KVVA 5IVPA 4L4UA 1RBYA 2WE8A 1GYRA 2VPIA 4LHXA 4ME6A 3VH2A 3X1YA 2NIPA 4YHHB 4ZCQA 3SHOA 1BFUA 1RKVA 2B4RO 4M7RA 2F9MA 3WYAA 3K92A 5FX2A 3LCUA 1RM5A 2DY1A 3A1EA 2IT1A 2ZZKA 4LISA 3LOPA 4K03A 4F5ZA 1DCTA 1RADA 3ILYA 1XTZA 1T15A 3R6GA 5AK5A 1PZHA 4L8LA 2IF2A 4EK9A 2QL9A 4BV9A 4YAFA 4C7VA 1TMOA 4Y6LA 1WXIA 1V6AA 1DTSA 4LDNA 4ZEXA 2AH5A 4JYBA 4QYXA 1ZZEA 2B30A 1YV9A 1NATA 2OVBA 1PVDA 3UJ9A 5GONA 4IWNA 1BHQ1 3K8OE 4IJ6A 1SOVA 4A27A 5DGIA 1JHPA 2HSGA 4YRLA 5ALTA 5ABPA 5IYZB 3C3JA 3V9PA 5FV4A 4NULA 3PUKA 1FL9A 4N6NA 4URYR 2DLCX 1HFEL 2VK8A 2ZVQX 1VJ1A 4RXMA 1D2MA 4Y7DA 4PVCA 5E7IA 3UMRA 3E0QA 3PXCX 4ZVLA 2B4AA 1XV5A 2B8WA 4TPKA 4XLTA 1H3EA 2HSJA 4O63O 3TZKA 1QF7A 3K70C 4FSXA 4OHOA 5FJIA 3E0XA 3A1SA 3HI4A 2IPXA 1BRTA 4H35A 3DA8A 4KQ2A 1CIPA 3SHQA 2PWZA 4G4JA 5CB8A 3CZAA 4MMYB 5GIPE 2GN2A 3VR5A 2CL6X 2BONA 3HCWA 1QGAA 3KR2A 3NBMA 4NLLA 2B99A 1K98A 2GN6A 2FR0A 1U2PA 2NTNA 4H6XA 1PBTA 5FPQA 1NE7A 3CZ4A 2H2FA 1NR1A 3JAKB 5JRZA 2E3JA 1DHTA 3CHYA 3WGHA 1CS4C 2OHXA 3PD1A 1IJBA 4H60A 4RYDA 2HSDA 4JHXA 1FUIA 1IB6A 5JO9A 4XYLA 3QUSA 2GR9A 3P0JA 3IV7A 4NZOA 4W7IA 3DVAA 1JDJA 4CWAA 1Y7LA 2IYAA 3LY7A 4D4GA 4TZKA 2AQ8A 4DDWA 2F3RA 4NV0A 4M1MA 5AI5A 1Q44A 5D8DA 1E89A 2CDCA 2CDBA 3IB6A 2O2ZA 4N9WA 4RELA 4QOJA 3RC2A 2J32A 2JI9A 1A96A 3NYIA 4NFHA 5IAJA 3CISA 1DB3A 5F4ZA 2FB9A 3LIPA 1FTNA 2ZT7A 2D4HA 4Y6OA 5SY4A 2WC1A 2XR1A 3T5GA 4K1XA 4X5OA 3TMYA 3T9CA 1A4IA 1Y1PA 1Z5GA 3SQOA 2X77A 3NNNA 1XZLA 1H5NA 1IM2A 1HGXA 2RGCA 4OQQA 4P33A 1M1UA 3VVCA 4ERNA 4DA4A 5EIXA 2H1LA 2XKJE 3CX8A 4P2GA 4MV5A 2FP4A 2BEWA 3LPDA 4YJ2A 1RXCA 5AJYA 4X8LA 3OEHD 5AO9A 5LOVB 4FP9A 5DX0A 4P9NA 4Z0HO 3ML1A 2F3SA 1L3IA 4XKJA 3ZHYA 2JB9A 1ECFA 1OR8A 4KXYA 5CFLA 4AG3A 5EUCA 2ONCA 3X1DA 3WLTA 5BPHA 2PSDA 3W5AA 5BRJA 1MQAA 4JT4A 3IBGA 1ENZA 3O4IA 3O3CA 1E99A 1CQIB 1ECJA 3BHIA 1KMMA 1ZWKA 2MSEB 2VA8A 4KAAA 1BU5A 1JVSA 2AEFA 3NB0A 4NWIA 3HUTA 2B2XA 2Q8PA 1HLDA 1NUHA 4KACA 1H22A 4QOIA 2O06A 3SYLA 3VI4B 4XD7A 3PGA1 1QHHA 4ZCTA 3GBVA 2H4JA 5IJ0B 2TYSB 3Q7QA 4CMHA 2H18A 1G8PA 5CEFA 4TTJA 5IJWA 1GR0A 1JRLA 3HU1A 1V8PA 1DMSA 2NQ8A 3K9GA 5BSEA 4HBGA 4RADA 1ZOSA 4HEQA 3THXB 4PO9A 3NIBA 2MOKA 1JAZA 3HRIA 3E7PA 4BOYA 4YALA 1GWNA 3HXKA 3M70A 5KDOA 4F5EA 5AW2A 1Q50A 1UC4B 1X38A 2CJWB 1Y3DE 2NPOA 1MCZA 3FWYA 4O4JB 5L3SB 3BH0A 3MGAA 3PJGA 2H2WA 1KZ9A 1W19A 1KYTA 2I4TA 3E8SA 3V4PB 3HKBA 2G8LA 2WM9B 3E3NA 2OHJA 4KPFC 3TPFA 1WXFA 3W9YA 4JT2A 1UMCB 2ZU6A 3KR9A 2H1IA 2GTHA 1XQVA 2PA3A 3ETNA 1NW6A 1QZZA 