3GJ3A

Crystal structure of human rangdp-nup153znf2 complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
202
Chain Sequence
b'EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 66
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj3A00
4LJ8A 1LF5A 4WA7A 3TVDA 5FUVA 3W8NA 2OXCA 1XEXA 2WWYA 2X1VA 1XD9A 3CRW1 2BM1A 3GJ8A 5DI3B 2GEVA 3F3YA 3IIJA 3R20A 4I1VA 4XWOA 4GDFA 1LV7A 2WOOA 1TTTA 4C3ZA 2CBZA 1T5IA 1VDZA 3JZMA 2HDNB 3Q9LA 1M1YE 4GBMA 4ZDWA 3TRFA 3VHXA 3N5CA 3I5XA 3KQNA 3AKYA 4PSAA 1R0XA 3BK7A 1Z0AA 3QOFA 4LV5B 1IJEA 2BC9A 3NBZC 4OI0A 4FWIB 4Q7LA 2W6JD 2KWIA 5B2ZA 3CO5A 4B48A 3W3AA 4AY2A 4JSYA 2DWOA 3H0KA 1JXOA 1GL9B 2BEKA 5EE1A 3U7EB 4ACBA 3WMEA 3GLFB 2WVJA 2J5XA 3KQLA 2PX3A 4BQSA 3AVPA 4URYR 3KZ1E 3HU2A 2KBFA 3EPJA 3SBDA 4WZ6A 1NL3A 2QPAA 4LJYA 1E9RA 4TL9A 2J7PD 2VRWA 3Q85A 3MWJA 3EW9A 1N5IA 3E1SA 1J2JA 2O52A 4UNPA 3MCAA 4N0DA 4IVPA 3A1VA 2ZROA 1Z5ZA 2Z0MA 3P32A 4XIGS 2BCGY 2GEDA 1HA3A 5AUQA 4B2IA 2A7QA 2EU8A 3A4NA 4OQMA 5JEEA 5L3QA 1SXJA 3MD0A 1ANKA 2HJGA 2VTKA 3GJ5A 4B32A 5JZVA 4V0OA 3BAFA 5FTMA 1VIAA 2RGGA 2XJ4A 5HE8A 4WZAE 5A5GA 3RHFA 1LTQA 3ND9A 5LDDC 3MJHA 3QKRA 5HCNA 1KGDA 3DMNA 2JLZA 1KZGB 1TQ6A 2JLUA 2I1QA 5TV2A 2V54A 3BERA 4LWZA 5FL3A 4RZ3A 1E2LA 1J8MF 2J0VA 2C2HA 4OQLA 4V03A 1Q3TA 2W2VA 3TVTA 4RD3A 2QENA 3DO6A 3L43A 4N0EA 3LD9A 1GL7A 4B71A 1IM2A 1E1QA 5KUTA 2FG5A 1EK0A 3K0EA 2JIZA 1JJ7A 4E09A 2OAP1 4TLDA 3VU9B 3GFOA 3SHFA 1G7SA 3WBKA 4F92B 2RH5A 2RMKA 1TQDA 2VHTA 3B82A 4FCVA 1X6VA 1Q44A 3G5UA 1SGWA 3UG7A 3K70B 3EIHA 5JJIA 1OSNA 4TL8A 4Q7KA 1XDBA 3BB1A 3NBYC 1FQKA 5A4JA 5TDHA 2WHXA 4TMZA 3B1YA 4I1SA 3SJAA 1OXXK 2IK8A 3KL4A 1M74A 2YOGA 4RY2A 4GP6A 4LCBA 1NMXA 4DLYA 4HLUC 1GWNA 1S0UA 1G21E 4QL3A 3LXRA 2BVNA 1G8YA 1S3SA 5AJYA 4S35A 4URVR 1MO3A 3TGPA 4JS0A 2QN6A 4A6XA 3ZJYA 1G1MA 3BD9A 1RC8A 5L3RA 3U5ZB 5JSZB 1FL9A 4MDEA 2OCPA 4WZBE 1TQ2A 1RRCA 4BEJA 3MLEA 3FVQA 1KKMA 221PA 4I81A 3S1AB 4RD6A 1D2NA 1F2UB 2VA8A 4NKRA 4W9MC 1HUQA 4HEJA 4DSUA 3KUDA 1ESNA 1WE2A 4NCNA 4YC7A 3FTQA 4D4MA 1F60A 4QM6A 4P33A 5FI0B 4Q9LA 2NZ8A 2NPIA 1JR3D 5JEDA 5IRCD 4G5GA 2GA8A 4NDZA 1A2BA 4AC9A 1RPZA 4B3FX 1S4QA 1SVOA 5JWHA 5AJXA 3RLFA 1ZM7A 3GLIE 4QHTA 2RGXA 4P0TA 2VPPA 5GJBA 1X86B 2V9PA 4NONA 1TUEA 4M4SA 2JJ8A 3K0SA 4HAVA 5EE9A 3UWOA 3FKSA 5FBVB 1XP8A 4D81A 5BN4A 5EE3A 2BJVA 5G53C 1OLOA 3OEHA 5M04A 1NKTA 4R2HA 4MQBA 1DS6A 3MRSA 1I4DD 2ZVPX 2P5SA 1CJVC 5FBRB 4CT4B 2VQSA 4DCSA 3G0HA 1Y63A 1KO7A 1W5SA 5FPHA 2NO6A 4PFSA 4PHHA 4LJ4A 2VO1A 3SR0A 1RJ9B 5AK0A 5IF9A 4BLOA 2J0SA 5JJKA 3B78A 1W36B 4JJZA 4FMDF 4KITB 3SFVA 3A1WA 1FNNA 3I1FA 4OHWA 3NXSA 1QG2A 1YR7A 1AGRA 1TL7C 1UDXA 4C7OB 3UMFA 4BFUA 3ZD7A 1XJQA 1KDOA 2WKQA 3FMOB 4RCYA 2K5UA 4DC9A 1KMHA 2QQEA 2QMUA 2PLRA 1JAIA 3EASA 1KJZA 1EG7A 2Q3HA 3B85A 5BYJA 1XU4A 4YMSA 4W5JA 3VX3A 2IX3A 4DSNA 2J46A 2VEDA 4NYJR 2ODBA 4EPTA 3UWKA 1G8FA 4KU4A 4Y0VA 3BFVA 4PPNA 4TQUS 1GAJA 4BFYA 4Q02A 4QBGB 4IJMA 1M6NA 4W5HA 3GJXC 1GNRA 1LNZA 3LW7A 4C0AC 2OXRA 3KKPA 5IHPA 2GJ9A 3C5CA 4DSTA 1SHKA 3AV0B 5K8UA 3T1VA 4F38A 4E5UA 2ZI7A 2QI9C 5EXTA 2GJSA 1FTSA 2QMEA 3P1JA 2E9SA 5FTJA 1E2DA 1NVVQ 2BMDA 1G8GA 3PFIA 1CKEA 4LBZA 2ZJOA 3O47A 3Q8XB 2MSDB 4IOLA 4BPBA 1EXMA 4DEYA 1QHXA 4ESHA 1G5TA 2C77A 2OBLA 1TQ4A 3R7WB 2H5EA 3ZIAD 4DLSA 5C2JB 1NY6A 5CDFE 2XSZA 4RVCA 2B6HA 3VR5A 1ZD1A 1UAAA 1ZM4A 1J7KA 2H7VA 3BFXA 3LO5A 4TQ9A 4Q1DA 4GP7A 4LY6A 2VP6A 4Q1AA 2QG6A 1T91A 3N2IA 1NVWQ 5GJCA 4DLZA 1WCV1 3TUZC 1W47A 3EZ9A 2PX0A 4JL6A 4QG7A 3TSOA 3VX4A 3ZDQA 5C46F 4IFEA 2FFBA 5LPNA 4LBYA 3TK1A 5TB5A 4DWJA 3CF2A 2XTZA 1VPLA 4WOPA 5AJZA 4M0LA 1G3IA 2YWHA 1F6BA 1NY5A 3FFAA 1OFTA 5IK2D 4RKFA 4A2PA 3DKVA 5DYIA 3HWSA 2QPTA 3Q7PA 3PCRB 2JLSA 4HAXA 5JCZA 5FR1A 1RRGA 3TIFA 2AD5A 1ZINA 1W1WA 1XB2A 4LHVA 4M1YA 1G17A 1Q57A 2C78A 1E32A 1XF9A 2WZQA 3RS2A 3A1TA 1GKUB 1F2TB 3IBYA 2F3RA 1NN0A 1US8B 3EG5A 5KPDA 1GRNA 3LVRE 1QZXA 4TZ6A 4MUBA 2OUKA 3AVYA 3KDSE 1X1SA 2CHQA 1ZNZA 3QENA 4JVLA 4YLGA 4CT5A 5FH9A 1FX0B 4JL8A 2FEMA 1NI3A 2HF8A 3N2EA 2P65A 3QI2A 2ATXA 2J0UA 3BS4A 1X8KA 4GZMA 2HCJB 1BH2A 3QKSA 5KOYA 1HQCA 3QKUA 1XBTA 2ZE6A 4M1SA 1N6OA 1OXUA 2ZSAA 1KSFX 4JLAA 3ADCA 1XFAA 1EWQA 2OLKA 2UZ3A 4O2RA 1HYQA 2CDNA 1ZMXA 4WXRA 5P21A 2O5VA 1NG9A 1ZYUA 4ITRC 2V7QA 3GCGA 4A8JA 1NLFA 1VG0B 1XPUA 4F4JA 4MH0R 2H92A 3RS5A 5L3VA 2QAGC 1JPJA 2HYDA 2A9KA 1KDRA 3EIEA 1GIAA 1VECA 1LS6A 5CK5A 4E03A 3Q72A 2MMCA 4JLOA 1ZM3A 1XMSA 4PPGA 4NBSA 3EIQA 4WW0A 4XWAA 5BWMA 5EJEA 2ZAOA 3CRMA 1COWD 3RRZA 3T34A 1KSHA 2PCLA 4LYJA 2P6NA 3A4LA 4OHYA 3ADKA 1HEIA 1JR3E 2P6UA 1II9A 1T4GA 2EYUA 4CDGA 2Z5FA 4DB2A 1SXJD 1WRBA 4YMVA 3QIAA 421PA 3K0AA 5FTKA 3CONA 1R4AA 5KSOA 4GSYA 4EJSC 1H8HA 2GILA 3TH5A 3PUWA 5CB6A 1G3MA 1SKYB 3UMRA 1N5LA 3QVUA 521PA 3DVLA 1OYWA 3T1TA 3P4YA 4QJ4A 5SZJA 4KVGA 1PJRA 1YJ5A 3QJYA 1P2SA 2FGJA 4LYHA 4M9QA 4B35A 1XCMA 3ZD6A 1T8UA 2GZAA 3FDIA 3DOEA 4HLDA 5AR1A 4C4PA 1KJYA 1K6MA 4TMWA 1U0JA 4V0LA 3TQCA 3ZVNA 3THYA 4C2TA 4IDNA 4B3GA 1E1QD 1SVIA 4QOSA 3TKLA 4YDHB 2JIZD 4ON9A 4TYPA 1ZD9A 2F6RA 4LBVA 3VAAA 3SQWA 2ZRGA 4DLRA 2DFNA 1NN3A 