5K0FA

Crystal structure of comt in complex with 5-[5-[1-(4-methoxyphenyl)ethyl]-1h-pyrazol-3-yl]-2,4-dimethyl-1,3-thiazole
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
219
structure length
219
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 80
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0fA00
3ELWA 1AF7A 1M6EX 5LR6A 3AY0A 3M6XA 1L1EA 1Z3CA 1YZHA 2AN3A 5E8JA 5EHGA 4YUXA 2P41A 2OO3A 2BR5A 1OR8A 2G8NA 3Q87B 3SMQA 3FZGA 3NJRA 2GA9A 4HG2A 2ZBPA 2YVLA 4FSXA 3DXZA 4KVZA 3T7RA 4GOLD 4CKBA 4ER5A 2P40A 3GRVA 3RW9A 2B9EA 2P8JA 4C4AA 3TPZA 2GS9A 5CUQA 4BLWA 5K03A 4HTFA 3DMFA 2JHPA 1QZZA 1HMYA 1KIAA 3G88A 5EEHA 5LQAA 5P8WA 4O29A 3EEYA 3MTIA 2P3LA 2AOTB 3HCAA 3FRIA 5DT2A 5EVJA 3G5TA 1EG2A 4GUAA 2VDUE 4AZVA 4ISCA 4CTKA 5LQUA 5IKMA 1FJXA 3P9KA 3HVIA 4P58A 4FZVA 1ZHFA 1SKMA 1BC5A 3GRYA 5K09A 1YFJA 2P7HA 4AZWA 1G6Q1 1RI5A 2XVMA 4POOA 1EJ0A 3GGDA 4C03A 4R05A 3QOWA 3UJAA 5EIFA 5LQNA 2HMYB 4MQ4A 4AX8A 2F8LA 5M5BA 3MQ2A 2I9KA 3OU7A 3P9NA 1XXLA 2YUIA 3M6UA 4OA8A 1B42A 3OZRA 4PONA 4QTUB 4KIGA 3RIEA 3BZBA 3PX2A 2JJQA 1FP1D 1RI2A 4YV1A 2K4MA 3DULA 3SXJA 1P91A 5FA5A 4GF5A 4AZTA 3P2KA 3JWIA 3LBYA 1RJFA 1VPTA 5KQSA 3BWCA 4P7JA 4C07A 3KQSA 2P7IA 3OFJA 2CMGA 2VS1A 4WXHA 1JQDA 3IYLW 3MCZA 5G02A 2H11A 5FA8A 2P1DA 3AWIA 1N7JA 5EKUA 3UWPA 4B17A 4MHTA 2YXDA 3MHTA 2ZLBA 1WXWA 3ID6C 4PINA 5DTMA 4A6DA 4XCXA 4M7RA 2FCAA 1R6AA 2GH1A 1XVAA 2ZIGA 1KPHA 1D2HA 3KKZA 3ELDA 3M33A 5EQJB 4H0NA 2V74B 4X63A 3PB3A 3CKKA 3EPPA 3M4XA 2ZZMA 2ADMA 2GAFA 4RYLA 2PXXA 3TQSA 2Z6AA 5GM2A 3HEMA 3R24A 1TW2A 1VBFA 3AXTA 4U7TB 3M70A 2B25A 1KYZA 5GIPE 4E70A 2NP6A 4LG1A 5EEGA 5BW5A 5E9QA 5DRYA 1EQAA 1I4WA 1D2CA 3DXYA 3FUVA 4QVKA 1JTEA 2VZ9A 2BH2A 3GNLA 3EVCA 2ZZNA 3SM3A 1XJ5A 3E8SA 2ZTHA 5HIJA 3MB5A 4PCLA 3ER8A 4FT4A 2AR0A 5K05A 3IEIA 3G2OA 3MGGA 1X19A 3CJQA 2BM8A 2HNKA 1VLMA 5GP1A 5EMJA 4ER0A 7MHTA 2C7QA 5CIYA 4OA5A 2CMHA 1QAOA 5IH3A 1P39A 4JXJA 3TRKA 2DPMA 2UYHA 3LKDA 2O05A 4CXMA 5DTQA 4EKGA 3B3GA 2HR1A 2ZSUA 1YUBA 3R3HA 2PXCA 3OFKA 1R74A 5CVDA 1ZGAA 2PX5A 2UYQA 3UA4A 3TKAA 5T64A 2JHCA 3OU2A 3PX3A 3JWJA 1HNNA 2BR3A 4RVDA 3G5LA 2ZIEA 4XUDA 4PWYA 2ZBRA 3GJYA 5FTWA 1JG3A 4RTNA 4Y2HA 3M6WA 2C7OA 3CCFA 4E32A 3TLJA 3SR4A 3E23A 5E1DA 2ESRA 3UJBA 1ORHA 4FS8A 3HA5A 3KQOA 3C6MA 4ATNA 1BKYA 2JH9A 2FK7A 3OCJA 4RVGA 3ERCA 3DUWA 4CTJA 5JUWA 4FP9A 5BP7A 3UJ7A 4C06A 1KPGA 5K0GA 1INLA 3K6RA 4YV0A 3KR2A 1G8AA 4QQNA 3QV2A 5DXAA 4RVHA 3TOSA 1SQFA 4KW7A 1EIZA 5FQNA 2AS0A 3BT7A 1VE3A 2YXEA 2CKDA 3LPMA 3TM4A 5EMMA 4FSDA 4BY9E 1XCLA 4QQKA 1X1BA 2P3QA 5GINE 4XUCA 4DF3A 3EGEA 5HIMA 3BGDA 4PNEA 1DUSA 1G8SA 2OB2A 5FWAA 1IXKA 1UIRA 2PWYA 3G2QA 4IV8A 2CL5A 3KPUA 2JHAA 5EHIA 1EAMA 4UOEA 3JWHA 2YR0A 3I58A 2PGXA 2Q41A 2I6GA 3TKYA 4DCGA 3CGGA 4MTLA 2AVDA 2IH4A 5LQCA 2Y1WA 4RX1A 3G2PA 4KRGA 4OBXA 2WA1A 1SUIA 3FPEA 3O31A 5T6BA 4IWNA 3RODA 3ER9A 1Y8CA 5CVEA 5K0BA 5DM0A 2PLWA 2YTZA 3MERA 5EC8A 1KR5A 2FYTA 1JG4A 2O0LA 4GC9A 4Y30A 2GPYA 3M6VA 5FHQA 5BW4A 4YMGA 4HTFB 3A4TA 1JR4A 1YZ3A 3DP7A 5DSTA 5GWXA 3KR9A 1MJFA 3ME5A 4QPPA 4V0RA 2NXEA 3UJ8A 2JG3A 5D1NA 3OU6A 1X1CA 3UJ9A 2G71A 5E8RA 3HA3A 4GC5A 2VP3A 1MHTA 2OXTA 3TM5A 3BUSA 3FUXA 3V97A 1M6YA 3B89A 5GOZA 3KQMA 3SX0A 5CVVA 5ICCA 1N7IA 4PCAA 3I53A 5CCXA 2PKWA 3HCCA 3UBTA 2H1RA 1JSZA 1XDSA 1NT2A 5EG5A 1NKVA 3KQQA 2ONYA 3LDGA 5E9JA 3SSOA 3FTFA 5C1IA 3H2BA 3HM2A 4RTMA 3DMHA 2PY6A 4HRAA 2HTEA 5ICGA 5JR3A 3BXOA 3B3FA 3GRZA 5DX1A 4QVGA 5C0OE 5K8VA 2XYQA 3V8VA 3U81A 2I62A 3P2IA 4X1OA 1NV9A 5CM2Z 3O7WA 2NXNA 3ORHA 2H00A 3A26A 5FQOA 2PT9A 1NW3A 3GDHA 9MHTA 2IDJA 1VL5A 4E33A 3FPJA 4YUYA 3G7UA 1R8XA 3C6KA 3GRRA 3T0IA 4CKEA 2OZVA 5GIOE 1PJZA 5K0JA 3EVDA 2VDWA 2ZWAA 4QDKA 5HEKA 1FBNA 3VYWA 2AOVA 4K6MA 1PRYA 3FTDA 3WSTA 4R6XA 1TPYA 4BLUA 3OZTA 3MTEA 1F38A 2ZWVA 3CVOA 2EJTA 3PVCA 2PBFA 4IKPA 5EMLA 2PX4A 5LQKA 2IFTA 4RV9A 4KWCA 2ERCA 3PS9A 4PYQA 4PYMA 3FRHA 5EZSA 5FADA 2OB1A 5HFJA 2XVAA 5HZMA 3TR6A 3CJRA 4OQDA 1L9KA 2PJDA 3OE4A 1XTPA 3C0KA 3E05A 3GCZA 3HCBA 4L7VA 5FHRA 1QANA 5HILA 4E30A 3P71T 3GXOA 5DRTA 1AQJA 2B3TA 2ORED 1L3CA 1R18A 2PVCA 3IV6A 3A27A 2ONZA 3NVMB 5FWDA 5E9WA 1DL5A 3VC1A 3CBGA 4YMHA 3FYDA 2ZCJA 4P7GA 4EVIA 4ER3A 3EEOA 1G55A 3MAGA 3LKZA 3P9IA 5DSXA 4DQ0A 5DM2A 1ORIA 2AOUA 2PXAA 2OY0A 5DX0A 5DLYA 4ER7A 3DR5A 4DCMA 3P9CA 5F2OA 2OBFA 3HA7A 2ZZKA 3THSA 4XUEA 3LHDA 5CCBA 2NXJA 4WVLA 3A7DA 2EFJA 3MCTA 5DX8A 4RTLA 1NV8A 3R0QA 2G1PA 1RJDA 4DKJA 4P7FA 2O07A 1L3IA 1RI4A 4DZRA 2AZTA 3FPFA 3NDJA 5DM4A 5DXJA 3BGVA 5ICFA 3KQWA 2R3SA 3E7PA 4U7PB 3KPVA 3NWEA 2JH8A 1L3BA 3Q7EA 4RTOA 4RTQA 2QRVA 2O57A 3C3PA 3KR1A 1I9GA 3G2MA 1AV6A 5E2BA 3FUUA 3EMDA 4PYLA 2C7RA 1WG8A 5HIIA 2DULA 1AQIA 2OYRA 5K0FA 3BKXA 3KPJA 3P8ZA 4F85A 4ZTBA 1NW5A 4AZSA 1ZGJA 1R00A 3UFBA 2ZBQA 3GO4A 3TMAA 4KDCA 1U2ZA 1BOOA 1FP2A 3DTNA 2EX4A 3D2LA 3KQPA 1M0EA 4HGYA 4YUVA 3LX6A 3K0BA 1X1AA 1KXZA 3G89A 2BM9A 5T67A 3VC2A 1IM8A 3X0DA 4E2YA 1DCTA 1JTFA 4OX9Y 1KHHA 2PSSA 1UFKA 4RSRA 3FYCA 2PWPA 5DM1A 3EVFA 5ICEA 2FK8A 1QYRA 2OKCA 5FUBA 1WS6A 4PYOA 2YQZA 1FPQA 3EGVA 5K01A 4RTSA 4P7KA 4R8SA 