2ZIGA

Crystal structure of ttha0409, putative dna modification methylase from thermus thermophilus hb8
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
236
Chain Sequence
VHRLHVGDAREVLASFPEASVHLVVTSPPYWTLKQLGHIEDYEAFLDELDRVWREVFRLLVPGGRLVIVVGDVAVARRHLVFPLHADIQVRCRKLGFDNLNPIIWHKHPYEPGAIIKTEIEYILMQRKPGGYRKPTQEQREKSRLPKEDFHRFFRQIWDDIPAPFPLELAERLVRMFSFVGDVVLDPFAGTGTTLIAAARWGRRALGVELVPRYAQLAKERFAREVPGFSLEVLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative modification methylase
publication title Crystal structure of a putative DNA methylase TTHA0409 from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 76
structure length 236
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zigA00
3M6XA 5EOVA 4C08A 1R00A 2P7HA 2ZBRA 2BZGA 2OB2A 3TM5A 4A6EA 1QANA 2ONYA 3HM2A 3TM4A 4IV0A 1NW5A 3CJQA 1QYRA 2NYUA 5E1DA 4AZWA 3OU2A 4CTJA 2HWKA 5CUQA 2WA1A 1L3CA 4KW7A 5GIOE 1KIAA 3OU7A 3PX3A 2IH5A 3G8BA 3G89A 5F2NA 5KQSA 4E30A 4EK9A 3EVCA 3GRUA 5FA8A 3TLJA 2G70A 3MTEA 4DCMA 4DZRA 5E9WA 3KQYA 4OX9Y 1NW7A 2FK7A 2GA9A 2O57A 3BKXA 3V97A 3EVDA 4PONA 2JH9A 4QVKA 3OE5A 4E31A 4ER6A 2O05A 4IKPA 3GRYA 5DT2A 4H0NA 2PWPA 2BR3A 4GEKA 2ZCJA 1JSZA 5K0GA 4B17A 2C7PA 2DULA 3OZRA 5GINE 5D1HA 3NDJA 4M38A 4V0QA 2Z6AA 3CVOA 4DCGA 1VL5A 3HNRA 4QQKA 5IKMA 4DF3A 2VP3A 2NXEA 3KQPA 3B3FA 4PIPA 3OZTA 1RI4A 2JHPA 1D2HA 2N47A 5EMKA 3BZBA 2PGXA 5KVAA 4QTTB 4GBED 1NV8A 1TW3A 3K0BA 1FP2A 3DLCA 4U7TB 5HEKA 3UJ9A 5EMMA 3LGAA 2NP7A 5CVVA 5FHRA 3KQTA 4EKIA 1IY9A 3TOSA 3FRIA 5DXAA 3VSEA 3KR0A 4DKJA 3F4KA 1VP9A 3CCFA 5FQOA 3EMBA 1JG1A 5HILA 2PX2A 2OO3A 1XXLA 3NVKI 3G2PA 4KWCA 5ICGA 2Z6UA 1QAQA 3O4FA 2AOVA 4OBWA 4R6XA 5KQRA 2AOWA 3BWYA 3P2KA 3UJ6A 2HNKA 1UWVA 4HGZA 4YMHA 3ELWA 2Z6QA 1N2XA 1L1EA 3HCDA 3OE4A 4IWNA 3UA4A 4GOND 2NNWB 4ER5A 1SKMA 1PJZA 2ZZKA 3LPMA 3FRHA 5DPMA 5E2AA 3HA3A 3CJRA 3DH0A 3SSNA 3GDHA 2IDKA 3FUWA 4HG2A 4RYLA 5EEGA 3HTXA 3FZGA 3UJAA 3L8DA 2P1DA 2BM9A 3AY0A 3UJ8A 1SVUA 3C6KA 2JG3A 4RTNA 1YZHA 3A7EA 4PWYA 2QM3A 5HIIA 3UFBA 3OPNA 2P3OA 5HIMA 3GRVA 3KR1A 4FZVA 4AUKA 2NP6A 2WK1A 3DXZA 3E23A 2G72A 1ZKDA 1RJGA 4RX1A 3ORHA 1JTEA 3G2QA 4G56A 3DMFA 2IBSA 4O29A 4ATNA 1AQJA 3KR2A 2ZSUA 1EG2A 2PLWA 1I9GA 1L9KA 3HCCA 1SUIA 1QZZA 3LDUA 3DUWA 3R24A 4BY9E 5EKXA 1P1CA 3MCTA 3HCBA 3FTFA 2PT9A 3H2BA 3KQQA 3FTCA 5HIJA 1VBFA 5DRTA 5HIKA 4P7FA 2BR5A 3GNLA 3SSOA 4WXHA 1F3LA 4FGZA 3A26A 2K4MA 3E7PA 1H1DA 3E8SA 3SX0A 4YMGA 1U2ZA 2FHPA 3ER9A 1Q0SA 3RIEA 4ER0A 2QYOA 3JWJA 2YTZA 3I5UA 3P97A 1EAMA 4GC5A 4QPNA 4AZTA 2HTEA 1X1AA 3SXJA 3P8ZA 1EIZA 3DLIA 1JQDA 3Q7EA 2P40A 2IDJA 2I9KA 3FPJA 3P9KA 4C03A 3P71T 4RTOA 4PYLA 1NKVA 4P7KA 3EVGA 5FTWA 3I53A 2G8NA 3HEMA 3VYWA 2ZW9A 5EMJA 4YUVA 5CVUA 3OZSA 4E70A 3PTAA 3DXYA 1B42A 1YZ3A 3FYCA 3HA7A 4C04A 3WSTA 2CMGA 3PFGA 3IHTA 2AZTA 3HCEA 5DSTA 4YUWA 1XCLA 1JQ3A 1YFLA 1XDZA 1TPYA 1VPTA 3O31A 2OXTA 2Y1WA 5LQAA 2R3SA 3TQSA 1Q0TA 4KRGA 4DM3A 2B78A 3MAGA 4Z2YA 4CKEA 5CVEA 3SSMA 1D2CA 3KHKA 3KKZA 5T6BA 2XVAA 2XYQA 3D2LA 4HTFA 1NW3A 2AR0A 4RTQA 2EJUA 2P35A 2P7IA 3AWIA 3A7DA 5DM2A 1VLMA 1N7IA 3C3YA 3FPGA 4BP3A 3JWIA 2PKWA 1FJXA 2E5WA 5F2OA 1RJFA 2VDWA 1NE2A 5P8WA 4GOLD 5GIPE 1WXXA 3LCVB 2HMYB 1AF7A 3KQVA 2AOTA 3PFHA 1WS6A 2GLUA 3AJDA 1HNNA 5HOQA 4GOOD 1O9GA 1V39A 4OQDA 4E32A 1OR8A 4GUAA 2BM8A 3TR6A 3GIWA 1QAMA 3EPPA 5M5BA 3G2MA 5LQCA 3X0DA 2PWYA 4M36A 3MHTA 5DX1A 3V8VA 2XBMA 1NW8A 4E2ZA 2PBFA 2IGTA 2OY0A 4KIFA 3A4TA 2AOUA 2CL5A 2AN5A 3BWCA 4ER3A 3MGGA 3KQSA 2NXJA 4PINA 1YB2A 1R6AA 3DP7A 1JR4A 4OBXA 2YXDA 5FHQA 4BP1A 3MB5A 4PCAA 2GH1A 2IPXA 3GGDA 5K0FA 1IM8A 2H1RA 4P7JA 2EX4A 2QRVA 2VZ9A 5FA5A 2AS0A 1AV6A 4PYIA 3I64A 4PYKA 1IXKA 2ZTHA 1P39A 5LR6A 3IYLW 2XYRA 2DPMA 2YVLA 4EKGA 1R18A 3SVZA 1G38A 1ZGAA 2ONZA 3EVEA 3GU3A 2IH4A 1G8SA 4QPPA 3G8AA 4RVGA 1RI3A 3LBFA 2JH8A 5CD1A 3FPEA 5DXJA 2UYQA 3UZUA 4R8SA 2ZBPA 4QQNA 4YUYA 5FADA 1ORIA 3HVJA 3OU6A 5EPEA 4JXJA 1UIRA 4YUZA 1BC5A 3DMGA 4IV8A 3EEYA 5DX8A 4E2WA 4RTLA 3T7SA 1BKYA 1JQEA 1RI2A 4MHTA 4OA8A 5IH3A 1D2GA 4GQBA 4RV9A 3NW9A 4QDKA 3KPYA 2AVDA 5E8JA 1O9HA 1XTPA 5FCDA 3KQWA 1YF3A 2ZULA 4LWOA 3LSTA 5H02A 2P3LA 2PX5A 4MQ4A 4M37A 3TPZA 5DTMA 5DSXA 3BGVA 4PYQA 5EVJA 5FWAA 3TKYA 4DMGA 5BW5A 2PVCA 1N7JA 3KPJA 1TW2A 4L7VA 2ESRA 3DMHA 3BWMA 2P8JA 2VS1A 4XUDA 5KYGA 5FWDA 5DM4A 4X63A 3T7TA 2FRXA 5EIWA 4NECA 5T67A 4F85A 4HTFB 5HFJA 2H00A 1MJFA 3ER8A 2PXAA 3LCCA 4HSGA 3THRA 3I58A 3AXSA 2IP2A 1WG8A 4AZVA 1ZG3A 2YR0A 3THSA 2QE6A 1G8AA 1WY7A 7MHTA 2I7CA 2FCAA 2R6ZA 3AXTA 3PS9A 4RSRA 4Y2HA 2O07A 2OB1A 4OA5A 3BKWA 5C9ZA 2OZVA 2C7RA 4RVHA 3NMUF 3KPVA 1M6YA 2AOTB 5CVDA 2Y1XA 3UJBA 4V0RA 3UA3A 3JWGA 4HRAA 4QDJA 4E2YA 3FYDA 2GB4A 5C1IA 3HA5A 3PT9A 3REOA 3SMQA 3FTDA 3KQMA 4HGYA 2FPOA 3G2OA 4Y30A 1YFJA 3LDGA 4RWZA 5U4XA 5LQJA 5CIYA 4PNEA 1DUSA 1L3BA 3PX2A 3P2EA 3GRZA 2UYHA 5K01A 1PRYA 3DOUA 4HH4A 5DM0A 4BLVA 1F38A 4PIMA 1VP3A 5EZSA 2AOUB 3I9FA 3R9XB 3CGGA 3A27A 3NJRA 4C07A 2OYRA 5LQRA 3B7PA 4BLUA 2ZBQA 3O7WA 3R3HA 3ANXA 4X61A 4QVGA 5E9QA 2ERCA 2ZVJA 3EGIA 4KIGA 4FR0A 3Q87B 4QTUB 4RTSA 1ZHFA 2CMHA 2PT6A 2FK8A 5LQUA 3JWHA 4RVFA 2ZZMA 2QRVB 5EC8A 5EEHA 