4MDYA

Crystal structure of periplasmic solute binding protein from mycobacterium smegmatis str. mc2 155
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
285
structure length
285
Chain Sequence
b'DDGSVTVRHAFGDTTIPGPPQRVVSAGLTEQDDLLAVGVVPIAVTDWFGGEPFGVWPWAQRQLAGAQPAVLNLDNGIPVEEIAALKPDLIVATNAGLDADTYAKLSEIAPTVAQTGSEAFFEPWKDQATIIGQAVFKNAEMTELIKSVDDRFTTVKTDHPQFSGKKALLLGGTLYRGGVQATPPGWRTDFLTQMGLTVLQVPALIPRDEIASVLDGADVLIWTTESDQDRDALLADPIVAQLAATRRDRNIFTTKELAGAIAFASPLSYPVVADQLPPELARVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein
publication title Crystal structure of periplasmic solute binding protein from Mycobacterium smegmatis str. MC2 155
rcsb
source organism Mycobacterium smegmatis
molecule tags Transport protein
total genus 91
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4mdyA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4mdyA02
1K7SN 2R79A 3NU1A 5FLYA 3ZKAA 3ZTTA 5CX1A 5KOJA 4FNAA 1PQ4A 3MINA 4GICA 1KAEA 5KOHA 2M6LA 1FP4A 2Q8PA 4K3VA 5HDQA 1N2CB 2PS3A 2XY4A 4LS3A 4WZBA 4WESA 1PSZA 4INPA 1QGUA 1XVLA 2PS9A 2XDQA 3K1AA 2WHYA 3ZK8A 3MD9A 3BE5A 4G07A 5M3BA 3TEFA 4WNAA 5M29A 3HH8A 3AETB 2MINB 5B58T 4CL2A 3CX3A 1ESZA 4HMQA 2YNMD 4WN9B 3AERB 3G9QA 4ND8B 1N2CA 2O1EA 5CR9A 1TOAA 2PRSA 3AEQA 4LJSA 1N2ZA 4TKVB 1K75A 4HMPA 5M34A 5I4KA 5GGXA 3MWGA 1M34B 3HXPA 4UDOA 1G20B 3AETA 2Q8QA 1MIOB 4NNPA 3R5SA 1M1YB 2OV1A 2YNMC 4MX8A 3UJPA 4G09A 3LI2A 3PSHA 4HN9A 4N01A 1L5HB 5AFSA 4WN9A 3AESB 4WZAB 2AFIB 5KHLB 3EIWA 4ND8A 4B8YA 5M2QA 3HJTA 3PDIB 4TKVA 4XPIB 4HMOA 4MLZA 4MO9A 3U7QB 3R5TA 1M34A 2XQVA 1H1LB 2OV3A 4BBPA 3GI1A 5BVHB 1G20A 2OGWA 2RG7A 4PAGA 4FKMA 1MIOA 1QH8B 1M1YA 2XV1A 2M6KA 5BVGB 2PS0A 4M7OA 3TNYA 2X4LA 3ZK9A 1K0FA 4UTOA 4NNOA 1L5HA 4WZAA 3AESA 4H59A 2AFIA 2MINA 1QH1B 2XUZA 4FILA 4IRMA 5JG7A 2AFHB 4TKUB 4XPIA 3BE6A 5JJ5A 2XH8A 3AERA 4OXRA 1M1NB 1KAHA 2QI9F 2ETVA 3U7QA 3MFQA 3MWFA 1H1LA 2PHZA 3AEKB 1G21B 4OVKA 4OXQA 3AEUB 5BVHA 3TLKA 5KOJB 1N4DA 1K2VN 1QH8A 5BVGA 5JPDA 4H0FA 2WI8A 5HX7A 4INOA 5CX1B 4MDYA 4WNAB 1KARA 3AEQB 1QH1A 2R7AA 3MINB 5KOHB 4FI3F 1FP4B 5JOQA 3PSAA 4WZBB 2AFHA 4TKUA 4WESB 3LHSA 4DBLE 1M1NA 1QGUB 2XDQB 5GGYA 3K1AB 3ZK7A 3AEKA 1G21A 1EFDN 3AEUA 3EIXA 4UTPA 3PDIA 4UDNA 4PM4A 1N4AA 2OSVA
chains in the Genus database with same CATH superfamily
2G63A 1P1CA 4OQMA 1PG5A 1YL7A 2ZVPX 3AJ8A 4QBHA 1WNTA 2UKDA 2VUUA 2X8JA 3Q41A 2NZYA 5ERYA 4V0LA 2X0FA 2EJCA 2XOEA 1KAEA 3COSA 4QVGA 1SBTA 4F2WA 3VAAA 1IMJA 3DE6X 3OFNA 2G9QA 3K9BA 3NDIA 4JLNA 4K88A 2QN6A 4PLCA 1Z8NA 4B5LA 1EUZA 1AUOA 1PSZA 4ZALA 2PZGA 3IUEA 3NH9A 1VGVA 1GQFA 3LLCA 2O05A 2D0PB 3EF1A 4DC0A 4D3DA 3CMMA 3EGDB 3ZZUA 5I51A 4O4JA 4OYYA 1U3UA 2P9BA 3H5IA 5IC4A 1I7LA 1P80A 2EGGA 3VSBA 2OLKA 2WHRA 2JHGA 3O6VA 1VCHA 5B4VA 2IZ6A 1NFRA 3DCYA 1KH1A 1CDZA 1UFVA 3VNRA 4AZWA 4C76A 2PU7A 5FR2A 4B2PA 3U5TA 2C2HA 3KVYA 4HNUA 5A1JA 3U37A 4BFSA 4UUOA 3AHGA 3UGKA 1LEHA 4PPGA 4WOBA 2Y6VA 1UBNA 5JCOA 4N76A 3S44A 1WW8A 5DNDA 5JYBA 3U44B 3LT0A 3EVAA 4DT1A 4J0HA 2B2NA 3W6OA 2XBUA 3B3FA 1FTWA 3GH3A 4HHEA 2DPLA 1ESDA 1VGRA 1Q15A 4IMRA 3EXG1 5F1YA 2J3DA 4HLQB 3DHEA 2REQB 2YZKA 4P31A 3RBVA 4G01B 2KS6A 2NTEA 1GPAA 2IY8A 1M0TA 1PJZA 2I4OA 3B3AA 3MLEA 4LXIA 4POAA 5EP4A 2QYHA 3EFOA 1EGQA 1PV1A 3UW3A 1RXUA 4E7PA 1O6FA 4MS3A 7REQA 5JMTA 1KZ7B 1PYOA 5LA6B 1SKYE 5IK2A 4A1OA 3JQFA 1P2DA 2V6FA 1NYQA 3HJRA 2H1LA 2BFFA 1ESNA 1O95D 3SP1A 2ODBA 1VHDA 3KSUA 4FGKA 1NJ1A 5FKJA 4GT1A 3V4PB 2XB4A 3QVLA 4FHEA 2CHEA 2JRCA 3BWMA 3PPWA 3PRJA 2FSHA 2NVBA 1GITA 2P62A 2YBEA 1MC1A 2OORC 4M2LA 3K05A 3KV3O 1WO8A 3LKVA 2BF7A 2WTBA 3UF0A 2IT1A 1QFMA 3NPAA 2ZYWX 4M7RA 2R5WA 4ZAFA 3RODA 1VYTA 4BNTA 3GRAA 4YJHB 3QSYA 4GQAA 4PPYA 2I6TA 2NQ2C 1JHQA 2HLHA 2OVFA 4IFIA 4LJ7A 5GONA 4OEHA 1CUFA 2WM8A 1F3LA 3UHOA 2O8NA 1X3LA 1Z4OA 1NGSA 1BU5A 2WV9A 1JAYA 1SZJG 5AM4A 2QYTA 1PBTA 1WUYA 4BVGA 3IPLA 5HTOA 1L3BA 3I8SA 1H8HD 3C8UA 1UL1X 3IXQA 4GPAA 5KNCD 3IE0A 2CFIA 3NV9A 3U4CA 1GJRA 2ZSDA 2IZ1A 3EY4A 3IBFA 3OUUA 4IHKA 4KMRA 2ZVDA 1F2TA 4ZXFA 2X8AA 4WNYA 3RIYA 3UT0A 2CLMB 4K5QA 3NM5A 5CA0F 3TN7A 1FZTA 3FX2A 1VG1A 2BFNA 3OLXA 3ZOKA 3HM2A 2QD5A 1A5ZA 4FIZA 1NG1A 2QTGA 3LHSA 2E0IA 1GP2A 2PRJA 4I4TB 1G8YA 1IWPB 1EVYA 1MB9A 1CS0B 4M6WB 4CQMA 2JVKA 1IPFA 4L7QA 2IGBA 1D8TA 2I7TA 1EWYA 3CSUA 3D6TB 4ISCA 3EXHC 4BQSA 1TB4A 3W9YA 4PANA 4FGJA 3VH1A 3B6KA 4QFCA 2F1HA 1UJ5A 1HT3A 1KEPA 3RYTC 2OYSA 5IASA 2G9ZA 3BD7A 4DLZA 3FFBA 4JUAA 3ZXUB 1MT3A 2YZMA 1QF9A 5BN4A 1OV6A 3OOJA 1LV7A 1H3FA 3CLKA 1T6ZA 4DIEA 4S04A 4KO8A 3RU7A 1ZJYA 2NACA 4AYXA 1G9XA 1MRSA 5C32A 5HZHA 1H22A 2IOFK 2PXHA 4R1UA 5HMMA 3MT7A 3HK2A 4QO8A 2QQ0A 2IHTA 1N7HA 1T15A 1UC4B 5GJCA 3T1NA 2J9YB 2YIJA 5KBYA 3I9V6 4XFJA 2E18A 3ZQ6A 3VRHA 3GFRA 2HJVA 2O8VA 1GQRA 4I50F 4AJ1A 4V1CB 2FG7C 2VEOA 3WAGA 2IS2A 4OP2A 1FC0A 1JZSA 1PRYA 3L7IA 3OCZA 3FDFA 3BGDA 2QRGA 2IUEA 4QBFA 3WK7A 4J6EA 4CR7A 4I9GA 4OJNA 3EH2A 3IP9A 2QZ9A 2EJTA 4XYEA 2ZRQA 1HEYA 1N8KA 3CZRA 1NX9A 3QJYA 3VYVA 2IELA 1P44A 1PV2A 1XZFA 1I4EB 4QXOA 3I53A 1KKLA 4FW8A 4I4NA 4J0CA 5SZIA 3CCFA 4NONA 1JNYA 1Z6GA 4RSMA 1ZNZA 5DM0A 3R7NA 1C80A 1DKLA 1YULA 3FNEA 3KJFA 