3GJ3A

Crystal structure of human rangdp-nup153znf2 complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
202
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 66
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj3A00
3CX8A 2YINC 3EC2A 5J4HA 5FBRB 5IDVA 1Z0DA 2QSYA 4ZI3A 4U00A 3BERA 3IEVA 4CW7A 2JJ1D 2GZAA 3H0KA 3LNCA 3TSWA 4A2PA 1E2GA 2CL6X 4CGZA 4PC1A 1CKEA 3FTQA 2HUPA 4OQFA 3TJZA 4PQRA 1KI6A 1SXJC 4MITA 4AKGA 3LX8A 4MYTA 3ZJYA 4O0MA 4LUCA 2QY9A 1OE0A 1KI2A 1Z29A 1R6BX 1ZD8A 2D2EA 4QG7A 2ZM5A 3Q8XB 3CX7A 5HTKA 4TYYA 5JRZA 2ZANA 1ZUIA 2YKGA 2B6HA 5CB6A 2O8CA 1KAGA 2CNWA 2HXYA 2OEPA 5CDFA 3QVVA 1FNMA 2JDID 3K1JA 4KSCA 5FR1A 1G291 4A8JB 1G7TA 1F6BA 2Q9BA 4N0DA 3NC0C 5GADl 3SFVA 4L16A 2P65A 1NIJA 5KNBA 4W9MC 2CCKA 1DAIA 4OQMA 4NCNA 2VHCA 1TL7C 5JRJA 2GXAA 1XTKA 5JS7A 4TSFA 1DAEA 3NKVA 1CF4A 4Z8YA 2F7SA 2GF0A 2QROA 3C5CA 2V1UA 2QSZA 2J0SA 4TMZA 2ZU0C 1FPMA 2OXCA 1U99A 1ZW6A 3QF7A 4RCZA 1WQ1R 2V7QD 4D2IA 3EZFA 4LHYA 5E7JA 3RANA 3AEZA 1E0SA 2XXAB 2FFBA 4LWZA 3QPWA 1SVSA 5JJIA 1IN7A 3D7MA 1LFDB 4QJ3A 3TLXA 3FMOB 4P31A 3AF0A 5BW8A 2J41A 1ZP6A 2ZJ8A 3ZS9A 1L4YA 1ZD9A 3LVQE 3FDIA 1AZSC 2IHYA 4AG6A 1F2TA 3BH7A 4QM6A 3GCGA 3B78A 1II9A 4HAUA 3EZ9A 5JSZB 1BS1A 4KYIB 1E69A 2PLFA 4GFDA 4M1SA 4NP6A 2AXNA 3HPRA 4RVCA 4BE7B 5JS8A 2ZI6A 3RHFA 1YRAA 1CU1A 3VMFA 3AUXA 4PX9A 1M2OB 2QBYB 4G5SA 2OILA 1W49A 2FSHA 4AK9A 3MRSA 1ZC3A 4JLDA 1H8HA 4RFSA 2HF9A 2CNWD 4MYCA 1GITA 1P9WA 1E0JA 3EW9A 1Q44A 4LBVA 1VKJA 2BM0A 5EXXA 1K5DA 3RWOA 5KDOA 2ZREA 2ZI3A 1G3QA 3ZZUA 4LZZA 4URXR 5K8LA 5FOVA 1UFQA 3SN6A 1KJWA 5M04A 2HCBA 2J45A 4TSFD 3PUVA 2FMXA 5EJEA 3AM1A 3BFVA 1SGWA 1GNRA 2VHTA 3NH9A 1G19A 1XP8A 2ZSDA 5AWFC 1ANKA 1ZIOA 2R6GA 3K0CA 1T8TA 5DI9A 2EFHB 4TMKA 4GRAA 4TQUS 1E2MA 4ZCMA 5DLQC 4PQFA 3GMTA 5CYPA 2ZRDA 1IAQA 1FNNA 4A1FA 4BFWA 4WXPA 2XZPA 1KI3A 4DKXA 3CRRA 4IW3B 5HCNA 1JBKA 2V9PA 4X8LA 3VFDA 2IF0A 4LJ9A 2GILA 4Q1DA 1G4AE 1EESA 1MKYA 2OV2A 5G40A 2W58A 3MCAA 4I4LA 1XXHE 4R98A 2BBWA 4XTCS 4EJSC 1N3BA 3SS8A 4CT4B 4DEXA 2X8AA 2RGDA 3EIEA 3HDTA 4DLRA 1QHIA 4RKEA 2GF9A 1LF5A 3W6PA 1IXSB 5B58C 4Q4JB 3B1XA 1IN8A 2WM9B 4QM7A 1UADA 4Q1BA 3ZVRA 3KZ1E 2V3CC 3U4QB 3B7GA 1H8HD 4OK3A 3NDBB 2WSSA 1G64A 3V4RA 3BK7A 2GCPA 1OH5A 1G8PA 1II0A 3WMGA 2BCGY 4Q02A 3THXB 2IYQA 3QXCA 2QUZA 2FDCA 3OE7D 2ZRFA 2KJQA 1Q1BA 1U98A 2ZI4A 4G0NA 3ICQB 1VG0B 4KLNA 5LPNA 3PQCA 2GBLC 5FPYA 2GZHA 3FFBA 2VSFA 4M1KA 3EPKA 1II8A 5F98A 1R5OA 1OFUX 4JL5A 3REFA 2E1RA 3QKRA 3F5FA 4BLTA 2ANBA 2EYQA 4B2LA 1O3YA 5DO9A 4EPWA 3AVPA 1T5IA 4KJZA 2YC4C 1M1YE 4TTQA 5EXTA 4C0AC 2CXXA 2ODBA 4MGIR 5EP4A 1CBUA 5BYJA 4E09A 3CR8A 3DPUA 4TLCA 5AJYA 4UNQA 3GJ0A 3UANA 3VU9B 2DWOA 1RW4A 4DWJA 4C4PA 2WTUA 5KNDA 3ECCA 3KUDA 3MLEA 5JFGA 2CJWB 1KK2A 4JVSB 3MG9A 1S0UA 1HE8B 1NN5A 1U8YA 4OHZA 1EXMA 3WYFA 1P7CA 4QXAA 2NIPA 2VF7A 1ZU5A 3GJ5A 1A2KC 2QNRA 4D25A 5EE3A 5L3SB 1X6VA 4C7OA 2QE7A 1BYIA 4QGHA 4JJZA 2C9YA 1NVXQ 3GLIA 1N6OA 2ZRLA 1CR2A 2WSSD 5JCPA 1XZQA 3UG6A 4ACAA 5H70A 1Z08A 3OHMA 5B64A 1GNPA 2RAPA 1VMAA 4IDHA 4PANA 1MH1A 2IYZA 4JVLA 1AN0A 4B3DA 1LS6A 4OQNA 2J1LA 5IHPA 4B74A 4BECA 3HYTA 1QZXA 3R9IA 3U7GA 3AVQA 4ZIRA 3I72A 4DDWA 1CRPA 3M1IA 2WWYA 1JJVA 1XPRA 2UVQA 1P5ZB 4XD7A 1UBFA 4Q18A 2JCSA 1KSGA 4B73A 1FMJA 1S3SA 1RJ9A 2O8BA 2CK3A 1PLKA 4ZCLA 4CYMA 3E2IA 2CL0X 1CXZA 3SQWA 1QG4A 3A58B 5LD2C 3Q3JB 1X8LA 1KSFX 4EIWA 3REGA 4GT1A 3EA0A 4XVRA 2OUKA 2PX0A 4MQBA 3K9NA 1E2PA 3WMEA 4Z54A 1Z6GA 5FL7A 5JHGB 1W4BA 5SZKB 3KQNA 3L43A 4S2EA 3KDSE 4MH0R 3UWKA 3I8XA 2NZJA 4IOMA 1KI6B 2ZSBA 2IYRA 3IQXA 1E9RA 4Q1EA 1JR6A 4OQXA 5UKDA 3NBFA 3OFND 1RRFA 5KSOA 1HT2E 2IL1A 3KXIA 5KUTA 3THYB 1JR3E 1F48A 2VRWA 2QE7D 2GJ9A 4HB4A 1HA3A 2XTMA 4OHXA 5J4YA 1T8UA 2WMOB 2XSZA 2WIBA 1SXJE 2IXGA 1F60A 2DFLA 2OT3B 1US8B 2ZRPA 2OSBA 3AKCA 3SFZA 4DJTA 4XTRA 1EWRA 2C77A 1IOZA 3NHBA 3R9WA 1ZJ6A 2AD5A 1CIPA 3UXMA 2IW3A 2REOA 4Q9KA 3U3RA 2CK3D 4RY2A 1MRSA 2A78A 3K09A 2ZVQX 4Q1CA 3O8BA 4L8GA 5GVSA 4LPKA 1GRQA 3TH5A 2OFXA 2Z4RA 3DOEA 4P33A 2MMCA 4RFVA 2QM8A 3PJRA 2I1QA 221PA 5ELXA 3QPUA 4ITRC 1HEIA 3B8HA 2RHDA 5FL7D 1KI8A 5KPDA 3B1WA 2FX3A 2R65A 5BN5A 2AHOA 4YMVA 1E99A 4HAWA 1J90A 3IILA 4ILEA 4AY2A 3GD7A 3AVUA 2EW1A 2NPFA 2X2FA 1Q12A 1OSNA 1P2SA 1X86B 5AUNB 3U6BA 2ZSAA 1RRGA 4HEJA 3P4XA 1VIAA 4RSGA 2ZS7A 3QXSA 2ERXA 4LBWA 4AIIA 3T06B 2UZIR 1E1RA 2C03A 2XSZD 2JIZA 2IT1A 4PQYA 1QHXA 4RD0A 1KY2A 1G3MA 3G82C 2D2FA 3UK6A 1EFCA 4MUBA 4M9SA 1GKYA 4ZKDA 3TBKA 1HUQA 3Q5EA 5KSYA 1E0KA 1P61B 1SVIA 3LX5A 4L4UA 5KYKA 4AKEA 3TE6A 3ZGXA 4C3ZA 4DCVA 4YQFA 3QI2A 4JLNA 1Z83A 1XEXB 1SHKA 1LNZA 3H2YA 3GLGE 4ESHA 3ZIAD 5DE3A 2OBLA 2RGCA 4Q03A 3AF3A 4C0QC 1SZPA 4II7A 5C4GB 3SEAA 3SC3A 4A2QA 4TQAA 3UKDA 2G6BA 3PIRA 2WBLC 4AD8A 2H7VA 5CIQA 4EAQA 2CLCX 1RYHA 2PT7A 3I1FA 3OIWA 3WNBA 4DDVA 4ZDJA 2FZLA 3C41J 1QHYA 3A1VA 4B47A 4MRRA 1AQYA 2XGJA 2PZFA 3V00A 4A36A 1DADA 2FG5A 4JSYA 3W5IA 1N5IA 2QRZA 1KI1A 1KNXA 1SQ5A 2FU5C 4V02A 3TQCA 3SYNA 2VA8A 1UEIA 4LJ5A 2MSEB 3P26A 3MWLA 4G5GA 4HYYA 2OCPA 4O2LA 2HT1A 1RIFA 4C0BA 1JNYA 2C95A 1ZRHA 3CPJB 