3GJ3A

Crystal structure of human rangdp-nup153znf2 complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
202
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 66
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj3A00
5C46F 5C18A 3NXSA 4DDWA 1U90A 3IEUA 3MG9A 1GL6A 1I2MA 2ZSDA 3B1WA 3X1YA 3GLGE 1W47A 4Q00A 5EE5B 3RS3A 3CLVA 1GITA 3IHLA 4Q18A 1ZUNB 1S8FA 1OXXK 3G5UA 2AKAB 1TTTA 1E3MA 3K1JA 5A0FA 1RJ9A 2AR7A 1EWRA 1WF3A 2GXQA 2OXRA 1EFHA 1XMIA 3N70A 4DLXA 3GP8A 1YZLA 1BOFA 1BH2A 1OFIA 2AD5A 1VCIA 2IXGA 1KNXA 1NF3A 3DPUA 1E9RA 2DFTA 3S1AA 1N5LA 1UBFA 1KOFA 4M1SA 1EGAA 4AIIA 1P2TA 421PA 5SZIA 4YXWD 3D31A 4NL4H 4BFZA 2O8DB 1R0XA 3RVBA 2F7SA 3I73A 2NQ2C 4C0AC 1Z83A 1KDRA 1K5DA 2GDJA 3IDQA 5JHGB 5JCPA 2AXPA 2ZAOA 3A1WA 4FMCF 2ZRLA 2UKDA 2XITA 4Q9JA 3H84A 3EZ9A 3V9PA 2K5UA 3K8YA 3MWYW 1JB1A 2XZPA 2EFEB 3EIHA 4E07A 4LCBA 2RHDA 3MCAA 4M1TA 2W00A 4LWZA 4DSOA 1KKLA 2G83A 3P4YA 4ILEA 3RABA 4ARZA 1P2UA 2BJVA 3TR0A 3O8CA 1QHHB 1DPFA 3GFTA 3NDBB 4HAWA 3ADDA 1XMJA 3QVVA 4OI1A 1P9NA 2W2VA 3VR3A 3W8RA 3RS2A 2R44A 1KI8A 4EPXA 3MUFA 1KSGA 3AVXA 1G8YA 2ZI9A 3AVPA 2ERYA 1R4AA 5BN4A 4A8JB 4LBWA 2WSSD 4V0OA 4IEIA 4OYHA 3TK1A 4QBGB 3W34A 1GTVA 2QI9C 1ZP6A 4YMWA 4FCTA 2GF9A 4HAUA 4C30A 4QKQA 2O8DA 5AUNB 2YOHA 1LS6A 4I1SA 4DIDA 2GF0A 2J87A 5EZ6B 1A1VA 1CIPA 5J5CA 5AJXA 3KXKA 1G20E 4TMXA 1YKSA 1NVUQ 3GFPA 4EJSB 5BXQC 4V03A 4XH9B 1AZSC 1KZ7B 3KL4A 2VRWA 4LJ9A 4F38A 3EARA 2AL7A 1UDXA 4KCGA 4BLTA 2DR3A 3NG1A 1S4QA 1QZXA 2GNOA 3LX8A 1KO7A 2J5XA 4P32A 3CIOA 3H0KA 2QBYA 1E98A 1OKKA 2IYRA 4HLDA 4B34A 4XSHA 1YVDA 1KZGB 2ZRJA 4KSBA 5KUTA 1PLLA 3ZYCA 5FBWB 4CT5A 4EIWA 1GRQA 1U0HC 4IOLA 4PANA 1E79A 4AKEA 1YRAA 5EXTA 3A58B 4KVAA 1XCPA 4GPTA 3T15A 4ASUD 3SQXA 5FTLA 2HYDA 1LB1B 4FI3C 4M9ZA 4NBSA 4BLPA 2GA8A 3LQRA 4P31A 4PQRA 2BIFA 1XXHB 2D2EA 2FU5C 4WW0A 3ZIAA 4F4JA 3T61A 1DE0A 3CW2A 4A15A 4JYBA 1UF9A 2ZVQX 2QMUA 4RD3A 2W0SA 3W90A 4GT1A 1FMLA 1VYUA 1N6HA 5F3WB 3VU9A 4M1KA 4A0RA 2ZJ8A 3K0AB 2F3RA 1DBSA 4B74A 1W36B 3PJRA 2UZ3A 1FOEB 4N0EA 4LJ8A 4MKIA 4MRSA 1XCMA 2BWJA 2ZEJA 2ZRGA 3QBVA 5EP2A 2V1XA 2DHRA 5JZVA 2FMXA 2VP0A 1E9AA 1JEDA 2ZE7A 3QVUA 4B2IA 4NE2A 1OH6A 1ZD1A 3ZS8A 2J0SA 5CDFA 2I4IA 1Z8FA 4B75A 4US0R 2P5SA 4PC6A 2FSIA 2XEXA 2ZI3A 4G5GA 4MITA 2ZJZA 3ASYA 1XZPA 1EXMA 1U0JA 4PSKA 4RD6A 4HLQB 3W5IA 3PV0A 3B1VA 2YINC 3CNNA 3QKSB 5IK2A 2A9KA 2HXSA 4U7DA 1Z08A 2CLSA 3B6EA 3IIJA 1KI7A 2QMHA 4AD8A 1E96A 2I1QA 1N3BA 4US1R 4LX0A 1NN0A 3LBIA 1NSTA 1ZIOA 1CXZA 4BZPA 4P3YA 4URWR 4NYJR 2WMNB 3DKVA 2QQEA 3EZFA 3LRPA 2ZUDA 4RCYA 1V5WA 2ZR7A 4LJ4A 2VP5A 2G3YA 2AFIE 4AYTA 3EG5A 3PVSA 4OKSA 4OQFA 2J7KA 3L82B 1IXZA 1NBMD 1Z3IX 3NC0C 5EP4A 3A1UA 4KBFA 1M1YE 3TLXA 1NG9A 4MGZR 3L43A 3NTUA 2ERXA 1UFQA 1W0JA 3EC2A 2FSGA 3VR6A 2YKGA 1SXJD 3EPKA 2ZS9A 3NEYA 4Q48A 5EXSA 3ZZ0A 5FTKA 4G1UC 5JCZA 1JR6A 2NO6A 3TIFA 3QXSA 3CF0A 4AG5A 3QPUA 2D7DA 2QG6A 1G7CA 4L16A 2EYQA 2FSHA 1FX0A 1NN5A 4HAYA 3NBZC 3O47A 1ETUA 1O3YA 3MGCA 1SQ5A 4Q4LA 5DN6A 1F2TA 2IYLD 2OSBA 1AN0A 2REXB 1XP8A 2R6FA 4KO8A 2ZS7A 1GRNA 4JBYA 4B3XA 1X8LA 2C96A 2WIBA 4DDVA 5HPYB 2OBNA 1E2GA 1P60A 2IS6A 4LBZA 2F9MA 2KE5A 4UNQA 2ZSAA 1G9XA 2Z83A 5FL7D 4B48A 2F43A 1JBKA 4DBLC 2Q9AA 2PEYA 5HCIA 4AKIA 2PZGA 1BO6A 3DZ8A 3QQ5A 4LYFA 1XD9A 2V55B 3VAAA 5AJZA 4ACBA 3IKJA 3ICQB 2ZYTX 4URYR 3GLIB 1ZRHA 3AF0A 3KKMA 4B35A 3ADCA 4CEIA 1P2SA 3C8UA 2IEYA 3P4XA 1F3OA 1N6OA 1U81A 2ZRKA 3KB1A 2PH1A 5FOXA 2GEDA 4JVLA 2V7QD 1W48A 4MRVA 5DYIA 2QAGB 3BERA 1CBUA 3BFXA 3FOZA 2VO1A 3MWJA 3EAQA 5KO2A 4L4UA 1T91A 1WCV1 2IUSA 4AWXA 3EASA 1E9CA 4NYMQ 1C9KA 4DUGA 2VHJA 2NO7A 2IT1A 2WM9B 3RRMA 2EFCB 4US2R 5E7IA 3FMIA 2FFAA 4IDHA 1X8KA 3LO5A 2EW1A 2PMKA 2AKYA 4UNPA 4JT2A 2C9CA 3U3KA 1ONBA 2QP3A 4IVRA 3ND9A 1SVLA 3U44B 1XEWY 4QHSA 4FCVA 1T4GA 4ZDKA 4IVPA 4TYPA 2ZUCA 4BQSA 3PENA 3F8TA 4GOXA 5DISB 3UKDA 2JEOA 5L3RA 3VHLB 1GKUB 4DLUA 4P33A 4ZDWA 4I81A 2CEAA 3KKNA 3ADKA 2OCBA 3L8YA 3CX7A 2F3TA 5EE3A 2W6ID 4DCNA 1KK1A 3VKWA 1WP9A 4B3GA 4B47A 4GRAA 2QAGA 1LF5A 3OFND 4X8OA 5UKDA 3VU9B 1IY1A 4M9XA 1UBCA 4CIDA 2WAYA 4BLRA 3KTAB 5KDLA 1T6NA 2CBZA 3FMPB 2OUKA 4IDOA 4PQFA 4YQFA 2WWHA 5DYGA 1KSJA 4WBSA 1JR3A 2P6NA 2G9NA 1P62B 3ND8A 3C7KA 4OI4A 3KZ1E 1LF0A 1ZM4A 3CX8A 4G3XA 2J0UA 5FPYA 1D9ZA 3QIAA 1UKEA 4L9WA 2QGNA 3JVUA 1QVRA 1NN3A 4BFWA 1W7AA 4LBVA 1VYTA 4TMVA 4Q7KA 4FMDB 1NMYA 4GBMA 4DDUA 3VKGA 1OV4A 5SZKB 2GWHA 1Z6TA 3QKSA 3NH6A 3TW8B 3TSWA 1R0ZA 3O8BA 1SVWA 4AY2A 2D06A 2P5TB 2X19A 5JFGA 4DLZA 3OAAA 2C95A 4GOJA 3QKRA 1KI6A 1XD2B 4W9MC 1KNQA 2GHIA 4OJKA 1BYUA 4QGAA 5LDDC 4W5JA 3W8NA 3IBYA 3N2IA 2H17A 2HF9A 3TE6A 5KDOA 2RGAA 1AGRA 2CHGA 3EWSA 3KTAA 1GAJA 5HR5A 3UXMA 4A9AA 5JS8A 1NVVQ 1P73A 2C9OA 1OH8A 2ZE6A 2OV2A 2QUZA 4U02A 5CB6A 3IQWA 3TJZA 5FPSA 4EKDA 1OXVA 4AK9A 3R9WA 1G8FA 2O52A 2WKQA 3M0EA 1S1MA 3BJIC 3BXZA 2YVUA 1FNMA 1QHHA 1RYHA 2IX3A 2Q9CA 4G5SA 4R9UC 3KQLA 5TV2A 2ZRCA 2FFBA 5AJVB 2J46A 2J0UB 2RGGA 4HI0E 3E1SA 3OEHD 4L8GA 2VPPA 4NCIA 5KSZA 3FHTA 2WHXA 4URZR 4XIGS 4Q1AA 1TL7C 4JSYA 5E95A 2GAAA 2R8RA 1ZNZA 3K70D 4M1WA 4Q7MB 