1SG9A 2IBSA 3SVZA 1BHJA 3GWZA 3CC8A 4HH4A 4EKIA 3ANXA 2ZW9A 2ZVJA 1NW6A 5EKXA 4YUZA 4GOND 3NDIA 2HV9A 4A6EA 3LDFA 2IH5A 8MHTA 4IV0A 2QYOA 4F86A 2UZ4A 1QAMA 5EZQA 4M36A 5EGSA 3GRUA 4BP3A 2IP2A 4CWAA 2R6ZA 2XBMA 3R6TA 4RVFA 1YFLA 4OQEA 3FTEA 4RTKA 3HCEA 3NVKI 1V39A 3GU3A 3KPYA 1Q0SA 2AOTA 4QPNA 2AOXA 3UJDA 4EQZA 2CWWA 1D2GA 3O4FA 5ERGB 3EVZA 3LCUA 1YB2A 3PLAE 2ZFUA 3SSNA 3UZUA 1VP3A 4FR0A 3KR0A 4DM3A 3BGIA 3NTVA 5MHTA 4RTPA 2NP7A 2EJUA 1KYWA 3GIWA 2C7PA 1Q0TA 4BLVA 2B78A 3EVBA 2UYCA 3KQYA 5K0LA 3P97A 4LWOA 2NNWB 4CKCA 2YXLA 1O54A 2AVNA 3FUWA 3HCFA 4YUWA 3KU1A 1RI1A 1R8YA 1NW8A 3I64A 4HC4A 1X1DA 1NW7A 2AN4A 2GLUA 3F4KA 1NE2A 1WZNA 5E1BA 2NYUA 3NWBA 1JQ3A 3C3YA 5EPEA 1ZKDA 1ZG3A 2GB4A 3JWGA 3DH0A 4MIKA 4C04A 3LL7A 1YF3A 3B3JA 2HWKA 2P3OA 2IBTA 3NW9A 4PIMA 4GBED 2G72A 1F3LA 2PX8A 2V7EA 3LBFA 4M38A 1O9HA 3FUTA 2IH2A 5HIKA 2PX2A 3OPNA 3R9XB 4X41A 5K0EA 3A7EA 3AJDA 1XDZA 1P1CA 1TW3A 5E1OA 5F2NA 3HP7A 4BP1A 2PV0A 3HVHA 4DA4A 5F2KA 4R6WA 4OBWA 1G60A 1SUSA 2BZGA 2FPOA 2ZULA 4PYKA 4Z2YA 2E5WA 2QE6A 2UYOA 4KIFA 3EVGA 4MWZA 3REOA 2IDKA 2QM3A 4GQBA 2KW5A 5CVUA 5FCDA 3LCVB 4E31A 3ELYA 4AUKA 2FRXA 3L8DA 1WXXA 4QTTB 2N47A 3PFGA 3EVAA 1XCJA 2P35A 1NBIA 4PIPA 4PYIA 2Z6QA 2G70A 5BXYA 3UJ6A 1SQGA 1H1DA 4RWZA 4C08A 3FPHA 1KP9A 5EOVA 4EK9A 2XYRA 2YX1A 5LSAA 3KPWA 3B5IA 4E2XA 3THRA 1JQEA 4NECA 4PGHA 3A25A 3KQTA 2WK1A 5HOQA 3I5UA 4G56A 3SGLA 1VIDA 3IHTA 3CJTA 4GOMD 4PGGA 5D1HA 5H02A 3T7TA 4E2ZA 2PT6A 3LSTA 5KYGA 2AOUB 3EVEA 3EGIA 5CD1A 2LD4A 3T7SA 2WA2A 2AN5A 3UA3A 5K0CA 3DLCA 1ZQ9A 3DOUA 3LECA 3DMGA 5EMKA 5DPMA 3TFWA 1P1BA 5FULA 1JG2A 2NXCA 1QAQA 3HCDA 3HNRA 4HSGA 4QDJA 2OPBA 5E2AA 1NBHA 4FGZA 3LCCA 1RJGA 4LWPA 3PTAA 3EMBA 1UWVA 3FPGA 3AXSA 3P2EA 3FTCA 3I9FA 3LGAA 4KDRA 1JG1A 1SVUA 1VQ1A 3KHKA 3OZSA 2Z6UA 1XDUA 4PYJA 3HTXA 3G8BA 2QRVB 3HVJA 1JSXA 4PYNA 4R8RA 5EIWA 1WY7A 2I7CA 5GM1A 5LQJA 4RTJA 3UJCA 4GEKA 2BR4A 2IGTA 5CVJA 4DMGA 4E2WA 2Y1XA 2FHPA 2QY6A 1RI3A 5KQRA 3VSEA 5DWQA 10MHA 5K0NA 3NMUF 4HGZA 5KVAA 5LQRA 1N2XA 1IY9A 1KPIA 3G8AA 2VDVE 2EG5A 4GOOD 5E1MA 2AOWA 3BWMA 3S68A 1EJ6A 3BWYA 1RJEA 4ER6A 5KS2A 2A14A 3QOXA 4LECA 3HVKA 5U4XA 4FT2A 1VP9A 3DLIA 4X61A 4EMSA 3OE5A 4M37A 2B2CA 3LDUA 3B7PA 3SSMA 2ZIFA 1I1NA 1T43A 3BKWA 3BWBA 3ELUA 3DXXA 3PT9A 4V0QA 5B1SA 4C05A 5C9ZA 4X60A 2XYVA 4YV2A 3KQVA 4F84A 5DTRA 2O06A 1G38A 1O9GA 3PFHA 2IIPA 4RTRA 2IPXA
chains in the Genus database with same CATH superfamily
1ACJA 5LOVB 1T6XA 2F3PA 1V8PA 4R16A 2AT1A 2B4QA 2JFQA 2VHQA 1KEPA 1Q0RA 1SCIA 2NTJA 3EBPA 4YUXA 1T1JA 5EJFA 4PN3A 2ERYA 3KAQA 5CK4A 4PSAA 3ZH9B 1IZ0A 2OBBA 4JOQA 4DMMA 5REQB 3RTEA 3GJTA 3PTLA 2B5OA 3X1XA 4JJEA 5EXDA 5MDHA 4OJTA 1MQ8B 3ER8A 2RB4A 3CF2A 2B9EA 2CXHA 3IDZA 1N6LA 3EQ6A 4O25A 3QX3A 2H9AA 4WBNF 1ZZEA 2CNWD 4X7RA 3DNPA 5CUQA 2WM8A 2VDNB 3TPZA 1VIAA 4G1EB 1K89A 4M9UA 4ECEA 5F98A 2R00C 5P8WA 1T2CA 3IVRA 2QAIA 1ISHA 3JRXA 1QQBA 2AD5A 1U7PA 1K6EA 2IE0A 2QBYA 3QHAA 1KSHA 1SBNE 2HIMA 1AKUA 3EE6A 3ZDEA 4DBLE 5EVJA 3G5TA 2YMQA 2OA0A 4FDLA 1IHUA 3CPHA 4OI2A 2GESA 4JI5B 5K09A 3CTMA 3E2PA 5C1OA 3TLCA 4ZT5A 4A23A 3ZNQA 1BMFA 4BJHB 4JMLA 4YH1A 3RS0A 1KFEB 5G3ZA 4EKNB 4UZEA 2V5UA 1UWKA 2G3YA 4MVCA 2X3UA 3ZVKA 2PQ0A 1TTQB 2XNSA 1RBZA 3NIDB 4PONA 4FHCA 5CFQA 1I5EA 4C88A 4AF7A 2HLDD 4IFTA 1RI2A 3KTOA 4DILA 1UXJA 5FV7A 5FA5A 1GTG1 4AZTA 121PA 1SKAA 3AJAA 3G5UA 2B9VA 4Q15A 1W2WB 1RP7A 2CMGA 1V16B 16PKA 3MT8A 1Q16A 1Q14A 2HF9A 2OCDA 4BO6A 2QM7A 5G02A 1D2MA 2FFAA 1NUUA 1GR0A 4RCYA 1IN5A 3RE1A 1PHRA 3ROXA 4WV3A 5HQ3B 1R12A 2GWHA 2IX9A 4OB8A 4FYMA 1JXMA 1USKA 4CF5A 2M2IA 4ZCQA 1XAJA 4ZDKA 3KKLA 1PLKA 2OBLA 4RENA 4BE4A 3ELDA 4DTIA 3HH8A 4X6UA 3RSCA 3EBOA 1LS1A 5AKZA 5CA0B 1Z0KA 3V1TC 2F7SA 1XVLA 1ZKMA 3JATB 5BN5B 4PQRA 2F8TA 4J8PA 2BFBA 1V7ZA 4PLPA 5JLAA 4Q3EA 4E70A 1QP8A 1KOLA 5B55A 1M33A 2PLFA 1FTGA 4ILEA 2Z2IA 2DUJA 4E5VA 4IXWA 3E2IA 2BKLA 2VHYA 3EVCA 4WERA 5FLYA 4HQKA 3BFXA 3MB5A 2YNMD 5DSZA 2PUJA 1K7FB 1X19A 1OT5A 1ZRHA 3C85A 4DY6A 1ZOIA 4OGFA 2WF7A 4REMA 2OE2A 5LQDA 1P39A 3N07A 1UKBA 5E6UB 1Q77A 3GT0A 4RQTA 4EB3A 2Y66A 1Z5PA 3IODA 2JD0A 3VJKA 4PLYA 3ZE7A 3ZIUA 2FSHA 1MW8X 3SZLA 3FCEA 1CUEA 3OFKA 4EFDA 3SICE 3DD1A 4QHYA 4F2HA 5KU1A 1OIVA 3K0AA 3R4VA 5HBRA 4RHYA 3RARA 5KOYA 3E9CA 4ZOLB 2ZJOA 1K97A 3EC7A 3O82A 1EA7A 1CSEE 4WOJA 3B82A 5I7UA 2XUGA 3LNTA 2C3YA 5I9LA 1M1UA 2F6RA 5LA6F 4KQHA 1JLSA 3OCJA 5GONA 2BHNA 3NASA 1EVZA 1E0AA 3U7EB 4YAIA 1OVMA 6Q21A 3HWWA 4UTOA 3K8OE 3CWCA 4INJA 2ACEA 2X1LA 1AMNA 4AG6A 1BO6A 4HQNA 1W4LA 4E21A 4LV8B 4QQNA 5B36A 3W4IA 1SQFA 2DE0X 1M66A 3VA7A 1MVLA 1R10A 2XTNA 4RNDB 1KZ7B 4F2PA 1E6CA 4QDUA 2H0QA 2GCGA 4OYHA 2PZGA 2A35A 2VBCA 4BMNA 1UBKS 2P3QA 2QN1A 2IRWA 2OHIA 2ORVA 2VK8A 3PQ5A 1KMMA 1V7QA 1Y4ZA 2XWQA 5CLLA 4CHTA 5F33A 1UKZA 3VVCA 2I22A 1S8AA 1XTUA 3QOYA 1S8FA 1HYEA 1W6RA 1U9CA 1G8SA 2WE7A 2I8AA 1L7QA 1XMVA 3WGHA 5AK6A 1IXKA 1UIRA 1JV2B 1U8FO 2I66A 2YR0A 3V8NA 4I46A 4TWJA 4XAQA 3T1HB 4G8BA 1B8PA 4WOPA 3U4MA 1PYDA 3KFVA 1SZPA 4X7BA 2FDCA 4BRUA 3ZLJA 2BE7A 1C80A 3CUKA 2ORYA 3DO6A 1O0BA 3DHWC 5EE0A 1EP3B 