4TTRA 2JLVA 3ECCA 1P4SA 1NVVR 2G3YA 1MV5A 2H8KA 1IBRA 1LY1A 4Z1MD 4AKGA 1KK3A 4TT3A 2ZEJA 2VF7A 1NNEA 4QJ3A 4A2QA 2NO7A 3U44B 2VBCA 3CRVA 1EFHA 1OW3B 1U8ZA 2FF7A 1UM8A 4UXIA 4PSVA 3I72A 3GPLA 3NVAA 1CRPA 4OHXA 3DZDA 1OIVA 1XEWX 2QE7A 3VQTA 3CRRA 2NIPA 3DHWC 3GLGE 1RKBA 1VG8A 1BYIA 3QXJA 4B75A 1KAGA 1N5KA 4G01B 4JYCA 3K8YA 3W6OA 4JKIA 5H1YA 4HDQB 2ZUDA 2Z4RA 3WRXC 1R5OA 2PL3A 2Z6VA 5L8VA 1N3BA 3PITA 2VHUA 1NN1A 4MA4A 1EFCA 5DN6A 4JLPA 2LKCA 3RRMA 3ZVMA 3B7GA 1MABB 4Q47A 5HZKA 3GLIB 1Q1BA 5FBWB 4A0GA 4H9GA 5JS7A 4AI6A 3FKQA 1OH7A 1II8B 3IBGA 4FCWA 4KBGA 3SJCA 2YHSA 4B44A 3J81k 4Q18A 3CZPA 3I5YA 1GDDA 1AGPA 4R71A 1IJFA 3TAHA 1Z83A 4FN5A 2ONKA 5H68A 3SI7A 4QNMA 2IS6A 4Q4AA 3L0OA 3CPEA 3NEJA 1T3HA 2YWFA 4U02A 3X1WA 2CNWA 3THXA 1W4CA 1Z6YA 4LBWA 4QC2A 3CB4A 1KI7A 2Z4SA 1Z2AA 3RC8A 4CZ2A 1ZU4A 4PZZA 2OCBA 3AB3A 3K9GA 2QAJA 5KNDA 1FQJA 2FDCA 2KE5A 1KJWA 3FHCB 1N0WA 2TMKA 3UATA 1OJLA 5J40A 2F9LA 4PZLA 4DLXA 5FOXA 2OAQ1 3SJZA 1KDTA 1KKLA 1D2EA 1U94A 2IYTA 1N2CE 3A37A 2EFHB 1SXJC 3FHOA 4XTCS 3RWMB 2D7CA 5DI3A 4LHWA 5EP3A 3QG1A 1T6NA 4HLCA 1OPXA 3CZQA 4TTPA 3RS3A 1VCOA 1XXHE 1NBMA 3PG5A 2J0QA 1GITA 2IHYA 5FPKA 3AVQA 2G0TA 1KNQA 3LAWA 3I8XA 4AURA 4UXJA 4M2LA 3WP0A 2Q9BA 4BRUA 4ZI2A 3HPQA 3OZXA 4BUJA 3T5GA 3RAPR 1SVLA 4BFTA 3U7FB 1UADA 2IYZA 1IQPA 3GLFA 3GP8A 3PEYA 2IS1A 2O8EB 1EESA 3IQXA 4IOJA 2O0JA 3FFBA 4HAUA 4URWR 3KQUA 4JVSB 3SFZA 2VSOA 2KI5A 5GVRA 4TLEA 2G1KA 1W2HA 2B7CA 1AS0A 2VHQA 3HP1A 5FUXA 2OCYC 3IGFA 5LBIA 1XTJA 4TMKA 1N6IA 2IYLD 1P61B 1GG2A 3I3SR 1SKQA 2AKAB 2J7KA 3K09A 1KO4A 1CU1A 4B3CA 1BMFA 1UBEA 4FXPA 5KPJA 1V43A 3VR4A 5SZHB 3CLVA 3QXSA 1E2HA 1FPMA 3RNLA 3SEAA 4N1AA 1OFUX 4IHQA 2WV9A 1Z0KA 2A5FA 5CIQA 5DYGA 5JCPA 2Q3MA 2CE7A 1VHTA 2H1LA 3GLHE 2OSBA 4M1OA 1CF4A 3QPWA 1XD8A 3I61A 1OKKA 1Z28A 3Q7QA 2G83A 3D6TB 5CJ2A 3B1WA 1IOZA 3FYHA 4IRUB 3U3RA 1KY2A 2CL6X 2ZR0A 5CYOA 5FI1B 4F4CA 2WWGA 2QZ4A 2FPKA 5EZ5A 1SXJE 821PA 4LX0A 2IEYA 1SVMA 4IDQA 1WBDA 5DI9A 3MUFA 1UEJA 1L4YA 4MKIA 3NEYA 1CP2A 2JATA 1X8LA 2BHRA 3OHMA 4HLQB 3PQCA 3VU9A 1N5JA 1CJTC 1VYTA 3AP3A 4YQFA 2A5YB 1E2GA 2G77B 1DAHA 1T5LA 1EFUA 1SQ5A 2YVUA 4B2PA 2JGNA 2WJJA 1PLLA 2YV5A 1KO1A 1JR6A 3C7KA 1YZQA 1MT0A 1YZNA 3FE2A 4GMDA 1SULA 2VSFA 4ZKEA 2C98A 3BBPA 5EP1A 3A6PC 4QJ5A 4ZDIA 1ZNXA 4WBSA 1AN0A 5F98A 1BS1A 3TR5A 4EIWA 3QSYA 3CWZA 3DMDA 1JQLB 1QF9A 1ZM2A 2ZYUX 4MRVA 4I4LA 4G0NA 1AJEA 1FP6A 1HE1C 2FEOA 5JSZA 3SJBA 4OHVA 3M0EA 1N6LA 3B1VA 3S1AA 4DSOA 1F2UA 2QTFA 3NHAA 1S1MA 2AKYA 1G7TA 1G20E 2O8FA 4R98A 4EDHA 3A4MA 3W3ZB 1A1VA 3AF2A 1P75A 2HF9A 1ZP6A 3U4QB 2QMHA 4L5BA 1ONBA 1KO5A 1M7BA 2C04A 2V7QD 4KSCA 5L3SB 2P5TB 4DCVA 1FTNA 1KZ7B 4A82A 3RC3A 5J4LA 3K0FB 4ASUA 5EXXA 2OEPA 4HSEA 2ZSEA 3DDCA 4OJQA 1OFHA 1U99A 3C16C 3OEED 4LHXA 4UJ3A 2X77A 3UK6A 4PAMA 2IXFA 5K8IA 1A2KC 2FFQA 1GUAA 3M6AA 3RS7A 2VP0A 3LA6A 2AXNA 3OAAA 2ZSBA 2W2XA 4C0HA 1E2FA 4JLVA 3PEVA 2EWWA 4PANA 721PA 2XNDD 2L0XA 3KJGA 4MRSA 4Q4HB 4ZV4A 1I2MA 2AXPA 1E6CA 1MO6A 5J4HA 1H8HD 2H57A 1HQYE 1OH6A 1IY2A 3DM5A 3UPUA 1RJ9A 3V9PA 3FMIA 4OI4A 1KI6B 4TYNA 5E95A 1S1CA 1JECA 1IHUA 3GJ3A 1IN5A 3QKTA 3CX6A 3K1JA 3TLXA 3LNCA 4C7OA 1JJVA 1UEIA 3MSXA 3DKPA 3U3OA 1ZNYA 3CR8A 1T0HB 1OE0A 1LFDB 1R8QA 2DB3A 5EP4A 4N3NA 5J4YA 2CCKA 2ZR9A 1U9IA 2BBOA 2ZRKA 3T5DA 2IC5A 3THWB 4KV9A 3B13B 5H8WA 1DADA 4RD4A 2QSYA 3SC3A 4Q7JB 2XB2A 4TT3D 2DBYA 4PQYA 1GNQA 4XVQA 2BMJA 2ZJBA 1CXZA 3JVUA 4PSKA 1X8JA 3D8BA 2ASEA 2H16A 3NDPA 3UMSA 1M7HA 2BKEA 2GRJA 2ORIA 4MYCA 5CM8B 3REFA 3VNVA 4Q9HA 1ZIPA 2PEZA 1DPFA 1MH1A 3PXGA 2QE7D 1JB1A 1KHTA 4PHFA 1SHZA 4MITA 2ZRNA 4MRNA 3L0IB 2GHIA 4PAOA 3O8BA 2R6AA 3U3MA 3N70A 4B47A 2OZEA 2AK2A 1U0HC 3BIFA 4DKXA 2DFLA 3O8RA 3PR1A 3KKMA 2FA9A 2HUPA 1Z22A 3C5HA 3TSZA 3R7WA 1OT3A 5DN6D 4EKDA 5F3WB 2WWIA 2Z43A 3LLUA 1PUIA 3EC2A 3QXHA 5FOUA 3U3KA 3BE4A 4HI0E 5E4FA 3EPHA 1FZQA 2NO9A 1D2MA 2XOKA 1YKSA 2O8DB 5GVSA 2FE4A 4QKQA 2ODWA 2FJUA 3I73A 1M34E 1XZQA 3IKJA 2WICA 2NPFA 4AIIA 4UNQA 1FW6A 4P3YA 1JEEA 5LB4A 1NKSA 2WIBA 4A8JC 1GNPA 1NP6A 4JLDA 4DJTA 4AD8A 4ESVA 1TAGA 2P6RA 1K8RA 5IT5A 3ND8A 2FPMA 2GXAA 3IEVA 4RZ2A 4ZI3A 2FMXA 3NKVA 2CNWD 5KSPA 1P62B 4GPTA 1M8PA 3CX7A 4LSGA 5DIFA 4F91B 2ZI5A 3MWKA 4PQRA 2JLQA 5JHHB 2X19A 2WWXA 3RYTC 5LB2A 4XWKA 1RE0A 1YR8A 2ZJ8A 1ELOA 3FB4A 4US0R 2KBEA 1ZRHA 2DFKB 1DE0A 2R6CA 1PVOA 4LI0A 4TWZA 4A2WA 1G6HA 5FOWA 3K9LA 3CNNA 5DISB 2ZPTX 1NJFA 4FWTA 1F2TA 1JPNA 1US8A 3T1QA 5DE3A 4HZUB 1F3OA 3BGWA 1Z47A 2GZHA 2R65A 4DCTA 2GDJA 2IUUA 2XTNA 2FV8A 2NGRA 1D9ZA 4QGFA 4DIEA 2J1LA 1DO0A 1XEXB 3CPJB 2D74A 3WYGA 3EZ2A 2NTYC 1NBMD 4B43A 4D0LB 2O0HA 4XVRA 3QQ5A 4Z8XA 1T3LA 3NC1C 3LXXA 3IDQA 2QU8A 4JIMA 3TSWA 1C9KA 4BZPA 2ZRBA 2JJ1A 2JJ2D 2PZFA 2FNAA 5LD2C 2ZS8A 1P7CA 1G3RA 2F1HA 2VH5R 1NMYA 2Q9AA 4HAWA 4WXPA 2PZGA 3U6BA 5C18A 1D9XA 2JLWA 2ZJ5A 5CLLA 1VYVA 2VP4A 1TF2A 1QRAA 2IS4A 1XJCA 3PIRA 3QUSA 4TN1A 5EZ6B 3SBEA 4M8NE 1ZVQA 2QUZA 4CIDA 4QHSA 3TBKA 4PR0A 3WRYC 1WQ1R 3GLHB 3I92A 4Q1FA 4F4IA 2BMFA 4TMVA 1Z2CA 2ZI3A 3HPRA 3IIMA 5HCIA 3SHWA 3W6NA 4YMTA 2Q21A 4OQFA 1SVWA 2CK3A 