1DJOA

Crystal structure of pseudomonas 7a glutaminase-asparaginase with the inhibitor donv covalently bound in the active site
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
330
structure length
330
Chain Sequence
b'KLANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMVAMTKTQDSKELQRIFWEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINASE-ASPARAGINASE
molecule tags Hydrolase/hydrolase inhibitor
publication title Reactions of Pseudomonas 7A glutaminase-asparaginase with diazo analogues of glutamine and asparagine result in unexpected covalent inhibitions and suggests an unusual catalytic triad Thr-Tyr-Glu.
pubmed doi rcsb
total genus 114
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.5.1.38: Glutamin-(asparagin-)ase.
pdb deposition date 1999-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1djoA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 1djoA01
1ZQ1A 5K45A 2HIMA 2JK0A 2P2DA 2HLNA 3NXKA 2WT4A 4Q0MA 3NTXA 4R8LA 5K3OA 5DNDA 1IHDA 5K4HA 2D6FA 2P2NA 1HG0A 1DJPA 1JSRA 5CBPA 1WNFA 5I4BA 4NJEB 1JSLA 4NJEA 1HFKA 4RA9A 4RA9B 5HW0A 5CBPB 1HO3A 5K4GA 4R8KA 2WLTA 3PGA1 1JAZA 5DNCA 4ECAA 1HFWA 2OCDA 1HG1A 1JJAA 5F52A 5DNEA 1AGXA 5I3ZA 1HFJA 3ECAA 4PGAA 1ZCFA 4RA6B 5I48A 1WLSA 1NNSA 1DJOA 1O7JA 2GVNA 4RA6A 1WSAA
chains in the Genus database with same CATH superfamily
1C1DA 2P6MA 2ERCA 2SHKA 4X60A 4JMLA 2BEUA 3BH6A 1M0WA 2FN8A 5AESA 2IXGA 2Q3HA 3M6AA 4M1WA 4YMSA 3ZY6A 1OYOA 1DG1G 1E7YA 3OE7D 1Z6GA 4LECA 2AJCA 4N5LA 1A88A 4O4LA 1QG6A 2IDMA 3OD1A 5CCBA 1N7JA 1OXMA 4NDZA 3QOFA 1Z7BA 3SR3A 1TO1E 4H7PA 4CHGA 2CL5A 3FRJA 3IXMA 4QLOA 4KL8S 4RPIA 4W9RA 1DDOA 3GLUA 2X8AA 4RMNA 1RADA 4LF4B 5JJIA 1VBMA 2QRPA 3UK2A 2JFFA 2ZI7A 5IZ4A 1IN1A 4HWKA 4JNKA 1CJMA 3MRXA 2HCFA 4LJ9A 4ZHQA 1ZHOA 1UKEA 4F3YA 5K3FA 1SU7A 3DWFA 4YP7A 1EFVB 2QUJA 5K0NA 4E2YA 3GXOA 1KMIY 3A1FA 1WBDA 3ESDA 5HILA 2O2CA 4OGLA 1A2BA 1VJ1A 3EXFA 4Y2TA 1QCZA 5MN5A 3RJTA 1ONOA 1SU6A 2E5WA 4DEVA 4UPDA 2XUZA 1JKIA 1C8VB 1YMVA 2UZIR 2XDQB 1KGSA 3E58A 1R6XA 2FOXA 2WWXA 3IJPA 4BGUA 3OPYI 1CKEA 1NX9A 4H15A 4JLVA 5JCJA 1BCRA 1TQDA 2CFCA 1NJ6A 3HHEA 3A0RB 2QM3A 1UKAA 4FR0A 1PV2A 2I3AA 1KS2A 4L4ZA 1JYEA 3QELB 1KR5A 3EAFA 4Q9KA 3WWPA 3IURA 5C7LO 2E4YA 2J67A 2G04A 2WZDA 1UOOA 3V1MA 1PWEA 4MPDA 2C94A 1X87A 4LWOA 1QVWA 1DC8A 1ZNQO 2WJJA 3AHCA 3WHKA 4BMPB 5KYUB 3OZSA 4QOFA 1QLWA 1NQWA 4Q0MA 2HLNA 4QFCA 5JQWA 2CUKA 3O4RA 4UHHA 3NEAA 4HVAA 2P2LA 3TZLA 5BOSB 1QVRA 4M2LA 5CIWA 2WWRA 2PRJA 2FZVA 1OZGA 1SBYA 5LJIA 2VZLA 3BTUA 2ZWMA 5FNZA 2QYTA 2Y1OA 1QX4A 4OA8A 4QX6A 4OHBA 3ROMA 4MYSA 4F6CA 2XRZA 5JPIA 1HNXB 3DHYA 1Q20A 4L4SA 5HCIA 5FOUA 1AMOA 1BXRA 1PWZA 1ZCFA 1FJXA 1ESCA 1A2OA 4J16C 2XNSA 1C41A 2W6JA 2R7AA 2G72A 2B1JA 3JD2A 4ZAZA 3ZY5A 1NRXA 2Z8ZA 2F1HA 5E6RA 3QX8A 3LQKA 4YYEA 4DWVA 1EIZA 5C3UA 1D1PA 1R9GA 5L45A 2C4NA 3FE2A 1R27A 1GQYA 1A69A 1D04A 3NTXA 2G5PA 4KNWA 4RZQA 2BJVA 2ZUFA 2W6MA 3KDSE 1N6LA 5ECYA 5FPQA 1V26A 1MC4A 1IOWA 3HFSA 1ZZGA 2XGMA 2B5OA 5DNAA 4JI0B 4EI2A 2PX4A 4R3WA 4I8DA 3N05A 2VH5R 2FPRA 4OL9A 4ZZ2A 5FUVA 2WT9A 3I9MA 4U6NA 1UXKA 4OD0A 3K09A 3OO1A 1SC1A 3WWDA 1NF8A 3S0JA 5LPNA 1EUDA 5CLQA 4NENA 3UKDA 3FNEA 1E4YA 1LDGA 2B1IA 1XZJA 3OF2A 4GYYA 2JIOA 2OFOA 2NQ8A 4D45A 4D5GA 2F48A 2REXB 4IQ4A 2FW0A 1QIDA 4JT2A 3NBQA 5BSTA 4WUVA 5FUWA 4JMPA 4QIHA 1RM0A 1TYDE 3J80A 3OUZA 1HL3A 2E85A 2VTKA 4BEVA 2FPKA 3IUEA 3R8CA 4BYMA 3GYGA 1YZTA 3H2JA 3JPYA 4LAFA 2FEPA 3GFQA 3CZRA 5KOJB 4MW1A 1Z38A 3EUEA 4ZV9A 5C35A 2O5CA 2EG5A 1Q0RA 3NWJA 1NSYA 4Z49A 1DC4A 5LC1A 2JLCA 2FEXA 3I2HA 1XK7A 2OGWA 1OGYA 4DR7B 5FTWA 3BCSA 1RWBA 3P45A 1EGQA 4RSGA 4HVTA 4OLFA 4CG3A 1XRLA 1JHUA 2OENG 1DJOA 1L7AA 2OO3A 4JHLA 4TROA 3UJ8A 3PPYA 1UPBA 3UMCA 4CM9A 1RM5A 4MMXB 2C29D 1ACMA 1EBUA 2ZSIA 2XE6A 5EGNA 2JLBA 5EERA 3CLVA 1WP4A 1G291 1PSDA 3KSRA 5DXAA 5JCZA 1T3TA 2PUVA 1QGUB 2FA9A 4RY0A 3KKZA 4H16A 1NW7A 3U3RA 3FSGD 3GC6A 1G41A 4F86A 1PZMA 1P9RA 2DP4E 8AT1A 1FYFA 3KXDA 2HPZA 3I9JA 4KXFB 4M86A 3VDNB 2X8BA 3VU1A 4A27A 4KR2A 1LW6E 3ILSA 3HHPA 3E2IA 3QBTA 5KREA 2XQJA 5E7MA 1QVZA 5IJ0B 1P17A 2D06A 2OFFA 3U49A 3DDWA 2FEKA 2W2QA 2GDZA 4JI5B 4ZDIA 2B2CA 2YASA 1U2SA 5KX5A 2ZAIA 3NETA 3D5EA 3KTDA 4TVSA 3AEUB 3CTPA 1K0FA 1LFDB 1TFUA 2RHMA 3DV0A 1A5SB 3SDBA 1YDFA 3VNBA 1Y3HA 2JGJA 2WIKA 1NF2A 2DY0A 3A4LA 3N5CA 3IP7A 1JDUA 1UK6A 4LYDA 3SM3A 1VBKA 1L4MA 4RK6A 2O3RA 3A6PC 5A6SA 1JG1A 1UP6A 4UD2A 1A4XA 2XY4A 3RSGA 1Q1ZA 4AZTA 2Z2YA 4P3OA 3HDTA 3T5CA 3I1IA 1C7QA 1QCCA 2QZZA 3IBFA 4UFOA 4XLLA 4EH1A 2O5VA 1IN7A 4MV3A 5JYDA 1W29A 2JGRA 1O95A 4RFLA 1XVTA 1Q0PA 3BEDA 2ZUUA 4OIMA 5BN4A 1H66A 3O0TA 4ONEA 3RROA 3WV5A 1NPYA 3R4VA 5A5VA 1VB3A 1NPTO 2D2IA 1I13A 3EIWA 3H87A 4LRSB 4DCJA 4EG8A 2VDWA 3ZBTA 4Z0TA 1MAUA 1LLQA 1TU4A 3FB1A 4DIBA 2R5FA 4FIZA 4Q37A 2F1KA 1BRTA 3A1EA 3PYLA 5L95A 2Y99A 3QVGB 1OXKB 3H11B 3TD2A 3IIJA 1CW2B 1U90A 1ZK1A 4ES6A 3RFXA 1W46A 3HO1A 2O3UA 3QUAA 4R1TA 3NBKA 1X7ZB 2BH9A 5J59A 1A9XA 4HCJA 2XB2A 5HQTA 1CT9A 1K1EA 1XRQA 2HX1A 3WZLA 1B0UA 3BXFA 4OLHA 5EYPA 3IODA 1U0GA 3PSAA 4B80A 2FLWA 2WVGA 2IU4A 2N3ZA 3NBUA 3F8WA 1ZXXA 4I2VA 3BD8A 4XRRA 2QPOA 3ACBA 