3GJ3A

Crystal structure of human rangdp-nup153znf2 complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
202
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj3A00
4TZ6A 4I4LA 4RZUA 1XEFA 1VG8A 2XEXA 3RRMA 1ZJ6A 2W58A 4PHTA 3A1TA 4H1VA 2GCOA 1VG1A 4EJSB 3TGPA 2IWRA 4HLUA 2IYTA 4PHGA 5BXQC 2BKUA 4G5GA 1HEIA 4PHFA 1IQPA 3SYNA 3B6EA 4AG6A 1YZKA 2W0MA 2FE4A 1E0SA 1N6NA 2GJAA 2ZRAA 2FA9A 3IILA 2HUPA 1GP2A 4IRUB 4OQNA 1T3SA 4RD4A 1VCOA 4M1YA 2OFWA 3WP1B 3OEHD 1E2NA 4EIWA 4NCJA 4DSNA 4UXIA 4BEBA 2JLYA 1XP8A 2QP4A 3M4YA 3BD9A 1XFAA 1SGWA 2QQEA 4O3MA 1KI6A 2O8DA 2XAUA 3EWSA 2WPDD 1G7TA 1U0JA 1ZYUA 2C04A 1N6LA 3BH7A 2NGRA 4LZZA 3A1SA 3LLUA 1NI3A 4F91B 1XD9A 2PT7A 3GFPA 3SJZA 4O25A 3AF0A 3UPUA 4RFSB 1N6RA 1Q1BA 1NVVQ 2GBLA 2RKOA 2FX3A 2WIBA 1U99A 4DUGD 5E7JA 4CEJB 4GBMA 2EYUA 3MWKA 2LCFA 1X1RA 3K0CC 2WJVA 1VMAA 3OEED 3AB3A 1E1RD 4PO8A 4RJLA 4ARZA 2P5TB 1Z6AA 2XTNA 1E9FA 4V0OA 2VQSA 4WXRA 1EX6A 1OYYA 1KAOA 2D4HA 2RMKA 2C96A 4B6EA 2FPLA 2GXSA 2QPTA 4PANA 4YMWA 4YMVA 5BN3A 2OXRA 5H8WA 2QL6A 1CJKC 4IKEA 5JZVA 1ZNYA 2CBZA 2ZRFA 2RGNA 1KK0A 3IEVA 4FWIB 1A2KC 1XCGB 3L0SA 3B2EA 4RFVA 1NL3A 3LO5A 4P3YA 1CULC 4NZYA 1XTIA 2MSEB 1XPOA 4N3NA 4AKIA 1AZSC 3C16C 1S4QA 2JLQA 5TMPA 4AC9A 2J0QA 3OIWA 4TTRA 5CB8A 4JJKA 2RGCA 5C46F 3IKJA 2AK3A 3HU2A 3KB1A 1Y63A 1E9SA 4Q18A 1ETUA 3ECCA 1YVDA 4YONB 2P3SA 3E1SA 4BWYA 3P1JA 3RVBA 3P26A 3SFVA 3ASYA 3QF4A 5CJPA 3DM9B 2JLVA 2FPMA 2D62A 2HF8A 1NLZA 2ZYUX 3HU1A 1KIMA 1Z5ZA 4LYHA 5DHAA 3AF1A 3UMFA 4PZZA 2EFCB 4WW0A 1ANKA 1DPFA 3FMIA 3QF7A 1KOFA 4QGAA 1CJUC 2AFHE 5KNBA 1KK3A 1E6CA 2WKPA 4QKQA 4E5UA 1R2QA 4QHYA 3KB2A 2ORIA 2FV8A 4TSFD 3AKCA 4FMDB 4V0ME 5JJKA 5HR5A 1ZW6A 2OBMA 2V7QD 3N5CA 2P2LA 4UJ5A 2IS2A 4M53A 2CDNA 3T5DA 2D74A 1E2EA 5DYGA 1D5CA 3P4YA 4HUQB 3E2IA 4MGYR 1SXJC 2J41A 3ICQB 2AWNA 3ZYCA 3IQXA 4EFNA 1TF7A 1PLLA 2VHCA 2FWRA 5AUNB 3R9IA 1UBEA 4TLDA 2VBCA 3QKTA 4JIMA 2JIZD 2J45A 2C5LA 3IBGA 1VG9B 1DAHA 3DMDA 2FEOA 5KDDA 3N2IA 4C7OB 1L8QA 2A5JA 4PC7A 4IW3B 4HSEA 1Q3HA 4TMWA 2DY1A 1NMXA 3OIVA 4Q4JA 1SHZA 1SVIA 5JSZB 1RE0A 2O8CB 4C4PA 3MG9A 1H8EA 4WIAA 4NL4H 1JB1A 4V0MA 4NYJR 4Q9KA 2ZSAA 4FMDF 3T5GA 3SJCA 1AQYA 5BW8A 4JYCA 4GZMA 1OT3A 2PX0A 4LV6A 1W0JA 4FD2A 1G20E 4TQAA 1CR2A 4LHXA 3FGNA 4Z8YA 3G5UA 4F4JA 2F1IA 1KDPA 1G3IA 1T91A 2FFAA 4HLUC 5F9FA 4BRUA 2IYSA 3KXIA 5LD2B 4M1OA 3TW8B 5J4YA 1XNJA 3ADDA 3AEZA 2IX3A 1GITA 1BIFA 1GL6A 3RNLA 1U2RA 5A4JA 5B30A 2VTKA 1UADA 4K46A 1H65A 4XD7A 3NC1C 2DB3A 3BJIC 4PPQA 2CLSA 5E4FA 3QKUA 1SULA 2WM9B 1W5SA 4TT3A 3CUEF 1E1QD 1NNEA 3HP1A 4Q9HA 3LW8A 4XTRA 2R6AA 1YR7A 2V6JA 4MGZR 1OFHA 1UAAA 3I4LA 4DCTA 1FQJA 4GP7A 2DCUA 3NBZC 4DBLC 1NG9A 1HE8B 1IN7A 1PJRA 2F1HA 2V8OA 3NEJA 1SVSA 1MO4A 4B34A 4FIDA 3OIUA 3CX7A 3ZS9A 4C3ZA 1AJEA 4DRZA 5P21A 1E99A 2GBLC 4M1SA 1Z0DA 2J3EA 3FMPB 1S9HA 5BWMA 3AP1A 2GXAA 3L82B 4OJKA 4OHYA 3CX8A 3GJ0A 4B75A 1GDDA 1G6OA 2AX4A 5EZ5A 1QF9A 4FI3C 2RAPA 3ND8A 4QOSA 4V0LA 1HY3A 1D2MA 1RJ9A 4URWR 2PEYA 4JVSB 1KI9A 4UQOA 4AKEA 4B3FX 2E1RA 2KBEA 2BDTA 2ZQ5A 4A36A 2YWEA 3KJIA 2BIFA 4C0QC 3WNCA 4DLXA 4BLRA 3O8DA 2RGNC 1US8A 4DDWA 1OXUA 4JLVA 1N3BA 2ZSBA 2X77A 4G1UC 5A5GA 1RYHA 5FTMA 4DIEA 3GLIE 2J46A 3VKGA 6Q21A 1OXSC 1TL7C 3CH5A 2HDNB 1KNQA 3ZDQA 1WXQA 1R0XA 4JS0A 1U98A 2BCJQ 3LV8A 2BJVA 2B21A 4S35A 3RS5A 4E09A 3W34A 2IS1A 2QTFA 2Z43A 3ZQJA 3O8CA 2YV5A 2V1UA 3REFA 1WCV1 1X8KA 3BB4A 2O0HA 1M6NA 4M22A 5DHFA 3IIKA 2ZJZA 4A6PA 5CLLA 5DIFA 1CR0A 4Q01A 4LCBA 4DLVA 5LB2A 2JA1A 1ZNZA 3IUYA 1SVLA 2HCJB 3GLHE 3AKYA 3G82C 4Q02A 4DDTA 3QEOA 4CGZA 1W46A 1Q0UA 2AXNA 2D06A 4EUNA 3RLFA 3HYTA 4JLAA 3SHFA 1KDTA 1FW6A 1IXRC 2QGZA 1GNPA 1KY3A 1XZQA 3LBHA 5TXGA 5HZHA 1BKDR 1RPZA 3EX7C 1ODFA 3GLIA 1P62B 1GFIA 2WZQA 3SQWA 3R8FA 2CK3A 3SZRA 1U94A 1XRJA 1BMFD 1YRAA 5JWHA 5JECA 3KJHA 2V6IA 3G0HA 2XB4A 2PJZA 3B1WA 2CLCX 3QIAA 2NZ8A 1CU1A 3LBIA 4LUCA 4A2QA 1MT0A 1ZU4A 4QC2A 1E9BA 1ZCBA 2EFDB 1QBKC 4OBEA 3UWOA 2F1JA 1ZVQA 2WV9A 2EWVA 2QSYA 2WJGA 2ZRKA 5FOTA 1Y3AA 3WYFA 2Q0HA 3CF6R 1OH5A 2WOJA 2H92A 1U90A 1D9ZA 4HEJA 4QGHA 3K70D 4GPTA 1OLOA 2WKQA 5H68A 2QU8A 2OFOA 2WSSA 1T5LA 3OFNA 1MV5A 221PA 4D0LB 2GJ8A 4IVPA 4PC3A 2JDID 4LGMA 2W6JD 1JR3D 2F7SA 5DISB 2DYKA 1L4UA 1CF4A 3JZMA 4PO9A 2HYDA 3T1VA 3H84A 1YR8A 5DI3A 1VECA 1G41A 2MSCB 2A30A 2OSBA 1BO6A 2I4IA 5KDOA 3LWNA 1PLJA 1OIXA 1FNNA 3THOA 3T12A 2ZVPX 4B71A 1Z06A 3ZJYA 5F9HA 3NBXX 3GFTA 3QNUA 2CHVA 1PUIA 2RCNA 3MAAC 5JJLA 3SYKA 1H8HD 1OKKD 2Z0MA 4D26A 4B73A 1Z29A 2I3BA 3WHKA 3VKWA 3KJEA 4I1SA 5JBQA 4XOIA 4PPNA 4TMTA 2CCJA 2VL7A 3SJBA 1JJVA 5EP4A 2HCBA 3HPQA 1ELOA 3T35A 5J4LA 3VU9A 3EPKA 3PUYA 1NKTA 1Z6GA 4QJ5A 3GJ6A 4C2UA 4DIDA 1UKVY 4RSGA 3X1XA 2OM2A 4TYPA 5CK4A 2P6NA 3LXXA 2B92A 4AURA 3LW7A 3PFIA 1FQKA 1ZM9A 5JWOA 2Z5FA 3NH6A 4JLNA 3QKSA 2G88A 4A82A 1EESA 1SKQA 2YJTD 1F2UB 1DO2A 2NO9A 3AKEA 4M1KA 2VH5R 2ZUDA 1YR9A 1XCMA 1JQJC 3VX4A 4B74A 3W6OA 5JFGA 2PZFA 2WAXA 4KBFA 3Q5EA 4XH9B 3L0PA 4FMCB 2EFHB 3DZDA 4HAXA 4DT1B 3VNVA 1J7KA 1KMHA 3NBYC 2FFHA 4R71A 2ZM5A 1X8LA 3DKVA 4B32A 4ON9A 4Q7MB 4TN1A 4OL0A 