3GJ3A

Crystal structure of human rangdp-nup153znf2 complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
202
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 66
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj3A00
2GZDA 2R65A 1EESA 4AYWA 1NSFA 1KJWA 5KYKA 1DG1G 4D0LB 5TDHA 4D25A 2PZGA 2ZJ5A 4GMXA 2BBTA 2FU5C 3B85A 2WICA 2QQEA 2ZR9A 5FH9A 2ODEA 1W49A 1YR6A 2W83A 4FMBB 4C9BA 1WBBA 2KI5A 5LB4A 4F92B 1PV4A 2GESA 1OH5A 2V1UA 4LHXA 5TB5A 1G20E 2GBLA 1XB2A 2WKQA 1XEXA 1SVLA 1DG3A 1NKTA 5FBLB 3UK6A 1HYQA 2P0EA 1P75A 1E2EA 3V4RA 4BRWA 4GZMA 4LBYA 4HLUC 3FYHA 3R20A 4OHZA 1KSJA 2F9LA 1ZD1A 4BFZA 4A8JA 1N5KA 2O8BA 3DOEA 3UKDA 4F93B 4CIDA 1GZSA 4PZLA 1KI3A 2ZYVX 2PLFA 1FP6A 4Q1AA 1W44A 3TUIC 1EFUA 2WJVA 3E70C 4QJ4A 1Q44A 1YJ5A 4ZDWA 1P61B 5BW8A 3ICQB 2ZJ2A 1I4DD 4F7WA 3EZ7A 4RCZA 4JLDA 2B8WA 1COWA 2J5XA 3I5YA 1D2MA 3LAWA 4GOXA 4ERNA 4CF7A 1SVKA 1JECA 1WF3A 2BMEA 4NYIQ 1MO5A 2WWYA 1UDWA 5SZKB 2IEYA 2ZSFA 3HPRA 4FXPA 1E9FA 2QMEA 5M04A 1QHXA 1U8YA 4MDEA 2J0QA 3CBQA 4PZYA 3GP8A 3ONWA 5BWMA 1GL9B 4RD1A 1UBEA 3THXA 3FKSD 4TQUS 4DLZA 2WHXA 4B73A 4LBVA 5K8IA 2IT1A 4YXWD 1IJFA 4IEIA 4XIGS 3D31A 1RPZA 3VR6A 3AKCA 2VRWA 3MMPA 3RDPA 2AN9A 2QROA 5CIWA 4IXNA 4JYCA 2HLDA 2JATA 4CT4B 1L8QA 4URWR 3FGNA 4JLAA 1CP2A 2ANBA 1NVUQ 4PPQA 4I81A 4BGDA 3ZGXA 1D2EA 1O87A 3ZQ6A 1TTTA 4AY2A 3O8RA 3CRVA 1KMQA 1JAIA 4Q9IA 3SE0A 3QPUA 3SQWA 1OIXA 2C98A 4Q1BA 5JS7A 3K0EA 2CVHA 2CNWD 2QGZA 1E2JA 1AKYA 2C78A 4L9WA 1UBFA 1OJLA 2RGBA 1FX0A 1NN3A 3VX3A 4AKIA 4K8OA 1KO7A 5HZHA 3LLMA 2EWVA 2ZE5A 3NHAA 5DLQC 5DI3A 1Z28A 1T3SA 4JVNA 1Z2CA 3QPVA 4G01B 3LWNA 3IPYA 4AKEA 3R7WB 4LUCA 2G9NA 1T5LA 1XWIA 1GITA 2WKPA 1XTIA 3NEYA 4KU4A 1FMJA 4YMTA 1RJ9B 3A1TA 4RSGA 2WIBA 2PJRA 5FL7D 2AL7A 3EA0A 1XD9A 4XWAA 5IK2A 4A0FA 5D3QA 2NO7A 1WRBA 2ZI9A 3OAAA 3PUXA 2ZE8A 1JR6A 3QG1A 1ZUIA 5DHFA 2P6UA 2RGNA 4QNMA 1ESNA 1M34E 1P7CA 2HF9A 3C5HA 4NZYA 3GFOA 4Q4JB 4TYQA 4GDFA 1UKZA 3SZRA 3Q5DA 4HUQA 4NCIA 5DI3B 1Y63A 3ZH9B 4LYHA 1II8B 3OHMA 1FL9A 3R8CA 1VCMA 4JMPA 1TF2A 4RFSB 2V6IA 1ZJ6A 3RC3A 4AURA 3U3KA 4XVQA 1KI6A 3RRZA 1ZM3A 5J40A 3W9YA 3TK1A 3EX7C 1BMFA 1RJ9A 1JI0A 2RGEA 1VHTA 5CLQA 5KDDA 1XMJA 3KKMA 4ZDJA 3ZLJA 1L2TA 2CCGA 2QRZA 5C4MA 5AUOB 4EPXA 3CIOA 3AVOA 1R5NA 1YZTA 2JA1A 2VSFA 4W5HA 4IOJA 2XXAB 1TNDA 2VF8A 2FSGA 2R44A 2GWHA 3WMEA 4EPRA 3AVPA 4URUR 1XMIA 4N3NA 2AWOA 1Z6GA 1VCNA 4B3BA 4JBXA 3K8YA 5JECA 1BMFD 1TU4A 2WBLC 4CT5A 2FZLA 2C96A 3FHCB 1ZBDA 1VDZA 4O0MA 2RGAA 1ZUHA 3L2OB 2Q3HA 4RKEA 2I1QA 1E98A 1NJFA 4HEJA 3DHWC 4B71A 4G5QA 1KSGA 4CEJA 4PTLA 4TLDA 2JLRA 1GSIA 2C8VA 1OXXK 3IIMA 2XNDA 1OFTA 3OEEA 3VNVA 1J8YF 3GLFB 1CXZA 3T1QA 3TUJC 1WBDA 3QKSB 4EJSA 4WXPA 5GJBA 4Z54A 2ZRKA 2IYWA 1OH6A 2OV2A 2HT6A 2O0HA 1ZIOA 2IYXA 1UKVY 4Q48A 4DEXA 1XZQA 4D26A 4JSYA 1G3UA 1N0UA 1N5JA 4ZI2A 3VNUA 4U00A 3MWLA 4KODA 4PC1A 3DDCA 4MYUA 4C0AC 5JCPA 4M1SA 3W3AA 2E9SA 2HYIC 4KSCA 3X1WA 2IS4A 1D5CA 3IEUA 5L8VA 2IUTA 4KVAA 1EWQA 2H17A 5HCIA 3I62A 2BBSA 3FHOA 4JL5A 5E7JA 1HA3A 1KI4A 3GPLA 1AQYA 3OAAD 1QDEA 2QAGB 1VHLA 3VR3A 2ZSEA 1K5GA 3EZ2A 3N70A 1NI3A 3AQ4A 2FFQA 4JYBA 2IYQA 1S4QA 2Z43A 3TAUA 4JKIA 3SS8A 2XB4A 4MKGA 1FZQA 4R7ZA 3G0HA 1U2RA 3TH5A 5CB8A 1LFDB 3GLHB 4HLDA 2WIAA 5EE9A 2V4ZA 3DEFA 3F3YA 3N2EA 4DSOA 4EQ6A 2IYLD 3U60B 5FI0B 1S1MA 5FOTA 1W47A 2JLVA 1ZCAA 4PPNA 2X77A 3THYA 1DELA 5AJZA 4A6PA 2D2EA 4A15A 3THXB 4BPBA 1N5IA 3DM9B 4L9SA 2IS6A 3ADBA 1XJCA 3DM5A 3LQRA 3LY5A 2EFEB 4KVGA 2AKAB 5KO2A 3Q9LA 4DLVA 3FVQA 1E9BA 1R0YA 4WA7A 3WNBA 4LHYA 2R6CA 2CL7X 4XD7D 4RY2A 1NBMD 2ZRGA 5JCZA 2G83A 2XOKA 4DEYA 1J99A 4PHTA 1T3LA 3TJZA 3AVUA 5BYKA 1VCOA 5F9FA 3B13B 2EFCB 2AFIE 1OT3A 3KB2A 4OJKA 2AK2A 4PSAA 4C0QC 2KE5A 3O8BA 1ZP6A 3C8UA 2IYZA 5G53C 4ZO4A 2F7SA 2C77A 1HEIA 3A1SA 4XH9B 2PCLA 3W90A 1VYTA 4NYIR 2DYKA 2WJGA 2W2VA 1Z3IX 5BYJA 2GXUA 1U8AA 2R6AA 4Z8YA 3TBKA 3CNOA 5L3VA 4MGYR 1ETUA 1W36B 1R8SA 1PUJA 1YQTA 4LSGA 1G4UR 5JWRA 2ERYA 4HAUA 3CZPA 3K0SA 3B7GA 4M53A 1T8UA 1QHGA 5CYPA 4PC3A 4E07A 1R2QA 2Q6TA 4RZUA 5FPYA 2ZRHA 1E6CA 2ZEJA 2QENA 1S0UA 1GOTA 3WRXC 3RWMB 2ZS8A 3AEZA 3EC2A 5DI9A 2WWHA 2J0VA 4D4JA 1KI7A 4UJ3A 1AIPA 5FUVA 2CHQA 5A0FA 4ZIRB 4ZCLA 3U7GA 4P0TA 1XDBA 4D6PA 3SHFA 2OILA 2OFWA 2PL3A 1E0AA 1OH7A 4HI0E 2DFLA 2O8DB 1KK2A 3BORA 2MSEB 3L8YA 3GLGE 3BE4A 4Q7JB 3CRMA 1U98A 5FBVB 4YLGA 4OHXA 1EX6A 3GFPA 5B2ZA 2FG5A 2ZITA 4DSTA 1TEVA 4R2HA 4LY6A 2V6JA 3B78A 1FUUA 2VIIA 1MH1A 1QHIA 1RVDA 2FE4A 1Q1EA 5E7MA 1UJ2A 4DCVA 2PMDA 5LPNA 1ZC3A 4DZZA 4JS0A 4AKGA 4BZPA 4YQFA 3AKEA 3QY0A 1FTSA 2ZJAA 3EARA 4FCWA 1ANKA 4B2PA 3KQHA 2IXFA 5D3MB 3EPJA 4C3ZA 2ORVA 4B2LA 3AKDA 2ZXUA 2E1RA 2PZEA 3JZMA 4W7SA 2RAPA 3AUXA 3HU3A 4CW7A 2FSHA 2RCNA 1HE1C 3NEJA 3AVVA 2JIZD 5EXXA 5E7IA 4KLNA 4A82A 4Y0AA 3SI7A 2AK3A 4KBFA 2VH5R 3OIYA 4NE2A 2BC9A 1XPRA 2X8AA 2IXEA 3LLUA 5A5GA 1OPXA 2OE2A 1JEEA 1P62B 5LD2C 2D7CA 3MRSA 3LXXA 5EP4A 1Q22A 1AQUA 4Q4LA 3SJCA 1R0WA 2ASEA 3B1WA 4NHOA 2QQ0A 4WZAE 2WJHA 5J4YA 1M7BA 1OSNA 4M1TA 2OCAA 2P67A 2J45A 2W0MA 3BAFA 1JEDA 4LJ5A 3K9LA 5FR1A 5JWHA 4ZKEA 4BWYA 1RRPA 