1KYZA 4LWPA 1XVAA 3OFKA 1P1BA 4CKCA 2JHAA 2B25A 2UYCA 2IIPA 2JJQA 3LKDA 3NDIA 4A6DA 3VC2A 3PVCA 4MIKA 3RW9A 3MTIA 4RTKA 5MHTA 3BGDA 4K6MA 1L3IA 2XVMA 1RI5A 4PYMA 5DLYA 2A14A 5BW4A 4KDCA 4FT2A 5E1MA 4AZSA 2ADMA 5FUBA 4FT4A 2FYTA 1JSXA 4PCLA 2XYVA 2CWWA 1BOOA 5FQNA 3EGVA 2PSSA 1KHHA 5LQKA 5DTRA 1NT2A 3HP7A 5DWQA 1JG3A 1KR5A 2OBFA 4DQ0A 4POOA 4UOEA 1NBHA 2V74B 3DTNA 3M6UA 3NVMB 3CBGA 3U81A 4R6WA 4ISCA 3B3GA 4RTMA 2LD4A 2YX1A 4RVDA 1VQ1A 1SUSA 5EHGA 1I4WA 2AOXA 3QV2A 2AN3A 4P7GA 8MHTA 3EMDA 1WXWA 2YQZA 4U7PB 1T43A 4C06A 4GC9A 2EJTA 3B89A 4LECA 4MWZA 3PB3A 2ZIFA 3C3PA 3P9CA 5DRYA 5K0NA 2YXLA 4P58A 1R74A 3LHDA 5F2KA 3G5LA 1M6EX 3B5IA 3RODA 3M4XA 5K05A 3NTVA 2ORED 3FUTA 1RJEA 2EFJA 3C6MA 4FP9A 4R8RA 3FUUA 1MHTA 2IFTA 2I6GA 3BGIA 5ICEA 3LDFA 3DULA 1KP9A 2ZWVA 5EG5A 1KPHA 2YXEA 4YV2A 3GRRA 1XDUA 2NXNA 2UYOA 3KQOA 2ZIGA 2PX4A 3BT7A 4PGHA 2KW5A 2IBTA 3GWZA 4ER7A 3HCAA 3K6RA 1KPGA 1X1DA 3MCZA 4FSXA 4KDRA 2OPBA 3ERCA 3ID6C 3UJ7A 2CKDA 2ZFUA 2PV0A 3TMAA 3KPUA 1AQIA 5CM2Z 5B1SA 4CXMA 5DX0A 1X19A 3NWBA 2B2CA 3ELYA 5ERGB 1X1BA 1DCTA 2O06A 1VIDA 1Y8CA 5EHIA 3M6VA 3P2IA 3HVIA 3VC1A 2ZIEA 3BWBA 3A25A 4XUEA 3T7RA 5JUWA 4F84A 3IV6A 2V7EA 3IEIA 3OCJA 4X60A 4CWAA 4DA4A 4EVIA 4C4AA 5E1BA 2PJDA 3M70A 3GO4A 3S68A 1M0EA 4E2XA 2HR1A 3NWEA 3B3JA 3LCUA 5K0JA 3KR9A 1UFKA 2B3TA 4GF5A 4KVZA 1KPIA 3DR5A 3FUVA 4LG1A 1WZNA 4PYOA 5CVJA 3UJDA 5K0EA 1BHJA 5C0OE 3TFWA 5BXYA 1G55A 3LX6A 3HVHA 2BH2A 4XUCA 3CJTA 3DXXA 3R0QA 2AN4A 10MHA 3SR4A 4CKBA 1SQGA 2ZWAA 1RI1A 4X41A 3M6WA 1G6Q1 1JG2A 2B9EA 3LBYA 1QAOA 2QY6A 2NXCA 3GXOA 3LECA 4PYNA 5DTQA 4CTKA 4EMSA 5GP1A 5EIFA 9MHTA 5ICFA 5ICCA 1ZGJA 1XDSA 1NW6A 5E8RA 2PX8A 5E9JA 1FP1D 1NBIA 1SQFA 4FSDA 2GAFA 3EEOA 3UJCA 1INLA 2ZZNA 4ZTBA 3M33A 3CKKA 3TRKA 2Q41A 3C0KA 3FPHA 3MERA 4F86A 4YUXA 2PXCA 4R05A 3EVFA 2F8LA 3FTEA 3BXOA 4PGGA 2I62A 3PLAE 2O0LA 2JHCA 2G1PA 2WA2A 5E1OA 1FBNA 2GPYA 3HVKA 3EVAA 5GM1A 5HZMA 2EG5A 1R8YA 1VE3A 3P9NA 3HCFA 4BLWA 3G7UA 2PXXA 4RTJA 5K0BA 2OKCA 3LKZA 4GOMD 3ELUA 3SGLA 1JG4A 5E2BA 1ORHA 5KS2A 2VDVE 5GWXA 3G5TA 1P91A 4M7RA 5EZQA 5JR3A 5T64A 3QOXA 5LSAA 5EQJB 1XCJA 4YV1A 1O54A 2P41A 3ELDA 1Z3CA 3CC8A 1EJ6A 3EGEA 3R6TA 5K03A 1EQAA 1SG9A 2BR4A 3KU1A 3MQ2A 2VDUE 3EVZA 3OFJA 5FULA 1XJ5A 1NV9A 2G71A 3SM3A 1KYWA 1KXZA 4PYJA 2IH2A 5G02A 5GM2A 3UBTA 4RTRA 2PY6A 3GJYA 4E33A 2ZLBA 1YUBA 1ZQ9A 4EQZA 4OQEA 1FPQA 2GS9A 5EMLA 4C05A 1JTFA 2AVNA 4AX8A 2UZ4A 2HV9A 4MTLA 3EVBA 1X1CA 4WVLA 5GOZA 1R8XA 5DM1A 4HC4A 3FUXA 1G60A 5EGSA 5K0CA 4X1OA 5EKUA 4YV0A 3KPWA 5K0LA 3LL7A 2H11A 4FS8A 1I1NA 3GCZA 3P9IA 3TKAA 5K8VA 4RTPA 2P3QA 3E05A 1HMYA 3QOWA 3BUSA 3UWPA 3G88A 1DL5A 1EJ0A 5D1NA 2C7QA 3T0IA 5BP7A 1RJDA 5K09A 5LQNA 2C7OA 2YUIA 4XCXA 5CCXA 3ME5A 5CCBA 3FPFA
chains in the Genus database with same CATH superfamily
4UCFA 1KJZA 5LWHA 2FRDA 3LNCA 5EXTA 3SYTA 3V55A 3FLBA 1SB9A 2XZLA 4NZPA 5JARA 1XZFA 1ANKA 3VAYA 3VJLA 2NYUA 2YRFA 3BVPA 3QHPA 3QUCA 2HF7A 5DLQC 3TBHA 3SR3A 1H05A 3GQVA 2IRWA 1UZLA 4NZOA 2IH5A 1FDWA 1KIAA 2XWJI 3OU7A 3UMYA 1IZZA 1E2JA 2NSLA 3KYDB 2MSWA 1I5OA 2RG1A 4E51A 4A2PA 2A88A 4I1PA 3NO4A 3EGXA 3T95A 3V97A 5C4IA 1P3JA 2RBGA 3PDIB 3AU8A 3IHKA 3KALA 3PC3A 3CX3A 4G5SA 4CU2A 4EX6A 1BU8A 2H52A 1R0KA 2VJCA 2JCGA 4ZHQA 3AX6A 1NJ6A 4TMYA 1E5QA 4DIBA 2XPCA 1JSZA 2B34A 4FWIB 5KPJA 1C8VB 2H7CA 1AKTA 1SA0B 1H2BA 3WL8A 2Y76A 5GINE 4A6PA 3QVUA 1K63A 2J48A 3KXLA 3WWZA 4ADSG 5K3OA 3PUYA 4WXRA 3PNVA 4XD7A 1QRRA 2WT8A 3NHZA 1H6DA 2CCGA 5JQGB 3G0IA 2Z4SA 2C3PA 2HMAA 1YA4A 4P98A 5T4FA 3F73A 5F9MA 3CW2A 3BZBA 1V2GA 2JLSA 1K3FA 4KUGA 5HEKA 1G3MA 2I4RA 1DMRA 3TUIC 1P9OA 1XPOA 5JISA 3DVSX 1WVIA 3DFZA 2A0WA 3W7BA 3QLUC 3SC2A 2EKQA 4YMVA 2NV6A 1PJCA 4YJHB 3U3JA 4CLDA 1M1YE 2X6RA 1E7RA 4CMKA 1WR8A 2XQVA 4OYHA 5JMPA 2EQ5A 4JBGA 2FQ1A 4AJ9A 4ENSA 5SV2A 3TZCA 5C35A 4FX5A 3H99A 2AOWA 2QPAA 3L9WA 3EZYA 4I14A 1LBQA 4UHEA 4OB8A 4DBLC 1XCOA 4P92A 1JMVA 4BZXA 4TM8A 1EHCA 1PBTA 1GPAA 2O2XA 3IJRA 1F06A 5HTKA 1K66A 1LQTA 1RQGA 1Z8FA 2A33A 2NYAA 3WGQA 4AF8A 2R8YA 4D6XA 3WRXC 2PWAA 1E8MA 1XIVA 3L8DA 1NR1A 4FYPA 4FQ5A 2JAQA 4KQKA 3I72A 2C2HA 1E62A 4G1UC 4LSZA 3C6KA 4EMBA 2G5GX 3GA5A 3GEMA 2H7YA 3VAAA 4BE4A 1E99A 3KYBA 3O4HA 4M8NE 3DZBA 3JQQA 1DJPA 4N03A 4W9NA 3STWA 1UK7A 3WIVA 4CFSA 4C7OB 2BJWA 4XM1A 3KR1A 3UC5A 2H08A 3AI2A 1ZNQO 1DT3A 3HJFA 1WX1A 4Y6RA 4LMBA 4BRZA 4EHHA 1NT4A 2HLHA 2IXGA 4CM1A 2VAMA 4DDUA 2H9YA 2AQ8A 5EESA 2IHNA 3ZHXA 2Q0HA 3ENKA 1JT9A 3TNFA 3R24A 3ILSA 3TIIA 1GSHA 1LPOA 1P1CA 1YQXA 3GZTB 4ZO4A 2CSXA 1PG5A 4I0WB 4XGNA 4DUGD 4RU1A 2RGCA 4F71A 2F64A 2O5VA 4B6EA 3B8EA 1L0BA 3DDOA 3M6IA 2LXNA 3BMCA 4OIFA 5T41A 4LFAB 1QVWA 1XRSB 2FETA 4BLOA 4LA4A 4TMTA 2BEWB 2EJWA 5K3DA 2XOEA 5BNZA 2VTVA 3BD7A 1ABBA 1U65A 3UXYA 1COWD 1KI1A 1MA0A 1N2ZA 2B3DA 1QHIA 1XXHA 4MNTA 1J9ZA 1B1CA 1K4YA 1X1AA 2BCGY 2HTEA 3P8ZA 1GTVA 3UWMA 1MV8A 1Z33A 3INYA 4FMPA 4CT0A 2ZT7A 3IJEB 3C7TA 4X8HA 2ZS9A 3P71T 2NUTA 4DABA 3VJMA 1MAHA 1LLFA 5EMJA 4D6PA 1RAHA 2WPNA 4BNKA 1B42A 4BZWA 5IZCC 5FFMA 4BVAA 1Y3CE 3PPYA 1Z29A 2QTWB 2YVUA 1WBDA 2QX7A 2O9JA 2H7VA 4BQRA 2NIPA 1BEUB 4Q3KA 4E3WA 1WUIS 4BO4A 2IHYA 