1YR6A 2IEZA 1MRNA 1QG2A 3EZ2A 3I73A 1QHHB 5FOWA 1EXMA 2J1LA 5JEDA 3NKVA 5IDVA 2P65A 4ZO4A 5K8TA 3EG5A 3GJ7A 3QG5A 2KJQA 4BPBA 2GXUA 2VYFA 4LJYA 3LH5A 1IY1A 2P67A 4Z8XA 1VYUA 1MO6A 1W36D 1W36B 1CJVC 2VP4A 1N6IA 4C0JA 2GRJA 1CKEA 5HPYB 4RCZA 4TYWA 2J0VA 3THYB 4AK9A 1FNMA 2BBTA 4W5JA 4YMSA 2CCKA 3UMSA 5SZIA 2ZPTX 1ZM4A 1NSFA 2C9YA 2GAOA 2ATVA 3JVVA 2WHXA 3DOEA 3LX8A 2IBMA 5AJYA 5TV2A 1EFUA 4EPXA 3KFXA 3A1VA 3C8UA 2O8EA 2JLSA 3FKQA 4POAA 5KDLA 4Y0VA 2WJHA 4IDNA 2QORA 1FX0B 4Q4HB 2F43B 2FPKA 2GAAA 3KQKA 4H1UA 1IONA 3KQLA 2IF0A 5AJWA 3D6TB 4GMXA 2Q3HA 4JKIA 2IYUA 2ZU0C 4NDZA 2VSOA 1TEVA 2ZROA 5AJXA 3RS2A 4B2PA 3LQQA 3ZGXA 3EC1A 2O5VA 4IDOA 4UXHA 1N6KA 1QDEA 1WQ1R 1W4AA 1PUJA 2ZRPA 3DO6A 4Q7JB 3GFOA 2WOOA 2HLDA 2MSDB 3QQ5A 4HZUB 4NCNA 4NONA 4P31A 3RS3A 3WRYC 5FR1A 4ASUA 1I4LD 3C5HA 2ZR0A 2XSZA 2HXSA 1QVRA 1UPTA 2G6BA 3K0FB 1P6XA 3U3MA 4B76A 4NCIA 4ZDKA 2IYXA 4XIGS 1XF9A 1F5NA 1NVVR 4GMDA 1RRPA 1GTVA 2QAGB 1WA5A 2R6FA 3AVVA 3U3OA 3GLHB 1IN4A 2OZEA 1KY2A 1XDBA 2QE7A 1IY2A 5FTKA 4JL8A 1VCMA 4AG5A 2GZAA 4DB4A 2YC4C 2OESA 3QPWA 2Q3MA 4MKGA 2WJYA 5B2ZA 4W9MC 3GJ4A 821PA 2QMUA 2C2HA 2GETA 1LFDB 2ZITA 1ZC4A 4G5QA 4BZXA 3NDPA 3AVUA 2ZREA 1XD8A 4EAQA 4JLJA 1ESNA 4MKFA 2QENA 5CM8B 1P2TA 2F55A 3SDZA 1DAMA 4ZIRB 4FCWA 2YYZA 421PA 2GESA 1R7RA 3B85A 3BBPA 2NIPA 2A7QA 2HV8A 3KQUA 1G5RA 2XOKD 2QMHA 1W5TA 3RSOA 2FDCA 3HJNA 1K8RA 1T5IA 3QXJA 2QA5A 1T0HB 1ZP6A 1E0JA 1S3GA 1UDWA 2NO0A 1S2MA 3CB4A 3NHAA 2P5SA 4KFUA 4OI4A 3S1AA 1COWD 3CM0A 2REXB 3KFVA 1S8FA 2YZ2A 5HE9A 2F6RA 3W5JA 2WPDA 1OV4A 2IYYA 4LYFA 2A5FA 4D4MA 2GVZC 4DWJA 1II8B 2KB0A 2W6IA 3U5ZB 2V9PA 3C14C 1IJEA 1G7SA 3QKRB 3TR5A 4ERNA 5AUOB 4DUGA 2ODBA 4CEJA 3VX3A 1KI3A 5JCZA 4URXR 1XPUA 2JLXA 1E1RA 4BASA 1KNXA 2E87A 1I4DD 3N70A 2JASA 5G3YA 1P72A 4L9WA 3CIOA 4Q21A 4RD2A 3O47A 4C0BA 4ESHA 4LX0A 1QHIA 3K9HA 1EK0A 5TB5A 3TAUA 3QXCA 2CE7A 2R6GA 3ZQ6A 3EZ9A 1MABB 3X1WA 3T15A 1ZCAA 4BGDA 2GKSA 4FMBB 2GJSA 1M7HA 1J2JA 2RGDA 3T1QA 2ZVQX 3RC8A 1EFRD 4A6XA 2NTYC 1FUUA 1GAJA 721PA 4GI7A 3LRPA 3ZZTA 1DG1G 2JJ2D 1W4CA 5FBRB 2OBLA 1G3MA 1XX6A 4D2IA 4GDFA 1GM5A 1VHLA 1E0KA 1P9WA 3AP2A 4Q7LA 4MGKR 3DEFA 3BC1A 3VMFA 5AUPB 3A58B 3LQRA 3VNUA 3ZZ0A 4C0AC 1IAQA 4MITA 4B43A 2R2AA 2X19A 1Q20A 4GNKA 1G3RA 1XBTA 2RHMA 3RHFA 4A0HA 3EXAA 5FBLB 3B60A 1E9CA 2AKAB 2ZS9A 1Q57A 1E3MA 3BE4A 1DAKA 1SKYE 2G83A 1R5NA 4D4KA 2WJJA 5EP3A 4TSFA 3OF5A 4TLBA 5EP2A 4DXAA 5DH9A 2V7QA 3ZVLA 3KQNA 4MYUA 2Z4RA 2DWPA 3U3KA 3DMNA 4WBSA 4A8JA 4QGGA 1NVUQ 3PEUA 3PIRA 3R20A 4OHWA 1U0HC 1YZUA 2D2EA 4DLZA 2JLUA 4HUQA 1E2LA 5CIQA 4Y0AA 3QUSA 1U81A 4PX9A 3SN6A 1E2QA 3AQ4A 1HTWA 4CYMA 2RB4A 2AKYA 3ND9A 1JEDA 2GJ9A 3TE6A 2JIZA 3AH8A 1F2TA 3TSWA 4EKDA 3ADBA 2CL7X 1MH1A 2VSFA 3LDAA 4CVNA 1AZTA 1KI4A 3CPHA 4KSCA 3U7FB 2C99A 1Z6YA 2ERYA 1YZNA 4NYMR 4LJ9A 3U7EB 5JSZA 1DVRA 3HWSA 1SQ5A 1XZPA 3AUXA 1KDRA 2H8KA 4EPTA 2QI9C 3GEEA 4Q03A 3KKQA 1LW7A 2ZI6A 3K9LA 4LYJA 4Q4AB 1GIAA 3GLFB 4A4DA 4YXWD 3DOFA 1G64A 1EWRA 3MMPA 4RKEA 3ZS8A 3B7GA 1KI7A 5F2EA 4B2IA 4KFTA 2PLRA 5BYJA 2KI5A 4Q1FA 5ANRB 3IDQA 5H1YA 5C4MA 2ZI4A 3E5HA 5FTLA 4QNMA 3C15C 4EFMA 3U60B 1ZD9A 4PFSA 2DFNA 3M1IA 1XEWY 2GTPA 5EJEA 2Z83A 1R8QA 3IPYA 5EUQB 4US1R 3WNDA 3M6AA 1K5DA 2J0UB 5FUWA 3I1FA 4RD1A 3A1WA 4LC0A 2NMVA 1BOFA 3CNOA 3JZAA 4MYHA 4RZXA 1W49A 3IO5A 1E1QA 4TWZA 3KTAA 4EFLA 3JVUA 2H7VA 5LB4A 2RHDA 1B0UA 1OB5A 1OE0A 4JLMA 3V4RA 1Z28A 2OAP1 1T0JB 2XITA 4KO8A 4Q1BA 3UG6A 1E4YA 4KITB 3P27A 1Q21A 4HB0A 1F3OA 4AIIA 2DR3A 4UXJA 3LX5A 2VO1A 1OFTA 4C2TA 4LHWA 2XNSA 2ZUCA 3CPJB 3OAAD 5KUTA 4KFSA 2HEIA 1XCPA 1R0WA 2CLDX 4G01B 3WRXC 4E03A 3MD0A 4IXNA 1FP7A 2YNMA 2XZLA 4I81A 4K8OA 1PZNA 1Z8FA 1ZM3A 5AUQA 4B35A 3DHWC 2IUSA 4MKIA 3MRSA 2RGGA 5FL7D 5TDHA 5L8VA 1JI0A 2QUZA 4Q4LA 3TUJC 2QSZA 1NN1A 1D6JA 1KI2A 4ZDWA 1CRQA 2Q3FA 2VHUA 4TL7A 2NPIA 3ZVMA 1QHGA 2QM8A 2X2FA 4DKXA 4XTCS 4GOJA 1UFQA 3QXHA 2ORVA 1HT1E 1NMYA 4YLGA 3TRFA 2FSIA 1XXHE 2J87A 1BS1A 2LKDA 2EWWA 1C1YA 2REOA 2DFLA 4PAQA 4F7WA 4B48A 1HYQA 2BEJA 4ZI3A 3BOSA 2QTHA 1G1MA 1P2UA 3U7HB 1X1SA 1II9A 3T06B 3VAAA 4F4IA 3THWB 4QBGB 3LY5A 4GOKA 2VP6A 1UBCA 5JWRA 3GLGB 3ZIAD 5EZ6B 4IVQA 2OO7A 4LWZA 2OCPA 1EFCA 4MRNA 2XGJA 1TADA 4W7SA 5CIWA 4BECA 1JXMA 4TQUS 2GNOA 3UATA 1KZGB 4AY2A 3VR3A 2VA8A 521PA 2NO7A 1SXJD 1SXJB 2OAQ1 2OCYC 2VLIA 4KI0A 5GJWC 1WMSA 1IXSB 2JJ1D 4ILEA 3EIEA 5DE3A 2W2TA 2XJ9A 1E69A 1QVAA 3IGFA 3PEVA 1JR3E 1XXHA 2J5XA 3TVTA 3IHWA 4WZAE 1BMFA 2QQ0A 3U4QA 1JBKA 2GILA 2RGXA 5EXTA 4A8JC 5JHGB 1OXTA 1VCNA 4GL2A 1M7BA 1T9HA 2R6CA 4M21A 3K09A 2JAQA 3KDSE 2YKGA 2EFGA 4DLRA 3L8ZA 3U3RA 2G77B 4MGIR 1RVDA 4RY2A 3RS4A 4WXPA 4BFYA 5FTNA 4KYIB 2KE5A 4NMMA 1P7CA 3Q7PA 2ZS8A 4Q48A 4OQFA 1ZU5A 1OHHA 1LY1A 2NO1A 4JBWA 1WDTA 1P73A 3FKSD 4PC6A 2WICA 2ONJA 2DWOA 1TQ6A 2REBA 3R9WA 2IS6A 3HYRA 2JDIA 1P75A 4JLKA 5L3VA 2W6JA 1JR3A 4X8LA 3L8YA 3BAFA 3EZ6A 4U00A 3SEAA 3A36A 4KLNA 1LS6A 4QJ3A 3LVQE 1XJCA 5C2JB 2OILA 3CF2A 4JJZA 1NY6A 2ERXA 4IOMA 5EE3A 3SNHA 3W3ZB 4LDJA 3W9YA 4ZDJA 2NOAA 4XSHA 3MWLA 3H4MA 5E95A 2Q21A 2EQBA 4I1VA 