3I52A

Ternary complex structure of leucoanthocyanidin reductase from vitis vinifera
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
307
structure length
296
Chain Sequence
b'GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNIHPSEVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative leucoanthocyanidin reductase 1
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 99
structure length 296
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i52A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i52A02
2CFCA 1F8GA 4KTTE 1Y7TA 2PD6A 1TT5A 2HJRA 3HHPA 1EQUA 4CQMB 1I0ZA 1LSOA 3GGPA 3TZQA 4E2XA 4TRJA 1RPNA 1YQXA 2J5KA 3AUUA 4NJMB 4RF3A 3FNHA 3RKUA 4CPDA 5CDSA 3L77A 3LT0A 3HG7A 2HJSA 3B1KA 3KOUA 3ONDA 3PGJA 3DC2A 2YHUA 3LC7O 2ZATA 5KKCA 2W2LA 4KDFA 1JU9A 4FFOA 2AQ8A 4L9RA 4EUHA 4Q3EA 4QECA 5IG2A 1K5HA 1PIWA 1QYXA 3BMCA 1Q7GA 1QMGA 2WE7A 3NT2A 5CHEA 2NVUB 3O8QB 1B3BA 4BHTA 2BKAA 1VC2A 4M89A 2PKRA 4TQGA 1UDAA 1J0XO 2ZQZA 3BHMA 1E3WB 2O3SA 4QFDA 3TZHA 2DUUA 1EFKA 4EI2A 2EEZA 4E5KA 1PGNA 1HXHA 5IN4A 2BD0A 2VOEA 4Z6KA 3H5NA 4OQYA 4XDYA 1KYQA 5T8KC 2O3QA 2C82A 5A05A 3EDMA 1ONPA 4LRSB 1GAEO 1FF9A 1HF3A 3ROPA 4CR8A 5A04A 4BNVA 2C2YA 2GR9A 3ZWAA 4YCAA 4EEZA 2OMEA 2PGLA 1MC5A 4AJNA 4RCVA 1H6DA 4B79A 4PFJA 3OECA 4D46A 3JQ8B 4IUYA 3UKOA 3MJVA 4OJNA 2VQ3A 3HDJA 2RIRA 2PH5A 1E6UA 3U09A 1GQ2A 4RQUA 4M8SA 1BWSA 4BMVA 3H4VA 3N7UA 3INGA 2W90A 1CEQA 2OHXA 3VZPA 3GHYA 2HK7A 1QV6A 1KBZA 3PK0A 4W9NA 2QYSA 3GVCA 3PHGA 1E1LA 1NPDA 1IB6A 4ZICA 1HDZA 1PQWA 1ULUA 2AQKA 2GNAA 4YQZA 4DPKA 3BMNB 5CDGA 4MVJF 3CE6A 4Y8VA 2I99A 3SJUA 3WTBA 3GK3A 3NYWA 5K0ZA 2Q1TA 4RORA 3ON5A 3H8VA 4LK3A 5FF9A 1HSZA 2VUSA 3WB9A 1ENPA 4N5LA 4XD2A 4D43A 3PDJA 3KLMX 1KETA 1G0OA 2WSBA 4YT4A 1Z73A 2EKQA 1JLLA 2X8LA 3S1LA 3TOZA 4PVDA 5BT9A 3Q3CA 4P8RA 1XCBA 4Y6SA 1WMAA 1Y8RA 3NTOA 4I08A 5ITVA 3PQEA 4CMIB 1IL0A 3E6AA 3KETA 3ZDFA 1HL3A 4BQRA 3OF2A 4E5NA 1QYDA 4GGOA 4DL9A 4KUGA 4B4VA 2EKPA 4YRAA 5AQ1A 4KUHA 4Q3AA 2Q2WA 4RPJA 3BTVA 3JD4A 3RC1A 1O95A 3LF1A 3K2BA 1JVBA 1QR6A 1VJTA 1YXMA 3Q1LA 4KOAA 5BR7A 1I8TA 1ISJA 2AEFA 1KOLA 5JDCC 3GNTA 1O89A 1PX0A 2YYYA 1HT0A 2J3JA 3QA9A 2AE2A 1X1EA 3BYZA 2QZZA 2FP4A 2RAFA 3AW9A 4WLNA 1WNTA 5JAQA 4A10A 1SOWA 4IINA 2NVWA 4O59O 5LCXA 1Z82A 5U4QA 1EBFA 1A9ZA 1UP6A 2AG5A 2BGMA 2IRWA 2NACA 3I9OA 3PFFA 4QXMA 3CZRA 1NVTA 2PZMA 1MG5A 4IGEA 2CMDA 3MTJA 3PYXA 3W4KA 3DAPA 3F6YA 3CZMA 4G65A 4EJ0A 3GZ4A 1WXDA 4WEQA 2IZ0A 2OFPA 3W4IA 3RSHA 2DTXA 4GX1A 3AWDA 3PPIA 3SVTA 4I8XA 1XGKA 4D44A 4YPOA 4RVUA 2VT3A 3L6DA 5JO9A 3O03A 1ZSVA 2JD1A 1BW9A 1R4MB 3LF2A 1LTHR 4FPXA 4XYLA 5DCYA 3CMMA 5HTOA 4DIFA 4BO8A 4WASA 1Y9AA 1E5QA 2GN8A 4L4XA 2I65A 4CQMA 1JAYA 4LN1A 1DIRA 4RZIA 3HB4X 3RUFA 4CV1A 1HE5A 4WNCA 2QRKA 5JDIA 4FGSA 3RFTA 4NJMA 3C24A 3TQHA 5CP8A 3DBHB 5CDYA 3H9GA 1W0CA 4OKNA 3DTYA 3NDRA 1HSOA 2EW8A 2CSUA 4BKOA 4R9SA 1UXKA 4CUJA 5BSEA 2Q3EA 4IMRA 1TB4A 2D5CA 2NVUA 1U8XX 3UCXA 3O8QA 5CEFA 5K6AA 3KB6A 2NADA 3CXRA 5IXYA 2XXBA 1EVZA 4BL5A 4Y6RA 3ZWYA 3BMOB 2ZYAA 3QWIA 2VHYA 1E3WA 1P1HA 3PJEA 5GZ1A 2VZ9A 1MG0A 1I2ZA 4J1QA 1MXHA 1V6AA 2O3TA 1UUFA 5KJFA 4BNYA 1Y5RA 2GN9A 5AOVA 1LDNA 1LQUA 1DJQA 5DOZA 1FMCA 4B7UA 3NTRA 3QWAA 4RF5A 2JAHA 4CLHA 2FSVA 3EMKA 1R6DA 3I9JA 1ADBA 1E6WA 4P22A 5ES3A 4AJEA 1QG6A 4E5PA 1R66A 4D3SA 1NQOA 4J43A 3HDYA 4II3A 3H9QA 5HA5A 3JYPA 2FY8A 1X15A 4FOSA 1BDMA 3IL2A 3KYCB 4FCCA 3RU9A 3JQ8A 1HTBA 5IDWA 1K6XA 4Q3DA 3B6ZA 4CL8A 4X54A 1LA2A 4OOEA 5COBA 2X0NA 4J0FA 4E33A 1GYRA 4PLWA 4OSOA 4CMEC 2DFVA 2DT5A 1T4DA 3X2FA 4CM6A 5C7LO 1QP8A 3F4LA 6LDHA 3G3EA 4UVHA 2DTDA 1NASA 3BIOA 3RC2A 4J9VA 5JNLA 4LMRA 5JCJD 2LDBA 4W7IA 1AXEA 3KV3O 1YL7A 4DC0A 3PP8A 1DFGA 1I24A 3VDRA 3DMTA 3PTZA 4AJKA 3F9IA 3BMNA 5DBFA 3SX2A 3MTGA 4OGWA 2YDYA 2X6TA 4J2HA 2Y1FA 1NVMB 1M75A 1YE3A 1YJ8A 1DAPA 2QQ5A 1PQPA 3CPSA 4MVJG 1GR0A 4J90A 4E12A 4N5MA 1PZGA 2C29D 3WGIA 3GGOA 5AXBA 3QSGA 3TN7A 1ZIDA 1YVEI 1PJ3A 4KWHA 4O0LA 4NNJA 3H7AA 2EGGA 1NNUA 1GU7A 3RC9A 4PLFA 2Y93A 4YVFA 4BNUA 5I9LA 2J3KA 4CM8B 2YUTA 4BNLA 3IOYA 4CMIA 1HRDA 3TFOA 2E48A 3ABIA 2NLOA 2Q46A 4LW8A 3GG9A 1LDEA 1F17A 1W4ZA 1Y9EA 3AY7A 3JQAD 4XZ3A 1B2LA 4DA9A 1TT7A 2D5AA 3ST7A 3F1KA 3QHAA 1Z74A 2OBNA 3FNEA 1DIBA 1PQUA 3L0DA 3AM5A 4XYBA 3PHHA 4IIUA 1GEGA 1Z75A 4KTVE 1P1IA 1OBFO 1KY5A 1PL8A 1E92A 4B4OA 3WG9A 1NVGA 3DOOA 4Y6PA 3ZU4A 4NDNE 1RYDA 3ANLA 3VTFA 4RF2A 3LT2A 3H65A 1DJNA 5KOIA 1JDJA 3QY9A 4A7PA 1QSGA 4TROA 5LDGA 4J16A 3WNVA 3KSUA 1KEUA 4BNMA 5TJHA 1Q7CA 4IDGA 3WQQA 3JQBC 2PD3A 3RUIA 1I36A 1D1TA 1MV8A 1QORA 4AJHA 3SEFA 3BA1A 2W8ZA 4NBWA 3GEMA 3I9MA 1R4MA 3D4OA 3OSUA 2WEKA 2G0TA 3PWZA 4LCEA 3ZHXA 1LRLA 4GVXA 3RC7A 5GZ6A 2P5UA 1U3VA 2UUOA 2Y1DA 3HUDA 1K0UA 3DQPA 3PDUA 3RAJA 3VDQA 3LT4A 4DREA 5IZCC 4CR7A 4BUCA 2ZJ0A 1H6CA 1WVGA 3OJFA 3WDSA 3K8ZA 3DBHA 1I3MA 3I83A 4MPDA 3H5AA 1NWHA 4R5HA 4YBZA 3W4JA 1ZK3A 3OQBA 4FJ1A 1P74A 1JKIA 4OO3A 5C3MA 2AE1A 1ML3A 4ZQBA 5JXWA 4FR5A 4DUPA 2Q1UA 4DMLA 3VVCA 3ZZNA 4GMGA 3R3SA 3KO8A 2PH3A 3ZWXA 3ONFA 4AJPA 1SAYA 1XKQA 2P91A 2FR0A 3BMOA 4HWKA 4YEDA 1GL3A 4XQEA 4OYRA 4A73A 4Q3NA 