1O5OA 3FPLA 2YIVX 3LVQE 4OY3A 3RJ5A 1RMTA 1ZNWA 2FX2A 3GN2A 4RVUA 3NKFA 4G1VA 3SX2A 1LBTA 3S40A 2JIMA 3AFHA 2PX3A 2ZETA 3BN3A 2E5FA 4YAOA 1I4TD 2WWYA 1O0CA 2K5UA 5B7PA 1DL5A 4I1RA 1CJCA 4V39A 1A3CA 2IU0A 2AZTA 1SC4A 3BMQA 3H4VA 3TCKA 2OB2A 3GVHA 1ADCA 2GEDA 3EIFA 3LW7A 1XMIA 3D54D 3MWKA 4GD3Q 2OHFA 4JHXA 1VYVA 3LUGA 3PF9A 4M1ZA 5HR5A 4Q3NA 3SFTA 4HTFB 1YV9A 1X74A 1QJCA 4WOBA 4J2OA 2NSLA 1BWPA 2OCLA 2DHEA 4JCOA 1QHHA 5EQDA 5JHGB 1ZAKA 2QNBA 3GGOA 3BM5A 4XQ9A 3VI4B 3K72B 5JJLA 4A2WA 3AL2A 4TUYA 4RTSA 1DAPA 1TO2E 3GDGA 2EARA 3JZDA 3K4QA 4BLVA 4BMSA 3EB9A 4KGXA 4HVLA 2OORC 2W6JD 3MJDA 4KYVA 3SYKA 2GMWA 4AS1A 3OWXA 1T0PA 4M89A 4K8RB 1WSDA 1X9GA 1CYDA 4RUKA 4I6GA 1PI3A 1MB2A 2FPPB 3ZU5A 2F9FA 3DBRA 5C7YA 4XYEA 1MAHA 3QELA 3ZG6A 4DBLE 5ADVA 3K0SA 2PLNA 1QH9A 2GCOA 1ZW6A 3GFBA 4FB5A 1RTTA 1PLLA 1CV2A 1W5TA 2FMHA 2WD7A 3FSRA 4LA4A 4M8IA 4X44A 4X85A 3REGA 3UKJA 3WA6A 4XRGA 1X3LA 3NALA 1EP2B 5JJBA 1J06A 2QN7A 1VI6A 1P29A 4L73A 1RP7A 2UXBB 4EG6A 4HRYA 4HRXA 2D0PB 4M8LA 5CGZA 1GA1A 3U7JA 1FW8A 1PJ8A 3CKMA 2IE0A 4DMFA 3E61A 1KTIA 4YAKA 3CONA 1KYZA 3CX8A 1L1FA 4DLRA 3FUXA 1R8XA 1VECA 1X1QA 3DW1X 4JUBA 4HWRA 3JYPA 3BMOA 4EHLA 3M49A 3D2CA 3DHWC 1I14A 1CD5A 1P33A 2CUZA 2X3YA 3VZBA 4LNHA 1C29B 1GPUA 5LP6C 3I09A 3RIYA 1KPHA 2UVDA 3HA2A 1ZN2A 1JI0A 3L8HA 3P7MA 5I48A 3CVVA 1H22A 2NT3A 3FCOA 3FOCA 4KH0A 3C16C 1NFRA 3E7PA 2NNLD 4F4DA 1F8GA 1JXQA 1SZJG 1GRCA 2YVLA 4Q1VA 1PR4A 4XD7A 3UMJA 2P9QA 4L5AA 1W9MA 4QPNA 3ZE9A 3GZNA 1YA8A 4EX7A 2YOFA 4JJFA 2PA3A 2QN1A 4M49A 4G5QA 4I81A 3JWEA 3DZDA 4MRPA 2X2OA 3JVDA 2H1FA 3LXXA 2ZBFA 3GA7A 3LY8A 3I04A 3O8LA 2DJIA 4MS1B 5EFOA 5KQRA 2ZJZA 2UXDB 2HMYB 3WYDA 1EWRA 4MEBA 5JBNA 5FTKA 4DR5B 2HEGA 4WCDA 1AKEA 4O2BA 2EKQA 2PXCA 5AJYA 3KZKA 4XLZA 1PQ4A 3RK0A 1AGRA 3ZQ6A 3L4BA 3MOGA 1E5QA 3D3NA 2C7BA 4CEIB 5A7GA 3N87A 2DLDA 4EHNA 5AW0A 3OM0A 5FORA 4PPNA 2I4NA 3RVOA 3G5AA 3N1UA 3IHTA 4KIGA 1NR1A 3PXBA 5CK5A 3RFCA 2V6MA 3ED5A 3DKPA 1G21A 4C7BA 1MQSA 5F1YA 2FPSA 1HDXA 2FUKA 4IQ0A 5IJWA 3PRYA 3L7LA 4D8WA 1N8SA 3DEHA 2ZYVX 4F2DA 1K08A 2NX2A 3S2FA 3NDIA 3O0DA 1OZ0A 1QP4A 2P2GA 3BX1A 1P1IA 5JSZB 4N6GA 4XIIA 2LZ0A 4Y0NA 1GILA 1SG9A 3UMBA 4GP7A 3M5WA 4PSVA 4R68A 5CA0B 3THYA 1G6KA 5I4KA 2ZATA 1NMQA 2R87A 2JI9A 4DJFC 2NZWA 2D4HA 2PO7A 3V97A 1X7XB 1EJBA 1U2DA 2V3VA 3RS2A 1SXIA 3TSZA 3OE7A 1SUPA 5C8DA 1DTEA 3VTAA 1UC4B 1PGOA 4H7DA 1QGUA 2QMZA 1YK1A 3CUWA 3E9MA 4P3NA 5HFAA 5CLHA 4B6JA 3BD9A 3KPYA 3QTLA 1H0RA 4XTRA 2V0CA 1G8JA 5HEKA 1ZR4A 4JXKA 2D8MA 2I67A 4V0SA 2CXNA 4L7QA 2JFGA 3L0CA 1Q0UA 1XXHA 4G26A 2H85A 1D2CA 1DT5A 4X24A 5HJEA 4PX3A 4A4DA 2RBKA 4FC7A 1MTOA 3OSUA 5ADWA 1KQPA 2A0KA 5AHOA 5B3AA 3JWIA 4S0ZA 1HT0A 3FPEA 2REQB 3OZXA 5D7BA 3OQBA 2W0MA 3I8OA 1BMTA 4IO1A 3OJCA 1FDTA 4XVCA 2BBTA 1GNVA 2IK8A 2Q5CA 4RF4A 2F62A 2GXUA 2ZE5A 3GOQA 3GRFA 5DBHX 3DFIA 2VDMB 1YGYA 3ICVA 4G9EA 1NASA 3O7WA 4IOLA 4COOA 3QEJA 2WJ3A 2OPBA 3D7NA 1P1FA 2EXXA 5KYNA 1EFCA 5CD1A 1JYSA 4BZWA 2VF5X 3MQ4A 2XADA 1U8FO 3RHFA 1MOPA 2A86A 3HBAA 4QYXA 3AP2A 1M3SA 1T4GA 2DT5A 1R0CA 3QE3A 4J0EA 3FD8A 1V8ZA 2R8OA 2V5VA 1N2CE 3D3EA 4R16A 2YWJA 3ADDA 4AD8A 3NORA 3AUSA 4ZU1X 4BASA 4M1KA 1C9MA 5ED0A 3LWNA 2VC2B 4G0ZA 1I7LA 3EZYA 3KXPA 4P86A 4QTZA 2HSJA 2RGRA 1C9KA 4XQCA 3D8SA 4Y2PA 3R0QA 4C7VA 1VB5A 2CVOA 5CFRA 1SBCA 2QMHA 4U9UA 5CGQB 1O6ZA 3EWAA 1VC2A 2F55A 5I9SA 1OXUA 4M76B 5IT9A 1T4CB 4IIJA 2AOWA 1MA0A 2QRZA 2IYVA 1HG0A 2HWKA 5LLSA 1Y7IA 1XDSA 2J9XB 3ICCA 1Z7YA 4J8PA 1X1DA 2NUPA 1GP2A 2W37A 3F9CA 5B37A 5LQJA 3DGEC 4CW7A 1EXNA 1ORHA 2CXSA 2BC9A 4DLUA 2EZ9A 1IU9A 1UJMA 1Y7PA 1SCDA 2A0WA 2E89A 3AC0A 3E9QA 3P1JA 1ODLA 1Y3DE 5CLGA 4ECAA 1K7CA 2AQ8A 2IYXA 3MD0A 4NONA 4PCUA 5K3AA 4G0WA 1AKQA 1ZD4A 3MS7A 1TZMA 4XUGB 1XHFA 2LDBA 3MJRA 1SCQA 2OCXA 1XEXA 4FSXA 3HS3A 4QNRA 3W5CA 1QF7A 4BNGA 2OYSA 5EOVA 2E37A 1OROA 4D42A 1E1CB 1XQ9A 3AJ8A 2J45A 4BVLA 1ZN9A 1SUFA 2WMOB 4GYKA 3I6BA 1NKSA 1UFVA 1A8UA 3A05A 1F0YA 3RRFA 4J0KA 4IGAA 1KYWA 1Z17A 4UFNA 2HBYA 5IKXA 3QSGA 3IOBA 3CF6R 4XSVA 5DWVA 1THZA 1S4MA 5CEFA 3VSCA 5A1JA 1HDGO 4ETIA 2BBWA 1I7QB 4OKNA 4N7JA 4HDOB 4P3PA 1X7WB 2ZK7A 2RSLA 3DZJA 3L8GA 4FC6A 3O4IA 4UU7A 1R00A 2RGNA 3H83A 2P6UA 3U4QB 4C4ZA 2VPQA 1WCXA 4BJ5A 1EG2A 4OH1A 1U4OA 3UJDA 4C07A 3HB4X 1ODTC 5IM4F 3DHVA 2KMLA 3L6RA 5A62A 3DZKA 1EBBA 2VBGA 3TKAA 3E5HA 1KH3A 3EFOA 2B25A 2WIAA 2L69A 3G79A 1PRYA 3JQFA 1N7IA 3QH4A 5DHAA 3DYIA 3WGZA 3C7DB 2X7JA 3PEFA 1F6WA 1YVRA 1KEEB 4PYKA 1BGXT 1M73E 2QAGA 3C7AA 3HCWA 4EOGA 3D7MA 5A9RA 4CDRA 4AZ0A 3JAMA 3D6AA 1U8XX 3PXUA 5GGYA 2OL4A 1U3DA 2ZTLA 3LZ6A 2X2FA 5A1TA 3I1YA 4HHEA 1N4AA 4ZK6A 3HB0A 5DMXA 4TMXA 3FFXA 2HZBA 3KXKA 3RFFA 3BL8A 3Q9LA 3K2BA 4DQUA 1V25A 4KFUA 4IS2A 1Z2OX 3ETEA 4XLTA 2IYAA 2PLRA 3C5VA 3ZV5A 1EP1B 2I6UA 4L2IA 4C5AA 3B13B 2ZSKA 3KT0A 3V7UA 4GPIB 4I0WB 2PFSA 1QIIA 3L7JA 3S1AA 5MDHA 5IP5A 2W4MA 1Q74A 5ERGB 4EPWA 3EODA 1ANKA 5JJKA 2YJ5A 1RW4A 1ZESA 2PTGA 2F1OA 4TV9A 1F48A 1NSTA 4AB1A 2JLUA 1KZ1A 1VPVA 4EHAA 2JGLA 3DR5A 1NUSA 3PGMA 3DV2A 4TLAA 4YRDA 4ZVQA 4MRMB 1W94A 1XQ1A 1QTQA 1XF9A 1GG5A 3ONFA 1Z75A 2IXTA 1TJ5A 3A1UA 3BL6A 2ARKA 2JAPA 3NU1A 4NBVA 2OCIA 5HDBB 5CAEA 1F8UA 2DFLA 