5JEDA 4FMBB 3O31A 3CE9A 5LQAA 3QVTA 1H2HA 3OKCA 2MSEB 1ZHHA 3MSXA 1F2TA 4XCVA 4LXIA 3OP4A 4L51A 4E21A 1DINA 3O21A 1FX0B 4LXUA 3STTA 3H4VA 3RK4A 2XWQA 2ZITA 1OLXB 1E2KA 1UK9A 1VMEA 1OFTA 2GZHA 3FHOA 4E5DA 4BKUA 3ZHVA 1Y6FA 2XMCA 4ETIA 4EYSA 3DDNA 4U3JA 4HPXB 3WNBA 2JVKA 2BDEA 2DHDA 4ZO6A 2FXVA 4M0MA 4I5GA 1NWCA 1AUXA 3E2MA 5FBWB 1Z25A 4I5FA 5HX7A 4MVWA 1XMQB 1OR8A 1SRRA 1HT1E 1JHQA 3EZXA 2JDIA 2RHWA 3FBWA 2B92A 3L0YA 3GLHE 2IYLD 1H2EA 2PK3A 5EN4A 2W71A 4HEQA 3DV2A 1CC1S 2J08A 4Y9RA 4CMHA 4C22A 4IY1A 3WJ2A 4F4UA 1OKKD 2ATIA 3E3AA 4H7DA 1CS4C 1N1DA 2QGZA 4R81A 3T3GA 1J39A 3H5VA 3ZNPA 1ISSA 2MYTA 5I7EA 3OCYA 1YB1A 4XFKA 2ATCA 3MB5A 2OK7A 2D3WA 4O4HF 2ZYWX 4NXNB 2XSZA 2YYSA 3GPIA 5CB4A 3NH6A 2ICAA 1UJ5A 5JW6A 1MX9A 1NBMD 1ZUIA 5TPWA 5LP6B 1A7UA 1PR6A 1AV6A 3VX3A 2I6SA 3GJRA 1CWUA 3I64A 3T3NA 2E6KA 3QSYA 3C5EA 4W8HA 3T3HA 4EKGA 4JKOA 1X8KA 1H4TA 3RRZA 1MIOA 3SVZA 5IFLA 1DO8A 1EZ1A 1XK7A 2F17A 1IWPB 4MZXA 4E13A 3JPYA 1LPSA 5IKXA 3PXXA 1QTIA 4PO9A 1H4QA 4S1TA 1GITA 1ADJA 1M2WA 4AWBA 1ID8A 3ER6A 3ZWOA 2Q62A 3CM0A 2PIDA 1QF6A 3NAQA 4M8LA 1UDXA 3TEJA 2DRIA 4ALIA 4MITA 5EPEA 2XNDD 5EE3A 4UTZA 3MQFA 1CVLA 3OMXA 2BMEA 1EPUA 2EGHA 1Q0QA 3FWNA 3KKQA 4FS3A 2FOIA 3S1AB 4GZ3A 1WMDA 4OA8A 4RMNA 4WHMA 3RYFB 1DT5A 1EVIA 1NASA 3R9KA 4F04A 3RFFA 1RWOA 5E8JA 2ZB2A 4Z9FA 1P4JA 5AW8A 2DFKB 2NZUG 4B3DA 3NBUA 1SFRA 4LRQA 1X8XA 3W8NA 2H1SA 2X15A 3A1CA 1CJBA 3GLTA 4PYQA 2BN4A 3DB1A 4PNHA 1S1CA 2Y9MB 4NCXA 4G0VA 4P4SB 2GYUA 1ZITA 3KEQA 1GG5A 3W4JA 2P8JA 4A82A 2WHRA 2JLWA 3GLIE 2WJ3A 3B12A 2Q4RA 4KXVA 2D2FA 4HVAA 1OASA 2KSQA 3EFOB 5FWYB 3IKLA 4GYWA 2H00A 3HP4A 4WA8A 4NAHA 1BH6A 1PGPA 1A9XA 2HAEA 4MI6A 4DARA 2WMNB 4LJYA 4X00A 3L4JA 1SVWA 2O1EA 1IIRA 5CLJA 1G8AA 2BONA 4D4IA 5JJIA 3VV2A 2V7WA 3F4LA 3VZSA 2OHVA 1RJ9A 4QEZA 3TLMA 4CLHA 3I1IA 3WK8A 2ZCVA 2YFYA 5IXSA 4PLPA 4R84A 4V0RA 1FY2A 2E48A 2YFHA 3MD9A 4QFCA 3H87A 1T8UA 3HR8A 4XW2A 4F46A 3F9RA 3H9CA 4BFVA 1TUIA 2C4KA 4YXWD 4XIJA 1O89A 3I1FA 3ZKWA 3ICOA 3LDGA 1CKEA 3GUZA 5FEMA 4GT1A 3SDZA 4LOLA 1JGTA 1H0KA 1GL3A 2CFRA 2YHUA 3LVBA 2W9XA 3FIJA 4HLNA 3WS7A 2NQ2C 4PN3A 2OECA 1LS6A 3A3KA 5PGMA 1E2NA 1SC1A 1VP3A 2BH9A 1KBQA 1KC3A 4HRVA 4OQMA 1SD2A 2HMWA 3QG1A 5B6IA 3OF3A 4I1VA 2WG1A 3TQHA 1Q92A 3TSCA 4BB0A 1F6WA 1IIBA 3PNBA 5E9QA 2F8TA 3PP8A 1DKMA 1OBCA 4MJ3A 4OSEA 3ZGLA 2PT6A 4PAQA 1RXCA 3QTBA 1SC3A 3AKDA 5JWHA 1E2FA 5CNMA 1BW9A 1RXEA 2WG0A 3JD3A 2YV1A 4NENA 1ESNA 2WNSA 3DZIA 1ETHA 4EVQA 3LKDA 1RLMA 2IXAA 5FPPA 4A6DA 2BJHA 1FTQA 1YDGA 1Q19A 1T9CA 4WKOA 3MTIA 5BQXA 1TZCA 2J5BA 5BY2A 5DK6A 1L3IA 3TMYA 1BE0A 4QFBA 3PNYA 4HRYA 4MMYB 3SICE 4QC2A 5E7MA 1ZUNA 4Z5XA 3DT8A 1LKZA 3WQRA 4X93A 3FNQA 4TLEA 2OBYA 1J1IA 1F5NA 1JSXA 2YWBA 2MIIA 3DE6X 3PNSA 4OM7A 4EDFA 5B6JA 5HQTA 1GAEO 3CR8A 1HYQA 5AVUA 1HZZA 4DY6A 3E27A 2AC7A 2AI3A 1XLTC 1M83A 2II6A 4L3VA 5FI1B 4ZJYA 1QHHA 2V74B 2Y2VA 4G1MB 1OJ7A 4RPKA 3RS2A 2E85A 4ISCA 5C3UA 3SJZA 1TL7C 4BO8A 1XHFA 2XGGA 3H5RA 3EWSA 3K0CC 3H05A 1B76A 1DV2A 3F96A 4G6ZA 4RXTA 4M99A 1B8NA 1PUIA 1QQ6A 3K9QO 3QEMB 3TNJA 3WHLA 4DNQA 5IM4A 1OVMA 3Q4GA 3IE0A 5KVSA 1W35A 2DFTA 4HNQA 4UASA 1DADA 3QSGA 1PLKA 3MS4A 2VNSA 3CPSA 5DRYA 5K0NA 3Q11A 1KF0A 4EO7A 1EB9A 1W96A 1T9AA 2IL1A 4HWGA 5DP1A 2WAOA 5JCJD 1CS0B 2X0KA 4OJTA 4RPHA 4K6HA 2X19A 2O8DB 1HH4A 3IUYA 4JQSA 2NAPA 3FUTA 3KP1A 1ZC4A 3DZKA 3FUUA 4KOEC 3FDZB 1LK7A 1OILA 4U9IS 2OCIA 2JCVA 1CUHA 3LW7A 4NJOA 5DYTA 5LBUA 1GXSA 1A3CA 3JQ7A 5BSMA 5JI3E 1EWTA 3F5QA 3KQOA 4YDSA 3E9NA 1AU9A 5AW3A 3EEFA 1N5IA 3VR4D 4C6HA 3GWZA 5BVHA 3EIWA 2TRSB 1NYLA 2G80A 3UXEA 3QWIA 3ERCA 3VR1A 1M6NA 4HNRA 1XMXA 1HORA 2EFEB 3G23A 4S0XA 1U7HA 5CM2Z 2KM1A 4QE3A 1E8DA 3UW1A 2WZBA 5FPHA 3AUAA 3ZE8A 4BLSA 3KZNA 4DHWA 2FP3A 2W6MA 3ZHBA 3K70D 3MJCA 3O9ZA 1K4KA 3IV6A 2PEYA 1J23A 2C96A 4Q1VA 2OHGA 1DAPA 3ZNOA 2C3UA 4FNMA 4PXAA 5E1BA 2FUKA 2GAOA 3HXLA 3M70A 2BMJA 1TCVA 3V1LA 4E07A 4CIYA 2BI7A 1P61B 3H1FA 1B93A 1FJ2A 1QOZA 1U8CB 2FZLA 3NAGA 1C3LA 3H9UA 4I6JA 4J94A 1EFUA 1OUMA 4G0PA 1HO3A 1UXIA 1WZNA 5ESRA 1EVYA 4M1QA 5F9FA 2HRBA 3RT9A 5BXYA 1NMSA 4X66B 4IDQA 1EWKA 3JQ6A 3RB8A 4XX0B 3BGOS 5CT9A 3DAHA 5ILGA 5B3LA 5JSQA 3OQNA 1UBMS 1NMEA 2PO7A 1DKOA 3UMFA 4TWJA 4D9MA 1JIXA 1JKIA 3KYDA 1NDQA 3SEAA 3GGOA 1Z6XA 3IRUA 3OFVA 2P2SA 3HR7A 2WMDA 4H1HA 4M0CA 4POAA 4YJ3B 4N6GA 1QCCA 1D7OA 3PDIA 1W581 2PX3A 3D0KA 4FSDA 4IL5A 4EX7A 2WFAA 5AW4A 1QOPB 4G9BA 2IDMA 2C84A 4WV3A 3RO7A 3TRKA 5CFPA 1UJ4A 4JR1A 1NN0A 1DC5A 1SA0A 4I5EA 4DLVA 4AKGA 3N05A 4HWSA 1P5ZB 4S1WA 2VWQA 4MUJA 1XTVA 3LY7A 5JQGA 1V3UA 3CEHA 4O4HB 5JWRA 5GM1A 4KHZA 4EPRA 3IH5A 4DV0B 1A1VA 1VE3A 4PGMA 2CXRA 3C5VA 5J9FA 4BGUA 1D4ZA 1JEAA 2C4HA 4Y0VA 2E1PA 4MEBA 3WNVA 5LUAA 4DKXA 1E3LA 4IS2A 4AW9A 4W1RA 5FPTA 4J90A 2Y1CA 1WV1A 2CD9A 2ZU6A 2ANCA 5BNFA 5JDCA 4DSTA 5T64A 4JIMA 4YJHA 1HG1A 3IBYA 5KU1A 5HKLA 3ACBA 1J0AA 5HCIA 1OZFA 1L9XA 2EQAA 3HMKA 5AHXA 4KAXA 5EXXA 3W2FA 2RK6A 2P41A 3WIUA 4RF5A 2HWUA 4QNRA 2ZXEA 3CONA 5K03A 1X14A 2NM0A 2QP3A 2TECE 1R4AA 2AFIB 1K8XB 3FE2A 1BO6A 3N2ZB 3QNWA 1CUBA 5FULA 2H8KA 3FG9A 1KXZA 3Q3EA 4H7KA 2ATXA 4LMAA 1R37A 2WP8J 3ZK9A 5C81A 5FTKA 4J6EA 