3V2GA 3PYMA 2BRUA 3INTA 1LLCA 4PZEA 4HY3A 3WGGA 4OHUA 1QLHA 3AU9A 4PZCA 4CQLB 2G1UA 2VZ0A 2EHDA 2B35A 2Y1OA 1D4FA 2VNAA 4AJJA 3VPXA 4CM5A 1KC1A 1KVRA 1QYVA 3JQGB 1XQ6A 2DBVO 3QVSA 4MOWA 1H2HA 1BGVA 3W8EA 1GZ6A 1FXSA 3GY0A 3VKUA 4ZVVA 4EDFA 2X9GA 3NRCA 3KYCA 4NBTA 2I3AA 1V8BA 3C7AA 1LLDA 5TS3A 4KDEA 4CODB 1PS8A 2I76A 3IP3A 1YQGA 5EQDA 5F5NA 2OUIA 1MLDA 3VHRA 2UVDA 3I9KA 1BXZA 3JYLA 3PJDA 4U8GA 3CIFA 2B69A 2ILTA 3VVBA 2P9GA 3QJ5A 5JCXA 1HDOA 4OH1A 4DYVA 1LEHA 4EJMA 4BNGA 5T6BA 3GMSA 2JFHA 2X5OA 4RPGA 1LNQA 3HDQA 4QTZA 4J2OA 4BKQA 1IY8A 3TJRA 3Q6IA 2ZTMA 2WYVA 3WSWA 3JD1A 3OM9A 4RVSA 5A9SB 2I9PA 1K6JA 1DSSG 5F21A 3C8MA 2EP5A 4ALNA 3VKVA 4C7KA 3CINA 3IC5A 3FSRA 3E1KA 2Q4BA 3OJLA 5L40A 1CERA 3L6OO 3TF5A 1LJ8A 1DC4A 3KUXA 4CM8A 4IJVA 4H16A 3RQSA 4RLHA 5JCJA 2YW9A 4A2CA 2JHGA 1LUAA 3ONEA 3LC1O 4LRTB 1J6UA 4XKJA 4DQUA 2CZCA 3VH1A 5A03A 1ZFNA 4BO4A 1U3TA 3TRIA 1NWCA 1RM3A 3F47A 4PGFA 1CQJA 4JX8A 4RO0A 4Y67A 4OIMA 1EVYA 2C7GA 3I3OA 5F5LA 3ULKA 5F1OA 3WGOA 4DLAA 2RCYA 2BGLA 1AUPA 1U4SA 2VHVA 4NG5A 3ZNOA 1OMOA 3UVEA 1V3UA 2VHXA 1M67A 1PZEA 2YV1A 5IN5A 3IUSA 4BO5A 4Z0PA 2X86A 3HSKA 1U2GA 4NZ9A 3DMYA 1PGPA 1WZEA 1HKUA 2IYOA 3JSAA 2FSSA 3R0IA 5T8KA 3JQAA 5EN4A 2QRLA 1ZK0A 1TI7A 2VUTA 2VWHA 2JAPA 4BV9A 3NEPX 2G82A 1ID1A 2PV7A 1PS9A 4DIBA 2LDXA 4XR9A 1BRMA 1LDYA 1ZJYA 3RKRA 3VPFA 1C0PA 1MUUA 3COSA 3EW7A 2DM6A 1DIHA 1ADGA 3TZ6A 1GY8A 2IE0A 1PZFA 3DXFA 5LDHA 2ZCUA 4YJDA 1Z45A 1YONA 4B4WA 1E3SA 1IPFA 4BO1A 3QLJA 5FEUA 3C3XA 1UR5A 3CEAA 4NH4A 5A3VA 4KP7A 1A4IA 2HLPA 4OAQA 3I6IA 4AJ2A 2Q50A 4IJUA 1IUKA 2FMUA 4TVBA 4BNFA 5AYVA 4HV4A 1H0KA 3OH8A 4IS3A 2FPPA 3ROMA 1AXGA 2ZYDA 4LISA 5IDXA 3OBBA 2FZWA 1OZAA 4GLLA 4LSMA 1RM5A 4GL4A 2GASA 5G4KB 1LSJA 1ENZA 2QIOA 1IOLA 2NV6A 4FQ8A 4HFMA 5KJEA 3WWYA 3ZW8A 4O63O 2GO1A 2BLLA 1GPJA 4RV9A 1D1SA 3EHEA 3WQSB 4A27A 1UZLA 2J5RA 4CQLA 2Y67A 3QRWA 4M87A 3QIVA 1Y8QB 2PLAA 4U7WA 1HWYA 1F12A 3WGTA 4L4SA 3PLRA 4D3DA 3JQGA 1HYEA 2P68A 4J91A 4R54A 4EBFA 3M2PA 1MP0A 3I9LA 4E30A 4WCFC 4FN4A 2DAPA 2FR1A 2E4AA 5HWSA 4IZHA 1O94A 2D1YA 2CD9A 3WLEA 3R6DA 3B70A 2ZB4A 4WPGA 1PJTA 3FR8A 1LDGA 3K31A 3OETA 3H2ZA 3UH1A 4WLOA 5DN9A 3PHIA 3VH3A 3D64A 4BNNA 1DPGA 3LK7A 3OIDA 4YA6A 3FWZA 2Y66A 1JQBA 3GVIA 4PLTA 3GDOA 1I3LA 3ZWPA 4IXWA 3AOEC 2ZJ1A 2O48X 2SCUA 2X5JO 3A14A 4RDHA 1AHIA 3EZLA 4HFNA 1E1MA 1XG5A 1ISGA 2JL1A 3U4HA 1V3TA 3ZV4A 1WDLA 5A9SA 3GDFA 3NDIA 3KTDA 3WICA 1KS9A 3OQ6A 3D5TA 3QWBA 4DPLA 2HDHA 4F3YA 1SB9A 1E7YA 5KWEA 4WECA 3PHJA 3UF0A 5BSGA 2POQX 1GUFA 4ALLA 1X13A 4QUKA 2WYUA 3KVOA 4FJ2A 2B83A 3RUEA 3WGZA 4ND3A 4YT2A 2PFGA 5JC8A 3NTQA 3PVZA 3L9WA 2CF5A 2JCVA 2BHLA 5TNXA 3F5QA 5B37A 5CPFA 3O38A 3KM0A 1P1JA 2JD0A 3DBLB 2O7SA 4GSKA 1WDKA 4YAJA 1GV1A 1FDVA 3GUCA 1RYEA 2ZB8A 1R12A 1GPDG 1ZW1A 3U9LA 4M1QA 2OOSA 1EVIA 2DU8A 3GG2A 3D1LA 4ILKA 5H83A 3S2GA 2BMAA 3DDNA 4MKRA 3VC7A 4I9NA 2IZZA 1EDZA 4YAKA 5AXAA 5DP1A 4TZKA 1V9LA 5JSFA 5T57A 3PIDA 1AN9A 2BFOA 4D79A 4RDIA 3UGKA 2GF2A 3STHA 1DXYA 4U0KA 1XWFA 2JKVA 1RM0A 1EBUA 2G17A 1VL6A 5EMHA 4E21A 3WGQA 1SEPA 1UP4A 3ETGA 3RBZA 3RIHA 1LX6A 4RF4A 1VJ0A 3K5PA 4IQGA 4JK3A 3E5RA 4BV8A 4DQXA 1IHXA 4EUEA 3FI9A 1AHHA 3UCEA 4MO2A 5G2OA 1D7OA 4GH5A 3E82A 1UZNA 1LDMA 5EINA 3FNFA 1E3EA 1EUCA 4MVJH 4QQRA 4F6CA 3WMXA 2GZ1A 3LVFO 1HDRA 3E48A 3VPHA 4JJGA 5C7OO 2EGHA 4CJXA 4ND2A 1GD1O 4NU6A 3EYWA 1KEPA 4ZRMA 1LLQA 2JCXA 3AUTA 5I7EA 3GVXA 3S55A 1B16A 2B0JA 3PIIA 2DQ4A 2YFQA 4PRKA 4DMMA 1LSSA 1C0LA 2BF7A 1EE9A 3INRA 4U6QA 4NK4A 3T7CA 5MGBA 3U4DA 1X0XA 3OJOA 3RWBA 1B8PA 3RUDA 2IODA 3QWHA 3HZZA 4BGEA 2RBEA 5KVSA 2QYTA 3GZNB 3M1LA 2FR8A 3FF4A 4GKBA 1DC6A 1I32A 1WP4A 2W98A 1A27A 2D0IA 3GN2A 4FFNA 2XF8A 4PLHA 1UXGA 2YV3A 4LCJA 5A3JA 5HRUA 5G4KA 3L4BA 3JQ9C 2OGUA 1C1DB 3G0OA 2Q1WA 3AY6A 3RU7A 1PU2A 1UZMA 3LZ6A 4J7UA 4L75A 2EERA 3SC4A 4ZRNA 1CDOA 1P1FA 4NU5A 4L74A 4NK5A 5BSFA 1Y8QA 1WPQA 3BHIA 3GN1A 4LMPA 2G5CA 4XWYA 2AA3A 5DBIA 1G1AA 2GLXA 3MWDB 4N54A 1X1TA 4R1SA 3QP9A 4E31A 2ZTLA 1SO8A 3EC7A 1UXIA 1WZIA 1PJCA 1U1IA 4RL6A 5EQFA 2GZ3A 2GYYA 5ILGA 3NKLA 3H3JA 4TRNA 1PWZA 3Q11A 1NFQA 3W6ZA 2VT2A 5HM8A 1O9BA 5FI3A 3ZHBA 4TWRA 1JAXA 3DO5A 2AG8A 2HMUA 4R01A 5I9MA 3DAFA 3AFMA 1E7WA 3ROQA 1PJ2A 2YDXA 3AM3A 1M66A 3BHJA 4JXKA 3P5SA 1DEHA 3K30A 3L6EA 3ZV5A 4BGUA 3EUWA 2VYVD 4BNZA 5IDQA 4ZA2A 4QEDA 2ZCVA 2ZB3A 3JQFC 3UW3A 4JGBA 1HZJA 3BMQB 1RKXA 1VLLA 3ORFA 3EVNA 2JCYA 4ITUA 4H15A 4WKGA 2VRBA 1ZEJA 3ZCXA 1A71A 4FB5A 1KVQA 3JQCA 1B8VA 2DBZA 3G1TA 1DFIA 1VL0A 3OEYA 4YAGA 1HDGO 1QV7A 4CV2A 1XDWA 3E9MA 1D8AA 4GKVA 3WQRA 3F1LA 4MIOA 4IS2A 3NT5A 4CMBA 1PJLA 3O26A 4ALJA 5C5IA 5JY1A 1C3VA 3E5MA 2FWMX 2IEDA 3DAGA 1N7GA 5ENVA 3D3WA 4IGFA 5DDIP 1BSVA 1UDCA 4JBIA 1SCUA 4CLRB 4P4LA 1A4UA 3DBLA 3MJTA 5DT9A 1HZZA 3UFXA 2X1HA 3I6QA 2EV9A 2J3HA 4XYMA 4DTIA 4CM7A 4BO3A 2VOJA 4CLXA 4URFA 4PG8A 2GERA 3UAGA 2R00A 3E03A 5JBIA 1R4NA 4BGVA 1M6WA 1O0SA 3VH2A 5DF1A 2EF1A 4JP3A 1U3UA 3EZYA 4B3JA 1NPYA 1P45A 4I5DA 4IXTA 4BNTA 3GHHA 2RH8A 1IHYA 4R1UA 2DVMA 5ER9A 3LC2O 1ADCA 1Q0QA 4E5MA 5JYDA 4W9NC 4BB5A 3PJFA 1T2FA 1ZK4A 4PVCA 1KVTA 3MOGA 4CM4B 2IEBA 3HNPA 