4EW3A

The structure of human glycinamide ribonucleotide transformylase in complex with 10r-methylthio-ddathf.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
205
structure length
205
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Biological and Structural Evaluation of 10R- and 10S-Methylthio-DDACTHF Reveals a New Role for Sulfur in Inhibition of Glycinamide Ribonucleotide Transformylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 65
structure length 205
sequence length 205
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ew3A00
1JKXA 4EW3A 2CFIA 3DA8A 4YFVA 3NRBA 4YFYA 1RC1A 3W7BA 1C3EA 3DCJA 1RBYA 4ZYXA 3N0VA 4TTSA 2FMTA 4PZUA 3AUFA 1RBQA 4IQFA 4ZYVA 3P9XA 4ZZ1A 4TS4A 1RBZA 4QPCA 1GARA 1NJSA 4DS3A 4ZYYA 4ZZ0A 2YWRA 3LOUA 3R8XA 1ZLXA 4QPDA 4EW2A 1MEJA 3Q0IA 1S3IA 2GARA 3O1LA 5J63A 4ZZ2A 1RBMA 3GARA 1FMTA 3TQQA 4ZYZA 4ZYWA 1CDEA 1MENA 2BW0A 1RC0A 1ZGHA 3AV3A 4R8VA 4EW1A 4Q12A 5J9FA 5CJJA 1GRCA 3OBIA 4ZYUA 1ZLYA 1CDDA 3TQRA 1C2TA 3KCQA 4NV1A 4S1NA 4TT8A 4ZZ3A 1MEOA 4ZYTA 1YRWA 2BLNA
chains in the Genus database with same CATH superfamily
2GPAA 2GXUA 3REGA 2Q5HA 2NZ8A 2XUAA 3RFVA 4HGQA 2C2OA 5K0CA 4PX2A 3WXBA 1NBMA 4QDZA 1Q11A 1QS0A 4DSZA 1PWZA 1DDIA 4HNGA 4M2LA 1GPDG 5CVJA 5EHZA 3AVWA 2FKAA 4FGZA 3OTQA 3TD9A 4NLLA 1I2DA 3AI7A 4Y0VA 4C0AC 3AHCA 3ZHOA 1VMDA 4ZHSA 4M0DA 4IIDA 3TVDA 1Y4AE 1E4VA 1KO8A 4HDSB 4ZYXA 5IKPA 1YASA 1Z16A 3HY3A 3L9WA 2XVMA 5JAQA 4ZCRA 4O2RA 2FMXA 2IT1A 2PH5A 1CJTC 4G4IA 4PWYA 4WASA 1LI5A 2B34A 4I7EA 1IUKA 4XJXA 1JEQB 2GAFA 4PZEA 4Z9XA 3WKEA 4YPVA 2AW3A 2VLIA 4LJ4A 3WB9A 2A2ZA 3OQBA 3R0XA 2FWMX 2QSZA 4IDNA 1P3DA 1KJYA 2Q46A 3HXPA 1KXZA 3MAGA 3OEEA 3T7KA 4MS3A 2P90A 2BTEA 2ZQYA 1QMGA 4DJAA 1SUBA 4FK8A 3LP8A 2JD1A 1R50A 2R2GA 2RGGA 3DMPA 4M3NA 4EIWA 4EG8A 2HPVA 1WAMA 2H1VA 5CEEA 1YHNA 3GLHE 4XGNA 5JQGF 3FAZA 1HR0B 3EFEA 1YZ3A 2C2HA 1BDBA 2ZBFA 4KO3S 4KMRA 3SKYA 2G1AA 4UBMA 2CNBA 1RMQA 4NTZA 2OO5A 3I01M 1E2UA 1AVTA 3R7DA 1OTYA 1U5CA 2P4QA 1MT3A 4KQFA 2VSXA 1LBHA 2XHZA 4OHCA 3TAXA 1QOZA 1ZXBA 5DV9A 2PZKA 1MDBA 2I2BA 1VJRA 4GGOA 4JSYA 3EDMA 3UN1A 1V5EA 1P4HA 1W581 1XTVA 2QPTA 1W48A 2GN2A 2Y2VA 3NO4A 1OA0A 4JLJA 3R4CA 3LNTA 1I5RA 2R4TA 3O5AA 2XDYA 1YR1A 3KYCA 3SDBA 1ZH8A 3K1TA 4DY6A 221PA 1F17A 4KGVA 4X8MA 3WYCA 4F85A 3DYVA 1LBTA 1JEAA 2G28A 1MR3F 3QFCA 1EB9A 2JEYA 3HLYA 3QLUA 4JBIA 4IVQA 4PBTA 3RANA 3IEIA 3TOZA 1GJRA 3E05A 5G0SA 5KOHB 4NBVA 2P5SA 2BCEA 3GXOA 4ER0A 1PN3A 5IXJA 1B74A 2WJGA 4IS3A 4UHEA 5JNSA 2UZIR 4E7OA 5L3QB 1KK2A 3ETEA 1LC3A 3I8OA 3OKCA 3TKLA 3P27A 5DH9A 1UAGA 3W5DA 1RRCA 4RXMA 5T3UA 2LWIA 1YFKA 1NV9A 3UMVA 5C5CA 1HYQA 3C6QA 3PUVA 4LY0A 4QLOA 4II7A 2R751 3IQDB 1UZNA 5LNK1 3R24A 5FD8A 2Q2NA 4D79A 2FQXA 3LCUA 5KX5B 1H6CA 4B47A 3E2IA 4OYHA 5CHYA 3EPRA 3LO8A 3O38A 5DDIP 2UYHA 5CGQB 3UAOA 1P5HA 1CFJA 1SPXA 1C7EA 1EVJA 1IQPA 4C0KA 1TUBA 2XQIA 3G0IA 4GDMA 1BG6A 5CB8A 5EZQA 2V6GA 2OKCA 3C3MA 3R7FA 1J0XO 3MRVA 1MX9A 5A7HA 3WLKX 1D1TA 4YP6A 2GK4A 5J47A 3KELA 3B1WA 4X8OA 421PA 4CKBA 1LW6E 2Z8YA 2C9YA 3O3MB 3WNVA 2RGNA 3AH8A 2QTCA 3RRFA 1J0EA 1FDIA 2NNLD 3KJNA 3KWMA 4HAXA 4RPIA 4YX9A 3AEKB 5HOQA 5CYPA 1SZPA 2BZGA 1ZDMA 4ZQBA 4MROA 9LDTA 4U5QA 5K5EA 5L53A 4IYRA 4OFWA 4WHMA 1T25A 4BPRA 2XCOA 1E3WA 5L3SA 1FQWA 1PFUA 1EFPA 3ZDBA 3QUSA 2YJTD 4CBVA 2BSQA 1QS0B 2QTLA 3FDXA 1RBYA 3DZJA 3OOSA 4HUQA 1Y9DA 3NDJA 1KIFA 1O1YA 4TTSA 1PJ3A 1ZA2A 1XX6A 1WTCA 2HF9A 1DKQA 5KTMA 4W5NA 1N6HA 4FHEA 2IEBA 1MB9A 1GA6A 4KE7A 3E3MA 4YS6A 1XZQA 1DP4A 1KH3A 5DXFA 5LDGA 3QMMA 1UL1X 3F7OA 4CV0A 2KYRA 4N3GA 3LPDA 1AKUA 4DDWA 5DHFA 2YINC 3FWPA 4QPCA 3ZWXA 5BWBA 2QQGA 2W6OA 1FL9A 1ZIXA 3VUEA 3BFPA 4TMVA 3IEPA 3ESCA 3GDHA 5JCJA 1YONA 4YQZA 2HXSA 4I5GA 4IRUB 2IHTA 4MS3B 4O3FA 1P4GA 4FNGA 1YC5A 3RIHA 1MC5A 3P5BA 2IS4A 4KQ2A 3ZIDA 1K66A 4BVGA 1RYNA 5FRDA 2QTWB 1RWPA 5IMSA 3B2EA 2ZIUB 3O9ZA 2GXAA 1I3MA 3IMKA 1DJOA 1CR6A 4RVOA 1UKAA 5A4JA 2DBZA 4BQSA 3EXHC 4QYTA 3OESA 3TM5A 2QZZA 5AI6A 4LFBB 1TQ2A 1GZ4A 2QUKA 5ITSA 3AHGA 4DJDC 3OPXA 1KZ6A 2J0SA 5EIFA 1RHUA 3KFVA 1I4OA 1XJ0A 2AOWA 1J56A 3I4LA 1ZGBA 3LLCA 1V3QE 3ORRA 4LCEA 5AVYA 3PGMA 1U3DA 2FWIA 1A5BB 5JD6A 5I45A 4JJ6A 3DGFC 4Q1FA 3KOWA 2E5LB 1PJSA 1NC1A 2I55A 4QO8A 2XCSB 3FY4A 3KYCB 4JJEA 2VH5R 4XPIA 1YZVA 5EWLB 2FHPA 4UMVA 5M5BA 1CUWA 2P65A 4WFIA 3DQQA 5FPTA 1F3LA 4EG7A 4REMA 4ES6A 2IUSA 3ACCA 4L4SA 4Q93A 4FM9A 1Z63A 1U7XA 4ZAXA 1EG2A 2RGEA 4ISBA 1YI8A 1CX9B 3UAZA 4AL4A 4W5HA 1CRZA 2ZIEA 3N59A 4KX5A 2CLCX 3VU0A 3N6XA 1B42A 3EEQA 3WMRA 5F12A 4E15A 8GPBA 1MNAA 3EWNA 4PZPA 3VZBA 2HNAA 1IZ8A 1E98A 1PFGA 1U5AA 2ZXUA 1DQRA 3HCDA 3PNBA 1S1MA 1RLTA 2ZJ7A 4H7HA 4XIGS 4DGQA 3UPUA 3RUPA 2C3OA 5CXXA 1USWA 3B7PA 1OYVA 4UW9A 5DM70 1CIPA 2VDWA 1EVIA 4NBLA 2QX6A 2J4FA 2D1SA 3VV3A 5TIIA 5ICMA 3JX9A 4Q66C 4NV1A 3F67A 1Q3TA 1JTEA 3PFNA 3ZHRA 1RSZA 5AM2A 5HHTA 1HX7A 3RVSA 2ONKA 4DRZA 1JDSA 1TUBB 2A5FA 4ZO7A 4DMCA 3NORA 5DNCA 2JJMA 1L2TA 1YIDA 3I6QA 3O9VA 1F20A 2FZ5A 4MWOA 2E1PA 3W3AD 3WIVA 2E4UA 2VBFA 2W2OA 2PGJA 2W2LA 1A1SA 2Z95A 3ORYA 2CXUA 4KODA 1QP0A 4CKBB 3KCNA 4YFYA 2GEJA 3A04A 1PFYA 5FTLA 