2DBRA 4PWYA 3W1VA 2NO6A 2IZZA 4HYEA 1E1YA 3V4SA 3ABSB 4L8WB 3SQXA 2AFRA 3O4FA 2QDXA 2TS1A 3VR2D 2Y66A 4CHTA 4NCBA 1V5EA 2YWHA 1WF3A 1RPAA 2VT2A 3FTCA 1Z45A 3KR1A 3G0OA 3MFYA 3ZOZA 5EP1A 3A11A 4ESEA 4GOLD 1RJFA 2JEYA 1L5HB 3PLAE 2D0IA 2QOEA 3X1JA 3A9UA 4NIMA 3NBMA 3PUIA 3WO0A 1WLYA 3U44B 3JSAA 2QENA 5LMCA 3TGPA 2H2DA 1TD9A 2MYPA 2W2OA 3T4XA 2FOIA 2AF4C 3FCYA 4WEOA 5HWSA 4FW9A 3FYUC 3T54A 2RARA 4QD3A 4UVEA 1T29A 1XC7A 1KIFA 1NDHA 1HMYA 4Y1RA 4JJKA 5CUQA 3D3KA 1O6GA 4PAWA 5F3DA 3TUJC 1EK1A 4CKWB 4TS9A 4FFVA 1FUIA 2W48A 3WGNA 4D82A 4L85A 4DV4B 1GTMA 4MGIR 4D9MA 1OH6A 4AY4A 4C89A 4AQ7A 2PQ2A 3RRNA 1MO3A 2HGZA 3DM5A 3FOWA 5F73A 5F51A 4UOQA 3NHBA 3WLRA 2Q3MA 1JRLA 3PQ5A 4LZNA 4P82A 5GP1A 5BWOA 5DSZA 1PJBA 3R3UA 4ESOA 3EWSA 1CY4A 1GNSA 1LW7A 1OMOA 1Q1QA 2P67A 4TN1A 3X1MA 5LNK1 3OZVA 2BGWA 1W25A 4OFBA 1DIRA 1A9PA 1IY1A 1F2VA 2PSEA 4EVSA 2FLKA 1A97A 5BNTA 1I2DA 1LJLA 1U98A 2OY0A 4MUEA 5DTRA 5B1SA 5I7UA 4BNZA 2XGJA 3FOZA 5HIKA 4RFSB 3M7IA 4Q7MB 1E1MA 3KFLA 5LMUB 2R7KA 5CDFE 3HL4A 4WBSA 4RHUA 2ZRCA 3T15A 4KQMA 2CXRA 3OHSX 2ZITA 2VZEA 1ULBA 2VZ0A 4LSGA 3AUTA 1JN0A 1A77A 1CHNA 3R77A 5E2AA 1G9TA 3RUCA 4NARA 4GGOA 4C5CA 3FDJA 3TZHA 2RCNA 4PC6A 3IIIA 5DBIA 3GGJA 1ZU4A 2IIPA 4R1NA 4C0HA 4DCPA 1ULSA 4F93B 4YY3B 2RJOA 3CPEA 1PZGA 3DZFA 3F8TA 3GUCA 3KSZO 4LJAA 4IV5A 2EERA 4V0QA 4CIAA 3JQQA 4B0PA 3DCIA 1UBJS 2H18A 1ZRMA 1A9SA 2GPNA 4MVWA 4A2QA 4WNIA 3C8UA 1ULZA 1XD9A 1JKMA 4V03A 4YRFA 1PAUA 2QZ9A 1GL3A 1LQ2A 1UBLS 2J0UA 3K70D 1AS2A 5A0TA 4I1UA 2BE9A 2RH5A 5J2UA 1CZRA 1TLLA 1HLPA 2ZUSA 3Q5GA 2XRMA 3O5AA 3VPBA 1XTZA 4UREA 3N0VA 1RR6A 2E21A 3GLFE 2FWAA 2VJBA 2J5RA 3RDPA 1ENYA 1XYVA 3GEMA 2X22A 3M6LA 3B1FA 1JF8A 3DT9A 4QYMA 3SM9A 1J7JA 5JZ9A 1WPQA 1IC6A 1P5RA 2K2QB 1WUHS 3TMYA 5TY0A 4W8HA 4EBBA 4FMDB 4KSBA 5KNDD 5HF5A 1Q0SA 1SR8A 3W77A 1N5KA 5BOVA 2BTEA 3TOSA 4RIGA 4AIRA 4ZI7F 3CLRC 4UCXA 3MC1A 5CX1A 4JI7B 3MELA 3K8OE 4HLDA 2EHDA 1VJ5A 3FYCA 2ETVA 3PQDA 4MQLA 4CKCB 5AKEA 1GG2A 1SVOA 3DFZA 3QXJA 2PZEA 1XL1A 3RARA 1MW9X 4PFJA 3RHTA 4XIFA 3BWXA 1M0TA 2OM2A 4V38A 5HKAA 2Q4TA 2FZEA 3E8MA 4LJKA 5DE3A 5HBRA 5JZSA 3K0AA 3QA3E 3RRXA 7REQA 5BSGA 3DAHA 4EZIA 4HGQA 1SUSA 3WWZA 5TF0A 5KOHA 1NTOA 3G2QA 5JAHA 1TZBA 1VJGA 5GJWC 2HCTA 4GRIA 3SIPA 1I4LD 5BV7A 3DNMA 3KLOA 1GM5A 2O54A 3NEJA 2EW1A 2P69A 1PHRA 3G2JA 3HJNA 3HLKA 1SZPA 4DCMA 1ZNXA 4ZVMA 5C1BA 5IT5A 1T2AA 1YS2X 2NLOA 2WC1A 3WWOA 4BB5A 5KDDA 1KKUA 4PZYA 2MWMA 3GCGA 1GXSA 4ZV4A 4I55B 4IIJF 3AVQA 1SHJA 1YL7A 3M4NA 5KWIA 4IXNA 4WLEA 1CLUA 2KW5A 3FOBA 4O02B 3LCMA 1CETA 2BCJQ 2QVBA 2F8MA 2WYWA 3W5VA 3WQRA 3ITKA 1YDMA 1ZUNB 1BD4A 3UXYA 1N6PA 1T3ZA 1QQ6A 3LT5A 3ZX4A 6CHYA 5T67A 3W2IA 1LVGA 1UEJA 4DE5A 2YRFA 4XSGA 1IWBB 2I2XB 2XSZD 4EFNA 2PLWA 1R9NA 1L4UA 2WU0A 3IXLA 4B75A 4C6TA 4RULA 2ZI6A 3FPHA 2IV3A 2YHBA 3K0CC 4JB3A 4Y98A 4YCNA 1DCTA 2ODWA 3AU9A 5CHYA 1VHJA 3BORA 3CLUD 1SUDA 3BC1A 1TM5E 3IEVA 2B78A 3GB9A 5EHGA 2R60A 2FYTA 2JW5A 3MILA 3BMNB 3LP5A 3K16A 5F35A 2B2NA 4KIJA 4PHHA 3AF6A 3ZDBA 4OQYA 5TC4A 1FZTA 1Z73A 4K8OA 3K9LA 5AUOB 5JI2E 5JXJA 2EQ5A 3Q7TA 1IMJA 2AMJA 2SKEA 3HKCB 3IMKA 2C7QA 4BO8A 1Y8ZA 5EXDA 2O2EA 1BHSA 2QVZX 3FVWA 1F38A 4IDFA 4LDRA 4B6GA 3MUEA 1CZKA 5LWQA 3VNSA 3Q88A 3GEHA 3QVOA 2L0XA 5KNBH 1S2IA 3WLOA 1T5SA 1FUYB 1CHDA 1UZMA 3D6JA 5F12A 3LO8A 2ZM6B 3IT1A 1U7HA 2JRCA 2P2YA 4K9NA 4GUAA 4UAJA 4GMDA 3AW8A 5AJWA 3R0JA 1H4SA 4COKA 3S7TA 1W4LA 3HRHA 5DH9A 3EZXA 2GD6A 5F1KA 1YD7A 5CA1B 2O1XA 3K8QA 1KEUA 2W2NA 3SYMA 3MINA 3BB3A 2BFNA 3Q6NA 5JNVA 3CX4A 1UDCA 4FKZA 2VF7A 3CLTC 5LYJA 5BY2A 2ZM5A 3NOXA 1QMPA 1W2WB 2P65A 3WS7A 4ANFA 2J59A 5I4CA 4FTWA 4YJKA 2REBA 1FSGA 1P73A 2BCGY 3G1WA 3O6VA 4IZ6A 1GPDG 1I0IA 5T6BA 1NYQA 1X39A 3EDYA 1H5QA 3KX2A 4K6GA 4R31A 2AHOA 4UNPA 3WR5A 2HXGA 4XJXA 2IH2A 3CEPB 1LWNA 1XJWA 1KE1A 4ZAWA 3KD3A 2IXEA 4JLAA 4RVOA 1YR8A 2BEKA 3UYLA 4CV3A 4EGQA 1GFWA 1T2DA 1MZVA 2OK7A 2QF7A 3BJZA 5ALXA 3WGOA 4ARBA 2ZTSA 3KJEA 3SE0A 2PL9A 4LN1A 2QPTA 4C2UA 1G3UA 4I1IA 1M1ZA 5EJGA 4Z1MA 2GK3A 1OFIA 1EUCA 1CB7A 4X5OA 4REQA 2DRIA 1XMXA 3KT6A 4XYLA 2Q3DA 1RJDA 3I61A 2O8CA 1BN6A 2I80A 2IZOA 2I7XA 2PL3A 2Q0XA 3ROZA 1XCBA 3COJA 1NOIA 1C7RA 1S2GA 3VPGA 3LP8A 5A7FA 3FKJA 3ELDA 1KSFX 3KU1A 1N78A 1HYQA 4D9IA 4M0FA 3KQOA 2ZROA 3P4YA 4A73A 3LC0A 4YPFA 4CM4A 3RE1A 4NY1A 1T8WA 4BAGA 2I8CA 4FFLA 2DHQA 5EJ5A 4N9QA 5HTOA 1JJIA 3KYJB 2HB6A 3N2GB 2H3HA 5ALVA 3QUBA 2W00A 1HDYA 1RXCA 1ZVMA 1NQAO 3QBVA 3CIOA 4NZZA 3RHZA 1T1SA 4JYBA 1F4VA 1OHHA 2GJKA 4KMMA 3JV7A 2JB9A 3RYIA 3WIOA 2QX9A 3GJYA 2BWJA 1ZMXA 4GM1A 3VQTA 3KJNA 1PJAA 1YU6A 4EUHA 2PXXA 3D7KA 1EEHA 4ICIA 1DHTA 3BGDA 5HMLA 3KKKA 3QIVA 3A26A 2X13A 3NAMA 1PT7A 4HQNA 3HB5X 3G85A 3TUZC 3TQQA 4GWLA 4WERA 3S55A 3LC2O 3K71B 2QY6A 2IHJA 5BN3B 4LY6A 1O6FA 4ZTZB 1ESEA 3OLZA 4RJKA 5E6SB 4JJAA 1XBTA 2E9SA 1KORA 1J33A 1JB9A 5CFLA 3L7IA 3AILA 3GLKA 1EFDN 2R66A 3FMPB 2ZI9A 4TTVA 1PLJA 3ZWXA 2FFRA 4MVJD 4NBSA 4MB0A 5TPWA 5IC6A 1DAMA 1IHOA 1R5OA 4BMYA 4PPFA 1UJNA 3L8CA 4BP9A 3CKYA 2H17A 3FSJX 3H9UA 1XCGB 4KPGA 4US0R 1PLKA 1UJ4A 3DUFB 1SB8A 1N2ZA 1N2SA 4PE5B 1GG8A 5L4LA 4YCBA 4FFBA 2ZS9A 3TSCA 4OI0A 1H42A 4LNUB 3FRHA 2MDTA 4LMBA 5IULC 1QDUA 