2WM8A

Crystal structure of human magnesium-dependent phosphatase 1 of the haloacid dehalogenase superfamily (mgc5987)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
b'GTENLYFQSMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAGNESIUM-DEPENDENT PHOSPHATASE 1
publication title Crystal Structure of Human Magnesium-Dependent Phosphatase 1 of the Haloacid Dehalogenase Superfamily (Mgc5987)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12689 Acid_PPase Acid Phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wm8A00
3A1DA 2NYVA 2I55A 3ONNA 2D2VA 4HGRA 4OFZA 1N9KA 4Y2TA 3R09A 5AICA 4NABA 1L7NA 1WR8A 3U7GA 2IA5A 5ALPA 1Z4PX 2MSNA 1O08A 3E81A 5AM2A 2NO5A 3I6BA 4BEWA 2PKEA 3BWVA 4J03A 2BDEA 5A3QA 2P9JA 4YCLA 2IOFA 4BNDA 2I7DA 3UMBA 5AK4A 3N5KA 2X4DA 2MU1A 3MC1A 2RAVA 3UM9A 3M9LA 2WF6A 3QU5A 3ET5A 4BEVA 4UASA 2YJ3A 4BX0A 1MH9A 2EAUA 3I28A 3WK8A 3U13A 2ODAA 4JB3A 5ALTA 2Q5EA 2R8EA 4HGQA 5AKKA 3FZQA 1ZJJA 1FEZA 4OHFA 4CF5A 3DAOA 5AW5A 2I33A 4NFLA 3NANA 2HOQA 2G80A 3ED5A 3L8GA 2HF7A 3MN1A 4UAVA 5AI5A 5A3RA 5ALFA 3RFUA 1WVIA 4UM7A 1RKVA 5AK6A 5ALLA 3ZVLA 5ALSA 1RLOA 4FFDA 3OCVA 1K1EA 2IOHA 3EF1A 4CF4A 2CFRA 2FDRA 4BBJA 1L6RA 5ALRA 5AVVA 3L1VA 5AW6A 5AI8A 3OPXA 4J2TA 1RPZA 3MMZA 2Q4RA 4C4RA 4OD0A 4BX3A 3B8EA 2HCFA 5AKIA 1XP5A 1Z88A 3U7FB 1L7PA 4HGPA 4MWOA 2AMYA 4IG4A 3R9KA 1Z4IA 3RF6A 1L7OA 3ZW7A 3WKEA 2C88A 1Z5GA 5AVWA 1RQLA 1QH9A 1XPJA 3FPSA 4CF3A 1L8OA 2HHLA 4I9GA 5AI0A 4BNDB 1S2OA 4UMVA 5ALXA 3NAMA 3QGMA 1ZRNA 2JARA 4L57A 3AR4A 1LVHA 2HSZA 5IS2A 1SWVA 3WGVA 4HGOA 1F5SA 4XE5A 2I34A 3QU9A 5IT4A 4ZEXA 3J7TA 5ALEA 3WK9A 2FPRA 5AKZA 4NV0A 1LTQA 3EWIA 2EATA 3HLTA 1CR6A 3CNHA 3U7EB 4H1WA 3SD7A 2GO7A 2AH5A 1YS9A 4AP9A 4MUMA 4HGNA 5AKYA 2O2XA 2G09A 2W4MA 3NIWA 4Y2UA 3QU2A 1Z4JA 5ALGA 4NWIA 2G06A 5AVUA 1N8NA 1ZD4A 2JAOA 4BYGA 3PCTA 1TJ4A 5AKLA 4KNVA 4F72A 3N8GA 3A1EA 1TJ5A 3BA6A 4L6AA 1RDFA 3NALA 3EPRA 4RESA 2I54A 3DV9A 3KZXA 3WK7A 1NF2A 2RB5A 5AVRA 3NRJA 4AS3A 2C9MA 4JDPA 2ZG6A 2RBKA 4XPZA 4Y2RA 4EEKA 4BX2A 4YIKA 1QYIA 1RMQA 5AI4A 2B8EA 1SU4A 5AVQA 2HEGA 2G07A 1U2TA 2IOFK 4GIBA 2B1QA 2GHQA 3AR8A 2P27A 3L5KA 2HI0A 4FE3A 2R8YA 2ZBDA 2B30A 4KN8A 2FPWA 3SLRA 5AVZA 5ALKA 4Y2JA 2FI1A 2P11A 4CNQA 4O8CA 3FGOA 2PR7A 1RC8A 2EARA 5ALVA 4FYPA 3EF0A 1RLMA 2VKQA 2FUCA 3KC2A 1L8LA 4UMFA 3ZTYA 4EZEA 4OCZA 1IWOA 2BY4A 5ALOA 3PGVA 3AR3A 5AW9A 1RLTA 1QQ5A 4XQ0A 4UU1A 2OBBA 3N28A 4DCCA 2YJ6A 3OCUA 3AR9A 1Z4LA 1TA0A 1X42A 3NASA 3ZWDA 2C8LA 1YNSA 1JUDA 1ZD3A 5AW8A 4UM5A 3KOOA 3KDPA 1RQNA 2OYCA 3WK5A 5AIBA 4Y2XA 4Y2YA 4KNWA 1VJRA 4B6JA 3CZ4A 2WFAA 1Z4QA 4Y3UA 3VAYA 4UU0A 1U7PA 3FPBA 1S8OA 5AW4A 3L8EA 3QYPA 4KX5A 4I9FA 5AM5A 1KYTA 1QQ7A 4UW9A 1Z5UA 4Y2VA 3UMGA 5ALZA 1WPGA 4G9BA 1WZCA 1Z4NA 2BDUA 3L0YA 3M1YA 3ESQA 5AIAA 4F71A 2WHEA 3ESRA 3R4CA 1NNLA 3FM9A 5ALNA 3MPOA 3OCXA 2HDOA 5AW3A 3UMCA 4IFTA 2AGVA 4DFDA 5AKJA 2B8JA 1CQZA 2W43A 3K1ZA 5AKHA 1Z4MA 4EX7A 2P69A 3ZI4A 1ZRMA 1ZD5A 3E8MA 2YMQA 3HYCA 4UMDA 3F9RA 3N1UA 2FPSA 1RKUA 3ZWKA 3DDHA 3A3YA 4EX6A 1T5TA 3S6JA 3ZTWA 3OTQA 1U02A 