5K0FA

Crystal structure of comt in complex with 5-[5-[1-(4-methoxyphenyl)ethyl]-1h-pyrazol-3-yl]-2,4-dimethyl-1,3-thiazole
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
219
structure length
219
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 80
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0fA00
3C3PA 3EVCA 4GOLD 5EC8A 2ONZA 4FZVA 4YUXA 4YMGA 5MHTA 2IIPA 3R3HA 2HMYB 4EK9A 3TQSA 3OFKA 3GU3A 4KDCA 4KRGA 5M5BA 4LWOA 3MCTA 3NVKI 4C07A 4M36A 1R8YA 3EVGA 1AQJA 4A6DA 4CKBA 5FHQA 4MQ4A 3PX2A 4R8RA 3FUUA 1RI2A 3KQSA 3NW9A 2BZGA 1WG8A 2PT9A 5EOVA 5FWAA 5IH3A 4QQNA 5DXJA 3T7SA 5FA8A 2FYTA 2GS9A 4ER5A 3R9XB 3GRUA 3CJRA 4NECA 4ER7A 5E1OA 1G60A 1DUSA 3G89A 3GDHA 2PT6A 3PB3A 2AOTB 4LECA 4ISCA 2P1DA 4PYIA 3DXYA 4WXHA 4QDKA 4P7GA 4C05A 3DLCA 1G55A 4LG1A 4M37A 2IH5A 2IFTA 3EVZA 3FUVA 2VS1A 4PGGA 3ERCA 1BKYA 5E2AA 3KQOA 3MTIA 4DA4A 2Y1WA 2R6ZA 2QYOA 4QPPA 4PYLA 1IM8A 3V97A 4RTRA 3I53A 4C4AA 1NT2A 2HV9A 3GRZA 3OE4A 1L3IA 3UJ9A 1BHJA 2GH1A 3CJQA 5DX1A 1AV6A 5B1SA 4F84A 3RIEA 5LQJA 1AF7A 1O9GA 2PWPA 5EKUA 2PWYA 3QOWA 3ME5A 2C7QA 3C6MA 2ZSUA 3FTCA 2FK8A 2OO3A 2HR1A 2YVLA 3A7EA 2AVDA 3UWPA 1L3BA 3B3GA 5E2BA 3P97A 2NXCA 2XVAA 3EVAA 1JSZA 5HEKA 4E2ZA 2JH9A 1XDZA 2JG3A 2IPXA 3V8VA 2IH2A 1OR8A 1JG1A 1XTPA 4YV0A 2B3TA 1NV8A 2ZIEA 3NVMB 3P2KA 4R6WA 1TPYA 2YUIA 3GRRA 2AS0A 2F8LA 3B3JA 3E8SA 3FTFA 3Q87B 4R05A 2YXEA 5CVJA 3AXTA 3DP7A 1ORHA 4QDJA 2P3OA 1NE2A 1JTEA 3CJTA 4QQKA 1P39A 1QAOA 3TLJA 1TW3A 5KS2A 4MIKA 4OBXA 3G2PA 4PONA 1PJZA 5EIWA 3G88A 2H11A 4X1OA 4V0QA 1EQAA 3SX0A 1DCTA 5K0GA 2JH8A 3CC8A 1ZGJA 4BLVA 4EVIA 2LD4A 3ER8A 3LGAA 2NP6A 1YB2A 4GC9A 3TR6A 2EFJA 2BR3A 4H0NA 4C03A 5EMJA 2IGTA 3D2LA 4P7FA 2G8NA 5F2KA 5HFJA 1RJDA 3KPYA 3DR5A 2CKDA 3MGGA 4LWPA 3ELYA 2AOVA 3FUWA 2YTZA 3KR0A 3LCUA 4B17A 1NBIA 2Z6UA 1XDUA 2PXXA 5FUBA 3HCFA 2WA1A 3P9KA 4KIFA 2IDJA 2ZTHA 1QAMA 4KW7A 3PVCA 3B7PA 4HG2A 3LCVB 4PGHA 1FPQA 2ORED 1Q0TA 3MHTA 1R00A 3FPJA 3HCDA 4PIPA 5G02A 3SGLA 2OBFA 1BOOA 4X63A 1MJFA 5K0EA 1INLA 1RI5A 2AR0A 3P9CA 4OBWA 3HVHA 1YF3A 3LX6A 3LKDA 5DWQA 4RTMA 5GOZA 4CXMA 4OQDA 4XUEA 4BLWA 4PYJA 3DULA 3P71T 4E2XA 5GP1A 3EEYA 3ID6C 5IKMA 4RX1A 3ER9A 3KQTA 1RI4A 4PYKA 5JUWA 3AY0A 3BT7A 3P2IA 2FPOA 3KR1A 1X1DA 4RVDA 1KR5A 2P40A 3BGVA 1B42A 1X1AA 2PY6A 4DMGA 4FR0A 2O0LA 1F38A 3FRHA 3BWBA 2AN4A 3KQQA 4MHTA 1Y8CA 2ZBRA 5E9JA 4AZVA 5K0CA 3GGDA 1PRYA 1JG4A 1X19A 2Y1XA 3LKZA 3UFBA 1RJGA 1SUIA 4A6EA 1X1CA 4P7KA 1VLMA 3OZRA 3RODA 4P7JA 1VIDA 2AN5A 2CMGA 4BLUA 3HVIA 4EKGA 4YUYA 3LBYA 3CVOA 4Y30A 2AOUB 2AOUA 2GAFA 1O9HA 3IV6A 2VZ9A 2DULA 3KQPA 3MCZA 1RI1A 1WS6A 5DSXA 1P1BA 3DMFA 3IHTA 4QVKA 3A27A 3EVFA 3B3FA 1FBNA 3ELWA 4PCLA 5HILA 3BGDA 3FYDA 2PBFA 1KYWA 2PSSA 2XBMA 2IP2A 4QVGA 4YMHA 1KYZA 2IBTA 5GIOE 3U81A 2QM3A 2ZZNA 1JG2A 5CVDA 3H2BA 1YZHA 3UBTA 3THSA 4DM3A 2P7HA 3LBFA 2H1RA 3SR4A 4V0RA 3I5UA 3EGIA 3JWJA 5DPMA 1XCJA 3I58A 3NTVA 1UWVA 3FUTA 3OZSA 4XUCA 2B2CA 2XYVA 1SQGA 4WVLA 5KVAA 2BH2A 3UJDA 2ESRA 3GXOA 4IV8A 2AOTA 3VC1A 3HM2A 5ICFA 1JR4A 5ICCA 1XJ5A 2PX4A 5C1IA 5BXYA 1XXLA 5GWXA 4E32A 1H1DA 3B5IA 5E9QA 5HIJA 5K8VA 3HVJA 4UOEA 2V74B 3DMHA 5EZSA 4DZRA 3DXZA 3PS9A 4DCMA 3OPNA 2OYRA 2QRVB 2QRVA 4C04A 2UYOA 3EVDA 1R74A 3FZGA 3E05A 3M70A 5ERGB 3PFHA 1JG3A 1NBHA 2P3QA 5CCBA 4RTOA 1NV9A 4AZSA 3KR2A 4QPNA 1EAMA 4POOA 5CUQA 4GEKA 4OQEA 4FSDA 2PX2A 3JWHA 3I64A 3FYCA 4GQBA 3FRIA 2AOXA 2WK1A 1V39A 3GRVA 4HRAA 5FCDA 4ER3A 1EIZA 2YXDA 1KPIA 2VP3A 4G56A 5EHIA 3WSTA 5ICGA 1I4WA 2HWKA 3KQWA 4RTNA 3P9NA 2JHPA 1N7IA 4XUDA 1SKMA 5ICEA 1R8XA 1M0EA 4YV2A 3HNRA 3EGEA 1YUBA 1VE3A 3IEIA 3EMDA 3OCJA 3CBGA 2BM9A 2ZIGA 3NWBA 4PYNA 4RVGA 4YV1A 3OZTA 3NDIA 10MHA 3MB5A 2OY0A 2EX4A 2UYHA 5CIYA 2QE6A 3PT9A 5C0OE 2BM8A 1L1EA 2A14A 2PX5A 3FPEA 3QV2A 2ZLBA 2CWWA 1VBFA 2YR0A 5K09A 3E7PA 5E8RA 1NW7A 4GC5A 5JR3A 3FPHA 2FK7A 3OE5A 3TKAA 3UZUA 2AN3A 5HOQA 2EJTA 2Z6AA 1UIRA 2GA9A 5LQRA 3G5TA 1QYRA 4CKCA 1IY9A 3EPPA 4L7VA 3BWMA 2WA2A 3VSEA 4ER6A 3LL7A 3P9IA 4EMSA 3PLAE 2PJDA 2O07A 2IBSA 3HA5A 3X0DA 9MHTA 2I9KA 3FPFA 4QTUB 5K0LA 4X41A 3O31A 4OX9Y 1AQIA 3SSNA 3G2MA 2JHAA 1KIAA 1M6YA 4HC4A 3FUXA 5KQRA 1JSXA 1NW5A 2NXEA 3DLIA 4F86A 4CTJA 1R18A 4Y2HA 5HIMA 5K0FA 3A25A 2P3LA 1HNNA 3GWZA 3LPMA 2CL5A 1FJXA 3MTEA 4ER0A 1KHHA 3DOUA 1JQDA 1D2CA 3UJBA 3O4FA 3G7UA 5EMKA 3SSMA 5CCXA 1VL5A 5DTMA 1WY7A 5EVJA 1G8SA 3K0BA 1QAQA 4CTKA 3EVBA 5BW4A 3JWGA 3OU6A 5F2NA 2PLWA 4PYMA 3HTXA 4JXJA 5K03A 2ZBQA 4RWZA 3S68A 5LQUA 5LQKA 1G38A 5LSAA 8MHTA 3B89A 5HIKA 2Z6QA 3G2QA 2YXLA 2V7EA 2OZVA 3CCFA 5P8WA 4DQ0A 5F2OA 1VQ1A 5GINE 3BWYA 5E8JA 2E5WA 2N47A 4DCGA 1NKVA 3M6UA 4X60A 5EZQA 3HEMA 5E9WA 3HP7A 3A26A 5EMMA 2PKWA 2OPBA 1KPGA 1I1NA 1DL5A 3BXOA 1NW3A 2ZIFA 3GNLA 3M6WA 5DM2A 4Z2YA 2ZULA 3LDUA 4MTLA 2P8JA 2OKCA 2PGXA 1FP1D 2PXAA 3TMAA 2HNKA 3NJRA 2AOWA 5HIIA 3CGGA 4E31A 5CVEA 1YFLA 2FHPA 4DKJA 5K05A 4AZWA 3E23A 4GUAA 4EKIA 1M6EX 5FHRA 3ELUA 5LQAA 1SQFA 1T43A 4GBED 4E33A 4PYOA 3SSOA 3C0KA 1WZNA 3AJDA 1L9KA 4HSGA 4PINA 1XCLA 2XVMA 5EQJB 1FP2A 3LECA 4PYQA 3NMUF 3C3YA 3A4TA 2I62A 4PCAA 4M7RA 4PWYA 