4PX2A 3QHAA 2GS9A 4C05A 3DTVD 4MV0A 3EDYA 4N8EA 3UXMA 1SJ9A 2VYND 2PBRA 3ZV4A 1JEJA 3LVRE 4D96A 1HT2E 2ZI3A 3GI1A 3KWMA 4HC4A 2DQZA 1T6XA 5CLHA 1RFGE 3GCZA 2W2LA 1YSCA 4TV9F 2PCLA 4QQFA 1BDHA 4UHBA 4FFPA 1VPEA 4TL6A 3AJ8A 3ZCUA 4OHXA 4F11A 2G17A 2QAGB 3IALA 4LFBB 1DELA 1W5TA 4RIHA 1VHLA 5LA6B 3ZVKA 2KBEA 2DHRA 2IHUA 3S29A 1DBSA 4P2GA 2CVQA 1P75A 1SOUA 2F3PA 2QNRA 3E6AA 3KZ1E 5DF1A 3MAAC 2G7ZA 1G5HA 1VE5A 4CTJA 4G5OA 3UM9A 1QIEA 4YMTA 2BEWA 1IVYA 5KEIA 5AHOA 1ZC3A 5F2NA 3A11A 3PEEA 2HT1A 4OYYA 1RW4A 4GPD1 4P36A 4CLEA 4OEHA 5E9WA 2P77A 4GVXA 3SLGA 3VKHA 1C14A 1TECE 2O57A 5AJHA 3U09A 3PFIA 4RPGA 4TROA 3T34A 2QZJA 1T3ZA 4PX3A 2P3SA 1DGQA 3WMFA 2H57A 3R0JA 3PJEA 3U3ZA 1E60A 4MO2A 4H0NA 1EM6A 1I6MA 4BQFA 1T0HB 1G6HA 1QVRA 4IYRA 2OBMA 1H1TA 3TOCA 3RG2A 2IPOA 3V32A 1I4DD 1HBJA 2WB2A 1Y3DE 1YJQA 3I0NA 1IY8A 2NXEA 5K8CA 2RD2A 1YR1A 1DAFA 3IOMA 3A1UA 1EDBA 1D2HA 2E4XA 1JXAA 1CUXA 1MOPA 3KZCA 3ZHYA 4B87A 2ZJ5A 2WHXA 4NULA 1OE0A 1J2EA 1NQOA 1Z75A 2WV7A 2ZI4A 2F7SA 2GVDC 3IVMA 2W2TA 3K0BA 2FZGA 3PEUA 4IM7A 3RAJA 1TQ2A 1L7QA 1FX0A 5THQA 3ZHRA 5AFSA 5AUPB 1JMYA 3IO5A 3JVUA 4PPQA 3VPSA 1VPLA 2YN2A 3IILA 1H6CA 3CH7A 3L9XA 4CZ2A 1NRWA 3HNOA 2ETVA 1MB3A 1D03A 2QD3A 3CZAA 4GI7A 4L16A 1GZUA 5HILA 4OLFA 2WQ6A 2L17A 2JD0A 3PWSA 4GPZA 3V7NA 4B76A 1AS0A 1YNOA 4AC9A 4CEIB 1C29B 1UWVA 2WTNA 4LGCA 3ZZNA 4B1FA 2V96A 2VNIA 1ZJYA 3EF1A 1JHDA 2HRCA 1NVGA 3O94A 4D4LA 3I2GA 1CJMA 4L3WA 1T0UA 3F1KA 4DDKA 4DA7A 3O4IA 4Q6BA 2UV8A 3HBJA 4YMIA 3BE5A 4FE4A 2HPHA 3G2NA 3STYA 3C97A 4HX2A 3UO8B 3PQ2A 3N0TA 4UNNA 3DL0A 3CXRA 4GVPA 3HSSA 3TNLA 5DO9A 3FJOA 3VZCA 2ZDGA 2HM7A 1RBMA 1JDJA 2UDPA 5KYXB 1I1QB 2YY7A 1OZGA 4QVIA 5LP6A 4IVPA 1TTHA 2PLWA 2CZCA 2OG1A 1EXWA 1QF9A 1SQ0A 4N76A 2J6HA 3HMQA 3K7EA 5DYWA 2K2WA 4M9SA 4UXHA 1V8BA 4BNMA 2XD9A 1K7CA 2D8AA 3KSDO 3QU4A 1JLMA 4IOLA 2CFOA 4OGGA 1E96A 3ZDRA 2F4VB 4WBSA 4WXHA 3RD5A 4A0GA 4EKDA 2EIXA 2Y92A 2QJFA 1Q0SA 5ELXA 4O1IA 3TO5A 3WMEA 1Q6ZA 4CF6A 5B5SA 1E0JA 3L8HA 5CPFA 3QHQA 2EBUA 1BTOA 3FPKA 1ZFNA 2RH8A 3DDWA 3GT0A 3S1AA 5ALKA 1SBYA 3RYFA 2JI6A 4CF7A 4CQJA 3T15A 3KXPA 3JYLA 1KKMA 1PQWA 4PEVA 2Q7XA 3B6JA 1J5PA 2YRWA 1RWWA 4RKWA 3KHSA 3K9CA 1LJLA 3PF9A 3AIMA 5J63A 5IMSA 3A2LA 2DWPA 3G0GA 1VYTA 4BKRA 3RRBA 4P4SA 5EHXA 3I6QA 2OXTA 5F7OA 4NBVA 4IVNA 1E1YA 4PY2A 2X0IA 2AZDA 4YASA 4UOZA 3SKYA 4DQUA 3EFOA 5FWYA 1D2CA 2B37A 4U2GA 4AN1A 4E4YA 3A14A 3D2LA 4ZXFA 4RTQA 1EVLA 1JZTA 3HDYA 4ZVRA 5EIOA 4BP3A 4KQ6A 1VSUA 2XZOA 3D0OA 1OV6A 5HXAA 3IE1A 3IQGX 5BV0A 4EP1A 2YIVX 3AY6A 3MJSA 3F3SA 4DJEC 5ITZB 3TBFA 2FHSA 1YTUA 3T3MB 1KEWA 3IMFA 3WGNA 1NMXA 4G9GA 3O3NB 1JR3A 4NPCA 1MPTA 3H3FA 2UXDB 1O9GA 1PS0A 3CEAA 2JCBA 4DANA 4GUAA 2BM8A 1OAOA 1BN6A 4ZDKA 3BXPA 3D9QX 1CSEE 5JZOA 1GN8A 5CFQA 2XBMA 5DX1A 1ISGA 5TMEA 4JELA 5IC5A 5BR7A 3SD7A 3VU3A 1T6YA 2AN5A 1I2AA 4WTOA 4H9GA 1FSSA 3PXCX 3KT6A 3AK4A 4K26A 3ZV7A 1IRIA 3CKMA 3H7IA 3NM4A 3CKYA 2IVFA 1ZBQA 3N53A 1A9SA 1HDCA 1IEVA 1RR6A 2D4HA 2QRKA 3ZBUA 3UOAB 1QV7A 4C0JA 3V5NA 1KZ7B 2AMJA 2ODQA 1FNSA 4KPGA 4Q93A 1DEOA 4GX1A 4L6CA 2XYRA 5HE9A 1FYEA 5K09A 1FFGA 4MB2A 4QU0A 3KYJB 1X7GA 1ML3A 3CSSA 2VYVD 5JAUA 3EVEA 4PLVA 4LOJA 4B71A 3TUZC 2XCRB 3OM9A 1ONSA 3MOIA 4BQQA 3DAPA 3F7TA 4OQPA 4P31A 4EPTA 4ZHSA 3RQIA 3N7UA 4FLFA 3MTJA 4R5HA 3I04M 2RGEA 1E63A 2ZSBA 4P7BA 1AMUA 4BTEA 3AVYA 1RE0A 3N39C 4KQ2A 2JCXA 4MHTA 5AVVA 3DWEX 2B4TO 1JNYA 4TS9A 4M1ZA 2Z58A 2W00A 2HD4A 3CBQA 1XTPA 2AEMA 3OQHA 3RU2A 4KVFA 1P31A 3TINA 1F5SA 4FCVA 4R1NA 5F12A 3W5CA 4IUDS 1YQ9A 3Q1KA 1KOFA 3U37A 4DV2B 1A4XA 5EVJA 3QEMA 5KQPA 4MZDA 1E79D 1ENZA 4BNIA 3ASZA 4NCKA 3PIRA 4QOIA 1QRUA 1E2GA 3O8NA 2FFJA 1C7RA 1S8FA 4MUHA 2X0FA 2FW9A 3GAFA 3R0ZA 4XYGA 1VRCA 4OMDA 3K4HA 4I81A 1ETUA 4IDAA 4AYWA 6NULA 5FORA 1CUWA 4D56A 3RHZA 1G9XA 1X87A 1MA3A 3VFDA 4BFWA 1RAEA 4KWHA 3SYLA 1A97A 1CS0A 2JGNA 3QEBZ 4G23A 3RYTC 5KPDA 3ER8A 1QV6A 5LMZA 2O8DA 5G41A 1U9IC 1Z28A 4DLKA 4DQXA 3P9ZA 1RKQA 3FDZA 5DN6D 1G291 1BVUA 4GRDA 4Y6GB 3BKWA 5E4FA 4C1BA 4TX1A 5C9ZA 4RD1A 1LZLA 4L6IA 2D06A 1L8AA 2ODWA 2QZPA 3WMWA 4N48A 3S8EA 4TZTA 2J6BA 3FDFA 3VOBA 3O9MA 1OSNA 4EI7A 1K8ZB 4NMWA 2AG6A 4P5DA 2FQYA 4K28A 4BATA 2X9VA 4MICA 5D3QA 3W8DA 3I09A 2DYKA 2JAHA 3WK7A 2R5FA 3WLRA 1W7AA 1EFVB 2BT4A 4IDPA 4BLVA 3DG9A 2YVKA 1Z39A 3OTGA 4B84A 3M2PA 4M1MA 1MEJA 2CYCA 3A27A 3DOJA 1ZESA 2QX6A 4EFLA 4IHQA 3V7FA 1GNLA 3ZD8A 2GCNA 1THMA 4YEDA 3DJYA 3R3HA 2Z08A 2MU1A 1XR3A 3HDQA 3IQFA 5LL6P 1C1XB 1T2UA 4UXIA 1RXWA 1TLFA 4WKPA 2GM9A 4BMYA 3L05A 1OGJA 1RZUA 4PQEA 4RVFA 3ADPA 1NUHA 4N65A 1PGNA 3MD0A 1R64A 3Q12A 4QLBA 2J7PA 2WICA 1JAZA 2B94A 2DQSA 1H66A 1YDFA 5JHHB 1UKCA 3WMGA 2J31A 2O7SA 4XX0A 5IN4A 1J09A 2WF7A 4TTIA 5CTJA 5HNKA 2AV6A 4YPVA 3HGMA 1D0SA 1GFIA 1GN9A 3TAHA 1MVOA 2A14A 2P4HX 2WHQA 1Z12A 3WRYC 2WD8A 3D4NA 4HDKB 3GEGA 2GCIA 3BICA 5FBLB 4P33A 1QIIA 2OP1A 5HW0A 3IESA 4URHA 4YJ3A 5GMOA 4EHJA 4YC7A 2I2CA 3R0IA 4N5HX 1H8EA 1R0YA 1REQB 1L7RA 1UJ6A 1PV1A 3EY9A 2ZJFA 3OMLA 4PQRA 3CRNA 2MSCB 4BNVA 2A35A 2R44A 3SHVA 4NATA 1XVVA 2OBFA 3QXSA 3RVMA 2R65A 4N5NA 2JGFA 2W6IA 5FOXA 5IEBA 1TMKA 3CBGA 2NGRA 5IT4A 1WO8A 3EZFA 