3TLMA 4L6CA 3U26A 3W5BA 1EK2A 3GYGA 3QU4A 5A3SA 5AVSA 1YDFA 3QNMA 3SKXA 2R8ZA 2WF7A 5AW7A 3PDWA 4UARA 1ZS9A 3I76A 2CFSA 5AK3A 4E88A 2FEAA 1RMTA 1O03A 2YMLA 5ALYA 3WKAA 5AW0A 1TJ3A 2HX1A 2QLTA 4UMEA 4YCNA 1XVIA 2GMWA 3QUTA 3ZX5A 1YV9A 3KD3A 1RRCA 4QJBA 3WKCA 3IB6A 2ZBEA 1Q91A 2FPUA 3B9BA 1TE2A 1T5SA 1YJ5A 4HAIA 1YMQA 3W5DA 3A1CA 5ALUA 4YH1A 5AI6A 3IJ5A 4UATA 2JAWA 4KYTA 2R8XA 2Q4TA 1VJ5A 1VFPA 4QQFA 2C4NA 3ZX4A 3OCZA 2I6XA 5FP0A 2ZOSA 2RARA 3L7YA 3WKBA 3OCYA 3U7HB 5ALJA 4EELA 5AKXA 4G63A 5ALDA 3ZVMA 1AQ6A 2G0AA 1L7MA 1ZOLA 1Z4KA 5ALQA 4AS2A 4NAVA 1PW5A 2OM6A 4UAUA 4RETA 1U7OA 5ALHA 5AK5A 3OCWA 5E0OA 3B9RA 4C4TA 3QU7A 2B1RA 2YJ4A 3NUQA 4C4SA 3P96A 2C8KA 4CE6A 4YIHA 2YY6A 3L0CA 2G08A 4Y2SA 5ALWA 2FUEA 4YCMA 4GXTA 3ZU6A 2B82A 3I1YA 2IYEA 3AR7A 3D6JA 2WF5A 2WF9A 4Y2QA 5AW2A 2AUTA 2WF8A 1Z4OA 5AW1A 1RKQA 3WK6A 5T41A 2ZBGA 2HO4A 1J97A 3WGUA 3SF0A 5ALMA 2GHTA 3QUQA 3AR2A 2OA0A 1NRWA 5IT0A 5AVYA 3SHQA 4Y2PA 5AKGA 1SWWA 3QUCA 3W5AA 2YMMA 5AM1A 3L1UA 4XOUA 3E84A 4ZEWA 2G1AA 5AVTA 3QLEA 3SMVA 3WKDA 4EENA 5ALIA 4ZEVA 2QYHA 2NO4A 5AKEA 4DW8A 3KBBA 5AVXA 2CFTA 4DWOA 2YMPA 3DNPA 3L8FA 5AESA 3W5CA 2O9JA 3QXGA 2GFHA 3ZUPA 3AR5A 3PGLA 2B0CA 1ZD2P 2W11A 2ZXEA 3SKYA 3U19A 3QX7A 1RMYA 3ET4A 3QUBA 5AM0A 2HF2A 5AM4A 2PQ0A 2WM8A 3ZVNA 1J8DA 3L8HA 4HYTA 2JGAA 2FPXA 3FVVA 3IRUA 5JJBA 1T9ZA 4BKMA 2ZBFA 2CN1A 3WK4A 3N07A 1U2SA 3E58A 1Q92A 2JAUA 2YFYA 2YJ5A 4YGYA 4PNHA 5AHXA 2YBDA 5AM3A 1Y8AA 3L0BA 1EK1A 4KX3A 2DQSA 5AI9A 2YN4A 3AR6A 1QQ6A
chains in the Genus database with same CATH superfamily
3TW0A 4M9RA 4JI1B 2VHVA 4R8RA 2R60A 3PU6A 4YACA 4D45A 4PSDA 3ZCUA 4JLDA 2WINI 4XWGA 1DZIA 1FDSA 1AGNA 2O5EA 1DWUA 3E18A 4N65A 4DV0B 5JSZB 4KQ9A 4U7JA 3RWBA 5KWVA 1XZNA 3K1AA 4TTRA 4LDAA 2IBSA 3FZGA 3V4PB 5CFMA 1FDWA 1XZDA 3KK0A 1L5QA 3HCPA 3HNOA 4XX1A 2XH8A 3W9YA 4AF8A 2QVBA 1W94A 1NLFA 5BRJA 5ITWA 3DTVD 3ESXA 4YRLA 3T7SA 4MUYA 4CCYA 1QUEA 3H8JA 2JCVA 2A4MA 3OZSA 3R23A 5AO9A 5E3IA 3F9CA 4ZI7F 2PFSA 4JITA 2X7JA 3LY7A 3KT6A 2JGKA 2PUVA 4QTZA 5L3VA 4ZYUA 2ZBVA 2IC5A 4W7IA 4Z99A 2F8TA 4CLRB 4DARA 1FNSA 4WDRA 5REQA 3O31A 1V5GA 2Y1DA 4LJ4A 5D6NA 5A4KA 1E6EA 1RRGA 4IY1A 4M8IA 4YGXB 5FTMA 2WBLC 5JO9A 4EUEA 3UM9A 3I4LA 2HMTA 5JNRA 2MDTA 2VP2A 3B7GA 5KX5F 4UASA 1TCBA 1Y3AA 2QTAA 3T1TA 2ZJ4A 4QUGA 4ZAXA 2XZLA 3A36A 3BGSA 4YEDA 3I45A 1IZ8A 2PGDA 4KQHA 1NNSA 2FKAA 3MJRA 1UKVY 1FLNA 2HZBA 2Q5EA 2D1SA 5BUCA 4MQEB 1QRTA 4FFRA 3S70A 5BR4A 4JYAB 4GL4A 5FI1B 1T25A 4WMLA 2ID9A 2E4YA 2QW8A 5JVDB 5HS6A 2C7RA 3E05A 5JDCC 3M8KA 3O2JA 1HLPA 1QRRA 1ZWLA 2B34A 3LP6A 1AQLA 2R5NA 3HI6A 1JZTA 1WZUA 3NBUA 3QLTA 4Q6BA 2FPOA 2XQJA 2ZSAA 3MG9A 4BTEA 1WL8A 4PPYA 1TEVA 3WL8A 3HDQA 2BGIA 4EW2A 4BVKA 2Q3BA 4ZVLA 3IVAA 1OYVA 5LNK1 3PUHA 4CI0B 3NHLA 4UDOA 3B6EA 4V0SA 1XFDA 1QWOA 3OE4A 2I9PA 2QDKA 3TZCA 1Z2EA 1E1LA 3QMMA 3G7NA 1BQEA 4EKEA 1PR4A 1MRZA 3B1FA 3OPXA 5T8KA 1NY5A 3Q5DA 3KKKA 4CMCA 5DLYA 2OR3A 3PHHA 1QRUA 2PMKA 2OMKA 4KZKA 2ZI3A 3ABSB 1ZFNA 3ZI7A 1W93A 5KYTA 1TF7A 2OUIA 2YNMC 4BKQA 1KH1A 3GXBA 3HYSA 3O91A 5I9BA 3IUMA 2H4ZA 