2AVNA 5LR6A 3P8ZA 3HA3A 2GLUA 3C6KA 3M6VA 5EEGA 3PFGA 2BR4A 5EMLA 4RTKA 3LDGA 2K4MA 2Q41A 4OA5A 5E1MA 1JQEA 2QY6A 3R0QA 1N7JA 2JHCA 5DX8A 5C9ZA 3IYLW 4KIGA 3I9FA 5LQCA 4QTTB 4HGZA 5E1DA 1BC5A 1SG9A 2O57A 4E2WA 2UZ4A 4RTPA 3UJ8A 4RVHA 1NW6A 1ZGAA 1MHTA 4AUKA 3KR9A 3KHKA 2ZCJA 3KPUA 4GOMD 4MWZA 4KVZA 5FWDA 5K0BA 2B78A 3HA7A 5KQSA 3T0IA 4K6MA 4FT2A 5FULA 2JJQA 2YX1A 2VDWA 3KQYA 2HTEA 1QANA 5U4XA 2GPYA 1KPHA 2IDKA 5K01A 3NDJA 1D2GA 4FGZA 5FQNA 1WXXA 2DPMA 3THRA 3KPVA 2OB1A 4ZTBA 3VYWA 3GJYA 3PX3A 3MAGA 3QOXA 2G1PA 4M38A 4FSXA 4C08A 1Z3CA 2B9EA 2IH4A 2KW5A 1SVUA 5EIFA 1I9GA 2ZZKA 3LDFA 3A7DA 1XVAA 5EKXA 1ZQ9A 5CVVA 4FS8A 2OXTA 5LQNA 2O05A 5DM4A 2YQZA 5DSTA 3HCCA 3REOA 1WXWA 1KXZA 2UYQA 3UJAA 4E30A 4GOOD 5DRTA 4YUVA 5DLYA 4PNEA 5T6BA 3KQMA 4O29A 4P58A 2EJUA 2P7IA 3DTNA 5T64A 3TM5A 3TPZA 2PV0A 1RJFA 1QZZA 5D1HA 5E1BA 4IV0A 1TW2A 2NXJA 5DX0A 5DTQA 4YUZA 2VDVE 4EQZA 4C06A 5K0JA 4HGYA 3EVEA 4IWNA 3F4KA 3NWEA 3BGIA 3G8BA 3EGVA 1IXKA 3FPGA 1G8AA 3OU2A 4CWAA 1ORIA 2NYUA 3LSTA 3G8AA 4FT4A 3SVZA 1RI3A 3DMGA 5BP7A 3L8DA 5HZMA 4RSRA 1VP9A 3UJ7A 4BP1A 5EGSA 5K0NA 3M6XA 3G5LA 1JTFA 2I6GA 2P41A 2H00A 4ATNA 5GM1A 1UFKA 2ZWVA 3M4XA 1VPTA 2FCAA 3EEOA 1NW8A 3UJCA 5CVUA 3ANXA 1P91A 5DT2A 4AZTA 4BY9E 1ZHFA 4DF3A 3TOSA 4U7PB 4U7TB 4RYLA 2G72A 1KP9A 3ELDA 3LCCA 1L3CA 5EG5A 3HCBA 7MHTA 3HVKA 4F85A 2ONYA 5CD1A 3KU1A 2NNWB 3K6RA 4KDRA 2PX8A 4OA8A 2BR5A 3DH0A 3EMBA 3BKWA 3T7RA 3UA4A 2C7PA 2ZBPA 5GM2A 3TM4A 3GRYA 3TFWA 4IKPA 4AX8A 3ORHA 2NP7A 1EJ0A 3M33A 2OB2A 5CM2Z 3UJ6A 3SM3A 3R24A 3OFJA 3VC2A 4HH4A 5T67A 4E2YA 1P1CA 1RJEA 2O06A 3KKZA 1O54A 5FA5A 4E70A 5DM0A 5DRYA 4RTSA 2EG5A 3TRKA 4BP3A 3FTDA 4GOND 1X1BA 3AWIA 1U2ZA 4YUWA 3TKYA 1D2HA 2GB4A 3LHDA 3OU7A 3DXXA 3PTAA 2FRXA 3AXSA 3BWCA 3SXJA 2ZZMA 1F3LA 1XDSA 2PVCA 2R3SA 4GF5A 5FQOA 2CMHA 2G70A 5H02A 3JWIA 2VDUE 2ZVJA 5FADA 5GIPE 3P2EA 2PXCA 1N2XA 3FTEA 4XCXA 5FTWA 3HCAA 4RV9A 5D1NA 1VP3A 1YZ3A 5EEHA 2ERCA 3GIWA 1EG2A 5BW5A 4RTJA 3MQ2A 1Q0SA 2G71A 2XYQA 2C7RA 2C7OA 2ZFUA 2ZW9A 5DTRA 3R6TA 2P35A 1ZKDA 1G6Q1 2XYRA 3BKXA 4KWCA 2I7CA 3HCEA 3KPJA 2B25A 5KYGA 3UA3A 2ADMA 3DUWA 1EJ6A 1YFJA 4RTQA 3RW9A 5EHGA 1SUSA 3O7WA 4CKEA 2NXNA 4R6XA 3CKKA 3KPWA 4FP9A 4PIMA 5DM1A 3G2OA 1R6AA 1JQ3A 3GCZA 4HTFB 4HTFA 4RVFA 3T7TA 4RTLA 3SMQA 4R8SA 1ZG3A 2AZTA 2ZWAA 1HMYA 3GO4A 3KQVA 4X61A 3Q7EA 3BZBA 5EPEA 3BUSA 2UYCA 5DXAA 3MERA
chains in the Genus database with same CATH superfamily
3C3PA 4GOKA 1ULTA 1PS0A 3R7NA 1SHJA 4X8HA 3QXSA 3IQHX 1Y80A 1HC7A 2ZI4A 3N76A 3TQSA 3R7AA 1JKIA 2WAMA 1P1FA 5CDFA 4EIWA 1ZXLA 1RMTA 4MRMA 4WERA 1J1UA 1IFXA 5BYAA 3HKCB 1Z47A 2CW5A 1WSAA 2FKNA 1T0BA 2B5OA 4LZJA 3VBEA 4CFSA 3WGHA 3AM5A 3L9XA 3QPCA 2QLJA 2XGOA 5DXJA 3GGCA 4RBNA 2VDQB 5FA8A 1I5EA 2H4FA 3P94A 3G0BA 2B1JA 2BWJA 1KDRA 2WJAA 5CDUA 4FDLA 1P7WA 3LQ1A 1E2IA 3D6JA 1N3IA 1XHLA 4RK5A 2W2QA 3DF9A 4N39A 2HWYA 2Y1DA 4R3NA 2J9RA 3ZGVA 4JI6B 2I71A 2VS1A 2BMEA 1BKYA 1I5OA 3MXTA 4RNCA 4G4IA 1TRKA 5ER9A 4FYPA 4GYWA 1OHHD 1HEYA 5ITVA 3L7KA 4JJZA 5FYQA 5JISA 5B7GA 4YT4A 1GUYA 2G36A 4EYEA 1ISPA 4A26A 5F1PA 3STHA 5AJXA 4E1BA 4AS3A 4JI8B 3A9CA 3RS2A 1A8UA 2BF7A 1FTGA 2WUEA 2P2GA 5DBFA 1GFWA 4CL8A 5B3KA 1MOPA 1ZR4A 3C2QA 3E22B 3L01A 3CVXA 3I73A 4LDPA 4OQFA 1NVXQ 1OVGA 4JENA 2IL1A 2Q2NA 1YD7A 2QN8A 2P9BA 1FK8A 1KOJA 5E2BA 1DKLA 1DRVA 2BE7A 1XROA 3BMOA 5EFOA 1WBBA 2NGRA 2JH9A 2OHGA 4ZICA 2IPXA 1QKIA 3QOYA 3F1LA 1VPLA 4BIIA 2DBZA 4B35A 4DMKA 4F06A 2BSXA 2WTBA 3C4VA 1O87A 2GCEA 4G67A 5DFAA 1QMGA 5AVJA 1FVFA 3RVOA 4BE4A 2WMYA 5DBHX 4D3XA 3CKYA 4MUEA 1NI4B 2FZEA 2XYHA 5LXTB 4UE2A 1T9GS 4OLFA 5DLYA 3U9SA 1EXWA 4JFRA 4OIFA 4YXWA 4C7JA 1IBMB 1RXUA 4KKXB 4TT8A 1W0CA 3R74A 3MELA 4XIGS 2PWBA 2H11A 3B6ZA 3CR7A 4YJ2F 3IUJA 3ZZ0A 1Q7EA 5IXYA 3V8PA 2IUFA 4I66A 3PHLA 4MMXB 1R88A 1LZLA 4CKZA 3SICE 4H0NA 3QVVA 1U3WA 4KLZA 2CVZA 3DMTC 1V4NA 4M8LA 1ZN8A 5EP4A 2YOGA 4FNMA 4PX2A 4WLEA 1T5OA 2V4ZA 1KAOA 5C7OO 4Q4CA 1Y3HA 4L2IA 5EJGA 4ND5A 1GCAA 3LCVB 1FPQA 3BG5A 3WLJA 5JBQA 1H93A 2AWOA 2ZPUA 2I54A 2OCAA 1Z5NA 3GDOA 3V48A 1PJ2A 3AO0B 3CUUA 1INLA 3IQFA 3K9LA 5FI0B 1KZ9A 5CEJA 1ORDA 4GI1A 4BB0A 3PKJA 4K86A 3EY9A 3S29A 1RKVA 2CV1A 5A6VA 4EW6A 1SEPA 4RMNA 5AVWA 3MS7A 3VJRA 2D4HA 3K0EA 1P75A 3B1ZA 1ZOOA 3ER9A 5LWHA 1M8PA 4B4WA 4CEIB 4RY9A 2BZ1A 1VPVA 2IIBA 5JNVA 2NO7A 1E20A 1GILA 4N82A 3K70D 3OJ0A 4KK3A 3A70A 4Y2TA 2QRZA 3BWBA 2YWJA 2I65A 3NHKA 4NMMA 4C4RA 4R1LA 3BMNA 1XBTA 4JC4A 3NHZA 1KTVA 4WV3A 3VNVA 1NJ8A 1UFOA 3M1YA 2ZRCA 4PSVA 3AM3A 2JFXA 2WSYB 4JU9A 1D03A 2OHOA 4GPIB 5HMLA 5J58A 1E7QA 3IRUA 4I4NA 5DBGA 3I30X 2GBIA 2O0MA 1D2NA 2WJVA 3CF6R 3NO4A 1MC1A 1EGMB 4OAOA 2CMFA 2GAFA 4L8VA 4C4YA 4UFNA 1G7TA 4G8JA 2V4MA 5KNDA 1YC2A 4X90A 3H1AA 1XC7A 2POQX 3VAAA 4EG7A 2BFAA 4RULA 1KYWA 2PSSA 3NBAA 2NN3C 4YMHA 3KXDA 4PGAA 1TT5A 3EK2A 1XAJA 3UBTA 3LQRA 1SBIA 2XJ4A 1T3LA 5DYNA 2XTJA 4V0RA 2HJRA 1C8BA 1YR7A 2DFNA 3AR7A 3LCMA 3Q41A 4CMEA 1L1RA 3OZSA 4CDNA 2XXAA 2JPDA 4ZP1A 2BFEB 3CZ5A 2AOTA 3O95A 1IZ0A 2L0XA 3CRMA 3HM2A 3TCNA 3WTCA 4DR5B 5GWXA 3QBDA 5LWQA 4JS0A 1V43A 1M1NB 