4MDYA

Crystal structure of periplasmic solute binding protein from mycobacterium smegmatis str. mc2 155
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
285
structure length
285
Chain Sequence
DDGSVTVRHAFGDTTIPGPPQRVVSAGLTEQDDLLAVGVVPIAVTDWFGGEPFGVWPWAQRQLAGAQPAVLNLDNGIPVEEIAALKPDLIVATNAGLDADTYAKLSEIAPTVAQTGSEAFFEPWKDQATIIGQAVFKNAEMTELIKSVDDRFTTVKTDHPQFSGKKALLLGGTLYRGGVQATPPGWRTDFLTQMGLTVLQVPALIPRDEIASVLDGADVLIWTTESDQDRDALLADPIVAQLAATRRDRNIFTTKELAGAIAFASPLSYPVVADQLPPELARVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Periplasmic binding protein
publication title Crystal structure of periplasmic solute binding protein from Mycobacterium smegmatis str. MC2 155
rcsb
source organism Mycobacterium smegmatis
total genus 91
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4mdyA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4mdyA02
5M29A 1PQ4A 2R79A 5CX1A 3TNYA 4WNAA 3PDIB 3AESA 4IRMA 4INPA 4HMPA 3U7QA 4M7OA 1FP4A 5I4KA 3AEUB 2M6KA 3K1AA 4XPIB 2OSVA 5KOJB 1ESZA 3GI1A 5GGXA 1K2VN 2AFHA 2XH8A 3AETA 1QGUB 2XV1A 4LJSA 5KOHB 3BE6A 1KAEA 1H1LA 5M3BA 4WZBB 4WESA 5BVHB 3LI2A 4UDOA 4FI3F 5JG7A 3AEKB 1L5HA 1G21A 3MFQA 2XDQB 4PM4A 3TEFA 4TKVB 4CL2A 1QH1A 2QI9F 4WN9A 1N2CB 3TLKA 3AEQA 4UTOA 2PHZA 1M34A 2O1EA 2XUZA 5HDQA 2MINB 1MIOA 1M1NB 1QH8B 3MWFA 5M2QA 3HXPA 2OV3A 1M1YB 3HH8A 4ND8B 3AERA 4MX8A 1TOAA 4DBLE 3HJTA 5JPDA 1G20A 4WZAB 4H59A 3MINB 1XVLA 2AFIA 5BVGA 4TKUA 1N4AA 3PSHA 4HMQA 5FLYA 4UTPA 2YNMD 2YNMC 4LS3A 2OGWA 4H0FA 3ZK9A 4GICA 1N2ZA 3PDIA 3EIXA 4FNAA 4FILA 2PS9A 4NNPA 5CX1B 4WNAB 4HMOA 2WI8A 3AEUA 1KAHA 3AESB 3U7QB 5KHLB 3NU1A 1FP4B 3ZKAA 1K7SN 4UDNA 4XPIA 5KOJA 2PS3A 4FKMA 5JJ5A 3K1AB 1K75A 4OVKA 4N01A 2Q8PA 2R7AA 1QGUA 3MWGA 5KOHA 5JOQA 2XQVA 2AFHB 3AETB 4WZBA 3UJPA 1PSZA 3EIWA 5BVHA 1N4DA 4MO9A 1H1LB 2Q8QA 3AEKA 4G07A 4WESB 3ZTTA 2PRSA 5B58T 2PS0A 2XDQA 4TKVA 1L5HB 1G21B 4BBPA 4HN9A 3BE5A 3LHSA 3R5TA 2XY4A 4NNOA 1N2CA 1QH1B 3MD9A 4MLZA 5GGYA 2MINA 4WN9B 3AEQB 3G9QA 1M1NA 1M34B 1QH8A 1K0FA 3CX3A 2ETVA 5HX7A 1EFDN 4K3VA 3ZK8A 3R5SA 1MIOB 4INOA 1M1YA 4ND8A 4G09A 5M34A 4OXRA 4WZAA 3MINA 2OV1A 2M6LA 3PSAA 3AERB 4B8YA 5CR9A 1KARA 2X4LA 1G20B 2WHYA 4MDYA 2AFIB 2RG7A 5BVGB 4TKUB 4PAGA 4OXQA 3ZK7A 5AFSA
chains in the Genus database with same CATH superfamily
1TT7A 1LVHA 4B7AA 5AVSA 4JVNA 1XEAA 3CWQA 3K4QA 3QFSA 3TMYA 4P35A 4DNFA 2HSEA 4UM9B 5AR1A 1QLJA 3BB1A 1JL3A 1JIXA 2RBEA 4N5DA 5T67A 5EHZA 2M6KA 4Y2SA 5JNVA 3EEOA 3P9PA 1U98A 1WBJB 3RS4A 2F1IA 1HDXA 1M1ZA 4N48A 1P7CA 5J5CA 4IPTA 2YMQA 3PNSA 2B2NA 4ZN6A 2VSQA 3E27A 1E0DA 3BM5A 3L9XA 3ZHBA 1KKLA 4LY6A 3FNGA 5EAIA 2IYTA 3VYWA 4GOMD 1X9GA 1MQSA 1KDPA 3EJWA 3CPSA 2TYSB 3M34A 2WABA 1KYVA 1ZISA 1NRIA 2FA9A 4QBFA 4X91A 4TT8A 1DFIA 3RQIA 1XDBA 2BKLA 2OQRA 4M22A 3FTDA 3GH3A 2WJGA 3HYTA 3JAKB 4PICA 4G0WA 1AN9A 1YZNA 3OE7A 4P9NA 3FOAA 1EUZA 1TVCA 3U37A 3CVOA 4D0GA 5JS1A 1SB8A 5EINA 3DFFA 2F8LA 1M8PA 2OCAA 3IKVA 3WIVA 3FUUA 2Z58A 1TJ5A 1O6GA 2P8SA 4PBTA 3WO1A 2P9TA 4MPJA 1GPLA 4MKHA 5ELLA 3V7WA 4AMZA 3PC3A 5F64A 4RWZA 3B6EA 3EEFA 4JJZA 2PXHA 4LQCA 2A1TR 3UHJA 2BDUA 4CR6A 2QIOA 3IR7A 4C76A 1GZHB 5A5DA 4YAUA 2XKKA 5IAOA 3ZDAA 2R86A 1M10A 4GS5A 1R74A 1T2EA 4ZMRA 4WVLA 3BF8A 1SUWA 1UC5B 4HDNB 3B6MA 1Y1RA 2QVBA 1SK9A 1ZWLA 2H4YA 3BBPA 3SDBA 5BUCA 1AKUA 2KB0A 4RF5A 1G2OA 2EFJA 5G3ZA 1WSBA 2DT8A 4K1LA 4C3UA 4O08A 3OA0A 4YDQA 3MJSA 1RAFA 5TGTA 2YWXA 1P0PA 2PZEA 3ND5A 3NOXA 4QA9A 4YP0A 4EEKA 5KPJA 3LX8A 1F60A 1F38A 2D00A 1KFCB 3LPDA 4LSMA 1PN3A 2GF0A 3WBKA 5FUXA 2AMFA 2DPGA 3P94A 1BAPA 4QJ4A 1UDRA 5IJ0A 4PX3A 3MJEA 2V4UA 1O97C 4Q4JA 3TDNA 4AF8A 3ZIUA 2DECA 3L7LA 3HXTA 3PXUA 3PEWA 3KZOA 1TTTA 4CEHA 1EUCA 3EF3A 4Y98A 3G68A 4H4CA 4JUAA 5JZSA 3HLTA 1TIPA 2OPBA 4JLUA 5LMNB 3QE3A 3KKZA 4MCJA 2MT9A 2DQYA 3AUTA 3W5CA 1RWQA 1XQ9A 2OO5C 3IOEA 3WK4A 1U3GA 2OWDA 4EABA 1W4ZA 3IS3A 2RGAA 3PD1A 5JIBA 4U9HS 1F4VA 1M2FA 5J2TF 3RJ5A 4FEYA 2QLMA 4CL0A 4D9HA 3PDHA 1J5PA 2PS1A 4C0WA 3OY2A 1JN0A 2G1PA 3NTXA 1KI3A 1AK1A 4ZYWA 3QVSA 1Z8FA 3EXHC 1FTWA 1QAOA 3PI6A 2V3VA 4OBWA 5BWLA 1UFOA 2UUOA 2VQDA 4YDSA 1JHDA 3VQTA 1XDDA 5I8PA 2FSIA 3IDOA 4AKIA 4AKEA 1N8KA 5B37A 1NTOA 4EHKA 1ZOIA 3BMOB 1U1IA 2NVWA 2P1ZA 4L4UA 5KYWB 2H85A 4BX8A 3FR7A 2MIIA 1M1UA 2X8BA 4MGHA 5IMBA 1GDHA 4AMYA 4FDUA 4PZDA 1XEFA 2BTEA 1EYZA 4QUGA 4M7WA 3TQFA 4BRSA 3C3JA 3ZI4A 2XXBA 3RRJA 3KB8A 5AIAA 5L3SA 2H52A 1WZUA 1PR9A 4D6XA 1SHJA 3BDVA 5THKA 4BNDB 3RASA 4QUJA 4ER7A 4M4SA 4CQJA 5JSZA 2DCMA 5FBVB 3FHCB 2IUYA 2QGNA 4JJAA 3A4YA 1ZXBA 2O0HA 1E1QA 3Q5GA 4HLCA 4KYUA 3M6AA 3JVDA 1DX9A 4UUOA 4AN0A 2VG8A 2C8JA 2BJVA 2GT1A 2N46A 3Q7PA 1VIYA 4OJKA 1S0UA 2I3GA 2IRWA 3H05A 3G23A 2H7CA 3FLEA 3KXLA 1M0EA 3RAEC 4JBYA 4X90A 3U3ZA 4MI3A 1JEOA 4IVRA 4GOOD 4CQLB 1N6IA 1CB0A 4LY9A 4MTLA 5IVKA 121PA 1NATA 3IP6A 1XEWX 4RDIA 2W70A 1U3TA 4C0QC 2ZRCA 1KGDA 2C8KA 3CZCA 4IQ0A 4PF1A 2IY9A 5ALLA 1EX1A 3T7AA 1YVPA 2CXOA 4UFNA 4W1QA 4KIFA 5A9SB 1GZ4A 4R9UC 4N12A 2RI0A 2Z98A 3UXHA 1SUDA 4RW0A 4FN5A 5DNWA 3ZUGA 3OFKA 4MPTA 2IH4A 2O8BB 1G6KA 3S70A 3C4VA 4NYIQ 3VR5D 4BV3A 1JEJA 4B6QA 2OGZA 4L2IB 4KR0A 3KOZA 1V4VA 3OHSX 