2B4RO 4O08A 2GBFA 4YAGA 2BFBA 3U7FB 1JEQA 2QT9A 2WIDA 1ZIPA 2HJVA 3H1BA 1OZHA 1MOPA 1XVLA 2CL6X 2XECA 3G85A 4LOAA 3HXQA 4KMMA 1PQUA 3PJDA 1QGOA 2FW6A 4HMOA 1QH9A 3PNMA 4FDAA 4W6ZA 2NTNA 2EG5A 5HRUA 2ZCVA 2D7DA 1NQAO 3F7OA 1VCOA 2ANCA 3HUTA 3O8QB 4IDDA 3O8OB 4CM9A 3GUHA 2V5UA 4QOGA 3FPAA 2GEBA 1HDGO 1GL9B 1QHNA 3HA5A 2GLXA 3MJVA 2SCUA 3DBLA 3OEEA 3KM0A 1JILA 3HMQA 1XQVA 3OTHA 8MHTA 4I46A 3GYBA 2HPVA 1LB1B 4C7OA 2QUHA 1UKCA 5KSWB 1F5SA 1K5GA 1EDEA 1R3DA 2OV6A 3JRWA 2O8EA 3AUFA 1PJZA 2QXTA 1T35A 4RPKA 3QXSA 3SEQA 5FJIA 3M7IA 1G8KA 2J30A 5BWMA 5IANA 1OT5A 4MR9B 1OIVA 3HS3A 3DG9A 4DYHA 5C51B 1VHLA 4RAOA 3SD7A 3P5SA 3WV4A 3LAWA 3SX0A 1FS6A 4A0RA 10MHA 4XQGA 1KDZA 1C80A 2BL4A 3W90A 1BDMA 1MIHA 2EERA 2Q3JA 2BTEA 1DL5A 2K4MA 3IOEA 4D9HA 3N8DA 4MKZA 4BNUA 1T1GA 2D5BA 2DKFA 3HCEA 2IZOA 1LDNA 1I33A 3PYXA 4ENVA 3VSAA 4QO7A 4ARZA 1JN0A 2NOAA 1GCOA 2R751 3AYXB 3HP4A 5CA1A 3L79A 2HIAA 3WHIA 4PS0A 4DN6A 3VPDA 5U1PA 2XQIA 3FMOB 3PEFA 4H3SA 2QMOA 2ZYDA 3GBPA 4BBPA 4P31A 2CSXA 4HBZA 2ID8A 2VZ8A 1U94A 4Q00A 1AS3A 3PE6A 4CKWA 2Q5LA 1KYWA 2ZWOA 3IT1A 3PS9A 1B2RA 4TRRA 4B2LA 4E21A 4B3BA 2GAJA 5DHTA 5FX2A 3QKSA 1TF2A 4QUIA 1G0NA 4A6XA 1CUBA 4TKVA 4B43A 4C2AA 4CMEA 5CPFA 1G8GA 1D2MA 4W5NA 3NC1C 4QC2A 3PFCA 2IUFA 1E94E 4FMCB 3GN2A 4HX5A 4P4TA 2O1SA 4D97A 1PWEA 2LCIA 4DDMA 1K7FB 4L8VA 4LG1A 2R8OA 3QUAA 4OO3A 5CYOA 1DQZA 2ACEA 1LRKA 2MJLA 1DWPA 4DMFA 1PJLA 3A11A 3R5TA 4WNYA 4IJWA 4MQFB 4GM0A 1M2EA 4JJAA 3G2HA 1B0AA 1D4AA 1YULA 3A6ZA 3QELA 1PUIA 4JT2A 2QUZA 3ID6C 1U31A 4ZI7B 1G20E 2AJLI 4U6SA 1EBBA 1VL2A 2NSDA 2FK7A 2QGFA 2O3RA 3D31A 3LPCA 1LW6E 4AUEA 1T6NA 1TVKB 2YZ7A 4GZMA 4ZJYA 2BCGY 2JFXA 5CAEA 3FTCA 2D1FA 2DBRA 4UOQA 3UG7A 1QZTA 4J0EA 3VSEA 2PBZA 2VTKA 4YLEA 2GN2A 1JF8A 2WJWA 5FORA 5H3HA 4Y6LA 3AHJA 5KX5B 4K2HA 1PT6A 2VRCD 5KAMA 4M55A 4YS6A 2B7CA 4RZQA 1EGVB 2GTHA 1RI1A 1WDMA 3RRYA 4QJIA 3IDSA 3PP8A 3H65A 1TMGE 3DMTC 2ZR8A 4RK7A 2WKRA 3WXMA 4CLDA 5ALVA 3GEGA 3ZQ6A 2NXNA 3P2KA 4ZT3A 2IV3A 1UM8A 1O0BA 1OYYA 3FA2A 3SZRA 4IJMA 1QG6A 2I4MA 2WICA 4JKOA 3ECCA 2O0JA 4I8DA 4RVOA 3U0VA 4DLKA 1CRQA 1GRCA 1OWOA 2FE1A 3F6CA 2P5YA 3D7RA 4P7GA 1RYDA 4IIUA 2XGSA 4U6NA 1M1YB 4MARA 2XB2A 2Q3LA 5F2OA 1CRPA 1YAJA 4WVLA 3UK7A 4CM8B 5FAKA 1VRWA 1X42A 2UKDA 4POOA 4E14A 2H11A 5KCMA 1RRKA 3I30X 1Y8QB 4MKHA 3V42A 1EGHA 3WNBA 2QRJA 3OJXA 3V5NA 1XG5A 3WIEA 3NUZA 1DIAA 4JBNA 3SSMA 1KK1A 1A96A 4CQJA 3FLMA 1BDBA 4Y2XA 2FP3A 2PA0A 2WD9A 3CFYA 3TLCA 3SOPA 3GLFE 1ULSA 4WSOA 1YZKA 5KVVA 5IUJC 1BE6A 4MKRA 3RD5A 1YASA 4GKVA 3RJZA 2JATA 1B0UA 3PC8A 2C5LA 4HDNA 5AHRA 5TJHA 2GB4A 3TSYA 4AYXA 3JQCA 2QUIA 5HRAA 1SR8A 2A9RA 2IVFA 1KJYA 3MLEA 3RRBA 4WOCA 1JAXA 4U8HA 1G8PA 3PFWO 1VE3A 1YA6A 1B74A 5JNWA 2H57A 1J22A 3UMGA 1PJ3A 4QYWA 4HATA 1P4HA 4OFWA 2GQ0A 1R0XA 2ENUA 4BAUA 4BNWA 5JMTA 3E22B 3O74A 4AD8A 5AIAA 2P3OA 1EX7A 4PG5A 2H16A 2HSDA 2N46A 3H1EA 821PA 5JZSA 3ZNOA 5GAJA 1E9CA 2GZDA 4A3SA 2OD9A 5AW3A 5LPNA 1C3EA 3IAS1 2N0SA 1CF9A 1DXHA 2WEKA 4CCAA 2R47A 4L7QA 4C3UA 4DBZA 4GSYA 4IUDS 1VB3A 5FBVB 3DDSA 1T4GA 3IOCA 4PZUA 3HNPA 