4B4UA 3UOWA 3PCRB 1UP7A 1NY5A 2D2EA 5LZ9A 4EG1A 4IW3B 1S0UA 5EGSA 4DQKA 3F96A 1B93A 4HAUA 4C3ZA 2KI5A 1R8SA 4JB2A 4X64B 4DSZA 4YJ3B 1GU1A 1G42A 1UPCA 1AZTA 1F2TB 1G55A 1GQFA 1HDRA 4NFSA 1R4MB 1OFUX 2ZAYA 2FPGB 3P0JA 4URUR 3RC2A 2IYNA 1Y6QA 3G0CA 2WSBA 3I8SA 3ZN2A 5JWOA 4LDZA 5LU8A 2ZZMA 2VRWA 2RB5A 5L4SA 5EIXA 4TYYA 1M2JA 4CG0A 1XDUA 3ROKA 1B76A 2GNOA 5KNLA 1D6SA 3DV0B 2B82A 3JYOA 1JQDA 4FFWA 1EXVA 4B40A 3EVCA 3C4VA 1WULS 1CY8A 4I1VA 1Z4MA 1FRFS 2YMQA 2I65A 5K2MA 3O73A 3RRMA 1YDGA 3FSGA 4MHSA 3RUAA 2V1UA 4U0JA 4L4XA 5D84A 1WCIA 3K9NA 2CZQA 5CIYA 3GLHE 5BSRA 1JHQA 5DT2A 2P0AA 3SJUA 2XZLA 2OV8A 1E6CA 4E31A 3BT7A 2TRSB 1Z39A 3EIQA 2HPVA 3O3OB 2WF6A 4RH3A 5JEDA 1YAJA 4LG1A 5KTNA 1WX1A 1A0OA 3RVSA 4E5PA 2HRRA 1QYXA 2PUTA 2D3TA 1C1HA 5BV0A 4DSOA 1KH1A 1V5GA 5HUHA 5J2TF 2NIPA 1J49A 2WYOA 1THGA 3KTAA 2QRNA 4AU1A 1N0HA 2QV0A 1MJGM 3PC8A 2JFOA 3PRHA 1VYHA 4E5SA 1HLFA 2YS6A 5A0FA 5IN4A 1Z5VA 4G89A 2OESA 5JARA 2P4EA 1Z2PX 3HR8A 2H1RA 3DTVA 3MSCA 4RZ2A 5AJVB 4UASA 5LIRA 3OIGA 1XU7A 5KDLA 1PG2A 4INJA 1XD8A 4E3ZA 4ED9A 5AW1A 2BYTA 3MTIA 1RAAA 1LPNA 2X5KO 1ONNA 2PH3A 4Q9HA 1G9XA 3B53X 4A6PA 4K88A 1IZ9A 1AH2A 2II6A 2Q1WA 3IP3A 3C3PA 1NW3A 4UDYX 1R0YA 4RTOA 2WT8A 4WKNA 4LOAA 1U02A 4QXAA 4HN4B 2FQXA 3HMQA 4GS5A 3RUEA 4UHJA 1S89A 2Z3VA 4P4NA 4P4UA 5EC8A 5EFZA 4GP9A 3T3HA 3JX9A 1QZXA 4FLMA 1EVYA 2BEWB 2H0QA 4FNAA 2XGGA 5EMKA 4MDFA 3IEXA 3ABRB 2COEA 3SKXA 4C7JA 3DPSA 2ZXFA 4D5EA 2VHXA 4X65B 1PDWA 3U3OA 1L4NA 1I1QB 3QVUA 1YR7A 4BO4A 1F7VA 1KY5A 1G3IA 4HQ0A 1XR3A 2IW3A 1MOZA 5EJ2A 1UMCB 4AJOA 1DJQA 3L6UA 3AKYA 5KSZA 4KB5A 2WSSD 3K70C 3C6BA 3MJVA 4WH0A 1QP7A 1PD1A 2AG1A 3LWDA 3NM5A 1ZOPA 1ILEA 1PNRA 3WMXA 4DCOA 2VLBA 1GOTA 3U81A 1LLDA 2ZRPA 1XRJA 1CE8A 2Y6UA 1E7WA 1S8AA 3O38A 1NUPA 3K96A 2FKAA 2D2VA 5JZBA 1G4AE 4ETMA 4QXRA 1UWLA 1TCUA 2A57A 1GFSA 3KZOA 3P27A 1T9HA 2ATCA 3A4MA 5JASA 1DZ3A 3OPYA 4B45A 4F2HA 4IHKA 1MVOA 1MTZA 1Z4IA 1GT6A 1RC0A 4RK4A 2VO1A 3M4ZA 3ILYA 2MSNA 1QAQA 2NYAA 1DXYA 4PC7A 1G20A 3PQ8A 5FADA 1V8DA 2PS3A 3EEYA 4QFMA 3PL1A 4ZCTA 1NNI1 3NASA 3M3HA 2JLYA 2YTZA 2BFFB 3UT5A 3GEGA 1XMSA 4G5HA 4HFMA 4ENWA 3ZCQA 4K5QA 4DKXA 2Q5IA 2QE7D 2Q3EA 2PDAA 1C9YA 1S8OA 4ZQCB 1R4ZA 2PSSA 1A9ZA 2AWNA 5FBZA 2R65A 1N9ZA 2XYQA 4DLNA 4HDKB 1EFKA 5TVKA 1KMHB 3BRWD 3QV1A 4HBZA 1J2RA 1RIIA 2O2SA 3HGTA 4GOND 3R40A 4MIOA 5BQOA 5K6TA 5J58A 3I5XA 3GFOA 4C2AA 3NI2A 2IWHA 2ODQA 4NXNB 1U3WA 4MLPA 2JHAA 1E7QA 1D0IA 3F5DA 2BFFA 3IP1A 4MVXA 4FPXA 2QRHA 4YUAA 2F1RA 2ZJ1A 3S27A 2B9EA 3D6MA 1KAEA 3GY0A 4UEKA 5C34B 2X3UA 4QODA 1I0ZA 1BXRB 1XZQA 1EJ0A 1PJ3A 3BK7A 3UBMA 2Z9BA 1V4NA 3PD1A 1RJ9B 1Z35A 2BZ0A 3HXTA 4FT4A 4NL4H 3KEOA 3V00A 2ZZNA 2CFIA 3D59A 4IVRA 2HZ7A 4LVOA 3GJ8A 4M98A 4MR9A 4RE5A 3GD5A 3SJBA 1L5MA 2P6RA 2CN1A 2YFYA 3SBEA 3W1EA 2H51A 5ALPA 2ZIXA 5IAJA 3ESCA 3F3SA 5CM2Z 2P7HA 1AVTA 3RGWS 5KKAA 4M9RA 3V6MA 2WYHA 4YJHA 3A1WA 4B76A 1D6MA 1VPDA 1U3TA 2RI0A 1Y80A 2HMUA 1KNXA 2J33A 1JKFA 2ZTMA 3QU9A 1DKNA 2YW9A 4AMZA 1JIKA 1TQHA 1IUPA 2BR3A 4R5MA 3WLLA 3UMGA 1QB8A 4RHFA 1ZP6A 3A7EA 4X84A 1QIFA 2I3GA 4NU0A 3RU9A 3RYTC 2HDOA 1N36B 3F5SA 2W6PA 1ZVVA 4W5NA 4G0OA 5BUQA 1Z4JA 2HMSA 4MWCA 5H16A 4DV6B 2HT1A 1R6BX 3DWGA 2B4YA 2J7KA 2UVQA 2ZBQA 2BMDA 4BQPA 1KZ6A 5LYYA 4MZXA 1MEOA 2R8XA 1ISGA 2VPIA 3W05A 3RFTA 3QLVA 4W1RA 2OLKA 1X9IA 2ERYA 4L8FA 2H63A 1JWBB 1RQRA 4PIPA 4FGZA 4B5KA 4X54A 1C7JA 1SUBA 4FEYA 2IUYA 1KYTA 2FWRA 3ZW7A 2XBLA 4CKZA 5KTSA 1WEHA 4H35A 4R4JA 4JSTA 1X1BA 4UTVA 3QWHA 4QREA 2R6AA 1IVNA 4K9SA 8ATCA 1P7PA 2QL9A 3K9GA 1VHWA 3PKJA 3KJGA 5AW5A 3TPFA 4EARA 3CNBA 4N03A 2CLHB 4ABTA 3QU5A 1IPEA 4NU5A 2QXUA 1R2QA 4B6FA 1GCIA 4MIYA 2BFDA 3WJ2A 2X1VA 3RAGA 3HB7A 4Z0NA 3QFCA 5CA0A 2HF8A 4YGYA 5DX1A 3HBNA 3W5HA 3PXEA 1YRYE 3VYRB 1P81A 1UXIA 1X0XA 1HM5A 2X0KA 4LI3X 2WINI 1QGYA 4MQ4A 4RF2A 4YAUA 1FFXB 2W6OA 3ETCA 4JKIA 2XNJA 3OE5A 4ND1A 3T7TA 3K9QO 1W4ZA 3RSZA 3EPRA 5LSAA 4Q16A 4DABA 1QQ5A 2VNHA 2WAYA 3I58A 1JKXA 1ZO8A 4FYMA 4QM7A 1QAMA 4MCAA 3MMNA 4HFNA 3OHPA 4IHJF 1I0LA 3MLEA 4JI6B 2KS6A 2EEPA 1CVIA 4X61A 3FRIA 2FB9A 1DKMA 2I2WA 1Q7BA 2GPAA 2OO7A 3ANYB 4H59A 1ZMTA 3CSSA 1YASA 3PT9A 4F04A 4FGWA 4R9RA 2XCLA 3R7WB 1P2DA 1ZGJA 2ZS8A 1EG7A 2QAJA 4HXEB 4QQRA 2ZRKA 4NX2A 3TFWA 1E2HA 1HORA 4LXIA 3SZGA 4F2WA 1J20A 3ZBPA 1FLAA 2WA2A 3PUJA 2B5VA 1Q83A 1XJQA 5BW8A 3KQNA 4XCVA 2A35A 4Y30A 4AKSA 4IFTA 1YZNA 2QN2A 3B6EA 5K0LA 5KHOC 1VLLA 2FUG6 2Q5FA 3WADA 1RM3A 3OOJA 4RV9A 5ALLA 5EE3A 4EY6A 2QY9A 2WZBA 3EGWA 1J39A 1NOJA 1E4VA 1YB7A 2SKCA 4H7JA 1GYQA 2J1LA 1ZA1A 3DXXA 5LA6A 4P7BA 1SD1A 1NBMA 1HE5A 2I7VA 1LGYA 2ZRDA 3H1TA 1PGPA 1VJCA 3SXUB 3U17A 3AYZB 5BVGA 5IRCD 2HWXA 1G3MA 2REOA 1BH2A 2QXYA 3RANA 2YZNA 2BR5A 2KLHA 1XG5A 2ZXEA 3PSHA 1J8DA 2IHTA 3ZHOA 3ZHBA 4AJJA 1SXPA 3IILA 1J5EB 2P4UA 3GWZA 5E38A 1K5GA 3VU9A 1RFGE 2IY8A 2ZWAA 4OF4A 4A2PA 4BDTA 5I51A 2WQZA 3G2MA 3CJTA 4TXMA 5I4BA 2R44A 1VI2A 3RTGA 3CH4B 3OZUA 1HBJA 3QRWA 3A4YA 1IYZA 3ELUA 1HYBA 3PE3A 3JQDA 3AG5A 5BMVA 1R0XA 2ZRQA 2FN7A 1SZCA 1RAEA 1VHQA 3OCCA 1FX0B 3FOFC 2W2VA 3ZEIA 2V3CC 2Z08A 1QNLA 1DO8A 4JS0A 2AKAB 2E6KA 5AKGA 4JDPA 4K1LA 3R75A 3AF1A 2HA3A 5AOCA 4YRPA 1PTJC 3SC3A 1W1IA 