2RGGA 2C9OA 5FBWB 4GOJA 3MSXA 3T1VA 2Q9CA 3IKJA 2RHMA 2UZIR 2WWWA 3GJ3A 3GJXC 3W8RA 1L4YA 1QHHA 1A5TA 1Q1BA 4Q7MB 5L3RA 1YZUA 2ZPTX 4YDSA 5KHOC 3VKHA 1N6RA 3H0KA 5JJLA 4M22A 3WY9A 2WWGA 5CDFE 4UNQA 1W36D 4GP7A 1Z08A 1JJVA 1WP9A 2Z83A 4IVRA 4YONB 1M8PA 3AKYA 4JVSB 2DFNA 1CR0A 2FPKA 3A6PC 1Z6AA 4ARZA 5HKKD 3X2SA 3K9GA 4HDCA 3WP1B 2CE2X 1SHZA 3X1DA 2DCUA 1S9DA 3SJAA 1R8QA 2VQSA 2ZVPX 2GEVA 1V43A 3CW2A 5CK4A 3WBKA 5L3SA 4BLSA 3DO6A 3DKPA 4TT3D 3THYB 4Q1DA 4DC9A 3AVXA 5CK5A 4TQ9A 2ZAOA 3C41J 3WHLA 1KZ7B 4CVNA 2B8TA 1TADA 1QG4A 2AXPA 2XX3A 2X2EA 3B6EA 4CDGA 3T35A 2A5YB 3ZS9A 3C14C 5F98A 1G41A 1IXZA 2GBLC 4ZCMA 2QBYB 3SOPA 3LH5A 4ESHA 1IY0A 1XFAA 2OCBA 4ZI3A 4MRPA 2TMKA 3L0PA 3EPKA 4CEHB 4JL8A 1ZD9A 2L0XA 5EZ5A 4HAWA 1PZNA 1L4UA 2EWWA 2MMCA 4A9AA 3EXAA 4WOPA 3WYAA 4GRAA 3RRYA 3ZD6A 2O8EB 1PLKA 4MQBA 1M7HA 1UM8A 3GLIE 3IBGA 2IYSA 1T0JB 1SVSA 5KSZA 4LC0A 3OIVA 3W5JA 3MWKA 4EPTA 2HF8A 3SEAA 3A4LA 4AG6A 4WW0A 1HUQA 2QGNA 4A2QA 1GTVA 2BWJA 1C9KA 2FPLA 1GP2A 1OXSC 2ZS9A 3HU1A 3F5FA 1UKYA 1TF5A 1E79A 1DARA 2ZE7A 4S2EA 3TW4A 4MH0R 4Q1FA 2CE7A 5JZVA 4R98A 2WZQA 2FH5B 1CLUA 3BK7A 2KBEA 1IQPA 2OBLA 5CDFA 4BLPA 4PX9A 2WPDA 1D2NA 3KKNA 4PR0A 4DLYA 1NVXQ 3NIBA 4Q18A 1G1MA 4Q01A 5J4KA 5FTMA 4OQNA 4XJXA 4LYJA 4B3CA 2D62A 2IWHA 1A2KC 4FIDA 5E95A 3VKGA 4LJ9A 3K9HA 1G7SA 3LW8A 4NYMR 4B43A 2VEDA 4C2UA 4Q4AB 1NIJA 2ONKA 1EFCA 2XEXA 1IN8A 3LBNA 3D7MA 1KMHA 2A5GA 1XPOA 2QEQA 4I4LA 4G5RA 1XTQA 3B1ZA 1KYIA 3NBXX 1VCIA 3RSOA 1GM5A 5KPJA 5C18A 2BJVA 3EG5A 4XTRA 4NU0A 3RSLA 1E2KA 1B0UA 4EFNA 3SHWA 1ZC4A 4US2R 1SVOA 4ZDIA 4PZZA 1AK2A 4PC2A 1WB9A 2O8FB 2H18A 4M8NE 4MUBA 1Z63A 1MT0A 2IYUA 3BGWA 4OQMA 4LOAA 4WVFA 3Q72A 2Q3MA 4XSHA 1E69A 1NKSA 1QZXA 4XOIA 2WAXA 3W5IA 3TSWA 1QHNA 2YYZA 1XXHE 3OIWA 3BRWD 3VAAA 2BMFA 1G6OA 2N46A 1F6BA 5C46F 1VPLA 4DLWA 5LDDC 4YXWA 4URVR 2V9PA 2CXXA 3LDAA 4V02A 4KFTA 3B9PA 4LCBA 3QSYA 3LNCA 4BLOA 5HKKA 1YZQA 3VR1A 1SXJE 2VP6A 1R4AA 4JL6A 4KFRA 1Q1ZA 2BEKA 3U7EB 4EKDA 3IIJA 5AK0A 1U0LA 2AR7A 1KJZA 2BOVA 1JR3E 4PPFA 3TR0A 1YR8A 1TU3A 2ZR0A 1J90A 1F48A 2PZFA 5B58C 1K6MA 1UBCA 2IX3A 1IY2A 3AGQA 2A5JA 1YRAA 2PX3A 3BB3A 4BECA 3KFVA 4B3FX 2QNRA 3WNDA 4C7OA 3C7KA 4R71A 3DKVA 3NC0C 3UMSA 4ZCIA 3KTAA 2ZRCA 1A82A 4JLOA 4MYTA 2REXB 2BBWA 3M4YA 2AXNA 2A30A 1E32A 3OE7D 2WOJA 2XZOA 4OI4A 2F1JA 2N42A 3TGPA 1IXSB 2JLSA 3TKLA 5G3ZA 2PEZA 4M1YA 2KB0A 1KSFX 4PQRA 1E9CA 4TTPA 2FA9A 4LV8B 3AVTA 4DHEA 2PLRA 3KZ1E 1DOAA 2AHOA 3T1OA 1SXJB 4YC7A 5KSYA 1F2UB 2ZE6A 3KUDA 4QGAA 2ZSBA 1GNQA 5DN6D 3IILA 2QT1A 4PFSA 1T9HA 3W3ZB 2JLYA 3KJEA 3AF2A 3H84A 1G8GA 1CJKC 4LJ6A 2QSYA 3HU2A 1HQCA 2ONJA 5EE1A 2Q9AA 1AA9A 1ZMXA 2GDJA 2IYRA 3MG9A 4OBEA 4BQSA 1J8MF 3L0OA 2VHUA 2C03A 2QP4A 6Q21A 4TLCA 1LTQA 5IT5A 1WQ1R 2BCGY 5FPHA 5JS8A 1W1WA 3NDPA 1R5BA 1RYFA 2ZRIA 3B2EA 4B33A 3ND8A 1EX7A 2UZ3A 4NL4H 5GVSA 1W4BA 1EXMA 2J46A 1OIWA 4DB4A 1XEWX 2YV5A 1NNEA 1CS4C 2OESA 3V9PA 4CEIA 1VG0B 1KTVA 3KKQA 3KUCA 3AVWA 4HATA 2YKGA 4EFMA 3IO3A 2JGNA 3H1TA 3QKTA 1UF9A 1J70A 1G64A 3BJIC 5E3HA 2W0SA 4I99A 5HTKA 1RC8A 1EG7A 1HH4A 3PQCA 2QTFA 4MYHA 2KWIA 2EU8A 521PA 4A0RA 4QHSA 2WJIA 4DCUA 1E99A 4RCYA 4CEHA 1SXJC 1II9A 1G8PA 2VSOA 3IUYA 2F9MA 3UXMA 1D6JA 2QRNA 5GVRA 1NY5A 4C0JA 4LHZA 1LV7A 2P65A 3DMNA 3LVQE 4II7A 3TW8B 4C30A 2D7DA 2CLSA 1JAHA 4GZLA 5H68A 5KUTA 2CVFA 3Q85A 4JLVA 3OESA 1ODFA 3GEHA 5KNCA 5AJVB 1XTJA 3K0FB 1DEKA 1OKKD 4LDJA 5FBRB 2F6RA 3PEWA 3GD7A 3TNFA 3RS2A 4DVGA 4U7DA 1MO3A 4JT4A 4L8GA 3RABA 3NH6A 1E0JA 2NPIA 2P3SA 2C04A 2REBA 3EAQA 4QNRA 3QOFA 4RD4A 2AFHE 4MDFA 4WZBE 4UJ5A 1JPNA 221PA 2FFBA 2H92A 3L0IB 5FOWA 4DUGD 4ACBA 2V7QD 1QG2A 2DY1A 3CPEA 4NONA 1NY6A 4OKSA 4BEBA 3I8XA 4G0NA 2QN6A 4A4DA 1W46A 4TT3A 1GUAA 1Q20A 3KQUA 5K8TA 2ORIA 4GMDA 1YZNA 4Q7KA 3CZQA 3K1JA 4NTZA 1US8B 4EIWA 1NN1A 4LBZA 3H86A 4IRUB 2ZR7A 3BFVA 1E2QA 4DLUA 2G77B 3EWAA 3D6TB 2I1VB 4LI0A 4G3XA 1JNYA 3K0AB 1KO5A 3KKOA 5K8LA 4N1AA 1T91A 1XX6A 5EE3A 4QGFA 1LY1A 1UADA 2GK6A 4MA4A 1E2IA 1G16A 1SULA 2BCJQ 1NMYA 5FOUA 5HR5A 2QZ4A 2YINC 3SBEA 2NZ8A 3ZS8A 1OW3B 2ZI4A 3NC1C 1NF3A 2F55A 1Z6XA 3B1XA 3IQWA 3LVRE 2DR3A 2OFOA 3C5CA 4Q1EA 3PJRA 4EUNA 1KO4A 1A7JA 5D3MA 1P9WA 1TQ4A 4URXR 3WYGA 1GAJA 4FMDB 4CEJB 2CK3A 1VYVA 2QAGA 3FTQA 1XD2B 2QE7A 1XXHA 5B57C 1FW6A 2EW1A 2GJ8A 1QHHB 4KXFB 2VP4A 1R7RA 4JJKA 1RW4A 1JR3D 1M1YE 3K0AA 2MSCB 3IDQA 3ETLA 3MAAC 4QM6A 2DFKB 3CX7A 1Z22A 3MWYW 2VA8A 4W5JA 1JJ7A 1KI9A 5GJCA 1JXMA 1ELOA 2VBCA 2WTUA 3CWZA 2IC5A 1YKSA 3Q5EA 1F2TB 1N0VC 4OYHA 3P26A 1NLYA 2FSFA 5TVKA 4YMWA 3G5UA 3QVUA 3CH5A 3PUWA 4P4SA 2R6FA 3TR5A 1ZYUA 5H8WA 3QKRB 5KDOA 2QPTA 1P4SA 5CJ2A 4DJTA 3SYNA 1Q57A 2XZLA 1NJGA 1U90A 1KY2A 1XD2A 4LWZA 1GG2A 4TYPA 5HE9A 3E1SA 1PVOA 3I92A 2J41A 4OQLA 4QBGB 4TMKA 1OH8A 3S1AB 1E4YA 1ZNXA 5DE3A 3FMFA 3ZVRA 3KFXA 3QVVA 4IDOA 4A1FA 3WHKA 4L4UA 5KNDA 3KTAB 4GFDA 1X3SA 2GF9A 4TL6A 4BFSA 5CIQA 2IS1A 1NIPA 4IDHA 2R6GA 1E9EA 5KU1A 2WSMA 2ZUDA 1VG9B 2FN4A 1P2UA 3DZDA 1EFTA 2ORWA 3NWJA 3VU9A 1YZLA 1D9XA 1OF1A 3SC3A 2ZRPA 4IDNA 4Q00A 1H8EA 1KY3A 1P6XA 4P31A 4PQYA 2CJWA 4CEIB 