3DHWC 4PRKA 1PLKA 4FILA 4I8IA 3LL7A 2XWQA 4QUBA 4HH1A 4L8FA 3U7GA 3THWA 3LUCA 3P2JA 4GMXA 4IFIA 3AEUA 3HZRA 1YVRA 2Z2JA 3R3HA 3VR4H 3ZIAD 1AVTA 1E6WA 1RAHA 1XMSA 3KB6A 4DDWA 2DM6A 2I1VB 4D9NA 1NV8A 1VLMA 2YV3A 3VKUA 4X1OA 5B12A 4LV8B 1UZMA 3VH1A 4Y9RA 1E6UA 3GA0A 3W1VA 1RRGA 3IQXA 4MUFA 4OU5A 3AGPA 4AY3A 3N6VA 4GPIB 4YRAA 2I3AA 2D54A 3C16C 4MDHA 4L8YA 3AG6A 1FW6A 1H1LB 1CLUA 3TS1A 4G0QA 2VT2A 4XRRA 4EK9A 5KYVA 1WEHA 2QRPA 5DM60 4BHTA 3JQFC 4QNMA 1OD6A 4P53A 4KE8A 5JNTA 3ERCA 5ARCA 5FCDA 1WXGA 1L5HB 2ZVDA 7ABPA 3BXGA 2B3TA 4RANA 1SXJE 1HNNA 3V8BA 3SR4A 3IP1A 4DAEA 2JW5A 2EWMA 3WKBA 1HH4A 4RL4A 2HJGA 3K09A 2JIZA 3L8MA 4YV2A 5BYKA 4TSFD 3SC3A 2YZGA 4PG7A 5EIBC 3WGOA 1ZNXA 3TLGA 5IHPA 2A5YB 3C4JA 2QJWA 4IYJA 4YUZA 2UZIR 3EGVA 2AQHA 4PG4A 1P4GA 2EW1A 4CDRA 1E3EA 5JAZA 3BMNB 3S2SA 5H82A 3SJCA 3LXUX 2IZ5A 4NZYA 1RC0A 1P1CA 3S4YA 1MRSA 1NJ1A 1W2GA 3B12A 1CJSA 2CXRA 4F7DA 4OHYA 2CUZA 2VAMA 3ENVA 3IPAA 5K8IA 3W90A 4X7MA 2IF0A 3ZCTA 2QP3A 4DBZA 3O9VA 2EYQA 4KQ1A 4LK2A 4M89A 4M0MA 3UB4A 3EGDA 2DBZA 3FYHA 3ONVA 2J85A 2ZUTA 4EAQA 5K7SA 4CM4B 1Q1GA 1KMCA 1YR3A 1UBSB 2KMLA 2HDOA 1EAMA 3VYVA 1QBGA 1WY7A 1P7YA 2CWWA 2ZRLA 2PT5A 3HUTA 1NWHA 2A1UB 2X5KO 3SFVA 3QF4B 4Z49A 3NALA 4W5RA 4Z0PA 3IIMA 4X45A 4IAOA 4JWTA 3JZMA 3PNPA 2NYVA 3CVVA 3GPCA 4AP5A 1WD5A 3DE3X 2IX3A 1UJNA 2OGSA 4KPFC 1NE7A 3LWNA 3NR2A 4YRTA 1EK6A 1QPGA 2BTQB 1ZUIA 2W93A 1E9CA 2COKA 2FUEA 3M5WA 4FFRA 4EY4A 2D2VA 3L8CA 4QOFA 1JE1A 2FWIA 3R09A 2PA0A 4G1FA 2RGBA 4YIKA 4N6OA 4BWVA 3LF1A 1CRPA 3RTBA 1RI4A 3CZRA 3DV0A 4ERXA 1GNSA 3DULA 2WUEA 3THXA 2Q7OE 1Z22A 1OOEA 1YR6A 1JQDA 2A4KA 1VPTA 1GITA 2OYCA 1DXOA 2P1DA 3NX4A 4JQSA 3Q8LA 4JLSA 1HBJA 1OR8A 3CLSC 1C8LA 3T7SA 2RIRA 5JZ9A 2CXXA 2I5PO 3D8TA 2XGJA 1MF7A 1OPRA 2YOGA 3AP2A 2H1CA 3JCZA 3B8HA 3BFJA 3ON5A 4RJTA 2YASA 4LX8A 1EEHA 2FK7A 1NG1A 3IT3A 1WBDA 2HJVA 2HV9A 2H65A 2RAUA 2OY0A 2XADA 3UMGA 5CAEB 3ZZTA 4R1OA 1M5RA 3WXMA 4UC0A 5C80A 4NICA 4WXHA 3IUJA 4M8KA 2GYVA 5ALGA 3WOHA 1DO2A 3AUFA 2ZQ5A 5KC9A 1MRZA 2GK7A 2KM1A 1UDBA 4O4JF 5KU1A 3LFTA 4RIFA 1C3LA 4RK1A 5B3AA 1B6TA 1K89A 1E2MA 1G3MA 2IOHA 2O9JA 2RBGA 5GVSA 4N0EA 2GZSA 2OFPA 3IAXA 4QD3A 3IJEB 1KDVA 3RRMA 3NVDA 1QGUA 3NH6A 1Q0HA 3C3AA 3I6QA 3QVTA 5KU7A 1YZHA 1N4DA 2UV8A 1XMQB 2R5NA 5JSUA 2R6HA 1JSXA 3DTYA 4GLJA 4QWMA 5JBNA 2GYYA 3W7BA 5FA5A 2CK3A 1JDUA 2IEIA 2XDQA 3D54D 3EE6A 4WDQA 4HXFB 1BN7A 2QM3A 4RIGA 1X0XA 2GRUA 1ZJJA 2I6FA 1DKRA 4P0PB 3BL6A 1VMAA 3F2VA 1QONA 4KWHA 3PWKA 1TAUA 2WNIA 5IW8A 2JH9A 1QOZA 2H08A 4GX2A 4MGZR 4AJPA 3SQWA 1A98A 1NP7A 1ZJ6A 2FLVA 3C3KA 4C3OB 3BD7A 5IVHA 1TXGA 3LDGA 2YWBA 2ZJ2A 4LYEA 4OTZA 4CUZA 5I01A 3IXLA 5DB4A 3GLIB 1N6OA 5I7EA 2Q3DA 3TLXA 4CLXA 3USZA 5LPNA 1Z2CA 2Z2XA 4NBWA 5LU9A 4D6PA 1R10A 4CG0A 5GVRA 3RS9A 3HBNA 6CHYA 1NULA 1E6EA 4Q9AA 3DYBA 221PA 1AKVA 3U56A 1RFGE 2DBVO 1S3SA 1OLSB 3QE0A 2GN2A 3EXG2 3HP1A 4ZOCA 3ZEAA 4N4AA 1OZHA 4OHXA 3K2IA 3FPHA 5DHUA 3KAQA 4K6HA 1T5LA 1OI2A 2YHIB 5F78A 1UT6A 1PYOA 4BNKA 2JNWA 3IPXA 2XUGA 1TAGA 4UKDA 3U1TA 4I36A 3WGKA 1SCNE 4WOJA 1YR2A 4HVCA 2W4IA 3JQ9A 2WD7A 2HEGA 3FCSB 4FCCA 5L4LA 3NTQA 1SXJD 3ILHA 4C3VA 3DDSA 3CA8A 4PO3X 4PVDA 1ORVA 2CHVA 2VAPA 2I65A 1DUSA 2BUAA 4OGFA 4FWIB 2AYYA 3IV9A 4EUHA 4XASA 5NULA 4R2LA 1EWQA 1VBKA 4L07A 3GRKA 1GAXA 1T2UA 2C3YA 2HRBA 4WK6A 1N7JA 1WZCA 3I34X 2JEZA 1P0CA 5DCWA 1TLLA 2Q3CA 3PIDA 2ATVA 1FRQA 4ZO6A 3V3TA 2XCUA 3KSZO 3QJGA 5ALIA 3KTAA 1ECLA 1RC8A 2IHZA 3ZD7A 1PWZA 1L4LA 4CIXA 1N36B 4Z4HA 1C3VA 3VOAA 2IDJA 4N3BA 3RM3A 3INRA 4LE1A 2FHPA 2JEOA 1NJGA 1CEQA 3KRTA 1ZR4A 4KIJA 1IBSA 1XJWA 5L3ZA 3ZHRA 1P17A 3FNRA 3QTLA 1VL5A 2AL7A 3LBHA 3T8YA 3TIXB 3G59A 3ROEA 4N1AA 3ZXSA 2IGBA 4PHHA 4HMQA 2D74A 1YMVA 2QMZA 4L5AA 3FB4A 3V4ZA 1H0SA 3CG0A 1GAJA 4BNIA 3K32A 5EWJB 1K63A 3P5SA 4IM7A 5EZ5A 3THYB 1DT5A 2O52A 2RGEA 1P8AA 5FA6A 1E18A 3EH1A 1Z68A 3S2EA 5B2ZA 1QF6A 3S2IA 1VE9A 1TM2A 1Z3IX 3CKLA 4J0GA 4P4SB 2YHAA 1XCGB 5C1IA 1G17A 1AUOA 3E9NA 4LF5B 1MB2A 4UXJA 4A9AA 4WCFB 4AP9A 3ETGA 4XUCA 3D0RA 4N65A 4KQFA 3BIOA 4NPAA 3QX7A 4JCOA 2JFUA 4BO7A 1A9SA 4P4LA 3NBMA 2VA8A 4HXEB 1RWXA 1P2UA 1GEEA 1NKVA 4KXMA 4XYMA 1L7MA 3PB3A 4F45A 3DT6A 1JXMA 1I2CA 2ZAIA 5GP1A 5JTTA 2C1EA 4HV4A 4F04A 1T0JB 4WWHA 1J23A 4HSEA 2PLNA 3ZHCA 1XMPA 5GZ3A 5A7FA 1P4JA 3DC7A 1ESDA 3H65A 5ICGA 3R1IA 1CVRA 2WF8A 1N1MA 3KKOA 5GGYA 2TRSB 2PBRA 1TA9A 1Z0SA 2DFLA 2B92A 1C7IA 3ND6A 1OYYA 1O4WA 3NBFA 3K8ZA 5ALTA 4E03A 2JZOA 4UUPA 3KQQA 4I81A 3R3XA 5J2TB 2JGIA 1AV7A 1E2PA 1T2NA 1X7WA 2FKAA 2YIJA 4TXLA 4EUNA 4RD6A 4WV3A 5HP4A 3FGNA 4LRQA 3BF7A 1Y3BE 3FXAA 4IVQA 4DM7A 4ZEWA 2I55A 4DR1B 5JZMA 1P3Y1 3H5TA 3EYAA 3EN0A 3LQFA 3OD5A 3P2IA 1M76A 2ZIEA 2ZBFA 3AXSA 5DRYA 2W22A 2ZWPA 1WABA 2G5CA 1Q91A 1TVMA 2AN1A 3D4BA 4MIEA 4Q4LA 3ROMA 1KK1A 1N5RA 3U81A 5JD6A 3IIKA 2OYRA 2IXDA 3ND9A 3HP4A 2P68A 4ZQCB 3BT7A 2XDYA 4K8RB 4BNNA 4KGZA 2IPOA 2OG1A 4OXKA 4BAZA 4ETMA 2Q2NA 4DDKA 4OHBA 1UXJA 1BW9B 4KPGA 3M1AA 3ZW9A 3PLNA 2C5AA 4LXGA 1CLEA 7YASA 1RM4A 3AUJB 4BO4A 3U5TA 1Y82A 4QPDA 2AKYA 2UZAA 2ICAA 1VMIA 2ZS7A 2CJWB 3IFSA 3ICQB 5KX5A 4TL8A 1II0A 5AVVA 4RS4A 1J20A 3RC7A 3W8NA 1L5KA 3A4TA 1NXQA 3W4IA 5JV5A 