1F14A 4RD1A 1NQTA 5KNBD 3LD9A 4RWEA 2B8NA 5K3OA 1U02A 4WX2B 4KE9A 4DAOA 1AIPA 1F0KA 1YO6A 3LC0A 2BGLA 4JB2A 4KJXA 1XL0A 1Q22A 1E2JA 4R1LA 4URHA 1WQ3A 2WC1A 1E3WB 5L3SB 2YVKA 1KY2A 3AEQA 3E1GA 1EFPB 1XNGA 2Z09A 4M1KA 2J32A 4HUQB 1YBAA 4E94A 4Y2RA 3C1TA 2OZLA 3QWAA 3QFHA 3KOYA 4K6CA 4MI9A 2HMVA 1HYEA 3K5PA 4J76A 2QNBA 1T8SA 2AEEA 1BZYA 2AFHA 2VWHA 3NYWA 4G81A 1G3MA 3A4NA 3UHFA 1AGYA 3IA7A 2QX4A 1N0WA 5AM0A 2VJKA 2VAVA 2ETXA 1GQRA 3COJA 4KR0A 4ALKA 1GQOA 4RU1A 4E3ZA 4W8OA 1XZAA 4MYDA 1XF9A 1TCBA 4FI3F 4KC0A 4OQNA 1ZIPA 2BGNA 1JIQA 4WQMA 1E89A 3EZFA 3U39A 4DMKA 5GTDA 2CYBA 5DN6A 4Y0AA 3E27A 3HUTA 5GM2A 2YV4A 2C03A 3HJFA 2W2PA 5GONA 3WGJA 5AM1A 2O5EA 4GI1A 1EI9A 1J2RA 2A35A 3BWXA 4YMLA 3D7KA 1WULS 1SVUA 1OBHA 3DPSA 3PX3A 4LZZA 1P1BA 2AF4C 3LGSA 3MWDA 4HKTA 3DFUA 1YL5A 2Q99A 3GEEA 4JOBA 2HWKA 5AXAA 2Q7DA 5A2GA 3QU9A 5L3VA 2HWUA 4MKXA 3SHVA 1M6NA 2D74A 3HRIA 3IVCA 5U1PA 3P97A 2FHSA 4G5QA 4CMAA 5ISMA 5JAUA 1AJEA 4O2LA 3RHZA 4NRDA 3SHTA 1G2PA 3G79A 2JDID 3TIFA 4JT9A 4KIUA 5DIZA 1T6ZA 5LA6F 5J2UA 3NKVA 5DT2A 5JALA 1IXZA 2VOJA 4JJAA 4UASA 4HLUA 4CQNA 4YONB 3K6RA 4O0MA 2I3BA 5K0JA 3ACDA 2P4UA 1RWQA 3O9MA 3ANNA 3PUKA 4IDQA 2WA2A 4XPIB 1H69A 1SVKA 2WM2A 4ZCQA 3NM6B 3GDGA 3OHMA 1H22A 1QFXA 3GA0A 4NDNE 4PRYA 5AHRA 2NVUB 3VU3A 2QZJA 3CEJA 4N48A 4IR7A 1U9ZA 3COYA 1X7DA 4HGPA 2R97A 2JIQA 4F56A 1IN5A 2LGJA 5EP4A 2IA5A 4J1TA 1TKCA 2HIHA 4UDXX 2PKWA 1ADGA 4KWIA 1SQGA 1QAMA 3F0TA 3K9WA 4OQZA 4IGAA 1KY4A 5TSDA 1GNPA 1RMTA 3MQFA 4TTPA 3SSAA 3R5FA 2C2WA 2PUEA 1DIRA 2BFFA 3TX6A 3VC1A 4C7XA 3TR6A 1MPXA 3IHKA 3L0ZA 3I6BA 1I3OA 3MERA 4LQLA 3PUIA 1OH5A 3VX4A 2JD2A 3U5TA 3TNLA 2DH5A 2OM2A 2HC9A 3FSGA 3R20A 4NYJQ 4AZTA 4B6GA 1D0VA 4UBKA 5FEMA 4N5HX 2J6CA 3OIFA 4TQ9A 5J2TF 3MCUA 2H11A 1P45A 2GD6A 3TGPA 4U8HA 3HXTA 1ACLA 4X00A 4L3WA 4WVFA 3TLKA 3A1WA 3BIXA 4CMHA 2F55A 3NANA 4CIDA 1ST3A 3A1UA 4IUBS 1MX5A 1YXMA 4N5IX 3V55A 3BTUA 3O83A 1K9VF 1OVMA 4BVAA 1NKTA 2Q5IA 4HLNA 1U1DA 1SCKA 1P39A 1R12A 2PQ6A 3LLSA 4PX5A 5CLHA 1IDN1 1UP4A 2NAFA 4L0MA 2G6TA 4R8LA 2BHRA 1L4UA 1RWXA 3TBFA 3U1VA 1QKJA 1OZFA 3OQIA 3NT4A 5LQRA 5EE5B 2UYYA 4M1WA 5JXWA 4FGWA 5K0TA 1QBGA 4UTOA 3CW8X 1RYBA 4J2TA 1A5SB 3K0FA 3C6XA 2HZBA 4GOXA 1WCYA 3KKNA 1TI7A 3U49A 5AW0A 3AEQB 4OAQA 1WF6A 3ZDYB 3U44A 2C9OA 4YAFA 1DUIA 4NPHA 3VDRA 4FYYA 2CLHB 3HM2A 1ZJ6A 2IHVA 4Q9KA 1ISRA 1L4BA 2UYGA 4US0R 3JQPA 3M4YA 3TUZC 2OZLB 3QWIA 3VKHA 4YQFA 1G3RA 2JIMA 1U90A 2AFHB 2IYRA 3LCCA 4NI5A 1Z83A 5F35A 3QQ5A 2VYCA 1IRXA 1FMCA 4FMDF 3AVYA 2GVDC 3F6RA 2O05A 2QN2A 2C5AA 5FT9A 3VC2A 3THOA 4F45A 1MHTA 1CTQA 2DTEA 3EPPA 3IB3A 1FNCA 1R9GA 5AI0A 5A7FA 3KQNA 3OY7A 3GBVA 4FOTA 4BWYA 2YWGA 4Z2AA 4FXOA 4WCDA 3T3HA 3QYFA 3WLJA 4AO6A 4UM9D 3I6IA 2RKWA 3UGJA 4OL0A 4QG3A 4H31A 4Y7CA 5CYFA 2A9KA 5GONB 4TV8F 5H83A 4KH0A 4DM7A 2FWRA 4TTVA 1CUDA 3T3PB 3FI9A 2W6ZA 3G7NA 3NOQA 1HTTA 2E3JA 5D6NA 3EE6A 3MWDB 1RAEA 4RFVA 1TCCA 3TZBA 2AK2A 1BX0A 4IVRA 1KTIA 3ETCA 3F5DA 4ZYWA 4NBKA 5AKYA 3GLSA 4JI4B 3AR8A 2OFFA 1Z13A 3MWYW 3U16A 3D8RA 3K96A 5IK2D 4V2UA 1IY0A 2FWJA 1QTNA 1WWKA 2BH9A 3DHNA 3L4BC 3ZGVA 3CVJA 3DCNA 3IULA 4WADA 2L17A 4ZAFA 3SX2A 5JAMA 3K9FC 1ZD1A 3IOBA 3FPEA 5J2UB 2HBYA 3WRVA 5AW1A 5ECYA 2GQ0A 2WIGA 4H7PA 4IIFA 3GB9A 4PTYA 5BSFA 4MDFA 2XB2A 3P32A 2IYWA 3ZWNA 3U4AA 5CD9A 2GZMA 1T2AA 1UDAA 4FQ8A 3AR6A 1A5TA 4KXXA 5E2AA 4F7DA 2GEDA 4XFJA 2P30A 1NSFA 2ZJ3A 4H77A 2HMYB 2FDCA 2QIPA 1GFSA 3GT0A 3V7FA 4H1UA 1GA1A 4UTVA 1ZUWA 4WY8A 1E2MA 2YZKA 4OQLA 1K88A 3H1FA 1L7RA 1UMCA 3DAHA 4JBXA 2FEWB 2F1IA 3H2SA 2GILA 2VYND 2WUDA 2XVYA 3B53X 1EFHA 2HIAA 3ZI7A 4PQGA 4H1WA 3LQKA 1EPUA 1JEYB 3T9AA 4MW2A 4QHYA 3U6KA 2BFFB 1ICEA 3AG5A 3LZDA 3RRNA 2OHGA 1LK5A 3L6BA 2MSCB 4FKBA 4XQCA 4PBRA 4URFA 3NHLA 4EO7A 1B1AA 4B2YA 2D00A 4BMSA 2VTDA 1O8CA 4NSNA 3FPGA 1J2EA 4V0KA 4G84A 1K06A 1U6JA 1GQSA 2JPDA 4CR7A 3GL9A 3PDCA 2YNMC 1E5QA 4X8HA 3TLGA 2V59A 1UXHA 2ZJOA 1G4AE 3W7AA 1JSXA 1SXHA 2P1ZA 2R25B 3ICOA 1SD1A 3L92A 4AJEA 2VFAA 4Q4DA 1GVHA 4HGOA 4IWXA 3BF7A 1E3QA 1K3FA 3WK8A 1IXYA 3ABZA 4OREX 4DDTA 4GBMA 3EGDA 2OQRA 3OFKA 4NE9A 4O29A 5J23A 4FB4A 1J8DA 1M72A 1SURA 2H29A 3P19A 5CGZA 3SZRA 3K20A 2YVQA 3PX7A 3OQIB 2PSEA 2DE0X 3NUGA 3V1MA 2WJ4A 3FKJA 1PZFA 4L3OA 2P3LA 1H0SA 5EESA 3FOZA 2X14A 3K0FB 3TQSA 3LQ1A 1HE1C 2W90A 2HTEA 1DNPA 1EBBA 1OHHD 3Q4GA 1Z4LA 4KZPA 3RSFA 1PGPA 4RHUA 4H6WA 4RV9A 3U44B 1XRQA 3IJ5A 3TG8A 2DFNA 2E18A 3FUCA 3L01A 1FUYB 5BVGA 1PZEA 1WVMA 5DHAA 1GCOA 4XWAA 1AB6A 2PUCA 3T6KA 1VIMA 3E3AA 2Q9UA 3BYZA 4G5RA 3IJEB 1TFRA 2XDQA 1Q7CA 3H11A 3QUAA 2E0IA 1H8ED 2WSLA 4HX2A 2BBOA 4HFRA 5D84A 2GJ8A 3SJ7A 2F3PA 5D1NA 1TL7C 2AT1A 1ZXXA 3P0IA 3GLKA 3TDNA 1ZGAA 3P1JA 3TCNA 3TNJA 1F0YA 4DUPA 1P2FA 5CX1A 2H1WA 2VP5A 5K0NA 1LD3A 1DIHA 2EF1A 4HGYA 4BFYA 5JATA 1OV4A 2CJFA 2FSPA 3DWFA 2WHPA 2VSFA 3HYLA 4GKKB 2EG5A 2YVUA 1QCCA 3QEOA 4B8WA 1V3TA 4IDAA 3EQ8A 3FWHA 2EQ5A 1LQ2A 2HQ1A 2Q41A 3NXSA 1M8GA 4MWGA 4CKXA 1YB4A 3K3PA 1E2DA 3TXXA 5ALJA 2O2SA 2Q6OA 2ZVPX 3IPXA 2NU8B 3OJXA 1JR4A 1RC0A 1SBYA 1NW7A 1TU3A 2IZ1A 1NYLA 4YP1A 5C52B 4OLAA 2PRSA 2R47A 4PW0A 5CH3A 2RBKA 4O4HF 4XLLA 