3I52A

Ternary complex structure of leucoanthocyanidin reductase from vitis vinifera
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
307
structure length
296
Chain Sequence
GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNIHPSEVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
molecule keywords Putative leucoanthocyanidin reductase 1
total genus 99
structure length 296
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i52A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i52A02
3WS7A 1WMAA 4D45A 5IFLA 2ZB7A 3F5QA 3W8FA 1YVEI 4TZTA 1WDKA 3ZH2A 1A7KA 3ASVA 5AXDA 1DEHA 3GQVA 1BXGA 4FPXA 3BZUA 5T64A 4QTZA 1LA2A 1VJTA 1NM5A 2Y0DA 4L8VA 3EDMA 4J4TA 2PGLA 2Y99A 3DTTA 3ST7A 3GVHA 5JO0A 3OP4A 4DIOA 5JAQA 4I1IA 1BGVA 3GHHA 2EGHA 4R5MA 3DBHB 4Y6SA 1LX6A 2IXBA 3LC7O 1Y9AA 3SBOA 1OOEA 1V3TA 2E82A 3L6DA 4BNGA 3OEYA 2DTEA 4DIFA 1H9BA 1NQOA 2B5WA 4CLOA 3DO5A 2JKVA 2JJYA 3JQFA 4CM8B 4H15A 4Q3CA 1KEPA 1QXSA 2WYWA 2F1KA 3CINA 1DFGA 2P9GA 4A03A 4BS9A 3KZVA 3TPCA 5TT0A 1KOLA 1UDCA 4NMHA 1E1KA 1F8GA 3N7UA 4IDGA 3WWZA 1ZBQA 1DC6A 2W8ZA 3HNPA 3MCVA 4R01A 4R9SA 3IC5A 4X54A 5HA5A 3E1KA 1LI4A 1U5AA 1EUCA 1N7GA 1HZZA 1XQ1A 2PD3A 1QV7A 1C1XB 3JYNA 3ENNA 4CM5A 3HDYA 1HSOA 2DBRA 3H9GA 1PJBA 4GPD1 4IJVA 4IMRA 1W4ZA 2VUUA 1KIFA 4J1QA 4E2ZA 5B12A 2LDBA 2VCYA 1UH5A 2EV9A 4AJNA 5EINA 1J49A 3OICA 3MJCA 3OF2A 4FGWA 3HN7A 4BMVA 1UXJA 4EGFA 4NFHA 5H83A 2IYOA 3MEQA 3ABIA 1HDRA 2CF5A 4GKBA 4XEHA 1I3LA 3WMXA 3RASA 1E7RA 2O3TA 3FBTA 2RAFA 4EZBA 4E5PA 1M75A 5L4NA 2DBZA 3T7EA 3PHGA 3VH1A 1LLDA 2YDXA 3KYDA 1BWSA 2P68A 3ZU4A 4M49A 2WE8A 4OXYA 4NK5A 2C59A 1H6BA 4KOAA 1P33A 1PGOA 4ND4A 4B79A 2GNAA 1YBMA 2A9FA 4JBHA 7MDHA 2VRCD 1I2CA 1U2GA 3PHHA 1K6XA 1N9GB 5MGBA 3VPSA 1CQIA 3LC1O 1N1GA 4FJ0A 3BMQA 3RJ5A 1HT0A 4GLOA 5F5LA 3NEPX 5IDYA 1V3VA 4CV1A 1YS4A 2Q3EA 3EHEA 2W4QA 2FN7A 4GX5A 2NTNA 1GUYA 3CKYA 3TRIA 1K3TA 4EUHA 5JMWA 1Z45A 4RCVA 4O5OA 4I5FA 3C7CB 3C24A 1ISJA 1MV8A 1PJLA 4CMKA 4ZQFA 3K5PA 5EL0A 4PG6A 2POQX 1LSJA 4DQUA 3D64A 1O9BA 2G17A 4A5OA 1NTOA 3BMNB 5HS4A 1DRUA 1UP6A 3DBLA 4XGKA 2PZLA 4A2CA 2J5KA 2F00A 1Y5MA 2Q2WA 4XZ3A 1EE2A 4R5HA 3AUSA 2DKNA 3RU7A 5G4KA 1ZXLA 1W73A 4B7XA 4B8ZA 1A71A 4B8WA 4CR8A 4PG8A 1D7OA 5DDIP 4JP3A 3PIDA 5TT1A 1WMBA 2IE0A 1Y8RB 3CMCO 2A94A 1J4AA 4E33A 4EDFA 1CDOA 5JCJA 1E7WA 3LYLA 1ZXBA 3NT4A 4P38A 4URFA 2VHZA 2DUUA 3F46A 4LSWA 5CPFA 3W4IA 4ZRNA 4INAA 4XQEA 5FEUA 2CDBA 1MB4A 3DB2A 3PJDA 1LLUA 3D1LA 5JY1A 2I3AA 1QP8A 1WLYA 3N74A 3AM3A 4J9VA 3IUSA 3RU9A 1FDSA 3EVTA 3FPLA 3JQGB 8ADHA 1TA4A 4W9NC 1PJ2A 3ONDA 4O59O 4XD2A 4OM8A 2O3UA 1LEHA 2NVWA 2WYUA 4GMFA 1UZNA 1ZVMA 4KUEA 1G6KA 1UXGA 3WQSB 5GZ3A 1O94A 1GD1O 4CLDA 4UVDA 1T2EA 4PLTA 4GWKA 4N18A 1LQTA 3DOCA 5GMOA 1RPNA 2O4UX 3QY9A 2Q4BA 3QQPA 3BA1A 4B3IA 2YQ4A 1KC1A 2VUTA 2GZ1A 2V6GA 2QRKA 3O9ZA 3ITDA 4AJ4A 1QYXA 1XGKA 3KM0A 4JBGA 5B1YA 4GGPA 4IIUA 3C85A 3K92A 3IKTA 1LTHR 1WW8A 1B14A 5A9SB 5IJZA 3B6ZA 3Q6IA 3ZNPA 1NPDA 3EK2A 2B36A 2VT3A 2HMVA 3MJEA 4UEJA 1ZJZA 2HMUA 3F5SA 4NBWA 3WBFA 3EZLA 4G65A 3R0IA 1YJ8A 3H2ZA 3ON5A 3CEAA 5IXSA 2C2YA 1NPTO 4KTTE 1JWAB 5U9CA 4GQAA 3HJAA 1PZGA 2AA3A 3AFNA 1XG5A 2V6FA 2X9NA 4IDFA 3M2TA 2PD6A 2RHCA 3FNHA 4IDDA 2PKQP 1SPXA 2H63A 3P2YA 1GPJA 1NNUA 1SO8A 2V65A 5A05A 4ZQBA 1W8DA 3GRKA 1ADFA 5TGDA 1TT7A 4M54A 4TKLA 3GVXA 4AJKA 2JFFA 2UDPA 1ISHA 3E48A 1A9YA 4DMLA 3DWFA 1I33A 1DBVO 2ZKLA 3EUWA 5THQA 2NM0A 3TZQA 4LN1A 2D0IA 1E7SA 1VM6A 1V9LA 4MJLA 4YJFA 2I66A 4U0JA 5CDGA 3MTGA 4L0QA 1IB6A 2NNLD 5AXAA 1N1EA 5K6AC 2NUAA 3TDKA 4HNHA 1N92A 1AUPA 1BSVA 1C3VA 1P74A 4BKUA 3H3FA 3OFSA 4Z9YA 1HTBA 4L4SA 3T7CA 4YTEA 2CVZA 1PGNA 3CZRA 3I9NA 3WFJA 1SCUA 4DGSA 3DHNA 5L53A 1YL5A 1U7TA 1YDEA 3QWIA 2OFPA 4EJ0A 4ND2A 4XYGA 2E4AA 2PA3A 4EI2A 1Q0HA 3HN2A 3L9XA 3U0BA 3VKUA 3QIVA 4ZQHA 2AXQA 4GGOA 3L07A 2JFGA 3DBRA 3DMTA 4ROSA 2O2SA 2P9CA 3JQ6A 2O7SA 2FSSA 4YAKA 1B3RA 1PJQA 1YE3A 4Z3DA 2YUTA 3BMOB 2C5EA 2BGLA 1TVEA 2ZATA 2WD8A 4OGWA 3JYLA 1U7HA 4ESOA 4PLGA 3F6YA 2NQTA 4PLHA 4RVSA 1YO6A 4YQYA 3ZGYA 4XRGA 4HADA 3VPGA 2R00A 4JGBA 1U5CA 1D4FA 2YZ7A 3AU9A 4MO2A 1NHGA 4O0LA 5JO9A 5IDQA 3CZMA 5JAZA 2Y1DA 3DDNA 1A72A 4RJTA 2VZ8A 3H2SA 4OYRA 2JAHA 2Z1NA 1U2DA 4OL9A 4AJPA 3H8VA 3HE3A 3GGGA 1PJ3A 4WLOA 1FK8A 1M6HA 4Y98A 3GMSA 1K6JA 2QRJA 4K1LA 2IYPA 4YEDA 4PVDA 4TRMA 3KYCB 2JD1A 1ONOA 1IZ0A 3UKOA 2YHIA 3COSA 2BH9A 4I9NA 2CDCA 3WX0A 1B0AA 1MGOA 5BNFA 3D0OA 5ES3A 3Q9NA 4A10A 2X7HA 2Y1OA 1GQQA 1PR3A 2QHXA 3ZWCA 1GUFA 2RIRA 5TF4A 5LDHA 1Y7TA 4BQPA 2EEZA 1ZK2A 3H9QA 1AXEA 3TL3A 3JQFC 4PGFA 3RUAA 1E6EA 4KTVE 1HE4A 2JCYA 2D1YA 1ISMA 1C1DA 1H0KA 3FN4A 3W6UA 4MIEA 2FMUA 2WEKA 5EQFA 1DHRA 4J4BA 5ER6A 1LBEA 1XU9A 4QQRA 4D3SA 1B8PA 1CF2O 2CFCA 4LCJA 1K5HA 4FFLA 2NACA 3OJ0A 1YQGA 2VHVA 3H7AA 4D0SA 3CE6A 2GGSA 4MVJH 3E9MA 2QZ9A 3PRJA 4CLRA 4FFOA 2W90A 1PZEA 2DT5A 4XWYA 3LT2A 3NTOA 4BNYA 4R54A 2ZTVA 4R41A 5LCXA 3C7AA 1YH3A 3GK3A 3WQQA 3GOHA 4IS3A 1HDOA 3RI3A 3KUXA 4FFPA 3U4HA 4PRLA 5HRUA 1Q0LA 4QO8A 4RZIA 4CMHA 2QZZA 3HUDA 3KO8A 2Q45A 1BHSA 3IMFA 1QRRA 5IN4A 3A4VA 4I8XA 3JCZA 4JJFA 1X1EA 2BFMA 3NYWA 