3I52A

Ternary complex structure of leucoanthocyanidin reductase from vitis vinifera
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
307
structure length
296
Chain Sequence
GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNIHPSEVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative leucoanthocyanidin reductase 1
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
total genus 99
structure length 296
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i52A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i52A02
1PZEA 1GZ6A 1E7MA 1T26A 2DC1A 5KJEA 3ZW9A 2EG9A 1A4UA 2ZTMA 2WJPA 5ILOA 4NBWA 4XRRA 3K96A 1R0LA 4HWKA 4WCFA 4ZQGA 1LDNA 1K6JA 3D4PA 3TFOA 1DC3A 3MTJA 4BO5A 4F45A 3F9IA 4GL4A 5ILGA 1RKXA 4YAJA 4L4XA 4WKGA 4CQMD 4Z6KA 2Q46A 4AJHA 4XJTA 4DPLA 4D3SA 3PIIA 3GDFA 4M49A 4NZ9A 4BKUA 1U4OA 2E49A 4IQGA 4BIIA 3WJ7A 1W4ZA 4WEQA 5C7OO 1VI2A 4J1NA 3IL2A 1P1IA 5HBRA 5JPIA 1ZIDA 3JQDA 4OAQA 3H9EO 2G76A 2FP4A 1GPJA 3A4VA 4QFCA 3W8EA 5GZ1A 5I8WA 4PZDA 4KQXA 1LSSA 3W8DA 4XDYA 4ZQFA 5FWNA 3LF1A 1J5PA 1VSVA 3OJOA 4FC7A 4M1QA 2V65A 4Z0TA 4J9VA 3F4LA 1QORA 3RC7A 1T1RA 3ORFA 2EHDA 1IUKA 5TS3A 1SOWA 4OKNA 3L77A 4TSKA 4MVJH 2Y1FA 4LCEA 2A94A 1DDOA 4W82A 1F17A 3DTYA 3H6KA 3PYLA 5DP1A 3D4NA 3GEMA 2BELA 1I3KA 2WYVA 3JQ9C 1E5LA 4I5DA 4CMJA 1HRDA 1N7HA 1QYWA 5THQA 3ZV6A 1AHIA 4CMHA 1E6WA 5ICSA 2VN8A 1Y8QB 1UR5A 4PLCA 5MDHA 4XYLA 3FNFA 4TKLA 1DOHA 1O8CA 1ZSVA 4J3FA 1DBVO 3RBZA 5F1OA 4NBVA 4CMKA 4QX6A 1SB9A 2YV1A 3KEOA 4J0EA 4MOWA 3WGHA 1V3VA 4N54A 2GSDA 3TQHA 2J5RA 2PKQO 2VYND 1Y1PA 2I67A 2H1SA 3E9NA 1O9BA 4E2ZA 3EY4A 1XGKA 3DOOA 1P77A 2Q45A 4NFHA 4AJ1A 4CM3A 2O3SA 3F47A 3L4SO 3JQ6A 1C1XB 5CG2A 4B8ZA 5TIIA 4CM8B 4RF3A 5T8KA 5I7FA 2D8AA 2RH8A 2UUPA 3I4CA 3N7UA 3QJ5A 4FJ1A 1GY8A 2JCYA 2YW9A 3RC2A 1IL0A 2X1HA 2GN6A 3JQBC 4XIYA 4CPDA 2PZJA 3AUUA 3NGXA 3TL3A 2AQHA 5ENDA 4Q3CA 5FI3A 1E3JA 4CM9D 3VDQA 3HFSA 5EN4A 4BNIA 3K30A 5IJZA 1I2BA 2R6JA 2EJWA 1I32A 1O89A 1V8BA 1ZFNA 1ZH8A 1DJQA 1YQXA 3NDJA 4IDCA 3HWRA 3JQFA 1H0KA 3TFQA 4K28A 2WDZA 3ZH2A 3WWZA 1BHSA 1B0AA 2FR8A 3OETA 4BO3A 3AK4A 1PR3A 2OO5A 5ADHA 4TKMA 5HA5A 5F21A 1MX3A 1LRJA 4OO3A 3PHJA 5L9AA 4YJFA 4P38A 3ADOA 3GDGA 1GL3A 3IMFA 3K6JA 1Z7EA 3QVSA 3TJRA 2O48X 1H93A 1BTOA 3PK0A 4I08A 1ZK4A 1P1KA 5A9TA 4A5OA 3KOUA 1Y81A 2W2KA 3GAFA 2BH9A 1HDZA 3PLNA 1PJQA 4F46A 2O3QA 1YBMA 2DVMA 3DZIA 3KYCA 1PS8A 5IZCA 2I5PO 1SPXA 3OP4A 3ITDA 1YDWA 2Z1MA 3NGLA 3AUTA 1T4DA 4WUVA 4I5FA 2P4HX 4FFLA 3AI2A 4I8XA 4E33A 3VZQA 4BB5A 4CMCA 4M8SA 5CHEA 4CLXA 1C1DA 1KEVA 3JD4A 3KVOA 3IKTA 4UUNA 3PTZA 4LVCA 1JN0A 3GGOA 4NI5A 1PTJA 2DBZA 4GWGA 3FWNA 4OYRA 2HLPA 2I99A 4FGSA 1OC4A 1ZVMA 3RUEA 4JXKA 4YTEA 2AEFA 5I7VA 4D42A 2YFQA 1EVIA 1XG5A 2B4RO 5FF9A 3PFFA 3WGTA 3PYMA 4BO1A 3DOCA 2OXIA 4G2NA 4I9HA 2VRCA 4OJNA 4XYBA 3OFSA 3FPLA 2TMGA 4R9SA 1UXKA 3TSCA 1HWYA 1GADO 2V7PA 3I1JA 1ADGA 1YOVA 4QECA 1T2CA 5B12A 2NVUA 1PGQA 4QSMA 3C7DB 3HN2A 2EP5A 1IOLA 1XU9A 4HADA 3IC5A 3AFMA 2PGLA 1OI7A 2C5EA 2ZTVA 1EMDA 1SAYA 2H63A 5IXSA 1FDTA 4ZVVA 4DQXA 1IHXA 3ZV3A 3I6IA 1FF9A 3L4BC 4I9UA 1Y5MA 1Y7TA 4R69A 4J43A 3CKYA 2X22A 1H2HA 4KWHA 3NTRA 4J49A 1T4BA 3PXXA 2AQKA 4A27A 4C7JA 4MIEA 1M66A 2GRAA 3GQVA 5IFLA 3AOEC 4BO7A 2QZZA 2FPPA 4EITA 1LQTA 3RUAA 3VH3A 2B4TO 1DHRA 1NWCA 3BMNA 3GZNA 1MB4A 4L76A 1MXHA 4N5LA 3FR7A 1U3UA 4NFSA 4OQZA 5A5EA 5JBIA 1NQ5A 2D5AA 4W9NA 1XLTA 2YV2A 4AJNA 4DVJA 1HDXA 4U6SA 3HFGA 4XD2A 2V6FA 1K6IA 2SCUA 3AM3A 2VHZA 1XR3A 3PQEA 4OXKA 1ISFA 4QEDA 3K2EA 3WSWA 4BNZA 1SZJG 4D3FA 1PSDA 3OQBA 5TSDA 3LC1O 3QIVA 1U5AA 4MIYA 4C4OA 1OAAA 2JD1A 4CM4A 3FWZA 1DJNA 2QQ5A 4UVEA 3FN4A 1VKOA 1L1FA 1VC2A 4P8RA 1A27A 3ABIA 1CQIA 4IDAA 4IZHA 1F8FA 4L73A 5HM8A 1YDEA 3INGA 2NQ8A 3DHYA 1NVGA 3K2BA 3O26A 4QT0A 4Q39A 5JDCA 1T2AA 1EEHA 1PL6A 3ZU2A 4CV2A 3RUCA 2Y1OA 2GZ3A 2C0CA 3WIEA 3MJCA 4EI2A 1G0NA 1AHHA 4PVCA 4RZIA 4ND1A 3LU1A 1BSVA 4HX5A 3DBLB 3DAFA 2AQIA 2QX7A 4IJKA 4UVHA 1J0XO 3LT1A 4GX2A 4PIVA 3V1TC 2P91A 1QMGA 2WWRA 2WYUA 4CLOB 2JJYA 4IS2A 3C7CB 1U7TA 4BMVA 4D43A 4BNWA 5JYEA 2NNLD 5A4DA 2DBVO 2X0RA 4MP3A 2Q4BA 4XCVA 1S6YA 4B4VA 3O8QB 2IDZA 2IZ1A 2YY7A 3Q2IA 3OJ0A 4IUYA 1VL6A 4FOOA 4E31A 1UAYA 4YR9A 1LSUA 2YZ7A 1VL8A 1WNTA 3X2EA 1G1AA 2ZB7A 3B1JA 3OIFA 4FS3A 4URFA 4DUPA 4J90A 3WFJA 3B1KA 2CSUA 1PJCA 2B36A 1RYEA 5KVVA 1JKIA 5A1TA 4E2WA 4WE3A 1ZKMA 2CY0A 2ZQZA 5JDIC 4FQ8A 1C0LA 4R1SA 5A9RA 4YQZA 1JKFA 1NYTA 1Q7CA 2ZJ0A 1KY5A 4GAEA 4RLSA 4XA8A 1BVRA 1OBFO 3GZ4A 1KVQA 1NASA 5BNTA 5IF3A 3PP8A 1C3VA 1DIAA 1UAGA 1N9GB 3LC7O 5DNAA 3V2GA 3DOJA 4GQAA 5G0UA 4MVJI 3GK3A 4TVBA 2J3KA 4WPGA 4U7WA 1Q7BA 2NU9A 3MJSA 3N58A 3EGOA 3OJEA 4YT8A 3GPDG 2LDXA 3VPXA 1QRRA 2AG8A 1VJ1A 3WQSB 4IBOA 1XEAA 3PFWO 2Y05A 3QWHA 4NIMA 3QWAA 4XGIA 4JCOA 2EGGA 4AJPA 2PY6A 2HRZA 3H9GA 4U0JA 1ZMOA 1R4NB 1ZCJA 1GZ4A 2AE1A 3GEDA 3HNPA 4CMBA 2VWQA 1ZEJA 2C7VA 2EW8A 1GCUA 2O50A 2J3IA 4QUKA 2Q1UA 3DHNA 1D8AA 4OOFA 1ONNA 4B8WA 5I7SA 5KJ1A 4D0SA 1U3VA 3KEQA 4ZRNA 4GVLA 5I9MA 1XSEA 2O7SA 3VH4A 4J7UA 4CQMA 3GMSA 3DBHA 4YJGA 5DOVA 5CDYA 2VRBA 3P19A 1FDSA 3ENKA 5CDUA 1LLCA 1Z45A 4CM7A 