4LISA 4YN3A 3P5SA 4G07A 3L4BC 4O4HA 1QK3A 4V0OA 4D8VA 2VSFA 1LLUA 1OGYA 4NICA 4ZXPA 1WXWA 4QA9A 4U7PB 2GXQA 4BCDA 1VLHA 2I2BA 4LECA 2EJTA 2HSJA 5BSEA 3L84A 1JYEA 1RM0A 2DFPA 1PT7A 2QU8A 1H8HA 4XIFA 2QIPA 4IQ8A 1O2DA 3C41J 5D7BA 1HEUA 2IOQA 2FMXA 2D54A 4OK6A 5F5LA 5CMLA 1HETA 1RBQA 3SHQA 1EHYA 2CE7A 3HKDB 2UXBB 5BPHA 2ZSFA 4DEVA 4R68A 1FYDA 1PFWA 1DIHA 1PT8A 2GBLC 2I4TA 4DC9A 4ND6A 1L7NA 2VJDA 3ZDFA 3RC7A 4ZAFA 2QYHA 2QYTA 5DULA 3JZIA 2AFIA 4S3MA 3BTOA 3V33A 1E1LA 3W5BA 1JKXA 2FDRA 4AMYA 3DFFA 5BV1A 3GNSA 3JV7A 5D87A 4Y3UA 4B33A 3NATA 3ZVRA 1GUDA 4EZEA 3C8MA 4EW2A 3RFTA 4YGXB 1MDBA 1K88A 4CI0B 2A5FA 4L28A 1EK2A 3DYBA 5CAEB 1J5XA 4AG3A 4B3GA 1AQIA 1Z16A 1H1LB 2W48A 2B0JA 2YCLA 3VSBA 2LR0A 3EF0A 3A2NA 3L7IA 1FU7A 3NOOA 4GP6A 1OYOA 2R8ZA 4RQAA 1XQVA 4DA4A 1GGEA 1KJ8A 1RAGA 4KMMA 1TAGA 4WLVA 3NORA 1F6DA 4B3TB 4C0AC 2EJBA 4XLZA 5EP1A 2VKQA 3KR9A 1IXRC 2QAGA 1J4AA 4ZTZB 1KI8A 4YFVA 5LA6A 4LG1A 2CHEA 3D3NA 1SG0A 2GCPA 1USWA 1KJJA 2WFZA 2W6ZA 3DA8A 4X7PA 5ALLA 2ETXA 1MV5A 2Q5EA 2QX9A 2WIDA 3D7KA 3K8ZA 4ML3A 1KJYA 2J32A 5I7RA 1ZJWA 1RI1A 2OSBA 3HYSA 4CV2A 2DUWA 2C1ZA 1VZ3A 3GXOA 3I4FA 2P2ZA 4F1WA 2GMWA 2XH8A 3ABIA 1OZ0A 4UU0A 1MJNA 3AKCA 3QBDA 1ADGA 1XWFA 4LYDA 4ZQCB 4CL2A 3RADC 4P3XA 2FPRA 4AO6A 3WWDA 5F35A 4URXR 2OBLA 1O1YA 2Q6IA 3CKKA 3AOGA 3CA8A 3DC7A 2VJQA 4F0JA 4F1JA 4NLLA 3HCPA 4JI5B 4YUXA 2FMIA 1R6DA 2CEKA 4NOMA 2DAPA 1KI6B 1YCGA 4TYMA 3CRMA 4QOJA 4ZVTA 1LWOA 1NZDA 5IJWA 3VUEA 1MU0A 5K6TA 3OKAA 1KMCA 4EW1A 4FR2A 3AHEA 3VX4A 4YCAA 5E2BA 2YINC 1MRSA 5D3KA 4AJOA 4RCZA 3CWQA 5EZQA 2PUEA 3IVXA 1IBSA 1A04A 1NURA 3OPXA 3ZD7A 3DE7X 3EGDB 5EQJB 1N1EA 2M1XA 2QQGA 3TIVA 1CY6A 1NQWA 3U3RA 3MQ4A 1DX9A 2GTHA 1Y1TA 3KU1A 3O3OB 4CEIA 3GK3A 3TYXA 4NCJA 1L4GA 1TEHA 1WU8A 4KQWA 4NQRA 5AJYA 5TF0A 3T7AA 4Q34A 1D07A 4AROA 4MGZR 3LT5A 5T3UA 5IP5A 2ZT6A 2Q6KA 3ZWXA 1QKIA 1GAXA 1WXDA 3F49S 4J4TA 3U4GA 1XU9A 1U8FO 3PHBE 4OQEA 4BEVA 4EQZA 1VBNA 2AE2A 1SCDA 3GFOA 3B9BA 3ZV3A 1Z2CA 2HV9A 3KJGA 1U1IA 1DB3A 1OHHA 2MSLA 4C29A 4RHCA 4GWLA 5KU7A 3HG7A 2AC2A 2IXDA 2F9MA 1NW4A 2VWHA 2XWPA 2R0QC 4F4CA 5I9LA 1D1PA 1PAUA 4EG1A 4EY5A 1HNWB 2B4YA 2QLJA 4MV1A 5KYXA 1LQUA 3SG0A 1F9AA 4OHZA 1ORRA 1TZKA 1BGVA 1CQJB 1P7YA 3PPIA 5KTYA 5CCXA 3B82A 1L7OA 1N3IA 5CB6A 1E1RA 5CA0B 1IATA 2C31A 2V7TA 4JDUA 4O3MA 3GP3A 3GLUA 1HURA 3W3AH 1HOTA 1DS6A 5B4VA 4MYDA 1M2KA 2R5WA 3HM2A 4TWAA 3I0ZA 1GYPA 1ONPA 3KB2A 2GKSA 4AZWA 2R7MA 4B6RA 3VC3A 3NM5A 4PRZA 3GCWA 3X2FA 3OO1A 2ZP1A 3G89A 4IUBS 3AEZA 5IC6A 5AVJA 5JCOA 4E6EA 3EVCA 1V25A 1D1TA 1T2CA 3TLJA 4PZUA 1XEXB 2SNIE 1NW7A 2VT7A 2VZ0A 1Y8RB 3E15A 4PU0A 4R2LA 4BJ3A 3BKXA 3IV9A 3VNQA 4Z4GA 1U8EA 1UXHA 2UYYA 1M2HA 5AKKA 4PGAA 5DNEA 2R1TB 3HLKA 4LPSA 2OCLA 4D8WA 4RJLA 3OJEA 5FO0A 1PJAA 2FGJA 4EKNB 2QW1A 1TM3E 4RXMA 4F9FA 3V4LA 1C9MA 1VJGA 4FXPA 4BVJA 3FIUA 5LYYA 3I01M 1JIVA 3GLQA 3W5HA 4MQMA 4UBJA 3MCAA 1V45E 3V3TA 3NDJA 1ML4A 3BF8A 4FC6A 3R7LA 1E3SA 4X65B 5T4BA 2BUCA 3BTUA 2JIMA 1ZCFA 5EJ7A 3B2EA 3RRFA 3ODGA 2JHPA 1IN6A 3NC0C 4TXJA 3LUFA 1Y4SA 2PRZA 3TI9A 1A2KC 4R01A 1GPUA 4BRSA 1G18A 2C0CA 3MOGA 4M0EA 4DMHA 4OYRA 4HAVA 1CJCA 4Z9YA 3TOSA 3W79A 1J49A 1VP9A 4DPLA 4H18A 3CCFA 3ILXA 3S2GA 3VHQA 1URPA 3NNDA 1HQDA 4HDRB 4MQFB 5DW3A 1I5EA 5ITZA 1R1DA 1KVRA 1DKLA 3C98A 5HF9A 2H1HA 2R85A 3NRJA 2DBRA 3WVNA 3ZLBA 3A3OA 4EYKA 4IIEA 1LDNA 4JLKA 2BIFA 4GE0A 1E3QA 3WYDA 1FNCA 4OQ4A 5C8VA 1LUAA 2PPVA 2VPIA 1PJZA 4G86A 1SKMA 4YLYA 3KAQA 1N2EA 4KUEA 4H4CA 4IKOA 4NCAA 4DB2A 1BGXT 1N9KA 2X6QA 2Z3VA 3FZGA 3Q6NA 4LV5B 3UJAA 5KNDH 2WR8A 4QGFA 2NU8B 3UHOA 1BAPA 2AI2A 4XVCA 3QLVC 4IMJB 4KREA 3AG5A 1YZHA 1Z0UA 3MJDA 3OWXA 3LI2A 3PNMA 4G85A 1XLWA 4Z0PA 4LGYA 3L6DA 1S2NA 1MO5A 1BMQA 1XRPA 2I34A 4MJ7A 4AUKA 4O3FA 1E2EA 2XJ4A 3O2SB 3ZJYA 4BE7B 1TMOA 1NQUA 3BE8A 4UHJA 3II6X 2IV2X 1NONA 4X20B 2ZYUX 4JNKA 2IBSA 3O8OB 2FF5A 3HJNA 4I4TB 2FV8A 4QXMA 3MUNA 1Y9JA 1NOJA 1YJAA 1M1UA 2IZZA 3U17A 4RHYA 1NI4B 3O4JA 4DHEA 1X39A 1EAYA 3PC6A 1NY5A 4UMDA 2P79A 1RHUA 1ZYUA 5EY5B 3OC6A 4G97A 3SYMA 1NP7A 2BKLA 4ASUA 3OWHA 2HDWA 4ZAVA 4RDHA 4O63O 4OM8A 4AJ2A 4MDFA 1VECA 1VC2A 2AD5A 2FPPB 2C3OA 4WSOA 2BR5A 3GNLA 2D7JA 1QKKA 4MKGA 2G83A 5BR8B 3JAMA 1Q84A 3E7PA 2FN3A 1Z5ZA 4H4DA 1M2NA 3ER9A 1GKLA 2HNBA 2W43A 5DT9A 5EL0A 2QYOA 1JTVA 1DEKA 1CJKC 4G4SP 3REQB 5JCPA 2O7VA 3DOEA 3HKBB 3ROEA 4FYIA 3TW6A 1LGYA 5ICGA 1FEZA 3BJRA 1U8AA 2JGJA 2P40A 1PR9A 3RJMA 4NCNA 3Q9NA 5ALOA 1E9EA 2Y4OA 3EIFA 1OI4A 2ZRKA 2ZGVA 3VYWA 2ZW9A 2CNBA 4Y2SA 2J3KA 5FIUA 2VAWA 1CPYA 5L8VA 3OQMA 1DOZA 1SWWA 2C8VA 3UPTA 1MR3F 1FUUA 1MMFB 2R00C 3GAMA 2VCYA 2E6UX 1E9FA 1U0RA 1YRWA 4HKTA 3GG9A 4QJ3A 3HJRA 3GLIB 1MNQA 4U2EA 2BL4A 3LQ1A 4JT4A 4Q4HB 2B78A 3CRRA 5EQTA 3I9MA 5T6BA 3KKZA 3WIBA 5JHGB 3FKQA 5CNJA 2P7IA 5IBPA 3ZCQA 4GSYA 1VLMA 4RJ2A 3MLEA 1JHPA 3DV9A 3L2OB 1YAJA 3UV3A 2XXAB 1WQ4A 2P9CA 2XVZA 4PG4A 3IEUA 3FCAA 2X8WA 1W44A 4N3AA 5JYEA 1F8FA 1G21B 3KD2A 3Q5DA 3KQVA 4I50F 4R41A 3ZHTA 4LZOA 4M76B 1J0XO 4PLYA 1RC8A 2F1JA 1TYAE 1XZHA 2Z04A 4LJ9A 1VI6A 4KPUB 3SOPA 3NUQA 4YYZA 1ZY2A 2FZVA 4A27A 1ZHOA 3BBPA 1I32A 3IERA 2HFJA 4KN5A 3JS5A 5AI5A 4Y9TA 2AFHB 1T4BA 