4EW3A

The structure of human glycinamide ribonucleotide transformylase in complex with 10r-methylthio-ddathf.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
205
structure length
205
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biological and Structural Evaluation of 10R- and 10S-Methylthio-DDACTHF Reveals a New Role for Sulfur in Inhibition of Glycinamide Ribonucleotide Transformylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
total genus 65
structure length 205
sequence length 205
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ew3A00
1RBQA 1ZGHA 3TQRA 4Q12A 2GARA 4ZYWA 4ZYVA 4IQFA 1ZLYA 4YFYA 4ZYZA 3KCQA 1C2TA 1RBYA 3O1LA 4ZZ0A 1CDEA 3W7BA 4EW2A 4NV1A 4ZZ2A 1ZLXA 1RC0A 4EW3A 4S1NA 4ZYYA 4ZZ1A 2YWRA 3TQQA 4ZYXA 5J9FA 3AV3A 3DA8A 4TTSA 4PZUA 4DS3A 3LOUA 1C3EA 1MEJA 3Q0IA 2BW0A 2FMTA 1FMTA 3AUFA 3P9XA 3GARA 1GRCA 1RBMA 1JKXA 2BLNA 3NRBA 1MEOA 4R8VA 4YFVA 1S3IA 4ZYTA 4QPCA 2CFIA 4ZZ3A 1MENA 1GARA 3OBIA 1NJSA 3R8XA 3DCJA 4QPDA 1RBZA 1YRWA 4TS4A 5CJJA 4EW1A 4ZYUA 3N0VA 4TT8A 1CDDA 1RC1A 5J63A
chains in the Genus database with same CATH superfamily
3OIYA 3PVCA 3IB6A 4JLWA 3GIWA 1TCBA 2ZE7A 4OQ4A 2X2OA 1W36C 5DTEA 2MSKA 2WW8A 3RC3A 3W2IA 1R5OA 2EW8A 1UQRA 1M6WA 2ZJFA 4AM8A 1T8UA 2C58A 2RGAA 3W5SA 4HVCA 3OLZA 2OILA 1I13A 1S6YA 4NX2A 5INTA 5JCXA 5EI5A 3PD1A 1F0YA 4IJQA 5JSFA 2CL0X 3NTXA 1FK8A 2MMCA 4G86A 1X9IA 5G0VA 2FMKA 2ZIXA 2Q6TA 2PGIA 2XMQA 2GBLC 2XQJA 2IEGA 3BERA 3DBLB 3JYOA 3BCRA 4I81A 1J2YA 5JTTA 4EG1A 4DMRA 1N9KA 4UC0A 4IDGA 1QS0A 1IAQA 2MSEB 4L2IB 5FEMA 4BNUA 4F56A 2GK7A 1XVLA 1CUIA 1ORWA 3C48A 2GHIA 4CEJA 2YUIA 1T5DX 4IX9A 2I99A 1RLTA 4I4TB 1ICIA 4BMXA 4ALKA 1PR9A 4A6DA 1XZEA 4G07A 1JEYB 5JCZA 1IDOA 1L5HA 1U0NA 5A04A 3W79A 1MNQA 3E03A 1CUZA 4IDDA 3E8SA 3PGVA 4RMIA 1ZINA 1TGYA 3I2YX 4G4GA 4WK0B 1FU7A 1TD9A 2PN1A 2COEA 3Q7TA 3H8JA 4E14A 4CKZA 1U3TA 3GRVA 3IVRA 4YK7A 1BA3A 3WK9A 1U99A 3JATA 1DX6A 2P0EA 1RLJA 3M5PA 4WBNF 3QYFA 3GH3A 4KFRA 4ESOA 3CPHA 3N87A 1PNVA 2GX6A 2OCIA 3OLCX 3ZKWB 5DNCA 2NO7A 1J09A 4FDMA 4F45A 1ADCA 3L0PA 1MNAA 3WIVA 2YVQA 1HYEA 4N7JA 1FFBA 2YQ5A 2ZB7A 1BX0A 3LP6A 4NE2A 1EVJA 5IBCA 3ICQB 4X61A 3VPDA 4F4IA 1A9PA 2PLAA 3H6GA 3G2HA 3N8KA 5KSOA 4CGZA 4JC0A 4XSHA 3ADBA 4F04A 2QX4A 3ZWYA 4B3XA 3IQGX 2P3QA 1E6WA 1RS0A 5JMPA 4HVAA 2W6NA 1XE3A 3I0NA 3P0IA 1KYWA 3NEYA 3W1EA 4RF4A 3WI7A 4EUHA 3PGA1 3R9XB 2BKUA 3KUCA 1L5NA 4C07A 3HDHA 2QJRA 2ZREA 2QD5A 3HKBA 1J49A 1Z4MA 4MVJP 4WNYA 3RIHA 2IPNA 3HU1A 3B6EA 4QELA 1AKQA 3KP1A 3EXAA 1CD5A 1M3SA 1V8FA 1MAUA 1DBRA 4FP9A 4MWDA 5JVDF 2KJQA 5IM5A 2HR1A 5GAJA 3ONVA 1V3QE 3TF5A 3T3OA 2BFEB 2EXXA 2G8LA 1DLIA 2ONKA 3ND5A 4KLRA 4CG3A 4G97A 3WLOA 4YUYA 3FDFA 3C85A 2XDAA 3C5CA 2J3QA 5BSRA 2VJLA 4W9RA 4KXWA 4E51A 3LRXA 2A0YA 3C8MA 2IPMA 1KP3A 1CE8A 1K2VN 3BMXA 1R4ZA 1Y8RA 1ZWKA 4R9RA 5PGMA 1SPBS 3B5EA 1QFSA 4A27A 4EMSA 4CL0A 1QZXA 4ZDWA 1FDRA 4XW2A 3I30X 4MKFA 3R40A 3RJMA 1I94B 4P54A 4TKMA 1QHSA 3GRYA 1ADYA 5JO0A 1V25A 3MJDA 1CZKA 3RU3A 5IK2A 3TR0A 4COKA 3D0OA 2P6UA 2DB3A 3A3PA 4PSCA 1IM2A 3TOXA 3GP8A 1OI2A 1QO9A 3PGKA 3DF7A 3K0HA 4R71A 1O89A 4RANA 5BWCA 3KHSA 4DGSA 4M0PA 4DBLC 3LUHA 3GPCA 3ASYA 3IE0A 2QP9X 4TTAA 5H83A 3WWZA 5LXTB 1G38A 3P0EA 3KT6A 1WVIA 5KTTA 2XGGA 2VDLB 4ZT4A 3FR8A 1FSGA 3KM0A 4Z6KA 3FYUB 1Q14A 2PKRA 1MKYA 1RAEA 1RWQA 3C4QA 5TMDA 1YR9A 2GK4A 1PQPA 4RV5A 1X8LA 2XIQA 3AB8A 3KCNA 2QRHA 3W9UA 4QOFA 3ZDZB 4WZAA 5F2KA 3C16C 1BWRA 3G7UA 3RR2A 2ZT7A 1NKSA 3I6ZA 3QEKA 4QWMA 1L8LA 3OT5A 3QVUA 4MV1A 5FTMA 1DAEA 4HMPA 3LX4A 3LO8A 5AK0A 3U61B 3G1UA 5KU7A 2O20A 4UHBA 2BGTA 5CFOA 1X7XA 3I2FA 2Z2IA 1UJ4A 4OFZA 4KQ1A 4UTZA 4LDAA 5FTKA 1QB8A 4IPTA 2ZSIA 2HQRA 4LZLA 4KHZA 3A31A 1AA9A 1SUEA 3HDQA 1SQFA 4NF2A 4S1PA 5CR9A 2VHJA 3SD7A 3UENA 1FY2A 4NG5A 3V8QA 4CCWA 5JCJD 5IU6A 4NENB 1TPZA 1UMKA 4LGYA 2NUTB 5I5EA 3A27A 1TMYA 4U1RA 5LFAA 1RPZA 1Q1BA 3IDQA 1L7VC 2ALJA 2XNHA 4UQLA 2O06A 5AW9A 5BRJA 3AG5A 4PGGA 4H6XA 3WVNA 2AA3A 2Z04A 4GPBA 4RA9B 3ZOKA 1OFVA 3JQBC 4QM6A 4EFLA 4GM0A 4G89A 1UBOS 2EG5A 4UD2A 3WL6A 1I80A 1OA0A 3OY2A 3SOZA 2BFFA 1XMSA 5DYTA 2FPGA 3ETEA 4IIEA 1MABA 5LP1A 1NXXA 3JWEA 1LZLA 2DBRA 1H2XA 3I3SR 4YHHB 3G8BA 3OX3A 4FFLA 5IVKA 3MS2A 3UAOA 5EWMB 4MVJF 3NUZA 3VA7A 3ILVA 3QOFA 1H4TA 2F17A 4JGBA 3V8RA 4YRAA 4WVLA 4TX1A 4XYBA 1O94A 2IUYA 3WAJA 1KDPA 1L7MA 4LVCA 3R9XA 1G6Q1 2AFIE 2P9ZA 3PA6A 4G37A 3EXHA 1JXQA 1PE0A 3PITA 3TB6A 3LCJA 3WRVA 4PSDA 5CFMA 4TWZA 2G6BA 3LPNA 4O1IA 4S0XA 4EBBA 4KFCA 3VJLA 5B7GA 1C0PA 1OZAA 1X3SA 3O2JA 1MXHA 1JDSA 3U7IA 4HZUA 4CCAA 4F2PA 1AMNA 1QVVA 4DKJA 4BDSA 3K0BA 5CEJA 3CW9A 2ZRPA 4LY9A 2BF4A 1NBMD 2CUNA 2ODEA 2ZRLA 3P2EA 5BN3B 1E3EA 2YCLA 3LTEA 1AUPA 2EL7A 1LWNA 3C7AA 1T8YA 4GW3A 2G1AA 3NIFB 2YMPA 1AUXA 1JT9A 4OMUA 4B6FA 2R1UA 2QPOA 2QU8A 4HMQA 4LNHA 4DV2B 1BX1A 2X4DA 3DKRA 1SKAA 3RUAA 4D8UA 4BKOA 2EKLA 3TSWA 3TGWA 3MTJA 4ARVA 1SMKA 4HWSA 3SP1A 4X41A 1U8XX 4UM7A 4CF7A 1H4VB 4N3AA 3U7FB 5KC8A 4OPMA 1OTYA 4RGBA 1PYOA 2F64A 2OZKA 4JB3A 3T7EA 3JAKB 3THXA 3AI2A 4RKEA 4B6RA 4MQUA 4POOA 4ZAVA 1CS0A 5FTNA 3R7NA 3AJ9A 3T7KA 3KYCA 1BE6A 