1E3MA 2NZJA 1ZNYA 1S96A 2OM2A 1PLJA 3BWDD 1N6PA 3QF7A 2H57A 1P2SA 1XU4A 4RZ2A 1KNQA 1RE0A 2PMKA 4XVUA 2J9RA 2QMHA 4P32A 1SGWA 2BMJA 3U5ZB 4UQOA 3BC1A 3I73A 2JCSA 3AB3A 3FMPB 2QG6A 2FV8A 2F1IA 2UVQA 1F60A 4AYTA 3ZVLA 3V00A 4BZQA 1BYUA 3TSOA 1G3RA 2JDID 3M0EA 2BEJA 3CNNA 4FWIB 4GT1A 1P9NA 4JLJA 1FQKA 3HP1A 3KQKA 1D8TA 1GKIA 1GRQA 3R7WA 2CL6X 3IQXA 1G5TA 1OXUA 1YR9A 2B7CA 2GETA 2ZROA 3R9IA 4ESVA 3T5DA 2V3CC 4RD3A 3MLEA 1II0A 2PX0A 4IEEA 4KAXA 3Q7QA 1OXTA 5DIFA 1KHTA 2CHGA 2DBYA 3FB4A 3P4YA 4OK6A 5HPYB 2ATVA 2ZETA 4TZ6A 2JJ1D 1Z29A 4BASA 3HJNA 4N0DA 1MABB 4RZ3A 4I1UA 3BH0A 2ZJ8A 2ZVQX 4MRVA 3AGPA 4EDHA 4PSKA 4RD6A 1NG1A 3LW7A 2HCJB 4HUQB 4OI2A 4QBFA 4JLPA 1CRPA 2J0UB 1GKUB 2IF0A 2CNWA 2OO7A 4LPSA 4M21A 3RC8A 3UG7A 1DAIA 3VR2A 5JMTA 1UFQA 3X1XA 1C1YA 3QF4B 1ZAKA 2GAOA 5CM9C 4MITA 1ZIPA 1I4TD 2W00A 2IHYA 4TMTA 4B6EA 1V5WA 2MSDB 5JHGB 5AJXA 1N2CE 4L16A 2DHRA 2IHBA 3RS0A 3AM1A 1J7KA 3GLIB 4DLXA 2H1LA 3K9NA 1IM2A 1KO1A 2NOAA 1KDTA 3B5JA 3VQTA 3G82C 1BKDR 2F1HA 3W6PA 4OJQA 4DT1B 3B1YA 1IOZA 3LD9A 1XTRA 3NBYC 4V0ME 5FL7A 1DAMA 2N1BA 3OZXA 4JLKA 1I2DA 1AZTA 3CLVA 1ZM4A 2O8BB 3GCGA 5CM8B 4LJYA 3GEIA 3VTKA 2YWFA 1A4RA 3A1VA 1VIYA 3X1YA 2RGNC 2ZUBA 1G7TA 3HPQA 3V4FA 1WE2A 3LRPA 2W2TA 4Q47A 5ELXA 4TYNA 3RHFA 1FNNA 5IRCD 4UKDA 4B76A 4P3YA 2G3YA 3VR4A 1VECA 2DWOA 5G40A 1FP7A 1NP6A 3PUVA 5FUXA 2YOHA 1VYUA 4KLZA 3CONA 1T4GA 2FEMA 2O8CA 2OAQ1 3CX6A 1VIAA 2OZEA 4OI1A 1H8ED 2G1JA 3NBZC 1JPJA 1XF9A 3OEED 5EUMA 2R62A 1KSHA 1CJTC 4CZ2A 1Q21A 4EPYA 2WMNB 1TPZA 2F43A 4TMWA 5C1BA 4JT2A 4MUAA 4TTRA 3UG6A 4ITRC 5F3WB 4TYWA 4B2IA 2JIZA 3AF4A 1ZNZA 4DCTA 2A7QA 1W0JD 1TQ6A 4S35A 1BH2A 5P21A 1XTSA 1Z0JA 3THOA 5DYGA 2J0SA 2VSXA 1H65A 4O3MA 1T0HB 2NPFA 1FPMA 2KSQA 3TE6A 3K0CA 5FTJA 1WMSA 3ZIAA 4MKFA 1T6NA 2F3RA 2EFHB 3JZAA 4EPWA 2VHTA 3BXZA 4X8HA 3QBTA 3K09A 1TAGA 4K46A 4P33A 3EC1A 1LVGA 2BKEA 5FTKA 3QKRA 1CF4A 3EA5A 4ZDKA 1W4RA 2ZS7A 2DPXA 2XJ4A 4JKYA 4V0OA 1RRGA 1E2FA 3KB1A 3REGA 3ASZA 3I1FA 4Q9JA 4LV5B 3CNLA 1E1QD 3T12A 4Z1MD 1EWRA 3WMFA 3GJ8A 3LO5A 4QBIA 3S1AA 3AF1A 3MGCA 2BMDA 1HT1E 3KQNA 1X1RA 3F8TA 2W6JD 5GJVC 4YMUA 1SKYE 5IK2D 4NPHA 2IYVA 3QXHA 4H1VA 2ZSAA 3EIEA 4KI0A 3MCAA 4ACAA 4FWTA 3REFA 2Q0HA 3ADDA 2ZTSA 3KXKA 1DPFA 2GCOB 2Y8EA 4LJ7A 2D06A 2PCJA 1P9RA 4V03A 2QPAA 2F1RA 4AD8A 4BFWA 5AR1A 5EE0A 4Q9LA 3B60A 4LBWA 3NKVA 2O8EA 4I1SA 4HLCA 4O25A 3PV0A 4M1WA 4RFSA 2XTMA 4XSGA 1ZU5A 1DBSA 1FTNA 4GI7A 4N0EA 3IEVA 2B6HA 3P32A 1OFHA 4LGMA 4F4IA 1MRNA 1SVIA 4Q4HB 1R5OA 1HQYE 3EZ9A 1E9AA 1N6LA 2ZYTX 3PR1A 1OFUX 3OF5A 4BEJA 3GJ6A 4FN5A 5IF9A 3CB4A 2HLDD 5BN5A 1Z0DA 1PLLA 4MRNA 2PEYA 1T5IA 3FPAA 2OLKA 1E1RD 4YDHB 3THWB 1W2GA 4RZXA 1NMZA 1AGPA 2VHJA 5AUPB 4JSTA 2Z4SA 4NYJQ 4Q21A 4B3DA 2HV8A 1FFHA 3B82A 3AF0A 3U3JA 1G8YA 4A0HA 1W5SA 2GJKA 3K70C 3NTUA 4Q03A 1CJUC 4HAXA 1KI6B 3JVVA 3T61A 2H7VA 1GDDA 3QF4A 3I61A 1YR7A 2LKDA 4Q4HA 3B1VA 5FPSA 2NTYC 4KITB 3KJHA 4D4MA 2EFGA 1ZM2A 2ZM5A 1IN7A 3BFKA 1U0JA 3KL4A 1U99A 1JB1A 4KJZA 5EXPA 5J4VA 1G5RA 1E4VA 4HSEA 4NYMQ 4NMMA 1X1SA 1W4AA 1OYWA 2J7PD 2ZRMA 3BIFA 3QBVA 4IOMA 4FMCB 2QPOA 4OHVA 4RFVA 2ZI5A 2FDCA 1M7GA 1ZUNB 2DFTA 3FKQA 3WBJA 3OEHD 3B9QA 1ZNWA 1G5PA 2DB3A 1LB1B 2C99A 3KXLA 5LBIA 1II8A 1GFIA 1U8ZA 1VKJA 2CEAA 1S1CA 3QNUA 3TAHA 4B44A 4B75A 2QI9C 3E2IA 2YWHA 1ZCBA 4QJ3A 4J0QA 3RNLA 2D3WA 4V0KA 3DVLA 2ZYWX 4F38A 4G5GA 1G21E 5EXSA 2E87A 4X8MA 4Z1MA 2X1VA 1BOFA 1EFRD 1W0KD 2OFXA 3P4XA 3RS7A 2GHIA 2FPMA 1I4LD 3SJBA 5C2JB 1P73A 5JJIA 1WCV1 3PEUA 2GXQA 4Q7LA 4IOKA 4QXAA 5F2EA 5FR2A 4TQAA 5B64A 3EZFA 4XWKA 1M6NA 3QXXA 5DSZA 4FCVA 1S3GA 2ZJOA 5AUNB 3BH6A 2A3RA 4URZR 5JSZB 3M1IA 1NLZA 1OHHA 3ZIAD 2JLWA 3SQXA 2CDNA 3A8TA 3LBHA 5JEEA 2BKUA 2IBMA 2OBMA 4D81A 2F43B 4MGIR 1QHYA 5EP3A 2V54A 2R6DA 3GLHE 1NVWQ 1NVVQ 2VTKA 4A8JB 1E96A 3U61B 4Q5IA 1BYIA 3K70D 1NMXA 3T06B 4C2TA 3GLFA 2ZIAA 5DNYB 2WVJA 5K8UA 1XCMA 3RLFA 2IWRA 3SJZA 4ARZB 4F4CA 2ANCA 2ATXA 1NLFA 3UPUA 3EPLA 3I3SR 4HZUA 5LD2B 3ZYCA 3WYFA 4CRWB 2OEPA 4QRHA 3A58B 3FMOB 4C7OB 1K8RA 1QBKC 2V55B 4RVCA 1X8LA 4BFVA 3I8SA 1MOZA 4M9SA 1W7AA 4JIMA 3LBIA 4E22A 2REOA 3SFVA 1J2JA 4DLSA 4UXIA 4D0NA 2HDNB 4K81B 4QJ5A 1X86B 5ANRB 1WXQA 2GEDA 2W6ID 4LJ8A 4TWZA 3VHLB 3CRQA 1UPTA 2FGKA 4Q9HA 1CKEA 3ICEA 2NO9A 2Z6VA 3I4LA 1F2UA 3QEOA 2CJWB 2NMVA 4KV9A 4PQFA 4QHTA 4QG7A 4HB4A 1UBGA 4A2PA 4ASUA 1X6VA 2IA5A 1DAEA 4ZPXA 2UKDA 3PCRB 4JLMA 2W6JA 5JWOA 2Z0MA 2QL6A 1X8JA 2IK8A 4BLTA 3CPHA 3EZ6A 3P20A 4HZUB 4NKRA 4IDPA 3U3OA 3N5CA 1ZRHA 4CYMA 2W2XA 1OIVA 2QAGC 1UEIA 1ZD8A 1AS3A 2GJSA 4FD2A 4LZZA 4LYAA 4NCJA 2CCJA 5JLJA 3CF6R 1XZPA 4KYUA 1IN5A 3EW9A 3FDIA 3HYRA 1MO6A 4NCNA 1TUEA 4DKXA 1BIFA 4ILEA 3W34A 4DRZA 3EIHA 1HE8B 3AP2A 1KZGB 2CMKA 2OHFA 3FWYA 3QKUA 1NBMA 2GZHA 4G5OA 5SZHB 3U3MA 2V8OA 4XD7A 2ZRAA 3UMRA 4PHGA 1G291 3U4QA 1XJ0A 4HLUA 3C16C 3LX5A 4TMZA 4C0LA 5EJEA 1LF5A 1IXRC 2G88A 2YVUA 4W5WA 3SU8A 3A1WA 3WXMA 1IBRA 2HXSA 4HDQB 4Q19A 4PPGA 2OBNA 1MABA 1IONA 1Q3TA 1KDPA 2XNDD 3FFAA 4HB0A 4KFUA 4LX0A 4LJAA 3NVAA 4PO1A 1RIFA 1KI2A 4GNKA 4PHFA 4PO8A 4YMVA 3WRYC 4GSYA 2H8KA 