1E2UA 4WIAA 5DHFA 4U7HA 5EZSA 5EYPB 3KHTA 2JLYA 1GNSA 3PFHA 2R85A 1JFTA 3V1UA 1NR7A 1XSEA 4IXWA 4BLQA 4G3XA 4R1PA 4P6VF 1XE3A 1VDZA 2VHVA 3LKBA 4OHMA 4PHHA 4UXJA 4Q3AA 1OXTA 1NYTA 3ET5A 2BGGA 1V1RB 4L4SA 3SYTA 1ZY2A 4A16A 3BYZA 5KPJA 1E4EA 3DBLA 1GU1A 3WMEA 2D62A 1YVPA 2QV7A 3DWFA 4R8KA 3N2YA 1A8HA 3AP1A 5IKPA 3KYDB 3UGJA 4ETNA 4ZZIA 1HSZA 3WSVA 1QR2A 4OQLA 2IWHA 3KQWA 1I36A 2FP4B 3B2EA 5LPNA 4ZHSA 2EZ9A 1FLDA 1N3LA 2PO7A 2V54A 4NNOA 1SR8A 5FUWA 3A9WA 1F06A 1XNHA 2XKKA 5H59A 1SKMA 1KAHA 3V1MA 1OLXB 3BB3A 3GEPA 2ZBVA 3CZAA 5KWEA 3VU9A 2H51A 1E99A 1MBZA 1R0RE 2BM9A 4FWIB 1Y5RA 2H1HA 4LYHA 4PYNA 1Q22A 1E63A 2R00C 3GJTA 1C14A 1H6BA 3JQBA 4J16A 1B73A 1XZPA 2DWCA 1JIKA 3EXG2 4Q1CA 4WOPA 2IOFA 3DBHA 3LF1A 4DLLA 2CDNA 1HR0B 3UK1A 4DEXA 2XVZA 1U7HA 4S1TA 2FVXA 2FPKA 3H8SA 3E7PA 4WK4B 3WWYA 2YWXA 3GCXA 4B3IA 4ZJYA 2A9OA 4GX0A 3F46A 3QYPA 3L77A 1M73E 3WL5A 4BB6A 4LV5B 3ICEA 1UIRA 2VYNA 2AIRA 2FG6C 3DE0X 3N2KB 4HQ6A 5DI9A 3UVEA 1QYRA 1E3JA 2M9MA 3NHUA 3JQAA 4NK4A 4Z49A 2DGDA 2NACA 5IAKA 3OKAA 2O3RA 3LW7A 4M7WA 3VSEA 4RK6A 1QVVA 4E08A 3KUXA 5KNDH 1Z38A 1LD3A 4LF6B 2HFKA 3AG5A 1ZD9A 4TUYA 4U00A 3F3KA 4KH0A 3K0FA 2AT1A 3JQ6A 5JFOA 1V0JA 1WSDA 3N39C 1XEFA 3RBXA 4DSTA 3LUAA 1E1KA 1WHSB 1JDNA 1LSUA 1RR6A 2PYZA 3N07A 3QHAA 4YNBA 1M6YA 2ST1A 5KWSA 4P81A 5CH8A 2QN6A 1WKVA 2HT6A 3CO0S 4QU9A 4RVUA 5TV2A 1CK4A 1Z39A 1IHUA 1O57A 2P65A 4G5XA 2OM2A 2RBGA 1PCXA 2DHDA 2NUPA 1D2CA 3COYA 3D3EA 3G7UA 4H35A 4P54A 4R7TA 5DHPA 3G6KA 2GFIA 1QE5A 2CZGA 3EG9B 1Z7EA 2E6KA 4EVQA 2YVKA 3PNKA 3A4MA 1R6UA 1WF3A 2FMHA 3DZGA 2BEJA 3MCWA 4HXYA 4K8RB 4X85A 1RJ9A 4JI1B 3MLBA 3B9QA 1E2GA 3G2QA 2UZAA 1D2RA 2V7EA 5KYUB 1PYDA 2BBOA 1RAEA 3AETA 3OWHA 3F7NA 4JNCA 1KZHA 4TRMA 1GNTA 5GPBA 3O3OB 2J5BA 2YWGA 4KNWA 5G0UA 3CONA 2ZE5A 4D9CA 4D6PA 3F6EX 3IJEB 4RZXA 4X3CA 4YN3A 5AM4A 3WHLA 3EPHA 5BSEA 4MTLA 4CKWB 1MAWA 2OKCA 1ZI8A 4G07A 4JN6B 4GIBA 4OP2A 3FWPA 3SYNA 4A8JC 5ITZA 1JHAA 4HQOA 1I5RA 1TLLA 4MUMA 4HO1X 4E31A 3WZMA 4PLWA 3TIXB 5L7WA 4KPEC 2FHPA 3CM0A 5I7AA 1CRPA 4H7DA 1EKXA 5IX8A 4UFPA 3O38A 3WVNA 4G4JA 4XM2A 5FH9A 4C1BA 1EMDA 1SCKA 3A4NA 4YCAA 3FXAA 5ES3A 3C0KA 4KFTA 2AUMA 4K7JA 1SKYE 1E6CA 4YJHA 2XVMA 4EABA 3RSZA 5FEUA 3R0JA 3H5VA 4S1PA 3IEVA 1C9KA 1D3AA 3EXAA 1AKRA 1N6IA 5FORA 4JQYA 2HBYA 1H4VB 3AFOA 4JT2A 5JE8A 4WBNA 2HIAA 3OZBA 4BJHB 2HK8A 4ZOLB 2P9JA 1D4ZA 3HQ4O 3RSOA 4KR6A 2NVUA 2P4HX 4MZXA 4QBTA 2OM6A 2XXJA 1A8PA 3IPCA 3OESA 4B6OA 5E6SA 5EP1A 2PGNA 1XK6A 3DAOA 4COOA 2PKEA 3BREA 4TTRA 1F0YA 2GCGA 2P2NA 4YRFA 4HAUA 4HX2A 2G07A 4OJTA 4OXYA 3M3DA 1NKSA 4TLEA 3NTQA 3CW9A 1VSTA 5CT9A 3TX6A 4DJ5X 1HY3A 3EN0A 3I92A 4FGWA 1REQB 3D8TA 1PKXA 1BX3A 2IITA 3Q7QA 5F33A 4KVZA 3CW8X 4MGYR 3HNOA 5CH3A 1N32B 2DG2A 2PA0A 2VRWA 5ELLA 4L8YA 3ZDFA 2O23A 2X2FA 4ZI3A 1OZAA 3ZCRA 1JQAA 4EMTA 3NDJA 5JO0A 4MVJF 1IUOA 4MULA 2RH5A 2A3NA 2IKQA 1H6DA 3GH1A 2C4NA 4TQGA 5AVUA 5CHEA 4JI7B 3ROTA 3CVVA 3NM5A 4TYYA 3CRVA 2WFLB 5REQB 3ECCA 4AWAA 3QBJA 3DPUA 4KTTE 4Y2JA 4BGVA 3QE9Y 2C94A 2XZLA 2E2WA 4B6FA 3OKFA 3FOEC 1X92A 2D5AA 1AZLA 3QUBA 4X20B 3GMTA 2VHJA 4Q1FA 2IS2A 5DRTA 4Q00A 3UHOA 1NJSA 2WUVA 5T6BA 2IP1A 3RS3A 1USKA 1I1HA 2ZI3A 4ICIA 5KOIA 1FXSA 3H2IA 5E1BA 1JDSA 5T8KC 2Q62A 8ADHA 2OXRA 3FF1A 2XUIA 3E35A 3MJFA 3UFXB 4ZKDA 3F49S 4HGYA 1KEPA 2C07A 1Q2XA 4Q9AA 1XLTC 5BWCA 3UKDA 3DF7A 3PPXA 2NSLA 3F5QA 1U8EA 1T0JB 3H9CA 2J0EA 2C5GA 5J2TF 1RS0A 1ZYUA 4QYWA 3PQ3A 3WO1A 2O2XA 4EGFA 2ZJ6A 2C1EA 2AQIA 2ZRPA 1KQGA 1CDDA 3T9AA 2IU6A 3ZJUA 3IA2A 5F64A 1ULZA 1RWBA 1BS2A 1R6TA 5AKHA 2C1ZA 2G5TA 4J7XA 4I1YA 4R1OA 4UHJA 4EG4A 2PUBA 4KFCA 2WTAA 4BVFA 6NULA 2G76A 1TOAA 4ONEA 1OWOA 3EIEA 4RYLA 1TCVA 5J47A 4W1QA 4KQ2A 3LY7A 4FB4A 4EPTA 1KZYC 4JBIA 5C1BA 4EBBA 1OC2A 1GPDG 3VOSA 2BL4A 2MSEB 4TTQA 4G0QA 3BXFA 5AJVB 4Z8YA 3T34A 4DMLA 5IDYA 4QGAA 2NADA 3TLCA 2ZVDA 3N8KA 4GKJB 1NRXA 1UDCA 4XJXA 5A4JA 3UNXA 2VC2B 2UU9B 4Q4HA 2V6MA 4PNZA 3HUFA 2DX7A 3JQDA 4MGIR 3ZNOA 3MJHA 4OG2A 3O92A 3R24A 1M8GA 4ND6A 4AF8A 2IUEA 5HJEA 1RJEA 1M74A 3E82A 2YASA 4UVHA 2CK3A 3RAFC 4WFIA 1X1SA 2VZ0A 2CLFB 2X3YA 3TRKA 1U2GC 1G5IA 1X1BA 4HQ0A 1XA0A 2GPBA 2P9HA 3PD1A 1Q12A 3PP8A 5CPBA 3TI9A 2OT3B 4MV9A 1UBHS 4B4DA 4G1FA 3V4RA 2FWIA 3VOBA 1O6FA 2QQ0A 3KKMA 3RAPR 5AW9A 4BLTA 5J2UF 3EF3A 2ZVJA 3G9XA 3MT7A 1Z33A 4GX5A 4KI7A 4LHSA 4LPKA 3C7KA 2MSLA 3HG7A 5AUQA 2J4CA 4YIHA 2KHZA 4RD1A 1FC0A 5EHNA 1PSZA 1XZGA 3WIBA 4IRMA 4RTJA 2VPPA 3QI7A 4J1SA 4KHZA 1ZD5A 1OU0A 4QOEA 4YDRA 4F1JA 5AQ1A 2J09A 2C7RA 2C7OA 4OXRA 121PA 2JGJA 3A1DA 2WFAA 2WRZA 3CPHA 1GGKA 1DBPA 2RJOA 1MT0A 2VK4A 1JPNA 4KSCA 3RLFA 3ZJTA 3RIXA 3A6DA 1K97A 4WQMA 2JIZD 2WNSA 1DC5A 4XSGA 4BMNA 1TUGA 3GARA 1RWMA 1F12A 1XCOA 3EG5A 1FFXB 1MGPA 2WSMA 3HBLA 4EM6A 1T4DA 2V7XA 3TI7A 4AMZA 13PKA 1I2ZA 421PA 4NQRA 4BNIA 2W6JD 3I2YX 1DDOA 5GZ6A 4HNUA 3EVCA 1AVTA 4FZVA 3EIUA 5EXTA 1KBOA 5DE3A 1YI8A 1SKQA 3RWBA 3K4PA 3E3OA 2XTMA 3JRNA 4JJ7A 4HT3B 2JGDB 2J6CA 1JSRA 2ZDHA 5HGJA 4GKVA 4Y8VA 3EFEA 3DZKA 1JFFB 3KKKA 2N1BA 3G0GA 4MQ4A 5AJUA 1VLQA 3ROEA 3M6AA 5B3AA 1B2RA 5EOVA 2OAEA 5IH3A 5F52A 