2F43B 5BN3A 1R5BA 4D4LA 4M1MA 4IVRA 3SYLA 4G1UC 2P3SA 1OKKD 1N6RA 1Z0IA 5B57C 2XITA 4C0KA 1CJMA 1XPOA 4NMMA 1ZJ6A 4HUQB 2EW1A 2IYWA 4O2LA 4X8HA 2GAAA 2XX3A 4HB2A 1TX4B 1J70A 2FFAA 2XGJA 1Q22A 2ZS7A 3I4LA 1RVDA 2QORA 2NO0A 1J90A 1I4LD 2KJQA 4PO9A 3GJ7A 2REXB 4NYIQ 4JVNA 2QP4A 2YZ2A 4DUGA 4HDCA 2BIFA 4Q1BA 5D3MB 4YMWA 2RGNA 2MMGA 1VTKA 2CHVA 2PLFA 4O25A 2IW3A 2IHBA 1JALA 4KI0A 3K70D 1OH8A 4G5RA 1N0UA 4X8LA 3FMFA 2J3EA 1VG9B 3U44A 3U7HB 1ZU5A 4Q1CA 4Q4JB 5HTKA 1Z0FA 5KHOC 1PUJA 3B1XA 5FPTA 4MYTA 4MYHA 4W5WA 4OI1A 2EYQA 1XX6A 4P4UA 4FMDB 1RZ3A 5DNYB 3EZ7A 4B33A 1TEVA 2DWQA 3EPKA 2ATVA 3VR3A 3ZGXA 3P27A 3IO5A 4G3XA 1Q12A 3VTKA 4DBLC 4ZDJA 5F9FA 3TJZA 5GADl 4QBFA 1M2OB 1QDEA 1D8TA 3M4YA 4IKEA 2HV8A 2SHKA 1P9RA 3VKGA 1PLJA 2DFTA 2IXGA 1VCNA 3LRPA 2ZYWX 4GOKA 2EFCB 3EZFA 1KO8A 2ZRAA 1MABA 4NL4H 1ESMA 5TARA 1H8EA 3W5IA 4ZIRB 1XMVA 3IQWA 4FD2A 4IOKA 1XZPA 4D0NA 3ZH9B 2XZOA 2GBLA 1DAGA 2AFHE 2FWRA 1II8A 5HR5A 3OESA 4KYUA 2FU5C 1BIFA 1W4BA 2A30A 2D4HA 4PO8A 3LBHA 2ZI4A 4ASUD 1M7GA 2ZRPA 3B6EA 3P20A 5E7IA 2HYIC 1CS4C 5G41A 4LRWA 4NP6A 1TPZA 3IILA 4X8OA 2A2ZA 1MO4A 2RGDA 4YDSA 3EWSA 4RD2A 4A1FA 4RZXA 4PC3A 3ADDA 4G5OA 5KU1A 2OFWA 1G8HA 2C9CA 3EA5A 2QQ0A 2W00A 3K09C 3UIEA 4TSFA 3AKDA 2ZXUA 1G7RA 1CULC 4MKFA 4LOAA 3U6KA 1AK2A 4U7DA 4K8OA 1P72A 2Z83A 3HR7A 1LB1B 3R8CA 3FWYA 5DGXA 1DTSA 1E2PA 4QNRA 1VHLA 1Z6TA 1IN7A 2P67A 1GTVA 4OQXA 1W36D 4XOIA 2FZ4A 4BE7B 2WSMA 1UBFA 3BRWD 3KX2A 5BYKA 3LY5A 4OK3A 2I3BA 1OYYA 4GFDA 2ZAMA 3SQXA 3QXCA 4OBEA 1HV8A 2XXAB 1KI9A 3ZVRA 4DB4A 4YMUA 1E1RA 4POAA 5K8LA 2FH5B 3KFXA 2QRZA 2YNMA 1HTWA 4QM7A 1S96A 5C4MA 1W0JA 1O87A 1R8SA 3TUJC 4C0SA 4TLBA 3GD7A 1NBME 5J4KA 5F2EA 2ZE7A 1A5TA 2GNOA 1UPTA 1P2TA 4AYTA 2FZLA 3K70C 3E70C 3F0TA 4KFUA 5CYPA 1Q1EA 3RSOA 1NIPA 4DLUA 4LC0A 3AF4A 4V0KA 4OYHA 2NQ2C 1KK2A 1OV4A 2BEJA 3GLFE 4Q01A 1WXQA 2CLDX 2LCFA 4KBFA 2NOAA 3X1XA 1CJKC 3AF0A 1N25A 1Q1QA 5FOSA 2X8AA 5FL7A 2GCOB 5JFGA 3OIYA 1Z6XA 4EAQA 3VKHA 1U8YA 5JRZA 3AGQA 4CYMA 1AZTA 4IXMA 5TVKA 4Q9IA 4CEJB 1QG4A 3VHLB 1XD2A 2B7BA 5SZKB 1ZC3A 4TYWA 1CR4A 3FPAA 2F7SA 2PT7A 2ZVQX 4MYUA 3M1IA 3C41J 1ZC4A 2WJIA 1W44A 2R44A 2FSIA 4RFSB 1ZW6A 3AVUA 3CNOA 2V8OA 3LBNA 3QF4B 2XOKD 1UDWA 4PTLA 2O8BB 4PQFA 1NN5A 1A82A 3SYNA 2BJWA 4RZUA 2P2LA 3L8YA 1YRAA 2QGZA 4RFVA 5ELXA 2REBA 3SZRA 3ZS9A 2ZRFA 2ZREA 2QRNA 1CR0A 2G88A 5FTLA 4Q00A 1NF3A 1ZCBA 2QL6A 2N1BA 2CEAA 5FUWA 4AYXA 1WBBA 1NMZA 4NYMQ 3AUXA 4YXWA 3W6PA 4GT1A 3MGCA 2V6IA 4LYAA 5KSYA 4DDTA 2R6FA 2GCPA 4TLCA 4ACAA 2WOJA 4LJ5A 3RDPA 3PUZA 4P4TA 4JLKA 4NTZA 1E96A 3E5HA 4GI7A 3L82B 3A58B 1G19A 4EQ6B 3L8ZA 4JMPA 5HE9A 4CEIB 1E9EA 3AP1A 5E7MA 3HU3A 2OFXA 3FKSD 4HB4A 2VL7A 4I1UA 4B74A 2HXSA 2WKPA 1W36C 4C0BA 4Z8YA 3OEHD 4HZIA 1R0YA 2EVWX 2W0SA 2UZIR 1KNXA 3AKCA 3W5JA 2YC2C 3ZS8A 3ZQ6A 2VLIA 2JJ1D 4CGZA 5JWRA 5E3HA 4JBXA 5CLQA 1P6XA 2W0MA 1E2IA 1W49A 2IXEA 2BOVA 4XD7A 3A8TA 1N6KA 2F3TA 3U4QA 2YC4C 1JXMA 1TEXA 1QHHB 4ARZB 4TLAA 2AK3A 2OESA 4AYWA 5L3SA 5JJLA 1VCIA 2A5JA 2ERXA 3WNCA 1S9HA 4PC2A 5KDOA 1W7AA 1S3GA 1AKYA 3K0FA 2GXQA 2ZSFA 5AUOB 4C0LA 2W58A 4MGKR 2Y8EA 2V3CC 1IONA 1KI8A 1MRSA 4BRWA 3ZZ0A 2E87A 1G18A 3LFUA 1RRPA 3PENA 3Q3JB 3KB2A 1IN4A 3BOSA 2QSZA 4Q9JA 5DLQC 1HURA 3RVBA 4PHGA 1IAQA 1ETUA 3AEZA 3OE7A 2YWGA 4NHOA 2CHGA 1UKVY 3KXIA 3L2OB 5EXPA 4BASA 1VMAA 3I8SA 2V6JA 4B2LA 2QBYB 4AG5A 5KTYA 2CK3D 3GJ4A 4Q4HA 4DXAA 3FHTA 1IY1A 3LV8A 2XAUA 2FX3A 2QTHA 4TYQA 1A4RA 1JAHA 1E4VA 3I62A 4HATA 2ZTSA 3PUVA 2GVZC 2XB4A 2W6IA 1JNYA 3TW4A 1IXZA 1XTRA 3X1YA 1E98A 4L15A 4KAXA 1D6JA 4EPVA 4OI2A 1W4AA 2LKDA 3DZ8A 2GJKA 2J41A 4FMCF 4RD1A 5G40A 2VP2A 1T8TA 3QY0A 1AS3A 2VHJA 3EXAA 4DHEA 4QBHA 3B60A 4XJXA 5DHAA 5JBQA 4Z54A 1HY3A 3RRYA 3BC1A 3KUCA 3ZZUA 4D6PA 1GP2A 1E9SA 4DCNA 4DUGD 1WMSA 1DG3A 2R6GA 3KJIA 1NLZA 2OBNA 4KJZA 3THWA 1YHNA 2XSZD 1WDTA 2VF8A 4QRHA 2V1UA 4C0JA 4OL0A 1Z8FA 5KSZA 2CCGA 4LC1A 1GVNB 1JQJC 1NSTA 1QHSA 3K53A 4DDWA 1XTIA 4WVFA 1QHYA 2JAQA 1T0JB 4U5XA 3C14C 3GMTA 1J99A 2Q6TA 3QBVA 3WP1B 2XTMA 1VCMA 5J47A 2DCUA 3CX8A 4DLVA 3IPYA 1OB2A 2C03A 1UBCA 2O8CB 1HH4A 3IHWA 3O8CA 1G7CA 4FINA 4UNSA 2G0NA 2ZRLA 2JLYA 4AKEA 3H4MA 2WIAA 2WAXA 3U2QA 4AKIA 3KTAB 3NTUA 3V00A 2REOA 1LW7A 4EFMA 3VKWA 4LUCA 4R9UC 3LLMA 1DAFA 4BFZA 1U81A 3RSLA 2XEXA 2RKOA 1FNMA 2WPDA 2CXXA 3LBIA 1UKEA 1R5NA 5A0FA 2LWIA 5FFMA 2XNSA 4JLNA 4E07A 2O8DA 4NYMR 3K0CA 3SS8A 2QY9A 2VSXA 1WA5A 2R8RA 1T3SA 5TXGA 3SYKA 4BWYA 1SVKA 1GL6A 3RANA 3IHLA 2PJZA 4DLWA 4MRRA 1GKIA 4O3MA 2GESA 4FMCB 4M22A 4BLTA 4BFXA 1B23P 2JDIA 2ZIAA 5KNCA 4Q48A 1H65A 1YZUA 2X2EA 1E0AA 2FN4A 2IUSA 3PUYA 4TMXA 4KFTA 1TU3A 4PC1A 5FOVA 4BFVA 4BFWA 5CIWA 3JZAA 1OIXA 4TSFD 4ZCLA 5EXSA 4RCZA 4AKHA 1E2JA 3GFTA 8OHMA 3THXB 2GTPA 2H17A 3OIWA 3U60B 5B30A 2GJAA 3P4XA 4URUR 3VMFA 3X1DA 4HB0A 4LK2A 1KK0A 2CJWB 1G291 1VKJA 3CR7A 4BZQA 3LWNA 4HZUA 1LF0A 2J45A 3C4JA 3HR8A 3JVVA 4IFBA 4PX9A 4OK5A 4LV6A 5ANRB 3CRQA 1W48A 3BB4A 3DL0A 3EAQA 4B3DA 1PV4A 4V0MA 1W5TA 2IYUA 2RGEA 1OXVA 4PPFA 2D06A 3TMKA 3K9HA 1AZSC 2WM9B 4IEIA 2R6DA 2QTVB 1YU9A 4DDUA 2IS2A 3MFYA 