4DB2A 4AKHA 2IYWA 4V0MA 4U00A 3K0SA 4BZQA 2GVZC 3PIRA 2QSZA 3G82C 4Q9IA 4QFMA 2VBCA 3AF4A 2BMEA 3AUYA 3B85A 4NU0A 4KVGA 4D4JA 1DOAA 1W0KA 3FVQA 1RRCA 1Z22A 1IY2A 1G4UR 4JYCA 3SJAA 2J9RA 2ZRFA 3IPYA 1X6VA 2VHQA 1ZVQA 4JL8A 3BH0A 5GADl 2JLXA 1TADA 1ZC3A 2OO7A 2BKUA 4CEJB 3T5GA 4MH0R 1CRQA 1W4AA 5KOYA 2JLVA 3TKLA 2FPLA 3N2EA 3TQCA 2VSXA 4D6PA 3GJ8A 4UXIA 1Q3TA 2QBYB 1KIMA 4F91B 1GVNB 1SHZA 3TMKA 5FTJA 4ZIRB 3LA6A 5JJLA 1KGDA 4GZMA 1NKSA 1IN5A 4MKHA 1CLUA 1LFDB 1SHKA 1G16A 3B78A 1F5NA 721PA 3A4MA 2OILA 1XBTA 1OYWA 2KBFA 1ZUIA 4TL8A 1OKKD 3RHFA 3AVVA 3DDCA 2VLIA 3ZZTA 1XXHA 1OFTA 4N1AA 4QM7A 3FYHA 1S3SA 4K46A 221PA 2OG2A 4D0GA 2GJKA 4DC9A 5AUPB 1IQPA 3T5DA 2PJZA 3PUWA 4BLQA 4B43A 1QRAA 2VTKA 1SVIA 1J2JA 2J0QA 4QC2A 3IUYA 1XF9A 1CULC 1KK3A 1N5KA 1NJFA 4TTPA 4IVQA 4P4TA 1GL9B 2GEVA 5BN5A 2A5GA 2XSZA 3AKEA 4V0ME 5CITA 4ZO4A 4XJXA 3V4RA 3WMFA 3B13B 5KSPA 5IRCD 1ZUHA 5BYJA 1HY3A 1FMJA 2REBA 1VHTA 1W44A 3RDPA 2J41A 3K0FB 4HZUA 2R9VA 3CBQA 5AK0A 2ZRAA 3LVQE 4Y0VA 5JEDA 1W4RA 2ZXUA 2WKPA 1S2MA 1Q1QA 4HUQA 1NVWQ 2ODNA 4TL7A 1GUAA 4JS0A 3ZD7A 4TQAA 2PBRA 4MGIR 4NYIQ 1GOTA 2Z6VA 1N5IA 4LYAA 2XAUA 3GJ7A 4MRRA 1II8B 2VEDA 4Q1DA 5CIWA 4AYWA 2R6GA 4URVR 3EWAA 1MABA 3CPEA 4X8LA 3E2IA 4E22A 3KQUA 5E3HA 4G01B 2IXEA 2AK2A 4H9GA 2YC4C 1J8YF 2X2EA 3B5JA 3UMSA 1G5RA 4PZYA 4BZXA 1NRJB 1M34E 4MYHA 1XPOA 2ZRNA 4JL6A 1KDOA 1LNZA 1UKVY 2WOOA 2LKDA 4TT3D 1P6XA 1UJ2A 1VG1A 4PO1A 2CLCX 1NLZA 2NOAA 1Z63A 1TF2A 3SR0A 1G8GA 4FW9A 2QE7D 1KHTA 5GJBA 1QHXA 2ORWA 4FWTA 1S1CA 1KO5A 3P27A 1A4RA 4RZXA 1DAIA 3G0HA 5IF9A 1V43A 3VKHA 2D74A 3ZS9A 1G6OA 2WOJA 4GSYA 4K8OA 2DFLA 1R0YA 2ATXA 2FFHA 3PQCA 3BH6A 4ZCLA 1A5TA 1T0HB 4BASA 4PPFA 4LHWA 1RW4A 1Z6XA 5EZ5A 1E2QA 2SHKA 3DL0A 1N6LA 4QBIA 2N1BA 4C4PA 1FPMA 3FMFA 3RNLA 5GJCA 3C14C 2QAJA 2XNSA 4EAQA 2O8EB 4URUR 4EQ6B 3S1AB 1M74A 4Q4HA 5AUQA 5E7JA 1T3SA 1I4LD 1A7JA 3AP2A 3QPWA 2VHTA 2VSFA 2GJAA 5TVKA 1W46A 4LHVA 3WNCA 1N2CE 3RS5A 3F0TA 4AI6A 821PA 3K09A 2BVNA 2OAQ1 1LV7A 1G1MA 4C0JA 5J4YA 1H65A 2YHSA 3U4QB 3RS7A 2Z43A 4KLNA 3KKPA 3CRRA 1J8MF 1I2DA 2ONKA 3NH9A 3UPUA 4ZV4A 2YYZA 1D6JA 2OBLA 2D7CA 2IK8A 3ONWA 1R6BX 3CB4A 1BKDR 1CR1A 1Q22A 1T3LA 2AHOA 4N0DA 4NDZA 1OFUX 4RCZA 1DEKA 1QBKC 3B1ZA 2YC2C 4Q4AA 5DGXA 1OIWA 3C4JA 3KUCA 5EP3A 3K9LA 2FPKA 3QXHA 4OHVA 2RGXA 5JWHA 5JLJA 2ZIAA 1XB2A 4KFSA 4A8JA 2VIIA 3AB3A 1X1RA 4BFTA 4DLTA 3ZIAD 5FOWA 1VG0B 2R62A 4OI0A 4ZI2A 5FOVA 2A5FA 3QUSA 3HPQA 1W36D 4JLDA 3WYAA 3DO6A 4LV8B 3WHKA 2HV8A 3SHWA 3WRXC 3THYA 1JQLB 4DLWA 3B8HA 4TYQA 3M6AA 1GFIA 1JAIA 5G40A 1T9HA 3OIUA 3VR2A 4EPVA 1A82A 1G3RA 3CR7A 4PAOA 4TQ9A 3CRQA 3Q5DA 4NYIR 1EFUA 3AVTA 1YZGA 1COWA 1GWNA 1ZNYA 2CK3D 4JKYA 3LAWA 3SYLA 3ETLA 3FE2A 3KX2A 4TTRA 3I61A 2XZOA 5DNYB 4LV5B 1KO1A 2YNMA 4MRPA 1OIVA 1P3JA 4A2PA 5C1BA 1KYIA 4PPGA 4HB4A 2NTYC 4PX9A 5TY0A 5FBRB 4LHZA 2QT0A 2FEOA 2EQBA 2OCYC 5EUMA 1XEFA 1L7VC 1ODFA 1E1QD 5CLLA 3R20A 2IW3A 1PUIA 4MGYR 2PT5A 1FX0B 2NPIA 2QRZA 2ZYVX 3EIEA 4NHOA 2LWIA 3MJRA 2JA1A 2JIZD 2NGRA 4KFUA 4CEHA 3TVTA 1WRBA 2NZJA 2O0HA 3WYGA 1SVKA 4WZ6A 2P3SA 3CPJB 2QY9A 3Q8XB 2CJWA 4JJKA 4LHYA 1ZU4A 4J0QA 4KSCA 5FBVB 2GKSA 1HURA 1RJ9B 1KI6B 1XD2A 4B2LA 5JECA 4W5HA 2CK3A 1XTKA 3KJIA 5GVRA 2DB3A 4JLJA 1LY1A 3TQFA 3RAPR 2OT3B 1KI4A 1YR6A 4LJ6A 2MMCA 4LJ5A 2B7BA 2ZROA 3CRMA 3SN6A 1Z06A 2BDTA 1VG8A 3L0SA 4QGGA 4JVSB 2IC5A 3FFAA 4NCHA 5FTNA 2FEMA 2P6UA 5CM8B 4Z51A 3AM1A 1QDEA 2XTNA 1PLJA 3AP1A 4RD1A 2NO1A 2Q3FA 1S9HA 2QGZA 1ZNWA 2WPDA 4R2IA 5CDFE 3BAFA 3PG5A 2D4HA 4OHYA 2OHFA 3SFVA 2B8TA 3ADBA 4D0NA 4C7OA 1BIFA 1UBGA 5J4KA 3HYTA 1NSFA 1G8PA 2AK3A 5J40A 4C2UA 3RC3A 1KY3A 1ZM3A 1ELOA 1E2IA 3EA5A 5J4VA 1F2UA 1E2MA 2YV5A 5CJPA 1XTJA 4FIDA 3Q7PA 1P9RA 3CUEF 4ACAA 4A1FA 4XTRA 3OF5A 4MUBA 1DO2A 3REGA 4HDOB 1CJVC 1R2QA 2R6CA 4MQBA 4TMKA 1ZYUA 1D2NA 2V54A 2IUUA 1YHNA 2RMKA 4W5WA 3HU1A 1XTRA 2CNWA 2CXXA 2VHCA 5B64A 5JBQA 1E2KA 4ZI3A 3ZDQA 3F5FA 1D5CA 4K81B 4L15A 5CYPA 4TLEA 4RD0A 2RCNA 3TUJC 1FUUA 4EQ6A 3GEIA 4M9QA 4EJSC 4PFSA 2CVHA 1J99A 1HQYE 5AJWA 3VQTA 2JLWA 2H1LA 4MKGA 4HAXA 4B73A 4YC7A 2BC9A 1E9SA 2P67A 1I4TD 1IBRA 4I4LA 4U5XA 5AR1A 1NIPA 3UG7A 1PZNA 5L3SB 3LD9A 1NY6A 3U7GA 5C4MA 3THWA 4KLZA 4IDNA 1FNNA 4RFSB 1QG4A 8OHMA 1Y63A 2VA8A 4M1OA 2QTVB 4QGFA 3FHCB 3QENA 3TGPA 1E2HA 1Z29A 2N42A 3AVQA 4BRUA 1HE1C 2RB4A 1SKQA 1U8YA 1MT0A 1P5ZB 4JT4A 2A30A 1U8ZA 1DTSA 4PR0A 4A82A 4AYXA 4TL9A 3EXAA 3SE0A 2JJ2D 2BHRA 3PUVA 5JEEA 2F43B 4CRWB 1AS0A 2OAP1 4B3FX 5JJIA 2FNAA 4LI0A 2DYKA 1YZUA 4CDGA 4ZKEA 4KITB 1Y3AA 4S35A 1MO6A 5GJVC 1W36C 2BBSA 2UVQA 1Z2AA 1A2KC 2YWEA 4IHQA 5DHFA 1GNRA 3QKRB 1Z6YA 1ZM2A 5FOTA 1F48A 5P21A 4ITRC 4LUCA 1TQ6A 2GXAA 1PUJA 3DM9B 2ZUBA 1ANKA 2GZHA 5EP1A 2CL7X 2P6RA 2HXYA 3KFVA 4YMTA 5JWOA 3GLFA 3ZJYA 4II7A 2ZJ2A 5TMPA 2O0JA 1KTVA 2ZETA 3O8DA 2ZI7A 1E0AA 1KI9A 3QPVA 2GZDA 5G53C 2BBTA 4QGHA 1LTQA 1NMXA 5EQTA 2Z4RA 3FKSD 5TDHA 4TYNA 1Z0FA 4ESVA 3W6NA 3PEYA 3SJZA 3UANA 4B76A 1KSFX 4W7SA 4EPRA 2ZJOA 4O2LA 4Q1BA 2O5VA 1VDZA 1JJVA 2GCNA 2FV8A 5H1YA 5B30A 2YJTD 1WMSA 2C99A 4NMMA 1IXSB 1EX6A 3K9NA 