4C7XA 2GPSA 5BR8B 4OX9B 1MJGA 2QMHA 3T52A 3U3MA 4ER5A 5BQXA 4ER7A 1ST3A 2WD7B 2ZTSA 4DMRA 2O2DA 4MLPA 4MQUA 1UQRA 3ZZTA 3ZC3A 4ISCA 3WXMA 3I5MA 3EGDB 4R54A 3SC2B 4B7CA 4UUBA 5GY7A 4MHOA 4HATA 3OEWA 3ERCA 4N8DA 1GQSA 3TZKA 1JVNA 2IC5A 1GZHB 2PNJA 4I08A 2C7BA 3ZGNA 2XWSA 4H3HB 2WMOB 4BNTA 3OE4A 3DWGA 1SBQA 1WU7A 2JLCA 4MQMA 1WZIA 4G26A 5KYWA 2PSHA 3L4SO 4H4CA 2JFHA 5BW8A 3BE5A 5AI5A 1BCSB 4M0DA 4WZAB 1ECFA 2ZCVA 5HM6A 4CEHA 5JMOA 1U7TA 2Q9UA 2HXGA 3TDKA 3IEMA 1EJBA 3ME5A 4AMBA 5BRJA 2XI4A 2JBAA 2PS9A 3TIIA 2XBUA 2ZSUA 3VMMA 2W42A 1TU3A 2OO3A 1GV0A 1SU8A 2J46A 3PWKA 3EXIA 1RMYA 4CEJA 5ENVA 1H3NA 3LPCA 3FGOA 4DLRA 1QHHA 5CA0B 1CR1A 2BFDB 4G65A 5BVGB 2WDZA 4RMHA 3VSDA 3V6LA 1GITA 4IMIB 5AK5A 1NBEA 1HUQA 4ZMRA 3DEJA 3P2KA 2HA6A 2ZQ5A 5T4BA 1USWA 1CV2A 1G9SA 2YUIA 3GG2A 4LF9B 3LS2A 1ONOA 3TXYA 3UAOA 1IHXA 1VLHA 2I6TA 2PAFA 3AR9A 3C74A 5G3ZA 4YCNA 2B4YA 2J0UB 2XUPA 2YV1A 2W6PA 3MWFA 1PBNA 4MIKA 2B34A 2DRIA 2OLJA 3U62A 2AYZA 4PONA 5F23A 3WYNA 1E92A 1EQAA 3G0CA 4ENWA 3DJFA 1UBTS 1LS1A 4UARA 1PR6A 4WTOA 3L82B 4IIDA 6LDHA 5DN6D 1D07A 2NZWA 4H27A 2VUUA 4EPVA 5JVDA 5JTTA 1H8HD 3NONA 1X74A 1Z4MA 2C3YA 3O8NA 4LDRA 5KPDA 3ZGZA 4D3SA 3WQRA 2AQHA 4B17A 2YTZA 2Y68A 3WLTA 3ZNNA 4S05A 1DHRA 3RKRA 2A9QA 3U26A 3S81A 3TFOA 1DC8A 3U4QB 2JEOA 3FTQA 2DWUA 5KBYA 1J2UA 2GJ4A 4EW1A 1MJ5A 2VQ3A 2ORED 1T5BA 1WPQA 2NQ2C 2WICA 3RS5A 4IMPA 1Z0UA 1ZITA 2Z6VA 2HSEA 2OOKA 3C3JA 2NW6A 3IDAA 5C8ZA 3GLFE 4E5NA 3IP3A 4YP9A 3OD5A 4ZTZB 1GYPA 4MS3A 3AIIA 3L0BA 4R9SA 3ESBA 1XZJA 3FJYA 1XD9A 3ZUGA 3QKWA 4PYJA 1SBCA 2IELA 4LY0A 1A77A 5IKMA 3TOXA 3OF3A 3ER6A 2IXTA 4AJ2A 3VNQA 2QYHA 4NKRA 2QIPA 2CCGA 4BBAA 2C3UA 1KR5A 2WIDA 2J4FA 4QOHA 3GPDG 4Q01A 3WADA 3KLMX 4A92A 4PC1A 2ZIUB 3W9SA 2O3JA 4WEOA 3VNRA 1FZTA 3LX8A 1TAQA 3U37A 4U7GA 1M7HA 3MMZA 1QQ6A 4R2IA 2RHCA 1PR1A 1Z8NA 4LYGA 4YUAA 1PAUA 5CTAA 1KFBB 4QU5A 4HQRA 4FW8A 4M0PA 1C4KA 3DE7X 3RODA 4ARSA 4IEFB 5BYBA 5KJCA 3DP9A 1Y9AA 2ZIVB 1ATZA 2AQKA 3U7QA 1XZCA 1GCIA 3T0FA 4F97A 3UB3A 5HKKA 3KQPA 2NSHA 5G1NA 4ZCMA 1ZOSA 4R2HA 3U31A 4CT0A 2VT6A 1Q0PA 2MCFA 4KOAA 4R98A 5F2EA 4P4TA 4J76A 2C8LA 3W3AD 8GPBA 4TXLA 5JCJD 4CQMD 1UMCB 2G25A 2CE2X 4DIEA 4E4TA 1TTHA 2AMFA 3D7MA 4CETA 4L9AA 1C7EA 3OJOA 1SUDA 2QM3A 4QWWA 2G7MC 2Z1NA 2Z98A 4QASA 1R10A 4A0SA 1RM4A 1QYIA 1PL0A 4LHXA 3HK2A 5KAPA 2HHJA 1Y7HA 2RHJA 1KSHA 2X86A 2XUDA 2YZKA 3FUTA 3UIEA 3V8QA 2EJBA 2RHRA 1QHYA 5KCMA 2BUCA 3UJDA 3FMIA 5I7UA 3LFTA 4UAUA 1AM4D 1J5XA 4FKBA 2QP9X 5BNIA 3RT9A 1Q57A 1TK3A 3MRXA 1HDGO 1RZVA 1U2RA 4GP7A 5HIJA 1N2ZA 3NASA 3HVJA 5CJJA 3ZWXA 1W9MA 5LQDA 4GX1A 4FONA 4BX3A 1ADJA 4P86A 3SWWA 5FAKA 3BEDA 2OC9A 5A9SA 2YQ5A 1X7WB 2G17A 2OAQ1 5KAMA 3CH4B 4QPNA 3CB2A 3T94A 5IN4A 2YINC 5CLQA 4DQXA 1K3UB 1IQPA 2HCTA 2W58A 2R86A 2EP7A 1GNLA 2XMDA 3FOCA 3PA6A 1EXNA 4RZSA 4CLRA 1F1JA 1L7BA 4DSOA 2W8BA 5DXFA 5EJ4A 2X0JA 4NJEB 3UN1A 4C89A 3KJFA 4A5OA 4MXDA 1DINA 3KT3A 4ZREA 3REQB 3UPTA 1V8FA 2D0DA 2FWBA 4RLHA 5K3SA 3RRFA 4D80A 4F9GA 2AF3C 2AYXA 3AV3A 4I6GA 4PC7A 1JXQA 2OC4A 1TYZA 5GJCA 5A71A 2WPDD 4N0EA 4XIIA 2QRPA 3IBGA 4R2LA 4B4VA 4NV0A 1EXDA 2E9SA 3VHLB 2EWMA 1FY2A 3ANYB 3U6BA 4LRYA 2EYUA 5DW3A 2ZRHA 3FPEA 1L1EA 5HBGA 1UT8A 2PL9A 4ZDKA 2ZROA 3OJFA 4IZOA 4IHJF 2P0YA 1NW7A 2Y71A 1M2OB 2H1WA 3BGWA 2GJAA 1X3LA 3QLVA 5HRUA 3IP1A 2OV8A 1U9ZA 4J4HA 5DK4A 4ZXFA 2HQSA 4CIBA 4LFBB 5F3RA 1NYRA 2VH2A 4K8OA 2WF7A 1KVSA 1ULBA 3CXRA 4GRIA 4RIHA 5DJ5A 1IY9A 2G80A 3EPPA 4D3FA 1VYVA 1XPUA 3WRYC 1AF4A 1KETA 1PLJA 3HB0A 2JF0A 3MCVA 2AN9A 4IQ4A 4OK5A 9MHTA 2PZFA 1IWBB 1SBNE 5D3MA 4IFEA 3BF8A 1P7YA 3SSNA 1DWQA 3PCTA 4MR7B 1AXGA 3FUXA 4YYEA 4PO8A 3STWA 1ZIXA 2WNIA 2FUEA 1T3SA 4CTJA 3PXDA 5ALFA 1OI3A 4UTXA 1RBYA 1VMEA 3JZAA 2F9LA 4DRXB 3B3AA 2ACWA 2YHSA 2BFWA 1H2HA 4BRSA 5EPUA 2XOEA 2G9QA 3EVBA 5DMHA 5T57A 4KR2A 3H5LA 5EJMA 5L9AA 1B0UA 3KELA 2XZOA 5TY0A 1MX1A 1XEWX 2LP4Y 3I9V1 3MBKA 1UK6A 3NBKA 5BN1A 5LSAA 3DPSA 3FFWA 1BWSA 4AULA 3WWPA 2V6BA 2YXLA 4PG5A 2B82A 1Z2NX 2LZ0A 1QB7A 1VQ1A 3TBHA 2PT5A 5ILOA 3NBXX 5F4BA 4MQBA 5JPDA 4RV4A 2YIMA 2RJNA 3GN2A 5NULA 4MHSA 5F4ZA 5CFLA 3DFMA 2C8VA 3A26A 4GUDA 1SBHA 4Z4EA 3RFXA 2N9UA 2HM7A 1WX1A 4TZTA 1OFUA 4I5EA 2BHTA 3GGPA 5IVIA 1JDTA 4Z2YA 4GMKA 3UQZA 4B1FA 3OM1A 3HU2A 2QA5A 4HEQA 3LX4A 4MVXA 1KA9H 1ND5A 3S2YA 5J4YA 4YBZA 3KTAB 4FKZA 4QRHA 4DR7B 1GXSB 1C0EA 4WZZA 3W5AA 4MYRA 2OHXA 2FWPA 1VIVA 5KOHA 3Q3HA 1UJ5A 3NGMA 2H63A 2OORC 3QWFA 5TMBA 1GGEA 4BB5A 4FD3A 1E7WA 4U7JA 4YJFA 4BO2A 2W90A 4NOMA 3F96A 3V4FA 4BNKA 2VQFB 1V9CA 4AF7A 2W5UA 4XGKA 1XEWY 4UJ3A 1PJTA 1RRPA 3EZLA 5F7XA 3FDZA 4KO2S 3ZXSA 4EW2A 2WIFA 3F74A 4JQCA 4LOLA 1RAGA 1YFKA 2AVNA 3OQIB 4IJMA 3U3RA 1UK8A 4LYEA 2GYYA 5I7EA 3BWXA 5IWCA 3I32A 4XD7D 1U9CA 2QLBA 1BQ4A 1H1TA 2OHJA 5BQ5A 1YKSA 4L0DA 2YWBA 5AP9A 2QY6A 5KOYA 4BO0A 2MHCA 4ALJA 4KZPA 1JV2B 1PJCA 4BATA 1D7OA 1FVHA 2OQ2A 3HFRA 4GVPA 1C3VA 3KZOA 4QTTB 4UBJA 4E1VA 2JGLA 5BNFA 2EX0A 3CZMA 4FUTA 4GMFA 3SJZA 1B41A 1RYFA 1SZDA 3NFRA 3EW9A 4M86A 4NS4A 4OHFA 1H9CA 5H80A 2SBTA 3TLGA 3K4HA 3EZ9A 4FGZA 3ZXIA 1G3IA 4DWWA 4JL6A 4OEHA 