3MJFA 2CMKA 2G9UA 3S27A 1UOEA 3LPDA 4LDQA 3SYNA 3SZ3A 2I4MA 1G4AE 1N75A 1ETUA 4FYXA 2BN4A 4RSGA 2CL0X 3PC4A 2WWXA 2WTNA 4QQ8A 2WYIA 5A7GA 3ZG6A 3NHYA 4D25A 2AH5A 2VXCA 1YZTA 4RPKA 4F3CA 2JG3A 1T2DA 3NJ4A 1HM5A 1PR4A 3UJ9A 3WL8A 3VTZA 2HT6A 2REQB 1P18A 2WIJA 3BZWA 3QNUA 3QE9Y 1MHTA 3MEQA 3GJSA 4E4TA 4GNKA 4UZSA 4UVDA 5KOJB 1JPVA 1EBFA 2DAPA 4MUGA 5ICCA 1I10A 4ZOCA 4D9FA 4PCAA 1XEXB 1PUIA 3DAOA 4ZREA 1T4BA 4FYKA 3COPA 1LVUA 1XTKA 1NKVA 3IPCA 4X20B 2HB6A 1LPMA 3QWHA 4UUQA 2HSDA 5C1IA 5JDCA 4YCJA 3DV2A 1NUPA 1X42A 3A1DA 4TTAA 5HJ7A 2O2HA 4L4ZA 1SCBA 1YAHA 3E9RA 3FMVA 1T24A 3GEIA 3TB6A 3RUPA 1RQPA 3GVCA 4BFXA 5JPDA 1PVDA 2C29D 2ZRJA 2GZSA 2PXHA 1NV9A 1N2GA 3O7WA 2IP4A 4FGJA 4A8JB 3V3TA 5CH5A 4OLHA 4BNMA 3FHOA 3SF8B 3WISA 3I6QA 2VJPA 1JWAB 3GDHA 3O8OA 2HDWA 3PIIA 2DWUA 2G88A 3IUPA 3FPJA 1DFHA 4J0HA 4BFYA 3GP5A 4HBGA 3HFRA 1U6IA 2AC2A 1UK8A 2I9PA 5IRCD 3G7UA 4KE8A 4BGEA 1OBVA 1V3VA 2C2ZA 2JVIA 4F12A 3TSYA 2B83A 1DJLA 1PUJA 2G5TA 5FR2A 4MZDA 3AVYA 1NVVR 5MGNA 4QDKA 1J21A 2FV8A 3WL6A 4Y3UA 2Q4RA 1N3BA 1C14A 2VHVA 4ZOBA 5BNIA 4QELA 5EJ8A 2CT8A 1G8MA 2XUKA 3EOZA 4AKGA 3GMTA 2ZJ5A 1WHSA 3HP1A 1V1MB 2ERCA 2QDKA 1BEUB 3RV3A 1KY4A 2QRHA 3TW4A 4EJMA 3NTOA 3BCHA 1FX0A 4OAQA 1J8QA 4XB6B 1ZK1A 4EFLA 3RVBA 4WL0A 3TIVA 1D7AA 3BHIA 3GJ3A 4CTMA 3DW1X 3MPUA 1PEYA 3DLTA 1RQLA 1KEEB 3S2FA 2YVAA 4QICA 3RT1A 1M6VB 3WWYA 1RPNA 4DDKA 5EXXA 1YIOA 3HB7A 4D4MA 3OO0A 5FHRA 3GELA 3N58A 4UUPA 1SBTA 2BZ0A 1JAHA 4MW6A 5ECYA 5U4QA 3SQOA 1ISMA 5LMUB 1A4RA 3R9WA 3EIWA 3JAWB 3V8RA 3QBEA 3WKDA 3AP2A 4J4BA 5DNWA 2WAMA 3GVHA 1ENPA 2FMHA 3OQVA 2QENA 2E1RA 2XCOA 3JR3A 5J43A 5C5IA 3VR2A 3K8QA 4AN1A 5CT6A 1I5RA 4ALJA 4QJ5A 3QSGA 4M1WA 5JC1A 2J9RA 3QLVA 5DLYA 2FWIA 1IPEA 3KZOA 2P9YA 4OQQA 3KV1A 3P9CA 4DLRA 2JLZA 4CJXA 5H83A 4XPIB 4QGHA 2V0NA 1XMSA 2MJLA 3TLZA 3WLEA 1C0LA 5LLTA 1J09A 3BIXA 4AY3A 1LDEA 1FMJA 3FPFA 2ZIAA 5ICFA 1MGPA 4MQUA 1NSYA 4OGLA 1QH1A 2P5TB 3O2JA 3QVSA 3Q7EA 4HFNA 4WBXC 3RNOA 3X1MA 1E2DA 3ML1A 4QE3A 4NZNA 1SVSA 2OD2A 1ZRMA 2QW8A 3LRTA 4HQFA 1Z33A 1U7HA 5H5JA 5LJLA 1UZNA 3QQPA 4W8GA 1JLKA 3IELA 3OO1A 4Q03A 3EMDA 5G0UA 2AQ8A 5D6OA 4EHBA 4ZOAA 3DJYA 4CLHA 1FLNA 4V1CB 4G5FA 5K6RA 1QHNA 4KQ1A 2YWCA 3LYUA 2PZAA 4ZTBA 2EFEB 3UK0A 4MJ7A 3WYFA 1X8JA 3IAHA 2VYND 3GUZA 4HLUA 2BZSA 1J97A 2PSDA 4R1UA 1B0AA 3K16A 1SK8A 4FHEA 1E7YA 4KDCA 3ZU4A 2FEOA 3GCGA 1FP2A 1EMDA 2EX4A 4UTZA 1OX6A 1PJ8A 1IOZA 4YUVA 4F11A 2BMJA 4QFCA 2WWVD 3PLNA 2XTMA 1E8NA 3M5WA 3QVWA 1EVLA 1JL3A 5KIAA 2FQYA 1XCPA 4FS3A 3H2YA 2F2TA 3L0IB 3DTTA 3KLMX 1PL7A 4R1TA 5BR7A 1UXIA 4NZMA 4LXXA 4MUKA 1FNMA 1UQUA 2C5EA 3M9XA 2V7TA 3QBDA 4X6YA 1Z0UA 4LCBA 4LFCB 5KYWB 2ACWA 2QT0A 4RTSA 3VTFA 1TEZA 3HDGA 1RLTA 1V4VA 4HH4A 4WINA 5F1YA 5JHGB 1X1RA 1TLFA 1CDEA 2JJ8A 3JCZA 5DTJA 5FPPA 1NAIA 1XMIA 4V0OA 2DB3A 2C9BA 1KZHA 4NF2A 2HXGA 4DS3A 4DXDA 5TMEA 4MQFA 2O3TA 2Y76A 5TT1A 5EZQA 2PZJA 1OT3A 2DGDA 3JVIA 5EGSA 2J3QA 3MK31 2AXNA 2FUG6 4JA2A 3W7AA 4AO7A 4EH1A 4FYPA 2BZ1A 4J0CA 4Q9JA 4RVOA 5H4HA 3D6FA 1PR3A 4RTKA 5BNFA 2PRKA 1J0DA 2YXPX 3IAXA 4TXMA 2AF4C 2UUOA 3UANA 2OORA 4QPNA 4ZAYA 1QHXA 2GPAA 3Q2KA 3AR4A 3ROPA 1GGHA 2BUBA 1UM8A 4I2NA 2KHZA 4KPUA 4Y0VA 5ERGB 3SZOA 4D9CA 4BTVA 1P2BA 4BLSA 4DCVA 4Z6KA 1QFZA 2XE4A 4PHCA 2K5UA 4DM3A 4RIHA 4RTPA 4WCDA 5GJWC 3RVPA 1ONSA 4F2GA 4AKIA 1YMUA 3RI3A 5SZJA 2OV4A 3EVBA 3OURA 1GKIA 4D0RA 2XMZA 1G5RA 1NY5A 1VLLA 2P9TA 3DVSX 5K0LA 4K3UA 3ZDAA 2O54A 1UEXC 5HZKA 4D9GA 1X7WB 3I23A 4WUVA 4QLOA 3RS2A 4WLVA 3PFBA 4BMSA 4ZC8A 4W99A 1VE9A 2FZVA 2XUPA 3BVPA 3DZDA 3LQ4A 4QU0A 1TKRA 5T57A 2V5AA 5JYBA 1DXHA 1CP3A 1SU7A 5DHUA 3RVDA 2LCQA 3RYIB 1F2TA 3NW9A 2J5KA 5CT4A 4WXPA 4UHHA 1QZTA 5BSTA 2Y68A 4IG4A 1DZ3A 4NENB 3FNFA 3U7HB 3S2ZA 4BQPA 2JLBA 3SHQA 3A6HA 4UCXA 3NHUA 2C83A 4CT0A 1IXZA 3HWX1 4NULA 5KKCA 3FVVA 1CVIA 1KRHA 4Z2YA 4PYKA 3V7UA 4AY5A 4MVJM 4C7XA 1I2AA 3AINA 4DA6A 3I3OA 4HNHA 5BV7A 2QMOA 4BO7A 4B71A 1QCCA 1I6LA 1ZGGA 3FCSB 1UKVY 2ZRNA 3ELYA 2C5LA 2J31A 2FRXA 2IXTA 1Z38A 4C0LA 2Q9AA 1BMFD 1ULBA 1YOVA 4PIPA 4S1TA 3UAGA 3WO1A 2A59A 5C5EA 4UNRA 3VNVA 1GEEA 4R7GA 2PUEA 1QU2A 1P80A 2G09A 4B80A 4X92A 3FMFA 1ODSA 1ZM2A 4Y6RA 3UWMA 3H99A 3U4GA 1HZZA 2LDBA 3L8YA 1KI6A 2X6TA 1O58A 1U9JA 4NECA 2V6GA 4D56A 4ZI7B 5JSKA 5HOQA 1VMDA 4TTTS 3GYBA 3L46A 3IHTA 5GADl 1QP0A 2CLLB 2GCPA 2VUHB 3OSUA 4E2ZA 2XNDD 2VHTA 1G3RA 4RPCA 1LNQA 1H2EA 4B5LA 2AW5A 3GB9A 1DRVA 5K8TA 1NJGA 3OH8A 2OGTA 3ICQB 3HE3A 4FGZA 3VAZA 2FZLA 5DGHA 4NEQA 2Y1GA 4RHCA 2BBWA 1J8FA 3THXB 1JSRA 5E3HA 3LGAA 2XMRA 1BX3A 1DARA 4B8ZA 5LYJB 2GYVA 3BWVA 1UZUA 3KHKA 4MVJG 4E5KA 3ICOA 4DB2A 1G5FA 5TQ2A 4A10A 4GZMA 3TJRA 5C1PA 2HU8A 3H05A 1QIFA 3NONA 2XUQA 4OL0A 1I4EB 1IHDA 2C2WA 2IYPA 4O8CA 4QECA 4B44A 4JI7B 2PGOA 4MULA 1IC6A 1YO6A 3ABOB 2HA3A 2R25B 4IUBS 3TOZA 3VHXB 3KB2A 3H5LA 4H1WA 3NIBA 4M7WA 3NATA 3HCOA 4JEIA 2BH9A 4TLCA 1AXGA 4JHXA 1QLJA 2PS1A 3KKKA 4R2XA 1M6HA 3F3SA 1KJJA 5AKJA 5GZ6A 4RDCA 1EESA 4EYKA 4L78A 1BE0A 3D8BA 3DXXA 1WBJB 3HV2A 3VO1A 4A8PA 1LK0A 4BVEA 1TJNA 2G7ZA 3JSAA 4JVSB 1PGJA 1TVKA 1X74A 3WB9A 4I50B 3BF7A 