5KBYA 2H1FA 5HF8A 5I3CA 2VPQA 2HSEA 3K2BA 1HDCA 3HSSA 4YQEA 3QBVA 4AJOA 3HBFA 1W88B 3S40A 4FLMA 4JJAA 3I2KA 2B3TA 3JXEA 5JSZB 3FLMA 1FW6A 3AETB 1N2SA 2YWCA 3E2MA 3MYRA 1B15A 2YMLA 5DISB 4I7EA 5DKFA 4CKEB 1R50A 4YROA 3VZSA 1NRXA 4KAJA 2O2ZA 3T9DA 2OBNA 2O6LA 3A28A 3F6EX 2VCEA 3PUHA 3UHAA 3TKAA 1D4FA 4KMMA 4LY6A 5DJ5A 2B2XA 3IOEA 4F4DA 3ZE6A 3BMOA 5JS2A 2RGWA 5JXJA 3WL5A 3K70B 1DCKA 1B8NA 1E8MA 1KKMA 2GA9A 4YMHA 1UXOA 1NIPA 3MUFA 3WGYA 1FNMA 1K2WA 3ER9A 3MYYA 3VRHA 1DFIA 4EDFA 5EWJB 2DERA 3TEJA 1V6AA 1X74A 2GBPA 3D7MA 3I5UA 3R5HA 3H13A 1KEZA 4MW1A 1SCBA 4GX2A 5CVVA 3PI7A 3SMVA 2B69A 1XNJA 4DBLE 1RTKA 3P0HA 3D54D 2H18A 3MUOA 4P3YA 1ISJA 2WQZA 4NMLA 4UAJA 4B33A 4BUJA 3G5MA 3O91A 5CVTA 1DC5A 2L2QA 3QU2A 1MUUA 1HZZC 1M74A 3AY7A 4FOOA 3IT2A 4O5OA 1SUBA 4ROSA 4BN0A 4CMBA 1JVNA 2WPDD 5C46F 1R8QA 2CDNA 1W8DA 2AJTA 4DUYB 2W2OA 3CU5A 4GMDA 4WI1A 1Z17A 2HWYA 4FINA 2C5SA 2VRCD 3TO5A 3W1WA 1NUQA 4BNIA 1OU4A 4DJDC 4DDVA 2QMQA 1HNZB 1ZO8A 2WT9A 4EY6A 2O1WA 5BVHB 4H4CA 2L0XA 3OJ0A 2JKVA 2A2ZA 4FMCF 5C81A 3GXBA 4BEBA 4BO9A 2EYUA 4GXTA 3PDUA 3TZ6A 2WUFA 4KEAA 1AQLA 2K7ZA 1RXUA 3DL2A 3FG9A 3UXHA 2VF5X 3T3IA 3RADC 1EQUA 4XM1A 4CIDA 1IXKA 5T57A 1Y4UA 5EE0A 3FGNA 3D1LA 3O9ZA 1ESDA 5H9VA 3L7CA 2EFEB 4HLUA 2YX1A 3DE2X 2BN4A 3JVUA 5LDGA 4C0JA 5GIPE 4B3GA 3IPAA 3NKFA 4OG2A 2XWJI 3SJZA 4E03A 2H17A 2ATEA 1DPGA 3PXXA 1VTKA 1WEKA 4I1SA 4IMIB 4NJEA 1TF7A 1A5ZA 3DEAA 1ZN8A 1B6SA 1FTWA 1N3YA 3BGVA 4GBED 1MH1A 2QRVB 1MRSA 3A4YA 1PD0A 3FRJA 3QX7A 4UUMA 5FNVB 1MVOA 2J8ZA 1B7GO 5ICSA 1CJKC 2B4TO 4TSFA 4PIPA 1UKEA 2IC5A 2VDUE 4RIGA 1CG6A 4YP0A 1BXRA 4PGHA 3HRHA 2HREA 3AETA 3IBTA 4KP7A 3VFDA 1MVLA 1GGNA 3KKLA 1ZR2A 2WTEA 4U5XA 4WUVA 3MWYW 2PS3A 1X2BA 3D4BA 4KYVA 4RSMA 3TM4A 4EA7A 5EJEA 3TVYA 1E7QA 4HFRA 3H86A 4WACA 2QVYX 1V48A 3N59A 4LHEA 1ATIA 4FXPA 2WIJA 3A1UA 1PT9A 4MVJH 4QUIA 1J70A 4MYUA 3HY3A 2YL2A 4N5MA 4OJNA 2WVGA 3I04M 1X0XA 4P5EA 5AXCA 2E6UX 5K8UA 4LBZA 2H8KA 4C2BA 3FX2A 1Z8FA 1EX1A 3PF9A 3S2GA 4BVFA 4CR6A 3HHPA 3RC1A 2B0CA 4V1CB 2NO5A 1Z6TA 3C98A 4QRHA 1XHFA 2F2TA 2A9VA 3JD1A 2E4ZA 3UQZA 3WIEA 1NBMA 3PC4A 3T9CA 3BEOA 3IUSA 2YIVX 1QTRA 3LXRA 2R3SA 2XA1A 1U0HC 3EA4A 2VK2A 3N28A 3U7GA 2NNLD 5JMWA 3DDUA 1Z45A 2P65A 5A0VA 1KI6B 2DAPA 1SIOA 3B5JA 3AUUA 3GAFA 1HYHA 4C89A 5J4LA 2XW6A 4TQ9A 4LDRA 1G66A 4DCUA 1UM9A 4H7FA 2HM7A 2QP4A 5JANA 5C8YB 1KJQA 4DQUA 4C7VA 4N0QA 5TF4A 1UDCA 3GLHB 5DT9A 2HFKA 4LCEA 5T8KA 1KMMA 1CDZA 2Q6VA 2QUAA 1GILA 3DVLA 3R7DA 2G0TA 1P29A 3A6JA 4XJVA 4HYQA 3NFYA 5ICMA 5EIBD 3SWWA 4FS8A 3B6MA 3PC6A 5CT8A 3CZCA 2HA4A 3F4LA 3SHTA 1KY2A 3O73A 3RU2A 3U0BA 1X7WB 4AECA 1ISSA 3MWDA 3QFSA 1NR1A 1UPXA 1MFPA 2UZ1B 4J16A 2RDMA 1TFUA 3BH0A 4IO0A 2X7HA 4QUJA 3L7BA 4PAQA 1ZAYA 2V45A 2QGFA 3ZVMA 3OZFA 2WHYA 2DKNA 1T13A 2X0KA 3CGWA 3LQ2A 1FFSA 1TKBA 2CLCX 2J6HA 2DFPA 2PMDA 3Q41A 5ARBA 4YT8A 3N2KA 3WLRA 5ALPA 2C82A 1BU8A 2QJWA 1RWMA 5AHOA 4EHLA 1DBWA 4IJVA 4BO5A 4EI7A 1PYGA 1WLYA 1RXVA 1S89A 2XI4A 1DJPA 1D1QA 2YMQA 3DF9A 4PR3A 4MP6A 2GHTA 2HHAA 1Q0LA 1VL1A 2P40A 1WX1A 1UBLS 2VWHA 4GR5A 4HNAB 3O95A 1P7ZA 1U5CA 4N1AA 1UKCA 1RFGE 3KB6A 3EWNA 3EVGA 4P82A 4ZYZA 1FQKA 2YQ4A 3WSTA 2RG7A 2I1VB 1GSAA 1PNTA 3W3AA 1RYMA 4RM3A 4QGSA 3OETA 3THSA 3KPUA 2XCUA 1YZTA 2JDIA 5FUVA 3L7KA 3ZZNA 4MI6A 1KSHA 3QUSA 1XF9A 5IKPA 4A73A 5IX8A 2CHUA 1U1DA 2R7KA 1FNSA 4BNMA 3TAXA 4JP3A 5JAQA 4LZNA 1FX1A 1Q12A 3GO4A 3H9BA 1RYBA 1SNYA 1C1DB 3ORRA 1CETA 2FWPA 3AI7A 5DTQA 3TTTA 4MB2A 4NZMA 3LRTA 4OL0A 5HOEA 4IOKA 2X5KO 5FBZA 4MKXA 3PEYA 3TFQA 4QUEA 1X8XA 5EIEA 1OOEA 4NHOA 2ECPA 2QI9C 2ZJ6A 3WB2A 2Q6KA 2RBKA 5KEIA 4RK4A 1PGNA 3OQOA 2OV4A 2GBLA 5F78A 4BNZA 4YMVA 3PNVA 3FSGA 3E9MA 2OKCA 4E5NA 1QGUB 2R4TA 2V55B 1JECA 3ITNA 2J3EA 2QQGA 4QG3A 4QDTA 5HHTA 5JS7A 2V3CC 4KN9S 1V6SA 2FWMX 2XD9A 1RWWA 1XZIA 1P2SA 3L0ZA 1A76A 1R74A 2PS1A 3MRXA 4KTTE 3DVSX 1U5BB 2FSSA 1DINA 1T9BA 5AVWA 2K7FA 2C88A 2ZG6A 1XTJA 1HSOA 1G8GA 2WIKA 3STWA 1LJ8A 4R3WA 2UKDA 4R6WA 3DEJA 4Q1AA 4ZOCA 5KVCA 1EK6A 2AMVA 3D3KA 4AQ7A 4OHFA 5JJ5A 2PFSA 4MQBA 1X9HA 1RM0A 5B1SA 5DO9A 4LYHA 5B4VA 4EY8A 4DMMA 5CW2A 1PD1A 4HDRB 4RGQA 1UC4B 2V6FA 3VAAA 5AVZA 1GNQA 1G8FA 4GE3A 4R2LA 3OM1A 3TOCA 5MN4A 2BHSA 2RJNA 4PXYA 4UFNA 2H1SA 3DAYA 3QFHA 4CQMB 2C7PA 3UOAB 1KKLA 2QQEA 1AKMA 3FOZA 3K8ZA 4IICA 2NZ2A 4LYJA 1TYAE 2HIGA 1DB3A 2ZSUA 1VKOA 3TNDA 3C15C 3HA3A 3TQOA 1CY1A 3I83A 3SYLA 4KRFA 3PNBA 1QH8A 1M2NA 3W8FA 2WM3A 2XE7A 1FFCA 1MO2A 3BM5A 1DJOA 5AM5A 1T2AA 2Q2QA 3LPDA 4CDMA 4YAGA 4P4TA 2I7DA 3H99A 3NJ4A 1U9JA 5FNVF 1QYWA 3FNEA 4Q16A 5EZYA 5LZ4A 1TAGA 3I58A 4NBWA 2TS1A 3S8EA 3V4PB 4F1KA 2YJ4A 4X1OA 5GQSA 4NH0A 4EO9A 4AUEA 4FMPA 3COSA 4KGZA 1A5SB 2B4RO 1BN7A 2W6QA 4RMNA 1XQVA 4BFSA 1LBIA 2FW8A 3RTDA 4DS3A 1R9NA 1UL1X 2ERCA 2JAHA 1ZSNA 4FHEA 1J1ZA 1V5WA 5JS1A 4AP6A 2FQ1A 4HFNA 3GDOA 1NP7A 1E96A 4ZAGA 3IHKA 4OGFA 4I1YA 5FUXA 1H8ED 3BH7A 3KEFA 2J3JA 2E5FA 3Q3VA 2PL9A 2NU8B 1O6GA 1A9YA 1L5YA 3IXMA 1BE1A 2A3NA 3IVMA 4F3YA 3MQ2A 3TZKA 1AH2A 3H8SA 1ENOA 4KO2S 2VDOB 2X42A 2ZROA 1MU0A 1X1QA 3ET5A 4G5HA 4IJMA 3AEUA 5ECDA 3RS4A 1SCJA 3GLQA 4KPGA 4LVNA 2W7TA 3EDYA 4EJSA 