5FPPA 1QRDA 2C54A 2XOKA 5JSZA 2FUKA 2NMVA 3DEHA 2VT2A 1QK4A 3G2LA 4G0QA 4Z0PA 1OWPA 1TD1A 3PI6A 4B6QA 7REQB 2WV7A 4X6XA 5AVOA 3VISA 1N0VC 1OX6A 2MSEB 5L8VA 4QWMA 3M6IA 2F3UA 1JAYA 4UOEA 2L69A 2P9BA 4U7WA 4NPAA 1BS9A 3UBMA 4RS3A 1BH2A 4EGAA 1CQPA 3T1YB 3A1TA 2DFVA 4P8RA 2ADFA 3RS4A 2I8CA 2VP3A 2AKEA 3HBJA 1OFUX 1I3NA 1PKXA 4E5YA 2WJYA 4IDHA 1Y3FE 4EP1A 3Q12A 3TQOA 5HVNA 4LMRA 2QI9F 1XVUA 4DR4B 5TMDA 2GN9A 4K1XA 4NFYA 5TT1A 1KGSA 2VP4A 4F96A 1KQFA 3K0SA 1CQIA 3RS8A 1QORA 3BJEA 4WK6A 1M0SA 1UMCB 3U2QA 4ZAWA 1N5IA 3N8HA 3WWPA 4QPNA 3VJKA 1L5YA 3DOHA 2P2SA 3I9NA 4DIUA 4U7PB 4DM4A 2HW8A 2WT8A 5AI5A 4FMPA 2FEOA 2A0WA 5D3MA 1E1DA 4MW0A 1J00A 3IVXA 1Q7RA 1V47A 2J3QA 3MMZA 3TGWA 4JP2A 1M8PA 4L07A 2Z56A 3FFBA 4G2NA 3JWEA 4NULA 1H0KA 2W58A 1N57A 2NX2A 1ZIDA 2O20A 1NXTA 4TKMA 3W3AH 1XCGB 3PDUA 5HQJA 5DEIA 2XXAA 3E3NA 4IKEA 5ALPA 2ZWAA 1XLVA 4Z8YA 6Q21A 2PSHA 1J42A 4EM6A 5KWJA 5GVSA 1IBKB 1GNLA 4WE3A 5CTAA 3TLGB 5LJLA 4LDZA 5EIBC 5FJJA 1PWEA 4DQKA 1QNFA 4PYIA 1I5EA 1G9SA 1A4UA 3QMWA 4LVUA 2Y1GA 4P4TA 5TGTA 5KNBH 2NADA 3NOOA 5BN5A 2JI6A 4TROA 1X1DA 5BN3A 5JJIA 4M7PA 3AF0A 2QL6A 5JASA 4JR2A 3EGDB 4C88A 3O4RA 3WIBA 2C4TA 4HEQA 3W8NA 1XMPA 2AMFA 2ZSBA 3IGFA 1QO0D 2BN4A 4ZT4A 4B84A 1KOJA 4I50A 1U3VA 1YCHA 5C7IO 3QE4A 3E22A 4D9GA 3E1SA 4Y30A 1MJ5A 2C88A 2NZWA 3OIUA 1L5ZA 3CN7A 4HWOA 2J0QA 1JHXA 3ILXA 1IPFA 4MMXB 1KVQA 4M0UA 1TZCA 3MJSA 4MVJM 4WK4B 4EF4A 3VR6A 3ZDFA 2VHQA 4JENA 2HA5A 3CVWA 2VAPA 2E5FA 5BVGB 4FQ5A 4JL6A 3EIEA 3P4XA 4MR8A 1E9EA 1YQEA 1LW7A 2AYXA 3HI4A 1ZKDA 5LMCA 3VZRA 5CFZA 5DSZA 3KG2A 4BE7B 1PL0A 1UKCA 1RHRA 2XDQB 3E0XA 3H11B 3MMSA 2VAXA 5EXSA 4ZV7A 5K1ZA 5HZKA 3QBDA 5B7NA 3V4ZA 5AW3A 3C5HA 1EGHA 2C04A 5EFZA 4H59A 4JI2B 2O3RA 3MTBA 2OOKA 4TT3D 2HQOA 1NWHA 2ZE7A 5K0GA 2WIDA 4OIFA 4HV4A 5CX1B 1FXWF 3R41A 3TBKA 3WQBA 4BLPA 1EJ2A 2QL7A 1FTGA 2OHHA 3LQFA 2ORIA 1PL6A 4NS1A 4OGFA 4X45A 2WHPB 3AIKA 4PICA 2R00C 5DEOA 3FZEA 4RE5A 5CH8A 1R2QA 1NU8A 3WRXA 4E5PA 1NQ5A 4MR9A 2BEWA 1IXRC 4MOWA 2R8EA 4WXYB 5A71A 3EOZA 3QUQA 2BAGA 1QWSA 4FN5A 5DM4A 4JIGA 2VJOA 2P41A 3CEMA 1R4MA 3C15C 2VYFA 2YX1A 3EMKA 4HEHA 1U0BB 4C4YA 4GEKA 2VPIA 5HF9A 3VKFA 3B3FA 3MC1A 4FONA 3KZCA 1HNZB 3K2EA 1T8PA 3F4KA 1G8FA 3SQOA 5JSZB 3GJ7A 1FSSA 1NNSA 4G4JA 4IDOA 4DIDA 3SYLA 3PYLA 1E1RA 3K8ZA 3T54A 3ZDCA 1YOVA 4JJFA 3KUCA 3E9DA 3RU9A 3AY3A 2FPPA 5EMMA 4B3TB 1QFSA 1E3SA 1VBKA 4AJOA 3X1JA 1F2UA 1G9XA 2VWGA 4BN4A 1IOVA 1NUAA 2FMFA 1C9JA 3KBOA 3LPMA 4LHSA 2Q8NA 3JPYA 4S04A 3ILSA 1ECGA 5DM1A 1DMSA 1CEXA 1JAIA 3UWSA 1PFQA 4EB6A 4M1SA 1VB3A 2QLBA 2HX1A 5B5SA 1G8HA 1YCGA 2C3YA 4LZNA 1UZLA 2NU6A 2PV7A 4M37A 3HJRA 3I72A 3NWBA 4P92A 1E3IA 1CQIB 1ZGGA 2FMHA 4H60A 4HTAA 4R3WA 4RPHA 3TMKA 2WILA 3A4TA 4BNJA 1GDHA 2C2MA 1J0BA 1FB5A 2C5BA 2NT4A 4TYNA 1WBBA 3LVRE 3ZH2A 4BO7A 3BEDA 1OYYA 1Y9AA 3BHMA 3OJCA 3KJGA 1Z6AA 3R7BA 3ZHTA 2I8LA 5D3MB 2Z3WA 4L28A 4IDPA 4TRJA 1WBJB 2FUG1 1SHZA 2IOQA 3MMXA 2VP9A 1IY8A 1Z7GA 2XWSA 3I1YA 4K9KA 5DNAA 2O9JA 3ZZ1A 3O21A 4EY6A 5HPYB 5JZOA 4EFLA 3PHGA 4DIBA 5EJ9A 2ISCA 3ANLA 4XM1A 2XXAB 1DMRA 2P6OA 5JQWA 4FP9A 2VJCA 3MRXA 4M76B 3ROMA 1N7IA 2NTEA 4G4SP 4WZAA 1KU0A 4R2WA 1DC8A 1JDBC 3CUYA 3WYNA 4F93B 4E0BA 1ETUA 2CDNA 2M6SA 3RF6A 1ORVA 3MJTA 1X74A 5G0VA 4NVRA 2AMLA 2GLUA 5AKKA 4HH4A 5BN5B 5BN3B 1CB7A 5DCWA 5LKRA 1IK6A 3X1MA 4NNJA 2EZ8A 2I4LA 4UJ3A 2F9MA 4TYPA 4W6QA 1K7EB 1DLJA 3ZHZA 3E48A 3O93A 1E32A 3D6AA 3X1XA 4EJMA 1A9YA 1H4TA 2EDAA 2GJ4A 1ZD5A 4HNHA 3WV4A 3R9XA 3ROKA 3LY5A 1ZISA 4N01A 4I50B 4RPGA 1ISHA 3E22B 1A71A 2OGTA 1D6NA 1BWSA 3T15A 1BJKA 1TTQB 1PDWA 4X85A 2PZMA 4FN4A 1NJFA 3PL1A 5IJWA 5LNK6 1KYYA 4LQ4A 5HF6A 3EVDA 3GA5A 3HXKA 3QX7A 3UJPA 1AKMA 1SC6A 1EK5A 3ZQ6A 4BZXA 4L0CA 4MR8B 1H2XA 5TLSA 2SICE 4DKJA 2H2HA 7ADHA 3IQZA 2XBUA 4MRVA 4C7BA 1NX6A 1POWA 4IV0A 1NF3A 2XQGA 3WZMA 2PO7A 3QWFA 4K9QA 1ZIOA 3WDMA 3LQRA 2J6BA 1N25A 1ORDA 2XTMA 4OEHA 1RIFA 2GASA 4X84A 4PZZA 2QXYA 4TVOA 5FLEX 5IPFA 2FETA 3HABA 1JH8A 2Z4SA 5I4IA 2VDKB 2BDUA 3AEXA 3FPFA 3PPXA 5HOEA 1BGVA 1CJBA 4NEGA 4DV7B 2QRKA 2IF2A 4D43A 3HP7A 4DF3A 3CC8A 4Y2UA 4K86A 5JNWA 2M2IA 5AW6A 4A2CA 4CMEA 3Q3VA 2BEWB 4MR9B 5K4GA 2BUCA 4ZYUA 2ZYGA 3C8MA 3EHDA 5JWRA 3BB1A 1R4MB 1GRVA 4J3FA 5L9AA 1X39A 1UPAA 3HB0A 1I9CA 4F8EA 5EQJB 3QLEA 5IXYA 2AYZA 2Q5LA 1SOMA 4JEUA 4LV6A 2R96A 2D06A 2VSNA 4QXRA 4AKSA 3IEVA 1OIVA 1F6BA 1EQAA 2HAEA 2ZIAA 2I6QA 3EDYA 1OZAA 3ORSA 5K6RA 3CKYA 4HNUA 1W0KD 2PKQO 3EGOA 4HAIA 4IBOA 2FF7A 1G16A 4L8FA 4QEZA 5D7BA 4M8SA 3WKCA 3A6PC 3FJOA 1OFHA 1SOWA 1UDXA 1YOVB 3E5MA 3E7XA 3GJZA 1GSAA 1W94A 2JNWA 5C1IA 3HEMA 3JQQA 3QLJA 2FPPB 4GMDA 4X6UA 3A26A 1P3Y1 2AH5A 1D2EA 3AC0A 4OH7A 4XWTA 4ER6A 1G5PA 4MQ6A 1PQUA 1F2UB 5AOVA 3CRW1 3GFRA 1E0JA 2B9VA 3GRUA 5TVKA 2NPFA 1BYIA 3IO3A 4EG6A 2KQUA 2B0JA 4G8CA 2Z5FA 1SIUA 3ONEA 2P62A 1RAFA 2PXCA 3G0GA 5EINA 1P72A 4EB6B 1NYQA 3V33A 3RYIA 3V4LA 3W7BA 3BK7A 3GI1A 4KEAA 3ND8A 4QPPA 1KI6A 4R01A 5C5EA 2QYSA 2JFZA 3HGTA 4D57A 1TUIA 1TT5A 2NU6B 4TN5A 3P8ZA 5THQA 3NYRA 2VEDA 3HCFA 3R4VA 3ONFA 4Z5XA 3VKUA 1TAQA 2OY0A 4GZMA 2VCHA 5KTOA 3DSRA 1CP3A 3O94A 1B8UA 1NXSA 3F6BX 3RHSA 