4NJMB 2CVQA 2LDXA 3ONEA 4O63O 4RDHA 1EDOA 5F5NA 3KTDA 1ENYA 4RVUA 1X1TA 2I6TA 4OQYA 1RYDA 4KP7A 4XR4A 1VSVA 2VWQA 1LDGA 1CETA 1GFSA 1UXKA 4D3DA 1Q7BA 1IHXA 1XYGA 1P31A 2SCUA 4N5NA 3Q0EA 4KDFA 5JCJD 3IP3A 1UDAA 3SC6A 5FFFA 3GNSA 4BB6A 4UULA 1UJMA 2VWPA 1ZK0A 3AUTA 4FOSA 4RGBA 2FR1A 4NFYA 5KKCA 2BLLA 3X2FA 5JC1A 1R0SA 3Q2IA 4U6SA 5JLAA 2B5VA 1PSDA 4CMJA 1LRLA 4CMIA 4YJFB 1B26A 3ZCXA 1PTJA 4HFJA 4HV4A 2EKLA 2ZIZA 1TXGA 5JAMA 3NDIA 3R1IA 5BT9A 2JCXA 2NADA 2O4CA 3O8QB 1K2WA 4KZPA 2AEMA 3UCEA 3MWEB 4WEQA 4DVJA 3LSYA 5HBRA 1DXYA 2J3KA 3DONA 1NP3A 3PGXA 3PYMA 2QQ5A 2YY7A 4ILKA 1WPQA 1BXGB 3U49A 3AUAA 2ZYDA 4J0FA 1P0CA 4R51A 3GRPA 1EQUA 4WLFA 4B4VA 2A92A 2NSDA 3CIFA 4J0EA 3E6AA 1Y6JA 3QV1A 1SEVA 5JDIC 5I7VA 3OJEA 4PFJA 3VH2A 1J5PA 2GUGA 3KVOA 4M55A 4NNJA 4FN4A 1EFKA 1ORRA 2UUOA 4NBTA 3L9WA 1LDYA 1PL7A 2ZTUA 4BUCA 3A06A 3NT5A 1I3NA 2AW5A 4IY1A 4W99A 4ALJA 1QV6A 3U3XA 1KEUA 4CQMB 3OIDA 3DZJA 1ENOA 2GZ2A 2BGMA 2IZ0A 2ZJ0A 3FTPA 4AG3A 4J90A 4QECA 3G1UA 2HRZA 4D42A 1M67A 4J2OA 3FNEA 2EKQA 5ENDA 3QVWA 4RPHA 4GX1A 5TNXA 2X5OA 4ALIA 4R1NA 4XQCA 2GN8A 3OJFA 5L7TA 3CSDA 9LDTA 2BF7A 2IEDA 1EVIA 5C7OO 4PLVA 4MVJP 4HXYA 4AVYA 3WIEA 2EF1A 2GLXA 2FP4A 2UVDA 3NTRA 4U5QA 1IULA 4RORA 5IZCA 2JCVA 3KXDA 1DPGA 2UYYA 4Q39A 5DOVA 4PG7A 2E37A 1T1SA 1JVSA 1B2LA 3WMWA 5T8KA 1BW9A 2EXXA 4KQWA 1A4UA 4WNIA 3PDUA 3S2GA 4LK3A 4YDRA 2Q46A 5TSDA 4TRNA 2PWZA 4E32A 5L51A 3NRCA 4E0BA 1IOLA 3P5SA 3I9MA 4XDYA 4YJGB 2VYND 3JD0A 2GR9A 3GR6A 3F1KA 4YJHA 4OIMA 4CM8A 4MVJI 3FWNA 1BXZA 1H9AA 2B0JA 3UAGA 1T25A 4ALKA 3GPDG 1CYDA 2D2IA 1E3LA 2IEBA 2B4QA 2EP5A 4IUYA 4W7IA 1Y1PA 1UZMA 4IZHA 4YT8A 5L45A 1DO8A 4MVJD 3PJFA 4L76A 3Q1LA 4R1UA 4PG5A 1JKFA 1VL6A 3AY7A 4QEDA 1IHYA 1M76A 4XR9A 3FTNA 3U9LA 3G17A 1XKQA 3JQ8B 3JQ9C 1VJ0A 4OHUA 2P4HX 3AM5A 5BR7A 1I10A 1Q1NA 4XJSA 4WCFC 1L1FA 3WXBA 1ZIDA 3RFTA 5KCZA 4JP2A 1C0IA 2O48X 2FWMX 4BNUA 1IPEA 2ZJ1A 2FR8A 5EIOA 4BHTA 2C2XA 4NK4A 3DBLB 2WYVA 1SB9A 3R3SA 1HLDA 2W2KB 3JYPA 1OI7A 3JQAB 3H5NA 2NLOA 4II3A 3OSUA 2OHXA 3D4NA 4ZVVA 3WDSA 4YACA 3I9JA 2CY0A 4BNXA 3VPFA 5TX7A 3WLEA 1NFRA 1HYEA 3DOJA 5L95A 2P91A 3RBXA 3TZKA 5A9SA 2JD0A 5JXWA 2AG8A 3AK4A 3EAGA 2VRCA 2VN8A 4DWVA 2ZYAA 3W8EA 2NU6A 1BVUA 1X7GA 1UDBA 4XYEA 1P1JA 5L9AA 1NQAO 3MJVA 1BRMA 4OSPA 4XIJA 1HXHA 3PVZA 4OMUA 1VL0A 4ZRMA 3AY3A 1AXGA 4BKPA 1LRJA 2GCGA 5AXCA 4CM9A 4WCFB 2J3JA 2P4QA 2B4RO 1B8VA 4UVIA 5A9RA 4AJHA 4OXKA 1ZW1A 3FNGA 3O4RA 3DZBA 4ZD6A 4IJUA 1JAXA 4I08A 1CEQA 3EGOA 3V2UA 2NV6A 4UREA 1MFPA 1U9JA 1GYQA 3ZWOA 3SJ7A 3ENKA 4J4HA 1EFLA 3HHPA 4XQGA 5HWSA 3RBVA 3P19A 1U4OA 1GYPA 3SXPA 1E3SA 4DA9A 2HK9A 1VRWA 3QVOA 1Y9EA 3MZ0A 1BDMA 1O6ZA 3VVBA 5ILOA 3WFIA 5JDCA 4WGGA 1TLTA 3RUDA 2CSUA 4FB5A 3KETA 2ZTMA 3Q9UA 3ZHZA 1HE5A 2BI8A 4CV3A 2HJRA 3ZWVA 4II2A 4BNLA 1E7QA 5ADHA 5I8ZA 1HDZA 4MKXA 5LC1A 1I2ZA 1RM0A 1R4MB 4RF5A 4CUZA 3DBRB 2HSDA 4P4LA 3DZKA 5G0VA 3B20A 1GL3A 2ZB8A 2IRWA 5JPIA 2WD7A 4Z0TA 4ZJUA 1DC5A 4DPMA 2R2GA 3BMOA 1GDHA 1E5QA 3RSHA 4Y67A 3E9NA 3HFGA 4NPCA 4WJZA 1RKXA 2WE7A 1U3TA 4CL8A 3UCFA 1XELA 4D7AA 1E6WA 4F6LA 1RJWA 4NQZA 2XXJA 2Y0EA 2I65A 3ZNOA 3P7MA 4DREA 4EEXA 1U3VA 1OZAA 3PIIA 1WDLA 3K6JA 4LMPA 2RHRA 5CEJA 2D5AA 5DBGA 4CR6A 3VZQA 2CDAA 2DBQA 4PG4A 4JLWA 4YT5A 1KVSA 5L3ZA 3UH1A 3CMMA 2JHFA 1UP7A 4K6FA 4TRRA 3OBBA 4N54A 4JK3A 2QRLA 4QUKA 1R66A 1ONNA 3IKVA 1KC3A 1LXCA 1P1FA 4XYBA 3D7LA 3TZ6A 9LDBA 1SAYA 3FHLA 3KYDB 2GPTA 3W6ZA 4AJ1A 4FFMA 1JW9B 3M1AA 1JN0A 4IGFA 2VT2A 4R69A 4RQTA 5KTKA 2GERA 4FFNA 1T2CA 5A02A 2QG4A 1PJCA 3VH4A 4Q3NA 1IY8A 4IXWA 1GCOA 2C07A 5ITVA 1ID1A 1TEHA 3VAZA 3Q3CA 2X0RA 3L6EA 3PWZA 2W2LA 3RC9A 3V1UA 1JWBB 3ZDFA 3F4BA 4AJIA 3H9JA 1CRWG 2FZWA 1P45A 3RJ9A 4BNKA 2AEJA 4W7HA 1V35A 2P5YA 2PNFA 5COAA 1GZ6A 2NTJA 1P1KA 1C1DB 1DIHA 3VKVA 4MP6A 3NGXA 3S2EA 3INTA 5TS3A 4RVDA 4IJKA 2OXIA 1MFZA 4C7JA 2DFDA 5T8KC 4Z9XA 3DMYA 2CVOA 1XIVA 3RAJA 3WGGA 4D0RA 4DC1A 3BIOA 4BO4A 4TWRA 4ZQEA 2VTDA 2W2KA 3KB6A 5JS6A 4KDEA 4E5KA 3JQAA 4YBZA 1LDMA 1L7EA 2C54A 1AE1A 1DHTA 5CHEA 2AHRA 1SOVA 2J3HA 3GEDA 3WYBA 1IE3A 2PKQO 1HF3A 5L4LA 1QYDA 3QA9A 5EMHA 1Y8RA 2P2SA 2W2LD 2BFOA 1T24A 4CQLA 1HYHA 4J7UA 1LLCA 4AJ2A 4YT4A 4YAEA 1OMOA 2C20A 5U1PA 2WDZA 3KOUA 3E5RA 4RVGA 4ONEA 4FR5A 4N5MA 3AI2A 1R4NA 1Q7GA 3LT1A 1RM3A 1P0FA 4BO9A 5CG1A 3DHYA 3GNQA 5JBIA 4JN6B 1O95A 1KVTA 4BNJA 3IDSA 3VDRA 4CM6A 2VTEA 4D44A 3EC7A 3JQCA 5BNTA 4CM4B 1T2AA 3IS3A 3PXXA 1M2WA 2YDYA 3JQGA 5JFOA 3PFWO 4CLXA 1LNQA 1Q7CA 2HQ1A 1SOWA 2C7GA 4JBIA 2DC1A 2FOIA 2XF8A 1FMCA 1I24A 4R16A 5J23A 1Y8QA 5K6AA 1T2FA 4MVJM 3ZW9A 3CTMA 1X0XA 4XDZA 2X9GA 3I4FA 3JQBA 4K9DA 2X0JA 5CPBA 1YOVA 5A3VA 1N8KA 3R3JA 5G4LA 5ILGA 1YKFA 1EQ2A 2BI7A 3PYXA 2J5QA 1H5QA 3FCOA 2JD2A 3LZ6A 3BXXA 1F17A 2OOSA 4FDAA 1Q2XA 3MJ4A 4CQLB 3ZWPA 5JYEA 2P9EA 1DLIA 2WJPA 3LK7A 1I5RA 2O50A 1DRVA 1J6UA 1HRDA 3OQ1A 3OJLA 4RVHA 4IQ8A 3BAZA 3O26A 3OIFA 4TKMA 4JIGA 4E21A 1QYVA 1RWBA 1JQBA 2DU8A 3ANNA 3D4OA 4MVJF 4BNNA 1E3WB 2VOJA 1BG6A 4OXNA 5I9LA 2EG9A 1JTVA 2CUKA 2G1UA 2HKIA 5KJ6A 4NBRA 3PHJA 3ZHYA 2PFGA 2WM3A 2HRBA 3K30A 1VJ1A 3AM4A 5AQ1A 4TROA 3ROKA 