2ZIGA

Crystal structure of ttha0409, putative dna modification methylase from thermus thermophilus hb8
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
236
Chain Sequence
VHRLHVGDAREVLASFPEASVHLVVTSPPYWTLKQLGHIEDYEAFLDELDRVWREVFRLLVPGGRLVIVVGDVAVARRHLVFPLHADIQVRCRKLGFDNLNPIIWHKHPYEPGAIIKTEIEYILMQRKPGGYRKPTQEQREKSRLPKEDFHRFFRQIWDDIPAPFPLELAERLVRMFSFVGDVVLDPFAGTGTTLIAAARWGRRALGVELVPRYAQLAKERFAREVPGFSLEVLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative modification methylase
publication title Crystal structure of a putative DNA methylase TTHA0409 from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 76
structure length 236
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zigA00
2XVMA 3O31A 3R24A 4C05A 2IPXA 3DLCA 4Y30A 1VQ1A 2PXXA 4YUWA 1JTEA 3LKDA 3QOWA 1NBHA 3T7TA 1I1NA 3FPGA 3HCFA 2ZZKA 3FUVA 5DTMA 1AQIA 3AJDA 5K0NA 1G8AA 5CVDA 4DCGA 4BP3A 3KR1A 4HSGA 2WK1A 2AOTA 3EMBA 2YVLA 5EHIA 2OB1A 3ELYA 3LGAA 3NVMB 2AOUA 2ZFUA 3LBFA 2PXAA 3BXOA 1P91A 2ZIFA 3KKZA 4YUYA 2Y1WA 3MQ2A 3FRHA 3M6VA 3PS9A 3SR4A 3PFHA 3R3HA 1U2ZA 1Y8CA 1KP9A 3P9NA 1F38A 3UJ7A 2HNKA 4POOA 2JHAA 3LBYA 4CTKA 1R8XA 1EG2A 4HTFB 4RTQA 4MWZA 2O0LA 2YX1A 5DSXA 2AVDA 5GM2A 1UFKA 2JHCA 3I5UA 3O7WA 5EEGA 5DM1A 1PRYA 3TFWA 5M5BA 3LDFA 5FHQA 5D1HA 3B3GA 2AR0A 2AN3A 3ORHA 2O07A 4QPNA 1NT2A 3NJRA 2QYOA 10MHA 3OFKA 1JR4A 1HMYA 3B5IA 2N47A 2YR0A 4ER3A 3UFBA 2OYRA 4C03A 2ZVJA 2IBSA 3M6UA 4NECA 4PYLA 1TPYA 2AN5A 5BW4A 5U4XA 1SKMA 2CWWA 4XUEA 3OE5A 2P1DA 5F2KA 4RTKA 9MHTA 3ELUA 2GA9A 2YQZA 4E31A 2NP6A 2PSSA 3JWHA 3KU1A 3LKZA 4P7GA 5T6BA 2EG5A 5IKMA 5BP7A 1ZHFA 3HM2A 5E1MA 4RSRA 5LSAA 4PYQA 3DTNA 2IH5A 4EMSA 4BLWA 3NDIA 2IDKA 4RVDA 4R6XA 3CBGA 2ZLBA 4CWAA 3FUTA 3LHDA 3UJ8A 2OBFA 3FTDA 4KWCA 2ERCA 1L1EA 2ZIGA 3I58A 1NV8A 4MIKA 1M0EA 2FK7A 3G8BA 4RV9A 2OKCA 4K6MA 4XCXA 3L8DA 4GBED 3KQQA 5DXAA 2P7IA 2DULA 4C07A 4GOMD 5KVAA 3LX6A 3UWPA 3TKAA 1VE3A 3GRRA 4RVHA 1QZZA 3DR5A 3G7UA 3ER9A 3LCUA 2BR5A 3E05A 5GOZA 3VSEA 2UYHA 3PT9A 3ANXA 4A6EA 5E8JA 1XDZA 3FZGA 5FCDA 4P7FA 3V97A 5KQRA 2AVNA 3TRKA 4C06A 1EQAA 1ORHA 2OZVA 3BWCA 3A25A 3DMHA 1D2CA 1H1DA 3FTCA 5EMJA 1FP2A 5LR6A 3KR2A 4JXJA 3QOXA 2CL5A 5E1BA 3VC1A 2IH2A 3EVGA 1MJFA 3GDHA 2PT9A 4RVGA 2IH4A 1R8YA 3P9KA 5KQSA 3GRUA 4HGZA 5H02A 1YZHA 4YV1A 1SG9A 2BR3A 1SUSA 4EKIA 1XJ5A 1L9KA 3KHKA 4YV2A 1NW5A 2O57A 2GPYA 2YXLA 1F3LA 4CKCA 3MCTA 5FQOA 2FCAA 2R6ZA 5EHGA 5DPMA 2HV9A 3PTAA 2PT6A 5HILA 3BKXA 5E1DA 2PX8A 4YMHA 3CCFA 3Q87B 3B7PA 4GC5A 3DOUA 4OQEA 5C1IA 4C4AA 2GH1A 5CCXA 3HVIA 5BXYA 5E9JA 4DMGA 2PY6A 2XYRA 5FQNA 5K8VA 5FHRA 3HVJA 2Z6QA 3UA3A 2ZBQA 1R6AA 1JTFA 4Z2YA 3FUXA 4E32A 2ZWVA 4IWNA 4BY9E 1BC5A 1KHHA 2B2CA 2EX4A 2YTZA 3GCZA 3MGGA 3K6RA 4OQDA 2P35A 5K0FA 5KYGA 3CJTA 4PGHA 4X41A 2JHPA 3G2QA 4FGZA 5EOVA 3X0DA 2FRXA 3M4XA 3GIWA 1I4WA 5FUBA 3FYDA 1P39A 2E5WA 3P2KA 3R9XB 2NXNA 1O9HA 1JQEA 1WS6A 1XCJA 5K0BA 3LDUA 4U7TB 3PX3A 3OFJA 3JWJA 1WXXA 3GJYA 1KYZA 4H0NA 4KDCA 3EVZA 1UWVA 2PVCA 3O4FA 1RI5A 1FP1D 3CVOA 5HIMA 2Z6AA 1Z3CA 4X61A 5E2AA 3OU2A 2QM3A 2H00A 5DXJA 5JUWA 3THRA 3C3PA 5IH3A 2OY0A 2G8NA 4YUZA 5LQNA 3P8ZA 3TKYA 3DULA 4GOOD 2F8LA 2Q41A 2H1RA 5E8RA 3SVZA 2QRVA 3HNRA 5EQJB 1G6Q1 1RI1A 1ZGAA 3I64A 3FPEA 3JWIA 4KW7A 5LQRA 5CIYA 4MHTA 4KDRA 3UBTA 3C6MA 2GB4A 3GRZA 4MQ4A 4PGGA 2O05A 3BT7A 4HTFA 3M70A 3KPWA 4ISCA 4ER7A 1JSXA 2PLWA 5FA8A 5DTRA 3E23A 5K0GA 1DL5A 2BZGA 4IV0A 3UJ9A 2PX2A 5ICCA 2ONYA 2IIPA 2C7RA 4FT4A 5CVEA 3EEYA 1R00A 2GS9A 3I9FA 4V0RA 2OPBA 1VP3A 3AY0A 2C7OA 1EJ0A 4BP1A 2OB2A 3PB3A 4R05A 2V7EA 4ATNA 3EVBA 3P2EA 5HIIA 4EKGA 2ZW9A 4XUDA 2AOUB 2XVAA 5EIWA 5FTWA 3U81A 1KYWA 4GOLD 5DRTA 4YMGA 1G55A 2AS0A 1QANA 4B17A 3KR0A 2FHPA 3UZUA 3KQVA 3OCJA 2ZZNA 4PYNA 3T7RA 5DRYA 3OU6A 3BGDA 1NW6A 3A27A 3HCDA 2ZBPA 3TM4A 3DXXA 2G1PA 3OZSA 3A7DA 4ER5A 1R18A 3C6KA 3G2MA 3P71T 4AZTA 3P97A 3I53A 1PJZA 3G8AA 3GGDA 3EEOA 4KIGA 3BWYA 5EMMA 2FYTA 4KRGA 2K4MA 3R0QA 4WXHA 3LCVB 1VBFA 4PCLA 5EZSA 5DT2A 5EMKA 5DWQA 3M6WA 3PLAE 4DM3A 1HNNA 4DA4A 1BOOA 2DPMA 5C0OE 4KIFA 5CVJA 3OE4A 3D2LA 4RYLA 3NWBA 5GIPE 3UJ6A 1TW3A 3RODA 4MTLA 4QDKA 5EKUA 2IGTA 2NYUA 1RI3A 1QAOA 1RJDA 4GC9A 4OBXA 1IY9A 5K03A 2PX4A 1RI2A 4RTRA 3DH0A 2UYCA 1KPGA 3SXJA 2G71A 3UJBA 3HVKA 3S68A 1SQFA 1RJGA 4HGYA 2AOWA 1WZNA 2UYQA 1ZGJA 2O06A 4GUAA 2UZ4A 5DM4A 5GINE 3NVKI 1TW2A 5HEKA 4CXMA 3NMUF 2PXCA 1MHTA 4AZSA 3TPZA 5EVJA 5K0EA 4OA8A 4FP9A 5DX1A 5ICGA 1L3CA 1RJEA 1IXKA 1NW3A 2ZZMA 3CKKA 4FSXA 3EVDA 1JQ3A 1OR8A 2GAFA 4PYOA 1FPQA 1YUBA 3DXZA 3DUWA 2IDJA 3BWBA 1G60A 4RX1A 1XXLA 1RI4A 2B9EA 2EJUA 1UIRA 1VP9A 3TQSA 3NW9A 5CCBA 5EIFA 5CVVA 2LD4A 4QQNA 5DLYA 1P1BA 2PV0A 5DX8A 3OU7A 4YUVA 2YXEA 1N7JA 3KQTA 5KS2A 5LQAA 3CJQA 2G70A 2NXCA 5K05A 2VS1A 3G5TA 1VIDA 5K0CA 4GEKA 3EMDA 3HP7A 3HA7A 3KPUA 1NW8A 4ER6A 1NV9A 3G2OA 4LG1A 1JQDA 3HTXA 1WXWA 2PGXA 3HA5A 5EPEA 2CMGA 3EPPA 3KQPA 5CUQA 4E2XA 4PYMA 2C7PA 4HG2A 1D2GA 3DXYA 3OPNA 1G38A 3EVAA 5FULA 3REOA 3PFGA 3MB5A 4X60A 3R6TA 3HEMA 2P8JA 1N7IA 3HVHA 4PNEA 2EJTA 1X19A 2YUIA 4L7VA 2HMYB 3HCBA 5D1NA 5DM0A 5HOQA 4IKPA 1YFLA 3QV2A 1Q0TA 3FPJA 3EVFA 4RTLA 1KPIA 