1R8SA 4R9UC 5FOUA 1LVGA 4JVMA 5GJVC 4ZPXA 4CIDA 4ESVA 3TMKA 1AKEA 3KKNA 5CDFE 1VCIA 4JSTA 5D3QA 2IYWA 2PCLA 2EU8A 1H8HA 4TL6A 2O8DB 1KI6B 3K9NA 3PG5A 3A4MA 3DDCA 4DDUA 1N6PA 3THXA 1HA3A 3A6PC 1RKBA 2OE2A 1R4AA 4HAWA 4X8HA 1M2OB 3OE7D 1O87A 2RGBA 3KKMA 2YOGA 3NH9A 2DBYA 1NIJA 1N0VC 1XTSA 2VP9A 2ZAOA 1KK1A 1U8AA 2VHQA 3U44A 2A9KA 2OV2A 3MWYW 4LBVA 2ZIAA 5FBQB 4ARZB 1NN0A 2A5YB 3EAQA 1OXXK 2AD1A 4OK3A 3ZD7A 1AIPA 2HJVA 1ZD1A 5L3SB 4IEEA 3WYAA 4CT4B 4NPHA 3RANA 4Z54A 2O8BB 4LJ5A 3L43A 1N5JA 1F2UA 1ZUHA 2OXCA 5CDFA 4URVR 3I92A 1AKYA 2PCJA 1M74A 5GJBA 3AVOA 2WTUA 4ZCIA 1QHSA 1RIFA 2ZYVX 4A92A 4U5XA 4TTPA 2W2XA 1Z6XA 3GP8A 1N5LA 3KUCA 3QY0A 4M8NE 4TYYA 1IBRA 3HR7A 3WMGA 4A2WA 5FH9A 4BQSA 1R6BX 2BBWA 2C78A 1U8YA 1XD2B 2JLRA 4JZKA 1KSJA 2BVNA 4V02A 4R2HA 4LBZA 4YDSA 2ZANA 5J4VA 4ITRC 1NBME 3AVXA 2F1RA 1DE0A 1N6HA 3NBFA 5DI9A 5JCPA 3K0AB 5IRCD 4V0NA 3RRNA 1SZPA 1W4BA 4HZIA 4I1OA 1Q1QA 3GMTA 4N1AA 2P6RA 1HUQA 4C0LA 1ZAKA 4M1WA 2BMEA 1P3JA 4PC1A 4C0SA 2BCGY 2QBYB 1TU3A 2NO6A 1GUAA 2ANBA 4BLPA 1GKIA 4BEJA 1D9XA 1ZM7A 4HAUA 3THYA 1GVNB 1T3LA 1ZD8A 1L4YA 1NMZA 3F0TA 1T4GA 1JJ7A 2ATXA 2IC5A 3EZ7A 4CZ2A 1TUEA 4D6PA 3B82A 2ZSEA 1QHYA 4YC7A 1G8YA 2MMCA 2GK6A 2J9RA 4V0KA 1XTRA 4TLCA 3MCAA 1VIYA 4U7DA 1G291 1M8PA 3TKLA 3B1ZA 4BUJA 4Q4HA 1OH8A 2GEVA 1NBMA 2F43A 4RZ2A 4BFSA 3K0SA 2ODNA 4GP6A 4Z1MA 4Q1CA 5AJVB 2O8FA 2VIIA 3PQCA 5CYPA 1FTNA 2VP0A 4NE2A 2J0SA 2UZIR 2C95A 5F98A 121PA 1JAIA 1G21E 3Q7QA 3T34A 2VSXA 4ZCLA 1PVOA 2IEYA 4LPSA 4MYCA 1UJ2A 1VYVA 2GEUA 5C4GB 5J40A 3LLMA 2ZI9A 1A7JA 3K09C 2ZXUA 1MRSA 2JLZA 4IOJA 4Q4JB 3NEYA 2YWFA 1CTQA 4PPFA 1GRRA 1OSNA 3TAHA 4RCYA 2A5GA 3DPUA 3B13B 2B6HA 3PUVA 1YZGA 5DNYB 2KBFA 2QAGA 4IOKA 3PUWA 4NCKA 1P61B 4JVNA 2CVHA 3K70C 3VHLB 4KODA 2FEMA 4IVRA 1OPXA 1OH6A 1LF0A 1J8YF 3AVWA 1CR1A 3B78A 4JT2A 2ZSFA 2AN9A 2ZU6A 5CM9C 4AYTA 1MO3A 3AM1A 4J0QA 4IEIA 4URYR 4HDOB 1XEXB 5L3RA 2BKEA 3P4XA 1II0A 1S1MA 3TVDA 4ZIRA 3PEWA 1OIVA 3ADCA 4JLBA 5KSZA 1WF3A 3D31A 1E32A 2MMGA 1G3UA 4M0LA 4PPGA 2XOKA 3TNFA 3CWZA 3LXRA 5J5CA 1KKMA 5FPKA 2WWYA 2CVFA 4L4UA 4XSGA 4ACBA 5M04A 1W2GA 1KI8A 1Z3IX 2ZE6A 3CLVA 4RD3A 5LBIA 1OF1A 2ZRJA 3I72A 3CRVA 3PENA 2XTZA 2XXAA 4FN5A 1COWA 4DHEA 4HB3A 3TW4A 2EFEB 1G7RA 4YMUA 4GZLA 3IBYA 1Z0JA 3P20A 4BFUA 4Q1AA 4H9GA 1NVXQ 2CJWA 1K6MA 4LBWA 2QPOA 1G7CA 2WMOB 2ZJOA 4RZ3A 3PJRA 3WHLA 1X6VA 1EGAA 3D7MA 4N0DA 2FJUA 2GA8A 3F8TA 4G3XA 4NYJQ 1DEKA 2CHQA 2Q9CA 3O8BA 2W83A 3QKRA 2ZYWX 1AS0A 1SVWA 2ZI7A 2ZJ5A 3B1XA 3RABA 1RJ9B 1GWNA 4OI2A 4PTLA 3CW2A 2FMXA 1EX7A 1GG2A 2FZ4A 4B3DA 4DEXA 5J4HA 1P60A 3QBVA 4CEHA 1LNZA 4BZQA 2PEZA 2YWHA 2ZETA 1US8B 1WP9A 3N2EA 2CL0X 3H2YA 3IEUA 4Q9IA 4YQFA 1SVMA 4EQ6A 5JI3E 4QBHA 1DS6A 1MABA 1P9RA 3AF3A 4LYAA 4PHHA 5JI2E 4C30A 1LV7A 1YZLA 2VHTA 2FZLA 1BYUA 2IA5A 4QBIA 3VR6A 1RFLA 1EFRA 4UNRA 2XTMA 3CNLA 2Q9BA 4JLDA 3SBDA 1KSHA 2ZRIA 4FMCF 2E9SA 2JJ2A 2L0XA 3EA0A 2CMKA 4BZPA 2FNAA 4KBGA 2FFBA 1E2HA 2VF8A 4BFZA 4G0NA 1G4UR 2ZRHA 2CE2X 4K81B 5JJIA 2ZE7A 4B6FA 2ZRBA 1A82A 3BERA 4JKYA 1N5KA 3DKPA 4XVUA 4TMVA 3VR5A 1XB2A 5EUMA 4TYNA 4PC2A 3R7WA 5FR2A 3GLIB 4E22A 4GSYA 3FHOA 4P4SB 2CK3D 3FTQA 4MUAA 4R2IA 4RD6A 2O52A 2ZE8A 3L2OB 5GADl 1Q3TA 2IHBA 3BXZA 3PCRB 1E94E 5D3MB 4FCVA 3U3JA 3X1YA 2R8RA 1XMVA 3GEIA 2CNWD 1CEEA 2QT1A 1XTKA 3W3AA 2QGNA 1S96A 2LWIA 1CLUA 2PMKA 2IHYA 3BFKA 4KJZA 4M4SA 4NH0A 1S1CA 2A5DA 1YQTA 1T3HA 4Q66C 4MYTA 3AF2A 2BJWA 2WSSD 3PXGA 3OFND 1XMJA 2WVJA 2ORWA 1YHNA 4NU0A 4DCVA 3FB4A 1GOTA 5JS8A 4ZKDA 5KTYA 4EJSA 3QI2A 5CK5A 2NQ2C 2QAGC 3GJ5A 2HF9A 5DI3B 2OCBA 1CS4C 3ASZA 1AQUA 3E70C 2UKDA 5KSOA 3U61B 2NZJA 1HURA 2XZPA 1LB1B 3LFUA 4QM6A 1TQ4A 3GLFA 2X1VA 2BOVA 1MR3F 1XMIA 2BC9A 4TMZA 4F4CA 4LHZA 1NJGA 4M9SA 4DLYA 3OEHA 1G17A 2OCAA 2WKRA 4P0TA 3QPVA 1Z22A 5BYKA 2GZDA 1GKYA 3ZH9B 3GJ3A 2PZEA 2IYZA 4Q19A 1DAIA 3IO3A 4IDPA 3VU9B 3I8XA 2VF7A 2FN4A 3UKDA 4LSGA 4KFRA 3SE0A 4LJ6A 1G16A 1HH4A 4OI0A 2J0UA 5HKKD 4RFSA 4Q9LA 1E2GA 1XMSA 5FBVB 1ZUIA 3AKDA 3Q9LA 2G0TA 4UNPA 3OEEA 5KPDA 3EZFA 3ONWA 5BN5A 1P4SA 5TVKA 1KO1A 5KSPA 3VQTA 2WWHA 3EPLA 1KO8A 4PSVA 3K9GA 4FCTA 1AM4D 3PUZA 2ZJBA 1A5TA 2ZRMA 3K8YA 4HATA 4JVLA 2B8TA 1GNRA 2HT1A 1IOZA 1UKYA 2X2EA 3A8TA 3HR8A 5E3HA 2CHGA 2IUTA 3OAAA 3CR8A 1DADA 1E2JA 4CT5A 4LC1A 2YOHA 1EWQA 1I4TD 3PR1A 3QEJA 2H16A 1XTQA 4RVCA 4DSOA 2GJKA 4B47A 4MQBA 2QZ4A 4B2LA 4M9ZA 3R9XA 1V5WA 4IJMA 2N1BA 3CRW1 2ZSDA 4YMTA 5IK2D 1G8PA 3QVUA 4DVGA 1OH7A 2VEDA 4D4JA 3X1ZA 1GSIA 3TUZC 5JLJA 1TMKA 1DO0A 2B8WA 2N42A 1FL9A 2N46A 2G1JA 4URZR 1KJZA 1YRBA 3VFDA 3Q5DA 4WZBE 4QBFA 3A4LA 3AF4A 4ZI2A 2OBNA 3LAWA 1DAFA 4UKDA 3I5XA 3NVAA 3ETLA 1UKEA 2QN6A 4P33A 3TUIC 4ZKEA 1LS1A 5EE0A 3TJZA 3THWA 3I5YA 3SOPA 1IHUA 4Z51A 1TQ2A 1W0KD 2BHRA 3EASA 3DVLA 4WA7A 4OI1A 3ZIAA 3FHTA 2QEQA 2ZYTX 1NIPA 4TYQA 1IY0A 2W0SA 2HJGA 4MH0R 2VPPA 4OHZA 4LY6A 3W8RA 3Q85A 1J99A 4DLTA 3CF0A 1NSTA 1N5IA 2V1XA 3Q8XB 3TSZA 1U9IA 3SYLA 4E07A 4F38A 4XVQA 1YKSA 4A15A 2JJ1A 4KLZA 1VYTA 4PQRA 4GT1A 5KNCA 4HLQB 5L3QB 4C0KA 2GK7A 1R0ZA 2JATA 1P9NA 1E79D 3MUFA 5FL3A 3WY9A 4HDCA 