3QKSA 4QJ4A 2V54A 4JJKA 5L3QA 1DG3A 1TU3A 3E1SA 4HDCA 1H65A 4HLUA 3SNHA 1G3UA 2R6DA 1NSTA 2ZE8A 3CUEF 2QGZA 1W4AA 4B3BA 3R8CA 3B6EA 1E1RD 1J2JA 2A2ZA 2AX4A 2BOVA 4YC7A 3AP2A 5G53C 5DNYB 2JIZD 621PA 1P2TA 1W0JA 1KNQA 2GESA 3L0IB 2IUTA 2OCYC 5AUPB 3BRWD 1EFHA 1G3IA 2ZU6A 1KTVA 4HAZA 4ZDKA 4FD2A 1NKTA 1OB5A 1LTQA 1TQ2A 2RMKA 3KKOA 5EXSA 1WB9A 5F2EA 2ZI5A 2PBRA 3OIYA 5BXQC 1M6NA 3LDAA 1GILA 1RKBA 3WYAA 3B9PA 2KB0A 4QBHA 2D4HA 5DI3A 1NRJB 3OESA 2IYYA 2WICA 4FWIB 2NTYC 3HYRA 5FUXA 4OHVA 3DKVA 1W36C 2JLRA 1AS0A 4TMVA 3LWNA 4P0TA 2L0XA 4D0LB 3X1YA 1RC8A 1JPNA 4OHYA 3QBVA 5E4FA 3IIKA 4LYHA 3GFPA 1UBCA 4QNMA 3ZVNA 2D06A 2BCJQ 1A7JA 4NYMQ 3W3AA 1D2MA 2BJVA 3LW8A 3E5HA 3GJ6A 3MJRA 4N1AA 4DSOA 4DXAA 2BV3A 2J87A 721PA 1OIXA 5JHHB 3WRXC 2A5JA 2IF2A 2GZDA 4B71A 4WAUA 1JXOA 3WNCA 1RVDA 4DIEA 3FMPB 4HDQB 1N6PA 2B8WA 2PMKA 3ADCA 3OAAA 5AUOB 2WKPA 1YZQA 4BLOA 4HUQA 3KJIA 4B3FX 5JJKA 1SVMA 2QAGA 3QY0A 4RD4A 1W1WA 2WOOA 1UPTA 3IBYA 1NBME 2REXB 3Q7PA 4M8NE 421PA 3WRYC 3EAQA 1VIYA 1VCIA 4KVGA 4CEHA 4EDHA 2WOJA 1P72A 1ESMA 1JQLB 2IYXA 1M7HA 3GLHE 4DSTA 4NKRA 2BBOA 4JLVA 2ZEJA 4DB2A 3LQQA 4V0OA 3U6KA 3B82A 3EX7C 2EFEB 3RC8A 4C2UA 4TMWA 4M1MA 4IEEA 2OZEA 3TIFA 3G0HA 1YHNA 5BQ5A 1S4QA 4C9BA 3TKLA 3BB4A 3KKPA 4EUNA 3F8TA 3BJIC 1XMVA 1G7RA 2A5YB 1XTIA 4ZPXA 1TF7A 4LJAA 2ZIAA 4JBWA 2ODNA 4XWOA 2O0HA 1IJEA 2ZRJA 3FGNA 2GVDC 3HR8A 3U7EB 3KJEA 5JWRA 4I99A 2NO0A 4M9ZA 2OO7A 1G6HA 2ZJ5A 5J4KA 3FMIA 4GL2A 1RYFA 4A6PA 3KQHA 2ZROA 5TMPA 3W5JA 4AKIA 1OH8A 3NWJA 4NH0A 1GVNB 1SHZA 2QPOA 4Q4HA 1K6MA 4E07A 2QG6A 3OAAD 4V0ME 4QC2A 4IXMA 1GFIA 2ANCA 4GMXA 3DEFA 3ZZTA 4P4SA 3D31A 1Z0JA 3CZQA 5HE8A 4QHYA 4M22A 2HT6A 4CDGA 1OHHA 2RGNC 2YOFA 1Z5ZA 5CM8B 2C04A 2VH5R 3CNOA 1XU4A 4P3YA 4URVR 1HURA 1H8EA 1E9AA 3DDCA 4GNKA 1OIWA 4OK6A 1CTQA 1AGRA 1P4SA 1IBRA 1XTSA 3KFXA 4NBSA 3MSXA 3W6OA 5SZHB 1EK0A 1NVWQ 1XD8A 2QTFA 4MKGA 2DFNA 1W2HA 4DC9A 2WWXA 4TL7A 2EFDB 4QNRA 1MABA 3AVVA 1RFLA 1G3RA 1TU4A 4OK5A 2PEZA 4LC0A 1XMJA 3UIEA 3H86A 1ZIPA 1OXUA 4D82A 1E2JA 4CT5A 1ZYUA 5KDLA 1N6LA 3CNLA 4CVNA 3V9PA 4PFSA 1NG9A 4FIDA 3PV0A 5EP2A 2BM1A 4EPRA 2ZRBA 5DN6A 1XXHA 2RGXA 3QKTA 2Y8EA 3WMFA 1SKQA 1FX0A 2ZTSA 2IUUA 1Z63A 4KITB 2FWRA 3U44A 2OFWA 3HP1A 4LOAA 4XWKA 1VYVA 2ZI7A 4KFRA 4Z8XA 4BZPA 4ERNA 2BWJA 2GA8A 3TSZA 2GVZC 2IYVA 2OFOA 3AP3A 4IJMA 3RS4A 3E70C 2H16A 1R10A 1XJ0A 2IEYA 4CZ2A 2P5SA 1FP7A 4EPVA 4TYWA 2JEOA 3CF6R 2OCBA 4LV6A 3AVTA 2H8KA 1X1RA 5KSPA 3ND9A 821PA 5EE9A 4UNSA 1G8FA 3BIFA 3MFYA 1G7SA 5J5CA 2QQ0A 3PEVA 1T3HA 5A0FA 1DO2A 3AF2A 1OHHD 1SKYB 5AJZA 2YZ2A 1KDRA 4GP7A 2PZEA 1AJEA 1H8ED 2F1IA 2LKCA 1DARA 3DO6A 1R4AA 3BH6A 1P9RA 2J0UB 4HLQB 3C14C 4ZKEA 5TB5A 3VAAA 3B1VA 3VR5A 4A4DA 3EPJA 1PUIA 1E2FA 4PHHA 2GJSA 4IFEA 2N46A 4LJ7A 4TYPA 3K9GA 5DSZA 3IHWA 3ADBA 2PJZA 3W34A 2LKDA 4BLRA 2ONJA 2KSQA 4PPNA 3AGQA 1G8HA 5JI2E 3IBGA 1NF3A 2FFQA 2WWIA 1R8SA 1Q1EA 4UXJA 3CONA 4KYUA 2IS6A 5DN6D 3CPHA 1NNEA 4QGFA 2J9RA 2DPXA 3LFUA 5EZ5A 4DUGA 5EUQB 1E2IA 2ZUDA 1AK2A 1GP2A 3A1WA 2C9OA 4HATA 3CM0A 1XD2A 4N0EA 1E2HA 1WE2A 4JLAA 4OJQA 3AVYA 4Z1MA 4OBEA 5HPYB 4MRPA 3VR1A 1EFUA 1U8AA 3QBTA 2RGNA 4RKFA 3WXMA 1OV4A 1OH7A 3B1ZA 1RPZA 4LJ6A 4HZUA 4ARZA 4YMUA 1FMLA 1N5JA 4KVAA 3N2IA 4TT3A 3CO5A 3UG7A 2CLDX 2H5EA 1DVRA 5KU1A 3M6AA 3NBYC 1U9IA 3N2EA 3PUXA 4KODA 4QL3A 2DB3A 4GOJA 1M74A 1DBSA 2FFAA 2P67A 3KKQA 1VECA 1N0WA 1IN6A 3UMSA 2FSGA 4F93B 3A8TA 1XPUA 1JAIA 5FTJA 3U61B 3A4NA 1S96A 1FP6A 4AYTA 3RSLA 1E9FA 4TLBA 2BEJA 3TUIC 3RYTC 1QHHA 5FBLB 1EWQA 5DI3B 2XZLA 1XEFA 3A6PC 2WJVA 2XNSA 3FOZA 4BZQA 4A15A 4MGZR 3CIOA 3ICEA 3ONWA 1JQJC 2XB4A 4FINA 1DPFA 2CBZA 3IIMA 4L9SA 2WAYA 2F43A 4DUGD 5HR5A 1TQDA 1DEKA 1D2NA 1XCPA 2A30A 3QF4A 1R0XA 4D4KA 2F6RA 1CR1A 4WZAE 3CBQA 4HSEA 4OI2A 4E03A 2FNAA 3CR7A 4JBXA 2ZRCA 2P3SA 1E9SA 2ZUBA 3Q7QA 1E2NA 4MDEA 4Z1MD 3I4LA 4UJ3A 2CEAA 2I4IA 4WOPA 4JZKA 4AURA 4Q9IA 1DS6A 2JLZA 1NJFA 1SXJA 4TT3D 3O8CA 4ABYA 2Q3HA 4FMDB 2YWEA 1JPJA 3LBIA 2GHIA 5EP1A 1QBKC 3QENA 1ZNZA 3I8SA 2IUSA 1JB1A 4HUQB 1U0LA 4URZR 2J0QA 3MWJA 2W6IA 1VHTA 5IK2A 1OYYA 5IT5A 3DHWC 3I92A 3ZD6A 1OYWA 1KI7A 1LW7A 3GJ3A 1QVAA 1W4RA 3R7WB 2GCNA 4LSGA 4BRUA 2ZETA 1CJKC 1NL3A 5CLLA 1PZNA 1UEJA 4HB2A 2DHRA 4L5BA 4G5RA 4Q66C 3PUWA 4TL6A 2ZJOA 1NVVR 3K70D 4ZV4A 4RZUA 2WJHA 5D3MA 1IN4A 3S1AB 5KPJA 5EP3A 2W83A 1BOFA 2J3EA 2IEZA 5FI1B 2R44A 1F2UA 4NCKA 4CEJB 4MRNA 3VX3A 1KSJA 3U3KA 4F4IA 3BORA 2JLQA 1KK0A 1P2UA 4KU4A 3X1WA 2QZ4A 1Q1ZA 2GETA 1XCMA 5TXGA 3A36A 5HKKA 2LWIA 1KI9A 1R0ZA 4UQOA 5DISB 3C16C 5J4LA 5C18A 1KI4A 4GBMA 4FMBB 1AGPA 1T0HB 3FHTA 2E87A 2TMKA 1SXJD 1PV4A 3SR0A 2IS1A 4XH9B 2IYTA 1VG1A 2O52A 3RS7A 4Q4HB 3SQXA 3K0EA 3P27A 4OHWA 1PLJA 4JLJA 2J7PA 2ZRMA 1MO5A 4I1SA 4UXIA 3SU8A 4B75A 2EWWA 3NBXX 1FTNA 2W6ID 3GLGA 5G3YA 2XJ9A 4DIDA 1R0WA 5CJ2A 2JGNA 1TNDA 2WV9A 3IUYA 4R7ZA 2CVFA 4LHZA 2OM2A 2VQSA 4UNRA 3LAWA 1W7AA 2IS4A 1IONA 3TRFA 3HPQA 3T1QA 1CR0A 1F5NA 3KQLA 1R2QA 2KI5A 2P6NA 4PPQA 1KJZA 4J0QA 1SVLA 1FUKA 4ZDWA 3DM9B 4KFTA 2AL7A 1MABB 3R20A 1TEXA 2UZ3A 3OZXA 4BZXA 4DSUA 2HV8A 1ZC4A 3NVAA 