2R47A 3IIMA 4ER3A 2IBSA 4Q21A 1VJ0A 1BAPA 4A0SA 3B52X 2EF1A 2NV2B 4RC9A 5DCLA 5AOBA 1XMPA 4V0ME 4JEUA 1U9YA 1RPJA 3S99A 3PHBE 3KHUA 3RVNA 4R0NA 4IH1A 5DTMA 3C6XA 1JSRA 1Z6XA 3EGXB 2JFWA 3E6AA 5ALJA 3TTTA 4EFDA 3UJBA 2XMSA 4LQLA 2RI1A 5BSMA 2HA2A 4W63A 2RI6A 4PS0A 3RTBA 4B2LA 4BV2A 2NUAA 3L4SO 1Q1NA 5AK5A 2YDXA 1CDZA 1YS9A 4MUMA 1EWYA 4MXDA 5FUXA 2JZNA 2Z5FA 2HQ1A 3EFOB 1U2GA 3CRNA 1MV8A 4X8HA 1B2LA 1OW3B 2H1SA 3R3JA 4BO9A 1PJZA 4LFBB 1SGWA 2ZRJA 3I5AA 2J07A 4ZPJA 4ASUD 4PIVA 2RIRA 3EULA 4FN4A 1E5TA 1OIVA 4ARIA 3MMXA 4EO9A 3V8EA 1RXEA 3G8YA 3KB8A 2A1TR 4URYR 3ZDDA 3BDAA 2XAUA 1C4XA 1JMKC 5AXBA 4BQSA 5H8WA 1NW9B 2BUBA 3GOHA 3UB4A 4PVCA 3ZBUA 3HB9A 1IY2A 2QVCA 5JDCA 2DPGA 1CUHA 4EJ2A 1JU9A 3DCYA 3LHSA 1A8HA 1WXFA 3E0XA 2J41A 3DULA 3GEBA 3E8XA 4PSAA 1DNPA 1FW6A 3WMRA 3GBSA 1LC3A 2CFOA 3N59A 4F91B 5D51S 1B1CA 1TB4A 4LUCA 4AKIA 1YR2A 4JP5A 2DBZA 1FC0A 3UB2A 3CUUA 1W49A 4L3WA 4RHXA 1UADA 3EMVA 3O2SB 4FFRA 4OXXA 5ICMA 4EENA 3FGZA 3MTDA 2ISSD 1WMDA 4YUVA 1I01A 2C7PA 2P2ZA 1QIMA 4LQ4A 1EVIA 3UWSA 1E63A 2GFIA 2XITA 1NT4A 1RRVA 1EYZA 3WZ2A 3G2LA 4GBED 3TLZA 1ZIXA 1AZWA 1V3UA 3EXG2 2XVMA 4A0FA 1E5XA 3TIXB 3DVSX 2UUAB 1JEYA 2BGGA 4O0MA 1CJUC 1II8A 3V8BA 4JJIA 4U8GA 1FLDA 2I1WA 4EY4A 3FTEA 2OB1A 1XRNA 3HABA 2O7QA 4HDCA 5CB8A 2PRIA 2PGIA 3F2VA 2LXNA 2IEYA 1SPXA 1GTVA 1LRKA 1SXHA 3TLCA 1XIVA 1JG6A 4Z1OA 4MQEB 3ZS8A 2Q9BA 3QI2A 4NU6A 3VC7A 3GX1A 4M1MA 3UF0A 1ZUIA 3ZWKA 3IVMA 4YO7A 3WK5A 1G5FA 2IV2X 4TWIA 4J1TA 3W9BA 2QLJA 4CDGA 3ANTA 4DANA 1M6EX 3EBLA 2PKQO 2FG5A 2P79A 3RKSA 5J4VA 1L8OA 2K6GA 4WACA 4MWOA 4EQ6B 2ZSJA 1FLVA 1NXWA 3TOZA 2HNKA 3V34A 1F8YA 1U0BB 4TZTA 1QV9A 4JI2B 2F67A 3D6TB 4PHGA 1ZHFA 2GEKA 3C6ZA 3JAKB 1XJ5A 4MTLA 5CH5A 4F8JA 1PQPA 1WDLA 1TUEA 2A9QA 4QGGA 5SZHB 2GK4A 1CNEA 3CW2A 3HQ4O 1JAXA 4HH4A 3T8YA 3BGIA 4H7HA 2JKVA 3OKFA 3PC7A 1L3CA 3DMFA 5C46F 2OECA 1KEWA 4C22A 2G0TA 3IKJA 3IR5A 1U04A 4FT2A 5ES3A 4CMGA 4FYHA 3I83A 1Z5ZA 1H5UA 3JQGA 2VDJA 5CR9A 3UIEA 2PT7A 1CF9A 1TXGA 3BH0A 4ZJZA 2JFYA 4JUFA 5FDFA 4ARCA 1GRQA 1I1NA 1Z0JA 1JSLA 1NW4A 2ORWA 3EYWA 3FYUA 2VZ8A 5JD4A 2P9YA 2DLCX 3F49S 3NHJA 1J24A 4MQMA 1BU8A 1P62B 1DOAA 2FH5B 3JW8A 4UUBA 1E18A 3VI3B 2FXIA 2BP7B 2LVBA 3NHLA 3OCXA 4FR2A 1EM8B 2CMFA 3HI4A 4XCQA 1HZZA 5I7EA 1AKWA 1BJRE 5HF6A 3W5BA 1Z68A 2PGJA 1N2BA 2WWGA 4PZZA 1JLLB 3BJIC 1K27A 3R9WA 5F9FA 3LU1A 1XKLA 5GZ1A 1XRPA 2A67A 4MAAA 4PCVA 3SOZA 1MU0A 2C3OA 4R3NA 4AS2A 3H65A 2PJRA 3VKFA 1JMYA 2V97A 1NBMD 3S3TA 4RHYA 4WJLA 1W0JA 3ZJVA 1LF0A 4IWNA 2CSXA 1RHQA 2BD0A 2VJCA 1U1FA 2C03A 4CNQA 4LYHA 1QLJA 1L1RA 3HV0A 3MWEA 3H9BA 3KFVA 3N8IA 4NRDA 4NU8X 1POWA 1H94A 2QORA 2XF8A 1PEDA 1XJCA 4G6ZA 4HUQB 3E70C 3CIFA 4U7TB 4XQEA 2WJYA 1GCUA 5A7HA 2HO4A 3VTZA 2WKPA 3PA6A 2NTJA 3QJGA 5F76A 1FFCA 4D8TA 3R0ZA 4YJGB 4LDAA 1L5FA 2EP5A 2XA9A 1CIVA 1HV8A 3FB4A 5FBLB 5AYVA 4N82A 4UEOA 3VPAA 2I62A 1LC0A 4GI7A 4EABA 2ZGVA 2P9GA 1FUKA 1PT6A 3ET4A 4B3XA 4NYMR 2C5BA 4RGQA 2ZQ5A 2QS9A 5IANA 4XUDA 4KE9A 3AESA 5EHIA 5DCWA 3ZW9A 2HSDA 4I3GA 3PYMA 4BLWA 1BROA 3BTVA 4HKTA 1LZLA 4PLWA 4HNVA 3AEQB 2QTLA 3QG5A 1ECCA 1Y7TA 1SQ6A 2D1SA 2PS0A 3ENVA 1OAAA 1X7YB 1ZEJA 4J6EA 1I3LA 2ZDGA 5D5QA 3RIMA 4MVJM 1FMJA 5E0KB 1T15A 4E6EA 2JIZA 2P5UA 3CLTD 5HIJA 1HR0B 2B37A 3BJEA 4I3HA 3NJ8A 3N8DA 1KOLA 3OZEA 1OFUA 3USZA 1GL9B 5JD5A 4QUAA 1NZFA 1P7CA 3DLBA 2GPYA 3FYTA 3G7UA 1P9WA 4LHYA 5ALRA 1DPGA 3EISA 2J9FB 3QWIA 4KRXA 4LXQA 1NMZA 3GNTA 3IT2A 1Z0KA 3WLJA 3DMTC 2HL6A 3RYIB 2FP4A 2CEAA 2X4LA 4LRXA 2VWGA 4YCJA 5LOVB 1PUIA 1OD6A 3N9IA 4KO1S 1PKEA 5LKRA 5G53C 4E5KA 4OAOA 1X14A 5AKLA 1ZIPA 2GDJA 1C9EA 3Q7IA 3TJRA 1DDGA 3V2GA 1T6NA 3OUTA 3VVBA 3WL7A 1Z12A 2QJTA 1BW9A 1E2KA 2CMHA 3H8VA 4IS3A 3P32A 3D1VA 4RK7A 4KXWA 4UBOA 4DMRA 1YOVB 3NC0C 4I3FA 1MABA 1Y1KE 5KCZA 1ESDA 1AC5A 2GKSA 3CZMA 1DKOA 4J0IA 4UBLA 2PZAA 4S1TA 4MV9A 3R8XA 3DXYA 2ZJ2A 3AFOA 4EKEA 1W36D 4WSOA 3IUMA 3DL7A 2O52A 2PV0A 1E9AA 2Q8NA 5C1IA 2J46A 3TRFA 2PZJA 3V8MA 5KJ6A 4QOJA 3IQHX 3LFHA 2V7WA 5IARA 2BI8A 1PYDA 3OBIA 4BWGA 5HZGA 3LBAA 2OXEA 4CMHA 5LOVA 3RR2A 4L6AA 2VA9A 5DW3A 4NECA 3GP5A 3A6GA 4M83A 2LRHA 1XTQA 4ZDWA 2J3JA 1JSXA 3HXKA 4KOAA 1NR7A 3TNJA 1I6KA 1E2LA 3O26A 4YROA 4LNAA 3DJYA 1IPHA 2NPFA 2JBAB 3ROEA 1U9JA 2VT7A 1NXXA 4P0PB 2Z09A 4REMA 2AOTB 4D4KA 1QGZA 1WUIS 2FETA 4J76A 4N6NA 4YCMA 2HJVA 4YASA 4WBNA 5FFFA 2RHHA 1GN9A 1K6XA 2QEQA 2XE4A 1ZK3A 2UYYA 3HH8A 3C6YA 2FI1A 4NCIA 3C5HA 3AY7A 3NHFA 3P9PA 2ORED 3IOEA 4P3XA 2AJLI 4D0SA 2D54A 3LVRE 3U7QB 3DL4A 3O7MA 1XK6A 3HZZA 2IOFK 3MJHA 2ODPA 3AIKA 3WLEA 1M33A 4EKDA 4UMDA 3ROXA 1I36A 2WUGA 3GJSA 2VWQA 5K1ZA 1YBMA 4ZYVA 4AKGA 1D0SA 1VG8A 4DRYA 3VH4A 4QU0A 2AN5A 4IQFA 3LUJA 1TKCA 2Q1XA 4KR0A 5DLQC 3UA4A 2NV0A 4CTKA 3MUOA 2ODNA 4EL0A 1P7ZA 4LV5B 2NO0A 4DR6B 5JOQA 4RGYA 1TKBA 5BYKA 3NWPA 2FMIA 4YT5A 5BNFA 2XPCA 4JC0A 2BTQA 4XVRA 4W5WA 1TU0A 5CYPA 1GAJA 3WL6A 2KX7A 3QSYA 1UEIA 2X7HA 4UDXX 3F98A 1GITA 1XNGA 2C61A 1DADA 4HXYA 2JATA 2EW2A 4I1PA 2XYRA 4GMFA 2B2XA 1L7BA 2PRYA 4G1FA 4Q4AB 3EQ9A 4V0NA 1XLWA 5CVVA 3TTUA 1EAMA 1TFRA 1CIPA 1WCYA 4BNUA 1M6NA 4QEKA 2E6UX 4QFDA 1XX6A 3FWNA 5TT0A 4A03A 3S1SA 1U3UA 1RWKA 1VP9A 1ZPDA 3QF4A 