1WB5A 3D81A 3DTYA 3CLHA 1NYRA 1K7SN 1OD6A 2BD0A 2D5AA 4G1EB 4UBNA 4EP1A 2X0FA 4KPYA 3PQEA 4J9VA 2JBHA 4OQLA 1YJAA 1NJ2A 2P78A 3EAQA 4HYQA 4F72A 4Z7JA 5KIAA 2A9RA 1V2GA 5B3LA 1QGZA 1UM9B 1WZUA 5KYNA 2IDJA 3CUSA 3Q98A 2K6GA 3ISTA 4DDKA 1YSCA 1R74A 2OXIA 4OI0A 2QQFA 3F5SA 1ECGA 4TTQA 2LW7A 1CQWA 3NRCA 4KI7A 4MGYR 1LK7A 1IWOA 2OV6A 2QP9X 3D9QX 5HTKA 4EUKA 4YRAA 1J8MF 1TUGA 2GJKA 4JDPA 4PCUA 1TZJA 3RGGA 1UJBA 4TYWA 1JDNA 2AE1A 3K96A 2WAYA 4IV8A 1OYVA 1W49A 2BUAA 1JDZA 2BFCA 2GYVA 2RBEA 5FWXA 1ZH6A 4BVGA 2VJYA 4U6NA 4E21A 2I6TA 2WSBA 5J2UB 1BH2A 1H5QA 3R24A 2X1VA 1B41A 3MRSA 3MMZA 3R6TA 1AKQA 1NF2A 4FWBA 5F1KA 2JASA 2XNHA 5HF9A 4CMBA 3LBAA 4XX1A 5AUOB 4DXHA 1O3YA 1KEZA 3VZQA 4H7JA 4AY5A 4KN9S 4D6YA 3PIRA 3GJ7A 2Z6AA 3DMGA 1PCXA 3FCUB 1PR5A 1ZSNA 4U2GA 2P5TB 5EYPA 4ZQFA 3KD3A 4WD3A 1LRJA 2HGSA 1KIAA 1O4WA 2AX3A 1D2GA 4ZGBA 1AOXA 4UCXA 4DBVO 1UKYA 2XGSA 3ZG6A 2Q3MA 2QRHA 4N7BA 4XVHA 1M0EA 4L4ZA 2ZRBA 4OMCA 1HEUA 3QWIA 4IZ6A 2YBEA 3BEDA 4UHKA 3H9JA 2R1VA 3ZV7A 4HQOA 2ZJOA 3E9QA 2ZTSA 2FWBA 3AJDA 1KPIA 3R3YA 1UBMS 3C7AA 4N12A 3C6KA 3HEBA 3J80A 3OP1A 3PGKA 4Z3KA 1OWMA 2PWAA 3EFOA 3GCDA 1R5JA 2Z04A 5LUBA 4B3RB 1QR6A 3RIGA 5MN4A 3I2JA 2Z1MA 1YGYA 4D4MA 4BS9A 4YP6A 2Z2YA 3OUZA 2FTKE 3RC3A 5A4IS 5EL0A 4EO4A 1MW9X 1YQGA 2PGJA 4QYIA 3W5JA 4IDEA 4TMKA 4EFMA 2GPBA 4ZJPA 1IOZA 1F8YA 1UOOA 2ARKA 2G76A 3KSZO 1R6VA 5SZKB 3FMGA 2LDXA 2PSFA 2XB6A 4QZVA 5J4KA 2JH9A 4YJ3B 2C3OA 1O6ZA 1YS6A 4YWJA 2AL7A 4Q7EA 1EWKA 4DEXA 1LDEA 4TN5A 5B64A 5FH9A 2CYAA 1JMVA 5A2GA 3GCXA 1SEPA 1N0IA 2J9RA 3SJBA 5C5IA 2OAP1 1DBQA 2J3KA 4KHZA 5B1EA 1Z12A 3C3EA 1GPDG 1ZUWA 3EDYA 3Q3GE 5B1IA 1UC9A 1B76A 5KBYA 1MOSA 3TW6A 1MX9A 1DBPA 1Y8AA 3SSNA 5TARA 1OC4A 3D54D 4UJ3A 3OO0A 5P8WA 3VDQA 4EPWA 1RC8A 4G5XA 3ZW9A 4TTTS 4ZV9A 4MLDA 2JNWA 3OPYI 2B21A 3CPSA 4Q00A 2O2GA 3LYAA 4M9UA 2FPPB 3ON5A 2H51A 2QTHA 1D8AA 1T3LA 2R7MA 4DR3B 2X8JA 1ES9A 1ISPA 1GVNB 3BBPA 3CH7A 3KPYA 3PVZA 1YJCA 1GZVA 1E58A 2Q4DA 1Z0FA 2G5PA 2PSJA 3F67A 5BY2A 2CCKA 4BO1A 5AVXA 2WI8A 4XYEA 2HNBA 4AQ7A 4HDMA 4MR7B 4X6UA 3JD3A 3DZ8A 2CF5A 4DUGA 5BOSB 2PU5A 3HCFA 1Z2NX 1IWPB 2R8BA 1X0XA 2WKSA 4LK2A 3RAGA 5A02A 1OBCA 1JMYA 4REOA 2VJKA 3UAXA 2KB0A 2VPZA 4FYPA 4XJVA 3WQBA 3UO8B 5C1DA 3ZKWA 1UDCA 2JLXA 5C32A 2YDYA 2FN8A 2VAWA 2XZPA 1L6IA 3CZMA 3GLQA 1USKA 2YWDA 1TIPA 3EYWA 3NPMA 4N6OA 4GH5A 4QHYA 3NHWA 5JWHA 2XB4A 4AIIA 3IQFA 4EB0A 5FTMA 2XNKA 2OYCA 1M7HA 1NNI1 4IWXA 3EF1A 3PQ8A 4DZTA 4LHVA 1ZZGA 4KTVE 5HYVA 1II8B 1SVKA 