3KQSA 2A14A 4M38A 1XDUA 5EZQA 2AOXA 5EC8A 5FWDA 5GWXA 4C04A 2FPOA 2WA2A 3ER8A 3IEIA 4OBWA 4LWOA 5CM2Z 1YFJA 1R74A 2B3TA 3UJCA 1FJXA 1N2XA 2ADMA 5EG5A 3T7SA 4PWYA 2HR1A 4E30A 4OX9Y 1EAMA 1EJ6A 3LECA 4M7RA 5CVUA 3KPJA 4DKJA 3BGIA 3HCCA 3NTVA 4ER0A 5E9QA 3EGIA 1Q0SA 2HTEA 5EEHA 4RTPA 2AN4A 1QAMA 2ZSUA 3OZRA 5F2OA 1WG8A 1KPHA 4XUCA 2VDWA 2JH9A 2ZBRA 3Q7EA 5K0LA 3V8VA 1X1AA 4F85A 4OA5A 3GXOA 1JG2A 2KW5A 3LSTA 4F84A 2JJQA 2XBMA 1AF7A 3IHTA 5GP1A 3KPYA 5EMLA 1X1CA 3JWGA 3B3FA 3BGVA 5P8WA 3SM3A 2IFTA 2ZWAA 4DQ0A 3AWIA 1JG4A 4PYKA 3MAGA 3TOSA 1JSZA 3TM5A 1SQGA 2VP3A 4YUXA 2WA1A 3DMFA 4P7JA 1SVUA 5EGSA 2PKWA 4CTJA 3GRYA 4P58A 5C9ZA 3FTEA 3FPFA 3KQYA 3BWMA 3P9CA 2FK8A 3NDJA 4U7PB 4EQZA 1SUIA 4R8SA 3FUWA 4PYIA 5ICFA 3RW9A 2QE6A 3EGEA 2XYVA 1VL5A 4ZTBA 5T67A 3TR6A 2AOTB 5K09A 2Z6UA 2BM9A 3F4KA 4UOEA 1G8SA 2XYQA 7MHTA 2VDVE 2EFJA 4E2YA 3ELDA 3WSTA 1XTPA 1JG3A 4G56A 5FA5A 2PWYA 2QRVB 2P41A 1I9GA 3A7EA 4GOND 1X1DA 4E2ZA 2C7QA 3SMQA 2I7CA 1QAQA 1X1BA 4EVIA 2B25A 3DP7A 2NXJA 5JR3A 2IBTA 1L3BA 4QPPA 4PYJA 4E70A 3CJRA 3HCEA 4RTMA 1YZ3A 1AQJA 4CKBA 3EVEA 5FWAA 3ID6C 4C08A 2OXTA 3TMAA 2ONZA 1M6EX 3HCAA 4PCAA 2CMHA 3CC8A 2PWPA 5DSTA 1VPTA 3ME5A 4Y2HA 2PBFA 5E9WA 3SSOA 3UJDA 4P7KA 3P9IA 4PIMA 4AZVA 5LQUA 3GU3A 4RTNA 3KQOA 3LCCA 3G89A 4DZRA 3SSMA 4YV0A 4EK9A 2QY6A 4KVZA 1YF3A 1EIZA 3A4TA 3A26A 3G2PA 3GO4A 3SGLA 3LPMA 2R3SA 1VLMA 3FRIA 3MTIA 5K0JA 1V39A 1WY7A 3EGVA 1B42A 5ICEA 2NP7A 2Y1XA 2ZIEA 1O9GA 2P3QA 2JG3A 1KXZA 3C3YA 4FT2A 3PVCA 1KIAA 2JH8A 1INLA 2I6GA 1L3IA 2VDUE 1FBNA 3CGGA 5G02A 3MHTA 3UJAA 4FS8A 5ERGB 5LQJA 3H2BA 3P2IA 4GF5A 3HA3A 2VZ9A 3K0BA 4AZWA 3ERCA 2PJDA 3DMGA 3RIEA 3NWEA 3B89A 5T64A 5EKXA 2P7HA 3E7PA 4R6WA 4LWPA 4X1OA 1AV6A 4RTSA 3AXSA 1NKVA 3KPVA 3ELWA 4FR0A 3DLIA 3OZTA 4IV8A 5FADA 2HWKA 3LDGA 1ZKDA 3BKWA 1KR5A 3EVCA 5MHTA 3SSNA 3G88A 3KQMA 1XDSA 4QTUB 2GLUA 2ORED 3UA4A 3TLJA 1IM8A 4DF3A 5HFJA 4HC4A 5GIOE 4QVGA 4QTTB 2ZTHA 2I9KA 3GNLA 3IYLW 2ESRA 1DUSA 2NXEA 4F86A 5HZMA 5E2BA 3FTFA 1ZG3A 5B1SA 1BKYA 1D2HA 3G5LA 5K01A 1NW7A 2IP2A 4M36A 3VC2A 2BM8A 4AUKA 2BH2A 5HIKA 3E8SA 3FYCA 4FZVA 4RTOA 4M37A 3T0IA 2UYOA 4GQBA 4RVFA 4E33A 3LL7A 2P40A 2ZULA 4LECA 1QYRA 3M6XA 2V74B 4WVLA 3GRVA 2CKDA 3AXTA 1ZQ9A 2P3LA 1P1CA 4HRAA 1BHJA 4X63A 2AZTA 3PX2A 3BUSA 3MTEA 1XCLA 2B78A 3SX0A 2G72A 3IV6A 3VYWA 2H11A 4A6DA 4BLUA 2YXDA 4R8RA 1M6YA 4HH4A 5E1OA 3M33A 5DM2A 4E2WA 5LQCA 3C0KA 3KR9A 8MHTA 2P3OA 4PONA 3BZBA 5GM1A 4PINA 1DCTA 2NNWB 5DX0A 1NE2A 1YB2A 3KQWA 1NBIA 4QVKA 4CKEA 2AOVA 3GWZA 4DCMA 5DTQA 5CD1A 2ZCJA 2I62A 3FUUA 2PX5A 4QQKA 5F2NA 3MCZA 4V0QA 2BR4A 1ORIA 4AX8A 3THSA 3B3JA 2OO3A 4BLVA 4RWZA 4PIPA 1T43A 3MERA 1JG1A 4QDJA 5LQKA 3FPHA 4RTJA 4FSDA 1O54A 1RJFA 5HIJA 5BW5A 4O29A 1XVAA
chains in the Genus database with same CATH superfamily
4Q9IA 1CULC 3KUUA 1PR5A 3I34X 5CBPA 2V6JA 1NI4A 1NM5A 2ZT6A 4D0NA 2NT4A 3UH0A 3A6EA 3M9WA 2B69A 2EHDA 2YWEA 2HW8A 3U4QA 4JT2A 4WOKA 4YQYA 1PZEA 5KYWA 3FLBA 1ECPA 2AWOA 4LW8A 4LF5B 1UKZA 4INJA 3HL4A 4HSGA 2PZKA 2DECA 4RHTA 2H1WA 3E9ZA 5JPCA 4XI9A 1G19A 2CDCA 2VYFA 1VI5A 3DL2A 4ZI5A 5C1OA 1GXSB 1ATZA 1F0YA 3FRHA 5A9RA 4BWFB 4WNCA 4Z6KA 2BMAA 2C77A 2R4QA 3Q6NA 3QNMA 4YT4A 2BH9A 4KSYA 4NCBA 1DBRA 4OXKA 4KGVA 2VJBA 2HX1A 3RLFA 2IHNA 5F98A 5A2GA 1R8XA 1LQ2A 1QBKC 2JGLA 3S81A 4MW7A 2BCJQ 5EIEA 1C80A 2QG4A 5EEGA 2QP4A 1ZIPA 4H27A 4LSZA 2VH1A 4PU0A 4UREA 1F06A 3VU3A 4E13A 4PAQA 4R7TA 2XKAA 1G98A 2LP4Y 2FMHA 4G1UC 1ECGA 1JA9A 2VJAA 1F0PA 2E48A 5LN1A 2LCFA 4YEDA 3K1ZA 5IARA 4YPFA 2IBSA 2NVUA 4NECA 3WI7A 5KYUB 5ALDA 1XTUA 2VP4A 2WQZA 5ENZA 2ZB8A 3FKSD 4Z2AA 4V02A 2PK3A 1E9VA 1KVQA 3WLMA 4D3FA 3HXLA 3ZE0B 2G25A 3NPAA 3F3KA 4N7JA 2BGIA 4QWMA 4A8PA 1CJSA 4HFMA 4RSRA 1HRDA 4TVBA 3WYGA 4M88A 2G09A 4XPIA 3B82A 1OB5A 1AV7A 4PV7A 1WV1A 4BLWA 3AVYA 3KDAA 3AP1A 3LBHA 1Q14A 4G9EA 4L85A 4BQIA 3T3NA 2QRHA 1LBTA 1K5DA 3I01A 3PFFA 4D82A 1QYDA 3CRW1 2F55A 1PL6A 1ZOSA 4JJFA 4AWBA 4PC6A 3FMIA 2O2HA 4A5SA 5B2FA 3I58A 3BCRA 1WO8A 2WHEA 1PGOA 1TT7A 1UMDB 1IBLB 1CJMA 5F51A 4MITA 1G9TA 1OC2A 3IVAA 4RA6A 4B6FA 3DW1X 4K40A 2AJDA 4MJLA 1Q7TA 3FTPA 4P82A 3GVIA 2VWGA 3IEUA 1E6CA 3GGPA 3SDSA 2JH3A 3TKLA 3TKAA 3OQOA 4KGXA 1JDUA 2D54A 5BN4B 3W5AA 1Q7RA 4XSGA 3LK7A 1H3EA 3RSFA 3LQ4A 3EJ6A 4J90A 3I9V1 4MR7A 2JFXA 1TL7C 4Z7NB 1JP7A 5KSYA 2AMVA 3Q0TA 3PVZA 4H7IA 2G28A 5H0IA 1MAUA 1VMEA 2IYOA 3KSZO 5H83A 4F45A 5BVGB 4DCGA 5AVXA 2W37A 2PD3A 2V3CC 1QCYA 2AHRA 1R6VA 1Y3CE 3PC8A 5TS3A 3UHAA 5BR4A 2P2ZA 2P6OA 4OL0A 4Y6LA 3IAS6 4OKIA 3NKLA 4X1IA 3RJ9A 3UV6A 4AP6A 1PZGA 2CK3D 1C9NA 4KFSA 4MYDA 2J6CA 4YCSA 2YFQA 5ICSA 4ILEA 5LP6A 1UXOA 3BQMB 4JUBA 2PT9A 2RMKA 1Y37A 4YS6A 3ZWWA 2AB0A 1E18A 1F8UA 5JZVA 2H1LA 5IN5A 4YV1A 1EGHA 5CLIA 4ZJUA 4W5RA 2H85A 5ULLA 3IP1A 2OZLB 3R77A 1LSJA 1RZVA 2H1SA 3LQ2A 4CT4B 2FCAA 5EYPB 4R8KA 5C5DA 3FHJA 3RE1A 4H4DA 1QDLB 1UM9A 4FMDF 4NULA 4EKDA 4QO7A 2YUTA 4IHJB 1JQBA 3FHLA 3MD9A 2GZDA 4BLPA 2EDCA 3CWQA 2Z6QA 3GJ4A 3PC3A 3TH5A 3ZZUA 4BVEA 3DV9A 2Y1DA 1XZKA 3O47A 3HJFA 1EFPB 4DJAA 1JEEA 1R5OA 2EX4A 4I1YA 3EPRA 3ESCA 1CQIB 3MRSA 3AYZB 1FQKA 2PZMA 3VR3A 2VKQA 5I7UA 1T15A 