1I10A 1QAMA 3AUKA 4DMMA 2QD1A 4ZAWA 1VSTA 1MO2A 1CHDA 3SC6A 2PN1A 2ZUCA 4R2WA 1EFVA 1SMKA 1T4CB 5FI5A 1OYWA 1VCNA 2FGKA 2RJNA 4FJ1A 4JODA 2CL5A 4DIOA 1FE8A 5CRIA 1AKVA 1CX9B 1M5TA 3EIUA 5CH8A 1NW9B 2NAFA 3T5DA 2OG2A 1TRHA 3ZHZA 1C1XA 2OEPA 4XVRA 1DQYA 4U7DA 1DQPA 2Q28A 2GH1A 3GAAA 4BBPA 3FR8A 3HUEA 2HO5A 4NS4A 5AUQA 1I33A 5GJCA 1H3FA 1KDTA 2GILA 2O0JA 4KQIA 4Q82A 5AKZA 3USCS 3ZD9A 3CN7A 1IN5A 2JCYA 2OFXA 1FYWA 1AY0A 1J06A 3QA3E 3TW8B 2W37A 2GN4A 4DLLA 3OOSA 2OCXA 1S8NA 1J8MF 1LZKA 1Q0HA 4HFMA 4RKEA 5HQ3B 5C5IA 2XMZA 2ZUSA 1WJGA 1PSDA 1ECJA 2F9FA 4AJEA 2Z83A 4IJKA 4NYJR 1XYYA 3X43A 1I7SB 1P19A 3RSLA 1DJMA 2B4RO 3KVVA 4C4XA 4HDKA 2P6NA 2EL9A 4BO9A 4DJJA 4E6PA 1EXDA 4NE7A 1J8VA 4JZKA 2GK4A 2XMPA 3SZLA 3P2YA 3KC2A 4YV7A 1REQA 2FFAA 3G1UA 2GCGA 1TGYA 2X5OA 3IKJA 4IV8A 2RGNC 3VSDA 1C3JA 2P2CA 4NNOA 3KVOA 3I6BA 3OZFA 3P19A 1MGOA 1W1UA 3DMTA 2CLHB 3JWEA 3G6WA 3K35A 3WGHA 4HYYA 1EBFA 4JXKA 4OI4A 1II0A 3KQWA 2I6QA 2ZULA 3AZPA 2DFNA 3LSTA 3N8KA 5CXQA 4MQ4A 2VZLA 4XA8A 1QHEA 1WIWA 2AL7A 5EMHA 4BLQA 3GDWA 3U4QB 1GTZA 2Z8ZA 2ZYRA 3DLHA 4Y67A 4JP2A 1OX4B 2PVCA 5EQFA 3QZUA 1T3TA 5TGTA 5MGNA 2E5LB 1ECGA 3I37X 3EG9B 5EAIA 3DAFA 5D6OA 3NBZC 5GV8A 4CKEB 4YCCA 3D8UA 3BL5A 4I3HA 1K6EA 2MWMA 3HKDA 3ACDA 4LDZA 3IAAA 2IXFA 1DE0A 4UCXA 4AY6A 2GJAA 1AE1A 1CRPA 4Q7EA 2YW9A 2G77B 5TMBA 3WA7A 3BHJA 3PS9A 5IVPA 3VR4H 5CDSA 3TXXA 4CEHB 4RS4A 2Z1DA 4RGYA 4TZKA 5THKA 4K9PA 4Q02A 1M6YA 4WZBB 3VXKA 3ZS8A 4FB5A 2HCFA 2Y66A 3FWHA 1GRNA 3VR6D 3PT9A 5D5HA 3T5TA 5A06A 4DC1A 4KO2S 2AJCA 2P2NA 4HGYA 3VDNB 721PA 4FSHA 3K70C 4HPJB 4JYBA 4K46A 5AUOB 3PX2A 5CAEA 4UOQA 2XB6A 5A1JA 2ZSJA 3F6BX 3PEYA 1H1LA 3K4QA 3DOUA 3LPAA 4L0QA 4JLUA 5DM0A 2X77A 3I9FA 3MRTA 2CB9A 5LQRA 1R4MB 1HNXB 3TTTA 4D98A 1GG2A 3PHJA 2P62A 5IVKA 1NFRA 4HMOA 3UJHA 1M2OB 3DC2A 1XAGA 5ULLA 3GG2A 3Q87B 1U3UA 1VHDA 2FUG6 1P1RA 3GFTA 4ZRNA 1WUTA 1IVSA 3KJHA 2QRVB 2D2XA 3E1GA 4LYAA 2DSTA 4V0MA 1XMSA 3JYNA 2A5YB 3P32A 4EJ6A 1XEWX 2I3BA 2IU0A 3GROA 1LBHA 1MW9X 4HDSB 4D0LB 2HPZA 3AR5A 4XVUA 1FUIA 4LRYA 1WVGA 4CG1A 3H3JA 4OAOA 4WINA 1OC4A 1PYGA 4PYMA 2QJTA 2IUSA 1OLUB 1LC0A 4WECA 4YYEA 3D6FA 1QZTA 5E1MA 3A4NA 4NBKA 3EPJA 2EW2A 2VHZA 3WV4A 1UFRA 4Y2PA 1TD9A 4EHAA 3M1IA 1L5VA 1W36B 1OBFO 2VJKA 5JWOA 5IU6A 1BOOA 4R8VA 4E08A 2IEYA 2QMZA 3S6JA 3B13B 1QO0D 3U6KA 3PQCA 3AQIA 1OXTA 1T9BA 3F5MA 5H9WA 5JZBA 3D6TB 1Z82A 4ZCQA 2QUHA 1KI6A 1HKHA 3GJ3A 1PKXA 1IHDA 4N3NA 3X1XA 1NM5A 4C0KA 5IABA 1P8AA 1WXEA 1L4LA 1M75A 3H1GA 1DWPA 2DGDA 4UKDA 1MC5A 1Z8HA 4S05A 4RELA 3LWDA 1VTKA 2UZAA 1QMPA 3PQ3A 3EMKA 4WBXC 4EJSC 2XW6A 1M73E 4W5QA 4OL0A 1NNEA 3C3PA 3BMQB 5B7QA 3A1TA 2YV2A 5D7NA 1L4NA 3E7FA 2V3CC 2O2IA 1YGPA 1IQPA 2LW7A 1FRNA 1NX9A 1SXJE 4FUQA 4WGGA 4X8OA 1O97D 4PNZA 1ZI9A 3W8FA 3EGDA 2X86A 4OLHA 1GQSA 2PGLA 4ZKEA 4KO4S 4YRTA 4GGMX 4F4FA 3MELA 5KTNA 5HE8A 5LQMA 9LDTA 2D7DA 1GRCA 3WTCA 1F14A 3OKPA 4BVLA 621PA 2ZXUA 4Q3DA 2ZQ5A 1ACLA 3NCTA 1RRCA 3ITEA 5A1TA 1E2BA 2JA2A 4XGQA 4BNYA 2Z2IA 1V8PA 4I08A 3B60A 4L5BA 4M21A 1W85B 3T3OA 4JI0B 4R1LA 3TQIA 1C4KA 3M1AA 1OH6A 5B55A 2RAVA 1CZUA 5A9RA 1JG6A 3EASA 1TEZA 5B1SA 5DNAA 5DX0A 4G09A 2B2CA 3VTFA 4R2MA 2QR3A 1L5KA 4RMHA 2GHQA 3QBVA 3PHCA 3KHUA 4MR8B 1AUOA 3UYLA 3W6UA 1FIUA 3A6EA 4QUDA 4X3CA 4HX9A 3GFQA 2DBVO 5SY6A 3G0DA 2FMTA 4C4AA 1Z06A 3NJ4A 4AU1A 4AM8A 4TWRA 4MKZA 3D1VA 2LRHA 4GXRA 2ZYDA 4LDPA 1Z37A 3NWEA 4D02A 3ICPA 1CQJA 4UAVA 2FEAA 2QV7A 5DWDA 3D3KA 1XMPA 4GF5A 2J9RA 4GSKA 5CA0A 4DBVO 1R9JA 3ENZA 4UE2A 4N5IX 4CKCB 5F98A 2ZYSA 3R23A 1ODKA 4UM5A 3RGWS 3X2SA 2ZR7A 3IR7A 4TS3A 4PW0A 4XUCA 5F5XA 4PN7A 2GJSA 5JSHA 4BX0A 4O08A 3A6JA 3O7MA 4ALKA 1NDHA 2R68A 5CJJA 1AUPA 4J0CA 4CMIB 3B36A 4RGBA 2B9EA 3NT2A 2XOKD 3N2YA 5DASA 1XEXA 5KYNA 1W6RA 3R3WA 3GGJA 1Y8RA 3BGWA 5GP1A 3TH5A 3TX2A 3WLTA 2OKGA 4B4WA 1NQVA 5AJVB 5ICCA 9MHTA 1CU1A 1HFKA 1Z4OA 2QQ5A 2R1TA 5IDQA 1YULA 1GD1O 5KCZA 1DPGA 2GCOB 3DHEA 3EOAI 5EIAA 3IQZA 1I7PA 2FUEA 2X1HA 5BUQA 4RH1A 4Q4LA 2RGRA 2GD2A 1KK3A 2NT4A 3GT4A 4GKAA 2Q8PA 1AGPA 1PWZA 4PBRA 3ZCSA 3QLEA 4MVCA 3WL5A 1JRLA 5ESWA 3TB6A 1QUFA 5DFAA 1FS5A 2OGTA 2QLMA 4XWAA 1NVVQ 4H7EA 3RYCB 4GZLA 2CLFB 3ZW8A 1R8YA 1KWGA 1YZYA 5CG1A 2C54A 4WOCA 2HHJA 1G98A 3E1KA 3HWWA 4LVOA 4U00A 2Q4EA 3KFLA 5HJEA 2SHKA 3RC2A 2AK2A 4EB0A 3ELUA 5AK5A 4QGSA 3L49A 1A8HA 4HADA 1HL3A 3QITA 2V9PA 2XMRA 2A3NA 4IO1A 4MXDA 5L6LB 3PL5A 1H4SA 4HDRA 4MQFA 2FEMA 2ID7A 3NAMA 3ELDA 3L0CA 3WQHA 2CBXA 4Y98A 3WR5A 1OXVA 2F6RA 5E3HA 4DLRA 3VZRA 4WBNB 3H5OA 2I9KA 1NIJA 4KE6A 3CVUA 3D2CA 3ISVA 1OXMA 3V4ZA 1YS1X 3SM9A 4M9UA 5M2QA 3LJKA 5T4EA 3GRKA 4NR0A 1PNRA 2ZLBA 2D5LA 3DMNA 2OYSA 1XA3A 2C2ZA 2H7XA 2W6PA 1R7RA 3PA8A 4Q3OA 2NU8A 4MQ6A 3GNTA 4EY7A 1GNSA 3TSYA 1F4VA 3ONEA 5K99A 3LO8A 1EP2B 1X9IA 5EGSA 2NTJA 5TJ9A 3F97A 2O2GA 4ITUA 3TUJC 4M1SA 1E61A 3JTMA 2Q0XA 4GLJA 4Z7JA 3DBHB 3SS9X 2ATEA 1Q1BA 2BFMA 2NO0A 3NR2A 1VBKA 2ZTMA 4X20A 2JEYA 1DL5A 3O8OA 2PUVA 1RZ3A 4I4TA 5FNVB 2RE8A 4K0KB 2QG4A 2XUOA 1TIPA 4G1BA 4KXNA 4AN0A 1XZJA 2QR5A 3KJXA 1NI4A 3BHNA 3MWFA 1R00A 1KZ1A 3OQOA 3OOHA 1HDOA 4AURA 2Q1TA 1XDGA 3D4PA 3PIDA 1Q20A 2GN8A 5JLAA 3TM5A 1Z4NA 