2NXJA 3SN6A 1B6TA 4G5HA 1ZGGA 3AIMA 4MRMB 1GTRA 3HNRA 2JFZA 2C42A 4Q18A 3WP1B 1N9KA 1QTIA 2HA6A 2YWRA 4CV3A 4LEIA 2RJOA 2QLMA 2A94A 2W43A 1SKBA 2CFCA 2JIMA 3KVNA 3SHTA 3TCKA 4IHJF 1CPYA 3NBUA 3ND5A 2OZLB 2ZI4A 2FK7A 2R44A 3H1AA 5C5DA 1YE3A 4FKMA 3ZCPA 1NOKA 3VR0A 1RPJA 3GGJA 2ZROA 3CZQA 2WUVA 3RVQA 1X3LA 2CZQA 3C3MA 1JEJA 2BFFB 3IJEB 1I3OA 5F9MA 3SKVA 4AJPA 3LA6A 2HCRA 4WL0A 1WQ4A 2A1UB 3KZ1E 5CVCA 3LSYA 4CEIB 3T99A 1GQFA 3WIEA 4EG6A 2FFRA 3U5ZB 3G49A 1KI7A 1CIJA 2R66A 4BAUA 4TYYA 1LNZA 1ZCBA 2F2TA 2Q6KA 3MG9A 1VLVA 4QG3A 4Z4FA 1QIMA 4LYAA 4MGIR 2REQB 3IR5A 3EVAA 3Q3CA 1UM8A 1Y63A 1Z36A 1W4ZA 2A9VA 2J30A 2ZIXB 2Y27A 3G2KA 1POWA 3R7WB 3TOXA 4S1WA 4FCCA 1GA1A 3ORRA 5FA6A 5AVYA 1YR3A 4WK4B 3FI9A 2R9VA 2VPQA 3R09A 3U80A 4HXEB 3PFGA 4BO5A 1X1BA 1OKKA 4QEKA 4L5AA 4INOA 2X1LA 2H7YA 1AHHA 1X7XA 2KMLA 3PUXA 2HCBA 3BXXA 5JVDB 3FX2A 1KJYA 4J1NA 4HO1X 1G98A 3Q3JB 5F2NA 3RRZA 3F5MA 4OJMX 5CDTA 3VH1A 9MHTA 2GETA 3PWZA 4ZODA 1AKMA 1L5WA 3V3KA 3YASA 3HVRA 1MAWA 4TLLB 4D80A 5A6SA 5C52B 2B4YA 2MSCB 2H06A 4OQ4A 5JZMA 1Q7EA 3K09C 3PZBA 2L82A 5UKDA 1HV8A 2PN1A 3QKUA 4H4DA 4ER3A 4PAGA 1PT7A 4LJ6A 4WN9A 4ZOLB 1XCMA 1GDHA 1Y3IA 3L8DA 5DN6A 5HJ2A 1UKVY 1UQTA 3T95A 3U0VA 4AO8A 1CWUA 5EIWA 2IPAB 3OE4A 1K8QA 2I1WA 4FXPA 4TKVB 3VR4H 4EPYA 4CKWA 4DC0A 1FNSA 3BGSA 3UV3A 1TMKA 4E32A 2EBWA 3BRWA 3N2YA 3VPXA 5BUCA 1U02A 3WKAA 4OG2A 3R0JA 4FBLA 3OZAA 4AWXA 3PT9A 1QLWA 2CKDA 2P3QA 4BFCA 1NT4A 1VIVA 2IZOA 3O8BA 2FX3A 3IQWA 1P74A 2G5TA 1U8ZA 3EZLA 4GPEA 4ZDJA 3S29A 1ND5A 1HURA 3CJTA 4Y2UA 5K2OA 3RJZA 1KBQA 2QMHA 1OFIA 2OV3A 3C7DB 4B3JA 4P34A 1RTKA 3ZK8A 4DLRA 1P7ZA 1XXHE 3QUAA 4K3VA 2QS9A 5F2KA 2Q2VA 3W7AA 3PUZA 4HAYA 4YVFA 2VT6A 5BXYA 5IZ4A 1YOBA 3FOEC 3DLHA 6GPBA 3ICQB 1B93A 5LMCA 1ZX1A 2AEMA 1P3DA 1LPBB 1XUOA 3DZHA 4Q48A 3QJYA 1U9ZA 1ULZA 1VJDA 3D2LA 1U2RA 2FYTA 1O6FA 3FG9A 3KYBA 1MTOA 5K0CA 1CUYA 1X42A 2GEUA 3HCPA 5DMHA 5LYJB 3ZHRA 3WNDA 2H29A 4EY7A 4W5OA 3KR0A 2XIJA 3GBSA 1IHUA 4OUDA 4DJEC 2V8OA 5JH7B 1IAQA 2GFIA 1YL6A 1ENYA 2IVFA 1YGPA 1BE0A 3AUAA 2HUNA 1RCFA 3H5NA 4J7AA 4ESEA 3EFHA 3FLBA 3R7BA 3RUIA 1H2XA 1P9NA 5DOZA 4B2LA 3R1IA 2AFIA 4TLBA 1HYEA 3OMXA 3PDUA 4NATA 5K4HA 3WYNA 4E3WA 2NU6A 1ODKA 2DBYA 4UXJA 2MWMA 3D0RA 3TZLA 1VQ1A 2CV2A 1G8FA 1WE2A 3BSSA 1DAFA 2J59A 3ILVA 4IJUA 1J24A 3RFCA 3LNCA 1RD4A 4OLFA 3C4VA 1NR5A 3Q7EA 3A1CA 4UTXA 4PBTA 1U6IA 3Q9NA 4FT4A 4XR4A 3VGJA 3LUGA 3GELA 5G4KA 1WCYA 3SR3A 2EKPA 4RTLA 2QMOA 3GVHA 2A0YA 1GXSB 4FX2A 5J2TA 3DDHA 