4NBUA 1E3IA 4JBGA 3UICA 2FN7A 1DIAA 3EVTA 4WCFB 4D0RA 3LDHA 4HBGA 3Q9UA 4E2YA 3H9JA 3WJ7A 4UVEA 5CG1A 3W8FA 4UUPA 2TMGA 2NQ8A 1C0KA 2VCYA 4GLOA 5IDYA 4BNIA 5ENDA 1RJWA 2QHXA 3GC6A 2OO5A 2EW2A 4KMSA 4N7RA 4XGIA 1JN0A 4L73A 4ZU3A 2YQ4A 4PZDA 1ZJZA 4GGPA 4XJSA 3FBGA 1I3NA 1B3RA 4B4UA 1ZMOA 4GWKA 4F6LA 4MVJI 5AXDA 3V1YA 4RJTA 5JFOA 2R6JA 4UVDA 1EEHA 3FPCA 2BFMA 1KIFA 1HE3A 2HQ1A 5H82A 3V8BA 1A72A 5JS6A 1FK8A 1X0VA 9LDTA 1ZO8A 3GZNA 3JQ7A 4KQWA 3S8MA 4ZQEA 4KWIA 4QX6A 1K89A 3D7LA 2NU6A 1UP7A 4GX2A 3ZGYA 1B14A 4QO7A 3ITKA 1C1DA 5L4SA 4L4RA 2VHWA 5U1PA 4YWJA 2BFAA 2F1KA 3IS3A 2VZ8A 1R0LA 2O50A 3KBOA 2J8ZA 2DKNA 2ZQYA 2CDAA 4CL3A 3KLPX 1CETA 1TLTA 3ZV6A 3AFNA 1E1NA 4PCVA 1ISMA 3X2EA 3ZWCA 1X14A 3JQAB 2WE8A 3RUAA 1CJCA 1NM5A 4UVIA 5DCWA 2Q2VA 2BFPA 2HUNA 2PNFA 1Y6JA 1ZXLA 5DBGA 3KSZO 2CVOA 4MINA 3I4CA 4YACA 1B15A 1TA4A 1LQTA 2EP7A 4WOKA 3I52A 3QQPA 1HYGA 4N5NA 4YJGB 2NU7A 2B4QA 3GRKA 1ZKMA 3PZBA 2GGSA 2P5YA 2GN6A 4WE3A 3E18A 4R41A 3GR6A 3RJ5A 4O5OA 3A28A 3QVTA 3GPDG 1J49A 4TSKA 3BMQA 4IMPA 4EW6A 3JQDA 2OL4A 5BNIA 3AY3A 1GQYA 3HDHA 4HFRA 3RVDA 3QVOA 5ITWA 2NWQA 4ZGWA 2X0JA 4XJTA 4FD3A 4ID9A 1U7TA 4UREA 3NDJA 4O6VA 2DUWA 5IFLA 3FRJA 3F5SA 5DZSA 2H63A 4BO2A 3K96A 2PK3A 3KHUA 1ADFA 3ITDA 4XDZA 1E7RA 1GYPA 2JJYA 1V35A 3QVWA 4R4JA 3WGYA 1BG6A 4W7HA 2EIHA 3RUHA 2VYVA 1U8FO 2GD1O 1U28A 4OQZA 3F46A 4QSMA 3HN2A 5JC1A 1T2AA 4AJIA 1UAGA 2ZK7A 4CLRA 3DOJA 4J0EA 4NQZA 1EQ2A 5CDUA 4FFMA 1N8KA 2WM3A 4ZQHA 4WCDA 1XR3A 3OP4A 3PYLA 3H6KA 4R3NA 1DAOA 1J4AA 1BTOA 3NAQA 3U4IA 5JAIA 5TT1A 4FFPA 5L4LA 5TC4A 2Q1SA 1WW8A 1ONOA 5C37A 4PN3A 4BMNA 1X7HA 4R68A 4NFYA 1V0JA 2VRCD 4DLLA 5FI5A 2C5AA 4E6PA 4DXHA 1HETA 3DBVO 1NAIA 5EPOA 1N9GB 4WOJA 4CM1A 3FHLA 4XCVA 2YV2A 3MJ4A 1JWBB 3MOIA 2B37A 3KSDO 3OMLA 2HMVA 3EGOA 3L4SO 5IAAA 5MDHA 4CMKA 2V6BA 3QVXA 3CH6A 4OXYA 1DIGA 4A0SA 3DMTC 2IZ1A 4CM4A 4BO7A 1K2WA 2P9EA 4YB8A 1Y1PA 4CR6A 4WCFA 1C0IA 1D3AA 3VPGA 4ZD6A 2YHIB 1ZUD1 2EKLA 4RVGA 4LVUA 5JMPA 2I66A 2HCTA 3WIDA 1M2WA 3W1VA 3H3FA 2AQHA 4GWGA 2UAGA 3IQDB 4BO6A 5IXSA 3DZGA 4JJFA 3VAZA 1NPTO 4EJ6A 4U6SA 1YL5A 3ZWWA 2GUGA 4F46A 2J5QA 1XELA 3SJ7A 1LU9A 1WWKA 4DQVA 3FPLA 2PGJA 3IUPA 2H9IA 1B7GO 1I30A 3OJ0A 1YBVA 3LYLA 2A9FA 4L0QA 3P2OA 3WBBA 5JO0A 1EFLA 3SC6A 3AI1A 2ZKLA 3FTPA 3AU8A 1WDMA 4K6CA 1ENOA 1H9BA 1JVSA 3KXDA 2O4UX 4WUVA 2BH9A 2DFDA 2Q45A 3GEGA 4RGBA 3EAGA 5JY6A 2VTEA 4B8ZA 3C85A 5KIAA 1TVEA 2HU2A 4XQ9A 2AQIA 5TJ9A 2WD8A 4PLVA 2O7QA 4JBHA 3ZU2A 3JD2A 1GDHA 3SBOA 3OJEA 3R3JA 5A4DA 1W6UA 2A92A 1SMKA 4XRRA 1IZ9A 5DNAA 2H6EA 4WLUA 4BS9A 4GX0A 5F3RA 1VL8A 4KZPA 3D4PA 4NJOA 2Z1MA 3OFSA 4XIJA 2Q49A 5I8ZA 4IQ8A 4AICA 4YYZA 3KYDA 5FFFA 1ENYA 1PEDA 4MJLA 4DGSA 1E1KA 2Y0CA 3RD5A 1JWAB 5B1YA 4EZBA 2Z1NA 2NTJA 2HK9A 4CLOB 4YJGA 2ET6A 3VOSA 4Q3BA 4Z3KA 5TT0A 1EK6A 4OOFA 4YT5A 3RI3A 3HB5X 1E77A 1Q1NA 1GFSA 4TKMA 1P77A 2BGKA 1MGOA 3U49A 4XX0A 4E4YA 1EUZA 3NJ4A 4OXNA 3T4XA 4IDAA 3DZFA 3ZN2A 4Z0HO 2WMDA 2Y68A 1CYDA 3WFIA 4II2A 4MP8A 3M6IA 4WNIA 3NV9A 1F0YA 3DB2A 4G5HA 1SOVA 2D2IA 4MDHA 5EESA 2DPHA 5CAEA 1Q7BA 1VM6A 1DBVO 2WD7B 4NBVA 3BAZA 4OM8A 3KEOA 4P38A 4GI2A 1AE1A 4FS3A 1ZXBA 3I5MA 4XIYA 3FR7A 1BVRA 4J1NA 4I9UA 2YFHA 2TMDA 5EL0A 2CDBA 2ZYGA 2O2YA 3DHEA 3K9QO 5KJ1A 1PR9A 4ND5A 1T2EA 4CLDA 1E7SA 4FGWA 1XU9A 2HRZA 3SLGA 3V1UA 2X58A 3V5NA 4LGVA 4PLZA 4PG6A 4F45A 2UUPA 3JTMA 5JYEA 1A7AA 4GPD1 1NAHA 3ANNA 1E6EA 4EGFA 1IYZA 1GUYA 3ETEA 3DHNA 1E7QA 2O3UA 4DBZA 1N1EA 3PI7A 5COAA 2WWRA 4UEJA 4DWVA 1LC0A 3D4NA 1VJ1A 3A4VA 5JLAA 3WFJA 4MP3A 4HNHA 5JDCA 3WR5A 4XR4A 3JQ9A 2B5WA 1GYQA 1ZNQO 1PJQA 4YJHB 4BNKA 1CWUA 1QLJA 4J49A 1MFPA 2FRDA 4BNWA 1N9GA 1YBMA 4ND1A 5JE8A 3UUWA 4E0BA 1NFRA 1H93A 2WDZA 1PL6A 4L8VA 4FSHA 3ETDA 4IDEA 4DRYA 1EMDA 3Q2IA 4E32A 4ROSA 1YDEA 2DPGA 3O4RA 3WGHA 1C14A 1DDOA 4YAIA 4RPLA 1U7HA 1XEAA 4Y9DA 5T5QA 3W6UA 1KVSA 1Q2XA 3OA0A 4LSWA 3OICA 1YB5A 4MVJM 2Y1CA 3I4FA 3OA2A 3WLFA 4DLBA 4Z0TA 5I7SA 1J5PA 1U3WA 3OQ1A 2IDZA 3ZW9A 4J6FA 5BSHA 1VKNA 2YHIA 2P9CA 4IM7A 4LVCA 3GRPA 4PG7A 3TL3A 7ADHA 2VRCA 1GEEA 1XYGA 3FWNA 2EWMA 3DTTA 1W8DA 3GMDA 4ONEA 2FHSA 5DOVA 3PRJA 4MVJD 3ZV3A 5IJZA 5G0TA 4E2ZA 3IP1A 5DCUA 1YB4A 3WXBA 4C4OA 3JQFA 1PSDA 2NTNA 2Y99A 3UOGA 3PQDA 3GFGA 2HMWA 4K9DA 4R5MA 1EE2A 3WX0A 1HYHA 2AHRA 3VTZA 3WJAA 3D3WB 4S1VA 4AJOA 2P2SA 3JCZA 1O5IA 4QT0A 1W73A 3WWZA 1LBEA 3PWKA 4Q39A 3MJCA 2HKIA 1CF2O 1M6HA 4YXFA 2VUUA 3DEYX 1QRRA 1GADO 3VPSA 1H94A 3NGLA 1EZ4A 2FPIA 3TSCA 1IE3A 5H81A 4J9UE 4R16A 3NX4A 4OSPA 4TMFA 4YR9A 3NJ8A 3HN7A 3GEDA 2P4QA 1R4NB 5B4TA 2WTBA 3D5QA 4HADA 1PJSA 5L7WA 4HFJA 2JFGA 3MJEA 4IDCA 3JQ6A 4INAA 3HQ4O 4W6ZA 3GVPA 1NQ5A 5ADHA 5TSDA 2NU9A 4BQPA 2YZ7A 2W2KB 1CQIA 1DB3A 4IDFA 3G79A 2GDZA 2PZKA 3JQEA 5L7YA 1PR3A 2H1SA 1XIVA 4PIVA 2NNLD 4XYEA 3PZRA 4MKXA 3NT4A 1GZ3A 4IDDA 3C7DB 3U3XA 4PG4A 4EYEA 5KVVA 1VSUA 2Q2QA 4N18A 2QZ9A 3KZVA 3HADA 5TF4A 5L4NA 4CLOA 4I5FA 3K6JA 4CMEA 3L07A 4WLEA 3U0BA 1Q0HA 1EUDA 3K2EA 3SLKA 3WIEA 2ZB7A 3CUKA 5I7FA 1P3DA 3ANMA 1VKOA 1CRWG 5THKA 3NGXA 3S2IA 1G6KA 2OZPA 8LDHA 2HRBA 1A7KA 4GQAA 3WSVA 2BI7A 3LSYA 4G2NA 3V2UA 3GA0A 1A9YA 