4EFMA 1AKEA 1NW5A 2P78A 3ZCTA 5JSFA 4AKIA 2J46A 2FPPA 5ECYA 5CUQA 3R7DA 3HI4A 4WNIA 3ZBQA 5K4GA 1RPAA 3R75A 2JGDB 1KOJA 1ULZA 3DB2A 2J0SA 2H4JA 3HXPA 1IZ0A 3DOCA 1P1JA 1VG9B 2V5AA 3TPFA 3REQA 3TRJA 3ZWDA 1VFNA 3HKBA 2R1VB 2BEUB 2VC2B 3TJZA 2FK7A 4U39A 4JJZA 2HU7A 3L8ZA 5HGXA 1WXIA 3KJFA 3OHMA 3ZGNA 4E11A 3I61A 3UFXB 4U7JA 3JALB 4GPAA 2B8NA 4D5GA 4MQ5A 1SQSA 4LXGA 3FMVA 5J4LA 3HNPA 3UKDA 3P96A 3VBEA 4IIBA 2Q3HA 2ZUUA 4LHWA 1SZCA 5TEWA 4A0QA 1U2GA 4IXNA 2VQ3A 4DJFC 4R3UC 4ZDJA 5LKRA 2FG6C 4UBIA 5SYAA 1MT0A 3UAVA 1YO6A 1AT1A 1CR1A 5DGHA 4Q39A 3K5IA 4JOSA 1A2OA 4Q4HA 4XQCA 4C2AA 3GLIA 3KTOA 4DL9A 4LGMA 1H42A 2DPXA 2PGXA 2IYAA 3HI6A 5ALTA 5KVAA 3ZOZA 1D2MA 1FP2A 4BKOA 4E4RA 1KAOA 1H22A 1NYQA 3MF4A 3FOEC 3MMXA 3O6VA 1Y5NA 3BRWA 4GD3Q 4WJZA 2XXAA 2V1XA 3QRWA 1Z8NA 3BQMB 4JWKA 4MWTA 2INGX 4ENVA 4YRKA 2PX2A 1G21A 3EPHA 3G2PA 3JU3A 1RYEA 3QEOA 3EOZA 2DWQA 5JT1A 1NBME 2JLQA 3QMVA 3HEBA 3SZGA 4IH9A 4KPUA 2HWWA 3PXAA 1G5RA 1F3OA 1N2XA 3VTAA 4YP9A 4PS0A 1Y1PA 4H59A 4FC7A 2D74A 2CHFA 4JVLA 4MP8A 4ND8B 2X4IA 3LPMA 4UD2A 5DU2A 3FWZA 2AFHA 1KEPA 3KEGA 3Q7RA 4KNWA 3RQSA 4GPTA 5EEGA 4EMTA 3C7CB 4ZYZA 2A9FA 4MVYA 4O2RA 2P1DA 1KOGA 1J21A 4AG5A 1T4CA 1E6LA 4D74A 3CCCA 2BLLA 4TV8F 2FG7C 2QM3A 1I4OA 1PX2A 4E7PA 5K0SA 1U11A 2I7DA 4UTVA 3F0TA 1C80A 4JLDA 2ORIA 1PWHA 1ZM3A 3DXZA 2G72A 2NYVA 3QPAA 2JFGA 1RJGA 3MWDB 5IFKA 3FWPA 4IDNA 4ZT4A 4B2IA 5HJ5A 4YBRA 3IIMA 3LVFO 4F93B 2CFTA 3NYRA 1SUIA 4NMXB 3TW8A 2X9NA 1LBTA 3P0JA 5GADl 3V4RA 1TVCA 2P11A 4YRSA 2BFPA 1HE1C 5HQ3A 4XVQA 5HS4A 4JYZA 4RL4A 1I3OA 4MGYR 4WE3A 2V97A 1O95D 1H9AA 3KB8A 1ID1A 2DLDA 1FFDA 3PJGA 5B2EA 2A67A 2I2DA 3PPXA 4GW3A 1I4EB 4UU7A 1NTOA 2AWOA 5L7YA 3V7WA 2FFRA 1E5XA 4EHKA 5JBQA 2O8CB 2R6DA 2MOKA 2A84A 4D9FA 3JQCA 4MV5A 3DLIA 5B58T 2ZWOA 1WQ3A 1U4SA 2IDJA 3PUKA 5CK5A 4DAOA 2EL7A 1OB2A 3C70A 4P7KA 1EE1A 2XY4A 5E4YA 3GFSA 3PXGA 4EAQA 2N46A 3WYGA 2IYPA 3ZHOA 5ITVA 2WILA 1RWPA 2FR1A 4NH0A 1T5OA 4IEEA 4LPKA 2WF9A 2X5NA 3DCIA 3DEYX 2WYOA 2Z5LA 3O0TA 2WTBA 4LDQA 1OX4A 2ZYGA 2DWUA 2R751 2EVWX 1NPTO 3W9UA 5B58C 5DNYB 1OA1A 3EG9A 1F51E 4ODIA 4YT4A 2FW6A 4JC4A 2VDMB 1K8YB 4CKEA 3SSMA 4TTVA 5CD9A 4D0SA 5I9IA 2IX3A 3M49A 2R60A 3IQXA 3AZQA 3VMFA 1PNTA 3PBKA 1PO7A 4DN6A 4C4PA 1N9ZA 1EFRA 2XV1A 3VI3B 2VF4X 5F2OA 1RJFA 1A8IA 3U56A 4LF6B 2HUPA 2FXIA 4YRNA 2VO1A 3B53X 3ZGYA 1NZFA 1SC9A 4CEHA 1C7ZA 2GEUA 4TTRA 5DSZA 3KRTA 4NPAA 3DM9B 4KK3A 4WZBA 4EGCB 4DUZB 1L1RA 3ILHA 2ZAIA 5HOQA 1KJQA 3MJRA 4HAIA 1DPFA 1RC1A 5BN3B 1NBOA 1U9CA 4XIIA 4D9JA 1XZGA 2H6EA 3DKKA 4NBRA 3CE6A 4OQDA 4OK3A 3BDAA 3EPPA 1VYVA 4HATA 4D1YA 1JFTA 5JTTA 2DWCA 2AKEA 1XCPA 3IV7A 3TOVA 4Y9SA 3PFNA 4JX8A 1XLUA 1ZI6A 3BWCA 3IELA 3LYUA 4KIFA 3RUEA 3SR0A 1R4MA 1WUJS 4FJ2A 3BRQA 3RIXA 4M46A 3FA2A 4HB4A 3BWDD 4OBXA 2PQ2A 1M2OA 3WYEA 5AMXA 4D92A 1N5OX 1TYEB 4EB6B 4L7QA 4FYVA 4B8YA 4CYMA 3WO0A 4ZYXA 4AD8A 1JDPA 2QRVA 2I67A 3IDSA 4TMWA 1TAHA 3KVNA 2AS0A 3LL4A 2JKZA 4WPGA 1R2QA 1FJGB 1UZMA 1ZVQA 2CZGA 1X9HA 3BL6A 3H9BA 4HD8A 3R6GA 3I04A 5TSDA 3VVCA 2Y27A 2GARA 3CHYA 2DPMA 2YVLA 4HDSA 4ND2A 4YI3A 2E4UA 3E3LA 4BCCA 1ECPA 4FFMA 3D54D 1MKYA 2C2KA 2ZJ1A 1G66A 1OLUA 2FE1A 5DXJA 2UYQA 2ECKA 1Z5UA 6PFKA 1RWQA 2X6TA 1PWXA 4ABYA 3TD6A 1JB9A 3K9HA 4TL7A 3IKMB 2AUMA 1RT9A 3JCZA 5FNZA 1UDCA 2LE0A 5EYPB 4ZO7A 1E89A 2HADA 2EDCA 2HSZA 2DXIA 1ZD9A 3YASA 3KJIA 1ZGBA 3Q3VA 2E21A 3D6NB 4JLSA 4KQ9A 5LQDA 3H1TA 3IMKA 1OCEA 1N34B 4MW5A 2XE7A 2A8YA 3TD9A 4KITB 2B20A 3A05A 4TMVA 1LV7A 4RORA 1U8UA 2PS3A 3R4CA 2R86A 3KUXA 2C5AA 3BGVA 3ASVA 4GG1A 2FJUA 4BB5A 1CIVA 1JPJA 3PDWA 1HK7A 4LHEA 2C2OA 2FSIA 1P4GA 1YFZA 3AHDA 4KLRA 3RSZA 1ODFA 1CV2A 3KK0A 3P0RA 5FWDA 3BMQA 3RYIB 4ETNA 1UMCB 3TW0A 1VJCA 3AB7A 3BX1A 2QORA 3WL7A 4DG8A 3KOOA 1QWSA 4B81A 2G6BA 2P2LA 4HSGA 4U7GA 3I58A 4MWCA 3C1UA 3SIXA 4MYSA 3GPBA 3TECE 4L76A 5CURA 2QE6A 2V7QD 3SVLA 3DMDA 2I7CA 3N7AA 1N3BA 4GU5A 4CM4B 3AXTA 3JQRA 2BGUA 1MLDA 3MYRA 3N2IA 4O2BB 3IB3A 4U0JA 3LH5A 3QMMA 4WY2A 4DPMA 3LY5A 3V48A 3VH3A 3O91A 5LYJF 4BNUA 1KO5A 2BGWA 3C3WA 4F4DA 1W85A 5BN5B 1W5EA 1Z2DA 1MO3A 1ZK4A 3FF4A 3R3UA 4WFIA 3N6VA 3GBVA 1PRYA 5CBKA 2OQ2A 3LE8A 1FF9A 3WDSA 5CXSA 1QRAA 4L08A 3DVQX 1GZ6A 4MR8A 5KQGA 4HVCA 3B2NA 1PFGA 5C18A 2YASA 4ZVQA 5C32A 1GPJA 1S96A 2QVCA 3HRKA 4D9CA 3IP3A 4ENUA 1EIWA 1L2TA 5H9VA 2PGDA 5ICMA 4I4LA 2QRUA 1I0ZA 2CMHA 3ZDBA 5H7XA 4UPDA 1GWNA 3K6SB 3B51X 3T9DA 1X3LA 1NRXA 4NYIQ 4CKCA 1C9EA 4ZA2A 4WZAE 3ROPA 1SWVA 4GBJA 4JL6A 4U2BA 4X0EA 2Y0EA 3AVOA 3AEXA 5E7IA 5ECDA 5GY7A 4A15A 1QFMA 2ZJYA 5HR5A 1HRKA 1X7XB 4HCJA 5AW6A 5DLYA 4CMIA 1KFBB 1H3NA 5EJ2A 1JUDA 3HUUA 4JNCA 5B1EA 4R1PA 3TXAA 1K9SA 1ELOA 3TZQA 5BSFA 2VJAA 2HGZA 1W0KA 2ZIVB 1DDGA 4HUJA 4A03A 2ZM5A 4PVCA 2AJ8A 4C4RA 1PQ4A 3J7TA 5EZYF 2EDAA 2GCOA 3V2UA 4G4IA 3IAS1 4M87A 5DBEX 1Z0DA 2SICE 1NT2A 2Q6VA 3Q3JB 3R3JA 3QLUA 1TM2A 1XFDA 3HXQA 2V6MA 2WYVA 4LXYA 4MARA 3OICA 6AT1A 1UBOS 3RS9A 1XQXA 2EZ8A 4WK4B 3FXAA 4KPYA 2HMUA 1VQ1A 2QPOA 2GR9A 5CEJA 3RYCA 4UHDA 3SSAA 2YQZA 1TO2E 3K9GA 3NBXX 3ONFA 3GCGA 3RBZA 3I1JA 4RQTA 3PV0A 1FSPA 5AKXA 3EZNA 3G9QA 3UBMA 2G28A 5F51A 2W90A 1QG6A 2QZZA 2BHTA 