2X1HA 5I9IA 4H6VA 1I4OA 3QQ5A 2ES4A 3M34A 3NOVA 1GSOA 1P61B 2LR0A 1ZCBA 1KIFA 4LV8B 3F3SA 3T7CA 1OH5A 1H2RS 2VOEA 2GUGA 3E5RA 1NW5A 4ZOEA 3ZBPA 2D74A 4S0ZA 4F86A 2QTCA 2JFGA 4KQFA 1UWVA 4PAGA 3F3MA 4GR5A 2QQEA 3Q87B 3HY6A 3LKBA 4N7BA 3DMFA 3MJEA 4C7JA 1CZOA 1X15A 2AYZA 1WXXA 2EG9A 4HV4A 1LKZA 1E69A 3AF3A 4HWSA 1AD2A 1BX3A 1I4TD 1NFFA 1ODTC 1CR4A 1UEIA 2PU7A 2TMDA 3EGOA 5FFMA 3R7AA 5KYYA 1EUDB 3F3YA 3GP8A 1Q74A 2DFPA 3BMCB 4MB2A 4RKRA 1G6KA 3VVBA 1L3IA 1A8QA 3JWEA 5A3SA 3TSZA 2IPOA 3RRMA 3EIWA 5ESDA 5FWXA 3EISA 4QYTA 4EMSA 1R0ZA 2BMEA 4FN4A 4Q37A 1M1ZA 1YBFA 2I6GA 2LE0A 1TJPB 3NBKA 4RZUA 4AK9A 5M3BA 1JQJC 3NPMA 4DSOA 5EJ4A 5KNCD 4AS1A 4KQMA 4BE9A 4F8EA 4M8KA 2WAAA 1JR3E 5BSUA 2Y93A 4DLVA 3R3VA 1VHJA 2ZBRA 4BFWA 3Q7QA 3LWNA 1U7XA 2FEAA 3OT1A 4DRYA 3ELYA 3KQKA 1OCEA 4B75A 4F4CA 3SR0A 1R66A 4B81A 2AG0A 1LV7A 1D7AA 2XIQA 5DEIA 2GMWA 2WMDA 3AI1A 2CKDA 3KD3A 4ZQBA 4D8YA 5AOAA 4M83A 2O5VA 1LWOA 4PE5B 1KU0A 5CLJA 1FBTA 2VF5X 2FSPA 3HDVA 4G5SA 3L7BA 4OJKA 1P8AA 1PR3A 2AEFA 4QX6A 2YNMD 3C1OA 2JW5A 3AQ4A 3PCRB 3HGMA 3ZIAD 2D7CA 2HBQA 2WTBA 1LH0A 2ZKLA 2DWUA 2VRNA 2AOTB 2C3YA 4G09A 1K5PA 1T43A 4BYMA 5JSYA 4G0PA 4Y1RB 3RYHB 5FIUA 4CLHA 3HDGA 1SUEA 3AJRA 2R8XA 3WBFA 3M5CA 1CE8B 1ICEA 1VA4A 1CQIA 4B3GA 1ZMBA 3Q9UA 1N4DA 2C2ZA 4X94A 1VJ1A 1W1WA 3OCZA 3I9V6 2JGIA 1R4ZA 5EGSA 3U3XA 3VKUA 4IXWA 3IAXA 4JSTA 2JJ1D 5EJ8A 1XO1A 4E30A 2C04A 2H31A 5B6JA 1VCHA 3AFIA 3GLUA 3RBXA 1Y6GA 1NP3A 4NBRA 1YJQA 3ZDYB 5BN4A 4K6OA 4WFIA 4YJ3F 4EGAA 1L7MA 5ICFA 2X4LA 3SCZA 3IR6A 1DV1A 2NWQA 4GOOD 3G5LA 4BN0A 2IOQA 2UYQA 2AQKA 3I2HA 1UC5B 5BR7A 2G7ZA 3VC3A 3S44A 1OLOA 1ZCZA 2ZQZA 2OFOA 3E03A 5AK5A 5U4XA 5A62A 4WHMA 5C1BA 2A8YA 2Z8YM 4P0TA 4B0OA 5C8YB 4OHUA 4GKAA 2OL4A 3BK2A 4L50A 4MV1A 1I2CA 2MIIA 1GPBA 2JI8A 5CJ2A 1LXCA 1YZGA 3SZGA 1ICIA 3AOEA 3PLRA 1KEKA 4CM7A 5INTA 3WGJA 2C42A 2QS9A 1B42A 1Z3IX 1PT5A 2B4TO 4HWOA 4JVNA 1E5VA 4ZEOA 2WSBA 2JGDB 5AUNB 1P1KA 4ARBA 2X15A 4J2OA 4MTCA 1D6NA 1BD3A 1F06A 1RR6A 4URHA 4Y2QA 4REOA 4AIRA 4E2FA 4AWAA 5DM70 1PJ2A 4F6CA 1QNFA 1KK3A 4HR7A 5ER6A 3ILHA 3ZVRA 2GM9A 2G0NA 1F8XA 1FS5A 4ZARA 3FAKA 2GEUA 1CJVC 2PH3A 3AY0A 4PIVA 2WQ7A 4C14A 3CVYA 4CTJA 1Z34A 3S7ZA 3HO1A 3CB2A 4GH5A 1JG1A 4E3ZA 1YR1A 2D8MA 2HUNA 3U39A 3BGIA 1IWPB 3W5IA 3HCCA 4ITVA 4CL2A 1W581 2WG1A 3FWYA 3KFVA 2XTMA 2KW5A 5HG0A 5ITZA 4AYWA 3CZMA 4UXHA 1YI8A 4AF7A 4C4OA 3JAWB 2PEYA 5ALIA 1ZINA 2ZJBA 3TH5A 1E8DA 1IHXA 1ML4A 2O2IA 1XZPA 3N53A 5AKEA 1V5WA 1JIKA 4B7XA 4AKHA 3BD8A 2C1XA 1TZCA 4DWOA 3DNPA 2FHSA 4EA8A 3VTFA 4LSGA 1VL5A 1HYBA 1FVXA 4AKIA 3IDFA 4F60A 3BTVA 5MFPA 4EEXA 3Q3VA 3GCWA 4ESVA 4BMVA 5KCZA 3ZUPA 2BFDA 2C1EA 3AR5A 1ZD2P 3TBFA 1U8YA 4L76A 4F1WA 3QX7A 4Q9KA 1OGIA 3TFWA 1RBYA 1ZK3A 4Z4IA 3KV3O 4ZOLA 2C29D 3F5MA 2P6UA 1YS4A 2PCLA 2PN1A 2FJ0A 1DO0A 1KP9A 5NLLA 1USWA 4B3RB 5BR1A 2HYIC 1KFJB 3R6WA 5JJBA 5LOVA 3FGNA 4OKSA 3E53A 4MYRA 5D3MB 1HZZC 2JJ8A 1MQ9A 4GW3A 4TOIA 2VJLA 3AMVA 3DZGA 4MYHA 4ZYLA 3MBIA 3N07A 3SS9X 3T3EA 2J87A 2GILA 1VLMA 3FYDA 1WPXA 1URPA 1OX5A 3Q7TA 5TXGA 3R8XA 2KS6A 4MEJA 3TRHA 