4OLBA 2I91A 4TSRA 4B47A 4AXBA 1WKBA 3LX4A 1VDZA 2RHCA 3HEAA 3RVNA 2NAFA 2EV9A 3O8RA 3HFGA 1GDTA 3QH4A 3N1UA 2JATA 1GL6A 2G0AA 3EEBA 1PT5A 1CR6A 4UE6A 4WINA 4DIUA 5THQA 1JIIA 5BSEA 1QRRA 5C35A 1KYXA 3B82A 5CLLA 1N6RA 3KPWA 3DB2A 5JSKA 1UP6A 4MJLA 4PLVA 1G5FA 4JXKA 2ZREA 4C4ZA 4CIYA 1T6ZA 2HQRA 3MJCA 2RCYA 3P20A 2J5XA 3RFUA 1BCSA 3OOJA 1TZKA 2OKCA 4WMLA 2I4RA 2Z3VA 3MMNA 1XMJA 1JSLA 1QAQA 4GI5A 3HKDA 3UHPA 4EVQA 2VJPA 3OESA 3EC7A 1VDMA 4QLAA 4TKUA 4IZHA 2IXAA 4ZARA 3EGWA 1WPRA 3H18A 1FA9A 1NMYA 5JO0A 5E9AA 1SVUA 3OO1A 5JAOA 1EQAA 4XWAA 3BWDD 4KPYA 1QTQA 4Q19A 2WKQA 3MWYW 4UZSA 2HCFA 1C1DA 2X2OA 3HA5A 2BDTA 4G1MB 2JD2A 3PR2B 3DZ8A 3VXKA 5JMOA 1KYIA 4IMPA 5EMKA 1ZM2A 5TX7A 4AWAA 1YZKA 4RTQA 5KKCA 4BMZA 5CB4B 4A6DA 1N8NA 1JEQB 2B7LA 4PQEA 1KQ3A 3Q3IA 3DEIA 3H2SA 3UHAA 4ARCA 3EIWA 3NHAA 3K5HA 5A02A 2JLAA 4F4FA 4NCJA 1O94C 4LMPA 1UAAA 3ST7A 1U2DA 3DR5A 1P39A 3QFFA 4LDPA 4Z9BA 2IV3A 3VKFA 1HSZA 3HV2A 3QE4A 3EXFB 1KQOA 3QJYA 3T4EA 3BGDA 2XVZA 4ZVUA 4QT0A 1VYHA 3UT5A 3HVIA 1A9RA 4IUYA 3SC2B 4ERNA 1OTXA 2Z95A 3K1YA 4BFXA 3TNJA 4G89A 1GNPA 2ZZNA 2ZRBA 1J56A 3R8FA 2GA9A 2CMKA 2FHSA 1HE3A 1GV0A 1U2QA 2Q3HA 3HUEA 3VHXA 4L16A 1WPXA 4IQGA 1X7YA 4RH0A 4A7PA 4B1FA 4DG8A 2IV2X 1BE6A 4WIAA 2F8MA 2YJZA 3OX4A 4O8CA 2EBFX 2HH9A 2I54A 3N2KB 3TPCA 1V8BA 4XLTA 5LZ2A 4JU9A 3X1XA 1CZHA 3ELBA 1ZRHA 3VSDA 2HU2A 4WKBA 1WCIB 4K9SA 2PKYX 4REOA 3O8NA 1VSQA 4FS8A 4B71A 4F2PA 1M66A 1NQUA 1WXXA 2H2GA 3MAGA 2R65A 2GCOA 1DKQA 1Z08A 3UB3A 3FTQA 4ZYTA 2ZRGA 2ZI9A 3BQ9A 3LHIA 4URWR 2BI7A 3I2KA 3ABOB 3JASB 1CP2A 1I3CA 3EHEA 1XPUA 2C95A 3FOCA 1PNOA 4BO1A 1RWVA 1IONA 1QMPA 1OX5A 1GCAA 1DMSA 3AI2A 5EUQB 4DQUA 2ZE8A 1Z16A 2EC5A 2J0UB 1VB3A 4YMSA 4IDNA 2EGHA 5H0IA 4CRWB 2X8JA 5ITZB 1XTUA 2CZQA 3I3SR 3P45A 1QZ3A 2FPLA 3NWEA 2ST1A 3NEYA 4ZAXA 4LHWA 3ROQA 2F3RA 3HU1A 3Q87B 4OLHA 3HCAA 1NSYA 2A9JA 2I4IA 1NVUQ 3HWX1 1E92A 2IH2A 4BQQA 1ZBDA 3HM2A 4UBIA 1L8AA 3P0IA 1W6RA 1X74A 1Z2NX 1S2LA 2P69A 1WTAA 5TT0A 3RK4A 1YWGO 2FFHA 3PX2A 4W63A 1D4AA 4NJOA 1DINA 3N2IA 1N2OA 5E6RA 3NUZA 3FWPA 4LMRA 4Z9FA 3W8DA 4R41A 4LZNA 5HRUA 2BM0A 3TGLA 4G0UA 1KGSA 1UEIA 3HK2A 4CYMA 4FWBA 1QIFA 4URFA 2YJ6A 2QBYB 5FUBA 1G16A 1B8UA 1LJUA 1PS0A 2NXWA 2QTMA 3VDNB 4DC9A 1Q1BA 1FNBA 3LUFA 3N8IA 4J90A 3W5JA 1L5GB 4DN6A 2GJ8A 2W90A 3MWJA 3T95A 5M5BA 3U09A 1S3FA 1L3CA 2PX2A 2GM3A 3HWWA 5JYEA 4URZR 4D9KA 3W6OA 4ZCMA 3H5WA 1CUUA 4X94A 1GZ3A 1L7VC 3WRVA 4LZWA 3MGKA 2G7MC 1BVUA 3NASA 4M88A 1I5OA 3K0CA 3MWEA 4HCJA 4O1IA 1BGXT 2QYTA 3DE4X 3LA8A 5DXJA 3R3ZA 5EVJA 3FPBA 1BEEA 2QXUA 4O4JB 4TV9F 1P19A 3LNCA 1PQPA 1FY2A 5AKGA 3A9WA 2VXOA 3IVXA 3RS7A 1QF9A 3WGJA 2MDTA 4LXIA 2FDCA 1V41E 3GYBA 1CW2B 4RTMA 1H5QA 4TXJA 1P6UA 3LY9A 4OGLA 1ZCJA 4AG6A 1T2CA 3HXKA 3QUBA 2IEAA 4BN5A 1DAGA 4EG6A 3GUYA 1IZ9A 5CJPA 4FGZA 4DAOA 4HAIA 1N9GA 4B6FA 3COSA 2WFLB 4BKRA 3JWEA 3E4CA 1KRWA 3H0KA 6YASA 1DOAA 1R1DA 1ZM9A 4YUAA 4TKVA 5ED0A 3R75A 5K9ZA 3D5TA 4MV4A 5B1DA 5YASA 1EMDA 1W96A 1KZYC 1O2DA 2CLKB 3HY4A 4F3KA 1OXVA 1VI2A 1W5BA 1BTOA 3GQBA 2F8SA 5G0UA 1KETA 2YS7A 2JGJA 1SZCA 3DF7A 5AHWA 4MRAA 1PSWA 5LYYA 1J39A 1XK7A 3W6UA 3WISA 3CXRA 5EHQA 3IILA 5IK2A 3VAZA 5K6RA 1L0BA 2AI1A 4U6QA 2FI1A 1RADA 4URHA 4RZQA 1LTKA 4QDOA 2WQ7A 3FA2A 4HB0A 4OH7A 2GCNA 3VNAA 1JGTA 1O9BA 4P93A 1IUOA 4C5CA 4KPEC 3ZLJA 3OX3A 4N6NA 2AQIA 5ECGC 3IURA 1QG0A 2WHYA 1PWEA 5K3EA 4NHOA 1V8ZA 1YIDA 2DE0X 3VC3A 4RTRA 3JQGA 1BDBA 1Z2OX 2Q6TA 1IDOA 2XOKD 3O4GA 1V37A 3RSLA 1I14A 2SBTA 3MN1A 3BG5A 2WU8A 3U3KA 4L3OA 3R5XA 5A2GA 1K3FA 4JLBA 1E2LA 2I3ZA 4Z8XA 2RD2A 1Y6GA 2X7HA 4QQNA 4WCFC 3CR8A 2P2DA 2QRUA 3TDMA 3I5XA 4MZDA 4H3SA 4LV6A 2ACVA 4RVCA 1PR0A 2F64A 1HFKA 2QQEA 1K98A 2X5OA 4BUZA 3CVUA 3BIXA 1P72A 2JJYA 4HQRA 1P31A 4MKIA 2B1IA 1QS0A 5FX2A 3BYZA 1U0TA 3F5DA 4KQKA 4QQ8A 2RE8A 5AW5A 5FOVA 2I66A 3JQRA 5A62A 3D1LA 1NASA 1WPQA 2UUCB 2FSFA 1GUZA 2O2ZA 4QX6A 4DSNA 1E2NA 1Y8RA 3KAKA 5A3JA 4EY6A 4PX5A 1V1JA 3EF1A 2OILA 4X8LA 4WH0A 4Z3DA 4Y6OA 3CISA 5DNUA 3C8ZA 1Q21A 3ZWKA 4TTAA 3KD2A 4LRYA 3CLHA 5A6SB 3TLKA 4D26A 3I0MA 4LRTB 3RUCA 2XUZA 5IF3A 4QDKA 1WUIS 3RIMA 3C5VA 3R2JA 4J4BA 4M9ZA 1U0FA 1QIJA 1YNOA 3DMDA 1JALA 3GW8A 3LKDA 5K0GA 4G67A 1N5JA 1AGYA 2H2HA 1PV2A 1OVMA 1Q57A 1ZESA 3KE8A 4LVUA 4DFDA 1JECA 1JDSA 2Q4TA 4K3UA 4MVJH 3WGGA 4DCUA 2G77B 2XYPA 4AWXA 4Z1OA 3GFQA 5E0OA 4MQBA 3RVJA 4JA2A 5JDIC 2PGIA 3VR0A 4B75A 4M60A 5F73A 1VHWA 2XNDA 2WPDD 4X1IA 5DBGA 3UT6A 1UDCA 4C0KA 3OZFA 5E4FA 4KXXA 5HZKA 1U5CA 2AUNA 3R7DA 3VTZA 4Q47A 5H3LA 3NYIA 1V5EA 4K8OA 4G4GA 4MULA 2I62A 4PPQA 5F7OA 10MHA 4D8TA 1IBMB 1TYCA 4S2UA 2ESRA 1YGYA 1XYYA 1RQNA 4PZ9A 3N0XA 2OBYA 1YTUA 2X13A 1O97D 1O5OA 1PJ8A 2JVJA 3CQ9A 2I4LA 2JLWA 2AXNA 1E1CA 2RAFA 3OKFA 3WV5A 3I8SA 1AH2A 1OBVA 2R60A 2CCGA 4UQPA 1XF9A 4Y0NA 5CCDA 1M75A 5FOUA 1PWHA 2FPPB 2XR1A 5DHAA 3BFKA 1X9IA 3CRMA 1VHLA 3PYXA 3UF0A 4N7RA 1CIPA 2W8ZA 2GA8A 1WCYA 3TSAA 5C31A 3VKHA 2GPSA 1RBQA 2FWJA 5DLDA 4CM8B 4BNTA 4O4IA 1VRWA 3A58B 5HE8A 2NQ2C 3EFOA 3NEJA 4G56A 2QR5A 1V96A 3HUDA 5KMGA 5L3QA 3V1UA 1WZ2A 2GASA 1YMUA 2PYIA 4J91A 4TWJA 5DT2A 2NO5A 4JLAA 4CTJA 2GPYA 1B8OA 1K5HA 4HUJA 3T3GA 1ZLXA 3H3XA 2Z5VA 3QYJA 