5JWOA 1QHGA 4M9SA 2C99A 4A0RA 1E1RD 3AVXA 2IA5A 1L2TA 2AN9A 4QFMA 4AK9A 5HPYB 3AVTA 5EE5B 4B3XA 3CUEF 1XJ0A 1W0JD 2R9VA 2ZR7A 2VHCA 2GZDA 2ZRIA 2ZJ2A 4OQNA 1KY3A 4PHTA 2RGNC 1JEDA 1U0LA 4AG6A 4A36A 5DHFA 3GJ0A 4QGAA 3B8HA 3QVVA 1GFIA 2OO7A 1FUUA 2IBMA 3WMGA 1EX6A 2BM0A 4KLNA 5CB8A 2ZJYA 5EQTA 2QA5A 1E9BA 1Z06A 2QT0A 1XPRA 1DG1G 1G5PA 1DO2A 3GLHA 3WHKA 2JLRA 2D3WA 3QEJA 4LHYA 4XVUA 3B9PA 2WKRA 5FL7D 2JLXA 4TQAA 1E0KA 2UVQA 1COWA 2ZE8A 4MGYR 1JI0A 1SVSA 3EX7C 621PA 2N46A 1F5NA 3ICQB 4I99A 2QAGB 2ANBA 2F43A 4MGIR 4F7WA 4FMBB 2J59A 2ZI6A 4NYJQ 2F1JA 4D82A 3CWQA 3UKDA 2EFGA 3RRNA 3GLGB 3BXZA 3FOZA 1XNJA 2V4ZA 5DH9A 4HUQA 2BBWA 1RFLA 2ZRCA 3IUYA 4Q9KA 4B76A 3ZLJA 2FOLA 1FOEB 1K5GA 3AUYA 4IDPA 3LX8A 1G3QA 3QBTA 4BLSA 1CR1A 5AWFC 5GJVC 2B21A 2DPXA 1RW4A 2RAPA 5CJPA 4IDOA 3VR1A 1J8YF 2GBLC 3NG1A 4Q66C 4WAUA 4BZXA 1GZSA 4UNRA 6Q21A 1VYUA 5TMPA 4M53A 5FR2A 1SKYE 5D3MA 4EJSB 3CM0A 1NJGA 3IIKA 1AKEA 4P4SB 4DT1B 1UF9A 2ODNA 2IYXA 3BORA 4KCGA 4LPSA 2BDTA 1LS1A 4V02A 1E9FA 2IYSA 3KKOA 1NRJB 5JMTA 4ZKDA 4Q4JA 3ZVLA 2D2FA 1IXRC 1MR3F 2PCJA 4YXWD 5JS8A 1G16A 1Z63A 1WP9A 4Z1MA 2EQBA 4DRZA 2B8TA 2Q3FA 4TL6A 2CVFA 2A3RA 1N6PA 2D7DA 1UBGA 4TMTA 3NDBB 3KQKA 4H1VA 4A0FA 2GJ8A 4DIDA 2AD1A 2FPLA 3LW8A 5BXQC 3U3JA 4UXHA 3ZQJA 1NLYA 1C1YA 4B73A 1S8FA 3H1TA 2IYRA 1EFTA 3B5JA 3PUXA 1W46A 4D4KA 5C1BA 1Q20A 3VR2A 1S9DA 2A5GA 2ZE5A 1R2QA 1QVRA 1DAMA 4DCUA 1JBKA 2ZJZA 2RGBA 2QNRA 3H2YA 4L8GA 5H70A 3TQFA 5FTNA 3LVQE 3D3QA 4GNKA 4CEHB 1VIYA 1XXHB 3ICEA 2IUTA 3SU8A 4XD7D 4ZIRA 1DAEA 4TL7A 3ONWA 3AF3A 4OKSA 1W4RA 2F55A 1FMLA 3WYAA 2DWPA 1K5DA 4QXAA 2GXSA 1EFRA 4DZZA 5B64A 3KJEA 4IW3B 2O8FB 3QEOA 1FX0A 2YWEA 2IYYA 4NZYA 2WMNB 1OIWA 1E2QA 3NBXX 1KMQA 4QHYA 1HT2E 1X3SA 2GEUA 4Q5IA 3O8DA 4BLQA 4LHZA 1I2DA 2WSSA 3L0PA 2OT3B 4K46A 1UKZA 1VG1A 1YQTA 1Z29A 3ADBA 2ORWA 1RYHA 4BLPA 4C30A 3OE7D 3WNDA 4FIDA 2QM8A 2FFHA 1X1RA 1E2NA 2NO1A 2P0EA 4CF7A 3A36A 4BLRA 4MGZR 1NSFA 4A6PA 4Q21A 1DVRA 2OBMA 1TMKA 4I1OA 2ONJA 4JSTA 1U2RA 4B3BA 1W0KA 2QEQA 3ASYA 2OCAA 2GF0A 4RJLA 3OIVA 3AGPA 3C8UA 2W6ID 1BMFD 1FFHA 4A0HA 1P2UA 4AWXA 1E94E 2AL7A 4FCTA 4NCHA 1ZCAA 5KNBA 2V55B 4D26A 1UKYA 4D25A 2ZUBA 1SZPA 2C9YA 4JLBA 1YRBA 2WJYA 1Z6GA 4JT4A 2XXAA 4PC6A 3VNUA 1GILA 3CW2A 1Q3HA 5C4GB 4GOJA 1N6HA 1P9WA 4P31A 4PO1A 5FBLB 4GRAA 3AH8A 2HLDA 4EPWA 1XRJA 3HJNA 4QGHA 2XJ9A 2ZM5A 3BWDD 4EPXA 2QT1A 4IXNA 1E2EA 1SXJB 1YR9A 5L3QB 5FOTA 3KFVA 4KVAA 2EFDB 4Y0AA 3MG9A 2D62A 3W90A 3RWOA 1AM4D 3H84A 2ZS9A 2ZI9A 2AR7A 2ZRHA 4H1UA 3QKRB 1FUKA 1L8QA 3PEUA 2MSCB 1XTQA 2R2AA 2YYZA 1IXSB 4US2R 2BMEA 2ZITA 1F48A 5AJVB 3RS0A 3SNHA 3H86A 4F93B 1Z08A 1Q0UA 4ZO4A 4JKYA 2ZU0C 3HU1A 1YZKA 1E0SA 1G3UA 4RD0A 4XH9B 2HT1A 3AKEA 4U00A 3T15A 2GCOA 2ZRDA 1CBUA 5FUYA 4Q1EA 5SZIA 5JLJA 4JZKA 1Z6AA 5J4VA 4EFNA 3CH5A 3CF6R 1E79A 3OFNA 1KI2A 4M9XA 4CEJA 1NVUQ 2OG2A 4URXR 3HDTA 3KJHA 2WJVA 4ZCIA 2G6BA 4HYYA 4ZDKA 1CIPA 1N6NA 2N42A 4NH0A 2PT5A 1E4YA 4TZ0A 3LDAA 3WHLA 4RFSA 4C2UA 2WPDD 4ZCMA 1OXSC 3QF4A 1MO5A 1YZGA 1ZM9A 1IY0A 3D7MA 3SN6A 2O8BA 2ZRJA 1IN6A 4MKGA 1MKYA 4PXAA 5G3ZA 1ZNWA 5AUPB 5JI3E 2BCJQ 2KB0A 1P5ZB 1GKYA 2DHRA 5AJWA 1OB5A 2AFIE 2V1XA 2I4IA 2PEYA 2NZJA 4PAQA 3GEHA 4GZLA 4WIAA 3X2SA 1OXTA 1FP7A 4GMXA 4URZR 4X8MA 3SE0A 2JDID 2ANCA 1KYIA 2CLCX 5J5CA 3HYTA 2GVDC 1Q21A 3ETLA 4IDHA 4QBIA 3GLIA 2OLJA 2ECKA 2QGNA 1G8PA 3NWJA 1ZUHA 4NCKA 3DM9B 2O0KA 1DEKA 3Q5EA 4LGMA 4D2IA 3R9WA 1E9AA 4BGDA 5CK4A 1XCGB 1G9XA 1KI4A 3RS4A 1Z0JA 2QROA 1GSIA 1ODFA 1Y3AA 3BH6A 5HKKA 4EQ6A 3QNUA 4LJ9A 1BKDR 5G3YA 4CEIA 4EPRA 4NE2A 2NMVA 2W2TA 4Z51A 5BQ5A 4C9BA 1OHHA 1Q1ZA 2MSEB 1UFQA 1U90A 3QPUA 3OAAD 1O3YA 1P2VA 2BWJA 2VP9A 1E9CA 1YZTA 4MDFA 4BFSA 2ZRMA 4FW9A 2RGCA 1AA9A 4MKHA 3PEWA 3LH5A 3EC1A 5JECA 2CL0X 3BB3A 2X2FA 3IEUA 4LJAA 1S2MA 4HLUA 2GK6A 3IO3A 4ARZA 1QHHA 4S2EA 4GL2A 2IL1A 2H18A 1OH5A 4M1KA 4O0MA 1RRFA 4L16A 3EA0A 4II7A 2YKGA 2OV2A 1KAOA 1QHNA 1E9DA 4L9SA 3A1SA 1Z0DA 3CH4B 1U98A 4NU0A 1BOFA 4JT2A 1G4UR 2OILA 2RB4A 3LX5A 3B2EA 3TR0A 3T35A 3VR6A 3AVOA 2PZEA 3F5FA 3UXMA 2G1JA 1G6OA 1MOZA 4HDOB 4JBYA 1KMHB 2BKUA 2O8EA 4US1R 1V5WA 1WF3A 3OEEA 4NPHA 2W6JA 3V4FA 1Z07A 4FI3C 2PH1A 5EP2A 3THOA 5CITA 3QG5A 4DVGA 5EUQB 2W83A 2QBYA 1NIJA 4M9ZA 1KK1A 1N0VC 1R6BX 3NIBA 1TNDA 2DR3A 1E2KA 3MWLA 2G9NA 4A92A 2GXUA 1P60A 4JYBA 5GJWC 2WWFA 2XNDA 4XSGA 4NCJA 4TYYA 3PV0A 2J7PA 4XSHA 2C5LA 3ASZA 1CEEA 1YE8A 4KYIB 3OIUA 3TW8B 2VP5A 1P73A 3L0SA 3KXKA 3TNFA 4LJ6A 1HE8B 3CNLA 5CDFA 4Q19A 3K9NA 5JHGB 3P26A 4Q7MB 2CE2X 1KSJA 2A78A 3QXXA 4NYIR 3R8FA 1G64A 3K0CC 1LVGA 1AIPA 2CLSA 2OHFA 2ZSDA 4PC7A 3TAUA 2UKDA 3RABA 5FPSA 4B34A 3IPXA 5DO9A 2XZLA 4KO8A 4A15A 2QPOA 5E7JA 2GCNA 4GOXA 1WB9A 1MRNA 3MJRA 5DSZA 1XCPA 1KIMA 2J87A 2BBTA 2RHDA 2AWOA 1E69A 1XEWY 2PMDA 3FMPB 1OFIA 1P9NA 2VYFA 1II0A 3X1ZA 5JI2E 2HEIA 3FGNA 2DYKA 4EUNA 3Q5DA 4RSGA 5KO2A 1CR2A 1W2GA 2RCNA 4OJKA 2HT6A 1KDPA 1ZD8A 3T12A 2EFEB 3A1UA 1DAKA 3KXLA 2ODEA 3CBQA 4HAYA 4PZYA 3WY9A 3HYRA 2FSGA 2O8CA 3GEIA 2IYQA 4D0GA 3BH0A 1HT1E 1AQYA 4LZZA 2IYVA 4P32A 1DAIA 4R2IA 3AM1A 3KTAA 4M1TA 