3QYAA 4X1YA 7MDHA 1XTVA 3GARA 2C8JA 4MX8A 3EF0A 4NCIA 4RPCA 3RH0A 5BT8A 3OQIB 1E2QA 1F17A 4HN9A 3B89A 1M6HA 2OFWA 3N0RA 2HA2A 1PAUA 2XYHA 1YI0A 3HA5A 3O94A 4M88A 4Q3DA 5DZSA 1RAAA 1KI9A 2H8KA 3R0VA 4O63O 2B5VA 3GIDA 4CQLA 1KVQA 1O97D 5C51B 3KJGA 3DGEC 1SBNE 1MFPA 2N75A 4B9EA 3LX6A 4OP1A 5E2BA 3PC3A 1JHOA 1ODJA 1UC5B 3CC8A 2I8LA 2Q3LA 3DT9A 2IIBA 3JALA 4UXHA 3RSZA 4OHBA 2VOJA 4URFA 1UODA 2RG7A 4WCDA 4WY2A 1FNSA 1XALA 2HREA 1P5JA 2GBCA 4J75A 1JKMA 2VG8A 4MV6A 1SC6A 2FMXA 4I1IA 5P21A 5T8KC 1ZEJA 3URKA 5E9AA 4BX9A 1XTSA 1B00A 4CVNA 1PK8A 4PZYA 3NWPA 1AMNA 5AW7A 3Q9SA 4RZQA 1WU7A 1ZUHA 3MCVA 3TZ6A 3K8QA 5IMBA 3OOEA 4BGVA 2TMGA 3NOQA 2P4UA 4KIUA 4HEQA 3WBBA 1NDUA 4UMDA 2DZDA 2CBZA 2QVZX 1E2PA 4MZDA 1RI3A 1Y9AA 1ZJZA 1OIVA 2VYNA 4E5NA 5FUQA 1XHLA 5I9BA 1JE0A 3FVTA 5DHSA 3SHWA 2OHOA 2RHTA 1P3DA 4KIFA 2IZ7A 3R8XA 5BN3A 1UADA 2XUFA 4MIEA 5KVCA 3MHTA 3A28A 4AY2A 2IPOA 4IJKA 4JUIA 1AHIA 1BYIA 1K92A 1WWKA 2ZE7A 2G0TA 3G2MA 1E7YA 4LHEA 1E3LA 1RM3A 2CNKA 1F5SA 2YVAA 1QIEA 2YZNA 2D1FA 5AP9A 4TSRA 5FO0A 1MH1A 3WLJA 2VP2A 2A33A 2W6PA 3RYIB 3LE8A 1ECJA 4GECA 1W34A 4WIAA 2AZTA 4CM8A 4JLUA 4L7VA 1TTHA 1MC5A 3NJRA 3CEAA 2A0FA 1BRTA 2I87A 2YS6A 5HCIA 5KOJA 4X1IB 4WN3A 4B5KA 3NU1A 5BR8B 4H7HA 4RABA 3WNBA 3DZDA 1Z4QA 2ZT6A 3GOHA 1FRNA 3WLKX 2GN4A 4ID3A 5EIBC 4J8PA 3IAM6 3W90A 3O4FA 3OF5A 1STOA 2I2CA 4QBTA 2MR6A 1PT6A 3EODA 4UMEA 5KDOA 2QG4A 1E1DA 2CVHA 2P5SA 4F2DA 2XE8A 4PX5A 3D0KA 5HHTA 1P7WA 3I64A 1LQUA 3DMFA 4QQKA 3RUIA 3W1EA 3W1VA 4G0XA 1CE8B 2EFEB 2OGZA 1EA5A 2Q21A 3U39A 4AKTA 1V4NA 1JHRA 5AJTA 4BKUA 4RGVA 4WJLA 5IDWA 3FFAA 1TYCA 1AN0A 1JSZA 5JD6A 1X7YB 2VH5R 3DZGA 3GEMA 2YW2A 4XD7A 3ZJ5A 1T3LA 3FZQA 5JDIC 3AVXA 3QLVA 1I32A 1KZHA 1JZTA 3SC3A 1H1DA 2ID4A 1FS4A 4ZVRA 1NU8A 2CUNA 3AUXA 3DLIA 1X9GA 1V96A 2O57A 4OBXA 5CTAA 1R12A 4B6GA 2ZZMA 4OOEA 2HCJB 2BBSA 3TLGA 2QY6A 4UUBA 3WDMA 4MVYA 2AR9A 1TUBB 4D5GA 2Z6QA 1ID1A 1OXTA 3B5EA 3HP7A 3T3MB 4WK0B 3RK1A 1KVRA 4WPGA 4DIFA 5A03A 1XRJA 1F5NA 3FHJA 5ES3A 1G20E 1G4AE 2J32A 3LSYA 1EZZA 3E5MA 3RYFB 1Y6FA 1WSBA 4Q7EA 4PFSA 4TV8B 1RYNA 1IVSA 1GZ5A 3JVEA 3DTVD 4Q16A 1ZD3A 1I3MA 4G8BA 2Q5OA 2P9HA 3L1KA 1FVXA 1PFQA 3QU4A 4RULA 5K1ZA 1JJIA 4JA0A 4M60A 4IHAA 4EMTA 5TV2A 1SEPA 1QH0A 2G07A 4OGGA 2P0YA 1IBLB 1EWVA 5CDGA 2EL9A 2P3QA 3RC3A 2O2CA 1I14A 2HDOA 1EESA 4H7FA 3ZH9B 3CT4A 3DEKA 4KREA 2JGIA 4N0DA 1C7FA 4J9UE 2WKWA 1GNLA 4OHUA 4DLUA 1HSOA 3CNBA 4J2HA 1XDWA 3ESAA 4NBUA 4JEIA 3FETA 1E3TA 3HWX1 4IDHA 1WXGA 2HEIA 3C3CA 1DC3A 4ND5A 5KX5F 3KOWA 4O0LA 1B43A 2NGRA 3OZ7A 3W9UA 4LE2A 4S1WA 5ADUS 1XEXB 3R4CA 3TMAA 4QHSA 3KQQA 1ECBA 2BC9A 1KYTA 1CY2A 1XQWA 2R6FA 2C59A 2PLAA 1XGKA 1FSPA 3RC2A 4OQYA 2FQ1A 2V9ZA 1AB5A 2YOFA 1OLXA 3G7UA 5JLAA 4D0GA 4EEKA 4O2RA 1P6XA 1PNVA 2I76A 3GROA 4M1TA 3SYNA 2V4MA 2QX8A 3B1WA 3UMYA 1DQNA 1OYVA 2IOYA 4OLBA 4HNVA 5DM60 3C3JA 3E53A 3RAEC 2A58A 1TFUA 3GCGA 3G0DA 3K1YA 4ENVA 1TEXA 3H04A 1FYFA 2WRZA 2OORA 1JP7A 1E96A 4JEUA 3EBOA 1NNUA 3KELA 1UFRA 4GPTA 1YGYA 2F1JA 1IN7A 4Y7DA 2ZBRA 3HHEA 5KQMA 3RWBA 4BE4A 4B7XA 3AR4A 4K8RB 1DEAA 1BVRA 1KVUA 2C2XA 2R6R1 1UR5A 5G2OA 2LXNA 5K51A 4ES6A 4NLLA 3KB1A 4RM3A 1R1DA 1N5IA 3K1JA 1RFGE 1BKSB 2OQVA 2OQ2A 3P97A 4KQWA 3IR7A 4RCYA 4W4TA 3VC7A 3T3OA 1NBAA 3F97A 3TQIA 2JARA 1DAKA 2H5EA 1GZUA 2XE7A 2VDJA 3ROFA 4DMHA 1KKUA 1ZVJA 1MIHA 3OIWA 3I6YA 2FUEA 1F3OA 1N7GA 2JIBA 3KLBA 3KQHA 3WRYA 3GD7A 1OXXK 4IF4A 3QE9Y 3MTDA 2ZU0C 4ERXA 3QVGB 1HY3A 2PVSA 1G5RA 4U3JA 3S99A 3U56A 3HJBA 3S4YA 4IDAA 3F47A 4TMTA 1GM5A 4AKEA 1O96A 4TWBA 2YFKA 1CJUC 1UIMA 3MBKA 3MGAA 1ZW6A 1N2CA 4I55F 3UUGA 1JVBA 1OBOA 3JZDA 4DV3B 1TCBA 1SUAA 2NN3C 1A5BB 2UVPA 3KOYA 1F0PA 1W46A 2JAWA 1JV2B 2BMDA 5DWQA 4BX2A 4I8XA 1XKTA 4YYEA 3EXHA 4US2R 4YUZA 3VJRA 4QYIA 2X1MA 3QLUC 3SF0A 5JVDA 4MLCA 5DW3A 3H7AA 5ARCA 2CLOB 3QELB 4QPNA 4U0KA 1QRUA 2W7TA 2GBPA 2DUMA 1U2DC 3ABQB 2QNIA 5HA5A 2A67A 4JL8A 2O8DB 2ACKA 3Q5DA 1QFYA 1MQ9A 2AOTB 2PMCA 2CBXA 1SKAA 4MVJH 3BTUA 2PZBA 1NONA 1NVWQ 2O7RA 2Z9DA 3A1TA 3C6YA 4XR4A 1N2SA 2HHCA 4PCUA 2PZAA 1JIVA 1KP3A 3AP3A 3F49S 3QXSA 4X7MA 1TEHA 3RU2A 1L3IA 2P27A 1R0SA 3I6BA 4MQ4A 2Y1WA 4Q6BA 3E1GA 1EXWA 1PU2A 5SICE 2GJ4A 1DL5A 3MYRA 3AQIA 4DCUA 1NNSA 4M1OA 3SEFA 1LGYA 3EQ8A 3MCUA 3Q9UA 1U9IC 2WP8J 3UMVA 4AIIA 5L7WA 1O0SA 3GH1A 1SEVA 3ZU3A 1E0KA 1SHJA 3RU3A 1G9SA 2NV2B 4IL5A 5JG7A 4LSWA 5C4IA 3B8EA 1GG2A 2QMOA 1JU4A 1XRPA 1NL3A 2KWIA 4RKYA 3JD2A 1NJGA 5K03A 3E3OA 2Y92A 3DBHA 3PGJA 4HZUB 3DL2A 3IURA 1AF4A 3VX3A 1V7ZA 1VYUA 3N87A 9LDBA 2ZYHA 4MV5A 1IZ9A 2WICA 1X1QA 5FTLA 4WERA 4HFMA 1LDEA 1SQSA 2XE6A 3S7ZA 1Y7HA 4P9NA 1QMPA 4XB6B 1KARA 3B1VA 2DJIA 5BNIA 3VTZA 1C1XA 3R3WA 4ZYYA 3R0IA 2PMFA 4M9CA 3AKEA 4H7JA 4LY0A 1B2RA 2V5VA 2C0CA 3ZY2A 1BS9A 2MSLA 1SCNE 3AV3A 5C8YB 1LK7A 4R9NA 5KWVA 2QROA 4FMPA 4B84A 4MVJG 3EIXA 4A23A 5BSKA 5T8KA 1IWBB 1XZAA 3IQEA 3PWZA 5DGCA 4DUGD 4FFWA 1XN4A 1OR8A 3DDZX 4JLVA 1PFYA 2H51A 2C2OA 4DNFA 2LIVA 2P4SA 3II6X 4RMHA 2PKQO 2GN8A 3CNNA 1AGNA 3JQ8A 3MQ2A 3DVAB 4R2LA 1SG9A 3HZHA 3RVOA 3U4HA 3UG6A 3PC6A 3WSWA 1B2LA 1VRWA 2GKOA 4YV2A 1TO2E 4ZYVA 3C3BA 1SQ0A 3C87A 3E9ZA 1Q7TA 1X2BA 2XZOA 2GN1A 3N70A 3H9JA 1Y0BA 