3HFSA 3DZIA 1R0KA 4CLEA 5LDGA 4LSMA 3TZCA 3GNTA 3UOGA 2AG5A 5IZCC 4PLYA 3V2HA 3VHRA 2HDHA 3AOEC 3WJAA 1GY8A 4BGVA 3ITKA 4JROA 3SX2A 3DR3A 2DPHA 2FHSA 4UUOA 1GZ3A 4HFNA 4L4XA 1BTOA 5EESA 1I30A 2X1HA 3LDHA 4PVCA 4NU6A 3UCXA 4ZQGA 4MPDA 3WGQA 3ZWBA 3LLVA 1N2SA 4E30A 3ZV3A 3GFGA 5EQDA 4FJ2A 5EJ2A 3GY0A 4L4RA 1PQUA 2H6EA 5IAAA 1A4IA 5DT9A 2VUSA 3E5MA 5BQFA 2ZB4A 1IZ9A 1FDWA 3IJPA 4NR0A 3KSDO 2JFHA 3DHEA 1ZMOA 1KVQA 4NJOA 5JYDA 4OKNA 2UV8A 1QLHA 1AHIA 2NU7A 2O3RA 2Y05A 1XA0A 4M8SA 4WOJA 1R15A 1BVRA 4I5GA 4IQGA 2DUWA 1HLPA 3JD1A 4J16A 4LMRA 3GZNA 3LF2A 5T6BA 3WB9A 1YGYA 3EVNA 4W4TA 2DVMA 3OA0A 5JE8A 3UN1A 4S1VA 3WWYA 3ANMA 2BKAA 3RQSA 1ZEMA 3WOHA 1QSGA 1ADGA 2X23A 3EY4A 1HEUA 2ZQZA 3WSVA 4A73A 5AXBA 3L6OO 3H6KA 3QVTA 2FRDA 1X7HA 5DZSA 1BXKA 4PZDA 3CPSA 5L7YA 3QWFA 3DL2A 2YV2A 3IUPA 5A06A 1R6DA 5CEEA 4L75A 1KEVA 1C1XA 1XHLA 3QP9A 3C1AA 3DAFA 3RIHA 3DAGA 3ZWNA 2VZ0A 5TLSA 4XYMA 3W1VA 1A5ZA 4U7WA 3WGHA 2IZZA 4F45A 4RDIA 4YR9A 2Q50A 3RC7A 4DBZA 2OZPA 5A4DA 1F14A 1DAPA 4LVUA 4IPTA 4R1TA 3PI7A 2BD0A 3U5TA 3DFZA 5K9ZA 1ULUA 3HSKA 3LQFA 1FXSA 1L7DA 1EBUA 1D1SA 1E3EA 2XOXA 3GG9A 3NT2A 4GBJA 5A5EA 5KVCA 4RF3A 2VNAA 2EJWA 1HE2A 2X22A 3IIEA 4JX8A 4IDCA 2GZ3A 4GSKA 1ZH8A 3GZNB 3NTQA 1NX6A 3OQ6A 3INGA 2O2YA 3TN7A 4CLOB 3VZRA 2ZCVA 1YQXA 2NQ8A 1W0CA 3EW7A 1NR7A 4GVXA 2VHXA 2VZ9A 3AI1A 3JQEA 1TT5B 3ADOA 3PP8A 1RYEA 2I67A 3AW9A 3LT4A 4TZKA 2HO5A 1PJSA 4GI2A 4AJLA 3HDHA 4C4OA 3D4PA 3I5MA 4IBOA 5DCWA 4ZHSA 3CXRA 4WE3A 3GEMA 3L4SO 3UGKA 4Z6KA 4HFMA 2D8AA 4BNIA 2QYSA 4I9HA 3TJRA 3I23A 1EUDA 3NJ4A 2EJVA 3GAZA 1CERA 5C3MA 3NJ8A 4YRBA 1P9LA 4GSLA 2JAPA 2R00C 1NXQA 4NIMA 4MOWA 4NJMA 4YJDA 4EEZA 4WASA 1G1AA 3MOIA 2B83A 2J8ZA 4RQUA 4R3NA 3JYQA 1LDNA 2EKPA 3MWDB 2G82A 1YJQA 1MP0A 1XDWA 3LT0A 2YFHA 3OIGA 3ONFA 4TQGA 3TOZA 3SLKA 4BQRA 5KNLA 3INRA 2GO1A 3OM9A 1MG5A 4DQVA 1JAYA 3U4CA 4E5NA 3TF5A 1U8FO 1GEGA 3JD2A 1R4MA 3BMCB 5IDXA 1ARZA 3RCBA 1BMDA 5L40A 4RVFA 5AVOA 3GLQA 1U3WA 1F12A 3JQDA 2IZ1A 3C8MA 3ZU3A 1OC4A 1P1RA 4GX2A 1ISIA 2TMDA 1PEDA 3VOSA 1DC3A 4Y9DA 3VC7A 3PZBA 5HM8A 3WQRA 3RUIA 5DNAA 4RF2A 4NBVA 2C7VA 4PN3A 2Q1SA 3DC2A 3JQ8A 3DZHA 1YB4A 4BNMA 4IINA 3C3XA 3DQPA 4Q9NA 1C0PA 3ADPA 3C7DB 5FF9A 4MKZA 4E5MA 4EBFA 1T26A 2B69A 1PIWA 2H9IA 2HK8A 3WR5A 4F6CA 1ZKMA 3GMDA 1VPDA 1B8UA 1NVGA 4D41A 1GPDG 3U4IA 4YCAA 1E7MA 1LSOA 3ZN2A 3I1JA 5G4KB 1IL0A 2ZK7A 4M87A 3ZW8A 5U4QA 4M86A 1O0SA 1D3AA 2X58A 3BTSA 4FIZA 4PLWA 4J6FA 4W9NA 4XGNA 1YONA 4ND1A 2FSVA 1E3JA 2HUNA 4QXMA 4IMPA 1MUUA 3H9EO 2BGKA 3B1JA 4WLNA 4N5LA 5B37A 4J49A 3A14A 3PYLA 4YVFA 3RUFA 4NZ9A 1LUAA 4UEKA 4K6CA 3I6IA 5TJHA 5CEFA 4PCVA 5G0UA 4O1MA 4F3YA 1I01A 4GKVA 1X14A 1UXIA 4QX6A 5KJCA 4ZICA 3DXFA 3KEOA 3AUUA 1PZHA 1ZNQO 3GN1A 4J3FA 3KYBA 3OETA 4BIIA 2VOEA 2E49A 1H94A 1WNTA 5CDUA 1PJ4A 2PY6A 4CMCA 5I7EA 4B4OA 3A9WA 4S3MA 3ICPA 3RROA 4M1QA 3OA2A 4TMFA 5KJ1A 2DTDA 3L4BC 5HS6A 1ONPA 2E6UX 2IODA 2GASA 1FDUA 4LVCA 2PH5A 4WNCA 3RBZA 1H93A 4P22A 2O3QA 1P1HA 3GC6A 3WJ7A 4B4WA 1LSSA 5EERA 1NAIA 2OP0A 2FPGA 5FYDA 4CMEC 3V1YA 1N5DA 4DQXA 4YT2A 2HMTA 1YB1A 1KY5A 3G0OA 1VLLA 3K96A 4W6ZA 3RKRA 3UF0A 5JY6A 3DZFA 4QFCA 5G0SA 5I9MA 1Z75A 5L4SA 4EYEA 3MJSA 2AMFA 3KLMX 3QW2A 2JHGA 1JA9A 3ZWWA 1UR5A 1U3UA 3FF4A 4WLUA 3NAQA 4XRRA 3GF4A 2TMGA 4NFSA 1HETA 4CMBA 4DIBA 2X5KO 5A9TA 3X2EA 2OBNA 4LRTB 2RBEA 4AL4A 2OBYA 1I0ZA 4R9RA 4W82A 3RUCA 5ICMA 1ISGA 2CNBA 2EIHA 3E03A 4UUPA 3H9UA 3DMTC 3FR7A 2EP7A 2YJZA 3BYZA 2I5PO 2ET6A 3B1FA 2Y1FA 1B16A 2ZQYA 3L77A 5COBA 1FF9A 1X13A 4L9RA 1NFQA 1WZIA 4Z9FA 3T4XA 1QYWA 1M66A 4NDNE 5ENVA 3F9IA 2XAAA 4BNVA 1K6IA 4IDEA 4CM3A 4JNKA 4IDBA 3BHMA 1Z7EA 4CL3A 2W98A 6LDHA 4ALMA 1LDBA 1MXFA 1SEPA 1YL6A 4B3JA 1R0LA 2EW2A 1NBOA 1V3UA 4FW8A 5H82A 3AOEA 2ZTLA 8LDHA 1E0DA 1F0YA 2VQ3A 4J9UE 5B4UA 4EJMA 4PLCA 3ZWAA 1A9ZA 3ANLA 5CP8A 3WYCA 4BO3A 1GADO 1GUZA 3VDQA 2Y1CA 3PFFA 3GUCA 2BHLA 3QJ5A 4G81A 5C37A 3PK0A 4J2HA 2NU9A 3GGPA 1JDJA 4UVHA 4BGIA 1KY4A 1JKIA 5JCXA 2FR0A 4EW6A 3AY6A 2D3TA 1AGNA 2QW8A 4FS3A 5G0TA 5A5FA 4EITA 3ZWMA 2I9PA 2PGDA 1SBYA 3DBVO 3DFUA 3JD3A 3AI3A 2JL1A 1EEHA 2HJSA 1E6UA 4Y8VA 5KJFA 4B4UA 1IYZA 2X86A 3AOGA 1EVZA 4XGIA 4BL5A 1YOVB 2WMDA 4BKQA 4BO1A 4G2NA 3FWZA 5IZ4A 2HMWA 2O3SA 3LLSA 1XLTA 4AICA 1PGPA 1VSUA 4FOOA 2RH4A 3ROPA 4YAJA 4DL9A 1WWKA 3RC2A 4CUKA 4BGUA 3SVTA 1T2DA 3QSGA 1GR0A 4ALLA 4A7PA 4EJ6A 1I3MA 4E13A 4OOFA 2D5CA 4QSMA 1ZZEA 1KBZA 4DYDA 3QLJA 1S6YA 3D3WB 4IIVA 3GGOA 3WGTA 5I7FA 4KUGA 2AE1A 1FDVA 4WOKA 5DF1A 5KOIA 4N7RA 5THKA 4A27A 1NQ5A 3S2IA 1NQTA 1YL7A 2HU2A 4UUNA 3NV9A 3I3OA 5BSGA 3OHSX 4BGEA 3VTFA 2VHYA 1V6AA 5T57A 4J91A 5DBFA 1KVRA 1NR1A 4HBGA 2FPIA 3EZYA 1CWUA 4QT0A 1HDXA 1V0JA 1V8BA 4FSHA 4YRDA 1PQWA 3VTZA 2DBVO 4TVBA 2J6IA 4IXTA 4JCOA 4RF4A 5IXYA 3ZWYA 4BNFA 2DQ4A 1ULSA 1R16A 4J7CA 2Y66A 4WEOA 2HK7A 3NX4A 3HB4X 2HMSA 4GVLA 3GDFA 1MA0A 1SNYA 4GX0A 2PH3A 3D5TA 1DAOA 3FPCA 3R6DA 1IPFA 1EE9A 1NAHA 3CUKA 4KMSA 3TNLA 3TQHA 3WYEA 3ETDA 3KYCA 2Z95A 4P4GA 2DLDA 2GYYA 3F47A 4PZCA 1SZJG 5HTOA 2X8LA 1NWCA 4BMSA 2PD4A 3K2BA 1ZK1A 1KETA 2BRUA 1Z6ZA 2YQ5A 3WSWA 4WECA 4GLLA 4P8RA 5CDTA 