3QQ5A 4JIMA 2ORIA 2ZPTX 1G7CA 2PCLA 2JA1A 2F3RA 4UKDA 1IXRC 2A9KA 5CDFE 5KNCA 1HY3A 3DMNA 3KTAA 1MRNA 1HV8A 4IOJA 4RD1A 3QPVA 1Y3AA 2A5DA 1BO6A 4PC3A 4PSVA 2IBMA 2OLJA 1XXHB 3HR7A 1T3LA 1NI3A 4IDPA 3O8RA 1E6CA 1JI0A 5DYGA 2BMEA 3NEYA 5HKKD 2AKAB 2ZQ5A 2WWGA 5GJVC 1HT1E 3ADKA 2BMJA 3L2OB 3IPXA 4RCYA 3J81k 4EFNA 2ZR9A 1DG1G 4PSKA 1NKSA 5FUWA 2E9SA 3SJCA 3SJZA 3BH0A 1VCOA 1ZM4A 4FI3C 4DLWA 4CEIA 4GOXA 1U2RA 1QF9A 2CHGA 3BB1A 1W46A 4PAOA 2F1RA 4EJSA 3PUZA 4DCNA 3HU2A 4BGDA 1NSFA 4JKIA 1YR7A 3D6TB 3Q72A 3MJHA 4Q4LA 1G9XA 1ZVQA 4LV8B 1ZM3A 2REBA 4AG5A 3AV0B 1NIPA 2DYKA 1PJRA 3DMDA 1VTKA 4LV5B 1E9DA 1L7VC 1NY6A 2NO1A 4A2WA 3GLFA 1KJYA 2IYLD 1G6OA 1G4UR 4MYHA 1YR9A 2IHBA 2AKYA 4FMCF 1W4CA 3ZH9B 2GBLA 1Z2CA 3PUYA 1JEDA 5KOYA 4GZMA 4QKQA 2MSDB 2FH5B 4LJ4A 3V4FA 3OEHA 3I32A 4OQLA 2YYZA 3HWSA 2QM7A 2O8CB 1XTJA 2VIIA 2ZRKA 3AUYA 3CH4B 1P60A 1KMQA 1N0UA 2C5LA 1E9BA 3Q9LA 3ZQJA 3W90A 1RRCA 2DR3A 2A5FA 1BKDR 1M7GA 1Z2AA 2GK6A 4M2LA 4MGKR 4A8JC 2NO9A 3WYGA 3RRZA 2R6CA 3U3JA 3WBKA 1SVOA 2ONKA 1X3SA 3GEHA 2GEVA 3QUSA 4XD7D 4YDHB 4D0GA 2J5XA 4LJ8A 1TMKA 2VHQA 1T0JB 2N42A 1KO8A 4U5XA 1XD2B 2RB4A 3BFXA 1FOEB 1UKZA 2GKSA 1T91A 2XNDA 3ZS8A 2XX3A 4B35A 3VKHA 3EZ6A 3Q5DA 2NO6A 3R9XA 3THWA 3HJNA 2G88A 2ZXUA 3BE4A 1E1QA 1G16A 1NBMA 2FV8A 2ZRHA 4KFUA 5FPKA 3PEYA 2W2VA 1RE0A 3SJAA 1OF1A 5GJBA 1E98A 2GXSA 2ZE6A 3W8RA 5CIWA 4HLCA 2IXFA 5KTYA 1JAHA 2EFCB 1O87A 3GLHA 2RGAA 3IQWA 1HTWA 2H18A 2YWFA 4NDZA 1Z6AA 1F2TB 1OIVA 2R8RA 3K9HA 3ZDQA 1S1MA 3IGFA 1Z6XA 3KQUA 1DAGA 1IY0A 4DDUA 2BMDA 2GAAA 4B33A 4XSHA 3X1XA 2XAUA 1EFTA 1XEWY 4B2PA 3LD9A 5AJWA 1SVKA 2I3BA 2O0JA 4MUAA 4AC9A 1S8FA 1Z8FA 3PEUA 3K70B 1E0AA 2YWHA 4RFSB 4XIGS 4U02A 3RS3A 1OT3A 1ZINA 3RC3A 5KHOC 3UPUA 1GIAA 2FE4A 2DWQA 2HDNB 1FW6A 5FPSA 5E3HA 4D80A 2CCGA 4QOSA 1U90A 1U8ZA 5EXPA 2W6JA 5JECA 2MSCB 1J70A 4YONB 3EWSA 2ZITA 4W7SA 3B13B 4URYR 4C0HA 4C30A 4V0MA 4B76A 4BQSA 1UDWA 2XNDD 3N5CA 2QRNA 1GM5A 3RNLA 2NG1A 1QHNA 3CRMA 1X8KA 3EPLA 4Q4AA 1JXMA 1HYQA 2CE2X 1E1QD 1NBMD 2X19A 3KKMA 1AM4D 4TL9A 2AWOA 1QG2A 4HI0E 1G17A 3T34A 2O8DA 2AN9A 1T9HA 6Q21A 2P6UA 1XB2A 2MMGA 2N1BA 2CMKA 2GWHA 5LB2A 1KO1A 4D26A 1XEWX 5JLJA 3OEEA 3U3MA 4QBFA 5TY0A 4F4CA 3THOA 4TZ6A 4IRUB 4XWAA 3TW8B 4JYCA 4A0GA 1D2EA 4GI7A 5FBWB 1XZPA 5E7IA 4K46A 1ELOA 1OFIA 4NYJQ 5FPTA 4Q9LA 4A8JA 4RZ2A 3LBNA 3FB4A 2WWHA 1XMSA 3SHWA 2UKDA 2X2EA 4PPFA 5CYOA 3DM5A 3IO3A 4R2HA 5DGXA 4WIAA 2PCJA 2A3RA 5C4MA 4DLZA 2QEQA 1K5GA 2EWVA 1GUAA 5D3MB 3SBDA 3IO5A 2JLWA 3SI7A 4Q7KA 1KYIA 2Q0HA 5GJCA 4WA7A 3T5GA 4WXRA 4PHGA 3CRVA 1CEEA 1N6RA 1DOAA 1F2UB 3BFKA 3TQFA 4Q7JB 4TL8A 1OB2A 4JKYA 2YC2C 3ZD7A 4NYJR 3K0FA 4HLDA 2WZQA 4MDFA 2I1VB 2QP4A 1XRJA 1YKSA 1IN5A 3U7FB 1KIMA 1BYUA 1KO4A 2W6JD 3QKUA 1DO0A 1II8B 1EX6A 1P75A 5AJVB 3HU1A 4KI0A 3EASA 1UDXA 2YV5A 3QKRB 1CS4C 2IC5A 3M4YA 2A7QA 4JLOA 1COWA 2AWNA 4JLPA 5J4VA 4F91B 3K9LA 2PL3A 4UNNA 2P6RA 3GJXC 3U5ZB 1GDDA 3NDPA 4V0LA 4CRWB 3A37A 5FOUA 1HQCA 2GTPA 2OCAA 4LHVA 4RJLA 4US0R 2ZRIA 2BEKA 5JSZA 4PZYA 4MRVA 2C96A 4OI1A 1OPXA 2FSFA 3NH6A 3WNDA 5F9HA 2F9MA 1U81A 2BBSA 3MWYW 4QBGB 2VP4A 5CK4A 3ZVLA 3I62A 1Z22A 4DCUA 3LXXA 1D6JA 4D4MA 3L0OA 5E95A 2QBYA 1UAAA 2G77B 4EPYA 2IYSA 5SZIA 3TGPA 1T3SA 2ZI9A 3AGPA 1NMZA 1ZUHA 4KBFA 4F38A 1Q3HA 1VCNA 2ZVPX 3NC1C 2QPTA 5FL3A 2FSIA 2BMFA 3ASZA 2W00A 3W6NA 1SULA 4GZLA 2D7DA 2RH5A 4C7OB 3KFVA 3X2SA 2Q6TA 4V0NA 4PZLA 2O8EA 3GLIB 2CDNA 2OXRA 4TTPA 2HLDA 3L8YA 1P73A 4TZ0A 3RRMA 1W0JD 2QMHA 2R6FA 1BMFA 2ZJ2A 3BC1A 2HYIC 1Z6YA 2AK3A 3KJHA 4MKHA 2XZOA 2VO1A 3P20A 4IDNA 3OIVA 3WHKA 5AJXA 5LDDC 3EARA 4D81A 2G1JA 3LQRA 4ZIRB 4X8MA 2QPAA 4LRWA 1E94E 3QG5A 1G41A 4Q7MB 2C98A 5J40A 1VDZA 1COWD 4HAYA 4BPBA 1FL9A 1YR6A 3PR1A 2O8BB 1RJ9B 1YU9A 4KSBA 3TR0A 5A5GA 4AI6A 1AKEA 5C2JB 4JS0A 5ANRB 2OG2A 1MO6A 2GEUA 3BS4A 4CEIB 4EJSB 1LVGA 4RZXA 2VLIA 4GMDA 1XJCA 3LRPA 1YZNA 2ZRAA 2D74A 4NTZA 2WJIA 4PHTA 3KXLA 4Q4JA 2ZAOA 2WPDA 1ESNA 1FQJA 4ZDIA 3PXGA 1T4GA 1TF5A 1VG9B 3GJ4A 3U4QA 2J0VA 1A82A 2IS2A 1YJ5A 1MV5A 3AKDA 3CNNA 3DKPA 4WBSA 4A0HA 3GLFB 4DEYA 4H1UA 1G20E 2DCUA 1MO3A 2IX3A 3CW2A 4LC1A 2VPPA 1W44A 3THXA 1MR3F 2EYUA 1Z0IA 3LVRE 1FQKA 1YZTA 4LY6A 1IXZA 2IWRA 1KGDA 4NCJA 4TYNA 1J99A 3MAAC 1S2MA 2KWIA 2HLDD 2FGKA 2WVJA 3CF0A 5DIFA 4A0FA 1ZAKA 1I2DA 1SKYE 1UM8A 3RDPA 4WW0A 3TSOA 2DY1A 5EZ6B 4C2TA 4EPTA 2JATA 1UKEA 1P6XA 1G8YA 1VYUA 3RS2A 3FKQA 1FFHA 1U0HC 3H1TA 3VHLB 4PPGA 5K8IA 1R8QA 1DAHA 1G18A 4TQ9A 3QEOA 4W5HA 5GJWC 3BBPA 3VU9A 1CR4A 5KDDA 4V03A 4ZCIA 3EG5A 2QT1A 3C7KA 4CIDA 1IHUA 4LYFA 1KDTA 4Y0AA 2JJ1A 1VHLA 1D8TA 5CLQA 2JLVA 2V8OA 5AUQA 1MO4A 1UBGA 2CJWA 3L82B 3AQ4A 3LY5A 4DB4A 3O8DA 1K8RA 2XOKA 4I1OA 1C1YA 4KXFB 1LF0A 2FZ4A 1KK1A 4KV9A 1Y63A 4BFXA 3K0AA 3TR5A 1FUUA 1XWIA 2BJWA 3GJ7A 4PAQA 2B7BA 1Z0KA 2GNOA 2ZJAA 5L3SA 2C9CA 3DZ8A 1Z0AA 3LLUA 4AYXA 1KK3A 4R71A 4YLGA 2WPDD 3GLHB 5FPHA 4K8OA 5H1YA 3U60B 1GL9B 1ZM2A 2JASA 3QXJA 1E79A 1XD9A 2B7CA 3FKSA 4Q47A 2PEYA 5DYIA 1Z47A 4TLAA 1GKUB 4TN1A 3K0SA 4M1TA 3KQKA 4LBZA 4HZIA 5L8VA 3QOFA 5EQTA 2CHQA 4TMXA 1KZ7B 4TWZA 4XJXA 