4AICA 4ZJUA 4YPOA 3BMCB 2OBYA 4CLEA 4CMAA 2GYYA 3BHJA 3H3FA 3PWKA 4RORA 3GNQA 4MINA 2XPCA 3BTUA 3NRCA 1DRWA 3GNSA 1XU7A 4BL5A 2D0IA 4B79A 3OEYA 1HZZA 5FYDA 2WD8A 3RFXA 1DIGA 4II3A 4RPJA 2ZYDA 4XR4A 1IZ9A 4M55A 5BSGA 2D1YA 3FBTA 1CRWG 3H8VA 2BI7A 4IXWA 1LSJA 4GSKA 3CPSA 4MKZA 3AY7A 4RVHA 2R00A 5C37A 5JC1A 3SC6A 3RASA 3HUDA 2AEMA 3M2TA 1M67A 3ROKA 5BSHA 1KETA 4PFJA 3JQ8B 3D3WB 1CIVA 4HNHA 1I3LA 2PFGA 3ROMA 1EVJA 4K6FA 4F3YA 3RJ5A 3KSUA 3WX0A 2JFHA 4YRAA 1OMOA 4GX5A 4CL3A 3O9ZA 4PLFA 5BT9A 3WYBA 3VPHA 2DPGA 4LMPA 2HRBA 1Y9EA 2OBNA 4Q3EA 2OUIA 1H6DA 1GYRA 3TNLA 4J2HA 1LDBA 4GGOA 4U6QA 2NV6A 3DZJA 2IZZA 3IP3A 1BVUA 3ZNNA 5F3RA 3VC7A 2C59A 5BNFA 1NPYA 5EESA 1MLDA 2VTDA 4PG7A 4C7KA 4ZD6A 2UV8A 1KEPA 4CM6A 2VYNA 3JV7A 3OA0A 1N1GA 3TZKA 5TJHA 2TMDA 3V2UA 5EPOA 3TN7A 1Z73A 2I66A 5L51A 3MWDB 2EEZA 3ZWNA 3KYBA 3E5RA 2ILTA 4RQTA 3IQDB 4DMLA 2GDZA 4E32A 3H9UA 1PL8A 1OC2A 4P4LA 3QRWA 3R3JA 4JNKA 2AE2A 3UVEA 4RVUA 1U28A 2FY8A 2DFVA 1EDOA 1BXGA 8LDHA 4QO7A 5THKA 5KKCA 1NPDA 4D41A 1LEHA 3E03A 4IJWA 2HMWA 3PWZA 3I5MA 1ZSYA 9LDTA 2UAGA 3RUFA 4KDEA 4R5HA 1VKNA 3PHHA 4JP3A 4BV8A 3AJRA 2Q99A 5A04A 5JFOA 3R6DA 1E3IA 1EUDA 3QA9A 4J7XA 1MV8A 3W8FA 6LDHA 5J23A 2CVOA 4EUFA 2GR9A 4AJOA 1ENPA 1AE1A 5JC8A 3O38A 1LRKA 2D4AA 3AUSA 1WW8A 4LSMA 5B1YA 4AJLA 4BGEA 3TOZA 5F5NA 4DIBA 2H9IA 3F5QA 2W4QA 4EYEA 2RBEA 3C1OA 2WTBA 1A72A 1E3WA 1LQUA 1H2BA 1N5DA 4IJUA 3GVPA 3GR6A 2HQ1A 3GUYA 3FPCA 1U7HA 4R01A 3ZWOA 4XGNA 2YHIA 3NJ8A 4XQCA 3A06A 1R4MA 4B7CA 2Y93A 3W6UA 4RDIA 3U9LA 4FC6A 3DMTC 4Q3BA 2O3TA 5H81A 4KTVE 4ZGWA 2C82A 2W98A 3UHAA 4IY1A 4JGBA 3A1NA 1N92A 3OSUA 5AXAA 5CEJA 2PR2A 4RLHA 1P33A 1EUCA 1GUFA 2GN4A 2IE0A 3QLJA 3BYZA 2RAFA 1R37A 3LDHA 1OZAA 3H9JA 5LC1A 1H6CA 2BFPA 4EDFA 5TNXA 2W2LD 2FWMX 1KYQA 2FZEA 1HLPA 2VNAA 3V5NA 4DQUA 1WDMA 1BRMA 2BFOA 1PJTA 1QYDA 1I10A 1DFIA 5GMOA 1L7EA 3ST7A 5CDGA 3JQGA 1EQ2A 3KXDA 3ICCA 3L6EA 5L40A 4MPDA 3ETDA 3AFNA 3FBGA 4LGVA 4MVJA 1SEPA 1XHLA 4E5KA 5HS4A 4JJFA 5HRUA 4MP8A 3WGOA 1QLHA 3JQAA 1X0XA 2Q49A 1J4AA 3RC1A 4KQWA 1I2CA 3GGPA 1LJ8A 3FCOA 1H94A 2ZJ1A 4CUJA 2GLXA 4ZA2A 5IZ4A 3TZHA 1A7AA 4BKPA 3LT0A 3WLEA 3WMXA 3Q9NA 1KBZA 4CMIA 1UDCA 3C7AA 4L75A 1T2FA 4J7CA 3DBVO 1A7KA 2I3GA 1KC1A 1NQTA 2JFGA 2VNSA 3DFUA 4QFDA 4FW8A 3GVHA 1N8KA 4E12A 3OQ1A 4PRKA 4R9RA 4R1TA 2E4AA 3AY3A 2JHGA 4OSOA 1HDRA 2H5LA 3GVIA 1EDZA 1B8UA 2NTNA 1IE3A 3WGZA 4EGFA 4IMPA 1PGOA 4GGPA 1ZSNA 3LQFA 3VZPA 4FR5A 3B6ZA 3ZU3A 4IM7A 2AMFA 2LDBA 3CTMA 1GYQA 3IUPA 4ALJA 3U3XA 3ZV4A 5BSFA 1VSUA 1X13A 5H83A 3GEGA 3L0DA 1FDUA 2Q1WA 3DWFA 4JBHA 2W2KB 4XB1A 3WNVA 3ZZNA 5A06A 5L4SA 2Y1DA 3KHUA 1UDBA 1JWBB 3KYDA 4H7PA 3RFTA 4Y6PA 3U4HA 4L74A 3G1UA 3KYCB 1Y6JA 4QQRA 3AI3A 3D64A 2CDCA 3G3EA 1U2GA 2YDXA 2QZ9A 1H6AA 4QTZA 1KEUA 1GYPA 4YCAA 5I9LA 4UEJA 5DZSA 4UUOA 3ZNQA 1LI4A 1XDWA 2ZKLA 3W4KA 4MKXA 2C07A 3PLRA 2ZB3A 1XIVA 3QQPA 1YQDA 4ND5A 3MOIA 3RBVA 1P0CA 3NYWA 5AXCA 1HE3A 3JYLA 1E3EA 3A28A 2PWZA 4IINA 3ZHYA 3HG7A 4BO2A 1ZK1A 1SNYA 1GDHA 4NBTA 1YWGO 3CUKA 4YJHA 4DLAA 4KUGA 2PV7A 1Y5RA 3QVOA 4OM8A 5COQA 3UICA 3IJRA 1B3BA 1QSGA 5L7WA 5JCJA 4Z9FA 3ITKA 1Z74A 1YOVB 1UUFA 4NH4A 3RCBA 1C0IA 1V0JA 3TZQA 3WGIA 4DLLA 3PIDA 3KRTA 1U3TA 2GGSA 1QV7A 3LSYA 4ALLA 2ZK7A 1UXHA 5IAAA 4XKJA 1RM3A 4CR6A 3M1LA 4Y8VA 2NLOA 5EERA 5JSFA 1JAXA 1LDGA 3X2FA 3QE3A 1Q0HA 1MXFA 5IN5A 3E48A 3ZI0A 5EJ2A 1E1NA 4YXFA 4FFRA 1MC4A 4MVJM 3RC9A 1GUYA 3OMLA 3UCXA 4IQ0A 4B4UA 1ONOA 1D7OA 2CZCA 2B35A 1X15A 5EQFA 4DTIA 1NXQA 1U9JA 4K6CA 4ALNA 3PGXA 3HJAA 4WJZA 4NJOA 4WECA 2C5AA 3DONA 2IEBA 4L9RA 5T8KC 5JLAA 3ZWVA 3C1AA 4K1LA 4OQYA 1SB8A 2VWGA 1DIRA 2BMAA 3ZHXA 1Y8RA 3MTGA 2RHCA 4E2YA 1V9LA 1ULSA 1K2WA 4A0SA 1GU7A 1BG6A 1I5RA 2Y67A 3DHEA 3EHEA 1SOVA 4BGVA 3PGJA 1YVEI 2X6TA 4IGFA 4LVUA 4HY3A 1QR6A 3GHYA 2G82A 1NTOA 2D59A 1UZLA 3JQFC 2OFPA 2VYVD 2EKPA 1FXSA 5DP2A 3M1AA 3WGGA 2EWMA 5G4KA 1ZK3A 4JLWA 4CM4B 3EVNA 4M86A 1IULA 2PZKA 3NTOA 4J91A 4XB2A 3ZHBA 3K8ZA 4RL6A 1NQAO 5DT9A 1N2SA 2XF8A 1AGNA 1UP7A 4RVSA 2Y66A 4BO6A 1W73A 4XYEA 4FPXA 4TWRA 3MWEB 3TL2A 5CAEA 5L4NA 3ENNA 4KUHA 1I0ZA 2GCGA 4O59O 4PVDA 1PQUA 4QXMA 4ZU3A 1KVUA 2EV9A 3LT2A 4AJJA 1YB1A 3ON5A 1H9BA 1YBVA 3ASVA 1JKJA 2NM0A 2C2YA 2DU8A 4FDAA 1HL3A 4RGBA 1JA9A 3HB4X 4EBFA 1P3DA 1FJHA 5IZCC 1HDOA 2OHXA 2OGUA 2FPGA 4HFRA 4PG8A 1JW9B 1UJMA 1UH5A 3JYPA 2JD0A 4KUEA 1IYZA 1E3SA 1JVSA 4IIUA 1E92A 3S2FA 3KLPX 3CZRA 5JCXA 4XEHA 1DLIA 2JFFA 3PJDA 2PNFA 4IDGA 1XA0A 2BF7A 3PVZA 4NR0A 4BNNA 3WG9A 1EVZA 4E0BA 3D5TA 3KSZO 1B26A 5KKAA 3WIDA 3DC2A 1PR9A 3U4CA 1NQOA 3AU9A 1D1SA 4G81A 3CSDA 1CDOA 3JYOA 4L4RA 4EJ0A 1YL6A 4JJGA 4OL9A 2CF6A 5T5QA 2JD2A 1F8GA 1T24A 3DTTA 4NHEA 3GRPA 1JQBA 1HF3A 3NUGA 1LBEA 5BQFA 3B1FA 2DM6A 2OL4A 1R15A 1ARZA 1E77A 4RZHA 2J6IA 2Q1SA 3RAJA 1SC6A 5H82A 4E5MA 2P9GA 1A71A 4WASA 4CM5A 4CLRA 1FDWA 1I01A 1JLLA 4RO0A 1HT0A 3O03A 5BR7A 3BTSA 2CMDA 2O2SA 3NJ4A 3FTNA 1EFLA 5TGDA 4B3JA 2BFMA 5U1PA 1PL7A 3HDJA 4ZQHA 3WB9A 7MDHA 3CZMA 3KM0A 1JVBA 4WLEA 1B7GO 3ZHZA 4BQPA 5B4TA 1NFRA 1BW9A 1H9AA 2UUOA 4I9NA 3WBBA 4JN6B 2FSSA 4HKTA 4RF5A 1E3LA 1KERA 4ITUA 4W99A 3SC4A 