1A7KA 1A7AA 3MAGA 3QOXA 4MUXA 5HJ2A 3Q2IA 5J4VA 2CYCA 4ZEMA 3CN9A 3WJ7A 3KO8A 5K0SA 5F12A 4L85A 5TPZD 2YZ2A 1ZUNA 3HY4A 5HCNA 3EGOA 2DJ5A 4P4SB 4Q21A 4DT1B 4L7QA 2EJWA 3LKVA 2Q7OE 3RC3A 2I4OA 3LVFO 4RPIA 3ZBUA 2CCJA 1PKEA 3CXUA 5DM4A 2WMNB 4LGMA 3VR3D 4KNVA 2VWQA 3FSEA 4WKBA 4GOOD 1P72A 4P3YA 1RHQA 1DEAA 2CLMB 3V2UA 1AKMA 3GHYA 3DTNA 4LXQA 5T64A 4CCYA 4CMKA 2Q3MA 3JQPA 3DZHA 1LY1A 2H7CA 1ZCZA 2QTRA 1PT6A 2H0RA 1H2XA 2OQRA 5DTQA 2VDVE 5G1PA 4FWTA 4IIHA 4BVJA 1Y6JA 2FQYA 3BD9A 4F3TA 2QTBA 2DPXA 3EVEA 3GOHA 1F9AA 4RFVA 4BQSA 4TM7A 3DMTA 4HAVA 4UU1A 5CFMA 1NMSA 3KOOA 2QD4A 5T4FA 1CE8A 2A88A 1RKBA 2DFPA 2P9YA 4M99A 4RA9B 2UZ1B 5BN5A 3G8AA 3DFUA 1LB1B 1BQ3A 1B76A 2C8KA 3IB6A 3QJGA 4JLWA 3TOZA 1I2DA 1V26A 4OXQA 4RIEA 3V4ZA 1G21E 1UANA 1WU8A 2ZI5A 1JN0A 4I5FA 3KAPA 1JYFA 5AHWA 1BFUA 2H00A 4UPEA 1YB7A 4BFYA 1UFKA 4AQ7A 1QONA 1SOWA 5L4LA 4X94A 1XU7A 3ZDXB 3RYCA 3OIDA 4O2AF 4M9CA 4GM4A 4TPKA 1AUQA 2QRQA 3VHXA 4DY6A 2YHIB 2PUVA 3N8GA 3ZK7A 3HFGA 2O0KA 3LCCA 3UM9A 2YZ7A 5CH5A 5E6RA 4HF7A 2O2CA 1CNFA 1P8JA 1W4BA 2W2LA 3HCBA 3HVKA 3NG1A 3Q72A 1XNRB 1KI6A 2Q4OA 3RFCA 2ONYA 4HFMA 2IHTA 4LZOA 4WX2B 4BEBA 2GPJA 2DPHA 3RUAA 4XAQA 4YP5A 3DH0A 2WQZA 4J91A 1AN9A 4L4ZA 6ABPA 1PL7A 4BKQA 3OPYA 4WKOA 1NFFA 4PWZA 1O58A 1QHEA 2IU0A 3WGMA 3HY6A 3HB7A 4RQBA 1OBHA 4E5UA 1Z5VA 1NTRA 1UZMA 1IHYA 4B79A 2C0PA 1RIIA 3X1DA 1RKUA 3KKZA 2D0IA 6Q21A 1FFSA 2RAFA 3ZE0B 2QVCA 4DWOA 3VR2D 4PQRA 4G5OA 4RTSA 1Y6ZA 1G8PA 1KEEB 3FPLA 2F55A 1VHQA 3RBAA 3FMVA 3AWIA 4MLDA 4WACA 3PGA1 1NVVQ 3V80A 4Y7DA 4EPWA 2H29A 4I46A 3DCJA 4G5QA 4QYTA 1HYQA 1OPRA 3DFKA 2ZZMA 1FQWA 4GF5A 2BKVA 5G4LA 1T5SA 3DO6A 4MUFA 2HRBA 1G2QA 2HUPA 3K96A 5FEMA 3JWIA 4YH1A 4YJ3B 4HXGA 5GIPE 1TAGA 3P2EA 1WCIA 4PPGA 1C4XA 4M21A 1SC1A 4OD0A 3IO3A 2P5YA 1WKCA 4GSYA 4MMZB 3LO5A 4Z0HO 4ANFA 5J2UA 3PPWA 3DLBA 1P3JA 2ATCA 1UWLA 4RORA 1IZ7A 4HDKB 4LMRA 5A05A 1T1IA 1CUCA 3WDMA 4F2GA 2BJHA 2JRCA 3CLUC 2GK3A 4TL9A 4LXTA 1C7JA 1SA0A 2R6AA 4JYBA 1MC8A 2DT8A 2P69A 1US8A 4CKEA 3DMDA 3PQ8A 1UC8A 2AH5A 3NKLA 5H1YA 5LKAA 1PFGA 2VJAA 4BNDA 4PLTA 3PX7A 4OBEA 3RHSA 3SIWA 3U3OA 1JQ3A 4HZUA 2GEFA 5FLYA 5A03A 1U0OC 2IS4A 3DHEA 2VXBA 1EQUA 1NTOA 3C45A 4TKVA 2VTBB 3FGNA 221PA 5AKKA 3L92A 3IIIA 5EERA 2WU0A 5EC8A 1I2AA 3WHKA 4YUXA 1ZNYA 3Q2KA 1BKSB 1ULUA 2EKBA 4OHWA 4LCEA 1I3NA 4LWOA 3OQHA 5CTJA 3G2KA 3PPIA 4OXKA 5G4KA 3QV1A 3STYA 1OIXA 1OXKB 2ZS8A 3KE8A 3P9PA 4C07A 4CKBA 3CFYA 3SQNA 1YS9A 4JVSB 4G5SA 1QTQA 1JG7A 5EN4A 1U1FA 4JCCA 4QECA 8OHMA 2ZRMA 3PJFA 1E62A 1I1OA 3H11A 1E1QA 2PQ0A 2RGNA 1Z6TA 2RKBA 2BVNA 4KN9S 1CIJA 3ZY6A 2Q1TA 3I2KA 4NONA 3MJTA 3RD5A 2R00A 4R2JA 1XNQB 2XWQA 1EGQA 1G6KA 2QPLA 3SR0A 3EDYA 3Q3CA 5E2AA 2BMJA 4IIYA 1T5TA 3RRZA 3WKEA 1PZMA 4PICA 3IIMA 4AECA 4B9AA 4HNGA 5BWMA 3D3JA 4KVGA 3K70C 2H1FA 5ALEA 4F5WA 3D4OA 1G5RA 3HBMA 1X0XA 3HYSA 3UYKA 2O5CA 3NT4A 3LWBA 3VO8A 4OGWA 1TQ4A 2FZVA 2ZQZA 3O26A 3R7BA 3K9WA 5FLEX 2XQIA 3I09A 3W79A 3MTBA 1A04A 1BQEA 1RQGA 1Z4OA 4ZOEA 1DLIA 3BIFA 2GFQA 4WASA 5AK4A 2AEEA 4HWSA 1CUUA 4URHA 3FVQA 4LV8B 2QU8A 4W82A 4MS1A 3RG2A 4EH1A 2VHUA 3GP3A 3MRTA 1NNEA 1IBSA 1DO2A 2DQZA 1P80A 2BDUA 1U6IA 3DCIA 5TB5A 1AGYA 4OU5A 3DBRA 2AXPA 1PV2A 2IPAB 1HE5A 4ECAA 2FPXA 5JI2E 3KYBA 3BL5A 4J0CA 3I0NA 3O8CA 2Y05A 5FOQA 2OHIA 3A58B 4E11A 1Q0RA 5IXJA 3PF9A 1KFJB 2YW9A 3K0AA 3KQNA 2ZP1A 1E2KA 3A37A 4XD2A 1R66A 1E3TA 4OTZA 3VISA 1G17A 1ZGHA 5KS2A 3K9FC 1MA0A 3GLGB 1W36D 1SBZA 2I3BA 1PNVA 2Z5VA 3GFQA 3GA0A 4TS9A 4XWYA 1ZI9A 2PR7A 3VVLA 2JH8A 4TWBA 5AIAA 1X94A 2RC5A 1KWKA 2LD4A 2YFQA 3L6RA 3F7OA 3R4VA 4JP3A 3IELA 2DUMA 1XMJA 3DZIA 4ZAYA 2G8NA 4PZEA 4TVOA 2G3YA 2CHVA 4EHLA 1J8DA 4KGVA 1Z2CA 3HYCA 3EWIA 2I1WA 1Z15A 5LDDC 1AUXA 4QL3A 2WM3A 3P9KA 4JLSA 4KIFA 2XRZA 2GF9A 3F8SA 5IEJA 3DKRA 4XVHA 1MQSA 1QG0A 3PTLA 1XP8A 1TUIA 3TEJA 1C81A 2BEVB 3IKVA 1M34B 4O2AB 1D1PA 3HDQA 1GQFA 1MJFA 2V03A 3HVUA 1U90A 3H9JA 1A50B 1O94A 2E6UX 3P9YA 3OOEA 3OJXA 3ABRB 4GYJA 4OQQA 1DHTA 3GLHA 4IDAA 2NPOA 3I83A 5DWQA 4CNQA 5E3JA 2I2FA 4YY3B 3HXKA 3BQ9A 1LQUA 1FYXA 2AFHA 2IU4A 3M4ZA 3VM6A 2O50A 1Q7RA 4D5GA 1VJCA 1LFDB 4F5EA 5DHUA 3IMKA 1A97A 1ZL0A 3WGJA 4RELA 3WKCA 2P40A 3NBUA 2QTNA 4DMGA 4G36A 3VO2A 4AW9A 1ESZA 1K8QA 3TUJC 1VZ3A 5JBNA 4TV8F 1GAWA 2PSFA 4XVUA 1DXQA 5K0CA 3ZWOA 2Y1XA 2WHPA 1KAEA 3QXCA 1RJGA 3PK0A 3I01M 4AIRA 1X1CA 4HFJA 4H7FA 4HP8A 4PU0A 2SHKA 3FHOA 4NK5A 2DF8A 3KL4A 3A9SA 4BCBA 5EWLA 1JIVA 4DIKA 5BUQA 4PZCA 3SEQA 4HWTA 4EKGA 1WEKA 3R6WA 1F7UA 2V6JA 3FTPA 1O9HA 4UZFA 1N6RA 3DDUA 1ZMBA 2C83A 1OIVA 3ENQA 1IONA 5HILA 1P5RA 3PE3A 3FYDA 5FIUA 3SM9A 1C41A 4G0NA 4HB3A 3FOZA 1N9KA 4RCYA 3OTIA 4LYYA 2BGTA 3SS9X 1NVKA 2C7GA 1TMOA 1H8EA 2VK2A 3FLEA 3NETA 3TD9A 1RXVA 2RGEA 3H75A 4M0CA 1P9WA 5TEWA 2O1EA 1RSZA 1ZINA 2JGMA 1YT5A 4N0MA 3NHPA 4RH1A 1RBMA 1K8RA 1Q3HA 3MYYA 3ZY3A 1IMOA 1KRXA 1DV1A 1H3FA 1WETA 4GPEA 1YVUA 3HO8A 2AWNA 3ZQJA 5C1IA 2JH3A 3STTA 5JVDF 4Q7KA 3DDWA 1VRCA 2IOFK 2ERYA 1N1GA 1DG3A 2AR7A 3G13A 1NSTA 3P5BA 5D6OA 1NBHA 5T8KA 3UMBA 1DARA 1E9DA 3Q5EA 4X3PA 4MV8A 4HXFB 4NZPA 1L5FA 1LCIA 3FYTA 3CINA 