2G7MC 4HZIA 3STUA 4NIMA 1WULS 1DRVA 2AQIA 3PHBE 3RE1A 5LMCA 3A10A 4RA9B 2ZI3A 2QL7A 4MWGA 5EZ5A 4DMGA 1JIUA 5BWNA 4I4IA 2B61A 3CH7A 1RKQA 5C1PA 4TMYA 5IH7A 3IIMA 3CBQA 1GEEA 1KPGA 2A5YB 3QH4A 4BDTA 4ZEOA 4M36A 1BROA 1GY8A 3LBHA 4FGZA 1T3TA 5KSYA 3OEEA 4YAEA 1O08A 3BF7A 1JALA 1M9NA 2ZSHA 2EEPA 3ELDA 4Z1MD 1T43A 1LCIA 4RIHA 5J2TA 1VLZA 2IPAB 5IS2A 5KNBA 2N1BA 2UZAA 5KYKA 1P61B 4LFCB 4JI8B 5CVJA 4M0CA 4X8HA 2XNDA 3OC6A 1INLA 1IZ8A 4J76A 2V9CA 1UKCA 1F14A 4P2BA 4N6OA 2DUUA 1W47A 2WIJA 3VOTA 2EATA 3DDUA 3UYKA 1JEAA 4CQJA 5ITWA 1M7GA 3SVTA 4Z2AA 5DHPA 1GNQA 2O06A 4PVCA 3WICA 1VTKA 2BBOA 1H5QA 3PUIA 2Y77A 2P75A 4KVAA 4TMXA 3SVLA 3BTSA 1O5IA 1SXIA 1RQPA 5HP4A 4L8FA 4KC0A 4NU0A 4UBKA 4RIGA 5TX7A 3IMFA 3O1HB 1RWNA 4QVIA 2D2EA 1MRZA 1U5BB 1EX6A 1XL0A 2AZDA 5EMKA 4ADSG 1E5LA 1JEJA 1WU8A 5JDIA 1E2FA 2GEJA 4YP9A 4X44A 5DTMA 2AOXA 3E84A 3GJ4A 2EBFX 4P7JA 4DAEA 4V1CI 3R9WA 4ZVQA 1CJKC 1U3TA 1VB3A 2ANBA 2R48A 3HO8A 3N75A 1YDHA 3JPYA 3QP9A 4IOMA 1WOMA 2DLDA 1T3SA 5FOXA 2XBMA 1USUA 2XUZA 4R84A 1T9KA 1U11A 3MS2A 3RARA 1AX9A 2MSWA 2OHXA 4L6AA 1NLFA 4BZXA 2VUTA 2XH8A 4W5HA 4FN5A 1I5EA 1COWD 1QOQB 1KQPA 4A8HA 1KZ9A 2ID7A 4YJ2A 1SN7A 1UDCA 1W35A 2DKNA 2K2QB 2QZPA 3OZVA 5JWHA 1W7AA 4F1KA 1KU6A 3QMWA 1PS9A 4YRFA 5KREA 3KYJB 1E58A 3AI3A 1ZHHA 3EMBA 4PYMA 4ER6A 1EFRD 2X5XA 1I1NA 2AR7A 2B8WA 5E7QA 3U4GA 3NP7A 3ZWYA 4F8JA 2XCTB 4AIRA 1V9CA 3O8OB 4IDDA 4KPUB 4IH9A 3GNTA 1USKA 1KIMA 4R9UC 4BQEA 3DQPA 4DR2B 4QREA 1ABEA 4QT0A 1E8NA 5JYEA 4N3NA 3O73A 3A27A 3TLEA 4NESA 2W6ID 1H0SA 3IA7A 4BN4A 4FDUA 4EVSA 3I52A 5CCBA 2XEDA 2W2TA 3OPQA 3HLYA 4U5XA 4ZODA 5KVQA 4A2WA 4CF5A 5ALSA 4ZCRA 2QMUA 2X40A 1IBSA 2BOVA 4H31A 1C9JA 2B92A 1Q6YA 1HDIA 1IQPA 2Q5EA 2XT6A 4UE6A 2B34A 1L5VA 2HJ9A 2FJ0A 4IXMA 4K46A 4QJ5A 1WZ2A 1OHHD 4HK4A 4YONB 5DT2A 3L41A 2VRBA 1CK4A 4UC0A 2GM3A 2IEIA 5LZ9A 5ALEA 3GLFA 3CUTA 3D81A 3ETLA 3V8PA 1YVEI 3I72A 3O2SB 3LY8A 3SKVA 4ENPA 3ZGVA 4LPSA 3MTIA 3HG7A 4C30A 4O4HA 5HE9A 1S2NA 3H9CA 1ZGJA 3P5SA 4OKNA 3DO8A 3IEIA 1ORIA 3HQ4O 4L2IA 4LF6B 4WA8A 3SMVA 2P6OA 2VAVA 1BFDA 3I3SR 4DRYA 2EERA 3QSGA 4KXFB 3H5TA 7ADHA 4QQ8A 5CX4A 5B6PA 1P9NA 3N2KA 4QRIA 3VGPA 4EI8A 4K26A 3NHJA 2DF8A 3PZRA 2OB1A 3V4ZA 2X58A 5CTJA 2GNAA 3H4MA 5EHZA 4NABA 1P91A 4JWTA 2QNRA 3HYNA 5FORA 2DH5A 5H82A 2XB2A 4LZWA 1T2EA 5EZ6B 3OP4A 4Y2UA 1W6UA 2JI9A 3KEOA 4ZZ0A 2ZJBA 3F3SA 4RPIA 3JAMA 3BK1A 4PG6A 4B81A 4CV3A 1IK4A 1KK2A 1G2OA 2QUBA 1J97A 1JUDA 2B21A 1KBQA 2WABA 5BURA 2DETA 3F78A 1J8FA 2DE0X 5LL6P 1N36B 1YUNA 2GRUA 2EG5A 3HVHA 4LE0A 1ZCBA 5JO9A 1PWZA 1CQJA 3TFWA 1PGQA 3CRNA 2GEBA 3ZWVA 3VVBA 3G5UA 4EABA 3BCSA 3BDVA 4GHWA 3T7EA 3DCNA 4FS8A 3IQXA 3MW8A 4CR6A 4L9AA 2RE8A 4R4JA 2PKCA 4P5DA 1UM9A 3O8QA 5D5QA 4ZCTA 2GZ3A 5A4DA 1CEEA 3K0SA 2AWNA 2LCIA 3DL0A 4HQLA 1WUKS 5ILOA 1OQAA 4AULA 4URWR 4ZU6X 2PUGA 1JEDA 4CKWA 3A7EA 4YN3A 1VLVA 1LK0A 3R23A 4JYPA 1L7RA 4LAFA 3WYCA 1ZH2A 5JNSA 2CB9A 1OX5A 2IYPA 2XQVA 2NQ8A 3D31A 3D8UA 5AVJA 1F0KA 1U9YA 3PRKE 1JQJC 1N92A 2IX9A 2QL6A 3KD2A 3K8YA 2CKMA 4ZDJA 1GVHA 5EZYF 2XUIA 3HJCA 1PNQA 4ALMA 3MMXA 3GW8A 1X94A 4WD3A 3PXXA 3OM0A 4I2VA 1G8MA 3TQQA 1M6YA 3DFFA 3SKXA 3TZCA 4TV9F 1M8PA 4YCAA 2IZ0A 2J46A 4IX1A 4MPJA 5F2KA 1Y9DA 5T41A 4KR7A 4I4CA 1T34A 1QIIA 1ZSNA 1UK9A 5B6JA 2V65A 3KBOA 4DCCA 5JHGB 3QLUA 2IU6A 2OE2A 1DG9A 3UUWA 4D92A 1YQQA 4LJLA 4TT8A 1QG6A 5EE0A 2VRWA 4OXQA 1OGJA 1J9EA 2B8NA 1U2DA 1W2WB 2HRDA 2PO7A 3EQ7A 3JCZA 4KXNA 4ZQGA 4BRZA 2NU9B 1KOGA 1YMQA 1N4DA 4MNTA 2BEWB 3LT1A 4PBTA 2LRHA 3R3ZA 1KR2A 2HGZA 4RL4A 4NZOA 2I3ZA 4E3ZA 2QGNA 1YZ3A 1V2HE 4NBLA 4WKPA 5FYQA 2Y1EA 4ZO4A 4BP1A 2AFVA 8ATCA 1WXFA 1AQLA 3S28A 4KWEA 2Q7DA 3PKZA 1SB8A 1N7IA 5IDQA 1GGMA 3GYBA 1QP8A 1PZGA 3NXSA 4WK2B 3ELUA 4G26A 3IIIA 3UMJA 4J4HA 4KLZA 1V4BA 4G65A 1KVSA 3M3DA 3NCTA 4DSTA 5DNYB 2BYTA 3LFHA 2XLBA 1FSZA 1C3JA 2ISSD 4HX2A 4INAA 4TQAA 2G5PA 1U9IA 1W5EA 1L8OA 3O26A 3AIKA 1QH9A 3LDHA 4C7KA 1LPNA 5IDVA 1NXPA 4R1NA 2BR4A 4E70A 1ITZA 2GBIA 4XDHA 3ORYA 1NR5A 1XKQA 1EWRA 1ZOPA 2B5OA 3ZEIA 2V0GA 2CL6X 4UQOA 5BN5A 5AJVB 5AW5A 4LE1A 1GAWA 2G17A 1KY5A 4OM8A 3EC1A 4LW8A 5D87A 1DXOA 3V48A 1C9KA 5M04A 1GIAA 5GP1A 2DC1A 5HE8A 4BL5A 1N7JA 3G85A 4QSMA 2DH6A 5DPMA 1EFHA 2CXNA 3USZA 1P8AA 3ZWCA 4AUNA 4LOAA 4GPIB 1RDFA 1ZC4A 4ZOCA 3GX1A 1GKKA 2C9YA 1DQSA 3QENA 3BWDD 4KTVE 4AT1A 3SQNA 4F11A 1QTRA 2BGKA 4TKMA 1G3UA 4U2EA 3H5LA 3WK9A 2A88A 4OGKA 4O2AF 3CNLA 2IHJA 3BGVA 3BMQA 4TWJA 2LTAA 2TS1A 1UJMA 1K0UA 1SHTX 2C54A 2NW6A 4W82A 3ZLUA 4YDQA 2DYKA 3ZLBA 3EC2A 4RKRA 5G0VA 1ZMXA 2O2GA 4LZNA 2DLNA 5C5IA 2L69A 3MMPA 1C9MA 3DE3X 2RCYA 3KU4A 5EXDA 4DDHA 1M1YB 1ZWKA 4I14A 3AZQA 4J0IA 4MS1A 5E6RA 2DERA 2OZKA 3TNFA 1YJAA 1KWKA 5EPUA 4BMCA 1ODFA 1OFIA 3VZBA 4AJOA 2ZRKA 3SOPA 1PR2A 4H3VA 4QO7A 4XWGA 3T7DA 4TKZA 3VAZA 2O1WA 3VUEA 4C3ZA 5CD1A 2PUFA 4LQCA 1Z0SA 5CVDA 3K8OE 4YC7A 1MB2A 1KK1A 1SZPA 5B58C 3GLHE 1I4TD 2PWBA 2BI8A 5EHQA 3CH4B 2NM0A 4DMUB 4BMDA 1YFJA 1P6QA 3GRKA 3EGDA 3MJRA 2QL9A 2Z1DA 2UDPA 1U90A 5AI5A 5FTJA 1V8ZA 1V8BA 3MNFA 3IP7A 4AP6A 3STXA 4IXTA 1E4VA 4ENSA 4U0JA 2EBUA 2I66A 1MPXA 2ZT5A 1FFHA 2YDYA 2COUA 2E37A 4JCOA 3HCWA 1XPRA 1Y34E 4KXMA 4QLBA 