4JL5A 1A7JA 4D4JA 3F8TA 3SOPA 4M1WA 1DOAA 4UKDA 1NVXQ 4L4UA 1BYUA 3I32A 3EARA 3SDZA 2QMOA 4HB3A 3ZZTA 1CTQA 4CW7A 5D3QA 1G41A 1EFRD 3REGA 1CJUC 1DARA 1R10A 2Q0HA 2GAOA 4ILEA 5FBQB 5KDLA 4A9AA 4DLTA 4B6FA 5HZHA 1EGAA 3DEFA 3NBFA 2B8WA 3TE6A 2NG1A 2Q9CA 1L7VC 2ZYVX 1DBSA 1XTSA 3PVSA 1AQUA 4OHZA 1RYFA 2C9OA 3GQBA 5KDDA 3ZYCA 2WSSD 3GJ6A 4KXFB 4KODA 3NH6A 2GF9A 5EE0A 2IWHA 2J0UB 4MUAA 4LPKA 4DEXA 4DDVA 1BO6A 2AHOA 2CCJA 4BECA 3QKSB 2GWHA 2QM7A 4D80A 3GEEA 4B6EA 4E22A 3AF1A 3AP2A 2A5DA 1KI3A 1UJ2A 1U9IC 2WAYA 1DELA 4CRWB 2F9MA 3TUIC 2FGKA 3WMFA 1OF1A 4KHZA 2CJWA 2CMKA 4JLJA 4QGGA 3R9IA 4A8JB 2C96A 1JR3A 3G82C 1R0ZA 1D5CA 1G4AE 1PLKA 1W0KD 3NC0C 4Q03A 1IN8A 2JEOA 4ZPXA 3LQRA 4G5SA 3KKQA 4KLZA 5EUMA 2E1RA 4EFLA 4L9WA 4V0NA 5FPYA 4UNNA 5TY0A 3GFPA 2KSQA 3VFDA 4BEBA 1R0WA 1AS2A 3MMPA 3AVVA 2YINC 4R7ZA 2OE2A 3QPVA 1ZUNB 3BH7A 5BW8A 5IDVA 4JVMA 2WTUA 2J9RA 3T06B 3EWAA 2HLDD 3B1ZA 1EWRA 1CLUA 2ZQ5A 4UQOA 2OFOA 4YONB 1FMJA 1QHIA 1YVDA 3E2IA 2WJHA 5CM9C 4JJKA 3WNBA 4JBWA 4KFRA 1RIFA 2FSFA 2HXYA 3K0AB 4V0ME 3BFKA 3MAAC 1KI6A 2RHMA 3AQ4A 3DOFA 2D2EA 2JJ2A 2PMKA 2JCSA 1L4UA 3OF5A 4KFSA 3B9QA 4UJ5A 3W8RA 2CVHA 3NHBA 2F1RA 2PBRA 5BN5A 3BJIC 3KKNA 1XMJA 4IVQA 3CF0A 3EPLA 1I4TD 3AVWA 4LDJA 2QP3A 5JRJA 2F1IA 1XEFA 4LV8B 3U61B 1C4OA 1B0UA 3THYB 2JASA 1QBKC 1EX7A 2FSHA 2XZPA 2VIIA 2WWWA 2ORVA 5B58C 1T9HA 5F9HA 121PA 3DPUA 1QVAA 3CIOA 3QE0A 5LD2B 2ZJAA 2HJVA 2ZANA 1ZUIA 1GRQA 2QAGA 2WJGA 1E79D 2C95A 3OFND 5AUNB 1TF7A 2IF2A 3LQQA 2R62A 4MRPA 2ZU6A 1XTKA 3W34A 3GLGA 2QP9X 5KYKA 4M21A 4ABYA 1TF5A 1YZLA 1ZIOA 4KSBA 1E2MA 3C15C 1R7RA 1TADA 1U8AA 2B92A 3QF7A 1XD2B 1ZAKA 3NH9A 4IOMA 4W7SA 3UANA 1NG1A 4HUTA 3WYFA 1P3JA 3V4RA 1GOTA 4G5QA 4HAZA 4LJ7A 1GM5A 2HCBA 4EPYA 1KTVA 2YOFA 2IEZA 4K81B 1KOFA 1XMIA 4JLMA 3W9YA 4EJSA 2GETA 2EWVA 4P4SA 4DT1A 4PPQA 3T61A 3UG6A 4RKEA 4NCIA 4A4DA 3EZ6A 1G5RA 2YOHA 1KSGA 1H8ED 4CVNA 4XTRA 3KB1A 1TU4A 2IT1A 2ZETA 3ZIAA 2WBLC 2ZUCA 3R9XA 2AWNA 1PZNA 3WXMA 3WBJA 3KQHA 3U7GA 2I1VB 3T1OA 1KI1A 2CL7X 4C0QC 4Q4LA 5UKDA 2OM2A 2ZYTX 2BV3A 4J0QA 4OK6A 2YJTD 1ZBDA 3CKLA 5HKKD 2DY1A 3CPHA 2IF0A 4IEEA 2AX4A 4TTQA 1CRQA 1E0JA 3PJRA 2RGAA 1Z3IX 1OHHD 3D31A 3MWYW 4ERNA 4Q4AB 2GK7A 2JA1A 1XWIA 1E99A 2C8VA 5IK2A 4LYFA 2IWRA 2PJRA 2ERYA 4CEHA 2BBSA 1GRRA 1E3MA 1XXHA 2WMOB 2WWHA 2GKSA 5K8TA 1TUIA 1YR6A
chains in the Genus database with same CATH superfamily
4LJ8A 4D9IA 1LXCA 4MV9A 2H9AA 1QC5B 1I94B 4CQMD 4GWKA 4YAEA 1BW9A 1D2CA 1WUJS 1XD9A 1MAVA 3E1GA 4XWOA 1GA4A 3IIJA 3R20A 4DV5B 5KQLA 5LNK6 3G9ZA 4RW0A 4W9NC 4DQUA 2Z8YM 4D3XA 1MNQA 2VAVA 3QFCA 2AB0A 5JUWA 1DIRA 3CKMA 1XRMA 1ZUD1 3M6IA 3VTFA 3MC1A 3PL5A 4Y98A 3VKUA 5E1BA 4DA8A 3KQNA 1GUDA 4AJOA 3BK7A 2PZKA 4R68A 4LV5B 4YVFA 2TMYA 3KC2A 4ZMRA 1JJAA 3DOJA 4FWIB 1QO0A 1ACMA 2KWIA 3EUFA 3LPAA 4AY2A 5M2QA 5TS3A 4RTKA 1JXOA 1GL9B 3GLFB 5BPHA 3KYIB 1I1QB 2WVJA 5KCMA 3ZHVA 2ZUEA 2PX3A 2FE1A 4MCJA 1J25A 1U8XX 1VL8A 2H8GA 2SBTA 2XZDA 3HU2A 4LTMA 3HA3A 3DWFA 4IIXA 4B4VA 3W5CA 1UOOA 1OC2A 2PANA 2WV7A 2Q6KA 2AE1A 2ZYSA 2ZUSA 4N9WA 3H13A 4ZTBA 1RI3A 2R97A 1BN6A 4ZANA 3MWJA 4BV8A 3IKTA 3ZY2A 5HDQA 2L17A 1N5IA 3E1SA 2O52A 1LVUA 2WTMA 1OXMA 3DCJA 4FGJA 4O63O 4UEOA 5A5DA 4QYIB 4M0DA 2A0KA 2R87A 1QJCA 4TTTS 3SZUA 2QVLA 1PNQA 2ZIUB 1YRHA 3DBVO 5C8YB 1H0KA 4F2DA 5HQ3B 1SUBA 1GCGA 5HK9A 1JR2A 1TJPB 1W87A 1HA3A 5GONA 2VJMB 1AF7A 1Y8RB 5JEEA 3JQ7A 2O2DA 3QUAA 5L3QA 1M2GA 2HJGA 2VTKA 4DJDC 5C3MA 3NWPA 1QE5A 1YB1A 2H0QA 4RF2A 3TOCA 1N2GA 1PL7A 5FTMA 3TZLA 2FOXA 2VCHA 3PDWA 4NBRA 2YQ4A 3KLNA 9LDBA 5HE8A 4WZAE 4EELA 2PD3A 4LSZA 1LTQA 3JQCA 3UK0A 5LDDC 5E0KB 1FXSA 5HCNA 4AJEA 4I5IA 5LUBA 1GYRA 3DMNA 2Z57A 5H9WA 1KZGB 4E5PA 1WQ3A 1JH9A 2V54A 3BERA 4HAOA 1MB0A 2ZYDA 3D4OA 3MWGA 1E2LA 3UUWA 5IJWA 3BHIA 2GK3A 3CVUA 2OZPA 2C2HA 1KP9A 4OQLA 1SPXA 2NYAA 5TGZA 4RD3A 4JUDX 2QENA 3I9LA 2LZ0A 2F17A 2H08A 2I55A 1GL7A 1KEWA 2Q62A 1E1QA 2IY8A 1E5QA 3K4PA 3QPCA 5KUTA 3K0EA 3DFUA 2JIZA 3GRCA 1P81A 5F2KA 3N07A 3RH0A 4E09A 3CVVA 2I9KA 2WW8A 3ZE1B 3MELA 1OCEA 3RM3A 4RZIA 2D2XA 3VI4B 3M3HA 1UJCA 4QQRA 5TMBA 1W85A 1QJ4A 3NO4A 1PJ4A 2RMKA 3PHLA 1PR3A 1QYIA 1TQDA 3LYUA 2FK7A 3AETA 2VA9A 4FCVA 4NPCA 3BWEA 5K0SA 4WL0A 2ZB8A 1OSNA 4TL8A 5BXYA 4YECA 5ITSA 4I9UA 3BB1A 3NBYC 1FQKA 2JVJA 3ETCA 4GYKA 5TDHA 4D02A 3UAOA 1FBTA 1T2NA 4I36A 1H2XA 1N5OX 5A3SA 3KL4A 2P79A 3U7RA 1PYGA 5ENVA 3NTVA 2IQ5A 2YOGA 3RYHA 4TVSA 4RTOA 1NMXA 2E4WA 2G6TA 2O1SA 4DLYA 5HHTA 1ODLA 2HIHA 3C24A 3AR3A 3UICA 2BVNA 4HDRB 2OCXA 1G20A 1LW6E 2WUWE 4M8SA 4FB5A 3OBIA 1Z0UA 2DKOA 3AJAA 2RI0A 3RU9A 3TB4A 5IKPA 4J8PA 3UC9A 2PZ8A 3UM9A 5DLDA 3NV7A 4J07A 2IHTA 5HMMA 1TVMA 4HS4A 4WZBE 1Y5LA 1DDGA 3N2KA 3F71A 3Q7SA 4JR1A 2QD4A 2NYRA 2VDRB 1KKMA 3RAGA 3BAZA 2PX2A 3EVNA 4RD6A 3S1AB 1D2NA 4PWYA 4WEQA 3K1AB 3KLBA 3SSAA 1X9IA 3QBJA 4W9MC 4KLAA 3H05A 3WGYA 1KETA 2JZCA 2G1AA 4DSUA 3LHIA 3OJCA 4NV3A 4C4TA 1USGA 3FTQA 5BW5A 3S99A 3G5TA 3F78A 2P0YA 3EQ2A 4F8YA 4P33A 1CWUA 5FI0B 2FCRA 4HOYA 2NZ8A 3VC7A 2P41A 4B6JA 4ERXA 2EZUA 3F8WA 1LZLA 3LUDA 4IH4A 4MUMA 4OHFA 5AJXA 3RVJA 