5BSHA 1XEAA 4YAGA 3RC1A 3SLGA 4LISA 1WXDA 4BNTA 2DFVA 5K0ZA 2Y0CA 3LC2O 1X7DA 4R68A 3F4LA 1P44A 2AQHA 2BFPA 2O7QA 3GZ4A 3JQ7A 4OO3A 1Z7BA 2XXBA 4HKTA 4ND3A 4NHEA 2O3JA 4ZGWA 1H6CA 4R1SA 1J0XO 2I99A 4RV9A 5F21A 4HX5A 2G5CA 1H6DA 1OFGA 4Q3EA 4JJGA 4XCVA 5DOZA 3ASUA 1ZK4A 3KHUA 3UVEA 2EWMA 1U28A 3QWBA 5KVSA 2AEFA 1PX0A 3WTCA 3K8ZA 5DCUA 1ENZA 2YW9A 4I5DA 1Z82A 2VRBA 3GEGA 4ZU3A 4CV0A 4IZIA 3EYWA 2NTVA 3DAPA 4RPKA 3OH8A 4MVJG 5KWEA 4U6QA 5TRTA 1UAGA 4WKGA 3F3SA 3I6QA 4UVEA 2PGJA 3H5RA 3H4VA 1HKUA 4L74A 3PTZA 3WIDA 1E1LA 4CM7A 2X5JO 4DRYA 4LRSB 2D59A 1HYGA 1ZEJA 3P2OA 4FBGA 3WLFA 2VNSA 4XB1A 3TFQA 3HG7A 2DPGA 3WNQA 3KBOA 4YXFA 1ZK3A 3I9LA 4E2YA 5ITWA 5KVVA 2OL4A 1MX3A 3GUYA 2Y93A 3C1TA 3FSRA 4OOEA 1F8FA 3JV7A 4CUJA 4QFDA 2PR2A 3HDQA 1UZLA 4RZHA 4IJWA 4O6VA 4GH5A 4RLHA 1IUKA 3GFBA 3RWBA 1T4DA 3K2EA 1TT5A 2Q2VA 5L7WA 2X0NA 1C14A 1PL6A 2QYTA 2RCYA 2DM6A 4UUMA 1H2HA 1D1TA 3ZHXA 1JLLA 2YV3A 4HNGA 2PZJA 3HB5X 4LGVA 3ROMA 1DIRA 2GSDA 3VH3A 3KSUA 2CF6A 1R12A 2AQKA 1KS9A 2R6JA 3RUEA 2GN6A 4CQMD 4R3WA 5T67A 4E4YA 3ZU2A 3HADA 2AQIA 2GF2A 4BOYA 3WGIA 3FD8A 3LF1A 1E1MA 2YYYA 3V1TC 4ALNA 3LVFO 3I9KA 3HZZA 3OEWA 3SEFA 4BNZA 2I76A 2ZB3A 3S8MA 1I36A 4BB5A 4FCCA 4YA6A 2NVUB 3C1OA 1ZFNA 1YBAA 2FY8A 1PWXA 4PIVA 4F46A 3D3WA 2PKRA 3LU1A 5KKAA 1QYCA 5G2OA 2QX7A 3KEQA 4B7UA 1DRWA 2YHUA 4YJGA 1W6UA 3E82A 4YJHB 1D8AA 1DSSG 1EDZA 1NPYA 1YWGO 1ZCJA 3JQBC 2IXAA 3BMCA 1OAAA 4BKRA 1LJ8A 2PZKA 3NKLA 3ZV6A 1C0KA 2EW8A 2C0CA 3K31A 4Z0PA 5CDSA 4L73A 1DJNA 2Z5LA 4AJOA 4BO0A 3OMLA 2NVBA 1EVJA 4MIYA 3ZZNA 5I8WA 1A7AA 3O8QA 4E3ZA 4GWGA 3QRWA 4XX0A 1PJTA 3HQ4O 2AE2A 1U1IA 1PU2A 2FZEA 4CM9D 1FJHA 1NVTA 4G5HA 1T4BA 4K26A 1EZ4A 2VYVA 4TSKA 1GV0A 4LW8A 4CR7A 3ULKA 1KERA 3PWKA 1LSUA 5KVQA 4CMAA 2H1SA 1WP4A 1QG6A 4Z3KA 4FGSA 1NWHA 3AJRA 3PEFA 3PGJA 2NVUA 4J1SA 3ROQA 4FD3A 3RD5A 3QVXA 2V6MA 1PGJA 3AU8A 4MVJE 4OH1A 2P5UA 1E77A 3FNFA 1C0LA 1I8TA 4BV9A 3PPIA 4WCDA 1YBVA 1XWFA 1K89A 2V7PA 1DIAA 3S55A 3WTBA 1VL8A 3I4CA 3PJEA 4HUJA 4RPJA 1XR3A 2X6TA 1HL3A 1QORA 2HLPA 4B7CA 4XYLA 3SC4A 3GHYA 2EGGA 4PRKA 4E2WA 4E6PA 3UICA 5EPOA 5DULA 2PZMA 4EUEA 2B4TO 5TIIA 3IP1A 1XCBA 3A1NA 1MC4A 4J1NA 1JKJA 4BV8A 1VE9A 3KSZO 2OORA 4WPGA 2VWHA 3WGYA 4IDAA 3VPXA 1FDTA 4KUHA 3U4DA 1XSEA 2BMAA 3E9QA 4GL4A 4BO7A 2BELA 3BMNA 1I3KA 2V6BA 4MP3A 1BW9B 3RFVA 1N7HA 2CMDA 4DPKA 7ADHA 4I9UA 4A0SA 3V2GA 1ADCA 4ZN6A 5A3JA 1ZO8A 3HDJA 1S7CA 2QIOA 5TC4A 6ADHA 4H7PA 3Q11A 5COQA 1YQDA 3CH6A 1OC2A 3DOOA 2WSBA 3DBHA 1QR6A 1G0OA 3W4KA 2PLAA 4D3FA 3VPHA 4YRAA 2AQ8A 2H5LA 2VYVD 3B1KA 4FC7A 3G1TA 4Y6RA 3IAHA 3ORFA 3GA0A 1HWYA 2A4KA 4U8GA 3IL2A 4PLFA 1N9GA 3VZSA 4BO5A 1SB8A 3Q2KA 3M2PA 3BMQB 3O03A 2X9VA 3BTVA 1U8XX 1ZJYA 2GD1O 5JSFA 1LQUA 4JJIA 1I32A 4RO0A 2Q4EA 5JW6A 1HDCA 1H6AA 4OKIA 2D4AA 1GU7A 1E3IA 3PLNA 1EK6A 1GTMA 3IQDB 3ZI0A 1WVGA 4MVJA 2YV1A 3TWOA 4D79A 2C5AA 4YB8A 1JVBA 3TOXA 4K28A 2C29D 1DB3A 4Q3BA 3RKUA 1R37A 1VKNA 5FI5A 4CV2A 4IGEA 4TVOA 3STHA 3GVIA 4AJJA 4C7KA 1CQJA 3IJRA 1PZFA 3I83A 4DBVO 4OSOA 3GAFA 4FQ8A 3K9QO 4AJEA 1LC3A 5DP1A 4DC0A 4DTIA 1WAMA 5DCYA 5F1KA 1XU7A 3M6IA 3RVDA 2X4GA 3S1LA 1JU9A 3AWDA 4PZEA 4XIYA 5TQVA 3JQAD 3TL2A 4BO6A 2ILTA 1X0VA 5CDYA 5F1PA 1YB5A 3OJOA 3NGLA 4OAQA 3BTUA 2Q1WA 3OQBA 3QHAA 2NU8A 4U0KA 1ZSYA 4NH4A 4DLBA 2Y1GA 5ICSA 1LDEA 1K0UA 1NHWA 5A03A 1GQ2A 2J3IA 5BSEA 1KYQA 1AHHA 3FRJA 2WD7B 2DAPA 3B70A 3HWRA 5IF3A 2HCTA 3E18A 1GV1A 1DFHA 3PHIA 1Y81A 3PQFA 4CM4A 4LCEA 3BHIA 1WDMA 3G79A 3JQ9A 4BNHA 2VWGA 3ICCA 3PHLA 4R4JA 4WLVA 1H2BA 4I5EA 1GQYA 5ER9A 2J5RA 4KQXA 1ZMTA 5BSFA 3UW3A 4BO2A 4CMGA 2EHDA 1RM5A 2Y67A 3T4EA 5JNLA 1YXMA 3VVCA 2GN4A 1VC2A 4HY3A 4MIOA 3JTMA 1HDGO 1PL8A 4QO7A 1B3BA 3GT0A 4OQZA 2GDZA 1SMKA 1P77A 4FJ1A 4CLHA 4XKJA 5F3RA 3ETEA 4RLSA 5GY7A 4DYVA 1XQ6A 1QMGA 3A28A 1DIBA 1UUFA 5A1TA 4YQZA 4BKOA 3O38A 1CIVA 3OECA 1ZSVA 4YPOA 4OJNA 3TZHA 2Q2QA 4P4NA 4UAGA 2PTGA 3DTYA 5IDWA 2O23A 5AYVA 3V8BA 1B15A 2UAGA 2C82A 4J7XA 3WGZA 4A26A 3BHJA 4XB2A 4E31A 4Q3DA 1PQPA 3ZV4A 3N58A 1NFFA 1HDYA 3JSAA 1UAYA 1WZEA 1NVMB 4D46A 1DJQA 4XQ9A 2X0IA 5CFZA 3FBGA 3GVCA 4PLZA 2NWQA 4TRJA 3PLRA 1GYRA 5F1OA 5GZ1A 4E2XA 1ML3A 4YWJA 1T1RA 1PS8A 2GN9A 3TSCA 3QE3A 1DDOA 2UUPA 4XJTA 5A04A 4DLLA 1EVYA 1SC6A 2B35A 3GN2A 1EBFA 1Z74A 4UVGA 4KWIA 1HE3A 3BTOA 3NDJA 5DN9A 4CMEA 5FWNA 1G0NA 3ZV5A 4MINA 3ETGA 5C7IO 5I9NA 3KRTA 1RM4A 5T5QA 5BNIA 2WWRA 4NG5A 1E1NA 4AFNA 3PQEA 4EUFA 1O5IA 3FI9A 2OO5A 4YAIA 1EK5A 3L4BA 5C7LO 1TB4A 5KIAA 3JD4A 4M89A 1P1IA 1NYTA 2Y68A 4ZA2A 4J1TA 1BDBA 3H65A 3KLPX 2VHWA 3PZRA 4DUPA 4E12A 5C5IA 4DPLA 2DTXA 4H3VA 1PGQA 3V5NA 5AOVA 1EUZA 2PV7A 4FC6A 5IN5A 1HZJA 1O89A 1QKIA 2HAEA 2A35A 3U62A 3RUHA 3NUGA 1E7YA 3GDOA 1ENPA 5JMPA 4ITUA 1U4SA 1Y8QB 4WUVA 3PQDA 3H5AA 1DFIA 2RH8A 3WNVA 3VZPA 4NBUA 4IS2A 4YYZA 1GCUA 1PS0A 1PWZA 1HSZA 3GPIA 1DIGA 4CLRB 3NDRA 3D5QA 3I52A 1Z73A 1DC4A 2Q99A 4Z0HO 4E5YA 1QLJA 5DBIA 4MP8A 3G49A 5G0WA 4NU5A 3GG2A 1GZ4A 3RFXA 2ZCUA 3PDJA 2OUIA 3ZWXA 4CJXA 4CPDA 4BNWA 2CZCA 1UP4A 3QWAA 1AN9A 2YFQA 4CODB 1R4NB 3PJGA 1GAEO 5CG2A 4WK6A 4HP8A 3U09A 1Q0QA 3AFMA 2VYNA 4NI5A 4GAEA 