3VC2A 4BGIA 3DAOA 1KHTA 4MGIR 1Q3KA 1RPAA 2QRLA 4FIDA 4KB5A 4OVKA 4EGQA 3FMPB 4IW3B 1M6HA 4L27A 2ETXA 4RKFA 3VX4A 5JYBA 5LZ5A 2VP3A 2IIBA 4QICA 3TLMA 4DBVO 4OB6A 2II6A 4JEUA 4INJA 1VYHA 1P75A 1GTZA 3QXCA 3VUEA 4TS1A 1JIIA 3DOOA 3NOVA 3TLBA 2QWXA 1V1RA 3PLNA 2H07A 4D26A 4L6CA 3H4TA 2QQFA 1PHPA 1QYXA 1Q21A 4A7PA 1J2EA 5F2EA 2Q3CA 2OSVA 4MXDA 1ZEMA 3CR3C 4GL2A 1WUKS 4G24A 1U80A 3O93A 4IKEA 1TT5B 2B82A 3EMDA 3K9FC 3GJSA 3C7TA 2JGAA 1Z8NA 3HABA 4EHHA 4AN4A 4RHYA 2F9MA 2CVZA 3ZJTA 2GBIA 2WM9B 3M6VA 2IHYA 2EW2A 2QM8A 3IIJA 3PTAA 3BWYA 2E87A 1B8PA 1RLMA 3SIXA 3PNSA 2C7GA 1M8GA 1DARA 1IUKA 4KIJA 1GGMA 2FRDC 2GYVA 2FGJA 4B46A 2AKYA 3QKSB 1F1JA 1U0RA 3FN4A 3O4JA 3PVZA 5E1MA 1F0KA 3RB8A 2Z8XA 3ZE8A 4ZGWA 5ISMA 1OFUA 3D6VA 4KLNA 2XPCA 3W8EA 2PEZA 1I32A 1PFVA 2OHFA 4EH1A 2PX8A 2V74B 3DSRA 4ZVSA 1E4OA 1BH6A 3GEEA 5JCPA 4OUDB 1LPOA 4P4UA 1RLIA 5K03A 2FSGA 4OYLA 5LDHA 5KIAA 2V6JA 3O7MA 3RBZA 5HBGA 1K8ZB 1L8AA 3PQDA 2B4KA 1O57A 4Q3KA 1IATA 3AT1A 3RVMA 3H5NA 3E18A 5EJ7A 3ABQB 2AV6A 3L82B 2PBZA 3PHJA 3N8GA 1SVOA 5FPTA 4GHWA 3J81A 4Q3CA 1II0A 2PIDA 5HQJA 4D42A 5KYWA 2F43A 3GUVA 4BBZA 4PLVA 5DN6D 4FCWA 2GM3A 4HDRA 2R7AA 4RHXA 3CEJA 4ENRA 4TUYF 1Q1QA 1XVIA 1DJQA 1SC1A 2EBFX 4HY3A 4J75A 4BEJA 3C74A 2IOYA 4PBTA 4OHPA 2VRCA 3LZCA 3Q3EA 1O9BA 1F7UA 3IJPA 4WSOA 1MJGM 3FUWA 1NMEA 4LF5B 1DBSA 2BWJA 2WJYA 3OE7D 1FIUA 2HJHA 2WWRA 2D2FA 5FHQA 1GPMA 4RDCA 1GPBA 3WBBA 4CT5A 4AC9A 5AW7A 4LF4B 1ZJ6A 2BISA 2WSSD 3FDJA 4X6LA 1HT0A 1XWFA 3OEEA 4GICA 1V16A 2FRVA 4UD6A 2CLIB 3H5OA 1BE0A 2ASEA 2VDKB 3UK6A 1QQ5A 3ELYA 3P0JA 1ECCA 1VFPA 4PC3A 1PZXA 1Y98A 5K0JA 2NYRA 3W5AA 3B7WA 2FPLA 3VXKA 4DCJA 1YS7A 5KTPA 3N5CA 1CDOA 2D00A 4RXTA 3FNFA 3IQZA 4OH7A 3DBIA 4X44A 5FBHA 2DUMA 4ALNA 5HZHA 2V65A 3RVKA 1ICEA 2FVXA 2QT1A 3H7AA 1L6RA 3D7SA 3Q6NA 4JT4A 2XZDA 4AICA 3ECCA 4EIWA 3FTQA 1AKEA 4M0UA 2GZSA 2JHGA 4B45A 5JDCC 2GO1A 2WKWA 1SVLA 1VE3A 2AXPA 2JFVA 3JYQA 4OMFG 3S2SA 3WZLA 1TYBE 2G76A 3DVRX 2DQSA 2XUOA 1VHQA 3M5WA 5AVTA 2R84A 4LE1A 3P2OA 3BFJA 4RIEA 3ENNA 4HGZA 5JYEA 4D25A 1ZD8A 1B74A 4G4JA 1H2HA 2GFQA 3I1IA 4MQ5A 5ALMA 3UMMA 1PEDA 2VWQA 3ZH9B 1M1ZA 3MMZA 3UGJA 3CV3A 3T3HA 3SU8A 1EFRD 2NAFA 5A5VA 5AVUA 1QNLA 2ZTMA 5E6UA 1ZM3A 5A3SA 4TGLA 2GM4A 2TMDA 3RDPA 3AQIA 3JRXA 2CHFA 4W5QA 2GOYA 5TPZA 4URYR 5HE9A 2IDKA 4HNAA 4QPZA 2WWVD 1I1NA 3BCUA 1BYUA 2P6RA 5C3UA 2IQ5A 1YZUA 1DV2A 4V3BA 1QTNA 2PJZA 3L7OA 1SQ0A 2WZBA 1NM5C 3DZ8A 1GCIA 1V9LA 2HF7A 4MV8A 2F9FA 4XUDA 1F2TB 2NADA 4NSNA 3JQ7A 4RE6A 1QAMA 1D2MA 1ZD9A 1Q95A 2D1FA 4HQNA 4YAWA 3T38A 3ZVLA 1E32A 4GQIA 3GDHA 2HMUA 3A4TA 2EIHA 3PUYA 3PHCA 3TLAA 1Z2AA 1ISPA 2WU8A 2BEKA 3KWFA 1UJCA 1JA1A 3PDIB 1P2VA 4OF4A 4UPDA 1RP7A 4J7UA 3VO2A 1T1SA 4MDFA 5EKSA 3HCEA 1V3TA 5FWXB 2IZ7A 2ZQZA 1SHUX 3ND8A 4OU5A 4BHTA 4C6SA 1XWIA 3LFHA 4RNCA 2LKDA 1X92A 2G28A 5TRTA 4EYEA 4H35A 3WMFA 1VXOA 1HOTA 2H4ZA 2UVPB 1A3CA 3DKPA 3CEAA 1T1JA 4IRUB 5ALYA 4NDAA 4R0MA 2PUFA 1HT2E 1N5MA 4LBYA 4YMWA 4XAQA 3ROTA 2WJJA 2YKGA 3UJ8A 4LWPA 1EDZA 4I14A 1MORA 3OOEA 3DBOB 1FVFA 4O4JF 4KL8S 4M38A 4ALMA 3KZCA 3MGKA 1LQTA 1U0GA 2Y4OA 1JQEA 3M34A 4M9RA 4OSPA 3P52A 3TRDA 3SR0A 5JSHA 4TOIA 2PL1A 1TAUA 1P45A 3E3OA 3KBOA 3U44B 1IQPA 2IZ1A 6ABPA 3CMMA 4JEHA 4UDXX 4ZK2A 3LT2A 2Q1YA 3KR0A 4XJSA 4YXWD 3RSOA 1I6KA 1Z7GA 2FWAA 2QTRA 2VNHA 1KP9A 1IJKA 3I45A 3LWBA 3IXLA 5TVGA 3TTVA 2DTXA 3OSUA 3ZX4A 4ENPA 5JROA 3UJCA 3KSAC 4GBMA 1N7IA 4IGEA 4MZDA 5EQTA 3QMVA 5JVDB 1PEAA 4DCSA 4RCYA 4WIAA 1ZK2A 1X6VA 1ZRNA 1WXGA 2DUJA 1VECA 2DFLA 2Q2NA 4OQXA 1EQAA 1W94A 4YYEA 3KB1A 2CLDX 3P9KA 4O2AF 1WCIB 1N5RA 1SVIA 3IEUA 3ANLA 2PY6A 4M3NA 4L57A 3LNCA 1U2DC 5I48A 4MQFB 1NLUA 4U2KA 1RPNA 3WA6A 2QMZA 3PNOA 4KBFA 5JH7F 3QXXA 3SVZA 4DMCA 2ZP1A 5I4BA 3CT4A 5JNSA 1HYBA 4L95C 1NM5A 3HR4A 4MQEB 4ARBA 5JSUA 3O8DA 4A0FA 4RVUA 5AW5A 1SG0A 3L77A 1MAHA 2WWHA 3AKYA 1UJMA 5EQFA 1L7PA 3HYLA 4UU8A 4R1OA 1KY5A 2JIQA 2QRVA 2BFFB 4HEQA 2AUNA 2UZ0A 4WBNB 3HCCA 1CQIA 1UBNA 1W4BA 1M1YA 2H00A 1Z06A 2WJ3A 3PJEA 4AZSA 1DRJA 1GARA 2BHLA 4NOMA 1VPTA 5EJGA 1BWQA 4B4VA 4OHYA 4V02A 3TGPA 2D1QA 1KMIY 4OAPA 3QI2A 4AAYA 3H2JA 1YMUA 2IYFA 4R2HA 3F97A 4X90A 3I0ZA 2A78A 2H5JA 2HOQA 3KJIA 2B9EA 4FPXA 2AC4A 2J48A 1NVVR 1ZZGA 5DM60 1JHYA 2O2IA 3U39A 4A10A 4BNLA 4TTTS 1R0KA 1OX4B 2CLMB 3HP7A 4HLQB 4NV1A 4DMGA 5K7SA 5KNCD 4KE7A 2FQXA 3G68A 5JNVA 1CXZA 2W6MA 3NWJA 4NV3A 4MMZB 4HLDA 4I9FA 4NNPA 3FWYA 2Q41A 3EGDA 4ND1A 3HB7A 2JIZA 2QMUA 4Q21A 3U3DA 3QUQA 4TV8F 3AWDA 3OD1A 3U3MA 1CY2A 4AN0A 4DQKA 4TM8A 3PEUA 1UXIA 1ZGAA 4O59O 1LC0A 3INRA 4J2OA 5HQTA 4E5KA 1IIBA 3S1AA 1XWWA 3SZMA 3HXQA 4QOGA 4CNBA 3ST7A 1L5RA 3BQ9A 4U2DA 3ZXIA 5KNCH 3TQFA 5TLSA 2R68A 4C4SA 1K7CA 3WFIA 1Y7LA 4RCZA 1I4LD 3LMKA 4ZT6A 3RVJA 3TZEA 4S1TA 3CNLA 3V1TC 4V0MA 4IMPA 3M4NA 2Q49A 3SZRA 5HSGA 1NJGA 1X1EA 5CB4A 4J29A 3TVDA 1KQNA 4JVOA 1TA4A 1XZJA 3K0CA 4PG6A 3V6LA 1EE1A 4UTVA 4LJ7A 4BOYA 1Y6RA 1ZGCA 3KE8A 4CM7A 4NC9A 4KVZA 2HHJA 1XNGA 5KO2A 3Q5EA 3VSAA 3ZQ6A 5AW8A 1PUXA 2XUJA 2YASA 4TLAA 4TLMB 3SR3A 3B3JA 1ZMTA 2BFAA 5E4TA 3C1AA 3Q11A 1ETHA 1QG6A 1SZPA 1WBBA 4RVGA 5LYYA 4L72A 2RKOA 3VKHA 