1PZMA 3FRJA 3RROA 4X65B 2NWQA 4IH1A 4E7OA 3O3MB 3WWPA 1QYVA 1M6VA 4FPXA 2IZ0A 3IL2A 3EGXB 3T1YB 4G4IA 1ZRSA 1A9TA 4KN6A 3D8RA 4U6SA 5BMVA 4HAVA 3IUQA 4K2AA 2G67A 4G1FA 3T9CA 3ZY4A 2Q3JA 2ZSJA 3U1TA 3FKSA 4JB2A 1XP8A 3IDSA 1TLFA 4Y9UA 4D81A 4DNQA 2IBSA 1QV7A 1JTVA 1TJYA 2J07A 3QX8A 3FGZA 4R2HA 3WLEA 4DARA 5BUCA 2FUNB 4NULA 1I51A 3DOIA 1NXVA 4R8RA 1H3FA 1RHJA 4XIJA 2V65A 4L22A 4CT4B 3G0HA 1W5SA 4PFSA 3GBVA 1KARA 1TO1E 2SKCA 4PHHA 1EAMA 4LJ4A 2UUBB 2GBIA 2VO1A 1QX3A 5DFAA 1RJ9B 1PNTA 1OX5A 4PIVA 5AK0A 2J0SA 2K6GA 3IP1A 3OURA 4FGSA 1OAAA 3NYWA 4JJZA 4XX0A 2WYOA 1JT9A 1NUQA 3ODPA 4OHWA 4G4JA 2JFOA 4D8WA 1M2NA 1FZTA 3UYKA 3DULA 1A2QA 2YWDA 3UMFA 3OX1A 1TYDE 3RTBA 4R3NA 2YL2A 2R7AA 2A6PA 2Z3WA 3G02A 3U7JA 1KMHA 1GQSA 1MQ8B 2ESRA 1AF4A 2QQEA 3LF2A 3SNKA 4AJIA 5JMOA 1KJZA 4CI9A 1EG7A 3IE2A 2DJIA 3HU5A 3NC4A 5LQRA 1JWBB 3FNBA 4F1JA 4W5JA 1RJDA 2B8JA 3FWNA 4RF3A 3WLNA 2WZCA 3WLHA 3PCTA 3NBUA 4NYJR 2I22A 3EEOA 1G8FA 1A8HA 3QEMB 4GF5A 4Y0VA 1VB5A 4JR2A 4B84A 1GAJA 1SCUA 3NTXA 4N0EA 3BA1A 4BFYA 1XQWA 4OQDA 3G2JA 3OPQA 4Y7CA 1M6NA 4YK7A 3VPAA 3WSTA 4YCSA 3D0QA 1LNZA 2V59A 2R8ZA 5L6LB 4DE5A 1QFYA 5IHPA 2WJ4A 1W8IA 1GEEA 4DSTA 2YXPX 1GPLA 3AV0B 3T4UA 2DT5A 2W6OA 3ETJA 4E5UA 1U0TA 3OT1A 3PRYA 4CJXA 1UZLA 3SSNA 2QI9C 3AEKA 4NJEB 1JIVA 3CV3A 3PEFA 4FFRA 3P1JA 1LPBB 5CT9A 2E9SA 4GDMA 4OBXA 1NVVQ 4M0FA 4OFWA 5HKAA 3PFIA 4FEEA 5CPBA 5EWJB 1TLLA 4B3JA 3ZV6A 4YRIA 3B7WA 4BPBA 4DEYA 3LIPA 1MC1A 4MV8A 2GLUA 3B51X 4QGSA 2QW0X 2OO5C 5B36A 1RYZA 4RHUA 4ZV7A 5KWIA 3NXKA 5C2JB 2HA4A 2H5EA 1QE0A 4M89A 5CDFE 3HFSA 2XSZA 1NVGA 1WR8A 2B6HA 1RM0A 4CPDA 2ORED 1P1BA 3DKKA 3UCXA 4C06A 4UULA 5G0WA 5IKEA 4IMIB 1XN4A 3B3JA 5IXYA 4Q1DA 3PA6A 4RANA 1T1EA 1I13A 2VP6A 3LBFA 3KTOA 4JB0A 4JP2A 3FLEA 2QG4A 5MHTA 4RK5A 2C1XA 4TV9A 1HL3A 3HACA 3OPYA 2ZIWB 1WCV1 2X7JA 1ZUWA 2PX0A 3VX4A 3ZDQA 2NP7A 3HSKA 4DDKA 1W0CA 1AHNA 1X7HA 1Y1RA 3A6GA 4RDIA 3TK1A 4CMAA 3H42B 2P2ZA 1USKA 3LQKA 2IHKA 2IKSA 2QLLA 3PJGA 4PIMA 2IPAB 1BX3A 1K6JA 3K8QA 3AI3A 4GE3A 1NVDA 2O3SA 1B8NA 5F9MA 3SAJA 1LSOA 3WJ1A 4R6XA 2B1QA 2IODA 5DYIA 1B42A 3NFYA 3AL2A 4YR7A 1WMFA 1MRZA 3B3FA 3WGQA 3S8YA 3TIFA 4DA0A 3L4KA 4M1YA 3G8BA 3TEMA 3GDOA 1IM5A 1ECGA 4BRZA 3EN0A 4ALJA 2C78A 2Z08A 3RS2A 1L5HA 1F2TB 5EC8A 2OPBA 4OU5A 5HJ5A 2VNJA 1AKVA 1BHJA 2DGDA 3S44A 2I7DA 4YT8A 1PS8A 2H2WA 5IZ4A 2CHQA 1ZNZA 4RH0A 2XUOA 2XHEA 4JVLA 4QPJC 5FH9A 1U0OC 3UAWA 3R4CA 4LFCB 5EIXA 3BPSA 2HA0A 2IGTA 2P65A 3JU3A 3QI2A 4K5QA 1ENOA 4MS4B 4D74A 2IPLA 1UDBA 3BS4A 3F74A 2JAOA 1NOJA 2X2OA 1YQWA 1MBZA 3EAGA 1HQCA 2CB0A 1X13A 2CXSA 1XBTA 2EZ4A 3FCXA 1N6OA 4UPDA 5TEWA 3U17A 3VOSA 1EWQA 2UZ3A 4L0CA 3N39C 4E5DA 4MO2A 3PHIA 3F47A 3BJRA 2O5VA 5L7TA 2QRLA 5EFZA 1M72A 2NU6A 2QD2A 4KXQA 5ALRA 5LYYA 1NG9A 4ITRC 4R69A 3I0NA 1JDPA 2O2ZA 4A8JA 3FCCA 3GN2A 3REQB 3UWSA 4A8TA 2PV7A 1TYAE 4MH0R 3OJOA 1L4HA 1CG6A 2QW1A 3BXEA 4PBRA 5K3CA 1X2EA 3IT1A 5LL6P 2HYDA 2X40A 1ND6A 2A9KA 4FC7A 3MEQA 1UKAA 2Z5LA 1VECA 2HCTA 4MCAA 4MQUA 2O1EA 3RJTA 3QVLA 4HPXB 3HUEA 4XWAA 1ZM3A 3LOUA 3RB8A 4NBSA 3VM6A 4OKIA 4EB3A 1U7HA 2IQIA 3CRMA 3E8SA 1GSOA 3N86A 2NU8A 4AZ0B 2HY7A 3HCFA 3HA7A 4UHFA 3A4LA 4OHYA 1HEIA 2YZ7A 5E6UB 1HK7A 2P6UA 3AUSA 3PWTA 1D4FA 2ZTUA 3FOBA 3IAHA 5FPPA 2GA9A 4CDGA 1WRBA 1E1LA 2I6FA 5LP6F 4E15A 3E9QA 4ZT5A 3ANNA 1FQWA 2GH1A 3NTQA 4IRXA 4U6QA 2PNJA 4ARAA 3JQGA 1Q7RA 1R4AA 1UXGA 4GWGA 5EMNA 3GFQA 3PE6A 4JX9A 1ISPA 4AZSA 3PUWA 1JZTA 5C81A 5LUAA 2HWUA 4KP7A 2PRZA 3A14A 1IEQA 2EKLA 1N5LA 521PA 2GZMA 3P4YA 1PE0A 1FFGA 5ER6A 4KVGA 5SZJA 4B35A 2FGJA 2AZXA 4KMOA 5KTMA 4DLAA 4JR0A 3FDIA 1OWNA 3DVRX 3DOEA 4HLDA 3S0JA 1EE1A 2I4TA 3Q7IA 4TMWA 3O8OB 3TQCA 1LDEA 4MPRA 1SVIA 1V2GA 3QYAA 4QOSA 5KNBH 3D5QA 1A9PA 5KTTA 2ZRGA 1WPRA 4QQNA 2K7FA 5L7YA 2Q46A 1MFZA 1QXSA 1P9LA 1NVVR 2NX2A 4KO1S 1B74A 1X1TA 1UINA 1HBJA 2OKCA 2D2IA 3MMSA 3MUNA 2I78A 4Z1MD 2P27A 1BFDA 4X6YA 5JAUA 2VF7A 4BV9A 3GIDA 1TZ2A 3HCAA 3VDNB 5ALVA 1T9GR 1IZ7A 3O4IA 2W2LA 1ISIA 3H5TA 2VDQB 1AURA 1OW3B 1O6CA 3DTNA 3I9OA 3JALA 1U8ZA 1U9JA 2D0PB 2FF7A 4EO7A 5A2GA 1W29A 1P8JA 3X0DA 3DE4X 1NW9B 1CRPA 1PX2A 3P9YA 3I53A 2Q3DA 4FOTA 3DZDA 3VQTA 2QE7A 2NQTA 3ZY3A 1C14A 4CQLA 2NIPA 3IMKA 3NDRA 2QUAA 3UF0A 3WV5A 1VG8A 4B75A 5BV8A 5E6SA 2HHHB 4GVLA 1JBQA 1NXOA 1RBMA 1GKKA 3K8YA 4PZDA 3QUCA 5DTRA 4ZVRA 1TU0A 1EKXA 2UZ1A 4UUAA 1BTOA 2QZSA 3AHHA 3COSA 3IAS6 5H1YA 4ETMA 2F8MA 3OMXA 2PGDA 1B7GO 2Z8ZA 5U1PA 2Z4RA 3WRXC 1R5OA 2Z6VA 4CLHA 4K0RA 2XCQA 4MA4A 1NTRA 4P9NA 4EUSA 3FZQA 1E7YA 4E4YA 5BV2P 2LKCA 3ZVMA 4WESA 3H8SA 2ZKIA 3LT0A 4TYMA 1QPBA 3ILHA 1EVYA 4GUAA 1OBHA 4I0WB 1JIKA 4N39A 3D4IA 4UTVA 1Q1BA 2B30A 5FBWB 4Z0TA 5C8DA 4UTNA 1OH7A 3ZD6A 3JWEA 4FCWA 1I33A 3L6EA 3OU7A 4B44A 3R3JA 1X8XA 3J81k 4BIIA 4L7VA 1XDWA 1R1DA 1YZHA 1AGPA 2ONZA 4R71A 1IJFA 3ROFA 3G5AA 3TAHA 1TI7A 1PT8A 1Z83A 3GRRA 4FN5A 4CMCA 2ONKA 5H68A 5ALEA 5K0EA 3FCUB 1IUKA 5D5HA 5TRTA 1GZDA 2FPRA 4WGFA 1RE1A 3H5VA 4EI7A 2B0JA 3THXA 2GRAA 3O38A 2B2XA 4ZZ2A 3NNNA 4I1YA 4QPCA 1AQ6A 1NHGA 1Z2AA 4AMZA 4CZ2A 3RC8A 4OBBA 2WD7A 5KNDA 1CR6A 1GZ4A 