4H1UA 5KPDA 4A6XA 4JLVA 2C78A 1VCNA 3QKUA 1ZBDA 3I8XA 1JQJC 3ASZA 5G3YA 1FP6A 2CNWD 3P1JA 1FP7A 1MRSA 1TAGA 2QPOA 5LB4A 1G3MA 4OK6A 3RRNA 2XB4A 5BYKA 2W6JA 4TMZA 1TEXA 2UZIR 4R71A 2GJ8A 3AKYA 2FDCA 5CLQA 4UJ5A 1ZMXA 1P4SA 2W0MA 3V4FA 2B21A 1IAQA 1VCMA 3CWZA 4G0NA 4A0HA 1IN7A 1CTQA 5EJEA 2ZU0C 3EZ7A 3PUZA 2VYFA 4UQOA 2CVFA 3PCRB 1HE8B 1M6NA 2IYTA 5F2EA 3VNUA 3HR7A 4WVFA 1ZCAA 2CL6X 2PX3A 1Q0UA 4UXJA 3Q7QA 1KK0A 3AQ4A 4NCJA 1E9FA 2FOLA 4EPTA 3NKVA 3RC8A 4UNNA 2YWFA 2ATVA 5KHOC 4I1OA 3RWMB 1C4OA 4DIEA 2QM8A 2EWVA 3THOA 4TLAA 2HEIA 4F92B 4HYYA 1OXTA 2OLKA 3HDTA 1C1YA 3SEAA 4D25A 2NO9A 4MA4A 3GLFE 2LKCA 1WB9A 2WWWA 1EESA 3GLIA 3R9IA 4PC2A 5TB5A 1W0KD 3EA0A 3LBHA 4YDHB 4DUGD 3OAAD 2BBOA 2IF0A 3QI2A 4POAA 2OCPA 3UMFA 1TF5A 2X77A 4PHFA 1B0UA 2XX3A 2QRNA 4KYIB 4M22A 2WZQA 1UEJA 4P0TA 1DS6A 5CB8A 1OH5A 4RY2A 1YZQA 4MYUA 3SJBA 5FUYA 1EG7A 1TU4A 1N0WA 2GXSA 4I1VA 4YMUA 3H1TA 4DDTA 5LB2A 3LLUA 2WSSA 1G8HA 4Y0AA 3U7HB 1R5NA 4QNRA 1U94A 5M04A 1E1RA 1G291 1YR7A 2VQSA 2GETA 3DMNA 3WRYC 2J45A 1E2DA 2MSDB 4FINA 4TMWA 5DIFA 4BUJA 1P7CA 5L3QB 4NYJQ 1IY0A 3EPLA 3QEOA 3VFDA 4DLSA 1R8QA 4D4KA 2RH5A 4X8MA 2P0EA 2W6IA 3QOFA 1VTKA 4C0HA 2GILA 1H8EA 4DJTA 1QHSA 4JLKA 4KU4A 1OIXA 1GM5A 2WJYA 2Q9BA 2B7CA 2JJ1A 4LJAA 4WA7A 3CNOA 2IYXA 3LFUA 4DT1A 3CH5A 2RGNC 4LZZA 3BFVA 2WWIA 1JEEA 4JLAA 1XX6A 1RYFA 2E1RA 4NCKA 4F7WA 4NP6A 2GJ9A 3FWYA 4C3ZA 1AS2A 2QEQA 1YR9A 1ZM9A 1N6RA 1QG2A 2WSMA 4PSVA 4XVUA 4BEBA 1JAHA 3TH5A 3PEWA 4TYYA 2W2XA 2QPAA 2O8BA 3QF4A 3LQQA 121PA 4B6EA 1XWIA 2EWWA 2PCLA 2OFWA 3BWDD 1NBME 3F3YA 1GSIA 1CR2A 5DHAA 4E03A 3D8BA 1R8SA 4I99A 1FUKA 1DARA 2FG5A 1NLFA 3UATA 4LBYA 2DCUA 4OQXA 3BH7A 3AEZA 1SXJB 5DI3B 3UWKA 2G0NA 3MD0A 2X2FA 3GFOA 3PUXA 1XCGB 2XNDA 1NL3A 1E79D 1Q44A 1DG1G 4IJMA 1KMQA 4Q1EA 3SYNA 5JMTA 5C2JB 3U3OA 5BW8A 5G3ZA 5A5GA 2ZQ5A 4M2LA 1B23P 3LDAA 3WHLA 1XEXA 2IHYA 3P32A 4Q19A 3K9GA 4WXRA 4Q5IA 4Z54A 1L4UA 3KB2A 1JPNA 1KK2A 2QN6A 2FGJA 4BE7B 4PHGA 3RS4A 4ZDJA 2GCPA 5KTYA 2RGCA 4Q66C 2ZPTX 2W6JD 4TWZA 1Q1BA 2IYVA 4LGMA 4HB2A 3CM0A 2IWRA 1G7SA 2ZANA 4TLDA 2BEKA 2D2FA 4HLUA 2ZR0A 3BK7A 2D3WA 5HE9A 3SU8A 2XTZA 2H92A 4XOIA 4CYMA 5LPNA 3H4MA 1RZ3A 4E5UA 4ZDIA 2OFOA 1E2NA 1Q21A 1XZQA 1GNQA 5IHPA 4QJ3A 1FW6A 4R98A 4BRWA 2W2TA 2N46A 4F4IA 5DI3A 2GK6A 1K8RA 3DEFA 5FR2A 4KJZA 4B3CA 3KJGA 1D2EA 1E9DA 3HU3A 1T3HA 1QHNA 1ZAKA 2C04A 1U9IA 1FTSA 1H8ED 2J3EA 4BWYA 2WKRA 2G6BA 1MR3F 1RKBA 5K8UA 3EZ6A 4CVNA 2WMOB 5FI1B 1ZD8A 4ZKDA 4KFRA 4PZZA 3QY0A 1QHIA 2NG1A 4JVMA 1RPZA 1M7BA 3BB4A 4WIAA 3K0AA 1GKYA 1JXMA 2QZ4A 4NZYA 2R65A 1FTNA 3LLMA 2DWQA 1Z0JA 2WV9A 3X1DA 2A7QA 2FZLA 5J47A 1GNPA 1MH1A 3GLHA 1YR8A 1UADA 3FPAA 2J7PA 4M1MA 2HT1A 2Q0HA 4WZBE 2XXAB 1CJUC 4CT4B 3KJEA 1E2PA 4PPNA 5J4HA 1RVDA 4D80A 5K8IA 3U61B 2ZITA 2F1IA 2A5YB 2QQ0A 5IK2D 2HF8A 4RD2A 4ZPXA 1G41A 2XSZD 4V02A 1KMHB 2ORVA 1G7RA 2JGNA 1XMSA 1Z28A 1S96A 3B60A 2YOFA 3REFA 3ZLJA 4M8NE 4UJ3A 3OE7A 4QOSA 4O25A 2KSQA 3C41J 3U6BA 3TAHA 1KI2A 2PX0A 1G18A 3SJCA 3MFYA 3T34A 2OFXA 3GJXC 4NTZA 4KI0A 3VX3A 3CONA 2L0XA 2VP6A 4RZUA 4X8HA 4OI2A 4GFDA 1EWQA 3IGFA 3L0OA 4EPWA 3FHOA 5K8TA 3A1TA 4GNKA 4G5OA 1U8AA 5DH9A 2PT7A 1J70A 4M53A 2JLRA 2JAQA 4QRHA 5JRZA 3THXB 1YZKA 3U7EB 3AGQA 3BRWD 4DSTA 2XXAA 3ZVNA 3AVWA 1W4CA 3MSXA 4DSNA 5F9HA 2D62A 3UMRA 3NC1C 4Q02A 2C5LA 5L3VA 2V1UA 4PSAA 5AWFC 2FZ4A 3AVOA 2H16A 5SZJA 4LRWA 2ZRIA 1G5TA 3TNFA 1W5TA 3Q9LA 4HAVA 3R7WA 2H57A 4LYHA 1GIAA 1RFLA 1N25A 1XTIA 2H18A 2IL1A 1H8HA 2IXFA 4WAUA 4TYWA 4QBHA 5KNDA 1P72A 2BMFA 1EFTA 4UNRA 1Z6AA 4ERNA 6Q21A 3OIVA 4HB0A 1TQDA 2GESA 1XU4A 4NYMR 2BCJQ 4IDPA 2HDNB 4B44A 4ESHA 1AS3A 2CCKA 4ZCMA 3WXMA 4BGDA 1U0LA 3BC1A 1WXQA 1DVRA 1ZM7A 3A8TA 4DXAA 5JS7A 2JDID 3FGNA 3GLGB 2CLDX 5DO9A 3OEHA 3AF1A 4IXMA 1D8TA 3AP3A 1KAOA 1R0WA 4GP6A 3NIBA 4BFYA 1G3UA 3T35A 2V4ZA 1AJEA 3RYTC 1Z47A 2IYYA 4D26A 3A4NA 1E9EA 3RLFA 3ZVMA 2KB0A 4BFSA 2FA9A 5AUOB 1MO3A 4JLMA 1XMVA 4R7ZA 3KKQA 1XDBA 5DSZA 2E87A 2QSYA 3B9QA 1E0JA 2HCJB 3KUDA 2VF7A 2PZFA 3ZZUA 4ZCIA 3LW8A 1NP6A 2IEZA 2BEJA 3GEHA 2Q3MA 2G0TA 2AXNA 1ZCBA 4LHXA 5HKKA 1US8B 3FDIA 4HSEA 3LBNA 1OYYA 2BBWA 3NHAA 3KKOA 4F93B 1OXUA 3KXIA 1L2TA 3U3RA 3VTKA 5BWMA 1Q3HA 3T12A 1HQCA 5IDVA 4F4CA 2QP9X 2FN4A 3NBFA 3U44A 2Q3HA 4R2HA 1GDDA 4Q9KA 1QVAA 4BFXA 1II9A 4D82A 1N5JA 3KJHA 2YWHA 1MO5A 4LK2A 4TSFD 4BPBA 3D3QA 2CMKA 1L4YA 2EFDB 2QT1A 5DN6D 1R7RA 3BIFA 3CRVA 3D6TB 4URXR 1VYVA 3QNUA 2PJRA 1HUQA 3K09C 2HJVA 2FJUA 3VR5A 3TUIC 3U3MA 4C0QC 2IYZA 2VP2A 1G21E 1NY5A 4EFMA 5JHHB 2EFGA 3FKSA 2J59A 2QP4A 4M1YA 4ABYA 2GZAA 2Z0MA 4DLYA 2ZJAA 2CHVA 3U3JA 3WMGA 1XD8A 4QJ5A 2HUPA 5C4GB 5H70A 3VHXA 4PTLA 1ESMA 4WXPA 4JJZA 4RVCA 3QXXA 1Q1EA 1I4DD 1YU9A 3WBKA 5B57C 4I1UA 4PC1A 2QA5A 3LW7A 2HYIC 2MMGA 2QM7A 1CRPA 1AIPA 4HUTA 3ICEA 3AVUA 3M1IA 4RFVA 2ASEA 1X3SA 2JLSA 4QL3A 4DEYA 3Q5EA 5BN3A 3GQBA 1XXHE 1E1RD 4LC1A 1KMHA 3KQHA 1LVGA 2GBLA 1EFCA 3K0CA 4IDQA 2ZJ5A 3SC3A 4RZ3A 3SHFA 4HLCA 1ZNXA 4HZIA 1Z6GA 2A2ZA 4M9SA 3LXXA 4B3BA 1ZW6A 2WVJA 3RRZA 1UAAA 2WWFA 2GVDC 1ZU5A 3SBEA 1OE0A 1KSHA 4JLPA 1KDPA 5FL3A 