3D3QA 1OLOA 1S9DA 5D3QA 4NONA 1G8GA 2FEMA 1TEVA 3FFAA 5FOXA 3WY9A 2AD1A 2OLKA 1E2LA 3H4MA 4P4TA 1N6HA 1R0YA 4Z51A 2VL7A 5B2ZA 1IY2A 3P32A 2KE5A 2OESA 2J7KA 4BFUA 5LD2B 4R9UC 2P2LA 3PG5A 5EE5B 5P21A 1W36D 4HB0A 1Q57A 3AKEA 2V7QA 2WWWA 3LA6A 4JLBA 4Q1FA 4Q9JA 3RSOA 2ASEA 3ETLA 4NU0A 3ZVMA 1MOZA 3QEJA 5C1BA 5TV2A 2H1LA 4TMTA 2NMVA 3FWYA 4FCTA 3CX6A 2VP9A 3IPYA 4NMMA 4QGGA 2FPMA 1IQPA 3MUFA 4G3XA 5FTNA 1DAKA 3A1SA 3W8NA 3CF2A 3LW7A 1E3MA 4LJYA 1I2MA 1Q22A 4Q4AB 2XOKD 3QXXA 4B2IA 8OHMA 5CM9C 1GL6A 2ORVA 3K0CC 1NLFA 3VX4A 3AB3A 2JLXA 4E5UA 4O2RA 4EKDA 2O8DB 2HXSA 1KZGB 3THYA 4A6XA 4JMPA 4M4SA 2IYWA 5FTMA 1M7BA 5FOTA 2IYUA 3IIJA 1R7RA 2OAP1 1E79D 4JLKA 1QVRA 3FKSD 3SOPA 2RGBA 3ZQ6A 1B23P 2VP2A 4FXPA 3M0EA 3QKSB 4AYWA 3DL0A 1UF9A 2OE2A 5L3QB 5IF9A 1US8A 5HCIA 1C9KA 3GEEA 4JBYA 4PSAA 3ZZ0A 3CWQA 4OYHA 1I4DD 1WCV1 2FJUA 3GEIA 1L4UA 4B3GA 3T1TA 1QHGA 1ZCAA 2RKOA 2XJ4A 4GOKA 4NZYA 1GRRA 1KSHA 3EC1A 3T1OA 4BASA 1D5CA 3T12A 3GFOA 1N6IA 4NE2A 4OL0A 4URWR 4XVUA 2VHUA 4I81A 3KX2A 3K0FB 2FA9A 4MKFA 1N6NA 2CVHA 2QQEA 5SZJA 2DBYA 1XX6A 2Q3MA 4H9GA 2VSOA 1T6NA 1ETUA 2RHMA 3JZAA 3RVBA 3SDZA 4KCGA 5JZVA 3PITA 1AKYA 1LB1B 3ASYA 1IY1A 4DZZA 4POAA 2DWPA 1QHSA 2KBFA 3TAHA 2O5VA 4NCIA 4DLUA 5JEDA 2JLYA 4PO8A 4WVFA 4D6PA 3BGWA 4B48A 2OBMA 4EPXA 1X1SA 1XDBA 2GDJA 3B9QA 3AF1A 1KDPA 2R6AA 1NLYA 1TPZA 3RABA 2QGNA 3TW4A 2VP0A 1JR3A 4YXWA 4D4LA 1J8MF 4JYBA 2DFKB 2YJTD 1KDOA 3U7HB 2VEDA 121PA 3LBHA 1D9XA 1EFRA 1NN0A 2Q9CA 4P32A 2B8TA 5CB8A 4EQ6A 1ZBDA 5FBVB 1XCGB 1OW3B 1W0KA 2ZSEA 3CZPA 1N5KA 3SYKA 1Q21A 3B5JA 4BFYA 2VP6A 2ZSFA 3OE7A 3TVTA 1C4OA 2V55B 5JWHA 1AIPA 3SYLA 4F7WA 4GP6A 4EFLA 1XF9A 1XEXA 4A0RA 1NVVQ 4Q1AA 2O8EB 2KBEA 5AK0A 2GJAA 1ZM7A 1CLUA 2QAGB 4KAXA 1UKYA 2WIAA 3FMFA 4I1UA 2BKUA 3HU3A 2J46A 4LK2A 4LPSA 4RD6A 4S35A 1E32A 2R62A 4IHQA 4Q9HA 5JBQA 1HQYE 1TTTA 4B3CA 1Q20A 3FYHA 5CK5A 1XFAA 4OKSA 2PT5A 1GZSA 1N25A 1SVWA 2HCJB 3TNFA 4CEHB 2VYFA 4PR0A 5FTLA 3A1TA 4B32A 1XNJA 4JL8A 3GFTA 5H68A 2ODWA 2FPKA 4X8OA 1KMHA 2V1XA 3VTKA 2IXEA 5KO2A 1E9EA 3KL4A 3B2EA 2FFHA 3T35A 4Q19A 2CE7A 2Z43A 4F92B 4QGAA 4AWXA 2NZ8A 4TLEA 4M1OA 1FZQA 3TVDA 1T5LA 5G41A 2Z4SA 2V6JA 1JECA 4B3XA 5GVRA 4FWTA 2FN4A 4YXWD 1JR3D 3VR2A 2GRJA 4B34A 1E2KA 4PO1A 4ZO4A 4M53A 2HYDA 3RRNA 4ASUA 1EFRD 1IJFA 1CRQA 2GJKA 4RD3A 5F9FA 5LB4A 1W0KD 3FHCB 5JI3E 2C78A 1KKLA 1L8QA 4N3NA 3KB1A 2ZE5A 3RS5A 2XEXA 2BKEA 1B0UA 1BIFA 1V5WA 3CKLA 3NEJA 3I5YA 1W47A 1RZ3A 4DLXA 2K5UA 3IEUA 3EXAA 3FE2A 4P4SB 2Z0MA 1DAMA 3L8ZA 5IK2D 2EQBA 4JT2A 2YHSA 4FMCB 4H1VA 2ODEA 3WP1B 3NG1A 1NN1A 1DTSA 3OF5A 1U94A 3N70A 5CITA 3MD0A 4BLPA 5FR2A 1N6KA 1NLZA 1W36B 2XTZA 1W48A 4JSTA 4JVMA 3KXKA 5FOSA 3GP8A 4DLYA 1E4VA 4DCTA 4U7DA 1W5SA 1OXSC 4F4JA 1QRAA 3T61A 5HZHA 4IVPA 4OJKA 3T5DA 3ADDA 4FCVA 5TARA 3DZDA 4C0LA 1YRBA 1CP2A 2ZJBA 3SE0A 3DVLA 4FMDF 3K09C 5AR1A 3U2QA 1GKIA 2H92A 2QL6A 4X8HA 1ZCBA 3JZMA 2HJGA 2ZJYA 2PH1A 2Q9AA 2YNMA 1UBEA 3K0AB 3X1DA 4PC6A 2VBCA 1DE0A 3CPEA 3OFNA 4M0LA 4O25A 3SBEA 4P4UA 5B57C 1FX0B 2QU8A 4D0NA 3U44B 4KO8A 2PJRA 4C0KA 4JVNA 5E7MA 3A4LA 2YOGA 2OAQ1 4ASUD 4OI0A 1E9CA 1X8JA 2W2XA 4BFSA 3FHOA 5KSZA 4JLMA 3B60A 3QVUA 3MMPA 4QRHA 3NBZC 1A2BA 3CLVA 1Z28A 1OKKA 4MGYR 2WWFA 1NN3A 2O8FA 2ZRGA 2J7PD 4GSYA 3SJBA 1ODFA 1G1MA 1TF2A 4TLDA 3JVVA 3QNUA 2ZYVX 2F3TA 3F0TA 2AR7A 1CULC 5BWMA 2PZGA 2HF8A 4R2IA 2JLSA 5FUVA 3P4YA 4PTLA 5K8TA 3D8BA 4BRWA 2GJ8A 2IWHA 4FW9A 4YDSA 4G01B 2F55A 2VSXA 4UNPA 2ZR7A 2QN6A 2SHKA 1OXVA 1AZTA 1DAFA 2D7CA 2F1JA 1TX4B 5JJLA 2PMDA 4URUR 4JL6A 1OJLA 2ATVA 1WMSA 1Z6TA 1UJ2A 2CLSA 2ZRNA 3PCRB 2BBTA 1P2VA 1GAJA 3C8UA 4PC2A 1CJVC 3SHFA 3TUJC 4D4JA 1R5NA 1XJQA 3VR6A 1AS3A 1AQUA 4BLSA 2GXQA 1E2QA 1J8YF 1NG1A 1A5TA 1NP6A 2G0NA 2ZE7A 5FBQB 5FH9A 5A4JA 3TMKA 4MYUA 4HAXA 521PA 1W5TA 4BLQA 2IA5A 4PO9A 2F9LA 1NVUQ 3L0PA 4HZUB 4M21A 3T15A 5TDHA 3VQTA 4ARZB 2LCFA 4Q48A 4DT1A 4A92A 4EFMA 1OKKD 1PUJA 3AF4A 4HLUC 3WBJA 2BDTA 4KLZA 2GCOA 4MRSA 4BUJA 4DCSA 2V6IA 2FPLA 3PENA 3TK1A 3ZIAA 4K81B 5FI0B 1IM2A 5EE0A 1KY3A 1ZM9A 2BC9A 3RAPR 5HZKA 1YZLA 1OFTA 1RRPA 2VTKA 4G5OA 4XOIA 5L3RA 3EPHA 5G3ZA 4LCBA 2EFGA 3IKJA 3F3YA 2C8VA 1YZUA 2ECKA 1QHHB 3QSYA 3OEHD 1XPOA 2QENA 2PLRA 3CRW1 1AA9A 2B92A 4QFMA 2CL7X 3B1YA 3AVXA 2D3WA 2RCNA 4B6FA 3I61A 3EIQA 5H8WA 4KHZA 1GOTA 2F43B 5BYKA 2X77A 1ZD1A 2HEIA 4B44A 3QF4B 3RRYA 2GEDA 1YE8A 3MGCA 2C2HA 4QHTA 2YWGA 1ZUNB 3A1UA 3LO5A 3QXHA 2ZR0A 3ZLJA 2YVUA 1JALA 4LDJA 3MWKA 3X1ZA 2C99A 4W5WA 1CJMA 2CHVA 3A4MA 2W0MA 4EQ6B 1OH6A 4YMWA 3VR4A 4Q01A 1SXJB 4IKEA 5JEEA 1DELA 1EG7A 2QP3A 3O47A 4NPHA 2J0UA 1KAOA 3QG1A 4QHSA 1W2GA 2WHXA 3VKWA 5BN3A 1V43A 1J7KA 2XTNA 4IEIA 3W3ZB 1PVOA 1A1VA 2GXUA 2QAGC 2O0KA 2NGRA 3BOSA 2Z6VA 1TUIA 1ZNWA 1EX7A 4WZBE 2H57A 1QDEA 1WDTA 1Q0UA 2ZYWX 4Y0VA 1TQ6A 1OXXK 1PLLA 2G83A 1YQTA 3GLIE 3L0SA 3BAFA 3H84A 4BEBA 4IVRA 2QAJA 1G5RA 3AVOA 1KMHB 3FVQA 4Q5IA 2W0SA 3WP0A 2EVWX 1VYTA 2NQ2C 2BIFA 5BN4A 4BEJA 3IDQA 1XBTA 4PZZA 1BH2A 3I3SR 4KBGA 4FCWA 4ZI2A 2AK2A 1NJGA 5JWOA 2NOAA 3UMRA 1WP9A 2HJVA 2XXAA 1D9ZA 2ZYTX 1Q3TA 2QTVB 4JT4A 2WMNB 