3VTKA 3QPUA 4A0RA 1P2VA 1NP6A 3MGCA 4C7OA 2GWHA 1ESMA 3KZ1E 2Z6VA 1KSGA 1Z0KA 2XNDD 2O8CA 5E7IA 2WSMA 1XJQA 1TX4B 1YZTA 4UNNA 1LTQA 4DLWA 1CR4A 4TL9A 2IS4A 1E2DA 1KK2A 4DSTA 1IXZA 1QG4A 1RRCA 1FPMA 1NLYA 1E98A 2C98A 3R8CA 1HV8A 1A1VA 3M0EA 4JYBA 1KO7A 2WWGA 3FKSA 1JR6A 4L16A 1D2EA 1E9DA 4EJSC 4D81A 3QXXA 5DN6D 3FHCB 1Z63A 1RYFA 3AV0B 3CWQA 1NKSA 1QRAA 2GVDC 3VHXA 5B58C 3RC3A 4CW7A 3NIBA 2OUKA 2YHSA 1GKUB 3BH6A 4QL3A 4KVGA 2BV3A 4W5WA 2IT1A 4FINA 3REGA 4FW9A 1E4VA 5FPTA 4CEIB 3GPLA 3H86A 2A3RA 3S1AB 2ZAMA 4QGFA 4XWOA 1CP2A 1GILA 1I2DA 4TQ9A 1M34E 2G0NA 1PLKA 4MKHA 4M9QA 2ZS7A 2V55B 3CRQA 1E9EA 3CRMA 4LJAA 2FSHA 4LJ7A 1YZQA 2CXXA 3OE7A 5B64A 2W6ID 2HXYA 1KDOA 1Z07A 2QNRA 2BM1A 1DBSA 1KJWA 3BB3A 4MRSA 1G5PA 2F9MA 2VHJA 4NYIQ 5EQTA 4WAUA 5SZKB 4EPWA 2BWJA 3I62A 2FSFA 3LNCA 4P32A 1JQLB 3RRZA 5JRZA 3NDBB 3EA5A 2R62A 2VP2A 1KMQA 1W48A 3BRWD 2IYQA 3AGQA 1V43A 2AL7A 3ZD6A 5L3SA 3U7GA 2WBLC 3UIEA 2O8BA 2HYIC 3UK6A 2FH5B 1FOEB 1CIPA 4LI0A 2Y8EA 2UVQA 4EDHA 3P32A 3ADKA 1YE8A 3TK1A 2D2FA 1NY5A 1ZINA 3FVQA 2BBSA 2EVWX 3KQHA 4ZCMA 3WBKA 1OJLA 3OHMA 1XD2A 4B33A 2PLFA 4MRPA 2AR7A 4DCUA 3UMRA 5BN4A 4L15A 2IWHA 4F93B 3FMFA 3EW9A 3K0AA 1AS3A 3D8BA 3QG1A 3F5FA 2QMOA 4D0NA 2JLWA 4DSUA 1TPZA 1Z2CA 1WBDA 1R0YA 4B3CA 4O2RA 1R5OA 5DYIA 5FI0B 2QBYA 5FBWB 5AR1A 2C03A 2PJRA 3SBEA 1NN5A 4XJXA 2D7DA 4UNQA 1TEXA 4DCNA 2DFTA 3EC2A 3SC3A 3KKPA 2R65A 5LDDC 2D7CA 4AKGA 1GRNA 1CJMA 4IDQA 1SHKA 2ZJYA 3I8SA 4A8JB 4AKHA 1Q1EA 3QENA 1Z6TA 2ANCA 3CKLA 2PBRA 3KL4A 3QSYA 2FFQA 2QROA 1U9IC 2G1KA 2G3YA 1ZIOA 4KHZA 1RZ3A 1UEIA 2AXPA 2J7PD 2JJ8A 3BK7A 4TMKA 2WWFA 1F2TB 1FMJA 1FTSA 3WNBA 3VR2A 4O0MA 2GCOB 4LHYA 2ZRCA 2UZ3A 1SKYB 4HAVA 1W2HA 3IHLA 4OKSA 3SHWA 5GVSA 5H70A 2FU5C 2OT3B 4LJ8A 5JEEA 4PQFA 3MSXA 4KVAA 1AGRA 2XJ4A 3KXKA 4AD8A 3PV0A 5DLQC 1VHTA 1UM8A 2ONKA 2B7CA 3A4NA 3TR0A 4AYWA 1NLFA 2Q9AA 3MFYA 1KGDA 3VKHA 1RW4A 4EPRA 3TQFA 4JT4A 4A2PA 4LV5B 3IIJA 3BS4A 3IQWA 4V03A 4F92B 4IFBA 1D2NA 1LF5A 1ZNXA 3V9PA 2JCSA 2G9NA 3I61A 1OKKA 5LD2C 621PA 4Q47A 1TNDA 1GRQA 4LV8B 1KYIA 4EPYA 3PEYA 3LA6A 4Q1EA 5KHOC 1GL9B 1XEXA 2OEPA 3RWMB 2DPXA 1Z0AA 2KWIA 1U0LA 4II7A 4PXAA 2Z4SA 5FUVA 5K8LA 3FOZA 3X2SA 2PH1A 4B3GA 2YINC 1QHXA 5KSYA 1OYWA 2XB2A 3PVSA 1IJFA 2GXQA 1JXOA 1UF9A 3KTAB 1KI1A 1G8FA 1W1WA 1G8GA 1CBUA 1WE2A 4OQMA 4D82A 2DHRA 3CRRA 2P0EA 1T8TA 4G5SA 5K8UA 4N0EA 3U6BA 2C9OA 5AWFC 3ZVNA 1X3SA 4ABYA 2OFXA 4I1UA 1KTVA 4NYMQ 4G5RA 1N0UA 2GZHA 3C4JA 2GEDA 4LOAA 5IF9A 3I3SR 4X8MA 4DT1A 5HCIA 1OXVA 2WAYA 4IOLA 3BFVA 1JAHA 4TTQA 3HDTA 5DSZA 3RSLA 2PL3A 4M1TA 3UWKA 3AVTA 4PAOA 2DFKB 4BFWA 1R5BA 5HTKA 4RKFA 1UBFA 4Q7KA 1IN8A 1QHHA 2V3CC 1DELA 2FOLA 3ICEA 1E2IA 4US0R 5DGXA 3CONA 2P6UA 4R7ZA 1J70A 4IHQA 2A78A 3QF4B 5CLQA 5TARA 1JPJA 4BRWA 4PAMA 1RRGA 5J47A 4B44A 1K5GA 1NRJB 3UG7A 4PR0A 3W6NA 1MKYA 4Q1DA 1Z0IA 3AUYA 2Q6TA 3K0EA 1TTTA 3CNNA 3B8HA 3V00A 2VRWA 3MWJA 3DZ8A 1C4OA 3W5IA 2XZOA 2IUUA 4DEYA 1G4AE 4WOPA 5EXSA 3GCGA 2GF0A 1S9DA 1WB9A 3ZZUA 1UDXA 1N25A 2CEAA 1Z08A 1GNQA 5FFMA 3U6KA 4KYUA 2AK2A 1TAGA 1FX0A 4M2LA 2VP5A 3D3QA 4MDFA 1CJTC 4NHOA 3V4FA 1Z2AA 3IPXA 1MO5A 2H5EA 4A0GA 4JL5A 3FFAA 5C1BA 2C8VA 4FWTA 3VR4A 4WZ6A 2OG2A 3TH5A 2DWQA 3TQCA 4DCSA 3CBQA 3FYHA 3CPEA 4PZLA 2FG5A 2TMKA 1XXHB 1FFHA 2GF9A 4P4SA 3K53A 3BFXA 3CR7A 3WMFA 3K1JA 3TLXA 5B57C 1QZXA 3U4QB 4HZUA 4JLPA 5D3MA 4DLUA 3FE2A 4TZ0A 4L5BA 4NBSA 2W2VA 3O8RA 3SJAA 3L0OA 5BQ5A 1E2MA 2CNWA 2QP3A 3K0FA 3AVQA 1A4RA 1W4RA 1H8ED 1T6NA 2YWGA 2JEOA 5KPJA 3QXSA 4HDQB 3QJYA 4C9BA 1UBGA 3CZPA 3Q72A 1C9KA 2YVUA 3QOFA 3BB1A 3CZQA 5EXPA 5LPNA 3LBNA 4NCHA 3GLHA 1M7GA 1D8TA 1HT2E 1W0JD 3AVYA 1OHHD 1VIAA 2BMFA 3K70B 3J81k 1OB2A 3CX6A 4AYXA 2IK8A 4BLSA 2ZE5A 4DC9A 1NF3A 4OK6A 2ZUBA 1OFUX 1VTKA 2FGJA 1XPRA 4LK2A 1VG0B 4QM7A 1UEJA 3GQBA 2FGKA 3I32A 4IFEA 4Q00A 2ZRNA 5AJZA 4DLSA 4CF7A 1AGPA 3T1TA 3EWAA 2WWWA 4BFTA 4XD7D 4DDVA 4YDHB 4P4UA 4KSBA 4BLQA 4JLOA 2R9VA 1AA9A 5GJCA 3BWDD 3C7KA 4TT3D 3UXMA 4ACAA 1FMLA 4CDGA 4HUTA 4JSYA 3T1OA 1R10A 5KOYA 5HE8A 8OHMA 4QRHA 5EXXA 5KNDA 2QAJA 2YOFA 3W8NA 2QY9A 1RRFA 5FPHA 4W5HA 4IDHA 3THXB 2PMDA 1O3YA 2WMNB 1NN3A 4HLCA 1E2FA 2JGNA 2QT0A 4DB2A 1HE1C 1Q22A 5FI1B 1NG1A 4O2LA 4WVFA 1XJ0A 1UKZA 5G3ZA 5ELXA 1DTSA 3U44B 1IN5A 1II8A 2BMJA 5IHPA 1G8HA 1G3QA 5EP1A 1ZBDA 1XWIA 5HKKA 2ZJ2A 1L7VC 5CYOA 3KXLA 2ZRGA 1KKLA 2WWXA 1A2BA 5JMTA 2WJIA 1ZM2A 1I2MA 3EARA 1N0WA 4NKRA 4GRAA 1EFHA 2H18A 4KV9A 4U02A 1BH2A 1Q1ZA 1B23P 1Q12A 1P5ZB 2ZJ8A 1KAGA 2BEKA 2IYRA 3SR0A 3FPAA 3GJ8A 5FOSA 1BYIA 1J90A 2ZR9A 3HPRA 4M9XA 1TU4A 3C41J 2FF7A 1FP6A 3B9QA 4BFVA 2ZJAA 3ZVRA 4PQYA 2V4ZA 3A1UA 4TLEA 3MJRA 4XWKA 4HAZA 2ZI3A 4MRRA 4TL8A 5IT5A 1VKJA 4UNSA 3KUDA 4QJ4A 1S0UA 2H17A 4QFMA 4D80A 2NPFA 1E96A 1YJ5A 2AWOA 3OIYA 3BH0A 1XEWX 1TUIA 2ZRLA 2IXEA 4MDEA 5IK2A 5FPSA 2H57A 4JBXA 3RRYA 4BLTA 1ZIPA 5SZJA 1JALA 2O0KA 1SVKA 3B5JA 5UKDA 5J4KA 5KU1A 1W36C 1G5TA 3WBJA 3X1DA 4B3BA 3QVVA 4QXAA 2HT6A 2EW1A 2ZEJA 1XTJA 5GVRA 1YU9A 2ZR7A 2R6DA 1ZRHA 5CITA 3KJGA 1OFIA 1E0AA 5FUXA 4CRWB 3ZLJA 3B1YA 4HI0E 3QBTA 4MRVA 4Q9JA 