3P9SA 3WRVA 4TVKA 4DIDA 4ZVOA 4X97A 1XLTA 1OX6A 2F3QA 1J21A 1E4EB 1J20A 1VHDA 2OXFA 3FDFA 4PR0A 5FNZA 4CF7A 2RG1A 1VIAA 1AK9A 4XIFA 2OSVA 2VDMB 1KPIA 1ZL2A 2ZKLA 4G56A 1DU4A 5IJ0A 2BFNA 2CWDA 1KC1A 3QY9A 4DVJA 2GBCA 1Y63A 1UBEA 2HD4A 2R44A 5JMTA 4QYMA 3HMKA 1HKHA 4PXYA 1YUBA 4Q19A 2O7RA 1O6BA 2H1VA 3K0KA 4D74A 1WMDA 3AUKA 3GZNA 3MWKA 2C59A 1TM7E 3QU2A 4DPKA 4HFRA 1MW8X 2YL2A 1A8SA 2ZGVA 4BASA 5KNBA 2BRUA 1EA5A 3LHFA 4PPFA 2ZJ3A 1QLHA 1TZMA 3DUFA 3FSGA 1EWRA 4RY0A 4UCFA 1UDRA 3ZCQA 2ZLBA 3JXEA 1MB4A 4RK0A 4EARA 4F0JA 5FLXA 2Y1KA 2WC1A 3K7EA 4GC5A 1IJBA 1A5BB 4UUQA 4B8WA 4FDUA 1MNQA 1WUTA 2O0HA 3BWDD 4HB0A 1UJ2A 2ZIWB 4IHJA 4LJRA 1P4GA 1XEXB 3A1FA 4ZYVA 4BKPA 4N5LA 2ZUEA 4REOA 2QR2A 3G5MA 2XKBA 3HV2A 1NVWQ 3WFJA 3JQAB 4ZYWA 5FT9A 1QH9A 3E3NA 1PJLA 4HQFA 5HSGA 4WXMA 1JZSA 2Q4TA 3CX3A 3PWSA 3RC8A 3IX7A 3K0FB 3O3MB 3MPUA 4X41A 1U2GA 3CT6A 2Q5FA 4R0NA 3T1VA 5L6LB 1ZKMA 4NYJQ 1ZCJA 4JHLA 4HC4A 4IDHA 4LYJA 1L1FA 2NXEA 5F51A 1JDVA 1RC1A 3TOCA 4US0R 4I5IA 1T2AA 3D8NA 3KBOA 3MTEA 5BORA 3DOUA 5BQ3A 3UJBA 3LZ6A 4ARBA 4AKSA 1JZTA 1R16A 1XQVA 4OHUA 5FTLA 1RLMA 1TPZA 5IWAB 1A71A 1MO6A 2M32A 2BMVA 4FX2A 3W2IA 4EPYA 1FE8A 4PYMA 4CRWB 4JXJA 1CVRA 1E1RD 1GPAA 3CH5A 4DJEC 3MSXA 4AQYB 4JLNA 4F4HA 2APJA 2IXEA 2VHYA 1FUUA 1H9BA 4REQA 1OXXK 5F2OA 3RUPA 2JBHA 3KZ1E 4KLRA 4X60A 1M1YE 2G9UA 3DZJA 4HXEB 1XMOB 2PUFA 1KPGA 1I1NA 5DM2A 2Z8YM 1W7AA 1GGJA 2YNMC 4TLBA 3L6BA 3GEHA 5AOCA 3JX9A 2YN0A 3GY0A 1TO1E 1DBQA 1SOMA 2AOWA 3MRSA 1WSBA 3V2IA 2QMUA 2AC2A 1UMKA 3P4UA 4QBGB 5DB4A 1QYXA 3T99A 3ELUA 3SX4A 4V0NA 2NVBA 1T5DX 3T61A 1T43A 2Q6TA 3R7SA 2GX6A 4A03A 2WM8A 1FP2A 3H1TA 1AN0A 1GA4A 2NSJA 4LJ4A 4LISA 5DHRA 5KNBH 3H2SA 1G20A 4TV8B 2XJ9A 2ZXFA 4IF4A 3URMA 4WBNB 3QXGA 2FHSA 4DXHA 4G24A 1MPXA 1GGHA 2YV5A 4NENA 4Y6LA 4C3VA 5L45A 4MJLA 1JXAA 1THMA 1I24A 3D6MA 2OBXA 4HGOA 4TYQA 4AB1A 1T9CA 2PL1A 3KZXA 3QENA 5DIZA 5D87A 5E4JA 1ZEJA 3O8LA 3L43A 1A4IA 1EDOA 2QTGA 1N75A 3H0EA 1WDKA 3U39A 2JD2A 4NPAA 4V03A 3PEWA 4JYPA 4BFUA 2ZIXA 2BUBA 5FOSA 5H7XA 4DCPA 3RSHA 3R7DA 1IPEA 2FDRA 1J9EA 3KSRA 4JUBA 1MMFB 3TG8A 2DUUA 3CO5A 1SMKA 2AEJA 1STOA 3RTCA 1QHIA 4MVJI 2YYAA 3VJKA 4FT2A 1KI1A 2H07A 2TS1A 2BIFA 2W2OA 1AUPA 3NGXA 3HMQA 2CGEA 3QX9A 3DLTA 1KPHA 4HAZA 5ERXA 5DMXA 2YDYA 4P2BA 2ECQA 3PA8A 4G0MA 4Z4IA 2VPZA 3AERB 3PQ4A 4PTYA 2F17A 2P4SA 3MQ4A 1F20A 2RONA 3H1BA 1KI4A 2AHOA 4GI2A 1UODA 1XMIA 4Q9IA 2DXIA 1M10A 3C8DA 5LB4A 1CP2A 5JNSA 4PPQA 5JPCA 3M1AA 4JLDA 1Z17A 2H9YA 2YHBA 5U1PA 2CLSA 4S3MA 3Q5GA 521PA 2A92A 4E30A 3REOA 1N5MA 1VJGA 5TNXA 2I87A 2PEZA 2WIKA 4KIUA 4L15A 2JCGA 1DBSA 3K5PA 1P1RA 3TPZA 1YU6A 1JJIA 4N9WA 1JALA 4ZT2A 2QTVA 2ZJ1A 4C2BA 3A3KA 2A5DA 2BGRA 3JVVA 4E13A 4QXQA 1SVKA 1ZIOA 4C06A 4EQZA 4LQCA 1GEGA 1MXHA 1QRAA 3LAWA 1L7EA 1IPFA 2QK4A 3IBFA 2I6FA 1EPUA 4CG2A 1GHTA 1X70A 2HMAA 3MIIA 3H8VA 1HFJA 2QTWB 3O47A 2G1AA 4EI8A 1LDGA 3R20A 3WO0A 1JAXA 5EWMA 2QT9A 5KWIA 3Q8MA 4AWBA 5EP2A 3DD1A 1VJRA 2JEZA 3FCSB 1FFHA 2BKXA 4L8WB 4MEJA 2O2IA 3UJ7A 1SXJE 2GZRA 5KUTA 4FE4A 1X8XA 3G5LA 4P38A 3SEFA 4C87A 3G8CA 1Y1QA 4K9QA 1F0PA 1NNI1 1LVGA 1W6UA 2CBZA 3M4XA 4ZVVA 5KNLA 3A4IA 4BY9E 5CVUA 3PGVA 4BNWA 5FI1B 4UM9B 1K5DA 3ONFA 3AVTA 4FZJA 3D6NB 3GUUA 4X1YA 4UU0A 3H5WA 5AXBA 5KKNB 1YZGA 3WXBA 1U3GA 3AR8A 3AMVA 2V4UA 4XR9A 3OHMA 1Z0DA 2QW0X 3CHYA 4AI6A 2Q5HA 1V3VA 1O7JA 2W6QA 4M1QA 3HPQA 3ZJ4A 1X7ZB 2I2AA 1QO0D 3ILHA 2F8MA 3K6RA 3L6DA 4HDMA 1ABBA 1PJ8A 1ZISA 3IRVA 3LT1A 4JSTA 2ECFA 4E46A 3GLIA 3EMBA 2YXBA 4WKPA 3DC2A 3ZDDA 3CUVA 2J3KA 3ZJYA 3VPHA 4F96A 1MB3A 2WU1A 4TSKA 3UJ6A 4Q3KA 4DRYA 4MGEA 3K9CA 1V8DA 1VE7A 2RHDA 4XB2A 2JFFA 2O06A 3CTPA 1NHWA 4C29A 3DT9A 1XVVA 3EFBA 1RU3A 3DLAA 2FMFA 1DX4A 1KMHB 1KJJA 2Z1DA 3DA8A 3C8MA 4FC7A 1SWVA 3KEOA 2X6QA 5EFZA 1KP2A 1E8NA 3D3NA 4R7GA 2J9ZB 1H0KA 1Z6AA 2JZNA 3E9QA 4NBSA 3IJPA 1GKYA 1G6OA 1L7PA 1EFTA 1T1JA 3FCCA 4HDSA 4MV6A 4UUNA 5TQ0B 1QHNA 2A67A 1ZK0A 2GXSA 2JVKA 3X3HA 1DKQA 5ITSA 5KHOC 1N0IA 1UZAA 4BPRA 3QI2A 1YZ3A 1BS9A 4J2TA 1FDSA 7ABPA 3NTXA 5BW5A 1TYCA 2R8BA 3N0XA 1R4MA 1M8KA 3TLBA 2DB3A 1F48A 3GLRA 1XWIA 4FGSA 4DC0A 3R6TA 3GX1A 1X1QA 2CDCA 2POCA 3HXTA 3SEAA 3AL2A 1E6WA 2D5CA 5JAIA 2X5JO 4H59A 4YK7A 1RVDA 2VI5A 2B4QA 3DKKA 1EVQA 3E9EA 3W5HA 3D8RA 1OASA 3RFVA 9GPBA 4BMZA 1PGOA 2IVFA 1FSFA 3G2OA 3U9LA 4X5OA 4AJLA 4H7PA 2ZS7A 3SMQA 2H1CA 1R50A 2PMDA 2TMYA 2VHWA 3L0ZA 4MEBA 4J8PA 4RK7A 5K45A 2EKDA 1FYVA 4P80A 2D54A 5TF0A 3RUEA 3FHTA 3VO9A 1SKAA 3NUZA 4AY3A 4D3ZA 2AHRA 1AE1A 1FF9A 3WJ1A 3LQYA 3M7IA 4J3FA 2VSXA 5A7GA 3H6HA 3IDSA 3TW0A 3ZW7A 4RZUA 3FKQA 3V3KA 3W9BA 3WGYA 1AQJA 2XNKA 2AG1A 3NPMA 1NRJB 3JRXA 1DKUA 1J25A 4BLSA 4DGQA 3KQSA 3NW9A 4OQMA 1TKCA 2CJPA 3JALA 2KMLA 4QOFA 4WDRA 2I7TA 4Y2GA 3AEKB 3AZQA 3B7WA 1GTRA 4D26A 3TEFA 2Q46A 5CX1A 2Q28A 5E6UB 4K2AA 3W4JA 2ZB2A 3WB0A 4QA9A 2IH5A 2OESA 2GO7A 1WLYA 3OT1B 3LX5A 1YJQA 4GMGA 1CZRA 3AYZB 2QL5A 4IWXA 3COSA 4JBLA 2Y1WA 3PUIA 3ZZMA 3F73A 3IAHA 2HZBA 4G0ZA 4JWTA 3HJAA 3GYGA 5B37A 2RAPA 1K8XB 3H9EO 3JYOA 4G5FA 3DEZA 3CLTD 3E7FA 1GIAA 4PIVA 1YO6A 1XTBA 4FOTA 2HMUA 1NVVR 