4O2LA 3I5XA 2J0UA 4AC9A 2IF2A 1TUIA 1G18A 1CRQA 1CJMA 4MRSA 4AG5A 3GLFE 1MR3F 4MKHA 3D8BA 1GVNB 3C15C 1E2NA 4LV6A 4FINA 1FMLA 4I1VA 2VLIA 1HT2E 5SZJA 2O5VA 3EASA 3ZQJA 2G1KA 2B21A 4GOKA 2O8FA 1LNZA 2NIPA 1VMAA 3SDZA 3A36A 1VTKA 2XJ9A 3N2IA 1GKYA 3QQ5A 1Q3HA 421PA 3CPJB 4GPTA 1D9ZA 4QHYA 5AUQA 2JJ2A 3O47A 2HEIA 4QBHA 3VFDA 5FPKA 3GLIA 2JJ1A 2D74A 2QP3A 1AS2A 2FEOA 2JDIA 1Q0UA 4WBSA 5FOVA 3CX8A 3RS3A 4YMSA 1NRJB 5DISB 4DT1A 2LKCA 1E2LA 2GA8A 3U3RA 2IS2A 1G7RA 4QKQA 2GTPA 1HURA 4DB2A 1IJEA 2PH1A 1MV5A 4IFBA 1U9IA 1E9SA 2AX4A 4DDTA 3TQFA 4DXAA 1NG9A 1US8A 4LHVA 4M1OA 1O3YA 5JRJA 3TIFA 2YZ2A 3M6AA 2VF7A 3R8FA 1SQ5A 3PENA 3CF0A 3KKPA 5J5CA 4UNNA 1RFLA 2NO0A 1E0SA 2GEUA 2YNMA 3IIKA 2QSZA 1XEWY 2RGDA 4CGZA 3TRFA 3KDSE 5TXGA 2C2HA 4H9GA 3CRRA 4JLBA 2WMOB 2C5LA 4NCHA 5KDLA 2I4IA 2QM8A 2IYTA 1KJYA 2A5FA 5DYIA 4X8OA 2W6IA 2XB2A 3SNHA 1W5TA 4TL8A 1P72A 3W6OA 1AS0A 4LYFA 1XMVA 1G19A 2QTHA 5JFGA 2IW3A 2JJ8A 2ZRNA 1XXHB 3P27A 2ZI3A 1A1VA 2GZAA 3CO5A 3K53A 3QKSA 2JASA 4EJSB 2CLCX 1SXJA 1R6BX 4NP6A 1KKLA 2PT5A 2IEZA 2PJZA 1OHHD 2OXCA 4KCGA 3R9WA 121PA 4UXJA 2K5UA 1GILA 2F3TA 2VP2A 4O2RA 3TVDA 2FX3A 4TYYA 4IVQA 3L0SA 3ZZUA 4RKFA 1P2TA 1P2VA 3AH8A 4A92A 4OK3A 2C9CA 5JI2E 3EIQA 1FQJA 4PANA 3BB4A 3QXSA 1N6KA 2WOOA 4P4SB 3VX4A 5FI1B 2BHRA 3AVQA 1E79D 1XBTA 4EQ6B 5F9HA 3GJ4A 3QE0A 1Z47A 1KNXA 1GL6A 3FKSA 2C95A 4EPVA 5L3SB 2GJ9A 1CJVC 5FOSA 3QXCA 4IKEA 1Q12A 1RYHA 2KBFA 5DGXA 5H1YA 2GXSA 3W6NA 1S3SA 4IDQA 2OLJA 3DPUA 4BLQA 1E2PA 2QUZA 4Q02A 4KHZA 4TSFD 2CL0X 4Q9KA 2EQBA 3KJGA 3UIEA 1DAHA 1EFRA 1W0KA 4U02A 4DWJA 3GLGA 1E2HA 1N3BA 1S9HA 2XTZA 5G41A 3U2QA 2OXRA 3W8NA 1LS1A 2LCFA 1DADA 1JR3A 5J4HA 3SBDA 5GADl 2QBYA 1PJRA 2QP9X 2HT1A 1SVWA 2QMOA 3AF3A 4EJSC 1U94A 3TUZC 2CK3D 2IL1A 3RS5A 621PA 5CJPA 3TMKA 2H5EA 3LX8A 3A37A 3K0CC 2O0KA 5HE8A 2GCNA 3K70B 1WA5A 2WM9B 3TQCA 1AKEA 1W48A 4W9MC 4OQFA 4DLTA 1DO2A 4B35A 2G0NA 2NO1A 1E1RA 5FFMA 3P1JA 4TL9A 5H70A 1R0ZA 1KK0A 4HB2A 3MFYA 3A4MA 3CH4B 1F5NA 2ZJBA 1FNMA 4IXMA 2A78A 2A5DA 2OSBA 1K5DA 5BN4A 2RMKA 1TMKA 4IOLA 4ABYA 2GVDC 3ADCA 5KNBA 1G17A 3MWJA 4NYJR 1Q1QA 2AD5A 2VHCA 4LRWA 1YZGA 1Z07A 3CF2A 2CCKA 2GNOA 2QE7D 3GFTA 5B30A 1RRCA 1ZINA 1FOEB 2FFAA 4HYYA 2R9VA 2CBZA 3CKLA 3QENA 1DAGA 1XCPA 1XP8A 2IUSA 2V7QA 3SFZA 3I72A 3ZVNA 1Z06A 2FFHA 1XMSA 4BFUA 5TARA 4C4PA 2O8DA 1G3IA 2O0JA 2J87A 3K0FA 5GJWC 3KJIA 3BB1A 3CUEF 1JQLB 1LF0A 4DCNA 4HUTA 4B3XA 1XNJA 3H2YA 1KKMA 3IPXA 4G1UC 3UANA 2KJQA 5IHPA 8OHMA 1AZSC 3B8HA 4F4JA 1TL7C 1YE8A 1TF7A 2AKYA 1I2MA 1OKKA 3OEHA 4D4KA 4GP6A 4L15A 4PSVA 4RD0A 2BVNA 2FMXA 3NH9A 4ZIRA 3PUYA 1TX4B 4TN1A 1SZPA 4LC1A 3U7HB 2SHKA 4GBMA 2J7PA 1E1QA 1LS6A 2G0TA 2YOFA 1U0HC 2B92A 1IN6A 3BD9A 4A36A 4BFTA 2HJVA 2Q3FA 2C9YA 4KBGA 2WWXA 2NGRA 5L3QB 5L3QA 1G4AE 2RB4A 4D82A 1G8FA 1H8HD 3QJYA 1OLOA 2GXAA 3LXRA 4DSNA 1KDRA 1UDXA 1XCGB 1IY1A 2DWQA 2YWEA 3O8DA 4Q4AA 3U44B 1UKEA 2QY9A 4LPKA 1UAAA 4FMDF 4ZKDA 2J1LA 4E09A 4PXAA 3RYTC 5CITA 3RRMA 1N6OA 2PBRA 2GK7A 1E9DA 3T1TA 3U6KA 1GRRA 1XRJA 1CBUA 1CTQA 4Q1CA 3I32A 1E2DA 2GJAA 4BZXA 3FMIA 3RRNA 4B32A 1XJQA 2ZU0C 2GRJA 2RGCA 2HXYA 1YRBA 4M9QA 4A6XA 4DIEA 2YHSA 2ZANA 4IFEA 5JHHB 3ASYA 1SKYB 4UNSA 2R2AA 1XTKA 3A4NA 1GNRA 4V0NA 4A0GA 1Z0IA 2ZJYA 3L43A 1DAKA 1R10A 2J3EA 2O8CB 4DBLC 4QL3A 1U81A 3PIRA 5DH9A 4UNRA 2Z4RA 3AUYA 3WNCA 4BLRA 1B23P 4NBSA 3T5GA 4WXRA 3ZJYA 4GL2A 2CHVA 5IDVA 4R9UC 1M74A 1C4OA 1OE0A 2DWPA 2ZRFA 1P60A 3GLHA 2ZAMA 4HZIA 2BJWA 2ODBA 2VHQA 4FW9A 5EUQB 1QVRA 4NCKA 4HDOB 4FCTA 3A1UA 2HJGA 2X2FA 3UWKA 3ND9A 3RWOA 5G3YA 1ZU4A 2D4HA 3LFUA 4AK9A 1ONBA 2BIFA 1L7VC 4ZV4A 1YHNA 2XGJA 3ZD7A 4Z8XA 3GQBA 2XNSA 4G5SA 4M9XA 5FTLA 2MMGA 2IXGA 3RAPR 3QUSA 1ESMA 1QHSA 1KK1A 3AVYA 1DO0A 2QORA 4TMXA 2BBOA 5TY0A 2ZU6A 5JBQA 2QT0A 1EGAA 3GJ0A 1Z6YA 2D2FA 4RD2A 2EVWX 3CR7A 1G8HA 4V0MA 2H16A 3GLGB 3NG1A 2WSSA 3GJ7A 1IHUA 3FFBA 3HR8A 2V1XA 4DLRA 3GEEA 5FTNA 3L8ZA 5HCNA 2XSZD 3OFNA 4B48A 2ZYUX 1F3OA 1KO8A 4PHHA 4UNPA 1S2MA 4DSUA 4POAA 3JVUA 3IHLA 2P5TB 4B3GA 5DN6A 5KSOA 4FMCF 2JJ2D 4MYCA 4AWXA 4TMVA 1SXJD 2O52A 3QEJA 1Z2AA 2VP5A 3ADKA 1GNPA 3BFXA 4AIIA 5EP2A 2WWFA 4JLNA 4M9ZA 3PUZA 2FWRA 3U7FB 3OIUA 1MRSA 3U4QB 3RVBA 3K09C 3IBYA 4UXHA 5CB6A 3BERA 2XAUA 1W0JA 1CU1A 4US1R 3PEYA 2XOKD 3MJRA 5UKDA 1DVRA 2ODWA 3C4JA 1NSTA 1R0XA 1W2HA 2EYUA 2PT7A 3IHWA 2P2LA 5E4FA 3FHTA 2ZRBA 4L5BA 4TL7A 2WJJA 3BS4A 5C4GB 4KO8A 4B74A 2YWGA 4BUJA 3QPWA 2X19A 4URYR 2P5SA 4OHYA 2GCPA 5BXQC 3SYKA 1FUKA 4BFXA 3OE7A 2BV3A 2YC2C 4XVRA 4JVLA 4M0LA 3QG5A 4Q66C 3WMGA 2W58A 5FPTA 4OI0A 2J59A 3VMFA 4HAZA 2IYYA 1CIPA 2EFDB 3J81k 3UATA 1E9RA 1OYYA 4OK5A 3GJ5A 3HWSA 5FUYA 1N25A 2BM0A 1JBKA 2WPDD 2ZSDA 5CYOA 4B47A 2OT3B 3D3QA 5EZ6B 1BO6A 2B7BA 4TSFA 4DCSA 4Q4JA 2FSIA 4HB3A 3Q8XB 4JJZA 4D80A 3T34A 5BN3A 2QTVB 4KYIB 1KMHB 1E2MA 4BFYA 3FOZA 4HAVA 2WWIA 2ERXA 3DZ8A 4IHQA 2FZ4A 2QU8A 3GMTA 1LW7A 4AKHA 1SVMA 3DOFA 4A2WA 3HR7A 4A8JC 1HY3A 1OXVA 4C0BA 1GL7A 2WV9A 1E2GA 721PA 3O8CA 3BOSA 4Z51A 1P3JA 1NN0A 2GF0A 4D4LA 1KIMA 5EP1A 5J4LA 3QIAA 1KAGA 4RJLA 1RZ3A 3BH7A 5JI3E 2AD1A 3TVTA 