4ZU1X 2Q3FA 4RCZA 1U65A 3A58B 1AN9A 2WT9A 1TMKA 1OY1A 3M4ZA 4BQOA 3TG2A 3J80A 1GARA 4NXMB 1XV5A 5KX5F 3LX4A 1JQEA 4J0JA 1AQNA 4Y8VA 4IJWA 4COKA 4AO8A 2GDJA 3ZHUA 1XEWX 1GD1O 1LRKA 1K63A 4WZAB 3G2PA 4QSHA 4CTJA 4LMAA 3WAGA 2JB9A 2LKCA 2ONZA 4LJLA 2V0GA 3HUDA 1RJDA 5ALDA 1A88A 2BKAA 5AI4A 2WUFA 3ZYZA 3ZWPA 3N2LA 3S8MA 5ALTA 1GSIA 1DV1A 4GLLA 4N5LA 4FBGA 4X54A 3P4UA 4Q4LA 1XZCA 4BASA 4OLBA 1Z15A 5TARA 3LKBA 1VIYA 4YJKA 2WIFA 1Z2CA 1FFHA 4CG0A 3ERCA 1U2SA 1HQDA 3CS3A 5IAOA 3H2IA 2NUTA 3A9VA 4OTZA 4YUWA 2FPLA 3ZWQA 1E5TA 1G7TA 2XWQA 1Z36A 2WTMA 1YR8A 4LC9A 2V55B 1GR0A 3WHIA 4B6OA 1PVVA 4GDFA 1CY7A 3EGVA 4EKIA 4GRIA 3I8XA 3O4JA 1ECPA 2OCYC 1ZU4A 2YCLA 5D87A 1KDVA 1FJXA 1I1OA 3NP7A 5CK4A 3MSXA 1S96A 1Y82A 2EV9A 2OXCA 4GM1A 3PGJA 4YDRA 1N6OA 4ALJA 1J8MF 4IQ4A 1CUGA 3EGIA 2E55A 4EHDA 3KQKA 3GCGA 1T2DA 1G21E 5B1EA 3N2GA 2G4CA 2CE7A 1J0AA 4F5DA 3KBBA 1PSWA 1U9CA 4LWQA 4Z54A 2IFTA 3S5JA 2GSDA 3D4OA 4EITA 1YZNA 3HUUA 3PE3A 4U9UA 5CDSA 4BFZA 3WB2A 4IIVA 2AMJA 2QVXX 5BV7A 2FQ1A 1I24A 2VOEA 3ITDA 2OT3B 1YOBA 3BE8A 1T5TA 3GX1A 4RJTA 3UZUA 3NBYC 3C43A 3EZ2A 1IZ9A 4BFUA 2D6FA 3DCIA 5LU8A 2J8ZA 3BK2A 4J7AA 1AKTA 4NBSA 3BCRA 1CUXA 4G5XA 5BMVF 3UXEA 2R4QA 3CPHA 3PTZA 4FINA 1SN7A 3QEKA 3WLMA 3CO5A 3ZU5A 3ESZA 1GWNA 2H7YA 5AVWA 2N0SA 2WSBA 3L9XA 3LXMA 3OZWA 1FTQA 4LDQA 2IH4A 4N8SA 2QRVA 4M0EA 1UBHS 2D7JA 2DR0A 2A9OA 3FXAA 4BQRA 2C7RA 1QRSA 1N34B 4WAUA 1TMGE 1Q7GA 2EKZA 2VZ9A 4M0CA 4JP1A 2DWQA 2RHHA 2QTNA 3I12A 3RQSA 5AP9A 2FSVA 2IXEA 3AKDA 3DXZA 1SKBA 3EZ7A 2BI7A 3CUVA 3U3RA 4W99A 1G291 4EKGA 1IWOA 3NRCA 1CIJA 2JVIA 2P2NA 3MWKA 3EMDA 4PRZA 4H4EA 5ESXA 5K3DA 3UJ8A 1G59A 3RYIB 2FY8A 2Q45A 3HBAA 4PG5A 1KI6B 1N2XA 3OZGA 3ZCQA 5JCZA 4WLEA 1X14A 1ZESA 2WYWA 1TT5B 4LOKA 4MMZB 4Q7LA 3WLFA 1JECA 2QJTA 5LBTA 4YO7A 1DVRA 3SM9A 2VNJA 4G8JA 2EDCA 2HIMA 4WINA 3IEMA 2ES4A 4MB6A 4LZPA 3DE3X 4DADA 2NVBA 2BFCA 4S05A 2JI7A 2BGUA 1Z6XA 4MRSA 4RQBA 3WIEA 3GFGA 3WLQA 1I2ZA 4R98A 4LXIA 3PLAE 4P35A 1CR1A 2I7TA 2FXIA 3PQ5A 1QV7A 4E5SA 4ZDWA 1AMNA 4OHRA 3CRMA 1BWRA 3ZXXA 4F5YA 4MNTA 4KQWA 4TLDA 1N1GA 3SJUA 4K8OA 3A4IA 5EE1A 5BR7A 3BB3A 1CIVA 3KXKA 3CX7A 2VNIA 4RVHA 4B44A 4HAVA 4LXHA 1U3FA 2X9VA 4ARIA 5B6PA 2QRNA 4N0MA 2PMEA 1GPJA 2ZRFA 2PUGA 2AZXA 3S7TA 1GG9A 3PX2A 4PLYA 4UKDA 4W82A 1Y6GA 4NCAA 2X0JA 2EJTA 1OREA 1HDZA 2R5NA 1YZQA 4UNSA 3DEIA 4KVFA 4CQJA 3G1UA 4GUAA 1XELA 4XH9B 1W2HA 1NDHA 3AM3A 2QR2A 3QOYA 1IIBA 4GFDA 2R9VA 4CIYA 4CU5A 2QAGC 1O54A 2EZUA 1P2VA 3RBAA 1HQKA 2Y76A 3JRXA 2BGRA 2I1WA 3DO8A 1AUPA 2NUTB 1ZFNA 4RLFA 4TWAA 4XDZA 8OHMA 1VMKA 1KDPA 1T1JA 2YXDA 5D7NA 3GFTA 4O1MA 3V8MA 2H9YA 4DEYA 1NXVA 1DRKA 2BFOA 3JD4A 2P9TA 3JATB 5FCDA 4GI2A 3B8HA 5L6LB 5TY0A 4AJKA 4L74A 1JPVA 3NETA 2X2OA 2WWYA 1EDBA 1EJ6A 3PKIA 1DKLA 3BICA 3GQBA 1KEPA 1L1RA 1NBMD 1P2GA 1K5PA 1ZPDA 4J2HA 2P91A 1LDMA 3AXSA 4J0DA 2ZUTA 3P9IA 1BHQ1 3VVMA 4EHKA 1PG5A 2OOSA 4YRDA 2Z5LA 3RKUA 4YPOA 5CG1A 1M6EX 3N2GB 4KOAA 5FUYA 1ML4A 4G5OA 1QQ5A 4GRAA 3TNFA 3GFSA 4L50A 3WGLA 4AZWA 4BN0A 2QP4A 3ABSB 2HJVA 3RAGA 2WKSA 1N2ZA 2Y67A 4CR8A 2BIFA 1T24A 3GLFE 2FQWA 5CFOA 3LQYA 2JARA 4O1IA 3JAMA 4WECA 4YV2A 4BJ3A 3F5QA 3A6LA 3QSYA 4BVEA 2G25A 1JKMA 2BOVA 3NTQA 3QMVA 4PM4A 3AUUA 3UTDA 4GX1A 4UTZA 1H0HA 3LHDA 2BVNA 4PC7A 1UADA 1IWPB 2RKBA 3PIDA 4BTEA 1ORWA 1S8NA 4B9AA 3CX8A 2ZJ5A 5IC4A 3CM0A 3A37A 4JGGA 5JO9A 5B3KA 4BGVA 4R84A 1T91A 2QRVB 3ZGYA 2R8BA 1G0NA 3JCZA 4RH3A 2OVFA 3PQ7A 3UC9A 4C5BA 1EWVA 1VG8A 5JLAA 5LP6F 3AINA 3F49S 2KB0A 2Q1SA 3V1NA 1B6SA 2Z0MA 2J6HA 5CT9A 4OUDA 4AMZA 4ER3A 4YLYA 4OX9B 1G1MA 1T4MA 2D54A 5JS8A 1GL3A 2EQBA 1GCAA 3ZIUA 2CHQA 2O8FA 1KFCB 1X8KA 3PXAA 3MTDA 1A8SA 3OTGA 4IQFA 4MTCA 1TX4B 3ZDAA 4B3SB 5HP4A 3P20A 1F6WA 1ZOOA 3KDPA 5KU7A 4A7PA 1NONA 1Z0JA 3AMVA 2ZRKA 3M4XA 3TJRA 2ZE6A 2FR8C 2WIBA 2YHAA 3FA2A 4JD5A 1DTWB 3TZEA 4ZYYA 3DEKA 3F46A 1Z62A 1G3UA 3AT1A 5COAA 1KRXA 1LGYA 2IU3A 1P4SA 1PQPA 4BV2A 1NE2A 5B64A 5AVVA 3D7MA 2X86A 1MXHA 1X6VA 1YI0A 1ZX1A 3M9WA 4GSKA 4TLMB 4Q5IA 5F2KA 1MUUA 2BFCB 1Z6GA 2BFNA 5B1SA 3VZDA 4LJAA 3SYMA 2PYIA 3B1XA 1PJLA 3D1LA 1LS6A 2P9FA 1SU4A 2PGXA 2QUIA 3KDSE 3M6VA 5KOJA 4PG6A 1N1MA 1KVSA 3WHLA 3OJOA 4LSGA 1YL7A 5TEWA 2VXYA 2GVZC 4KI0A 3E18A 3PXUA 3JQ7A 1LU9A 1P81A 1XMJA 2PS0A 3DZ8A 4EUSA 2VNHA 3KK0A 1XNQB 1MAHA 4BVBA 3CF2A 3DEFA 2ZS8A 2BM1A 5J4HA 1V95A 1WXDA 1LB1B 4Z0HO 3T7TA 4UHCA 3TDKA 1QLHA 3LQ2A 4YJHA 4JH0A 4DNOA 3VGPA 5FO0A 4ZYZA 4RJ2A 4ZANA 2PKEA 5CNIA 2A67A 1XCLA 4R7GA 3CZ4A 5DXAA 2K7FA 4C43A 1F2DA 1E9FA 2V98A 3I34X 4QGFA 4L5JA 4ZU6X 1C3LA 2EARA 2H0RA 3OTOB 2PWYA 3C5EA 5CB6A 3LY7A 4K2HA 1UBLS 2OBXA 2EP8A 3ZJUA 2W0SA 2I4NA 4TL9A 4K9OA 4HZGA 1RYYA 4FFLA 2BHNA 2HU2A 1CLUA 1X92A 1ONBA 3E2PA 1NQUA 3FPSA 4D26A 4RKFA 3KLNA 4N9QA 5KOIA 3LDAA 4OAPA 3MUNA 1FYDA 1QO9A 4Z86A 1WCWA 2H2IA 3GQBB 4JFAA 1TU0A 4LKOA 4MW5A 1XQ6A 4OAOA 4GO1A 1FMJA 4ALIA 2YWXA 4XIYA 3TTSA 5JHHB 3Q3HA 1HDYA 2IXAA 3WVNA 5BV2P 2QYHA 2JFBA 2OWEA 4JLUA 1UFRA 3OIWA 4KAAA 5AJVB 2I2WA 4B34A 2P11A 4BKPA 4TTRA 4OSOA 1LNSA 1KIMA 4QUHA 3BVPA 1XCOA 5TVGA 5CVUA 1AY0A 3QVXA 1HM5A 4UBNA 4YXFA 2XWBF 1NP7A 2FEPA 1W0CA 