4X24A 1S2IA 5LZ5A 1G4HA 1NXWA 4B3MB 3GEGA 3GQBA 3R0ZA 2C7QA 2X8JA 2HZ7A 4OMUA 1TM3E 4IGAA 3WRYA 4B09A 5HQ3B 2VJCA 3A7EA 1WDLA 1I94B 3ROQA 5LU9A 3QEOA 3O4VA 3IE2A 2VHTA 2ACVA 1L3BA 4C0HA 4OUKX 1E1NA 4D46A 4DMFA 5T7BA 4UNIA 5UKDA 4UNSA 3I2JA 3PNPA 3ZH2A 5M04A 1NZFA 1PUXA 1TYDE 2YC4C 1Z25A 1NV8A 1HEUA 4MYDA 1WUJS 2HJVA 5EUBA 3RABA 3U4DA 4CR6A 4ZK2A 2FJ0A 2XDAA 4JBXA 3EIXA 3ZTYA 5HJ5A 5T3UA 3MWDA 3Q0TA 3E8SA 2CNBA 5FAXA 2RKWA 4QJ4A 4AU1A 1YAHA 4O1HA 1QRTA 1JPJA 4XWGA 4CN9A 1T6NA 1UM9A 1PJZA 1GD1O 1O5TA 3GLKA 3RVBA 1JQBA 2J3LA 4CQLB 4DE5A 5CB4A 1QCYA 3ZHCA 3ANMA 4WOJA 2XCTB 3HKEB 4QFBA 1KEUA 1ZW6A 1PZGA 4PGMA 1RZRD 1KMQA 2AXEA 1SG6A 1GPLA 5IPFA 3IR7A 4M1KA 2IGTA 2V7GA 3IVAA 1KS2A 2O2EA 1FRZA 1W4AA 5DVZA 1SOAA 4ZAWA 2QOEA 1F2DA 1EGHA 3LCUA 1NBIA 4KAFA 2WA1A 3GW8A 5AUNB 1E9SA 1KDOA 4D9GA 1I1QB 4KREA 2I1QA 4GQAA 2FFAA 1OXMA 1ZH2A 3B7PA 4D9BA 3VKUA 5DWVA 4KX3A 4M9QA 2XCSB 4DJAA 3CVWA 5AVOA 4HNRA 1A9TA 1O4VA 1MU0A 1RQXA 1PG2A 1QR6A 1GAJA 1GRRA 1SB9A 2A4KA 4RM3A 4Y2XA 5JSFA 1JFRA 4K9OA 1YE8A 2OORA 1JDJA 2P9GA 3B7GA 3CPSA 3DHWC 2D1FA 3FVWA 3P32A 3LKDA 5DV9A 3TSOA 3UMCA 4Z5XA 1OB5A 3R0XA 2VKTA 4BLWA 3DULA 3OCXA 3P7MA 1IC6A 1W29A 1I10A 1Q21A 1FPMA 5AHOA 1QLJA 2EX1A 4WN3A 2HT1A 2RHMA 5I51A 3MIZA 3TQIA 1A95A 2GN1A 2MJLA 3TO5A 4RVDA 3AUUA 2XMSA 3OE7D 4NCIA 1G16A 1ND6A 3BGVA 5BWNA 1X1AA 3IQWA 5DT9A 3IVGA 2O0LA 2Y4OA 2I67A 621PA 4D8UA 4JEMA 2EZ8A 4U2BA 1CW2B 1JHPA 1MKYA 1F60A 1PRYA 4WFQA 1OCEA 4QNRA 1AOXA 3SXPA 3LXRA 4FGKA 2EIXA 3F9CA 1TTTA 1SXJD 2CDRA 1ZCAA 3GFPA 4MW5A 4INPA 4ND2A 3T7IA 4JBNA 5H0IA 3OQBA 2ZUTA 4LY3A 1TJ3A 1Y8ZA 1EP3B 3MB8A 4Q82A 1N34B 1KEWA 1VIDA 2H1SA 3B6EA 3FNFA 4UVGA 1J7JA 4K9DA 3A6LA 4TYWA 1WVIA 2FPIB 2HEGA 1B26A 1KJYA 1NPTO 1RXEA 5K2MA 2Q9BA 1PTKA 3LPNA 1YJ8A 1VKHA 5I5GA 4H7KA 3EZYA 4NEHB 1AH2A 1XO1A 1FTWA 1Q7TA 3B6KA 3EC1A 3ELWA 1DCKA 4OJKA 4QYXA 3T5PA 3E70C 3GT7A 5JXJA 3NXKA 1Y4SA 1DMRA 4WCVA 2C99A 2GOYA 4JYMA 4JUCA 5KC9A 1ZX1A 1JG2A 2WYVA 2ZSDA 3I9MA 4PPYA 3THSA 4FYJA 1X8LA 3VDXA 3R8CA 4E5DA 4DC9A 4H16A 3E2MA 3F5MA 1IN5A 3PVZA 4R9RA 1ES9A 1KP3A 3WK4A 3Q3GE 2X5KO 3EGIA 3WYAA 2RE8A 4ML3A 3CURA 2R7LA 2W6OA 4QUJA 4XUCA 4OYYA 1KGDA 2CUZA 3N86A 3ZJVA 1V7CA 2NTEA 4JZKA 2YYYA 4NSNA 1IOWA 2ZCUA 5IC6A 4CCSA 5ICCA 3PDHA 1GTVA 2QR3A 4JT4A 3VSAA 2WWTA 1CNMA 1SUWA 1VHWA 2HKIA 1SEVA 3LUGA 4C6SA 3I05A 2FLVA 4BFTA 4YRDA 1W96A 2BJWA 4H18A 2UUAB 2I8LA 2RGCA 4HDAA 2ENWA 3LT2A 1N5RA 1EWKA 1ECPA 3HU5A 3LXXA 3N0RA 4YAGA 1DRKA 4TVSA 1L5SA 5J40A 1XF9A 2R6JA 4PFSA 3EVTA 3A10A 4POOA 4L72A 5I7SA 4KRXA 4XLTA 4HK4A 3RU9A 3A1CA 1HZZC 1U2TA 4A27A 4DIFA 4OHYA 2AOXA 2GGSA 4CLRB 5LOVA 1KNXA 1OWPA 4D96A 2XIQA 5DCLA 1EK0A 1EVZA 5JC1A 4LK3A 1IN4A 4BN4A 1VC2A 4E07A 1NVAA 4KUEA 1KH3A 2WSSD 3Q3IA 4XLZA 4AKIA 2QAGC 5DSZA 5B12A 1LDBA 3AI2A 1Q15A 3NV9A 5L3VA 2IS1A 1DPGA 2XOXA 3HJGA 5FI3A 3T3GA 1ESCA 3NWBA 4C9BA 3H97A 3LC2O 2BFBA 3TGPA 1UDXA 1XXHE 1R5OA 2A1UA 5KSOA 2H0AA 3I1FA 3ZWVA 3M9XA 2PPVA 3IUQA 3VQTA 1CJUC 3AEUB 3H2YA 1DOHA 1GN8A 3MM4A 4RESA 5TQ2A 4Y1RA 2VPXA 2ZDQA 2Y27A 1BGXT 5HOQA 1ZR2A 3LRPA 1P33A 4LZWA 1N5LA 3EIQA 3U3XA 2EARA 3ZOKA 4ZI7F 4EMBA 1OHHA 8ABPA 2ZRBA 1F8UA 2QENA 1PQ4A 1K75A 3A2MA 2Q5LA 1WMSA 1BDHA 3T0GA 3D5EA 3P9IA 2NQTA 5GONF 1TIBA 2AI2A 3S40A 5B4VA 1LC0A 2ZSBA 4GEGA 5D3MB 1AMUA 4QTUB 1DX6A 1E77A 1UPTA 2D0OB 4L9SA 1WW2A 4A91A 3NEYA 4WDQA 4KVFA 3G2MA 3GEEA 3OVMA 1MVOA 1VMDA 4LY9A 3AINA 4F6RA 1JSXA 2ZANA 2Q1WA 1KDZA 1GVHA 3CEJA 1N6KA 3PYXA 3LPMA 1ELOA 1PL8A 1Y4DE 4ILKA 1PG0A 5FPYA 4NBRA 4QT4A 4B87A 1IYZA 2WAAA 5EMKA 2PH3A 5SZHB 5EVJA 3GGSA 4QBIA 3RC9A 4ENTA 3RC7A 1JXOA 3HTXA 1M2VA 1DQYA 2IXAA 2GPAA 3UHJA 5TMPA 1K92A 2QPOA 2QUBA 2Q5JA 3DDCA 1LGYA 2QL9A 2WYHA 2XT6A 2YMMA 3ORYA 5CMLA 5I6DA 3IT0A 2NU6A 1B00A 1ZK2A 1ZWKA 1QWSA 4DQDA 1T24A 2FX5A 4R5MA 4TZKA 1LDMA 1XOIA 2FUNB 2OCXA 4OI2A 4E94A 5GINE 4XTRA 4L8GA 4Z7NB 4EF5A 2IGBA 2IYPA 1V25A 5DM70 4EFNA 1YVRA 4QPCA 4HYYA 4Z9AA 4GSLA 4C76A 5AMXA 5L3RA 4Z53A 5D3ZA 1ZONA 3GNLA 3M89A 1MABB 3Q11A 4ZGBA 1E7RA 4CMAA 4EDFA 5EJ5A 4KU4A 5ICMA 2ZE6A 2BAGA 2L18A 3C8HA 3OEED 1YIOA 3FOWA 1Z37A 3KWLA 1ESDA 4HPXB 3WLOA 4AICA 2XTZA 4ZJZA 5DCWA 1MIOB 1OIWA 3KJNA 3ZKWB 4CR8A 4BLPA 3OKPA 2PJRA 3L7CA 3V2GA 1EFKA 3NAMA 3VTAA 3WL4A 4XGIA 1OMOA 3RRYA 1BSVA 2Q0HA 3HY3A 3NANA 4M1MA 4BQPA 2OGUA 3EUEA 4P08A 3BN3A 2YWDA 1ZK3A 3ENVA 3QF7A 4BJ1A 5FNVF 3D59A 1H2AS 3AJDA 4Q4LA 1WLSA 2GESA 4DLPA 5EE0A 3ADOA 1I0ZA 1RPJA 3QVJA 5EVCA 1MX3A 1NLUA 4A3SA 1V47A 3QK7A 2BMWA 1GYRA 2QUZA 4WK0B 4DCJA 2EW1A 4CDMA 4ETWA 4Q3OA 3TL2A 2JGAA 3RVQA 3O2JA 2C0CA 3AEQB 4R0MA 5K9ZA 1SIUA 5IM4F 2GKSA 2WZCA 4UVIA 4JSYA 4MDEA 5E1MA 4H1WA 5C5DA 3HS3A 4JH0A 1IXRC 3ZQKA 3SQOA 1YS4A 1CJVC 2E4VA 1ILWA 2GEKA 3U3DA 4KJZA 1K5GA 1FX0A 2PWZA 3ABSB 3WTBA 1BRTA 3F3MA 3PGLA 2A5GA 5E1DA 3JASB 3M6FA 2O57A 4MI1A 3LWDA 2UZ4A 2QW8A 1TEHA 5EAIA 4B33A 1JEJA 2AZ4A 4NYJR 1DKRA 1XT6A 3QYJA 3O74A 3RASA 3SG0A 3ZW8A 5LLTA 1V8BA 4NYIQ 3ZD8A 4EQ6A 3N9IA 1RAIA 4CM9D 1SHTX 1LLDA 2COEA 2OVFA 1H42A 3S70A 5B7PA 2JJQA 1BWPA 3QYAA 2Q07A 3TLGB 1A1VA 1PTJC 2GPYA 5FA6A 