1SHKA 2QRGA 4IILA 4NH4A 2ZZMA 2JI4A 3I1JA 3HLYA 1NVUQ 2WTMA 3S40A 4P7GA 4LGMA 4JB8A 4L5BA 4WZAA 3U4CA 5KINB 1WO8A 2PFSA 1G5IA 3CT4A 5DLYA 3EBLA 4KYVA 4J4HA 1ZP6A 1P2DA 4WEQA 2CJYA 4RY8A 3DHYA 4PPNA 3IIIA 3OZWA 3DYBA 4LPKA 3P2IA 2BKVA 4M53A 3GFRA 3PITA 4NG5A 1BMTA 4JB0A 4YXWD 1SC3A 2JG3A 2XZOA 4RE5A 2R4QA 1I3CA 2RJNA 1E63A 2G04A 2R7AA 3FHOA 2AMYA 1KF0A 2IHJA 2R68A 2ONJA 5FWXB 1LNQA 3HV2A 1SQFA 4LF6B 2R87A 3P9CA 4WCDA 4RTMA 4S1VA 2C2WA 5FI1B 2DBQA 1T9AA 1PK9A 3DEJA 1Z2EA 4O4IF 5H5JA 4BJ1A 4B6GA 4D43A 3DLTA 2X8BA 4CMIA 3HXTA 5CJPA 3ZLVA 3RSZA 2PUDA 1VHDA 1HZJA 4EDHA 4R2MA 3G9UA 1QVZA 4WI1A 1QLHA 5F51A 3N6RA 4G4SO 1O6BA 3Q5DA 5KJ6A 1YRLA 1XIVA 2A2ZA 2ON6A 4RNCA 1GFWA 4UUMA 3ZD6A 4RMIA 1PJBA 3OICA 3PXXA 2FG7C 4W8HA 2XUIA 2WQ6A 2NGRA 4WFKA 1UANA 3GEEA 3LP6A 3UJDA 4XTRA 3VU3A 1PG5A 5A4DA 1V26A 3CGWA 4EQ6A 2AOUB 3IKVA 4M3NA 4FVTA 4N5HX 1GARA 5AKEA 3I12A 1UJNA 3EQ2A 4AB1A 1N6IA 4RPCA 1E59A 4JP1A 4COOA 1PR0A 3GFTA 1W52X 2WYOA 3AYXB 4MDYA 1O2DA 4ENWA 2D1YA 5JBNA 4FFVA 3LZDA 3NTOA 3O2JA 5E4FA 2VO1A 4OJKA 2P11A 4UW9A 3E7XA 5C8YF 3IAM1 5TQ0B 4U00A 1COZA 1KNXA 5JPDA 4P3OA 2A0UA 1I36A 3AF4A 3K6SA 3TI9A 1E1NA 5AW4A 1TT7A 2QD3A 2J6IA 4C29A 3FHLA 1JEQA 4PGGA 4ALIA 1IWBB 3GJ4A 4EHIA 3IJRA 5JUWA 4XVUA 1DX4A 1C3LA 4OHPA 4KLRA 3W6UA 1V11B 3EOAI 5E8JA 1ZL2A 3BSFA 4DHWA 1PJSA 5AD1A 3RSQA 3HH8A 4CKCA 3OM0A 2BGJA 3KPWA 4CR7A 3L4SO 5IAOA 3FWNA 3A1NA 4HWPA 4BMVA 4D9FA 3KT3A 3RU9A 3UTDA 3S8YA 3KFVA 4TLEA 5AVKA 3ZDCA 5FWNA 2LCFA 2Q9BA 3E9CA 3ZWMA 3HZRA 5EIOA 5J5VA 3AK4A 2QZJA 2QAGC 2G5GX 1LPPA 5ARBA 1RJDA 2JH3A 3ABIA 4KDRA 4JMPA 3H5AA 3FGPA 4PSDA 4L0MA 1WPRA 3CB4A 1G19A 4N5DA 1JSXA 4B44A 3UK6A 1JZTA 1ZOIA 4YUAA 4RAQA 3B1XA 5GOTA 3L6OO 3SSMA 3PCRB 4KFRA 4GWLA 3F4BA 2FPSA 2IPLA 2WWFA 2ZIWB 3FYUC 2SKEA 3L05A 1N2BA 3LBNA 3X1KA 4BQEA 2G67A 2ONYA 5BWNA 3EDRA 3ZBUA 4OLBA 1M2VA 2A9QA 4WOBA 5HDQA 4LC1A 5KNBA 4C0AC 3HXMA 2UYHA 2JCGA 3QVSA 3WADA 2EP5A 3F5QA 4WW0A 4ZEMA 3LRPA 4OKSA 3NV7A 5LNK6 3A04A 4OHKA 4B7CA 1KETA 3NQ41 2BAGA 3UFBA 4I7EA 3TXAA 3ZY3A 2YIDA 2LV8A 4CMEA 2IE8A 3T3IA 4HUJA 2L19A 3ANTA 2PKXA 5JBIA 1R7RA 3FA2A 5HRCA 2FEAA 5GV7A 3FFAA 4K46A 1MNQA 5A62A 4ER5A 4RAOA 5K2MA 1QSGA 5D00A 1BO6A 3B3AA 3ZIAA 3V8RA 2J4CA 4HKTA 4W4TA 1C30B 4HDSA 4ZT6A 1CJVC 1R4MB 1ZNYA 4M8LA 3KC2A 1VJGA 2RB5A 3BORA 1YRBA 1W59A 3ISVA 2J41A 3GVCA 4BNYA 3I9FA 5FCDA 1LS6A 5CCXA 1ZPDA 4GU5A 4KAJA 3JQ7A 4GI7A 5CDFE 1W581 1W5BA 1Z0ZA 3A28A 4M8SA 4HMOA 4JU8A 4D9IA 2ODWA 4F60A 1ULTA 3FWKA 