4BNVA 3GD7A 4AKSA 1D8TA 1KQFA 4U7WA 2Z6AA 4M7PA 3FPGA 4MAAA 2FG6C 1U7HA 3UW1A 1KQNA 4DWWA 1W0JA 2P5SA 4TS4A 1N9GB 2AF3C 2X8AA 1V96A 2YZ2A 2OAP1 3ONNA 1BDIA 2RCYA 4BQSA 1FVOA 2XWBF 4QFDA 2AV6A 3QVMA 4N7RA 3IQZA 4FFBB 4ZI5A 1YCDA 2Q3MA 2HFJA 4N01A 5AICA 3ZYZA 4L4SA 1COWD 1G7CA 5EHXA 2ECOA 3UT5B 4CUJA 4JI5B 3ZE7A 1EVKA 3IKVA 3LDFA 1PJBA 4MWDA 5FPTA 4WASA 1P9LA 4ND5A 3GVHA 4HYQA 4MS1A 2DWQA 2OC9A 2XWJI 3GARA 1ZQ1A 1O5TA 1E3TA 2XUJA 1XMXA 1G98A 4HEQA 4DANA 2W2LD 4IP0A 2PKEA 1IDN1 3BWVA 3KXPA 4ROSA 5IU6A 2QY9A 4QXOA 5A3VA 3AF1A 3L0SA 5IT5A 4X20A 3G1TA 3EG9B 3W2HA 1SHLA 3ELBA 3BIFA 1Q0TA 3QMPA 3LC0A 2R5FA 4ZHQA 3V8PA 4NV3A 1MCZA 2NSLA 4ZQCB 4N6GA 2DWCA 4K86A 1FTYA 4BB9A 1WSWA 4CEIA 5DIFA 2Y1LA 3JAKA 3R6DA 4XGKA 4BUCA 2PH5A 3OPYA 5HDQA 3U9TA 1QHIA 2UV8A 3S3TA 4MVXA 4R5MA 2X8JB 1P1RA 4E32A 4TLCA 3JALA 3TGWA 1Z0ZA 1W85A 3EIHA 1XDSA 3JD2A 3MRSA 3SBDA 2GJ9A 1Y63A 1MH9A 2PD4A 2EAUA 3I28A 3K05A 4QULA 2J3MA 1T6YA 1WOMA 5HUQA 1Q0RA 4QXQA 3EQ6A 1O97D 3LBIA 4AB1A 1QLHA 4J7UA 3OQOA 2R6DA 3F49S 1C0EA 2OSVA 1ZOSA 3DEJA 3L7KA 1QZUA 3DMYA 1ISGA 3LC7O 4FMDB 4YJ3B 2YHBA 4CF5A 3FBTA 4FX5A 2GRAA 5FOTA 5HS4A 1OUMA 4BXOB 3RYFB 1GLVA 2BLNA 1J9ZA 3A2LA 2YXDA 1EG2A 2EC5A 5TE9A 2HF7A 4RD2A 5ALFA 2WU3A 4D9KA 5FOQA 4DZRA 2GN0A 1LNQA 2A3NA 4FZRA 4L5BA 1ZA2A 2D4HA 1IULA 3DBHA 4IO1A 5ALSA 3ZVLA 4CIBA 1CLUA 1AIPA 4M87A 4L5JA 1MT0A 2IBMA 3UMRA 3NM4A 4O2BF 2WJ6A 5TGDA 1O3YA 1JHXA 2P9EA 4N47A 1AQYA 1RWKA 1C7QA 1J0AA 2BFMA 4I1OA 4NOJA 2XCTB 4R54A 4EJFA 2CUKA 4L2IB 2E7ZA 5HYVA 2WWFA 2E85A 3ELUA 4P80A 1ENOA 2J6CA 1ISHA 5KTYA 4C4RA 1KFBB 2PGLA 3QK7A 2PWPA 3D9QX 5FWNA 1RC1A 4WLNA 5JI2E 3B8EA 1X1RA 1ABFA 1YRWA 4IR7A 4URFA 4YO8A 1FP4A 1WU7A 5IKEA 2WTAA 4AJ1A 3ORFA 1R8SA 4OKIA 1L7PA 2HU2A 5I9SA 4UFPA 1EXVA 1R8QA 2QJTA 4RF3A 1DTSA 5ECDA 4LOJA 2AMYA 4ND7A 1QLWA 1R6AA 2H4FA 3SHWA 4I6JA 1KPHA 1ECGA 1GFSA 1B1CA 1NTRA 3GGGA 1XTIA 3M2TA 2ZSHA 5F7XA 2R6HA 4FGKA 3JVUA 4K8RB 3S81A 3QYAA 3JRXA 1O57A 4JUBA 2O8EB 4FXPA 1E4EB 2C4VA 3K1YA 2XGMA 1AURA 3W9SA 3ZWMA 4D74A 4UMVA 1TQ8A 4TS1A 4MCJA 1P31A 3DGEC 3HKEA 1ZRNA 1UPCA 5B7PA 2PYDA 1O6ZA 1XN4A 1P8JA 3B3FA 1FDIA 5IM4A 2EZUA 1AJEA 5DI9A 3V8VA 1FFBA 3K5WA 1LVHA 2V6IA 4F3RA 3ND7A 4IS3A 4HNRA 3USCS 4AJOA 4Z1OA 4LDPA 4AJLA 5IN4A 2Q5QA 4GM4A 4HB2A 1Z06A 3LY5A 4X95A 3W8FA 3JVEA 5TPZA 4LECA 2IYRA 2XXBA 1ZC4A 3A1SA 4XB6B 3WQHA 4HAXA 3D3EA 1E92A 4NZMA 3SQMA 1CEXA 4UQPA 1HQKA 3STTA 3VUFA 2B0JA 2D1QA 2DLCX 4C1BA 6REQA 1ZNXA 3HVJA 5K6TA 4IICA 5ICSA 1KBOA 1CR6A 1G16A 1ZSYA 3U2QA 3FY4A 4AN0A 3KLPX 1EFPB 3VR2D 5LZ9A 1NF3A 4DR7B 4U9UA 1WHSA 1SB8A 3D1LA 3MMPA 5IKOA 3PUYA 1GTRA 2L69A 2A0YA 1X1CA 2J5KA 4HZUA 3KYCA 4KWEA 3TLGB 4TLDA 1USKA 1KZ7B 5I8WA 4WCFC 1Z0FA 1AO3A 3LHFA 1LSSA 5AJXA 1DC6A 3RHSA 3WFIA 4LBZA 4AVYA 3O4RA 1X77A 3QF4B 5GOZA 4M1MA 1A4RA 1ZAYA 4MEAA 2OE2A 3PG5A 1SBZA 1RJEA 4WXYB 4Q6WA 2EHJA 2OPBA 1O5OA 2CJFA 2GNOA 5COQA 3BB1A 3LX8A 3QVWA 5F64A 4BMSA 4EG5A 3RYCA 4ZIRA 4AZ3B 1VGQA 3DHNA 4YCBA 2IHZA 3SP1A 1MENA 4E2YA 5AHKA 4F84A 2F64A 2R1VA 3MMSA 4N3BA 4TZ6A 1GTL1 1II9A 3DV9A 