1P2SA 1W0KA 4PZYA 1SVOA 2OLKA 2A2ZA 2BM0A 4OJQA 3W90A 1NBMD 1AS2A 4Q5IA 1F48A 1G6HA 2J59A 3GEHA 4GOXA 4Z1MD 1TQDA 4D4LA 4S2EA 2O8FB 2F9LA 1E2KA 2I1QA 1KJYA 3GLFE 3EPHA 5KO2A 2QMEA 2R44A 1W7AA 2PX3A 5FPYA 5DO9A 4HLDA 4OHXA 5L3QA 1Z0FA 2F3RA 1EFTA 3U2QA 1Z47A 1E79A 1WBBA 3PUXA 4AI6A 3OZXA 3RS0A 1KO4A 3MJHA 3NTUA 3PITA 4PSAA 3H1TA 3Q3JB 1JPNA 5JRJA 2IXFA 1W47A 3WYGA 2XX3A 2XNDA 4NYIR 1DAGA 1XU4A 2GCPA 4KAXA 4FXPA 1E2PA 3SQXA 4XWAA 4D25A 2GHIA 3MLEA 2RGEA 5G53C 4Q4AA 3FWYA 4TMXA 4RD0A 4EPVA 2F3TA 1L2TA 3DM5A 4PO1A 1IN6A 1DAEA 4YXWA 3B1VA 3A37A 1VDZA 3CH4B 3FFBA 5EE5B 1HQCA 4B3XA 1KHTA 4QG7A 5G41A 2AHOA 5CJ2A 3RS7A 3AVPA 5F3WB 2ZI5A 3AGPA 3CO5A 2AD5A 2ECKA 4XVRA 5DN6A 5E7MA 3QE0A 1W44A 3TBKA 4IXMA 4AWXA 1OW3B 2PZGA 1X86B 4X8OA 4DZZA 1Z83A 1TF5A 2BBOA 2GDJA 3L0IB 4LHVA 1J8MF 1MOZA 3WMEA 5HCNA 4US2R 4HYYA 1G18A 4GFDA 1E9AA 4ZV4A 1JNYA 2C77A 2PT5A 3RAPR 3C5CA 4CEIA 4KCGA 4LRWA 3WXMA 1ZNWA 3K0CA 5EE9A 4A0FA 1T8UA 1N6OA 3QKSB 2AFIE 4NP6A 3TSOA 3SS8A 2XXAB 4BFXA 3H0KA 2C9CA 1NJFA 2QP9X 1E9RA 3LD9A 1DARA 2BMDA 2X8AA 5A0FA 5SZHB 1FZQA 3TIFA 2QRZA 1RC8A 4I99A 1PV4A 3B9PA 5AK0A 2CJWB 4NTZA 2GCNA 2CCGA 1JEEA 1F60A 2RH5A 3OESA 1U8ZA 1M1YE 2SHKA 1KMHB 5C18A 4QHTA 2IYLD 1DG3A 1IM2A 1AK2A 4OHVA 2IXGA 4A9AA 2W00A 1CRPA 4UJ3A 3UANA 3BGWA 4L9SA 1JECA 2ODEA 3GLGE 1Q44A 2LKCA 2NG1A 4CEHB 1HQYE 4OQXA 1OIWA 3BORA 2D3WA 2J7KA 2WIAA 4LJ4A 3KKOA 4OQLA 4TLAA 5FOVA 5G40A 4ZDIA 5FOXA 5EE1A 4BE7B 2O0JA 3EIQA 5FL7A 2OHFA 2V54A 1KSFX 3KX2A 4EQ6B 1KO5A 4URUR 1ONBA 1ZUNB 3NWJA 5HZKA 1SXJE 1G9XA 4BLOA 3NG1A 2WWIA 2H1LA 1TF2A 2OLJA 4HAYA 3EPJA 4MUBA 1KZ7B 4OYHA 3DL0A 2YC2C 1AN0A 4A1FA 4MA4A 5JHHB 2CL6X 2O8EB 3FMOB 2QPAA 4G5OA 3HU3A 3RYTC 4M1MA 4QHSA 2IYVA 2QRNA 3GLGA 1N2CE 1EG7A 4LBYA 4LPKA 2QM7A 3EIHA 5FTJA 1DOAA 4QNRA 2IL1A 4JMPA 4HB2A 3IIMA 2IF2A 3LVRE 3NHBA 4DJTA 4KXFB 3F3YA 1G19A 5TY0A 4C0HA 1WRBA 2ODWA 3R7WB 3GD7A 1SXJA 3RDPA 3RWOA 4KU4A 1GZSA 3AP3A 5KYKA 3NXSA 1VPLA 5K8IA 2ZTSA 2HLDD 2QG6A 4ASUD 4L8GA 5CB6A 2XSZD 2ASEA 2IW3A 2ZRDA 2RGAA 3VR1A 3BIFA 3SFZA 3GJXC 4HB4A 1NVWQ 2EYQA 4R98A 3T61A 3SU8A 1QHNA 2FSGA 3NC0C 2KSQA 3WP0A 4JL6A 1FUKA 2K5UA 5JS7A 5FUYA 1GL7A 1S3SA 2QTVB 4JBYA 4OK5A 3W6PA 4D0GA 1F6BA 3FDIA 2B7BA 4P4TA 2I1VB 2QE7D 3SI7A 1CXZA 1ZC3A 4PSKA 1ZMXA 2J7PA 1X8JA
chains in the Genus database with same CATH superfamily
4CI9A 1XEFA 1VG8A 1JHPA 2CD7A 4QFBA 5I7EA 5T6BA 3LP6A 3N8GA 3A1TA 1TXGA 1Y6JA 5KYWB 3N59A 4B3IA 2IYTA 1LWOA 3EYAA 5BXQC 2BKUA 2ZAYA 3BCSA 3NALA 2XTAA 1NUAA 4G5GA 2ZZMA 3F3MA 4RA9B 5K1ZA 4AG6A 1SHUX 3OD5A 1U1IA 1V6CA 3AWDA 4ZRDA 2A6PA 4CM5A 1E0SA 5B53A 5ICGA 3MK31 3O4JA 2C2WA 1GKKA 1LU9A 2QMQA 3EJ6A 2LP4Y 4K40A 5CXXA 2DFPA 3E8SA 1GP2A 1SK9A 3O26A 4OQNA 4E15A 1VMIA 1VCOA 2KPOA 2V7UA 1CP3A 3I23A 3WP1B 1D07A 1L4GA 4QXOA 4EIWA 3I04M 2M98A 4XOUA 1AK9A 4R3WA 4UXIA 2QI9F 1J2YA 1XP8A 3EJWA 1R6VA 4LZLA 4PRZA 4RS3A 3BD9A 3TTYA 2QQEA 5AHRA 4BKPA 5I45A 4O3MA 2X6RA 4ZVLA 1U0JA 1NZFA 2HA3A 2WA2A 2C04A 3EY4A 3ZE8A 4F91B 2J3KA 3GFPA 2FMIA 3SJZA 4O25A 5A7FA 1Q1BA 4O4LA 2RKOA 5GV8A 1NTOA 3D6VA 4DUGD 4OEHA 2FMUA 1P80A 2XVMA 1FFBA 1JFSA 2FB9A 1X1RA 3K0CC 2PX2A 3OEED 2H1VA 2GN6A 3HKCA 1E1RD 1JN0A 4ICIA 4RJLA 3GZNB 5FX2A 3NUQA 1WCIA 2PRIA 2XTNA 3W0LB 4WXRA 3JVEA 1BFDA 3F5DA 3KB8A 1NXVA 2RMKA 3KU1A 4AJ4A 2GXSA 5AXAA 1Y3FE 4PANA 4YMWA 1MH9A 3DR3A 2NYVA 3CJTA 4JYPA 2CBZA 5LZ7A 3ZIUA 1SOMA 3URMA 5K6AA 4GC5A 1XCGB 4BBAA 2P9BA 3LYUA 1NL3A 1N1MA 4WY8A 1J20A 4WXYB 4E46A 1PG0A 1Y5NA 2JAOA 3PHLA 4BNZA 2C9MA 2Q2WA 1I7NA 4F12A 1IBLB 1FMFA 3UK7A 1DB3A 3DL7A 3WKBA 4KNWA 1FFAA 3CISA 4AC9A 5TMPA 4TTRA 2RGCA 4PGAA 2AK3A 3HU2A 3N3BC 2WUDA 1XLWA 2Q5IA 1YVUA 2VBGA 2VS1A 1E9SA 2BR3A 2CXNA 1CUSA 1ETUA 3D0OA 3R76A 4BBPA 4BJ3A 1ZIXA 1CK4A 1KEEB 3KKLA 1Z6ZA 1N0HA 1GTG1 1GFZA 2VT2A 3P1JA 4FFRA 4DG5A 3VGPA 1P0FA 1YWGO 1S7CA 5FWDA 5CJPA 1R16A 2OYRA 3VR5H 2GEKA 3C8HA 3W9SA 3LHIA 3PQ7A 4L3WA 3HU1A 4JI1B 3H83A 6AT1A 2ABWA 3QU2A 3AF1A 3DPIA 4CMIA 3UMFA 2POCA 2AOTA 3FMIA 1JL3A 2AFHE 5I7WA 4RTSA 3WTCA 1KK3A 4NS4A 2WKPA 3MJTA 2B4YA 4L08A 5C34B 3G0GA 4BAUA 5FFFA 2H7XA 3PC2A 3C5WP 4WLEA 3PE6A 2RH9B 2J32A 3KR1A 1D2RA 1AXRA 1GZ7A 1B7GO 4TSFD 5CW2A 4P9NA 1ISSA 3SZLA 5IWCA 3FCUB 1JU4A 3F9IA 5C3MA 1ZW6A 4N3BA 5HR5A 4D74A 4P3OA 2P30A 4M53A 1XCLA 2HOQA 3ABQB 2MWMA 5MDHA 6ADHA 1G9TA 1XTPA 1Z4NA 4F2DA 3IBTA 1SD5A 2GRAA 2KW5A 2WYWA 2ZSUA 5LIPA 3ROXA 4EKEA 1SXJC 3KLNA 1GPDG 1W8IA 1SO8A 1WMDA 1L7OA 5CMLA 2VHCA 1TUBA 3EXIA 3WB2A 1N3IA 5LJIA 4REMA 4X1IA 2D2IA 4IIXA 4Q05A 2Y9MB 4RCVA 5ABPA 1PK8A 2J45A 2XUHA 2QLBA 4GYJA 2C29D 2AFHA 4LECA 4HX2A 1T13A 3DMDA 4UU1A 5HKOA 1RLUA 1UOOA 1WDMA 2FQ1A 4Z4FA 5EG5A 1F4VA 1L8QA 5JNRA 4FR2A 1XVAA 4HSEA 4TMWA 4PAWA 3OIVA 5TS2A 2K87A 1CUYA 1PFKA 1SHZA 4Q4JA 2LW7A 5JSZB 3WO1A 3G0IA 4C4PA 1T1EA 4KIJA 2P2DA 2EP7A 1WBJB 3LC0A 4WIAA 1JB1A 1M5TA 2IELA 3ZCTA 2ZSAA 1A9XB 2WG1A 3DMTC 5BW8A 4OB8A 3SJCA 4JYCA 4GZMA 4ZVVA 4NJMA 1QKKA 2PX0A 3LFTA 4G4JA 3TQIA 4FD2A 2PAAA 3FIJA 3IQFA 2VDOB 1YONA 4LHXA 3RI3A 4UTNA 2IYNA 2IZOA 4H4CA 2BP7B 1G3IA 4RABA 