3NDPA 3X1ZA 5FPKA 2V9PA 1P9WA 3FKQA 4GP7A 1HA3A 1EK0A 2H8KA 2MSEB 4DCSA 4YDSA 2AWOA 4NKRA 4Q9LA 1Q57A 2R6DA 2EFHB 1YE8A 4YMVA 5FR1A 1FZQA 1NLYA 1Z0IA 3IQXA 2AN9A 4C9BA 2OZEA 1T5LA 1OFHA 4O0MA 3MRSA 1E4YA 2P2LA 3BOSA 2ZYUX 4M0LA 1KKMA 4QHYA 1E2LA 3RRYA 2ANBA 2F55A 4AURA 3RSLA 4TQUS 2BV3A 5KSYA 1KI3A 3U6KA 2EVWX 3DHWC 1UPTA 3SZRA 1FQJA 1F60A 1XJ0A 1VMAA 3IPXA 2ODWA 5TXGA 2WPDD 1IJFA 1HH4A 1YJ5A 4JZKA 3BGWA 2CJWB 5FH9A 3KQKA 2G1KA 2BKEA 4TLCA 4QJ4A 4A6PA 3QJYA 1OB2A 3KDSE 2WIAA 5DLQC 4EDHA 1JI0A 3GJ0A 2C03A 1OXSC 4DKXA 3AV0B 3UK6A 1LS1A 1WE2A 4LPKA 4N3NA 1E2FA 1VIYA 1P75A 3EW9A 3H2YA 2H7VA 2ZTSA 2VP9A 1N6NA 3SNHA 2WAXA 3GLGA 2FGKA 1QHYA 1SKYE 4YXWA 4ZIRA 3C5HA 1EFRD 3QG5A 4C0LA 2CE2X 3OE7D 1ZC4A 2IF2A 3OIYA 3V00A 1AZTA 2GK7A 5H8WA 4LYJA 2O8EA 1W0JD 3OIWA 2C98A 3PXGA 4V0NA 1E1QA 2OE2A 3CRW1 4Q7JB 1W49A 5KNCA 1Z5ZA 1U2RA 2A5JA 3LV8A 1BMFA 4PAMA 1SXJE 4JMPA 2ODBA 1COWD 4A4DA 1SVSA 2ZSFA 4LSGA 1JECA 4RJLA 1U99A 1WA5A 3GJ4A 1G4AE 5HZKA 4TN1A 2ZRBA 2LCFA 3AF2A 3Q85A 4LJYA 5JWRA 1S3GA 2OBMA 4S2EA 3I72A 4EJSA 4PQYA 1N0UA 3L8ZA 1JR3E 1G5PA 5LD2B 1KJWA 1J7KA 4QNMA 1TUEA 2GCOA 1BMFD 2WBLC 4L5BA 1SZPA 3GLHB 5FOUA 5JI3E 2BCGY 2ZRHA 5IT5A 3NVAA 2WICA 4OL0A 3B7GA 4HDQB 1MO4A 3W6PA 4OHZA 3CX6A 5H68A 3RS0A 2OEPA 1AGPA 1Z0AA 3FTQA 2ZM5A 2JLYA 3A37A 3NBXX 2YWGA 3NBYC 1JALA 3U7FB 2NMVA 2P65A 4XVRA 2WJVA 4IW3B 1WBBA 2BM1A 2F6RA 1KJYA 4XD7D 2CCGA 4JL5A 3FMOB 1OF1A 2BOVA 4JIMA 3LVRE 4HB3A 1TEVA 2NZ8A 2QENA 1NVXQ 4JLOA 3IIKA 5EXPA 3M4YA 4TMTA 5EE9A 2CHQA 1VCOA 5FUWA 1W2HA 4PHTA 2R2AA 4C2TA 2QROA 4EPYA 3LY5A 4M4SA 2ECKA 4JSTA 1JJ7A 3GJ5A 5D3MB 5FPHA 1XPUA 1E2EA 1OSNA 2GCOB 1DAFA 2PL3A 2A3RA 1TUIA 3P20A 3VR4A 5LBIA 2FH5B 1YZNA 1E4VA 3TSOA 4D81A 2J0VA 3J81k 2QTHA 2VP4A 4LOAA 4OQNA 521PA 2WWYA 4AC9A 5BQ5A 1OJLA 1KO8A 1G19A 1GL7A 1RC8A 3QEJA 3CWQA 2HT6A 4IEEA 4B2PA 1T8TA 1VHLA 3HWSA 4B71A 3GLFB 3W3AA 4LC0A 2OESA 4MGKR 4MDEA 3B1YA 3HPRA 3OHMA 4HDCA 4LPSA 3DVLA 1NKTA 3JZAA 4DLVA 5F9FA 3E70C 1W1WA 3RWOA 1HT2E 2PZEA 2V6JA 3K0CC 1XNJA 1AQYA 4MDFA 4MYTA 4B33A 1S0UA 5G41A 5B58C 3U60B 1KJZA 2GJSA 3X1XA 5K8LA 2QE7A 4MYCA 3ZGXA 3ZVLA 2IHBA 5EXXA 3CNLA 2ZJBA 2ZE8A 3B82A 3HJNA 4MKFA 4DHEA 4KFTA 1DAGA 2X1VA 2KWIA 3MAAC 5E4FA 2FWRA 4BLOA 5FUVA 1DAKA 1SULA 2XNDD 4PC3A 3SDZA 2RGBA 2PMDA 4D0LB 4OJQA 2FSFA 3L0IB 3IEVA 4DT1B 4P4UA 4A2QA 4TZ0A 1E99A 5FBLB 1YZTA 1SXJC 1AKEA 1O87A 2ODEA 4A2WA 4B3DA 5GVSA 1RRGA 2IBMA 3SS8A 3QG1A 3O8RA 2IYUA 2GRJA 2C9YA 4B6FA 1CJKC 1Q1ZA 4IOJA 4IFEA 1F2UB 4QXAA 4LY6A 1F2TB 1X1SA 4PO8A 4O2RA 1M7GA 4XWKA 1OH7A 4O3MA 4D4MA 1TNDA 2ZI6A 3X2SA 2JASA 2GEUA 1G7TA 2QL6A 3DM5A 2IUTA 4OK5A 1CKEA 3T1OA 2ZR9A 3K70C 1ZJ6A 1IHUA 1HYQA 2BJWA 2C8VA 4OBEA 2FF7A 4Q4JB 3TVDA 5KYKA 3I32A 1WDTA 2DPXA 2YZ2A 1AA9A 5JJKA 2OXCA 4FMCB 2JJ2A 3QKTA 2O8CB 1EX7A 5KU1A 5F98A 3UIEA 4CEIB 1Z0KA 2GXUA 2DWPA 1RIFA 2JJ1D 4MUAA 4DWJA 1CF4A 2ZAMA 1GZSA 1XFAA 2XOKD 5L3SA 3THYB 3AVYA 3B1XA 1AM4D 4TSFA 1SVMA 5L8VA 3THWB 3PR1A 3MMPA 3X1WA 4IXNA 3TR5A 1OPXA 2QU8A 1KI1A 1Q20A 1XPRA 3OFNA 4OK3A 2WJJA 3EPJA 2DFKB 2CE7A 3GMTA 1OW3B 4OHWA 4PHHA 4UKDA 2V7QA 3BD9A 2NIPA 2JJ8A 4BLSA 4C0BA 1XTSA 3IO5A 3B9PA 3IILA 2AD1A 2JLQA 1RRFA 2PCJA 3GJ6A 4A0FA 2WTUA 3I5XA 3MLEA 2ANCA 3CZPA 2Q21A 5FOSA 3BFKA 4FD2A 3HU2A 3GD7A 2OM2A 3D7MA 2HCBA 2V8OA 4Q4JA 5HE8A 4XSGA 2C77A 4Q4HB 5EE0A 3LX5A 1N0VC 2JCSA 1MOZA 1HT1E 3I5YA 2PLRA 2ZU6A 3MJHA 2TMKA 1IM2A 1EFRA 5CM9C 5CYOA 2F9LA 1BS1A 2WJIA 3B2EA 4Z1MD 1OT3A 3TAUA 1T5IA 4HLUC 1CP2A 1G17A 1N6IA 1AKYA 2GAOA 2JDIA 4FCWA 1R5OA 4DCVA 2JLZA 1DAHA 2WWGA 1E69A 4JBXA 2RHMA 4PAQA 1GKIA 2ZE5A 1JXOA 1DG3A 2B8WA 3PITA 4CGZA 3PFIA 5DI9A 1SGWA 4GL2A 4GOKA 4P4SB 2RAPA 2IA5A 3BORA 3FFBA 4Q03A 3T1QA 1G3IA 3OEED 1VIAA 3GPLA 5KSOA 4UXHA 4C0KA 3SQWA 1FQKA 5EE1A 4M21A 5HCNA 2VH5R 1G64A 3K0FA 1GP2A 1W5SA 2I3BA 4FXPA 2NPFA 3U2QA 4C7OB 5JSZA 1XTQA 4Q01A 2IYSA 2R6AA 4YMSA 3VMFA 4D2IA 1UKYA 5FBQB 1UEIA 4L9SA 5CJ2A 3TUZC 5ELXA 5FL7A 4Q1FA 2QMOA 2VSOA 2PLFA 4YONB 3TRFA 3RSOA 1UDWA 2VHUA 1ZD9A 3WP1B 4NCNA 4RD4A 1G6HA 1IJEA 1XRJA 4NPHA 2WJGA 2XTMA 2ZSEA 1W4BA 2F1RA 3U5ZB 4HATA 4FMDF 4TTQA 4E09A 3R8FA 3NHBA 4Q7LA 1R5BA 4XWAA 1VPLA 1CR0A 3CR8A 4V0KA 3C15C 4XWOA 3W6OA 2A5DA 2ORIA 2CCJA 4FN5A 3VR1A 3OESA 1DAMA 2W58A 1JNYA 3DZDA 2XOKA 3R8CA 2EU8A 2XGJA 4PC7A 3ECCA 3P26A 1NI3A 3I8SA 3T1VA 5KPJA 3CH4B 2IS2A 4BFVA 4IRUB 3Q3JB 1K5GA 2ZRMA 4DEXA 4TT3A 3CZQA 3UG6A 4FWIB 4NONA 4DSUA 3R7WB 1DO0A 1MRNA 3T1TA 1ESNA 1GILA 4DRZA 5A4JA 1Q12A 2HJGA 1QHGA 4A36A 4BEJA 2ONJA 2ZYWX 1PVOA 2WWXA 1HV8A 1E94E 3BB1A 3QXCA 4GMXA 4IFBA 1QF9A 1P2VA 2QMEA 3FB4A 5CK5A 1CR4A 4CEJA 4DVGA 3AKDA 1Z2CA 1OLOA 4Z8YA 2G1JA 2NO0A 3AKCA 1N6KA 2O0KA 1UM8A 2QNRA 4PPQA 2F1HA 4BFUA 4DLRA 1GG2A 2AWNA 1IXRC 3WMEA 5ANRB 1D9XA 4WOPA 3KFXA 4CZ2A 3K70B 2ZVPX 3I92A 3IBGA 3ZVRA 3HP1A 1M8PA 3BE4A 3I3SR 1FL9A 4GDFA 2X8AA 1RRPA 1WQ1R 1TQ4A 5GJWC 3GLHE 3U4QA 3CF2A 3SOPA 1CJTC 3AUXA 3DOFA 2B92A 4G5QA 4YLGA 1X86B 1JR3D 1TPZA 3C5CA 3GCGA 2VL7A 5TARA 3CF6R 1IOZA 4DZZA 3SI7A 1NN1A 1VG9B 4Q1CA 1E9BA 3PEUA 4KAXA 4KYUA 1RE0A 4JLBA 