2WJGA 4QBIA 5JCZA 4WZ6A 2QMOA 2YOHA 3EZ2A 2FEOA 3QIAA 1YVDA 4M9QA 4PAMA 3FPAA 2XITA 4PXAA 5B30A 1G5PA 2DFTA 3DOFA 3I73A 4Q21A 4BFVA 4HAVA 1WF3A 2Z83A 3RS0A 3LV8A 4CF7A 2XB2A 4DVGA 2W2TA 1OFHA 2AFHE 3EZ7A 3VHXA 1Z07A 1ZMXA 1E4YA 5FOWA 4E22A 3VKGA 2PX3A 3AKYA 1GL7A 3OEED 4UXHA 3P1JA 3KKNA 4DLVA 3GLGB 3PEWA 5LBIA 1ONBA 3VNVA 1Z06A 3CH5A 4V0KA 1YZKA 3GLFE 3VNUA 2WSMA 1GRNA 3UMFA 1WBBA 4QJ5A 5FTKA 4BFTA 1XMIA 1UKVY 3C4JA 4M9XA 1KHTA 2OHFA 4O3MA 4AKHA 3KB2A 2QI9C 2ZUCA 1VG8A 3BWDD 4C0JA 4UJ5A 1F3OA 3T1VA 1P62B 4NHOA 1S9HA 2JAQA 4XSGA 1GSIA 3QJYA 4LHXA 1KO5A 2V4ZA 1VCMA 4YMSA 1LV7A 3KTAB 3CWZA 2OBNA 3AVWA 4NL4H 2P5TB 2AXPA 3EA5A 1YZGA 4ON9A 1MT0A 1AS2A 3VR3A 2RGGA 1S1CA 3LLMA 2ZAMA 4LYAA 3GJ8A 3KUCA 2VF8A 4KFSA 4US2R 2JLUA 1NMYA 1S3GA 2J59A 1HE1C 4IVQA 4PHFA 4HUTA 4DRZA 4B6EA 1I4LD 5C46F 4DLSA 4RD2A 4LYJA 3UWOA 5HE9A 1WXQA 2AFIE 2IK8A 1XTRA 3W9YA 2QA5A 3KJGA 4HDOB 1E96A 5L3VA 2G0TA 3BD9A 4NYMR 1CJUC 3PFIA 1FTSA 2QMUA 5F3WB 2CCJA 3R7WA 3RLFA 2ZS8A 4RZ3A 1ZNYA 4G1UC 2WKRA 3CB4A 1TADA 2O8FB 4LX0A 2P0EA 2WKQA 4W5JA 5EE1A 1CJTC 1M34E 2JJ2A 4TTRA 3IHLA 1NY5A 4M1YA 4FN5A 4MKIA 2GAOA 4DBLC 2BHRA 4C0SA 3S1AA 1E2DA 1N5LA 4IDQA 4LHWA 4ESVA 2Q21A 2A5GA 1U0JA 1GG2A 2F1HA 5K8UA 2JJ8A 3C15C 1TAGA 3WHLA 4CEJA 2G3YA 3BB3A 1G5TA 4IDOA 3C5HA 2Q3FA 4IOLA 1N0VC 2G1KA 1HH4A 5FFMA 2VP5A 4L9WA 5EUMA 2QORA 4US1R 3NHAA 2QTHA 1BMFD 2H17A 1G21E 3R8FA 5J47A 4DDTA 1JEEA 5CJPA 2QT0A 1KO7A 4BWYA 1TQ4A 2FOLA 3K8YA 1WRBA 1GNQA 3NTUA 2X1VA 3EWAA 4DHEA 3TUZC 1WBDA 1XTQA 5IRCD 1GTVA 1VPLA 2VHJA 4TYQA 2BVNA 2WJYA 1KKMA 2ZS9A 2WAXA 4NYIQ 4ACBA 2NO7A 4B43A 3ND8A 3K53A 5FUYA 3RWMB 3THWB 3OIUA 1R5BA 3EIHA 1I4TD 1N2CE 2D62A 2R2AA 4DT1B 3SZRA 1WA5A 2R9VA 3B85A 2QMEA 4PC7A 3I5XA 4A9AA 4Q00A 4M1WA 4GPTA 2GCOB 3NXSA 1GWNA 2JJ2D 3U3OA 1LS1A 2G9NA 3UATA 1U9IC 4DSNA 1TUEA 1E2EA 3AH8A 2NPIA 4LI0A 4LBYA 2FF7A 2B21A 2WJJA 4MA4A 4NYIR 1Z0FA 1ZNXA 2EU8A 2ATXA 5JMTA 1OXTA 2Z5FA 5DH9A 3LXRA 1A4RA 3GPLA 4Q7LA 4DLTA 2JDIA 4LGMA 1Q1QA 5DHFA 2RGEA 1ZU4A 1P3JA 3AP1A 3ZYCA 1L2TA 4BFZA 2GK7A 1EGAA 4IOKA 4G5QA 3Q85A 1LY1A 3GQBA 3NIBA 3LH5A 2ZYUX 4XVQA 1Z3IX 4GDFA 2ORWA 1P9NA 4IXNA 3K70C 3QE0A 3BXZA 3CRQA 3PVSA 4NCHA 3TAUA 4IFBA 3JVUA 1YR8A 1M8PA 1JJ7A 2QP9X 2FGJA 4L15A 5TVKA 1NMXA 4YMTA 4I1VA 2ZJZA 1KOFA 2ERYA 3G5UA 4A82A 4OI4A 5DHAA 4HB3A
chains in the Genus database with same CATH superfamily
3HEMA 2ZIFA 4DBVO 3CX8A 5J4HA 3ET4A 5HYVA 3J7TA 2GUGA 1ZOPA 4G41A 4AO6A 2MDTA 4BO5A 4ZQHA 2ACEA 2AG8A 3GRYA 1O6FA 3LCRA 2BD0A 2GZAA 3WS7A 2AOTA 3V1NA 3DYVA 2QLTA 1E2GA 2EZTA 2YWJA 5HA5A 1XZIA 4MJLA 2CVOA 1WVGA 1A3CA 1XZGA 1WW3A 3G0CA 1B93A 4J0EA 4UBIA 3RYIA 1Q3KA 1KI6A 1SXJC 3BJZA 4O5AA 3TJZA 4MITA 2G9UA 4AJ2A 1DWOA 4UTVA 4O0MA 1FSFA 1RE1A 3F90A 1OE0A 2I6XA 2Q49A 3IMGA 3FOAA 4KTVE 4FW8A 5AW9A 1P7PA 1R6BX 1ZD8A 2EEZA 5LQJA 2VF5X 1R9JA 2FVXA 2HPVA 4QG7A 3VGJA 5KCZA 3F6BX 2ZM5A 1NPTO 1NLUA 2GYYA 5EWMB 1ZUIA 4BB6A 1A27A 2X13A 3LUPA 5AO9A 2HXYA 2RI1A 3SIRA 3QVVA 4OSOA 5EHZA 4N0DA 3NC0C 2I55A 4AJIA 4J03A 3VR0A 3BWXA 2IQ5A 5ALFA 1DDOA 1OC4A 2DPHA 4OQMA 3ABQB 2ZYSA 4G0WA 1E1NA 3AYXB 4EO9A 3GCZA 5FWXA 1XTKA 1YR3A 2YBDA 1RWNA 4MJ7A 2AB0A 4TSFA 5JS7A 1CF4A 1OU0A 4KSYA 1VBKA 2F7SA 2ZT7A 4A27A 2ONZA 1WB4A 2VYNA 1V9CA 2QSZA 2H1RA 1CQWA 4HKTA 1MTZA 4BIIA 2V1UA 4B2YA 5AIAA 4LGCA 1J9ZA 3B12A 1ZJ5A 3QF7A 4LCEA 1B8UA 1WQ1R 1QGAA 1X1QA 3ANYB 3V8QA 2XGSA 3RTCA 1Z8HA 4WLVA 3K1AB 1Y6FA 2BGIA 4JKOA 1Z6QA 1SOMA 2HZ7A 5LMCA 5GOTA 3FBTA 4I8XA 3ZV5A 1LFDB 4GUDA 2GTIA 1V16A 2JAHA 3FMOB 2P40A 2P4QA 4L27A 2V98A 1Q92A 4M55A 2OXIA 1G5IA 4B40A 4YHHB 3AM5A 1ZD9A 3BZUA 3LVQE 1AZSC 5IARA 2VUSA 5H83A 1ABEA 3IAS6 5EJ7A 1XZEA 1FE8A 1VCHA 2VPZA 5CFMA 1PFKA 2SCUA 1G5QA 3NT2A 4FHGA 3I6MA 4HAUA 4KMMA 5C7OO 2RHGB 5LM3A 5BWCA 2XYVA 2IHZA 4E0BA 1R9NA 4PIVA 3MUEA 4OMDA 1OTXA 1VB5A 2IOFK 3CGWA 2UVPA 4YQYA 1M2OB 2FUNB 2W6QA 4D45A 3VZBA 2PV0A 4P1ZA 1J20A 3U4IA 5KC8A 2FSHA 2Q1XA 1F4PA 3UMBA 3W7AA 2VPQA 2C4WA 1OVGA 2R1VB 1JHQA 2C4UA 5IDQA 5LU9A 3E82A 5JFTA 3EOAI 1GITA 5B4UA 4ZAGA 4TS9A 5A4AA 2PKQO 5IZCC 1VKJA 2BM0A 5EXXA 1K5DA 4OFZA 5ALXA 2CUKA 3UTDA 2PYDA 1L4KA 2ZREA 3U7JA 1SXQA 3L7AA 2E4VA 3VXKA 4YH1A 4LZZA 4UW9A 5HMMA 1WUJS 3D6FA 3RS8A 3FSEA 2GZ3A 5EKUA 1RFGE 1X77A 3KKKA 1Y3FE 4FHZA 2HCBA 2QJTA 5ALRA 1RWQA 4S1VA 3MTEA 2RGUA 4C2BA 5MN5A 1H6CA 2PZLA 1U0GA 2FXIA 2VHVA 2WT9A 4IFIA 5E6RB 1EX1A 3PLRA 5AWFC 1XP8A 3S40A 2B98A 1ANKA 1J33A 1Q0SA 2R6GA 3K0CA 5J58A 1QH0A 3MINB 4MZDA 4S05A 3IVGA 1VL6A 1OLXA 5MFPA 1V1RB 1O94D 2L18A 3MMZA 1SBTA 4PQFA 5JV5A 1BH6A 1PTJA 1C7JA 4EBBA 1X1EA 3DUWA 3EXIB 5A6VA 2W2KA 4ECEA 3PXBA 5HZMA 2RGRA 5EY5B 4CKBA 1S7GA 4AZTA 2B8NA 1GKKA 3ANXA 2II6A 1JBKA 5B3AA 5EC8A 2IF0A 4LJ9A 4AKTA 5FBZA 3BMQA 4BV9A 4DTCA 1N2OA 4RF2A 3F49S 1EESA 4KDCA 4LK3A 1EX9A 1K06A 1X94A 1NONA 2R6ZA 3O4JA 4I4LA 5CVDA 2QVBA 3QPAA 2QL9A 5B6JA 4EJSC 5KQMA 4HDRB 3L8CA 4W99A 3Q41A 2RGDA 1X70A 3A6EA 3V80A 4CNBA 2GF9A 4FS3A 2KLHA 5B58C 1CY4A 1CDDA 2PTHA 3HMKA 1K9SA 2QNIA 4MPJA 3FDFA 2I3AA 3W1WA 3ZVRA 3HJBA 2XADA 4CIVA 3CLUC 5GZ1A 3L6BA 