2AWNA 4WAUA 2NG1A 4IVPA 3SYLA 3MUFA 1XD8A 2QM7A 4PC7A 3IGFA 3RANA 1GWNA 1ZW6A 2JLUA 1XPUA 3ZZTA 4HAYA 2Z5FA 2LWIA 3FE2A 1GRNA 3L82B 2XXAA 1G3MA 2ZRJA 5FOXA 5HZKA 3QI2A 4TTQA 3MD0A 2I3BA 4H1UA 1VG1A 2ODNA 5DO9A 1JXOA 5A4JA 3KX2A 2CLDX 2BDTA 2RGXA 2HCBA 3LV8A 2A2ZA 1MKYA 1DS6A 4IW3B 4ON9A 4QC2A 1W36C 3Q3JB 2NO6A 3E5HA 3X1ZA 2BM1A 2XTNA 3EWSA 4V0LA 3EPHA 2ZQ5A 3MJHA 4HLQB 821PA 1DAFA 4M1KA 3LQQA 1Y3AA 2YJTD 2JAQA 2ZJZA 1WDTA 5TMPA 4P4TA 4R2IA 1QVAA 1MO4A 3PITA 5JEDA 2VP0A 5J47A 2JLZA 1OB5A 1F2TA 4MRRA 5JSZA 2QA5A 4DDVA 4LK2A 1XEXB 4JZKA 1NL3A 4AI6A 4M4SA 1NN5A 3ZDQA 1TQ2A 3VR5A 4B34A 3T15A 4PC6A 4C0HA 1P5ZB 1KI8A 2ZREA 1H8HA 1Z5ZA 3VHXA 1E0KA 1OB2A 1Z0FA 1COWD 3QXJA 2OCYC 2P6RA 2VYFA 4PAQA 1GIAA 3UMFA 5KSPA 3AV0B 2Q21A 4PO9A 4C0KA 4E5UA 1NVVR 1JALA 1QF9A 2OG2A 2XSZA 3OFND 5TV2A 2A9KA 4WIAA 1YVDA 4X8LA 3KQLA 4E03A 4D0GA 4MKIA 3F0TA 5FBQB 2FOLA 1ZM9A 4B6FA 2WSSD 3SR0A 5LB2A 2EYQA 4AYXA 4M1MA 1ZM7A 2VL7A 2WAYA 5FL3A 5KPDA 4M2LA 1G6HA 2HYDA 1OV4A 3AP1A 1HTWA 3PFIA 3Q7PA 4MGKR 3DMDA 2ECKA 5AWFC 2R8RA 3NDBB 4WZ6A 4QOSA 1N5LA 1KK3A 1RKBA 2QMUA 3AP3A 1T8TA 3VU9B 3UWOA 2FGJA 2OAP1 1Z0KA 2NQ2C 4JBYA 5DHAA 3ECCA 3CM0A 4KFSA 5JJKA 2HUPA 1G9XA 4BRUA 1KDOA 2JLXA 4EAQA 2RH5A 4KSBA 4OL0A 4P4UA 1IN4A 1IAQA 4OHWA 4DDUA 1Z8FA 4NDZA 2YC4C 3NXSA 1Z83A 3ZZ0A 4I1OA 3CWQA 3VKWA 4F91B 5KOYA 1CR2A 1QRAA 5EXTA 1EFHA 1AGRA 2VPPA 2GCOA 1KGDA 1FX0B 3WP0A 2GKSA 1SKQA 2QAJA 1EK0A 2ZI6A 1CR4A 3KXIA 1N6IA 4U5XA 3HDTA 1XEFA 5BQ5A 2J7KA 5AJWA 4NH0A 4PAOA 2ZI7A 3SN6A 3NBFA 1YU9A 2GVZC 1TEXA 1CEEA 3THWA 3TLXA 4DUGA 1N6HA 1Z6TA 4FI3C 4TLBA 4XTCS 1CR1A 2YOGA 3R9XA 4EFLA 4MGZR 4QM7A 3NHBA 2RKOA 4TLEA 4US0R 2FNAA 2G6BA 1M2OB 2OCPA 4JVMA 4JBWA 2IUUA 5AJYA 5CLLA 3BBPA 4Y0VA 1ZVQA 1KOFA 2FJUA 3IO5A 1RRFA 2FF7A 2ZRLA 1BS1A 3PG5A 4LHWA 1OFIA 3DL0A 4D2IA 1A2BA 4ASUD 2OUKA 1S8FA 2XZPA 1AM4D 2ZUCA 2RHDA 2ZRDA 2GAAA 1N0WA 1AJEA 1E94E 4PAMA 4QGHA 3RS4A 1DE0A 1PUIA 1Z0AA 5JRZA 4BE7B 4QGGA 1TQDA 4QFMA 2JEOA 4TLAA 4XWOA 2VP9A 3CRW1 1G7CA 2XITA 1T3HA 3HYTA 3TSZA 1W4CA 4C0SA 5KTYA 1UEJA 4DIDA 2WKRA 1N6NA 3U6BA 1G3QA 1DTSA 3H4MA 4DDWA 1SHKA 2Q9BA 5SZIA 3U44A 1AN0A 2GILA 2JLQA 2VO1A 4TZ0A 1KAOA 2P6NA 3CR8A 1CULC 1NBME 2WJYA 4OQXA 3ZVMA 3PXGA 1KI1A 3PEVA 3PVSA 4LJ4A 1HV8A 1YZKA 5EQTA 5FUWA 4IJMA 1JQJC 1X8KA 5EE5B 3LA6A 1VG8A 1U9IC
chains in the Genus database with same CATH superfamily
1EFVB 2GZDA 3PKJA 4MLPA 1B16A 2Y0PA 3AL2A 3NIFB 3L06A 1HOTA 4AJJA 3CFYA 1IZ8A 2ORYA 1DG1G 5KYKA 4RPLA 1JE1A 3CRZA 4D25A 2ZJ5A 1IYZA 4GMXA 5FKJA 4BN0A 3RJMA 3BMXA 2QQEA 1A5BB 2R7LA 2ODEA 2Z8YA 2D2VA 3KWMA 3OWHA 5IMSA 4FMBB 2GZ3A 4I9NA 4DQXA 1QFMA 3FYCA 3L84A 4J6FA 5LB4A 3D3KA 4KTVE 3SR3A 4F92B 2XVYA 4G24A 1OH5A 1N33B 2HNAA 4P83A 1WDWB 5GONF 5TB5A 5TQ0B 2C00A 2GBLA 1XB2A 3QEBZ 1YAHA 1XEXA 1YNOA 1DG3A 1D2GA 1NKTA 3OLWA 5FBLB 2PAFA 3FHLA 3E05A 1HYQA 4H15A 1XAGA 3UK6A 4G4SP 4BJ5A 2P9JA 1P75A 1E2EA 3NHZA 3T4UA 3V4RA 3QE9Y 3IUSA 1H4VB 4N6NA 3SE7A 4BRWA 1XZIA 5IASA 3HZOA 1L4LA 4LBYA 5IAAA 2IZ1A 1CUAA 1I4WA 5ALLA 2WDZA 3R20A 4OHZA 3RSSA 1QCYA 4YIKA 5CNIA 4FNOA 1KETA 1YL7A 2O8BA 3TAXA 2J3MA 3H2HA 4OM7A 1JKJB 3DOEA 3M6MD 3ZHXA 1LPMA 2LBPA 1X94A 2QVCA 2Q5LA 2RHHA 3OUTA 4CIDA 1GZSA 3VR3D 2Z95A 1I4EB 4DV1B 1MIOA 2FPUA 4KXMA 5JBNA 4JB3A 1MX3A 1FP6A 3DD5A 4AJEA 2G09A 1U7PA 3TLBA 5G0WA 4C43A 1YRLA 4GECA 3RYHA 3FSRA 1Q44A 3JYNA 4CG2A 1RD4A 2FR8A 3UUEA 2A57A 3LECA 2Q8NA 1Z4OA 2PX5A 1TAUA 3HDGA 1JECA 1WF3A 1XUOA 1FU4A 4FGUA 1N1GA 2ZSFA 3CLTC 1WX1A 4LZPA 1P4GA 3H5RA 1T8PA 2GWRA 2HPAA 2QMEA 1U8YA 3ISJA 4MDEA 1GZ5A 2J0QA 4PZYA 4C03A 3ONWA 1RSZA 4YT5A 1MB9A 2GLXA 4BYMA 1D7AA 3FKSD 4FYKA 2BN4A 1N7JA 4DCJA 1OWLA 3F2VA 4B73A 3BSFA 3JAKB 2YJGA 4LBVA 1CHNA 1M8JA 4MO9A 1OWPA 2O2EA 4IEIA 2R7NA 4N3GA 4XIGS 1K63A 3KPUA 2VRWA 1U3WA 4EA6A 4EENA 5FNVB 4Y1RA 1Z5OA 2DMRA 1V6SA 3EE6A 1HNWB 1JB9A 2BDUA 4PPQA 4XW2A 2LIVA 2MSLA 3BMOA 3AR6A 5CBPA 3AJ8A 3T0GA 5KMGB 2MINA 1JAIA 3N6VA 1P0QA 1U28A 2VRCD 2A9OA 3KZVA 4I8DA 4AO8A 3K0EA 1E2JA 2C78A 1UBFA 4N82A 1T9GS 2EDCA 1FLAA 3ESZA 3MILA 2I3ZA 4JD5A 1D8AA 2EWVA 3L8EA 3NM6B 4IXDA 5DI3A 1DQPA 1Z28A 4GLBA 1C8LA 2JFOA 4BTLA 2WUVA 4JVNA 2QSJA 4LOJA 1TEHA 3PFNA 2TMGA 4YIHA 1FFEA 3RT9A 1Z7GA 3COPA 3OURA 3FRHA 4IMIB 4JV5B 3FYUA 3DUWA 2VDQB 2XQGA 3IFSA 2G9NA 1RWWA 5I9LA 1SO8A 2FQQA 5AKEA 5ED0A 1X7WB 5T8KA 1RJ9B 1Y9EA 1B7GO 3ZDYB 2WIBA 4L07A 3FM9A 4P3NA 1YASA 3OBBA 3ZI7A 1O2DA 2WWVD 2PKCA 2A1UA 1NQOA 4L0QA 2M6LA 4MP6A 4OP2A 4CV0A 2NO7A 1YE3A 1GCUA 3BE5A 1R9JA 4YJ3A 1R9NA 4H6VA 1VMIA 2V6FA 4QLOA 4Z99A 1UBOS 1H2RS 1P7CA 4TYQA 3WIEA 5GZ1A 1SXQA 3GFOA 4W8HA 4EZIA 2D13A 3L7BA 3A26A 5IJ0B 2Q3EA 1ZLXA 2AYXA 4EUSA 1KRHA 3CLTD 4LF4B 4K86A 4KTTE 1EIWA 3OHMA 4RPIA 1HT0A 3OTWA 1F9AA 4UOZA 2Q2VA 1TF2A 1VSQA 1WZ2A 1AQ6A 4IH1A 4GLOA 1IOWA 3KPWA 5J40A 1PJQA 1F2VA 4UM7A 1VB5A 1L1FA 4U7WA 4EKIA 2FEAA 3IULA 1VHTA 4PLFA 5CLQA 5KDDA 3ZLJA 4AP5A 1F1JA 4Y6GB 1MB0A 3D4IA 2IH4A 3ON5A 3LG2A 4GM1A 3ZU2A 4HXGA 2H1WA 4REQA 1IB6A 1JHMA 5DHPA 1BA3A 1RCTE 3G7UA 1EVEA 2VF8A 4H7JA 2FSGA 1GZHB 2GWHA 3WMEA 3LL7A 