2Z1NA 1LLDA 2A4KA 3DR3A 2NU8A 2PTGA 4IMRA 4B7UA 1Y9AA 1F12A 4KDFA 3BMOB 4E5YA 2VHVA 1LXCA 1B15A 4K9DA 1P31A 1RM0A 3GN1A 1MG0A 3BA1A 5GZ3A 2WD7A 4YACA 1NAIA 4NFYA 4S1VA 2Y68A 2G1UA 3DQPA 4BMSA 4Q3AA 4J0FA 4NJMA 3STHA 3SXPA 1ZJYA 3PHLA 1ENOA 3I9LA 3QHAA 2C20A 1N1EA 4D79A 4Z9YA 4CR7A 1RYDA 2Y1GA 3DO5A 3NEPX 1LC0A 1AUPA 1A9YA 4P4NA 4BNVA 1K3TA 3DBRA 1QV6A 5L7YA 2DQ4A 3E82A 4WLVA 3OIDA 4NNJA 1HYEA 3GOHA 1X1EA 4W9NC 4WNIA 5L45A 2EIHA 3L6OO 2VOJA 4E4YA 3JQCA 1I24A 2HUNA 4U0KA 4DLBA 3WNQA 3NT4A 1TB4A 3CE6A 1WMBA 4FB5A 1LDEA 1UP4A 3S2EA 5CEEA 4DIFA 3UUWA 3U49A 3FSRA 4YT2A 2BRUA 4CQMB 3DBHB 3JCZA 2Z5LA 3ZWPA 4YJGB 1P1FA 4BNTA 4DBZA 4E21A 1MUUA 5A9SA 4RVGA 1E7YA 3I83A 2POQX 3DMYA 3RIHA 1CEQA 2ZCVA 3ZU5A 1PJSA 1ZK0A 4PG6A 3Q11A 3OA2A 4YAGA 1EUZA 2VHXA 1WAMA 2QYSA 2XXJA 1O95A 3HN7A 5EMHA 2HK9A 4OIMA 3TZCA 1YB5A 2AW5A 4ZQBA 1QP8A 3H7AA 3RROA 3CINA 3RJ9A 3SEFA 3VZSA 2UYYA 2NUAA 3NDIA 1ISHA 3L07A 4XRGA 4MDHA 1I8TA 5JDCC 2CNBA 2X5JO 2DUUA 3WBFA 2P5YA 3R1IA 1YL5A 5DCUA 2V6BA 4TMFA 5A3JA 1ENZA 4CMEA 4RQUA 1RM5A 1E7RA 2O4CA 4KP7A 3ONFA 4IGEA 4O1MA 5ER9A 1CERA 3KSDO 4J1TA 2VWPA 1A5ZA 4L8VA 3FNGA 4WGGA 1N7GA 1ORRA 3KLMX 3OJLA 1ZNQO 1TA4A 5TX7A 1ZBQA 2EW2A 1MG5A 2WE8A 3OBBA 7ADHA 4RPLA 5JNLA 3S1LA 2OMEA 3KB6A 3GVXA 3AI1A 4WLUA 1RWBA 2X0NA 3IP1A 4FSHA 4NBUA 5AYVA 4UREA 5CP8A 1B8PA 1NHGA 1OOEA 1E1MA 4PLVA 4L0QA 4R41A 3SJ7A 3Q6IA 3WSVA 3JD3A 1CETA 1U8FO 2RIRA 5G0SA 1NVTA 2Q1TA 3AWDA 5K6AA 4LISA 1DO8A 2VUUA 3LC2O 1U8XX 2VUTA 2NTJA 1GZ3A 5FFFA 3SVTA 1I3MA 4MIOA 4LRSB 5JMPA 1WPQA 4UUMA 1KS9A 1E0DA 2ZTLA 3IDSA 4XQGA 4E5PA 1F0YA 2QW8A 2ZB8A 4FFMA 5C7IO 1KEWA 2B83A 3I6QA 1VJTA 2FMUA 1LX6A 2NQTA 4PCVA 5I7EA 3WWYA 4LSWA 4NG5A 5CFZA 5DULA 1YL7A 2EGHA 2QHXA 3OF2A 4GLOA 5TC4A 3GY0A 2ZTUA 1GFSA 4XZ3A 1GPDG 2A92A 1XELA 2NU6A 4ND4A 3E6AA 1DPGA 2IXAA 3IJPA 4TVOA 4EJMA 3RU9A 1XYGA 2VRCD 2X0JA 3S2IA 4Y98A 1NX6A 4O0LA 1U5CA 3JQ7B 1E1LA 1HE5A 1BWSA 3H65A 1KY4A 4EUHA 2Q2QA 1SEVA 2HJSA 4Z3KA 4CLOA 2I9PA 3AW9A 5C7LO 2QRKA 1D3AA 2J3JA 4YBZA 4J2OA 3JD2A 2Y0CA 5A03A 5BSEA 4H16A 4HP8A 4YQYA 1PJ2A 4JX8A 4BO4A 4BOYA 4OXNA 1E3WB 4BNLA 2D5CA 4R16A 1IPEA 1LLQA 2AQ8A 1WZIA 4JROA 5DN9A 2OZPA 3EAGA 4UVDA 2GZ1A 5JMWA 2FSVA 2NTVA 4IZIA 4JQCA 4MVJF 1NVMB 2HK8A 4CMGA 1HZJA 5L7TA 1LLUA 3EVTA 4IPTA 4D44A 3OECA 2UDPA 1TEHA 1B16A 1R16A 4J6FA 3HHPA 4BNFA 4CL8A 3AOGA 5U4QA 1ISGA 3UF0A 3EZYA 4BGUA 4DWVA 4WLFA 5LCXA 2DBRA 1QKIA 4PZEA 3KZVA 1O5IA 2J8ZA 3PHIA 2W8ZA 4MVJP 4FCCA 1ZZEA 3QWBA 1I2ZA 3AM5A 4F6CA 3PZBA 2H6EA 3GG2A 5GY7A 1BMDA 3WOHA 4BNUA 4A10A 2WE7A 1T2EA 4HXYA 3WR5A 3N74A 1E7SA 1TT5A 1NR7A 2HDHA 4CQLB 1NPTO 4G65A 1DRVA 1HSOA 3T4EA 1ULUA 2R00C 2FR1A 3GLQA 4FN4A 2Q4EA 3VVCA 2PA3A 2J5KA 5JXWA 1P1RA 3JQGB 1NHWA 2IEDA 4YT4A 1ONPA 1R12A 3GGGA 4S3MA 3G79A 2X5OA 4K26A 2B4QA 3C24A 4TROA 3VVBA 3FR8A 4JP2A 3IIEA 3VTFA 2X9VA 1X14A 2DTDA 1PU2A 1DC4A 4KZPA 4R3WA 4YRBA 3LLSA 2HMSA 5DBGA 4ALIA 3DZFA 3JQAB 4N5NA 4WCFB 4W4TA 4BVAA 1V6AA 4UAGA 2IZ0A 4CM9A 2BD0A 1Q2XA 3I9OA 3ZWXA 5JAQA 3BMQA 5CDSA 3ZGYA 1GEEA 2HU2A 4LK3A 2RHRA 3K31A 2GZ2A 3HQ4O 4O63O 2G17A 3JD0A 5HWSA 4E13A 4CMIB 3ANLA 4GH5A 4ONEA 1ZMTA 1Z7BA 4R68A 3WGQA 3U4DA 4Q3DA 3VH2A 3ETGA 4BKOA 1X7GA 2VT2A 2UVDA 1U1IA 2EJVA 3B70A 5T64A 4P22A 4PGFA 2P2SA 4AL4A 1LRLA 3G49A 3NX4A 4I1IA 2HO5A 1M6HA 4UUPA 1G6KA 3KBOA 4Z3DA 3UW3A 5JAMA 4UULA 3BMCA 5TT0A 4PLYA 1ZUD1 2YUTA 4E6PA 2V6MA 2YHUA 2ZCUA 1I30A 4BO8A 3JQEA 1IPFA 3RKUA 1LU9A 4IJVA 4II2A 4Y6RA 1PEDA 2P9EA 4XJSA 3I9JA 4HV4A 1O94A 3TF5A 1ZJZA 4O5OA 1DAPA 3ZWYA 3H4VA 3DEYX 1IZ0A 1J49A 2PD6A 3BTOA 1BDBA 1M6WA 3H5NA 3TWOA 2FOIA 4YAIA 3NT2A 4BKRA 1PGNA 1RPNA 1VJ0A 2BHLA 2PKRA 4H15A 3RI3A 4PLTA 3CMMA 1KC3A 3PHGA 2GASA 3KYDB 2X9GA 1YE3A 1ZXBA 2B5WA 1WXDA 1W0CA 2VOEA 3P2YA 3F4BA 2B0JA 3PDUA 3VKUA 3QP9A 1DAOA 3PPIA 3MZ0A 4PG5A 3F46A 3KTDA 4IDEA 1V3TA 3WS7A 1HYGA 5K9ZA 1DEHA 4XGKA 5KWEA 2R2GA 1HSZA 2FR0A 4DIOA 3FHLA 4A03A 1ISMA 4FFPA 4INAA 3GT0A 4DRYA 2CVQA 3CH6A 4PLWA 4Q9NA 4ZHSA 3GH3A 3JYNA 4OKIA 1DRUA 2PH5A 3I9KA 3BAZA 4XX0A 4AG3A 3GFBA 4GMFA 3PQFA 3WJAA 4YJHB 4FOSA 3T4XA 3F5SA 3Q2KA 4HFMA 4GPD1 4J16A 1HLDA 4DL9A 4IDFA 3S55A 5C5IA 3OM9A 4RPHA 3MEQA 1V3UA 1VM6A 1X1TA 2NADA 3LK7A 5IXYA 1ZO8A 3KO8A 4PLGA 1SO8A 1D4FA 3HSKA 4R51A 5BNIA 3L6DA 4JBIA 1GR0A 1XQ1A 2GUGA 3M2PA 3A9WA 3V1YA 3WLFA 3I9NA 2CDAA 3G1TA 2HAEA 3LZ6A 3SJUA 4HBGA 4LMRA 4GBJA 5IN4A 3JQ9A 4BUCA 3IS3A 4TRJA 1XCBA 2PZMA 4I5GA 2CVZA 1LDMA 2W90A 1JU9A 3W4JA 3ZDFA 1YJ8A 5L95A 1YGYA 1DXYA 2Y0DA 1K5HA 2DPHA 3NKLA 5KNLA 3QVWA 3PYXA 5KJ6A 8ADHA 1JTVA 4E30A 4YJFB 3F6YA 4AJEA 1RM4A 1U4SA 1L7DA 3GPIA 2AXQA 3PDJA 1HDYA 3BHMA 4YJDA 3W1VA 4WCFC 3DZHA 3EZLA 1EZ4A 1HKUA 4W7HA 5LDGA 3UXYA 5IDWA 1LUAA 2D3TA 2EF1A 1DFHA 2HMTA 5B4VA 4A73A 1X7DA 3BTVA 3GMDA 4YAEA 1Y8RB 2ZYAA 4BS9A 1YONA 2VHYA 4NPCA 4YWJA 5JYDA 1TXGA 1M2WA 3HDQA 1T2DA 3U62A 2QIOA 3W4IA 5ITVA 4TZKA 2VHWA 3CEAA 1LA2A 1NP3A 1UXJA 5CEFA 4MJLA 4RV9A 4DXHA 5L4LA 1P74A 1C1DB 5B37A 1GAEO 2XXBA 5G4KB 4IQ8A 3PEFA 3BZUA 4MKRA 1TT7A 5DCWA 4BNJA 3E5MA 2IODA 3H2SA 1ISJA 2Q2VA 3JQBA 3Q1LA 2Y1EA 5KVSA 4W7IA 3SX2A 1GD1O 5F5LA 