4QXOA 4Z51A 3AP2A 4HTAA 3ZXIA 4ERXA 1V9LA 1XL0A 2UUCB 5C4IA 1D6MA 3M4XA 1E5TA 4EATA 1WY5A 2FFAA 3EIHA 1Z2PX 4HDMA 2P5SA 4EMBA 5LOVB 3D6AA 1QVAA 2OK8A 2HYDA 3BG5A 4G1EB 1DU4A 4YRCA 1QYIA 3U7JA 3I5AA 4PZDA 4AZ0A 3OWOA 1IWOA 4RKRA 2BMFA 1R4ZA 5FPHA 1JTVA 3AUSA 1O94C 2XDQA 3A6HA 3HEAA 1S7GA 3IKLA 1U1GA 4YNBA 1N5RA 1B0ZA 2AN1A 3ZZNA 4X62B 1RPNA 1CQJA 4RZ2A 5J9FA 1P81A 4DAEA 5KX5A 1Y8ZA 4WLNA 1ZVVA 2W8BB 4DA8A 2Z43A 2JFPA 2G8LA 2R79A 2AFRA 4Q66C 4UU8A 1SVIA 1UXKA 1N92A 3RU9A 1QIKA 3AVWA 1UK7A 5JQGB 3PR1A 2I22A 3JCZA 2O8NA 3NONA 4FDTA 3G6KA 4MS4A 4BV9A 5IEBA 4YAUA 4LZWA 1NNUA 1J4AA 1OLUB 3H2GA 3K0CC 2YMLA 4HN9A 3EMVA 5TQJA 1L5YA 1SBTA 1RKQA 1A7JA 1M7BA 1Z4JA 2FUKA 3C3EA 1L5OA 3TW6A 5JAMA 5L53A 3L1JA 1O0SA 2X2FA 3EEYA 3JPWA 2NV6A 1G6HA 3K4HA 2H1OA 2YHBA 3W2EA 3M6AA 2QN8A 5I9SA 3P9RA 3N8HA 3U80A 1P73A 3D7LA 1KI1A 1MAWA 4JYAB 4QDXA 2HT1A 1OZ0A 1OBVA 3K09A 4UD6A 4GL2A 4N0QA 3TQQA 2ZCVA 3LVQE 2OZPA 2CXXA 4Z3DA 5DM70 1QQ7A 2BFAA 4Q3AA 2FSSA 4TL9A 3OD5A 3GDGA 3QEOA 1Z2DA 2FPSA 2J46A 5HUQA 1YR9A 3ANNA 1VCIA 1FA9A 3D64A 3I6ZA 1EM8A 1SKQA 5C1DA 1EJ2A 4Q3BA 3J81A 2GD6A 1FLVA 1YVDA 3EY4A 1FX0B 4OAOA 3RSCA 3OX2A 4H3HB 1VBFA 3TXAA 4A7PA 2VPQA 4EW2A 2X77A 1H1TA 1ANKA 3A6ZA 3IAM6 4MUNA 3RAJA 2H1CA 4CJXA 2WV9A 2X7HA 4JITA 3WYEA 4EGAA 2DM6A 4C7OA 3LL4A 4QJIA 5B57C 3IBFA 1L8XA 3AERA 4H7HA 3K16A 3G8YA 5A02A 4OHXA 1CS0B 2FGJA 2GRAA 1EK2A 4OBXA 4M46A 5FOXA 5B4VA 1RI2A 3RS7A 3D2AA 2ZYHA 2RHDA 1ODTC 3F7TA 1F4PA 1Z82A 3QVTA 4FKBA 3QTBA 4KQXA 4DLLA 3MJ4A 8ABPA 1YCGA 1R66A 4LYEA 1K88A 1BXZA 1T8RA 1XIVA 1TW2A 4S1OA 3ZY3A 3RC2A 2B61A 3FR8A 4YA6A 5E4YA 4XX1A 4AZSA 1OW3B 4OA8A 5EXTA 3MJHA 2XQJA 3IDQA 1V6SA 1E7YA 3TW8B 3UGJA 2ZZMA 3PEYA 4PSDA 1U02A 3GLGA 1JQ3A 2PGDA 3VQTA 1G20E 3M1LA 3G82C 3IUNA 3JALB 2HSWA 3NEPX 3NBZC 3PC4A 1VP9A 1ZBQA 2GCIA 5I9LA 3OKFA 1OFGA 1CF4A 1DG3A 2YW2A 2QQ5A 1UZAA 3VR2D 1W2HA 3OU7A 1N7JA 2EDAA 4H6PA 3DZIA 5LQAA 5A3RA 3QUQA 5BR7A 3OUTA 2NXCA 4N3AA 3G5TA 1AUQA 5TPWA 3LC7O 2A1UB 5IAJA 1J5PA 1IONA 1FP4A 1NRWA 4U6NA 4UC0A 1MF7A 1L4YA 2GLXA 3DJYA 4CFSA 4PC1A 2GA8A 5CPFA 3SZGA 4C3ZA 2AFHE 2ZG6A 1JEYA 4BMOB 3KUCA 4ITRC 1R5NA 4NLLA 2P6RA 3COYA 3E3LA 3P9YA 3EVAA 2ISSD 3REOA 2OCXA 4ENRA 1NNI1 3KEOA 1GZUA 3QVJA 3SSAA 4MYUA 1G64A 1C50A 4IEEA 2C4KA 3ITNA 4HQOA 3GCGA 2YH2A 2RH9B 3UH1A 2BPOA 3WBKA 4DBLE 1Z18A 5CLLA 4CM1A 4UBMA 3PKZA 3WISA 3FNBA 3OECA 1Z7WA 3QLUC 5FWDA 4BVFA 1I6LA 3ZU3A 4KH1A 3E8XA 5JVDB 1YUNA 1W88B 1XCPA 3T52A 5ITZB 1DJLA 2NQ2C 2PUTA 4PGFA 3R7WA 3DFMA 3OQ6A 4JSTA 3QWHA 2ZRJA 2XMGA 1GG9A 3MWGA 3TOVA 3IUQA 1MHPA 3M6FA 4EPTA 5A6SA 5K8JB 2VWQA 3T3DA 2FN9A 4KQJA 2W4MA 4ZHQB 1NF8A 1P17A 3G17A 3U5TA 3BGIA 4ZV4A 4DBZA 5AVKA 2P68A 5CA1B 1LI7A 2OOSA 3CNEA 5JYEA 1Q1EA 5TARA 4DR2B 2R68A 4V2UA 1T9CA 3T8YA 2EQBA 3CPJB 5T4BA 3KSRA 1ONPA 3MINA 5K0LA 1MVNA 5CB0A 1PJTA 1ZJYA 2BT4A 4IVRA 1XZIA 1LFAA 3QEJA 4CF3A 2GYYA 5JS1A 2D7DA 4PG7A 3V32A 1J0EA 2X9QA 1GQYA 3IT1A 1TQDA 4MQLA 3LKBA 4YO7A 1AO0A 1GKUB 4KO8A 3CMMA 1NY6A 2WIBA 4LY6A 5MN5A 2D00A 3RRBA 4OHPA 4E5YA 4DJEC 5CYGA 4IRXA 4PTLA 1H3FA 3GJ0A 4R8SA 2ZE5A 4EKNB 2AMLA 5EPOA 4G5YA 2GBLC 2C03A 3ABOB 1N2BA 1N9ZA 4KQMA 1JDPA 3HI6A 1TM1E 4X8LA 1IAQA 1IB0A 3ELDA 1YS9A 2X9LA 5KYXB 2JLVA 2XPCA 4E2ZA 2Q5EA 2VZ8A 4OLFA 5F4ZA 1GGHA 2VXBA 2HFKA 3I0MA 3RC1A 3H99A 3SF8A 2Y68A 1WSDA 4MQEA 3O92A 2DPLA 4B2LA 1X94A 4DM7A 4Y2TA 4BQNA 1QFMA 3V3TA 1EUQA 4ROTA 2X23A 4X85A 2J6HA 3VBEA 1UFVA 1Z2CA 1KK1A 2AG8A 1AXEA 4NYIR 4AJ4A 1PJCA 4E1BA 4W5OA 3GLFE 3FMPB 1XO1A 1CQZA 3NBMA 3RASA 2J07A 4BV3A 5K20A 2RAPA 2ON6A 4DLNA 3NQ41 5KHLB 4FM9A 3KZCA 3JQPA 3EAFA 5K8IA 4QEKA 3MCUA 5B6JA 4EK9A 2P1RA 1K4KA 4F7DA 3BHIA 3G2PA 4NR0A 5DHUA 1O94A 5A05A 3N6VA 1V5IA 2WG0A 1GTVA 4B81A 3KVNA 4IH1A 3KBBA 4JQYA 4BMVA 4ZU3A 1WDMA 1OE0A 3ZDQA 3LUHA 4HV4A 2VJCA 1UBHS 5KJ6A 2VO1A 4C7BA 4GKAA 1KQNA 4WY2A 3D4BA 5J1SB 3GBPA 1Q1AA 2WV7A 4INPA 1WW2A 4JFRA 3K1YA 4CTMA 1FCJA 1HC7A 1Z6XA 3RFCA 2I2FA 2JCXA 2VXCA 1MT0A 1UDWA 3CLSD 2IYRA 1E79D 3KL4A 1XTQA 3BORA 3L7LA 1CR1A 5EESA 1Q83A 3K0CA 3D1LA 4MCIA 4YDQA 4Q37A 2XB6A 1AK9A 4YJFB 5AK6A 3LUDA 1D04A 4RVOA 3LDGA 3D7NA 5EUMA 4H7PA 2BUBA 3ZV6A 4X93A 5ECYA 4PX2A 1VYHA 1CFZA 1W0KA 1UDXA 4YCLA 3CF4G 1WEHA 1RAAA 4HMOA 1J22A 4IXTA 4MR9B 1Z2AA 5BRJA 4YRMA 5KBYA 1EUZA 3C5CA 3D6TB 3DBLA 1T6NA 1V95A 1NJSA 4HRVA 4NE7A 4D5EA 2XQVA 3OSUA 4S1WA 3F5QA 3OI7A 5AKEA 4I1RA 4BFYA 2DMRA 1WMDA 1ENZA 3HADA 3IVMA 3DEHA 4JR2A 1D9ZA 3T6KA 3MIIA 4JUDX 1P9NA 3K9LA 3DLAA 1J8YF 1BVYF 1Y9ZA 3AXTA 2ACVA 3OZ7A 3QZUA 3BUSA 4EPWA 1KBOA 1A5SB 1Z5OA 4EFLA 4EG8A 3DAPA 1XTBA 4ZVRA 1XCGB 2CB9A 4WXPA 3BD7A 1PWYE 3IJPA 4HATA 3PHLA 5DWVA 1YZQA 2BGLA 3DE4X 1B1CA 2HF9A 2ZTUA 3HXTA 4JIMA 3UMFA 4YRDA 1EZ4A 5EP2A 4FDLA 4XYGA 5ER9A 4R2MA 1RIFA 4S1PA 3SXUB 4ZT3A 1GDTA 4JVNA 1SKAA 4A4DA 5ICGA 1Z4LA 1IXZA 4JBYA 2ZDHA 1MGPA 1UT5A 4JBXA 4W99A 1T5SA 2A5FA 5EWLA 1S8NA 3WK9A 1BCRB 2ACWA 5F2NA 4GPEA 1CUGA 3WNQA 2OFWA 2WTAA 4AJNA 5KTRA 5EERA 3DVQX 1Y8QB 4MWDA 1LBEA 1JGTA 4D8WA 5JQWA 2JFZA 5J23A 4G84A 3NRBA 4LJLA 1ZR4A 3TOXA 3FNGA 1O57A 2PYIA 4XWOA 3GJQA 2QBYA 2YRXA 3Q1LA 4RELA 4OXQA 1VRVA 2DBYA 5BW5A 2BGJA 