3HCRA 1XMIA 2I55A 4N3NA 1DBQA 1Z6GA 4CE6A 2Y2UA 1VCNA 4WUTA 5HIAA 5K45A 3LCJA 3FX2A 3WSTA 5JECA 3ZWBA 1TU4A 2BW0A 2Y76A 3LHKA 3QV1A 4CLRB 3TG2A 4K8RB 2HJSA 1VDZA 5EC8A 2RGAA 2PQ2A 3KFLA 4FUTA 1I6LA 4NK5A 1UMDB 4MHSA 4DUPA 3DHWC 4B71A 1NVMB 1FSGA 4FYVA 1KSGA 4PZEA 1ONOA 2HRQA 1I14A 3OTQA 2C8VA 3IIMA 1N78A 1J8YF 3T1QA 2X4DA 1GJRA 1XDWA 3QKSB 3N0WA 1T6XA 4Z54A 5JCXA 1MC4A 2GCEA 5D7NA 1WJGA 4D9FA 2WWRA 3DULA 1ZIOA 2IYXA 4YT4A 1UKVY 4Q48A 1QGYA 1DUIA 4DEXA 1E7MA 3JWJA 2I91A 4HQKA 2Q3DA 4PC1A 1J56A 2RFLA 1T2CA 3DDCA 3RJZA 3T3DA 3DW1X 4C0AC 3A27A 4OD0A 1T9CA 2YZ7A 5LOVB 3L04A 3TO5A 3SS7X 1D5CA 3OICA 3ROPA 2IS4A 1Y5RA 2G63A 3I4FA 3GH3A 2BBSA 2NT3A 1YZFA 3R0XA 1NQTA 1HA3A 1DNPA 1UQUA 4I3FA 2BELA 1KI4A 1XALA 2VPXA 3PC6A 1BEZA 1QDEA 2QAGB 2R8EA 2HMUA 2W22A 4XRRA 1YXMA 1IVSA 1NYQA 2ZSEA 1V5GA 1TCAA 1NI3A 3NEAA 4YCSA 4JYBA 2FFQA 4NARA 1E3LA 5A3RA 4OB6A 1WKBA 2WT9A 3CV3A 2YCLA 2ZT6A 1NBHA 2F2TA 3T7EA 3TH5A 3BJMA 2XE6A 4K6HA 4D97A 3AFOA 4RA9A 5JAPA 4NQRA 2A92A 1LFDB 3D54D 2QVYX 4O2AF 1HE4A 4D8VA 2HF2A 2C31A 3SVLA 1CUYA 2HCTA 3K70C 2XVZA 5J1TB 4I14A 3OLVA 4CLHA 2FOIA 5D1NA 5IKOA 1U2ZA 3O03A 1VMEA 2IYLD 1CDZA 4OHRA 5FI0B 1DQYA 5FOTA 1PJLA 2JLVA 3GDGA 3Q6IA 1RBQA 2X77A 1E4EA 2YYSA 2ZZKA 1UZUA 16PKA 4I4NA 4J7CA 2D2EA 4BPBA 2C7RA 1BXGA 3DM9B 1JVBA 2Y1KA 1QQBA 3I01M 4GKBA 1HLFA 1FSPA 5AD1A 4YAIA 1GZUA 3Q9LA 4QODA 4DLVA 1P0CA 5AVTA 2I7TA 4BVAA 4LF6B 1R0YA 5FA6A 1QSGA 4PYRA 3NDJA 1Z5NA 3AIOA 3MGBA 3D4LA 3GRRA 3ASUA 4DWWA 3IT3A 4RY2A 5JCZA 2ZRGA 4KKXB 2G83A 3S5JA 4LDNA 3WQQA 3BT7A 3H19A 4L76A 4UD6A 4CI9A 4HFRA 2G17A 2AJ8A 5BYKA 4QO8A 4C14A 3DZCA 5EWLB 2PXXA 3QU4A 2O3SA 4K87A 2X9LA 3OZFA 4P5DA 3NS7A 4G8JA 3DHNA 1ZP6A 3FNEA 2OB2A 2P77A 4I2VA 2W42A 4ZO4A 2ZSUA 2B94A 3JARA 2PMEA 4KMMA 3UWPA 1VYTA 4IJKA 4U2KA 4E46A 5LZ8A 3Q2OA 4WXMA 4NYIR 5HUJA 2WJGA 2W2VA 4Y1RB 4NH4A 1XTTA 2R6AA 1N4DA 2J9XB 4V3BA 4MPPA 1ISIA 3HH8A 1WNFA 2C92A 1R8SA 1X1AA 3WRYA 3WWZA 3NBKA 1PUJA 4LSGA 3WGLA 5I01A 4TUYB 3IB6A 2E4VA 5JWRA 1V7ZA 2GZ1A 3B3GA 1QUEA 4YRQA 5KMGA 3CMMA 3K9CA 3K0SA 4HGNA 4UE6A 3OJEA 4J49A 1T8UA 3M5DA 2BHSA 4MNTA 3EEOA 1GV1A 4RIFA 4PC3A 4UREA 1V11A 1NQUA 1YIAA 3C6MA 3Q8LA 2BGMA 2HTFA 2JIRA 1O5IA 1H6CA 1EBBA 3FPGA 5I7EA 2J0VA 3MT7A 1T6ZA 2OQ2A 3K1TA 2Z5VA 4D4JA 3FTCA 4UJ3A 4YCJA 5BSMA 4YA6A 2CSUA 5ISMA 2OCIA 4ZCLA 3SHFA 1BE6A 4BU0A 1V2GA 1QFJA 4DIOA 1P1BA 3UVEA 3VU8A 4BLVA 5IXSA 1WS6A 2DFLA 2PNJA 2O8DB 4UZFA 2AQIA 1SCUB 3L1VA 2MSEB 1DJPA 2WG0A 1R6UA 1OXBB 4JC5A 4EVSA 3U56A 3G0DA 5FBVB 1M8FA 1RYMA 2I0FA 3AC0A 3QYPA 2O20A 3LQKA 4OHXA 1NQAO 5B2ZA 4DXDA 2ZITA 2FZVA 1TEVA 4R2HA 5D00A 2QVBA 4ZO9A 5H80A 3SSOA 1TMOA 4LY6A 1ZXXA 1V26A 3I42A 3AY6A 1T5BA 3OE1A 5KREA 2XCRB 1NVAA 1AQNA 1Y8AA 5E7MA 3DAPA 1UJ2A 1JPUA 5LPNA 1WXIA 5CX1A 4KGVA 2X8JA 4ZFNA 1DDGA 2OXTA 1M2KA 5K0BA 3KQHA 3HM2A 1ANKA 2RHRA 5LLSA 5THKA 4NMHA 5KX5A 4MI3A 1QRTA 1QUFA 1Y9DA 4FKMA 2ZTMA 5M2QA 2VAWA 1UP7A 3FBGA 3OCWA 4KO1S 4MR9A 4P98A 1Z6QA 5CFNA 1N2XA 1QYVA 2RAPA 3AUXA 3F6BX 1Q1GA 4JFRA 4TRNA 1KP3A 1Y7HA 4BNKA 3PHJA 4G8DA 2O3JA 4JCOA 3D2BA 3H2SA 3FRIA 1T29A 3HKCB 2J9ZB 1PHPA 2X8AA 4AY6A 4ZYXA 2IXEA 1JL3A 4DGQA 4CFYA 1OPXA 2OE2A 2R4QA 3OQ1A 2Q07A 3SIWA 2P2ZA 1UWVA 3LXXA 4TKLA 5EP4A 1Q5PA 1XZCA 4JP2A 1FDSA 3ROFA 1OV6A 4JA0A 1WUJS 4B46A 3BMCB 5TMDA 1OSNA 4Y0NA 1WEHA 4DYHA 2C2XA 1MDBA 2CMDA 4ZKEA 1X7YB 2QM0A 2B61A 4DG5A 2RGGA 4RAOA 3ENVA 2XBUA 3HGTA 5E4TA 1SY7A 2UUOA 2V7XA 3EHDA 4QEKA 2ZBGA 3STVA 3OMXA 3W8RA 5HJ2A 1PR0A 3M6FA 2ID4A 2O4UX 1A5TA 1Q1BA 5L3RA 2ZPTX 5AKXA 1UMCB 5D1HA 1FDIA 2IE8A 4AWBA 2ET6A 4B5LA 1S3FA 3H0KA 2EEPA 1P0IA 2WWGA 1N5OX 4MWZA 2PVCA 2JIQA 2Z83A 3NUZA 4JVSB 1VLJA 5HMLA 2R6JA 4OBXA 1O94A 1ZD4A 3R76A 2AMLA 3CJQA 4MLZA 4DMGA 5WRFA 3A6PC 4Q3DA 5SV2A 4GI5A 4BQEA 4Z9BA 2PO5A 1CVLA 3H2IA 4GMFA 3UGJA 1FCJA 4HEHA 1YRWA 1TM5E 1X7ZA 3OC6A 3WP1B 1JG7A 1C81A 1W88B 3ECAA 3HN6A 5KWJA 1RHQA 4MXDA 1S9DA 2V9CA 1XF1A 3CLSD 3OT4A 4KYVA 4OUDB 1BS9A 3ML1A 3OQVA 1W2WB 3EXIB 4QRDA 3DKPA 2XUAA 4G25A 1USKA 3O8LA 1YI1A 3ZY2A 4R1UA 3V7FA 5ADHA 3AVXA 1LEHA 4U9IS 1GFSA 1I1HA 4L6AA 3UM9A 3ZQKA 2ATIA 3C8MA 3C8ZA 4TQ9A 4AJ1A 1S4MA 2ST1A 3C41J 3OZDA 2FN8A 4HBGA 1OAKA 4LJSA 3WHLA 4Q37A 1W1IA 3FTFA 1DQNA 3PRJA 3HZHA 4D0RA 3NM5A 5BORA 4MVWA 1TADA 2W6OA 5A4MS 4W1PA 1OUMA 1NF8A 1SVUA 4WRRA 3V1MA 3PQ2A 5FEUA 3T3EA 3B6EA 1OBOA 1P44A 4CDGA 4BX0A 1EK5A 3T35A 3G9XA 3DCIA 3GZNB 3HA2A 3P9YA 4O63O 2QW0X 1G41A 1IXZA 1O4WA 1TUBB 1YBMA 2YV1A 3DH0A 4LOLA 2QBYB 4CFZA 1N5DA 3GG9A 1JR2A 3SOPA 1EGHA 4GG1A 3ZNOA 1QOPB 4ESHA 2Y2VA 3RROA 2NYAA 1JG2A 2OENG 4ZI3A 2VYVA 3IP3A 3LL4A 4KIFA 5A0VA 1TM1E 3DHEA 4OB7A 3ESYA 5EJ4A 1UBLS 3P19A 4EAAA 3FIJA 3INGA 5JMWA 2VHXA 1A9ZA 5DJ5A 2E37A 2QUAA 2QN1A 4XX0B 3QEMA 2DR2A 4WOPA 3GGSA 1B8UA 3O9VA 2D7DA 2O8EB 1RYZA 2PXAA 4OEHA 4XPIB 3WLEA 3KXDA 1UM8A 1H85A 1ZW1A 1T26A 4QLAA 2NSHA 3MWKA 1PN3A 4X44A 2NU9B 1SELA 3SEAA 5HNKA 1QV6A 3A4LA 3MHTA 3KD3A 1B6RA 1PSDA 1X14A 2EW8A 1X92A 2C3MA 4I9UA 4J0IA 4YYZA 3E3NA 3HSSA 1GTVA 1EP2B 2BWJA 4O29A 1UDBA 1YULA 3ZE1B 4E4TA 2MINB 3ZBTA 3F78A 1OXSC 