3V55A 4L0CA 5C80A 2Y0BA 1G8FA 1JDNA 3DTTA 3OX1A 1GRRA 2BKUA 2GCOB 3ZDRA 3KIPA 2ZZKA 5C2JB 5E2BA 2FVXA 1XQXA 1EWVA 3PA8A 1EK0A 3GRCA 1FDIA 3PC3A 2ZIUB 4GR4A 4NJEA 3FCUB 4TLMB 3TIIA 2QSYA 1Z56C 3CUTA 2JBHA 1IHXA 1EWQA 4HH0A 4UEQA 4OHUA 4WOCA 3AWDA 3NEYA 4MB2A 1WM1A 1TGYA 3NW9A 3R7DA 3BHIA 3EPKA 1E0AA 2I03A 2PMFA 2W2KB 5CA1F 3U13A 5EKTA 1XPUA 2X9GA 5E1MA 4KPEC 2BELA 3IBGA 2OP1A 4JX8A 4ZC8A 3TI9A 4D44A 2QVLA 1KAMA 1Y9JA 2O2GA 2EJWA 1ESNA 3Q2IA 4IDGA 4Z7JA 2MR6A 5H70A 1KVRA 4KYIB 3CA8A 2IYWA 3T95A 5FFMA 3G1TA 3W8EA 1VOTA 4OTZA 4Q93A 5AK3A 4G5GA 2VDRB 4P34A 3ZDXB 3Q12A 4YV1A 1PGNA 3DYVA 1IHUA 4U2EA 4E5MA 2J3MA 4PAMA 3T12A 4TMWA 4PLYA 4GBMA 3WDKA 1Y8CA 1LK5A 3FUCA 2XUDA 1UINA 5F1OA 4XPZA 3ZNOA 3F4LA 4PZEA 1WE2A 2NPOA 2WLSA 4S2UA 4R0MA 4ZCPA 1E4OA 2JJ1D 4WESB 3L6BA 4AZWA 4ZZ1A 3RVKA 1JXAA 4HEJA 1NBEA 2Z2JA 4G9BA 4I8IA 4RZUA 1UR5A 5I3CA 3FMOB 1YR6A 1UK7A 3OPMA 1AO3A 1M10A 3QTTA 3MCWA 5JVDF 2C9MA 2PZLA 4A23A 3VR2A 3N2KB 1T2NA 2IS1A 2WG1A 5T3YA 3I4LA 3LKBA 1DV2A 2V9PA 4GQAA 2QSJA 1K88A 4MRNA 5CBKA 1HYHA 3NIDB 1WOYA 3GMTA 4FWBA 5AQEA 3TK1A 3ONEA 2QRVB 3FIUA 1SCBA 3PGA1 3M6XA 3OF3A 5CTJA 1G4UR 3KJFA 1P0QA 1U8ZA 4N39A 1JMVA 2NZUG 4PNPA 5AI4A 4ZYYA 5LP6F 1QH8B 4FYKA 1T6BY 1DRUA 1D7OA 3ND7A 4NQRA 3THXB 1YJ8A 3H2SA 4O2AF 2VJPA 4ML3A 3NNDA 4EELA 4NS1A 4RF3A 4EGJA 3N2YA 3R5SA 3SZMA 2ZJAA 1XRMA 5CYOA 3O8BA 2CNWA 5HPYB 3U26A 1OI3A 1A2QA 1O8BA 2R6FA 3TNFA 2AXNA 3I52A 4Q82A 2JANA 4C4OA 2Y2VA 2JIQA 5CP8A 2WMNB 4H18A 1C3VA 1OAKA 1A71A 3TR6A 1GSIA 2JFUA 4KODA 4ZOLA 1JDBB 3UK0A 2IODA 5JT1A 3D02A 3JZAA 1AA9A 1HK7A 4A5SA 3QUSA 1ZBDA 1Q16A 3BUSA 2H5EA 1I2CA 1MQ8B 3KWFA 2FKNA 2Y0CA 3LQYA 1I7SB 3UQYS 4ALIA 3TFOA 4INOA 3PQ3A 2ID8A 4RLSA 2WF7A 1LVUA 3T5GA 1S1CA 2ZAGA 3EZ7A 3GG2A 1GGEA 1E3LA 4FNGA 4V2UA 4PZ0A 1A9TA 1XEWX 4A8HA 4Q3LA 1KRWA 4UPVA 3WI7A 4ZYXA 2AC4A 3OTHA 3RWOA 3OESA 4II2A 1U2RA 2DH5A 1VG9B 1O6BA 1YACA 2WUDA 2AN1A 3G0BA 2ZIAA 3OZFA 4L8LA 4EFKA 5EZ5A 2C2ZA 1NPDA 5FUQA 4QAQA 5IK2A 3ZU3A 2WVHA 2W83A 1LSOA 3I2JA 4YRAA 5BMOA 2XB6A 4IJKA 1F8XA 5EJAA 2Z2XA 4FZ5A 3SHVA 1RRMA 3O8OB 4M38A 1Z4PX 4HDRB 3PQEA 3NUZA 2QVGA 3RAJA 2ZANA 3OBBA 4PYMA 3O95A 3WIDA 3DAYA 1JDPA 4AP9A 5FP0A 4BQIA 4KZKA 2CFSA 3BIFA 4P7GA 4JBIA 4IUBS 3WJ7A 4DC0A 3KOZA 3LOQA 5DHPA 3PVZA 3ZZUA 2W6IA 1CDDA 1I7PA 3ZDQA 4L6IA 2KB0A 5IMSA 2CHVA 5JDIC 2Q7XA 1WPXA 1BS2A 5D2CA 1B6TA 1B41A 1ISSA 2PWPA 1G5PA 1NKTA 4OB8A 1TJNA 5CURA 2VDNB 4UUMA 4EYSA 3S1LA 4RPHA 2BSAA 4B3FX 1YRLA 4NMMA 4JV5B 3B7GA 3H3FA 3AR8A 4N3GA 3ZI7A 4TWBA 1XZDA 3CNOA 5I7OA 1NDUA 4H31A 3ZV3A 2HK9A 3WBKA 2G25A 5ECDA 4JBNA 3WMWA 2DPYA 2XTZA 3EXEB 3LCVB 2JCVA 1J8VA 3L7AA 4FNOA 5CDTA 1MEEA 1Q1EA 5B4VA 4ZAVA 3ASZA 5MN4A 5BV2P 3GV0A 1SIBE 1R3UA 3WX0A 2O2ZA 4EJSB 5C8YF 4IAOA 1CY1A 1M7HA 13PKA 1FVOA 4Q18A 3WNZA 4PYJA 1A5AB 1K89A 1XO1A 4CTMA 2ZYGA 4K6MA 2UUOA 4BHTA 3C1TA 3QUQA 4Q6BA 1ZLYA 5BR8B 1Z16A 3TRKA 4IOMA 4H27A 1Y9ZA 1E0DA 2F90A 3QKTA 4B9EA 4C5BA 4EPRA 1QP8A 4BVGA 3FAZA 1TQ8A 1V3TA 1I9CA 2DFKB 4EGCB 1W0KA 1JHVA 1NLFA 4XFJA 2WSLA 1JHRA 5CVJA 4N0MA 2EJCA 2NYVA 3A32A 1C1XB 2V03A 3TH5A 1G8PA 2Z2IA 2VJAA 3B1ZA 4FN5A 5ALMA 4TTAA 5K8LA 4OJQA 5J5AA 1UPAA 3EZLA 3UFBA 1QRAA 3PFFA 3AK4A 1GR1A 2R8EA 1N5DA 3ISTA 5CNKA 3TD6A 1KK0A 2WJPA 1LX7A 2H31A 5AWFC 5HKKD 4WDRA 5KSWB 8GPBA 2GH1A 5IABA 1K66A 1J2YA 1QGOA 3VOAA 3Q8LA 1JT9A 4Q9AA 1EH5A 4UDOA 4UMEA 4DQVA 5A4IS 2A1TS 2W43A 4S24A 2Y1LA 5A5DA 5D00A 3PL5A 3PR2B 4UAUA 4DT1B 3U2QA 2ZW9A 1N2EA 3IAFA 3AL3A 2CNNA 2BGNA 3BILA 4DNXA 1FXWF 3WB2A 1EFTA 3OZIA 3L4JA 4RU1A 1ZONA 3SS8A 2A58A 3ILHA 2EQBA 2RGDA 3QQPA 4QYIA 5EKUA 3R7LA 4YRBA 2HDWA 4S05A 3EEOA 2RK6A 4BEWA 5I6DA 2VJDA 3HCBA 1V1JA 3WC4A 1SQSA 3I12A 1CUWA 4J7AA 2AI3A 2A5DA 1FQOA 2BEWA 2J3IA 2WAAA 3UNXA 5CD9A 2IYQA 1KI8A 1LPSA 3AGQA 3ZWDA 3RRZA 3SXPA 1TADA 5EE0A 4UAVA 3JY6A 4PF1A 1BO6A 2HDNB 4LWZA 4MVCA 2CXTA 4RYLA 2R8BA 4MJXA 1VG1A 3C3JA 3EFHA 5HS4A 1WIWA 1PZFA 2VI5A 3BEOA 4N8SA 4NEGA 2GEFA 5HJ5A 2Y6VA 2VQSA 2AN9A 4UNRA 2GM9A 1ML4A 2MSWA 3ZCSA 4HK4A 1JQAA 5ALZA 2JHFA 2DSTA 1ZJ6A 3CW9A 1TM2A 4F9EA 3AETA 4WGFA 5DGIA 2GERA 3ER6A 1Z82A 4EMUA 5FT9A 1XFDA 5IF9A 1AJEA 3ZXSA 4YAFA 1OLSB 4HMQA 1CRPA 4FBMA 1J1UA 5JCXA 2NT4A 3NQ41 1SBHA 4RK5A 3U3MA 5C8XA 4LF5B 3N8NA 3C7KA 4IIHA 4WECA 2H4HA 3T34A 1VE9A 4HS9A 1SQGA 3BJRA 4UNQA 4D0LB 4TKUB 4Q3CA 4O4LB 4R2HA 5U4XA 4EZBA 2DWOA 1DMSA 4IEEA 3GRRA 1PT5A 3EVZA 1E0JA 4P2BA 4G67A 3AHHA 4HYYA 2GO1A 3NDPA 5E3JA 4XW2A 3SR0A 3FKQA 1EWTA 4YLEA 2ZR8A 3DEYX 4LBZA 3M1IA 4RPGA 1PJQA 4MVJP 3Q10A 4TTPA 4E51A 4WV3A 2Z83A 4AG5A 4D4JA 3WGQA 3LPLA 5ETJA 4PYNA 1M5UA 2X6RA 1D6NA 1V3QE 1C50A 1HWYA 3DO8A 3QVKA 4RA6A 2NVOA 3GPLA 1ORIA 2PVSA 5HFJA 5B6IA 2NYRA 2NADA 1CULC 3M5DA 4MR8B 3ZDFA 3ZZ0A 1E89A 1TMOA 4OJKA 5BT8A 2RD2A 3R2JA 2PK3A 2P2NA 2VYVA 3BB4A 4TKVA 2PSHA 3TCNA 2XDAA 3UEOA 5AVKA 4K6HA 1NRIA 1RPNA 5ALWA 1YDHA 2PMWB 2Z1MA 1U7TA 4CF6A 3RODA 4A5OA 5JNSA 2C59A 5F9MA 1I2MA 3LPNA 3GLTA 3BXOA 5JTTA 2HA6A 2Q0HA 1Z6PA 2GRUA 4JC5A 4IGKA 3B12A 3H17A 2ADMA 1R88A 2Z30A 4WI1A 2QDKA 2A84A 2BOVA 5I47A 5BVHA 5KYUA 4DB4A 3B3AA 2H54A 3CINA 3KJXA 4II7A 3O1IC 4MKHA 4AUKA 3EIOA 1D9ZA 2PBZA 2D13A 4QBTA 4N47A 