2OZEA 2PFSA 1YCHA 3BZUA 3DAOA 3OM8A 1B8UA 1LS6A 1QIJA 4GIBA 4IFEA 1U1IA 5FYDA 3T5DA 2Q0HA 2PKQO 1D1TA 4Y2YA 4UBOA 1VQ1A 5C3UA 4UHEA 4PX3A 4MWCA 1VL0A 1FU4A 2LUOA 3CXUA 3VZSA 4GZ5A 1N5IA 2YHAA 2G5CA 3LKVA 3HB5X 3ZI4A 2QR2A 3KR1A 4KV7A 2WK1A 4IHJF 4L76A 1XZMA 4OLBA 1SY7A 1K08A 1KI7A 1Y82A 2CY0A 1X7ZA 2C3YA 2ZFUA 1K6XA 1NQVA 3CLSC 3E9QA 4Q4HB 3MQ4A 4D9KA 5A4KA 4UNIA 2A33A 1X1QA 1CUSA 1H94A 1MVLA 4QBFA 4DQXA 1LU9A 3SR4A 1L0BA 3OCCA 2BHRA 3A2NA 1UBNA 4LC0A 2ONJA 2PUDA 3JQ7B 1D1PA 1RXCA 3ZD6A 2HNKA 3V4PB 3W8NA 1QHHA 4RGYA 2MINB 3GNTA 2QQ0A 3DB1A 1DV2A 4Z0NA 2MYTA 4GL4A 4ZCLA 2JZOA 4BGEA 2BSAA 2WJZB 4AF8A 4QDUA 1E4OA 3QLUA 4LS3A 3FVQA 3HJNA 2W2MA 5LOVF 3H9CA 1EFUA 2QVGA 2A35A 3AUJB 5EXEA 4QFDA 2VAWA 4FHGA 2Z08A 4A73A 1R1DA 2CUZA 2JGJA 3GZJA 3OFKA 5DGIA 2YV3A 3DZ8A 4D2IA 1N2IA 1TOAA 1SKMA 3VA7A 1MH9A 2AN5A 4KREA 2FWMX 1YHNA 3NV9A 4V0KA 4C89A 2FFHA 1Z6PA 4LYYA 1E0KA 4MARA 2WF8A 4JAVC 4E11A 1F9EA 3ONDA 3JWHA 3L1VA 2QX4A 4IKOA 1UANA 2AEMA 4F0JA 1NIPA 1DO8A 3ORSA 1M74A 4JBIA 4RGQA 3V4ZA 2IWHA 4B80A 3DNFA 5JQGF 5AWFC 2GDJA 3AKCA 2K7ZA 4REQB 4R1PA 3U7GA 3QOYA 4F56A 2PA0A 1E7WA 1G8YA 2Q8PA 3GGJA 2B7CA 3HB0A 3PK0A 4ZCPA 2AI2A 3HFSA 1QHYA 1EVYA 2VH5R 4YCMA 3AUXA 3BB3A 3GLIE 2GK7A 1F8XA 2GXSA 3O0TA 4F3RA 3LLSA 2QAIA 2EBWA 5FRDA 2E18A 1CX9B 4DWJA 4NF2A 4B3DA 4BQQA 2ZB4A 3P96A 3ZU2A 2P7IA 4FOTA 1KSJA 3L6BA 2HHJA 3I28A 2FP3A 2GBLA 3SK0A 1MDFA 2C5BA 4RJLA 1QQAA 2PO7A 3G7UA 4D92A 5JTUA 3ER9A 1AUVA 1P1IA 4LOJA 5GOZA 4REMA 4AO8A 4A6EA 4IINA 3BAFA 4UZEA 4US0R 4HVLA 1OTHA 1T8YA 1FE8A 5M29A 4H60A 2W70A 5IHPA 4PPQA 1W29A 2UUAB 1JKFA 3VR2A 1WHSB 1LPPA 3UQZA 5BWLA 2RHMA 2HV8A 4C2TA 2IU3A 2HJWA 3OEWA 3UUFA 2DFVA 2YS7A 1KZ1A 4IFBA 4RPLA 5AR1A 3WDSA 4BKMA 4DSUA 1YBAA 4XVQA 4C7JA 3R9IA 3RK1A 2J85A 1YZHA 2QZ4A 4G23A 1QZTA 2ZI3A 5I8WA 4CM6A 2C7BA 3FTQA 4BQOA 4LFAB 4BAZA 4ARIA 1L7MA 1Z0JA 4F97A 2R6ZA 2G9UA 2QTHA 2R6DA 3L4SO 5ITVA 2PT6A 3CLRD 4QSHA 1K98A 3BKXA 3T5CA 3U3DA 1E69A 1YNSA 3DOUA 5AM1A 4C2UA 1V6CA 3HR4A 2EW2A 3BJMA 3IPLA 4Q6WA 4XUGB 4DMGA 2VPYA 1G21B 1SR8A 3CY6A 3RIYA 4RJTA 3JAWA 5JWHA 4GAEA 3GEEA 4IWNA 4CGYA 4UTRA 5H9WA 4BY9E 3F6SA 3V6LA 1KHHA 5AVOA 4YRLA 4JC8A 4NBKA 2BBWA 3BF7A 3LY7A 2I66A 1CE8A 4YK7A 1Y9DA 4ZWNA 3IIEA 1A82A 1HFKA 2G67A 2VQ3A 2ZRCA 4G9GA 4ZQIA 1A88A 4EAAA 2VNIA 1DCKA 4FGZA 2UVDA 3JZIA 4HOYA 5E0KB 2A58A 5IDYA 4BB5A 1CR0A 2P27A 1GN9A 1WAMA 2A9KA 3LXUX 4BUJA 4EY3A 2WF5A 4Y1FA 4MAAA 2OXEA 4Q9HA 4LNUB 3ZKAA 3AEXA 5EHXA 4CKEB 1QTIA 4L5JA 1CUHA 1FP1D 1WLYA 2BV3A 1A9XB 1K6MA 2CFCA 3H16A 3N8DA 3J7TA 3IXLA 4PHTA 1E63A 4TLAA 5DXJA 4QGBA 4UQOA 3U4MA 1PV2A 1HTTA 3JQ6A 3HDJA 1JJVA 3ND9A 3DFUA 1DIRA 1UZMA 3QKRA 2YZ2A 4GOOD 1P4SA 5LBIA 2Z9BA 3UKOA 1H5QA 1PLJA 4CMBA 2R1VA 1DFGA 3I64A 1X74A 3EZYA 3JWIA 5HM8A 5TMDA 4FHZA 3VPDA 1TZBA 4ZTZB 3BT7A 1PU2A 5HDQA 3PRKE 3PXAA 5C8DA 5JALA 2JGDB 1XZCA 4BQRA 5JVDF 3U6KA 3ZVRA 4S1VA 2BKVA 4YT8A 5I4IA 2H5LA 1DL5A 3AIMA 4NYJQ 1PX2A 3ETLA 4G5RA 4TV9B 5FI0B 2F7SA 2GKOA 2YWDA 3ZUGA 4DL9A 1R00A 4GBGA 1VBKA 4ZHQF 5AVYA 1IK4A 1YS6A 4TTAA 2HQBA 5EJGA 1YSCA 3P2EA 3GCWA 3N2ZB 1NUQA 3AFIA 3PQDA 1B0UA 4XUDA 4TYMA 3PA6A 4LJ7A 1R0WA 5EIWA 4I5GA 1SHUX 4GYWA 5A7FA 3ASVA 3LFTA 1R88A 3DTVD 3Q2IA 2P6UA 3TM4A 2G1PA 3ODPA 1E58A 1T0IA 1XJQA 3O26A 4NJOA 1RHKA 4DNXA 3NRJA 1OA0A 1EGAA 1A69A 4L3OA 3ETCA 2OXIA 4QHYA 1DC4A 3EEOA 2OV6A 2ZUVA 1ODKA 4PAOA 3WR5A 1Z2NX 3CCCA 3L0SA 3VNSA 1Y89A 3RYFB 4AICA 4RF2A 1UQRA 3LG2A 2DQKA 5EMKA 5C3MA 1NG9A 3OTHA 1IJEA 3CLRC 2DPMA 3WRVA 1Y9JA 5HXAA 2ZXUA 2B8NA 4HCJA 3EIFA 2NAPA 5DK6A 1J97A 4AULA 1ZEJA 4D9CA 2O7VA 1F8GA 1DARA 4Y1GA 3IBSA 5EKUA 3TZ6A 1U81A 5AOVA 1C8VB 2QD3A 3I92A 3IAS1 2X6RA 3ZHXA 2UYCA 4KR7A 1JMVA 2WD7B 1IQUA 2AOWA 4L51A 1B8OA 1EGMB 2RAUA 1E79A 4OHUA 5LU8A 1ECCA 4B44A 4CXMA 5FR1A 5CXXA 4HH1A 1L8QA 4NBLA 4QQFA 2O3SA 1KZGB 1NMEA 2H4YA 5AI8A 1W1UA 3LI2A 2OGUA 2DHQA 4K6KA 1YUBA 5JADA 2O7NA 4HNGA 1UMKA 1XXLA 2B9EA 2HJGA 1VCHA 1R0KA 2EEPA 2JA1A 1GL9B 1NN0A 1RJ9A 1XNHA 3N2YA 3W2HA 5B1DA 3OT1B 2VZ0A 5DX8A 5HKLA 3VOSA 4YMUA 1EWKA 2RGUA 1OYYA 1VIDA 1GWNA 3L18A 4GEKA 3KE9A 4ETMA 2MSKA 1P31A 4Q01A 4F1JA 2BFBA 1FTQA 1HI9A 4ZO6A 5GZ6A 2PWAA 1SHLA 3VR0A 5JH7A 1L5HB 3R3UA 2X6QA 4DYVA 3NNSA 4W1RA 3SX4A 2NU6B 1P3JA 2R7KA 3EPPA 3I52A 4J43A 1HE8B 2HLPA 3SHWA 4HL6A 3PRJA 3VBCA 3QXXA 3HA2A 4L08A 1E3SA 5CPBA 2GEBA 4L50A 4ESOA 2VNHA 4JS0A 2CEAA 2BGKA 1AS0A 3ADPA 4YAKA 4J6EA 3WGYA 3CGWA 4EHBA 1N5OX 5HQ3A 3A3OA 2FB9A 5CH5A 4L4UA 4GZ3A 1O95A 2VZLA 3LFHA 4QDOA 2P30A 4C0QC 2FZKA 4ZQGA 4NU5A 5FTKA 2BAGA 3NIGB 1GP2A 2ERXA 3LAWA 4QEDA 1OIVA 1GPAA 1TAHA 1XNJA 1EFRA 1LZLA 3Q4GA 4PBRA 5AICA 5LLTA 3H9EO 2C4HA 3QLJA 4NCKA 2MT9A 3B6ZA 2EIXA 3IUEA 4OYYA 3I9OA 4G0UA 4OB8A 2R7MA 2FWBA 4MYCA 3TLXA 5L45A 3L7KA 1EAMA 4M7RA 1L5SA 5BUSA 3TIIA 3EZFA 5HGXA 2I2AA 3STHA 2P9CA 4L5YA 4TSFD 3S2GA 2W2OA 3P20A 1A0OA 1NQ5A 3HRIA 3IIIA 3PYXA 2AW5A 2H52A 2I4NA 3GPDG 4H1VA 1FNSA 1YKSA 1OWPA 2FY8A 1GHTA 1EBBA 1PJ3A 2IBMA 3PQ7A 5GAJA 3RC9A 3RVNA 5ILOA 2J30A 1EE1A 1WDKA 2VDWA 2ZBRA 3DOHA 1XKXA 2HRBA 1VHQA 3M82A 3FAKA 3L0YA 3HYSA 3IR6A 1JG2A 1HO3A 3S6JA 3W79A 3JQRA 3WWPA 2QUBA 