3BS4A 2DBYA 5L3QA 3QF7A 2FE4A 1E6CA 3JZMA 5FFMA 1CU1A 4QBFA 5JRJA 1NG1A 4KODA 4JKIA 1UBEA 5D3MA 3KXLA 4PO9A 2AFHE 3UWOA 1NIJA 3MWLA 1K6MA 4A8JC 2A78A 2I1VB 1E0SA 1L8QA 4KBGA 4Q9HA 1KAGA 5D3QA 2MSCB 3CPHA 2OLJA 3DKPA 4HEJA 3K0EA 5KNBA 1XJCA 5DE3A 3WP0A 1SKYB 1E2JA 1JPJA 4C0SA 1M2OB 1IN4A 2B6HA 4CW7A 3VX4A 1E32A 2DWOA 2WJHA 2V3CC 3TSZA 1LW7A 3EX7C 1N6PA 4FMBB 1YQTA 2C2HA 621PA 4LV6A 4RSGA 3ZH9B 4HUQB 1T0JB 3WBJA 1TX4B 3QE0A 4KXFB 4IOMA 3SBDA 1GRRA 1KO4A 2O8BB 3THXA 3LH5A 1G3QA 5E7MA 2E9SA 4GZLA 3ZQ6A 2RGEA 1II8A 3HR8A 1DAEA 1DADA 3K53A 5AJYA 1H8HD 1VKJA 3EZ2A 2QAGC 1Z0DA 4DB4A 2KJQA 1NVVR 2Q6TA 5JSZB 1OHHD 1SXJA 3MWKA 2J1LA 1IN6A 5SZHB 4EUNA 3ZQJA 2G77B 1U98A 4IKEA 3IO3A 4KV9A 3QXJA 3IHWA 1U9IC 2VF8A 3A36A 3W9YA 4B32A 4CEHB 4OQLA 2F1JA 4V0LA 2PEZA 2ZS8A 2ZRDA 4TL6A 3DOEA 2XB2A 3I62A 1TQ2A 3EPHA 2IS1A 3KQNA 5JI2E 1NBMA 3H86A 2QTFA 4GI7A 1IN8A 4EFNA 5FI0B 3A6PC 5FTMA 3QSYA 2ZRPA 3I1FA 2Z5FA 4EFLA 3TBKA 1HEIA 5CK4A 2XJ4A 3BB3A 1A2BA 4RZ2A 5KDDA 1P61B 3W5JA 2KBEA 3WY9A 1TU3A 3EC1A 1NJGA 1KY2A 3I4LA 4OHXA 2O8FB 3DMDA 4ARZB 3A1VA 2W83A 3NEJA 4WZAE 1PLKA 4H1VA 2FX3A 2JIZA 4QHTA 4PZLA 1D2MA 4DCUA 2BMJA 2QORA 3JVVA 3PUYA 1MKYA 1II0A 1MV5A 3N5CA 3QBTA 1NMZA 4JVNA 2YOGA 2DY1A 1DELA 4LDJA 3AGPA 2O8CA 1CJMA 3HYRA 1SVOA 1ZINA 2HLDA 5LD2C 2ZREA 4AKGA 3GJ3A 5EUQB 1US8A 2IWHA 2JLUA 1YRBA 1R10A 1Z07A 1T8UA 4Q47A 1PV4A 5HKKD 2IYQA 1XJQA 3W3ZB 1W2GA 2EYUA 2CL0X 3AH8A 4RKFA 4D4LA 2RKOA 2Z4SA 4QM6A 1XEWX 2ZSBA 1NNEA 1UKZA 5FUXA 3WNBA 4JBWA 1X8JA 3A4LA 2XJ9A 1IONA 3E5HA 2GTPA 2G88A 3EIQA 4ON9A 2O8FA 1TMKA 3OZXA 2H5EA 3ZD6A 3R9XA 1CEEA 1FFHA 4KHZA 4Q4AB 3LNCA 1OB5A 1AQUA 4ASUA 3BBPA 3K9HA 4HZUB 3SYKA 3SFZA 2XZLA 3AF3A 3OEEA 3A1SA 4DCTA 4GMDA 1J90A 5HTKA 5J4LA 2JATA 2RGNA 3GEEA 2FFQA 2V6IA 2ZI5A 2RGDA 2Y8EA 2ZI4A 4JLNA 4RFSA 4BECA 3GLIE 2ZJYA 1OHHA 3LXRA 4NH0A 4A92A 4MRNA 1VECA 3L2OB 4Q21A 3CKLA 1AK2A 4Z8XA 3TW4A 3QF4B 2AX4A 3NWJA 3LWNA 3IIMA 4XD7A 4AG6A 5HZHA 4RKEA 1WBDA 1M7HA 4LJ7A 2QPTA 2BMDA 1BYIA 1MABB 2HLDD 4QG7A 4A0GA 4G5RA 5FPTA 2REOA 3PEVA 3RANA 2GBLC 1PJRA 3Q72A 1ZIPA 5CIQA 4TLBA 1S9DA 4CF7A 4Z1MA 3VNVA 3WYFA 1KDTA 4IOKA 4XVQA 4P4SA 1E0KA 3C16C 4XTCS 3CO5A 3WNDA 2IS4A 2BM0A 2DFNA 1TF7A 3T06B 1HTWA 4UNSA 2OCAA 4PXAA 2FPMA 2KI5A 4TZ6A 1F6BA 1CS4C 3L0PA 5B2ZA 4OQMA 2CDNA 1XEXB 2J7PD 4HAZA
chains in the Genus database with same CATH superfamily
5JISA 1T0BA 3Q5GA 2QL5A 4PAGA 3PJFA 2I29A 4DDWA 1U2ZA 4LRXA 2GT1A 5LLTA 5LZ2A 3EIXA 4PIVA 4RENA 4C06A 3GOQA 1XALA 3OSZA 2E2WA 4ZICA 1RQ7A 1WULS 2VSNA 4WLOA 1ZJYA 4Q18A 1QCZA 3TQQA 4Z9BA 1ZUNB 1S8FA 3NM6B 4QBTA 4YBRA 3NBMA 2CFIA 2Y27A 2CBXA 5LQUA 1TTTA 1H05A 2W2OA 2WILA 2QVGA 5FQNA 1P31A 1Z68A 2O3TA 4N47A 3T38A 3WWDA 1PIWA 1WF3A 3A4YA 2PUGA 4F3TA 2OXRA 4IICA 1XMIA 2QX6A 1BOFA 1BH2A 1M54A 3N59A 2Q6KA 1SIUA 3NCTA 1I36A 4I19A 4CMJA 1GPKA 1TIKA 3QHPA 4X7BA 3VSAA 1PR9A 4KR9A 3CLSC 3BWCA 4PR3A 2HBQA 4JX9A 4B45A 3PWZA 4ZEWA 2VUTA 3ANTA 1Z2PX 3R4VA 1CQWA 5ALUA 1OBCA 4MQFA 4EGFA 3WAGA 2XBMA 2BFEA 3PRHA 3SAJA 4EHAA 3TW8A 5KKNB 4HNAB 5SZIA 4NL4H 1Z6PA 1R0XA 5C34B 2O0LA 2F7SA 2O6HA 2FG7C 2NQ2C 5EERA 1PDOA 1W4ZA 4DC1A 3RGWS 1Y8RA 1CY4A 2H7YA 4INZA 4OP1A 4JI4B 3RG2A 3IKLA 2AXPA 4KQJA 1PVDA 2ZAOA 1ULAA 3JATB 5C3MA 3KWMA 1QANA 4C6HA 3TVYA 2ZRLA 1GGKA 2PWBA 5SYNA 1YR2A 1M8FA 3EBPA 4RLQA 3PL5A 5G0WA 2K5UA 5I45A 2NP7A 2FN3A 1VJDA 4FGKA 2OOSA 3MWYW 4IIJB 5FIUA 4EW3A 3EIHA 5BW6B 1J2EA 2YHIB 3O2QB 5FA5A 5IUKC 3L7CA 1SZDA 3VYSB 2W00A 1OLSA 1YONA 4ISCA 1KKLA 3P4YA 2PAFA 4ILEA 4LWZA 4HWRA 4DGQA 4R1OA 5J2UF 3NNDA 3WFJA 3O8CA 1K06A 4ZI7A 1TJ4A 4FJ1A 3ADDA 4OI1A 3RR2A 4EHKA 1A04A 1O95D 3ANXA 5AKIA 4CM9A 1N7JA 2PQ2A 4EPXA 2ZI9A 3AVPA 5DW3A 1TA9A 3GFGA 4N5HX 3HWRA 1CP3A 4Z9XA 4A8JB 4EI7A 3ME5A 2RHJA 4IEIA 4OYHA 3K73O 3ANYB 4CV3A 3BM5A 2GQ0A 1M0WA 3PKJA 3IQIX 1E7YA 4YMLA 2Y2VA 5C9ZA 5AM1A 1XP5A 4C30A 4QKQA 2O8DA 1L5NA 1O9GA 4QYMA 1A1VA 4G9BA 4DBLE 5EZ6B 1CIPA 5LXTB 4DQUA 3ORRA 2ONYA 1BDIA 3NVKI 3HBFA 1KYZA 3KXKA 3H9JA 1O0BA 1G20E 2VK4A 3FLMA 4HVCA 4FD3A 3GFPA 1EHCA 2FW6A 3AO0B 5EMHA 4GBED 4FGZA 3TJMA 2B78A 2OD9A 4PZ0A 4NABA 4UHKA 3EOAI 3LA8A 3UPDA 3V4LA 3IXMA 2AL7A 4IS3A 1VPDA 3IRVA 4QJBA 4KCGA 2XE8A 4BLTA 4MSUA 1X1TA 2CFTA 2RAVA 4B7ZA 2O4UX 5ED4A 1TYZA 3I9V1 5ULLA 1YRWA 4LXQA 2QBYA 4HLDA 1P33A 2C54A 2FPRA 2E4WA 3JR3A 1JQEA 2BKVA 4TVOA 1GFWA 1IFXA 1KZGB 4CKZA 1PLLA 3VPGA 4ER7A 5JAQA 2LDBA 3GELA 1K6EA 1DTWB 1IZ8A 2I9PA 2VPIA 1F2VA 1SAYA 3GQBB 4O4HF 1XCPA 4GPTA 4ASUD 3LC7O 1LB1B 1FP4A 5AVYA 4BO1A 4AZSA 2BRUA 2QXUA 4PINA 5JV5A 4AQYB 3ROTA 2XGMA 5AKKA 5DWQA 3PQ8A 2IKSA 3ZIAA 3T61A 2EZ8A 4KQ2A 2DKNA 3OQOA 1E6UA 5BNZA 1HC7A 3L18A 1R6AA 2R25B 2ZVQX 3RVQA 1YU6A 5TQJA 1VYUA 5C7OO 3IE1A 5A6SB 2VTBA 3GIWA 3VU9A 2GN1A 4YAUA 1ICIA 5LA6A 1AE1A 3GF4A 4M1KA 3ZEAA 1M2FA 5ARBA 4KXXA 4Q3OA 1WLSA 2HD4A 1DBSA 2VJOA 2CZQA 2F48A 4K2HA 5TMEA 2ES4A 4HXGA 4RH0A 5JTUA 1W36B 1J1ZA 2BMAA 2FHPA 2RIPA 1XCMA 2BWJA 2ZEJA 3D3EA 3EOBI 3OHSX 4Y2UA 2V1XA 2A4KA 2Y6VA 5DVZA 5JZVA 3KZOA 4IJVA 3PDIA 3DOJA 1BVHA 2YUTA 3AUKA 3B36A 1E9AA 1JEDA 