2FFAA 2PYIA 3UMMA 2IYSA 2W43A 3ZBQA 4YR9A 1X7GA 2A35A 4M1OA 5J4YA 5DM1A 4OU4A 1HMYA 2QD2A 2YV4A 1LQUA 3ADDA 4GUDA 5HW0A 1RKQA 1XQYA 3GB9A 5JYBA 2EZ8A 3QEKA 3RNLA 4JXXA 2VTKA 1UADA 3L8MA 1H65A 2JIQA 4XD7A 2DB3A 3SD7A 4PPQA 1T8SA 2C7QA 5DEIA 3EEBA 3QKUA 1PGQA 2WM9B 2WTNA 3NJRA 2Z6AA 4C6TB 3AU8A 3HB7A 1T9BA 4CGYA 3A3OA 5LWQA 4XTRA 4EI2A 1QJCA 2YZKA 4EO9A 1MEEA 3O4FA 4OHOA 1YV9A 3RTDA 3PNPA 2A4KA 2F3UA 3ZY6A 4F9TA 2OB1A 2QVXX 1RP7A 5IAEA 1QPZA 4DPMA 1FTWA 1JI3A 2I6FA 3ILHA 4OJNA 1XZIA 3NEJA 5CW1A 1MO4A 5EHQA 4AZVA 4BO7A 2H9YA 4L95C 2P62A 1AJEA 2P4SA 4OB7A 4IJWA 1E99A 4OCZA 4K6FA 1C9NA 1KFJB 4WECA 2A0YA 4QGSA 4W5NA 4QPZA 3L82B 3QWIA 4OJKA 4UQLA 2P9FA 4J76A 5AI6A 2AN3A 4OLAA 2AX4A 2R8XA 4EHAA 2UYGA 1XKQA 2N3ZA 4ZARA 5B4UA 2RAPA 3NX4A 1E92A 1E3IA 3C74A 2PEYA 1BSVA 3RH0A 4AKEA 4RPKA 1Q0TA 1O4WA 2E1RA 5ERXA 4B3FX 4D4HA 3LRXA 2B1JA 2YVAA 1E1YA 4WUVA 4QIHA 5KS2A 4PPYA 3VYUB 3KJIA 2BIFA 4R0MA 4IXTA 3WMRA 2RGNC 2EL7A 3IULA 3UAVA 4NBRA 5E6UA 5IC6A 3IQDB 1O08A 3N05A 1N3BA 2VRNA 2Q5LA 4QZVA 1NW4A 3ORQA 4G1UC 4JDUA 1P1BA 1U5BB 1ZXBA 3BA1A 3KQVA 5A5GA 1ABBA 4G8BA 1OXSC 4R9SA 2G82A 1WXQA 1R0XA 4JS0A 4WLVA 3LV8A 2B21A 2MIIA 4S35A 2GARA 3T9FA 2EJWA 3MJEA 4OHFA 2V1UA 3ZJVA 3REFA 3VDRA 5CVUA 1FIUA 3D2LA 3ILXA 4CG0A 5I7OA 2GPAA 3I9KA 2XQIA 2ACEA 1M0WA 1EVEA 4M22A 1VHDA 2GZ3A 2R96A 3EVTA 4C1NA 4YP6A 5CLLA 5DIFA 1KORA 1CR0A 1FLDA 2Q7XA 4OP3A 4DLVA 1SXHA 4F8YA 3BT7A 2JA1A 4L28A 3OC6A 4UBKA 3R3VA 1P18A 3G82C 1W2WB 4DDTA 4IF6A 5AK4A 2D06A 4YHBA 4EUNA 3RLFA 4ER3A 5KNCH 1IQRA 3HYTA 1FW6A 2QGZA 2VAVA 3BZUA 4BB6A 2RJNA 5TXGA 2HRDA 2Y92A 1SUIA 3VZRA 2FSVA 4L6CA 1RPZA 4E12A 2EW8A 1GFIA 2H3EA 2WZQA 2Y0DA 3ROTA 3LQKA 2CK3A 1FDRA 1O95A 1XRJA 3EXHC 4R01A 3ZX5A 3AIKA 2Q45A 5JECA 2YDXA 2IV2X 1R6UA 3BRCA 3E0QA 3X1MA 1QX3A 4ZALA 2CLCX 1FS4A 1G6Q1 5A3QA 3QIAA 1EHYA 2O57A 3L8GA 4LUCA 4QYWA 4AMGA 1MT0A 1ZU4A 1BXGA 2D5AA 4O1IA 2OUIA 1KERA 5AVKA 2F1JA 2X1LA 4X44A 4G0YA 2QSYA 4NV0A 2WJGA 1R8YA 2FPPB 3A4IA 3N0XA 4U2GA 3EC7A 4EBBA 4KR3A 4A16A 1A3CA 4EY5A 4LWOA 1H9CA 4KX5A 3ES9A 3SC6A 2AVDA 1T9ZA 3SSNA 2X76A 2WKQA 2QU8A 2OFOA 1T5LA 3LUGA 1JDJA 1T2DA 3Q87B 1W5AA 1UBHS 1K8ZB 3U81A 3Q15C 4UMEA 4WY2A 4LGMA 1IEVA 5ITZB 3CW8X 3OETA 4MUIA 2XUFA 4IJQA 3V2HA 1L4UA 2Q4EA 3EFHA 1UC5B 4BNUA 1CF4A 2DBRA 3LBAA 1YFJA 3ETEA 2Y1DA 2HYDA 3T1VA 1N4DA 2FR1A 4MS4B 5LBUA 3R09A 3WBBA 1X7WA 2OBFA 4KO4S 1JHYA 5CPBA 5AESA 3PQ2A 3CY6A 1X2EA 1KDVA 4LOJA 3THOA 2I6QA 4KWIA 5JIBA 2XHZA 5F1YA 4ER5A 4R8SA 1COZA 1D2HA 2PH7A 3GFTA 2RCNA 5L40A 3MAAC 3SYKA 4WCFA 2B9VA 1FVFA 1OKKD 2Z0MA 4Y1EA 4CTNA 3GPCA 4B73A 1ADYA 2N0SA 3BXHA 3LUHA 3DBIA 1XAGA 4BATA 1NJSA 5DK6A 4TMTA 3QPDA 2XQVA 1SCQA 5EP4A 2HCBA 4DDMA 4JI4B 3VU9A 1E7QA 1I2AA 2X5OA 5CITA 2GM5A 2C9ZA 3GELA 1NKTA 2WIGA 1CUHA 3T9CA 4L78A 5LLTA 4TUYF 4DIDA 3UJNA 4C2UA 2TS1A 4RSGA 3C39A 2F3SA 1Z36A 4TYPA 4EUSA 3I6MA 3N0TA 2P6NA 4PCAA 3IEKA 3FPSA 2B92A 2QSUA 4Y9DA 2NACA 5JD6A 1SIUA 3PTZA 4X71A 5LOVA 3ODPA 2HU2A 1KJIA 1ULTA 3PFIA 1ZM9A 4L5JA 5JWOA 4FGUA 2Y93A 4CIWA 2ZZNA 4M54A 3QKSA 4LDZA 2G88A 3RIMA 1EESA 2M6SA 1Y4SA 3OE4A 1VPEA 2J5RA 3KOWA 3UGTA 3EUAA 1QIMA 2PGIA 3AKEA 4QRIA 5C35A 3GH1A 2PVSA 1GXSA 3VX4A 1Z15A 3ZHZA 1YR2A 1VP3A 1XAIA 3AOEC 3CLSC 1N9GA 3HBJA 4NCXA 5JFGA 2LCIA 4GGOA 1ULHA 1LDBA 3Q5EA 3EOAI 1QTIA 1XZJA 1YL7A 4P2BA 1U2TA 2EFHB 3CZ9A 3NV9A 4HAXA 1TA9A 1J7KA 1V4NA 4G09A 3NBYC 4M87A 3T1NA 4R71A 5SV2A 4JB2A 4B32A 4GVLA 1GFSA 3QE9Y 2XNKA 2CYAA 1POWA 2Q1SA 1YR6A 5JNUA 3U3XA 4MB0A 1XLVA 1QG2A 4CQLA 4JVOA 4HQKA 1QHHB 1PWEA 1S7GA 2VR1A 2IOFA 3QWBA 3MBIA 5L4SA 1YVPA 1KWKA 1QV9A 5K8TA 3EG5A 1T1RA 1ORTA 3QG5A 1G8AA 3NORA 3WK4A 1ZK4A 2GXUA 2VYFA 5I9NA 3L4KA 1B8VA 1SCJA 4TXJA 2HA7A 2P35A 5JW6A 1HLFA 4C0WA 1BN6A 4YP7A 1T3ZA 4GR9A 5I4IA 1CKEA 3H9JA 2QRKA 3PZBA 5DM70 3QMVA 3R5KA 4Q12A 5EIHA 3K8ZA 3ZH2A 1VZ2A 3RNOA 4YMSA 4NJOA 4ENRA 3E0XA 1GRCA 3G13A 2ZPTX 5SZIA 1ZM4A 2OGSA 2W2LA 4LJKA 3E5MA 4O02B 3IEMA 1D6MA 1EFUA 3KT6A 4E4RA 1YIDA 4OQDA 4RV5A 3E03A 2B3TA 3DVAB 1IOWA 1U63A 2XBUA 2G7MC 5KDLA 3H9EO 4GPAA 4ZD6A 1FX0B 4OQZA 3W7VA 3QGMA 4LZAA 2XMRA 4Q4HB 5JNLA 5D7BA 3CNHA 3ISTA 3FOAA 1V96A 4H1UA 3O1IC 2IF0A 2X4LA 1VKHA 2WM8A 4XQ0A 4RKYA 1JLRA 1YJCA 3CTMA 4ESEA 1KQFA 4AF8A 4B1FA 3ZGXA 3EC1A 3ZU5A 2O5VA 4J4BA 4MQ4A 4EB0A 1JBQA 4K03A 1Q2UA 1Y1QA 4C7MA 4ID9A 5KTPA 1Y4DE 1DQNA 1T9DA 2ZRPA 4Q7JB 5HKBA 2VHXA 3GFOA 2PK3A 1WQ4A 2MSDB 3QQ5A 4NCNA 3DKRA 3BAZA 5AP9A 1X7YB 2HXSA 2OK8A 2QUIA 1Z5VA 3WISA 3K0FB 3N6RA 1P6XA 3NHRA 3NIDB 5DCWA 1JKMA 5FXMA 5LUAA 3K4HA 4NCIA 2IYXA 3HVHA 3K9WA 1DQYA 2VUTA 3LCCA 4RYLA 4D5GA 4HFMA 3CEJA 1NVVR 3ETJA 3G5AA 2AA3A 2GZRA 4BJ5A 1WA5A 2R6FA 4EY6A 3AVVA 2ZTHA 4PNHA 3WLOA 3GLHB 4RO0A 4HDNA 1XZGA 1IY2A 3NBKA 4JI8B 4AG5A 2BCEA 3DBRB 2Y1FA 5ES3A 2GZAA 3FRIA 4GM0A 5IAJA 4EO7A 2YC4C 3DAPA 2XUKA 2ZR8A 4COOA 4W9MC 2WJYA 3GJ4A 2QMUA 2C2HA 4AU1A 4JASB 1YB1A 8LDHA 3JWIA 4G5QA 4H7HA 1EZ4A 4IDFA 4D3DA 1UPBA 1F9EA 1NXPA 2F64A 2TSYB 3L1KA 1Z34A 1JVBA 3PGXA 4FLMA 5G0UA 1P2TA 2F55A 1U3UA 3AFIA 4CM8B 4L5YA 1O9BA 3A11A 1CPYA 1SBCA 3N0VA 