1P45A 1E9BA 2AKYA 2FF5A 3CH6A 1Y98A 3GARA 1ZEMA 1X1CA 2IZOA 2VAMA 3PNVA 2IQIA 1K7XB 4GLJA 2ZWAA 4I4LA 1JG4A 3EXIB 1Z22A 3AEUB 3EGWA 4NK5A 3R8CA 5ER6A 1SNYA 3JVVA 2EFDB 2FXIA 4CCWA 2VOEA 3SPXA 3NHFA 3PNOA 4JBNA 3FTEA 2MR6A 3OIYA 1TQ6A 2BRUC 2DVMA 2F43A 4N4AA 1GQFA 3DWEX 1WCXA 2PMWB 4R69A 3EASA 2DJIA 1NQWA 4MINA 3W7BA 4QT4A 5K09A 2W6JD 2EZUA 3PUJA 5F2EA 1EMDA 2BGUA 3NNDA 4GPD1 1F6BA 1ZMBA 4D9EA 4BEJA 2ZPTX 1ZICA 3IAM1 1TJ3A 2P41A 1OGYA 1T8UA 1UFOA 3QYAA 1EX9A 4CL2A 3CX7A 3L6DA 5JR3A 3BCUA 2ZJ4A 4M1MA 1LF5A 4HAXA 2AXPA 4PYJA 4E70A 3WLSA 1RYYA 3DZGA 3AL3A 1HM5A 3F90A 2QN3A 1XA3A 5FNZA 3R7LA 1TECE 1SELA 2PWPA 3P32A 2ORYA 1VCNA 1YOVA 2WEKA 4G0MA 2FRVA 4KQIA 4JJEA 4X65B 3M5CA 4I1OA 1XU4A 4FFDA 4MVJA 2D3TA 4MP6A 4YHBA 3UUWA 1R0XA 3TVDA 2VJMA 4DA0A 3U7HB 1NYRA 3VPAA 5CTJA 5JJLA 1TKCA 1Q50A 2F62A 5BRNA 1WY7A 1QX3A 3LH5A 3A1DA 3SXPA 4WL0A 3FJ1A 3IOYA 4DREA 1SBNE 1Z28A 5TQ0A 3X1ZA 4DRYA 2GPWA 4A1FA 1AKWA 2R00A 5HJEA 2Z58A 2BUAA 4Q15A 3FCAA 4WEQA 4TXLA 3BREA 1BAPA 2COKA 3CGGA 4P4LA 5G3YA 3ISVA 4CM9A 3C45A 4EEZA 3MJTA 4KOAA 4C21A 3FPCA 1G2QA 4WJKB 1XLVA 1Z75A 1T35A 3EIUA 3CN7A 3Q5EA 1I51A 4NZ9A 5AI0A 3UWMA 3R20A 1CZUA 1XELA 1O7JA 3DCJA 4OAPA 1QQTA 1K7SN 1L4KA 2YICA 2M6SA 3DQQA 4M1QA 5AYVA 5KWIA 4BWGA 5IJ0A 5HBRA 3K7EA 5EJ9A 1N8SA 4NABA 6YASA 4DA6A 4RLSA 2AIRA 3OFVA 3ENWA 1F9AA 3WXBA 4XSHA 2AD5A 3PWKA 1KR5A 4UFOA 2DAPA 2E4XA 3IE2A 4LZJA 1SHKA 3TRFA 3JD0A 1AS3A 1XDSA 3A6FA 3C3BA 1VHDA 3FZYA 4M7WA 3RBZA 4C4YA 2V55B 3ND8A 5J1TB 5KOHA 4WK0B 5TJHA 1U1EA 3VM6A 5GIOE 5D6NA 1FYEA 1ZZEA 2XT9A 1QRAA 1TUGA 4U1RA 1I5OA 5EE1A 1X7YB 4C6TA 1KAOA 4YCNA 2G0AA 4Z9AA 4A2PA 1UZUA 3MUEA 3GFOA 3DTTA 3QPVA 4KDEA 3L7JA 4MA0A 4DYHA 4ZI7A 1BN6A 1DQYA 2AZDA 3B12A 3CQ9A 4M37A 3UT5B 2PPVA 3DWIA 1P2DA 2I65A 3HDHA 4G4IA 4NMMA 4F5EA 1SCAA 2BONA 1TD1A 3T06B 1HYGA 1MCZA 2VJDA 1KO4A 1DTWB 3E7XA 2AZ4A 1E2GA 2CKDA 3IQXA 4K3UA 4UXJA 4M8IA 1P1CA 3F6CA 2JLBA 1J1ZA 3RDPA 1LTHR 3MFQA 1L7BA 2CXNA 2RGDA 3AI2A 3CR3C 2H11A 4HEJA 3AEKA 5WRFA 3W34A 4FB5A 1J7JA 5SY6A 3QE9Y 1COWA 3BHNA 2ZYSA 1VL1A 1ZI9A 4EENA 3VO9A 4XR4A 1N2HA 1UOQA 3EXAA 1Z68A 2P4SA 2GJAA 2PUJA 1LK7A 2MWMA 2RGEA 3DOJA 3WFIA 2XMRA 4ZDIA 5LYJB 3OQVA 4D97A 4JP2A 2CXHA 2VA9A 2YJGA 1UQTA 4FMBB 4KUGA 3RVBA 4RM2A 1GQQA 1U0LA 3F47A 4H59A 5BNTA 4N76A 1J0XO 3C3KA 4FX2A 4XXHA 3S3TA 4ZPXA 1UK6A 3J81k 2VRCA 1JQLB 4LHZA 3ZW9A 1PGQA 1JVBA 2PL3A 2HJSA 2IYNA 4OREX 4LFBB 5I01A 1OPRA 2AX3A 4OHWA 1OWLA 5DNAA 4XSVA 3H1AA 4DYDA 1KI2A 3OJEA 4RVNA 2C99A 2IIQA 5HIJA 3VDMA 3ZY5A 1G5HA 1JIXA 4I6EA 2XUGA 2QG9A 3CRVA 3T35A 3PF8A 1JFSA 4UEQA 1U0GA 4PPFA 1H0SA 2Z4RA 1NR7A 4K9QA 2FZWA 3WWZA 2Q99A 4I5DA 1E9FA 4BMNA 5BWOA 1E64A 3WAJA 1JDNA 1EDOA 5U9CA 4Q9DA 2C9MA 1C3JA 3RQSA 3CMCO 5JMOA 3DAGA 1X80A 4GPZA 1SD5A 1DBQA 5TDHA 4L5BA 3E35A 1QQ6A 4ZXPA 5TXGA 2CNDA 1QIFA 2IQ5A 1M9NA 2RK4A 3N3AC 1VJ1A 3W4IA 5LZ2A 1LZKA 3K2QA 4UTVA 1TT5A 3UAOA 5IXJA 5KYYA 1QH1A 1IJFA 1EHIA 1EQ2A 4UHKA 1Z33A 2LCQA 3CRRA 3PFHA 1WCIA 4JVLA 2MSDB 3ED5A 4JP8A 2IYQA 1GPH1 4LYJA 2EU8A 2P9QA 4LY0A 5JROA 4Q1VA 1C7QA 3RPEA 3UK7A 3U9SA 1A7UA 3CPEA 3IC5A 4N5DA 3A4NA 2FFRA 1RM3A 1MXFA 2D3WA 3KLPX 4D8YA 5BSWA 2DUUA 1AKVA 1ZC3A 1Q6ZA 1AK2A 3Q8KA 3II6X 4CEJB 1GN8A 3C2QA 4UZSA 3LDFA 2GDZA 5FHQA 1AA6A 3QX8A 1JF8A 5HMMA 4I2VA 4K28A 1BZYA 4ASUD 3IDFA 3PIDA 1BFKA 2Q3LA 3DMTC 3P45A 1FTSA 4FYXA 2IXBA 1X1EA 3DOEA 4MW2A 1PJBA 4BMXA 4TTRA 5JS2A 2O2DA 4MYTA 5KCZA 4A27A 1DRUA 2BMEA 2EGUA 3VR1A 3W7AA 4A23A 4PG6A 2V7QA 2HRRA 2WTNA 4P7GA 3SJCA 2OCPA 4YONB 1L7QA 3KK0A 4KPFC 1BSVA 3W1WA 1ZL0A 4Y7DA 3VUFA 1J99A 4HDKA 4MGKR 4ZVPA 4XYEA 3UAZA 2PKRA 1ZSYA 3CZQA 1N3LA 5F33A 2D1FA 3LD9A 5CCEA 1YB7A 1OF1A 1NHGA 4TV9F 4AYWA 3FHTA 3WLTA 1VE9A 2DWCA 2C5HA 3A04A 4HB0A 1KKUA 3REQA 1M72A 3ZWBA 4CCSA 3ADDA 1SWWA 2HK6A 3Q7QA 1BX3A 3WICA 3F96A 4FGLA 3UHPA 3K6SB 2IS4A 1CNEA 4Q3CA 2C7VA 5ENDA 2HCRA 5B3JC 3PUVA 4HRYA 4OMFG 1SD1A 3FH0A 5T3UA 5B6IA 5DXAA 3QYFA 2PA3A 5FLEX 2C4WA 1T8TA 3GK3A 2I8AA 3LX6A 1L7RA 3M5DA 3U49A 5AW2A 2BRUA 4D56A 4B0PA 5FUQA 3SQXA 1RXVA 1C2TA 2RHJA 2G6BA 4EEXA 1E5LA 1G3IA 4LQCA 4LGMA 1NJ2A 3ST7A 2BBOA 1LCIA 1JLLA 3W6OA 1HEUA 2YWBA 3BIJA 2I4TA 3AF4A 3KV3O 4BQPA 3ANXA 3C15C 3K0AB 4L72A 4UUNA 4ZI3A 5JYCA 2ADOA 3LY9A 4EG4A 5K9ZA 2VH2A 4PAWA 3MD0A 3RF7A 1YS1X 2XZTA 4P4TA 5EWJB 2CXPA 3AJ9A 2YJNA 5LR6A 1N5LA 1I7NA 1AQ6A 2ZYAA 4L27A 4YJHA 3DO6A 5DNEA 4MI3A 3KAPA 4QOFA 3AVQA 2BFCB 5DN6A 2HIHA 2QP9X 1YR6A 2HWUA 2ECOA 1B2LA 3EF0A 2Q0QA 3WLNA 4Q19A 2R8OA 1XLTC 3INTA 2BR3A 4IYJA 3N0VA 2YL2A 5F7ZA 5DI3B 2R8ZA 3IP5A 1T9KA 3MCTA 4MCHA 4AU1A 3QYPA 3HV2A 1SUCA 4JFAA 1WQ4A 5I9IA 5KYYB 1V1MB 1EP9A 1B4DA 3DDNA 4O8ZA 4DG5A 4LY9A 1XK6A 5E9JA 3AHCA 3NS7A 1T2NA 3PZBA 4TXMA 4XQEA 1ODCA 2PN1A 2ZBQA 2F3QA 3EIEA 4DMCA 1TTTA 4HQRA 3NHBA 1HX7A 4WASA 2G9VA 2B2CA 3EWIA 5DZSA 4CR7A 1ZK3A 3QPCA 5IN4A 2I67A 2J3MA 5F3WB 4KXNA 3WRWA 4WLOA 1KK3A 2JHPA 4W1SA 4ZXFA 4YRBA 1H5NA 1IDOA 1SUFA 2PVSA 4Y9RA 2REBA 4LOKA 2H1HA 4DCCA 2C2WA 1JDVA 2XDWA 2Y2VA 1OHHD 3QIVA 1ZC4A 3P2KA 4TSFA 2Y0EA 3F8TA 2PUVA 2XCTB 2KPOA 3REGA 2H3EA 3JR7A 1DC7A 3CNHA 3O90A 1W49A 4ESVA 4JI2B 3B5JA 1G9SA 3MWKA 