1TIBA 2DLNA 1AKWA 1UMCB 2JA2A 1G8JA 3G8AA 3QVUA 4HDAA 4NE2A 3RASA 1MQ8B 3IOEA 5GOZA 3T1NA 3ZS8A 2VEOA 3AEQA 5CDFA 4E6EA 1RPTA 1SB9A 1LD3A 1W30A 3NTXA 2HSJA 4EARA 2X4DA 2XEXA 1Z5GA 2ZJZA 5LIRA 1DAPA 5AJUA 4V2UA 1KEPA 1U0JA 5A7HA 2GN0A 3C3XA 5KNDH 3UHJA 2YFHA 4RD6A 4HLQB 4X61A 3ZDZB 2YINC 3QKSB 2ZSIA 4YP6A 2HXSA 2AZ4A 2IP2A 1IG0A 2I6QA 2P4HX 1Z08A 5ABPA 4U7DA 2FUNB 1EU1A 2B8JA 1LK5A 1QH1B 4XM2A 2D13A 2HX1A 1OI7A 3TLBA 4HS9A 4AD8A 1BE0A 2M9MA 5TF0A 1N3BA 2YV4A 3PXBA 4RL6A 4US1R 2BLLA 1PG5A 1NN0A 1NSTA 3GRPA 4TM8A 5E0KB 3OEWA 2FOXA 2WMNB 3PDWA 2QQEA 1HGXA 4YAIA 1E6MA 1V5WA 4TTSA 4AYTA 4BO6A 3PVSA 1TKCA 4OQFA 3L82B 2EP5A 4FGWA 1PK7A 1NBMD 2P2NA 3K72B 3NC0C 3A1UA 4YRAA 1WCYA 5CDUA 1AMNA 3FLEA 3L43A 3NTUA 1SCJA 1UFQA 3EC2A 2X0NA 3WHIA 1E1KA 2VFAA 5DKFA 4CN8A 2UZ1B 4OA5A 2BGJA 3EPKA 3NEYA 1K27A 4KQ1A 3BTSA 5JCZA 4DQVA 1L5WA 3QXSA 3ZCQA 2PLNA 2XUGA 1GUFA 1XTVA 2JIBA 1D6MA 2Z95A 1XZ8A 3CF0A 3QPUA 4G9GA 3U7QB 4DIBA 2QRMA 1SBZA 2IU4A 1G7CA 4F4DA 5F7ZA 2QTGA 3HXLA 1S8NA 4C89A 4YCNA 1DX4A 2IHNA 2AN5A 3C4VA 2V58A 5JALA 4F12A 5EUBA 4ZC1A 1EM8B 3N8NA 5EJFA 1NI4A 1F9AA 5BOSA 1GRNA 4JBYA 5LU9A 1X8LA 2Q07A 2C96A 2WIBA 3ZJ4A 2Q62A 4INAA 1QMGA 3THWB 3RGGA 1U11A 1WXFA 2F9MA 4K6FA 3K96A 1H2WA 5FL7D 5SV2A 3PKZA 3AESB 3KUUA 5G0UA 5J2TA 4K6KA 4B7XA 2XIJA 2NUTB 3KD3A 5G02A 1D03A 2Q9AA 4I9UA 5HK8A 4N5MA 2FAXA 1UFVA 2B94A 13PKA 1BO6A 3DZ8A 3FCAA 3N1UA 3QQ5A 1D2CA 2V55B 3P9XA 4HNQA 4IQ8A 4X90A 2ZYTX 4URYR 3TB4A 2Q6VA 4PLWA 1FVFA 2APJA 4KQKA 2TS1A 4WXMA 1WPXA 2GBPA 4F5EA 4ENVA 3KKMA 3ADCA 2P9ZA 4CMEC 4QDZA 2QSJA 4P5PA 1M75A 2XYGA 4LTMA 1R00A 4ND4A 4D9FA 1JIIA 3D2BA 1NXVA 5FOXA 1E58A 3PDHA 2V7QD 4RWZA 3O82A 3AB7A 3EMBA 4MUHA 3BERA 2YS7A 2YXLA 3COWA 3RHTA 5C7LO 3EAQA 5KO2A 2Q41A 2X2OA 2IUSA 4E1VA 4GIBA 3EASA 1LTKA 4NYMQ 3NDJA 2PL1A 4KLCA 3CT4A 2NO7A 5JQGA 1GA6A 4CQMA 1PGPA 1EK6A 3UK0A 1CW2B 5E7IA 7ADHA 4R69A 5HJ7A 3L4JA 1L7OA 2EW1A 3SEZA 2AKYA 1ZXLA 5I9TA 2KYRA 2QP3A 1A8UA 4MJXA 1E6WA 1M8KA 3RFTA 4I6GA 3I2GA 5KB3A 4HFMA 3LNTA 3DF9A 3INYA 3M1LA 3S2EA 1MPXA 1P80A 3CT6A 3TKAA 1QK3A 3U44B 5CD9A 1BXGA 4W8HA 4CMHA 1YQQA 4O1IA 3HE3A 3KELA 4IVPA 4ZDKA 4BQSA 4YR7A 8OHMA 1VPWA 4DZRA 3F8TA 3UJHA 1T2DA 5ALDA 4P33A 3ROKA 4LJRA 4I81A 4X6XA 2P4UA 2QTBA 2ZRQA 1QQ7A 2NTEA 3LBFA 4L78A 2OCBA 4UPVA 2WM2A 5EE3A 5L4NA 3NZEA 2BE9A 2FRDA 3HJBA 4QDTA 5DP2A 3N9IA 3Q6NA 1HQDA 4DCNA 1KWGA 4B3GA 2YXPX 3VI4B 1Y34E 4BO0A 4EW2A 5C8XA 5JSYA 2JH3A 2NAFA 3D5EA 4HNGA 5AI8A 4CV1A 5BVGB 1T6NA 2G82A 1JMYA 1I4WA 3H2BA 4GS5A 2AI2A 3OCXA 4PQFA 4COKA 2WWHA 5DYGA 3TLGA 2C5GA 1U7OA 4WBSA 4XDGA 5F1OA 5CFOA 1P8AA 4M89A 4O5AA 1XCOA 1X0XA 3ND8A 1KBZA 3FN4A 3GHHA 4OI4A 5DNAA 1SC1A 1Z4IA 5JYEA 1OAOC 5DMHA 5G4KB 2J0UA 3N87A 1N2IA 4TWRA 2VKTA 3JVUA 1NN3A 2OTCA 5JCOC 1W7AA 4LBVA 1L9KA 4B3TB 3ND7A 3WK8A 3TSAA 3GRFA 4GBMA 4JEMA 4OP2A 4MI6A 5JYBA 5A7GA 4IX1A 4ZPJA 2GWHA 2O2CA 4ZVKA 2OBBA 5J2UA 3TW8B 4JFRA 2X42A 4R2WA 1V9SA 1YSCA 1R0ZA 2FI1A 1SVWA 4S1NA 4EQZA 3COZA 5FEUA 5JFGA 3OAAA 2C95A 3LCVB 5AW4A 3QKRA 1R12A 5I5GA 1XC7A 2PIDA 3ROFA 4GPIB 1J5PA 1FF9A 2I7VA 4HDRA 4W5JA 1JSCA 4W7HA 1PWZA 1U6IA 3EMVA 4GX5A 4EY4A 2AC7A 2RGAA 3BRSA 1RR6A 3DYVA 1CQZA 2CHGA 4HNSA 3ZHZA 5JVDF 1BN6A 3TRDA 3Q8MA 2F8SA 5L6LB 4A9AA 1QUFA 1NV8A 1PS9A 1JLLB 4MR7A 2V7TA 2CWDA 3LKZA 1VFPA 2OV2A 3O6VA 4RWEA 3DKRA 4B31A 4FMPA 1OXVA 4DBZA 1V9LA 4PV7A 4E11A 2WKQA 1WNFA 2GPYA 3BXZA 1R3UA 3DV0A 1M6HA 1NJSA 1Q0RA 3KQLA 1SK8A 3L49A 5TV2A 1JIUA 2YJZA 2FFBA 2J46A 2J0UB 2RGGA 2RHTA 4KPUB 3VZDA 3E1SA 4NCIA 1F8YA 5FYDA 2O3UA 3FUUA 3D0RA 2WHXA 5KSZA 4GF5A 4G81A 3FNQA 1TL7C 3EVZA 2JRCA 1GQ2A 1LI4A 4M1WA 4DB2A 3DFZA 2AFHB 4U00A 4MR8A 3OY7A 2X4LA 3DDZX 1K3FA 2QY6A 3HKCB 3L7AA 1NUSA 2XDQA 2EZTA 2ODTX 4I4CA 3DAGA 3FYSA 4D4JA 3RI3A 3CZMA 4PCAA 1VLHA 4M9UA 2AQKA 3RNOA 2O3JA 4RDHA 4JYCA 4G8BA 3NKLA 3U4CA 4PFKA 3O3NB 3IPYA 2H1HA 1X6VA 4RK4A 4JL8A 3BH0A 5GADl 3KR1A 1ZD2P 2KX7A 1ZC3A 3D4IA 3T5GA 2OWDA 3E9ZA 5KOYA 4KTTE 4PSCA 4MUGA 3E03A 3VJKA 2QLLA 3S8MA 2WJPA 4NV0A 5H16A 5IDQA 1MNQA 1MC1A 1LDNA 4ZARA 4ZD6A 4YQYA 1WTAA 4D6PA 1O4VA 2QBYB 1LSOA 2EJUA 4W4TA 2FUG1 5F5XA 2H65A 3GN1A 4LF7B 4B5KA 3NASA 1P1JA 1IN5A 4V1CI 4YRMA 3PT9A 4MW7A 4MKHA 1LFDB 1L7RA 1SHKA 2V9ZA 3KKEA 4MCIA 5KVAA 1IZZA 2KHZA 5LC1A 3N7TA 4LDAA 4D8TA 4Q3NA 1OYWA 1F9EA 4GI3A 3AR9A 4EECA 2P6OA 4CTKA 1ECFA 3DDCA 1EP1B 2V5AA 2B1JA 1NQUA 4BN0A 4BDTA 1OFTA 1CQIB 1GRVA 3FYHA 4WNAA 1ST3A 2CMHA 3SXJA 2WB2A 4I3FA 3EG9A 1AGNA 5ERXA 3VBEA 2OG2A 4D0GA 2GJKA 5BVHA 1ZIXA 3DDWA 4YJKA 1QKIA 3UAGA 4EW6A 3FPBA 4EA8A 3PXUA 5A6SA 5ECWA 1XF9A 5CNJA 2JFWA 5BR8B 1TYDE 3V32A 3PGXA 3NHUA 1CULC 3AQIA 1V3UA 1NJFA 3B52X 3NETA 1IBCA 5EZQA 3TTTA 4TKMA 4XX0A 4HMOA 3UQYS 1ORWA 2A5GA 2XSZA 4V0ME 3KT0A 3LGAA 3V8NA 2VT3A 3V4RA 4MW9A 2IHTA 3KQQA 3TRJA 1NC1A 1A9RA 1P3DA 3R9XB 5IRCD 1A5ZA 4M7OA 3AJDA 4B83A 4UM9B 1L8XA 1NW5A 2JFZA 2J41A 2PY6A 5AK0A 5CDYA 1EK2A 3MEQA 2QRVA 5I7EA 1U8UA 3V97A 4LMPA 5K99A 5JEDA 1QSGA 4J7XA 3A0UA 2AR0A 2OCGA 3A11A 2C92A 3O95A 3L46A 4KI7A 3VOBA 5IT9A 4AT1A 1M1UA 1O5OA 4G1EB 4HUQA 3ZBPA 