1PBTA 4NMXB 5AK4A 3UOGA 3WJAA 1HYHA 4G1EB 3PK0A 5KVAA 4KWTA 3WOVA 1GGVA 3U6KA 1AKMA 3GT0A 5EVCA 2PMBA 3WLAA 4Q1FA 3SWWA 5T3UA 3I4FA 3GX1A 2B5VA 3IH5A 2UVPA 5DM1A 2FRXA 1DQZA 4FR0A 1ZD5A 1QORA 2P79A 1Z38A 3UGJA 1SUAA 4OJMX 1YFJA 2QNIA 3LY5A 3V7NA 2VYNA 4TS9A 3GWZA 1HURA 3OEEA 1K68A 3FLAA 4NDZA 1BEUB 2WHRA 4NZNA 1H8ED 3W2GA 1PJQA 2VI5A 1EQ2A 4N7JA 5HMLA 3SE0A 1N34B 4ZYUA 4F3TA 3ILYA 3BZUA 4KMSA 3FJOA 2FEPA 1XTPA 1R9MA 4OFZA 4PIVA 5ILQA 4BYGA 1ZL2A 1YQEA 4AS2A 1QR6A 3GUVA 3OLCX 3ANNA 2HCRA 4HNAB 4D6YA 1JA0A 3S28A 3HRKA 4XQ0A 2I6XA 1FX0B 1UDWA 1FFCA 3HJHA 2JDIA 2FJUA 4JB0A 2P78A 3PE6A 1RLUA 3SYLA 4O2AF 1HO3A 1QZZA 1SQ5A 5ALZA 2DU8A 4X95A 1FFYA 4E6EA 2WSSA 3LO8A 1F6DA 5LSAA 2VOEA 5MDHA 3REQA 4TQ9A 1KERA 4AJ1A 4P4GA 1G6HA 1GG5A 3E4DA 1EGQA 3IAM6 4ZDWA 5EIFA 1O95C 3J81A 4PS0A 3PP8A 4LMBA 4QBKA 2EX4A 4EJ0A 5JH7F 2IZ1A 1U31A 1SVLA 2O4CA 5LN1A 3HB4X 3EPLA 1V3TA 2BCEA 3OIDA 4C1BA 4Q4CA 2ZSEA 3AHHA 1SULA 5B7NA 2AI2A 2W6ID 4NPHA 1R5JA 3PHCA 4UHKA 3WB0A 2YNMC 2DUNA 2WSMA 2KYRA 4YECA 2VRCA 2AW5A 2N9UA 4CLOA 1CQPA 3TSWA 3ME5A 2CNKA 3HSSA 1WHTB 1NM5A 3OM1A 3RHFA 1SRQA 4MW9A 4AK9A 2VA9A 2VDRB 2FX2A 4WFJA 2WWRA 1GCOA 4AP6A 2YN2A 1IVYA 2W6ZA 2EZ8A 1ZVKA 4UQLA 1CUZA 3JD4A 3QA9A 4PGGA 4QULA 2BM8A 1NP3A 2Q6VA 5EC8A 5HUQA 4RL6A 2Z2IA 5J4YA 2F43A 2Q1UA 2FKNA 3V8EA 3ELDA 4YXWA 5L6MB 1A8SA 3RYIA 1MHTA 4AFNA 3IAEA 4ENTA 1PJSA 1DJLA 2A5DA 1EE9A 1S5PA 2B83A 1SCKA 3IVCA 4KFUA 1YB5A 5FEMA 4DOMA 5IDXA 1WA5A 1W29A 3GP3A 5KSWB 2IELA 1JJFA 1POWA 2DKNA 2RI1A 5ALWA 4BVAA 4CFZA 1DADA 5HZHA 1GSOA 4J0CA 2WP8J 4DDHA 1UP7A 4BS9A 1NLFA 2H06A 1N3LA 4FGUA 1BX1A 1VPEA 1UZAA 4DJFC 3QVVA 2JIDA 2XUJA 4XQ9A 1O9GA 2H92A 1YZQA 4EYEA 3MLBA 3IOBA 4U7DA 4QM6A 5EIBD 3ZWNA 1IRIA 3IAAA 1J0XO 3MGBA 1MDFA 2CDNA 4MVJM 4YCAA 5E7MA 2EL9A 5L7YA 4CMEC 2Q5JA 3TG8A 3HYCA 1WB6A 4TMTA 4Y2XA 1MAVA 2F1HA 2QGZA 3N75A 3JTEA 3CUYA 3PXCX 4IEEA 1ODIA 4XYLA 2BT4A 3PGMA 4MWGA 1W52X 2ZXFA 4YV1A 1CR4A 2A58A 4A10A 1QO7A 1A82A 1FMLA 3NM6B 2XUHA 3B20A 2G36A 1U2PA 1NI5A 3KLNA 3PD0A 3AM3A 3QK7A 1M2HA 1VGQA 2JH8A 3CF4G 4JWKA 4KAAA 1EZZA 1PZNA 2EW8A 2H4JA 4W9RA 4F2WA 4JK3A 3SF8B 1T0PA 4EG0A 1T1JA 4JLOA 3IMFA 4B3IA 3G5TA 1RI1A 3I09A 1M2EA 3MA0A 4MW0A 2ZEJA 1Y0BA 3CZ4A 1X92A 1KK2A 3SXPA 2BRUA 3RUPA 4JV5B 2H18A 2OSVA 3WGNA 2HUPA 5AK0A 4XQEA 1YRBA 4AMBA 3THSA 2GKOA 1OV6A 1NLUA 1PT9A 2ZRMA 3OJOA 1QMGA 4IIXA 4BWFB 1NF2A 2GX6A 2RG1A 5JT1A 3BMQB 2RI6A 4E3WA 2GD1O 4N0MA 1D2AA 5LVAA 1E77A 2PUFA 2CB9A 4NWIA 2JIQA 2QZZA 1OBOA 2ZRIA 4MR9A 2Y1DA 4LTDA 2B6HA 2F4NA 4PSUA 3RBZA 3O8BA 1XTKA 2X2EA 3AH8A 2BEKA 1YXMA 3DGEC 3H4IA 4I4LA 2CNWA 2B0CA 3ZZ1A 2M6RA 4TLBA 4FOOA 3EMBA 5C5CA 4MV3A 4RTNA 3GHHA 2C2ZA 4PWZA 1X70A 1H8HD 2XMDA 2X86A 2Q5EA 3I73A 3CLSD 2HUNA 2VDQB 2QTFA 4O59O 3SHFA 2X9QA 1K4KA 2D0OB 2G9QA 2CXHA 2MSKA 2P62A 1VYUA 3R5JA 3BTOA 4FD2A 1O0BA 4MYTA 4DV5B 3VKWA 1L9XA 4BXOB 3MS2A 1UQUA 4ZC8A 5IC4A 3CWZA 3G6WA 2VR1A 2PPVA 4Y2QA 1I4DD 4FFBA 1GUBA 1DJNA 4N7BA 5CDSA 3E0QA 3IEPA 2R11A 2X8WA 3GPIA 2WVJA 1L7XA 1U8AA 2FE1A 3BRSA 3G0GA 4MRRA 1YV9A 4N03A 2VHJA 5E6UB 5KBYA 2O8VA 2XKAA 1YQWA 2WWIA 2AG0A 4UVHA 2XODA 2A2ZA 3ICVA 4QU5A 1XQWA 3K20A 1A9TA 1XEXB 1CJBA 2P6RA 1K7SN 1VP3A 3MS7A 1Q3TA 4IS2A 2ID9A 4C4RA 3WLSA 5AVZA 2EX1A 5BORA 3TQQA 4OVKA 3A1VA 4TV9B 4BAGA 4IUBS 3V7YA 4WEQA 1Y9EA 3TLJA 1E64A 1N0UA 1ECPA 3BRWD 1JUDA 1JNXX 4KRYA 4O0LA 5CLIA 1AQYA 2B35A 4RVFA 4YJFB 1QO9A 5EIXA 4UCWA 3WRYA 1HORA 2IDKA 2ZPTX 1QG2A 2EU8A 5B1HA 2HSJA 1BXGA 1VTKA 3C8UA 1T26A 4WXRA 4ZVLA 5TVKA 1HUQA 1RTTA 3FLBA 3P1JA 4ID9A 4WL0A 4D96A 4G0VA 3KAJA 3WLMA 1LKZA 4AU1A 4EJFA 1V8OA 1YDWA 3C74A 2Q41A 4IDEA 2KQUA 5AW1A 1NF8A 2C9DA 3BICA 2Y68A 3FMIA 3HDTA 3ZWCA 2GAOA 5LDGA 2DHDA 2PDAA 3KWJA 3R3YA 1E60A 1PFWA 1XRPA 1GFWA 3E1SA 5DI3A 4B3BA 4DJ5X 4EVSA 5DIZA 2Y3IA 1QHEA 1CY8A 1UBOS 3GFBA 1B0AA 4C7VA 4ZICA 3H8VA 1U28C 2QTBA 3LQ2A 1HDRA 1EFTA 5D5PA 4BU0A 4I3FA 4JUCA 3R9WA 1HE2A 2DH5A 1KNQA 2BBSA 2ZATA 3B53X 5G1NA 3EZXA 4MVXA 2CMHA 3D4OA 3WDMA 4YAGA 4B32A 1AOXA 1L1EA 2XMBA 2Y9MB 3EW7A 3F0TA 3LYHA 1TQ2A 3WI7A 3X43A 4L95C 1U0OC 5AJWA 1TUEA 3NDBB 3HXLA 4KR3A 4Y2HA 4KGXA 3R5FA 5ALEA 2B8TA 4YRGA 1RWBA 1AUVA 3IPCA 3CIFA 1BDHA 2WB4A 1X1TA 4EKNB 5KOJB 3KTDA 3DZKA 3SNHA 1EBBA 1I0IA 1UWCA 5DTEA 3THOA 1OLUB 1ST2A 1W87A 1RI3A 3WO0A 3QVOA 4C87A 4FYVA 1RPAA 1JXQA 1XO1A 2FPGA 1LLUA 2LP4Y 1Z18A 1VKNA 3EGXA 4HNGA 1PTKA 5LBIA 5IJ9B 5JJCA 1L9KA 5IWAB 1EX6A 2HV8A 4ZIRA 1K1EA 1DCKA 2G28A 2V8OA 2VPPA 3PE3A 1OIWA 3VO2A 2L69A 5BOVA 1V5GA 1YHZA 3R0ZA 2Y8EA 3B36A 3W6ZA 1XVTA 1TLFA 3DO8A 1N57A 4H1HA 1H2BA 3DFKA 2IWHA 5AOVA 4CNBA 4HUTA 4M76B 1VL6A 1XDZA 1S96A 2OORC 2REOA 3L9WA 3LUJA 1K4MA 4YJHA 5BQPA 2FWMX 1NMQA 1J21A 4JNCA 2WUGA 2C92A 2OZLB 2ZRQA 3MWFA 5DMXA 3N5CA 4BX0A 3FDIA 2ZYGA 1JKMA 4YCCA 1HE1C 1EQUA 1EBFA 1HSOA 1NI4B 2CEKA 2PX6A 2XUPA 5EP2A 1XNQB 3QUCA 2RAVA 1EVLA 2ZR0A 1NW5A 2CVOA 2O3JA 2WWXA 3C3PA 5B2FA 1U7UA 3STUA 2F3PA 2OK8A 1SUEA 3Q3VA 5IT5A 1JB9A 4P58A 3HWRA 4GLLA 4GPD1 2ZSHA 1HPLA 1US8A 2QI9C 1RDFA 4OBEA 4QRIA 5FI3A 4B8ZA 4E5MA 3ONDA 1V16A 2BGMA 3VPGA 3TEMA 3I61A 1HQCA 1LDYA 2RAPA 3L7BA 4OJQA 2QT1A 5IVIA 1UOPA 1FZQA 2OAGA 