4X6XA 1A97A 5H9WA 3O8QA 1AK2A 1PIWA 2ANBA 4L57A 1I33A 4LQ4A 2NPIA 1ZHHA 1EJBA 3QITA 1HZZC 1P2TA 3IAS6 1V71A 3IDSA 4O8ZA 4QGHA 3EHDA 1W8IA 2OILA 1H4QA 2XXAB 5KC8A 1UPFA 1AZLA 4BUCA 2A33A 1TEZA 4AULA 1MLDA 2P27A 4RDIA 1MX1A 2Z1DA 1BMFD 1RYNA 2FEMA 3TZHA 4UOZA 4DS3A 4E33A 2WD8A 2ATCA 2QD5A 1FU4A 1IQ0A 3H1GA 2OQRA 3ROGA 3VR6D 3ZVMA 3TI7A 2G4CA 1K7CA 3LHKA 2NU9B 2ZUBA 1AHNA 2RJ3A 4X6LA 3BJZA 1NQTA 1ZRNA 2VPPA 1U8UA 2ILVA 2RAFA 5IBQA 1UPXA 4BMZA 1PQYA 2PA0A 1NNEA 4KSCA 5G0SA 2WB2A 4TX1A 3KJNA 3VDXA 4ZGGA 2J0UB 5K3AA 2XITA 2LP4Y 1NJ8A 3E2MA 3EQ6A 1DWPA 3OOJA 5DSTA 4U39A 2AN9A 3OT1B 3EJ6A 3QPCA 4NTZA 2FFAA 4ZCRA 2FZKA 2D5CA 1U8XX 1TYBE 2JGJA 3FH0A 1BGVA 4JUAA 1VCNA 3C15C 3VR3D 2HOQA 5CD1A 1DFGA 1W88A 2ZWMA 3O92A 2JGIA 3O4JA 3BILA 4LQDA 4N5NA 1RLJA 2OBLA 4C4AA 4AJ2A 2PIAA 2ID8A 4MP6A 2A30A 5DNEA 3RC1A 2YQZA 3DE1X 4QRDA 2AMJA 5IKXA 3PHIA 1KVSA 2ZRPA 4K86A 5CPFA 1GL6A 4M22A 1PD1A 4TQ9A 2OKCA 3SZLA 1DX6A 1P0CA 1EGQA 1LU9A 1QMGA 3DL7A 3N28A 1JLHA 1HTTA 2YWBA 3KZKA 4GG1A 4Z51A 3EDMA 4Q01A 4E2ZA 4BXOB 1SCUA 4JJ6A 1TVEA 3VR2D 3CINA 1HE4A 3VDMA 4W9RA 2HXGA 2CLEB 1IIBA 3JD2A 1GUBA 1JIUA 1UUFA 3B6ZA 1BOFA 3C0KA 2FR1A 1ZJ6A 3RI3A 3BL8A 1W30A 2X5JO 3SQNA 3ZJYA 4CUJA 1W94A 2RGNC 3CBQA 2IIPA 4XX0A 4HNGA 4R54A 4RVSA 4NCBA 4HAVA 1SKQA 1AKYA 2EEPA 1JXQA 4HY3A 4TYPA 3I2IA 1MO3A 1JTVA 2HIGA 4LX8A 4QTTB 2Q1WA 4FGKA 4TWRA 1M6YA 4FFRA 5AJUA 1YCFA 1G9SA 4Z49A 5GPBA 4DIUA 1SK8A 4Q1DA 4U8GA 4ES6A 1DLIA 4F04A 4JROA 1CDZA 3AV3A 4RPJA 3NM4A 2HBQA 4X66B 1Q0TA 4KX5A 2BYTA 3VU1A 4KPGA 4N0EA 1OVGA 4NMMA 1U3CA 3FNBA 3UJPA 1GYPA 1WTAA 3F46A 1VIDA 2CWDA 4GEGA 1TQDA 4E30A 4EW3A 2CMDA 4AJEA 5DM60 3QY0A 3GD7A 2F4VB 1LFAA 1RHMA 4KEAA 1S9HA 1IL0A 2Q7OE 2RKWA 4EF6A 4MHOA 3VM6A 2EU8A 2QTRA 2XXBA 2F8LA 2ZKLA 4HJXA 4IIJA 1G7SA 4I5GA 2ZREA 4FYKA 5HJ5A 2HK9A 1F2UB 4BWGA 2OP1A 2OXRA 3HY4A 1LF5A 3M7IA 4EYQA 2PJDA 1FBTA 3LHFA 2WB4A 4F9EA 3IB3A 1ZGZA 2NVWA 3WGJA 1P7YA 5JCOC 5LP6F 2A86A 3I62A 3ENQA 4HRYA 4EG8A 3T4PA 2C61A 5EP2A 1N57A 3QMMA 2WIAA 1EB8A 1JJBA 2HRZA 1F9EA 5FUVA 1CJKC 2R00A 4K6FA 4BWFB 1NVAA 1T91A 3FHTA 1UMDA 2NN3C 4P7JA 2X22A 2VATA 3KWJA 1H6AA 3CW8X 2HHJA 3ADOA 2KS6A 4ENVA 1TKRA 2ABWA 3ICWA 4TXNA 2Y66A 3HO8A 4ZU1X 2JIZA 5THQA 3EXHB 4RVCA 3LCCA 4IX1A 1V96A 2W2VA 5HDBB 1GZHB 3BT7A 1I8TA 4OXIA 3Q9SA 5JJKA 1FFHA 1ORHA 1ZUNB 1UADA 2J85A 3AKYA 5DZSA 1L7PA 3PC7A 2YRXA 3RSOA 3CUTA 1ECBA 3AR3A 2V3CC 3PP8A 3IAHA 2QX8A 2ZXFA 3C16C 2NU8A 2IH5A 3SY8A 1OTXA 4P4SA 4Q9LA 1B42A 2Z8ZA 