3ZBTA 4P0QB 4EBFA 2P90A 5JZ9A 3ROXA 4C4XA 2VK1A 3GH3A 2I3DA 1OFUA 4Z2YA 4I0WB 3B3QA 5EJAA 4BQQA 3LQYA 3JRWA 4KXLA 3RK0A 2FR0A 4X62B 3GJ7A 3FNEA 4MRRA 3C39A 2VEDA 3V8VA 5KNLA 2UYQA 5EHNA 3CPEA 1P19A 2ZYGA 2CJYA 4UBKA 2EL9A 1FY2A 3LC1O 5I9BA 3DB2A 3I1JA 2BFFB 2QI9F 4L4YA 4YXFA 4BOYA 2Q3EA 3KQUA 4D6XA 1XN1A 1FXSA 5A05A 2LP4Y 2PO5A 5AXDA 3MTBA 3BSWA 1R27A 2WSBA 2X2EA 4PZYA 1K7FB 4DL9A 4LSMA 1I3OA 1U1GA 4MYHA 4RY8A 4JL6A 1JA0A 4CLEA 1UKVY 4LF8B 1E7MA 5CLGA 1H0SA 1KAQA 1V8FA 1P6XA 4MIKA 3OP1A 1LLUA 4PO1A 4UOQA 2NOAA 1J0EA 2ZFUA 1TF2A 5AVWA 2W6PA 2WTMA 1YGPA 1UJNA 1KHTA 2QE7D 5GJBA 1QHXA 4IINA 4MQUA 4N54A 5K0EA 1T26A 1P1RA 4J4BA 1EUQA 3HDJA 1AOXA 3D5TA 3AEYA 2ZWAA 2P3LA 4XYEA 5DBOA 4YBZA 1A5AB 1HTBA 1ZMOA 2PKEA 3C3WA 4BIMA 5C7IO 4REQB 4CNBA 2DFLA 2HOQA 2Q1SA 2WT4A 4GEKA 4ZT6A 4YMHA 4IRMA 3HBMA 3WDKA 4RJJA 4BASA 3RARA 1A5TA 1T0HB 2GX6A 2R6JA 3HWWA 4GXNA 4LHWA 5EZ5A 2I3GA 1DDIA 2JI7A 1OWMA 4XLZA 1NAHA 1VLQA 3TCXB 4UHCA 3UB4A 4C6SA 1LCIA 3FMFA 1HYGA 1E3WB 5J2TB 2ZYHA 3DMFA 5KOJA 3U4HA 2O8EB 4URUR 4BO2A 2OO3A 1VOTA 5ICEA 3S1AB 5AUQA 1IUKA 2H7XA 1T3SA 1VKOA 3G2QA 4YUZA 3DOIA 1REQA 1Y3CE 3BZUA 5F4ZA 4BP8A 1QS0B 1V96A 1WDWB 2GJAA 1XZDA 3L4SO 3E35A 3UUFA 4LHVA 2FP4B 5EKUA 3WNCA 5INTA 4FZRA 5KTKA 3RS5A 2IZ0A 3F0TA 3RG8A 4AI6A 2X13A 1RLTA 3ESDA 1IVSA 1HE2A 1VA4A 1IK6A 2Y1WA 3K09A 4J16C 3F7OA 5H0IA 3KQMA 4MI1A 1JKJB 1FDIA 1C81A 4F3YA 1SD5A 4C4SA 4P58A 3NI2A 1A9TA 1J8MF 1FP2A 2NUPA 5KWEA 1QGUA 5HG0A 2G9UA 5G0TA 4U6QA 1SIWA 4DMCA 1WB6A 2QTVA 2YYZA 4DMGA 4ZV4A 9MHTA 3DAHA 2P91A 3URKA 1JKXA 1GHTA 2D7CA 2OV4A 2QZJA 3ONWA 4ARUA 1NJ2A 3QMMA 2AHOA 3VPDA 4DJ5X 3ECAA 3GRVA 5CG1A 5K05A 4Q4AA 2I78A 3GRZA 3TZEA 1CUJA 2W37A 5D3KA 1OIWA 4JITA 3KUCA 3ODGA 4QXPA 2ZIUB 3K32A 4WJZA 1T4DA 3H5RA 2Q4EA 2ATEA 4PE5B 5JARA 2ZIAA 4G2NA 1ZNQO 9LDBA 2QIOA 1U2DA 2VIIA 1X1RA 3PXEA 4W6QA 3LWBA 4BFTA 2PSSA 3LC0A 5EGSA 3D3WA 3LXMA 4ZI2A 5JNTA 4AO6A 1YCGA 2UUPA 4PLYA 3U7RA 4A6DA 2DBVO 5DIZA 1W36D 1W76A 4D1YA 3E9RA 5HF9A 1QRRA 5LUBA 5EWLB 3WHKA 1RWMA 1USUA 4MV6A 2HV8A 4QU5A 5WRFA 3WRXC 4E5YA 1S2IA 3JWGA 4QXMA 1JAIA 2VJAA 3OIUA 3KK0A 3OCCA 3ZW9A 3RODA 4IGIA 4I1IA 2NXCA 3ZU4A 5BVGA 2R6HA 1WHSB 3LT0A 4HSGA 4L4ZA 5JZMA 1SFRA 2NUPB 1DKUA 3CR7A 4PAOA 3TQTA 3VHRA 1OBVA 5JH7F 2BE7A 2PZMA 3HJHA 1YZGA 1ZNYA 3EUEA 4II2A 4B0PA 3RVDA 3I9V6 3MINA 3LAWA 5K3SA 1Y8CA 3I61A 4TTRA 1DT5A 2W7TA 4PG8A 5LU8A 2OAEA 1OZGA 1X9IA 4D9HA 1O9BA 1KO1A 3T4UA 1PJ4A 3GZNB 3ZDDA 3QTTA 5D84A 5DXFA 4PPGA 2NTYC 1AKRA 2VWPA 4DA4A 1KU6A 3C3BA 2FEOA 2PXXA 1W52X 3U3XA 3H5IA 5HSGA 2EQBA 5KTOA 1I1HA 1GSHA 1M1YA 2B3TA 5K6AC 1ISHA 4GE0A 3R20A 1PUIA 4JNKA 4LJSA 3VU0A 3BMCA 3CVXA 1JA9A 4NHOA 5KAMA 3UJNA 2LWIA 3MJRA 1QDUA 2JA1A 2PX4A 1I3NA 1CRLA 1U9ZA 2WK1A 3E0QA 3IIIA 3PFCA 1F8XA 2DUJA 4IGEA 3ZWYA 5CB0A 2X58A 5KVSA 2O0HA 3WYGA 1ZZEA 2R751 1IY8A 2OHOA 1V41E 1N0IA 3N2KB 3Q8XB 4LHYA 2VLBA 4WZ6A 5EIAA 2PMEA 3ZG6A 5B3JA 2CMGA 3ZHRA 1RJ9B 1SG0A 2KQUA 3RYIA 4B2LA 3VI3B 4C3OB 2CK3A 3AI3A 4E5PA 2DB3A 4UEKA 1NUQA 4JLJA 4NMXB 3S6JA 2H2GA 3RAPR 4JROA 5K9ZA 2HK9A 2BFDB 4Q3CA 3WKDA 3DEKA 2H54A 1X0VA 2A0YA 2FUEA 2JEZA 2Z58A 3CRMA 3L0SA 5D87A 4EGSA 1P7YA 3R09A 4EUSA 5TVGA 4JVSB 3TOVA 1WMBA 3N8HA 3W4IA 2IC5A 2C7QA 2FEMA 1D7AA 3UYLA 5CM8B 1QPZA 2QW8A 4Z51A 1CUSA 2XTNA 3F46A 3TO5A 4O2AF 1XSEA 5FWXB 3DWGA 2NO1A 1NBOA 2QGZA 3KCQA 4EG3A 5DXJA 5L7WA 1H2XA 1NQ5A 3PG5A 5DU2A 2VHXA 4D41A 1F7VA 4FQ7A 2JFFA 4XYLA 4DE5A 2B8TA 4TS3A 2HZBA 2HTEA 5K1ZA 4D02A 4XOUA 3BT7A 4F11A 1BIFA 2D5BA 1UBGA 1MA3A 4MWDA 3HYTA 1YK1A 1NSFA 2AH5A 4KNWA 1MV8A 1ULZA 4EEXA 1ECLA 2VYCA 1LK0A 3G2MA 3EA5A 1OWNA 3JQCA 1ISRA 2OL4A 2GN2A 4DIMA 1XTJA 1OBHA 1YIOA 1QKKA 1UBNA 2UU9B 3FUCA 4MUBA 5EJMA 3IVAA 4A27A 1DO2A 3N2KA 1AH2A 3UFBA 5MGNA 3IJEB 3KYIB 1GA1A 2QXTA 4W5WA 4DG5A 4WCFB 1XTRA 2XKAA 3V2GA 1JE1A 4YY3B 2GUGA 2AF3C 8ABPA 3QUQA 1CVIA 1E2KA 2CXOA 4ZOAA 1D5CA 4K81B 5CYPA 5KJEA 1YS4A 2G08A 2JGJA 2VTDA 1TM3E 4RD0A 2RCNA 5CP8A 3UQZA 1QM5A 1VA5A 2OBXA 4LZNA 4XFKA 4LRUA 2VBGA 3RVOA 3TOXA 3ZDFA 4YJ2A 2DH5A 1ACLA 2I33A 3OU7A 5AM3A 5K4HA 3VH4A 1Q1GA 1XDDA 2YUIA 2BC9A 4YGYA 3GUUA 4Q3AA 1JHMA 1RYNA 2BI4A 3JYOA 1IBRA 5D6OA 5E1DA 2WG1A 4N6OA 2OO5C 5AR1A 3R7FA 4OM8A 1T5SA 4PGFA 2HI0A 1JDVA 4AXXA 2XWJI 4LY0A 1M2OA 2J07A 4RPHA 2GZRA 5DNWA 5C4MA 4FU0A 4IDNA 4Z2AA 2JCBA 4BVKA 2OXEA 4ZO9A 3D02A 4FE3A 5I9NA 3GC6A 3TQHA 3NBQA 1RWNA 2YN2A 5FUBA 4CLOA 2FJPA 1UZUA 1OV6A 2H8GA 1SCBA 1UPFA 2Q5IA 3DBOB 1QPBA 1WEHA 3FHCB 3QENA 2Q8QA 4TXHA 1I3KA 3AVQA 5CR9A 4BRUA 4RVUA 2P2YA 3G0GA 1HE1C 3CVWA 1SKQA 1P5ZB 2E6KA 2QJFA 3ZHBA 1RHMA 1DTSA 3WTCA 1U4NA 1QOZA 2JANA 4R9RA 4TL9A 3EXAA 4TRNA 2JJ2D 2QDKA 4RULA 2F43B 3WSTA 3FTPA 5CB4B 2HFJA 4LYFA 4R4JA 3STVA 1USWA 3GCXA 1FDSA 2FNAA 2ZVDA 1UXKA 3GG2A 4LI0A 3P2EA 1DB3A 5E6SB 1P0PA 3PFBA 5KCMA 3UOWA 4ACBA 4UQLA 2UYCA 1MO6A 3QU2A 2DRIA 4I66A 4F3CA 1ZR4A 4UHDA 1W36C 3LWDA 4WHMA 1Z2AA 1A2KC 4R1LA 4B7AA 1DEXA 1QV6A 1WY7A 4FK8A 4B4UA 3HB7A 2HRBA 2M98A 1CJSA 3UUEA 4J0DA 3VNAA 1L7EA 4EHBA 4CMGA 1DBQA 4L6CA 2VWHA 3CJRA 4XQ0A 4UTOA 2V5VA 4ITRC 1FDRA 