3OIFA 3DZBA 4AG3A 3AI3A 3OEWA 5GY7A 4DC1A 3N74A 5THQA 1EK5A 2PKQO 4IPTA 4J4HA 3VZSA 1Y81A 2NTVA 5L95A 4GAEA 2WD7A 1U4OA 2WYWA 3JQ7B 3SXPA 5KJ6A 2UDPA 4XQGA 5COQA 3C1AA 5F1PA 4GSLA 1R15A 2V6MA 2V6GA 1GUZA 1P0CA 2CNBA 1T24A 1HE4A 4FBGA 3IJPA 4YJFB 5G0WA 1P9LA 4FJ0A 3RBVA 5BNFA 2B4TO 4FDAA 4D41A 3GH3A 4NHEA 3TDKA 3JV7A 2DBRA 4ZN6A 4ZQFA 3E9QA 5L53A 3KEQA 1R0SA 4M54A 4MIYA 5HS4A 2GN4A 2PGDA 2JFFA 4OMUA 1DRVA 1H2BA 3B20A 4MP6A 2Q99A 2DBQA 1SEVA 5KTKA 2E82A 3LU1A 3TL2A 2E6UX 1ARZA 2HMSA 1CIVA 2ZTUA 3GPIA 2Y1GA 3NUGA 4K1LA 1DRUA 4XGKA 4XQCA 5AXCA 4YTEA 2D3TA 2NUAA 3PFWO 1XA0A 5KCZA 3HJAA 4KUEA 4YJHA 3ZHZA 3BXXA 1ISHA 4I1IA 5B12A 2HSDA 2C2XA 3ZU5A 1GV0A 1T2DA 4IQ0A 1BXKA 3H9EO 5TX7A 4J1TA 4PG5A 3DFZA 3UN1A 5TLSA 5LC1A 1BXGB 1E0DA 3B1JA 1LRKA 4J1SA 1I3KA 2I3GA 5A5FA 2VYNA 4YDRA 1H5QA 5IZ4A 4A03A 3P19A 3CKYA 4B7XA 1OC2A 3ROKA 1P44A 4U5QA 1Z6ZA 4D45A 3V1TC 1H6BA 2O2SA 4Q9NA 2HMTA 3UCFA 5JW6A 4UUNA 3PLNA 3WYCA 2NU8A 3JQBA 2J6IA 4OKIA 4MVJP 3GQVA 1OI7A 2EXXA 2OORA 3RROA 2X0RA 5EIOA 4BNXA 3H5RA 1VI2A 2O3JA 4CV0A 2P4HX 2CVZA 1NP3A 1U5AA 5A9TA 1M76A 2NQTA 2PKQP 1YBAA 3GFBA 3TWOA 2FOIA 1F14A 1B8UA 1T26A 1UJMA 2Y05A 4BNJA 3F3SA 1ISIA 4CUZA 1X7GA 3AK4A 1AGNA 3QV1A 4P4NA 2X0IA 1T1RA 4R1NA 1I2BA 4FFRA 3JYNA 5IZCA 6ADHA 4XYGA 1PJBA 4TKLA 1H9AA 1PGOA 4HUJA 3WNQA 3GVHA 4Z9YA 2CDCA 3PHLA 3DOCA 2R2GA 5JPIA 3DONA 4HXYA 3P2YA 2PTGA 4GVLA 4QO8A 4J7CA 3VZQA 2WJPA 3DZJA 4CLEA 3PWSA 1OC4A 1OAAA 3PJGA 1DC5A 3PGXA 5CEJA 1SNYA 3Q2KA 4PLGA 1NBOA 2GCGA 4PLPA 1YJQA 1N5DA 5HS6A 3ZNPA 4MVJA 1IZ0A 4FIZA 3ZHYA 3CTMA 3TZKA 2FPGA 1UH5A 4I5EA 2UYYA 2ZIZA 4R9RA 4WEOA 1XHLA 1ZZEA 1YH3A 1DHTA 1YOVB 3MWEB 4GX5A 1SPXA 3WBFA 1ORRA 3FNGA 3B1FA 3PXXA 1SZJG 3TFQA 3U62A 3BTUA 1E3LA 2W2KA 2BI8A 3DBRB 4NI5A 3DHYA 1MC4A 4BVAA 5JMWA 1T25A 1TEHA 2UV8A 4D7AA 2AMFA 2C5EA 2D59A 2B36A 3BZUA 4IIVA 3P7MA 5L7TA 1S7CA 3FBTA 2X5KO 1L1FA 1E3JA 1DRWA 4J7XA 5TRTA 4MVJE 4H3VA 1XLTA 2CF6A 4Z3DA 4UUOA 1V3VA 4JQCA 4O1MA 4OL9A 3ZI0A 1E7MA 1BMDA 1Q0LA 4PLYA 1YDWA 4CMJA 1HLPA 1FDWA 4NMHA 1ZCJA 4MKZA 1E5LA 1ZMTA 4UULA 4XRGA 1NXQA 4R51A 2GZ2A 4GMFA 1HDYA 4NFHA 5ILOA 3OIGA 1NR7A 4BKPA 4AL4A 4D42A 5CEEA 4UUMA 3FN4A 1GCOA 1K6IA 2RH4A 5I9NA 1YQDA 1KEWA 3K73O 3U4CA 1WLYA 4XEHA 4BB6A 1XSEA 5L9AA 3WYEA 2A94A 3RCBA 4IDBA 1L7EA 2QRJA 4R1TA 2EJWA 3UXYA 2OBYA 4FW8A 4W99A 1XU7A 2C0CA 4JNKA 1F8FA 3IKTA 4CMHA 1BDBA 2VWGA 3L4BC 4IZIA 5EERA 4DBVO 1YB1A 4B7CA 4YJFA 2DC1A 5A1TA 2V7PA 3GNQA 4L76A 4BGIA 1SB8A 1LC3A 3RJ9A 2BELA 2YQ5A 3K92A 1VRWA 1NQTA 4KQXA 1LXCA 1T2CA 4C7JA 3GDGA 3UHAA 5FYDA 5TIIA 2DLDA 2PY6A 4WJZA 3S2FA 3ZWBA 2EG9A 5KJCA 1HEUA 1EVJA 4J4TA 4K28A 4M86A 4M55A 4BNHA 3TPCA 4YRBA 2X7HA 4ESOA 2PR2A 1DLIA 1NYTA 3VH4A 3WOHA 2I5PO 3DZKA 4WLVA 3D3EA 4CUKA 2VHZA 3KYDB 3VZRA 1MA0A 1PS0A 4Y98A 3GUYA 2AEMA 3ADPA 3LLVA 4UVGA 2YJZA 4PRLA 1NFFA 2XOXA 1QYWA 3LQFA 3M1AA 4RLSA 4EEXA 2G76A 5AVOA 1ZH8A 4E2WA 3U5TA 1P1KA 2Y1EA 5KNLA 1JW9B 2X22A 3CSDA 1HLDA 4Q3CA 7MDHA 2AEJA 1FDSA 1U5CA 1YWGO 5TQVA 1BXGA 2PD4A 4K26A 3GT0A 1DHRA 5G0SA 3PEFA 1N1GA 1PWXA 1ZEMA 1P31A 1VSVA 3RBXA 2IYPA 5IF3A 1U2DA 1F06A 3G49A 3LLSA 5JDIC 4A26A 2AW5A 2JD2A 4BMSA 4HKTA 4JIGA 4HP8A 1G0NA 2NSDA 1I33A 3N58A 5G0VA 1C1XB 4BKUA 3QWFA 2VWPA 4YAEA 3TZCA 3OHSX 4CMCA 2QW8A 1I01A 4H7PA 4I9HA 5JAMA 2CVQA 3C7CB 3ZWNA 2VNSA 5K6AC 1I10A 4IJWA 5L3ZA 5CG2A 4UEKA 4ALKA 9LDBA 5G4LA 4HNGA 3W8DA 1MXFA 4Z9FA 1L7DA 4JP2A 4AFNA 3ENKA 2CY0A 5CPBA 1PTJA 3O9ZA 2FZEA 5ICSA 4CM9D 1DO8A 5EJ2A 4A5OA 1ULSA 1QXSA 3RUCA 1PJ4A 4PLCA 2E37A 1KY4A 4E5YA 3TOXA 3IMFA 5DULA 2PA3A 3DZIA 4JLWA 1IULA 2R00C 3CMCO 1GTMA 5KVCA 3E8XA 2X23A 4UAGA 1LRJA 3I1JA 4XB2A 4GBJA 1S6YA 3F4BA 1A5ZA 3ASVA 1YOVA 2PWZA 3DZHA 1UXJA 2B4RO 3EK2A 5G0UA 4CMGA 4IBOA 5A5EA 4K6FA 4QFCA 4BOYA 4YT8A 1UAYA 2OP1A 4BO0A 4ZQGA 1N92A 1O6ZA 1T1SA 3DBRA 2W4QA 2NVBA 1FDTA 1EDOA 2AXQA 1QKIA 4RVHA 5F1KA 1N2SA 4JN6B 1SBYA 4AVYA 3ZWVA 2VWQA 3ICPA 4E3ZA 1FDUA 2QX7A 1KEVA 4HX5A 4XB1A 5ER6A 3T4EA 2W2LD 3C1TA 3FCOA 2B5VA 1HDCA 3QW2A 3DFUA 3WMWA 5I7VA 1LDBA 1NQAO 5ICMA 1XQ1A 2O3RA 2PZLA 3BTSA 4DVJA 2PZJA 1QYCA 1KC3A 1I2CA 1GCUA 1IPEA 4NPCA 3IDSA 3A1NA 3IIEA 5GZ3A 2EJVA 5L51A 4E13A 4TVOA 1SC6A 3Q9NA 4RVDA 5DP2A 1TT5B 5K9ZA 2YY7A 1LLUA 3AOGA 1R37A 4RVFA 5B4VA 2GRAA 3MJSA 1FJHA 1VPDA 5KKAA 5T64A 3AOEA 4EUFA 1DLJA 2C54A 3D0OA 4NFSA 4D0SA 3I23A 2CUKA 1ZSNA 2A4KA 4RQTA 3BMCB 1PGQA 3ZWMA 4RPHA 1ZSYA 2V6FA 3RASA 1KVUA 3GOHA 4ALIA 3M2TA 4CV3A 4DIOA 3HWRA 2ZTVA 4G81A 5KVQA 3S2EA 3T7EA 1PZHA 4IJKA 1PL7A 5CFZA 3TNLA 1P0FA 2C7VA 2QG4A 4IY1A 1PGJA 4NBRA 5I8WA 5BQFA 3DL2A 3IKVA 1ZBQA 1ZVMA 1TXGA 1UDBA 4XGNA 1KERA 3WYBA 3HFGA 2H5LA 3AI2A 5JAZA 4JROA 2HAEA 1ZK2A 1GQQA 2D4AA 2Y0DA 4D3FA 4AJLA 2RHRA 5B4UA 1MX3A 1B0AA 1DFHA 4ZJUA 5GMOA 4R69A 3JYQA 3KRTA 1T4BA 1YKFA 3ASUA 4BKRA 2XXJA 1YGYA 5C7IO 2C07A 3PQFA 3L9XA 3A06A 1DOHA 2F00A 1R0KA 3KYBA 5TGDA 1WMBA 4R3WA 1NX6A 3C1OA 4JJIA 2I6TA 4ZHSA 2DTEA 1JA9A 3FTNA 1RM4A 4W82A 4RPKA 1Z7EA 2JHFA 3HFSA 4MIEA 4DYDA 1R16A 3AUSA 5FWNA 5U9CA 3ZWOA 1ZK1A 3GNSA 3AJRA 3H9UA 1Y5MA 3JD3A 3ZU3A 5HBRA 4JCOA 4BO9A 1LSUA 2RHCA 2VTDA 