1UXIA 4O4IA 1KSFX 1Y7PA 1MAAA 1PBNA 4LCBA 5GZ3A 2O7RA 5THKA 3ZQJA 2PWBA 4RZHA 4DSTA 5F2NA 1BVYF 1Z4KA 5CFQA 1Z82A 3PDHA 5EXPA 3EOBI 3VZQA 1DT3A 4BO8A 4OSEA 2ORVA 5LYJA 1EB8A 1SVWA 1ZL0A 1MXFA 2LRHA 2W7TA 3KKEA 3R9WA 3VNAA 1KMIY 1PGOA 2ZE5A 1VMAA 4E4YA 2CLDX 2F64A 2V8BA 1GPNA 2J3LA 1KAEA 2RAVA 5B1HA 4CEJA 1A76A 3I9JA 1AQIA 1OX4A 2IPAB 2W6NA 4GXNA 1VL1A 4FGUA 3RUFA 4YV7A 5F9MA 3PPIA 1U1IA 1WQ1R 2LW7A 4MIEA 4F97A 5JOQA 1DBVO 1NL3A 5C7OO 4OUDB 4TMWA 5IUKC 1DKMA 3IDAA 4HYTA 3ZXYA 5J2UF 1Q1NA 1JZSA 5AQ1A 5TNXA 1RBZA 1SCUA 1Z2PX 3B6KA 3C8DA 4HEJA 4C4SA 2O8FB 4UUPA 3PRHA 3CINA 2V3WA 3AK4A 3HDTA 3KUUA 4KLRA 2VHCA 3L1IA 2F7SA 1SZDA 4FHGA 3RJZA 1JDZA 1XZJA 4GSLA 2J9XB 4Z0NA 2V9CA 2WYUA 1E0AA 1TQHA 2NXNA 4JVSB 1JIVA 3OD5A 4M9SA 3EF0A 3JYPA 5DSXA 3FPKA 3Q0IA 2PMKA 2P75A 3SFVA 2GARA 2QTTA 4RA6B 4TMKA 5KQMA 1KZYC 4EKDA 4CF4A 4YMGA 2B4RO 3KPWA 2XT6A 1E6UA 1XDUA 3IT2A 1UJ4A 1SHJA 2CSUA 4G0OA 2I2FA 1ULSA 5CLGA 1M34A 3NHKA 3OCUA 4JA0A 1QKKA 1SKUA 3JPWA 4YH1A 3FHJA 1CHDA 3JQ7B 1NMQA 3NUZA 3SN6A 1C8VB 1H4VB 2V4UA 4X7MA 1E1QA 3DTNA 4RXTA 4R9NA 5I4CA 5A0TA 2NWQA 1TLLA 4GZ6A 4Q7QA 4JYCA 4I5FA 4MITA 1T1EA 4BB6A 4RYDA 4Z0TA 4DLAA 4LGCA 3WHPA 3WB0A 5HUQA 2AF3C 2H31A 2O2ZA 4EPVA 4BLRA 2YIJA 3W90A 4YJHB 1F4LA 4JP8A 4QASA 4BJ1A 1LI4A 1Z0DA 4GQBA 2G3YA 3W8EA 4L2IA 4B09A 4DFDA 3W5BA 1PLKA 2Q6LA 1O9BA 2W2LD 4AJ2A 3ORQA 2AGVA 1FS4A 5K05A 2HB6A 4P86A 5GJWC 1LPPA 2IOYA 2R11A 1VA4A 4CRWB 1AK1A 1SG0A 2BGKA 1QVAA 2ETVA 3A7EA 1NW5A 2N1MA 3KETA 4OU4A 2P67A 4UPDA 1XYGA 2IUUA 1DG9A 3ZEIA 3Q8MA 1CB0A 2AQ8A 1HUQA 2Y6VA 4QLAA 3AF4A 2G5CA 2G88A 4MCJA 3S2YA 1M1NA 2PZEA 1ZONA 1FP1D 2C8VA 1CJUC 2K2WA 3B3GA 3LBHA 3IQGX 4IY1A 3V4FA 5EMJA 1JBKA 2NVWA 2PJZA 2ZB3A 4OI4A 1FXSA 5KWIA 1RXVA 1T3GA 4JQCA 3N2KA 5JD3A 2C4NA 1M1ZA 5JT1A 4Q7MB 4P3PA 4XB1A 5DKFA 2JD0A 5BW4A 1VE7A 2Z04A 2I66A 2KSQA 4LYFA 2WU4A 1L5KA 4DHWA 2QRPA 2VK4A 4QSMA 1U28A 4Y2XA 5G4LA 4ETIA 3VI4B 3QEJA 4GVPA 4DG9A 4GQIA 1NQOA 3LUHA 1DWOA 3EQ2A 3IUMA 2AOTA 2EWMA 3JSXA 3NGXA 4BNIA 4O4IB 4H0CA 4CCSA 4US2R 3F7TA 5DN6D 4BNMA 3VU9A 1ULUA 1L5NA 1L4YA 3FFXA 3UATA 1SCNE 1OSNA 2GN1A 2HTFA 4MVYA 5CDFA 4JROA 3VNBA 1U8AA 3S1AA 4E88A 4XQ9A 5LYJB 2EZTA 5KVVA 5AK3A 3QHQA 2WAXA 5E7MA 4BX2A 1KU6A 5GPBA 4HH0A 1AV7A 1P4AA 3VPFA 3FPBA 3B7WA 3KXIA 3C3XA 4CEJB 1M74A 4GMKA 1IMOA 5BNWA 4TYWA 3A1CA 1OX4B 2TRSB 2ZWMA 4B71A 3TEJA 1I51A 2QQEA 1R7RA 4G0MA 2BUBA 2WJPA 3OZCA 3MJEA 1RMYA 2XZTA 5HTKA 4DB2A 2Y1LA 3TXYA 3L8FA 4EPYA 4ZGBA 2F9FA 1PEKE 2XYRA 3IYLW 4N7BA 5AUNB 1SCUB 4UZSA 5JDCC 4TZ0A 5FUXA 3VPGA 2PU7A 3OCXA 4J8PA 3PLRA 4M9XA 4MIYA 4EW2A 1JFSA 2WJIA 1NSYA 4W8GA 4D3XA 2IE8A 1AUOA 2ZSEA 2VPPA 4TXMA 1PL8A 1E2EA 3A3OA 3BE5A 3D2BA 2E49A 4H6PA 3HJTA 2CBGA 2Z8XA 2JFGA 1LVHA 3L84A 3ANTA 3WX0A 4A2QA 3W5IA 3AF5A 4O8ZA 1IOZA 4E2FA 3MUOA 4GYWA 2IH2A 4UAVA 4C0LA 3GC6A 4DMMA 1E60A 5J4KA 4PYRA 3VSEA 4ZOLB 5AW8A 4CT4B 2ZCVA 3PPYA 3VR0A 3TIVA 4OQ4A 1M34B 5SZHB 3ZBUA 2ZUVA 3G0HA 3HA5A 2G6BA 1CDOA 3QG5A 3A9CA 2WHEA 3CLRC 2LIPA 3FI0A 4RX1A 4XSVA 1A5ZA 3BD8A 1DOHA 3CNEA 3JYOA 4QUDA 1YA4A 1C0EA 3MB5A 1GCIA 2Q5FA 2IIBA 3IX7A 3KZXA 1I8TA 1YZHA 3ZU3A 2H00A 1KOFA 2FF5A 2Y0BA 4PGHA 2D0OB 5I3CA 2XCLA 5NULA 3AERA 3QIVA 3FGPA 5T41A 2IBMA 1NNLA 4L2IB 3S8EA 3L4JA 2VF7A 3L7IA 2ZR0A 3VVCA 4DCMA 4H16A 3N8NA 5JLJA 3C39A 1AQLA 4A10A 4FHDA 4JVNA 2G0NA 4KBFA 3PZBA 3EODA 3TR0A 4QKQA 4QLBA 1Q1AA 4OGLA 2GUWA 3ZDXB 5CITA 1JJBA 4BAUA 1XQYA 2CLKB 4UPVA 1MJGM 2FX2A 5LYYA 1IJEA 4HL6A 2H0QA 1GZUA 1L5MA 4DA8A 3K6KA 4ON9A 3DEZA 1M1NB 2IY7A 3A1SA 1HL7A 2FUG6 1ZEMA 3MF4A 4PQYA 3V42A 4D7AA 4MJLA 2HR1A 4YJ2A 3AR9A 1CE8A 2LDBA 3A4VA 2OESA 1WU7A 3HN6A 4QU9A 1V8OA 3FNRA 3ZG6A 4HGNA 2C58A 3X0DA 3AP2A 3N2KB 4WJZA 4R40A 5BUQA 1WXHA 1UIRA 1R4NA 2O2DA 3VR3D 2YY6A 3RJTA 1OFVA 3RJMA 4YGXB 3SAJA 2YXNA 1CY6A 3L0DA 3S29A 3WY9A 4DV2B 1N3BA 2A3NA 3UV7A 3HO1A 5EPOA 1GNQA 4UCXA 2OA0A 5G3ZA 1IC6A 1AM4D 5GJBA 2TS1A 1EVQA 1ORIA 4YI3A 5F5XA 4OY3A 4MKZA 4U2KA 4LHYA 4GZLA 4TMFA 4Z7OB 4M53A 1NYTA 2AOTB 5C37A 4MRAA 1ONNA 1NXWA 2X4GA 1IUPA 1QB7A 1UR5A 4RTSA 2Z5VA 3HXOA 2UZ0A 3G2QA 3VU9B 4DZZA 3LECA 5HIMA 3PFHA 4A0HA 4XE5A 1UPUA 5HX7A 1SBHA 3T1HB 3BRSA 1Z5NA 4Q03A 3S1AB 4L5AA 4BP1A 1VTKA 4GBGA 1QV6A 2CL7X 2JIDA 3FDZA 4KCGA 3G2OA 2K4MA 3DAGA 1C8KA 2CXOA 4U8GA 3TNDA 3SY8A 5KIAA 3GBPA 2IYEA 1GILA 3MJ4A 1KL7A 3HN2A 1JF8A 4Q39A 3WLIA 4YAKA 3EZGA 3HY6A 2AG5A 5ED0A 2XVZA 4GOLD 4ESEA 5IWAB 1T3HA 5CT6A 4ZTUB 1W46A 2HI0A 1MW9X 1KBQA 2P79A 1E1CA 4K9LA 5K3EA 4IIHA 1B0UA 3NHAA 1K92A 4NEQA 3J81A 4NP6A 4YRIA 3KU1A 3AZQA 3OO0A 1IMJA 3SEAA 1E2BA 3FG9A 4HFJA 1WUTA 2O7QA 3ICVA 5EJGA 3T5GA 1A8HA 1QYIA 1XRMA 3DFKA 5BQPA 5A4AA 1DJLA 5CIYA 1N9GA 3V2IA 2R8OA 3HXQA 2OLJA 2H07A 2ZIVB 4Z4IA 1LZLA 1B76A 4I8XA 2B99A 4OXXA 3UJ6A 2ZRPA 4EVSA 1LKZA 1DKRA 4A91A 3E6AA 4RCVA 4K28A 1PV4A 3KQMA 3BD9A 4KLAA 5ITWA 1HT3A 2VH1A 2XCQA 3ASYA 5HUHA 3QWBA 1BIFA 2XA1A 2HEGA 3RHTA 3B1FA 1WB6A 3CYFA 1ECCA 4F9FA 2RHMA 4MW1A 5DVZA 1AUVA 5KQGA 2C00A 2Q3DA 3C7AA 3G88A 1XQ1A 3HJBA 1R8SA 1ZD8A 2H16A 4ENPA 3T9BA 5KVCA 2XZDA 1L4NA 2V7XA 3FUWA 1CVRA 2Q5CA 4KQKA 5IASA 2ECFA 1EBFA 