1LKZA 2JI7A 4MKIA 4RFSA 3WGTA 2QA5A 4X6LA 5CJJA 1RZVA 1UC9A 2EOAA 3KK0A 4U2BA 5BWNA 2XVYA 1T0BA 3ODGA 4JITA 1AU9A 4ZGWA 4KJZA 5ALKA 3TAHA 3UJ7A 4CFYA 2O8DA 3DA8A 3W5JA 1BH6A 1L7NA 2HBRA 3KSDO 4W5QA 2JLAA 1VIMA 3I64A 5J23A 3NRJA 1IH8A 1LA2A 1BVUA 4HNQA 2I3ZA 4G5RA 3FLAA 3PEWA 4JL6A 1NJGA 2QG9A 4V3BA 2A1UA 5AVQA 1B7GO 1JJAA 1P77A 3TL2A 3VSEA 4KP7A 4GLLA 5H82A 3L92A 3T7DA 1DJNA 3FFBA 1QQAA 3LUDA 4EYOA 2FW1A 2Q5QA 3ZDCA 1DGQA 5C31A 2F7SA 1M7BA 1D2AA 4TS1A 3LV8A 4V0RA 4U00A 3KTFA 1N77A 3QYFA 4R7ZA 2GM4A 1MABB 3T5AA 4XWOA 2YN0A 3IJEB 3S28A 1ECGA 4AWBA 4AO6A 3IBYA 4PPQA 5CCDA 4F4IA 3UN1A 1BMDA 1Z83A 3C70A 1W1UA 1YJBA 1K7YA 1X2EA 2ZBRA 3MOSA 1JLLA 3EOAI 4W99A 5FRDA 1XHEA 3CVYA 1E9DA 4EFMA 1D4AA 4D43A 1VXOA 1AV6A 3GLGE 2H08A 4NPHA 3JAKA 3KUDA 4AN4A 1IULA 1GSHA 4BBJA 2C07A 4O1HA 1QGED 1C1DB 2BBSA 5BV1A 4TZ6A 3EG9A 3LFUA 4PC2A 5JAPA 4OFZA 3MUFA 1NW8A 1RC1A 5B3LA 1TI7A 3D1LA 5I7VA 5JMOA 4NBLA 5HKKA 1N2GA 2H06A 4HWPA 4M0LA 2H7VA 4TWZA 3AM1A 2K4MA 2NQTA 2QRQA 1B8VA 5AOAA 2YYYA 1BXGA 4L5IA 2B4QA 4G3XA 3UV3A 4X91A 3AUFA 4QUBA 2V7QA 5KOHB 1KI2A 4G5XA 4CKBA 1P1KA 1ZGBA 1L4EA 4XDZA 2ZRFA 3G68A 3LT2A 3BXPA 1USWA 1CUDA 2F1IA 4ZYTA 2VAMA 1JPJA 2AMYA 3EGXA 3ZXXA 4CQMA 5IF3A 1YZUA 1CUYA 3OLXA 1H1LB 4J3FA 3ZKWA 1IG0A 2BFOA 2GAAA 4Y2HA 4RVSA 4O4HF 5TQ0B 1QS0A 2B35A 2JHCA 2RGGA 2ZSAA 3FFWA 3HGQA 4PNHA 5A3SA 1VPWA 1KFKB 3E22B 3OMXA 3OZ7A 1IXSB 2BTQB 1Z3IX 2SCUB 1Z08A 2CBXA 4AZ0B 3O94A 3H5WA 3BZWA 3SC2B 3V3KA 2ZULA 2V7TA 4UBMA 2XODA 4W6QA 4AJIA 1ENPA 3PZBA 5JAOA 3Q5EA 4OI4A 4D26A 2Z6UA 1QE5A 3PQCA 4KAAA 1NYLA 1RYFA 3FA2A 3T3NA 1PJ2A 3V8VA 1RPZA 3HSYA 4BFTA 1H4TA 2VIIA 1G1AA 1MAWA 1C7FA 1NN3A 1XDWA 2ECPA 1YU9A 4LEIA 4RHEA 2H9YA 4I46A 2WJ6A 4HQFA 1H2XA 3L8EA 3R4CA 4YMTA 1KF0A 5C32A 2FFHA 3VNQA 1KO5A 3UCEA 1X7WA 4R81A 1WZEA 1M1NA 2VNIA 2OXTA 4IIUA 4HGZA 1UBMS 2GXAA 3BS4A 3E5MA 3L7MA 4XCXA 4YJ3A 1DBPA 5GV7A 1TUBB 3DG9A 4ZANA 3VPCA 2P5SA 1V1RB 4WCVA 1VKHA 4D0NA 2C5HA 3CMMA 2JBAA 1MX9A 4KE6A 1ZI6A 3WQSB 2UZ4A 1PJRA 4GAEA 5HZHA 2H4JA 4B7ZA 2V98A 1A5ZA 1WQ3A 3BE5A 3C8MA 1RQLA 3AIMA 3B85A 1YIAA 2P75A 3NVDA 3WLQA 3LD9A 4K0KB 3IH5A 5FOVA 3FPKA 2Q2WA 1YB2A 3JALA 3KEFA 2HMTA 1P4SA 4M87A 3C41J 1TIKA 4Y1GA 2Q7OE 3AF5A 2UYGA 3UJ6A 1Z6TA 3W0LB 4QTYA 1S2DA 3JD3A 4TQAA 4U5QA 4YAIA 3Q72A 2JGMA 3MINB 2OCAA 4B3JA 3QOYA 1Z6QA 3IUYA 4GQBA 3L7BA 2OA0A 1TIBA 5CU7A 1O94A 1L5NA 3LX5A 1FVFA 1FPQA 3QVSA 3BIJA 5EWLA 2V8BA 3L79A 1XEWY 2A0UA 4OJTA 3SJAA 4JYZA 3SHFA 1M1YE 4TYQA 2XD9A 4RH1A 3R7FA 2XUQA 4D46A 2NUAB 5TNXA 4J1SA 1WV0A 4LJ6A 1E79D 2JFHA 2P68A 2AMFA 2ZT6A 3NIBA 1T1EA 4LW8A 4YH1A 3ZGOA 2Z57A 5F9HA 1ZOLA 3FWHA 5AXAA 3VSDA 2ODAA 1W87A 3O82A 2O19A 4G4GA 3TN7A 1O9HA 3NDRA 1W44A 1HC7A 3D8NA 1K6IA 4FCTA 1BE1A 1BE6A 4JH0A 3FNFA 5LCXA 4CF5A 1N3BA 3BWMA 4C3UA 4Z4CA 2AIRA 3OKCA 1DOZA 3COVA 3MCZA 4CT5A 2Q45A 2XA1A 3GH3A 4JQYA 4XGQA 3VVCA 4YV2A 2BZGA 1CP2A 1OBHA 4HDAA 1GPYA 1OI4A 2PUBA 3LZDA 3BWBA 3RUHA 2G09A 3GAMA 1J42A 2X14A 4ZZIA 1AMNA 3LKZA 1QF9A 3QFHA 2XV1A 3A6FA 1NZDA 4HPJB 1NATA 2YFKA 3AI3A 3K9WA 3LL7A 3VKVA 3PUHA 4CM4B 1T9DA 3HY4A 4MYDA 2AX3A 2ZUBA 3HWX1 4ILEA 5FOQA 1NQUA 1C9JA 1XA3A 2O3QA 3HO8A 3FR8A 1L9XA 2A9OA 3DMYA 3OTWA 3F0TA 1GUZA 4QGBA 1NU8A 4IYJA 4JX9A 2OV2A 5EUMA 1N3LA 4PNEA 1J0BA 2RHJA 4UM5A 1B42A 2NZXA 3GFGA 4AN1A 4EF5A 1WU8A 2EF0A 4EPYA 4FMPA 3D3JA 4JBHA 2B8NA 4U7DA 3N74A 1Z15A 3T4EA 1PG0A 2IH4A 1A7AA 2WA1A 3PZRA 5BRJA 1KDOA 4HQOA 4ALJA 1P72A 4S3MA 5DW0A 3ZH2A 3IA2A 1SHTX 2CSUA 3PGLA 4M3NA 6GPBA 2FEAA 1T8TA 4CM5A 3A2MA 1D2RA 4DMMA 4BFXA 2R25B 2QTVA 3AB7A 2DLNA 3PRJA 4HUQA 1XA4A 1OIXA 4ZVUA 4QXPA 4D56A 3CUVA 3ED1A 3GJQA 2YVAA 5E7QA 5BSEA 3R0VA 5IT4A 2IELA 1M72A 4Q7EA 1ZD8A 2C2XA 4MEJA 4UVGA 4D3FA 2GXSA 3U7IA 1EB9A 2G3YA 3OT4A 1GSAA 1M2HA 1Z4KA 3AOGA 3LT4A 5EUQB 4IDDA 5CX1B 1QWOA 5KQSA 3HU3A 2DFTA 1FQKA 4MKFA 4KXUA 1SKYE 1CUAA 1M8JA 2DHCA 5LOVF 2BCEA 2D00A 2UZ1B 1UT8A 2V7QD 3TXAA 3THYB 3AHFA 2GYYA 2GCIA 3A3OA 2MSCB 2EGGA 3K94A 1E98A 5EXSA 2ZSUA 4PZUA 4O4JB 3KD2A 2MYNA 3SHQA 1WB5A 1M54A 3G3EA 4I50B 5KOJA 1T4DA 1VBFA 1M8KA 2A33A 1KIAA 3AFNA 2VYND 3CTMA 4GE3A 4WY2A 4C30A 1ITZA 1R0RE 1CUVA 2VUSA 3G2KA 3OT1A 3STWA 3WGKA 4FFDA 2IOHA 3QKRB 1LPOA 2BFDB 5JECA 2HLHA 2Z5VA 3G0IA 3ICEA 1ECFA 4MIKA 3T1HB 4EG0A 5IBPA 5T3UA 5JEEA 3GLFB 3LS2A 1ULAA 3RTAA 1V1MB 3CBQA 4CMCA 1HPLA 1YL6A 4GU5A 3ID6C 5JRZA 4LF6B 2J08A 1DOHA 4B3HA 2HRCA 4C3OB 1AXRA 5M34A 3NOQA 2XNCA 4H6PA 4UJ5A 5EAIA 2X0FA 3AZOA 3SYTA 1S3IA 3TQOA 9LDBA 2W90A 1YQXA 5ED4A 1ONPA 1SK8A 3D6HA 3Q4GA 4MMYB 2ZUDA 4I14A 4P22A 3M5PA 3UKOA 4FVTA 4DLBA 1E2EA 2AS0A 2H2IA 2Q6IA 3PPIA 2IZ0A 2XUIA 3PG5A 2ZJOA 1W0CA 3HADA 1HNZB 3OZCA 1U11A 2YJGA 4NYJR 3JR3A 5SY9A 3TZBA 1JAIA 4IGFA 3Q3GE 4UVDA 2DKNA 4PG6A 3WWCA 4B87A 1T1IA 5IDWA 2B21A 1JE1A 4WKOA 5EHQA 3IR6A 1CUUA 1H0HA 1SPBS 1LSSA 4YIHA 1R8YA 1UBEA 5F2EA 5EMJA 4DHEA 5JU6A 2XTJA 3KS9A 4L5CA 4A6DA 4V02A 2V7VA 3P0EA 5ALUA 1LS6A 2J8ZA 3L0ZA 2WVAA 2WP8J 4JLWA 3EGIA 4LZZA 4B9AA 4DNFA 1M67A 5A4KA 4P98A 5G0UA 3MWGA 4FLEA 4KNVA 1KAQA 5CXQA 4MVJF 4RDXA 2B8WA 3KQTA 7REQB 3R3VA 4EB8A 1BOOA 1T10A 4EM6A 2JH9A 3FDFA 2F3SA 2PZBA 1KO1A 4IDPA 3THWA 4IUDS 4WVLA 