1JH9A 2WSSA 1G64A 3UJDA 1NWCA 4XYEA 3D6JA 5WRFA 2Q6KA 4ZU3A 1II0A 1JMYA 4Q02A 5AOAA 3UFBA 2FDCA 3I01A 3TE7A 1F1JA 3GGGA 2FWJA 2ZRFA 2KJQA 1U98A 1ORIA 1FU8A 1OTHA 3KAPA 1VG0B 3D02A 4G0NA 1A9TA 4TRNA 4YROA 1VLMA 2R8ZA 5K3FA 4FBGA 3EPKA 2XKJE 2HU5A 1R5OA 1ZD2P 1IMJA 3K2IA 3F5FA 3QKRA 4HYEA 4NBWA 4O2BA 4K6HA 3V55A 4BLTA 1J0BA 4CLRA 3FPBA 2C7PA 3LQ1A 1E6KA 4NY1A 2D59A 2QB5A 1EGQA 2WR8A 4DGQA 3E7WA 3QVKA 5EXTA 1UOPA 4HFNA 4EF5A 4MGIR 2C4VA 1CBUA 1UKAA 2UXBB 4BLWA 3CR8A 3JQGA 1G2PA 5AJYA 4GE3A 4UNQA 5LJIA 2DWOA 1JQKA 1LSUA 2NW6A 3NGLA 4PYIA 4CLDA 5KNDA 2IU6A 3ECCA 3KUDA 1M2WA 4ND6A 3ZEIA 4L4ZA 3QVSA 1NUTA 4PQGA 2FZVA 1FJ2A 1HTBA 1KK2A 2A58A 2NSHA 1S0UA 3RQIA 3NKFA 1S2LA 1MLDA 4AY4A 1HNNA 2Y3IA 3IT0A 2NIPA 3K72B 1K5HA 4QWMA 5H82A 5LA6A 3RW9A 1DIBA 1WETA 1USVA 4ENPA 3B6MA 1A2KC 2QNRA 3BE8A 3GJ5A 3NC4A 4J2TA 5EE3A 1IUOA 2PXCA 5L3SB 3DDOA 2QE7A 4BJ1A 2ICAA 4QGHA 4RNDB 1NF9A 1E3QA 3H1PA 3Q1KA 1N6OA 3GLIA 1CR2A 3G0GA 2HDHA 3HKCB 4BC1A 4IV8A 2J3DA 4JI7B 2ISSD 3NAGA 3OHMA 5CT9A 2CLFB 4C03A 1PNVA 4N5MA 3HCAA 1QRDA 2I76A 1LS6A 3TX6A 4PX3A 1TEHA 1FF9A 2C82A 4V39A 4XDZA 2DBVO 2TECE 3OQBA 5D5QA 4ZVOA 2IYEA 4CCWA 1UMDB 4DDWA 1PBNA 3PE4A 1CRPA 3H6HA 4MVJA 5DPMA 2WWYA 1I4EB 1VXOA 2CN1A 4GZ3A 5KNCH 1JDBB 3QUCA 1T2EA 4XD7A 1UBFA 3PGKA 4QASA 2JCSA 1U7PA 1FMJA 2PGNA 1TJ3A 3ECAA 1XVLA 1UDCA 1LSSA 3NHMA 2M1ZA 4JA2A 1DRVA 1PLKA 3RSFA 4BV2A 1JSCA 1I51A 4Z86A 4YX9A 3VC3A 2YVQA 3ZY5A 2QN3A 2IODA 3NJ8A 1NYRA 2C5AA 3A58B 4ZT5A 4Q7JB 1X2EA 2WNSA 4EIWA 2OR3A 3IIEA 1BCSA 1F8UA 1ID1A 3R3ZA 4LEIA 1KU0A 3EA0A 4RPCA 4DNFA 5KYGA 5D3ZA 2OUKA 2PX0A 5ILOA 2DT8A 3RG2A 1WABA 4I0WB 3GUVA 2JIQA 4D46A 4FFPA 4QDZA 1CG6A 4UTPA 3SVTA 2UYQA 4PRLA 2OO5C 4EY8A 1T4CB 3K30A 2Y1WA 3QBJA 4CM8A 1PZHA 1KFEB 2NZJA 2Z08A 3RVNA 4ZJUA 3EGOA 3IQXA 3ISJA 2P90A 1JR6A 4IWNA 2XE4A 5UKDA 2F00A 2HHLA 1OBCA 1BWQA 1MVOA 3KXIA 2FPRA 2J07A 5KUTA 2VRWA 1LU9A 3QOXA 1KDYA 4IDEA 1BE8A 3F46A 4ZCQA 4C0XA 2NO5A 3GH3A 4OHXA 3S2IA 4MEJA 4CQLA 1K0UA 5CLJA 1T8UA 4M99A 1GU7A 1M33A 4U0KA 3RU3A 1Z82A 2WIBA 4QPZA 5BSGA 2QUJA 2H7XA 3GZ4A 4JCCA 1F60A 2A0FA 3AKZA 4XARA 1B00A 1GSAA 1U28C 2GA9A 2XUKA 1RWBA 2OSBA 1B42A 2V4MA 5FADA 2K7ZA 5FLEX 3QFHA 3EQ8A 1OZGA 3RLIA 4RDHA 2FN7A 4PF1A 3G0IA 1IOZA 3QNWA 2CXUA 4L8VA 3X1JA 3FHLA 4QYIB 4EMUA 5C7IO 3R0XA 1CIPA 3PD1A 1H9BA 1UZAA 3AY0A 3UT5A 3TZHA 5AHWA 2FK8A 4E4YA 2REOA 3U3RA 1KS9A 4RY9A 4RY2A 5EPUA 4RQAA 1YQUA 4X92A 5KYYA 1H5QA 1XKXA 1Y7LA 3N0RA 4P93A 1T35A 5FTLA 5TPZA 2XMCA 3HXQA 1GRQA 1PV2A 4J7AA 2OFXA 5ALGA 2QM8A 4QTUB 4MV3A 2C92A 3JXEA 3MTBA 1C3JA 2G9ZA 1W9HA 4XQCA 4Z53A 1JLLB 5CDYA 2OLEA 1JDVA 4DVJA 3FBGA 3AUTA 2AR9A 3B1WA 3ZGLA 2NT4A 3KWFA 1T34A 2ODAA 3HWX1 4C7BA 4YMVA 3WO1A 1OA1A 1P2GA 3IILA 4ILEA 4QPDA 1YB5A 1G9SA 1K4MA 1PVVA 2E1PA 1Y4UA 4PS0A 3PPYA 1TLTA 4WXYB 4X7BA 2ZBDA 1UXOA 3UQZA 4B0PA 2EW1A 5K6RA 4NFYA 2NPFA 2AJDA 3UWMA 1OSNA 5YASA 1NR7A 5JSYA 1A2OA 1GFSA 4K1LA 3IPAA 3F71A 5T4EA 1NW9B 2CFTA 3D59A 3MS7A 3ONNA 4RMGA 5F64A 5THQA 1WUHS 1YULA 4K6GA 3QXSA 3VI3B 4CL0A 2NV2B 4L8WB 3PYLA 3BGVA 2QJFA 3WK8A 2IZZA 2C03A 4GLFA 1OU4A 2IT1A 2JIZA 3AINA 3L7LA 1KY2A 1G3MA 1UPBA 3NLLA 4P2GA 4RD0A 2R1UA 1DKPA 1FXWA 4LNAA 1G21A 5B1SA 3T9CA 3TTYA 4ZKDA 3TBKA 3VJKA 2W6MA 1L4FA 5A9RA 1P61B 3DBRA 2JAXA 3FI0A 3T9BA 1TVEA 2I5PO 4CLXA 5FO0A 4EWLA 2PT9A 1WUIS 2Q2QA 4DCVA 1S02A 1UFVA 3EVDA 1Z83A 1SHKA 1LNZA 3FIJA 1KEWA 2FEXA 4LDAA 4JJ4A 3SK0A 5DE3A 1Z8DA 1HNXB 1LTHR 2RGCA 4RA9A 2XWJI 5BUQA 2JKYA 3KSAC 5C4GB 1EGVB 2CXQA 5FQOA 1KZYC 2PFGA 1YI1A 2X0KA 4HQNA 4TMYA 3UKDA 3PIRA 1DEAA 1NM5A 2D2IA 3E18A 2H7VA 2IVZA 2W90A 2NUAB 4ZVNA 4R1QA 3VO8A 1Z4QA 2PT7A 2VJAA 3VAZA 1JZQA 4IV0A 2QZPA 1QHYA 1YS2X 3C41J 3IUJA 3BWCA 5COBA 4UTXA 3ZHUA 1CUJA 4IHKA 5EGSA 4GKJB 3NALA 3RVLA 1LPPA 3BK1A 4UUPA 1KOGA 1JGTA 2MINB 3OICA 3PEEA 2PHZA 1L5HA 2VXYA 5U1PA 3RVMA 5CVTA 4V02A 1Y5NA 1ID8A 1TK9A 1K2WA 3AI1A 1NVEA 1JDSA 1L8LA 3RBAA 3QNMA 4CQNA 2OCPA 5I7OA 4GQBA 1I6LA 2E6UX 2JEZA 3JQ8B 1ECCA 3SICE 2HT1A 2I0FA 2C95A 1DCKA 2CUTA 1NVBA 5IBPA 1C4WA 3VPCA 4JJKA 1QO9A 5F3DA 3E1SA 2J6BA 3UAOA 1D2HA 2HY7A 3HLKA 4HS9A 1G3UA 3QLUA 2R6DA 3WQQA 1SN7A 3RGGA 4GX2A 2WUVA 4QAQA 4B3BA 1ENYA 3H0CA 4ZARA 2BFNA 2O9JA 4F1KA 1F1BA 5G53C 3BMOB 1L7MA 1TJNA 4YC7A 5DNYB 2V0GA 5TNXA 3FLBA 621PA 2IS4A 4YI5A 3L0IB 1DXQA 5CDTA 2CNBA 1OVMA 2G70A 1BGVA 2A4MA 2VQFB 1FUEA 4YWHA 3P4UA 2OCYC 4G85A 3BRWD 4OQEA 1TVMA 1G3IA 2QL5A 4ZVRA 5JCJA 5AUPB 3O1LA 5HIAA 1NKTA 4CR6A 1OB5A 3LWBA 3L8DA 1UMCA 3MJVA 3F9IA 4IH4A 4TPKA 5EXSA 4BZWA 3A9TA 2ZI5A 4U3JA 3K4PA 2HN9A 3U09A 3AY3A 4HX9A 2KB0A 4MAFA 4WEOA 5KNCD 5H16A 5KAMA 1UXJA 4YRQA 3PJFA 4TKUA 4ZU1X 3I04A 3A31A 3LUBA 5DI3A 2BFAA 2MYPA 4ZALA 3PFNA 3G8CA 1EXWA 3MQFA 4FWIB 3RB8A 3T4XA 2Z2YA 3DKVA 4A5SA 4RYDA 3M34A 5BMVA 4P0TA 1P2FA 3AUJB 3HN6A 4H1TA 2BGJA 1Y0BA 4UUBA 5EFOA 1RC8A 4YJ2A 1IBSA 1U1FA 3QBVA 4DREA 1YZYA 3CB2A 3K7EA 5KTPA 1E3IA 4BO2A 5D7NA 5E3JA 3ZVNA 1E4EB 3A4YA 5D5PA 3KQPA 3ZD8A 1AHPA 4NOKA 4L7QA 4ZI7B 3GJ6A 4ZYVA 1SC9A 2COEA 1NT2A 2O7NA 3HSSA 4DSOA 4XUCA 1M10A 3OKCA 1ZWLA 4INAA 