3HDYA 1G8KA 2WSSA 2IIQA 2JCBA 3T9EA 2XNHA 3UWPA 3JZAA 4J9UE 1OT5A 3URMA 1KTVA 3T41A 3X44A 1EVZA 2W8BA 2YWCA 2XB9A 1G42A 3AERB 2BBSA 3QFFA 1EINA 2V7EA 1DKNA 4I1PA 2CVQA 2JGNA 3F6EX 3UJDA 1GZ3A 3W5HA 2WTNA 2ZJ4A 1P0IA 1NJ1A 2B7LA 4GEGA 2ZRLA 3QKWA 3F5FA 1M2HA 1OI7A 4G67A 3IDZA 4AWXA 1POXA 3DH0A 3BRCA 1YB7A 1PQYA 4I50F 1BO6A 1MVLA 5B4UA 1E96A 1G21A 4DLKA 1RYHA 3I04M 3LDUA 2Y27A 3SQLA 1FJGB 1ACJA 1THZA 3G2MA 3ENZA 4M6WA 3RIGA 3HLKA 4YJ2B 1F8XA 1Q5PA 4U7HA 1CE8B 3IKJA 1KI1A 4Q02A 4B5LA 2W6MA 4DJJA 5FUQA 3O8RA 2VHJA 2RHRA 1EX7A 3HH8A 2XAUA 2P77A 3JYNA 4QYSA 4DPLA 3V7YA 4GKJB 1CY1A 1R4NB 1XZPA 3A4YA 3EH2A 3H1TA 3NTRA 4G85A 2ILTA 4BC1A 3LRPA 1YKGA 4DHEA 1X7XA 3TI7A 1U7WA 1KJ8A 1L4GA 4Q3AA 4XYBA 4AZVA 5KYKA 1IQUA 1EJBA 1WZIA 5IWCA 2VJAA 5A2QA 5ALQA 1Z07A 3ZXUB 2FXVA 4B3IA 5BNTA 5IM4A 4GL2A 4MV9A 2C20A 2WTUA 3WL5A 1H42A 3WO0A 4RVDA 1LLUA 3VZSA 2CNLA 4WESA 1IJKA 1KYZA 5M34A 5A7GA 2Q5OA 4HBGA 5TJ9A 3Q15C 3ZQKA 4E6EA 4QTYA 1HWYA 1WZEA 1J0DA 2J85A 5FULA 3N3AC 4X63A 2QQ5A 3FDZB 3HA3A 2I03A 1IIRA 3LTNC 3HJUA 1GY8A 2HJGA 3NG1A 1XMSA 1GL7A 2J9YB 2O4UX 2P6PA 3SHFA 1RZRA 2HSWA 5LQKA 1KEEB 3BREA 3GGPA 3KLMX 1GLGA 1H2YA 2OGWA 2XOKD 4KYVA 3LXXA 4WXEA 3O6VA 4CLXA 4Y6OA 5ALLA 5GZ6A 3WMXA 2JGLA 3NNDA 1E0DA 1E1CB 4NG4A 1ZI9A 2MSWA 3FRIA 4DIOA 5K8IA 3STYA 5SYAA 3PXGA 1XU9A 3M1YA 1RXEA 3NVMB 3OMWA 2CDAA 3BQNB 3KAPA 5EC8A 2LXNA 2DX7A 2IHNA 1KOGA 3QUBA 1J1IA 1JSCA 2OEPA 4KHPB 2EBWA 4F1WA 3KT3A 1E0KA 3OUUA 1T0UA 3I5YA 1ZQ9A 2R66A 3IELA 5FPSA 1N9GB 2JAPA 3FYCA 1O3YA 2GF0A 1ILWA 1FNDA 1JZTA 1XQXA 2B4YA 1BKSB 4FMCB 1RT9A 2N42A 2NTNA 2ZEJA 5JZBA 1Y6JA 3GP5A 1YDWA 4OJTA 1Z6YA 4B6SA 3AP1A 3ZOZA 4QXMA 4MPJA 2J3DA 3V4PB 1E6WA 1JMKC 4DAEA 3CKMA 3VBCA 3P52A 5FTMA 1R5NA 4LTNA 1Q0SA 4MVCA 3Q1KA 4CFSA 2X58A 4XD7A 4L9RA 4LOLA 4OJMX 3MTQA 1BAPA 1N2SA 4O4LA 3X1KA 4QWWA 3GFQA 2EJVA 4XD2A 1MQ9A 4MAFA 5KKNB 1TYCA 4TS9A 1ID8A 4A2PA 3LBYA 3NHJA 4D4KA 3KQHA 4YNBA 5LMUB 4UULA 5SZIA 3W5AA 5C53B 4OM8A 4W7SA 2W8BB 5L7YA 4YP9A 2ZYIA 1N9ZA 3FBTA 2O0LA 3H1GA 2JKVA 4TV9A 3RRXA 5LD2C 1IB0A 3F74A 3FMFA 2MDTA 5BUSA 3ECSA 1E9RA 2NAPA 1BVHA 1XXHE 1DQPA 3A3PA 4TWBA 1UJ2A 3CBGA 1XTRA 3GCWA 3QOFA 4X5OA 4CFZA 1Q17A 4B6RA 5AKJA 1WUKS 1GYRA 3K1JA 3SS7X 1UC9A 1GV1A 1JT9A 1V1MA 5DCUA 2CLIB 4WBNF 1DFIA 1NRIA 1G21B 1SNYA 3NIDB 2VH2A 3SR4A 2QORA 5KHOC 3D6UA 2PGNA 4M6WB 2NUAA 4B31A 3RVLA 4EY8A 1MW8X 3WRYC 1QK5A 3L4BA 4B2PA 3GLFA 1G63A 1Z73A 2YASA 5F5LA 4C6TA 2OXRA 4DC0A 2ZCJA 4G07A 2Q4OA 2WKRA 2QW0X 3RSQA 3OJLA 3UV6A 3ND9A 2VPZA 1FYFA 2NO4A 2P68A 2WPDA 3IUPA 3JXEA 4X9XA 3ZDRA 4BEJA 3REQA 2R6HA 3SX4A 1KYQA 3IMFA 4LFCB 3NH9A 3PHHA 4OV6B 1X7XB 4IKOA 4PSKA 4RBNA 2XBLA 1OT3A 4NJEA 3A9RA 1L4MA 3ZDQA 3KSBC 3NHRA 3G5TA 1BXGA 4BVHA 2OBNA 1GTMA 5EP3A 2WQ6A 4F5WA 4N18A 2FRDC 1FDUA 2IYZA 3NYQA 1NDUA 3O2SB 5DWQA 1ZR4A 1M6WA 2I1LA 1Z2AA 2IZ6A 3AXTA 4HWPA 3G0BA 4WESB 5FKJA 3WWDA 1RXSA 2V6MA 1HPLA 2YBEA 2AHOA 4LK3A 3WICA 5DM60 2ZU6A 5CM2Z 5JZ9A 4B6JA 4U0KA 4U2FA 3I58A 2ZGVA 1U2GC 2VPXA 3OEHA 3QEMA 1NLUA 3RUCA 3KYIB 3IKTA 3H8WA 1CDZA 1NZJA 2AJDA 1FU7A 4NC9A 4WOKA 3M3HA 5H3LA 2GGSA 2WOJA 1EP2B 3B9QA 1PGJA 2FB9A 3G0OA 4B7ZA 1P7VA 1JKIA 2Z2IA 2YVLA 4YIKA 3BXPA 2YNMA 3RK4A 4A0RA 3EBPA 4KW7A 3ZWAA 3GEHA 1BJTA 3L0IB 3QFTA 5A4MS 4DR7B 2O06A 2K87A 4P4SA 4PC3A 3FHLA 3WLOA 3NM4A 3TPFA 4KQCA 2WWIA 5EHGA 1DG1G 3AYXB 6GPBA 2XPCA 3A3KA 1TA9A 2DBQA 1H9AA 1SQSA 3D9QX 1A4IA 3KKQA 4A8PA 1CUCA 1XD9A 1JA9A 1NVXQ 2H6EA 3I0ZA 3I4CA 2CYCA 3DE2X 3JQRA 3LPAA 5DLQC 4D4LA 5BOSA 3Q6IA 4IFBA 3SC6A 3QK7A 5AI9A 4G56A 4DTCA 3DBIA 2J7PD 4Q1EA 3F90A 3OWOA 2UV8A 4HQKA 3F6YA 3PNYA 4M54A 3LOPA 2G9ZA 4UAGA 2WWTA 5MN4A 1ENZA 1IY1A 1ORRA 2NUBA 3RYCA 2C7BA 3MCZA 5ENDA 2B94A 4F3TA 1E2PA 3HVUA 2IUYA 1AG9A 1J20A 4KYTA 3KKOA 1N2IA 3QVGB 4XVQA 5SV2A 1CCWA 4O4LB 2WJVA 4KQ6A 1HQYE 2FGJA 2P4HX 1SQ6A 4H7EA 4PBSA 5AVZA 1LVGA 3N8KA 4HQ6A 2CD9A 3LL4A 3ZDEA 3FGZA 1NPDA 3NJ4A 4CG1A 4DWVA 3UC5A 3JTEA 3AEYA 3CLVA 3GLIA 1RM4A 1PJ4A 2BLNA 1E1MA 1FX0A 5F7JA 1NVBA 4NZOA 3R40A 4DV1B 1TM4E 1Q95A 1NQWA 4GYKA 4BLSA 5A5DA 2CHVA 2ZYAA 5HZHA 4TV9B 4OVKA 5SYMA 2WD7A 4K6KA 2Z6UA 4QGBA 1CWUA 1S4MA 4RTMA 3SJCA 2IV2X 4HLDA 1MV5A 1VYHA 4MVJP 3S1LA 1FFCA 1FDTA 2ZAOA 1YBFA 2J3JA 3M5DA 3FUUA 5EVJA 4JODA 4CODB 1X7YA 3PIRA 2QY9A 2UZAA 4YBZA 3ZCUA 5SZKB 1V1MB 3DXFA 1Z0IA 1UK6A 5BRNA 1FDSA 5AKIA 5ALVA 3HGMA 5DK4A 2DCUA 2GT1A 2NUAB 1T5BA 3I09A 4TMZA 3GLFB 4ENRA 1O58A 4C6TB 3CHYA 1JNYA 1HNWB 3OP4A 1IM8A 3SYTA 4UXIA 1QFJA 4P34A 3KXPA 2WIJA 1RAIA 3NQ41 1JS1X 4LXUA 3REQB 3W9YA 2ZI7A 4MULA 3VPSA 2HMTA 2XY4A 2IEAA 3MFQA 3R0ZA 5L95A 1DAGA 1F1JA 3I2YX 4NJEB 5CW2A 4WOJA 4AWAA 2VNSA 1KR2A 4C3VA 2GHIA 2BMFA 4CLOA 2Z43A 4Y2TA 3LT4A 2DPGA 2NV6A 4GL4A 2AMVA 1MFZA 2VKTA 3E15A 3IR6A 3II6X 5IARA 5HA5A 1S0UA 1W9MA 3OFND 4IZ6A 5BSUA 2PRKA 1IOLA 4EH1A 4BNHA 2YY7A 3KTOA 4EHJA 3W2HA 1ZVMA 1UP7A 5DGDA 1BA2A 4U7GA 4AN4A 2O8NA 1SEVA 5KQLA 5D1HA 1CF9A 1DOAA 3RE1A 4BO6A 5JIBA 3FFWA 4U2EA 4IHQA 4OPMA 2WYVA 3G2NA 1ZKMA 1PP4A 2B82A 1CSEE 2XVXA 2YUIA 3PNPA 3QEMB 4I14A 4PX3A 4AJPA 1YDEA 2TMDA 1DO2A 3PJDA 4FCTA 2ECOA 3DMFA 3NVAA 2X6RA 