2PSJA 5K0CA 5IPFA 3TRFA 4BX8A 5TC4A 3OI7A 4KLCA 2PEYA 1I7NA 2DZDA 3NETA 3GROA 3OX4A 4QG7A 3FY4A 3NH6A 1NOIA 3IUPA 1M34B 1NI4A 3B7GA 1EHYA 3CUSA 1ILWA 5B58T 4CDGA 3FMOB 5BSVA 4DAOA 1M10A 1ORRA 2QTNA 3SQOA 4GOXA 3LHDA 4MO2A 4WCFC 4A92A 2DFVA 3MINA 3W6OA 4L7VA 3UXYA 1BQ4A 1VE7A 4ZVTA 5HF6A 4ZVVA 2QYOA 2FZKA 2R4UA 3RUFA 3EUAA 4BQFA 4KUGA 3OZSA 3C3EA 3A06A 3DR5A 2J9XB 4F92B 2VAWA 3CPSA 3GVXA 4JVLA 1ILEA 3RUPA 2EFJA 4P6VF 1NVKA 4G0XA 1EDDA 1BS9A 3C5WP 4H7DA 521PA 1B6RA 1XEFA 3SHOA 3FD8A 5H7XA 1E9EA 3V4OA 2P9CA 2P3OA 4TYPA 4M0DA 5KOYA 1EXVA 2JLRA 1QV7A 1YL6A 4QC2A 1BMQA 5IAAA 1BDJA 1BMFA 4YRNA 4C2TA 1AF4A 4OL9A 2NZUG 1MGOA 1T3SA 4XFDA 2XRZA 3N1UA 4J0CA 1G8AA 2GEJA 1Z4KA 5G3ZA 1G2OA 4BMDA 1OAKA 3GLIB 3NHZA 4FBGA 3RAFC 5CEEA 2LBPA 4H7IA 4QU8A 5A4IS 5HXAA 5F7JA 4N18A 3WYFA 2C8LA 5KNLA 4URXR 2R6GA 3KFXA 3MMPA 4HGRA 5E7IA 3H5RA 3EMBA 3ZCVA 1SEPA 4YRRA 3A1TA 4HWGA 4ZCTA 4HNGA 1YS9A 3KQOA 4JP1A 4HAWA 3AB7A 1GRQA 1L5ZA 3FDZA 4X92A 1X70A 3CA8A 3M3HA 1ZWLA 5DIFA 1U6IA 4AJJA 4B9EA 2W2LA 3P9SA 1LSSA 2OFXA 2P4EA 2PS9A 4XFKA 4CTJA 3NXKA 2WHEA 5EYPA 2GPYA 5EWLA 3QF7A 1GZDA 2NLOA 2FAXA 4BQRA 1XMPA 2O8CB 4ZICA 4P80A 2H5EA 3SQWA 1LNSA 5ALTA 1TW3A 3F90A 5DXJA 3H87A 2B98A 3OO0A 1V8BA 4O2BA 4IIBA 2VLBA 5ALEA 2QW8A 1M6YA 4CCYB 3B9PA 2G77B 4R1PA 2A94A 2R62A 3TBFA 4B4OA 5CCDA 4U9IS 2FEOA 5DHQA 5BR1A 2CFSA 3HL0A 4IIJB 5TQ0A 2O5CA 2F4NA 1QQTA 5EIAA 3LCMA 1WOYA 3M9WA 3QY9A 4TUYB 3W6ZA 2PUEA 3ILHA 3D7RA 1WUTA 3TNYA 3TW0A 3RK1A 4NYMR 3STHA 3WLEA 3GLFE 3GBVA 2ZI9A 1ND5A 1DWPA 1E6LA 3V1LA 1MPXA 3C2QA 4HQ6A 2PH3A 3LKDA 2YFKA 3T3GA 3X3HA 1JX6A 2G9RA 1KQOA 2X9LA 3FWPA 4GEKA 4WLVA 1Q1EA 1RJGA 2AK2A 3LYHA 5KQRA 2FR8C 2PWBA 2BEVB 3HSKA 3WDLA 3T06B 3L1VA 1SD2A 3SC4A 2AR7A 4HAVA 3UHFA 3R3YA 4RU1A 1CUBA 5FCDA 4ALLA 3MGGA 4N8DA 2XADA 5DHUA 1YACA 3LLCA 4X9XA 2BHNA 2I78A 4ZOQI 2CV0A 4L16A 3MM4A 1XRQA 5ADUS 4K6OA 1PR5A 5A3JA 4WQMA 4MJXA 4KNYA 1T5LA 3ZGYA 2NO1A 2NPOA 1KAGA 4WJKB 4AY4A 1AV6A 5HFJA 2C4NA 3IQFA 2WIAA 4P34A 4MWGA 5E2IA 5C8YA 2JBWA 3SEAA 821PA 3N53A 2VTBB 2IUEA 2ZFUA 2BDTA 2C2XA 2BGNA 2OV3A 2HD4A 1G5PA 2AZ4A 2QTVA 3GJQA 3JRWA 2YN0A 1TM1E 3ZGZA 5JTUA 1TU4A 2XB9A 1HG0A 1NBOA 1Z25A 1AZLA 4FDVA 4F2GA 2CWWA 2V97A 3DT6A 1T36A 1DO8A 4G26A 2IW3A 4YS6A 1LRJA 4DREA 3ICEA 2YMMA 1Z3CA 5KWSA 1E5DA 2C96A 2VQEB 1GPDG 2WVAA 1TF2A 3VC3A 2AFRA 3OAAA 3D9QX 3I9NA 2QZZA 3PT5A 4AI6A 1SQ6A 2JBAA 1K5DA 3GCWA 4RPJA 3SIWA 1KJ9A 1UFKA 2ZRBA 3NOOA 4TXMA 4RK6A 2QHXA 3RSQA 3I9FA 3CNNA 4LVUA 2ZE5A 4KU4A 3KYIB 3DQQA 3K7EA 1B1CA 3D3NA 2FG5A 1JR4A 3E2PA 3LC2O 7AT1A 2B4YA 2E89A 4WZ6A 2C29D 3AHHA 1YI1A 5C8VA 2YXEA 4G5YA 3GVCA 1LI7A 5TQ0B 2ET6A 4FK8A 1YBHA 3QELA 4DXAA 2QPLA 3QXSA 4GNRA 5EIOA 5CFZA 1XXHA 3R3XA 1TJ3A 1JIJA 1UFRA 2X1VA 1PGOA 2X8BA 4MV7A 5NULA 3L6OO 1M2FA 5AKHA 4OQZA 3FOFC 2QT0A 3O0DA 5DSXA 1JN0A 3RYIB 3VMFA 4ZN6A 1W5BA 3KKMA 2W70A 1EUDA 4R01A 4RF3A 2VHWA 4C0BA 1BMFD 3TNJA 4XWOA 4I1PA 4FR2A 1GNLA 2QD1A 3DC2A 1T43A 3FETA 2ABWA 5EYPB 3ZNQA 2UYQA 1J8FA 4RJIA 5IJWA 4C5AA 3D0QA 5IC4A 3QHAA 2FW1A 2GJKA 2VYND 2ZAGA 5TT0A 1I9CA 2Z2XA 1XAIA 3AR7A 5BSWA 1Y9EA 1W0JD 3DBRB 2GPJA 4LV8B 4UU0A 3IDAA 5FBQB 3ZXSA 3ELBA 4KDCA 1IXSB 4WOCA 1ORTA 3F3MA 3A6ZA 1TW2A 4KFSA 5FLKA 3R0QA 2EQ5A 3TLJA 2ZCVA 3QLTA 5BR7A 3MGAA 3ND9A 4M53A 4TTPA 3VVLA 5KS2A 3M5DA 4HXGA 1I4WA 5IH3A 4MUNA 5HFNA 4XASA 1EBFA 4RSHA 1W6RA 4DA6A 5JNTA 1EP2B 1G20E 1MIOA 2NUAA 2LE0A 3DFUA 2GAFA 3FAZA 4IHJF 4MI9A 4WHMA 1IHYA 2ZT5A 5B1HA 5J59A 3OFSA 1VSVA 3WLPA 1DAMA 3GVHA 4X7BA 5TVKA 1C3LA 4ZJPA 2TMKA 2J5RA 4HH1A 1W0KA 3HU2A 3ER8A 3ENZA 1ZCJA 3LC0A 4LRSB 1A98A 3R5KA 3WLJA 3I28A 2XMPA 3E3AA 5DX1A 2QYSA 3NKVA 2GF9A 3ZBPA 2NXCA 3TFOA 3WYDA 3CUWA 4OAQA 3N5KA 4FYWA 3QHPA 3H1FA 4WZBE 1NUAA 1FPQA 4WN9B 4NCHA 1E2KA 2BY4A 2WUGA 3G5UA 3FYCA 4LQ4A 4C9BA 1T9DA 4K40A 1BHQ1 3FYSA 4AMZA 4Y2VA 1FNBA 2D7JA 4XUEA 2ZI5A 5D1NA 3ZHZA 2R6R1 3C6QA 4HEJA 3TZBA 1GTVA 4CV2A 2VDPB 2IPLA 1U2GC 2P79A 2P7IA 2A5GA 5DP1A 4NJMA 3IP3A 5JD3A 4C0KA 3STTA 5LZ2A 1BXKA 4QQRA 2OORC 1JKMA 3LSYA 1HLPA 5K01A 4JLDA 1X2EA 2XVXA 3ABRB 1QMPA 3BZBA 1LLCA 2F1RA 2HA3A 4HJXA 4RMGA 5EHIA 4KX3A 1NF9A 4D4LA 4EPXA 3EEOA 2LTAA 5FT9A 4KR7A 3LHFA 3ZIAA 2Y99A 3AU9A 5AK4A 3OP1A 2PX4A 4HBZA 5EZYB 3KVRA 1VM6A 2XT9A 4YC7A 4JBNA 4TT3A 4AS2A 3UJ3X 1A5TA 3N2IA 5BSUA 4DC1A 3SZUA 4FONA 4YJKA 1T6BY 1DWUA 3HM2A 4LMRA 1JH9A 3TPFA 3H1EA 2NP7A 3Q6IA 3AP2A 3Q3JB 4DM7A 2PKCA 3FKQA 4QOIA 1QKJA 4ABYA 5JJCA 1BOFA 1XTPA 4AS3A 4HNTA 3ZI7A 1TT5A 5EJFA 4QDUA 4D3XA 1DG3A 1N5OX 3NHSA 1GFIA 4IF4A 4RS3A 4B3JA 4KHPB 1KEKA 1RQRA 4HLUC 3FFXA 3ZVKA 2DLNA 2OLEA 1DTEA 3LQYA 5ABPA 5TE9A 5JT1A 3P9QA 2NV0A 3UW1A 1C80A 4BCDA 4MI1A 2W2KA 5GJWC 1FXWF 1TUEA 3CJTA 3CLRD 4KI7A 5F52A 2BSAA 2QTFA 2QTWB 3CLKA 3ITDA 3MIZA 1WKCA 4HVLA 5C5CA 1ZD1A 3TQQA 5HTKA 2C1ZA 2REOA 1YRBA 4W9NC 4WY8A 1V47A 3MBOA 1BZYA 1A1SA 4GDFA 3UY4A 1O96B 1AQJA 4OAOA 1AKUA 5M3BA 2G1UA 2YWEA 1PNQA 1ITZA 4HMOA 4OBEA 4CLXA 3OJXA 3DP9A 1YBMA 4P3KA 3JALA 1KQFA 2M6RA 3LT5A 1UUFA 2WBLC 3BMOB 4TRRA 2XUZA 3GK3A 3ESCA 2FWJA 3ET4A 4KGVA 2RGUA 3DOCA 5C51B 3LDHA 3FVWA 4X6UA 1CRLA 1Z26A 3DWEX 4N8EA 