4L0CA 4QGGA 4KPEC 3QFSA 3QPAA 3QSYA 5JMOA 3L0DA 4J4TA 3TE7A 1LDMA 4LDNA 2QW0X 4KBGA 2IQ5A 4I5FA 4XIGS 5EJ9A 3T3MB 1GSAA 1U0RA 3PE4A 5A6SB 2EDCA 1NA5A 3QEJA 4V0MA 1PQYA 3PQ7A 3MGCA 2JGIA 4K9NA 1CJTC 2FPPA 3TK1A 1NU8A 1ND6A 4MR8B 4RM3A 3RBAA 2ES4A 3L4KA 3QKRA 4B4DA 1CE8A 3DXZA 4YT4A 4WY5A 1JE0A 3MT9A 4LSWA 4K05A 3SR3A 3HI4A 4DLAA 4OMCA 3D0QA 1Y98A 2QORA 4LOAA 5AP9A 3HZHA 1RQ7A 1E5VA 4RKWA 3U60B 1P0PA 2FWJA 2ZQZA 1D7OA 3T94A 1IVSA 3GZJA 2AOTB 2COEA 1EX1A 4YR7A 3GAZA 1U3WA 1RIFA 1NDQA 1UZAA 1Z4JA 2Q07A 4IQGA 5IM5A 4GUAA 4K6KA 5A02A 5IVDA 4C7OB 5LQSA 1YA4A 3MWDB 3QLUA 1YFJA 1Q7BA 4AJOA 2PR7A 3BF8A 4BV8A 2V6BA 3PR2B 1EJ0A 5BVGA 4IEFB 3BQNB 3HWSA 2QLTA 1YL6A 2IUSA 2ZRMA 1ZD8A 2W2MA 2OC9A 2IV2X 3WBFA 4RKQA 3DTVB 5AK4A 5T5QA 4AX8A 1UBEA 3FTPA 3BZBA 8ATCA 5H9WA 1BD4A 3PX2A 3Q7RA 1KDVA 1O03A 3DE2X 3NJ8A 1WW3A 4FGSA 2W71A 1L7VC 1M7HA 5IC5A 3JWIA 4TQAA 5IWAB 3W90A 3EHEA 5I7WA 1RABA 4ZIRB 1L4UA 4UM5A 2BISA 1K4KA 2Z98A 3V2UA 2H11A 4F9EA 1MNQA 5HBGA 4NATA 3OQBA 1KKUA 1TYAE 1IIRA 1WXWA 2D0DA 2FX5A 2X8AA 3IOMA 3R6WA 4JKYA 2QNRA 4PINA 3V8QA 3VYTB 1XVAA 3RVQA 4MUYA 3JTMA 2QTVB 4UBJA 3IDSA 4JIMA 1ZUNB 1H4TA 1KQPA 1P81A 1NSFA 4X93A 2G6TA 4U7WA 1NMXA 3DVAB 1OAKA 3HR8A 4GMGA 4CDRA 1HLFA 1WZUA 2VWGA 1XDBA 1ZEMA 5H7XA 1KYZA 4C4ZA 2QRKA 3S2SA 2P6RA 1TAHA 4P4GA 2RD2A 3PZBA 1VZ2A 4IVQA 4RK6A 1TT5A 3IP6A 4Y9DA 5DRYA 5JWHA 3TQCA 4CG0A 3UAYA 3UT0A 1FLVA 3E8SA 1UODA 1BFUA 4FPXA 3DE0X 1Z4QA 5AM4A 2VQSA 3TDNA 3H83A 4REOA 1XLTA 1A8QA 1JXOA 3SY8A 2Q21A 3Q3JB 3MGGA 1Y8QB 4M1ZA 4ER0A 4BU1A 4GM4A 4F7WA 1V1RA 1ZCAA 2RAUA 4ARBA 5KZMB 2C7QA 1P7CA 2PG3A 1OWPA 3NZEA 5LLDA 3OQNA 2ADFA 5J4LA 4MWSA 5IBPA 1QXSA 1U9IA 3M9LA 4M1OA 2ANCA 3ACBA 2CFTA 2YHIA 4RETA 2UYQA 1CFZA 5BYBA 1Y42X 2WIDA 2GERA 3SC6A 1W76A 5FWXB 3QEKA 4JSYA 3RHZA 2JHCA 4J43A 3PX3A 3JWJA 1PNOA 2CHGA 1DOAA 1G41A 1XHFA 3CEHA 3GDWA 1BMDA 3E3AA 3L7AA 2Q8NA 1YS4A 3JYHA 3U4IA 4MQMA 2NO1A 2NIPA 3EZFA 1Q22A 4KQMA 5E1DA 4EARA 2GVZC 5LXTB 4B87A 1YC5A 2AZXA 4IILA 1YHYA 1APBA 1CUIA 3AZQA 2OC4A 1Z2EA 3DBIA 3AU8A 3C7KA 2XDQB 3N3AC 2P2ZA 3ZNNA 3FNRA 3ERCA 3JYLA 3EPHA 1NONA 1XTRA 1ZMOA 2UZ1A 2JLWA 1MDBA 1T0IA 2YOFA 2PTHA 1XJ0A 1S9HA 2QVLA 2WIGA 4BMDA 4E3WA 4N7RA 4ZTZB 3C3MA 4EI2A 2HEGA 1T1IA 4IF4A 2OENG 4AJ9A 2FA9A 2DQ4A 5KYTA 1DXOA 2HYIC 2HNAA 2R4TA 4WEQA 4C0SA 3G2HA 4Y98A 5KHAA 4R1PA 1I8TA 4FC6A 2NMVA 3CVWA 3OZEA 3I61A 3QVVA 5EFZA 4ETMA 1CUBA 5DMHA 3L0BA 2CL5A 1EE1A 3HCRA 3NKVA 4IICA 4AO8A 1PG2A 2RGDA 3EPLA 1O57A 1GQOA 5ADUS 1QGED 3DEAA 3FNIA 1MQAA 3VR2D 4DZTA 1W1IA 4HV4A 2F62A 1O2DA 4CMIB 2WPNA 2NAPA 4EDHA 4I08A 4D4KA 1XZMA 1NKTA 4R0VA 3A3KA 3A6ZA 2EQ5A 2XAAA 3D4BA 5JNVA 1YWGO 2GZRA 1C2TA 4P3NA 4QFBA 1WF6A 2Z9CA 4XFKA 2B1JA 1F51E 2YN4A 5ARDA 3TEMA 4B40A 2I78A 1JIVA 5DSTA 1TTTA 3ME5A 4ENTA 5GVSA 2GEKA 3KTDA 2RC6A 1UANA 4MWBA 3RS4A 2FR0A 2XDAA 3EQ8A 3V4LA 5AUPB 4WCFC 2VP3A 1N2BA 4PSVA 3OLWA 5ALXA 4CMHA 1EFPB 3DAYA 4GYYA 3KQLA 4BCBA 1JDPA 4WN9A 1JDTA 2D7JA 3TTSA 3S3TA 3CXRA 4CLOB 1VJ1A 4HLQB 3HCCA 5IJ9A 4FKBA 1NPDA 2YWXA 3RYCA 5E9JA 3MGKA 2O5CA 4P6VF 1ACLA 1ZC4A 4OXKA 3ZWMA 4Z4QA 2HTEA 2FEWB 2W11A 4RPLA 1MRNA 2E18A 4EHNA 1Q92A 1U2GA 3UH1A 2G5CA 3KJQA 4HDSB 5K8VA 1DC4A 3IEPA 1WKBA 4I4NA 3CUSA 3SNHA 4IVNA 2WUFA 1D2EA 2ZIXA 2M9MA 3A1NA 5L4SA 1JDVA 5KJEA 1XTQA 5ADWA 3WGOA 2QYHA 3E53A 3L82B 5DTIA 3NUQA 1AHIA 1V5IA 4OK5A 2ZVDA 3GNTA 1DO0A 4M46A 1JDJA 1QBKC 1Y7HA 2A0XA 5IJAA 1W0KA 3FAZA 3ASVA 3TH5A 5K0JA 1MIHA 5BMVB 1ICIA 2HIAA 1S2NA 3FHLA 5BOSB 2YV3A 2X8LA 5JRJA 1AGXA 3VAYA 4J0KA 1WVMA 3TZQA 1VJGA 4O1HA 2AFHE 2L19A 5AVVA 4JBGA 1LEHA 5JZBA 1YK1A 2WG0A 3S1AA 3RAEC 4KH0A 2AE1A 1Z26A 5EZSA 2G83A 2Q1YA 2X14A 2IPAB 1VFPA 3VR0A 4B4OA 5ALVA 2HJHA 3PKZA 4Z54A 4K6CA 2CXNA 1GRNA 2Q1WA 1GNSA 3MN1A 4B6EA 3ZK7A 1MX3A 1RCFA 4H7IA 2Q5JA 5F3DA 6AT1A 1N7GA 4PU0A 1A71A 1IHOA 4EF4A 2ZAYA 3O26A 1Z6AA 2VQ3A 2GF9A 3C74A 4YAEA 1W96A 2W6JA 1AQJA 4TKZA 1L3CA 1R18A 2PZEA 4RZXA 5CDFA 3T3HA 3GJ5A 2R1VA 3ND8A 2G9QA 1K8RA 5CX4A 1C8KA 3V9PA 1T8YA 2HI0A 2J85A 1TMOA 4MVXA 4EVIA 4F8EA 1LTKA 4MEBA 2ZDHA 3RASA 5A9SB 3WHPA 4CM8B 3PGMA 4HDMA 2O8CA 1A9QA 2ZRAA 1CETA 3SNKA 3VSDA 2OY0A 1IN6A 1BS1A 2A9KA 5KTPA 2RGNA 3A4LA 2AKYA 1ZQ1A 4UVIA 5AKIA 1IK4A 1GNRA 1XD2A 4CIDA 4E46A 4MVJH 2YNMC 4ED9A 4DNPA 5I4KA 2VJCA 4DZZA 1SVOA 1YS7A 3K9QO 4JBHA 1R5NA 5JD5A 5CCBA 3I3SR 4LJ4A 4BNIA 3KZNA 4MP6A 3E03A 1BDMA 3R7SA 4DIDA 2PTGA 4DMRA 1CZRA 1QC5A 3RU9A 4OL9A 1YH3A 3SPXA 2Y0BA 3ECSA 1S2MA 3DDWA 4MWGA 3VH4A 3KPVA 2I7VA 2QRVA 1DG3A 2O9JA 3Q9LA 2G1JA 5BUZA 4ZZ0A 1V8BA 4DRXA 2I6XA 1VSTA 5MN6A 1EXVA 3QI2A 5H3CA 3KOUA 3W0LB 3D59A 3OT5A 5HF8A 3LWNA 4R1QA 2VDKB 3V2HA 4AJKA 1XEFA 1BAPA 3WK6A 3H2GA 1PE0A 1TMGE 2Q1UA 4N47A 1CKEA 1FSPA 1PR9A 3UVEA 1JG7A 2RHTA 4LXYA 1QMPA 2DTXA 3EIUA 3FF1A 1A9OA 4Q18A 2ZREA 3ADCA 2ZJAA 1NBMA 4UMVA 3UN1A 3W9UA 1GLVA 3NRJA 3IJ5A 5K3DA 3RBVA 2PVSA 2WILA 3B1FA 2ZJYA 5TXGA 4C6TA 4X62B 2EP8A 2YZ2A 3W1WA 4W5NA 2PGNA 2J3JA 2XT0A 4P86A 5JQGF 3A6DA 3AV3A 3B2QA 2W2XA 3IERA 3WKAA 2HEIA 4BNGA 3VKWA 1MG5A 1TKBA 3OA2A 4HRYA 4E5DA 3B36A 4IF6A 2HV9A 3Q1KA 