2X4GA 1VE9A 5A02A 2O23A 1C1XA 1LI4A 1YL6A 1GZ4A 4FOOA 1OOEA 1DC3A 3G17A 3DWFA 2Y0EA 3BTOA 5J23A 3H2SA 4S3MA 3WTCA 3G1UA 4UEOA 2O4CA 3Q0EA 3ZNNA 1NR1A 4P4GA 3GGGA 2XPCA 3DR3A 4M49A 4BIIA 4B3IA 3EY4A 3V2HA 4ND4A 1P1RA 1RWBA 4AJ1A 1Y8RB 3FD8A 3ICCA 4EITA 1Z7BA 1O8CA 2VN8A 1YRLA 1MB4A 3JYOA 3GAFA 2I67A 4ALMA 4B3HA 1P33A 4OXKA 2XAAA 3MZ0A 4TRRA 2VYND 3A9WA 1WAMA 2GSDA 2A35A 2Z5LA 4J4BA 4NR0A 3I9NA 4WLFA 2J3IA 3AUAA 4XA8A 1I5RA 3IAHA 4FC7A 1N7HA 1YS4A 4W4TA 4I5GA 4Z9XA 2X9VA 1K3TA 1X7DA 3HE3A 3RFVA 2C59A 3ENNA 4U0JA 1HDXA 4YRDA 1YO6A 3WS7A 1NTOA 3AM4A 5CDTA 3MCVA 1UXHA 1H6AA 3ADOA 1ISFA 2IXAA 4J3FA 4WK6A 5T67A 8ADHA 5BNTA 1JTVA 4WGGA 1NHWA 1BVUA 4YQYA 2V65A 4CMAA 4AJ4A 3E9NA 3R1IA 4FC6A 2OXIA 4CQMD 2Z95A 2GPTA 4CM9A 3GF4A 2E49A 1U9JA 1JKFA 2HK8A 3GLQA 2D8AA 4TRMA 3ZNQA 1BHSA 1OFGA 2NM0A 1B26A 4TZTA 3ZH2A 3JD0A 2OP0A 4DPMA 1JKJA 3MEQA 5A9RA 1MFZA 1HE2A 2Q4EA 3GAZA 4NIMA 4CM3A 5A06A 2HO5A 2X9NA 4FFLA 1BW9B 2IXBA 4B8WA 1NHGA 1ONNA 3IJRA 3RFXA 2C20A 3LT1A 4RZHA 5L45A 3QE3A
chains in the Genus database with same CATH superfamily
1EVEA 1FP4A 1Y7TA 1T8YA 4P54A 2IDKA 4LFCB 2WYIA 2OYRA 5AUOB 5BV7A 4G9GA 2J6BA 2HJRA 1M7BA 2IGBA 1EYZA 2A0UA 3HHPA 1HGXA 1OXBB 2CLOB 3OZTA 5A1JA 4D96A 5A4IS 5K4GA 1RPNA 5AVUA 3O3CA 1PYOA 3AUUA 3RKUA 3FNHA 2H1WA 2RG1A 3PVCA 2VC2B 2TSYB 2HJSA 2AWOA 4P84A 3ABQB 3WMRA 4JJEA 1Y6RA 5K01A 1J8FA 1L8QA 1PNOA 5EWMB 3LW8A 2X41A 4L4ZA 4EP1A 2W2LA 2FFQA 1B23P 1CR2A 1XZQA 2AQ8A 2FW6A 2JC3A 3B51X 3NUZA 4Q3EA 4QECA 4F4JA 4RH0A 3W7BA 3BMCA 1CJTC 1YR3A 2BIFA 2WE7A 2D7DA 3ZXSA 1QIGA 3KB2A 1SCJA 1U2TA 4B48A 3IVAA 5LYJF 2AKAB 2DECA 2SKDA 3P9RA 5LMNB 2VK8A 2W93A 4TQGA 1XX6A 1J0XO 3TEFA 4ER3A 3WYDA 1QRAA 3VJLA 4J1JA 1XQYA 2WTXA 3TZHA 5F52A 1SXQA 3ZGXA 3FPKA 3EODA 2VPIA 1TE2A 3N2GB 4XSVA 3T7SA 2KSQA 3R7DA 2LW7A 5CK4A 3ZCVA 4CN9A 4TLMB 4Y2UA 1L5HB 2QX8A 5FIUA 4OQYA 1XEWY 1YDFA 2C82A 2QTGA 3BC1A 1LI7A 2RI1A 8AT1A 5I9IA 5KX5F 3K6SB 1ONPA 1GAEO 3ROPA 4AROA 3MC1A 4NZOA 5EFZA 3VMMA 2DJIA 2C94A 2GR9A 1JFVA 1KFJB 2GFQA 2YQZA 1N2IA 3WBJA 3NYIA 4O08A 3VJKA 1QHIA 2H18A 2XOKD 4PFJA 5JS2A 3OECA 4QUEA 2WV9A 1PFGA 4X8MA 1I51A 2QU7A 3UQZA 3EDYA 4JKOA 4IGKA 2XDQA 4DV1B 3OTHA 2VQ3A 3KK0A 3U09A 2RIRA 4LY0A 2AOXA 4G5OA 4TUYB 3R75A 1GPNA 4NOJA 1BWSA 1DRKA 2P7IA 1GNSA 4Q37A 5D84A 3IT0A 1MO2A 3H4VA 3OI7A 1WXWA 5F2EA 3I6MA 2W90A 4LGMA 1CEQA 3LIPA 4KBFA 4R8LA 3RRMA 2A14A 2C84A 2QWXA 3TPZA 3VZPA 1AF4A 5KYYA 5JAHA 1R88A 2VDOB 3GVCA 3PHGA 1N33B 3GMIA 1NPDA 3C15C 4GQBA 4YQZA 2GNAA 4DPKA 3QEKA 3U61B 4MDFA 3BMNB 1T8TA 2I99A 1Y5NA 2XVZA 4B9EA 5K0ZA 1E2BA 3ON5A 5AR1A 4KEAA 3H8VA 5FF9A 4BC0A 2V4UA 3I39X 1HSZA 1TNDA 2HN9A 4EPVA 4ZV4A 1TZMA 2XUFA 4HEQA 4DT1A 1G0OA 4J0CA 4D02A 1U04A 2Q6OA 2GEKA 5FPQA 5AVKA 3EYAA 3WWEA 2AZMA 3KJNA 5EIFA 1JLLA 5F2OA 4RW0A 4Q7KA 5SZJA 1RYFA 5C8DA 3KD3A 3TQCA 4HEJA 1EXNA 4KK3A 3Q3CA 1I0LA 4P8RA 4RSGA 5BT9A 3FUUA 4RTLA 4I08A 1NY6A 2JDID 2J4FA 4BE9A 2YBDA 1OTHA 1ZVVA 1EGHA 3BGIA 4L8YA 4B3TB 4IV0A 3KETA 2BM9A 2BEVA 2DSTA 1HL3A 1U8CB 3QTTA 1L5LA 4BQRA 3OF2A 3WC4A 3A1DA 2FDXA 1SBIA 5AQ1A 3TAXA 3WK5A 4YCNA 1WPXA 2IYVA 4TMKA 1K5PA 4X90A 2GNOA 3CJQA 4OBWA 3PG5A 4AZVA 3LF1A 4RHCA 5LJIA 1JVBA 5TGTA 2R1TB 1OX6A 3NTXA 3Q1LA 3HXOA 2Q9UA 2XZPA 1I7QB 3HRIA 4KFSA 2EZ9A 3DT9A 2HWKA 3I76A 2BGNA 3G9UA 3GNTA 3AHGA 3K4PA 1O89A 1K88A 4Y2YA 5K3BA 4IDNA 5IDVA 2YYYA 2V1UA 2J3JA 2ID8A 3FFTA 4PPGA 4L6AA 1Q44A 4CQJA 1VLVA 3SGLA 3FIJA 3OO0A 4JITA 2FP4A 3QX9A 3AW9A 4WLNA 1G7CA 5JAQA 1PJRA 2AOTA 4J0JA 3BXGA 3LUJA 4Q93A 2QM0A 3VYRB 4QBFA 1Z82A 3RH0A 3U3MA 2AG5A 2NACA 2CVFA 4G8BA 2FA9A 1E2DA 4JL8A 1YS6A 5FOTA 3UM9A 2ZROA 2PZMA 4C20A 1MG5A 1PG5A 4P3XA 5IPFA 1Z8FA 2P67A 3EAFA 3P97A 1YR6A 1JX6A 1UMDB 4G65A 4OX9Y 4HZIA 3VYWA 2WKRA 1VLJA 3L8FA 3GZ4A 2X77A 2B78A 3FUXA 4PFKA 1SG0A 4DBLE 4WEQA 5D1HA 1NVEA 1MRZA 4IIYA 1JHAA 1CFJA 2N3ZA 5DK6A 3RSHA 3VJRA 3TD2A 1FSGA 4GF5A 3W3ZB 2QF7A 3JAWB 3QGMA 3P9XA 4N49A 1EK2A 2P2ZA 2NTEA 3GLFA 2IEAA 1XGKA 2XGGA 2XMGA 4I8XA 2Q3JA 1DEKA 3CG0A 3G1WA 3ENQA 4HLNA 3CUEF 1MNQA 1DKNA 2WU3A 1ZGHA 4G5XA 1I6LA 4L7QA 4U7PB 4ND8B 521PA 4XYLA 1ETUA 3HRKA 3R6WA 5IJ9A 3L2OB 4BO8A 2P3QA 2PS3A 3B1XA 3KYJB 4OA5A 1Y9AA 4PNZA 3T7AA 4UPDA 4B84A 1SIUA 1A9XA 4EG3A 5KMGA 1E5QA 2GN8A 2Q7OE 4L4XA 5J4LA 2ZRIA 4CQMA 4PS1A 5C0OE 3TBKA 5FULA 1KJ8A 4OGLA 4YRGA 4P83A 4WNCA 4Y2PA 1CR4A 4FGSA 4NJMA 1THZA 2XXAA 5LB2A 1WSWA 5CDYA 2Q0HA 1OLXB 3RVLA 4D4LA 3G0BA 4ETWA 3DTYA 3M83A 1F6BA 1B43A 3GYBA 3NDRA 1GSAA 1HFJA 4TXMA 2H4ZA 4BKOA 5K0SA 4RETA 3R7AA 1Y0BA 5B6IA 1PLLA 2VJQA 3HK2A 3T5CA 3GT4A 4MO9A 1PR4A 3L0CA 2MSEB 4IMRA 4M1MA 1G8KA 4CUJA 3U44A 4E4RA 1QE3A 4DLPA 3NWBA 1SKBA 4IGIA 4RTJA 5K6AA 3KL4A 1D8TA 3CXRA 1CUVA 3LO8A 4GR5A 4O4HF 2NUPA 5HR5A 1EVZA 4H7FA 4Y6RA 1X7YB 2GEVA 5GZ1A 2VAWA 1MG0A 2VZ9A 4J1QA 1XVVA 4KPUB 5DYGA 2QJTA 2X0FA 2X7XA 5C5EA 1WZ2A 4OK5A 1NNLA 1EM8B 2WSLA 4D5EA 1DJQA 2WC1A 5D3MB 1O5TA 1FMCA 1Q77A 1ZM7A 3P2IA 4ZZ1A 4RF5A 2JAHA 3PL1A 1XD2B 3EMKA 1ADBA 1JMYA 4AJEA 4QDJA 1B6TA 1R66A 2NZJA 3F67A 2B7LA 4H59A 5A4FS 2HC9A 3O84A 4II3A 4PPQA 3ZDAA 3H9QA 5KKNB 3G2HA 5HA5A 1TIBA 