1NUPA 3MTQA 2B9EA 1N5IA 4RKRA 5KCMA 1RBMA 1UKZA 4EARA 1LDMA 2NYRA 1FL9A 2I71A 4M0CA 2IU4A 1ISPA 1MHPA 3V8VA 3NUGA 3ZX4A 1VE1A 3WIEA 5JVDA 4JI4B 3SZRA 3UWDA 2P4HX 3KVRA 4JC4A 3K70B 1I6MA 2WTXA 3F3SA 821PA 3D2BA 4F92B 5E1OA 1IB0A 3QRWA 1T8YA 2ZUSA 4CKWB 4RMIA 3NVKI 1PGQA 1GAWA 1QV9A 1A5AB 1TTQB 2UZ3A 2IT1A 5DBEX 4B3GA 2WWFA 3AINA 4J43A 1M6NA 4R68A 3KT6A 1SELA 2ZBPA 1RD4A 2HC9A 1OFUA 4OYRA 5U4XA 3IMCA 4AZ0A 1P4HA 5BV1A 1NDUA 5J4KA 1XBTA 5IDWA 1E2FA 2EJBA 2Y27A 2Z5GA 1YKFA 3OZGA 5C5DA 1GFIA 1PLJA 5K3OA 4UEJA 3CBQA 4KKVA 1EFDN 1ML3A 1T9CA 1XCJA 1DWUA 1I4TD 3O4IA 4GXQA 4J1QA 4A91A 2H57A 2QX6A 3G0DA 3MJVA 3UK0A 2BE9A 3DE7X 5ALXA 3UC9A 3AW9A 4OUKX 4YP7A 2I2WA 3DOHA 3V4FA 1T2AA 2FXVA 3E03A 3FSGA 2ROQA 1SG9A 3NUQA 2Q4OA 4JJ4A 5AJZA 1E2KA 1TYDE 2XTMA 3KTOA 5DEIA 1WM1A 3OC6A 4MYCA 4DRZA 4FLMA 3VH3A 4ZOQI 1KEEA 3GLIE 1E66A 1EX7A 1FW8A 2FJ0A 2GVZC 2ZT5A 4S05A 1C0PA 5BN5B 3SEQA 1FTNA 4CF3A 4D9IA 1E3MA 1XNRB 2C9ZA 1ECJA 3VPHA 4PTLA 4OMDA 3KQOA 3GZNA 4C4XA 2ISQA 4POOA 1X0VA 2CT8A 1UBNA 1VHDA 3HJFA 2O8FB 2EIXA 5E7QA 5DLYA 1CRZA 3OMXA 4PE5B 3ICEA 1GZ5A 2DWCA 3MMPA 4NBRA 3BXXA 5JCJA 1YJ8A 3BPSA 5B64A 1KEKA 1TW3A 1V9LA 2OK7A 3EZ6A 2ZRJA 3O3MB 5F9FA 1IQ0A 3KXPA 3F8WA 3O4FA 1AZLA 1E7SA 5LXTA 4MJ3A 4AO6A 1ANKA 3BMXA 3LY7A 3VNSA 4IDDA 1ACMA 1UPUA 2V8BA 5IANA 1GGNA 2VLIA 1YUBA 3B7GA 2ZBQA 3LT5A 3TEFA 1UC8A 4W7IA 4HDOB 1ETUA 1TO6A 2JI6A 3HY6A 3L7IA 4OQEA 3IO3A 4O2AB 4TKMA 4MO2A 1NR5A 1SQGA 1FFAA 1FQJA 3B5IA 4YR9A 4DV0B 3MERA 5TRTA 1MGOA 4CKYA 4AN4A 4EEXA 1JR6A 2DF8A 2E4WA 5T4EA 1YQGA 3OZEA 3EULA 4BFVA 2DBYA 2B1RA 3P9QA 1NJ2A 5K1ZA 4BRWA 1QH8B 1VPWA 1PZEA 4UULA 1Z07A 4P3XA 2ZUUA 4U3JA 4V0ME 3T0GA 2DCUA 1PL7A 4DKXA 4WBNA 1O4VA 2O8DA 3O2SB 4DMHA 1UKAA 1P7PA 1L7RA 1X2BA 2OV8A 4RV4A 3UFBA 1GSAA 3KAPA 4ISBA 4I50B 3LF2A 4PTYA 5IZCA 1UBCA 3LXXA 1T1IA 2ZG6A 3AHFA 3C1AA 3TMAA 4B6OA 5L51A 2HQBA 2QKYA 5C52B 1OJ7A 2FLKA 4A23A 1LQTA 4LJ4A 3SR3A 1ISGA 4A0HA 2F4VB 4IOJA 4F84A 1TF5A 2OCGA 1KO1A 4E94A 3FOBA 1JAIA 4F96A 4MR8A 4R0VA 1H2AS 3VJMA 4W5WA 2VPYA 2OGUA 3QU7A 4IZIA 2W2VA 2IPXA 4B76A 3SQNA 2CLHB 1E94E 5ER9A 5KSYA 3DSRA 3KPJA 5IT9A 1QP4A 2X6RA 3VVMA 2AJBA 3WGYA 4LF6B 1ZR2A 4GGMX 4V0OA 2BYTA 2IKSA 3G0IA 3I01M 2J07A 3RTCA 1O94D 4RQUA 3IUQA 4LCEA 5SY9A 3G6KA 4LQDA 1A3CA 4EB6B 2AT1A 2D7JA 3JQCA 4N49A 5EJ8A 3LX5A 3OFJA 4I7EA 1MJHA 2II6A 4Q9KA 5IAJA 4M53A 1L7DA 1MJGM 3EUAA 1XVIA 1C3JA 1XJCA 2NV0A 4D74A 4KXWA 2BFDA 2KE5A 3QXHA 4G36A 3ROKA 3ZQUA 3RSFA 3BZWA 4BVJA 5I9NA 2ZE7A 3L77A 4ND7A 1KEWA 3BRQA 3F97A 4JP8A 5F21A 1HYEA 4ZYZA 1CJMA 3ABZA 2VYVA 4LJ5A 4Y6LA 5AXBA 1U63A 4ZJZA 4G8CA 4UZEA 4W7HA 4KQ2A 4LYJA 5EIOA 3MBIA 2IYRA 4TYQA 4Y7DA 2G40A 4HDMA 4EPWA 3E23A 4HNVA 2C9BA 2H48A 4G24A 2V1UA 3MRTA 2O3UA 3KM0A 5EYPA 1TC2A 3K92A 2NVUB 1HXHA 2PZLA 2ZWOA 1XPJA 3K9QO 1HNXB 5B5SA 1U8EA 2IYUA 1ZK4A 5UKDA 3GZ4A 4ZWNA 5I9SA 1JA1A 1JHRA 1Y7HA 1RXWA 3OPNA 3L40A 4Z7QB 3UJAA 2R68A 4XPIB 2O06A 2IBTA 2LBPA 3HJUA 1ZNYA 3TAXA 4WJLA 5I7UA 2VOJA 2CXUA 1F0PA 4FCTA 1T4CA 3IAM1 2OQVA 2I8LA 4YJ2A 3I9KA 3GMDA 3AM1A 1WX1A 3UUFA 4WKOA 5KYXB 1OZAA 5K2OA 1GIAA 1RXCA 3A28A 1MZPA 3OEHD 4HP8A 1E7YA 1QYCA 2FU5C 5B30A 3QMWA 5FB3A 5H8WA 1OFTA 5KWEA 2VHQA 3I2IA 1YL6A 1G8GA 4C6TA 3ZJVA 4ESHA 4LWOA 4ENSA 1BXKA 1SXIA 2XECA 4MEJA 7MHTA 4BTVA 3SCZA 4B73A 4YCSA 1TQDA 4EHBA 3JYQA 4PNPA 1AGRA 2C78A 5FOTA 1Z4PX 3W05A 3CLVA 2FETA 4KVZA 2SKEA 4IX9A 3WGVA 2FXIA 1F06A 1A96A 3NDJA 5FOWA 5FWXA 4IX1A 4PYLA 1RM3A 1DIBA 1PZFA 4JX8A 3RTDA 1PDWA 2Q46A 3ETHA 1XQYA 4Q7KA 1ENYA 4ZCQA 1CRLA 2R4UA 1R6BX 1WNTA 4M1MA 3TL6A 1Q5PA 2HHHB 1I1OA 1N5MA 4QQKA 2JI9A 2ZJ4A 3CZMA 3HN6A 4LDAA 3TUIC 1W4CA 3V8MA 1JNYA 2A9PA 4JYZA 1ILWA 2JJ1D 3K5IA 3OQVA 2OXTA 3FCEA 2YWHA 4ZCTA 1ABBA 1OZFA 3RAGA 2TMYA 2R8PA 2Z6VA 3I01A 3Q3CA 4UASA 5EWLB 3WGZA 2C5SA 2WIAA 4OJNA 3NB0A 1DP4A 1ZK3A 4K46A 2I4TA 3RLIA 4BN4A 4DCPA 2R7MA 1U3WA 4JLWA 1SWVA 2G08A 2PWYA 3LUKA 5JJ5A 3OIVA 1GR1A 3DLAA 3FM9A 2W6JA 5EHXA 1DC7A 3S68A 4QARA 5FUYA 3EXIA 4ARZA 3QOYA 4MUIA 1ZL0A 4ZAGA 4R01A 2WZCA 4RF2A 4I1PA 4QDJA 3BXFA 3O2NA 3WB1A 2EG5A 1WV0A 2XTZA 1SM4A 1Q15A 1I4OA 2X7JA 4S1NA 3X1YA 1IQUA 2QA5A 3D43A 5IUNC 5A5EA 1IHUA 4MQ5A 5K3BA 1YRLA 1BZYA 3S8MA 2MSNA 4C88A 1M7HA 3W5BA 2Z5LA 5E2IA 4U5XA 5P8WA 2J9XB 4NKRA 5CDUA 1RBYA 2DGDA 1YI8A 1L7QA 2Y1EA 5AW7A 5IRCD 1F8FA 4ZVKA 1Y5LA 4PIMA 1ZEJA 4GSYA 4IGKA 1JAZA 5ES3A 1VL1A 4D5EA 4NENA 2VBFA 1EJBA 1HZZA 1I1QB 2Q4BA 4K3VA 4BQIA 4TV8F 3IUEA 4DT1B 2XA1A 1IZ0A 5JJLA 3M6UA 2GEJA 1G7CA 3R4VA 4MIOA 2Q2OA 6REQB 1RPZA 1A9YA 3CRW1 4CM9D 3QXXA 3DMPA 5CR9A 3NIDB 5DSTA 3DDHA 1U8XX 2F9LA 4Y0AA 2FRVA 4IZOA 7REQA 3FF4A 3OLVA 1D03A 2ZJAA 3G8BA 4WN3A 3B3FA 3GGGA 1QCDA 1OT3A 3K9CA 3R76A 3RUHA 5I6DA 1GRRA 2PMKA 1RR6A 1GUAA 2SCUB 3DEHA 3FETA 3KPUA 4TLEA 2IL1A 2RH8A 4B46A 4F9EA 2LRHA 3BA6A 5CA0A 4BNWA 1QFSA 3K1AA 3R0JA 1FRNA 2JBHA 4LTMA 4ARVA 5LQRA 4OB7A 1E1MA 1SUPA 2G5TA 1PAUA 1WULS 1C9EA 2XV1A 3PE4A 1FYXA 3BAZA 3WVNA 3K70C 5JCPA 1YOBA 3IAFA 5K6AA 4TYYA 3K3PA 3WKEA 4DEXA 1DAHA 4MGKR 4BO5A 1GKKA 2IITA 3R9XB 3QMVA 4I1UA 4PX2A 1AQJA 4JVMA 5BOSB 3VHQA 1FYFA 5H16A 4W1PA 2HLDD 4EATA 2OCLA 1ZGGA 1HLDA 1XX6A 3K73O 4HGOA 