4KG7A 1XELA 2JFGA 4NJMB 1NZFA 2ZBVA 1LA2A 2I80A 1AQYA 1WPGA 1PWYE 4WZAE 2NZXA 3KB8A 3PDWA 2RJNA 3OF3A 3OI7A 3WWOA 3MGBA 1LV8A 2ZJBA 2EG9A 1W2HA 4OQEA 1X86B 4E94A 2FRDC 3S2YA 1D0SA 1N57A 5I4BA 5ENVA 5DM60 2GTIA 1FRFS 4IEEA 1HH4A 4ALLA 2OQIA 2AG8A 2QJWA 3FLEA 3IKJA 2J3IA 3QXJA 1T3ZA 3JQBA 4TS9A 1L4NA 5HCIA 1ILEA 2FW0A 2A4KA 1K7YA 2K6GA 2Q5CA 1ECJA 2NP7A 1ATIA 3QUQA 1EXDA 4MDFA 1ZDMA 3E27A 3H5TA 5JH7A 4WY2A 3S7ZA 4O4LA 4Y6QA 1E9AA 1Z5GA 3F8SA 4P81A 2ZWMA 1PEAA 3MUFA 3PQ8A 2ZGVA 5J3JA 1NBAA 3B8HA 4EW1A 2DBVO 1G59A 4RYDA 3I64A 1X7ZB 3PFNA 1J99A 1NW7A 2GLUA 2QLJA 4U2GA 3PXAA 5F23A 1EEXB 2NYUA 4BNVA 2NVUA 4DCNA 5J4HA 2FDXA 3DW3X 3VDQA 3FIUA 5C2JB 3T99A 1DKNA 3EGWA 4TUYF 3MSXA 1HDOA 1FFXA 3LL7A 5CX1A 3QJ5A 2GYUA 4GBED 2PX8A 1JR3A 3GLFB 1YULA 4L22A 3TX6A 2W6QA 3FUTA 3V7WA 4R9NA 4QBHA 3EG9B 5KNBA 3I9LA 3K1TA 2QEQA 3GAAA 4YRMA 1NR7A 2E4AA 3SCZA 4PAMA 5E1OA 4LSZA 3W5IA 4BP1A 2F4NA 3FROA 2JI6A 3NHSA 4KMMA 4KQXA 4LVUA 2C3UA 2ZULA 1C8BA 1U3CA 5KDLA 5DBGA 2GYWA 3EVGA 3M7IA 3KXDA 1K7SN 2VUTA 2OO5C 3AFOA 1XZPA 1CC1S 1G5PA 1YMVA 2E6KA 3LCVB 3PGJA 4AUKA 1UM9B 5CFRA 3SLGA 2HH9A 5FNVF 2AEEA 3M3HA 2JGFA 4I6JA 2QRNA 3BSSA 5P21A 2C9DA 2VAMA 1H3EA 4JLWA 1K4YA 3KZMA 4MS3B 2P69A 2GCNA 1NWHA 1SKBA 1S96A 4Q6WA 5EZYF 5C80A 4MB0A 3GEHA 1A4UA 1EX6A 4LZWA 5ILQA 1AO0A 1J2TA 3JQFC 4S04A 1JMVA 1FYDA 1G291 2R97A 1V9CA 4U7DA 5H02A 1XT6A 2YZNA 4PGGA 1FYEA 3KZCA 2Q7DA 2IEYA 2DSNA 1RTTA 3NGXA 1DJOA 5EERA 3T7SA 1CHNA 3V3KA 3W9YA 1RT9A 3DLCA 3LC7O 4Q12A 1IDN1 2ORIA 3GF4A 4LJSA 3WFIA 1DU4A 2RGXA 3FPGA 3P2EA 2X0DA 1OLUB 1ZU4A 2DHEA 3WGUA 4Z5XA 1X6VA 4ZQCB 1J0BA 1JG1A 2A5JA 2CLFB 3U3JA 3H4MA 2P2DA 4NDZA 3IBTA 3QGMA 3GMIA 3K9GA 1RKQA 3Q12A 4J2TA 5LYYA 4Q3LA 4IJWA 3SEFA 2Z8YA 4F3KA 1YBMA 4O4IF 3E4CA 4FK8A 1BMQA 4F5WA 2QD3A 2F3QA 1NI4B 1UXOA 4HB3A 2IKSA 3CRNA 3NIFB 1FVHA 4WNIA 2ASVA 4YO7A 1PZGA 2PSFA 1LK7A 1Q2UA 3CX6A 5PGMA 5U4XA 2C4MA 1SELA 2RAPA 4IZ6A 5A4FS 1E6EA 2HN9A 4BFUA 3CPEA 4WDQA 3JZDA 4A2CA 4FCVA 3U3KA 2EZUA 2ZWIA 4JWTA 4V1CI 3I45A 1RZRA 1G2PA 2FR8C 2HMTA 4NJOA 4AMGA 2NVOA 3T7KA 2QD5A 2O4UX 1V8DA 1LTQA 2OBXA 4DMFA 1TD9A 3DQPA 4OMUA 1ZU5A 1E2NA 1O1YA 3L7LA 1KU6A 1Z3CA 1YZHA 2EIXA 3F6BX 5KWIA 2P41A 2L42A 4HNRA 3DQZA 1R8QA 3R5HA 1WMDA 4X1KA 3W4JA 2XOXA 3HGTA 4DLUA 4UVGA 3FZGA 3P5SA 4OM7A 1BX0A 3CVYA 3DDUA 2ZTMA 4PO3X 4GZ5A 1LWOA 4GOLD 1TE2A 1E9RA 2MSDB 1CJSA 1QM5A 1UBCA 3RVJA 1ZN2A 3K94A 4TKUA 1IN7A 3PPVA 1DAIA 4LJKA 4ZDWA 2JHPA 2D0IA 5IANA 4P34A 1YRWA 4GWGA 4JB0A 4QJIA 2FDRA 3ZVNA 1NJ6A 3OIUA 1EI9A 4CEHB 2D1TA 4EX6A 1RXUA 3VDRA 1DWUA 5CR9A 3TVTA 1Y8RA 5I7OA 2QB5A 4UD6A 1AQ6A 3WMXA 4NTZA 1KAMA 1NRIA 4F7DA 1L7PA 1KDOA 4GHWA 1IBKB 1GEGA 1IN4A 3Q2IA 4ZP1A 5DLPA 3WKBA 1Y1LA 2QVBA 3OD1A 1ISGA 4JB8A 3QOWA 3S2EA 4TTRA 1JT2A 1TMKA 1YDMA 2VHCA 4B45A 3ITKA 5IH7A 3WK7A 2EJVA 2EHJA 3LUCA 3M6FA 3H9GA 5DU2A 4OK3A 4ZT6A 4FIDA 1WCV1 4OOFA 3WL3A 5T3UA 4IV5A 5EMNA 1SA0A 2R7NA 1YF3A 3UQYS 4D8WA 1AS3A 2O5VA 3O9MA 4DR5B 3NEYA 1WB4A 3GLIB 3PNBA 3T4PA 1JDBB 3UW1A 5HS6A 1KS2A 1Y34E 5EKUA 5FA8A 3UWPA 4KB5A 4JOCA 4H4CA 4LBZA 3ESQA 1GYPA 1ZCJA 1QH8A 2XV1A 1U4SA 3CZ9A 4N0QA 2YS7A 2Z43A 2IL1A 4Q48A 3KKZA 3BD8A 5T4EA 1UPXA 1A5ZA 3B5EA 4FX2A 5E7MA 4QBGB 1DIAA 1K5HA 2GSWA 1E6MA 2W2QA 2R6GA 2W5UA 2WOJA 3EPPA 3NALA 4J7AA 4URUR 4UU8A 4XM2A 5PNTA 3NBXX 4GLJA 4MINA 5AQEA 2X0IA 1RWBA 2JLRA 5BV1A 2GKGA 1R4NB 3TAHA 1KMHB 3ZQKA 1G1MA 1R8SA 5FOXA 4ABYA 1OWOA 1Z18A 1PNVA 2CVFA 2LWIA 1ZCZA 3A58B 2FFRA 2QTLA 3CRQA 3FNHA 1NG1A 1CJCA 1ZESA 1Z4IA 1UP7A 2YY5A 5DXFA 3DP9A 4ZXPA 2MU1A 3KKNA 1MO3A 3IALA 2GF2A 2Z2ZA 3CNBA 3LUDA 2C03A 3FGZA 3K0FA 4R2HA 5EMJA 3TRIA 4F1WA 4L4RA 4QGSA 1WSAA 2OOSA 4OKNA 3D6NB 1SXQA 3QV1A 1THMA 4NC9A 2ZYRA 4V02A 4JYZA 2GFIA 1OI3A 2E4YA 3ROFA 3PG5A 2PXCA 2UUPA 1F8YA 1HPLA 5D5HA 4ETNA 5IXYA 2YV1A 3R5KA 1USVA 3NETA 1IFXA 9GPBA 2E7ZA 3GJXC 4C2AA 1KZ1A 3LUAA 4M8KA 1H2ZA 5KYUA 1QGDA 2R6DA 3PGLA 5I5GA 3WP1B 6REQA 4FS8A 4HAXA 2OUKA 5LDHA 1JZQA 3E81A 1AUQA 1ETHA 1P4AA 2QTBA 2XCQA 5LA6B 3OT1A 4FQ5A 1QGZA 4IOMA 1SD2A 2EFHB 1IM2A 3UPTA 2E4ZA 1H42A 2Y3IA 4FP9A 4MW5A 3ZLTA 2QXTA 2VRCD 3GD5A 4JT2A 3OKCA 5JAMA 1UPCA 1U04A 1V8ZA 2JIZA 4HKTA 4YV0A 2BMVA 2D13A 3DFUA 4DYDA 1CG6A 3R7WA 4RHUA 2KMLA 1MH1A 2CJWB 3T5GA 4GNRA 4RE5A 3NAQA 4RZ3A 1C3OA 1Z5ZA 1HC7A 2ZBUA 3B51X 5LZ5A 2C4UA 3BWXA 3CH4B 4P4TA 3O8NA 1AOXA 1SKYE 4O2RA 2VCYA 1FTQA 1IEWA 1JJFA 1VHLA 3JYQA 2ANBA 3VR6H 1FXWA 2BIFA 5FTJA 3VX4A 1Y63A 4L9SA 1CUVA 4G0NA 3KPUA 1DAKA 4LC9A 3GBPA 5JANA 5CBPB 1SXJD 3F6RA 3TKYA 1T4CB 1E98A 2L69A 3MELA 4Q4LA 1TRKA 3RQSA 3RK0A 1P1IA 1XZEA 2BGJA 3PSHA 5IKPA 4QUBA 2ILVA 3A6EA 5EYPA 4CFYA 2I67A 2ZITA 1ADCA 1LUAA 3N0WA 3VOTA 3EXEB 3K1AB 1QYCA 1M74A 3OQ6A 4C1NA 5JYEA 4TVSA 4MI1A 3GPBA 3QPUA 1T0BA 3FZEA 3VR5H 1RAFA 4GC9A 2A92A 2ZDGA 1EG7A 4KN6A 1XQ1A 1KEVA 4CIWA 4MPTA 2QAJA 3A4TA 1JSLA 3AUTA 4JR0A 1WZCA 2QRZA 4JT4A 4JXKA 2NXEA 3QYFA 4C22A 3SJAA 2R8YA 3N39C 2ZJ0A 4RK0A 4YJDA 2Q4TA 3JQ9C 1E4VA 5DMXA 1A8IA 3NHRA 1XTZA 4ZYTA 3NC0C 1PZEA 3AHDA 4N01A 2W2TA 3GJZA 4ADSG 1WY5A 2C58A 3HUDA 3B78A 4IIGA 4OJMX 4ZEOA 