2FDCA 2KE5A 4CM7A 1GPUA 2LP4Y 2TMKA 3QA9A 2R1TB 3KR9A 1EPUA 1OJLA 3VTZA 4CV3A 5I7OA 2F9LA 3TQTA 1SC4A 3N0TA 1C41A 2XHZA 1OBOA 1KDTA 5FADA 1KAQA 4BU1A 2G08A 4C7JA 3A37A 1DPGA 3FHOA 3G13A 3HBNA 4N65A 2D7CA 3CLUD 1BHQ1 3RWMB 4HQNA 1I5RA 5DI3A 2ZTMA 3HG7A 3KSUA 1T6NA 2LUOA 3O1LA 4MR9A 4QXRA 3WLPA 1JQ5A 2P9HA 4QTXA 1OPXA 2DH5A 3CZQA 3GNLA 1YJQA 3IBSA 4LDAA 5E8JA 3RVMA 4CQMB 2CFIA 3MZ0A 3FDFA 5DGIA 4DG8A 5AVTA 1VCOA 4KPGA 1XA0A 1KEEB 1N4DA 2OHVA 4C2BA 2CJYA 1EGQA 2IHYA 4BAGA 3GRFA 4ZAVA 4RHCA 1JU9A 2G0TA 4RDHA 3H2IA 5FKJA 3I8XA 3GUVA 4ZT6A 4M2LA 4OSEA 2YVLA 5IC5A 1YCFA 2PA3A 3UGTA 3W2GA 4ZI2A 2B35A 1SVLA 1BE6A 2E1PA 2VATA 5D1NA 3U7FB 1ZHOA 2IYZA 5JU6A 4P8RA 1I32A 3F4BA 1H0RA 3WK6A 3WZLA 4D9EA 3PEYA 4XB6B 2IS1A 3VO9A 3JYQA 1LRKA 1Q2UA 1YL7A 3FFBA 3MW8A 1WNTA 2B94A 2JFQA 4URWR 2VSOA 3K96A 5EQFA 2MCFA 3STWA 2GFHA 3SFZA 3D59A 4AJ2A 2ZR8A 4O4LB 4TRNA 3GRUA 1WMAA 4MVXA 2CUNA 4ARVA 1UQUA 4CEIA 1ONOA 1W2HA 1AS0A 2B7CA 5GM2A 4QYSA 1R0BA 2FMTA 3MGAA 3LT1A 1N6IA 5JC1A 3NOVA 3V42A 2IYLD 4S04A 5BRNA 1HDRA 2Q07A 2Y0EA 5IULC 3E7XA 2BR5A 1KO4A 1CY6A 1CU1A 4I50F 1BMFA 4OSOA 4B3CA 1JG3A 3PCXA 1K7CA 4FOPA 4GX0A 4PW0A 4Z4CA 2P62A 5T4BA 3V6MA 3MRTA 1IG3A 5SZHB 3QXSA 1QNFA 1E2HA 3BK2A 2CXNA 3RNLA 3OCWA 4L95C 4DR3B 3PPVA 4IHQA 2IV3A 3MXTA 3ZXUB 1XTZA 1ZH0A 2OQIA 1N78A 2DUJA 4HQ0A 5KWJA 3L18A 1JQAA 2QN8A 5EY5B 4DXHA 3BUSA 4FGZA 4F2PA 4AECA 4BQFA 3NIWA 1FP4B 3B1WA 1IOZA 2B1IA 4IRUB 2CLMB 3HGMA 2YHUA 3ICVA 5F7ZA 2IP1A 4LKOA 5CYOA 3EEIA 2P6PA 1Z26A 2C4MA 1MLDA 4PGAA 4RHEA 4C07A 4ZT2A 2QZ4A 3A2LA 1WCYA 3DDWA 4X60A 1RCFA 1CUBA 1I2BA 5F78A 2D59A 3NIFB 3FBTA 2ZQYA 1JX6A 3FWKA 3MUFA 3GRAA 2CL5A 1UEJA 4JCOA 1L4YA 1CP2A 5E3JA 2PS3A 1PW7A 4M76B 3FYUC 1IWPB 1R64A 3E7WA 4DS3A 4RGYA 1YDEA 4F5WA 2VDMB 2E4ZA 3TI9A 1UBUS 1DAHA 2D0DA 4KGVA 3QUQA 1T5LA 3PHCA 4ZAFA 1EFUA 1SQ5A 3EIOA 1JA1A 3MK31 1BZYA 4GKJB 2WJJA 3D54D 5MFZA 3DBLA 2FMFA 3FUVA 2EX1A 4TRJA 3E7DA 1MT0A 1DMSA 3AJRA 1N9ZA 3FE2A 1SULA 1EB9A 4ZKEA 4ZHQB 3GROA 3BBPA 3A6PC 1CHDA 2H1SA 3IB3A 1A71A 4QJ5A 4ZDIA 3IULA 3A28A 5KREA 5F98A 3AJEA 3EFEA 4PLCA 1ISMA 3TR5A 5CNKA 1A8IA 2PUHA 4HMQA 4UVHA 3RKSA 1JQLB 1R9NA 5J43A 1KBQA 3EXIB 4I4LA 4IJUA 4JJAA 1ZK2A 3O26A 3OEYA 4MJXA 3IALA 3CLUC 4MVJH 4NEGA 5AI4A 4FLFA 2YR0A 4LC9A 4B4UA 3SJBA 1OJ7A 1RXEA 1U1FA 3LFHA 1AMUA 3MJ4A 2BKLA 4C4YA 1TA9A 3G49A 3L0ZA 5G1PA 4DSOA 1EWTA 2YFKA 1L6RA 3U1VA 1S1MA 3OTIA 4IVNA 1G20E 1HRDA 1L7QA 1E7RA 4RZSA 3TX6A 3W1EA 1DSSG 2BRUA 1JF8A 1EUCB 2HF9A 1ZP6A 3CEPB 3P96A 3U48A 1QTIA 3B1JA 3G8YA 3L92A 1MOQA 2NSJA 4LKRA 2OAGA 5KTPA 3P9ZA 2YDXA 2R8OA 2P5TB 2XKBA 5CT8A 5DM60 3KQTA 2IEAA 3VR6D 3E22B 4A82A 1YCHA 4X71A 1MFPA 3CSSA 3CUSA 2BEUA 3S8EA 5ADVA 2H65A 3FROA 2WWTA 3VC3A 4GXTA 4HSEA 5I7HA 1KWGA 2WPNA 4H1TA 4OJQA 4XX1A 1OFHA 1U99A 3L1VA 3OEED 4LHXA 5A71A 2YIJA 2H9YA 3SX2A 3UK6A 4PAMA 3IAM6 1Z7BA 2OBFA 3HLTA 5DTMA 4D98A 1A2KC 4LS3A 4DMFA 5JXIA 1N2SA 2VP0A 1ZSYA 2XVYA 4C0HA 4QUKA 1E2FA 3TINA 4NR0A 3HGTA 1YQQA 4GBED 4EO4A 3FYCA 4ZHSA 1NV9A 2Q5FA 3FPHA 1ZW1A 1T1RA 3DV0B 4MW6A 1PGJA 2DERA 4EATA 2QJFA 2VQEB 2LXNA 3IXQA 3R7AA 4IXTA 1WOYA 2CLKB 1IN1A 1QVZA 5DHRA 1IY2A 3KOWA 3DM5A 4HPJB 4J0KA 2JGLA 4CFYA 4LCEA 3V9PA 3V6LA 2EBWA 1DV1A 2ATIA 2DJ5A 3D2CA 1BWPA 4BU0A 1K7SN 5E95A 2A33A 5A4AA 5B1HA 1JECA 1C7FA 4GM1A 1S7GA 3KRTA 5BURA 1VRWA 2ZWAA 3AJ9A 2ZUFA 5BR7A 3CX6A 1TPYA 4C7OA 3I12A 3EIFA 1VKRA 1WW3A 4L0MA 1AB6A 3DKPA 4P3KA 4QTTB 3HB4X 5I4IA 5J4YA 1UPXA 1HFWA 2BBOA 1YTLA 3FN4A 4J3JA 2IC5A 4BKQA 4HNAB 1TUBB 2NYUA 2W93A 3ET4A 4YAWA 1Z18A 4RLQA 2QTWB 1EXNA 3TFOA 1S89A 2C82A 4WRRA 4KH0A 2NVUB 5I9NA 2FQ1A 1U4SA 4TT3D 2I4RA 3PPXA 4PQYA 2HSGA 1BRMA 1B0PA 3K9WA 5TVGA 2WU3A 4L08A 3UHJA 2RKBA 1A9RA 1SHTX 4AO7A 5JSQA 2OFPA 3D8BA 3K6SA 4I46A 4P7FA 2XGOA 1MXHA 3ZE6A 3NDPA 3UMSA 5KVVA 1V96A 2BKEA 3REFA 5JASA 5CM8B 3VNVA 3FIUA 4RKRA 1DIBA 4Q9HA 1PWYE 5JCOA 2ZVDA 1DPFA 1FFEA 1MH1A 2X0NA 1JB1A 2DUWA 3AF5A 4FFBB 4B17A 5K3BA 2FW8A 2HIMA 5T3UA 3FH0A 4B8ZA 2XB9A 4B5KA 1B6RA 4G8JA 1FFAA 3OCYA 3EVTA 1FRNA 3HL4A 4KZPA 3KWJA 3L0IB 2GHIA 4L75A 4PG7A 3L8EA 2OV4A 3BEOA 4MMZB 5CFLA 4B47A 1OAOC 4YACA 2GPAA 4MLDA 3Q4GA 4R54A 5FYDA 4RC9A 2YCLA 4DKXA 3PR1A 3KKMA 4J0JA 1UMCA 4DW8A 1U1DA 2C84A 1K3FA 1K8ZB 3G68A 5BSRA 4EKDA 3LLUA 2EBUA 5F3WB 4HGOA 4PFKA 2E5LB 1YBMA 2Z95A 3IDZA 4N40A 4HI0E 3EPHA 2R5FA 3BDAA 4LQDA 1QU2A 4JBGA 2RHGB 4HRXA 5HEKA 2O8DB 5GVSA 2PUCA 3TXYA 2PUEA 3KD2A 5ALXA 3I73A 1U5AA 3V34A 1I0LA 3PF8A 1S01A 4FUQA 1JEEA 1QH8A 1ZEMA 2WB4A 4J9UE 2WIBA 3WLJA 1MN6A 3WZMA 1GNPA 3DSRA 1JW9B 3FBWA 3IQZA 4W82A 2PFSA 3PWZA 3WK4A 2AA3A 1K8RA 1ITZA 4OGLA 4NEHB 4RZ2A 2FMXA 3G2LA 3DFIA 3ZE2B 2CNWD 1TD9A 1NVEA 4KIWA 2NAFA 2ZI5A 4PQRA 5TPWB 1QG6A 3FDXA 4IGFA 2M1ZA 1DEOA 1VRVA 2QTMA 1HM5A 1ZIDA 2ZJ8A 3LUGA 3Q3CA 3QVKA 4U1RA 2B5OA 2WHPB 4US0R 4KTVE 1ZRHA 2VTBB 1EJBA 2HSZA 1ZD5A 4OD0A 1T34A 4CF6A 1IZ9A 5FOWA 2J5RA 3K9LA 3CNNA 3OSUA 2FQQA 2ZPTX 4P08A 1NJFA 4RPGA 4Y0NA 2I54A 2VS1A 3CEMA 3NNSA 2FDXA 2R6ZA 1US8A 4A91A 5DE3A 5B7QA 4KR3A 2H4ZA 1WX1A 2GDJA 3MS2A 1THGA 4W5RA 3JQ6A 4ND5A 2FV8A 