3ISJA 2WJGA 4YAOA 2OXIA 1QONA 3K31A 4PN7A 4C76A 1E1CA 3V2HA 1Y1QA 1T25A 3DOHA 3CNOA 3JCZA 4BVGA 4EB0A 1N6OA 1YQDA 1YRAA 1IWOA 2H63A 3GLHA 4LGMA 4RYDA 2ZXUA 1WUJS 3EA0A 3ZS8A 4K1XA 2AN9A 3FCEA 4PNEA 4D9KA 1T0IA 2VH2A 1POXA 1N1DA 3EH2A 4UTPA 4I9NA 3RBAA 2GK6A 5C18A 4N6NA 3Q3HA 1H5QA 1S5PA 3GQVA 2C9OA 1UPFA 1YFKA 3FVTA 2VZLA 4IXMA 4MRNA 5FTWA 2PR2A 3ETJA 1EJ6A 2J9FB 3RUIA 3VC7A 2IYXA 1HE4A 3ZW8A 3M9XA 2A0KA 5FQNA 1ML3A 1G4UR 4KRYA 4ILEA 5AI5A 1E4EA 4C43A 5KZMB 2P4SA 1AJEA 2IEIA 4NMXB 3GNSA 4GLJA 1L8XA 3O3NB 4HQKA 4IIGA 2IS1A 1XZ8A 3ZZ1A 1ZR4A 1R0RE 4HWRA 1HDYA 1B4DA 5C1DA 2AMFA 1VMAA 2Z1NA 3EXIA 1ZUHA 3OZEA 4GT1A 4KUHA 4XRRA 1XYVA 1KHHA 3GPBA 4R8LA 3AYXB 2IHTA 3FHTA 4TRMA 1ISIA 3ESXA 2FZLA 3OBIA 4B4KA 3COJA 4MQ4A 3CEMA 5EWJA 1MO5A 4TL6A 1CJMA 3HGTA 4HFMA 3KVOA 1TQ8A 5HZKA 4KO8A 1HNXB 3AHIA 2ZIEA 3A6DA 3MJRA 1FDTA 3SM3A 3WSVA 2OR3A 4M76B 1B93A 1PFYA 4JYMA 4MS4B 4DPMA 3IESA 4K9RA 1J00A 4OHRA 4TN1A 2GAOA 3PQ6A 4IZ6A 1AM4D 4UAVA 4QYIB 1BMTA 1PJLA 3OHSX 5K2MA 5TQ2A 1P60A 1N25A 1XR3A 5DK6A 1T8WA 5BV8A 2FFJA 3V7FA 3LLVA 4AKHA 5TS2A 3OFND 3H2ZA 1FU8A 4XFJA 2XE8A 3K09A 4MQEA 4OGLA 2V3WA 1WE2A 3K8QA 3PJFA 4POAA 2GMWA 4BNDA 3SLRA 4DSNA 1RMTA 2OV2A 3QUAA 4KUEA 2RJOA 2ZYAA 2WD8A 4KWIA 4LGCA 1O58A 2XUGA 2FY8A 3FSRA 3E0QA 1O0CA 3DLIA 3KZXA 1H0HA 4ZIRA 2C97A 2ONYA 1Y8RB 1DX4A 2PD3A 5HRUA 3VYRB 3ASVA 3SF8B 3FVQA 4CMGA 3I6BA 1YB6A 4G9EA 4EP1A 2B1RA 1ZLYA 5KX5A 5JIBA 4GNKA 2Y66A 4A8HA 4M6WB 1F2TA 2NT4A 3T7AA 4HCJA 2XDWA 2EP7A 1JDPA 4K6GA 5DCYA 1WP9A 3FWNA 2A5DA 4PE5B 4ZGBA 1U7ZA 5FOVA 1C3VA 1MOPA 2QLTA 3BJIC 3DZHA 4FVTA 5KVSA 1G8SA 1I1QB 2H2AA 4OD0A 3RHTA 5KTRA 1FBNA 5D3ZA 3TTUA 2X3YA 3VKUA 4DGQA 1LB1B 1NVFA 4YCMA 3U3KA 2B94A 5DOVA 3UPDA 4K6MA 2GCGA 3HB0A 8ATCA 1Q92A 3RPEA 4RTMA 1WF6A 4MVJE 4PS1A 3WQHA 1MTOA 4ZCMA 5J2UF 1YO6A 1SULA 1U11A 3UUGA 4X0EA 2GGSA 2HGZA 1LPBB 3JU3A 1Y3DE 4W1QA 3IVGA 3BE6A 2VDQB 4FZ3A 3EODA 2UVPA 2EDAA 3TBKA 4RSRA 3L8MA 3W5IA 4ANFA 5A1JA 2VTEA 1CUHA 1OBVA 5HQ3A 3GLIE 4GM1A 2A1UA 1WXHA 2AF4C 2JGFA 5F1KA 5HKAA 4KSYA 1HI9A 4D97A 1CWUA 1XA0A 1JJBA 1TIKA 3ICPA 2K2WA 4LKOA 1VJ5A 4NYJQ 1L5LA 4JBHA 621PA 3CYFA 3MJTA 2VPPA 1YS4A 5EJ9A 4LNAA 2CUZA 5DBEX 3MTDA 3IEPA 2RH9B 2RGDA 3H18A 3OJCA 3FOAA 1E4YA 3LGAA 3MUNA 3BA6A 3TIFA 4I50B 4E7OA 4RK1A 1TC1A 5IVPA 1GU7A 3MOGA 4GVXA 1VBKA 3WZMA 1T8RA 2YZMA 3VOTA 4ZI2A 2YR0A 4BJ5A 1ANKA 1XFAA 2R8PA 1EUYA 1IMJA 2WF8A 4DT1A 1CQPA 3TKYA 2X5JO 4ZFNA 1TJNA 3OZCA 1L5KA 3DAFA 2DQ4A 4QOJA 4BRSA 5HJ5A 1LSUA 2L19A 4HGPA 3G3EA 2R96A 5EFOA 5LA6F 1ELOA 1S3IA 3H2IA 2PT7A 2IXTA 3VGJA 1NXQA 2HRBA 2DTDA 3EXIB 1II8B 4MVJM 5CB4F 3D4PA 4AY2A 5MN5A 2GDJA 2DPMA 1ZN2A 2CLOB 1T9CA 3DTYA 4Z0NA 1O3YA 1MQ8B 3RABA 1QRRA 5C7YA 1GM5A 4JBXA 3UAWA 4EELA 1H6DA 4JJ4A 1P6QA 2NU8A 1M1NB 2D2EA 2EU8A 1TJ4A 4MW7A 3HXMA 3K5HA 2VZ9A 1CVLA 3MT7A 3FKJA 5DU2A 2JFBA 5DH9A 1ZNWA 3EUEA 4LY3A 4L78A 4M22A 5AJZA 3VX3A 3U44A 1IWPB 1W75A 3OUUA 1UDBA 1UQTA 3WC4A 1CR4A 2A9FA 4B43A 2O0HA 3PB3A 1VE6A 1DRWA 3NHJA 4HV4A 1G291 4R3NA 1JW9B 3OUTA 2V6GA 3ZIUA 4ZAYA 1A0OA 3JQBA 4NMHA 4RAOA 3EIFA 3M9LA 5FUQA 4DR4B 1IK6A 3P5SA 4O08A 3VHRA 4Z0PA 5HVNA 2FPIB 2A0FA 4EHAA 2OBMA 1CIPA 2G40A 1KE1A 4LEIA 4IOMA 4KG7A 2QENA 1N6RA 3IPLA 3KTAB 5E2BA 5TB5A 1EZ4A 3ZS9A 4X20A 5BYKA 4D6YA 5I7OA 4W6ZA 4TLEA 2ID8A 4KNVA 2MJLA 1UT6A 4OJQA 4B6GA 4B09A 1OXBB 1YQQA 4WBXC 1DBVO 4NBNA 3ZZTA 1DOZA 1ZBDA 2VPWA 3BWDD 3U4GA 3B1VA 3WLMA 3P8ZA 1IEXA 4E2FA 1VE5A 1TVMA 2RHOA 2PGLA 3FSJX 2JI4A 4LA4A 4YUAA 5DYNA 2CL6X 5U4XA 3LDUA 4WLUA 5GTDA 5LU9A 4D9GA 2W5UA 1BE8A 3MUEA 4DQ0A 4Y2GA 4D96A 3HK2A 1GA1A 2BJVA 1WZ2A 1O03A 4C4TA 1QRAA 1PK9A 3KYCB 4KBGA 4LGVA 5LJIA 1K97A 3HKDB 5HIKA 3NHWA 3IPRA 2BDEA 3E0XA 2FA9A 5SZHB 2FK8A 4PANA 4BV9A 2OY0A 3G8CA 2OZVA 3DDOA 4WH0A 3IA2A 1OI4A 1F51E 3BQMB 1DMRA 1O6FA 2G1JA 3CLSC 1U2RA 3JARB 2VBIA 1EFPA 1XP8A 2BKAA 2O3TA 3JWGA 5I7WA 1QRUA 5T6BA 1QYVA 5BYJA 5JHGB 3ITKA 4RD4A 1YDWA 2B37A 3AP3A 4HTFB 1II9A 2J6IA 4KODA 1TLTA 2O0JA 5EHNA 3RREA 1O95A 4C1NA 1KVQA 2R0QC 1XVAA 4MUJA 5SYAA 4BLRA 5EMNA 4F6RB 4K9NA 5DV9A 1HDOA 1RHUA 1P81A 4DDHA 1FFEA 1PVVA 2V9PA 3AUTA 4Z1OA 4OGKA 3WIDA 1FUUA 2IEYA 4HPXB 1E5LA 4UZEA 3RYHA 2FZVA 3ILXA 1SBIA 3O38A 4IOJA 2ZQ5A 2XWPA 4ZVNA 5E9QA 4EJ2A 2QUHA 5CA1B 2PSDA 3L7YA 4Q7QA 2P78A 3TTWA 3OTGA 4RK7A 3ZUGA 3ZWPA 1CT9A 1E3TA 1E6EA 1K0FA 1ZKDA 2XMGA 4W7HA 5TMPA 3LX5A 3LY5A 3T35A 4RA6A 3GLVA 1E1CB 4B6QA 4BO8A 4P4GA 1LA2A 1M67A 3O0TA 3WLHA 4GLOA 1NKVA 4IM7A 4RTSA 2FPMA 1AG9A 4OFWA 5CBPA 1SFRA 2BGUA 2OQIA 3BQNB 3G85A 4KYUA 5HF9A 3BGSA 2RGNA 3KKZA 3ZTYA 1GXSB 4OQNA 1GADO 2GUGA 4DCVA 1NA5A 1WV1A 4QPJC 3VPSA 2HRCA 2WZDA 1UQUA 3LYAA 1M6VA 3GFGA 5EEGA 4OHVA 3U9LA 2DJIA 1C50A 4LK2A 3BXEA 5LQUA 4G5GA 5EHQA 2R6DA 1DIOB 4REQA 4X1YB 3DR3A 1KIFA 2CFTA 2PCLA 1V39A 2FKNA 3AEXA 4OKIA 5I5GA 2CB9A 1CR1A 5CT9A 3QYAA 3UHPA 3PNMA 3O8LA 3OZXA 1CJVC 2Y0PA 3FDXA 3Q0TA 1XFDA 1TI7A 1TIPA 2R5WA 1T3HA 1R27A 3OZGA 1F2UA 1PR3A 3C3JA 2GXSA 3QPWA 1FS5A 2YIDA 2HQSA 3EVBA 1BOOA 2BZ1A 3RKRA 3KUUA 2QK4A 5DI3A 1U28C 4WV3A 1GUDA 5AVKA 1NRJB 2AJBA 4P98A 4ZYWA 2JI9A 1DMSA 3UH1A 3HFSA 1XTSA 