5HS6A 3D5QA 1ENYA 4MO2A 2E37A 3OICA 3MJEA 4DPKA 4FD3A 4MVJE 3U4IA 3ZU4A 2JHFA 4CM1A 1XWFA 1A4IA 2YQ5A 4DQVA 3WDSA 3DXFA 3G0OA 4KOAA 1WP4A 1GQQA 3EW7A 4WOKA 3H9QA 2NVUB 4EZBA 2GERA 5CPFA 3E8XA 5A02A 5G2OA 2ZYGA 3RQSA 3LVFO 3H5AA 4ESOA 3NAQA 1I36A 2F1KA 4RVFA 2VZ8A 2BI8A 4OMUA 4GI2A 2EKLA 1XKQA 2VWHA 3ULKA 2IYOA 2IYPA 1I33A 4FBGA 2PD4A 5EIOA 4MP6A 1F14A 5CPBA 4NU6A 1PZGA 4GKVA 2HKIA 5JO0A 4IDDA 3I4FA 1EE9A 2I3AA 4KWIA 3PQDA 3ZWBA 3VAZA 3LF2A 2HJRA 4PLZA 4XR9A 4LCJA 1NWHA 4O6VA 5TJ9A 4D46A 1M75A 1EBUA 1ZW1A 2AG5A 4BMNA 2WSBA 3BMNB 3EMKA 3GZNB 4HNGA 1YO6A 2FN7A 1FMCA 4UEKA 4ALKA 4BNHA 5GZ6A 1P0FA 2B69A 5COAA 2GD1O 4CODB 4CV1A 3CIFA 4GWKA 1SBYA 4J4TA 2WEKA 3Q9UA 3WGYA 1C14A 1EQUA 1AXGA 4CLRB 1T25A 1M76A 4CV3A 1ZEMA 5G0TA 1NFFA 2Y1CA 4PZCA 3GN2A 4R1NA 1DIBA 5FI5A 3ZN2A 5AVOA 1UZNA 1PJ4A 4RVDA 5F1KA 4PLHA 1WLYA 5KJFA 1AN9A 5MGBA 1P1JA 1BW9B 4CV0A 2OP1A 4RPKA 5G0WA 4RDHA 1ADBA 4YB8A 4CJXA 3ICPA 3WQQA 3H5RA 1B3RA 1PWXA 5DCYA 3U09A 3JYQA 3RUDA 2X0IA 3UOGA 2WD7B 1HYHA 3CMCO 5I8ZA 3QWIA 4NQZA 3MJVA 3ANMA 4EUEA 4R3NA 4BNMA 4DREA 1PQWA 4NJMB 4GSLA 1Y8QA 4ZRMA 1SMKA 4M87A 5KCZA 1ID1A 1LNQA 5HTOA 4X54A 3C1TA 1BDMA 3VDRA 1BGVA 4FGWA 3DBRB 1D1TA 5ITWA 2CD9A 3EUWA 3P7MA 3L4BA 4DMMA 1Q1NA 3E1KA 5DBIA 2E6UX 3UFXA 4YYZA 4B4WA 3ZWWA 1WZEA 2I6TA 2OORA 1PQPA 5JW6A 2QG4A 1FDVA 4GKBA 3TOXA 5T67A 1UXIA 2VCYA 2Y0EA 3E9QA 1GQYA 3AOEA 4GMGA 4LN1A 4ND3A 3S2GA 4NU5A 1SCUA 4KMSA 1YBAA 4WLOA 2YYYA 2PGJA 1C1XA 2Y99A 3VKVA 2X5KO 3VPSA 3DAGA 5A9SB 1JWAB 1VRWA 4CM8A 4MVJD 3TRIA 2CF5A 2O4UX 4OGWA 3WMWA 4RF4A 2JAPA 3R0IA 1HTBA 3JTMA 1HEUA 1B14A 3GC6A 3PI7A 1KOLA 4DYVA 3EYWA 2VTEA 2PH3A 2X7HA 3JQAD 3ASUA 3ROQA 4Q3NA 3K5PA 4J4BA 4YRDA 3D7LA 2I76A 1WVGA 1GV0A 2DAPA 4Y67A 5DBFA 2DLDA 1PS0A 5KVCA 2BKAA 4XDZA 4CLHA 3GA0A 3EK2A 4IXTA 3ROPA 2J3HA 4Y6SA 4FFOA 4GVXA 1P1HA 1HE4A 3GFGA 1YXMA 4UVIA 5AOVA 3ZWMA 1ISIA 5JAIA 1EK6A 1BXZA 3RUHA 1QYCA 3FD8A 4EEXA 3PZRA 3L9XA 9LDBA 3DZGA 3CXRA 1J6UA 3PJFA 3ANNA 4GX1A 5CDTA 1H5QA 3DB2A 3TZ6A 1GQ2A 4AFNA 4E2XA 5KOIA 1Q0LA 4IDBA 2ET6A 4OSPA 4G5HA 3FI9A 3HDHA 4YAKA 2O3JA 5TF4A 2JAHA 2DKNA 2A9FA 1R6DA 4YDRA 2NU7A 3UN1A 2EERA 3GDOA 4YT5A 4CLDA 4H3VA 1I3NA 5B4UA 3TPCA 3SLGA 1HDCA 4YVFA 5EINA 3IKVA 4J1QA 1GUZA 4D3DA 1IHYA 3L9WA 4RF2A 4AJ4A 4HUJA 4BQRA 2NWQA 4BB6A 2Q2WA 4D45A 1NAHA 5KIAA 3AU8A 2X86A 4BNXA 4FFNA 4OOEA 5JY6A 3WYEA 2O3RA 1V35A 3HZZA 1JAYA 3I9MA 1TVEA 1Z75A 4I5EA 4P4GA 2D2IA 4TZTA 5T6BA 3DZBA 4BHTA 2C29D 3P5SA 1E7WA 3MJ4A 1DC5A 3RUIA 3TDKA 2P5UA 3VOSA 3QY9A 3C3XA 2FRDA 1X0VA 1XQ6A 2EXXA 4N18A 5G0VA 5JY1A 5L53A 1HDGO 5KJCA 2C2XA 3R3SA 3H2ZA 5I9NA 2CDBA 5KTKA 2GNAA 3OH8A 4BV9A 3GG9A 2BGMA 1PGJA 4JK3A 4BNYA 5EL0A 4F6LA 5JDIA 1LTHR 3M6IA 1UZMA 5ENVA 5JCJD 3B20A 3E18A 4TRRA 2PK3A 2YFHA 2P4QA 3GHHA 4EEZA 4R54A 2BGLA 1QG6A 3IUSA 3PWSA 3HDYA 4DBVO 2XAAA 3DFZA 4XYMA 3DZKA 1T1SA 4EW6A 1QYXA 4R1UA 1BXKA 4WCDA 1YQGA 1PX0A 3PRJA 2NVBA 5JO9A 3WYCA 3ZCXA 1R0KA 1ML3A 5FEUA 4MVJG 2G5CA 3HB5X 2JKVA 4PLPA 1PZHA 4D0RA 5G4LA 1EBFA 5C3MA 4KTTE 1GTMA 2YJZA 2X9NA 2P68A 3INTA 3GRKA 3MJTA 3O4RA 3I52A 4A26A 1YH3A 3RSHA 2VUSA 1PIWA 4M54A 3Q0EA 1RJWA 2EP7A 2JCVA 3DAPA 1WDLA 3AUAA 2W2LA 1PJLA 1PZFA 3EC7A 4TQGA 5EQDA 1DLJA 4WEOA 1PJBA 2GO1A 1TI7A 1C0KA 3ONDA 4Z9XA 1A9ZA 1VE9A 4CUKA 2EKQA 4BO0A 1TLTA 1AXEA 2V6GA 3NDRA 6ADHA 1TT5B 1Q0QA 1ZXLA 2B5VA 2Q3EA 3F1KA 3VH1A 4B3HA 2O2YA 1GEGA 4HFNA 4JBGA 3S8MA 4BKQA 3QVTA 4CMEC 5IDQA 3W6ZA 5A5FA 3BMOA 1KVTA 3RD5A 1WDKA 4RPGA 3F1LA 3COSA 4A7PA 3BHIA 3ZW8A 4J1SA 3RWBA 2JCXA 1MFZA 1DIHA 3UGKA 2ZIZA 3Q3CA 4ZN6A 4JJIA 2PKQP 1DHTA 1BXGB 1CWUA 5TLSA 1R0SA 2DBQA 3RKRA 4DA9A 1W6UA 4AJ2A 3LLVA 1KVRA 3VPGA 1PGPA 2Z95A 3BMQB 1H6BA 4HFJA 4N7RA 1P9LA 4NBRA 5IG2A 4ILKA 2GN8A 4ZQEA 1E1KA 1NFQA 3SLKA 2HMUA 2YDYA 3DBLA 3QSGA 3PJEA 4NMHA 4XQEA 3ZNPA 5TT1A 5K6AC 2C7GA 5KVQA 3C85A 3NTQA 4DGSA 2VQ3A 1U2DA 1IY8A 2FZWA 4OH1A 4ZICA 5AQ1A 1E6UA 3NV9A 3PJGA 1QXSA 1YKFA 1FK8A 1GV1A 1EK5A 3QWFA 4BO9A 2JL1A 1QYVA 3JSAA 1ADFA 1DFGA 1EVYA 1MC5A 1YJQA 3LT4A 1IB6A 2NVWA 1P44A 2DUWA 4IIVA 4QO8A 4LRTB 5DOZA 4M89A 1EFKA 3E9MA 3T7EA 1LSOA 2IRWA 2QYTA 3O8QA 4N5MA 1HETA 2WMDA 2YHIB 4J9UE 4R5MA 5AXDA 4A2CA 3KUXA 1CQJA 1ZK2A 1R4MB 3FF4A 1G0OA 3QW2A 2BLLA 2P9CA 2FPIA 2B37A 4TRMA 3K92A 4XYGA 3VZRA 4NK5A 4AJKA 2WM3A 2O3UA 5ER6A 5T57A 2WYWA 2BGKA 4WOJA 1MFPA 4GX0A 4ND2A 1E6EA 3GUCA 3UCEA 2DTXA 5ES3A 1PS9A 4ROSA 2ZATA 3VTZA 5ICMA 3INRA 1VLLA 1VL0A 4W6ZA 4XQ9A 2GPTA 4ID9A 2F00A 1O0SA 3K9QO 5COBA 5JS6A 5LDHA 4E5NA 1O6ZA 2PD3A 4PRLA 3FTPA 3RBXA 4DPMA 5F1PA 4DYDA 2FHSA 3FNHA 4AVYA 4Y9DA 4B7XA 2HSDA 3MOGA 1EE2A 5U9CA 4FJ2A 3UKOA 4J4HA 1N9GA 2CUKA 3WXBA 2GF2A 4RCVA 3ADPA 3V1UA 2PGDA 3ZNOA 1MGOA 2I65A 3OIGA 5JAZA 2DTEA 4U8GA 3U0BA 1NBOA 4BNKA 3ONEA 2J5QA 3FRJA 5TQVA 3C8MA 1S7CA 2C54A 4Z0PA 1MP0A 1LDYA 3I3OA 2GN9A 5A3VA 3UCFA 3DDNA 4PG4A 3WQRA 3D1LA 2X8LA 4CR8A 1OFGA 4LW8A 2E82A 2QRJA 4R4JA 1KIFA 1K89A 3OQ6A 1UDAA 5DF1A 4WNCA 4CUZA 1VPDA 2VT3A 3KETA 4B4OA 3QV1A 5CG1A 1W8DA 4BGIA 4YA6A 1PJ3A 3ETEA 3GF4A 1R4NA 1YRLA 5L3ZA 2PZLA 3BXXA 5IDYA 4NK4A 1DB3A 4IS3A 2OP0A 1MA0A 4JIGA 