3PVZA 4RA9A 2GESA 3PDCA 421PA 4S1VA 2QXUA 1JGTA 5ESWA 2HV8A 4N4AA 3HBMA 1JDBC 1G5RA 2XOKD 1JZQA 4QDTA 1L4HA 1FVXA 1LW6E 2PS1A 2FDCA 5EXDA 3NJ4A 4X84A 3QVTA 5F1PA 2QA5A 1RMYA 1T0HB 1QOQB 3BMQB 4RPHA 3CB4A 3EMBA 3F1KA 3GVHA 3NKLA 1X38A 3H1BA 1J25A 2A9PA 4BO2A 4C29A 3FYCA 3SEFA 3BE5A 5GV7A 2YMQA 3TTWA 4BMZA 5GOZA 1QTRA 2ET6A 2WPDA 3NTOA 3PD0A 3UH1A 3IVAA 1Q95A 4N6NA 4X1KB 3WFZA 5E4JA 5IZ4A 2UUCB 2ZB7A 2BGRA 1RCTE 3M5CA 4D4MA 1QVZA 3RCBA 4R31A 2HWKA 2CFTA 2CF6A 1PR4A 3TEMA 5KYTA 5CB4B 2V9PA 3O6VA 3QKRB 3RJTA 1XYYA 4GECA 4H7DA 4OD0A 1TTQB 1J56A 2NZUG 4Q9NA 1D7AA 1JWLA 3D6HA 1VJ0A 1KI3A 2I67A 1CQJB 3OT1B 4EF4A 4YCMA 2DHCA 1P6QA 3RVKA 3AUAA 3Q6MA 2E87A 2AW5A 2XTJA 2JASA 3NEPX 4UU8A 3B7PA 4NBLA 3S2ZA 2IH2A 3PJEA 4TRMA 2AEJA 1UQRA 2Z2IA 3TTTA 1E61A 1IEXA 1GGEA 1AURA 2JCBA 2YIMA 3G6KA 4L76A 1BGVA 2MSLA 1AO3A 3K9HA 2I7TA 3ZYZA 4MV4A 1PL7A 4IS3A 1TEHA 1MABB 3EZ9A 2FAXA 2JBAA 5T4BA 3S2IA 3CEHA 3P9SA 3ZBPA 3OKPA 2GKSA 2QLMA 4FUQA 2VBIA 3OEWA 4FMBB 1X3LA 1M7HA 2GJSA 2RGDA 4IDEA 5K8JB 3G2JA 2EV9A 1EFRD 2OVBA 3EOBI 1AOXA 4ADSG 2NTYC 3EGOA 4WOBA 2QQ5A 3SP1A 4C5BA 3HK2A 5CA0F 3G0CA 1ENOA 4DHWA 1GU0A 4JY7A 4JI3B 4ZVTA 1Y1PA 3LRPA 1U8XX 1DG1G 1XZFA 1J0DA 3DSRA 5CB4F 3K2EA 3OX4A 4KQFA 4S24A 5M3BA 3MS4A 1KEEA 3QW4B 4GDFA 4Q7LA 1Y6QA 3IAAA 5KMGA 1ADGA 4MGKR 1GL3A 3DOUA 5AUPB 1QB7A 3NTQA 3TIVA 2WNIA 2I87A 3GF4A 3MWEB 1JMVA 5E9JA 1Q16A 3TWOA 3UT5A 3V4OA 5BQOA 2ONZA 2QKYA 2VXCA 1LBQA 3UK0A 4Q3CA 2FRDC 4H7PA 1HFEL 4KMMA 2C5FA 4GNKA 1C3VA 1G3RA 5JR3A 1E6LA 3B60A 2G08A 4WBNB 3SG0A 2N47A 2ZS9A 5JZOA 1CZRA 1Q57A 3RT9A 2PANA 4P3PA 4FZVA 1LDYA 1WL8A 2QGFA 3DYVA 1ACJA 4B3RB 2QYHA 1WZNA 1R5NA 2IXAA 3ZI4A 1Z25A 5ALGA 3OF5A 7AT1A 3A1CA 4BLVA 3HVIA 4DF3A 1A9TA 2CJXA 4PU0A 3KQNA 3WNZA 4MYUA 2DBQA 2DWPA 1NLMA 1PT9A 5HK8A 4QYSA 3ITKA 3PIRA 1RACA 4RL4A 4BQPA 1J97A 4TWBA 2D2EA 1EM6A 3BTVA 4PQGA 3VZDA 4CMBA 2JLUA 1E2LA 5CIQA 1PTJC 1UPFA 4Y0AA 1U81A 1HEUA 2ZKIA 3C70A 1DPGA 3SN6A 1FNCA 3MUOA 4HDKB 4C43A 4MW9A 2YZGA 3LZDA 3WIEA 3DAFA 1OWPA 1Q1AA 3DLIA 2OCXA 5G1PA 1Q15A 4MUGA 1S8NA 1T6BY 2B5VA 2WRZA 4S1WA 1QGUB 4FHFA 4P7GA 1SBTA 2NYUA 2D1SA 5C31A 4EKDA 1A8UA 4MQEA 4CVNA 4Z53A 1URPA 1VGRA 2J3DA 4WBNF 4FN4A 1DC8A 5D84A 5IKEA 5JSZA 3U7EB 1W75A 2XF8A 4NYMR 4EHBA 3CW9A 3DMRA 2V3CC 1WPQA 4BNIA 3WGVA 1I24A 3DLTA 2ETVA 1KDRA 1YA4A 2P9QA 2RAUA 5GMOA 5B37A 3TL6A 3D6FA 3KKQA 3K9LA 4LYJA 1XRLA 3GN1A 3EGWA 3UB2A 1A9XA 1U0BB 9ATCA 3GLFB 5KVVA 4DZRA 2Q1WA 5L95A 1EXVA 3UWPA 4G1FA 1R0LA 1SIOA 1Z45A 2J48A 2GSWA 4PZ0A 4UPVA 3PGLA 2DUNA 4XASA 4DLKA 5JPCA 5FEMA 1L1QA 1P3DA 1KDYA 3GJQA 1E63A 4R1UA 1HSOA 2BP7A 1Q11A 1UXIA 5F2EA 4KFTA 3B3GA 3SHOA 4LRUA 4UZSA 4D8VA 1YAHA 5F77A 2JFFA 2ZI4A 3F6RA 4IHKA 3ZGNA 3E3LA 4ZVQA 1Z7GA 4PFSA 4FUTA 1VIDA 3UY4A 1XEWY 1XTBA 2Z83A 3PYMA 2X2OA 4US1R 5JDIA 3GPDG 1U2GA 4RXUA 1VI2A 1VI5A 3A1WA 1X0XA 1R8JA 4LC0A 3JZAA 3AR7A 1SCNE 4WNIA 1HQKA 3ORHA 3W6UA 3RFTA 4C6TA 4TVBA 4KXUA 3D5QA 1U7XA 4KJXA 2H7VA 3KEOA 1OB5A 1E1KA 5CU7A 1WHSB 4NR0A 1J1ZA 3E4DA 1EG2A 3J7AC 4C06A 4ENUA 4KO8A 4FE4A 3N2KA 5I8PA 1XGKA 1E4YA 1PZGA 4KITB 2G17A 4WKOA 2ZRQA 4FCCA 2B3DA 1ONPA 3AOGA 2WG0A 3NHZA 4OQEA 1OZ0A 2MINA 3PSAA 4LHWA 4AQYB 4KR6A 1MJGM 2XDQA 4V1CB 1FCJA 2ECPA 3A4VA 3PXBA 5I8ZA 5KUTA 4G0WA 1GLGA 4OKIA 2WD7B 1FP7A 1JHRA 2YNMA 5LR6A 2A0UA 3F7MA 3FCYA 3F6EX 3RVJA 4QPCA 5AK3A 4PGMA 3MF4A 3R9XB 2AG5A 3VDMA 1I2ZA 4MKIA 1WXFA 2SBTA 1H94A 1VI6A 1Y3BE 2RGGA 2V3WA 2Z5VA 6NULA 4JT9A 5ED0A 1DIRA 1PDOA 1GT91 1F0PA 1PT6A 2A67A 1NN1A 1D6JA 5IVPA 2XQJA 2Q3FA 3FVVA 2WAOA 5J58A 4R1SA 5BSMA 3WWDA 2QM8A 2WUWE 1ECPA 1UFQA 2HI0A 5BQFA 1U5BA 2ORVA 1HT1E 4IQ0A 1RM4A 3BMCB 4QSHA 3W5VA 4NZ9A 1XXHE 5E1BA 3P8ZA 3M4ZA 2EWWA 4Q6WA 1TMGE 1SZDA 2YFQA 2DFLA 4BNWA 4KQKA 2R2GA 3VZPA 3LCUA 4RELA 2QTHA 2VAXA 3ZUPA 2XA1A 2JGRA 3T06B 3VAAA 1DHTA 5A62A 4YJHB 4GOKA 1NC1A 3QTLA 3PR2B 3OHSX 4Y98A 4L02A 2BJHA 3FPLA 4MOWA 3KLOA 4IVQA 1IK6A 1MVOA 4J0EA 3PWSA 1ZHOA 1WDLA 2OCPA 1EFCA 1NV9A 2Y2UA 2ZOSA 3U4IA 1TADA 2AMLA 2GO7A 1P2GA 4UCWA 4W7SA 5CIWA 4BN5A 3LECA 1IDOA 2Z57A 2YV2A 2W6PA 1K63A 4H17A 1FK8A 1Y7TA 3DQZA 1V16B 3HUDA 4LDPA 5EVJA 3VR3A 3FPCA 4I1YA 5C5EA 3ICOA 2WVHA 2JJ1D 1EFPB 2NSLA 4IINA 1QS0A 3IGFA 1U02A 1XXHA 1CRLA 1P1KA 4OO3A 3DKIA 4NNPA 1GDTA 2QQ0A 3T3HA 3TPFA 3AINA 3OPNA 3GGPA 4JOQA 1T8PA 3U4QA 1JBKA 5TQ0A 5EJ2A 1OXTA 1NM5C 2D0PB 1M7BA 2ZT7A 4YWJA 4MGEA 2WJPA 3TBHA 3T1HB 1U7ZA 4M8LA 4ZAXA 3D7KA 5DYWA 4HDRB 2QXYA 3F5MA 4QQFA 4BVLA 1P5HA 1A9SA 4OGWA 1CF9A 1N2CB 1W5BA 4FDTA 2HLNA 4WXPA 1GJRA 1UK6A 2IUEA 2Q0QA 2FPPA 2H5LA 3FBTA 3RODA 5FTNA 4PYRA 3LBFA 3WMWA 2II6A 1QTNA 2ZM6B 1AY0A 1P7CA 3RVRA 4QA9A 3M2PA 3ROGA 4F7DA 2Y71A 2I8LA 2NO1A 4OA8A 2Q6VA 3OPXA 2O48X 1R0SA 1RPAA 2ONJA 3KXPA 3T99A 4TUYA 2FEXA 3DNPA 3A7EA 5JY1A 3W7BA 3HYRA 4BRSA 2PFKA 4JLKA 4NNJA 5ITZA 2IS6A 1NUQA 1EMDA 4X8LA 5KVQA 2H2FA 3L8YA 5DM0A 3RKSA 3WLIA 3H8WA 3HCPA 4U7PB 4U00A 5DX1A 2ATEA 3BMNB 3PEEA 1XJCA 2PRYA 4I8IA 4YRDA 4BVFA 1CYEA 3W1EA 1NY6A 1PQWA 1DBVO 4IOMA 3SNHA 3W3ZB 2DLCX 4DA0A 5HCUA 4DM7A 2NOAA 4XSHA 4E1BA 