2WIKA 5H16A 5IKOA 5IASA 3D0RA 1YCFA 3I2GA 1RE0A 5ES3A 5HMLA 1SC3A 4JUIA 5JUWA 1UADA 1V9SA 4H9GA 3AVOA 5ALTA 2GD2A 2ZAYA 4P35A 4ITUA 2EFHB 2H92A 3NWOA 2Q6TA 2H1RA 3SVZA 5FT9A 1SOWA 3ZE2B 5LQRA 3G9QA 4KW7A 2Y76A 5F52A 1G41A 3DOIA 1CZHA 5BRAA 1ZD5A 1T3LA 1QGED 2FJUA 2OG2A 2Q3JA 4L4YA 4ENSA 5K0GA 4IV0A 1AZLA 4N39A 1E3QA 1MR3F 3EK2A 4J4TA 4P08A 1Z56C 4NHEA 1I5EA 4BXOA 1Y42X 3W9BA 1SAYA 1UJ4A 2E5FA 2W6JA 3F5SA 3LUCA 4UUQA 5DU2A 4CV2A 3AHFA 3FM9A 4YAEA 3UJHA 1WB4A 1QHIA 3FGNA 3NWJA 4INAA 3UNXA 2ZW9A 5FV4A 1MOZA 2OGZA 1TCAA 1JR3D 1KYWA 1O6ZA 1RU3A 2GCOB 1P0QA 2OC9A 2Q28A 3AKEA 4NPAA 5AJXA 4M60A 4DCPA 2IXEA 3AFOA 3EC2A 1NLFA 3GLQA 4K0RA 4CQLA 2BFEA 4E5KA 1EP2B 2IZ7A 2ZB2A 3BAZA 3BGDA 3LQRA 2AKAB 5ELMA 3NBFA 5T4HA 4EZIA 1GNLA 1DZIA 1NXOA 2P79A 2LBPA 2VHVA 4NRDA 4KMSA 3PQ3A 3M5PA 1YIOA 3OJWA 5EQDA 1BXGA 3ZU6A 1D2MA 3I61A 5K6RA 2I4OA 1FNMA 1A2OA 1Q16A 3CF0A 1GFSA 2ZI4A 3HB9A 4L1KA 4L95C 1Y48E 4KRGA 3RTDA 2YMPA 2ZUSA 1GFIA 4RESA 1SKUA 4NARA 5IAAA 5CU7A 1G63A 3KJNA 1Z4NA 1T0JB 2W8ZA 4ENQA 1ZXLA 2IYLD 2B4AA 4KIFA 3WK6A 1OOEA 3W04A 1SXIA 3T1YB 2G9RA 2W0SA 4JLVA 4ZVNA 1EU1A 2TSYB 4G5SA 4FB4A 1PF7E 1RI3A 3HU1A 5AXAA 2RE8A 1QC5A 3REFA 5IJZA 3KYIB 5K8CA 2CXQA 2BI7A 3HVKA 4OJTA 2FPIB 2OC4A 5KYKA 1RKVA 3I2HA 1QFXA 2OLEA 5GINE 3IT3A 4QYIA 5DP1A 4E46A 1T3HA 3KTOA 7MDHA 1W35A 1U5CA 2EJWA 2ACEA 5ALEA 3ZW7A 1HNXB 5F5XA 5AW5A 3EVDA 1SBZA 3IUMA 4IJUA 3ESYA 3EMKA 1N75A 1XD9A 3DXZA 4LKRA 4PNZA 2ZWOA 2IEGA 5BOSA 3T9AA 5H4HA 5KSOA 1W36C 2O8BB 1M76A 2AFIE 3NW9A 3OJCA 5EIFA 1EWRA 1ZPDA 5DLYA 1ZI8A 4YUVA 3CX4A 4EB8A 1MD9A 1RVV1 5K05A 1XMPA 4RKWA 4RV5A 2ZYGA 2WJPA 3DMTA 1T2FA 4AJIA 5K0CA 5LQDA 1M1XB 3HZRA 5I4CA 3K15A 1AHNA 3B1JA 4Z1MA 5G0UA 2OP1A 2IHKA 3PYMA 2WG1A 4Y1EA 1FNCA 5E3JA 4TKVA 3G79A 4TRJA 2NNLD 4F2WA 1EFVA 1M1YA 2G04A 2Q2WA 5IJAA 4KK3A 4PEVA 4MW4A 4RK5A 2NYRA 3IJRA 4U3JB 3TG8A 1R4MB 1Z88A 2V7BA 1MU0A 2YUIA 3GBVA 1OXBB 1KI4A 4URWR 1LW6E 3SQWA 1QU3A 3CPHA 2HHAA 1YAHA 4R9SA 4TMXA 3WGZA 3QBTA 5EC8A 3CVWA 3U56A 1E3MA 3THXB 4PVCA 3QE0A 4NZOA 4OBWA 1GZ3A 1BE1A 1JVNA 1NBEA 4D43A 1KJ8A 1RRGA 3EDYA 2JIQA 4QRHA 3HUFA 1KFCB 1U8TA 1DIGA 3P2MA 1WXGA 4G8JA 9ATCA 5EG5A 5IANA 1J1UA 3MSXA 4MVJI 1JAYA 2XWJI 1I1QB 2B8JA 1QS0A 5TE9A 3ECAA 5BY2A 1KNQA 1K86A 4C78A 4DKJA 1TF2A 3R7NA 2ZJ6A 2EZ8A 2Q9AA 2XCUA 2YXPX 4Z7QB 3FFBA 2C5EA 3DM5A 4OBBA 4F6CA 3ETHA 3AVTA 1DDGA 4HKTA 4UVEA 3NIFB 2JD0A 1FFXB 4ZYLA 1Z7GA 4M6WA 5CT4A 2FMUA 1X1AA 4NBVA 4UCWA 3CUSA 4ES6A 3NYWA 1U1FA 2VLBA 1SBHA 1C9DB 1WW3A 2PLFA 1HA3A 3ZGVA 1XPUA 5PGMA 1XA4A 2HC9A 3N5CA 3DAFA 1DTSA 4C6RA 1RRKA 3JSAA 1C1XA 3MAGA 2J0QA 1QHEA 1GT6A 5A9TA 5KWEA 3ZV4A 2C7GA 1AN9A 1L6RA 2EWVA 1NWCA 3V4SA 2QU7A 1XLTA 3HKBB 4JA0A 1V1JA 3ILXA 1Z37A 3P9CA 4H2DA 1KVSA 1VTKA 5LYJF 1Y3HA 821PA 2HD4A 3ENVA 3OOYA 2QRJA 1OU4A 1RYMA 3AT1A 3E70C 4TUYB 2C96A 7MHTA 2WUGA 1Z83A 4FYKA 2XZOA 3AWDA 3F71A 3O3CA 1Y0BA 4G56A 2BIFA 2PXHA 4D8TA 4BX8A 3DKIA 1C3VA 2QR3A 3TSAA 3LZCA 1J2TA 3H1TA 3WAGA 2E85A 4Q4AB 5IVDA 2OHOA 1DWUA 5DOVA 1CLUA 2YY5A 2FPXA 3RS2A 3ESRA 3CJRA 1CUEA 3JASA 4EL5A 2XGSA 2XX3A 4JLSA 4UXIA 3UFXA 4EGQA 5LQSA 5HW0A 2AR9A 3NP7A 3TCXB 3DEAA 2XRMA 5DDIP 2XLCA 4F7WA 4YMSA 4P5PA 3A1FA 3ZHCA 4F2GA 1OLSA 1TCVA 3UJDA 2QGZA 2ZYRA 3IEPA 3Q85A 4DV0B 4UNPA 2OMEA 3C5HA 4Y9TA 1XV5A 1NZFA 4MIEA 4ZP1A 3WAKA 3ZCVA 1TM2A 1TK3A 4TMTA 3LO5A 4RK6A 1V2GA 3A4TA 1RWKA 3RS0A 1IN7A 1P4AA 4EHDA 1J9EA 4GP7A 1WPRA 2CXSA 1QCDA 3KD3A 4TL6A 3VUEA 5ICEA 4B48A 3NG1A 2JG3A 1EVZA 2EGHA 2XUFA 2P9JA 3EQ6A 3QSGA 4JJAA 3N2NA 3JARA 4RK7A 5G02A 4DG9A 2ODTX 4F2PA 3ZHOA 1T9AA 5EZYB 4YI5A 1G5QA 3TTYA 5AM4A 4IJVA 2PJDA 2AT1A 3JRNA 3JRWA 4W63A 4B7UA 5JYBA 5DHAA 1OH8A 5COBA 3GQVA 2Q1WA 1P29A 2YNMD 4DNQA 3ZVLA 3UV3A 3DR3A 4F6RA 1BGWA 1M67A 4Z4QA 3U7QB 1NVXQ 5LPNA 1LX6A 2NUPB 4EHAA 2G9ZA 2QV7A 3SSNA 1UCFA 4GVLA 4QTUB 1A71A 2OGSA 5CM9C 3ZD7A 4EG6A 2XQKA 2H06A 4JBHA 4QVGA 4CE6A 2JIBA 1QK4A 2Q6VA 2GBCA 4WX2B 3ZZ0A 3NT4A 3O2SB 3H05A 3E2IA 4IDPA 1F2UA 5ARCA 2GOYA 1T5DX 3ZXXA 2EP7A 1PUIA 3JQ9C 4RKFA 4YAWA 3JYQA 4QUAA 2ERYA 3T0IA 3IPXA 1A5TA 5LDHA 3U09A 1UFQA 1E32A 3B51X 4W5WA 1LDYA 3C70A 4MRMB 1HT2E 4B8ZA 2HLNA 3JD4A 1UPFA 1VPEA 3LCRA 4N03A 4B4OA 4BNDB 1ZQ9A 3AEQA 5FX2A 4XYBA 4DEVA 1PDWA 1KAMA 3ZWOA 4EJSA 1NRJB 3ZCRA 2B8WA 4BJ3A 3OJ0A 1VDZA 3M33A 1L5MA 1A1SA 1FUKA 2J7KA 3OZWA 1TQ2A 1V3TA 2HRZA 4ZQFA 3W2FA 3ORQA 4L8GA 1UAYA 3AM4A 5HJ7A 3CFYA 3R9XA 5A1TA 4Z4GA 2YBDA 3LA8A 4G1BA 4JUCA 4HUTA 1GZ6A 1G8KA 2B3DA 2IEYA 4MV4A 4WKOA 5FYQA 5LZ4A 5TSDA 5IXYA 1O4VA 1Z0UA 2GRJA 4P2GA 2BSQA 3VC7A 1EAYA 3DB2A 2PRSA 3GPCA 1DHRA 1OGIA 5AK5A 3RWOA 1G8HA 5AM3A 2GBPA 2MMGA 5HRUA 1UBJS 1C3OB 1R10A 2GLTA 3FCOA 1QHNA 1HK7A 1XMXA 1FXWA 1Z4PX 2HB6A 3WJ1A 5J3JA 1OHHA 4N5MA 4AN4A 5AVZA 1PT8A 2R6FA 2VF2A 2KM1A 4Z54A 2IVZA 3PWSA 4O29A 4CN8A 5BWMA 4OO3A 2COEA 1PD1A 1PVDA 3M83A 1FVOA 2HCJB 4JXKA 2UUOA 3KEMA 4X8HA 4PRZA 5AJUA 4B31A 3EUFA 4UFNA 1SVSA 3K1JA 4F4DA 4G0WA 1JAZA 4DHWA 4JDUA 3IIJA 3INNA 1NBME 2P9TA 5DTMA 2B1IA 1GTG1 3TF5A 4OJQA 3KJEA 3BXPA 4MUXA 1GUBA 2ODWA 4OXIA 1CY2A 2O1WA 3FPKA 4U2KA 5AVTA 3ELYA 1ORRA 1MEJA 1VLHA 3LGAA 4TQ9A 4EI8A 