3ZV5A 3GVCA 3NT5A 3RU7A 4OHUA 3KV3O 4XIJA 3D3EA 1YS4A 3BIOA 1X7HA 2A35A 4GLLA 4OXYA 1K6XA 1WWKA 3OEWA 2X4GA 4EJ6A 3H3JA 3RFVA 3G17A 3EDMA 2DFDA 3DMTA 3QVXA 3OHSX 3HE3A 4B3IA 3F3SA 2O7QA 3IAHA 3RVDA 2HCTA 3UAGA 3ZWCA 1NNUA 4ALMA 1JDJA 1R66A 1WMAA 3SBOA 1ADCA 3HADA 2X58A 5JE8A 3UH1A 1GCOA 3JQ7A 3ZWAA 3GAZA 1CF2O 2CFCA 1HE2A 1C0PA 4BNGA 2AA3A 4AJIA 2VZ0A 3FNEA 2HMVA 1CJCA 4FIZA 1PWZA 4Z0HO 3VPFA 3JD1A 2RCYA 3I23A 3P2OA 2OOSA 2X23A 1E7QA 4DC1A 3T7CA 2XOXA 4RJTA 1B8VA 3VHRA 5IDXA 2YV3A 2QRLA 1LC3A 4L4SA 4TRNA 3JQ8A 1HXHA 2YQ4A 1CYDA 3D3WA 3OJFA 2VYVA 1U3WA 4NDNE 5K0ZA 1Q7GA 3AY6A 3LYLA 4YEDA 4PN3A 1Z6ZA 2IXBA 3WTBA 4FJ0A 2ZQYA 1P45A 3A14A 3MCVA 4UVGA 2AEJA 2AHRA 3IOYA 4U5QA 4UEOA 5A05A 5TRTA 2NSDA 1DC6A 1KVSA 1QLJA 4WLNA 1E5QA 2DT5A 4E3ZA 1DSSG 2VZ9A 5AXBA 3WFIA 3D4OA 2BFAA 2O23A 2NACA 3V8BA 1YB4A 4D7AA 2PLAA 3U5TA 2RH4A 2HK7A 4WK6A 3WTCA 4CQLA 3AM4A 4DC0A 3WICA 2E48A 1NM5A 1K0UA 3D0OA 1NR1A 1UXGA 2ZB4A 2Q50A 1Z82A 3K73O 3GNTA 1B2LA 4XWYA 1UP6A 3DL2A 5DDIP 1F06A 3V2HA 2G0TA
chains in the Genus database with same CATH superfamily
1GZ6A 1VPEA 5DRYA 5KJEA 1SKQA 4C76A 1T5SA 3A7DA 4BVLA 4YP5A 1C9KA 4Z5XA 4NV0A 1XAGA 3EMVA 1R0LA 2O2EA 2OLJA 4GOLD 4GW3A 4HWKA 4ZQGA 3T3NA 3OQOA 2GTPA 1PG5A 3IMKA 3TFOA 1DAIA 5J5CA 3TVDA 3ZGVA 5DGIA 4F45A 5AVTA 1N6KA 4MI1A 2B4AA 4AMUA 2OK7A 1RKBA 2BCJQ 3EG9A 3FROA 4YAJA 2Y2UA 3LW7A 5DYTA 5B64A 5I01A 3A2KA 3QMVA 4Z6KA 1FFSA 1AGRA 2Q46A 2DR2A 3QUSA 4YJ2A 5BSRA 5KYUA 3QXHA 1LJLA 4M49A 4NZ9A 5FUQA 1FU8A 3RYFB 4CKBA 4OG2A 1JG7A 2JK0A 2ZFUA 1GCGA 3A1DA 1RQRA 5KCMA 4E6EA 2GEUA 3QEMB 4B1FA 1ZCAA 1P1IA 4JNCA 4DLXA 1PV4A 1VE5A 3V7FA 1OYVA 1ZIDA 5E1MA 3WLKX 4OAQA 4OXRA 4A0SA 1CG6A 4KQXA 2HF7A 1LSSA 1SZDA 3GW8A 4XDYA 5LDDC 4FC7A 2IYSA 3R4VA 4M1QA 4J9VA 1ODTC 3ZDQA 1YCGA 1P5FA 3U7EB 2A5GA 1ZJ6A 3L77A 3OE7A 1ZICA 4TSKA 1N5LA 4JD5A 5K3AA 3WNZA 3ZZMA 4DUGD 5K09A 2A94A 3U7JA 1XBTA 4C7BA 3D4NA 3JQ9C 4CMJA 1I3KA 1T8PA 2GBLA 1E5LA 4MI9A 1Z7WA 4CI0B 4EA7A 4QAJA 4IUBS 4NMWA 5NLLA 3ZDZB 1Q1QA 4D02A 1SCBA 1QYWA 3CX7A 2ZBDA 3GUZA 5THQA 1HG1A 3G82C 4ON9A 1AHIA 1WOMA 3BKXA 2G9ZA 3MTQA 2QMOA 1N6RA 5C18A 5DCLA 4ATNA 2Q5LA 3SHQA 5ICSA 5DNWA 2REOA 4KB5A 4PLCA 1E1RA 1YR2A 5JCZA 3EBLA 5GJWC 2GK7A 2VQSA 1DOHA 2W43A 1ACMA 1QWOA 3ESXA 4L50A 1YI0A 1ZSVA 4J3FA 1KDYA 5F1OA 3ZJ4A 2V9ZA 4RMNA 1TYCA 2XQVA 4FX5A 4MOWA 4ZKDA 1T9HA 4CNBA 1V3VA 2XWSA 4TV9B 3TW4A 2DPLA 3UFXB 1CT9A 4KXFB 3TQHA 1OFIA 1PJ8A 2J5RA 3E81A 2EZ9A 5ITSA 4NCHA 5CX1B 2FVYA 2WHEA 3E9NA 4FONA 4JAVC 1XGKA 3SXUA 2KBFA 3QU2A 4S12A 4M3NA 5E7IA 3KUKA 4NFHA 2Q45A 2QRZA 4KE6A 1L9XA 2C04A 3EIEA 2W00A 4QUDA 5BUQA 2O3SA 2ZI3A 3JQ6A 3PA8A 5TIIA 4WZBA 1E2GA 2OECA 3CA8A 1I1NA 4PGGA 4RF3A 3EOAI 1TIPA 2CJWB 5T8KA 4EY6A 2UUPA 3NJRA 4B82A 1KP3A 2H9YA 1BA2A 4MWOA 2ODBA 3LM8A 3UAOA 1P4GA 1FB5A 1ZN8A 3M49A 3TKYA 2YXPX 3SK0A 2L2QA 2DQSA 4HQRA 5BORA 5DM70 2ZPUA 2YW9A 1JR3A 5PGMA 1OU4A 5A4FS 5IMBA 2RGCA 3P2KA 1QHSA 3RT9A 1IBKB 6YASA 2PZJA 3NGXA 3CEMA 1FYVA 3R0QA 3QUTA 4XFJA 1PBTA 2O2GA 5FI3A 2CMKA 2OBBA 1L5SA 3O82A 4FN5A 1IWBB 2AG6A 3EOBI 3OESA 4HDSA 1EDEA 4OA5A 4U8HA 2JBWA 5EN4A 3VX4A 4BNIA 5LWQA 3KDPA 2EJWA 5JG7A 3KQLA 1CUAA 1OH7A 3LUGA 4BCCA 3ZTYA 5HFAA 3HI4A 4MRVA 5EC8A 1UPCA 4LY3A 1H0KA 4G1MB 3LP6A 4K28A 3RAEC 1Q6ZA 2AYZA 2WDZA 5I7UA 2CKDA 4PR3A 1B0AA 1Z0KA 2DBYA 1Z5PA 3AB3A 4BO3A 4CGYA 2VUIB 3HVKA 1CW2B 4QRHA 4XVQA 1ZZGA 4EVSA 1I7SB 4LJSA 3W05A 4DLSA 3THYA 3R3ZA 3TTVA 2PXHA 4C6SA 4DSTA 3H2BA 1U0FA 4YJFA 2ATIA 1QFSA 1JG4A 3JZMA 4ARZA 1MQSA 4UBMA 4HB2A 1M1XB 4W5TA 3LBHA 3K6JA 3Q8LA 1GR1A 1VG8A 1BEZA 2BY4A 3G68A 4HWTA 1X92A 4MITA 1P1KA 1RJDA 3HR8A 4I1SA 4UHEA 4A5OA 3KOUA 2A30A 4PINA 2W2KA 4X00A 4YRTA 1SUCA 1PJQA 3E9EA 4NYJQ 2QBYA 4EJ2A 2Q7XA 2V45A 3UB4A 2GYUA 3GRVA 4F56A 3DZIA 3QE4A 1MT3A 1MJHA 5IZCA 2I5PO 1SPXA 2KMLA 3WWEA 4DR5B 4K03A 5I51A 1ZHOA 1D2CA 5JXHA 3SMVA 1IOVA 1ZMXA 1TEZA 1KK2A 4TYMA 1QPGA 3AUTA 3ZOKA 4TTTS 2XODA 2FW1A 2IYUA 3AI2A 3PXAA 4KPFC 4M8SA 5IASA 1KEVA 3ZY4A 1VKZA 5K3OA 1I9CA 3UV6A 1EFAA 3R3VA 4LXUA 2QP9X 1NUHA 1KYXA 1ZCBA 2VI5A 3PU6A 4ZVTA 4BEBA 3QG1A 1FFGA 2HLPA 4FGSA 1OC4A 2XNCA 2IF0A 1HL7A 5GP1A 4YTEA 5JJKA 1TJ5A 3A70A 3AERA 5I7VA 3O8BA 5IAEA 1KI6A 1XG5A 1EGMB 3HCCA 3KJZA 2C92A 3N28A 4O4HA 5ABPA 3G2KA 5J4HA 4BO1A 4N0QA 3DOCA 4FSDA 4COOA 1VE1A 4OHKA 4OJNA 1OV6A 2VRCA 1S1MA 3AF5A 4H1TA 3L1VA 4OHYA 4QVKA 2JCSA 4GYJA 2WTUA 4E51A 4R9SA 2VIIA 3ZCSA 4ERNA 1HWYA 1GADO 1SIBE 3PDWA 4UNQA 3UJDA 5CB8A 1FTWA 3R3YA 4QECA 1T4MA 1B8OA 1X1QA 1OVMA 3ANSA 1URPA 4J0DA 4UTVA 2NVUA 4IJQA 5CNMA 5IWCA 5JD6A 2QQEA 5JHHB 4J0IA 5KDDA 4TMKA 1QJCA 2VHCA 3MWGA 2YR0A 1XU9A 5CURA 3IIKA 3IC5A 3SSMA 3AFMA 2H7XA 5JCOA 2FWJA 2R4QA 2FPLA 1DPFA 1Z0IA 1N4AA 1FNNA 2ZTVA 3R41A 4YRFA 2J67A 3SYNA 4Q24A 1SGWA 3P9ZA 5DSXA 5F76A 1BHJA 2P77A 2JFOA 4O4JA 2JKYA 3D7SA 4R69A 1XMOB 1KI4A 2X22A 3C6KA 3PPWA 2HFKA 4ERXA 5AIBA 1T4BA 3BCSA 2JIRA 2OORC 5FUYA 4AN1A 1JFLA 5GONB 1E0KA 2CHVA 2C88A 1J0AA 2WFMA 1CVIA 3MCWA 3AOEC 4IDPA 4X6YA 4EITA 1XZGA 2WFZA 3LFHA 1T9KA 1DHRA 1XYVA 2QOEA 3OZAA 1W44A 4I2NA 4TVSA 2JGNA 3V2IA 1JLHA 3L79A 2ESRA 2NIPA 