1LPAB 1MA3A 4ND8B 5I7VA 4TL6A 4ZJUA 5AJUA 4GO1A 1GPUA 3R3HA 3NRJA 2BI4A 3PDJA 3RVBA 3M4JA 1HORA 2M32A 5ETJA 1S2MA 1QDEA 2O5CA 3RS3A 5J4HA 5L51A 1DBPA 1E59A 1GTZA 3OA2A 4MGIR 3GVXA 4QAJA 4RFLA 4ETMA 2B8EA 1XI2A 4WK6A 2NZ2A 5GVRA 3RGWS 4X91A 4X1KA 3TCKA 3DHWC 3OAAD 4JOCA 3H8WA 4RGBA 1RLUA 1A8UA 1W96A 2ANBA 2AK3A 3EZGA 3F5SA 3IIIA 3KUDA 4FW9A 1WBBA 4CL8A 2O2JA 4R8VA 1SVNA 2W6QA 4LTMA 4QA9A 3DR3A 3NTUA 1M1XB 4D8VA 3KETA 2O2SA 4YFVA 4KN8A 4E7PA 1N7IA 3RC3A 5E3JA 4F0JA 4LRUA 4H3HB 1XJWA 1KSGA 3MVEA 4EO7A 4FK8A 3M1AA 2ZM5A 2E5LB 4LQLA 4Z2YA 1GPKA 2A1UA 2EARA 3UJAA 3LZCA 4C0XA 1PUJA 4CG2A 1OBVA 2PZJA 3AI2A 3N39C 3PTLA 3L43A 4NDZA 3VYTB 5DDIP 2I4OA 4Z9AA 3VO8A 2P5UA 3GGJA 4XQ0A 4WLUA 5K5EA 2G88A 1N1EA 2I2XB 4FB4A 2BTQB 1H65A 4Y2GA 1VE5A 3C2QA 3M6XA 4W5OA 4G89A 2PGIA 2GK7A 1PT7A 4I50F 2GLUA 1ODCA 3HM9A 4EEZA 2IQ5A 4P2BA 2ZDGA 2FB9A 2X6QA 2ZTSA 3PIIA 4PXYA 5GJWC 5MFZA 1T9AA 4O2BB 4YDSA 3T9FA 5KOYA 5C8DA 1U7WA 4OTZA 5P8WA 4BQIA 2BONA 1PQ4A 2CNLA 2JJYA 3UK1A 3IDAA 1BHSA 2BEWB 2VJBA 1XQWA 4DYDA 3NTVA 4CTOA 1LFAA 2FX3A 4K6HA 1Q3TA 2OZPA 3K6SB 2R2GA 1ZGHA 2BMAA 1DBVO 2HWUA 1AN9A 2XRMA 3NWJA 5CX1B 1LJ8A 1FP7A 3R0IA 4K8OA 4PZ0A 4YRRA 5H59A 2B5WA 5K3FB 7AT1A 1FX0B 3EBOA 3P9YA 4MJXA 1U28A 5LXTA 5CVEA 3LBHA 4P4SB 4BJHB 2CUZA 1Z47A 2OAEA 2H54A 4EGFA 3TQRA 4X8MA 1ZW1A 4C7XA 2YQ4A 3EFBA 3TIFA 3L0IB 2Z4TA 5E1BA 2G25A 2W2KA 3EXHC 3M1YA 3QG5A 4Z4CA 5JALA 4A6DA 5IMSA 2JFHA 1VPEA 2YV1A 3WL3A 2H5EA 4Y6GB 4FLFA 1PFGA 1TL7C 1F60A 1IPFA 2OXCA 2XOEA 2FMXA 1E3EA 3KYBA 4BNXA 1THTA 1WB4A 2LRHA 4XIIA 5KI6A 4D44A 2GARA 2MINA 2A67A 3MFQA 4FOPA 3LL7A 3CMCO 3QIVA 4ER3A 2H59A 1JNYA 1DEKA 3E82A 3GGDA 2H1WA 2GASA 3MK31 3WLJA 1SPXA 1ACMA 1NP7A 1UMCB 2YV4A 3K1ZA 2EZ8A 3GLRA 5CH3A 5JDIA 5KQPA 2BM1A 2WM2A 3K0CC 5BT8A 2P69A 3T0GA 2H9IA 4JXJA 3F8SA 4QREA 4AQ7A 3IEXA 1UFVA 3BE5A 1CNEA 4EB0A 2I3GA 3V2HA 3ZEIA 5TQ0B 4GFDA 3ASYA 4QD3A 1W4RA 3ZWCA 2RIPA 4S1VA 1OT3A 4RA6B 1F1BA 2PBRA 5ED0A 3EX7C 3ZDDA 3I4FA 1RI3A 1I1QB 4IIDA 1BC5A 1L5WA 3ZD9A 5F3RA 2XR1A 2GN9A 2IPAB 3WZLA 5TT1A 1ISMA 1YBAA 1YU9A 2R11A 5IYZA 3DLHA 2WPDD 1JFVA 1O95D 3WA7A 2WLTA 2NGRA 3RSCA 5FEMA 1G21A 2DCMA 2PJDA 2XZDA 1N0UA 1I0ZA 5IF3A 1JKXA 1I9GA 2MSLA 2BFWA 1JLSA 2Z8XA 4K7JA 3PC2A 4NU8X 4O4JA 2F8SA 4AP5A 4L4XA 3ZBTA 3BDVA 4LBVA 3X1ZA 2QTFA 4RMNA 2V7GA 1VBKA 3ZQUA 3HBFA 1ODLA 1AQUA 5DISB 5JAHA 1P4RA 4QQ8A 2ZIEA 3DEZA 3L7DA 4OSPA 3RH0A 1OA0A 1ZK2A 1IEVA 2BGUA 4EAQA 2AI3A 1H2HA 1NVWQ 1XJ0A 2VDNB 3QUTA 4DA0A 4JA2A 4L27A 1RM4A 2MMCA 4IJ5A 9MHTA 1XKXA 3ESYA 1B43A 4GBJA 1VSQA 4UHDA 1UJNA 2B8WA 3C3KA 4U5QA 5HIIA 3WV5A 1GCUA 1NQVA 3M6VA 5K0LA 3OIGA 2PKXA 2UZIR 3EODA 4XSHA 3AG6A 3B9BA 3ER9A 1SCDA 1CYEA 1DQSA 2Z8YA 4WY8A 1GAJA 4L74A 1LI5A 1LX6A 4TGLA 3K0FB 4ZT2A 3F74A 3K1JA 5B2EA 2Q3CA 1QHSA 2POCA 3W78A 2W6PA 2JAWA 1L7EA 3C8ZA 5LP6F 1GHTA 2D1RA 2PO5A 3D6FA 3WDMA 2RAUA 3S2ZA 1Y3FE 4MVJA 3AFNA 4PQGA 4CQMB 3LHDA 5C1PA 1WDKA 5JW6A 1ZJYA 1LEHA 1ZHOA 4PZYA 4LDZA 1ZHFA 1N32B 1YOBA 1ECPA 2G1UA 2I4RA 2PT5A 1HV8A 2VEDA 1QYDA 2IW1A 3L1JA 2P6MA 4IDPA 3OOJA 1NW4A 2ZRIA 