2FPPA 3WG9A 3D3EA 1ISFA 1MG0A 3PWSA 1E5LA 4FFRA 4B3HA 1P3DA 2Q1TA 3FR8A 3ZHBA 5JDCC 4DLAA 4BMNA 2GRAA 1E92A 2ZYGA 3JQ7B 3UUWA 3IOYA 3W8DA 1DOHA 4MKRA 5JC8A 1Y5RA 3GH3A 1LLQA 3MTJA 4DXHA 2XPCA 1OBFO 4RPGA 2Z1MA 4H16A 2I3GA 3WICA 3UHAA 4DMMA 2OMEA 1ZSNA 5B4TA 4CMIB 3GVPA 4BVAA 1O8CA 1CJCA 2Q1UA 3JYOA 4RL6A 4D43A 4ND5A 1PS9A 2G0TA 4MDHA 3KV3O 4HWKA 4JQCA 4XA8A 1NASA 3E8XA 5JDIA 1MC5A 3MOGA 2WTBA 3GDGA 4JXKA 2Y1EA 2Q49A 4BO8A 5GZ6A 3TFOA 3ZNNA 1MLDA 2BFAA 1MXHA 2YHIB 3H3JA 4ID9A 5TJ9A 3S2FA 1KVUA 1B7GO 5B4VA 2OP1A 3ZNQA 1VKOA 4Y6PA 3QWHA 3WBBA 1PR9A 1ADBA 2IDZA 4KWHA 3M1LA 3ZU5A 1YRLA 1DLJA 4Q3AA 5MDHA 3DZGA 3L0DA 1I2BA 4HFRA 1YDWA 1EMDA 4RPLA 3QVSA 3WGOA 1E3WA 3DEYX 1X15A 3SJUA 2OGUA 3K73O 4IM7A 5FI3A 1ZUD1 5EN4A 5I7SA 1A27A 2B37A 3G3EA 4IQ0A 1LU9A 1VI2A 3EMKA 1F06A 3UFXA 4GMGA 4CQMA 3I9OA 1M6WA 5KJEA 5H81A 1KEWA 5CAEA 5IG2A 4UEOA 2CD9A 1LC0A 2EERA 4CM1A 2E48A 4WLEA 5JAIA 3F1LA 4J43A 2G76A 3UXYA 4WCFA 3W4JA 1TI7A 1UXHA 1LRKA 2PK3A 3MJTA 1GEEA 5DP2A 4PLPA
chains in the Genus database with same CATH superfamily
2FDXA 3E3AA 3WS7A 2WTXA 1NIJA 1P72A 1UMCA 4OQPA 3ABQB 1NVBA 4PPGA 2O54A 2QM3A 1DBPA 2B8JA 4TZTA 3LC0A 4MV7A 3GQVA 4L0MA 1P7WA 4P98A 1XCLA 3JS5A 3BZUA 5AHKA 1OXVA 4K6HA 5ELMA 4ZOLF 3LHSA 1KEEB 3CF2A 3IPAA 3OZFA 1RYHA 2HT6A 5E9AA 1K7YA 2OO5C 4MQ4A 1Z4OA 2V45A 4C3UA 1SBTA 1GXSB 5CYFA 3DTTA 2JDIA 4X6XA 5CLIA 1XC7A 3OQIA 5JO0A 3DUFB 1CP3A 1EK2A 2VXYA 3ABOB 4FYPA 3TKLA 1EM8A 3DBHB 4Y6SA 3ZI7A 3LC7O 1NXPA 2J59A 3RPEA 2DGDA 4BNGA 3GARA 4Z0NA 1H9BA 2B5WA 4CLOA 1FFWA 3BL8A 3JWGA 3ZW8A 3VMMA 3CYFA 3F5FA 3M83A 3QFTA 1QXSA 5C8ZA 5L8VA 3IIIA 4GQBA 3UFXB 3UUGA 4BS9A 1DFGA 1TO2E 2QE7A 3BJMA 1EJBA 4UHHA 5B1HA 1F7VA 1ZN9A 1PI3A 1AGRA 1RAFA 2HDOA 4NMHA 3M6WA 4QHYA 4LBVA 4EG6A 2W8ZA 4X54A 5AVWA 1Y1TA 5HA5A 1YE5A 4MEAA 4R71A 4KNWA 5ICGA 3FH0A 3PFHA 3DOFA 3KPVA 3FWKA 1JPUA 3QYPA 4A0HA 1IBLB 1G291 3F8SA 4C88A 1C1XB 3JYNA 5BRAA 3ENNA 1X7XA 3UHPA 3ZKWB 1A8HA 2JGMA 4BDTA 3HGQA 2DBRA 3WZ2A 3H9GA 3WL6A 1PJBA 5LYJB 2ZRQA 3A9VA 1W4ZA 3K53A 1KIFA 3JR7A 4GZ6A 4E2ZA 1T36B 5AW0A 1ZKDA 4DGQA 1UH5A 4XEUA 4AJNA 2FK8A 3R74A 3ZD7A 3P26A 6GPBA 1VPEA 5THXA 3OF2A 5J2TB 3HN7A 4BMVA 1UXJA 3I2FA 3BCRA 4NFHA 1EYZA 4Q01A 2CF5A 4XEHA 4BE7B 4JXJA 1QP0A 1ODJA 3NU1A 4CKXA 2JI9A 1O94D 4JJ7A 4DCVA 4EZBA 1KSFX 3GJ8A 4OJKA 5WRFA 3VH1A 2NYRA 1SOUA 2PLWA 3M9XA 5E6UB 1BWSA 2YRXA 5LLDA 4M49A 3FHTA 3ZBQA 1ES9A 1JLHA 2RHLA 3AHCA 4KOAA 2HA5A 3H0KA 3S1SA 1PGOA 4B79A 2KI5A 5EUMA 4TPKA 3TNYA 4AIRA 5IEJA 2IYNA 4ER5A 4MUNA 1U2GA 3WLTA 1UZAA 4KO3S 3PD1A 3CPEA 3LC1O 4XW2A 3GEPA 1CS4C 1N1GA 4FJ0A 4IGAA 4R0NA 4XLTA 5FI0B 3RJ5A 4EA7A 4I1OA 5JYCA 1E66A 1HT0A 4BFUA 5F5LA 3NEPX 1VBFA 1V3VA 4X24A 4AURA 3C1UA 1YS4A 3FVQA 3CLHA 1HLFA 4TTTS 2X0FA 2FP3A 3N6XA 2CV2A 2AUNA 2FN7A 4EUHA 5ELXA 1VJ5A 4HGZA 3RT7A 3O0DA 3LG2A 3PU6A 5SZKB 2I71A 2O5RA 2QTCA 4KGVA 5DBHX 3IA7A 5TS2A 5K4HA 5CGQB 3TX6A 4PG6A 2Q0SA 2W58A 2XX3A 4XM2A 3NGMA 4B45A 1AZSC 3OEED 1LSJA 4DQUA 3D64A 2PSJA 4FX5A 3BMNB 1GN9A 1UP6A 1MEJA 1UBTS 2F00A 1Y5MA 2J5KA 1BQ3A 3AUSA 3K0EA 4JLBA 2W6QA 1Y80A 5CX4A 1G66A 1G8GA 3QKWA 3VAYA 1T6XA 3N8NA 3SWWA 4B8ZA 1A8UA 4PG8A 5LBTA 3UUEA 5TT1A 3UGTA 4RQBA 4R7ZA 1MABA 2A59A 3BQMB 4JUFA 1RMQA 2JJ1D 2YN4A 3MGCA 2A94A 1KBOA 1R6UA 1J4AA 2ASEA 1KL7A 1CDOA 4QASA 2DR0A 4TUYA 3SX4A 4E33A 4EDFA 4EHJA 1ZXBA 4WUTA 4B6FA 4RE6A 4EHHA 5BR4A 1G6Q1 1HM5A 4P4SA 1CY6A 3CCFA 4URFA 3EULA 2YYAA 1X70A 2FEXA 4H7HA 5HZMA 4ZRNA 1R5OA 4LVOA 3TYXA 4XQEA 5CT6A 2CLCX 3I61A 1E4OA 3RRBA 3V42A 4UHJA 1V47A 4XQ0A 3UGJA 4DLTA 1S3FA 4EY7A 4ZAYA 1JDBB 3GRVA 2I3AA 3DTNA 2OC4A 2JFVA 3TLXA 3TO5A 4AMBA 3AM3A 3H1BA 4MTCA 3THYA 4DF3A 5CW2A 2YXBA 1DQSA 3M4XA 5EMMA 1DAIA 1QUEA 1LPAB 1DOAA 3ONDA 1LEHA 3OZWA 1T3GA 3JWPA 2VDVE 5GZ3A 4RS3A 1Y42X 4O8CA 4IF6A 2QL9A 2A30A 3RNLA 4MDFA 5FLEX 1XRNA 1S9DA 4EH1A 2QRMA 3HVJA 4AMYA 4QRHA 4Y2JA 5LJLA 1IM2A 1M0WA 4OQMA 1Z17A 1X19A 3QU9A 1ZVKA 3UY4A 4ZDKA 1HKHA 1JDZA 1XPJA 2V6GA 4NXMB 3PFKA 3Q9SA 4WXRA 4EOGA 1JSZA 1IVSA 3R7AA 3OCYA 4MB2A 3WP0A 4LQLA 3GPBA 4JBGA 1YK1A 5B1YA 2IWHA 1RLTA 4GGPA 4I3FA 1RJDA 1W2GA 4NSNA 1B14A 4A8JB 1NNI1 4IOKA 1NUUA 3B6ZA 3Q6IA 4JR2A 4L4UA 4BYGA 1IVNA 3MJEA 2VT3A 3P9KA 4NAUA 4EA8A 1EXMA 2HMUA 1XPUA 4X1OA 3WBFA 1SVLA 4MVCA 5C80A 2P78A 4FD2A 3E9ZA 3DDUA 5EZYF 5JNVA 4RPIA 1CUHA 3CEAA 5IXSA 3PR2B 2DQZA 4M4SA 1ZD9A 1PZGA 4CFSA 1XG5A 3B60A 3T1QA 5E2BA 1Q2UA 2G4LA 2RGYA 3M2TA 2PD6A 3EJ6A 2NMVA 3NRJA 3P2YA 1XRRA 2V65A 3CM0A 3PXDA 4ZQBA 3VOBA 3LKVA 1ADFA 4IIJA 3K4HA 3SDSA 1FJXA 1YQ9A 2XDQA 4TKLA 3GVXA 1JT9A 4AJKA 2OSBA 1C4XA 4KXLA 1A9YA 5BV1A 2OZVA 4L9WA 1I33A 1W30A 1DBVO 4NZZA 5D87A 1CNEA 1AUVA 2VBCA 3BA6A 1MX9A 3F6SA 3LVBA 3T0FA 4D3ZA 2IPXA 2O2XA 2YWDA 2C58A 1RYFA 2PWYA 4R8VA 3I0ZA 4EQ6A 3IQGX 3IXMA 1JEQB 3BF7A 2I54A 5CDGA 3V4RA 3MTGA 4LSZA 4TSRA 5K6AC 3TDKA 3SZLA 3F73A 2FZ4A 1MJGA 4RJLA 1PDOA 5D85A 1P74A 4IHJF 2AR9A 2Q8QA 3EVBA 5CD1A 1L7AA 4HAUA 1R6XA 2YXPX 3BRWD 3T7CA 1OV6A 2R8BA 5ED4A 2GSWA 2OC9A 4O4IF 1OE0A 2FUKA 3H0CA 1E9VA 2J0EA 4I4NA 4IHJA 2SNIE 4FQ5A 4G1CA 4DCCA 3IBSA 4PQFA 2H17A 4EJ0A 