4RVNA 2IYXA 3BK2A 3PUWA 2CL7X 4FZ5A 4YCMA 1GSAA 3MCWA 1OT5A 1Q1GA 2ZWIA 3BFJA 3F5SA 3OCCA 4CQNA 3AR9A 1Z7GA 4TM7A 3L8GA 4Q3EA 2Q7DA 1SBZA 1EVEA 2BEJA 3FNGA 2C58A 3L6UA 2VATA 1XYVA 1QPZA 3H13A 4FR5A 2I6GA 4DBLE 5ICEA 1RXSA 4A2CA 5AI6A 4HLDA 5G1NA 2PU5A 4DMKA 1KEVA 4HR7A 3S2FA 1CYDA 3DV0B 2IUTA 3FZNA 4FHDA 4PGHA 1H69A 5I7UA 2OCAA 3EXFA 2QI9C 1KPGA 3OQBA 2HEIA 1JEOA 2HSGA 2AF4C 2RK4A 1Z4JA 3IDAA 4R1OA 1K97A 2CKDA 4QUBA 5HQJA 3TR0A 4UNRA 3OAAD 4IDBA 3TMAA 1QM5A 1YE8A 2CL0X 5EJIA 1H2ZA 4NWIA 2WE7A 3D3QA 5C34B 4CXMA 1Y37A 3N28A 1E5DA 3NNNA 2QZ9A 4IHKA 4HWPA 4MUKA 4E3ZA 4JP1A 1WSBA 4LRTB 4F84A 4V1CB 3MJFA 3DBHA 3W5DA 3ZVMA 3ANNA 5ALJA 3TZ6A 2VWPA 3PDCA 5BNTA 1JKJB 1Z88A 3QXJA 5G53C 3TIGA 4NCIA 2HDHA 4ZEWA 1NFFA 4FQ7A 3B3JA 3FI0A 4RPLA 4EA6A 3LQ2A 3ZY5A 2C5SA 1M3SA 3H75A 1XNQB 4LGVA 4M88A 4L4XA 2IPAB 3ESQA 3BCUA 1ZP6A 4P22A 4C0BA 2I71A 1RXIA 2XR1A 1S8OA 1JA1A 1QIDA 2OC9A 1QTNA 1QHXA 3CJTA 2BGRA 3KEOA 4IOKA 4OHWA 4RZIA 2JGDA 2OC4A 3BEOA 2AQKA 2PDAA 1NXXA 3GLVA 1ZA1A 2R1VA 2BEUA 4NJEB 5HIAA 3VYRB 3MHPA 1ABFA 5BYJA 4NHOA 3UWDA 3PRHA 1L4HA 2CLKB 4PFSA 4BRUA 3ONWA 5KYVA 3JALA 4QL3A 1SKYB 2VPQA 4ZTBA 1BQ3A 3RFXA 4B73A 2WHYA 4OU4A 1OH5A 1ZH0A 2IPLA 5J23A 3R6LA 1ILWA 2BMAA 2VF8A 4KVGA 5BSRA 3WAGA 2I1VB 2O50A 3PGLA 2WOOA 2M98A 4X44A 3MTBA 1G7RA 3EFBA 4JLNA 1NVUQ 3IQHX 2R2AA 3OSZA 4GZMA 1EX6A 1V43A 1NLMA 2NXWA 2C8KA 2HREA 4RD4A 4D0NA 3A6LA 3G7UA 4M83A 2IEGA 3GHYA 4HH3C 4G1VA 1L4FA 5JJCA 1Q14A 4GOMD 1FDSA 4DIFA 5TT0A 4JENA 3BZUA 1MB4A 2DTXA 2CB0A 3CSDA 4INJA 4LXHA 5KS2A 3CLVA 2RK3A 4IGIA 2B2NA 5E4JA 2X8LA 3GRCA 4IJMA 1ND5A 3EIQA 2X41A 4FOTA 2AJBA 2IBMA 5C7OO 1Y80A 3EDQA 1N6HA 4LE1A 1OFVA 5AKJA 1PWEA 1TCAA 3MUOA 1EJ6A 2XT0A 3N3AC 4ARAA 4D82A 2BR4A 2BGLA 1N5RA 1ZIDA 1KP3A 3OVMA 3OFJA 3ESDA 4G0YA 1NHWA 2G08A 4KV7A 2CYBA 1NV9A 4UEWA 1XP8A 4XIYA 1ZQ1A 1UF9A 4ND8A 1RWXA 1J5EB 5J3JA 3E61A 1JW9B 1T8TA 2RGYA 1KTIA 2PY6A 2OZKA 2RARA 4MVJM 5JYBA 4J0EA 3D8SA 3H5IA 3QENA 3OX1A 5GVRA 3BWXA 1Z36A 3EJ6A 4EVRA 1FQKA 1PYDA 2HX1A 3PPVA 2HJRA 4MTLA 2VAPA 3T1VA 4WVLA 3W5IA 3WISA 4M2LA 5GOZA 4OLAA 2PH5A 1CZHA 1IBCA 1OOEA 3U4DA 4N0QA 3FUXA 4G5FA 4NEGA 5K0CA 3C4QA 2G88A 2R8XA 3B38A 3KPWA 4FUTA 4CLOB 2FOLA 4U8HA 2VUHB 3P9IA 4YRDA 5DKFA 5JXJA 2P3QA 4CN9A 1NF2A 3T9BA 3MWDA 4IEIA 4LUCA 4JYPA 3VA7A 2G06A 2ZJ6A 5J2TF 2AC4A 1QLWA 2FWRA 2YJZA 3T0IA 2O3QA 1E6CA 2PH7A 1UP7A 2ZE6A 4FKZA 4G0OA 1VL2A 3ME5A 2ZSDA 5DHAA 3WL3A 3BJMA 5IT5A 3EIOA 4JOBA 5IUJC 2PNJA 1J20A 2WTUA 1UK6A 2EZ9A 4HY3A 4Z1MD 5CDFE 1XPUA 1WTAA 4UAGA 4CMGA 1JHXA 4NHEA 2WSSA 2ZTVA 1E2HA 1TKAA 3M34A 5LZ4A 1F1JA 4KW7A 1YR8A 4C6RA 4E5YA 2O8CA 3EC2A 1XTJA 3BORA 4AJLA 5JRJA 3AFNA 4UDNA 4DZRA 4E1VA 3CCBA 3IQEA 4C43A 2H4XA 5JDCC 5BV7A 4HT3B 2XKJE 3EVDA 5M3BA 4CODB 1EFAA 2Z1NA 4PONA 3I62A 5GAJA 2ZB4A 2VF5X 3E3MA 5C1PA 1ULTA 4O1MA 1X1TA 4OMUA 3T54A 4NU5A 1T13A 1VKZA 1OF1A 1Z4IA 3L0SA 5AK6A 3T7CA 1RXUA 3JQPA 1G7SA 1YNSA 2VTEA 2QE7A 4QO8A 3EXIB 2CXXA 2F67A 2I6XA 5ER6A 1EP9A 2RGDA 2FKAA 2QT9A 3ABSB 3KB6A 4GBMA 1CY8A 1QE5A 2MSDB 2P90A 2QSYA 2SBTA 1FDUA 3DWIA 4TYNA 4HZGA 1I1OA 4FCCA 4YALA 4EABA 4QG7A 4PIPA 5KBYA 3OZTA 2PUWA 4Y1EA 4JBWA 1D3AA 3WA6A 4J0KA 2QQFA 2E4ZA 3O9VA 1VSQA 2CZQA 2HJWA 3H2GA 4GBED 2VNJA 5FT9A 1MPXA 3UJ9A 1BJKA 2B69A 1H94A 3IQWA 4RSMA 4DIMA 3QJ5A 4ZJPA 3E9CA 4P35A 2B5OA 2BCJQ 3F4KA 5IBRA 4HUQA 3WXBA 3RSSA 4D8TA 4E22A 1L5SA 4A36A 1B23P 1U8TA 3EMBA 1GAQA 2B4QA 2OLEA 3OEEA 4HQ0A 4E2ZA 1U7PA 1YRLA 1J9GA 4JR2A 3DZ8A 4JROA 2VTKA 4L9AA 4RK7A 4BQSA 1H3EA 5K1ZA 2Q3EA 4TVKA 3FCUB 1XN1A 1WF3A 1ZXXA 3L01A 2H4ZA 3LRPA 3PGXA 3ZIUA 1L1EA 3AI1A 5K2MA 5KAMA 5BN3A 1TTTA 1GGNA 3RG8A 3QYFA 5EXSA 2WU8A 3SF8B 2AR7A 3K30A 2J9GA 1VIVA 2E2WA 2PM8A 3ECCA 4Z4EA 3V2HA 1Y48E 3PR2B 2MINB 4V3CA 3ZX4A 1QX4A 3OZWA 3C6XA 4Y6PA 5I3ZA 3FHTA 1O77A 2VIIA 4PBTA 1EGHA 3MTAA 4FZVA 2NP6A 1AX9A 4CTNA 4EF4A 2RMKA 4R1MA 1DHTA 4LOKA 3W05A 5DHTA 1C0EA 1Q95A 4EB6A 4EPWA 4RJJA 4RX1A 2DHQA 2KE5A 1QBGA 2C97A 3DMFA 3G2QA 4UBMA 3UQYS 4ATNA 5EJ6A 2BGGA 1AGRA 2D2IA 2GTIA 1N2CE 2WBLC 1TF2A 5IZCA 3K1TA 3LYAA 2QP9X 4MO9A 2VUSA 4Q9AA 1K7EB 1SUEA 1Z73A 2CVOA 2QMHA 2XCIA 1BRTA 5FP0A 2PSDA 3LF2A 1V41E 1PQYA 2H8GA 4LSWA 5DRTA 4RHTA 1QQTA 1DEAA 2W2XA 3R3XA 3R41A 1U7OA 3RPEA 3SSOA 4ZOAA 3GRAA 3K0CA 4ZK2A 1CEYA 2V9CA 2DPGA 2K4MA 3A26A 2ZI7A 2XUZA 4N6OA 4QDOA 5J40A 5JCXA 3MMPA 1PJLA 4BU1A 5EXDA 5KAPA 4ZIRB 4RHFA 5AJZA 1OLOA 2GYVA 1RNLA 1GQYA 1DRJA 4PNPA 3FPBA 1BDJA 1G8YA 2ROQA 4N40A 5EYPA 5LBIA 2O2SA 1CNFA 2QM8A 1D2RA 3V4FA 4NMHA 2JFBA 4PCVA 3RVRA 4LJ5A 4BFLA 3E5HA 1ZNWA 2QJWA 1AHPA 3V9AA 5I6DA 1XKQA 1YQTA 4Z3DA 5JJBA 3EULA 1OX5A 4W5TA 4JL8A 4C04A 3HA7A 2J4CA 4U7HA 2C83A 1V95A 2PRJA 3IODA 4LJ4A 3W0LB 3MJVA 2QHXA 4QHYA 4MMZB 4LI0A 1ZCJA 1NVAA 1CG6A 5B3AA 4GUDA 4OD0A 1Z4LA 1R9NA 2R3SA 4H08A 3HPRA 4BNNA 1JX6A 3RYIA 5AWFC 1QBKC 3Q7SA 1UMCA 3VH1A 1OXBB 5UKDA 3U7FB 2XB8A 4RY8A 5BRAA 2WZDA 4FGJA 4IIJF 4RS3A 5CLIA 1KEEA 4D9HA 2DSNA 5JADA 5FTJA 1NJ8A 2D1RA 2R87A 2VUTA 1PEYA 2IHTA 4CM4A 4LF8B 2OCBA 1KRWA 1QV9A 3R5FA 2QX8A 4O2BA 3EAQA 1FFWA 3RAGA 5LP6C 4CCSA 3N8IA 1K5PA 3LUPA 3MINB 3GPLA 7AT1A 1HNNA 4R8KA 1EEHA