3K6RA 4BN5A 2HSJA 2W6MA 4WK4B 2FG5A 2FSPA 3REFA 2JGJA 5TQ2A 1VQ1A 2BEVA 2BISA 3KIPA 1Y3AA 1MC1A 1QTNA 1Y1RA 2NP6A 1SBCA 1CEEA 3TXXA 2JRLA 2KW5A 3KEFA 3VR2A 2RSLA 1E4VA 1REQB 3NB0A 1ONBA 1UOQA 3TQQA 5LWHA 2I9KA 3ZKWA 5LQRA 1BS9A 1LVUA 4XD2A 3O8RA 1T8SA 3O2JA 3I8OA 3RIYA 4ARCA 2IZ7A 4KHPB 1GQSA 3P9YA 3NYQA 3CF6R 4RAOA 3AM3A 3AI7A 4C0WA 2VDNB 1RCFA 1WZ2A 3IFSA 3UTCA 1YZUA 1V5FA 1XTIA 3K2EA 3R7WA 3PX7A 2ZSIA 1ZD8A 3QH4A 1C9MA 4D3FA 4C6RA 1PSDA 4CF5A 1R6XA 1MO4A 5GJBA 3RK4A 3TSYA 5CXXA 3R5FA 4IGKA 4DMFA 1DAGA 4IGAA 2QQ5A 2ZZNA 1NQUA 4XVUA 2W8BA 3NHPA 1TTPB 2RGNA 1VKOA 1VC2A 2D62A 4P8RA 1O2DA 2MWMA 4V2IA 4L73A 1Z6QA 1F8FA 4KGXA 3INGA 1JSLA 3EDCA 4R8RA 3ASYA 4RX1A 1B00A 4Q39A 5A62A 1GUDA 1I3OA 2ZBRA 1FRVA 5AM0A 4C20A 3DZ8A 4UBOA 5AW8A 5JDCA 1NBWB 1RC0A 4DCUA 1QS0B 1ECCA 2GZ3A 1G5PA 4L0DA 5KTPA 1XRQA 1UFOA 2LV8A 3I9V1 3NC4A 3M7IA 4MKFA 2Y71A 6ABPA 1QFMA 1VECA 3BC1A 4PVCA 4RZIA 2WVJA 1YJ5A 3IPAA 1XRSB 2PKYX 4X90A 3X0DA 4OHMA 3J7TA 2Q5HA 2WILA 2VP6A 3DBLB 3EPPA 3I53A 1J0XO 3HJBA 3H86A 3CX3A 1S2GA 4X5OA 3K6SB 4NCNA 1VZ3A 2WWRA 2BBTA 2JJYA 3C3DA 2GK3A 3F7TA 3MN1A 4QU8A 5CLLA 1A76A 4ZU1X 5LVAA 2ZCJA 1FJGB 1MIOA 1OU0A 4KYIB 4BMVA 1GXSA 4D43A 2B4YA 5AI9A 4BNWA 4EG4A 2NNLD 5BOSB 3T52A 2HI0A 5KNCD 2DBVO 3RHZA 3DO8A 2ODPA 3CY6A 1W5TA 1V96A 3OCZA 2Q6TA 1K75A 3ESZA 1DT5A 3FF1A 4EGAA 3NANA 2J07A 4B4VA 2IDZA 2VJNA 4JC5A 1ILEA 3JPWA 4YV7A 4MUIA 3RYHA 4E31A 1UAYA 1M2NA 1B73A 2W2QA 3OY2A 1T0IA 2FRDC 2ST1A 1Q0RA 3ETHA 4TLMB 3IV7A 1KEKA 2ZZMA 4JYZA 3KFXA 4FS3A 1IEXA 4NNPA 1TECE 5F23A 1Y42X 3VSBA 4QBTA 3W6PA 2R60A 2GK6A 3RODA 4UM9B 1CZKA 1PJCA 3HBFA 3KKZA 4MNTA 4C0LA 2B36A 5JYCA 3O92A 4GWLA 3N3BC 3DJYA 3VC7A 2QL6A 3NHZA 4WE3A 1ZKMA 2C7QA 3DS8A 4LOAA 4KQ2A 3T1QA 4F4UA 2RC5A 3A0UA 1Q7CA 2WM9B 3S2UA 4GOMD 1KY5A 4GAEA 1WU7A 1M9NA 2WUEA 2BW0A 4RLSA 4Q4HA 1L8OA 3EXAA 1DEXA 1H2XA 3FOFC 3BGVA 1QVWA 4ARAA 4NU0A 5IF3A 2EF0A 1OXXK 1X7ZB 4LPKA 1SRRA 5DXAA 1QV9A 1DIAA 2VP4A 3V2GA 1DNPA 2F4NA 1NF3A 3DOJA 4PS1A 4KN5A 5G0UA 3RSGA 4JKIA 4MVJI 4M9SA 3K70C 3U3JA 3II6X 1YNOA 2J3KA 1N5MA 2A59A 3MJSA 3N58A 3NWBA 1L7NA 4U7WA 4ZTZB 1TQ8A 1XDDA 4Q1BA 3THWB 4HGNA 4U7DA 2ZIXB 1PNRA 5H7XA 3E9DA 3I4LA 4Y30A 1WTAA 4IBOA 4E4TA 2Y9PB 5LQAA 1XEAA 3PFWO 1SQFA 2GVNA 2VPTA 2Y05A 3FDJA 3UMMA 4KPUA 4KAJA 2CV1A 4JCOA 4O02B 3IPRA 5A6SB 4DLKA 1ZWKA 4P86A 4C30A 1GGNA 3SHTA 4U0JA 3UO8B 1K86A 3RS3A 5FUBA 3TLZA 4V0QA 2AE1A 2B3TA 1Q74A 5BUSA 2F2TA 1BHO1 1NI4A 2X14A 4I1YA 2EFJA 4N5IX 4PGHA 1OXVA 4CMBA 4EG7A 4JVSB 9ABPA 3QFFA 4CE6A 1M2FA 2J3IA 3QPWA 3W9UA 5C4MA 3DHNA 3HO1A 1TIKA 1EIZA 1PFUA 1OKKD 2FPSA 4EECA 2AWOA 3PVCA 4QLOA 3TTYA 5I7SA 2YVKA 4LKOA 3ZJ5A 2VDWB 3S68A 4K6MA 5HSGA 1CSEE 5JARA 2GBPA 3SC2A 3WZ2A 1XMIA 3H2IA 3FTFA 1XSEA 2CDNA 1U7OA 1YCHA 1DG1G 5CH3A 1V4BA 4N9QA 3DBHA 5EKTA 5ELLA 3AR7A 3A3PA 3P19A 3FB4A 3MMSA 1SC1A 4YPOA 4RV5A 3BMCB 3SZUA 4BZZA 5FWYA 2FSFA 4BQOA 1BH2A 3YASA 4KIWA 4RORA 2IOFA 4QDKA 3GNQA 3PDHA 3NBUA 3A3NA 3NAMA 1G16A 4XWKA 3SXJA 5JR3A 1JRLA 1HZZA 2EQ5A 1QB7A 2WD8A 3DWEX 5E2AA 2CE2X 2WZDA 4ESVA 4WDRA 1Y6GA 1CEYA 4HPXB 1LWNA 1LY1A 3QU9A 2PSFA 2L0XA 1V1RA 1UDWA 3P9IA 1RAIA 4FYIA 4KJXA 5AT1A 5FOTA 4TN5A 4NDAA 1CRWG 6PFKA 1Z34A 1WMSA 2EOAA 3CG4A 2WBLC 3CPSA 5JC1A 1K3UB 2XYRA 3L8HA 5DWDA 1V1MB 4RIEA 4CFYA 2D7JA 4PFJA 1P60A 4ZDKA 3JQ8B 3TTSA 3D3WB 4FGJA 4FYYA 3P9CA 1E58A 4I46A 1EGVB 1SWWA 2HLNA 3ROMA 3NVMB 1RZ3A 4HGYA 1NN1A 3U7IA 5K0SA 2Q8QA 4WBXC 1OX4B 2NPIA 1CULC 3A1SA 4KBGA 4CL3A 1BS1A 1PCXA 2FA9A 3JR3A 3F4KA 5DO9A 4UZFA 4NQRA 1AUQA 5AM4A 4POAA 4Q3EA 2C00A 2XOKA 4M6WA 4EKDA 3AB7A 1LDBA 2QRGA 1OD6A 3I5AA 3P2EA 2NV6A 4BFXA 1C8KA 2XRMA 2NZVG 2VDKB 1RI2A 3FFAA 2A67A 3K71B 2ZDHA 1OSNA 1PK7A 3DTNA 1UBCA 3ZNNA 2CW5A 1XQWA 2WF9A 3RQIA 4UHDA 2ASVA 3QKRB 1JIVA 4GECA 3FPEA 3UFBA 2PTHA 4MUEA 5BNFA 1NPYA 3JAKB 2PWBA 2G80A 1T2UA 4PG7A 4TTAA 2C2MA 4CM6A 1O97C 4NYIR 1GDTA 3PVSA 5DI3B 5KQLA 2R6R1 2WWIA 4Q4JB 2B25A 1VHWA 2UZ0A 3AONB 3P9NA 3PT9A 4OTZA 5TJHA 4V3CA 2C3PA 3CW8X 3TGWA 5TMPA 4FSXA 4GICA 1EX7A 3LQYA 4DQUA 1TL7C 2ILTA 4L2IA 4RQTA 4RYLA 3IQDB 4UOEA 1MQ9A 2VSXA 4E7PA 4DMLA 1VYUA 5C35A 3PNMA 1JVNA 1XP5A 2ZE7A 2AOTA 4LXIA 1PL8A 4HVAA 4DJJA 3C7KA 4GU5A 1JTEA 4JNKA 4OHRA 3GCWA 4JUAA 1DIOB 3R0VA 2FNAA 3UVEA 5THXA 4O2AB 3SF0A 4PZLA 2FY8A 4FU0A 3UT6A 1X80A 3LUCA 2REXB 1CZRA 8LDHA 1J8FA 1M1YA 1NPDA 2PRYA 2SKEA 3N0VA 4FYWA 4Y0AA 3RWOA 4C6TB 3IUMA 3QOYA 1ZY2A 2Y92A 5CT4A 3C3BA 4G56A 1IZZA 1ZSYA 1Q17A 1YNSA 2UAGA 1OXKB 2VQDA 4I3GA 4RTLA 5CDFE 3LQ1A 3VU8A 5LQNA 4NCAA 2X8AA 5LZ2A 2O2IA 4HR7A 4BV8A 4ID3A 4O2BF 2ZUEA 1G3UA 2Q99A 2BGWA 1VGVA 4ME6A 3LY5A 3R6DA 4G09A 1E3IA 3G9QA 2J85A 2CXTA 1PN3A 4KE8A 1MV8A 4WUTA 3W8FA 1SOAA 2O8VA 4ACAA 4BJ1A 4EUFA 1NVAA 2C2WA 2GR9A 4TZ6A 3UWMA 2RHMA 4BHHB 2HIAA 1YQWA 3OZFA 4AJOA 3D6TB 5JC8A 2D6FA 1LRKA 1WW8A 1J56A 2V0NA 5CIWA 1YU6A 3BRCA 3R8FA 1JR4A 2AOXA 1Z4JA 3LI2A 3P8ZA 2W4QA 1JJFA 4KXVA 1SKAA 1QGDA 1EESA 1KOGA 3C1OA 4MGHA 2FJUA 4WY2A 4MXDA 1I7QB 1U9YA 2IP1A 2VP3A 4MWZA 4PAWA 4LSGA 1Z0FA 1UMDB 1LQUA 2OCIA 1N0WA 1N5DA 1CUUA 3LUKA 2QIPA 3MINB 4IJUA 4GUDA 1QIKA 4HZIA 