4LMPA 3OM1A 1DDIA 4BMZA 5J3JA 1H6DA 3L7LA 3LXXA 2GO1A 1M3SA 4QWMA 3AX6A 1R88A 4NQRA 1DADA 3N87A 4XGIA 1U7OA 1W5EA 2NUAA 3QPDA 4L16A 5DGTA 3S99A 1SBQA 4YMTA 1QHFA 3U4DA 1F3OA 5CDGA 5LQJA 4DQLA 1Q83A 2E4WA 3DHYA 1YI0A 2REOA 3AIMA 3D4BA 3PIDA 3ZY5A 4C4SA 5H80A 3K4QA 3H3XA 3JQ7A 1G41A 1FE8A 1KETA 2Y2VA 1KQOA 2FPGA 1WEHA 4FI3F 4QAQA 4NPCA 4I50B 4UD6A 1SC4A 3NP9A 4KLZA 1GZ4A 4WUTA 1ODKA 1R00A 2WW8A 4Z9XA 2PGNA 3TTWA 3ZC3A 3VR5A 3KPWA 3DJYA 5JQGF 5JUWA 1EZZA 1T15A 1JVBA 4OX9B 2H07A 5K9ZA 4KB5A 1EFDN 1P7CA 4YQYA 2KHZA 5EJ9A 1KZ1A 1U5AA 3GLGA 5C18A 4HH1A 3O26A 4LYGA 2AUTA 4D25A 3E48A 2NV6A 5CUQA 3RRJA 1KAGA 5CBPA 2AS0A 3EDQA 4LXGA 3B78A 3ZCPA 3WGYA 5DNCA 1W8DA 1OXBB 2PZAA 2HO4A 1J97A 3LXUX 2XPCA 3A1UA 1F4VA 3QUQA 4P4NA 4XFDA 1TLTA 4XCXA 4LNAA 1PS9A 3K8OE 1OF1A 1S8NA 1GGHA 2MSCB 3SJZA 1EJBA 3NHFA 5ENDA 2OB1A 3P26A 4QO8A 3ZR4B 2YMMA 4BKPA 4EITA 3D3WB 1CQJA 1M8FA 1Q7EA 3ECSA 1N33B 4MP3A 4LJRA 3ZWPA 2FZWA 5KJEA 4ZEWA 3VMFA 3MTEA 4E11A 4BGEA 2W4QA 4DMLA 2ECFA 2GESA 1PFYA 1PJCA 2Z1MA 4U2EA 3RVDA 3ZXSA 3DL0A 3ETDA 1EJ6A 2ESRA 2P2GA 5FOUA 3OFSA 4HQKA 3ABRB 5EZYA 4ZZ0A 4XI9A 3ZV5A 3ZLTA 3CZ5A 5JOQA 1QC5A 3HN6A 2YMPA 2UZ1B 1DS6A 3FFBA 3I9FA 4PFSA 2QX7A 3DJFA 4Q1AA 2YOGA 2P2YA 3DM9B 3J81k 3C6XA 3N2KB 1MTOA 3FJOA 4C0KA 1WOYA 4X6UA 3EQ8A 1JZQA 3CLKA 2CW5A 5EESA 1RBZA 3FB1A 4UU7A 2PDAA 1VHTA 4GUAA 2A78A 3NHJA 2K2WA 1JEEA 2G67A 2JGAA 4RYLA 3O95A 1DTEA 1O77A 3RODA 5JS1A 5HIKA 5JFGA 1JFSA 3BERA 1AKQA 4UBIA 3KQSA 4NTZA 1RU3A 2V4ZA 1BIFA 1E3WA 4LNUA 1KIMA 4C0QC 1U2SA 1MC8A 3BB3A 5FFFA 1Z63A 1WQ3A 3GOHA 1A0OA 3K30A 3M0EA 4GP6A 1NMEA 2Y3IA 1CJKC 1EP1B 1Y8AA 3SJCA 3MT8A 4YV2A 1NA5A 1O6BA 1UIRA 1VSBA 2L0XA 2OHJA 2QVYX 2H5JA 1DKLA 2CBXA 2GXUA 2NM0A 3A1DA 3CA8A 5FI3A 1NBAA 421PA 2XZOA 3SLKA 1N75A 1IG0A 3QIAA 1G1MA 2D2VA 3K0EA 2WPNA 4KE6A 1UZLA 3C3YA 3TKLA 1N9KA 5YASA 4O5OA 3U44A 4MPTA 3GMTA 1N6IA 3BM5A 4JSYA 4XTCS 1E3QA 3EZ2A 4YAIA 3SKVA 1C4KA 1A5TA 3HVIA 3SC2A 2PCJA 3CTMA 1W5AA 3MGBA 4S05A 1P2GA 1XR3A 5G53C 2WHXA 4YRKA 2O05A 5JY6A 2H63A 1AUOA 1BDJA 1T2UA 2IEAA 2YL2A 1I01A 3PPVA 4F3TA 1E8MA 1FW8A 4MQ6A 1P29A 4DBLC 1QIGA 1WNTA 3KZNA 3O6VA 3PPYA 4IEEA 2YQZA 3DVRX 5TGTA 5T6BA 1ZH0A 2QVCA 4OEHA 3GLTA 4XWYA 3FMVA 4I4TA 4R3WA 1TGYA 2B98A 3FCUB 3EPKA 4MIEA 3UQYS 4B8YA 4PCAA 3L82B 1LLFA 1CEQA 2HCTA 3MC1A 4URVR 1DHTA 4R1PA 2GZ3A 4D57A 3NBYC 5HTKA 3PX3A 1T5IA 3FOZA 3AHHA 1DLJA 1MRSA 1GXSA 1HURA 1U6IA 2CY0A 1FXSA 2HV9A 2I1QA 4TWJA 4DA4A 1CX9B 1MVNA 2E6UX 1SOWA 4GLFA 4BS9A 3U13A 2BMVA 3LIPA 4BECA 1ZH2A 4AECA 2HO5A 1QQBA 2ZZNA 1E66A 3V2IA 2GKSA 5I7HA 1YIAA 2WIAA 4EJSB 4D8WA 1WM1A 4Q18A 2W8BB 1M8PA 3KKOA 1UBNA 2ORYA 2XNHA 3DAOA 4HMPA 4ZO6A 5DYYA 4IVQA 2J3JA 2ZSKA 1YOVA 2IYXA 1BYIA 1RWBA 1YRAA 5AHWA 1XF1A 3FF4A 1QJ4A 4OUDA 4UAVA 1J1UA 2FMIA 5ES3A 5AI5A 3IEPA 5A3RA 3IBYA 3N2EA 4FDVA 4ZC8A 3RKUA 3H0CA 2JCSA 5JCJD 3CW8X 1ZYUA 4NU0A 3U40A 2VK2A 1MABA 3TPCA 5AWFC 4EHAA 2PT7A 5CHEA 2HW8A 4KIGA 2Q0XA 3ZD8A 1PVOA 3O8RA 1L6RA 2AMFA 3JTMA 4M0EA 1JJBA 3GFSA 3VZCA 2QAJA 2FQ1A 3T9AA 4OHWA 1AV6A 2YW2A 1XZEA 2OV4A 