4ND2A 1T1JA 4BIMA 2ECOA 1Y9ZA 2MYUA 2Z0MA 3L9XA 4G0OA 4MVYA 4OHVA 3HXQA 1VGQA 3DVRX 3U13A 3V6MA 3QHQA 4ROSA 4MYTA 1QZTA 2KYRA 2OZLA 3OOWA 5KSYA 5K8TA 3UATA 2WIJA 2XTJA 4R1MA 4RBNA 3E7PA 3JQ6A 4JD5A 3RAGA 1PJQA 1R0XA 2CHUA 4H0CA 5BV8A 1Q19A 1Z28A 5GJWC 4KDCA 4Z3DA 2VDUE 5IC4A 2YUTA 3BMOB 4AZWA 2ZATA 4Q48A 3PI6A 5FBKA 3O95A 3T3MB 5JATA 3K0SA 3JYLA 3NHBA 1O9GA 3OLZA 3F6YA 4PLHA 3UT5B 1YO6A 1Q1BA 3K5WA 3CC8A 1DJLA 4Z1OA 1KQGA 5FOSA 2EKZA 5TPZA 2NGRA 3QOFA 4ZT3A 2IYWA 3EQ9A 2V8BA 5EZYA 4B2IA 3SI7A 3N6VA 1XMVA 5TEVA 2QUBA 1RU3A 4Y1EA 3RYHB 1U5CA 1D4FA 3VXKA 4MO2A 1QONA 4BFCA 1FFHA 4OK5A 4CEIA 3TJMA 3THXB 5BR1A 3ADCA 1A72A 2VZ8A 1EIWA 3ZJVA 2MYPA 2X4IA 3ODPA 4NBKA 2IP2A 2JAHA 5EEGA 1RWXA 4UCXA 3HE3A 2ZJYA 4CTJA 4WLOA 1RKQA 1FK8A 3LUKA 1M6HA 4G6ZA 3GMSA 4K1LA 1B6SA 4YEDA 1ONOA 1KO8A 5DXFA 3UKOA 2YHIA 3L6CA 1JLSA 4ZC8A 4JLSA 2CDCA 4S2EA 3WX0A 3ITNA 4FOTA 3EH2A 3GYBA 2VUIB 3T5BA 5AVSA 1FVXA 4A10A 1JJBA 1RWQA 4GRIA 1M5TA 2QHXA 3KZOA 4N6NA 2FSUA 2RIRA 3B89A 2C84A 1GNRA 2GCIA 3GCXA 3HNRA 5TF4A 3R9KA 1Y7TA 4DV2B 3QU7A 4BWYA 1E1QD 2YJNA 1ZK2A 3GD7A 3RC3A 1H23A 2C8LA 4JVNA 1N1MA 4MR8A 5J9FA 3W78A 1XTPA 1E3QA 1Q3KA 2I2WA 2QY6A 1JHOA 3H8SA 4KBFA 3ASZA 5DXAA 1K7CA 2WRZA 3EVDA 4AS2A 3VR4A 2JCYA 2REOA 3HJBA 2EL7A 2R6AA 4GOXA 5J40A 1EFPA 4BMZA 3W6UA 1WL8A 3NIWA 5EQFA 4EKYA 3R3VA 3T0IA 4D3SA 3L5KA 4DSOA 3IEXA 1K5HA 1I51A 1KNQA 1K5PA 1YQGA 3AKDA 3BB1A 3KB8A 4DMHA 3AF6A 3BFPA 1QZUA 3NVKI 1YCHA 4IJMA 1E5VA 4IG4A 1PZEA 2E55A 4C3OB 3NTOA 4BNYA 1TK9A 2ODBA 2QTGA 3A4NA 1E2IA 1VG0B 4GSYA 5LCXA 4L78A 4LI0A 3GK3A 1VFPA 3FJ1A 3IALA 2NXEA 1HDOA 4G8DA 2GQ0A 1E18A 1P7PA 4S1OA 3FI0A 4M7RA 3BREA 4FFPA 1UC8A 5HRUA 1F38A 4MUAA 4I55B 5EAIA 4QO8A 4G4JA 1NVWQ 3A1WA 3EXG2 5AHXA 3TD2A 4CMHA 2FQYA 4MDEA 3KO8A 3M3HA 2WNSA 3K0BA 1JZQA 1BHSA 1VCMA 2XNJA 1QRRA 2H07A 3A4VA 3FE2A 5IN4A 4NJMB 3M4JA 3UMFA 1XALA 1XZBA 4MUGA 4B3FX 4O63O 1J2YA 1DBRA 1OIXA 1L0BA 1UKBA 221PA 1PN3A 2XCIA 3ABZA 4KH1A 4OGKA 2QN1A 4PAQA 4RIEA 1UKZA 1OT3A 4HGYA 3B3GA 4AMGA 1L4YA 4D9HA 1NKTA 5JR3A 1C9DB 3GJRA 3MWDA 1CETA 1UXKA 1XD8A 1NMXA 3IDQA 3PCRB 4DARA 1P31A 2QVGA 5CTAA 1FP4B 4AUKA 2PXCA 1I9GA 2OT3B 3IP3A 4PO9A 2J9GA 4NATA 3G6KA 1E5XA 1YDHA 3HXMA 2IYAA 4D9GA 3IVMA 4X45A 4WDRA 3RW9A 3SOPA 3UMMA 2JFPA 2I6GA 1KO7A 4FYMA 3VZCA 5KKCA 4J0KA 4BASA 3N76A 4OJQA 4TM8A 3X2FA 2P6MA 3TUJC 1Z4NA 3N7TA 2B5VA 3D6NB 3U4QB 4YJFB 1GCGA 2V74B 1IPHA 1PTJA 3A9SA 4JS0A 3T3PB 2I1WA 4RANA 1SIBE 2ZIZA 2DOKA 3NDIA 2W48A 4GP9A 1MHPA 1FS4A 3OZXA 4RDXA 1FXWA 5BT9A 1Y3FE 3U19A 2O8BA 3G13A 1K2WA 2P8SA 3K6SA 3MWEB 3RS5A 5FT9A 4DVJA 4YHHB 2W2NA 3QFHA 5IVDA 2Z57A 3AGQA 2OV8A 1IBSA 2PBLA 4ILKA 1BXGB 1QB8A 2IXEA 5E3JA 3EF3A 4J0FA 1X7YA 4R51A 3ZH9B 4G1MB 2VBGA 1EQUA 2KW5A 1ICIA 4ZI7F 1JF8A 5LWHA 2B4AA 1RHMA 3UMGA 1V5GA 3QV1A 4TV8B 1E0JA 1SEVA 5ECDA 2OYSA 3T9EA 3T3EA 4CKBB 2G25A 3GJ4A 5BNZA 2IZ6A 1EFKA 1ORRA 4JVLA 3IMKA 2XWBF 4BUCA 3G5UA 2J67A 3A06A 3OIUA 1SXJD 4KJXA 1D4OA 1G41A 1NSTA 1TE2A 2V0NA 4HMOA 4I1SA 4GW3A 4IY1A 1ABFA 5SYAA 4HQRA 3S1AA 3U3XA 5K0EA 1KEUA 2MSLA 4GM1A 4C4ZA 1ZD2P 4CQMB 1TO6A 3OIDA 1ENOA 2GZ2A 1R7RA 1TZBA 1TD9A 1KZ9A 3H19A 1VMKA 1KS2A 2ZJ0A 3NZEA 2O6HA 3PKJA 4MSUA 3CR7A 4J90A 2JJMA 1YZQA 5DO9A 4CIYA 4D42A 1M67A 4HLQB 4J2OA 2I9KA 4ZDJA 3HCNA 4GX1A 4RPHA 5JCPA 2NXNA 2DCUA 4FZ3A 3CJRA 2GN8A 2HHHB 3CSDA 5BN5A 2IEDA 3W2GA 4ZC1A 1O0CA 1JBKA 1KYZA 1QE0A 1EWQA 3GEEA 1Q7RA 2GJAA 2QPTA 4YN3A 1USGA 1SK8A 3A4MA 5B2FA 2HHJA 3BD7A 4ZT7A 2IUUA 3NTRA 4U5QA 4WESA 1EB8A 4RORA 5IZCA 4PWZA 5ERGB 1T15A 2FA9A 2QU7A 1Z47A 3D7SA 5JBNA 1T1SA 1D03A 3RIYA 1B2LA 2D3WA 1Y48E 3R6GA 2VJOA 1H0RA 3BRCA 4RE5A 5J4LA 1CUAA 3C3DA 3VO2A 5LA6A 4M38A 4WNIA 4Y2XA 3A58B 4OBXA 4H31A 3DUFA 3S2GA 2C96A 5A7FA 3G2OA 4B3SB 3WKEA 3CTPA 1WCWA 2X3UA 2XUZA 4CKBA 4TRNA 3ACCA 1E96A 1AS2A 1U5BA 3E84A 2GM9A 1QDLB 1T10A 4FGUA 1IUPA 4XDYA 3A0UA 4EM6A 1YVUA 2GR9A 3OM1A 4I4CA 2C4NA 1QK4A 2ZBPA 1E5TA 4L2IB 4CG1A 2NTEA 3LCMA 1N0WA 2FZCA 4FLFA 4Q9HA 3GPDG 4CN9A 1SH7A 1CYDA 5BORA 1PL0A 4I19A 4W7IA 4CIXA 3TQIA 1UZMA 1F9AA 4IZHA 4C06A 3BGIA 1X42A 4EHKA 1RQGA 4YT8A 2H57A 5L45A 1OH8A 3PUVA 4L76A 2ZZNA 2Z3ZA 3LOPA 4FBLA 1XAIA 3TAHA 3P4YA 3H86A 2Y71A 1SRRA 1IMJA 2QVZX 2VK2A 2XOEA 3AY7A 5TQJA 3U9LA 4DMUB 3W5DA 3NCTA 1JJFA 2AN9A 4OHUA 3RVKA 3VSCA 2P4HX 2C8KA 4R1PA 4O1HA 4FU0A 1V7QA 1ESMA 1WRBA 2EWVA 4Y2VA 4FKZA 3OP1A 1ZIDA 1HEYA 3RFTA 3JAMA 3J7TA 1G4UR 4JP2A 4AO8A 5KCZA 2QTMA 2ZVJA 5LA6F 1C0IA 3H1FA 4K87A 3NWJA 2R9VA 2W2VA 5LKRA 2DKOA 4UU0A 3FYUC 1KI7A 2HYIC 4BEVA 2FR8A 1F4VA 3CRRA 4B6RA 2WPDA 5CYGA 4F4UA 3DBLB 2P7HA 1MN6A 2WYVA 3HUUA 1SB9A 1Q15A 4LHEA 3R3SA 3UJ3X 1J56A 3N0XA 3JQAB 4BLWA 1T5TA 3OSUA 3D4NA 4RA9A 7ABPA 3DZDA 2HPAA 4RFLA 2CY0A 4QPPA 4BNXA 1PD0A 2WHPA 1Z4JA 3ESAA 3L0CA 1ZM9A 4RPCA 2EKBA 3G0IA 2EJCA 4WN9A 2FTKE 1O96B 1I94B 5JXWA 3HEAA 1Z6AA 3EGCA 3UB2A 1RRFA 1W1UA 3ANXA 1Z06A 2GPJA 2O7RA 5F2KA 1X7GA 4AN0A 1NJ1A 1UDBA 2RMKA 3NFYA 1MOQA 4XYEA 5A7HA 1AA9A 1NY5A 1NQAO 2JIPA 3MJVA 4EPVA 1DG3A 4UW9A 5G40A 4EHBA 2JS7A 2WIGA 3BJRA 3WYGA 2ID4A 4WY2A 4IX1A 1V7PC 1DRKA 1Q6YA 3OU6A 4WD3A 