4I6EA 3LYAA 3F5MA 1ZQ1A 4NV0A 1GDDA 2I6QA 1BMFA 3E7DA 4YRRA 3U09A 1N32B 2O59A 5KHOC 2HMAA 3LUKA 1HETA 2X8LA 2V3VA 5LIRA 4KQEA 2ZSFA 4YP0A 4M76B 2VC2B 3AB7A 2RGRA 4GX0A 2A5JA 3ZYZA 4B71A 3NAMA 4CIAA 1DGQA 1SXGA 2IYWA 5F9HA 1H5NA 2OZPA 2AEMA 1O94D 3OFKA 1H6DA 2AF3C 3K6SA 5A71A 5LXTF 3PZBA 4HNAB 4XWAA 2GK4A 5U9CA 4TQGA 2GAJA 3AWDA 1AKEA 4E4TA 2PT9A 2R87A 3ZNQA 1A9XB 3ZU4A 2PH5A 5JAUA 3DDWA 1EBUA 2JBAA 2Q4RA 3IMGA 2HF2A 1CR6A 2K87A 4DPKA 1JIKA 2DPGA 5FNVF 1FLAA 5AK5A 3SZLA 2O54A 1K6XA 3ZDBA 3QVWA 4BX0A 3IVXA 2ZETA 3A4VA 5A3SA 4CV1A 4OBWA 3S2YA 3W7BA 5EJ5A 5ANRB 5FV7A 1XU4A 5EE3A 3IAS1 2VTBA 4HGRA 1D4OA 3FPGA 1M5TA 4TMFA 5EIWA 1KE1A 3IDFA 3H84A 1F8GA 4CKBB 4GW3A 2VP3A 3NKFA 3OPMA 1HDXA 1PJSA 1Y98A 2BFCA 3R77A 1YA4A 2QW8A 1LVUA 4H1TA 2FKNA 2NU8B 4DF3A 3BXEA 4C0BA 4UTNA 3H8WA 3LHDA 5KWJA 2P6NA 3RKRA 3NDPA 2C96A 1KFKB 4FHCA 2FTKE 3L6OO 3V9PA 2G09A 3B13B 4LMBA 3TSOA 2O6HA 1L5SA 3INTA 4N7BA 1OI2A 1TJ3A 2XQGA 4D97A 4F4FA 4GAEA 4OAOA 4RLHA 1YAJA 4L9RA 2HNBA 3AERB 2O1EA 3VPBA 1Q14A 1OXMA 4B4WA 3QG1A 1N6OA 1M7BA 3FGPA 1GFIA 2OZEA 2AT1A 4FSHA 4ENRA 4MULA 3OLYA 4C0XA 3M6FA 2FSVC 2HH9A 1Y5RA 3WQHA 2Z9CA 1SCUB 4ALJA 2ZXEA 2I2AA 3T9DA 4E2XA 2CLFB 1QFJA 3R75A 4EYEA 3AL0C 3RGGA 5DB4A 4D79A 3ROGA 2D2XA 1AKVA 3GJXC 3OKAA 4PYKA 3A11A 3T7CA 3PSHA 2PANA 4AO7A 2A1IA 2XT0A 3GYGA 1TL7C 2IZOA 3KTFA 1RPTA 1E4EB 2VHXA 3JWEA 1ISIA 3ORSA 4NH4A 5FUXA 4QATA 4Q1VA 1EQ2A 3K0CA 4G5HA 1FSSA 2E1PA 3EXEB 3SBOA 4L76A 3TO5A 4B8YA 4PN7A 1FA9A 1FNCA 1G4HA 2D54A 4Y1EA 3HXQA 4FWTA 4LF8B 2BMVA 3KVRA 3BXPA 3MIIA 5ADWA 3Q5GA 3T5AA 1CJSA 4NK4A 2ZBUA 1P72A 1XNRB 1PIWA 4M55A 1YC5A 5HGJA 4A5SA 5BUZA 1DJMA 5G53C 2Q4BA 4B17A 4CYMA 1LRLA 2Q2QA 1TU0A 4PZDA 1K08A 3NATA 3SR0A 4GYKA 1MLDA 3WLLA 5JH7F 4Q03A 3A2KA 2GYUA 1PJLA 4NS1A 1TD1A 3GFOA 3EA0A 1GHTA 1X80A 2LD4A 5GZ6A 1A27A 1HYGA 1QZ3A 1LBSA 1RU3A 1XFAA 2D4HA 2EJBA 3C7DB 2AMFA 5DM4A 3VV3A 1KJQA 1AMUA 2WF7A 1DKOA 1UPCA 3GD5A 4IX9A 3SZGA 1NNLA 2VCYA 4US0R 5IJ9B 2Q4OA 4PHGA 5AM0A 4PG7A 2PGAA 5J4LA 1T9BA 2VNSA 1DI0A 4QPDA 2NVWA 3CLSD 4ZJYA 1U8AA 4JVLA 3MD0A 4HH1A 4CFYA 3AEQB 4FLMA 3SC6A 5KOHB 2I2XB 2JHAA 4WVLA 1PJAA 3KLNA 3MRSA 3O91A 2KI5A 2UYYA 3TRDA 1QUEA 1SCJA 4YV0A 4PM4A 2EX1A 1CYDA 2QY9A 3GT4A 4LHSA 2F4VB 5CDYA 2BUBA 1EYZA 5FI3A 1AN9A 3F6EX 4DZTA 1L2TA 1U6JA 1YACA 2QVLA 5IBRA 3SHTA 4BBZA 1EFDN 1O0BA 3DV0A 3NUZA 2XQJA 1BE6A 2HV9A 2XDWA 4R7TA 3CW8X 3X44A 3V7WA 4H6PA 5DVZA 2UUOA 4FHZA 3MTGA 1NW5A 3HYSA 3PDHA 1RCUA 5IUKC 5TY0A 3UJBA 3CCBA 1RC1A 1RLOA 4HDOB 3SNKA 1YZHA 5JCZA 5AW8A 1RADA 4CM6A 2BGIA 3KOXA 4PNZA 3I5UA 2X8BA 2OLJA 1U0LA 2AE1A 3WB2A 1GU7A 3BIOA 3TXYA 4KQ2A 3EG5A 3DB1A 4INPA 1FFDA 4OXKA 3V1NA 2VDWB 3LQKA 3LO8A 3CLTC 4X94A 5CFQA 1K4MA 3AXSA 1LVGA 2I4TA 2WKRA 3C1OA 4U2CA 1ESCA 3DUWA 3TW4A 1CJTC 5DCLA 1DV1A 2QJTA 3JD0A 4HWOA 4J6FA 3MXOA 1MC4A 1J9GA 3QQ5A 2PAAA 2H2GA 4HO1X 4QHTA 1EH5A 1QZZA 2EZ9A 4Y2YA 1A2QA 3A70A 5GQSA 3MT0A 4P81A 3UUFA 5JCPA 4TLBA 1X15A 3P9CA 1BD4A 1OIWA 1V1MB 5G1NA 3WK4A 3D5TA 3QVUA 4Q66C 1WHTB 4B9AA 4RACA 2PH1A 2LKCA 3HR8A 3J7TA 3ROMA 3G7NA 3P2EA 5JSFA 4HMPA 4R40A 4TYWA 1BTOA 1K6JA 1G18A 2O20A 3U7JA 1YC2A 4YRCA 3WISA 1D0SA 4I4TF 3PPIA 3RYIA 4NMWA 2C20A 4PLFA 4NOLA 2IS4A 1YU9A 1NN5A 3IYLW 4WGGA 3F7TA 4X95A 2DUWA 3LBNA 3AHFA 3LC1O 4E1VA 4EA6A 4RSRA 4F3TA 3Q6IA 1E3DA 2HFKA 4ETWA 2H1WA 3MT9A 4HG2A 4X3CA 1XQ1A 5CHEA 4JCCA 5ELLA 2KW5A 5BW4A 1T9GR 1V8PA 2XVYA 5D6OA 2JIOA 4RLFA 5K4AA 2BFOA 1OI4A 3KAKA 5EHIA 2XCOA 2B1QA 3FXAA 3KK0A 3O4VA 2XXJA 4MUJA 2HQOA 4ODIA 4PQGA 5TT0A 4ZZ2A 3S29A 2B4RO 2CFOA 4PZ0A 1RQXA 1HI9A 3MXTA 2ZRPA 5JROA 4BBPA 3GI1A 2DGDA 1SZDA 1TQHA 3KQTA 5J58A 2OUIA 2WUEA 3PEWA 3EMDA 1RAHA 4RVOA 1Q0LA 1M83A 2I6GA 3TE6A 3V2UA 3AKYA 4BNIA 4UPVA 5KTNA 5EXTA 5EJ2A 3H2IA 3ZGOA 4UTZA 2WOOA 3W5UA 1ZGZA 4G23A 2ZI4A 1TK9A 2CLCX 3C45A 2FRXA 2FZ5A 3E7FA 3KLOA 4QFMA 4ABTA 3RREA 1IXYA 3OCXA 2D7CA 4AN0A 5KNLA 4Q15A 3CXRA 3LT4A 1LY1A 2QLJA 2MHCA 3KZCA 1L5KA 4MGHA 1OTHA 2A6PA 2FLVA 1G8FA 3KAPA 4GI1A 1E98A 3VKGA 4HAOA 1O3YA 5JAZA 4EF5A 3OHPA 4Y6GB 3TAXA 3GGJA 3SAJA 5JPDA 5KSWB 2W8ZA 2IEBA 1T26A 2JANA 3ZJTA 4KHPB 1TUBA 1FP2A 1QCYA 2HSJA 4UNNA 5JWOA 1Y8RA 1RBMA 2G40A 2PLNA 1X7XB 3EDYA 4YJGB 5M5BA 1TEVA 5C3UA 3ZLJA 2JZOA 4BUZA 4NE9A 4TV8A 1V0JA 4L22A 4ED9A 2G80A 3SIPA 4DBLE 3BD9A 4FEYA 3Q87B 3U6BA 3ZK7A 4HXFB 2FOLA 3DGFC 3NTVA 3H5NA 4ENTA 1KK3A 3FNIA 3EGXA 1C14A 3GNLA 1Z36A 4L6IA 4P3NA 3GF4A 3RAJA 1ZCZA 5IVPA 1DT5A 1JMVA 1EVKA 4M87A 5BV2P 3E9EA 2A5DA 4MTLA 1TVKB 1V48A 3L8HA 1T5OA 5H8WA 2VYVA 1J1IA 3TLMA 2G28A 3UXYA 4C7VA 5JNWA 3ZVKA 3E27A 1SCIA 2QMZA 1Z5NA 1V37A 3PHIA 3K9LA 3JQQA 5JQGA 2QUZA 4E09A 1A9PA 3LS2A 2CYCA 2NO0A 4EYGA 2ZM6B 4LBVA 1KVTA 1N8SA 4GUAA 3C41J 1R8XA 4LJAA 5EA2A 4MEAA 2P40A 5AVTA 2XDQA 4XGRA 2X7HA 1VSUA 1ZH0A 1YBHA 3H3JA 3VR5D 3O1IC 2VQDA 2M6RA 3VU8A 1CUUA 3G0CA 4Y3UA 3W78A 1YZFA 4K9RA 3LXXA 3TLJA 4E2WA 2DUNA 2RHDA 3VR0A 2H1CA 4ZJZA 2OPBA 2R8BA 5KS2A 2P77A 5B58T 2REXB 2VPWA 3QVTA 3RI3A 1ZLXA 1FX1A 2F1RA 2FP4A 1FTYA 1M2KA 2OBNA 3LDAA 2OXCA 4YJFB 4NCHA 2IGTA 2GHIA 2VYVD 4JLJA 4MAMA 3SPXA 3V3KA 2AKAB 4D4HA 3UJCA 4AJ4A 5KZMB 4OKSA 3EIFA 3W3AA 5AVOA 