4KE6A 3G8CA 3RSLA 3X2FA 3F7OA 3NVAA 4GQAA 2P9EA 1U6JA 1XFDA 4W5QA 3ZTWA 1J8QA 1XZAA 3PQ4A 5K3BA 2FVYA 2O2SA 3WNZA 4L8YA 3GMSA 5D5QA 4TLMB 3COSA 1WWKA 3P9XA 1NU8A 4QPDA 5TEVA 5JWRA 1XEAA 1MUUA 4FCWA 1BD3A 2PL5A 2I6UA 4MWZA 1W4ZA 1GQ2A 1Z5VA 3JPYA 1ATIA 2ET6A 4YRFA 5K4AA 1LPAB 4NL4H 4BKUA 4UJ3A 4BO9A 2OFPA 5D1HA 5IDQA 4J1TC 1YQDA 3EGOA 2BM0A 5E6RB 2JAOA 3VZDA 4DV3B 1OXVA 1JR3A 3NJRA 3PI7A 2IF2A 5BSVA 2XTAA 4IHAA 1BD4A 2J4DA 5BURA 4JL5A 3PHHA 1BXKA 1YAJA 4CMCA 3OE5A 9MHTA 3B6EA 2SKEA 1USWA 3G2NA 5I48A 4KN6A 5T6BA 1JB1A 1KBQA 4F4FA 2XXBA 4F60A 4W9MC 2C0PA 4F46A 2ZIVB 2G82A 2ES4A 3JR3A 4IGAA 5EIAA 4UM8B 1Z8DA 3DDHA 7ADHA 3BMQB 3WY9A 2H2IA 1ODLA 5IC4A 1RRPA 2E5LB 3L41A 3TZCA 1JB9A 4Y9SA 1UT8A 4HVAA 2FW8A 1IQPA 1JBEA 1I7QB 1AC5A 3QFRA 3FBWA 4IMIB 2VHTA 1R3UA 1V4VA 3FTDA 4FYIA 3V7FA 4BIMA 1JR2A 4KRXA 1FTYA 3D59A 5AHXA 3MCWA 3FBGA 2CHGA 2W6ZA 3QQ5A 3W2IA 2OBNA 2FK7A 2OV2A 5EHQA 4FCVA 4ETNA 5E4FA 3A4YA 5J59A 3RSOA 3AFHA 3QMMA 2IYUA 3H7AA 3A58B 4Z5XA 2DULA 2POCA 2O8EB 3M4JA 4COKA 5KVAA 2B2NA 5CNKA 3E2MA 2BTQA 3F2VA 4R81A 3SOZA 3IMFA 4G5QA 1DKOA 1YULA 4RVHA 5E7QA 4HS4A 1I30A 3IA2A 8LDHA 3E05A 3SZLA 4XW2A 1S7CA 4TN5A 3ROQA 2IYVA 4GDMA 3TLKA 2CXRA 2CGEA 2JCYA 1CETA 4FFSA 4OU5A 2B36A 3N2EA 4PFSA 1MNQA 1E20A 4LXHA 2PRKA 5HRCA 1D2CA 3ZXYA 1XE3A 1MIHA 2HF8A 3GLHE 3TTTA 2XAAA 4ODIA 3ZUPA 4NJEB 1Y3DE 1L8OA 1CEYA 5CHYA 5E1BA 4B35A 1N6IA 4EMTA 3OQHA 4R2JA 1MJFA 3OC0A 1N1EA 1NUAA 5FUWA 5LVAA 1Q1ZA 3P9KA 3ZWQA 4C0KA 3QY0A 1A2BA 2GI4A 4PS1A 3GLVA 5FWXA 5C4MA 2NZVG 3GFSA 5IC5A 2BJHA 3VNUA 1U04A 2VNSA 2PTHA 3CO0S 5CW1A 3BE6A 2V58A 2VSXA 3DT8A 3X2EA 1M8FA 3EPLA 5A5EA 4V3CA 2P6MA 2ECKA 3ENNA 5IBPA 2I71A 1ZH0A 1DX4A 4O5AA 2IW3A 3QW2A 3EEBA 2R6R1 1H1LA 2JHGA 4B87A 1CBUA 3Q87B 1JZQA 1OZHA 2IDZA 3GRCA 4RS3A 4TT3D 1E1QA 4RPJA 3WGGA 4RPIA 3MHPA 4NYIQ 3U3KA 4PO3X 1J2RA 3BVPA 2I03A 4IH9A 2IZ1A 2VIIA 3LV8A 3K32A 2WKSA 3GVHA 1S2GA 2XNDD 1C0PA 3U13A 1IBKB 1MAAA 1S3SA 4XTCS 3KFLA 3S55A 3S2YA 2RGNA 1I13A 3CA8A 4IDHA 2QMEA 4P92A 3S1AA 3PD0A 1AXGA 4PHFA 3ZCXA 5B64A 4EQ6A 2TMDA 1V8BA 4RD4A 3UOAB 1OJ7A 1QYXA 3S28A 1QIEA 1SKBA 1NVKA 1DKMA 1QYCA 1MB9A 16PKA 2RG7A 1SK9A 1V8ZA 2F59A 3GVPA 3T41A 4BVBA 4DLBA 1CHNA 5THKA 3HO8A 2O8FB 3QUBA 2FW1A 2GNOA 3JWJA 1BS9A 4M7PA 4NEQA 2WHQA 5CJ2A 5HIMA 3WNBA 4ALJA 1TCCA 3VAZA 2FLWA 2WP8J 3ELBA 4GI5A 3VGJA 2IA5A 5IH3A 1HTWA 4R3WA 5LM3A 1XVVA 4BNUA 3E0XA 1IWPB 5E8RA 3WQSB 1DAEA 4UBIA 2VTBB 5A0VA 2FSPA 1UINA 2JRCA 1N2JA 2QLNA 3OIFA 4NNOA 4XVRA 4OGGA 3S5UA 5IT4A 1DAPA 4LDZA 1YBHA 3CZRA 1AD2A 4E0BA 4NMWA 1WZEA 5E7JA 4ER7A 1RLTA 1IMJA 1MMFB 2W0MA 3E4CA 5CBPB 4N9WA 4EKEA 4KPYA 3ZH9B 1Y1SA 3NGLA 4FT4A 3WHLA 4PANA 1X0XA 2Z09A 4WQMA 3ZE9A 3I9FA 4E5SA 4EPVA 1J5EB 5KYWB 3GNSA 2CVPA 4TT8A 2FZLA 1U3TA 3U4HA 5DNCA 2NVWA 3TPFA 1T4CB 1UC5B 3QVWA 1N1GA 4J0DA 1BWRA 2Y77A 4MW9A 1TF5A 4HX5A 4L74A 2PHZA 2YJ4A 1HSOA 5JXHA 1KDRA 4M76B 2B2XA 2W7TA 4P80A 4YXFA 4JB0A 1LC0A 3PGMA 2OO7A 4BBZA 5C7OO 5IDWA 3L4BC 3JQQA 2OK7A 1ENOA 3W2GA 1R18A 4XASA 2GZ3A 3ONWA 1CRLA 2WAAA 5GPBA 4DV1B 1ZNQO 3GGDA 3ISTA 2VYVD 3MXOA 4DIMA 3RG2A 1EA7A 1Z08A 3SYKA 1CK4A 1T2CA 2CT8A 2PAAA 3CUUA 1V3QE 4DNOA 5M7EA 1BWPA 3HGMA 3LCVB 4J91A 4KKVA 3MIZA 5EE5B 2IX9A 2V9PA 3AB3A 1YI8A 3M6WA 2C29D 1UMDA 4K05A 1W5SA 3K5HA 2B94A 3RT7A 3SKYA 4DM3A 4ZMRA 1DBVO 2NVUB 4XFKA 5FOSA 3GELA 3NH6A 4TUYF 2WTEA 5FTJA 3EISA 1DX6A 4QDKA 4QGHA 2WIGA 1RJDA 2XH8A 1YQQA 5AJWA 2P0EA 2G7ZA 2ZI9A 2Q5QA 4LJ5A 1PSZA 1W581 1RPZA 4CEHB 3S68A 5HFNA 1OYWA 2FZGA 3N75A 4WLFA 1ZGJA 4GUAA 2RHCA 2AG0A 4XPIB 5T57A 4WLEA 3H42B 2ZGVA 1YB1A 7REQB 4D46A 1CDDA 5BVGA 3ZNNA 4QWWA 4GYJA 3GQBA 1O97D 1KEUA 1IXKA 5K2MA 3JAMA 4LJ6A 4CTOA 2QMHA 1JFFB 4R1OA 4EI9A 5L4NA 3QHQA 3MWFA 4AM8A 3B7WA 4DHEA 1RZ3A 5SICE 1YRBA 1FFCA 3NDPA 4RX1A 4X9XA 4GI2A 1GNTA 4U0JA 4ZT4A 4C0HA 2AFVA 1T5IA 1HRKA 4B6EA 4E94A 4DMRA 2DETA 1RIIA 1ISMA 3IT0A 1R6XA 1KMCA 2H7VA 1EK0A 5CVVA 5T3YA 1KDVA 1SIWA 2VUHB 3PICA 4FCCA 4NFLA 1PX0A 2C61A 3IMCA 3KXPA 3MJFA 5K4HA 2ZJ7A 4E5DA 5ALIA 4UMDA 3TLBA 1XPRA 3KZMA 1ZONA 1Z0DA 1OVGA 2HT6A 1FW6A 2V9ZA 3OZAA 5EYPA 5AW8A 1NV9A 1N36B 4MR7B 4EEKA 3I76A 4LG1A 1TO6A 2Z6VA 3QHAA 1E2EA 5FIUA 3EOBI 5HZGA 1FK8A 1P4GA 3TIXB 3ER6A 5KNDH 4IHJA 3O21A 3EB9A 4L9WA 4RNCA 4ZOAA 5EZYF 2XUPA 4JC5A 4CYMA 3H1EA 1GPDG 4J9VA 3O75A 5IDVA 2NTEA 4DMMA 1M1NB 1U8UA 2VVTA 1EINA 1DS6A 1T5BA 4WWHA 4AWXA 5EZQA 2OD9A 1CNFA 5KSPA 1TZCA 4I1IA 1KRXA 4DLPA 1QHSA 1A8QA 5BSHA 3PI6A 4EY5A 5AVSA 2NGRA 1DNPA 1RTTA 1VZ3A 2WR8A 1F17A 3CH4B 1XZHA 3UJCA 1JTFA 3TRJA 1SCNE 1NUPA 2CJFA 3UAYA 1U8ZA 2V4UA 1IZ7A 2AJLI 2HR1A 1BW9A 1UM9B 1XAJA 3TNLA 1V5WA 2HLHA 2R25B 1EHYA 1OXMA 2XJ9A 3HKDA 2AQKA 5DCWA 1IBMB 3HCCA 1CY6A 3P2JA 4GX5A 4R1NA 4RQAA 5FFNA 2PFKA 3CEHA 1CY0A 1U4OA 4L2IA 4L4ZA 4LXXA 1ESNA 4DIUA 3HCOA 4GUDA 3R0IA 3RUAA 2ZSUA 2I0FA 2W8BA 1HYBA 1MB2A 2FLVA 2NO0A 2JJ1D 4ZT6A 2VT3A 4IBOA 2ZUTA 3UJPA 5AUOB 1JWLA 3LXRA 4E07A 4A03A 1Q91A 3ZE6A 2FWAA 5HF8A 5CEEA 2O20A 5EJ7A 1CDZA 3H0KA 5SZJA 5J4YA 4XH9B 3KPYA 5EMLA 5KNDD 3SM3A 1R6BX 1ZK0A 4AN0A 1OLUA 1T10A 1K3UB 1XZNA 4WZBE 4HDMB 2BGTA 4JV5B 4BDTA 1R8SA 2J0VA 3TLAA 