3FTPA 2V97A 4YJFB 3S27A 4AIRA 1W35A 4W99A 6NULA 1E4OA 2QR2A 4IH4A 3A7EA 5FUBA 1MH9A 5HFJA 1XQ1A 3K0HA 4EHKA 3UTCA 3BL5A 5CDFA 4ZZ2A 2WPDA 3K9WA 2PZLA 3FZEA 4PR0A 4RPCA 2TMYA 3QPCA 1NVXQ 1TVKA 4LZJA 3OKPA 1PQYA 4YAEA 4YRJA 5JV5A 4OQNA 4XJXA 5HDQA 1Q0HA 3ZXXA 3KEMA 2JVKA 1T3ZA 5J59A 4G1VA 2JZOA 4B3CA 2CHFA 5EQDA 2O05A 3GL9A 4CKYA 4MWBA 3C3KA 1YIDA 1X7WA 2J4FA 2OFPA 1PJ8A 1XVVA 1FP1D 3E7WA 1DIRA 2B2CA 2WJWA 3KV3O 2VEDA 2W90A 3O93A 4MQ5A 5C8XA 2HJRA 2EZ8A 5C8YF 1B8NA 3VVBA 1L4GA 4XYLA 2PA3A 1PBTA 3O6VA 1XPOA 4LHEA 1JFLA 4Y8VA 5CH5A 3RFUA 3B1ZA 2PH7A 1JFFA 3RSOA 1N5MA 4RHUA 5C5EA 5KPJA 3UCXA 4NU0A 1POWA 4YRMA 1BCRB 1E2KA 3JR3A 1ONSA 1BMTA 3C6YA 3OG9A 4US2R 3EDRA 1T1EA 1SVOA 4F97A 4I8XA 4Y67A 3D5TA 4N3AA 5IW8A 1MT0A 3PLNA 2QNBA 1V95A 3W05A 1A27A 1P74A 3A3KA 3Q72A 1LA2A 1YNSA 1Z68A 4UBKA 2Q1XA 4XSHA 5CTAA 2WAXA 1NFFA 3UMCA 3GUVA 2LW7A 3I9MA 4M46A 1WKCA 2XKJE 1XXHE 3OIWA 1Q7GA 1PT9A 3Q7RA 3AB7A 3N2NA 4OAOA 2XXAB 3IBSA 5C46F 1VPLA 2VYND 4GM0A 4G9GA 1J2YA 1DL5A 4M49A 3I23A 4U7FA 3LDAA 1R16A 1VHJA 3EQ6A 3PGMA 3QFTA 2VNKA 4GP9A 4ZTUB 1R3DA 1Z3CA 3NIWA 4G41A 4RA6A 2SKEA 3LNCA 2ZIGA 3QSYA 5HUHA 2YY7A 3M9XA 4BLOA 2ZATA 1NJSA 1YZQA 2GLUA 1O77A 4YGXB 3VR1A 5IDXA 2VP6A 4J43A 4PLPA 1JHAA 1R4AA 1GZVA 1WD7A 5IBPA 3R9KA 3DAGA 3ACBA 2PL1A 3VA7A 4FHEA 3ITKA 3WMWA 4XVCA 3PHGA 1U0LA 3GUZA 2HAEA 1XK7A 5DTMA 1CX9B 3VBEA 1A0OA 1I36A 1T0PA 1ZMTA 4RK1A 4UAJA 1AKNA 1TU3A 4J2HA 3QKIA 1UC5B 1YA4A 2PZFA 5B58C 4QXQA 3JQ8B 3LGAA 3TN7A 1K6MA 2PT9A 1NPTO 3ILVA 1PYDA 1U3TA 1IY2A 2HRBA 1QK3A 3NNNA 2A5JA 4R31A 2PX3A 1AOXA 1F17A 2VBFA 4N6OA 1FB5A 4OP1A 1E0DA 2MDTA 3DKVA 4OSPA 3TEJA 2ZKLA 3FA2A 3WIVA 2BBWA 4O2AB 4B2YA 3GEDA 3OE7D 2WOJA 2WZCA 2XZOA 1PS9A 4OLJA 4D9CA 2DKFA 5JSYA 3G1UA 2N42A 3OFSA 4HXEB 4OH1A 1IXSB 1CF2O 2JLSA 5CB4B 5KVAA 2HWWA 2KB0A 3X1JA 4HTFB 2YWCA 3H2KA 4AZWA 1P6UA 4AY4A 2DWCA 1J00A 1I6KA 2ZJ3A 5KSYA 2Q5EA 3RRJA 1Z7YA 1N2EA 1PR6A 3C6ZA 4WECA 3KUDA 2QB5A 5JC1A 1ICEA 2IXTA 2AMYA 3MM4A 1NSYA 4QQ8A 1RXWA 1T9HA 4PZUA 3IAFA 3R7DA 3MERA 3KJEA 3CJTA 1VL2A 1ZJYA 2NTVA 2ES4A 2P7IA 1NW3A 2Y9PB 3H84A 4EGSA 5KQMA 2F1KA 1RAHA 3CN7A 2DXIA 3N8HA 1D4ZA 1Y33E 4X54A 3IAS6 1J8FA 1ZMXA 3JQ7A 4B3RB 3MG9A 4DW8A 4BQSA 1I01A 3C3EA 1J8MF 3D02A 3UPTA 2VHUA 3EGVA 1HFJA 6Q21A 1QH0A 3OZCA 5EHNA 1RM3A 5FPHA 3O1LA 1TW2A 3G6WA 3PC3A 4FYIA 4RHFA 4CIVA 1RYFA 2ZRIA 1EE1A 4B33A 3G59A 4BY9E 3DP9A 3H1FA 4HQOA 2UZ3A 1U5CA 1YK0A 2WFLA 3JTEA 4H7EA 4L4YA 1DMRA 4FNGA 4TTVA 3STXA 2PE5A 4DB4A 1ZOPA 4MVYA 5DP2A 5B6PA 2YV5A 3DFMA 1NNEA 1CS4C 2OESA 3EWNA 4FCCA 3V9PA 4ARBA 4CEIA 4XIYA 2AFIA 3U31A 5AXBA 3AVWA 2D54A 1GPDG 2JD1A 4JI8B 2R1TB 2FSVC 1T9BA 2M6RA 3NGLA 5DBFA 4ZRNA 1J70A 1G64A 3H9JA 3HSKA 2AXQA 3WV4A 4UHJA 3P9PA 3PQCA 2QTFA 2IS6A 2FPIB 5L3ZA 3IE0A 4Y2SA 1FFYA 1UZNA 3LZDA 2Q5FA 4RCYA 1JMVA 3DAFA 1UBKS 3DGEC 2VSOA 3NJ8A 1KFEB 2GPNA 4BB5A 2HV9A 1DKQA 4YHBA 1NY5A 4RXUA 2DWUA 3RD5A 2DEUA 4LRUA 2P65A 4YV2A 2FSPA 4II7A 1ADYA 1WCIB 2G82A 2XCUA 2XDQA 1HOXA 2WAOA 4RWEA 4RHXA 2BEUA 5D5PA 4HYTA 5H68A 1SG6A 5LA6F 1RVV1 3ZE7A 1K5PA 5KUTA 2VYVD 1RRKA 1S8AA 1ZZGA 2DSTA 1DQRA 2QD3A 2JFFA 4PIVA 1S02A 4EVIA 4MKXA 2Q99A 3RS2A 5KEIA 2JG3A 4U7DA 4NFSA 2V0NA 3SNKA 2QYOA 1O94C 3V8VA 1E0JA 2REBA 1I9CA 3VYRB 3UQZA 1C3LA 1YRHA 2GASA 1U0FA 2ZKIA 3ZHRA 2H92A 3GCXA 1E8NA 4HX5A 4YRIA 2PMCA 5FOWA 3LLSA 4AZ0A 3L8DA 4DUGD 4E5YA 2DY1A 4BCDA 1KVTA 1NY6A 1MP0A 4MV4A 4BEBA 3F73A 4CR6A 4G0NA 4A4DA 2QLNA 1L4NA 4PYMA 5IZCA 4IFIA 3K4HA 1V4BA 1Z73A 3A3YA 4RLQA 2XUZA 4F2DA 4NJOA 1MNAA 4OYYA 5B3AA 4B40A 3HVJA 1USUA 1D2AA 2RJOA 4BUZA 5CYGA 2C2MA 2NYUA 1VJDA 4JUAA 2YRXA 3K1JA 3L8MA 1NN1A 4COOA 5HJ5A 2H4YA 1FDUA 1T36B 4DIFA 4UCFA 2ZR7A 2Q49A 3PJEA 1E2QA 2G77B 1FBNA 1UJCA 3EWAA 1TTPB 4HN2A 2C7BA 3D6TB 3Q6MA 4YRFA 3ZD9A 4LI0A 2DBRA 3K0AB 1KO5A 4K1LA 1Q19A 4QDKA 1P5HA 1HC7A 5K8LA 3D6NB 1K75A 1LY1A 1E2BA 4CODB 1G16A 4WBXC 5HR5A 1CETA 3K2QA 4ZCQA 3QSGA 5B5SA 2A1TR 4TV9B 5DRTA 1OW3B 4O4LA 3PRYA 5J2TA 1EWQA 1NW4A 1A8UA 1ABFA 1EJBA 3IQEA 3ENZA 2WZBA 3FCEA 2GK3A 3CW8X 1FDTA 3CZAA 4WJZA 2W70A 4DNQA 3PJRA 1KO4A 1A7JA 1JFVA 5ICGA 1V25A 2H1CA 2WUFA 2CBGA 2HA4A 1LBEA 3OA2A 1TQ4A 4R8LA 3RE1A 4YJ2F 3T7DA 4KUGA 2QTLA 2F8LA 2OM6A 4GOMD 3IA2A 3QOXA 4B4VA 4FMDB 2I62A 1KERA 5FA5A 3HXKA 1VYVA 4LA4A 4OHFA 4BO5A 4OQDA 1XXHA 4NPCA 5B57C 2EW1A 2GJ8A 1UR5A 2EWMA 1RC0A 2YFKA 3AEQA 4KLCA 5EKUA 3TX6A 1R7RA 5C8DA 3F5QA 1RW4A 2C59A 5E1OA 2C7QA 1L4HA 4ETMA 2QU7A 3MAAC 3VPHA 4QM6A 3ETLA 1I3KA 2DFKB 1J9ZA 1FRNA 3VC7A 1EK6A 1KI9A 2OYCA 4PWYA 1GPUA 5GJCA 5JDCA 2WTUA 2VBCA 1VXRA 2V65A 2V5AA 4E4YA 8MHTA 4QFBA 1HMYA 2Q6IA 2R96A 5BWCA 3P26A 2VNSA 3JSXA 4RA6B 2BZ0A 2W2LD 3G5UA 2XT6A 3IIEA 3BMQB 1Q17A 3FBTA 1V6CA 2G28A 2VDOB 4HMOA 3TR5A 2YS6A 5F5NA 3SXUB 4Q1VA 5MFPA 3QKRB 4UUPA 5LYYA 5REQA 5JCJD 1DJMA 1GSHA 3KCNA 4LTDA 2WW8A 3IMEA 3C74A 5DHTA 3EXHC 1GKLA 2OBFA 1XD2A 1VBMA 2DU8A 4LWZA 3NAMA 4UUBA 2YW9A 1CQJA 2PWBA 5CMLA 2J41A 3KVOA 4OSOA 3WYCA 4EY6A 3PEEA 4OQLA 2PG3A 1VI6A 4QBGB 3S1AB 2MOKA 3OH8A 1E4YA 1OXMA 3UW1A 3ZVRA 4MLDA 4R7TA 1Y3HA 3AUSA 5FP0A 