4ZV9A 4DR5B 1N2ZA 2CXTA 1EA7A 1IFXA 1QG0A 4GO1A 4KK4A 4EGAA 1CUWA 3MS4A 3NHRA 4P4TA 1ZU5A 4KE8A 1QUFA 5IAGA 4PYOA 1XAJA 4BNKA 3L1UA 3HFJA 2VDLB 3WFIA 2YNMC 1CJCA 4D41A 4EPRA 2LWIA 3OBIA 3LI2A 2IIVA 1M0SA 2B1RA 2EKBA 3MLBA 4CE6A 2J4DA 3E9DA 1L7DA 3QX3A 3A9WA 3PGMA 4Q7QA 5IF3A 2NTNA 3ZGZA 1AZTA 4XPIB 5DCWA 4UHFA 2VHQA 3K35A 4LZJA 1FDVA 2PUJA 2ZJ8A 1XZIA 3I5MA 3IODA 1HG0A 3B78A 3OTHA 2QX9A 5TPZD 2YASA 4KH1A 1QYWA 3EF3A 1WCWA 3RUDA 4LRTB 1T6BY 3ZHSA 2YHUA 4P80A 3RUFA 5CYOA 1XMIA 4N4AA 3C4QA 3I9NA 3BULA 3QEKA 1QZXA 4WXYB 4ZDKA 3ENWA 4B1FA 5BQFA 1P2BA 1RRFA 1F0NA 2X0DA 3P2YA 2QR3A 2XWPA 3KV1A 2FSVA 4NF2A 1JQ5A 4DQ0A 3M5PA 5KEIA 2CL0X 3LJKA 2X9LA 3WA7A 4YQEA 1YIOA 3OOSA 5CXSA 3LBIA 4OVKA 2JL1A 4RMNA 2HTFA 4URZR 3UNXA 2WPDA 1SRRA 4Z4QA 3ADCA 1M2EA 2VPPA 1ADCA 2YWJA 4NCXA 3NHWA 3GJ5A 3EXAA 2W0MA 4GLFA 3QQPA 2AOUB 3VR3A 2AD1A 3FWHA 4EY5A 1GL6A 1UUFA 5JRZA 1Y1LA 4KO2S 5JOQA 1QVVA 1U02A 3IPAA 2ZRHA 2QRPA 2OXTA 3VZRA 2YV4A 2VNKA 1IB6A 3JQCA 3F5FA 3ESZA 1DTWA 5EHGA 2DCMA 4K9DA 1OVMA 4ZYTA 1V8DA 3ED1A 5BSTA 2HBZA 1ONNA 2O2JA 5BWCA 4HDNA 4CXMA 3BXHA 2XNJA 5TQVA 2IS6A 1OKKA 1XWIA 2C1XA 2FPIB 4CEIA 4CJXA 3MTEA 4C2UA 3MCWA 1ZS9A 3VNBA 2B1GA 3CCCA 1KDPA 1TU3A 1XDSA 2IVZA 2OEPA 2X9QA 2PX3A 4GS5A 1X9IA 2HA4A 3NIFB 5B1DA 3U7FB 2FK7A 4I1SA 4FMCB 2WILA 8AT1A 1PR9A 2PX5A 3HJFA 1JT2A 1ZISA 1Z5ZA 2YY5A 2ATXA 2FQWA 3AVWA 4XLLA 1FMFA 1DUSA 3ZVNA 4BO8A 2EWVA 4FX5A 5EVJA 2XNKA 3QF4B 3KETA 5ER6A 4RZUA 5M29A 2XDAA 4R9SA 2RMKA 4MGKR 5TF4A 1PR5A 4WLOA 2X6QA 2ZCUA 4NMLA 2UXCB 1YZNA 1E4OA 1T8SA 1WHSA 2AEFA 2FEWB 4M9RA 1HK7A 3HNPA 3P0IA 3TX2A 2ZDHA 4ARCA 3HWSA 2V7UA 4IH1A 4XVHA 4HMQA 1PJ8A 2OESA 3STWA 3PNPA 1FS5A 2NUTA 2AK2A 4TUYF 4ZV4A 4BFLA 1YKFA 4MRSA 3DLAA 3PEEA 1NQ5A 3HSSA 2V7TA 3VO2A 4F71A 1NI4A 5JISA 1T1SA 4WAUA 3WNDA 2H7YA 5IT5A 1PJCA 3WVNA 4E5MA 4A27A 1DFGA 1JSCA 4RDIA 1GZVA 1W76A 1DOHA 2VEDA 4PZZA 5FXMA 3FMFA 1EP1B 3NTUA 1DAPA 4YS6A 5AVSA 5GZ3A 3KDPA 4KU4A 4E94A 2UZ4A 2V5UA 2C5AA 3FFXA 3F9CA 4MGEA 4WN9A 3TQHA 1BS1A 3BGSA 2ZUCA 4MROA 3PICA 4QUBA 1IOWA 3ZEAA 1BEZA 3HUTA 5CXQA 4J2OA 3CVYA 4JLPA 4KBYA 3SQWA 2HU7A 3HR4A 3OMWA 3DVAA 1SBZA 2CLKB 3H9GA 2HQRA 4RKEA 2RGXA 2W2OA 3WWYA 4EK9A 1HDEA 3N2GB 1QR2A 5DASA 3GG2A 3HCBA 1FBNA 4ARZA 4V3BA 5IKMA 1A71A 3LUFA 3LY9A 3VOBA 2VRNA 5I3ZA 2B37A 3H19A 1RTKA 5MN6A 5IT9A 1ZESA 5FYDA 4QASA 1X3SA 2YJTD 4MV0A 3EWAA 1UC8A 3LYHA 4LGCA 4AF6A 1G60A 4LEIA 2BMFA 2HA0A 3Q8XB 5K3OA 2BR3A 4M38A 2HHLA 2QD3A 4Q3KA 2QN1A 3SCZA 5JEDA 1NPDA 2A0YA 2FEMA 2J7PD 5H02A 4QLOA 3U7QA 4ZOQI 5KKNB 1GYQA 1T0PA 3AJRA 3AVQA 1H1LA 4KQ9A 3ANLA 4Y1FA 1IHDA 4PC2A 4BFTA 5CB4B 5B3AA 1ZMBA 4NEGA 3RHTA 2JDID 4AYWA 5L7TA 3SM9A 2CFTA 2NADA 3CPSA 3RS9A 1SVMA 3LWBA 4KFCA 4QM7A 2P65A 3FPFA 5LOVB 4CGZA 1HSZA 1P18A 4NG5A 1RR6A 1XQ9A 4QUHA 3TW8B 5KU1A 1LC0A 5HYVA 2PYZA 3RLIA 1DKPA 4MP3A 1LKZA 3ESQA 4MKFA 3AIIA 1R0XA 1C3EA 1OAAA 4DCSA 4B7UA 4B3IA 1BAPA 4JJAA 3G6WA 5EFZA 1GUFA 1JI0A 1PT7A 4MWSA 3HEMA 4U7GA 5JJIA 1HQDA 2C95A 1KJNA 3FM9A 1W85A 3GAAA 3NBUA 4BXOA 2CJWA 2FEXA 2WQZA 2D00A 3IS3A 1V6SA 1L8XA 3DAYA 3QPDA 4QC2A 3AZOA 5JUWA 1GZDA 3CF2A 4YJDA 1RWKA 5E9QA 5JU6A 5FWYB 3D8HA 2Q9AA 1E2UA 3NEAA 2DY1A 1NLUA 2YWEA 4OQDA 4LSZA 1P2SA 3G2OA 3A25A 1KMHB 2XTNA 3DEFA 2F59A 2RARA 2WEKA 1CBUA 2WHXA 1Q1AA 3DOCA 4RVFA 5ER9A 4BLUA 4CUJA 2ZI7A 2B82A 1HFJA 4YAFA 3L84A 3VVCA 3A1WA 3ZV6A 3RUCA 5HRUA 3AF3A 1ILEA 3CB2A 4ZOLA 2V1UA 4K9QA 3K30A 4JZKA 3D3NA 4YR9A 3T1YB 1QSGA 5CEJA 2CE7A 1D4AA 3WLTA 4C0LA 1WNFA 3DW1X 2JH3A 3AF0A 3GUYA 4LRWA 1PTKA 5AOVA 4AU1A 2IYLD 4RVHA 3W3ZB 2G1AA 4DJ5X 2LDXA 3PXDA 1WMFA 5FULA 4HGNA 5KNDA 4XGKA 1DBPA 1CP2A 1KXZA 1TOAA 3O8OA 4J94A 4LDNA 2GRAA 4UQLA 3H8SA 2A9JA 4ZTUB 1S2IA 3AIOA 5FQOA 4YACA 3G8CA 5HG0A 2Q8NA 4E7OA 1XKXA 4UREA 3KEGA 4DJAA 3P9NA 3THRA 1QCZA 1OJ7A 2JPDA 3F2IA 4RKWA 1MQAA 4FHGA 2N1MA 4NEHB 1CIJA 3FMOB 4CMAA 1RRCA 4J90A 3FDIA 1UAGA 1VI5A 3A9TA 3RV4A 1RI2A 5K4HA 5AVKA 3OA0A 5K8LA 1YFKA 2QB5A 3ZNPA 4KO1S 1S8AA 4PGMA 4C0SA 2YJ3A 3NEYA 1DIHA 2OBLA 2HXGA 4EHBA 2GO1A 2WMOB 3PT9A 1NW9B 1EGMB 2JIDA 2FPXA 4HFJA 3PQCA 4CF3A 1MH9A 2GWRA 5BRJA 3T3HA 3IQWA 1H05A 4KJXA 4FXPA 1N6NA 3T3NA 1UEJA 1C30A 3KXLA 4OFXA 2FQXA 5DWVA 1WDMA 3ER6A 4IDCA 2OBBA 1CETA 1U04A 2YICA 3B1YA 3GPDG 2PKWA 3G13A 1T3GA 2ODQA 4BUCA 3EW9A 3FMGA 3IAAA 4MA0A 5AOBA 3P9ZA 4FFRA 2XV1A 2B99A 2YRXA 1NW6A 1VJCA 2A9FA 2FR0A 4KN9S 1PX0A 1EKXA 1XLWA 3KNZA 4WXMA 5CFOA 1R6AA 1ONPA 5FUWA 1T9DA 1P5FA 3NTQA 2I4IA 4IOLA 4O4JF 2XI4A 5CVUA 3WLSA 2Q3DA 3C8MA 2DHQA 3P2OA 4G9BA 5CNIA 5LWQA 2W71A 3V8MA 1LNQA 1OH6A 2VBFA 5LJIA 4A16A 1ZK3A 3Q3VA 4JH0A 1D07A 1KAHA 4PGHA 4TM8A 1HL7A 1EJ0A 1FU8A 3MLAA 2DSTA 4PLTA 2CCGA 1L7VC 2GM5A 4RHUA 2WUFA 2YNMA 3HL4A 4I1OA 3RFUA 3RVPA 2H8GA 2NWQA 1AV6A 4IWXA 3R9XA 4NU6A 5B2ZA 3RBXA 4PU0A 4XFDA 3ZJ4A 1GYRA 1SUPA 1LDNA 3NKVA 4GGMX 2O0MA 4Y2GA 3SIRA 2J0EA 2VQEB 5JCOC 1PJTA 1SULA 4UJ3A 2ZSKA 1RMTA 3O1LA 1PEAA 4QOSA 3NPMA 5EXPA 2M32A 2Q9CA 3HVJA 1T5IA 5ALGA 3ILSA 1LZLA 3O4JA 3DAOA 3VVLA 3MJTA 1C1YA 4EEXA 1ST2A 3L79A 2YFHA 1P4GA 1TUGA 4LCBA 4MYHA 1OFUA 1Z22A 2A1UB 2RGCA 2Z2JA 4IVNA 1NW8A 5HCNA 4F9FA 5L6LB 1YS1X 4RESA 1L1EA 2MTBA 