2FY8A 2NXCA 3OLXA 5HMMA 4E22A 3PNQA 1Z4QA 1VG1A 4FKZA 2F3TA 1JQ3A 2IA5A 4PQYA 5D1NA 3ZD7A 2VQSA 3NHWA 3RU9A 5IDWA 1HTBA 2OOKA 2PO5A 3B6ZA 4IIHA 1X80B 2A5YB 2FLWA 2X0NA 5JVDA 2IYFA 2O1SA 1GYRA 5KUTA 5A71A 2DFVA 2DT5A 1T4DA 4Y2RA 1E9FA 5AHKA 3TTVA 4FD2A 5JZSA 5TDHA 1GPBA 1EFTA 4XX1A 1E64A 2ZBRA 5HKKD 1WKVA 3OOHA 1NASA 3O1JC 5EXDA 3ANXA 1Z25A 1P62B 4LMRA 5EWLA 3HCDA 5JCJD 2FE1A 3KQYA 4FN5A 1H1LB 4EIWA 4AMBA 1EGAA 1SZDA 1I4WA 4LX0A 2GBLA 3KT6A 3LZCA 3DKIA 3DMTA 4LNAA 4CDGA 1MT3A 3T1NA 4R6XA 4OHZA 3B3QA 2I2CA 3SX2A 4UHBA 4BC1A 2H0RA 3PUZA 1F48A 1XJ5A 4B87A 3K9NA 4E14A 3ZDDA 1YIDA 1DAPA 3OLYA 4BX0A 4CLOB 1GR0A 3MWGA 2JATA 2C29D 1QV9A 4CQNA 4Z4IA 1NULA 3AO0B 2IS1A 2P1DA 1ZIDA 1PDWA 2WZQA 4UMEA 3ACCA 3SEAA 4O0LA 4NNJA 3H7AA 3UJ6A 3QE2A 3H5IA 4Q47A 4G1EB 3ZE1B 5F9FA 3LX5A 5I45A 1ZCFA 3PFBA 3M4NA 3I64A 4PLFA 4JBLA 5I9LA 5KWVA 1Q12A 4LJSA 2XNHA 5ALOA 3NG1A 5GM2A 5NULA 1HRDA 4CMIA 3GP8A 4YGXB 4KKVA 3ZI4A 1JJAA 4LOJA 5K09A 3HFRA 3RS8A 3SR3A 4DIUA 3JQAD 4HQRA 2PR7A 3K0CA 3ND9A 2D7CA 3TSOA 5B7NA 2O07A 3OQIA 4PGGA 4UNQA 1IOVA 3RS7A 3V3TA 2ZR7A 1CQJB 3QUQA 3OT4A 3CRNA 4A8TA 4GU5A 1IJFA 4BP3A 3FNEA 1DIBA 4OL0A 1VIYA 4W1SA 2X3UA 1JFLA 1QHNA 4WZAB 4UU7A 5LZ2A 4LJLA 3PEWA 4LWPA 3QM1A 3O2NA 3PHHA 1NUAA 2J6CA 4YRFA 5DSXA 2FSHA 3ZQJA 2ZXUA 1JBQA 3WGKA 4D92A 1R6BX 1CS0B 2CE2X 3ILYA 4OJKA 3FHCB 1P4SA 1E92A 2FHPA 1V47A 4B4OA 3EW9A 3N9IA 5A3QA 4Y6PA 2EKBA 2PU7A 4U7HA 4GW3A 1RYDA 4J1TC 1AY0A 1RPJA 3AY0A 3U7EB 4FHZA 5KOIA 1PD0A 5LQUA 2ZYRA 1JDJA 3M3HA 4J8PA 3MTAA 5M04A 5G40A 3A11A 2ZBEA 4COOA 1GL9B 3WNVA 3H42B 2JLXA 3ZTTA 2XUKA 3UJ3X 5J40A 1TM5E 2OYCA 1J2JA 2QG6A 2VQFB 2BT4A 2CYBA 1FZQA 1V41E 2Z30A 2W0MA 5BW8A 4AJHA 3BA1A 3RG8A 3AT1A 2W8ZA 5C7YA 1D0VA 2ZBUA 2C4WA 3I9MA 3TUIC 3BBPA 3PWZA 4E5VA 1G63A 1VE5A 5IT9A 1D4AA 4R8KA 3EQ7A 3O3OB 2WV7A 3IXLA 3TZBA 1UKYA 5GZ6A 4K0KB 4AO8A 1WE2A 2NO5A 3QJYA 3WHLA 4H6WA 3RAJA 1N9KA 2I1QA 2H4WA 3LT4A 3JZIA 4S1PA 5IZCC 3B1ZA 4CR7A 1SCKA 2I55A 5CH5A 1JR3A 1RRKA 2WSMA 5ECDA 3W6PA 3I8SA 3BXOA 4KOEC 5KC8A 1I3MA 3AYZB 1YDMA 2BEWB 3R5JA 1NWHA 4RTRA 2D54A 4XTCS 4R5HA 1E8DA 5LPNA 1ZK3A 5B3KA 2QKYA 2X0EA 3KDAA 2H59A 4J0KA 5HZKA 4Z3OA 1WF3A 2EJCA 5KDLA 3FB4A 3NS7A 4ZIRA 1JDBC 1U81A 4AD8A 5I4KA 1QC5B 4QD3A 2IOQA 4PC6A 2OFWA 3VYVA 2XYHA 2Q1UA 3EE6A 3EMDA 4DMLA 3W6OA 3FSEA 4GMGA 3GIWA 1G20E 2OAQ1 2W8BA 2J9RA 1J8DA 2P91A 2FR0A 2RSLA 2B8NA 3BMOA 3KHKA 3LKVA 2GK7A 4XIIA 4XQEA 4Y0AA 2IC5A 1JEAA 2GH1A 1XDGA 2IU3A 4Q3NA 3ESCA 2VF7A 3EEQA 3KR9A 1K97A 2BRUA 2HOQA 3JWHA 3PQ2A 4PZEA 4A4DA 5KSZA 4HY3A 1XVIA 1XZFA 4OHUA 2EF0A 1GRRA 2G1UA 4KI0A 4M1OA 4N39A 3R5XA 1MB2A 1W5TA 5E7QA 3ER8A 2CNLA 1D4FA 4EA9A 2EJTA 4CM5A 2C4KA 2JVIA 2WTNA 4IV5A 4ZOAA 1QYVA 4JLPA 2QN3A 3QVSA 4ADSG 1H2HA 2C4UA 4IAOA 3N2IA 1C2YA 2UYCA 2OKCA 3S1AA 1JQDA 2X9GA 3NRCA 5EJ4A 3KYCA 4C7VA 1INLA 5AW8A 1C81A 1SCNE 1CY7A 1MIOB 1JAIA 2C2OA 2IP1A 2WR8A 4OFWA 4RXTA 5AICA 4XWKA 1LI5A 2I76A 3MT0A 3KQMA 1YQGA 4OQLA 1TAQA 1XNHA 2KPOA 2IS6A 2OUIA 3OC6A 4RGYA 4D2IA 1JEQB 2WWWA 3NRBA 5KSPA 1UK6A 3PJDA 5BVGB 5EIEA 3NTLA 5KQMA 1RC1A 2B69A 3VVBA 3TINA 4DDTA 4ZZ0A 5IJXA 5KINB 4JCCA 5KZMB 2PQMA 2QTRA 4ZHQA 1HDOA 4OH1A 2VDKB 2M32A 4QLAA 5T6BA 2WUDA 2JFHA 1EA7A 2PT7A 2X5OA 4MV7A 3EBLA 1G17A 1N6IA 3QYJA 2GM9A 1LNQA 3NCHA 1IDN1 4JAVC 2BZGA 3CPEA 4QTZA 1TC2A 2ZU0C 1CB0A 1IY8A 1N3IA 4J2OA 1TM2A 2SCUB 1ZH4A 2QB5A 5FLKA 4BKQA 5TB5A 2G28A 3IIJA 1XFAA 1NUSA 3DXYA 4M0CA 2REBA 1H5UA 1LS6A 4RVSA 5A9SB 1VHJA 2P27A 2WHRA 5FUVA 5BSUA 3CX3A 4I6EA 5KYXB 4ALNA 2OG2A 3MJDA 4LKRA 3VHXB 3VKVA 4LBYA 1WQ4A 3CINA 1UT5A 2XB9A 3QLEA 4HMPA 1B1CA 1CERA 1YA4A 4B8YA 3ICOA 1W46A 3TF5A 2ZPAA 5EIHA 4CM8A 4TVKA 3KCNA 3L82B 4BZWA 2XWQA 4MWTA 3RQSA 3VA7A 3A3OA 5A4AA 2CNDA 4WOBA 4R2HA 2G36A 1MRSA 5ALTA 3RT9A 3U3ZA 3MJFA 5CXUA 3IODA 3LC1O 4L27A 4XVQA 4LRTB 2PNJA 4XKJA 5GIPE 1PT7A 3HB0A 1QG0A 1XDDA 4G8DA 1U3TA 2HJGA 3A1SA 3A4YA 3O83A 4WDRA 2XQFA 1RM3A 4PGFA 3PR2B 4RO0A 2FZ4A 2WF6A 4V24A 5DIZA 3QPCA 5ARBA 5GGXA 1E4YA 2Z83A 2O8EA 1XZJA 1EINA 2W0SA 3MHPA 4G0ZA 4INZA 5CJ2A 4AF8A 3MTBA 2WRZA 3ULKA 5F1OA 4PC3A 3TG2A 3KTAA 5MHTA 2BGLA 1FSFA 1AUPA 4L07A 2YZMA 4P58A 1RWWA 2FRVA 1OMOA 1VZ2A 4WNAA 1V3UA 3UVEA 1JHYA 1I13A 4GXRA 5CURA 1M67A 3EWNA 4NCXA 3TDNA 3IUSA 4BO5A 4MI3A 1XXHB 3HSKA 5DYYA 1NVVQ 1KZGB 4NZ9A 4ZFNA 1G5HA 2ISQA 2UZ1B 2K7FA 1MH1A 1D2MA 1J9ZA 2BCJQ 2IYOA 3TW8A 1JHDA 3JSAA 2X4DA 3X1MA 5HUHA 1YDHA 3IALA 3R0IA 4OD0A 5EN4A 5HOEA 4X66B 4TYYA 1TI7A 4IIDA 1M33A 3NEPX 4CXMA 5FXMA 1I6WA 5EHIA 4ETMA 4F4HA 1ID1A 1PS9A 3DEIA 2IV7A 3T54A 1VB3A 3MINA 2YR0A 1T6YA 1ZJYA 4PYNA 4YECA 1MUUA 1G8GA 3X1XA 1JJVA 3SVLA 4OHPA 3VKFA 2PL3A 1ADGA 3TZ6A 1TVMA 1UBTS 3IMGA 1PZFA 3ZY3A 1AG9A 1V4BA 5AOCA 3CX6A 1TK3A 1YONA 5ANRB 1E3SA 1QCCA 3RR2A 2OUKA 1O97D 1PFWA 3IDOA 4N9WA 4BO1A 4EWLA 1SBCA 1S3IA 2PMFA 3CEAA 1KKUA 1DJLA 1EG2A 1Z3IX 4LJ5A 2F7SA 1KAGA 1OXKB 1G5QA 3I6IA 3V4ZA 3Q3EA 4V0LA 4RADA 5FTNA 4RELA 4HPJB 4K9PA 4BNFA 1W29A 5AYVA 4JSTA 4X71A 4YGYA 1MBZA 2GF0A 3E7PA 3WLLA 1AZWA 2FPPA 2JGJA 3PQ4A 3ROMA 5HQTA 5KQRA 4LF8B 2JIOA 3MAGA 3OBBA 5EJAA 2V55B 4XPZA 3H5OA 