2GYYA 2H9YA 2GCIA 2J6CA 3I4LA 3EZ7A 4MR9B 2JATA 4K5QA 4AVYA 3LTNC 1JHDA 2AQIA 4QDOA 2ZRMA 1H42A 1RYNA 2RBEA 3ANTA 1LSOA 4FLFA 4BRZA 3UWDA 3KHUA 2C95A 3WYNA 4HGYA 1JDTA 3IMGA 3KOUA 5REQB 5HUHA 3EQ6A 1IEVA 4ZGGA 2VHEA 3ZCQA 4UJ3A 4LJYA 1HZZA 1CFZA 2GRUA 3WGIA 2P69A 3Q88A 3U1VA 3S1SA 1QDUA 1SM4A 1AUVA 1ZITA 3HS3A 1PJ8A 6YASA 1VL5A 2EJTA 3RASA 3WJ1A 3PYMA 1UWKA 2C8VA 3F4BA 4CTNA 3EIUA 4B7ZA 4H1HA 4IKOA 2PKQP 4YUVA 4C87A 2XYQA 3FR7A 1QE3A 3NFRA 4LTMA 4MV0A 4HNUA 4CTKA 5CCXA 3NJRA 4S2EA 1WW3A 2J09A 4LOHA 1ONPA 3NPMA 1CZUA 2H2GA 2ESRA 2YIMA 3ABOB 3P0FA 2EKZA 4HDMB 1UAGA 3ZTWA 3GF4A 4B1FA 1N1MA 1UBHS 3O74A 1H1DA 4RS4A 5SZIA 4CM3A 1U7DA 2ZTHA 3ZDRA 2W4QA 4B6EA 4WJLA 1LVUA 1W30A 1WHSB 1EFPB 2XUDA 4V3CA 4JI3B 4O1HA 1U0OC 2I55A 3ZCPA 4MKGA 3TQTA 4QJ3A 4AZ3A 5ELXA 4G1MB 2XYGA 5B37A 2O3SA 1NMYA 2OGZA 1NASA 1E2BA 1DT3A 2BM1A 3WRYA 4KE6A 1RSZA 4WEQA 3SXPA 2IW1A 1JLLB 1EP9A 1YD7A 4IIJA 4REQB 3RM3A 3N2EA 1OHHD 1AXGA 1XZFA 3H1AA 1AU9A 1QF9A 3DPSA 3FVVA 4FHCA 3A9SA 1Y9JA 2EWMA 3AZQA 1WDWB 1Z0IA 3B8HA 3CJRA 2Y1XA 4FYJA 4L0MA 4R9NA 5LBUA 5M5BA 4YDRA 3E9NA 3IE2A 4I6EA 3U5ZB 4EX6A 1E79A 1T36B 1C30B 3ESRA 3LDFA 1GPJA 1JG3A 1YHYA 3DZBA 4MEJA 1B6GA 3ZXUB 1W581 1QR2A 1RM5A 2Q8NA 3JS5A 4Q37A 1OLSA 4WK6A 4XWGA 1NJFA 3P94A 1TKRA 3QJ5A 1JLHA 3ROMA 3MBKA 2HMYB 4U9HS 2OO3A 2Z4TA 3M2TA 1M6EX 4LYYA 2GCOB 3LPAA 3IKTA 5FBVB 5DPMA 2HYIC 1FP6A 4PNPA 1YONA 4AYXA 5CLQA 1I7DA 2FU5C 1W52X 3PUZA 2UZ3A 4J4BA 2R6CA 3LDAA 3E82A 1U9IC 2BGRA 1KERA 5FYQA 3SHWA 1OA1A 2BFEA 3GUCA 4G5RA 4L3OA 3CZRA 3CIOA 5FBKA 2QVGA 4XH9B 5JOQA 2B21A 1T5BA 2CNNA 5LUAA 2WILA 4MJLA 4DEVA 1QUFA 1QIKA 1KVUA 3EVDA 4TZTA 2Q50A 1YCHA 3AR2A 3TSOA 3F5QA 3T61A 4U8HA 3EMKA 1ZOOA 3PTLA 4BFXA 1EH5A 5CM8B 1PT7A 2PZKA 4NEQA 2D13A 2NG1A 1JEAA 2PR7A 4ZXFA 4F3TA 4BC0A 3EZXA 2ZR8A 3UB3A 3AM3A 5DOZA 1Q7EA 1Z07A 2I76A 1GNTA 3HJNA 4BWVA 4WDRA 3O9VA 1D6MA 1EAMA 5E6RB 3WK4A 1GZ5A 2Q6LA 2XEDA 3I76A 4W82A 4ZA2A 3RF6A 5IJ9B 5AW6A 1P0CA 5DK4A 3G2PA 5EJ2A 2QAJA 1GEGA 5ESWA 3E3MA 3BMQA 4YMLA 3SGLA 2RC6A 1GKKA 3G2JA 3QFRA 4DYHA 1M75A 4YIHA 3HKDA 3ZGVA 4FWTA 3M4YA 4AG5A 1XJCA 3FZQA 4FSDA 2UDPA 1SBCA 1RNLA 3CWZA 1Y5MA 3WHKA 2Q4OA 1N6HA 3W4IA 2JVIA 3HJAA 1S7CA 2J7PD 1G21E 2V7EA 4I2VA 1FXUA 2VHUA 1QHEA 2CLSA 2TMGA 3AJRA 3KQVA 4TWIA 4LJLA 4F72A 2WFAA 3H7IA 3Q98A 1IJFA 4MR7B 5CH5A 4MV9A 5JCJA 4BX3A 2X86A 1HT3A 4ZOEA 5K3SA 1RRMA 3IAFA 4RSGA 2W2NA 1U8UA 1UFQA 2O0LA 3CINA 2DFDA 2WWXA 3E7DA 4TYWA 2AC2A 3PX2A 1L4GA 3SJCA 3L5OA 3CKLA 2KM1A 3LL4A 1KKUA 1YKGA 3HHEA 3EG9A 1XKQA 3FHOA 3K15A 2VBFA 1RI1A 1Y3IA 1IQUA 5E6SB 4NCXA 3UJPA 1UC5B 2C20A 4LZZA 5BNWA 1XN1A 3BSSA 4MI3A 5JAOA 2AZDA 3RYHB 2OVFA 3ZHRA 4WMLA 1JMKC 5FJJA 3C6ZA 2BKEA 4XUCA 2IX3A 4ER0A 3ROZA 1XCOA 1UXHA 2WJIA 1SOVA 2XQFA 1V4VA 2XJ4A 1NW9B 2X2EA 1VLJA 2OHOA 1P77A 3LX6A 3F7NA 1RI2A 5A5EA 3DZKA 4B3SB 1RABA 1TO2E 2P9BA 3RFUA 3LUCA 3LBHA 2BTQB 2OGSA 4LCJA 4HAOA 3AVXA 3STVA 2WKRA 3BB3A 1JEYA 1XD9A 1ZIYA 1ZGBA 5EP2A 5IAGA 3H75A 1WPGA 2BR5A 4LXYA 4AXXA 1KH1A 1Z2PX 4IEIA 1J21A 3OJOA 3FFBA 4US1R 3R7FA 3QHQA 1VPVA 3ZWNA 2Y1CA 6GPBA 5B3JC 3LH5A 4GRAA 1F1BA 3A4VA 3DO8A 2PGNA 2XCLA 2NTNA 4YREA 5EPEA 1HWYA 4TSFD 3X1YA 1HDGO 5E6RA 1D09A 4BVBA 4P9NA 4E6EA 4GOJA 2PKWA 5G4KB 4JKYA 3WGOA 2G07A 4P7GA 3G0OA 2XE4A 4RQAA 4DZZA 1EG2A 2BUBA 3IEIA 3W5UA 1DOHA 2DCUA 3JQGB 2HADA 3ZDXB 4GP6A 4MRMA 2MINA 3GWGA 3UG7A 4R2JA 2QVXX 2YY6A 3L7MA 1LDGA 3LZ6A 3NHFA 5EXTA 1P2DA 3RH0A 3AOGA 3OKPA 1Z7EA 1Y8AA 4HB3A 1F8YA 2WKPA 2A86A 3MRVA 1I1HA 3D3WA 4L85A 3QKRA 1C9KA 3HJTA 4X3CA 5SY9A 4GPAA 1O94D 4EW1A 3TR5A 2AJCA 1HYGA 3OM8A 3DTTA 4OXYA 1YE8A 1H3NA 1ENZA 4BP9A 5D85A 1P18A 4NPCA 5IJAA 1FDWA 1KO7A 1MF7A 4MWOA 4TRNA 1M0TA 3GEPA 4O29A 5REQA 3RT9A 2CEKA 4BNHA 1C1YA 3GBPA 4EA6A 1X87A 1HOXA 3VTZA 3VPBA 1A4UA 1CB7A 3EFEA 4ZOLB 3PC7A 4P93A 3AUFA 4KQWA 1KPGA 3IIIA 1W36D 1Z75A 3TR6A 4K9PA 3S7ZA 4P3XA 4RGYA 1CC1S 1NMXA 1Z8DA 3RS2A 1HG1A 2AIRA 2P2DA 4B40A 4ES6A 2INGX 3N2ZB 3ZNPA 3HDTA 3LW8A 4FFPA 4QLOA 4H60A 1V2HE 3OMXA 2O57A 5DW0A 4AYTA 5IF3A 3VM6A 1SQGA 3USZA 3GEDA 1RJFA 3IMKA 4V24A 4CL8A 1UWLA 2XRYA 4NS4A 2EZUA 2AQHA 3EW9A 5JBQA 4ZDJA 2OHHA 4U7DA 2BBWA 4L1KA 2GETA 4C14A 2YRXA 3RWOA 4DB2A 3KXKA 3NMUF 4AZ3B 3NUQA 4GE0A 3IB3A 4UVDA 4BB9A 2WK1A 4I8XA 4UBIA 2P30A 2QTHA 3OY7A 3ECAA 1ZJ4A 4TVSA 1ZXBA 1E6UA 2I29A 3X2FA 5IWCA 2YN2A 3L5KA 3KQKA 5CLFA 4B7UA 2DQYA 1NUHA 5CIYA 3QVTA 3KO8A 1V8OA 3R1IA 5KCMA 3WYBA 2A57A 2QL6A 3RGWS 3IOCA 4IJ5A 3UV7A 1Z63A 3C6XA 1Z5WA 2YY5A 5SICE 3QU9A 3R77A 4F6CA 3PFFA 2ZIUB 3QLJA 3SBXA 4ZZ0A 3O26A 2NVUA 3DDWA 5LQJA 3ZQUA 2UYOA 4UTOA 1X1RA 3AIIA 3PCXA 4L07A 1IIRA 4I9HA 5J9FA 4RTLA 2W8BB 2ZKIA 1KL7A 3A11A 3FIJA 3E35A 3A9RA 3FWKA 3MSXA 3T4XA 4M89A 3UFXB 3R6DA 2BFDB 4BWFB 1FFYA 1MG0A 3OOHA 4Q93A 2H52A 4EF5A 1QNFA 5F7XA 1MJFA 2W6JA 3DPUA 1XBTA 1ZVVA 1Q7GA 4ER6A 4AY6A 1A97A 4JFRA 4EFDA 1Z47A 1TZCA 1OPRA 1JKJB 1VIVA 4HWTA 3R24A 1QO7A 2BEWA 3QWIA 4PQEA 4V0SA 2Y68A 1N34B 3N7AA 1NP3A 1ZSVA 1L7DA 1KU0A 3G2IA 5ALSA 1HTTA 1NAIA 4RZHA 4AFNA 2EKDA 1G8YA 3AOEA 2QN9A 2HIMA 1LNZA 4FSXA 3HWX1 3IR5A 2R7NA 4W7IA 4GGMX 3U62A 2AFVA 4BECA 