3L7YA 1CY1A 1LSUA 1DLIA 1NUUA 1CUWA 2BCGY 3JSAA 3MB5A 5EJEA 2J9RA 1RQLA 4IWNA 4RQTA 3CKMA 3UA3A 4I2VA 3GLRA 4ZMSA 3WL6A 2OZVA 2BGKA 1QV6A 4KXNA 5DXFA 1RRCA 1CR1A 1IPFA 4XWWA 5T6BA 3Q0IA 4WY8A 3G1UA 4WTOA 5DTMA 3LFUA 1DFGA 2E1PA 2PUEA 5JMPA 2X1VA 3FCCA 4MROA 2D2IA 4EY5A 2R48A 1LJLA 2Z09A 4AURA 5AJYA 3QF7A 1E20A 1FLAA 3EC1A 1M2NA 1PX0A 3X1DA 1MUUA 1FLVA 2VPZA 1HFWA 2FW7A 1HG0A 4XB1A 3Q41A 3FSRA 3K9BA 3UENA 3TXYA 1ORDA 1RXUA 1K9SA 1VJGA 4DIOA 4OI0A 2LVBA 2J5BA 1Y9AA 3A9UA 3OPVA 4QGBA 3HUFA 3FKSA 4LZAA 1GSHA 4HMOA 5FI5A 3T7TA 3USES 1GRNA 1NL3A 3JYLA 3K0EA 4LNAA 2BKAA 3H0EA 1P4RA 4WDRA 3KYDA 4UDNA 3ZDXB 2PKCA 4WUTA 4FKMA 4DS3A 4UAGA 2CFIA 1J8DA 3KZKA 4TZKA 1JIVA 1U9JA 3G5AA 2AMYA 3WQRA 3Q7IA 4DIMA 3BK2A 2H51A 4LA4A 3WLLA 1RKUA 5GAJA 4ZZ1A 2FUG1 3AIKA 1MO5A 3S2FA 3W78A 4BL5A 5I9IA 5EMNA 1DU4A 1PEAA 1Y7TA 1JJIA 4RM3A 3TR0A 1KU0A 1SHZA 4AN1A 1Z2AA 3JATA 4QBIA 4EEZA 2DWUA 4BLOA 2HJ9A 1QHSA 5FWAA 1VJ0A 5T4FA 3TOXA 1DX6A 4BBZA 1SU7A 3QITA 4BWYA 2E87A 1JMKC 4HJXA 2D7CA 2VHVA 4GP7A 1G7RA 4IOMA 2CVPA 5EJ5A 1M1YA 2NO6A 2B5OA 3QEAZ 3TFWA 2AC4A 3I6IA 2JL1A 4UVIA 3STHA 4ADSG 1C50A 5LKRA 4PSCA 1ZVJA 1UXIA 2BHLA 4C43A 4EPYA 4EZBA 2JGDA 3X1ZA 1KIAA 1XRLA 2HDNB 4XM0A 5H68A 1CF4A 2IXGA 1PGPA 4CIBA 3EX7C 5KZMB 2UXDB 3L0IB 1O9HA 5DULA 3FI0A 3WP0A 3MGGA 4Z7OB 3LCCA 1W6UA 1NMSA 4PO8A 2CJPA 3A6JA 4GWLA 1GYRA 4RD0A 1G2IA 4P7GA 4RTPA 3LQ4A 4ALMA 2ZKIA 1QGED 1D7OA 4M9UA 1X1SA 4NV1A 2F1RA 4ZI3A 1A2BA 3H9UA 1UDAA 2G7ZA 3O21A 3ROPA 1QSGA 1YRWA 3IIJA 5B57C 4OK6A 1KXZA 5AXCA 3LBFA 4HDQB 4EJSA 5ALKA 5CM8B 4YDRA 2IQ5A 1GQSA 2YV5A 2NTYC 2YY6A 4UNQA 3QXGA 3KLMX 4K6MA 5EFOA 1KAEA 4IDGA 1DJMA 1UM9A 4AB1A 5IJ0B 1F2TA 1MD9A 4Q4JB 2BCJQ 2BFFA 3C1OA 2FG6C 3EAQA 4EUSA 4Z9YA 4H6VA 3CRRA 2KW5A 2DPHA 2WZBA 2WYHA 3EDYA 1GGJA 5IASA 3ZVLA 4L0MA 4ZV7A 1EUCB 3G49A 5DGIA 3GMTA 2GK4A 3JAWA 3UC5A 5K3FA 1LSSA 2GCEA 3DZDA 3M6XA 5EPEA 1QFXA 5HTOA 5LCXA 3DZHA 4LZZA 1E9VA 2B8JA 4RFVA 2BV3A 4L6IA 1NXWA 4RLHA 4PC3A 1HT2E 3IR6A 2IU6A 4AZVA 4ED9A 5CCXA 1I10A 1ZVMA 4GOXA 4JYBA 4EGSA 3DQQA 1O95D 5BYAA 1P9NA 1WJGA 4YAFA 3ET4A 5TV2A 1J07A 2PT7A 1E9RA 3B1ZA 3OEWA 3QTTA 4EHAA 3GA5A 2XUIA 5JQGB 1ORHA 3WR5A 1KFBB 2YCBA 3GJTA 1OU0A 4JEHA 4UZFA 2WJPA 2XB2A 3F3MA 4CVNA 5DSZA 3T1QA 1KP3A 4GVLA 3A7EA 2YNMD 1GPWB 3KYBA 3STYA 2H1OA 2C0CA 4A8JA 3AY6A 3NHMA 3VSEA 1OILA 2I8AA 3L05A 3BCUA 1KI9A 4R9RA 3T41A 2HAEA 2E55A 5P21A 3LRTA 2CXNA 1L2TA 1L4BA 3HHEA 2XE4A 1D2GA 4Y67A 4MINA 3RSZA 1PWYE 4EPVA 2JCGA 1J2YA 1SBNE 1Z4LA 4LJ7A 4IF4A 5G1OA 3ULKA 5AVUA 2XMCA 5BNZA 2PXAA 5EFZA 1W0KA 5IC6A 3ILSA 4PLTA 5L9AA 4PPYA 4ND4A 4PLGA 4WRRA 4B3XA 4BEWA 1GTG1 1JU4A 1YU9A 4NK4A 2I1WA 3VNQA 2Q07A 2V7TA 3G0CA 1KNXA 2JCVA 5JSZB 4XWTA 1M73E 1BH2A 1B3BA 5CNMA 4DJEC 4GHWA 1QGOA 1ZCZA 2UYOA 4ER3A 1GKLA 5A9TA 3WAJA 1PJBA 5ALMA 4K86A 4ZC1A 2WE7A 1W85A 3I30X 3T3DA 3QQ5A 2A7QA 3HCRA 1O8CA 5HE9A 2FR8A 2HYDA 2JZNA 3NBUA 1BNCA 3UO8B 1CEYA 2YDYA 1LC0A 3IJRA 4LZLA 1QWSA 3JQDA 4DB4A 3PUKA 1LDNA 1SXHA 1X38A 4E70A 3ZU6A 4XWKA 4INOA 2HK6A 1JFFA 2VJCA 2RGRA 2HU8A 5CNKA 1KH1A 5TLSA 2BAGA 1AZSC 1YZVA 2XWSA 5E7IA 1XLUA 3AKEA 4XDYA 5SZJA 1YMQA 3HFSA 3I8OA 2RG7A 2P3LA 1WLYA 5DHQA 4EWLA 1SKUA 4R8MA 4X92A 1EINA 5E3IA 1WQ3A 3EIQA 3RUAA 5IXYA 4W9NA 4OHWA 3OQHA 1X1CA 4R1UA 4B3HA 3DHEA 3QLVA 1S2DA 2VAWA 3THWB 1CY7A 2AHOA 3GRPA 2P9GA 2P9BA 3AEUB 5K51A 5KYUA 3SQXA 1FMJA 3PXXA 2A4MA 1KDTA 4D44A 4EO4A 3SBEA 4A15A 5HFAA 4B6RA 1K2VN 2WVAA 3EY4A 4KXLA 3ZCXA 2WG2A 4B34A 4JI0B 2E0IA 3WK6A 4F86A 3ZBUA 4YV7A 1DOZA 5AKJA 3WLIA 4D0RA 3L49A 3HKCA 4MV5A 4OJTA 4TOIA 5C4IA 1QO0A 1BYUA 4MP8A 1BH6A 2ZUWA 3IUNA 3WB9A 4PM4A 2GJKA 2JLXA 1QU3A 2FF5A 3CSSA 2DLCX 4LI3X 4LKOA 2I4NA 1WUTA 4Q1AA 1F14A 3NORA 3R4CA 4BE4A 3OE5A 3HZZA 4Q6WA 4TXHA 5HK9A 3T5CA 1X7XA 2WDPA 4DWOA 4HDSA 2FN8A 1E3LA 4QRHA 5K05A 5CH3A 3O3CA 4IWYA 1F8UA 4JP1A 1AHPA 4C0XA 3UAVA 1GWNA 3TLGB 1ZVQA 3ENWA 1VZ3A 4BMNA 5HZGA 1EB8A 1EM8A 1L1RA 2BD0A 1VKZA 4FFWA 4INAA 4MEBA 2ORVA 1DV2A 4D9CA 2JBAA 1EFCA 3IUMA 1SURA 2OD9A 1PFGA 1Q6ZA 1Z4OA 2Y0BA 3FMGA 3BAFA 3OTIA 4BVGA 5CVEA 1LPMA 1X87A 3MT7A 4D3FA 4QNNA 3EGDB 1CQWA 1RLJA 3BEOA 4COKA 4XKJA 3KPVA 4XW2A 3RVPA 3FSJX 4JI5B 1DBIA 4MKGA 4LYFA 4Y2JA 3SYMA 1MPXA 3AVUA 4DB2A 4NS1A 1QBKC 1WW3A 1N6KA 2NO0A 4GR5A 1IY9A 1HV8A 1OQAA 4RZHA 1Y42X 3QI2A 1F8XA 5ICSA 3CUUA 3EZGA 3A6ZA 1M72A 1FQWA 1W4RA 2E1RA 3Q2OA 3ZX5A 1EBUA 2HMTA 1TD1A 1A27A 1GVNB 4JQYA 4KQ6A 4PYQA 2YJ4A 3I9NA 5SY6A 4QDXA 5F9HA 5EJ4A 2I78A 4EY3A 2PSDA 3DLCA 1TMKA 2QD4A 1DHTA 2H2DA 3DKRA 3NKVA 4JBGA 1B3RA 4KIGA 3TJZA 3DV0B 3I28A 4GOKA 3SBDA 3THXB 1V1RA 1ENZA 3JYOA 4GECA 2JGKA 2JA2A 1T5IA 1TZMA 3U3XA 3PA8A 3QIVA 4D81A 4ZO4A 1M2JA 2FUCA 1A7UA 4KFSA 5JCOA 4A3SA 1EWKA 1TEXA 2E37A 4HYTA 4F9FA 4TXMA 3QGMA 4LC9A 4Q66C 2D1TA 3PIRA 3K6SA 4N9WA 1I4LD 4OH1A 1FX1A 2HHJA 1TNDA 2N75A 3SAJA 3CSDA 1B73A 1UJ4A 4YO8A 4WNAA 2HPHA 1JHQA 2RONA 3PJEA 3I9FA 5FTMA 4ZVTA 2B4KA 2CLLB 3KJFA 5E8JA 3QVKA 2NVBA 4D7AA 1LF5A 1KEVA 5DK4A 3W7AA 4BFCA 2GM4A 3UTDA 4EHHA 3CC8A 4MUMA 1IM2A 2ZUVA 2ABWA 1JQ5A 1NHWA 1WQ4A 1DQNA 1H94A 2LNDA 2O2XA 3A6FA 1QGUB 1A7JA 3CEAA 3DDUA 3N76A 4Q7MB 4YALA 4C03A 2RGGA 3U4DA 