3R7BA 4LSMA 1U9IC 3UENA 1N1DA 3IAS1 2WP8J 4GL4A 1AGPA 1XZNA 3O4FA 1YV9A 4I1OA 5G4KB 2UVPB 1LSJA 5KAMA 3MAJA 2CK3D 2QIOA 2OV2A 2PZ8A 2W37A 4H31A 2B1GA 4G09A 2PUJA 4HFMA 4M0DA 5KJEA 3UBTA 1S0UA 1GPJA 4RV9A 1MGPA 1TO1E 2A4MA 4AKHA 2PWYA 3EHEA 3WQSB 4W6QA 4CQLA 2VBGA 1NMEA 4P5PA 4B3SB 4AUMA 4ZDKA 2TMYA 1QGAA 1Y8QB 1XQ9A 5KCZA 3WGTA 4L4SA 2FF7A 1RAEA 3OTQA 2QS9A 2QW0X 4H3KB 3ME5A 3PPVA 1M2VB 1N7JA 2P68A 5HXAA 4J91A 2QY9A 4LV8B 4LZWA 4S04A 1IIBA 3FM9A 3M2PA 2IXFA 3L8GA 4KN5A 4E30A 3OMXA 3SSNA 2GFIA 1E32A 1SRRA 2O0MA 2ZSIA 1UEJA 4XCQA 3SZ3A 1GTL1 4FLEA 5KOHB 5AVWA 3W2GA 2FE4A 2F3UA 2DAPA 5KYWB 1DAMA 2YIVX 1NYLA 1L9XA 2J87A 2WFZA 4C01A 4NLLA 1JXAA 3LRXA 3ZDZB 3KC2A 3GRYA 4H4EA 3R6DA 721PA 4KLNA 1I5EA 4GOND 4MNTA 2Q0QA 3CF0A 3I5AA 1E9AA 2BKXA 5SY4A 4MA0A 4JOBA 4RIHA 3B89A 4KSCA 3VH3A 1S8AA 4HDRA 3UC5A 1GGMA 2C9ZA 3KFXA 3LK7A 3OIDA 1VZ3A 2JLSA 1ZN7A 4JL6A 3MMPA 5TR9A 4BLQA 1DTWB 2DKFA 1JQBA 2VEDA 3KT3A 3VC2A 3GEBA 4HRAA 3IB3A 1I3LA 2FK7A 3GGDA 3ZWPA 1MAVA 1N2BA 2O48X 2ZJ1A 4RHXA 5MFZA 1W59A 3O0TA 1AHIA 4HFNA 1BS1A 1KHHA 3L84A 4LF7B 3P4YA 2O8BA 1FEZA 1KR2A 2GAFA 1DXHA 1MB0A 2GPJA 2HQRA 4G6ZA 3WICA 2Q5QA 2RE8A 1RZRA 2PLFA 5AJZA 4A6EA 3HYSA 3JPYA 3V97A 2HDHA 1P73A 4F3YA 2SECE 2B2NA 1P4RA 4RFLA 4TXLA 5J1TB 1AO3A 4G24A 1YR8A 3ZKWB 4LZJA 4N41A 1K7SN 2PCJA 1JAHA 4XTRA 1ZD8A 4QUKA 1KE2A 2HHLA 3DP7A 1YQEA 4MULA 3VQTA 4OKSA 1EXDA 4L5IA 3U7IA 5KAPA 5IK2A 3WGZA 4ND3A 3OPMA 1II8A 2QUAA 3OZEA 3NTQA 2E6KA 4XM0A 5SZHB 5JC8A 3L9WA 5K20A 5LKRA 1TJ5A 2CF5A 1NBIA 4DEXA 5FTKA 1NBME 5CPFA 3LNTA 5ALZA 5EZYA 2NZXA 2FDRA 3KZMA 3TAUA 5IKMA 2VYFA 3VI4B 2RHTA 4PX2A 1YFLA 1WDKA 1QE5A 3E3OA 4QTUB 2FEWB 4EG4A 3L0YA 4B31A 1GTG1 3FPAA 3U9LA 1XRNA 2YXPX 2OOSA 3GG2A 4ILKA 3VO8A 3D1LA 3VZCA 4BRWA 4WOPA 1G21A 1A5SB 5KI6A 4I9NA 1IHOA 2HLHA 3LVQE 4EB6A 2P5TB 2OPBA 5AXAA 3UNXA 2Q8QA 4F7WA 1CHNA 3MCTA 1WPGA 2G04A 4I6JA 3PT5A 3O7WA 5JNVA 1XTJA 4KRGA 1OAOC 2B8TA 2BISA 4GECA 3E9CA 4IKEA 3DD5A 3STHA 4D99A 1KJZA 1KYVA 1RXSA 5EMHA 4E21A 2PLRA 4FYPA 2XB2A 1GDTA 1HC7A 3ETGA 1BJRE 1YB7A 2EBUA 3F78A 2Q5EA 2VDMB 4NMWA 4RDCA 4JK3A 4RF4A 3E5RA 5IUKC 5K4HA 1IHXA 4G5QA 1DAGA 1KI9A 1NN1A 4HYQA 4C0JA 5G2OA 1D7OA 4E5SA 1RCUA 1E5DA 1X2EA 5BRAA 1WV0A 4XIFA 3TX6A 1PT8A 1UZNA 3UXHA 5AUNB 2WUVA 4WTOA 2XTZA 2ZAYA 1T9HA 2DR3A 1EUCA 1PLJA 2VT7A 3G02A 3HDGA 4HAVA 3HB1A 3I9V6 1XMPA 3P27A 4QRHA 4QQRA 1AIPA 1C7EA 1HTTA 1MU0A 1NJSA 1VHLA 1UBGA 3LQ2A 4AURA 5C7OO 1W9HA 3TSAA 4EA7A 4ND2A 2B8EA 1VYUA 2WW8A 1MRNA 2QZ4A 3EYWA 4G0XA 3Q7IA 4N0MA 3EZ6A 3PFGA 4QDUA 2Z6UA 5ERGB 1Z0UA 2XMSA 1LLQA 1D6NA 2JCXA 3AUTA 2QNBA 3CZQA 4ATNA 3ORHA 1B16A 1KTVA 5E7JA 2XB6A 2CKDA 2YFQA 3L7DA 2OXFA 3BRWD 1LSSA 1C0LA 2BF7A 3MRVA 4PRKA 4XSHA 2QMYA 3OE5A 1BQ4A 4U6QA 4QDZA 5CW1A 5KVAA 1BOFA 1F5NA 3DMFA 2ZJZA 3MQ2A 1MTZA 4IXMA 4YP6A 4G0QA 3R9IA 3OJOA 1UIRA 1OLUB 5D7BA 3TUJC 5CBPB 1OB2A 2GEBA 4WD3A 4HRVA 4V3BA 3UHOA 2C1EA 1T6BY 3GRFA 2R6CA 2Y1LA 4HG2A 1D6JA 2GA9A 5ETJA 2Z98A 3WIBA 2PX0A 4YASA 4GKBA 4B6RA 2C2BA 2QJOA 3NP9A 1DC6A 4Y6LA 1YCFA 1VG9B 1POXA 3P0FA 4FFNA 2XYPA 3BFPA 4TUYF 3GXBA 2N42A 2YV3A 2CL7X 4LCJA 5CJPA 3EJWA 2IYRA 4MX8A 1YNOA 2JA1A 3L4BA 4LAFA 3S2UA 5A3JA 5HRUA 2OGUA 1C1DB 1Z63A 3G0OA 2Q1WA 3AY6A 3RU7A 3O5AA 3I0MA 5D6OA 5I7AA 4FTWA 2DHEA 4EGAA 3RGWS 4M8IA 1BN6A 1EZ1A 2JJ2D 2KMLA 4BZQA 1Y8ZA 2EERA 4N65A 3SC4A 2I6QA 2NXEA 3GAMA 3RC3A 4EAAA 13PKA 1XK7A 4ZT2A 2B8WA 1P1FA 3K05A 4NU5A 4RJJA 5HOQA 3U1BA 3BRSA 4GEKA 1Y5IA 4IP0A 3SSAA 3UWSA 3EISA 1W0JA 1O77A 1RXIA 2IH2A 1NT2A 2D1TA 2IWHA 4NWIA 1DXQA 3WLTA 3QI2A 3I45A 1DP4A 4PC7A 1QQTA 3MWDB 2CB9A 3PU6A 2YZKA 3QP9A 4BHHB 1QGUA 3CFYA 4QGSA 1ZD5A 1JEOA 5H5JA 1UXIA 4G23A 4IUDS 5EQFA 1U0OC 4LZLA 1VG0B 4RBNA 2GYYA 2YVUA 4FZ3A 4MWSA 5ILGA 3RE1A 4TRNA 1QNFA 4O4LF 2ZSJA 1YULA 4EHIA 3C3DA 4ER7A 3MHTA 5SV2A 2PL1A 4OFZA 3G5AA 4D0LB 1TA0A 2AG8A 1JYFA 5I9MA 3CNOA 3DAFA 1D0IA 3MD0A 1SUEA 3AFMA 2RGRA 4X63A 3SF8B 3AM3A 3BHJA 2MJLA 4N7JA 2JHCA 5D5QA 3L6EA 3WVNA 2P9ZA 3EQ8A 3EUWA 2VZEA 4ZA2A 2ZCVA 2ZB3A 4G56A 2AD5A 5DLYA 4MW5A 1FFWA 2B7CA 2V5UA 3B78A 1OU0A 2OBMA 3S1SA 3OZXA 4LF5B 3BMQB 3JW8A 1VLLA 2AJDA 2V0NA 4PBTA 5IWAB 2FSIA 1V95A 5EKSA 2WHPB 2F1IA 5KNDA 1F2TB 1XLUA 3ZCXA 4ARIA 1ZEJA 3ELUA 4NCIA 1SWVA 2D2XA 1A71A 1CB7A 1J0BA 2C58A 3K15A 5GOZA 1KVQA 2A9PA 3I2IA 3JQCA 2HCBA 2DBZA 3NO4A 4LY9A 1S3GA 3G1TA 1DFIA 4BE7B 1APBA 2OCLA 4HGOA 4YAGA 1HDGO 2HIHA 5CLIA 1WCXA 4KO2S 4HR7A 1AGYA 3E9MA 3HXQA 2A86A 2BSXA 4MIOA 4IS2A 5J9FA 1HDEA 4N5DA 1XLVA 4Y1RA 2RGCA 4ALJA 3UJBA 5JY1A 1C3VA 1T0UA 1FX0B 3R5FA 4PX9A 4DCOA 4WAUA 1ZL2A 2BBOA 3DAGA 3HWSA 3T99A 2PZBA 1L4UA 4IGFA 3NC4A 1UDCA 3T61A 3VO9A 1R0RE 3F96A 3IJEB 4YP5A 1SCUA 3INNA 2X42A 3JQPA 3PL5A 5FP0A 1MCZA 1T9GR 1M2EA 4LIPD 2FFAA 4CBVA 3DBLA 3V1LA 5TQ0A 2X14A 1HZZA 5FL7D 1AUVA 3H11B 1S4QA 5H02A 5ECYA 2PXHA 1PI3A 2RGWA 2VK2A 3T5TA 1M6YA 1VHQA 2X1HA 3CNNA 3SJCA 4HVLA 3IX7A 4DTIA 2J9ZB 4CLXA 1IIRA 4AP6A 4URFA 4BNDB 2HNKA 3PNPA 3A1FA 3E03A 1ZA2A 4KN8A 5JBIA 4G86A 4EG8A 1MAAA 3EWSA 5CH8A 4BGVA 4V0NA 1N2CB 3TS1A 1NY5A 1YASA 3HNOA 3VH2A 1NTRA 1W5BA 5DF1A 1FUEA 4Z1MD 1PDVA 