5KOYA 2EFYA 3RVBA 4WCFB 1QFXA 3O3CA 4RBNA 3TR5A 1HKHA 2ZE7A 1UCFA 1W88B 4JEMA 1NP3A 2H2WA 1MLDA 1PCXA 4L51A 1SXQA 5DHFA 5JYEA 3G0HA 2O59A 1MO5A 3EX7C 3LVFO 4JLJA 4JWKA 1WDTA 1O03A 3CX6A 4GICA 4BN4A 4B83A 1JR2A 1CUIA 1KJ9A 1U7PA 3BICA 1L4HA 1IEVA 3TLGA 5A3RA 2Z95A 1B14A 2ISQA 3FJOA 4HZIA 3P9YA 2QL7A 4MDHA 1CZLA 3KETA 3B9PA 1ORWA 3GLGA 1ZBQA 2ZWIA 3K35A 2AN4A 2UVPB 2ES4A 2QN9A 3MM4A 5FTJA 1CQPA 3OP4A 3QVGA 5D3QA 2XE7A 1E6EA 1Z0UA 2GAOA 2NXNA 1JH8A 2HSZA 1RI4A 2P8JA 2R6GA 2TECE 5HGJA 2OHOA 4E70A 7GPBA 2M1ZA 3HR4A 5HDQA 2OGUA 3F73A 1T5OA 1L4BA 3CR7A 4HS4A 1T35A 1T9GS 2VNAA 2QSZA 4M1YA 5TS3A 1OB2A 3AO0B 2Y4NA 2DBQA 3CCBA 1L6RA 3KQSA 4KQWA 3DLCA 4MYUA 1GD1O 3EA4A 1PL8A 5C8VA 4PPYA 4GIBA 3VFDA 1YMQA 3PNSA 4P93A 5EP2A 4WWHA 2YJTD 2KSQA 1WQ1R 4W7HA 3D8RA 3OSZA 4B85A 4DXHA 3T9DA 3KQHA 1O0SA 1OREA 2TMGA 3DUWA 1A27A 4RK0A 4W5HA 1YCDA 5DISB 4G0MA 1FP7A 4ZCMA 2YUIA 3PBKA 4DR4B 1EVZA 1UT6A 4B47A 2NTYC 3IBSA 2JKYA 3G59A 4CWAA 3B1KA 2AXQA 2QU8A 1O4WA 4H1UA 1SULA 1VSUA 4BCBA 3QKSB 3IPLA 1DWQA 1PYOA 1U0OC 1RT9A 4YR9A 4H08A 4ODIA 2G5GX 1GLGA 2DQZA 3JQ8B 2Q6LA 3DLIA 1N75A 1MRZA 2O14A 3SQDA 4RTJA 1F2DA 1NDQA 3DZIA 3CN9A 3EGCA 2C4WA 1CE8B 3IQFA 4FEAA 4J7UA 1H05A 4N40A 4FGLA 3W7VA 3NC4A 4B8WA 2G70A 1OCEA 2JGDB 2ONCA 5A3JA 5BYBA 4GSKA 3DO5A 2CL0X 4AF6A 4HDQB 4K2AA 4BMXA 2DFNA 3EWIA 3NNNA 1MOSA 5AHKA 2FPLA 4J7XA 1JG4A 1X2BA 1ZINA 3NB0A 2AW5A 3RM3A 4N7MA 2WHPA 5E1BA 4F0JA 4Q00A 1KI9A 3OKAA 4GI5A 3AINA 4UU8A 5SZJA 4EVQA 1ODCA 4D2IA 2AWOA 4LYJA 5BRAA 4HY3A 2XUPA 3VTKA 5IVDA 3ZC3A 4QXMA 5H3LA 4ALLA 3R5KA 2PMKA 3I5MA 2WNIA 5DIZA 2PYIA 2BFBB 1HKUA 3QVJA 1QHIA 3VR6A 1E3TA 4MKGA 3HVKA 1DU4A 1SCJA 4RTKA 4AY5A 2CK3D 4YRRA 4GM4A 4WMLA 5GV8A 1MR3F 2FUNB 4UBIA 1M6YA 2VYNA 4AMBA 5JMWA 3ILXA 1PS8A 2JASA 1LDEA 2WJIA 3KJIA 2BW0A 3MT0A 4ZVVA 2UXCB 3AZQA 4B5LA 1T0UA 4BO0A 3OQIB 1W36C 3P4UA 3DONA 1JEYB 1PN3A 3KLPX 2WFAA 3MF4A 3N0XA 1IHYA 4R8LA 5DIFA 2O8BA 3BMOB 3BZBA 2QD3A 1Z74A 3GPCA 3JYQA 3LOUA 4IF6A 3RABA 3E3NA 4EPXA 2VH2A 1ACJA 1CLEA 1W5AA 3I1FA 1GPAA 1RJEA 2QAGC 4NEHB 4Y8VA 5HS6A 3S4YA 5A4AA 2NP7A 2HCJB 3ASVA 2G82A 5GONB 4A9AA 3UH1A 3GWGA 1KZGB 3TBHA 3HTXA 2RBEA 2PU7A 2KPOA 1XQWA 3NM4A 4TV9B 1M1YA 3DJFA 3PC8C 2H5JA 4NMWA 3A6DA 5B1IA 1VPLA 4OYHA 4F46A 2VP9A 4N1AA 1P0MA 2I4LA 1VGQA 2PPLA 2CMDA 5LKAA 4FQ7A 3MBIA 3CVXA 1R6DA 2AJBA 2VSNA 3OI7A 1TEHA 2P3LA 4YJHB 2PBRA 1FSPA 1OYYA 2JDIA 3EARA 3FYHA 3CR8A 1ABBA 2YWEA 1LBSA 1J09A 3ST7A 1XLUA 3O8RA 1A1SA 1P4HA 4P7KA 3CVUA 3NP7A 3A58B 3LLSA 3JAWA 1N32B 2VAXA 5FD8A 3TIFA 1FX1A 4UHCA 4PICA 4ER6A 4R8RA 3MSXA 4B4OA 1XELA 2KLBA 1SXJA 2BM9A 3U1BA 4KIUA 1IAQA 1K8QA 4PFKA 4TQ9A 4PSUA 4C0SA 4DLWA 1MH1A 3W4IA 3QVMA 4Z4QA 3OIDA 1MFZA 1IEWA 2RAFA 4RS4A 1CBUA 4GGPA 3H2KA 3RYHA 4EI7A 4EUEA 5LIPA 4BQEA 1QYWA 2JF0A 3T1QA 3GPBA 4KR9A 3A6KA 2XI4A 3ZWMA 1BXGB 1FYDA 3NHZA 1UDAA 5TGDA 4L78A 1PFYA 3JZMA 3T5MA 1UJCA 1NSFA 1A4IA 2C95A 1EINA 1K9SA 2FSIA 2XQKA 4I5EA 1ES9A 2YYZA 2VP4A 1LTHR 3REFA 3KQYA 2G1JA 1RMQA 2C31A 3IEUA 3HFGA 5HIIA 3WYEA 1QQTA 4JXZA 3NBFA 3DFKA 4RADA 4M46A 3VPXA 5DM2A 4D9JA 4F06A 1U0EA 1BDHA 1T25A 4M9XA 4TMFA 1O57A 2E4XA 4ZJUA 4UU0A 1BXKA 1MVLA 2C3PA 4AJLA 1V0JA 1B0ZA 3TFQA 1J70A 3URKA 1E1RD 2QZ4A 3GMIA 3LLCA 4H2DA 1KAOA 4ZQIA 3ZD7A 5GVSA 1HLGA 1E2DA 1I3MA 1FTGA 2GJAA 4IMIB 3U9SA 2AKEA 2HIMA 2PLAA 4BV8A 3D4BA 1R0WA 2EWVA 5H7XA 5F2NA 2GAJA 1QK5A 3C3XA 3ISVA 1RXIA 3QFSA 2VQ6A 3ROFA 3C45A 3SCZA 1DBWA 3HJCA 3PE6A 3VZRA 4RNCA 2QRKA 2CW5A 4NJMA 3J81A 4OA5A 1W5FA 3EPPA 2ENUA 3E15A 2EKLA 4FHZA 3CU5A 4JLKA 3RIEA 3ZLVA 4F1WA 4AVYA 4C76A 2VF8A 3EXIB 2NWQA 4G9GA 4H3VA 2IHVA 3K0FB 1JDZA 2B8JA 4H7KA 2VCYA 5D7NA 5I9TA 5TRTA 3V7FA 1QCDA 1KOJA 1PU2A 2NGRA 4YRTA 1F60A 3KB2A 4EA6A 4XUCA 1CCWA 4GMXA 1GFZA 4JVMA 3OPQA 5K3DA 1US8A 5EHXA 4FWIB 5CXUA 2XUHA 3C74A 3LDGA 4ZRNA 3E18A 3F74A 4W5RA 4CVNA 3WRWA 5EA2A 5DX0A 3AH8A 3S5UA 4JLSA 4EMTA 4H6XA 3TM5A 2KWIA 1EJ6A 4FHDA 2CKDA 3URMA 5K6RA 1I1OA 2FXVA 1CDEA 1NV9A 2Y4OA 3L43A 1YR9A 3T9EA 4OBEA 3K5WA 3OLYA 4LDPA 2QUZA 1TK9A 3WSTA 1ZI8A 4RZSA 1LNSA 2Y93A 4L9AA 3JVVA 3P0HA 1XZMA 4FJ1A 5M2QA 4J49A 1QZZA 1XROA 4LJ4A 5FBKA 1HNWB 2J0SA 2W7TA 1YIOA 2FJUA 5FFNA 2H3EA 4AJPA 1AURA 1G7TA 1YIDA 4URFA 4WJZA 4B3GA 2R86A 1PTKA 2Q3JA 4OCZA 1K2WA 3PDJA 3BE8A 4CI0B 1DTWB 5EG5A 1GEGA 4GX1A 1T43A 2EL7A 3OLVA 3S2SA 1W0KD 1Y6ZA 3DTYA 3DZBA 4MQFB 4X45A 3UWPA 4D8YA 4CLOA 2WYIA 5HKBA 1L7DA 4BB0A 4BNHA 4R54A 4UE3S 4FHEA 1HE1C 1WKVA 1K6JA 2WM2A 3T0FA 5K3EA 5LP6B 1ZICA 3SQOA 5JS8A 5CLLA 4WY5A 2GHQA 5ILGA 1EX9A 3HDVA 4QUJA 4YMVA 2BEUB 3KRTA 1RKXA 1JQ5A 3HU1A 3QK7A 4J75A 4GX5A 4JYMA 4MPTA 4RJLA 5J2TB 2OV4A 4M88A 5ALHA 3THRA 2QGNA 1T0HB 3V80A 5T8KA 3PXGA 1QOQB 3SSOA 3RBZA 1J1IA 2GBFA 1UBOS 2DWQA 4W5OA 4MQFA 1RXSA 4PZDA 3VO9A 1UPXA 2OBNA 3PFBA 521PA 3GUHA 1WCIB 3CZPA 3UAGA 1M2OA 3OU7A 1GHTA 4YONB 4I1YA 2PX6A 1JR3E 3W5SA 2FPUA 2IP1A 4ACAA 2Q1YA 3CNEA 3OTGA 4FUQA 4KI0A 1GJRA 4BFVA 4C0JA 2QM7A 2G9VA 3O92A 1W4CA 1O97D 2NTEA 4ZREA 1MB9A 2ZTVA 4MYTA 2RK4A 3GVXA 4EY7A 4DBVO 3FPFA 4AG3A 4EKGA 2B34A 4JQOA 5KIAA 2FZGA 4N49A 2ID9A 1V8FA 3QU7A 4FJ0A 4MEAA 3UG6A 4FHFA 3W9UA 4DDWA 1ZJ5A 2OR3A 4D9BA 3WB0A