4MQFA 4P84A 4QOFA 4WJKB 2YTZA 3TTUA 3VOBA 3W4IA 1SWVA 4Z3OA 2QTMA 3KELA 2A5JA 1GCOA 4WMLA 1S2DA 1G2IA 5A1TA 1IOLA 1GQOA 1RVDA 4DIEA 1JF8A 1VC2A 4X64B 4ENTA 4RHEA 5JAOA 3IKMB 1H5NA 4HFMA 5AUOB 4HUQA 1YQ9A 1IHOA 4RBNA 1ILWA 4B3FX 4UPEA 4EZIA 4RENA 3OOJA 3QVLA 4RD4A 1W1WA 2IHUA 2PA0A 2Z8YA 2WOOA 3VSEA 3CVOA 1CF2O 1CYEA 2RGYA 3O1HB 1NBME 2UUPA 1JEQA 1V96A 1U2EA 2OCDA 3OZFA 4P54A 3V1TC 1QLHA 4Q1VA 421PA 2QYSA 3C3AA 4BX8A 4AJ9A 4EDHA 2WOJA 2CFCA 1M2HA 2HK9A 3Q3VA 1ESMA 3OPVA 4NBRA 4KIFA 1SUPA 3SVZA 2IYXA 3K4QA 2XBLA 2XB6A 3GLHE 1ZXXA 3R6WA 3SEFA 1DV2A 5K3AA 2C61A 3D64A 4NKRA 2BBOA 3T94A 4JBIA 4DQUA 2ZEJA 1HFJA 3O3OB 3U6KA 4COOA 1SO8A 1JDTA 1CVLA 4NQZA 5EMKA 2VH1A 3DL7A 2X6TA 3PX7A 2VDKB 3RC8A 1EINA 4DEVA 1N2GA 3KD3A 1DC8A 3GZNA 4H7EA 2EIXA 1WXEA 3DMYA 4MUIA 1S4QA 2JHFA 2WSIA 4KTTE 2CNOA 3PE3A 4O2BF 5CHYA 4EEXA 5D2CA 4EUNA 1VSUA 4LVCA 3BJIC 1YE3A 2WYWA 1G7RA 2Q6IA 4JBWA 2GWRA 2FSUA 4EHLA 1K8QA 4RH1A 1M6YA 3MJTA 2D7JA 3RE1A 3HR8A 3R5XA 1KARA 2ZBQA 4GPZA 3REQA 4QU9A 3W3AD 4MTLA 5KTOA 3N8DA 4MI3A 3EISA 3UFXB 4QE3A 4YTEA 3FMIA 4IYJA 2Q4DA 3BEDA 3D3NA 2RG7A 4U7FA 1KJNA 3KQHA 3ZJTA 2ZROA 1UMKA 3OKFA 4FYYA 5LU8A 3JVDA 5EG5A 1BMDA 1YZFA 4PG4A 5CW2A 1MOQA 2Q0SA 4NH0A 3TBFA 3TI9A 4ND8B 3CE9A 1MXFA 3OAAD 4RK7A 1Z17A 4R7GA 1YQDA 4IXMA 1D7OA 5DSTA 3RADC 1DWPA 2IEIA 3DHYA 3DEFA 3JWJA 4HWOA 4P4SA 5EWJA 4D8VA 1Z0JA 5AXAA 1E59A 3CZQA 3QLTA 5HE8A 1GCIA 4GOOD 4HH1A 4QHYA 2CF6A 3O8LA 4GZ5A 1UMBA 2LIPA 4L73A 1MH9A 2C04A 1XU4A 1HURA 2V7UA 3TFQA 4NU6A 2IKSA 4OK6A 4XYGA 1WCXA 3ROTA 3FYSA 2YFKA 1CVIA 3MSXA 5SZHB 3W6OA 1A0OA 1EK0A 2QL7A 1NVWQ 5DTEA 1SQ6A 2QTFA 3ZN2A 4MKGA 1B8OA 3EAGA 1DRKA 2GN1A 2WWXA 3KYDA 4J16A 4TL7A 3ABOB 3L6DA 3L84A 4AX4A 4JI6B 1THGA 1EUZA 3TLAA 4GPAA 2Z6UA 1OZ0A 4Q0MA 1XMJA 1B1CA 5CX1A 1OXUA 1WD5A 1PQYA 4CT5A 4OQZA 1N6LA 2OCIA 3PJEA 1WHSB 1XHFA 2DP4E 2SECE 3E6AA 3PNSA 4IJQA 1HT0A 3PV0A 3BZWA 4NV1A 4PFSA 4WI1A 2BM1A 1NVAA 2C1EA 3CPSA 3OCCA 2FEKA 4GM0A 4HWTA 1ZCJA 5DN6A 3W7VA 4AJNA 4KMRA 4B81A 1RQNA 5KJ1A 1MC8A 4FP9A 4ARIA 1VI2A 1XL0A 3LXUX 2QXYA 1N2JA 3TNJA 4AX8A 4KITB 2UYCA 4LOAA 5HWSA 1CW2B 4N7MA 4KFRA 4Z8XA 4I5FA 1QH1A 2BWJA 2RDMA 4ROTA 1G0OA 5JSKA 4IJMA 5K4HA 4C20A 2HR1A 3P2OA 2Y76A 2GSWA 1XJ0A 4XUGB 1LSJA 4DCGA 2PSDA 1GSHA 3HLTA 3H9JA 1G20B 4FGUA 4CZ2A 4OUDB 3DTTA 1PJLA 1FP7A 1ZMRA 3STXA 1JMKC 4EX7A 1PX0A 2OCBA 3KUUA 2FWNA 3AEQA 4G97A 1VL8A 2JGMA 2OGSA 2Y0EA 2RI6A 821PA 4LDNA 5EE9A 4ZJZA 5GINE 4G0UA 1B1AA 2H65A 3MFYA 2JC3A 1NAHA 1PZXA 2G72A 5ERGB 4Y6SA 3RIYA 4KPYA 5E3IA 2H63A 1REQA 1U80A 2J30A 2ON6A 1JT2A 1X7XA 1Z3CA 2O3RA 3L79A 3O83A 4M0CA 4QOHA 1HF3A 1DARA 3R0IA 2LCQA 1GPLA 1OBVA 2J0UB 2Y6UA 3BH6A 1J9GA 5TB5A 3VR5A 1U8EA 2QD3A 1TQHA 3GVCA 3RSZA 4DMLA 2GR9A 3K6RA 3I9OA 2GJSA 4KEAA 4RVNA 5LLTA 3MIIA 3EULA 4H08A 1HFKA 1P5JA 5JE8A 2IOHA 1YK0A 2ZIEA 4BNFA 5B1IA 3EZNA 1KH3A 4OJYA 2XAAA 1SY7A 4YYZA 3OLCX 2ONJA 2G4CA 4PPNA 3OPYI 3V4ZA 4U6QA 2HNBA 2WJWA 3PE6A 4Z9YA 2XA2A 2WWIA 5K2MA 4FBLA 5A9SB 2I4TA 2VH2A 4Q3CA 1I1OA 2FPOA 2QKYA 2HIMA 1EVKA 2GLTA 3CONA 3O6VA 1QWSA 3QVGB 1OFVA 1QKIA 4FFBA 4AY5A 5LYJF 4XZ3A 1NNEA 2BJHA 3CPHA 1DU4A 3LQYA 1R1DA 2FW9A 2ZGVA 4CKYA 4Z6KA 5DWVA 1E2IA 2ZUDA 1ENZA 3DWIA 3A1WA 3MGGA 2E21A 4GP9A 2QD5A 5ENDA 4RTQA 4YJ3F 1XD2A 3R0QA 4N0EA 4MZXA 3QYJA 2RIPA 2JL1A 2ONYA 3GD5A 3PNOA 4MRPA 3VR1A 3FYUC 3QBTA 4RKFA 1VJ0A 3W4KA 1OH7A 2QN9A 2FQYA 3MT9A 3OM0A 1TRKA 4X95A 5AVXA 2JAWA 2JRLA 4KK3A 1FMLA 1XVIA 2OBBA 3AU9A 2RB5A 5DXFA 1Z13A 4P5DA 4TT3A 5MDHA 4FSXA 4LZOA 5KS2A 4P3XA 3HFSA 1SHTX 2CLDX 1AF4A 2QNBA 1E6MA 4MPPA 3SVLA 2WIGA 3N8IA 1YQEA 2HA0A 1XJ5A 3H19A 3PUXA 4KODA 4NPCA 3G5AA 4MVJP 4Z0NA 3TIVA 4GGMX 2JBAA 4J07A 3STYA 1QQ7A 2B83A 2ZIGA 3GARA 1MA3A 3Q2IA 4G67A 1JIJA 1M74A 1DBSA 1BW9A 2FFAA 2PBZA 1QU2A 4OH1A 4JUIA 1VECA 1ZSNA 4EGQA 3UMSA 1FTWA 1FB5A 1M73E 3A8TA 5BVGA 3OT5A 2V6FA 3G8DA 3R6TA 1S96A 1X14A 5D85A 1DOHA 2Y1CA 4AUNA 5IJ9B 4MQEB 3WGKA 3RYTC 1YS9A 8LDHA 5F76A 1QHHA 4O2AA 3NBUA 4RQTA 5I7HA 3QFCA 5CDHA 3PNLA 1QYWA 3RVQA 4RWZA 3IQHX 3QHPA 3L05A 4BZQA 3G3EA 5DOZA 4MGZR 3CIOA 1DRJA 2QQGA 3HO6A 4OFXA 3VZQA 4OB7A 1J8VA 3EQ6A 4Z4HA 3KALA 4K6OA 3SHQA 3GB9A 5K8VA 3DZGA 1LBIA 1DEKA 1PWEA 3A2MA 2VQEB 2QLBA 3ELUA 2CLMB 2F6RA 3DOUA 1NXWA 2BI7A 1FVHA 2FNAA 2N3ZA 3COPA 4OI2A 4C6SA 5CRIA 3RAJA 3Q7QA 1E9SA 3SR3A 2IZ0A 2XYQA 3I4LA 1LNSA 4PRYA 4RV9A 3WFIA 5EIBD 1PS0A 3AHFA 3G2JA 4WKGA 1AKWA 4XD2A 4Y9UA 4Z2YA 5C3MA 4BNGA 2W8ZA 3NW9A 1TTHA 3WGVA 1BQ3A 4Q9IA 3CEMA 3SKXA 3WLHA 2BH2A 3PQEA 4BVEA 2AXEA 2PNFA 1VE6A 3O8CA 1D1TA 3SIWA 4MUMA 2C7OA 1Z35A 4AFNA 5T6MA 3RC7A 3EQZA 4BIMA 3TZKA 1VPDA 5AI6A 5SYAA 2C4KA 4YCSA 1HDRA 2OP0A 1YS6A 1T36A 1ZNZA 4E5PA 3AL3A 3Q7EA 3QBDA 3Q0TA 4GMFA 5FUBA 3PLAE 2I6QA 1Y4AE 2IUSA 3GPIA 3OWHA 4BMPB 2J0QA 3GZJA 3VZPA 1VHTA 3WGTA 4BQOA 5BPFA 1M2JA 1L6RA 3H1FA 9LDTA 3WG9A 2D0IA 3QFRA 1LW7A 5K7SA 3KP1A 2BGRA 1J8FA 4Y2GA 3SGLA 3RUAA 3SJUA 4DNPA 4UQPA 1E66A 3ZE0B 1U7WA 3MUOA 4FDLA 2GCNA 2I2XB 4MS1B 4WCVA 5DHSA 1CZNA 2ZETA 4QULA 3U81A 1CJKC 1MVNA 2Y1LA 1UPAA 3H99A 2GJ4A 1RP7A 5JCXA 1IZ8A 