2BE9A 1D3AA 1NDUA 2CVOA 2IS4A 4Q4JB 1O95A 1QHIA 1L8XA 3HJAA 4HQRA 4HG2A 4KGDA 4MX8A 4Q4DA 1FIUA 1Y34E 4PYLA 2P9YA 4F4JA 4ENQA 4KR2A 4A91A 3CJRA 3F1KA 3GW8A 3Q7TA 1I1QB 1FMJA 1Q2UA 2XMZA 1T9BA 2CCJA 2FGJA 2LUOA 2QMEA 3M34A 2QLNA 4HDRB 2NUPA 2C5GA 4ZJZA 3K9QO 1NI3A 3BGOS 5LQMA 3FDFA 3B20A 4J3JA 3L79A 4R4JA 2RGGA 5JMOA 1WBJB 3NHUA 1RE0A 1VTKA 5EP1A 3ZE2B 3TD2A 1MU0A 5AI0A 5HW0A 3FI0A 3QKTA 3G1WA 3LX8A 4C03A 3SZGA 3H99A 3N07A 4E51A 1NV9A 4BJ3A 2X23A 2CMKA 3OLZA 4IYJA 4BMOB 1TIBA 2JAXA 1MEJA 2V1XA 2BGMA 5TS3A 4BNHA 4A9AA 3ZZTA 1D09A 2QM7A 5E2AA 4OGLA 5FULA 2FZ4A 1U9CA 2GD0A 5JNUA 1JXOA 1OQAA 2OCAA 3SYMA 5K03A 1LBSA 1UOEA 4JC0A 1M74A 1C1XA 1KI8A 1KYWA 2JHCA 4IX9A 5D7NA 4RW0A 5JAUA 4GYWA 1TF7A 4XIFA 5JSZB 1T4CB 3GIWA 3LC2O 1RHQA 2FUG6 2IOHA 4AUMA 1KAQA 4ZN6A 1RAIA 2AC4A 2HAEA 4OM8A 3CUUA 2AN1A 1YFJA 2FHSA 1SCNE 3G2MA 4LHSA 4YUYA 4WCVA 3L07A 3V4LA 3VUEA 1JU3A 1NTRA 3VC7A 3HHEA 2GPWA 1Y4DE 2G17A 3EEFA 3WMEA 5B12A 2D0DA 5JJBA 1NYQA 2JGDB 4C07A 4JELA 1HDZA 1ORWA 1U11A 2KX7A 2B0CA 3BH6A 3JATB 3D0QA 2RC6A 4ZCPA 5SZIA 3U81A 3PKIA 1ZO8A 3WGVA 2LE0A 2C8JA 2ZIZA 3BGVA 3FCSB 4PLTA 3TRDA 4EHDA 5HXAA 5IVHA 4HEA6 5CA0B 3GZTB 4PV7A 4A6DA 4OMFG 2PWPA 3F4LA 1E79A 3GZNA 2OORA 4DLUA 1G7CA 3QEMA 3B6MA 4JJ8A 5DE3A 3QJGA 1YHNA 2OO3A 3IFSA 3TB4A 3VNQA 1ZDMA 4ZAGA 2VQSA 5H59A 3U3RA 1U63A 2HJGA 3ZCSA 1T8WA 3K1AB 3ET4A 4RA6B 4REMA 3N3BC 1N32B 2B7CA 1JQLB 5K3CA 5EINA 1P2BA 2OOKA 2QNIA 4GLBA 4RJIA 1WSWA 4DVGA 2XNDA 1N2CE 3NETA 1PE0A 5CDSA 1GKYA 5JAQA 1E2DA 3B5EA 1NW3A 1QH1B 4JU9A 1QUFA 1L4YA 1JYSA 4V1CA 1YZQA 4I2NA 3FUWA 3DLBA 4UQPA 3NDBB 1KMNA 3D6JA 1X0VA 3RF6A 4CIYA 2W2QA 1Q0HA 4N8SA 4B4DA 1DPFA 4JYZA 2HIAA 3DUFA 5KVSA 3MF4A 2V9PA 3QTLA 2QTFA 2FUEA 1E3MA 1YJ5A 2ZPTX 4OTZA 2BWJA 1JIVA 2WWTA 4QD3A 4EGQA 2CZGA 5A5VA 1F0NA 4PCLA 5L8VA 3SQWA 1EDEA 3JVUA 3K0AA 1MF7A 5DTRA 1X8LA 2L2QA 4FYJA 2BEVA 4LI0A 4DWJA 5I7UA 5FL7A 1Z0AA 4L2IB 5FA5A 4E5UA 5I4KA 4QG7A 1IVSA 3HB1A 2OHIA 4QHTA 5EE9A 1YDWA 5DO9A 1CUZA 3A3YA 3EH1A 3STWA 4Q3LA 2CK3A 1OREA 2Y05A 4QT0A 5E6RB 1J33A 3S0JA 4DR2B 4N5LA 3QPDA 3N2EA 3G1UA 5IX8A 1IZYA 1MT3A 1T8RA 1WG8A 5BNZA 2WHPB 1H69A 2AK3A 4FZJA 2FPMA 1GT6A 3OFJA 1PUJA 4FSDA 4R2JA 1FFGA 5DX1A 5IU6A 4HNRA 1B8OA 3AKDA 1XRSB 3I0MA 3KSRA 2OM6A 3KR1A 2OFOA 2HQSA 3OJFA 3BL5A 5SZHB 3KVOA 2DLDA 4QPCA 3KELA 4AUNA 1W0JA 1V1MA 3IJ5A 4BGIA 3GJ5A 5JANA 1T10A 1EVIA 1JBEA 1A3CA 2WD7B 1N8TA 3LXRA 2DFTA 1U7WA 2CEKA 2IXBA 4Z2AA 4GLJA 1KQNA 1OI3A 2OBYA 2QTZA 4H16A 5BWCA 1ABBA 