3WHKA 2UXDB 5KSWB 4L4UA 3V4PB 3A2NA 1KARA 3WDLA 3T9AA 1PEYA 1O8CA 2GF9A 1PS0A 1RZUA 1Z2OX 2JBHA 1NW6A 2IS1A 2R6GA 1FVXA 2Y1GA 4EUFA 3SDSA 2QIOA 4I19A 1YC5A 4LSMA 2PR7A 3EQZA 2YMPA 3HO8A 1LFAA 4EMUA 2PLAA 1EFTA 4XD2A 3ESCA 2C0QA 4JGIA 4WL0A 3DBIA 1HT3A 1YB6A 2VJAA 4OKIA 4A6DA 1D9XA 1TGVA 3SC3A 4IDNA 4ILKA 1QGUB 1NXTA 2RGWA 1P6XA 1C9MA 1N2CA 2FJ0A 2CJWA 1PRYA 1YDEA 2I34A 3PE4A 1X19A 4LRXA 5L6MB 3OZBA 3MRTA 1IC6A 3GDWA 4CM1A 2W2NA 4XCQA 1ZD5A 1OLSA 2XCSB 2H57A 1XU4A 1GU1A 1KNQA 1FP4B 1ZR2A 3EQ2A 3DGFC 3HKBA 4L75A 4GPIB 4MPRA 9MHTA 1C9EA 1RMTA 2QMHA 4P32A 3DL2A 3GFBA 2BMJA 5F4BA 4LF9B 3CUVA 3A9TA 2RH4A 3BC1A 4UQOA 5CFOA 1LWNA 3AB3A 4CIXA 5D3KA 6REQA 2UVQA 5CT9A 3QLJA 3NETA 4BZQA 3CRNA 4GT1A 4FWIB 4I9FA 1P9NA 1Y8QA 5COAA 4MJ3A 5I8PA 1FQKA 3HP1A 1SJ9A 1D8TA 3LT4A 4ENTA 2ZIFA 1Y82A 2FW0A 4K9PA 5FADA 4ESVA 1G5TA 1OXUA 2P68A 3CF4A 2XZDA 4LWPA 4FDLA 3R9IA 2QLMA 2Q1UA 1KU0A 1IULA 4BJ1A 2C7OA 3WIDA 4D3YA 2PX0A 3IAXA 2QUKA 1IL0A 4ZVKA 5LA6A 1OZ0A 3E1KA 1KHTA 2DBYA 3FB4A 3FYUB 2WD7B 3M89A 5HPYB 3FTNA 3I28A 4W5OA 1R6TA 1LD3A 2ZAGA 3NBAA 2NU8A 3WWOA 3RYCB 3T7RA 10MHA 5I47A 1ZVMA 4BASA 3RUCA 4I1UA 3WOVA 2NUTA 5M3BA 4EYSA 3C3DA 3P9XA 3WDSA 2C4HA 2BEVA 3KJQA 1H6AA 2HDWA 1CDEA 5HDBB 1JG1A 1GTL1 1HFWA 1P81A 5AVOA 1X8XA 2YX1A 3LW7A 4FOPA 5I7SA 1NR5A 1X1CA 4JLPA 3SOZA 1I5OA 1GKUB 2RHJA 3MCZA 3QW2A 4DIKA 2H0AA 4ICIA 3HADA 3ER9A 1AK9A 1ISSA 2HK9A 2AZ4A 1ZGZA 4KQHA 1JAXA 4CI0B 4CKWA 2QNIA 3UG7A 6ADHA 3VR2A 5JMTA 2AJCA 2EQ5A 3X1XA 4K6CA 3EZLA 2X9VA 4D9JA 3FG9A 1DX6A 4CIYA 3W2TA 5HJEA 3GRYA 3IYLW 2W00A 4FGLA 1RDFA 2QAIA 1ZRMA 2Q1SA 5JZMA 2BTOA 3HV0A 5ABPA 3S8EA 4DWVA 2VHEA 5AVRA 1TM4E 5IH3A 2GSDA 4YR9A 1R0LA 2CWDA 2G9RA 2DHRA 1ECCA 2EZUA 1NW9B 2A1TS 2IHBA 3F1KA 3IQZA 1K8ZB 2E4YA 3RS0A 5EWJA 3W2HA 4FFOA 4FW8A 2QJTA 2HA7A 1IM2A 1KO1A 2NOAA 2Y1DA 2PH5A 3JQFC 2ZDHA 1ZJWA 3Q3GE 3VQTA 2WVGA 1K4KA 2QHXA 2YVKA 3FWZA 5MFZA 2XAAA 1BKDR 2W4IA 3H7IA 3W6PA 3G8CA 4DT1B 3NB0A 3W4IA 5BP7A 5K3DA 4FK8A 3LD9A 1XTRA 4V0ME 5FL7A 3N28A 3O94A 3OZXA 1FMCA 1BCRA 2QJWA 4KYTA 2X7JA 3DOJA 1I2DA 3KOOA 4REOA 3CLVA 3ERCA 2GUGA 3ZU5A 3MJCA 3MT8A 1ABBA 4LJYA 5LZ2A 2YWFA 3AU9A 1PW7A 3Q1KA 4AZ3A 2ZUBA 3IP5A 3AMVA 3SS9X 1HZJA 4OFZA 3M83A 3L8GA 1CNEA 1RQPA 2ZWMA 1X2EA 4G9EA 3GRZA 3W06A 3EEFA 1YMVA 3OUUA 4JX8A 4UKDA 5IBQA 7MHTA 3GPIA 3VR4A 1DQSA 2DWOA 1UXHA 4TTAA 5G40A 1FP7A 3B38A 2C5EA 5FUXA 4D45A 1VYUA 3D8SA 3OT1B 2FEMA 4F2WA 2V45A 1SR8A 3S81A 5KYXB 5HRUA 1QPBA 5C7YA 3NBZC 3VHRA 1XF9A 3WIOA 1R66A 1RQRA 3KBOA 2IHTA 3JATB 3OEED 3X2EA 3C6BA 3OWXA 4NBUA 3PGXA 1EFDN 2HA6A 2IY7A 3ELYA 4Y6LA 5GY7A 1RI4A 2CXSA 2VJMB 3ICPA 4TMWA 4EPYA 1QP4A 4XQ9A 4FM9A 1EBUA 4HS9A 4LNHA 2EX1A 1I8TA 4TTRA 2I8CA 4MQEB 1VPDA 5F3WB 2EQAA 1U7OA 1JWAB 2A7QA 4GQIA 1D2CA 1TQ6A 4ZI5A 3TGWA 1NM5C 3GCZA 1NUUA 2EHJA 3ICVA 4ZA2A 4RQAA 2X9NA 2VSXA 2C5FA 2IGTA 3FPFA 4J94A 1T0HB 3I1JA 1FPMA 3WGJA 3CH6A 5JZBA 3SX2A 3RYHB 1QH8B 4NR0A 1EGMB 2QZZA 1SAYA 4KIWA 2IIBA 3BN3A 3CA8A 3K8ZA 5DX0A 3UK7A 4DUYB 3GAZA 3GDFA 1WMSA 4PRLA 5K99A 1HZZA 4RIIA 5JPIA 4ZQIA 2F3RA 4D56A 2NXNA 1U2DA 2FEKA 2O6HA 2H9AA 2Q46A 2VHTA 3JZAA 3LF1A 1XLWA 3U9SA 2OGZA 3TD2A 2I99A 4MMYB 3QKRA 2OC9A 3ETCA 4UHCA 5E0KB 2ZAIA 3F9IA 4GF5A 2SKCA 1UPXA 3UUFA 3T7SA 2ECOA 3ASZA 1NYTA 3DBHA 1XKQA 2AMVA 3QEAZ 2JA2A 1ILEA 3T12A 3RUEA 1SCIA 1N3YA 4X6UA 1GT6A 3GJ8A 3D7RA 3S1AA 3MGCA 4Y6RA 3VISA 4F3RA 1UANA 4YUVA 2X76A 1KF0A 2W6JD 1A76A 3EMDA 4RZIA 5HOEA 3OOYA 1XVAA 1UM9A 4HGOA 5BUQA 1O97C 3LT2A 4BO1A 3T5AA 3QNWA 1Q77A 3FNFA 4MW6A 1EUYA 3MCAA 2Z6QA 2YDXA 4L4XA 1Q0RA 4RTMA 4R54A 4D4HA 5B6IA 3ZGXA 1RCUA 1RLMA 1EFPA 2GCOB 2Y8EA 3LHFA 4RK5A 5ALPA 5AOAA 1FYFA 4KUHA 1PL8A 2JHAA 3PNVA 4RHCA 4GXTA 1VP3A 4BFWA 4GR9A 3W2GA 2AEMA 3TTTA 3UW3A 4BWGA 3A06A 4B82A 4YDRA 5KAMA 2FUKA 1L9KA 1PT6A 2FP4B 4LBWA 5BV8A 1TDJA 4CXMA 1OU4A 4O25A 4UBLA 3TSAA 2WU8A 1N9GA 5H59A 4J3NA 1WB5A 3A04A 3ESXA 3L7OA 2FQWA 1FTNA 4PPYA 3VKUA 1R3UA 4QYIA 4TUYA 1KBQA 2X3YA 3P32A 1IEWA 2JIDA 4F4IA 2G06A 1K1EA 3NW9A 4Q4HB 1R5OA 4TX1A 4UM9B 2OZKA 1NT2A 1ZXBA 1E9AA 5C37A 4CMAA 2OV6A 2Y1OA 4FDUA 5KTOA 1ZVVA 4TV8F 3LX6A 2YZKA 2BHLA 1Q0PA 2B1RA 2NSDA 4FN5A 5JO0A 5IF9A 3ANYB 3N0TA 4NESA 1MJHA 2GKOA 2W2LA 2WINI 1PLLA 3N8NA 2A9QA 4KQ1A 1O0CA 1T5IA 2B5VA 2IP2A 1STOA 1JU3A 2Q6KA 2H4ZA 2WUEA 5HMMA 3ZEAA 5CPFA 3V33A 2VHJA 4GYYA 3T7KA 3M1AA 1MQ8B 1FUYB 3U80A 1NYRA 4NYJQ 1WZCA 3U3JA 1JJBA 1CC1S 2FF5A 2Y4OA 3L6CA 4EB6B 5DASA 4HAXA 4EA9A 1KI6B 3T61A 2BMWA 3QF4A 3MPUA 1YR7A 1CP3A 2D1SA 4INAA 1KPIA 4GWLA 3G0BA 1EUQA 4D4MA 1SBNE 2EFGA 2ZM5A 4EEKA 1L7BA 4HP8A 1U8FO 4EG3A 1U99A 3NWBA 4LZNA 4Y2PA 4DGSA 1SU8A 1QH1A 3J80A 2JFUA 4F8EA 4WCFB 1E4VA 1U3UA 3FNBA 4HSEA 4IJ5A 2P9EA 4MTCA 6AT1A 3BSWA 5HKAA 2J7PD 1XYYA 4DV4B 3IAM6 4ZVPA 4AVYA 3ZU4A 4RFVA 5K0NA 2ZI5A 3OZIA 2JNWA 3FCOA 4I9GA 1ZUNB 4J6EA 2SKDA 3OLCX 2JI6A 3OEHD 3B9QA 4Q3LA 5JRDS 1IE3A 3G9QA 1SCJA 3IVXA 1LB1B 2C99A 5IHXA 2Z2XA 3MT9A 1OX4A 3UAZA 3CLRC 4CKZA 3PNSA 1S1CA 2MYPA 3H11B 3URKA 1W59A 1KFBB 1ZCBA 4QJ3A 3P2YA 1Y1LA 4OFBA 4S1VA 4AJ9A 3C7AA 4MS1B 2XB9A 4NICA