3PWKA 4AZTA 2FDCA 1EDBA 3WB9A 4PX3A 3Q3IA 1UM8A 1IJBA 3DWEX 2ORIA 2M98A 3I0ZA 1DEKA 1KSGA 3IP5A 1TT5A 4QWWA 2J0UA 3I2IA 3TPFA 2O4CA 2XYRA 1PDOA 4KP7A 3IUQA 3IAHA 1IC6A 1OROA 1L7XA 3KJZA 1KY4A 4KAJA 2BGLA 1C2YA 1G3MA 5L3SA 3ZDAA 4BVKA 1IOVA 2BZ1A 1TK2A 2FKAA 1NXSA 5JARA 3TG8A 3DFIA 4XB1A 1YE3A 3NHLA 5CVEA 3ZK8A 1DCMA 3M6WA 3E1SA 5JALA 4QXQA 1I01A 4EFNA 5BQXA 621PA 1Y4UA 3DR5A 4OHVA 2Q50A 1KRXA 1JKXA 5D51S 1NPYA 3HXMA 4BV3A 3QUBA 4Q93A 1L5OA 3BGWA 2E5WA 3IVMA 5BRNA 5BSUA 3SJCA 4DJTA 4TS9A 3JU3A 3U61B 3TIVA 1ZMOA 2BEWA 1A88A 1PG0A 3HZZA 1JVNA 2C5HA 5JXJA 4LFAB 4HXEB 4ND8B 3I09A 3VPFA 2QJFA 4EJ2A 2HQ1A 4GH5A 4QUAA 1JEQB 4IIBA 1NIPA 3A37A 4RANA 4HUQA 4ZCQA 5KCZA 4UCQA 2C94A 2C42A 2PMDA 1B8OA 2CLHB 3BM5A 3ZNNA 1EDOA 4E07A 4S1VA 4B4DA 4EHJA 4PLZA 1B15A 1YK0A 1QP0A 1L4YA 4B47A 3SX2A 4PRLA 4UHKA 4MA4A 4CKCA 2XXAA 1UCFA 2OCAA 2P3SA 3ETNA 3PUJA 1EHCA 3PV0A 3K0EA 3LCMA 4CKYA 4QDXA 1C50A 1SKMA 2RHRA 5F9FA 3I1IA 3C14C 3CFYA 4HDKA 4EECA 1CF9A 1NVDA 1NYTA 1FMCA 2YXEA 2Z1NA 1EE2A 3DOHA 3GJTA 3O95A 4KUHA 3H7IA 3TVTA 3WAKA 3NZEA 4DIMA 4C04A 4G24A 5DOZA 1WCV1 1GPDG 1X9HA 4FXOA 3RIGA 2WSYB 1AK2A 3DF7A 3LLVA 2OGWA 5DI3B 2WVJA 4PAGA 2QLLA 3NVMB 1I6MA 3DBOB 5I7FA 4EW2A 5DNVA 5IJWA 2X4LA 4ZV7A 4HKTA 3D6VA 4UCWA 1E7QA 1XWFA 1UZLA 2GHQA 2H1FA 3NBZC 2O2DA 4WZAA 1L5HA 3W6UA 3WTCA 4UCFA 3ZXYA 3LXUX 1IB0A 4GI5A 4BNVA 4FILA 2WSBA 4M83A 1V7QA 3EQZA 2FI1A 3HBJA 3IBYA 1ND6A 3W05A 4IGFA 3CA8A 4YFYA 3OY2A 3PR3A 1GN8A 1ADBA 4W99A 5FFNA 4ITRC 1HFKA 1VC2A 2Q0HA 4LWQA 5IBPA 4BB5A 2QSJA 2QX7A 3M5WA 2FZLA 3AEUB 3LBAA 2X15A 1RXVA 3BZBA 4KUEA 1YTUA 5DHTA 5AI9A 4B4VA 4TTQA 1TKAA 2Q0XA 3FA2A 2YH2A 1I7NA 2QJOA 1AS2A 5EY5B 5CB0A 4JC8A 1TM4E 2CK3D 4U4AA 1A8QA 4BNDB 4F8YA 5JZSA 3SOZA 4Q3OA 5JI3E 1M3SA 1GA1A 2ZIWB 3W5VA 4KG7A 1YOVB 1DDIA 1M72A 1RZ3A 1FY2A 4I46A 5DN6D 3A6DA 2XRZA 5KVAA 4MAFA 3RVNA 1RWXA 2WHPA 4FT2A 3AINA 1V16B 1KQOA 2GZ2A 2R751 5K3CA 1R50A 2A5FA 4KLCA 1FQOA 5F78A 1PJBA 3H0EA 3KL4A 1HTTA 1WJGA 3T7AA 3KXDA 4HVLA 1N0VC 3BKWA 4GL2A 2XKJE 4GBMA 4UMFA 3CX7A 3OJOA 2CD7A 1OWMA 3S7TA 1U80A 4YXFA 5A4IS 4UVDA 1XTQA 2R65A 4IZ6A 4JP5A 4O8ZA 2OHJA 2YVLA 2C5GA 3ABRB 3KSZO 2VBIA 4TMWA 4BNGA 3QI2A 3ER9A 3QBDA 5COBA 4FZJA 3DDNA 2OGTA 1N6HA 3FNGA 3QI7A 4I1RA 2BH2A 3LQ1A 1IK6A 1J07A 1NHGA 2VO1A 1I4DD 3KZNA 5CK5A 1C1DA 1WDWB 4V2UA 2BP7B 3CINA 4AQDA 3THOA 2YMMA 1OYYA 3P9XA 2XR1A 1NY6A 1K68A 4LX0A 5EJ9A 1V5EA 4D9FA 4MDHA 3L4SO 4I19A 4IHJA 5CPBA 4IG4A 4U2KA 4W1QA 1XJWA 5FB3A 4AKIA 1RJWA 1XQ6A 2MYUA 1A97A 1ZD9A 2WJHA 2WWFA 2YL2A 3R0XA 4HNAA 4K8OA 5F52A 1T2NA 1U6KA 3LHIA 5I4KA 3IJEB 2CNOA 4BKMA 2OC4A 1YQDA 2YN2A 4BMZA 1ISHA 1VRCA 5KNBH 1A9XA 1YVDA 2GPJA 1M2NA 1HYEA 2BHTA 5LDHA 4YJ3F 1JA0A 1WZIA 4WRRA 4KBGA 4Z9BA 4II3A 4R9VA 4IEFB 2X76A 3VMMA 1E0DA 2I91A 1I1QB 3EUEA 3DBVO 3NGXA 5A7HA 4ZXPA 5IXSA 3AX6A 1JLRA 5JADA 3E8MA 1HYBA 1KIAA 4FE3A 5AT1A 1VCNA 5A3JA 4L50A 1F4LA 3RS8A 1Z63A 4J7XA 5GVRA 3V1YA 3UOWA 1GGVA 1ZG3A 2GT1A 2XAAA 4CKBA 1V8FA 3DFUA 2Z4TA 5A5FA 5CNJA 1KDVA 4UW9A 2QRLA 2X7JA 4K6CA 1NBMD 4WK4B 3NLLA 1XAGA 3WIEA 4PBSA 4DCMA 6PFKA 3C8DA 4HQ0A 5AI8A 5KCMA 5IT4A 4JJ6A 3BJZA 3H1AA 6NULA 4H1UA 3VHXA 1YF3A 1M2OA 3ESCA 4WFKA 1EK2A 2ZJ0A 1CEXA 3IQGX 3L8CA 3WLAA 3WKAA 2PGOA 5F5LA 3HDYA 1AJEA 3AERA 1HDGO 5CD9A 2GCNA 1QO9A 4RS3A 3IDAA 1FTSA 1Z5WA 4KJZA 4OBBA 4R2MA 1K9VF 1B1AA 3D1LA 4QUGA 4R6XA 3GIWA 1FW6A 2PX4A 4ND3A 2HLPA 1KYVA 5ALZA 1KXJA 2ENWA 1FJ2A 2XCUA 4QT4A 1S4MA 1SCUA 3TOSA 3P52A 5BMVA 4F21A 4XSVA 3JQDA 1GOTA 1LLCA 3ICCA 4O3MA 4N82A 5F3WB 4QJ3A 3OTQA 1Z39A 4MLDA 3OZSA 2QG6A 3BMOA 2A4KA 3NFYA 4LNUA 4BRUA 1DFIA 1P62B 4L5YA 4EG7A 4YP7A 4IS2A 3EPPA 5FI0B 4H0CA 4IDEA 4DRXB 4QM6A 3QM1A 1ZRSA 4IICA 1BXKA 1ULSA 3A4LA 3C7AA 2FPGB 4BB9A 1R6BX 2QTMA 2FOIA 2OD2A 3ICEA 1Y82A 3R5JA 4U8HA 1XHEA 1D6MA 3QA3E 1KOFA 3MINA 1JZQA 1L7MA 4B40A 1V3QE 5COAA 2IKQA 5IJZA 1R9NA 4TLDA 2ZW9A 4QTZA 1K5DA 2QE6A 1FJXA 5MHTA 5DISB 2WHYA 3INNA 3NO4A 2FJUA 4S3MA 4ETNA 1NOIA 5H4GA 3OZUA 1IJEA 1C0IA 5M7EA 3ECCA 2QV0A 3GELA 3RRZA 3OECA 1X7DA 4MLPA 3K6JA 2ZRCA 1F6BA 3TR0A 2Q0QA 2EJUA 2Y76A 3D3WB 4G81A 1EJ2A 3DC2A 2JJ1A 1PTJC 4JXXA 4ISBA 1U0SY 1CUYA 1Z2CA 4JVNA 3GLHB 2Y1OA 1JHZA 4LDJA 4QPJC 5MN5A 2PJRA 1XCGB 2C4UA 1I33A 1KNXA 2B1IA 4MKGA 4QEKA 5TLSA 1URPA 2ILVA 1YZKA 2ISCA 2WJAA 3FTNA 3AEQA 1S7GA 4OB7A 4XZ3A 4JB2A 4ND1A 2ODWA 1SY7A 4FK8A 4GOND 3BIJA 5KSPA 5AJXA 4MR9B 1EM8A 1U28C 1FBTA 2P9EA 3U7EB 3VJMA 1L4UA 1UKVY 3ZHBA 3UFXA 4Z86A 3BA6A 4L5BA 2J8ZA 2Q8QA 1EAMA 1NF3A 4HUJA 4Q3NA 5DYTA 2H08A 2O23A 3K1TA 2XW6A 3TX6A 1D1SA 1OCEA 5IDYA 3TD2A 1MB4A 1O7JA 1W0JD 1RRVA 2B4AA 2O5RA 2OQIA 1GKLA 3EEBA 4X61A 4YCMA 3AFOA 4BWFB 1AY0A 5IM4A 4LBWA 3AHHA 1Q3HA 2HKIA 3VU0A 4DIKA 3K0FB 5AKXA 4D9IA 1OFGA 4CEHA 1NQXA 2HB6A 4L4RA 2EWMA 5IJAA 2ZXUA 3MPUA 2AYZA 1KDTA 1VG9B 4X1OA 4E1BA 4BN0A 1ZIPA 1AD2A 4KNVA 4CMIA 1EP3B 2H5LA 3BWYA 4EDFA 1HNWB 3E7WA 2CXOA 2XA9A 1BE8A 3RSQA 4M54A 2J31A 1U3DA 3IAS6 3GB9A 1J00A 1QH8B 5TVKA 3RT9A 1FDIA 1NQUA 1UFQA 4RD6A 4MWZA 2CD9A 1WQ1R 1CHDA 1FOEB 5DNAA 1E1QA 1QH1B 3ZQUA 1U63A 4UVGA 2C04A 1BKYA 4XVUA 5KYNA 4L1KA 3MA0A 2JH9A 5JSZB 3RSLA 4KDRA 3DM9B 5K3DA 2ID8A 