2X3FA 2GASA 4OI2A 4YEDA 4QJIA 3DD1A 3FVVA 3IIEA 4GR5A 3NRBA 2GFHA 3KAPA 4OYYA 4DLWA 1BVHA 2I71A 1IFXA 3ILXA 3DYIA 4XARA 1WB4A 4KDCA 2W6PA 4RVHA 1WDKA 4DHEA 4JS0A 1AMNA 4YCNA 4OFBA 1JR4A 2IH4A 3ACBA 3I9OA 1L7RA 1L4MA 1U2GA 3C14C 3CKKA 5CVEA 3T5PA 1QU2A 1AKNA 2PY6A 4UEKA 1DS6A 3KYIB 4PTYA 1A9YA 1Q21A 1RPNA 2CNLA 4DREA 1TF2A 4II2A 3WFZA 2C9BA 4JT8A 4M88A 2D1RA 3L7BA 2NXCA 1HKUA 1FVHA 3AVOA 4M0UA 4IOJA 3THYB 2VWGA 1H2YA 2WJGA 3GOHA 3PENA 3B1KA 4XQGA 5E3IA 2QP3A 2LVBA 3ZVNA 1P1RA 3I9KA 5AW1A 1WPGA 1M2FA 3DV0B 4LV8B 1ORTA 1M33A 2DT5A 2OO5A 1JR3E 4I14A 5EGNA 4UQLA 2CVPA 3TQCA 2CKMA 3AM5A 1I7QB 1FSSA 3ODPA 3RBZA 4MUKA 3AVQA 4HGNA 2G1PA 1JXAA 1NRIA 4MGEA 1BVYF 2FPIB 2CNWD 2G36A 2WEKA 3FFWA 1KI1A 1SC6A 2DFNA 3GMIA 3ND7A 1ZM3A 3OQHA 1F1BA 4GMDA 2HH9A 1B1CA 1ZVJA 1RM4A 4RLSA 3NHKA 1RMYA 4XUGB 4YP0A 4D9BA 2JGNA 1NQUA 3C3AA 4Z1MD 2WKRA 1JDVA 3C43A 1B6RA 1EINA 1X8JA 3OZDA 1XB2A 3R9WA 2WIFA 4G5RA 2W6JA 3KQLA 4H15A 3TPZA 1PV1A 1CRQA 1N25A 1YZ3A 3K1YA 4KE9A 1NUTA 3D3WA 1W93A 3USES 3KU1A 4Y9SA 1K06A 3P0RA 3GYGA 3CX3A 5ELMA 3A06A 1NN0A 4DBLC 2EQ5A 3FDXA 5DGXA 1NQVA 2HWKA 1PG2A 5CBPA 4NU6A 5IPFA 2ZAYA 1MVOA 3CWCA 4D96A 3UMGA 4FGZA 2XGJA 3MRTA 5ALHA 4PC2A 3E8XA 3V7WA 4A2CA 4ZK6A 5HCUA 2GN8A 5H82A 2RSLA 2BH9A 1MZVA 4PSUA 4QQRA 1QK5A 1KKUA 3DFKA 4RF2A 3EPLA 4F46A 4U2DA 1KEEA 1NXVA 3TXXA 5KPDA 2HYDA 1Z5WA 3ILHA 1HETA 1JSLA 4M55A 1ULAA 1GTVA 1WVMA 3ZDEA 4OK5A 1EUCB 4ZREA 4U63A 2XWPA 3CGGA 1U04A 3OO1A 1E9AA 1GPUA 2R2GA 2AYXA 2ZTHA 4O4LB 2QI9C 2YC2C 4WCFB 1ZKMA 2FUKA 2YJ5A 4V0QA 1RYBA 4Y6SA 4EG5A 3CSSA 3NVKI 1E0JA 3AFMA 3LKBA 3OA0A 1T25A 3WK6A 1TMYA 3PPYA 2Y1LA 1QZUA 5L3ZA 4H3VA 3I9V1 3VO1A 4KN6A 1QVVA 1YQEA 2DFKB 1JEDA 1GU7A 3SNKA 2W42A 1A2KC 5LMUB 3PCTA 1KMHB 2GBPA 3T5AA 3ZYCA 4RPGA 2CD7A 2V9ZA 3U3OA 2P6NA 1O7JA 3CLRC 3OLQA 2CYBA 2O8FA 3I05A 3PYMA 1NXQA 1QH8B 2WVGA 4DDHA 4F96A 1V3TA 2ZB7A 4F91B 1IZ8A 3QJ5A 3WHKA 5A7GA 2ZSBA 3KT0A 4TL7A 2VRNA 1YB2A 4NBUA 5NULA 1K9SA 3V1MA 4LWZA 4K2HA 3SMVA 2GBLA 2JD0A 2C1ZA 3L6UA 2PT5A 4R40A 5JRJA 1XVUA 3F6YA 1GHTA 1DADA 2AXEA 1MHPA 2PQMA 5FV7A 2HRBA 2WMYA 5G0VA 4LHZA 4QQKA 5DNAA 2AZMA 4NIMA 3T7TA 2ZUEA 5D5QA 2A59A 4MDEA 1ZQ1A 3FNFA 1PTJC 5JAIA 1R27A 2F8SA 3VHXA 2ID9A 1KP3A 4MQEB 4QPDA 1NW5A 2HJSA 5CX1A 5KYUB 1YBMA 4YAEA 1JXMA 3UKDA 4D8XA 3I64A 3DE5X 3P45A 1IZZA 1KFEB 2YJ3A 2YXPX 3E15A 3F9IA 3PHCA 1K6EA 4H7EA 5AIBA 3ZVKA 2HADA 1JDBB 2BEJA 2YR0A 5EKUA 2EVWX 3JVIA 4MWDA 1UOPA 2KM1A 2YVUA 1BRMA 3HS3A 4WK2B 5DP2A 3RIXA 