1XDBA 5B2FA 5LBIA 2I4RA 4I5DA 2ZR0A 1WXXA 4J03A 3O4RA 3UB4A 4JGIA 1KQ3A 4D98A 3MZ0A 3W5BA 1EGAA 2QN9A 3MYRA 4A0FA 3EPJA 5EZYB 3CRZA 4FDAA 1ZUNB 4X54A 3U5TA 5K0ZA 3HO1A 4R4JA 2UVPB 4M4SA 4G1VA 1NW4A 1TMGE 4MI9A 4Q39A 2PE5A 5A5GA 1ZQ9A 2UZIR 5JTUA 1UADA 1NAIA 2CLDX 2I7DA 2ZAGA 4G5YA 4OB8A 4UPDA 1XCMA 2OXTA 1L4BA 5B7QA 5LQNA 1W73A 1GY8A 4BXOA 2A0YA 2LBPA 4HUQB 4C2AA 3U7HB 1GZDA 4P58A 1NI3A 4I4IA 4O0LA 1PR0A 2ZTLA 1Y98A 3CCCA 1DJMA 3D64A 1M5UA 4BFLA 3SQXA 1TW2A 4S0XA 4YUZA 1D4AA 3EMKA 3DBVO 3G8DA 2R48A 3NVAA 5AJWA 3QNWA 4YBRA 4QGSA 5CB0A 1PQWA 2JB9A 3D8SA 3F4KA 4IWNA 2X8AA 1JSCA 4B85A 3CX8A 2Q2WA 1JDBB 2GLXA 2I7VA 2XMRA 3LTNC 3PEYA 1CE8B 4PZYA 1EUZA 1Q0QA 1AX9A 1WCYA 2NYUA 5BN5B 5IU6A 3IUSA 1QFSA 1ZMRA 2VNSA 2W4MA 1DAHA 1XZDA 5DNDA 4B81A 5I8PA 1N8KA 2DBYA 3KQLA 1TZKA 2W2VA 4DM7A 3QU7A 5ILQA 1J33A 2IYQA 3C3EA 2RK3A 1TD1A 2Y9MB 4GT1A 2R8EA 1SBTA 1HTWA 1R9JA 2PTGA 4NICA 2CFOA 3EEOA 1N78A 4OHOA 3EAFA 1V3TA 3HXMA 4EELA 3HC7A 3FM9A 1SO8A 4UHKA 4RIGA 4GBJA 2WB2A 3OZWA 3HR4A 1JJBA 1LBSA 2JLBA 4M0FA 3A1SA 4XGRA 3B1FA 3JQ9C 4TRRA 2ATIA 1U7PA 2WWFA 1EXMA 4K9NA 5E6RB 1KI6B 1KY5A 1QH1A 4QUEA 3WBBA 5B7NA 5KQMA 5H8WA 3GFOA 5F3WB 5AYVA 4WNAB 3W8NA 1T13A 3E9CA 3WIVA 1TCBA 3SHQA 3L8FA 5D01A 1AS3A 1SOVA 2CYAA 2QNBA 3EDQA 3NWPA 3OX3A 5CT4A 2C7PA 4XTCS 4O4HF 3GRYA 3TFWA 1G5QA 4BNMA 5TMEA 4IDQA 1WHTB 1PG5A 2IYYA 2HQ1A 5CM2Z 2G77B 3I3OA 5JLAA 3HSKA 2V55B 3H5TA 3FETA 4W5NA 4H15A 5FBRB 3OUTA 1S6YA 5EHZA 3JQRA 3UY4A 4K9KA 4WVFA 3DTTA 2OO7A 2EG5A 5CFZA 4RJIA 3LHIA 4KXWA 2VIIA 1N1EA 1XD2A 2NWQA 3VGJA 1V5GA 4D3DA 1XRMA 4YUWA 5F98A 4EEXA 2VQSA 5AKEA 2FH5B 4LXHA 3BWCA 3T9CA 5IANA 4EJMA 3FKSD 5D86A 2GZHA 3I45A 2CMHA 4TWAA 1E1YA 4L5JA 5B58C 4QGHA 4U9IS 1LQ2A 3CEHA 1XVUA 2Y92A 1LXCA 2RKOA 3H6GA 3PUHA 4OATA 3KE9A 2W6NA 3RB8A 3RVSA 3T6KA 2C2GA 5J23A 4NFLA 1PDVA 4W9NC 5FBQB 2ERCA 2O8EB 1EG2A 4XM1A 4AF6A 1MB0A 1QIFA 2XH8A 5LZ7A 2GBLA 4EKDA 5JNRA 3PNMA 2FOXA 4LSZA 2YHUA 3BK7A 4J94A 4B40A 2I7CA 2ZYWX 4BCDA 4AP9A 3ED5A 2HLDD 4D41A 1W36C 4KQWA 1E3WA 4BHTA 2R8YA 4X84A 4ES6A 4OJMX 1ONBA 4IIBA 2M6RA 4MB2A 3G1WA 1JF8A 1K2VN 3F9RA 3DAYA 3BD7A 3DMPA 3M8KA 4EL0A 2J3MA 3TLKA 1H5NA 2XMZA 1RFLA 1AQLA 3QKUA 4TKVB 2XNCA 4W63A 5MFPA 2D74A 3JWPA 3MERA 4JOCA 2X4IA 1GZSA 4XB6B 4YRBA 1KDPA 1SCUA 4YMGA 3PNYA 2J48A 4TMVA 3L93A 1B93A 2ODWA 3C3WA 1FFCA 5LP6B 5IYZA 3HUEA 1XJQA 6GPBA 1RABA 3N3BC 3A6ZA 4Q3LA 1RP7A 4B2PA 2ODTX 2PA3A 1V6SA 2AB0A 3RYIA 2XCLA 4FIZA 1ZXXA 1B6SA 1OFGA 5TT1A 3ZQ6A 4BKOA 4G1BA 1NNUA 2QORA 1R6XA 3CJRA 2CUTA 3H11B 3HI6A 2WW8A 5CFOA 4JBYA 2R1TA 4BMVA 2EGUA 3R4CA 2B1RA 3IQXA 2Q6VA 3RU2A 3LQ4A 1UFQA 2ICAA 3ZU3A 2CVFA 2HA3A 5LYJF 3F8WA 1N0UA 3FUVA 4BEJA 3MCUA 2G1UA 1G8GA 2NQ8A 3NHYA 4FE3A 1FSGA 1DZIA 1W93A 4QUKA 4TLDA 3OLCX 4OGGA 1NR1A 2HV9A 3SK0A 5HKBA 1PT8A 2WAXA 1D2EA 2WVGA 2PS0A 2VWHA 1FNNA 3Q6NA 2V3CC 2RI0A 5TSDA 4RXTA 1FYEA 4UQLA 2GPTA 3L0DA 2PWYA 1HETA 4MH0R 4P32A 1XD8A 4AY4A 3H4TA 3BQMB 1P6XA 2KLBA 1C7QA 1E5VA 3IAS1 4G5GA 1GJRA 2G0TA 1SU6A 1KAMA 2HL6A 4XCQA 4BQIA 3AM1A 3B3GA 4Z3KA 1Y4ZA 2Q5IA 5DO9A 2WOJA 3EVAA 4E2ZA 3ZI4A 4A6PA 4EG6A 3OFSA 2KBEA 4ZHQF 1YJXA 3EA4A 3DBRB 2IH2A 3W6ZA 5T4HA 2ZIEA 2JGRA 1FFWA 4PBSA 3AK4A 2G5CA 2GILA 3K0AB 3BTUA 4R9UC 5ALZA 1IAQA 5B53A 4BMYA 1P74A 1MB2A 3Q87B 4EHIA 2IOYA 2WUDA 2YXEA 2XPCA 3AXTA 3NQ41 3Q7RA 4MA5A 2VP2A 1LJLA 2PMWB 3UW1A 4MMYB 3H5NA 4ZCRA 1GP2A 1W1UA 4X66B 1U98A 1SC4A 2QLLA 5AOVA 4IGEA 1GDHA 2AZMA 1VYHA 4LS3A 3UMVA 4UDYX 1PEDA 3Q88A 1W0JD 1DRUA 4O4IF 4BLVA 1ZH0A 2NP6A 1PQUA 3ESXA 1X9GA 3AU9A 3IOBA 4N7BA 4TS1A 4PLHA 3TR6A 1XRPA 1VI6A 2IYXA 3IP5A 4NYMR 3KAJA 5F2KA 4X65B 1PBTA 4ZEVA 1F5NA 4P4UA 2YFYA 3AW8A 4GYKA 4QOJA 3PUXA 2CKDA 4X7PA 4KZKA 3THYA 1UBRS 3HLTA 5EQTA 3U6KA 1NN5A 2W4IA 1KIFA 4CM4A 5KDOA 4DUZB 1EX1A 3ZE8A 4LJLA 1PJ4A 4FSHA 5T3YA 1CQZA 3UXHA 2HHHB 4XR4A 2Z95A 4FI3C 1NUSA 3O7MA 4MWSA 1R00A 1N0VC 4GL2A 3I34X 4K3UA 2EV9A 3L02A 3LP5A 4D92A 2BFFA 2IOHA 1KOGA 1RI5A 2AR0A 5JO9A 3B8HA 2VSFA 2WLSA 1OH7A 4MP6A 3KVNA 3CRRA 1Y7LA 1Y1KE 3FMGA 3C3BA 4N7MA 4PHGA 1Z8DA 3GJQA 3QUAA 3PGMA 4D4GA 2AFHB 2WHYA 1PWEA 3EEYA 3I52A 2CSUA 3MS4A 3KQTA 2W6ID 1JAHA 3H5RA 1N8TA 4O4HB 2QN1A 4PRLA 4YRJA 2MU1A 4BFVA 4WK6A 2AI3A 1FDIA 1V7PC 3AB8A 3KFVA 3T9BA 1F7VA 2ZSJA 5BP7A 2GN4A 2OGSA 3U4IA 2VZ8A 2O4UX 2ZB3A 3PKZA 1T10A 5J4LA 1I6KA 1JG4A 1NXTA 1P9NA 4JB3A 1KO5A 1CNEA 3L9WA 3KYIB 4LJAA 3ZE6A 4D9HA 3KFXA 1SUIA 4EPRA 1E1DA 1IXZA 1Z07A 1OXVA 2YIJA 3F6YA 3G9TA 4KV7A 3GZJA 3ZK8A 1NBOA 1AKUA 2WG1A 6REQA 5JXHA 2QGFA 1I7LA 2AC4A 4UD2A 5AK0A 3ZVLA 2XCOA 3A31A 3UJ3X 3SY8A 2EVWX 2XAAA 3LHSA 5I45A 4DYVA 2DULA 1CRZA 1LPBB 4UEJA 5HZHA 1LEHA 2PX6A 3AUTA 1ZP6A 1RPTA 1P29A 1JAIA 2AUTA 1CERA 5K3CA 3FAZA 3GPIA 1R0ZA 3K16A 1X9IA 4MQ6A 1H2ZA 2JLRA 4Z8XA 3WGQA 2XBMA 2DT5A 2NZ8A 2P6UA 4AJEA 2PMKA 1GSAA 5LMUB 3N74A 1U5CA 3QX3A 4BX8A 2V5UA 1O6GA 4GICA 1HPLA 1ESEA 4H6VA 2X23A 3I5UA 4J0HA 3G2NA 2VDRB 5ILGA 5B6PA 3HL4A 3JWJA 3PD7A 2OR3A 3GFBA 5AVQA 5K8IA 3KM0A 3KLPX 1TFUA 1QUEA 5CT8A 2QVXX 1XELA 2XDQA 5BWOA 1ZM7A 2VJYA 1VG9B 3D7LA 3SBEA 5ICFA 1E4VA