2ETVA 2NSLA 1V1MA 2VTVA 4AJKA 3GJ7A 2FW9A 2P3LA 1WDTA 2V7XA 4H16A 5T4FA 5GAJA 2VDKB 4OXYA 4V0ME 2ZQZA 4QOGA 1D2HA 4FCWA 4N0MA 3QPVA 2IDZA 2ZJ7A 4PPQA 1NF9A 1NQTA 1KPIA 1Q95A 1ZI6A 4JLBA 5C8VA 5JRDS 1XVVA 1XDZA 2QAGC 5ICEA 1IEQA 5JVDF 5KYUB 5LMNB 2ADMA 3G2HA 5ECYA 3K5WA 3IJRA 4KDFA 4URYR 3SYKA 1G5PA 3H75A 4IMIB 3WK8A 1WZEA 4P08A 3L7DA 1U2TA 1DE0A 4CIWA 2GVZC 2AXEA 3DBIA 5HBRA 4DC1A 5HM6A 5J1TB 5JBQA 5K5EA 2W90A 2VT7A 3KSMA 4JP8A 4DNXA 1D04A 1TZCA 2OWDA 1F8XA 3VR4D 1VPEA 4IJQA 1IRXA 3TS1A 1IZ7A 4D4GA 5I7WA 3BRWA 4M53A 2V7GA 1CR1A 1NVAA 3BB1A 4LX8A 1OASA 4O0MA 2H2HA 1U98A 1JKIA 1U8EA 2HF8A 2Q5LA 4IF6A 5C3MA 1BW9B 4FFNA 4HBZA 3LQYA 4FE7A 1WTCA 3NI2A 5ADVA 4Q1BA 3DOIA 4WOJA 1DTSA 2JGJA 2Q2WA 3EPRA 1G66A 1FUKA 3FPEA 4OUDB 1OX4B 1YR2A 3QXCA 5BW5A 4RPGA 4AWBA 3MMSA 3MJDA 2QN9A 4UNIA 5LLDA 4R7ZA 4D0NA 4HDRB 4AJNA 3SSAA 3QXXA 4HNGA 2NTJA 4OKIA 4BZQA 1IM2A 3OAAD 5C1DA 2BRUC 1JEOA 1EFAA 3HDGA 4OMCA 1WVGA 3WGGA 1RPZA 1EMDA 3FGZA 2ZBGA 3LQRA 1ESZA 1KI8A 1TKRA 2ZB8A 1ZM4A 3IMEA 3O7WA 1MA3A 3CPJB 1H9AA 4TLLB 4F6CA 2YHSA 2FW1A 4G37A 1E1RD 2DPMA 1U4OA 2EP7A 3HB7A 1ZH8A 2COEA 2F1KA 3HU3A 4GX5A 4LXUA 5CH5A 4D9NA 5BYAA 5KSOA 4AMYA 5D7NA 3STYA 1JLHA 3KR1A 4KMOA 3K9CA 3K94A 1BDBA 3ZHTA 2IXDA 4RWEA 3PIIA 4TM7A 4DWVA 4E13A 5KTKA 4C7OB 1IMOA 5B7GA 5DLDA 3OO1A 4JB3A 1LPAB 4NULA 3DTTA 3BFJA 4XOIA 1UDBA 5K05A 3L7NA 1CZLA 1I0LA 4RL6A 2JIQA 2YVKA 2QGZA 4JKOA 2PCJA 2RONA 1RQLA 1TVKA 1RYFA 1Q84A 2WFMA 3O4HA 5BXYA 1SELA 5EKUA 3PDIB 1GWNA 3I01A 2C31A 1KKMA 4NDZA 2VJOA 3ZE1B 3GL9A 4KN6A 1NWCA 1JHDA 1R8SA 3D7SA 3H9UA 5AJWA 4B0OA 1AM4D 4EF4A 2A3NA 3U3ZA 2PX8A 4K40A 1KJWA 3NT5A 2JI4A 5LM3A 1NVMB 1V5FA 1A4XA 4YMLA 5LBIA 2YZGA 1TLTA 2EARA 3VO8A 3MWKA 4RXTA 1YDEA 5A05A 3TUJC 2P2LA 1RFLA 4HLNA 1OYOA 1UEXC 1W73A 2PGNA 4EVRA 3CHYA 3CVWA 3HABA 1E1LA 3EXIA 3UCXA 1US8A 1BXGA 4A26A 3T3GA 4X6XA 4LOJA 4FHDA 4YJFA 1C3VA 1TECE 1J2UA 2P1ZA 1Y9JA 4MS4A 3KHUA 1LSSA 4XIIA 4KQFA 3DD1A 1KF0A 3JARA 1G21B 2O2SA 2YC4C 3KO8A 4H08A 4L85A 3QWAA 1NV9A 1NZDA 2VTEA 4M9QA 4QYSA 2P2SA 1EHYA 3E8XA 3L0ZA 1BWPA 5I9NA 3G0HA 4NU5A 2I2FA 3SC4A 4MMYB 1G7RA 3DZJA 1OVGA 4GMGA 4MDYA 1GARA 1IHXA 4MWEA 4K7JA 1WPXA 2VS1A 3M6MD 3ZWDA 5CFMA 4P92A 1GQOA 4GI2A 5G4LA 1UZMA 1TGYA 1M8JA 4R5MA 4RWZA 3T8YA 3SXJA 4FBMA 2HSWA 3C6XA 4HWKA 4J03A 1LA2A 2WNHA 3H2BA 1G8SA 2V6GA 3FTPA 4MJXA 4C0AC 4CTNA 3BBPA 4X91A 3WLNA 2F62A 1DP4A 4MDEA 1YJ8A 2X23A 1T8TA 4HGPA 2BGJA 1Y4ZA 3DF9A 3PI6A 4Q24A 1TZJA 3VHQA 3CXUA 1DOAA 1J5XA 4AKSA 5EHXA 1NJ8A 4KUGA 4BQNA 2AH5A 4IINA 5AHOA 2YCBA 2BLNA 2YFQA 4MEJA 3U1TA 4A0RA 3ZIAA 3UC9A 2GLTA 4G5OA 2W8BA 2PUAA 3CZMA 1EEHA 3ESBA 3SFTA 3CNEA 5I7UA 1XNQB 5PNTA 3QWBA 1S3GA 2AQKA 3BJMA 4QAQA 2DQKA 2F3QA 1XU7A 4E3WA 4P7BA 2R2GA 4HJXA 5HFJA 2FFHA 5ERXA 4ENUA 2QLFA 4HNTA 4RC9A 5E7IA 5MGBA 3QYPA 1RQ7A 2VK8A 1Z2NX 1ZQ9A 1TD9A 2AOVA 4DQVA 3NEJA 1HE8B 1IH8A 1PL8A 2IP1A 2Y9MB 3V2IA 4LYAA 1Y1KE 1O89A 3B6IA 3ADBA 4N7JA 3WLIA 1UT5A 4NH0A 2B30A 2XGMA 1E1KA 4YALA 4C4AA 5AKYA 1V1JA 2P7IA 4MMXB 1DC8A 3BK2A 3KR2A 4W9NA 4BIIA 3SZOA 5JATA 4BE7B 4DV0B 2MJLA 4A36A 1T6XA 2P2GA 2ZIXB 3HBMA 4IWNA 4JP3A 4CW7A 3R8FA 2HW8A 2WZDA 1AK1A 1Q21A 2AI3A 2QOEA 4S1TA 2XYVA 3IUSA 4JXKA 4R8KA 1ZVQA 1U9JA 3AKDA 3DEYX 3WHIA 1RWQA 4AF8A 1KEZA 4KIWA 4EA8A 4H3HB 4Z9AA 5JCXA 5KB3A 5GIOE 2FDRA 3M82A 1EFLA 4L8VA 5AUQA 3W5IA 1AUQA 2WUDA 1Y5NA 3LL4A 3KB2A 4BTLA 3G0OA 3P9RA 2AN5A 2IYYA 3IUNA 2SBTA 4MGIR 1H93A 2P35A 3C97A 2Y6UA 1W36D 2ZI9A 2Z3ZA 3AP1A 4KE9A 2FAXA 4M7PA 4PG8A 4TWAA 1DUIA 4O4HF 1G20A 4RE5A 5EJ4A 1E8MA 1PTJA 1ELOA 2PZLA 2VQ6A 3UMFA 2EJVA 4FZ3A 1IJFA 5LQAA 3MRTA 4DGQA 4IV5A 2QNBA 3GRCA 1JG4A 1JXOA 1D2RA 1I7DA 3CU5A 5TR9A 4LF7B 2IKSA 2ZUSA 1DKQA 3H5WA 2Y1GA 4Y2VA 2VF7A 5DJ5A 1U28A 3LTEA 4TKUB 4ZVLA 1TMYA 3L7KA 4B8ZA 4TWRA 2DHDA 3FUVA 3LPCA 1CEQA 1NV8A 3L5OA 2FXVA 3AEKB 4Y2TA 4DVJA 1DEXA 1JXQA 3IHKA 3NDJA 2CHQA 1Q1GA 3E23A 1D6SA 1YNOA 3VPGA 2PH7A 4EA7A 4XX0B 1LJUA 1BH6A 4L8WB 4F7DA 3O2NA 4NCBA 2A1TS 3FPSA 2IBMA 4KPEC 1U5CA 3TPZA 1E3WB 3A3PA 3WRVA 3L7OA 2ZJZA 5CM8B 1NVVR 2XA2A 3GCXA 3U9SA 1THMA 1JJFA 5ALYA 5A3QA 1G7TA 4WESB 4N47A 1QYRA 1E4YA 4G86A 5G4KB 4XAQA 1VLMA 4OSPA 3EZGA 2XE4A 4QFDA 2V7QD 2PTHA 2PYDA 3QVSA 3LY5A 5HK8A 4DVGA 2ZJ5A 3UQYS 2VPQA 4ZMBA 3R7WA 1Z6XA 3F8TA 1UPUA 1X8KA 4D9CA 5KVSA 4E6PA 4H4CA 4CM3A 1EFCA 3EFHA 1TYAE 3MM4A 4L0DA 3CNHA 1Y3IA 5EMHA 1ZJJA 2JLCA 3JYQA 2EZ4A 3BCUA 1U2EA 5LZ5A 2QWXA 2ZGVA 3PQ6A 4GICA 4IEEA 4M1ZA 2WU8A 3NETA 3GA7A 4UAGA 4J0DA 2HLDA 1I4OA 1DZIA 3FOAA 4GXNA 4B83A 4ZCMA 3KYBA 3M89A 5U1PA 3W7AA 1WG8A 1W4ZA 3CF4A 1CULC 3C3MA 3PWTA 3DOFA 5G40A 2GN2A 4M0FA 2ZRFA 3P4UA 3U4QB 3VQTA 5ABPA 2QTVA 4HD8A 4HSEA 4DLYA 5KJ6A 2AKEA 2QAGA 4LECA 1C8KA 3WGYA 3RC8A 4CU5A 1N2EA 1T0IA 3KJEA 4CV0A 2R62A 4LZZA 5A2QA 4DLSA 4GPD1 2ZJAA 5IVKA 4DEVA 1BWQA 4DCGA 2IHUA 4RYLA 1HMPA 2ZIGA 4TYQA 4XLTA 5C46F 3QKTA 2GKSA 4TTTS 3SIWA 1T8PA 2YR0A 1MO5A 2WSIA 2QR5A 2C92A 3PNKA 5CYPA 3UKJA 3OCYA 4WI1A 4F97A 4HL6A 3JAKA 2P2CA 1HQCA 2PEYA 2LZ0A 2R00C 3DZCA 3QVXA 2WU1A 1ENOA 4I9FA 1NN3A 1P4AA 4LF5B 4TLCA 3RK0A 2XGJA 1ZKMA 2Z5VA 3UJDA 3E81A 1Z4JA 1EFPA 4HPXB 4CLHA 5EWMB 3CR8A 1P5RA 1YQXA 