1V7CA 5HQ3B 1U7HA 4R01A 4AG5A 3NM5A 2YHIA 1DV2A 4CF4A 4DQDA 3ZE8A 2GEBA 4Z7QB 1C3LA 2OC9A 4RH3A 4X6UA 2GA8A 3W6UA 2PCLA 1SELA 2FU5C 4FC6A 5TXGA 3UJBA 2VUHB 3UMBA 5B30A 1MN6A 2O3TA 1Z29A 2QTMA 3E61A 4OJYA 3EXIB 3IOCA 4U5XA 3VHLB 1HR0B 3ZHCA 1E9AA 2C82A 2W98A 4LY6A 2D1RA 3UHAA 2RHLA 1IXZA 3DYBA 3VV2A 3FWYA 5K0CA 5C7YA 1N1DA 4RTOA 3GLIE 1TM2A 2R3SA 1M2VA 1SQ6A 3A4MA 3F5FA 1KYTA 3ZGXA 1VGRA 3L49A 1UBFA 1ZGAA 2JGRA 5IBRA 2ZRNA 1S4MA 2QDXA 3BDIA 4M1SA 4E15A 4ZIRA 4L08A 5BW4A 3H9JA 2P6NA 1YJCA 3HO6A 1WMDA 1IAQA 3KU4A 1T9DA 2A88A 2FWMX 1KYQA 1L3IA 3COYA 4N9WA 5M5BA 1XF9A 2ANCA 1WDMA 3SAJA 1BRMA 4QJ3A 1OI3A 1PJTA 2J09A 3ND6A 4DLVA 2FLWA 1L7EA 2D8MA 2AKYA 3DDSA 4NEQA 5GMOA 3JQGA 3WMEA 2BE7A 1K7XB 1VG1A 3AFNA 1VCHA 2RIPA 3HJFA 1XAJA 4O0MA 3K94A 3EXHA 4DBLC 3Q4GA 4E5KA 4JJFA 1QFYA 4OQQA 4JJ4A 1I7PA 2FEPA 3R5XA 5HRUA 3U17A 3WGOA 1O0BA 1G55A 3DSRA 3OAAD 1WY5A 4BX9A 4B6JA 4ZVUA 4KQWA 1L4KA 3X43A 3GGPA 4E1AA 2PMKA 3CISA 3V97A 5LQUA 3SFZA 5KKNB 2BFCB 1W0JA 3FCOA 1R6TA 3HCRA 2PHZA 4CUJA 3VA7A 5IZ4A 1QZZA 4EBBA 3D6JA 3TZHA 1A7AA 3LT0A 4MB6A 3FDZA 4DJEC 2HLDD 3OZEA 3SIRA 1Q19A 2A5YB 1XN1A 2WUFA 3BE4A 4MV8A 5K2MA 3W8NA 1GIAA 2LGJA 1M8KA 2QLJA 1L4UA 1FE8A 3L6CA 2I3GA 3MGKA 4QFDA 1G4HA 5EE0A 3Q7PA 4E12A 4XVCA 1NM5C 3BOSA 3O74A 4CN8A 1T3ZA 2XW6A 1J23A 3GVIA 4BN4A 1B8UA 3LQ4A 1IE3A 3CQ9A 4MVWA 1YMVA 4FQ5A 3VPDA 2GBIA 1GZVA 1SUSA 4IMPA 4YGYA 3NH9A 1U7WA 4FFBB 4I4TB 1JQLB 4R6XA 4IM7A 2AMFA 3OE5A 3CTMA 4X1KB 5CLJA 3DT9A 5HK8A 1SVOA 1WU8A 2HJGA 1YIOA 2N9UA 3ED1A 1FIUA 2ZULA 2K2WA 3NAGA 4WL0A 4HQNA 5BSFA 5BN4A 3P9QA 1L5VA 3ENQA 3MHPA 3GEGA 3OEHD 1NIJA 2R84A 3JY6A 3MCTA 4ZK2A 5D1NA 1BCRA 4TT3D 4GMHA 1Y82A 3WNVA 1CUBA 2XB6A 3ETLA 3NWEA 4TS3A 4DCGA 1KYVA 1IC6A 1UDBA 3KYDA 3FMFA 3U4HA 5F7ZA 2I2XB 4L74A 3RU3A 4GPZA 3EMDA 3KYCB 4QD3A 3D64A 4H6PA 2OFXA 4GOOD 5FOUA 1E62A 1GYPA 2BBOA 4NZPA 3E7FA 4QOIA 1PVVA 4MS3B 1LD3A 3HI6A 1YDMA 3EE6A 2ADMA 1JHPA 3BD6A 2ONYA 3L01A 3QVUA 5DTRA 4HN4B 4R2IA 3IJEB 2WF5A 1YQDA 1H0HA 1GT91 5JOQA 4AQ7A 4LMBA 2I3ZA 3Q6NA 3RBVA 2GXSA 5EAIA 2Z2IA 1IM2A 2IX9A 5EQTA 5LQDA 2EFHB 1PZNA 5DYWA 5G1OA 3A28A 3AKYA 3UB3A 1USGA 3ONNA 4WNAB 1FP4A 5K8CA 1HUQA 4O4IF 4Z53A 2V4MA 1XTJA 2HRRA 2NV0A 2CEAA 2ZDQA 4H0CA 2Q21A 2W4MA 4LWZA 1BKSB 4TXJA 2PRZA 3RVMA 1EM8A 3D4LA 2ZXFA 1AH2A 1FXWF 3SBXA 3UICA 5L7WA 1GP2A 4YONB 3TFWA 4XD7A 4N76A 3OTGA 4Z9FA 2XUZA 3D31A 4X20B 4UNRA 5LXTA 2N42A 4JLKA 2DUMA 4JT8A 1UUFA 1V47A 2C8LA 3BIWA 4K9OA 3M4XA 1SA0A 1P72A 4Q12A 5LBIA 2OGTA 3SHWA 3TBFA 3ZD9A 2WP8J 1U3TA 1EAMA 3ZG6A 3IESA 3O1LA 3ESRA 2FSGA 1JA1A 4OX9B 3KKQA 1E9SA 5BN5B 3BL5A 4NYIQ 3H8SA 5FFNA 5BNZA 4LY9A 4D81A 3C3EA 3DGEC 3MTBA 1UXHA 1T9CA 1RM3A 2BFFA 3M1LA 1J21A 3RTCA 4RAQA 1DARA 2AOUA 1NW6A 2INGX 3BWEA 4Y8VA 4MLDA 5F9MA 4BC0A 1YRHA 4KR2A 4G0UA 5JSFA 2GM3A 2CMHA 2WHXA 1S5PA 1Q0HA 3QE3A 2QGZA 5F4ZA 5IN5A 2GEVA 1H0RA 2XY4A 3GZTB 4EB0A 5B58C 1DXQA 1DKMA 4UHJA 2VHEA 1E1NA 4Q3LA 4MVJM 3QU5A 1NNSA 4NV3A 2G5TA 3PT5A 1D7OA 4YH1A 2FPPB 1NU6A 3FKSD 1X15A 4H6XA 1PG0A 4WACA 5FADA 4IYJA 2AR7A 4K6CA 1EFUA 2IV7A 4ALNA 2OK8A 4IR7A 1V16B 3E7PA 3ZXSA 3K2QA 1NKSA 1N5IA 1N6LA 3C0KA 3EPHA 1SUPA 3N2GB 2IUSA 2I8AA 2OCGA 5CFNA 3C1AA 1G60A 3UK7A 3K0BA 1VOTA 5JUWA 1G2IA 2VWGA 2R1TB 4QHYA 4CIBA 2F90A 3AEUB 2IH5A 3WIUA 1DIRA 2IOHA 3SVLA 2ZBGA 5BV2P 2QVCA 1NVBA 2AVDA 3EBPA 5IJ0A 1J42A 1GAQA 4GF5A 2R4UA 3SP1A 2XCIA 4E2YA 1YCDA 1ULSA 3TAXA 2C8JA 3CV3A 4MR9B 1L7QA 1M1NB 4L27A 2ZRQA 3EHDA 4D6YA 5B7GA 2FP3A 4BGVA 3OUTA 4OMCA 4B0OA 3IXQA 5CBPA 1PQ4A 3DHVA 1D5WA 3K53A 9MHTA 1R1DA 3GHYA 1F6WA 2D59A 4BBJA 5JNTA 2Q1YA 4HATA 5SZJA 4AP6A 1UFRA 3AXSA 1SQ5A 4YN3A 3QXSA 5BOVA 4KX3A 3ERCA 3CVOA 2EARA 2FR8C 3L6RA 4S2UA 4CM4B 1KQPA 2P69A 4IMJB 1NOIA 2NO6A 1H66A 1TZCA 2WFAA 1TU4A 4QYIB 2R5NA 5LYJA 3IVAA 2PZKA 1PSWA 1ESCA 4XB2A 1FJXA 5AW1A 3U60B 3P0JA 1NQAO 3L1IA 4N0DA 2VF7A 2XF8A 2IXDA 3CG0A 3ABSB 3B3AA 3LDUA 4QUEA 5ENZA 3AMVA 1KORA 1EFHA 1VJRA 2JIMA 2VXBA 2GAFA 2ZJBA 1EHIA 3K5HA 4W8HA 4XYEA 2EFDB 3HR7A 4ZMRA 4QRDA 4QXMA 4ZZ2A 3B8HA 1Q15A 3EA0A 1U5BB 3A6KA 2WSSA 4AJJA 4Q0MA 3LX4A 2F3PA 3ASVA 1JKJA 4BLRA 1AY0A 1NJGA 1KY2A 2D06A 4CEHB 3I1IA 1O03A 1O6CA 3BWBA 2OHXA 1A2QA 4DY6A 3CLUD 4PG8A 1JW9B 1GSHA 1UH5A 3JYPA 2JD0A 4FP9A 3A1EA 3ISVA 1E92A 4U63A 3R0XA 2Q4DA 3WRWA 1BKDR 1P61B 2OV2A 4XAQA 2I6SA 2JFFA 3B9QA 1G21A 4OQPA 3SG0A 2PNFA 4BMOB 5ALNA 4NR0A 1E3QA 1J39A 3ZU6A 4BNNA 1TIBA 1EVZA 2JDIA 3TLGA 4BE7B 4ZOLA 5F3WB 1E2MA 1PR9A 1TCAA 2C3OA 3D8SA 3IVCA 2V4ZA 4ZOBA 1SUDA 3CWZA 1M33A 2GEKA 2QRMA 3MW8A 2QDKA 4WBNA 4ZRDA 1WOYA 3I2IA 1Z16A 3PIRA 5AM2A 3LTNC 2FE1A 7REQA 1H3FA 3M3DA 4D8UA 2QXUA 2W22A 4QGAA 4JJGA 1RT9A 3ILYA 3T35A 1G20A 1ZD1A 3WKEA 3IVGA 1RYNA 2JD2A 5DMHA 2C78A 3KALA 4BQQA 3K20A 5EHGA 4EOGA 4AZ3A 1LBEA 2W0MA 3WQHA 3EUEA 2OL4A 4QDJA 5AVKA 2YJ6A 5B2ZA 2JGFA 2PPLA 1A71A 2NGRA 3O3NB 3KTAA 3Q3EA 4CIAA 2IFTA 5JSZB 1JLLA 1JEDA 1HT0A 4H59A 1QQAA 4F5ZA 1XZNA 2P1ZA 1WTCA 2ECPA 4IFBA 4B3JA 2BFMA 3KJFA 2WAYA 3HDJA 4NOKA 5U1PA 1KE1A 3CZMA 4L02A 7MDHA 2HHHB 4WLEA 1B7GO 1B74A 4BQPA 5B4TA 2IEIA 5JD3A 1BW9A 1H9AA 1PK9A 2PLNA 2UUOA 