1JNYA 1OLXB 3SC3A 1DEKA 2JIOA 4GT1A 4XWYA 4ED9A 4EH1A 1E6EA 3DC2A 4K6HA 5FBKA 3QXHA 1UWLA 4LZPA 4RJJA 5F76A 4EVQA 3U1VA 4L4RA 3DZBA 3AL2A 4UPDA 5LZ7A 4OB8A 4BEWA 1WY5A 1DBSA 3VX3A 5LMZA 1P91A 3ESYA 3SJAA 1KDRA 1QANA 3QELA 3TLKA 3QMPA 2ZAOA 3CF6R 4HAWA 4KU4A 2BBTA 4MVJH 4G8CA 4HN2A 4MVJD 4O59O 3WLLA 4Z4IA 2BFDA 3UOWA 5CCBA 4JB2A 4RJTA 4ER7A 3ZY2A 4DR6B 4ZT5A 2GEVA 1C8KA 4JY7A 4NXMB 421PA 2XKAA 2ZDGA 5HR5A 1T13A 2E87A 1ISFA 4HXFB 5U9CA 3BMNA 2JGKA 3ITEA 4CM7A 2I76A 4I6JA 1XKQA 1XJCA 2PJUA 2OD2A 1BQEA 1BWSA 3JWPA 1QQ5A 4GDFA 1NVVR 5F78A 1LB1B 1JEYB 3IEXA 3NHAA 1AX9A 2EERA 2Q5EA 1N5OX 5L40A 2B9EA 4WJZA 5D5PA 4W5HA 1JDSA 3TTUA 1H1DA 1QMPA 1WLSA 4Z4QA 4JD5A 4ASUA 3BJRA 4Y2TA 4C7OA 2VQDA 5KWVA 3R20A 1W87A 3R75A 3BZBA 2WTUA 1DLJA 4GC9A 3SE0A 1T9GS 3UWPA 4P82A 5GJVC 3E7FA 3RTEA 4NBLA 4YBRA 2QPLA 1GUDA 4YJGB 1XNRB 3ZWOA 5I48A 4LKOA 3EN0A 1OHHA 3RSCA 1F7UA 4X93A 3NANA 5T4HA 4O5AA 1J2YA 2Y9MB 3OQ6A 4Q5IA 1CJCA 2RGUA 3OTQA 3KJXA 4KXWA 5DI3B 2H4WA 3X1JA 3EXIB 2XLCA 1U7OA 3DF9A 4PAWA 3C5HA 3MFYA 2D4AA 4DCGA 4DCNA 1KYIA 3DB2A 4RCVA 3EXEA 1EP9A 3KVRA 1B3BA 1VPLA 4I6EA 1IXKA 5LXTA 3JAMA 3BA1A 4FQ8A 2DR0A 1Y6FA 2P9JA 3WRYC 3UM9A 1ESCA 2UYOA 4GFDA 4PLFA 4BTVA 1TJPB 2PDAA 3CCBA 3I52A 1GTG1 1P5FA 1PW7A 2CWWA 3DP7A 1PJLA 5KX5A 1VC2A 3K0CC 4KXLA 1Y80A 5IUKC 5KQLA 1FP1D 3A14A 1V9CA 2LNDA 2JBAA 1IEVA 2JAUA 2W2MA 2C96A 3OZXA 4PAMA 3EXFB 3LBHA 4WNCA 5EPOA 1B0ZA 4DIEA 1VIYA 1WOYA 5BMVB 1WUJS 4U0JA 3GJYA 5IHPA 5TEVA 1BTOA 1SXJB 2OYSA 5ESRA 3X0DA 4ZCIA 2YN0A 4QU9A 4Q66C 5EWJA 4EKGA 2GJ4A 1JHQA 3T1OA 3BUSA 2JVIA 4EEZA 1Z2AA 2FR8C 4QAQA 3GR6A 1U3VA 4MPDA 3TRIA 4B82A 4QBKA 4A0SA 1C0LA 5BV8A 4FFWA 5B58C 1P6XA 1BD3A 2QRQA 2YV3A 3IUBA 4G5SA 4ZQIA 1WZ2A 4ZVQA 1PJAA 4LVCA 1WV1A 4G26A 3J7AC 3LQFA 4PWYA 2IV2X 1O57A 1WWKA 5JNRA 1T6NA 5IVIA 1G5PA 4DMCA 4BFLA 1FFDA 2PYZA 4JIMA 1E69A 3CRW1 2IS1A 4U8HA 1YBFA 2DPLA 3EZFA 1NVDA 3EVZA 1SIWA 4MQ6A 2INGX 4JQCA 2R48A 4WADA 1N75A 3KUCA 3DYVA 4RJ2A 4V3CA 1DG1G 4RFSA 2G88A 1VFPA 1OUMA 4QBFA 2XCLA 5A4MS 1YZUA 1QBGA 3V7NA 4CQJA 1Q7RA 4JC8A 5FTKA 2LBPA 4GKVA 1FJXA 1XJWA 2CXXA 2I2WA 1WUTA 2F8TA 5G53C 1JILA 3NOVA 1M2OA 1VBFA 2WVAA 4JODA 4IR7A 1BJRE 1JFVA 4QU8A 4UDXX 5LQDA 1WRBA 4BAZA 4B3HA 1DXYA 1GZ4A 3FUTA 3M6WA 4DM4A 4LZAA 1T0JB 1UBJS 3DQZA 3HO6A 4P7KA 2HFJA 4FBGA 4UVDA 2ZIGA 4KQ1A 4E7OA 2A9FA 2Q41A 2R7KA 5BVHA 2IFTA 4NMLA 3G0BA 4I81A 5COBA 5GMOA 2E4YA 3CE6A 3U7GA 3TIXB 4F21A 1CJMA 4KDEA 5EJ8A 1ZN9A 2CF6A 3FMOB 2G7ZA 3DBVO 2W6Z