2Q6OA 1MJNA 1I7PA 3TW8B 3HJGA 3TZBA 1KWGA 1DKRA 2Q2OA 4XOIA 4ZRMA 4Y2TA 1JMVA 5EMLA 4MVXA 5EKXA 4CM9A 4DIKA 2J3JA 4UVIA 1B8VA 2MTBA 4ZAZA 1KJNA 5BUCA 4OXKA 5FOQA 1UBKS 3FNGA 3DZBA 3O84A 4OHZA 4FGKA 4HX2A 3B6KA 3UPTA 2X76A 2GESA 3QU4A 1WTCA 4J76A 3Q85A 3WBKA 1AKMA 2ADOA 3EGOA 3EXIA 1FFXA 1H1LB 2IGTA 1AV6A 3Q7IA 1MFPA 2BUAA 1KJYA 5K8LA 1WUIS 2O2DA 1GYQA 2ZIXA 3G0DA 4NJEB 1ZJJA 2R6GA 2SKEA 5JS8A 1EFLA 2VVTA 3DP7A 1LZKA 1PK7A 5HWSA 3DULA 3P19A 2JGEA 3NW9A 3PTAA 3OQOA 3MWFA 1QB7A 3FOAA 3PC8A 5K4GA 3GLTA 2QT9A 2XA9A 3WMRA 3QVOA 1Z34A 2A0FA 4FMDB 2O14A 3MZ0A 4RD1A 3MGAA 2G7MC 2A5YB 2WM9B 4H7JA 2QV0A 4N39A 3WFIA 3COZA 1KI1A 2V03A 3RUDA 4FMCB 1UT5A 2VDWB 2ZRIA 3FGNA 3I9V1 4TSFA 3T54A 3B85A 5ESXA 3T9AA 4UTNA 3KETA 1UBLS 3AHJA 4TTQA 1LPOA 3ED5A 5I8ZA 1KIAA 2J08A 1I2ZA 2DFKB 4YV2A 2WG2A 1AKEA 1QCYA 2JCSA 1ILEA 1XWIA 3P0RA 4MCAA 1U98A 3KC2A 3KXPA 4YP5A 3U4MA 2C4MA 2HSDA 4MW6A 2Y77A 2IRWA 2WD7A 3U9TA 1XNQB 2FMFA 1H22A 4QICA 4DPMA 4LDAA 3NHKA 1M1XB 5HKKD 2H9AA 2ZYWX 3ELUA 3E9NA 4OHXA 4JT2A 4PYNA 1W0KD 3VSAA 5F7XA 4RK7A 4BQSA 3I0MA 2LKDA 1U3TA 1XELA 2BEKA 4F6LA 4NQZA 2XXJA 1OASA 3PC8C 2BFEB 4EEXA 3GUHA 4JMLA 3PIIA 4BZXA 3BH7A 5AW2A 1ZJWA 3LBAA 1FSZA 2ZBUA 4GZ3A 4F0JA 1N1DA 1SUSA 2D5AA 3IOBA 5DBGA 4CR6A 3VZQA 5E7IA 3TQFA 3HVHA 3T95A 4YT5A 2PZEA 5G53C 1EFVB 1VL5A 4L27A 1C1YA 5HILA 4L5YA 4TRRA 2ONKA 4B0PA 1MDFA 5CCEA 3GL9A 3F2VA 2CLMB 3DQZA 2QRLA 4TLCA 5L3VA 2Q7DA 1Z88A 4AUEA 3IKVA 1LXCA 3MF4A 4MW9A 4XYBA 2VHQA 1SAYA 2CNWD 2ZTHA 2ZSJA 4AJ1A 2ID7A 1HRKA 1OBOA 1EHYA 5AJWA 2Q7OE 3ZHCA 4DUYB 3OQJA 4ZCQA 1U8EA 3G88A 2RJOA 2GERA 2HNAA 4FFNA 5IAKA 5BN4A 5J4HA 1L5QA 2WQ7A 4JVMA 1T2CA 2R25B 3P20A 1TD1A 1KY3A 1XRJA 4Z53A 3H04A 2Q3CA 1QJ4A 1IY8A 4DMRA 4OK6A 2W6ZA 3EIUA 3V8QA 4ZKDA 1ID1A 5ITVA 1NJ2A 3L7OA 1OFHA 1XZFA 4B87A 3IQZA 1F4PA 2GHQA 3F4BA 4FFBA 2FZWA 1B43A 4EA9A 1VG9B 3UJNA 1KJ8A 2AEJA 1Q7EA 5DEOA 2P5YA 4G01B 2A2ZA 1IHOA 1TM7E 4RMJA 1DRJA 2PAFA 3EQ2A 4F3TA 1C1DB 3BE6A 4Z5XA 3QVVA 1T6NA 2FSHA 5D7NA 4FS8A 1CHNA 1SXIA 4MP6A 4OPMA 5BSRA 2G9NA 3S2EA 4HWPA 3VGPA 5JWRA 3O94A 1WXIA 2OXIA 1MFZA 3UK1A 3VC3A 3DE6X 4QULA 1U7UA 2ANBA 3UIEA 2PJDA 4PS1A 1XIVA 4D0RA 1SCJA 3WGGA 4DC1A 4EF6A 4TYPA 4ARIA 2XBMA 4XVCA 1LV8A 1QFZA 4BO4A 4YMHA 4TWRA 4A2PA 2D1TA 1Q74A 2HD4A 2W2KA 2IUSA 3F98A 4NF2A 5ESDA 4U39A 5FOVA 5JS6A 2O57A 1UOEA 4YBZA 1LDMA 1TU0A 1AE1A 1RLOA 3BHNA 1V8ZA 2AHRA 1KO1A 1SOVA 3C3WA 3DCJA 3O2QB 1IE3A 2PKQO 4DCNA 4CN8A 1HF3A 1Q20A 2OHHA 2RK4A 3SHTA 3WIBA 3QA9A 5EMHA 5L4LA 1DDIA 4MWZA 2QD2A 4KWCA 4CKYA 2BGRA 4ONEA 1SC3A 2R6ZA 2YOFA 1FP1D 3CZ4A 4PXSA 2CNOA 3FOCA 1RM3A 4LA4A 2KX7A 5JG7A 3WL8A 3X43A 3VZBA 4D99A 4BO9A 1CQXA 2MJLA 1PEAA 1T4CB 3PS9A 1MBZA 5FWXB 1MVLA 1KVTA 3VDRA 2VTEA 3WWEA 3SKYA 5DI3A 3OLCX 5CTJA 3QMPA 4ME6A 3EB9A 3O8RA 1WCXA 4Q15A 3PFWO 4C4RA 1SXJB 1Q7CA 4CLXA 2HSEA 2RGXA 4RVNA 5K01A 2CXSA 2DC1A 2XF8A 4KLRA 5K51A 3IOMA 1OFUA 5JNWA 1UANA 3U26A 4AKIA 4MVJM 1DQNA 3Q40A 2H5JA 3JRWA 1EBBA 4ZVPA 3ZW9A 1UBNA 5DU2A 3TNLA 1TECE 2IVZA 3WV4A 3WYEA 3I4FA 3JQBA 1JIIA 4RZQA 4UBMA 5EE5B 5CPBA 3CUYA 2Y0BA 1CY8A 1LFDB 5G4LA 2WTAA 3WRVA 3BD9A 1Z2DA 2NV0A 1FNMA 2OVFA 2V7UA 2B2CA 1S1CA 2P4SA 4N12A 3HXTA 4O4IA 3ZIAA 4C4PA 2RCNA 2WSSD 4JGGA 1E4EA 4BXOA 1ZRNA 3OQVA 2J5QA 1E98A 3MXTA 3U17A 2ODWA 3BXXA 3KZCA 1F17A 1KQNA 5KKNB 1Q2XA 1ATIA 2Z9BA 1FRFS 6NULA 2J3LA 5GGYA 3H6HA 4MS4A 5EJ6A 1KYYA 3ZWPA 1RMTA 1SC9A 2P9EA 3EFBA 4L28A 3T9CA 5BPHA 1P17A 2DT8A 4NFLA 3ZYCA 2ZT6A 1GO2A 3O6VA 1KE2A 5KAMA 3OQ1A 3SE0A 3T5GA 1B6RA 4REMA 5T7BA 3VUEA 4MPRA 2FEPA 2HA2A 3GT3A 1RWBA 3K35A 3D4OA 1L5NA 1V11A 2AD5A 2A57A 1E3WB 4O4LB 1SUWA 2ONCA 1OX4A 4MQ5A 1RXWA 1S0UA 1XDSA 1ZM3A 1N6RA 1XPRA 5GINE 3RANA 1L8LA 2EG9A 1T0PA 4LY9A 4BB9A 3KKZA 1HZZC 2CC2A 3CR3C 2CUKA 2HKIA 4PNHA 1XTZA 4WOPA 2NAPA 5AH0A 4GBMA 5K8JB 1P8AA 3I58A 1DKLA 3ZHYA 3P45A 1UMBA 2HRBA 3BDVA 3K30A 4G2TA 5SZIA 3RFUA 3ROKA 2J32A 3T38A 1R0KA 2V0CA 4AZ0B 2B9VA 1VCOA 4LSMA 3FOBA 1NBME 1TGVA 4CFYA 2EFDB 3PPXA 3V1MA 2OCAA 4M0PA 2HDHA 1ABEA 3RFFA 3TTYA 3G2IA 4YCSA 4N3NA 4PN7A 2Z3VA 1KJIA 4KQ6A 4G1EB 5CITA 1P3Y1 4ETWA 5LP6B 4Z4EA 4HFNA 1FRQA 5AKLA 5EESA 1I30A 1ZMBA 2X6QA 2XODA 3QZUA 4NU6A 2DWPA 1G98A 2R6HA 2VF5X 3C3CA 3K1AA 4G8BA 4MPDA 3ZLUA 3ZWBA 1NBEA 2FAXA 4P32A 1Q7TA 4OGLA 3OEHA 4K3VA 2XCUA 2D1FA 2FWIA 2N1MA 3ZUPA 4EI8A 3LP8A 1V6SA 2OA0A 3C4QA 1RT9A 2VUSA 1BFUA 3E5MA 5CVEA 3VYTB 3WIOA 3WIUA 4UPEA 4KU4A 1NNLA 4NR0A 3W0LB 2FFHA 2Q5FA 4FDTA 5KYTA 1SQ5A 1QF7A 4LUCA 1KVQA 2DP4E 1RZUA 2O1EA 3FSJX 4OKNA 3SSOA 2UV8A 1FTGA 1I1OA 1XFDA 2NU7A 2Y05A 1XA0A 3JXEA 1W52X 2PUBA 3K2QA 1V16B 4JHLA 2DUWA 1AHPA 1HLPA 2GARA 2EJBA 1BJTA 1YZKA 4KPUA 4W4TA 4ZWNA 2F9MA 3OA0A 5A0TA 5JH7A 3WWYA 3ANMA 4YO8A 2BKAA 3EGVA 1ZEMA 3CNEA 5EJ8A 1ADGA 5CA0A 1K66A 1RRVA 2X23A 2B99A 4JKOA 1UK6A 1HEUA 3CX3A 1SELA 5ALJA 2ZFUA 4MRAA 2C5BA 2YHSA 1OWOA 5K3EA 4A91A 3LRPA 1W5AA 4Q16A 2QI9C 2FRDA 1R5JA 3MGGA 1ZW6A 5DZSA 1BXKA 3U3KA 2WVHA 2ZAGA 2W6PA 3A6LA 4UNPA 1W581 2A6PA 4TUYF 1V5FA 1O2DA 3QWFA 3DL2A 2YV2A 1DX4A 1W5TA 3RLFA 1KQPA 2ZDGA 5HKOA 5HOEA 1KEVA 4BVJA 5ICFA 5LP6A 2IE8A 