1OX6A 3H5WA 4L8FA 4XPIA 2FSSA 3ZZTA 1KERA 1F9AA 3H5LA 5CNJA 3DR3A 1FLDA 2PTGA 2X2OA 2IUFA 4FGKA 4B7UA 1O0CA 4BVEA 4OBBA 4KDFA 1OUMA 5K3FA 1I4EB 5DW3A 1MG0A 3BA1A 3OE7D 4YACA 4LECA 1QHFA 4IIHA 1TRHA 3ELWA 4GIBA 4I55B 1WJGA 4UU7A 1XHEA 3VZDA 2CHEA 2VEOA 3STHA 5E2IA 1ENOA 3WISA 3I9LA 3ZLTA 2C20A 4Y2SA 4D79A 2BSQA 3NEPX 4JLBA 1C9NA 3DMDA 3DV9A 3WZLA 1N9KA 2Q6KA 3N1UA 2HB6A 4YS6A 3NHYA 3PEWA 1UEJA 2DQ4A 4M9ZA 5DWQA 2WTNA 2XXAB 1IH8A 4WNIA 3GOHA 1E1RD 3KZOA 4JL6A 5DJ5A 2EIHA 4NBKA 4ZC8A 3CVUA 3L6OO 4LZJA 3EWNA 4E4YA 3LY8A 4Z8XA 1FUUA 3KV1A 2BHRA 3IEVA 2R79A 5I6DA 1LDEA 3LHSA 4HAVA 4P0TA 3DL0A 4DIFA 1NXPA 1CZLA 4KVGA 3FSRA 4S1NA 3HC7A 1DKRA 2BRUA 4MV5A 3QGMA 2Q7DA 3UB2A 3ZWPA 4BNTA 1P1FA 4CQMB 4DBZA 2HNBA 2ZRGA 3FDXA 5GPBA 2WA1A 1PQYA 4RVGA 1E7YA 2REBA 3QBJA 1QRDA 1FYFA 1CEQA 1KKUA 1GUAA 1XVUA 1ZK0A 2MINA 2VNHA 3CW9A 1P17A 3F71A 3GLHE 3Q5EA 4PG6A 2ZRFA 4OF4A 1ZI6A 4NONA 1EPUA 2Z9DA 5NULA 3WP1B 2TMKA 1EUZA 2C9ZA 1L6RA 2XXJA 5REQA 2DKFA 4RD6A 2AW5A 3EXFA 1Z2CA 2K2QB 1QHXA 3H7AA 1ZR2A 3O8OA 3HJNA 1UODA 4UAVA 3RROA 1IEVA 1JR3D 1KHHA 1VPLA 3VZSA 2G9UA 4OU5A 3JAMA 2NUAA 3VUFA 3WYNA 4MDHA 5HJ7A 4IIJB 3KE9A 3WBFA 5GIPE 1YL5A 2XUIA 4Y1RB 1KSFX 4I6GA 4TMFA 4M1YA 5C1IA 3RFUA 3P4YA 1XK6A 4CMEA 1N5JA 5A3JA 4RQUA 1RM5A 4AXXA 4TKVA 5C32A 2O4CA 2Z56A 1TJYA 3ONFA 1EJBA 1R0ZA 2JGDB 3L7JA 1F2DA 3NIBA 1MGPA 3DLIA 1IOZA 3PFBA 1IU9A 4I8IA 4JB0A 3GLFA 4WZ6A 1QU3A 1AOXA 1XJCA 1A5ZA 2VWPA 3WNBA 2FH5B 2G1JA 3HZRA 1N7GA 1ZP6A 2YUIA 3EFOA 3KLMX 1E2BA 1MD9A 1TA4A 5A71A 5C8VA 1YB6A 2EW2A 3HVIA 4BRSA 4QGFA 7ADHA 1QHIA 3PTLA 4RPLA 2I62A 3T54A 3ZIAA 1KMHB 2GAOA 2OMEA 2WUWE 1RWBA 3AF6A 3K0FA 2BGRA 3DKVA 4HB4A 1BHQ1 2L18A 3IP1A 2O59A 1TAGA 3GI1A 4R2KA 5KC8A 1KYYA 2IH2A 1C9DB 4Z4CA 4LRYA 1YJAA 4Q7EA 4QQ8A 1OV4A 3FUUA 1W36C 3DZCA 4PSDA 1FMTA 2ZT8A 4R41A 5C8YB 3M9LA 3SJ7A 2WQZA 1F3OA 3I8SA 3I6YA 3CEHA 5AJXA 3T5PA 1ODSA 2PXCA 4A8JA 2VBFA 2EC5A 1QYRA 2VSNA 1G17A 1RFGE 1UJ4A 4GNKA 3ZTTA 2AFHA 4DV7B 2QT9A 3OT4A 4II7A 4L5JA 1XU4A 4JJ7A 4NE7A 3SZMA 5K6AA 1BMQA 3DFMA 1U2PA 3DBOB 1LJUA 3SEZA 2VUUA 2O07A 5IH3A 3LC2O 5EYPB 1EEXB 4UU8A 2B4KA 4GM1A 2HW8A 2D13A 3FYUA 1LBIA 2EU8A 2R8RA 3F8SA 2BDEA 3HU1A 1JEJA 1FP2A 4LRSB 4PSAA 5EMLA 1IK6A 3CLTC 1ACLA 1UL1X 1Z17A 1ZI8A 4HPWA 4E5PA 3HDVA 4OQMA 3UK0A 5MN6A 3IUNA 3Q8WA 2IX3A 3COPA 3TCNA 4LBWA 4LRUA 3RW9A 2AN9A 5HCUA 2B83A 4CIWA 5DVZA 2BAGA 1HYBA 4HNVA 3MHTA 3J7AC 2QE7A 1DKOA 2NT4A 4IXDA 1I13A 2PYDA 3GELA 1Y3CE 2Z3VA 4NG5A 4B6EA 3F7MA 4CCSA 1WB9A 2CB9A 2PBRA 4WHMA 3SKVA 1C7JA 4J2TA 4QRIA 1ECPA 4HDNB 2VSQA 3NW9A 3RRMA 3K0CA 4ICIA 3S7TA 1KMMA 2CLSA 1XPUA 1TYZA 2OGSA 4CL0A 3VZCA 4MWSA 3IJPA 1N32B 4EJMA 4TV8A 2FG6C 2GT1A 3BM5A 1XYGA 2VRCD 1MABA 1ODCA 2HQBA 3VR5A 3PQ7A 1U5CA 3G2LA 5DGXA 3LE8A 1BWSA 5I9TA 3U1BA 4FE4A 1QNLA 5E6SA 1Z7GA 3SBEA 1X1CA 2XNJA 1P80A 2JAWA 2OCLA 3U7QB 1F2TA 4RPIA 1W52X 3P4XA 2HA5A 2Q8PA 3PDIA 4L5CA 1QE5A 4N5HX 4RK0A 4YQEA 5LA6A 2QRKA 2J3JA 5FPYA 2YXDA 4EH1A 2XD4A 5J2TF 4E4RA 1EX9A 1I7NA 1O6GA 3K9BA 4XM0A 4YMGA 3HJHA 2FK7A 4Q1DA 4R16A 3HYCA 1V26A 4G0NA 4KLRA 1KGSA 4JFRA 3UHFA 4MW9A 1JV2B 3PB3A 3EAGA 3LT5A 3R5TA 4TUYA 4UXJA 2IOQA 5EFZA 5K0TA 5JMWA 4JENA 2BIFA 1RW4A 2NTVA 3G9XA 4JQCA 4MVJF 3DEIA 3ZY2A 1HZJA 1IG0A 1LLUA 2GPJA 2I7DA 3H19A 3O9MA 4Z4EA 4JDPA 4FYXA 4ETIA 1NUAA 2AUMA 2CLCX 4FKZA 1R16A 4MMXB 3HHPA 1O96B 1MA3A 2C97A 2ORYA 3JR7A 3OZRA 1RAGA 4R0NA 2EFYA 5E2BA 2AZMA 1KFJB 5ECGC 5U4QA 3UH0A 4DWVA 3NHSA 3EOZA 2QV7A 1GZSA 2C4HA 3BCHA 4RADA 5A7HA 2QLLA 1TRKA 2LVBA 3PHIA 4HX9A 1G42A 4KN9S 2VK1A 2O8FB 3DO6A 3IQZA 3DMFA 4QFMA 3AJ8A 2P27A 3FOBA 1I2ZA 3AM5A 3G0IA 3MJHA 3GEIA 3LXRA 2PUDA 1GL7A 5GY7A 4FZ3A 1K97A 1P4RA 2VQEB 2G1AA 2Q3BA 3NIGB 3VR2D 1LK0A 3CF4G 2A1UB 2E6KA 1UM8A 3WR5A 3N74A 1NR7A 2E9SA 1OBCA 3OQPA 2AHOA 4G65A 2QMZA 4Q47A 1ULUA 2R00C 1CR0A 3I9FA 6REQA 1TGVA 2Q4EA 2RB4A 1CY2A 2YN2A 4IL5A 1G8PA 4UQPA 2GHRA 2IEDA 4YT4A 1ONPA 4PQEA 1R12A 1XTPA 3IUYA 3L46A 3PUVA 2CJYA 2CXUA 3BJZA 5E4YA 3T7TA 1AKWA 2R7KA 1DWQA 2OCPA 3EGVA 5HR5A 1SU4A 1EB9A 3W5IA 4GXQA 3FR8A 2XDQA 1HX7A 3B7GA 3IVXA 3ESCA 4BP8A 3PTAA 2G6BA 4YRBA 4R3WA 3LLSA 5KMGA 2RJOA 4ALIA 4BUJA 3JQAB 2JIDA 4N5NA 3QKIA 1EA7A 1NONA 3OZBA 3H4MA 5K5EA 5CLGA 2I6XA 1V6AA 3OX4A 2COUA 2I29A 3I9OA 5JAQA 2FEOA 3ZY3A 2IEYA 4J0CA 4XM1A 2GN1A 4FD2A 2RHRA 3KHTA 3VO1A 4JA0A 5EQJB 2YZMA 4FOTA 5HWSA 4GPAA 1PJAA 5B36A 4UATA 3HKDB 1ZW6A 1FUIA 1Q1EA 4X7RA 4ZCRA 4TLBA 4PAOA 4FZ5A 1OILA 1EWKA 4ZZ1A 4O29A 5DW0A 3I30X 4A6EA 2AD5A 3F97A 3W5HA 3RFFA 1U1IA 2WF6A 1TYDE 1I0LA 3GJSA 2P2SA 4AL4A 4C0XA 5IKMA 1Z0DA 1LZLA 1JAHA 2GJAA 2WTAA 1EXVA 3REGA 1G6KA 4HNQA 4QQFA 2R86A 3KBOA 3DDUA 3HRHA 5JAMA 5CK4A 1N78A 2IYFA 1STOA 3W2IA 1ZUD1 2OENG 4LWPA 1V8FA 1O5OA 2Q0SA 5LD2B 1N5KA 2V6MA 3ZKAA 2ZCUA 1EXWA 3EZXA 4IEIA 5KYNA 1W87A 4AYTA 4FX2A 5LU8A 3I8XA 3WL8A 1QH1A 3ER9A 1PEDA 5CJPA 2IE8A 1O94A 1Y6RA 1AV6A 4K5QA 2NQ2C 5A1JA 2W6JA 3OX3A 4O5OA 4OFWA 1WQ1R 2CV0A 1UBJS 4B45A 3ZWYA 3CKLA 3H4VA 2GKGA 4HNRA 3DDHA 2P11A 2PD6A 3BTOA 4OAPA 2OPHA 4GYYA 4YAIA 1Y7PA 1T9GS 4OYLA 2Q6OA 2BHLA 4DB4A 2XYHA 4PLTA 2TRSB 5I7OA<