1YMQA 1C9EA 2JVKA 4F21A 4D43A 2A4MA 1SHLA 2IZ6A 2GLXA 3TINA 5A6VA 2HXYA 2VDWB 2OY0A 2ZJ2A 2AJ8A 1G6Q1 2VJBA 1L5MA 3MWGA 3C6ZA 4FONA 5TMPA 1YBVA 3S2GA 4LXGA 1PN3A 4MXDA 3WI7A 1E0AA 3QU7A 2PYZA 1JW9B 3PXXA 3ABSB 3ZWQA 4MW5A 4YRQA 1LTQA 1NMXA 5EQTA 2ZIFA 1GEEA 5FRDA 1M76A 1LW6E 1SRQA 4TYNA 1Z0FA 4ESVA 3LY8A 4U4AA 1WU8A 3FCSB 4GKVA 5I4BA 5K2MA 1Y4SA 4BWFB 2B2NA 4W7SA 4B46A 4EPRA 2ZSUA 5G1OA 1EP3B 4QYXA 1W85A 1GFSA 1A9OA 1QVZA 2GCNA 5B30A 1Z2OX 3P0EA 4UMDA 2VYNA 1IXSB 1T0PA 3K9NA 4H1UA 4OGWA 3TZ6A 4A6XA 2QMZA 4BN5A 1S7GA 2ZXEA 3NEAA 1FBNA 3QKUA 1KVTA 2AIRA 4JCCA 3RFCA 1JQJC 3ASZA 4IIUA 3NUZA 3OF2A 5G3YA 1A4UA 1TMYA 4OXRA 2CNWD 1FSSA 1SOMA 1WKCA 3LECA 3FY4A 3M5CA 3SF8B 4NJMB 1TAGA 2C0CA 2QPOA 2YFYA 3F6YA 3BUSA 2HBYA 4XWGA 4F46A 2EIXA 3KZMA 4TMZA 1X7WA 4U2FA 2P5UA 3CEPB 4R71A 2HHLA 4GOND 3T99A 3JYHA 3E3AA 5CDGA 1QF6A 5KYVA 3AI1A 4LF6B 1I0ZA 1Z9BA 1XU9A 1TC1A 1PJCA 1P4SA 2Q0XA 5CU7A 1LDBA 5DLDA 5IAEA 1RXWA 2B21A 2MSNA 1SUWA 1ZWKA 4I1PA 1AGYA 3NXKA 2YYYA 4G0NA 1JHZA 1NUAA 4A0HA 1O6CA 2Z2IA 2JFUA 4RZHA 2A94A 3GQVA 2PS0A 3QWBA 4MUMA 1AN9A 16PKA 2EDCA 2VYFA 1KDZA 1WY5A 3SSAA 3DZHA 1C9JA 4JQOA 3RRJA 2NYUA 3BMNA 1HE8B 4BTLA 5F78A 4LQLA 1M6NA 1J0AA 3DS8A 1QZZA 4IR7A 1W85B 2HJHA 2CL6X 3HR7A 4WVFA 3UK7A 4UOEA 4RPLA 2FW9A 1PDVA 1AVTA 3MHPA 1FDVA 4PYIA 2PS9A 1CE8A 2WG0A 3R0QA 5DX1A 1R6DA 4BCCA 1Z18A 2PT9A 2PGXA 4NCJA 3G2JA 4HAOA 5AT1A 1WZUA 2WMYA 2GNAA 3NKVA 3OURA 5EN4A 4GYJA 2YWFA 1O6BA 3BICA 2Q1XA 5ELLA 1YZFA 4DWWA 1QR2A 3OZSA 1C4OA 4KRXA 1Y1LA 2EWVA 1CEYA 3FYUA 5DP1A 5EZSA 4C5BA 4GXTA 3HFJA 1PD0A 1T9DA 2I9KA 3S1LA 1QV7A 1PV1A 4EHDA 5JC1A 5PNTA 3F90A 1ONPA 1LSUA 1XL1A 2FMKA 1VL0A 4MS1A 4TS1A 1DO8A 5JNRA 4G67A 3GVCA 3WBBA 3LBHA 4BC1A 2XB8A 4KQXA 1PR1A 4V0SA 1YUBA 3MXOA 1MIOA 4POAA 4H7HA 3CBGA 4KPYA 2X77A 2ID4A 3MF4A 4F5WA 1C1HA 1K7CA 4LSZA 2GO7A 3LPDA 1UEJA 2VYND 1GZDA 2CVQA 2EDAA 4LVNA 5KYYA 1V4VA 2ECOA 2WUEA 1RYEA 4GKAA 4KVZA 4MYUA 4A0QA 5IFKA 1EG7A 1FMTA 5LL6P 1N0WA 2QZZA 4YJ3F 3WSVA 2DUWA 2NACA 2P79A 4JQSA 1N33B 3NDIA 3LLUA 3OICA 2WSSA 1EFKA 1G8HA 1XR3A 3NRCA 2EXXA 1PZGA 1UDAA 1G291 4K87A 1VP9A 3HV2A 1J07A 1GPJA 1PT5A 3LY9A 4JXZA 3KSDO 1J20A 1TJ3A 2X4GA 2PVPA 3DZBA 4Z0HO 1P7CA 4AULA 1UBOS 4NYJQ 4NK5A 3A2NA 4BUJA 1A98A 3OJFA 4RMJA 3EPLA 4FILA 4EEKA 4Q9NA 2YW2A 3OWXA 3SEQA 1R8QA 1EJ6A 1V7ZA 4P83A 1OAKA 2RH5A 2PRIA 3UGQA 1EQAA 2W6IA 3QOFA 3R7AA 1VTKA 4Q3KA 1YKGA 2OCLA 5HA5A 3KHUA 1PNRA 1SELA 2FMUA 2XUIA 1OIXA 1YI0A 3IA2A 3LQ4A 2G9QA 4Z0NA 5EIBD 4E2YA 2RI0A 4WA7A 3CNOA 3MFQA 1LU9A 3M9WA 2XYRA 1Y8RB 1L0BA 4J2TA 4WZZA 3C7DB 1Y8QB 1GTSA 4GKJB 2WWIA 3GIDA 3U4DA 2X5XA 5LQKA 1EUDB 2AMVA 5CA1F 4CM3A 2E1RA 2CLMB 5CT6A 1V5FA 1VKNA 1W25A 1Y1QA 2FLVA 3DLAA 3I6IA 1L5LA 1N77A 5DBFA 3VO1A 4JX8A 3FWYA 5JXGA 1E4EB 5HNKA 1WVGA 2A92A 3MGBA 1YKFA 4JP3A 7ABPA 2QRKA 4NG4A 4X5OA 5KTNA 4Q3EA 3TH5A 3H5NA 4M0EA 2VJNA 3L3BA 1HDCA 1I1OA 2HHHB 4GWKA 3LQQA 4W1QA 121PA 4B6EA 2J3JA 3ONEA 2HIHA 2EWWA 5CCXA 3C7TA 3KE8A 3E9DA 2JBHA 2ZAGA 1QNFA 4HQRA 1ZFNA 4I99A 4JUDX 3HRIA 3TXAA 2O5EA 4LOLA 5AVZA 1SXJB 5DI3B 3UWKA 3MD0A 1SZJG 4XGRA 3G7SA 1XCGB 1U5BB 1QCCA 3ANNA 3ENKA 1M5UA 5J1SB 4U7HA 2FQ1A 4PX2A 1VM6A 1DG1G 3DTTA 4KAJA 4ZO8A 3WDMA 4X6UA 1GPWB 3CX4A 2C4HA 1OZFA 1WDMA 3TRHA 3TM4A 1BGXT 3ELYA 5FUQA 1ZMBA 5EJIA 2ZQ5A 1T5HX 1NVTA 1AQJA 3I0NA 3KIPA 3VPSA 2IHYA 4NOJA 5AW3A 1J39A 1U7PA 3MJEA 1U7UA 1L6IA 4OLFA 3ZV6A 4MRMA 4WXRA 2E4VA 1RBYA 4MVJG 4Q5IA 2AOTB 5KTYA 4MVJM 1I7PA 1RMTA 1BXRB 2RGCA 2ZUUA 4Q66C 2AYXA 1HT0A 2B20A 2ZPTX 1NMQA 3JQFA 3KYDB 4ZT4A 2W6JD 4LGMA 4QO8A 4EDFA 3Q11A 2VDOB 3FYUC 3GUHA 1FLAA 1QIFA 2BEKA 3N6RA 4XIFA 2RHBA 3VR4A 4ZI5A 4KXVA 1M2NA 3I2JA 4WCVA 3HGMA 1LRJA 1M66A 2XTZA 3VYRB 2H92A 4P2GA 1ZH8A 1OREA 2W8BA 1T0IA 4ETWA 5LPNA 1R4NB 3I6BA 2QTAA 2YX1A 3R7DA 3T0FA 4QJ3A 4JWKA 4H17A 1HMYA 1FU7A 4BRWA 3EUFA 1EWVA 1Y1PA 2N46A 5CA0B 4F4IA 5LN1A 5DI3A 2GK6A 3ZZNA 3FJYA 3O4RA 3KJGA 1BFKA 1D2EA 5KS2A 1E9DA 2I2XB 4BU0A 1T3HA 3L06A 4BKMA 4AJOA 1ZAKA 2QW1A 2C04A 2NZUG 3E3NA 4CIVA 1YUNA 2BH9A 1FTSA 2J3EA 3LGSA 2HPZA 3PPWA 4R0VA 3MILA 1MR3F 3E9EA 4OHUA 2BYTA 1RAGA 2O1WA 3NHYA 1SBHA 3MOSA 3P9ZA 2XDWA 5CH3A 3SXUA 3K1YA 4CLHA 3IBSA 2E7ZA 2WMOB 1M5RA 5BNFA 4PZZA 2OHVA 1VJRA 5JE8A 2NG1A 4NCXA 4JVMA 3VHQA 4BB5A 1RPZA 1DXYA 4WIAA 4JY7A 3K2QA 1W1UA 2XQKA 3OJEA 4X6LA 2H06A 4MPDA 4XR4A 5BWLA 3LLMA 4CM8A 2DWQA 2QUBA 1RHRA 1IXYA 3X1DA 2JAHA 1P0CA 1U3CA 3G2IA 5JTTA 2XMBA 3EDYA 1EP2B 1ZR2A 3UY4A 1YVUA 1LX7A 5T4BA 1BDMA 2HWWA 2GFQA 4S1VA 4ZEVA 4GVLA 2H1VA 2HT1A 4LHEA 2HJSA 1CJUC 4QXRA 3TIXB 5HKOA 4U1RA 2MSLA 2CVOA 4YRRA 5KVQA 3C8ZA 4C7MA 3U61B 2F1IA 1THMA 2A5YB 3FF4A 4NESA 3LVFO 4HMQA 2BKXA 1WUJS 3LTNC 2H0AA 3HEAA 1DSSG 1G7RA 3O92A 4DANA 2J3MA 1IEWA 3JS5A 3DWIA 1EFPB 2Y1KA 3SX4A 2PPVA 4G84A 4LDZA 4I5EA 1SCIA 3I2FA 3OE7A 1UT8A 4RK1A 4H1WA 1YRYE 3UJCA 1JDTA 3TBHA 3C41J 2JARA 3DW1X 4K3VA 1G18A 2RAUA 1ZCJA 5E2BA 3SJCA 4BV9A 2JB9A 3ILYA 5HFAA 3W5BA 1WB4A 4KI0A 4XGKA 4YRCA 3CONA 2XYQA 4OI2A 2Q46A 2ISQA 3NANA 4GFDA 1GZ5A 1NR1A 3PI6A 4KH0A 5DBGA 4DARA 2IYAA 1GT91 4FDLA