3FAKA 1LC3A 4Z6KA 3KDAA 4QLOA 1WXDA 1OI7A 2Q21A 2Y0CA 5EOVA 3ROEA 3GLRA 4ZPXA 3TMKA 4CETA 1AKEA 2ETXA 2JI7A 4Y7DA 1ISFA 3GJZA 4JSTA 4N0MA 2IYWA 4TL6A 1H8HA 2IP4A 2O8DB 3K9NA 4RK1A 4QDXA 3THXA 1C9YA 4AN1A 4UMDA 2FSPA 3A6PC 4TS9A 1RKBA 2OE2A 1B3RA 1EX1A 1TVEA 4K9PA 3TLYA 4CG3A 3FZGA 7ADHA 2ARKA 3GMDA 3H5AA 1W1UA 4HDAA 3FSRA 3JSXA 4EQZA 2OB2A 3KBBA 4IIHA 4CIXA 4MLDA 3BICA 2D5BA 1U8AA 2GZ2A 2R8ZA 2VHQA 3Q11A 4W9NC 2KLBA 4DSAA 3LG2A 5LLDA 2O5EA 4LBVA 2ZIAA 3DBOB 5EQFA 4ARZB 4JGBA 5BXYA 1Z7YA 2HBZA 2CDBA 1OXXK 4JCOA 3U48A 4OK3A 1R9GA 1U3VA 4IEEA 3C3CA 4YCLA 2GBGA 2PM8A 2PXAA 1DJLA 5BN3B 1QF6A 2DVMA 4KDEA 5JASA 1R6AA 4ZV9A 4D9HA 3I92A 3NDJA 2PCJA 4YP5A 4BNVA 4ARIA 1GT6A 1RXCA 3BJZA 4S0XA 4BQRA 1PAUA 2NVWA 4BZZA 4WDRA 4ZCIA 1ITZA 2ZYVX 4U5XA 2OO5C 4TTPA 4ZVSA 2W2XA 1K2WA 3K5IA 1F8GA 2QVZX 4CM9A 1N5LA 3FHLA 3QY0A 3U3DA 4MQ6A 4DBZA 4I6JA 4BQSA 3DMFA 2IOYA 2C78A 5IARA 3RTBA 1UANA 2BGJA 1XUOA 2JLRA 3K8QA 3TLKA 2BVNA 1L8LA 5CR9A 2I9KA 1W6UA 5DP1A 5DI9A 4X5OA 2I3GA 5IRCD 1CIJA 1UXGA 2BL4A 1EJ2A 3OBIA 4V0NA 2FHSA 3RRNA 1SZPA 3NT2A 1W4BA 3NVMB 4HZIA 4I1OA 1OQAA 1MX1A 2FHPA 1AGYA 4UAUA 1I9GA 3I9NA 4C0LA 1ZAKA 1L5WA 3I05A 3ZX4A 2F17A 3AHGA 1K3TA 1OBFO 4I14A 4C0SA 1ST3A 3NTVA 2DWUA 5E2BA 3SCZA 1EHCA 1GKIA 3JQ7B 5AMXA 5A3SA 1TTHA 4K9KA 4OB6A 1J24A 4HAUA 4GQAA 4BEJA 1GVNB 4CLDA 1K92A 1QH1B 2Y1WA 4L2IA 1JYEA 1L4YA 3L0DA 4RBNA 4Y2RA 4BN0A 1JJ7A 1GQFA 1X0VA 3EZ7A 3MIIA 4L50A 3RPEA 4D6PA 5JARA 5M34A 3B82A 1QHYA 3KYDA 5AYVA 3AR6A 1BQ3A 2MMCA 2SCUB 4LSMA 5JVDB 1NXXA 4F5EA 1SUEA 5B6JA 1U28A 2J9RA 3UXHA 1XTRA 3OJCA 1VIYA 3ZHOA 1Z38A 3EGXA 3K8OE 4U7DA 2HMYB 4A27A 4MYRA 1Q0ZA 4Q4HA 4R8VA 3ZCRA 4BCBA 4BUJA 3TVYA 1OH8A 1N33B 4ZV7A 4BFSA 3Q9UA 4RZ2A 2XMGA 5AOBA 1M5UA 2XD9A 5ELMA 5A9TA 3PU6A 2FP4B 5IT9A 2FE1A 4G4IA 4CN8A 4JP5A 1HOXA 2VIIA 1WAMA 2YW2A 1ZY2A 3RAGA 1H2WA 2C95A 4UM7A 3RASA 3ZCUA 2Y0PA 1ISJA 5D8DA 5K0SA 4I3GA 2XWSA 3TD9A 1JR4A 1JAIA 1BG6A 1EINA 3EQ7A 3I2KA 3LHDA 3M4NA 3Q7QA 3T34A 1J5PA 3MCTA 3EQZA 4QUBA 2FKNA 1PVOA 1OFUA 3JYNA 4MYCA 1KH2A 4YJFB 1VYVA 4RVHA 4CV3A 4RETA 3T3OA 2GEUA 3UOAB 1NKVA 5GM2A 4W6QA 4PE5B 4C6HA 1MRSA 3DR5A 4IOJA 2JLZA 2IW1A 4RWEA 4NZPA 4PPFA 4LMRA 3GLSA 4O1HA 3I34X 5AQEA 1BWSA 4RCYA 5G2OA 5JVDF 1MW8X 3B13B 2BKVA 1JHOA 4HN9A 4Z2AA 1YZGA 5CGZA 5JUWA 2WM3A 1IDN1 3OQ6A 1FFYA 1RXWA 1WXGA 1G5IA 4C89A 4AMYA 4ND1A 4CDRA 4LOIA 1QF7A 2JEYA 3UJHA 3VHLB 4H3KB 1P0MA 2FEMA 2NU8A 1OPXA 2PHZA 4R1MA 4YYEA 4MIOA 2YJ6A 1EWVA 1NZJA 4ND2A 4OXKA 1GARA 4JT2A 2ZSFA 4FFMA 3WWZA 2NM0A 1W93A 4AUMA 1JIIA 3ZHBA 1ZISA 4W5OA 3U40A 2XCOA 4URYR 3ZUGA 1VKNA 4D9MA 4RTLA 2GEBA 1IWPB 2BKEA 2I7VA 3ESYA 1YMQA 4CM8A 5CD9A 1S1MA 3R6TA 4KAAA 4UBIA 1LD3A 4CKZA 3QLUC 3D31A 2HN9A 3U62A 1E32A 1TK3A 3OA0A 3S8EA 4M0LA 3NWOA 3DT6A 3LIPA 1WG8A 3LXRA 1JR2A 4BX8A 4XGNA 4ACBA 4L4UA 1PL8A 1NI5A 3B3FA 3K20A 3NU1A 1Y1TA 5AH0A 1WCYA 3HSSA 3CRVA 1LNSA 1G20B 2NLOA 2XTZA 4FN5A 5CFQA 2XDAA 3EIUA 4JI0B 1G7RA 1P5RA 4C0KA 4HJRA 1JHMA 2X5KO 1DLJA 1RYDA 3IBYA 3HKEB 2W71A 4GRIA 4H9GA 1NVXQ 3AWIA 4X1KA 5CA0A 2QPOA 3HYNA 3PXDA 2WMOB 4PYIA 4PRYA 3IFSA 1X6VA 3HZRA 1EGAA 2D4AA 1YBAA 3I01M 5FUQA 2AUTA 1UOEA 5CB4A 2GA8A 3F8TA 2W22A 2IU3A 1TJNA 3QKRA 4P7FA 4QLAA 3X43A 1AS0A 1SVWA 2ZJ5A 4PBRA 1T43A 1Z16A 1KIFA 3OT1A 1GWNA 5IPFA 1EKXA 4PTLA 2FMXA 1GG2A 4DEXA 1HPLA 1QH8B 4OLBA 4IDDA 1JLKA 4CEHA 1DCFA 1P60A 1ZWLA 1T10A 1KFBB 5JROA 1N8TA 4GAEA 1VL5A 2PEZA 2XWBF 3T3MB 4JJ4A 1ODTC 4Q9IA 2CL0X 3H2YA 4WKGA 4EI7A 3U1BA 1B76A 1Z62A 1NI4A 2C8LA 3Q4GA 2QOEA 4QBHA 2CT8A 2C07A 4FTWA 1MABA 4N7JA 4OIFA 3RYFB 2WU1A 4EO4A 3L8FA 4CV2A 5CDUA 5MFZA 3H8JA 4OOEA 4X7RA 4MV5A 3LY7A 2J8ZA 3CU5A 3S68A 4EY7A 2X6QA 4QBIA 1QFSA 5B1HA 2BSQA 3FW1A 4XWWA 2DKOA 1YC5A 5ERYA 3CX3A 3G2KA 2C5BA 3GFVA 4L85A 3IBSA 2XA9A 2Q9BA 3RJMA 3C3DA 5L51A 3C24A 5ES4B 1GADO 5CFOA 5T4FA 4LF6B 2IHJA 4N40A 5LMNB 2IXTA 2L0XA 5LU9A 2CMKA 4KXXA 2J31A 4KBGA 4BFZA 2VF8A 3ND7A 1QIFA 2HHJA 3HQ4O 3PPXA 2J33A 4GM1A 4MINA 4JI2B 3ZK9A 3GOQA 3Q2IA 5EIBC 3RR2A 2ECFA 4QECA 1OC4A 3MWEA 3QV1A 4PHCA 3OOYA 4AY3A 1SU7A 2H1RA 2GF2A 5DM4A 5CEFA 3GMIA 2PGXA 2BDUA 3BERA 1N5KA 2D1QA 2WD9A 3BGOS 2AG1A 3DKPA 3PUKA 5EEGA 5EL0A 3WKEA 4C22A 4PC2A 4M0PA 3R7WA 3GLIB 1DUSA 4R41A 1O5TA 2WTBA 2CK3D 4MUAA 4RD6A 4R2IA 4U0KA 3B48A 3CCBA 1XQWA 3HCDA 4DMHA 5GADl 2YRXA 1C8VB 3EEOA 1NF8A 1E94E 2PH5A 1GQYA 1V41E 2P4UA 3E9DA 2ERCA 3LGSA 2CNBA 5TPZA 4MARA 3WGNA 2FLKA 1JE0A 2JIDA 3IUBA 3QELA 2PFSA 2YS7A 3E3AA 1X9HA 5COBA 1T5TA 5TR9A 4PINA 4C4ZA 4ZJZA 4CNBA 1XTKA 4DY4A 4DVJA 3W3AA 2QGNA 4L6IA 4RK6A 5CCBA 2IHYA 1M54A 1E6EA 4M7WA 3A9VA 3KOUA 3Q98A 5HF5A 1PJTA 4HX5A 2DU8A 3HNPA 4HDKA 2N75A 5JANA 1ZRNA 1QRUA 4FSDA 2BJWA 3PXGA 3PCXA 3ZV3A 1NDQA 1D3AA 1FXUA 1JW9B 4KNYA 1QGUA 1TD1A 2IZ6A 2R8EA 3PC7A 4K26A 1XP5A 3AL2A 4NU0A 3F97A 3N2LA 3QW2A 3PWZA 4DCVA 1C0IA 3UFXA 1Z4LA 1KMMA 3GQBB 3GEGA 1H85A 2NADA 3QZUA 4LZWA 1HK7A 4MLPA 4S0ZA 4XB2A 3VJKA 2VJMB 3AIIA 4FX5A 5C51B 1OUMA 2VVTA 2QAGC 2YZ7A 2HF9A 3WO0A 1K6XA 2FZ5A 2VT3A 4HDSB 5DI3B 1XLTA 2VF4X 3FETA 1V8ZA 2AJBA 1T4DA 4KX3A