3ONDA 4C1BA 4KFUA 4EPTA 1NZJA 2DKFA 5IBQA 4AJ2A 1ZOOA 4F06A 2LDBA 4DJDC 2VDVE 4P34A 3HFSA 3PHLA 1PN3A 1TGVA 4RKQA 2V3WA 3DHVA 3WYDA 1V8OA 3CZ5A 2XNHA 1FUYB 3CWQA 1UBLS 3FSRA 4NXMB 2Q6LA 2V4ZA 2DBRA 3SEZA 1G2PA 2HMWA 2QT1A 2Q49A 2FUCA 4YRDA 3HJNA 3T61A 2VF4X 3UMGA 4E14A 4YRIA 2E2WA 2R66A 2OCGA 4QYMA 5G3ZA 3FYHA 4OLFA 3S81A 4RTPA 1LPSA 1MJ5A 4IILA 4C89A 2I6XA 3W5DA 4OSOA 3SD7A 4HQFA 3DLBA 4FZRA 1HOTA 1E3JA 1YMVA 3RFCA 1OXSC 1RJFA 4L27A 2V6MA 3CISA 3L6UA 3L2OB 2AGVA 4UVIA 4AFNA 4RTKA 3ITEA 4RY0A 3O8CA 4D4KA 4HDSB 3BE6A 2IPLA 3S8MA 1Z6QA 1KL7A 1UAYA 1USGA 2IH4A 1IXZA 1OMOA 1XDDA 1DO2A 1OPRA 3UY4A 3ONWA 1P5HA 5TJHA 1QPGA 2X5OA 1N2HA 1WMAA 2HNAA 2I5PO 2V4UA 1J8QA 5GPBA 3ZD9A 2R1TB 3LKDA 5A1TA 4YGYA 5L95A 1Z08A 1YSCA 2XF2A 3IIEA 3T52A 3PFWO 4D99A 1MXFA 3EXFB 2ZT7A 3EMKA 3EYAA 3OUZA 4O2BA 2VPZA 2QT9A 4MQEB 3KKMA 2G1KA 3R44A 3ZDXB 3JY6A 1WDLA 3WB1A 1XD9A 1YMUA 1ZJ6A 3M5CA 4KQKA 4YDHB 5IAKA 3VPAA 4YV1A 4LF4B 4YRGA 1A8PA 4NBNA 4JN6B 2PBFA 3E5HA 1DWOA 3K4QA 2W6JA 3PBKA 2FQQA 4R1MA 1XTIA 4XH9B 1WY5A 4DOMA 1J1UA 4XJVA 2EL7A 3E3AA 3TEMA 4GMKA 5DSZA 3VYSB 4BNFA 3N28A 5TGDA 4JJFA 4AKGA 1VL0A 3WJ2A 4XVCA 2Q2VA 1N77A 3V4LA 1AQ6A 2CCJA 3G2LA 3OTGA 3D6MA 2CXSA 3Q7EA 3AK4A 3X1DA 4POOA 1ZINA 3PGVA 4R2KA 3HCOA 2OXFA 2PN1A 3BWVA 3CUEF 3H9EO 1ZXBA 2QAJA 5JQWA 5L4SA 2ZCVA 3CH6A 2GPWA 3P20A 2HPHA 3EDMA 3P2IA 5LP6B 2I7XA 4CCSA 1FXWF 1W8DA 2C4HA 4EITA 2XITA 2W2LD 3P0RA 3EZYA 5AQEA 4PRKA 4DMCA 5CDSA 2FVXA 4YX9A 3PXCX 4L3WA 1Q17A 4OFBA 2HSZA 4HGOA 2EKLA 1JFFB 1ST3A 1MW8X 1ZU4A 3B60A 1CZKA 5GWXA 3BREA 3COZA 3MUFA 5TE9A 2IP2A 2WTUA 5LR6A 4X7BA 4LCJA 3R3JA 5JRJA 2VDNB 5BV7A 3W3AH 5L53A 4KDCA 2D1QA 1R0BA 2PKYX 4DY4A 3L7CA 2HGSA 2P9YA 4N5IX 3F6RA 3OFVA 4TXMA 4F45A 3P32A 4ZEVA 5BXQC 2GM4A 2XOKA 4G09A 2O2HA 3TSZA 4KMMA 4L74A 4N03A 5KO2A 3ROZA 2WM3A 3GZ4A 1X42A 3D6AA 5CW1A 2J30A 1DIGA 2EKPA 3VYUB 2PE5A 4MYCA 1SU4A 2O0KA 4L08A 5J40A 1JECA 4BLVA 4P84A 3WIDA 1A8UA 1EWTA 1QTNA 2Z08A 5ITZB 5DEIA 5EJMA 4HNSA 3GVHA 3RTCA 1H4SA 3U4AA 5ILGA 3UHFA 1AUVA 2EBHX 3W77A 3AUKA 4KIGA 2QDKA 4RK1A 4CMHA 4EGFA 5EXSA 3KVVA 4X97A 1HT0A 5F23A 3M8KA 3KTOA 1KI6A 5CVTA 1I7SB 1P0IA 1HGXA 5DBEX 4MTCA 1TJPB 2GZSA 3A1UA 5L7YA 4BQQA 1MU0A 4N5MA 1IM8A 1XQVA 1PVVA 2W37A 2ES4A 3I5XA 5GOZA 4RFSA 3IAFA 5CLGA 1HRKA 1NXWA 3AHEA 3UAOA 4BB0A 1IIRA 1TUEA 4FS3A 5ENDA 4CF4A 3TYXA 4NCKA 1OBFO 1XAIA 4L5AA 4TROA 3HJAA 3E18A 1CERA 3QKSB 1WXXA 3ZCQA 1QC5B 2BBWA 3ESRA 2DVMA 4K1XA 3X3HA 2W2MA 3FZGA 1Z5PA 2YWXA 4BATA 2WD7B 1DQRA 1LD3A 1NIJA 2VJMA 3CR3C 3OZFA 5A5GA 2PLRA 3GMSA 5K0SA 4X71A 4GRDA 3I6ZA 4YT2A 1BE0A 2HX1A 2IIQA 4OY3A 3U7HB 1MVOA 3FFWA 3H0KA 2QU8A 3AONB 4E12A 1C3LA 5HZKA 1E9SA 4PLWA 2V0NA 1Q3TA 1CJMA 4JAVC 4E88A 3WNZA 1Y7PA 5JT1A 4FYKA 4IW3B 4CT4B 4L3VA 4ZREA 4DQDA 3BF8A 1F6WA 4WL0A 5JSHA 2I65A 4GKJB 1ZVMA 2YWFA 3H0CA 3ABSB 4PSKA 5DI3A 1J8DA 2WU0A 3B70A 4PW0A 4BYMA 2GSDA 3N8HA 4Q01A 4NMHA 4ZCSA 3WB0A 1JG2A 3QVJA 2IQIA 3IEUA 4HYTA 4OHFA 3L93A 3REGA 1JIXA 5TGTA 1P2TA 2GESA 1U7WA 2GPYA 4Y1RA 1JR3E 1V2GA 2JI8A 2NX2A 2J48A 3QEJA 3L06A 3DAHA 3FPJA 4LA4A 1UXGA 1V3TA 3PXUA 2FSGA 2QENA 1A9QA 2RKBA 3THYB 2OXEA 4OL0A 1ZBQA 5E3JA 4KV7A 3W04A 3I8XA 1PWHA 4KYTA 1TAQA 4S0XA 4BNJA 1ACLA 2WTEA 4BP8A 3VJLA 3L3BA 4MPDA 7AT1A 1X19A 2A7XA 5TMBA 2HPAA 3JASB 3QPCA 3TSAA 3IV7A 3ZDQA 3D9QX 4HEA1 1ZOLA 1L8AA 2Y1DA 1KK0A 3L6BA 3NYIA 4I36A 4WCFC 5ELXA 2HCRA 1D5WA 1WRBA 3DE1X 3KQSA 3G5LA 3O3OB 5CJPA 5F7XA 2XCRB 4EARA 1CQZA 2GJ8A 1XJ5A 2ZJOA 2ZWVA 4QTTB 1YOVA 3OFSA 1MO2A 2QVCA 4E2FA 1JFTA 2J1LA 1M33A 1Z28A 5F12A 2IXGA 4ERNA 2C7RA 3KUKA 1HFEL 4HI0E 4J4TA 3GP3A 2J33A 3CN9A 3D3EA 3W8RA 1H94A 4BAZA 1M0EA 4MRMB 3QUTA 3SK0A 5AW4A 5CT9A 4Q4LA 1B0UA 1SHKA 1DTEA 3KTAA 2QTFA 1Z6YA 4H7KA 1PO7A 4HS9A 4O29A 3GT0A 3NTRA 3AF1A 3ZZTA 3DNFA 4LVCA 1DXQA 1L4EA 1U1IA 4K9LA 4EX7A 5CH8A 1QAOA 2JIZD 3PT5A 3QG5A 2ZZNA 5IEJA 4R69A 4CIBA 2DQSA 2P3OA 4URVR 3HKDA 1G6Q1 3OZXA 3N5KA 2QN8A 3VH4A 4R8SA 4L07A 3DTYA 4EPYA 4LYYA 5JBNA 4F2HA 1E9DA 2X5NA 3UPUA 2YMQA 2ZRJA 2HJHA 4TT3D 2ECQA 1YZGA 1CY1A 5E4JA 2C2MA 1E7RA 1MMFB 4XTRA 2G5TA 1EB8A 2R00A 2ZYDA 2F48A 4JFAA 1A7UA 3OQMA 2X22A 3QU5A 1BXZA 2P68A 4C2AA 5AW3A 1JDBB 2E5FA 1O6CA 4U63A 4DN6A 4ZGWA 1E3MA 2XUKA 2Q5FA 3FNBA 3NRJA 1GPWB 3A9UA 1U7TA 3DKKA 3FR7A 1ZGCA 5IAJA 3HYLA 1GSHA 3KSRA 1AUPA 2G1PA 4BAGA 4HDMB 4WGFA 3SNHA 5EJEA 5GV7A 1WKCA 4MW4A 2GBGA 4F3RA 2C3OA 3D8TA 4A2PA 1P9LA 2ILTA 1T5BA 3SZUA 3D7KA 2WTMA 4WLFA 3TTXA 3B9QA 5HKAA 5EGSA 4J4BA 1QS0A 5TQ2B 3AVTA 1XX6A 5BMOA 4W5TA 3K1AB 2HWUA 4HLUC 4M1QA 2HZ7A 4M22A 1GA4A 3FTDA 3IUJA 1MCZA 1IN6A 2C8VA 2H1SA 3AF5A 3ZW9A 2UZ1B 3A6GA 3OKFA 3HN6A 1RLUA 1ML3A 4G1BA 2Q7OE 3AUYA 2DWCA 2ABWA 2FFRA 4GEKA 1TIBA 4KR0A 4Y2QA 1B6GA 4ZO8A 5BORA 1OX6A 1EE1A 3NHFA 3GFSA 4Y9DA 3UUEA 1CW2B 2AUNA 2ZB3A 3E5NA 3HBAA 3FSGA 5TQJA 3TB4A 4N12A 2QR2A 4Q4AB 5AVZA 2GCOA 1E5TA 3NH6A 1OWLA 1RRPA 2P1DA 4G2TA 3JYHA 3RVBA 4QOEA 4RSHA 4K6MA 4LYHA 5JC1A 4XIFA 2V58A 4NV1A 3E4DA 1J8VA 4BMVA 1LPMA 1ULZA 2SHKA 3BHNA 1YBMA 4UU1A 1XMPA 3WGMA 4S1NA 1E79D 5AJYA 2CWWA 2OHGA 2VDUE 2ZTSA 2EJWA 1NP6A 2VHYA 2NYRA 4P4GA 1GGEA 4FKZA 1FDOA 2AE2A 1LPPA 3JQ7A 3UJ8A