1ICEA 4BV9A 3LHSA 4G85A 3U4CA 4LS3A 3INYA 2IUEA 3FLAA 2HHHB 3R5FA 2R4QA 5IAAA 5IMBA 3MQFA 3HKDB 3OLXA 1J9EA 2RONA 3GFTA 5C0OE 4ACAA 4QLBA 3WGVA 2H1HA 3RAFC 1J42A 1NR5A 4K40A 5ELLA 4TRMA 1F60A 4HPJB 4AJLA 1IWOA 3EEIA 3OX1A 1NBMD 4FVTA 5HMLA 4H0FA 5I3ZA 3LUBA 2P9CA 1WSBA 2FETA 1JXQA 3CR8A 1DO2A 1MC5A 5LC1A 5COBA 1HDIA 3MB8A 1VI5A 2X40A 4NS1A 2WSLA 5JWOA 2WD8A 1NLZA 5DB4A 3ZY4A 4DDTA 5LD2B 4XIFA 3VHQA 3S0JA 2FEKA 3M0EA 3VYWA 4BX0A 4DG8A 3DBRA 5DASA 1J2UA 1SEPA 1TPYA 1O97D 2Z2JA 3OZXA 1L4BA 4GX1A 4YRZA 1F38A 2YWDA 3CVOA 4ASUA 2ON6A 3U37A 3ZW8A 1UQRA 3HJGA 3OPXA 3MGAA 1GGKA 1O96A 5COQA 4UU0A 2AMYA 1WDLA 3CNEA 4C0BA 4QT4A 2V6JA 3L1JA 4EELA 2YZKA 2PX0A 4GM1A 4LVCA 2HL6A 2IJGX 1EU1A 1FFEA 4EYOA 1GPUA 2QX7A 3M4NA 1FU7A 4NQRA 2CV1A 2DERA 1TEVA 5A2GA 4TMWA 5T4FA 2GJ4A 2UV8A 4C3UA 4G0VA 1Y3DE 3DEJA 4F56A 4EQ6A 1Z5UA 4MUNA 4BDSA 4EL5A 2WM9B 2FOLA 2UZ3A 1MO6A 2ZUUA 4UU1A 1TF7A 1C81A 3P71T 4GZ6A 3OHSX 3ILSA 3UHOA 2B37A 5ES3A 5FWDA 1I51A 1BVYF 3KJXA 4J1QA 5E9WA 4CG2A 3NOVA 3ND5A 4LF4B 4YWJA 2PT7A 3OZBA 2ATXA 2JCYA 2XNJA 1DV1A 3O4RA 5AHXA 4RU1A 1MC8A 3MAGA 3N2IA 2BKVA 1GADO 1AGNA 5TF0A 3RIYA 3T7CA 4CMJA 3EIHA 2B0CA 2X2OA 3KYDA 4KODA 3PDIB 4B6SA 1N0VC 4TYYA 2OLEA 3BL8A 2JLSA 3KJZA 1C8LA 1EZ4A 3QK7A 5E6UA 4BMYA 3RNLA 1GZUA 4LOJA 3AEXA 3V4RA 1W7AA 1JR3D 2WPDA 4QTXA 2Q5IA 4XUEA 5GONF 4NCAA 2O59A 2GCOA 5KNBD 2EFJA 4CN9A 5F1PA 5H59A 1N3YA 3MJRA 4JYCA 2GK6A 4I1RA 2AZTA 2B92A 4KQKA 3SE7A 2W7TA 1JQJC 2B4AA 2EC5A 4JEMA 4JD5A 5AVWA 3I30X 1GCOA 1W30A 1X8XA 5C18A 5D6NA 5HXAA 1H6CA 3EPRA 1FVXA 1Y7TA 2JK1A 1KZ4A 3VH1A 1PJAA 3AL3A 3DCJA 1IATA 3HBLA 1P0IA 3OCUA 5DEOA 1B6GA 1CB7A 2QXYA 2ZYGA 3EYAA 1P2TA 1QGYA 3LDAA 1WXIA 3UMRA 1AQIA 2NV0A 3RTBA 3WLJA 3ZPXA 5IJWA 1GGJA 1RYNA 4B7CA 1M3SA 1V71A 2QD2A 2VNJA 4J7XA 5B7GA 5B5SA 1ZGJA 1ZK0A 3T5PA 2QRUA 3TRFA 5GPBA 4IWXA 1NYRA 4FDMA 3RHTA 3EAFA 5FAKA 3QWFA 3U7QA 1GU7A 4I4TB 3ORFA 3IURA 2CXSA 3QIAA 3KQPA 5L7YA 2F43A 3R7AA 4BMPB 1QYXA 4BQQA 1TAUA 4ZI2A 1V0JA 4GLLA 4KYIB 2QTNA 1Y4DE 2ZJ8A 4I9UA 2H1CA 4AUNA 5KYXB 2GEUA 2JHGA 1IUPA 2F55A 4BRZA 2ZB8A 1SU8A 4RJJA 1G9XA 4NRDA 3W04A 2WSIA 1C3EA 3F74A 3X3HA 1DIHA 1JQLB 2C98A 1GLGA 1F4PA 5HE9A 1E2IA 1UMCB 4H3HB 1FVOA 1G7TA 1Z2PX 3SX4A 2CW5A 4D9JA 4DCTA 4P7KA 3M1IA 4JLJA 4MGIR 1QHFA 4YJHB 3L77A 1FJ2A 1THZA 3OQ1A 5C1DA 5EPUA 2HPVA 2JA2A 2KS6A 3ISJA 3JRNA 2W70A 3W2FA 4PZPA 5MFPA 1EB8A 5CNJA 4BNJA 5JS6A 3DZIA 4QM7A 3VSBA 2B30A 3VR5D 3SBDA 5ILGA 2I3BA 4YT8A 2DPYA 2WB4A 3RSZA 1T36A 3F6SA 4IM7A 3FTEA 4HF7A 2XT9A 1G5TA 1T0PA 1VE1A 1E9EA 3HCEA 4H0CA 5D86A 2XODA 2CNDA 3AB8A 3EIOA 1T4MA 5LBTA 3KPYA 2DH5A 1EUDB 3N1UA 4MR7A 5DYGA 4CFZA 5L3VA 3RFFA 4DLBA 4UCFA 4LMAA 3JTEA 1QX4A 3DAFA 1LD3A 1VYVA 3GLGB 3KQKA 4G24A 2YIVX 3K4PA 2BRUC 1L6RA 3KR0A 2YFKA 3BA6A 3LA6A 4LXHA 2HK8A 4A0GA 2C7PA 1Q7RA 1F1JA 4CUKA 1XCOA 2QKYA 5G0WA 1IQRA 2ZSEA 3TW6A 2UYCA 3DT6A 3WV4A 2F9LA 4YQEA 1K4MA 3MLEA 2WRZA 3RFXA 4CKCA 1ZWKA 4NCBA 4H7PA 2XGGA 2ZUCA 4KNYA 3NH9A 5E1BA 5GMOA 2A67A 3LOPA 4A16A 1MGOA 2Y71A 4GGOA 4LZJA 3H0KA 5IM4A 3CLRD 5EPEA 2IPNA 1OZ0A 2FG5A 2YXNA 1I6MA 2FW1A 1N9ZA 2O6HA 4RMJA 3DFZA 5EESA 3VC7A 3WFJA 4D57A 3CG4A 4H16A 1AXRA 4HLUC 4ZYXA 2J3DA 1JHAA 2I2XB 5HK9A 2NO0A 1F3LA 3LBFA 1X7GA 5B37A 5IAOA 5BN4B 4AUEA 1F8FA 3J81A 5J5VA 4KHZA 5FFMA 1G8FA 4MMXB 4UW9A 1GG9A 3OWHA 3AJDA 1OXUA 2PKXA 2H3HA 1P73A 3B2EA 1KQGA 5AK0A 4UTRA 3C7TA 2D2XA 5AI8A 1QDLB 3EDMA 2AEJA 5HNKA 3PEWA 4YJGB 2BZGA 3NP9A 1NLMA 2ONJA 5A4IS 1L5YA 2GEBA 1TYCA 4HDRA 4JQZA 4M49A 3TSZA 1IHXA 1XDDA 1ZOOA 3LY7A 1DTEA 1G21E 4OHPA 1PJ4A 3CCCA 4MQBA 2BFAA 3CH7A 4IS2A 1FNBA 2DQZA 3PC6A 1D9XA 1DQYA 4HVAA 3SU8A 4YRQA 1FSGA 5C8VA 1RP1A 1RFLA 1X92A 4I99A 2FWBA 4ZDJA 5ITZA 2WHXA 3A25A 1NVFA 2AI1A 1KZ6A 3PGVA 3H1GA 4WXRA 3ED1A 5LIPA 5KYGA 2JGDB 3FLMA 1RAGA 1QRRA 4DV2B 2E5LB 2QRLA 2AN5A 3RS7A 1Z45A 2PFSA 3IB3A 3OZUA 1DE0A 4L15A 1TPZA 1X9HA 4M9CA 4H4DA 1RYHA 3C43A 1AKMA 1NBHA 2TRSB 4OFXA 4XYBA 4I3HA 4FZ5A 1Y9AA 1UDCA 4ND1A 4N3BA 4ZCPA 4YGXB 4PYJA 1Q95A 1YNSA 3E7XA 1B6TA 4RD0A 5IKEA 1N8NA 4QBTA 2IS4A 4G8DA 4YECA 3GJ0A 1U7TA 2RKBA 4ZQIA 1LBTA 3GL9A 1FRQA 3HABA 1IUOA 1S7GA 4JU8A 5FI5A 3UBMA 3S68A 2VDVE 3PC8A 4EA7A 5HP4A 1WPRA 5KOHA 2ZE7A 4XVQA 1HBJA 1MV5A 1NLYA 1UDBA 3P0HA 4H31A 3LC2O 4LECA 4RMIA 4DPLA 1A8SA 4WY8A 2QAGA 3EODA 5DWDA 3NFRA 1XCMA 3CZAA 2F8SA 1GA6A 5HKLA 1FFHA 1QTIA 2FFQA 2C9YA 3SZRA 4RJIA 5I7HA 1J0CA 2IEZA 4TTQA 3DDNA 1W8DA 2ET6A 2NGRA 1JP7A 1G18A 3DEFA 4S0ZA 3IR6A 2Z83A 3H3XA 1U11A 3UMFA 4HYYA 3E3NA 3ILXA 3AEUB 4AN0A 1PNTA 2YW2A 1GLNA 3OFNA 1I3NA 3M6XA 3RT7A 1NUQA 2GK7A 2HGSA 821PA 1BDHA 2AN3A 3LUPA 4W5HA 1WP9A 3CS3A 5LMZA 1J25A 3UK1A 4Q3OA 3OEHD 1GU0A 4Z8YA 4CDGA 1IEQA 4P38A 4PZ9A 4BZWA 5FTLA 2J9YB 5JMWA 2KBEA 3R0ZA 3C5VA 4FSXA 3SFZA 3T7RA 4QL3A 1Y7PA 3M1YA 2P8JA 3MFYA 3THWB 1S3SA 4GT1A 5TLSA 2GS9A 3N0XA 1FLAA 1QTRA 3S6JA 3WX0A 4KTVE 4LYDA 1U3VA 1PLJA 1ZNQO 1JHPA 3WFZA 2NXWA 5H80A 4G2TA 2JIZD 4ICIA 4K3VA 2VA8A 2XADA 5B3KA 3K1JA 5LFAA 3RIMA 3KB6A 2BP7A 3PC7A 3WA6A 5IU6A 2C54A 4II7A 3UMCA 3BX1A 2X9LA 3AJEA 1X87A 2FZWA 2XUZA 