2B78A 3ICOA 3QP9A 3CCBA 3SS9X 3DAGA 4QDJA 2VZ0A 3ZWNA 3KUDA 2UYCA 1J90A 1FNDA 2EYQA 2FDRA 1MHTA 1IBMB 4RDIA 3QFRA 2WT9A 1PNQA 1SU7A 5A4DA 1QP7A 2R66A 5JROA 4MA0A 1DAPA 1Y1RA 4UXJA 1SKYB 4LVUA 4IPTA 3RH0A 3U5TA 3I1IA 2R8EA 5DE3A 3T4UA 4XLLA 2AKEA 2VTKA 3SFVA 3DWEX 5I51A 1ORHA 3LQFA 4HVLA 4ZGGA 1ESEA 4FUQA 1OXBB 3K71B 1EBUA 1XHEA 5K7SA 5KVCA 4YWHA 1XD9A 1H3FA 3VR5H 4GUAA 5J1TB 1HE2A 2EJWA 2VNAA 2X22A 3NVMB 2FUNB 2H59A 2BOVA 4H6PA 4JX8A 5EJIA 5K0TA 1I3OA 3VU3A 4TWBA 3ZXSA 3H97A 3GZNB 4EDHA 3AX6A 4K1XA 2I0FA 2EHJA 3OQ6A 1RC0A 2F6RA 3TN7A 4QJIA 1JECA 1YQXA 4GVXA 5DHQA 3SIXA 5EE3A 1GKYA 2CSXA 2CK3A 4TSKA 3JQEA 3C5CA 6CHYA 3OU7A 1TT5B 1Q0SA 4UE3S 2JANA 1HT2E 1RYZA 1YK0A 2FVYA 2B8NA 1O57A 1FQWA 1Q3HA 4AJLA 4BTLA 3TNDA 1N8NA 2O52A 4F5DA 4Y2UA 1E2GA 2FX5A 3I6YA 3GEMA 3M3PA 2WVJA 2X0DA 1FEZA 3A9RA 1N0VC 4H1TA 3NHAA 4PEVA 4PO8A 4X8OA 4Z6KA 3TOSA 4YQEA 3T1VA 5JXJA 3BXHA 5M5BA 3AM1A 4KQ9A 3D7KA 4RK5A 1RPJA 2PUDA 5IFKA 8AT1A 4O4HB 1XHFA 2OHVA 2P2NA 3GAZA 4FHEA 1NJ8A 2Q3JA 3EASA 3KD2A 4XUDA 1CERA 5EJMA 2HTFA 2OHJA 4YMGA 3WK8A 2Z3WA 2DE0X 2VS1A 4LRYA 4KQGA 4ZHQB 4QQFA 3RYIA 3A6DA 4YJDA 3U7GA 5JJLA 4WASA 1RBMA 5CFMA 5HKBA 3OLVA 13PKA 4RCZA 3REGA 1XXHE 3EXFA 3ZVNA 2B83A 3EPPA 1RIFA 4R3NA 3JYQA 1V9SA 1O97C 1CUGA 4S1NA 1LDNA 3ZY3A 1L4BA 2VSYA 1YR8A 3MWDB 4B6GA 4Y6LA 1TMYA 4RETA 3UENA 1MP0A 1XDWA 3LT0A 4TQGA 3ONFA 5FPTA 2NOAA 4EI9A 3U4CA 3T5AA 1CUXA 3GRRA 1U8FO 4LYJA 1WKCA 1Z5NA 1JQKA 2QUHA 2VPXA 3JD2A 5FQNA 5IDXA 2IF0A 1U11A 1VP3A 2XADA 5TE9A 2VPQA 4QOHA 1TUIA 4G0XA 3C8MA 2BGIA 4Y9TA 1P1RA 1XN1A 2WOJA 2OCYC 1DC3A 3QFCA 3FRIA 3VOSA 1OILA 4H0FA 3EQ7A 3FDJA 3ER9A 3QF4A 1S4QA 3A04A 4F5WA 3TXXA 4ZYYA 5KAPA 3IR7A 4Y0AA 4KN9S 3D9QX 3DZHA 4NCIA 5IKXA 2WP0A 4UMEA 3DOEA 4M1WA 3WGUA 3GU3A 3OM0A 4ANFA 3ZLAA 2Q3LA 3E58A 1EFRA 2MINA 4MKZA 4EBFA 1T26A 3BKWA 2XSZA 4IICA 4GXRA 4QGAA 3PUKA 2MSWA 3QPUA 4IG9A 4Q1AA 4NX2A 4JJ6A 1OFVA 1OBCA 2OXRA 4NBNA 1R3DA 1NA5A 3K16A 5CNJA 3U4IA 2A1UA 4YCAA 2Z04A 3PKIA 1E7MA 3Q72A 3TM4A 1Q57A 2VAWA 4M87A 5U4QA 2GMWA 1G8YA 2BFFA 3BTSA 5C35A 4LF8B 1TMOA 1IN6A 1BH2A 1TTHA 3RVSA 1HR0B 2XGJA 4IJSA 4DE5A 1O96A 4WXYB 1E3JA 4MV8A 1J99A 2VH1A 1QGDA 2A9OA 1OU0A 4XASA 1CUCA 3M0EA 1TEXA 5GM1A 2HA3A 3CEMA 1J5EB 4PAMA 4NOLA 3WKAA 4IVRA 4WLNA 3AETA 1E60A 4WADA 5D3MA 5HIKA 1C8VB 5H5JA 4J49A 2QD1A 4V0LA 1IEWA 4YVFA 1CQZA 3E7DA 3AUJB 4NZ9A 1LUAA 1Y3CE 3KSAC 1RCFA 5LOVA 2ZSHA 4O1MA 3O8NA 5G0UA 2Z8ZA 1BDJA 3ZIUA 1I01A 1J1IA 4GKVA 4XWKA 3H13A 1BKDR 2P27A 4IZOA 3DSRA 4MLZA 4UJ5A 5CURA 4PPNA 5DN6A 4TMVA 2A3RA 4ZICA 1G20B 5A4FS 2COKA 2W9XA 3AUUA 1D8TA 1ZNQO 2PIAA 1XAHA 4CF3A 3CBGA 3OETA 4BIIA 4S35A 4QOJA 1L7RA 1QRTA 1H94A 3NG1A 4HB3A 3ZBUA 5IK2A 4AF7A 3AEYA 4O3FA 1LI7A 2H29A 2QUKA 4XPIB 4B9EA 1PJ4A 4PC3A 4YRMA 1W1IA 2A84A 3DDOA 4GP6A 5J5VA 3UK6A 4FYJA 2B30A 4CNBA 2BM1A 4M1QA 1GFIA 3DDCA 3C6KA 1MPTA 2E6UX 4IDXA 4P83A 2GASA 2KS6A 5KYUA 1UQTA 2PH5A 5IASA 3F5MA 4KLNA 4DJJA 1IQ0A 1LTKA 5LB2A 1Z26A 2A1TR 3RK1A 2WABA 1GZHB 2GCOA 3C98A 2ZXEA 1JR3D 1U9CA 3EXHC 5K0SA 3LOUA 2E4YA 4LXQA 4X9XA 1NAIA 1ZOLA 2UYHA 4DS3A 5CB8A 1N5DA 5HFAA 4DQXA 1XVTA 1P60A 4Y1RB 4LHVA 2VF7A 3G0OA 3DXYA 4IUDS 4ZCTA 3RKRA 1USIA 3D4IA 3UJ9A 4GZ5A 3UF0A 4Q05A 2CXHA 2F4NA 1YFLA 4UDOA 4RHCA 1FYEA 1LI5A 3IDFA 4QFCA 2DLNA 4GS5A 3IHWA 5JRJA 3IP5A 5L4SA 4Q12A 3KLMX 4WA8A 2INGX 1NC3A 3ZYZA 2JHGA 1FXUA 5GJBA 1JA9A 1QVWA 5J5CA 4D80A 1U3UA 5LOVB 4YPVA 2XZTA 2QNRA 4ZZ2A 1N2OA 3NAQA 1T5BA 3AV0B 1FCJA 4UHDA 4G86A 4CMBA 2PVSA 3OKAA 1G5PA 2EATA 3TI9A 1K88A 4NZOA 1QK5A 4L07A 2RBEA 1G21B 2XVMA 3U3RA 4G56A 1VCIA 2XWJI 5DGIA 5FLYA 2J6CA 1BDIA 1JIKA 1V43A 4FEEA 3SCZA 2V7TA 4DA0A 1GPLA 2O1WA 3PVSA 4UBOA 10MHA 4BZZA 3IIJA 1PBTA 1VYVA 1ZVJA 2EZUA 1E1DA 1E9AA 2JIRA 3O2JA 3Q7RA 3O4HA 1RWNA 1G64A 2YBEA 3C3YA 1FF9A 2VH5R 3L93A 1TYCA 3LA8A 3QTBA 1T1IA 3I2YX 2IZ5A 2XT0A 1L6RA 3EYAA 3QBJA 3STYA 1QYWA 5KYUB 1M66A 5HZGA 2XAAA 2EL9A 3FXAA 2IS6A 4PZ0A 4UCQA 3LXRA 2O8FB 1M8FA 4JNKA 3RSOA 2RAPA 4KV9A 4GYKA 3JRXA 3NETA 4CL3A 6LDHA 4ALMA 4WK4B 1SCUB 3MIZA 2ECFA 3M8KA 5BSTA 1KTIA 4NS1A 5K03A 1PWHA 2FCRA 3ETCA 3OHMA 4LZAA 3RIEA 1YL6A 5KDDA 1CRPA 2ZUWA 1R0LA 1V3UA 4FW8A 2H1IA 2ZJ2A 5H82A 2ZTLA 3RV3A 2Z5GA 5IP5A 3W5JA 2UZ1B 1CJTC 2FXVA 4EJMA 3CF4G 1M8KA 2H2FA 2MYNA 3B1VA 2XQFA 3P0JA 4P4SB 3ZWAA 3A8TA 2ZR9A 4DQDA 3OKPA 1DBWA 4ESHA 2DHRA 1DV2A 4GLBA 4BO3A 3MOSA 1C81A 1ZYUA 2LTAA 2A9KA 3G0HA 3WISA 2HIMA 3IEKA 2GKOA 5C2JB 5AVVA 3VDQA 1D2CA 1UBMS 2EX0A 4IIYA 2Y1CA 1VZ3A 5E1OA 5A71A 1CBUA 1JQEA 5C37A 3UMCA 1I7DA 2FG5A 2JZNA 4LPKA 4J2HA 1DBSA 2R3SA 3LWZA 5JWOA 1QQBA 2IVFA 3GFFA 4JUDX 3KQWA 3I64A 5DX8A 3UHOA 5K45A 1GTL1 1QQ6A 2AOXA 3EXHB 4ARSA 2FGJA 1OUMA 2QW8A 3FSGD 5A5FA 2Q0HA 4XD7D 1T9BA 2EBHX 2ZYIA 4KE7A 2OE2A 3USZA 1SBYA 2RD2A 3L41A 2XMDA 2JL1A 4FBMA 1EEHA 4PSCA 2QUIA 4BBJA 4PZLA 4N3GA 2P3SA 1AOXA 1FTNA 1P19A 4AY4A 4D74A 2C9BA 4YK7A 4ENQA 1EVZA 1BEUB 1E2PA 1H4VB 2WMDA 3CT4A 5UKDA 2IS1A 5ETJA 4QJBA 4BO1A 2BDEA 3EUFA 2PMFA 5IZ4A 1NG9A 3LLSA 1XLTA 1H3NA 1PGPA 4UZFA 3HLKA 6Q21A 3BICA 1G2IA 4GG1A 3AFOA 4DT1B 5INTA 4M7WA 3KAPA 1TLLA 5EWMA