4DIEA 4ML3A 3TYXA 3LLMA 4ZODA 5C4IA 4IV0A 4LZPA 3O5AA 1IY8A 1H69A 4BUZA 1D2CA 4D9IA 1U02A 3NANA 4I08A 1A50B 1TM4E 2PZGA 4UKDA 3BB1A 1FLVA 3DQPA 4V0QA 3RRMA 1PL6A 1VIMA 3PSAA 5LQCA 2BUAA 3AL3A 4CV0A 4YQFA 2YWJA 4B4WA 5BQFA 5IYZB 3RVDA 1P9NA 3Q7EA 1RXEA 9LDBA 4M6WA 3ZUPA 4DUZB 2NVWA 2PBLA 2NYUA 2BTEA 3FNQA 4PYOA 1EINA 3K8YA 3LKBA 2OCDA 3KYDA 4MWSA 1VHLA 1X1AA 5KUTA 5J5VA 4NJOA 1JA0A 2IYVA 2JLSA 4EA9A 3A26A 3GCGA 2RBGA 4Y0VA 3S4YA 1DOAA 1ZISA 1RIFA 3AV3A 3H8VA 2DR3A 3ADPA 2VPTA 1C3EA 2KHZA 2L17A 3KB2A 3OQ1A 4NL4H 3MTQA 3O8OA 3OP4A 3ADOA 3TCNA 5IT4A 1RXYA 4G56A 3R0IA 2QV7A 2G72A 4N01A 5AIBA 2I1LA 4JOBA 5DM4A 1NVGA 2I7CA 2WUVA 3LUGA 1ZD4A 1W4CA 1W87A 4J0QA 2JD2A 2XSZA 4G4SP 1T8PA 2VHXA 5GV7A 3KZ1E 4DCGA 1D1TA 2ZBDA 4MTLA 4V0NA 3WR5A 5I51A 2CFRA 4PLCA 1VLMA 1OWLA 1XEWY 2SKDA 2H7CA 2IXEA 1RRFA 2O8DB 1UT5A 1ZUWA 1ZM9A 4M9QA 1OILA 1F3OA 5CW1A 3AF3A 3RQIA 1G8JA 1B0AA 5JI2E 4LF9B 2PSEA 1XTBA 5F9HA 1VOTA 4JLJA 1KJZA 4KZPA 1I6WA 4NR0A 1HUQA 2ADFA 2PMFA 4YI5A 5HMLA 4N3NA 2E7ZA 1HL7A 3CWCA 3KOXA 5DE3A 3W2EA 4C0LA 4UOEA 2VP6A 2VF8A 3OESA 1XDSA 4Z9AA 3SSMA 2BMWA 2C9YA 3TS1A 2CMKA 4QXRA 2PXCA 1GPUA 3S2ZA 2R47A 2BT4A 4HZUB 3HCDA 3EZNA 3N0RA 2Q29A 2ZZMA 1YDFA 4KACA 5IARA 2WI8A 4J03A 2Y6VA 5I4CA 2WTXA 3PGJA 3A6GA 3V97A 1P31A 4L8WB 5LC1A 4UARA 4TV9F 3P9YA 4C4ZA 4A8JA 1J0EA 2YZGA 2AG0A 4JK3A 2A14A 2GAJA 4YCLA 1KFCB 1CP3A 2HSJA 3V7UA 2RHMA 3ND7A 1WPRA 2O2YA 2ODQA 3H2SA 3UWKA 2BPOA 3IELA 3LUFA 1USVA 2HGSA 2WRZA 3LFUA 4FC7A 4WLNA 5CX4A 1JKIA 2R48A 3UXMA 3H5WA 3NQ41 3LG2A 3GU3A 2DR0A 1DUSA 2A9OA 2GPSA 4LWZA 4QT0A 5JMOA 1QGYA 2PL5A 3ZK8A 4ND8B 4Y98A 5T5QA 1TCVA 1PQUA 5TQJA 5ALLA 5AHXA 1YQ9A 3IO3A 2QA5A 3HA7A 2ZJ4A 4MQFA 4BBPA 4OQFA 3SY8A 1BXGB 2Z57A 5FL7A 2DSNA 4Y7CA 1KK0A 5DGXA 4EITA 3T7TA 2FF7A 2ZUWA 1VDMA 1B3BA 1YDEA 1XCLA 2FYTA 3WIBA 3AKZA 1VLVA 3HV0A 1E1QD 4INAA 3U1TA 2QBYA 2BR4A 4X1YA 2Q28A 5H0IA 4DMFA 3EGEA 4ZO9A 3P4XA 4L4XA 1FTSA 3NTRA 1A2KC 1EBBA 2FPSA 4PCAA 4R51A 3ANNA 2CN1A 3OIUA 4Y18A 3EZFA 4AXBA 3UF0A 1RT9A 3B6JA 3KSDO 1IDN1 3HO8A 4BB0A 1NZJA 2VCYA 3LVRE 3PKJA 3PPVA 2ZI7A 4YT5A 3QLVA 4EYSA 5AJVB 3SR4A 3UV6A 2HRQA 4E21A 2R6ZA 1UWVA 4BU0A 4EY7A 3TWOA 1VA5A 2B8NA 1RWKA 2H2WA 5ES3A 4CNQA 3VOSA 5KYWB 5LNK6 5ALQA 4DR5B 2HFJA 1CIVA 1JWBB 2XCIA 3EVEA 3H9QA 3VKVA 5ERXA 2SHKA 3CW2A 1LJLA 3KTFA 5AI0A 5AM0A 4PC2A 1R8XA 2E1RA 5KPJA 3KUKA 4R7ZA 2G80A 3KTDA 1DAHA 1RWVA 2EBHX 3G0DA 3ZHTA 3KETA 1OAOC 1U8TA 1TM2A 1W85B 4DV6B 5GPBA 4RKWA 1TM7E 1Z4JA 3NTOA 5BSTA 3C1UA 1KIMA 1W4AA 3OLYA 1FXWA 1AS0A 2NZVG 3MQ4A 1XQ6A 2R8RA 2XF8A 3SQMA 1WY7A 3N75A 1K92A 4I1RA 1VXRA 4M1ZA 4HQOA 3THWB 4UCXA 2WIBA 2G3YA 1U0TA 1JG6A 3HJUA 1GTL1 4BWGA 4RDXA 1ECPA 3NM4A 3WWPA 3ZWCA 1JIUA 3CLHA 2FFHA 1EK1A 3V4FA 1KBZA 4LOKA 1LQUA 1XLTA 3KLOA 2FE4A 1FFXB 4HAUA 5BQ5A 2DPXA 4WCDA 4H0CA 5A5GA 2LZ0A 3O47A 4FFBA 3BTVA 3AEZA 4L8FA 1B00A 3UANA 5JAZA 4S12A 4CFSA 2W4MA 1E6MA 4Q7EA 3U31A 1JTVA 2REXB 2CYBA 4Z2YA 4EHDA 4EPWA 1XRPA 1XPOA 2XKBA 2GILA 2I4MA 4LYGA 4V03A 3TXYA 3PLAE 3EZGA 3FCSB 1Q20A 3GLSA 3RU9A 3PT9A 2ZAOA 2JJ2D 3QXJA 3NM5A 1O4VA 3I72A 4XB6B 4KN5A 3NTUA 4EX7A 5L45A 4G0VA 2FOIA 3D6JA 1VYUA 4V1CI 4N5LA 2VJBA 4Y6QA 5IWAB 4Z4HA 5AKIA 4OBXA 1PZMA 3UJ9A 2OCLA 2Y1DA 2YHIA 2ZYTX 3FNGA 1MW9X 2ODWA 4R16A 1UIRA 2BFNA 1EGAA 2ZS9A 4CRWB 3EUFA 5FX2A 1U5AA 1QP7A 3LK7A 4KJZA 4RK5A 3EGCA 4DIOA 5JADA 1VJ1A 4JB2A 1ZRSA 2GM9A 3HMQA 5EMMA 1AGNA 4EKDA 5B12A 2ADMA 2WYWA 3PEWA 2AJLI 2EF0A 1CUEA 1PJ3A 1GA6A 3FRIA 4PIMA 2C42A 1OYVA 4M0FA 5EPOA 4EHJA 4UEWA 1R0XA 1NUSA 2ZRCA 4EG5A 4EVIA 3VR3A 2JI6A 1BCRA 2Y1EA 5L3RA 2GZ3A 4V0ME 3ZXYA 3ZWMA 2BYTA 1OVGA 3EBLA 4IL5A 2JGEA 1QHHA 3WAGA 1MZPA 1V8ZA 1OV4A 4AU1A 1BSVA 4BL5A 1UDAA 5AT1A 1ZH2A 5LZ9A 1PNRA 1QRTA 2YDXA 2YJTD 2BJHA 4WJZA 4YMSA 2W42A 1U3CA 1G8MA 3AFMA 3QBEA 1JSZA 3D7KA 1C0KA 4YWJA 1A95A 3DNMA 2BHTA 4PSAA 2C8KA 5CA1A 3KQHA 1YDGA 2PKEA 3P2YA 3R3WA 2GZAA 3EPJA 2GVZC 4JL8A 4YDQA 4XLLA 5DBGA 3SDZA 2OFOA 5CVCA 4BV2A 1T34A 1Z16A 1E98A 4CMEC 3BJEA 4QIHA 4EPVA 2V3VA 1DP4A 3BXOA 3BRSA 1SK8A 2VHVA 3QY0A 2R87A 3K71B 1YRWA 1XZKA 2A92A 3L1KA 1K06A 1XCMA 3VDXA 3VV3A 5A03A 5I7FA 3I1YA 3ZU6A 2OO5C 2EKQA 3PHGA 3VVBA 2IOQA 3FGOA 3D8UA 3FYUC 3RRXA 1PP4A 1F38A 2RAFA 4G9GA 4O4HA 1FYWA 1J2RA 1WWKA 3ED5A 2Z6VA 1IULA 1BVRA 4KWHA 1GWNA 5DHTA 2CL7X 2VUIB 3D6NB 2N0SA 3G23A 4KLZA 4HNVA 3Q6MA 1NN0A 3L49A 1PFWA 2J6BA 5DX0A 3RYCA 2QN8A 3HZZA 5DMHA 2KSQA 1TVKB 2V03A 3BG5A 5E38A 3JWIA 1J90A 3QTBA 1ESEA 1RTTA 4ITRC 1S8OA 4F9GA 2WFMA 2AN5A 3HDVA 3O2QB 3ZOZA 3UG6A 1TAHA 1PWYE 4UBJA 4YRTA 1YIAA 2COKA 1E2JA 1EKXA 4EA8A 3WFZA 1TTQB 4W63A 4AKIA 1ZIDA 3RS7A 1Q3HA 2JVKA 2AX3A 3L43A 4LY0A 2QB5A 2MIIA 3HWWA 3SCZA 3PX3A 4LRQA 3CSDA 3WNDA 1UZAA 1KH3A 4PU0A 3AXSA 4RPKA 1G63A 4M9UA 4MRAA 5B64A 3UMSA 1V7QA 1JYSA 1OXUA 3OLXA 2Q2WA 4FZRA 4PYKA 3OQPA 1WD5A 1NJ2A 2VJCA 4Q48A 3V1UA 4YRBA 3CNBA 5L3QA 5E95A 3DOIA 2IZZA 4KXNA 1IXRC 3Q8XB 5CNIA 1AK1A 3QUCA 2Q5CA 4L02A 1QHHB 4OJMX 3V42A 5JNLA 3FTPA 1UPAA 4GBGA 4M1MA 3AUYA 2W2PA 2X6RA 4OK5A 4WESB 1D8TA 4PX9A 3OA0A 2P2YA 1ODFA 2VHZA 3LDGA 4UVIA 4XCQA 4ARUA 4PQRA 2AC7A 1VJCA 