5FWAA 1CUFA 2HA3A 3N70A 4L5BA 3K2IA 2VCYA 3L0BA 3U4MA 1B43A 3TLZA 3UQZA 1Y4DE 1I01A 1O89A 1EQUA 1RLJA 1RVDA 4PSCA 5JEDA 3PI7A 3W5SA 4P4SB 3O2JA 4D4JA 1VL8A 1UDBA 2CLOB 2B1GA 3ZE9A 1I1NA 1ATZA 1E5VA 2JAHA 4Z1OA 3NXKA 4X62B 1W25A 3TRHA 1HDXA 5B2ZA 2R1ZA 5BOSB 3LUFA 3SBDA 5AXBA 5FORA 5HK9A 1N8SA 1WL8A 5FBWB 4IH9A 4HH1A 4DRXB 2E4XA 4Y1FA 2HK6A 4RELA 2ID7A 2J4DA 2X5NA 4YRQA 4EDFA 4XVUA 2LE0A 2W70A 5BP7A 5C18A 4NNPA 1I4TD 3HKEA 3RYCB 2LR0A 2MJLA 5LUBA 2BR4A 1EX9A 3I2GA 1X70A 1PS9A 4MAAA 4ZMRA 1WSAA 2F3RA 2RHGB 1G3IA 2ZKIA 4ND2A 4ZOBA 4B4UA 1BDIA 4M89A 3LZ6A 2PGIA 3IT0A 2AD1A 4QUIA 2WRZA 4K6MA 4G1MB 4MQEA 3PDJA 4AS2A 4JL5A 1GQ2A 4OLFA 5JPDA 1GG5A 1R27A 1A9OA 1MEOA 1Y63A 3EUEA 4XXHA 3SEQA 5CJ2A 3OM9A 2JVJA 2WT4A 1AF4A 4DABA 2QNRA 1IJBA 2ZOSA 2C5HA 2VQ6A 2DM6A 4GP7A 4EB3A 5KOYA 5HS4A 2RH8A 1UXGA 4FU0A 4RIFA 3L4KA 3GLIB 1VCOA 4DDVA 3NBZC 3VPDA 4MARA 4BGEA 1I7LA 3SDSA 4A5OA 5JMOA 1FX0B 1G98A 2JFNA 4HQNA 1R0ZA 5ALYA 3VTZA 1Z5PA 3ZWVA 4ZV9A 1E61A 3IODA 2FR0A 5LCXA 1QNLA 1R0WA 2WD7B 1X19A 3TOXA 3HQ4O 1DQZA 4MR7A 5IH7A 1ISIA 1L7BA 3KB6A 5JXJA 2DHDA 4AP5A 3COPA 1VBNA 4D41A 1OGJA 3U0BA 3TTWA 1X7YB 2ON6A 3T8YA 2QUAA 1TM7E 4W1QA 1PHRA 2IEYA 5CDGA 4MGHA 4ZZ1A 4AIRA 3CJQA 1U1GA 3EVAA 2DEUA 2JIZA 3FLAA 3G7UA 3GNLA 5I51A 1YACA 2VDRB 3GELA 1DE0A 1WHSA 4YJ3A 3PC8A 4MCHA 2DT5A 1ZVJA 2V9ZA 2V96A 3B1JA 2GHQA 3EVTA 5F64A 4EARA 3PXEA 1JSRA 3V80A 1U0EA 1NRXA 3F9RA 3RSSA 1QDUA 3AEZA 1AKRA 3RBVA 2REQA 1TRHA 1RWOA 3WC4A 1EZ4A 2IRWA 2BF7A 1FQOA 4L7VA 3ZE7A 4ETNA 1ZLXA 2G76A 3LL7A 3NLLA 1USVA 1QE3A 2G72A 4GPD1 2HO4A 2GN6A 2X0KA 3IUJA 2IS1A 1JIUA 1DG3A 1BFUA 2XUHA 5JDIC 1XRNA 4MWZA 4LOJA 3I42A 4IVPA 3I1JA 4O0LA 4C0BA 5H7XA 3WK5A 5EVCA 4CLOB 2GUGA 3FNHA 1YVRA 5HBRA 4JI7B 2XMDA 2FPSA 1P44A 2ZRGA 1RVV1 1L8AA 3QE3A 5T5QA 5FR1A 3WE7A 4HATA 3N2NA 2GCIA 1A0OA 1Z4QA 4IHJA 3K70C 2NUPA 2Y05A 3A14A 5SYNA 1F51E 2AC2A 1YS7A 1U7PA 1Z0SA 3V5NA 3WGGA 8LDHA 3LF1A 2UUCB 2BFEA 4OQYA 2BHSA 5HEKA 1B6RA 3UJAA 1WKBA 1LF5A 3FCSB 4QQKA 2CXPA 3CG4A 1HZZA 1MA3A 3MGBA 3E0QA 1VYVA 3KUDA 4LY3A 4N12A 1E9VA 3SF8B 1Y3BE 4D0GA 3ILYA 2CVOA 3WYEA 2GHRA 1Y1TA 2WNIA 4Z3KA 2AA3A 3U7EB 1FU8A 3S4YA 5F3RA 1PI3A 1Y1SA 5EZ6B 1G6HA 2FWPA 4S2UA 3DV2A 3CNBA 1F12A 3MUFA 3FNFA 4JOCA 4MI3A 3UA4A 2NU9A 1LWNA 2XDWA 4RSMA 3R6TA 3ZW8A 1YB1A 3CRNA 1MPTA 4CKCA 4ML3A 2DHQA 3D1VA 4X92A 1ZBQA 3DMHA 2DPLA 1N6NA 2WDZA 2WHYA 5EJIA 2DQ4A 1SR8A 3WRWA 1Z39A 2FW7A 5H4HA 1KFKB 1YUNA 4DQXA 1Z5UA 1ODTC 3H0KA 3OY2A 3GUHA 3OOEA 2ISQA 1JFFA 3LBNA 4F3RA 2G06A 2WZQA 4MUBA 2RG7A 2QRUA 1BA3A 1O0CA 2AKAB 3HKEB 3BTVA 2O2JA 2NO1A 2V65A 3GF4A 3FWYA 1S01A 4LNAA 2ZBPA 1T9GS 5KYGA 2IPXA 3GROA 3MMNA 3O2NA 4TWIA 2XUIA 5FI0B 1Y7LA 3RARA 4V0QA 2UYOA 3E70C 2NTJA 4M38A 2R7KA 2DLDA 1R0SA 5C1DA 4NMWA 4G0WA 2V54A 2X0FA 4MQEB 1IXSB 3EIXA 3BHNA 3NHBA 1Q77A 4ICIA 1Y6QA 4Q9IA 4E22A 3R3SA 4BV3A 5COBA 5E6UA 4GZ3A 3GPBA 5IABA 2FVYA 3LYUA 3P94A 1E3MA 3DOCA 3AZPA 2J87A 1BNCA 4NYJR 1X42A 1KHTA 3H9QA 5IAEA 3CMCO 2A1UA 3EA4A 4LGMA 4I9FA 4YCLA 3LT0A 2GPNA 5IHPA 2OCPA 1GT91 2G71A 2JK0A 3OLXA 4NXNB 2BP7A 2EX1A 4W9MC 1I5OA 3AFGA 4H08A 3CKKA 1PR4A 3MWEA 2PU5A 3N87A 5FIUA 2UYQA 1C1YA 4TZTA 4AF7A 4Z3DA 2JHFA 2HF7A 1J33A 1EA5A 4M9CA 4KV7A 4B4WA 2M6RA 4MR7B 5DMHA 1OCEA 2I29A 2G70A 1ZS9A 4WLUA 5COQA 2VF2A 5KAPA 4X6LA 1WMAA 2BFDA 3IKVA 4OHBA 5BSVA 4B0PA 3QU2A 1T9AA 2J3HA 1KK3A 2ZYHA 2CNOA 1I4WA 1X1QA 1RWNA 3FIJA 3NCHA 4XYLA 3D5QA 3PQ6A 3V8PA 2O2XA 4W1SA 5K9ZA 4EVIA 2OBYA 3PB3A 1TO6A 1WHSB 3NT2A 4I46A 4YJ3B 2WF8A 3NRJA 4RDIA 3WYFA 5CFMA 1U7OA 3FSJX 1UEIA 3OOHA 3WL8A 3CF4A 3D59A 1B2LA 3EWIA 4IPTA 2ZSAA 4WMLA 1EP9A 3RVJA 2REQB 1NLYA 4RHEA 3EA0A 4BFTA 1ZJWA 3Q2OA 1PD1A 2RGWA 1WB4A 4ZARA 1MU0A 3ZW7A 1HFJA 3BJIC 2Q2QA 2WWVD 4F2GA 1M2OA 3C3JA 1MBZA 3IP3A 4H7DA 2V7VA 3HR8A 1ZD4A 3JARA 3OCZA 2GHTA 2NACA 5EE9A 1QM5A 1U0FA 2B8EA 4GBED 2ZSJA 4YT4A 3EPHA 2HN9A 1UJNA 3EJ6A 1A4RA 1RRVA 3O4HA 2JH3A 2SKEA 1L5GB 4A27A 3EPJA 4KBYA 3S99A 3W6ZA 4C2UA 1A97A 3ADDA 2YOHA 1J1UA 2PJDA 5IANA 3RODA 1HE5A 1JHPA 1B0AA 4XGQA 3I5AA 1L1QA 3R3HA 4J16C 4EFMA 1FK8A 2HLPA 4IHJB 3GRYA 3C4VA 4IOLA 4AQ7A 1Y5NA 1DAFA 3MD9A 1Q1GA 1VG0B 3PF8A 5LYJF 3UKJA 1LV8A 5C4GB 4WT7A 2BW0A 2BFEB 5DYTA 3UAYA 1DTEA 4YUZA 4C3UA 4FWBA 5FWYB 2O5RA 3JR3A 4NZMA 4Y9RA 2Y0CA 1IK4A 4JXZA 1IUOA 3FWZA 2EP5A 2PMCA 3RJ9A 5ICCA 4V3CA 5CJJA 1YI1A 4QYWA 1GYQA 4MUAA 1NJGA 5DNDA 3BILA 3RFTA 4K81B 1HT1E 3OBIA 1YZTA 3R77A 1ISGA 1YVUA 2NU9B 4MWTA 2I76A 1FRNA 4I4LA 1QE0A 3E3OA 1UINA 3JQ6A 4RIGA 3T5CA 3WA6A 4K3UA 4F3NA 2G9UA 3NBXX 1UBNA 4CKCB 1KY5A 2QXUA 4GI5A 3RBZA 3ZY2A 4BC0A 4NESA 3TZ6A 3NGMA 2PZFA 3EVCA 1DPFA 5EUQB 1UODA 3D2LA 4LJKA 1P80A 2XUQA 3Q41A 1D2AA 3KXDA 3DM5A 2Q8PA 1JFFB 2XGOA 3B6IA 3KEQA 4G89A 1H2FA 2WAMA 2PZ8A 4M8IA 3H5RA 4KNWA 4DCJA 4OBWA 1RWKA 2GTHA 2ZTLA 4UARA 1V37A 2WM8A 4EY4A 4D46A 3SIXA 2VTKA 5IYZA 2WK1A 3OCJA 5F7XA 3AJ9A 1XVAA 4POAA 3IP7A 1KPIA 5E3JA 3QX3A 1AC5A 1ZVKA 4GNRA 1NQXA 5E6UB 3L1KA 3K71B 1UC4B 2OG1A 5FFMA 3W5UA 1QLJA 4JQSA 1E9SA 3PV0A 1K5HA 3RASA 2A1UB 2VIIA 3PQ2A 2ZAYA 1HI9A 4R5HA 3VMFA 4KLZA 3UXMA 4E2XA 1LPOA 4WXHA 4QC2A 4IIEA 