3M5PA 4CMIA 5KTOA 4RZ2A 3O4VA 3NDPA 5TPZA 4M1KA 1A1VA 2UXCB 2W00A 3EZ9A 1ZM7A 2XNHA 2QE7A 1XAJA 3E58A 1D3AA 3A9VA 1LTHR 3C14C 4HRXA 3UK2A 3AVYA 3ELUA 2XDQB 1DPGA 2JAWA 3IBTA 2HPVA 1FVFA 2O0JA 4IG4A 1VHTA 3OE4A 4TN5A 4IDAA 1MJFA 4KH1A 1W19A 4X7BA 4XD7D 3CPEA 4YHBA 4ZEMA 5HXAA 5TGZA 5DCYA 1XXLA 3L41A 3OOSA 4JOBA 4OQYA 3R40A 3V48A 3T1HB 3ZWQA 3PF8A 4JN6B 3AKCA 2H59A 4BECA 3H5NA 1V8FA 4YR7A 2GVDC 4OX9B 1GEGA 4O2LA 4NBTA 2ONJA 3ZCRA 1V1MA 4CU5A 4EG3A 3AERA 1EM6A 1P5JA 1TM5E 1TECE 2HDHA 1FYDA 1Q1ZA 2LKDA 4FDMA 2P2YA 3TX6A 1AA6A 1NC1A 1QE0A 4IG9A 3KQMA 4PYKA 2QW8A 1S8NA 3VR5H 5F9MA 3MOSA 5ALVA 4RF4A 2E4UA 1A7AA 2C0PA 3L1KA 4OQNA 5K8LA 3Q5DA 1VKRA 4ZD6A 2JD1A 2R5FA 3IXMA 4N39A 1VSTA 3TTTA 4JODA 2W6NA 3DCJA 3F1KA 1ZY2A 2QZ9A 2GN4A 3WZ2A 3KJQA 1W36B 2EKDA 1G1AA 2TS1A 5HZMA 4JGBA 2ZQZA 1SOMA 3PD7A 1FNMA 1K75A 1NJSA 1FCJA 1ZD2P 2ET6A 2FH5B 3BVPA 2BFEA 3CGWA 3H3JA 4NVRA 1UBMS 1KZ9A 2RGNA 1YZTA 3DD1A 2WD7B 5E1BA 1PW5A 4CKBA 1PSZA 1KFKB 3F73A 1WXWA 1KA9H 2H31A 2R8YA 3PRKE 4ZVQA 2QJOA 1AF4A 3BCSA 3PUVA 3TBHA 4DV3B 2IBSA 4GKJB 3GCZA 1TZJA 1KYWA 3LC1O 2QUHA 2YN0A 3OQOA 1JILA 2V6BA 1RC1A 1E5LA 3DONA 2DWOA 1IPEA 2Y6UA 4CT4B 1F7VA 1II8A 1CYDA 4H16A 1MIHA 2CXTA 2X4DA 4CLDA 2AOUA 1AY0A 4N82A 1G7SA 1RJEA 4DCVA 1Z5ZA 1B6SA 2ECPA 4EHIA 2UDPA 1DC3A 3SZ3A 1G59A 3KTAB 4C05A 1C8VB 1UJBA 5E4JA 3PS9A 1SH7A 2ETVA 2N1MA 2FOLA 3JQ6A 4WUVA 2V5VA 3AYZB 2IPAB 2VNAA 1GCGA 3N39C 3R5SA 4O4LA 5TS2A 4B7CA 4C04A 1U0LA 3DBLA 2XZDA 4P1ZA 1BHO1 2QRVA 3NWOA 4TSKA 5BWMA 3L82B 2C4KA 3L43A 2Q4EA 3R6DA 2VP4A 3K2EA 4FHEA 4I0WB 3BFVA 3GF4A 4KQEA 2IIBA 4BRZA 3WMFA 1C3EA 5A03A 1X1QA 3P9NA 1XVVA 2XITA 3BXPA 5IDVA 3GELA 3VR3D 5D1HA 4CMBA 5FBWB 4O63O 4PIPA 5M29A 1P91A 1A8HA 3ETDA 1ESEA 3FRHA 3WNZA 1JR3E 5JRJA 4ICIA 4Q3EA 5A7GA 2YFHA 4E2FA 1AQ6A 2F1KA 5HUJA 3EZ2A 1JHVA 2OM6A 2PO5A 1HKUA 2QYOA 1KPHA 1D2NA 3G3EA 4IUCS 1DAOA 5HKAA 3BN3A 3T1YB 2GETA 5LP6A 1YZ3A 2YQZA 4X8OA 4Q7JB 5EJGA 5C7YA 4NH0A 3UK7A 1X7DA 1C9JA 4LOAA 1IY0A 1IY8A 2A0KA 4M36A 2FFQA 3MRSA 1YU6A 5I9TA 5A4MS 1EWYA 4B3MB 2P6UA 4UCQA 2NP6A 4BMSA 3AFNA 1XLVA 3MQ2A 3DUWA 1NUTA 3MM4A 2GEVA 3A8TA 3QPDA 4NX2A 5CGZA 2DQSA 2WKSA 3NHRA 3U4GA 4A6XA 4YT2A 5JECA 5G40A 3QVMA 5BNWA 4DIDA 4FYIA 1GU1A 1B2RA 1OX4A 2BKUA 5AK6A 2JAHA 1XP8A 3QZUA 3NRCA 5DYTA 3RWMB 1OJLA 4AQYB 2YYAA 4O33A 1XV5A 1DWQA 4L85A 1H2HA 3QLUA 4O4IF 4TWIA 5LQCA 4QG7A 4RESA 1CUEA 1FDVA 1FFWA 2QXYA 1OA0A 1H5NA 1SN7A 3LE8A 2ARKA 2B2CA 2G9UA 2VKQA 3QKIA 1TIBA 3EW9A 4I1VA 3LIPA 3JQ7A 2X1MA 3SIWA 1CF9A 1R64A 3WBFA 2OV3A 3ZUPA 2C04A 4OXXA 3HNPA 4YV0A 4QOJA 1KC3A 3TNFA 1U5BA 1BMQA 3JQEA 3R7BA 1X7WB 2REQA 3WFZA 4H59A 1DBVO 1Z62A 4FI3C 2C2GA 5FBQB 1NQWA 1Q20A 5HF6A 3VOBA 1MOZA 2QZPA 3F5MA 3RRFA 4I1YA 4BO8A 4DADA 3IIIA 5HCNA 4BC0A 1ID1A 2QLFA 4TLLB 1TQ8A 2EQBA 4PLPA 1F2VA 2M6SA 3D4IA 4W6ZA 4YMLA 2EKQA 4JLJA 4QXPA 3E9YA 1UIMA 3UA4A 5AIBA 4BGEA 4DMGA 4UD2A 2FPMA 4QICA 5SV2A 2WB2A 1U2GC 3K96A 3KVVA 5H83A 3SZGA 3MVEA 3WDSA 2YW9A 3KZCA 3W2FA 4DDVA 2YVAA 5EZQA 1BX3A 1T9BA 3M4YA 2FNAA 1NJFA 4BVKA 3KQLA 2WYOA 1A8QA 3AHIA 3BL5A 2VJDA 5CNJA 1R16A 1XD8A 1O6CA 3MOGA 5C3MA 3GEMA 3GCXA 3ZHSA 3DMHA 3N58A 2AC7A 3OZIA 4Z99A 3RI3A 5KVVA 1IZZA 3IAUA 3DOJA 3ZGOA 3DZJA 5FL7D 1Q0ZA 3QYPA 4NV3A 1O5IA 1SUCA 2W83A 2AG1A 2ZJ7A 3EC2A 4TL7A 1Q1NA 4UPDA 5I9BA 5DHRA 1GPJA 2JJQA 2QL9A 3D6NB 1QDEA 3O75A 3X3HA 5EZ6B 2PUTA 2GNAA 4ZAYA 1E9SA 4KIUA 3PFIA 3ADPA 1XMVA 5D2CA 4AAYA 3F4BA 1ZRNA 4GSLA 1C1XA 4ALNA 4BNYA 2QDKA 4F5DA 2Y71A 3L8YA 5HNKA 5JYDA 2WFMA 4CEJA 4P98A 1YTLA 1I2AA 1U8TA 4PZ0A 1IWBB 3KR1A 4R9VA 2FSVA 2C2MA 1BCSB 2WM8A 4JDUA 3MINA 4OAQA 2FDRA 2XGMA 3OZCA 1QCYA 2WOJA 5D8DA 4KR6A 4ZU1X 3HKDB 3MF4A 3OJFA 4OI1A 2FP3A 3LW7A 4TKUB 2IP2A 5DM70 4DUGD 4BFWA 1IXSB 3LXMA 3ZK7A 2DTXA 4NG4A 2OD2A 3DNMA 4C4SA 5KNDH 1ZICA 3QYFA 4OMCA 5HMMA 4FONA 3COPA 1J8MF 1ZG3A 4FSHA 3BGWA 3O73A 1G5IA 4R54A 4RUKA 1ZVVA 4Q9NA 4Q12A 4ALKA 1GPNA 1Q11A 4X85A 5LZ5A 4PLCA 1C1DB 2WK1A 3KOMA 4OM8A 4B4DA 4ABTA 4CETA 2G9ZA 1TIKA 2Z04A 5KIAA 2VQEB 2B0JA 2QTGA 4KRXA 3WKCA 1HMPA 4E31A 1WUKS 3BS4A 5BQXA 1JEAA 1WKVA 2E89A 4GMKA 4LBVA 4ZPXA 5AHKA 2PL9A 4EBFA 1KI7A 3IP3A 4KX3A 4TQUS 3SVTA 1JZQA 4G4IA 4GGPA 2FMIA 1KYZA 2EEZA 2O8NA 3U9LA 4F5YA 1JG3A 1U2EA 3AC0A 1W73A 1GILA 4I55A 2ENWA 1CDZA 5IZ4A 3LHFA 2P6PA 1JI3A 1ORTA 1RMQA 1ZYUA 2Y1LA 3PC7A 5F3DA 5T57A 4A5OA 1TEVA 3OZBA 3UT5B 3E7PA 1I8TA 4BV8A 1IE3A 3P9ZA 3ZGXA 4P2BA 5EGNA 3UAWA 4DMRA 4TWBA 4XWYA 3WYBA 4TYNA 3FPGA 1PFKA 1U8CB 1JFSA 3CT6A 3GFFA 5F2OA 3ES9A 5KNCA 1P1KA 4W8GA 3VHXB 4C2AA 3E15A 1E96A 1MIOA 2RHMA 1ZH4A 1X7YB 3UZUA 2Z1NA 3W5SA 2QN3A 4ZQHA 1VKOA 3I37X 3O47A 1JR3D 2B1JA 8MHTA 2AVDA 3TIFA 4DXHA 5KWVA 3UJCA 3ZHQA 3QELA 3T15A 5J1TB 2YBEA 3H1EA 2WYIA 2W37A 2QG6A 5FLYA 3WGHA 3L4SO 3MJTA 1ZMTA 2B98A 2J32A 2P7IA 1RJDA 1BFKA 4Q3KA 1QKIA 4BKMA 3PENA 1OLOA 3Q3JB 4PQGA 4DE5A 2NTJA 1MEOA 4ZZ0A 1IN1A 2PGJA 2XRFA 2GCOB 4XZ3A 1W2HA 2HK9A 3VDMA 2A0YA 2HBZA 2FN9A 2IHTA 1FMFA 1TTHA 3TXAA 2I80A 3B13B 3D6VA 1VJ1A 4CZ2A 3VTKA 3VRHA 4TZTA 1TE2A 2PNJA 3K8YA 3NHKA 3FWNA 3TSCA 4MUKA 1DC4A 4KCGA 1AE1A 4KO1S 4PFQA 1JHZA 2K7FA 1BDJA 1F4PA 1KAOA 2X8JB 3FFBA 