3EZYA 3OT1A 3ETJA 1NPYA 1P45A 1T3HA 4E46A 1T3SA 3M8KA 3TK1A 5CFOA 1UFOA 3OZWA 3IAXA 4IXTA 2HA0A 5GM1A 2WUGA 4C4PA 1ZUNA 5LP6B 4TLCA 1EBBA 1Q0QA 4LVNA 2FWRA 1Y6QA 4XFJA 5CUQA 4E5MA 3UH0A 5CFMA 5A6SB 1JIXA 5B57C 2I7DA 3A9VA 4HQLA 4RY8A 3FWPA 3U7GA 4WVFA 3PXGA 3KEMA 3LAWA 3MOGA 2WWTA 4M0PA 4CM4B 3KJZA 1E3IA 4F91B 4TV9F 3IIIA 5L3SA 2VJNA 2FN7A 1DIAA 2NZ8A 1W30A 3EVTA 3GLUA 3EUAA 5F1YA 3ROTA 2IV2X 4P86A 3GWZA 4M53A 3Q9UA 4B3DA 3JARB 3MT8A 5HFNA 3UT5A 1LH0A 1EVLA 2OCXA 2WAMA 2TMGA 2NQ8A 1C0KA 1QHXA 1VLZA 4GLOA 3T9DA 1TKAA 1ST3A 2XTJA 4CT0A 2UUCB 3D43A 1RJWA 2QHXA 1PV2A 2WA1A 2RGXA 5HNKA 1JN0A 4WN9B 1F7VA 2YQ4A 2QTWB 4PZDA 3SI7A 1EK0A 3ER6A 2CHQA 4JEMA 4JUAA 1I3NA 5EXSA 4B4UA 5E1MA 1R2QA 2OBBA 3N3AC 3DG9A 2Z3WA 3DLAA 4GWKA 2IGTA 2VJYA 3FUCA 5HDQA 3LOQA 4D9GA 4E7PA 1C3OB 4RJTA 2GPAA 4Y3UA 5E6UB 3ZK8A 3PNLA 1RACA 4PO1A 2B1IA 2HQ1A 4GOJA 4KGXA 4YAWA 5H82A 5BQ5A 3V8BA 1VRVA 5JS6A 1X0VA 2H1OA 4AZ0A 1GG5A 1Z0SA 2I2BA 3PKIA 4HDNA 5TGZA 4RA6B 4HH3C 1A88A 4NCBA 1U6JA 1J9EA 2GCEA 3ZGYA 1WCYA 4CKBA 5L4SA 2ZB2A 3JVEA 3IPLA 4O1HA 1QP7A 3MSCA 3TGWA 4EX6A 2LZ0A 5K8LA 2QT9A 2BE7A 3IS3A 3ZJTA 3BGSA 3CWQA 1K66A 1DWQA 2C99A 2O50A 3AIIA 3EQ2A 4MVWA 4GYJA 3T4PA 2VDLB 3O2SB 4KQIA 1M5UA 2ZQYA 4CL3A 2Q5IA 1A3CA 3L7IA 3QVJA 3DFKA 3S4YA 1WZUA 2VL7A 1OT5A 4ECAA 3EIWA 1TLTA 1LK5A 3AFNA 3A2LA 2JGKA 1RC8A 1XOIA 4AXXA 5LA6B 5HG0A 1PT6A 1EWQA 1CJCA 3HBJA 2WLTA 4WK4B 2P69A 1JR4A 2PMCA 2MDTA 4UVIA 5F9HA 2O6HA 1J1ZA 1YC2A 2YC4C 3DMDA 3DV0A 1PJZA 4FT4A 4UOQA 3SYNA 1ZXLA 2EZTA 2IIBA 2P9HA 4MW6A 4MINA 4KMRA 4QE3A 4MGHA 1B15A 3E4CA 3P32A 2GZHA 1F51E 4IOKA 1GQOA 2PBRA 3A3KA 1T0JB 2CMFA 4HUQB 3Q3VA 2G70A 1HYGA 1XTQA 2Q29A 5LQNA 5E9WA 1L7XA 5DYIA 4BFWA 4L5JA 3FA2A 2P5YA 5F77A 5ALHA 3E18A 3NHJA 3GR6A 4BQSA 1ETHA 1C9EA 3A28A 4E94A 3PB3A 3SFZA 3GPDG 3TE6A 4J0HA 4TSKA 4RSHA 5CTAA 4EW6A 3JQDA 4KKXB 2R60A 1A96A 1L4BA 2JKYA 2IUTA 2WD9A 3HDHA 1CFZA 2A2ZA 4WZZA 3EF1A 4X95A 3OLZA 4BEWA 4AF6A 4MCHA 4RSMA 2HQBA 2NWQA 5FWAA 2JGIA 4OJTA 1EX6A 4ZGWA 3PTAA 4TLLB 1V1RA 2P1RA 1WQ3A 1Z0IA 1W5EA 3KQKA 1Y4AE 3N8KA 2BW0A 3U9TA 5IFLA 1V1MA 3FRJA 1X87A 3W90A 3ADCA 1Z12A 4ZVSA 2OD7A 1JDVA 3K96A 4BO2A 4WGFA 3TTYA 4BEVA 3ITDA 3R3XA 4WFJA 1E7RA 1GYPA 3QVWA 1ITZA 3RHFA 3V9AA 4PAOA 4F38A 3FOEC 4URXR 2VYVA 5FO1A 2X4LA 1IRXA 4B44A 3F46A 4QSMA 2QG9A 4HLQB 2GJ9A 3BS4A 3PFIA 5JC1A 3LKZA 3RRBA 4IVNA 1N6NA 4Q05A 5IFKA 2HTFA 3FPFA 4CLRA 4NQZA 2IYTA 4JYZA 1SUAA 5AUQA 1KMHB 1QYRA 2J85A 2WM3A 4FFMA 4ZQHA 1P8JA 3H6KA 4F4DA 1SXJE 5JH7B 2JGMA 1JSLA 1MORA 2H0QA 5EIWA 1CUWA 1KARA 2G1KA 4C4SA 1CHDA 2HLDA 2VPXA 4K9LA 4P5DA 4QA9A 2Q9AA 2O2CA 3RHTA 3AETB 2DUNA 4Z4GA 1D6MA 1R8YA 1LPNA 1DINA 1QR2A 1FYVA 2J5BA 3OBIA 4BMNA 1P2DA 3OWXA 1Z7YA 2JRLA 4BTLA 2BWJA 5DH9A 5IULC 4OYLA 2VRCD 1MJ5A 1P5FA 3GAAA 4FLMA 4KU4A 1MX1A 4FYXA 5FI5A 1UF9A 5K0NA 3WB1A 1ANKA 4DUYB 4E6PA 1HETA 3MQFA 4V3CA 2HR1A 5IT0A 5EPOA 1N9GB 1U3FA 4WOJA 1DJOA 3IUNA 3F97A 4YP9A 1JWBB 1QIMA 1YKSA 1PL0A 3O9VA 5GJWC 2VP9A 3EQ9A 2HMVA 3L4SO 4IO1A 5IAAA 4C6TA 1EWTA 4P0QB 1YI0A 3QVXA 1KNQA 3WWDA 4OXYA 3UOWA 5FWXA 5BQPA 3QUSA 1YACA 4P3PA 5BP7A 2IZ1A 2YXNA 1JEEA 1KU0A 2FF5A 2PUTA 3HKDB 3G8YA 1K2WA 4NYJR 4TYPA 2BGTA 4CR6A 4DM7A 5JAUA 4IEEA 4IVPA 4OJMX 3A6HA 4RWZA 4HD8A 3VPGA 2GBPA 1BEUB 2CL6X 4XASA 1KP9A 2H8KA 2AUMA 3KB8A 3IMCA 2IOFA 2HLNA 3PNVA 4PQRA 5CW2A 1MOZA 3RRXA 3UMCA 1NW7A 3KPWA 2OHOA 1IBKB 5A7FA 5K03A 4AKEA 5P8WA 3WIDA 1XMSA 4PGMA 2AQHA 3A8TA 2Q4TA 1UMBA 1IFXA 3L1JA 2LE0A 5GP1A 2GK6A 5IXSA 3DZGA 1VPEA 4RD4A 1AQNA 4A0RA 4EJ6A 1YGPA 2WPNA 1Z5NA 2J9FB 1WWKA 2BFDA 1LWOA 4YCDA 3FPLA 3QITA 4P4SA 4QYTA 4ZVQA 3DE2X 1IY9A 1YBVA 3PCRB 4L0QA 2WZBA 2I7TA 3D2CA 3WBBA 4DB4A 2XRZA 1EFLA 1O03A 2DFKB 3GP5A 4Q9DA 3AI1A 3M9WA 4OHRA 4MJXA 4UBOA 1A97A 4HVCA 5LLSA 3FTPA 1ZVKA 2HSZA 1ENOA 3UK6A 3GI1A 1JVSA 1P18A 4UDXX 3GEGA 2M1ZA 2QBYB 1WD5A 3WGLA 4B8ZA 2C2GA 2N1MA 3C85A 4OMCA 3TW4A 1TM3E 5SY9A 2YNMD 1GXSB 5KIAA 1G55A 3ZDCA 1WMDA 2R8XA 1T34A 1I4LD 1P7PA 4C0QC 2J3MA 2O7QA 3ZU2A 4O8ZA 4ZXPA 4MQ4A 2J08A 1GDHA 3HB7A 1XROA 3TTUA 3OJEA 3L01A 1Z33A 5BUZA 4D9MA 5IARA 5TPZA 1DO0A 2ZS8A 5DNAA 2C9OA 4IIXA 2WWVD 4I55A 2HXYA 1ZOOA 2WF9A 2Z09A 4GX0A 4IG4A 4WLUA 2IZ6A 4AQ7A 4RM3A 1G8PA 1CQIB 2VJAA 3ID6C 1YRAA 3JXEA 1M34A 4NJOA 1RCTE 4LJ8A 4ACBA 4BP9A 3U16A 4EKYA 1FS4A 1TF7A 5I8ZA 4J16C 4F4CA 5K8IA 5ALNA 2RJ3A 3P45A 5JFGA 1PEDA 1VCIA 2UYHA 4C5CA 2DWOA 4C0SA 5K3FB 3QKIA 2Y0CA 3E3LA 1IN7A 4JJ8A 1NW5A 1U1GA 4JB3A 2Z1NA 3H18A 5FNVA 1G8HA 2VH1A 3TQSA 3II6X 2QZJA 2ET6A 3QBTA 2EEPA 3KHTA 4Q4JB 4YJGA 2JLBA 3MF4A 3VOSA 3N2KA 1NZFA 2II6A 4JOQA 5TT0A 3SR0A 4UTVA 2MHCA 2GXQA 3DNPA 3HB5X 4ZU6X 1E77A 5G1NA 1J7KA 3DKPA 2BGKA 3ZZTA 4R1QA 4FIDA 3T9AA 3T4XA 4IDAA 5F73A 3SM3A 1OZHA 3TBFA 2YJ5A 3W2TA 3G59A 4Z0HO 4H4DA 3BGDA 2WMDA 2VVTA 3RRYA 2E4YA 1PJAA 2Y68A 4GBMA 4EHAA 4Q4DA 3EWIA 1OFUA 1SXPA 1DX4A 4BLWA 5KNDD 5BWCA 3D8SA 3ESAA 3BN3A 2DPHA 1GG2A 2E1RA 1VM6A 3C5VA 3G2IA 4KVAA 5FJIA 1DBVO 3SBXA 4EG1A 4ZREA 1CJVC 1HG1A 3ED1A 5ECGC 4J1NA 4I9UA 4V0OA 4OVKA 3FMGA 4FBMA 2ISSD 3VU9A 5AVVA 2ZYGA 3K9QO 2GHTA 3VPDA 1D09A 3ZV5A