4MQ5A 2BP7B 4OK5A 3ZS9A 1JVBA 4E1BA 1AXRA 3D0QA 2MR6A 2P6RA 2OK8A 4WEQA 3MWEB 3BHIA 1WMSA 4UVDA 4J75A 3HZZA 4BO9A 4PSDA 5TXGA 5HM6A 2FLKA 2QM7A 1G17A 1YJ8A 3E8MA 2DMRA 4FS8A 4R6WA 1SKQA 1P2DA 1UBEA 4CE6A 2Q3MA 1WOMA 3PC3A 4N5NA 4QQ8A 3BXOA 5DHUA 1N6IA 3K9NA 4G63A 2IY8A 2HSEA 4NX2A 3ZE0B 2BFDB 1PEYA 1SRRA 3L18A 1OUMA 4JLKA 4P7FA 1OE0A 3RS2A 9ATCA 5JMTA 4I19A 3PQ3A 2BSXA 1PR5A 1SCIA 1WPRA 2ZAIA 3P2YA 4IP0A 4JVMA 3SI7A 1KJQA 3PU6A 1BE0A 1DFGA 2OFPA 1U3GA 1H85A 5B3JC 3K5WA 1UBFA 2HDNB 2IX3A 1HEIA 4HJXA 1I6LA 4BVJA 4KRYA 1E4EB 1PK9A 4EOGA 3FHTA 4B6EA 4CTMA 2VPWA 3MJRA 1EXVA 1L4HA 4L78A 4W5RA 1UBTS 2IUFA 5FOQA 1W29A 3U62A 2YJGA 2AE2A 3QVWA 1PTKA 1JLMA 1M2OB 3JALB 3RS5A 5JC8A 1LRLA 4IIGA 2HYIC 3V1KA 3JARB 2DLNA 3IQIX 3L8HA 4K5QA 1UJCA 3IUBA 3PXBA 4FTWA 3HHEA 2YFKA 4PTZA 5C1OA 2IUEA 3OLCX 4IG4A 1KSGA 1WDKA 2PLNA 1JLLA 3T3GA 1JHAA 1SM4A 1ZGHA 4NMXB 3WK9A 4E3WA 2CXHA 5IVHA 4Q16A 4G36A 1LS1A 1SXQA 4JUBA 5EGNA 3M6AA 4CQMD 1SD2A 3WL6A 3HSYA 4KRFA 2J9RA 1N3LA 2V6FA 2XTNA 3WLRA 1M2EA 4CN8A 1JJ7A 1UBRS 3HCCA 5IFKA 3FX2A 4ND3A 2I7XA 3ZBTA 4Y2SA 1PZGA 2E5WA 3MINA 4P9NA 5LIPA 4LKRA 2UXDB 4ZQEA 1I4DD 3QNUA 5C46F 1K9SA 5CDYA 2A33A 4NOJA 5DNWA 4JXXA 4N82A 2J9FA 4KFRA 1UWKA 2HQRA 2QPOA 2CVPA 1ULTA 3FTFA 2RJ3A 2UUOA 2Y0DA 4G26A 4X3PA 4KLCA 2CJPA 5KSPA 4A3SA 5G53C 3KFLA 4PZ0A 5F3DA 2ZSIA 3CSSA 1LXCA 1DJPA 4B75A 3R2JA 2GJSA 4URUR 4EGJA 4BQEA 1R0CA 1J2UA 3N9IA 2DUNA 5DMXA 3OQVA 3UA3A 1RWMA 2QAGA 1AOXA 5A4KA 3EXG2 3W7VA 3PXCX 5EEHA 5LN1A 3VAZA 3TE7A 2IZZA 2C07A 4H1TA 5E7IA 3GAFA 3BMQA 2C0PA 3VH4A 3GP3A 5IF3A 1DL5A 2NQTA 4LZOA 1NVWQ 1HETA 1VKJA 1GZVA 1BE1A 1A72A 1NMYA 2UVPA 2HKIA 2XQVA 4WZBE 5TQ0A 4YP0A 2FWBA 2BR3A 5LQJA 1JP7A 2IYAA 5KSWB 4UAUA 4TWZA 1N92A 5BR8B 1O4WA 1U4SA 4IKPA 4LQDA 2VAWA 5IYZB 5KTNA 4KIJA 1T9GR 5DX1A 3B60A 1XLTC 4RY0A 4KPFC 5HRCA 4RF4A 2I2AA 4D56A 3FOEC 1M0WA 4B7XA 4D0SA 2D13A 4OBXA 3WISA 1SIWA 2J31A 4OU5A 1Z4MA 1LPMA 4MVJE 4RORA 5LQDA 5AVXA 1E1QD 2B8WA 4WLNA 4BTLA 3ZDZB 1WDLA 4D8WA 2E4WA 2I62A 3BD6A 1Z35A 4PCVA 4Q05A 3V1LA 1EESA 2JVKA 2E7ZA 3SP1A 2IP2A 4AF8A 4YYZA 3ETHA 3VX3A 3HMQA 2BM8A 1KMNA 4U39A 3R0VA 3LP6A 4DJTA 3NTLA 1JSZA 1MHPA 1V16A 3ZE8A 4QOSA 5CJPA 4PLWA 1N6RA 2X3UA 4H3SA 4PNPA 4YB8A 5CTJA 4CGZA 3WDSA 2OCXA 1KDRA 2A0XA 2B6NA 2RHJA 3EBLA 1TW2A 2CXSA 2QR5A 3GVHA 3ASVA 4PGAA 2GMWA 5K8JB 3CNNA 1GPH1 3OQJA 1JIJA 1FVOA 3VO9A 4FGJA 2R1VA 1Z22A 4DOMA 1ZAKA 1Y3HA 3FZYA 4YC7A 4AMYA 4UD2A 3PNLA 5JSYA 3SZLA 5E1OA 1XHLA 3OX3A 1NN0A 2R5WA 2GF9A 3I01A 4QT4A 4YJ2F 5JXHA 3KYDA 3DD1A 2GN4A 4BJ5A 2ODTX 3PP8A 1RI2A 1W4RA 2K5UA 1V43A 4E5UA 5EL0A 1C9KA 4QGHA 1KE1A 2X4LA 4RENA 3IHTA 1W73A 4KE6A 3V6MA 5HUJA 1JHVA 2OYCA 3LFTA 3WO1A 4JVOA 3L06A 3KU4A 1IBCA 2Q9BA 5BSKA 2PIAA 3CY6A 2HRRA 1VLHA 3OT1A 4ZRNA 2FRXA 2HHHB 4JX9A 1REQA 1GQFA 4UMEA 4RY8A 2WM9B 2YQZA 3KVNA 1JL3A 3H42B 4LSWA 3E1KA 1ARZA 1H3NA 3FPHA 3GD7A 4GC9A 2QAIA 1A9SA 4R68A 5FTJA 3L6OO 1JLLB 2XUKA 4HRAA 4PZCA 4QNRA 3B6MA 4X90A 2ZIFA 5IAKA 5B7PA 3R3VA 2SBTA 1VZ3A 4JZKA 1OX5A 4KE8A 5K03A 1XO1A 4NYMR 4QICA 5FV7A 3CZRA 1GU1A 3GPCA 3D64A 1MD9A 1S2GA 2CLEB 3ZUPA 4H17A 4IDGA 2XGSA 4JBHA 1RM5A 1X1RA 4HYEA 1ZD9A 3IMGA 4QTUB 4RD3A 3WL7A 5U4QA 1FTSA 3MINB 4DT1A 2Y3IA 1YMUA 1HMPA 2B36A 5FO1A 3DLHA 4INZA 3WYDA 2J9FB 1QHXA 4LW8A 4HNVA 4R9UC 4OBEA 1K75A 4C1NA 1GEGA 1V5WA 4JQYA 1Q44A 2O3UA 4B3MB 1EUDA 1FRVA 1BMDA 1TB4A 1NP6A 4FYJA 4YQYA 1SHTX 5CH5A 4O1HA 1A2OA 3W0LB 1M0EA 2IHUA 2WF7A 2ZLBA 3HZOA 3ZHXA 4CKZA 4R9RA 3W3AA 2LUOA 3PK0A 2X0RA 3RIMA 5A04A 2V7PA 2QAGB 1NW4A 2LNDA 1X7ZA 2C84A 3HFSA 3IILA 4KSBA 4QBTA 4C1BA 2Q4RA 4HB4A 4IDEA 1QC5A 4QOFA 1UZUA 3R6GA 1PYDA 3BMQB 4Y6RA 3ANSA 4YDQA 1VJ1A 2RIRA 1SOAA 2R8RA 2UVPB 2Y1DA 4ZZIA 4FMCF 5TQ0B 4ZYLA 2B2CA 4R3NA 4CDRA 5ALZA 2Q0QA 3TE6A 5AVQA 2UZ3A 2HA4A 4G9EA 5H5JA 4B9EA 3DV0A 1AQ6A 1QIIA 1O94C 4BEWA 1V7PC 3BMCA 2VP0A 3NHPA 4HDCA 5AVTA 5FQOA 3T7DA 2VJPA 1Y1RA 3RTDA 3BXFA 4XOUA 5DISB 5ALIA 1ZG3A 3S2UA 1PG2A 2W4QA 4WXRA 4FHZA 2XT0A 1N2OA 2AVNA 1G20E 1NVVQ 3U19A 4CI0B 4MXDA 1QRUA 5CNKA 2QX8A 4Y2YA 4ER7A 1E9AA 4JJ8A 3PC2A 3IRVA 4U00A 5DASA 1NOKA 4BWFB 1RI1A 5FPKA 5KKCA 1QIEA 3KT8A 2F48A 3LRTA 5AQEA 2ZE8A 3V4RA 3OEWA 3VOTA 4GPIB 2G40A 1SH7A 2LIVA 4F6LA 2A30A 1HBJA 4V24A 2PUBA 3QLTA 2VA9A 4RVCA 3O74A 3PQDA 2VTBA 1FLAA 1V16B 1VYTA 3I52A 2EHDA 3IOCA 3OM1A 3CH4B 5LWHA 1IHOA 4LF5B 2FP4A 5AJUA 4LFAB 1MT0A 4I1SA 5AIBA 1AKYA 2IBTA 4S0ZA 3ESXA 4CKEA 1OB5A 2WQ7A 2R85A 5KCMA 3COVA 3Q3CA 1UDRA 2R1VB 3NTVA 4K2AA 4RAOA 4UUQA 4PGMA 2ZT8A 1GAQA 2UVDA 1IEQA 2YMPA 3KYDB 3KL4A 5JRDS 1WW2A 1NYRA 3LU1A 2P9ZA 3MA0A 5T4HA 3UJCA 4EVQA 2CCJA 5J58A 3VXKA 1XTJA 2O1EA 2XA2A 2JDIA 2DJIA 2GFHA 4K0KB 1E18A 4RA9A 2W4MA 1ILEA 4CLHA 5ILQA 2WU0A 4P32A 1QUFA 4L27A 3L82B 4YRKA 4WA7A 2WD8A 1YD7A 3OT1B 3A31A 5JSFA 4IO0A 1LDGA 1JKJA 5FBQB 2H4FA 3CKLA 3ONVA 5REQA 1AO0A 4KUHA 3THSA 2QJOA 2ZB8A 3EC1A 3PICA 6AT1A 4OI0A 3TVTA 4IWYA 4KR7A 4X97A 1QYRA 5FTNA 2C5SA 3VAAA 2XNDD 2B8TA 4BX0A 1I30A 3L40A 3BFKA 3F97A 5FYQA 2C78A 3E5RA 4NDZA 2DWCA 2TECE 3R75A 1ZR2A 2GESA 2WJWA 2QN8A 3AUTA 3G3EA 4GPEA 3L1JA 4R8SA 2WU8A 4OQFA