4YUXA 1UBMS 2G1PA 1PSWA 1OAAA 1NVTA 2J9ZB 1AUOA 1ZJJA 4FS3A 4J1NA 4YFYA 3OCVA 5EIBC 5HIMA 4YRKA 3DBHA 4Z4CA 1GLNA 3GY0A 3CHYA 4RZIA 1RMYA 1MLDA 4RORA 3UJ6A 1GSIA 3IBCA 1H2EA 5C1IA 2IPOA 2WAYA 1KBQA 2PUTA 3GRRA 4JR1A 4XCVA 5HG0A 1C4OA 3IKLA 3ZQJA 5I7SA 3SVTA 2ZE8A 5LUBA 2RH5A 4PG4A 4QDXA 3UKJA 3OOJA 1PZGA 4IRXA 3S7TA 1IVNA 1PDWA 2D74A 5EMHA 2XHEA 1WETA 2F3TA 3OQHA 2FN3A 5EGNA 2GXQA 3AHFA 1WHTA 1A88A 1J8YF 4BNKA 1QB7A 4DW8A 2O4CA 3U17A 1HSZA 1K0UA 2J0SA 1TK3A 1JR3D 2C4VA 3IIEA 2FPPA 3HVIA 1P9RA 3NB0A 4D0NA 4MUHA 1GNRA 4NONA 9LDTA 5TY0A 3WGNA 4DYVA 1FRQA 1D6SA 1JFVA 2DBVO 3JQ9A 1A9XB 3MLAA 3RK4A 3ZWVA 3AMVA 4FZVA 4K46A 3VJKA 1GTSA 2HXSA 2ZYDA 3H19A 4R8SA 5CRIA 3W77A 1G3UA 4GQBA 2VPYA 4HH3C 4WEOA 5K0TA 1I3CA 1DC3A 4FDUA 5AM4A 1OH6A 4PNHA 2R8XA 1GUFA 3CZQA 4KXXA 3FTNA 1VHWA 2PH7A 5EJ4A 1VMKA 4MA4A 1AGRA 2AD5A 1IYZA 1YHNA 3HB1A 2V8BA 5FFNA 5ALVA 1TM3E 5K0GA 4ATNA 4MA5A 5A1TA 2FWNA 2OOKA 2ORED 4MDYA 4UUQA 4CXMA 2NU6B 3OM0A 5BMOA 2JIZD 4UEJA 1DDOA 1FC0A 3WL4A 3I12A 3FGPA 4F12A 1P1IA 1C3OB 5HUJA 3T34A 2UV8A 3K6JA 4MOWA 2GCOA 3LVFO 4E3ZA 4YAUA 2NSYA 1MJGA 3U3ZA 1IMOA 1LLDA 2EFDB 1NR5A 4Z3DA 4ZK6A 5HK9A 2MTBA 3TIVA 2WYIA 1AY0A 3GI1A 4PO9A 5DTMA 4B83A 3F6PA 3LLSA 2XWQA 2NPFA 3V9AA 1KDTA 2IE0A 3FH0A 4K1LA 4ROTA 1NZFA 2R00A 5CDGA 1CRPA 2WAOA 4EQ6A 1CYEA 2IGBA 3QV2A 1JHQA 1RKVA 1V0JA 3E48A 4LXUA 1F3LA 5BSGA 1VL2A 3GQBB 5I7RA 2DETA 1V4NA 2C3MA 3LA6A 4M4SA 2YRFA 5IXJA 5FOQA 3BWBA 4ZOAA 3VSCA 4UCQA 4EFMA 3H0EA 1SU4A 3LM8A 4KVGA 1RMQA 2H1RA 2MDTA 4Q3OA 2NZXA 4I5FA 2JIOA 1DC8A 2O48X 4C6HA 3QIAA 3INYA 1A82A 4JUAA 5D3KA 3MJVA 4N7RA 4ND4A 2G8NA 3DDNA 3F74A 2Q4DA 4OXQA 4RQTA 5GGXA 3VOAA 3BREA 1U94A 3PUXA 4OB7A 1PVOA 3ZGNA 3VYVA 4TM7A 3FUCA 5DBFA 1K7FB 3H9CA 4TWAA 4MUBA 2B36A 3WSWA 4H1WA 4KQCA 4FN4A 4IQ8A 4O2BB 2CNKA 1U04A 4NCIA 2GTHA 4P3OA 3D8HA 5J63A 2AZMA 4DWJA 1LU9A 5KI6A 4A6XA 1EJ0A 1VSTA 1PUJA 1SHLA 2FPXA 2TECE 2Z8ZA 4LPKA 4MPTA 1X8KA 2ATCA 2JH3A 4LK3A 5CYGA 4EY3A 4PG8A 3SSOA 2IS2A 3E5NA 1IBRA 2W2QA 4XLZA 5FWDA 1KZ9A 5I7EA 3O92A 1Y8ZA 1AE1A 3L1UA 3H9JA 4MJ7A 1S2LA 2X9NA 5K3AA 5L51A 1E7RA 1YBAA 2BV3A 2AMLA 3AILA 4O6VA 3HJFA 3DDSA 2JLWA 4DCOA 2Y0BA 4Q3EA 3RG8A 1WQ1R 4RABA 4YN3A 2I6FA 1V1MB 4V0RA 2ZI6A 1C9MA 4NK4A 2V7UA 4CDNA 4YY3B 1J0DA 3NWOA 4KN8A 121PA 2ZIVB 3BS4A 1J9EA 1JTFA 2YC2C 2IDMA 1B26A 4NCKA 3UUEA 2C07A 3OTIA 1B3RA 4N40A 4EZIA 4P4NA 3RTBA 5CFLA 5J40A 3Q9LA 3MJHA 3EEYA 3BZWA 1RAFA 1EVQA 2ZYVX 3EGIA 1P8AA 4HGNA 1E1QA 5AK3A 1T8SA 5HGXA 5CGZA 1JU4A 4JLUA 2LNDA 1FF9A 2ERXA 5H02A 4MRMB 1JR3E 5J4VA 1DQZA 5JR3A 1H05A 2OHXA 1I5RA 1ENYA 1O94C 1LUAA 1HZJA 1N57A 1YK0A 2HRRA 2W93A 2XR1A 5ERGB 3UMJA 5K3FA 2RHBA 2PH1A 4QQFA 1YZHA 4E2ZA 5CA0B 3DNPA 2CNLA 1HO3A 1EFDN 5LNK1 1ZGZA 4KIWA 2VL7A 2YWDA 4E2XA 5JH7A 4IF6A 5H3HA 3GNTA 5HMMA 5FI1B 3RNOA 2WSBA 1O6ZA 2OAQ1 3EXEA 2XYVA 2QSZA 4IS2A 4FFVA 4HEA6 4YP6A 1PS8A 4UTXA 1GNSA 4UBNA 1RZRD 5FEUA 5IJ0A 2ZT8A 2M6KA 1PV1A 2D3TA 1AS3A 1DV1A 2C4HA 3GX1A 1TD1A 4OQPA 1V3UA 5K45A 2XOKD 2DY0A 4YPVA 2GHQA 3QE4A 4R68A 3ZV5A 4MR9A 5A4JA 1UOQA 4KK4A 4C29A 2BE9A 1IHOA 4G5XA 3MC1A 4GIBA 1KTVA 1B14A 5IH7A 3EMVA 2X58A 3UJBA 2BKVA 2IA5A 3NT4A 2BMJA 4W5TA 3KT3A 2GA8A 1XD8A 3ACBA 3VC1A 1T2VA 1E3MA 2XZOA 3PNYA 4BXOB 3I9MA 5LQNA 1CW2B 2QPTA 1S1CA 2XUIA 1EXDA 4PZYA 3MWEA 3I37X 2Q46A 4FFSA 3TLXA 1QMGA 3PL1A 3IAS1 5B53A 5HJEA 1OVMA 4K6FA 3O2SB 4O5AA 1AGXA 1GGHA 4U2BA 3WV4A 3SE0A 4HTAA 3FOCA 1ZI6A 5IUNC 2AOUA 5IVIA 1VSQA 4F6RA 4IVNA 1JAIA 2Q9CA 3CBGA 5AK5A 4B8WA 5J23A 3KQUA 1HC7A 1SC4A 1WAMA 1ND6A 4ALIA 3QOXA 2YV4A 3KOOA 1VCMA 4GOLD 1JDVA 2HK9A 2JCGA 1IAVA 1MV8A 3IUNA 1JQKA 3GD7A 2REQA 4Q34A 4X60A 4BBAA 1QQBA 3K0CC 3V8MA 1NWHA 1C2YA 4OQDA 2JARA 1R15A 3AFGA 4B8YA 1E79D 3H9GA 1YVPA 1SD1A 3EPKA 1IJBA 3AZOA 1QO0A 3MMXA 4IIFA 2JF0A 2I6SA 4C0SA 4Q3DA 3V6MA 4E4YA 4PG7A 4URHA 4AQDA 1YVDA 4BVEA 3OC0A 2C2KA 1RRCA 1L5OA 3A9WA 1MJNA 1A96A 3FPCA 3CH4B 3NHAA 1RQGA 5LA6B 3IP5A 4YRFA 2E37A 2ILTA 5JCOC 3T99A 2GPBA 1NI4B 5C7OO 5GJBA 1AB6A 1RXIA 2HY7A 3GR6A 3QLVC 4BO4A 3HP1A 2IBMA 1FMCA 4PTZA 2QQ0A 1EZZA 1T1RA 2PGXA 4NE7A 5K6RA 3ASZA 2CNWA 3UWOA 4MUEA 1VCIA 4WZAE 3UB4A 3DG9A 2A5YB 4GI1A 2CKMA 2QZJA 2JKYA 1T2DA 2I65A 4B48A 1D2RA 3E27A 2VK1A 1THGA 1I3MA 2XOXA 1SHTX 3IDSA 4GYKA 1X7WA 4Q05A 4UHDA 5SY4A 3RRZA 2J9RA 4E11A 2IYNA 5J3JA 4C6TA 4JYZA 1F48A 2YJGA 4RHFA 2VSOA 4PTYA 1WRBA 2VOJA 2PMEA 2CLFB 3SK0A 4E3WA 1PL8A 2J9GA 2AG1A 3ACCA 3E5RA 3FCAA 3BTOA 3HEBA 4Z9XA 3JQ6A 3CE9A 3FJOA 4L9AA 4GMKA 3G9TA 3HVKA 4YDSA 5ER9A 3R4VA 3TSYA 1BN6A 2XZPA 4YI3A 1JDJA 1JSCA 4QATA 1CY7A 5AOAA 1SBZA 1L7BA 1UXGA 3R5JA 2H7XA 4FBMA 3RF7A 3UCFA 2UVDA 4KW7A 1YQTA 2HNKA 4PONA 3ZY4A 4DLSA 3D1JA 1QIDA 1XDBA 3VNAA 3CJQA 4O4IB 4ASUD 1VMEA 3GN2A 3RUHA 3INNA 4BMZA 3FF1A 1ODJA 1P7YA 1UJNA 4R54A 1LI4A 4B73A 1U1GA 1CHNA 2ZVJA 3G7NA 5ED0A 5IBRA 2YNMC 1QR6A 2VYNA 1MPTA 1HK7A 3KJQA 3OCUA 4P7FA 1QC5A 1IUPA 3O75A 5K99A 4X8HA 4WOJA 1O87A 1SVUA 2BFPA 3FHCB 2FZEA 4D9CA 1K98A 1N2GA 1E94E 1MB2A 1PJCA 2Y8EA 1N8SA 5JSQA 1JT2A 3Q72A 3JVDA 1G2QA 1C5KA 3KUXA 4LYFA 4TSRA 2FTKE 5HZGA 1WXWA 2BF7A 2WSIA 4AB1A 4F6LA 4HI0E