4JWKA 3GFVA 3QWBA 1JEYA 3HVIA 2EQAA 1ZHFA 4UHFA 2IW3A 5JZSA 3SR0A 2PD6A 1F5NA 5CYFA 2ZU0C 3N8KA 5JXHA 4IHJB 5K45A 1YZUA 2IOHA 1DC5A 3RFVA 5ADHA 3BSWA 2I9KA 2VBIA 2HIHA 3LUJA 5DKFA 3H1FA 3STXA 2PFKA 2JLYA 4MEJA 4F6RA 1R9JA 5JZMA 4NE7A 2HU7A 1SWWA 1FP1D 1MRZA 3HHEA 4LJ5A 3SDSA 2QUKA 3CW8X 3HB0A 3I4FA 4EVRA 1LI5A 2FQ1A 1KJWA 2FR1A 2VJKA 2FH5B 3EEFA 4IHAA 2HV8A 4RSMA 3U3XA 5KQSA 1JI3A 1HETA 4RVSA 3LLUA 3KEFA 3QLEA 4TKVA 4HGOA 2GDJA 3IBCA 3BRWA 5DZSA 1K98A 3TMYA 4EA6A 4KPYA 4N5DA 3C24A 3INGA 3OQIA 1B3RA 2B5WA 2HFKA 3A6JA 1XA4A 3KP1A 1AN0A 5AJXA 2AR9A 3A9UA 4B3SB 1KNXA 1KI9A 4KVGA 3ZK9A 4L9WA 3NHJA 3C1AA 2OVBA 1EJBA 3CKKA 4RDIA 2B36A 4EP1A 3VZRA 4MARA 2Z6VA 4KXWA 2VBGA 3LT1A 3U1BA 3FETA 3MJVA 1BKSB 3KKEA 2B25A 3RS8A 4JB3A 5JEDA 3N87A 1HE8B 3OCYA 3PU6A 4I8XA 4ND2A 3RCBA 3X1YA 3E5HA 3USZA 2BH2A 3FBGA 4ESEA 3LP5A 1SB8A 1OGIA 4EGJA 2I6UA 1DG1G 4IHQA 4OXRA 5BNTA 1KAEA 2AR0A 4ZI3A 3AVOA 5D85A 2KWIA 2OUIA 2P67A 2PR2A 4Q4HB 4BO1A 5BN1A 1N32B 3A70A 4CTOA 2I8LA 1EFVB 1M2FA 1N2SA 4TX1A 3T34A 5F7ZA 4XYLA 1ULAA 3AF5A 4DXHA 2DPMA 1JEQA 1MFZA 4IOJA 2BCGY 5AVQA 3M83A 1LRJA 1TVMA 1LPNA 3CHYA 3NXKA 4YROA 1N2JA 2VBFA 4OFBA 3ZGXA 1EZ1A 1XG5A 2X9GA 4G5SA 1AKVA 4P2GA 3H11B 2PLAA 1DEXA 5KINB 1WKCA 2WTMA 3HEBA 1R88A 2BUCA 3KK0A 3SF0A 1BWPA 3GLUA 4WZZA 1YD7A 1Y8AA 1YIDA 4H60A 3SQLA 1BYUA 3GN2A 4FFRA 2VK4A 5TGZA 4JBYA 5IASA 3F6CA 4LTNA 2VNHA 4HRVA 4AYTA 4UM9B 5IUJC 2GCIA 3HA5A 4KYVA 5AM0A 2IYUA 3GT3A 4JENA 4N54A 5FPHA 1VSBA 2HF2A 2Z58A 4HMOA 4X8LA 4LUCA 2VQEB 2AFIA 1VMEA 1YDHA 2BTQB 2OXRA 2YL2A 4MRMB 4U8HA 3W6NA 4EY8A 2YJNA 1XTVA 5BRAA 2Y1EA 1INLA 4B0OA 3TBFA 5KX5B 1F7VA 1G8AA 1FS4A 4PVCA 4MHSA 3CH5A 3KT0A 1OYWA 4MDYA 3GROA 5AW1A 4AD8A 3FSGA 3I2IA 2RG7A 1NN3A 3LPMA 3C70A 4LSMA 1ZX1A 4U39A 3H6GA 3TM4A 1ESZA 2PN1A 2WAYA 4AK9A 5JNSA 3UMYA 3F4LA 1LF5A 4DCUA 4NBWA 4OLBA 1B8NA 1T6YA 4CQLA 3EGEA 5HIMA 1VL1A 2GZDA 1S6YA 2WFLA 5FWAA 2INGX 3OM1A 2PJZA 4GL2A 1J1ZA 2H29A 1K5PA 2Y6VA 2BEWB 2IQIA 5KYYA 2IHZA 4YYEA 5IT0A 1LLQA 4MTLA 4FCTA 4P5PA 3RB8A 1PV4A 1EJ2A 2Y1WA 4JS0A 1DRJA 2EEPA 4TXLA 2OV2A 3AJ9A 5T6BA 6LDHA 2JJ2D 3DE4X 3EA5A 3PXBA 3G2NA 3I37X 3L6OO 4GMDA 2W98A 4OHUA 4TTJA 1A50B 1RM4A 3T61A 4D0LB 1AQUA 1XLTC 2A9FA 4B3GA 2IEBA 3I2JA 1HLDA 4F04A 4ZT4A 2XQKA 2HQSA 2XX3A 1QVVA 3P20A 2QM8A 1H94A 3UJ8A 4J07A 1AA6A 4B6OA 3C45A 1UEIA 4QDZA 2CFCA 5HFAA 3W2GA 3AHCA 1KA9H 1WUJS 1LPSA 3U4QB 2R62A 5G4KA 5TPWB 3H5WA 1U9IC 4U63A 1E60A 4O8ZA 2AMJA 4ZCTA 3A2LA 4P8RA 3IIIA 4EUKA 4CU2A 1ZM4A 3V97A 2O14A 1XD8A 2N42A 4JP2A 4J3NA 3I0ZA 1YSCA 3H7IA 2CZQA 3U9TA 1C9YA 3RM3A 4ZYWA 4QEDA 3W4KA 4AKHA 3EFOA 4K81B 4HB0A 4BX9A 4POAA 2DY1A 2YQ4A 1U0EA 1TFRA 4MHOA 2OV3A 3IJEB 4K03A 1US8B 5ITSA 3AKZA 2ZS7A 2DHQA 1KZ9A 3RO7A 1JFFA 2P30A 2X86A 5KNCA 1XXHA 2V0CA 2QMZA 2RH5A 1U0NA 3E6AA 2AMLA 1A7JA 3GRZA 4QVGA 3ZEAA 3CVVA 3H4IA 1D1PA 4BVGA 3D0KA 4HXYA 4FGLA 4KFTA 4U7JA 1O94A 4C14A 3I76A 1GL7A 1MO2A 2AK3A 1Y3BE 3F6YA 4ZKEA 5F4ZA 1OLXA 3X2EA 2OR3A 5F35A 2CEAA 1E3JA 2Q5LA 3G59A 4WBSA 3ZE2B 2A1UB 1K0FA 2YJGA 1AO3A 5EUQB 1YR2A 1KO8A 5TGTA 2OKGA 3HXTA 3GRRA 3T95A 1RRFA 3IQWA 2ECQA 3H5NA 1E18A 3KLBA 3KV3O 4G1FA 4LBWA 1W0CA 1E2UA 1M6WA 2Z04A 5IHXA 4ND4A 5DYIA 3LCJA 4DJJA 5BORA 2VN8A 3IAUA 4MVJE 3B48A 1Z06A 2CYAA 3MTJA 1ZA1A 4FMBB 5TF4A 3MTEA 1M5TA 5KTNA 2AFHB 2FP4A 2YVKA 4DV6B 5K3AA 4O3MA 1QWSA 4A91A 3P2OA 2PE5A 3FRHA 1X7XB 2C8LA 2BMFA 1PWHA 3L8HA 1Q91A 1TIKA 3FGPA 4IXTA 3L8EA 3K6JA 4J16A 3BSYA 1ECCA 3QPWA 3ZWXA 3UO8B 4EBBA 4JT9A 5H68A 2J5XA 1QANA 1LF0A 5D7NA 3B3QA 4X66B 2IV3A 2J3EA 1NIPA 2ONZA 1CY0A 1O6BA 3O0DA 4BVKA 3BHJA 3MCVA 3UUWA 4UHEA 3HVRA 2D7CA 5KKAA 1BZYA 3ZXXA 5J2TA 1L5QA 2ECOA 5AHKA 1SBYA 2Q6KA 2XLBA 4TL9A 4D92A 2HDHA 1Z4NA 4JIGA 5HX7A 3P9IA 5EKSA 4BBJA 2WTBA 4M6WA 5DP2A 4BO5A 1G3IA 3OIYA 4HDNB 3DOCA 3DR5A 4RVUA 3AIOA 1X13A 3ROTA 4DCMA 2R6AA 4MKHA 1R0XA 2JIQA 3U7RA 1PV2A 4ROTA 1GTSA 3KCNA 2HCBA 1NMZA 4EO9A 3A7DA 2HBYA 1U2GC 2XIJA 4O3FA 1NW4A 2LR0A 4ZU3A 3NORA 3MJSA 1FMTA 4MB6A 5DF1A 2NNLD 3MIZA 2FWAA 3BZUA 4BYGA 4LZAA 4RGYA 4MIEA 4M7PA 4WK6A 1ATZA 1KSFX 2JH3A 4XDYA 2C95A 4JJFA 4P33A 1I3MA 4D9BA 4J0EA 1V5EA 2L0XA 4L4XA 1USUA 4FR2A 1V47A 3IKLA 2W6PA 2VHUA 2Y9MB 2GFQA 4GPD1 2JBAA 2XRMA 3P32A 5K3EA 3E70C 2FSSA 3OQJA 3Q40A 1URPA 1GA4A 1MPTA 1NW5A 1RRVA 4P2BA 4V0SA 1MJ5A 4JAVC 5IARA 5LB2A 4A73A 2O2YA 4FFBB 2C5AA 1PR6A 3IC5A 5AKYA 3PNSA 3PUJA 1GGMA 2XXBA 1N6KA 1ZD3A 2CUTA 4R9VA 4E13A 1QS0B 4J49A 4YCBA 4C1BA 1J39A 1T4GA 3VC2A 1Q7GA 5L8VA 4HN2A 2BBSA 3L7IA 2N75A 2PLNA 3WNCA 4EO4A 2WD9A 3HYCA 1QYRA 3DHYA 1MT3A 1J07A 1WS6A 1HO3A 1IBSA 2D2VA 2FMIA 2PX3A 2Z5GA 3IP8A 4GOJA 1FPQA 2AD1A 4HB2A 1BCRA 1WCIB 3HADA 4JY7A 3VZQA 5H4GA 4CLRA 2HW8A 5JSQA 2B35A 5AVXA 5JQGB 4LBYA 5EKTA 2JFPA 3FW1A 1THGA 4FYIA 1T2FA 1NW6A 5EKXA 1SQ5A 3TTWA 1G98A 3HPQA 2G77B 1E9CA 5EXEA 3LDFA 4ZEWA 2X4DA 2ZYWX 3G7SA 3P9RA 4C7JA 5L45A 3KIPA 3AGQA 3OMLA 4FUQA 1JKMA 1DPFA 1SXJC 1S4MA 3I09A 2X4LA 4AF8A 3MW8A 4XJVA 3N86A 4RVFA 1Z8HA 1YE5A 2A9JA 2Y1LA 4JBLA 1ZICA 3NVKI 2WT4A 1KKLA 1HK7A 1M0TA 2JF0A 1CZNA 4QWMA 4EY4A 4WFQA 