2H2AA 2NGRA 1K6IA 1B8PA 2R00C 1U8UA 1DXOA 2XMSA 2D74A 5A62A 2XCLA 4Y1RA 4JUBA 1NBMD 1KBZA 1T9BA 5JV5A 4B43A 1MJNA 1U0FA 5F64A 1L4KA 3ISVA 4ZI7A 1E5XA 1XDDA 2QU8A 4B7XA 4FE3A 1HLFA 2X86A 5I45A 1W581 1Y1TA 2JJ2D 3OFVA 4GBGA 3HRIA 4MGHA 2OHHA 5JDIA 4KIUA 4YLYA 2P7IA 1TT5B 4G24A 3STXA 4TV9B 5BW4A 5KTNA 4LXIA 1Y4ZA 2Q9AA 4WXPA 3S55A 3ZPXA 3T5AA 2PZGA 3CCBA 3RUHA 2OK8A 2H1FA 4DMKA 5C18A 5BQXA 2CHFA 2C7VA 4F72A 3OM1A 4EY8A 1QRAA 1A50B 4RIEA 4W7HA 4G56A 3EDMA 3QUSA 4MV5A 1YZ3A 4RULA 2UVPB 1QIKA 4QHSA 2G5CA 1ZPDA 1ZJYA 3TBKA 2R66A 1WQ1R 1GQFA 5B7GA 1NBIA 5DRTA 2BT4A 3I9KA 1VE9A 1NUHA 2OCDA 2V96A 2VPYA 1TQHA 3JVDA 1Z2CA 2ZUVA 3D1JA 3IIMA 3KHSA 3PHJA 2H7CA 4J9VA 4FYKA 4ZOAA 3SHWA 3W6NA 8GPBA 2RH8A 2IUYA 1DKLA 2IIPA 4JJGA 1UK7A 4OQFA 3LRTA 4Z4IA 2WU4A 1QQBA 1KFBB 1VLLA 2CK3A 1R5BA 2LGJA 4BO2A 4M1MA 3EIUA 4G1UC 2H2HA 4PICA 2P3SA 3QWBA 3W3AH 4CKEB 2OORC 1ZZEA 4HWTA 3BD8A 3G9TA 1OOEA 4W63A 3ANTA 4C0KA 2H2DA 4NMMA 4HUQB 5I4BA 2V7XA 5IX8A 3OY7A 3TMYA 2GAAA 4L8VA 4E31A 1J70A 1KPGA 1BDJA 1HDOA 4HJXA 3H5AA 4J3FA 4E4TA 1QIIA 2GPSA 2WJWA 2JFXA 5EKXA 3T99A 3W7BA 1T9AA 2REXB 4C05A 1D2RA 1KQPA 3BXGA 1YS7A 4D8XA 4HDCA 1B93A 4K86A 2OC4A 4RJ2A 1A8SA 3MB8A 4LYEA 1GAXA 1CRLA 2BIFA 5B4TA 4CIXA 4DRXA 1L5MA 1V7CA 4M1ZA 4ZCQA 5KQGA 2NSDA 2IW3A 2IHBA 2X8LA 1JI3A 2AN5A 3IHTA 3TLBA 4OOFA 1E2BA 4X6XA 2XXBA 5FCDA 1C3OB 5KJ1A 1U31A 3U44A 2IOFA 4Q1CA 4Q4JB 1K7FB 3AO0B 3OZEA 1Z0FA 1KZ9A 4YCMA 3B1XA 5FPTA 3U4GA 1CY1A 1P4HA 1U2DC 4MYHA 4XUEA 4A73A 4L6IA 4W5WA 5I9LA 3WO0A 3Q0IA 4UBMA 2GCGA 3Q40A 2RAVA 3WGOA 3G7SA 2W6ZA 3GCWA 5DNYB 4XWWA 4OJYA 2JLBA 1COZA 1XQYA 1E77A 2DWQA 1MOPA 1TVKB 1NXPA 2VJLA 2VPZA 2CMFA 2P5YA 3VR3A 2PVCA 3ZIDA 1HT3A 3IO5A 4U0JA 4G3XA 3T52A 1M6EX 1NRWA 3E5RA 4QAJA 1K7YA 5T3YA 3W05A 4AG3A 1DKRA 4MVJG 1ZMOA 4QBFA 3KV3O 2BFFA 4PCLA 3RSZA 5GGXA 3LPNA 3CZMA 1WXHA 3F67A 3CIFA 3B6JA 2AMJA 5HGJA 4YRBA 1NA5A 1DKOA 2IXGA 1UBTS 2VYCA 3TCKA 4GOKA 4YUXA 5BN1A 4X3PA 5LP6A 3IP6A 2G1UA 1MABA 1Q7GA 1Q16A 1BS9A 3DV2A 4NL4H 4CE6A 4ENQA 2WZBA 1LU9A 3HI6A 2FZVA 1XZPA 5AK4A 1HRKA 4F46A 2AG5A 3D3WB 3EXFA 4AS3A 3FPKA 4K6GA 4KYUA 3DHVA 4E2FA 1BIFA 4LDQA 1JZSA 4CM8A 4F85A 1OBCA 2AN3A 4AZ3B 1F0NA 2WIJA 4R2XA 3RARA 2HTEA 4ASUD 5LJLA 2P4EA 2FHPA 2ZRPA 4R31A 1R0CA 2GM5A 4DEVA 2MYNA 1P5FA 4UDXX 1SU8A 3H5LA 4UZSA 1PK7A 4ZQCB 1X1CA 5G41A 2FOIA 1GTJ1 5CB4F 1C0KA 1FYEA 1N2EA 1UWLA 1YB6A 2A2ZA 2RGDA 3QFRA 4YDSA 5PNTA 4F6CA 4IF4A 4D44A 4A1FA 3KBOA 1CS0B 3R1IA 1BEZA 1DKPA 2EW8A 1E6UA 4XFJA 4TSFA 5EJ9A 1VGQA 3AKDA 2FW0A 3QNMA 5JXHA 3TRKA 4RTSA 1Z8HA 1LDYA 1PD1A 1EHCA 2C83A 1GUYA 2O7SA 5C5IA 4L51A 3RSHA 2VBIA 5F4ZA 1KH2A 4UOZA 1Y5MA 2R7NA 2DFDA 3NHKA 1PBNA 2P78A 3EODA 3U81A 3R8CA 1QRUA 4K0KB 1WUTA 1DX9A 1RQPA 2CBXA 2FN3A 2INGX 4LXTA 3SR3A 4B6PA 1TCBA 5ALLA 4RF5A 4AT1A 1VHLA 2H9IA 3H3JA 1NM5A 4J16C 4KV7A 4LRYA 5TPZA 4DV3B 2FZ4A 2QR5A 3FUWA 4RU1A 4PRKA 4XLTA 3PJDA 3BRWD 4Y2YA 1GPWB 2X4LA 3FJ1A 4YRGA 2V98A 3D0RA 3ICCA 3L93A 1Q11A 5E4JA 5L9AA 1OYYA 4GFDA 1ORHA 1AKRA 3C3AA 2XKJE 3VZSA 1JKJA 1TYBE 3K6JA 3NAMA 4DB4A 2D5AA 1GJRA 4GMGA 4IRMA 1LDGA 4EKIA 1RWBA 2FKAA 4AY5A 2YNMA 1ZI6A 3TTSA 3TM5A 4PAGA 2DX7A 3G7NA 1FDWA 1R8SA 2OECA 3OOSA 2QLBA 5FP0A 5IJ0A 1DMRA 1RU3A 4Q3NA 5CDGA 3ZUGA 5ICGA 2RGWA 2ZE7A 2AI2A 3F4KA 2QUBA 4R2JA 5LMNB 2J09A 4QE3A 1TA4A 2QS9A 2W2QA 1P2TA 3AFNA 4AYTA 2CUTA 2WNHA 4MQ6A 2FZLA 5JXJA 2G17A 3E70C 3PQ2A 4M0UA 1Q1EA 4G09A 4KRYA 4NENA 3WIOA 1UT8A 4RMNA 1X0VA 3MCZA 4M38A 4EF6A 2BEJA 1PZXA 1WXQA 4Q01A 1RIIA 1QB8A 2YASA 1H4TA 3LCMA 1N25A 3JD1A 3P9IA 4IV8A 1ISRA 1Q1AA 2W6QA 4ZFNA 2X8AA 5FL7A 5CDHA 2HNAA 3OIYA 1Z6XA 2GNPA 2Y1LA 1MD9A 1U8YA 3PDIA 4EAQA 5T6BA 5JZOA 5JRZA 3HXPA 2Y1KA 3W2HA 4CYMA 1G21B 1L3CA 4XFKA 1NXXA 3TZEA 4YCLA 3N2GB 4LVOA 3VHLB 4Z4QA 5CPFA 1XD2A 2Y68A 3T7EA 1JKMA 4EHHA 2RGUA 3FPAA 1JVNA 2F7SA 3GA5A 4Y6GB 2ZSHA 5FA5A 3R6DA 3FNFA 3KEFA 2V8OA 1C9MA 2ZB7A 4PZ9A 3O8NA 3QF4B 5BOVA 3PGJA 1RBZA 1WY7A 1XYYA 3F5QA 2XOKD 3EF3A 5JC8A 3NYIA 1H23A 4PTLA 5IXSA 2GB4A 4DC0A 1NTOA 4UQLA 1NBOA 3FZYA 3M34A 4QASA 4PVDA 3RG2A 3STYA 3O4VA 1SFRA 2XA2A 3GHYA 3UJNA 1PJ8A 2REBA 3OU2A 1MGOA 2CJFA 3SZRA 5JAIA 3CN7A 2O3RA 4ENWA 3RTCA 1CRWG 1ML4A 5M34A 2ZREA 4IDBA 3CH6A 2QRQA 3W6UA 4D43A 2QRNA 2G88A 1AX9A 5FTLA 4Q00A 2OHOA 5HFJA 1M2HA 3CUUA 1NF3A 1D1PA 2WJAA 4Y6SA 3KELA 4AKTA 2N1BA 2CEAA 4NRDA 3DG9A 1T43A 4AFNA 4AWBA 1FDTA 3ILXA 4MVJM 4UTXA 3G85A 1NMZA 1EFVA 5CTAA 2KYRA 1K8XB 4KWEA 3AUXA 4EVQA 1Z4LA 1HYHA 2JK0A 3DR5A 4YXWA 3W6PA 4GT1A 1TLTA 3MGCA 3PRHA 3C3CA 1ZICA 4RGVA 4U2GA 3QLTA 3O93A 4TKUB 3IAS1 3W2IA 2YMQA 2QIPA 4YRZA 2FX5A 4RLSA 1PJSA 1UP6A 2ILVA 4NTZA 1PL8A 2ZCVA 3C7CB 1QKJA 2C5FA 5TC4A 3A58B 2HJ9A 3KO8A 3DMTA 3IJEB 3COVA 3UGKA 2P9ZA 1QPGA 1E9EA 4P2GA 3UFXB 1KU0A 5EQDA 3YASA 4GOOD 2FN9A 4I50A 3HU3A 4X20A 5FHRA 3UWMA 2IOHA 2K2QB 5HZMA 5LQJA 3NM4A 1P80A 3W6ZA 2IDJA 2WKSA 3A7DA 4Z8YA 2A35A 3E3OA 2PXHA 1P18A 3OVMA 4ZVUA 1BJKA 3JQQA 3WLFA 3M6UA 4JASB 3E8MA 1T36A 4TKLA 4KQCA 2JJ1D 2RI1A 2Q27A 4IS2A 4XGQA 5E3HA 5JWRA 5CLQA 1IBKB 1P6XA 1YA4A 5BR1A 5I01A 2BOVA 3N74A