1JFFA 4DJEC 4RJKA 1P5RA 2Q41A 1I7NA 1Y8RB 3ILHA 3D7KA 3OQ6A 4AJOA 3FJYA 4HGZA 4KQJA 2H52A 4CM3A 1NVVR 5F35A 5H4GA 2QF7A 2WJHA 5KPJA 2BFWA 4WPGA 2PKEA 3ZDFA 1CEXA 1M6VB 5REQB 3T7SA 4PZDA 4C6TB 1QV7A 3ZE7A 4ZZ1A 3U4MA 3GNSA 2A4KA 2IEZA 2V7EA 4LRQA 4RDXA 3HBAA 1EH5A 1F2UA 4KN5A 3Q4GA 2H4JA 2VJYA 1DUSA 2EQAA 2WC1A 3BORA 3E9DA 5JAQA 1KK0A 3U3KA 4D8WA 4DA6A 5EQDA 3X1WA 2QZ4A 2IYAA 1Q1ZA 2JCBA 3L4EA 1XCMA 3N28A 3FCAA 4RWEA 4ZAYA 5TXGA 5EQJB 3TLGB 2FN8A 2VRBA 3A36A 4LISA 3CSDA 1KFCB 1NX9A 1R0ZA 1YRWA 2BGUA 3D4BA 1IBKB 5J4LA 4RJIA 1EUYA 1AC5A 4FHEA 4P34A 3KAJA 3N2YA 2DFPA 1J39A 3I53A 4PLFA 4NR0A 4D97A 5BUZA 5CXQA 4AN1A 5K6AC 4TN5A 5AHOA 5T4HA 3B9BA 3F6CA 4YECA 2HQBA 3ANSA 1TA4A 3SQXA 1IJKA 1SG0A 1GZDA 3LOUA 3PUJA 1CY7A 4I1SA 1YOBA 4B75A 3KG2A 2W6ID 2PU7A 2ZBRA 4L50A 4LQDA 3LYHA 1DIOB 1NP3A 3U6BA 2P0AA 1ECBA 2F67A 3IUYA 5TEWA 4FDUA 4BQFA 3OOWA 1ZGBA 3BULA 1EFPA 3T7EA 4KC0A 4UNRA 3LAWA 5F2NA 1DUIA 3TRFA 3EGVA 4B4OA 3HPQA 4TWBA 1CR0A 3K1YA 4LFBB 3N2LA 4Y2VA 2AN1A 1KVSA 2JGLA 5JBNA 4QOEA 3CR3C 1SVLA 3ZHBA 1L5SA 1RXSA 4EKGA 4O5OA 1M2KA 1MABB 3NWPA 1TEXA 3OZXA 3R20A 1U7XA 3LP5A 4OVKA 4DSUA 4KLCA 1J42A 1LWNA 2FMTA 1ZC4A 3NVAA 1VJ5A 3QQ5A 3R7SA 4J0GA 4OSPA 3CJTA 3IVXA 4R2XA 1SZCA 3INYA 4UKDA 1U8UA 1VDMA 2A9KA 1Y81A 4IJWA 5LUBA 2B37A 3HY3A 3VR4A 1YDGA 2R86A 3CRNA 1JQAA 4RV4A 3DMNA 2A84A 3DHNA 4AU1A 2CXRA 4F5YA 5J2TA 2H1VA 1MRNA 1EUDB 1KJ8A 2AKEA 1Y3AA 3WRVA 3WL3A 3GMIA 4PC3A 4JODA 4RS3A 1XXHB 1MB0A 1BXKA 1T3LA 5EMNA 3EIUA 3QHQA 3L7BA 1IPHA 3FGPA 1AN9A 1MX5A 4KPUB 5GQSA 3CVXA 1WMBA 1G63A 1Z45A 2WF9A 4PZ9A 2ZYGA 5DHUA 2OMKA 2BMJA 2FB9A 4MQLA 3J81k 5LQDA 3OD1A 3E03A 2ENWA 4GLLA 4PSKA 3O0DA 1PD1A 4CEIA 3T9EA 3DBOB 1QF9A 1W46A 3SR4A 4HAIA 3K94A 2AFHA 2PMBA 3H97A 3HU2A 4JKIA 3BL5A 5IAEA 3LC0A 3Q72A 4MNTA 5IKXA 3HA3A 4MWTA 4DA4A 4ALNA 1ZNQO 4LVNA 3EVCA 5C7YA 5IXJA 4RX1A 1OLUB 3AXTA 3FYCA 3HJTA 1M54A 5AYVA 4I46A 5JRJA 2REBA 4AG5A 3KTDA 1ZH8A 1DC4A 1PS9A 2H1IA 2EBWA 1KYQA 1NY6A 1TA9A 4BRSA 2YW2A 1EPUA 1Z5VA 1YGPA 4YALA 2P9GA 4EG3A 2YJ5A 4P4LA 4MYHA 3FDJA 1FFCA 4EFDA 3JATB 4PVDA 5CEFA 1SXPA 4JQYA 1Z2CA 3CVJA 2R11A 4RORA 1K5PA 3BL8A 1K8YB 2MSDB 4QAJA 3C5EA 2FH5B 4LJ4A 5KOHB 5B7QA 1L7NA 2GNPA 3LUHA 3DLIA 3I32A 4MDYA 4OQLA 2YYZA 3V1KA 3HY4A 1P7WA 5JMOA 1EVJA 1N4DA 2N47A 5A7HA 1PX2A 3SC2A 1E5LA 5L95A 1N0UA 3W90A 2D5BA 1WLYA 3DZHA 1Z0SA 3FDZB 1T2FA 4CQMA 2IPOA 3ZJ5A 4QFDA 4XUEA 2VBGA 2BGTA 3PUHA 1B14A 2XDAA 5BO5A 3ODGA 1Q50A 2GEVA 1YOVA 3NBAA 4YDHB 4D0GA 3LSYA 1TMKA 4FEEA 2VPYA 5B6PA 1M3SA 1XCOA 2RB4A 4YO8A 5EZYF 3TQQA 1E2BA 2PKCA 4MA0A 1POXA 4RTMA 1PNRA 2EJBA 2XNDA 2AS0A 2XX3A 4B35A 4LXHA 2B5VA 3VKHA 3K20A 3Q5DA 4OGGA 1FRNA 1OILA 1W4ZA 3QV2A 2PSEA 4U7PB 3SSOA 1KJQA 4HYQA 4B5KA 3D7RA 13PKA 3MOIA 4RTPA 2NVUA 3SJ7A 4DA0A 1FNSA 1NBMA 2FV8A 4L74A 1I3MA 3RTEA 2ZJ0A 3RTDA 3G17A 3USZA 2ZYRA 2C3OA 3FGZA 1RE0A 5LXTF 5GJBA 2WK1A 3M1LA 1QOQB 4W5TA 5E0KB 1E62A 3QELA 1D09A 4HLCA 4BNZA 3ETDA 5KTYA 1JAHA 3GLHA 1OGYA 4CFZA 3W5AA 2Z30A 2H18A 5TQJA 4RHFA 3U0BA 3AT1A 1OIVA 2FMFA 4KE6A 2GZ2A 3K9HA 4L9RA 4UHEA 1ZJWA 1Z6XA 2V59A 1DAGA 2NUTA 1IY0A 2QV7A 4DDUA 3K8QA 3U39A 5C51B 4CV2A 2O2IA 3FSJX 3B5EA 3STWA 3X1XA 1P7ZA 1Z4OA 1XEWY 1J0EA 2RHHA 5EINA 1PT5A 2NQTA 1EM6A 3LFTA 2O0JA 1YAHA 3I39X 4J0KA 2VLBA 1S8FA 4IQFA 3IELA 3PEUA 4PHCA 4HNSA 3IAUA 4RFSB 1IJBA 4J49A 4MUEA 1SHJA 3IH5A 3I4CA 4K6KA 4AT1A 1B0PA 1OT3A 2JIOA 3RC3A 3TLJA 4O1IA 3UPUA 5J1SB 2QD4A 2FPIA 3S81A 2QW1A 3GU3A 2PBFA 1Q6ZA 2DWQA 4L5YA 5FPSA 3K73O 4QOSA 2IZ5A 2PQ0A 3BX1A 3FR7A 4UMDA 2YASA 2C4MA 3FMVA 1JU4A 2ZITA 5AKZA 4AULA 2IFTA 1RC0A 1CY6A 1LQTA 1QIDA 1AGNA 4N40A 3VJLA 4M0UA 2QRNA 4BOYA 3K32A 1GM5A 3EPLA 1QHNA 3BPSA 4KVFA 3VDQA 3IRUA 4UATA 5IPFA 1UANA 2GBPA 2Z1DA 5BW6B 2RD2A 1MN6A 1E1QD 2C54A 1B6SA 3GELA 3KKMA 1QG2A 2N75A 1BVYF 4V0RA 5A05A 3T34A 2O8DA 4LX8A 2P6UA 1NQWA 5D7BA 2N1BA 2CMKA 2FUG1 1FDWA 3I52A 3PUIA 4LYYA 4EHAA 4M0DA 3RJ5A 3U3MA 3UQYS 1VLHA 3G0BA 2H85A 1KYYA 3MWEB 3QWBA 4ETNA 2I2BA 1WNFA 3G23A 4HNVA 5EWMA 1ECJA 4JXZA 3BA1A 4A0GA 3FWPA 1D2EA 4KBYA 4NEHB 4R54A 5FX2A 3M2TA 5ALNA 2Q6VA 1ELOA 3PK0A 4HFJA 4GX5A 5IU6A 1Z7BA 2DTDA 1T1GA 1MAUA 4XPIA 3DA8A 2E55A 4FGZA 3LBNA 4RZ2A 4QT4A 4H0NA 4Y2XA 4GLBA 4I9FA 3SHWA 2UKDA 2H7CA 1VL0A 3KPJA 5F5XA 2ZQZA 1MQ8B 3EDCA 3L6EA 5ED0A 2EIHA 2PKQP 3KSUA 4AQDA 2QEQA 1K5GA 2EWVA 5DHQA 3VVMA 4ETWA 2JLWA 2RCYA 3DDSA 2Q0HA 1EK5A 3O4RA 3SI7A 3SQMA 4NCXA 5HXAA 3A4IA 2WI8A 3I1JA 3BEOA 5KMGA 2VRNA 4PSCA 2A5LA 3M8KA 4TL8A 5DULA 4MI1A 1U8CB 4ETMA 4R69A 4NYJR 3GVXA 3DV9A 1Q19A 2QP4A 3PFCA 3K3PA 1KIMA 3O95A 4J1TA 4L8FA 4M98A 5TQ2A 3I58A 3B3GA 2QRHA 1UP7A 1EX6A 1X7GA 1NJSA 2NSJA 1HE2A 1NW4A 1UDXA 3PA8A 4JLOA 1A88A 1CS4C 3H8WA 2R6HA 4AVYA 4C4AA 5BNIA 2AMYA 3NRJA 2AWNA 5CVVA 4EJFA 1YZ3A 1V0JA 2FK7A 4HGYA 2P6RA 4CHGA 3GG2A 3NDPA 2PIDA 2JI9A 3P0HA 2Z3ZA 4WY2A 2PJDA 5H3LA 4RF5A 2WIDA 1YBHA 4FT4A 4JR1A 3E8SA 5GONB 4LHVA 2SKCA 1JFRA 4QWWA 5EJGA 1HQDA 1OPXA 2UYYA 3NH6A 2VOEA 3WNDA 2YMLA 4P4GA 3UJ8A 3MWYW 3G9XA 3ZVLA 5F9HA 1EDEA 3LXXA 3P2KA 4OIFA 1LBEA 5E95A 1N0IA 1J2YA