3O3MB 4AJHA 3IEMA 1OQAA 1E4EB 3CKMA 5K4HA 1VA5A 1NBOA 5IABA 4RTJA 2ZFUA 1LSSA 3W5JA 3ECCA 3UMJA 4DC9A 1XZGA 1G4HA 1Z16A 5ULLA 1H69A 1ODJA 3HM9A 1XRQA 4KXLA 4WI1A 1MJHA 2B78A 2Z30A 2A58A 4GVPA 5A2QA 1PL8A 1T3GA 3EZYA 3OFND 3VOBA 1O54A 3GP3A 2OGUA 4K9KA 2JC3A 1NQTA 5KJFA 3EEOA 1OAOA 2VF5X 1OC4A 3A3NA 3GLQA 1PUXA 5A5DA 2O2DA 4R81A 1EE9A 2VDJA 1ZH6A 1GUFA 4OSOA 1MDFA 3JWGA 4HUQA 3DH0A 2NU7B 4KQEA 4TUYB 4B2YA 3B3JA 1DJMA 1G7RA 1LJLA 3GLHE 1BIFA 4B82A 2XIQA 5BT8A 3EUEA 3D6HA 1CYDA 2PUWA 3OKAA 3DKPA 1W36D 1U99A 4MW9A 3OESA 4CE6A 5D8DA 3P1JA 3A7EA 2IIVA 4PRKA 4YB8A 1J2YA 3R23A 2LBPA 3AOEC 1JU4A 1QE0A 2BDEA 1XP8A 1KFCB 3PNQA 3HHPA 4IIEA 1NL3A 4YK7A 1U2RA 4AT1A 2GD2A 4RF2A 4J0DA 3NBQA 1ZR4A 1IU9A 1NJ8A 2MSCB 4KK3A 3HL0A 1AS2A 2Q99A 1G63A 2FX2A 1ONOA 3EQ9A 5AM1A 3PFGA 2FPMA 3O90A 4QULA 2QTMA 1TGVA 5FNVB 3CUEF 2ERXA 1B0ZA 1D6MA 4P4SA 4TVKA 4WUTA 1R9GA 5AJVB 4B4VA 5BXYA 1SK9A 5LM3A 3AETB 4G5RA 1UKAA 1IY0A 1XROA 4X1YB 2V98A 1WRBA 5EZYB 1SXJE 3B5IA 1N5DA 2VTBA 1JQEA 1O97C 1RKBA 1YR1A 2JFBA 1FP4A 2QN7A 3SHFA 4L85A 4B6FA 4EHAA 2BGWA 2H1OA 1ZBDA 3WV5A 1H1LA 2PCJA 2Y8EA 1YT5A 4ZV9A 4JHLA 2I71A 4JC8A 5T6MA 2WU0A 2XITA 4U2CA 3HY6A 3DBOB 2I1WA 3L0PA 3RBXA 2OCXA 1D6NA 1O5OA 1P1BA 1JG2A 3I1JA 4TLMB 2W8BB 5E4FA 2AZMA 4HYTA 3ZGVA 2BJHA 1EB9A 4W5RA 2V3WA 3W5CA 5I9TA 2A1TS 2ISQA 3ASYA 3I9FA 3IR7A 1Z63A 3CNQS 1DJNA 4TLEA 1X7YA 4O2AA 2QT9A 3E58A 4MVJP 1O95A 4OIFA 5MN5A 5T4BA 1CJKC 5IBCA 2WTXA 2Q3LA 1RWNA 3M1LA 1IJKA 6ADHA 1OH8A 1UCFA 2I6QA 3BRSA 1P9LA 1M5RA 1PFGA 4ZGBA 4H7JA 1Z17A 4XLZA 2XKBA 2G5GX 3QPCA 5E1MA 3SK0A 2EG5A 3NV9A 4DSZA 3MXOA 1FSSA 4YLGA 2A14A 1Z82A 1L5RA 3LUFA 3RLIA 4DBVO 4R1MA 4QOJA 1UAYA 3OE5A 3TXYA 4BASA 4ZVNA 4MP8A 5BV2P 2P1RA 4HNQA 2QD4A 2B8WA 2QTCA 2PRJA 4NFSA 3BIFA 5K8JB 2I91A 1K6MA 1I32A 2O3QA 4XX0B 2WJAA 2V1XA 4OSPA 2GJ9A 2EFCB 2B6HA 1M34A 2RH4A 3IAM1 3N2KA 4G0QA 4JDUA 5JYCA 1V45E 2IIPA 4PC7A 5CM8B 3IDQA 3C3WA 4ENUA 1SBIA 2DJIA 2MYPA 3BB4A 3FI0A 3GGJA 3FOBA 4JFRA 5ALLA 3K0HA 3RRXA 1PKXA 1QDUA 1Z83A 2W2KB 2YWRA 2NU9A 3A6GA 3DZGA 4G0ZA 4WWHA 4YFYA 3RK4A 4A36A 3HC7A 2ZSDA 2WWIA 4YA6A 1JKIA 2QUIA 3SFTA 2R8RA 4EG7A 5E7JA 3VQTA 4KAAA 1XNRB 1DMSA 1JF8A 2GWRA 3D3WA 4KVZA 3IPXA 2JAHA 1HDZA 2ZG6A 3CE9A 1ZR2A 4DSUA 3TCKA 2F48A 4KOAA 4HFRA 2W2PA 4TL8A 1N9GA 4BLWA 3L3BA 4RACA 4HTFA 4OLFA 3RYFA 3U3ZA 2YICA 1R0CA 2AIRA 4DSAA 3CURA 1EWQA 1XALA 2MR5A 3EEYA 4IG9A 2XNHA 3MBOA 1A82A 2HSZA 5TRTA 5LZ2A 3V2GA 1Q19A 1K2WA 1P0FA 1L8XA 3QLJA 4CPDA 2WD7A 2X5OA 4N65A 3FSGD 1Z7GA 1I2ZA 4KE9A 1AU9A 4QFMA 4QRIA 5DT2A 4KQ2A 1EG2A 1BNCA 1HE1C 1MHPA 5LQUA 2HD4A 1CF4A 3P9KA 2VFAA 4HQ0A 4JJAA 5K99A 3A10A 3T9EA 4URZR 2YWFA 3L7JA 5JH7F 2A0WA 3COWA 1RKVA 1HT2E 3HKCB 4IY1A 5LMCA 2YYYA 2WFMA 4O4LF 3HA2A 1CRPA 1MABA 3UJAA 4EOGA 2FGJA 1FS6A 5M5BA 2Q49A 2ZI3A 3ZWYA 2X9VA 4MYCA 3ZD8A 1RBMA 4PQFA 4BC1A 5HUQA 3I2HA 4KQCA 2EJCA 4BJ3A 4HI0E 4K46A 3GV0A 4UE3S 2GVDC 5THXA 2DCMA 1UFOA 3EXG1 4MUFA 1A5BB 2XQJA 3F8TA 2XRYA 4HGRA 3IYLW 2JANA 5AI4A 3RIXA 3G3EA 3UUEA 4BN5A 1E69A 3AM4A 3ICPA 4LEIA 4XR9A 4CGYA 1CQJA 4LF5B 3P94A 3GGCA 1KI8A 2HA5A 5CDSA 1RYZA 2BGGA 5HHTA 1KPHA 2J9GA 4HNSA 3KYBA 1RWQA 1IK6A 3KJHA 3M33A 2PMKA 5EWLA 4CG1A 5C35A 1FYWA 2LGJA 3KFXA 4MKXA 2ZZMA 1VI6A 2ADMA 4P98A 3WJAA 1LNZA 3ICEA 5BSUA 2HNBA 4V2UA 4XH9B 1BCSA 3WYCA 4BMOB 3K4HA 4IDPA 2G82A 4EI7A 3M70A 3BN3A 3EDYA 5KPJA 5GIPE 3CLRC 2O7VA 4NE2A 3A6PC 5GZ1A 3C6ZA 3LLVA 4LOHA 2X9QA 1I3LA 2ZTLA 3AQIA 3GNLA 2VZ9A 4U00A 4XVCA 4BIIA 1P7PA 1SCUB 3AHFA 4TV9B 5KNCD 3IEIA 2PS0A 3KT6A 4UDXX 5DIFA 4Z4EA 3QVMA 1VLMA 3E1SA 2I03A 3N5CA 3CA8A 3HO1A 3BRCA 3NBYC 4HNGA 4YAOA 4GPIB 1O8CA 1V5FA 3ZYZA 4OYLA 4N3AA 2A5DA 3LXRA 1O94D 1TZ2A 1GPMA 4NU6A 2GYYA 2O05A 2ZYTX 4EKGA 5IF9A 1IULA 1PO7A 1TTHA 3FMIA 2EGHA 3QFRA 4C78A 3AB3A 2FE1A 1Y5LA 2QN6A 3BD9A 4LVNA 3VU9A 4HVLA 1P4RA 1HEIA 4WADA 1Z4KA 3BBPA 1GD1O 2BDUA 2Z8YM 3CLHA 3G5LA 4MQEA 5LUAA 5LDGA 1X15A 3P7MA 4Q05A 1IHPA 2AF3C 3ADBA 4MKIA 5J4KA 3RC7A 4HS4A 1QQ6A 1DQNA 3KG2A 4L9AA 1OVGA 5AXAA 5B57C 3C6QA 4P32A 1DKOA 3RIHA 4RVGA 4Z7NB 1YR8A 4QJBA 3NC4A 4QG7A 4CM9A 3G0DA 5JXJA 2RHWA 5BN3A 3PFFA 2I6TA 1PZNA 2OHVA 1YQWA 3A4NA 3VPGA 4F97A 3KOWA 5AW6A 4HZUA 4G1VA 1YDWA 2XYHA 3JALB 2YXEA 1XOIA 1X80B 1Z0JA 1Z12A 1KP2A 3IIMA 3KT8A 4GGPA 4FSDA 4LPSA 3ZWNA 4B74A 4F85A 4YX9A 1Q1ZA 3TWOA 1X1BA 4BECA 2JIBA 5JU6A 3TBKA 4HAOA 2C84A 1VL6A 2GZMA 3BGDA 1SKYB 4I1UA 4YRBA 2CEKA 1SURA 4K6GA 3NIGB 5JTUA 2A33A 2OGZA 3ZY2A 2OCLA 1WDMA 1Y1RA 3TJMA 3H42B 1N1MA 3M6AA 1SCJA 1I2DA 4JH0A 3PGA1 2X23A 3WNBA 5LQCA 2IH4A 2R6JA 1LU9A 1XHEA 3T1OA 5K0BA 3MC1A 2O3SA 3PR3A 5DM0A 3SJUA 3AUSA 1AM4D 1ZL2A 4PO9A 1AX9A 5HG0A 1WPXA 2FYTA 2DR3A 1JG4A 2O0LA 3QFCA 4MS4A 3IOEA 3NHWA 4BE7B 1YNOA 4CIBA 5HCNA 1YBVA 3MTBA 2W6OA 3ZDQA 2GK4A 4JVOA 4MVYA 4NAUA 4P54A 1H66A 3TW8A 1B76A 2FZ4A 3L9WA 5GWXA 4CTNA 1OC2A 3OQHA 1KP3A 4JGGA 4TPKA 1OAAA 1T26A 1D8AA 2QBYB 1ZO8A 5E8RA 5C3MA 5IZCA 2GPTA 3ZWBA 2Y2VA 4ZICA 1PQ4A 3NKLA 1GZ5A 1UJCA 2UVDA 4IO1A 4ETIA 4WBNA 2FFHA 1A2OA 1MKYA 2D8AA 3LBIA 4IGAA 1F2UA 4UVHA 5TDHA 2V0GA 1AVTA 4GRAA <