2L2QA 1P9RA 2GRJA 3FGZA 3KYJB 3LDHA 1X13A 4HLQB 4QWWA 2PSSA 2UZ0A 2PRYA 3QSYA 3RHTA 3H5IA 3VSAA 1LPAB 1PG2A 4F6CA 4RE6A 2YJNA 4YMGA 5AK5A 2I4MA 2Z4SA 1B1CA 1F1JA 3LIIA 4X64B 4QOIA 1R9JA 2VDJA 5AM2A 1N77A 3J81k 1QHYA 1DEXA 1E5TA 3L6OO 4D9EA 4Y2UA 4ZCRA 1CZOA 2WJAA 4KQHA 3GMIA 1N0IA 4X1YA 5E6RB 3IHKA 3UWSA 5J58A 1UJ5A 2AZDA 2JIBA 4HI0E 2GMWA 1GPBA 4YMTA 4U7GA 1PZHA 5EXTA 4GX5A 4LYGA 2UUPA 1KH3A 1Z35A 4J9VA 1Q12A 4OHFA 4JBIA 4D0NA 1YQQA 2O3RA 2ZAYA 4GD3Q 3TRFA 2P9JA 4C1NA 1FDTA 2BEUA 2MSDB 2VEOA 3KU1A 3ETEA 2BW0A 1OKKA 1W36C 1JPVA 3IA2A 1WB9A 1NN1A 1Q74A 2VSYA 4URUR 4CUJA 1G66A 4DA4A 1D0IA 3MWEB 1QIIA 4DIEA 3C15C 3P2YA 2R1VA 4MIYA 4Y9UA 1TKCA 1D8AA 2ZUDA 1E4EA 2C96A 3F4KA 3JQ9C 1KE2A 5HJEA 4E1AA 1HC7A 1G42A 4FTWA 3QVLA 4XX0A 5GOZA 1ISFA 1ENPA 4OHCA 3BE6A 1AQIA 4IHJF 3TVTA 3K70D 3FPFA 3ACDA 4FT4A 3BQMB 4Q6BA 3BD9A 4NZ9A 1BFDA 2EFEB 3X2FA 1M83A 1N9GB 2GN8A 2P7HA 3OFVA 4MVJF 4BMOB 4KRGA 3K2QA 2GO1A 2WUVA 2JHCA 4HNSA 4I99A 3HB5X 2ZRPA 4TKVB 5CMLA 2QTCA 3CF0A 3GRYA 5ELMA 5KNBD 3OF3A 1FQOA 1Y6JA 2ZWMA 3GQBB 3A3PA 2GHQA 3HDVA 3P26A 1EFVA 1Z17A 2YV2A 1KR5A 1FTSA 4ARSA 4BJHB 3GAMA 4AZ3A 4P32A 3K0AA 3FOZA 1OHHA 4JBXA 4E7OA 2B8WA 1NRJB 4NCIA 2WBLC 4NFHA 1FFHA 2CL5A 4MUHA 5JMTA 2IK8A 3BXZA 4NC9A 4RZXA 5KSOA 3QENA 5ENVA 2F9FA 5GZ1A 3PUHA 1DJQA 4NE9A 5ECYA 3L4JA 1QK3A 2IUSA 1FPMA 4E09A 1IUKA 5I8ZA 1J7JA 2F17A 3MTDA 2R6DA 4HVLA 3RU2A 5D7NA 2WG1A 5F1KA 5KTNA 3GLGA 3V8NA 3HN7A 1I3MA 1NXVA 2QPLA 4RK5A 4P80A 3HCBA 3JQGB 3ZZMA 5AM3A 5ADWA 1KO4A 4AZTA 5F7ZA 1QIMA 3R20A 2ZJ1A 4FMPA 4PYRA 4CM6A 2IW3A 5KHLB 2GSWA 2X76A 3O84A 4YASA 1C3OA 5DO9A 1FU7A 2XX3A 3OURA 3RVRA 4DJJA 1LCIA 3GJ4A 2O07A 4PYIA 4NCHA 3C6BA 2N3ZA 3NIWA 2O2EA 1OC4A 3UJ8A 4BQFA 1B93A 2C97A 2VDOB 2L0XA 3DNPA 4RKEA 3DOFA 2YY5A 1NXOA 3N6XA 3QA3E 4HEJA 5K3SA 4D3YA 1QS0B 2DQKA 3ZLUA 3ZWBA 5CVVA 3KHKA 2X0NA 5C1DA 1GR0A 2ONZA 5ALQA 7AT1A 1JQKA 3R7WA 3W2EA 2NTVA 1Y8RB 2I34A 3CMMA 4TMKA 3TECE 1NXTA 5L4NA 4ZYVA 4J1TA 1PGOA 5BUQA 4QOHA 4MLZA 5DNVA 2V5UA 2I2DA 3R7LA 4UM5A 5H59A 2HJHA 2FW8A 1NTRA 3IQFA 4CG2A 4DLBA 4HWOA 2QRMA 5JLAA 1Z37A 1SXQA 1YJXA 1WTCA 3ZH2A 2PZAA 4FINA 5HOQA 4DLAA 1PP4A 1TQ4A 2VZ8A 4WZAA 5AW8A 4TWZA 3PEYA 3A4LA 1M6YA 4XIIA 4Z2YA 2Y0CA 3M6MD 5BSVA 2OZKA 4JY7A 4MA0A 2R4QA 1A5SB 1RTKA 4PAGA 3ZY5A 3S5JA 1SMKA 2QR2A 3QWFA 1N0HA 2Q6OA 5FWDA 1RI2A 2QTZA 1NFQA 3F6RA 3QHPA 3ZE2B 4P6VF 4X1IB 3JR3A 3TR6A 5FR1A 3UEOA 3QLJA 4W5NA 1N3YA 4IRMA 1HNZB 1TCBA 5IU6A 4D25A 3V32A 5CUQA 3OZUA 2NW6A 4V38A 3H2IA 4N8DA 3ZE7A 2YZ2A 4V0LA 3V4PB 2H63A 2QVCA 1UFVA 1H4SA 3H04A 3JQAA 4G2TA 3Q98A 3SLKA 4HEHA 1U1DA 3Q15C 2WVGA 1Z5VA 3WLNA 2WUFA 3PJFA 3BWCA 4NCKA 5LU8A 4YMIA 2CHGA 3OFSA 1K7YA 3ELWA 2J7PA 5FD8A 5FO1A 3D7SA 1E1CB 1JAXA 5TPWA 5FBZA 5I7OA 1JHMA 1TW2A 1T8SA 3P4YA 1J33A 1WSAA 2O2HA 4ZT7A 4AMVA 1KYTA 2VLBA 1UKEA 1UMBA 2BWJA 4I08A 3ZOZA 3A10A 3N05A 4NZMA 4CTOA 4HQ6A 5DX8A 5LKAA 2FEAA 4LQLA 2IHBA 4MI1A 2X41A 5KNDA 3PWSA 1AQNA 4X65B 4FKBA 2Z0MA 1BWRA 4O4IB 4C4TA 2DQ4A 2XBMA 1D6JA 1O7JA 4TUYF 3LG2A 3EFOB 1BXRA 3CY6A 4FNMA 3JVVA 5H7XA 5L3QB 5KMGB 1V43A 1Q17A 3OAAA 4O2RA 5T7BA 5F3WB 1CKEA 2PCLA 2R00A 5IT0A 4L73A 1TJNA 2A57A 1S8FA 1PHPA 4E14A 3HJTA 4JAVC 3EGCA 1QK4A 3MD0A 3LVQE 1H93A 3CEHA 2JFXA 3SX2A 3WMXA 1DKMA 2EZTA 4N7MA 1XRJA 3ZWWA 2G25A 2ZIXA 3GROA 2UVPB 3G13A 3OX2A 4P4NA 3ZIDA 1Z0FA 4LVNA 1VXOA 3E9QA 2FW1A 2HXYA 1P9OA 4I2NA 1S89A 1R4NA 5CJJA 4CV2A 5LWQA 4B3FX 2PZMA 4MJXA 3MBOA 3M1YA 2QD3A 5AVKA 3ZXYA 4UHBA 4YP1A 3RIEA 3MWGA 1Z25A 4GL4A 5COQA 4F4HA 4XA8A 1IVNA 4RMJA 4WT7A 5EUBA 2V3CC 3HDGA 1U2DC 4S2EA 4XQGA 1EB9A 3AEKA 3ANLA 4WFQA 3WJ2A 1XL0A 4QEKA 2AF3C 2HWXA 3RABA 1G19A 1U02A 5SZIA 2HF7A 2UYQA 3CM0A 3IDAA 1U7WA 4D97A 5LNK6 3NHZA 4ODIA 3AI7A 3RT9A 1FQKA 5IXSA 3CH4B 5CIYA 4DR6B 2JLZA 1KDOA 4JI8B 1MRNA 5GOTA 2NTNA 3KQPA 1CUCA 3REQB 1ZSNA 1ZN8A 4P92A 1E69A 2A5LA 3QFCA 1XELA 1KE1A 5TNXA 3SIXA 4G23A 5K3CA 4XH9B 2Y4NA 2QX7A 1DB3A 2ZITA 2XVYA 4EQ6A 1XPRA 1V3QE 1WOYA 3KZMA 2ADOA 2VTBA 1UT5A 3E53A 3C7KA 4XPZA 5FEUA 3A4MA 5AD1A 3O92A 2C4NA 3IV7A 3OM9A 2XRZA 2J48A 3OU2A 2J41A 3EB9A 4M8SA 2R47A 5EEHA 1REQA 2FEKA 1NKSA 2P8JA 2C4MA 4FUTA 4UREA 4CLOB 1U04A 1UKCA 4TT3D 3BH7A 4L0DA 2OYSA 4IUDS 4OIFA 5I4KA 1QE3A 3IQDB 2W71A 2FFAA 1KJYA 3F71A 5DRTA 2WDZA 3PQCA 1YA4A 5EA2A 4HQKA 1WXQA 1YH3A 4JIGA 2PUJA 1O3YA 1HT1E 4B79A 1DBSA 1Y33E 2WV9A 2O2YA 2F43B 3L6RA 3T61A 4KUEA 5AI0A 1RYEA 1Z6XA 3F8TA 3Q3GE 3RYIB 2EERA 4E4RA 2CV0A 1CNEA 2XCSB 4F0JA 4XX1A 3TE7A 2P5UA 4AJ2A 3CW9A 1E6LA 3LV8A 1L7BA 1DAMA 2FF7A 2ZPUA 3M82A 4BWGA 3PC6A 3WSWA 3UG7A 5JCXA 3NHBA 1BRTA 4CXMA 3BILA 3WRXA 2HW8A 4YHHB 3OIWA 3H5AA 2P2GA 4MYSA 3QYAA 4TQAA 5KTKA 2FWRA 4TRJA 5EMHA 4EKIA 3NYRA 2JJ2D 1AMOA 1WMAA 4QDTA 3O1HB 5K4AA 4ZT6A 2WWYA 2WJ4A 2YICA 2ZU0C 3ENZA 1JHPA 4F1WA 1N9ZA 1SJ9A 3KT3A 1YE3A 2J0EA 3NTRA 2D8AA 3EQ7A 5EE1A 3WHKA 4ZI7F 3PLRA 4QPPA 1QRTA 3ITKA 3ABSB 1J70A 1W1UA 4G0MA 1D1PA 3ZZUA 3VHRA 1WDTA 3L0BA 4DJDC 2MWMA 4I5GA 3RT1A 3UN1A 1W8DA 3T1VA 1UKVY 5AMXA 4JLPA 1NMXA 3VTAA 4BYMA 2GFHA 2VT7A 2F3SA 3HBAA 8AT1A 3Q2KA 1SU4A 5AK3A 2CE2X 3SX0A 5KX5B 3FWYA 2H8KA 5CVDA 3K0CC 1XTQA 2E4AA 3IERA 3ND7A 1RYBA