4H3KB 3WKCA 1AMOA 1IPEA 2L17A 4EYEA 5HKKD 1WKVA 4RE5A 2YWHA 3Q3JB 4LY3A 1T29A 3AMVA 4WI1A 4XWYA 1EFKA 2XDQB 3BH0A 3M6MD 3RUIA 3DDUA 2XE8A 2YASA 2FHSA 4FBMA 4PYIA 5FFMA 2C94A 1TNDA 2F1IA 3F9RA 5TGDA 3VU9B 1JAIA 4OP1A 1X7DA 3H2JA 1O97C 5DHSA 5BQ5A 4DDVA 5KX5B 4W5TA 3DCYA 1WABA 3LLCA 5GQSA 1RMTA 4BX2A 1RAHA 4NV1A 2Z1DA 1U0EA 4NNPA 4U5XA 1JMYA 3SNKA 2B83A 1WKCA 1TEXA 2OBXA 3NGXA 3PBKA 3SZUA 1YL6A 2OCBA 4QPPA 3HJTA 3C8HA 4AJ2A 5I5EA 4JEMA 1C0EA 3AETB 1RVDA 421PA 4HZGA 4ALKA 3VDXA 2ONZA 2C2HA 4WMLA 4WKPA 3WZ2A 1B3BA 3T7KA 3DMDA 5KMGA 4DN6A 4HDNB 3AY6A 2FEPA 1SVWA 2HMTA 1P2VA 1HL7A 1T1EA 2VEOA 4XARA 5L7TA 1GZHB 2GJSA 3OLVA 4YV0A 3GLTA 5G3ZA 5KDLA 4IFIA 4TTJA 1CS0A 2JGFA 4XE5A 2JLRA 4X97A 3W3AH 2R3SA 4J7XA 2FCRA 2FDXA 4OHFA 2PM8A 2YIVX 1P8AA 4OL9A 1USUA 3PA8A 1PT6A 1G5IA 3GEDA 4DY4A 3TFOA 3GR6A 3C1AA 4EUKA 5C8VA 2JJMA 1EM8B 2VDUE 2WG2A 3PGA1 3PUHA 5AT1A 2WQ6A 5JXGA 1L1RA 1NNSA 4LBYA 4NJMB 5LQJA 2Q2VA 3BWEA 3I2IA 1QIMA 4UAGA 3SYTA 4ACAA 4ZZ1A 1NATA 3Q0IA 3O84A 2ID8A 3PFWO 4R41A 3RIEA 1OASA 5JC1A 4C7OB 2AEJA 1U9IC 4L3VA 5B4TA 1AV6A 3AXSA 2EKZA 1G7TA 2HUPA 4ND5A 3AERB 4DJJA 1KFEB 4DCTA 2UZIR 4ROSA 3PQ5A 4WINA 4GFDA 1ZKDA 4TZKA 3BKWA 5JNLA 3I09A 1V3UA 3G88A 4A0RA 4K6OA 4C06A 2ZJZA 1IM5A 5DIFA 1WU7A 3TS1A 3EIQA 4PICA 2I2BA 2DRIA 4EFMA 3VOAA 4C7MA 1HQCA 4BO7A 2MHCA 2BTOA 1YFZA 2PEYA 2QRGA 2H1FA 2NWQA 4UVGA 5KTNA 1QF6A 2IZ0A 2FEMA 4ZK2A 3W3AD 3GLGB 3K72B 3A1WA 1J0DA 3COVA 4QT0A 5I7OA 3GH1A 3N8IA 4CM5A 1G59A 3MRTA 3RUDA 2WZQA 1HLGA 1DB3A 1J0AA 3DF9A 1NKTA 3WTBA 3ZWVA 2EV9A 1ULHA 3HU3A 1NP6A 3SQOA 2J48A 4MRRA 4CM8B 3CLHA 4PE5B 4AXBA 5F7OA 3W5BA 2B92A 4XIJA 1OBHA 3LRPA 5ITZA 1W88A 2BFDA 3EZ6A 3I0ZA 5DM2A 5TPWB 2B34A 1KZYC 2ASVA 1FP4B 1DOHA 1E1DA 1V48A 1ZD9A 2G17A 3GC6A 3OZCA 4FONA 3T95A 3L8MA 3CUYA 4GKBA 1HFWA 5C7YA 4U7GA 4YVFA 4JLKA 1T6ZA 1RAFA 1CDEA 2DBQA 4PLYA 1OH5A 4RJJA 1XHEA 3RARA 2AOVA 2AQIA 2IHUA 1MB3A 2HWWA 3I32A 4AKEA 5FLKA 3O8NA 1TA4A 1ORIA 1U9CA 5K99A 1RYEA 4HXGA 2J5QA 4CG1A 5AQ1A 1DIAA 3NM4A 4AW9A 5TQ2A 2X5NA 1DIHA 4K88A 4XJSA 4AB1A 1FTWA 4NATA 3W8RA 1VL2A 1SZPA 2IOHA 4B3CA 4DCOA 3R7WB 4LWOA 3F67A 2XVMA 1ZESA 3RFUA 3DV0B 2VL7A 3O31A 4M54A 4XB2A 3DLCA 5KREA 1B74A 3IE0A 3BK7A 3K9CA 3LQYA 3SM9A 2DSNA 1PR4A 1PFUA 2WYWA 4CZ2A 4KP7A 5KDOA 4K1XA 3OIVA 3BQNB 4BLRA 1W52X 5IYZA 2Q9UA 221PA 1BYIA 3D3JA 2YYAA 4NXNB 2NV0A 1FU7A 4LSGA 5AHWA 1DRJA 3TPCA 3MYRA 4TPKA 4IZ6A 3QVOA 1OV6A 1QP8A 3HHPA 3LXMA 5KYXA 1RXWA 4ASUA 1Q21A 1VIYA 1X7GA 1VFNA 3M6VA 4MV1A 4CBVA 1IRIA 2CVOA 3R0VA 1WXFA 3MJEA 3P26A 4WEOA 3IELA 2PEZA 2RSLA 1VRCA 3EXG2 2XKJE 4IG9A 4LYHA 1QVZA 1VKOA 4ZYXA 4CEIA 5E3IA 4RTQA 2GD1O 3TZHA 1JQAA 5F64A 5GM2A 2V98A 3M49A 4OI1A 4C0JA 3ZN2A 3AHGA 1PRYA 3GEHA 1WF3A 3RYTC 1IZ0A 1G0NA 3MLEA 4QG3A 1YVUA 4MWOA 2JARA 3IEMA 4LHVA 4BJ5A 1MO2A 2KHZA 2NVBA 1JR6A 4I99A 4P53A 4UDOA 3BFVA 4K03A 2Z04A 1IU9A 2LE0A 2RKBA 4ZAVA 4DGQA 4E3WA 4GBJA 4JR0A 2XNCA 5DNVA 3ZHSA 3FMOB 1MIOA 2W6CX 5EQFA 4BFUA 2B6HA 3IVGA 5ESRA 1V7PC 1GCGA 3ZH2A 5K6TA 4WA7A 2VYVA 4KWIA 5HCIA 1VPWA 1ZLYA 4W4TA 1G18A 4MQEB 4NESA 3SF8B 3K71B 4RNDB 5G1PA 3IPYA 1MA0A 4B2PA 4EYQA 4KLCA 4UM5A 3O95A 1GT91 2N9UA 2BHSA 3GHHA 2IV2X 1E6EA 2HA6A 5B36A 2NZJA 3H65A 1M66A 3RT9A 1X9GA 4P36A 4GE3A 1KC1A 1YQGA 3H04A 1XLWA 1RLUA 1T26A 1XQ1A 1ESCA 1MLDA 3GGGA 3PE3A 1NV8A 1U5AA 1KA9H 2Q3MA 3N2KB 1U0FA 1UBEA 3EEIA 1CVIA 3LZ6A 3NAQA 3Q3VA 1PNRA 1W5TA 3T12A 4K6MA 3H87A 3L8DA 3TIVA 3BSYA 1YZNA 4KQEA 2QVYX 1KQ3A 3K0KA 3U61B 4FBGA 2PKYX 3L7AA 4G36A 4GH5A 4LRWA 5FI5A 5H9VA 4B79A 1A8HA 1BVRA 2J3IA 3Q0EA 4QHTA 4C2AA 3L05A 3DR5A 3FBTA 2ISCA 2G1AA 3EQ9A 4B47A 1NVMB 3D6NB 3KFVA 4MR9A 4MUBA 5E7MA 5ADHA 1RADA 3NYIA 1XDZA 2R7NA 2ZSBA 3V97A 3C87A 1CR4A 2ILVA 5D86A 4C5CA 2ZIAA 2I1VB 2C8KA 1H1DA 1C81A 1Z6AA 2V4ZA 4LDNA 2CJXA 5FEUA 5K45A 3U19A 4DIEA 4IP0A 2Z3WA 3PITA 3DZBA 3M34A 2PLAA 3SJUA 4EYGA 2WBLC 4ENVA 2DQZA 3A31A 5BQPA 3PJRA 1UEIA 1JIQA 2XMCA 4RVGA 1PYOA 4NX2A 4DSZA 5CX1B 1X9IA 1XPOA 1NXVA 1JDZA 1KWKA 2GNAA 3AX6A 4WLVA 3UB2A 3MCAA 4QBGB 1CEQA 4KX5A 2X0NA 3V00A 3OOHA 2GTPA 1QJ4A 4I81A 2BMJA 4L9RA 3KAKA 5F1KA 4ZJPA 2BELA 3DBLB 4ZMSA 1MO6A 1OREA 2X4LA 3P7MA 3SXUA 4RPGA 1NPDA 3B7PA 3ZWYA 3N70A 2YCLA 3ZVNA 2A9RA 3T54A 3HSYA 3G9XA 3QA3E 4XZ3A 5FQNA 4ZTUB 1QYWA 2F1KA 1A9ZA 1BCRA 3EGCA 3IP6A 4M0CA 5IT9A 2I2WA 4LMRA 4UMFA 2XCLA 1DKUA 2WYHA 3G5AA 4HWSA 4PQFA 2EHJA 4IO0A 4YR7A 1BC5A 2YTZA 4H7DA 3GCZA 3EZGA 3MG9A 1ZGHA 3RC3A 4IVQA 2P4EA 2P35A 3IUSA 1TUBA 4P0PB 1U9IA 4GOJA 1U8EA 4MV5A 4PGHA 5KSZA 1FRFS 3WHKA 4RSHA 3FZQA 2FR8C 4NYMR 1ZH6A 5EOVA 1G291 2PS9A 3FCEA 3ZTYA 3E9MA 2J5KA 4LYDA 1EKXA 5KHAA 3KVVA 4ZVMA 1R0RE 1KFJB 3M3PA 1NVFA 2C97A 3PXCX 1P5JA 1RD4A 3AJEA 4HX2A 4TVKA 2YJZA 4YYEA 1ISGA 2O14A 3LDUA 1M5UA 5DISB 1T4MA 3NXKA 3O4FA 3ZNQA 2WZCA 2KYRA 3QNWA 4MGHA 4X61A 4JWKA 2UUPA 1XNRB 1QK5A 2WWVD 3H7IA 2ZI6A 4YAIA 4ZPJA 1OBOA 1REQB 3JQ8B 5BQ3A 3WYCA 1WCWA 2F8LA 3EZLA 4A6XA 1U2EA 3IQDB 4V24A 5JI2E 2UXBB 1EP1B 1X8LA 2NZYA 2FKAA 5ALNA 2UVQA 3JQ7A 2QBYB 3ZZ1A 3SQLA 3ZCQA 1WHTA 3DEKA 1EWQA 2M9MA 3D8RA 1QHXA 2MINA 3HVUA 3I0NA 3R7FA 5HKKA 5IPFA 5DXFA 3TFQA 4DSTA 1KDTA