4I5IA 4UE3S 1KS2A 2AD5A 2YZKA 4ARVA 3CHYA 3BSYA 1ENZA 1BU8A 2FP4B 2IZ6A 3OPYI 4GOXA 2OBNA 4JJGA 4RABA 4V39A 4EHLA 3RFVA 4FFPA 2JVKA 3N0RA 3OJOA 4M1ZA 3I9NA 3HJNA 3PNOA 1I51A 2GA9A 1JA1A 1X0VA 2BZ1A 4FD2A 4HNQA 3LBAA 3D6HA 4IV0A 1QH8B 5EEGA 4Q66C 1ZRSA 3E9DA 5G3YA 3V8BA 2VUHB 3CZ9A 5GOTA 3HZHA 1I0LA 1T0UA 3HM2A 1MBZA 5HUHA 2B7BA 2FZGA 3LVBA 3OMXA 3CNLA 4LRYA 3H1FA 1U0GA 3WGLA 3NONA 3GELA 4U7GA 5DLQC 2DPXA 2QMZA 2YHIB 4FBLA 2VHEA 4UKDA 1C9MA 1L8OA 2H7CA 1LVUA 1U3VA 4DMUB 3THWA 2HQ1A 2JIOA 3GXOA 4BE4A 5E6SB 2NU6A 1ZMXA 2ZIFA 2NUTA 3R7SA 2XWSA 4MPRA 1K0FA 2WSLA 5TMPA 3AVWA 3OZEA 1NE7A 4BFCA 3ETNA 5FLKA 2V0NA 3KRTA 2QRLA 4AWBA 1GLNA 5EAIA 1UXGA 2V0CA 1U8ZA 1TEZA 3CVXA 3LT5A 5BP7A 1M66A 1SWVA 2FKNA 4OHCA 1XZJA 4CMHA 4FDLA 2VQDA 3C16C 2LKCA 2TMGA 1SJ9A 3I2GA 2BLLA 2VKTA 6ADHA 1GL7A 2R8RA 4FFVA 1AVTA 5BSVA 1VTKA 3GLHA 3CM0A 2JZOA 3CUWA 1Y8CA 3OOHA 4ZDWA 3W7BA 4MUBA 4LJ7A 4MW5A 4U7HA 5JS8A 5B4UA 1TYBE 2I71A 5EQJB 4CL3A 2OVFA 5DRYA 3SJBA 1MJHA 1R50A 2PR2A 4ZXFA 2J1LA 3EDMA 3CRQA 2QP9X 4UHHA 4Q1CA 1P45A 3D2CA 4QUAA 3FWPA 5EIOA 4ZK2A 3V8EA 3DE1X 4P3NA 4L73A 2O8VA 4Y7CA 2HLNA 3SBXA 2JKZA 2IS2A 3LVQE 3UYKA 2OWEA 3D5TA 2YV2A 4K9KA 1BHJA 1RXIA 2YWXA 4F2GA 5K3OA 1AKMA 3PVSA 4ZZIA 4HH4A 5KO2A 5J2TA 3GRAA 4GVPA 5ELMA 3ZD7A 2VBGA 4D0GA 4F96A 5H70A 1PI3A 4LHEA 1FFCA 1Q0SA 1SUIA 3RVOA 3IQHX 2FFJA 3C6ZA 3ER6A 4MR7A 1A9QA 4RE5A 5A7GA 1JDVA 5J40A 5HJ5A 4B7ZA 1V8ZA 4AJIA 4FHCA 3KQQA 4M7OA 1YO6A 3DPSA 1OB5A 1GILA 4I4NA 1B6RA 1N2CE 2VRCA 2RB5A 2XY4A 5JU6A 3LSYA 4D81A 2XYHA 3PF9A 3JZMA 2GAAA 3PSAA 1GWNA 4IIEA 1F7UA 1ZUIA 1V7CA 2OAGA 4RVHA 3SVZA 1EUZA 1XNQB 4U0JA 3N8KA 3KKZA 4K05A 3UFXA 2AKEA 5KPJA 3THYB 1G8AA 1V3QE 1ZOOA 2VBFA 5BSMA 3R8FA 1E4YA 1R4MB 2RGEA 3A0RB 4P54A 2P35A 1JFRA 3AZPA 5FEUA 2PSFA 1FNNA 1GPNA 4ZDJA 3AESB 3JQ6A 1HE2A 2A1IA 4TTJA 1HE5A 2XA9A 5K01A 4NH4A 1JNXX 1DIOB 4B7UA 4EB3A 4KO3S 1TRHA 2ZBDA 1NNUA 4H08A 1RWNA 4HH0A 4QDUA 4DDUA 5LP1A 3PFKA 4MWGA 3P0EA 3VH4A 4DXHA 3H86A 3ZHUA 3BRWD 4AG6A 2Y2UA 3EAFA 2AD1A 2XMQA 3U56A 2KB0A 3TLYA 3P1JA 2UZ3A 1R3UA 4O8CA 5JROA 1DU4A 1RJDA 3FX2A 1WP9A 1W88B 1F5NA 4XRRA 1QAQA 3I2FA 4YRFA 5BUQA 4IXMA 1KVSA 2QB5A 1Y1LA 2VDJA 2W6MA 1PT8A 2ZRJA 2QPOA 1T26A 3K3PA 4BKRA 4HNAB 1OAOC 2GD6A 1UBCA 3EPJA 5K09A 4GLLA 4WACA 3HLYA 4I3FA 2OCGA 2YIVX 2FX2A 5BQ5A 4RCZA 3BFJA 2P0AA 2IHUA 2OBYA 1K6JA 1I6KA 3AR9A 5EJEA 2ZPAA 3C0KA 2PH1A 5EZQA 5I3ZA 2XGOA 1TM7E 1UBEA 5THQA 2Y4NA 5A2GA 1P2DA 1JIXA 2ZRQA 5DM60 5K03A 1QTNA 3TSAA 1YNSA 1IZYA 1Q12A 3CN9A 3HJAA 3DYIA 4RY9A 2FEXA 3MTJA 5GJVC 3RBZA 4GYWA 3ZHSA 4DJDC 1YZ3A 1YUNA 1RWVA 3A06A 5AIBA 1TC2A 2RFLA 5DHRA 2R66A 2VP3A 4X6YA 1DTWB 3B1VA 1KQPA 1SEVA 2CNNA 2C77A 2DTEA 4F85A 5LFAA 3CZ4A 2B61A 1CUAA 3U09A 4FKMA 2QNBA 2BE9A 4J0KA 3SIXA 2B2NA 4FU0A 4J1QA 1DRUA 3H4TA 4AP6A 1TU3A 1MX9A 1TUGA 2BGKA 3C8UA 4V02A 3BE8A 1GU1A 4NJMB 4X60A 2HNAA 2Q1YA 3SXUB 4GKBA 4Z9YA 1G18A 3CPEA 2NP6A 3KWJA 3WADA 4WADA 1XEXA 4D3XA 1LSJA 1ZGGA 3QVGA 3RREA 1W73A 4U39A 2I3ZA 4C6HA 2AX4A 3NBZC 3NI2A 3M1IA 2BUBA 2WHEA 3NTXA 4GMXA 4EZBA 5GADl 2I3BA 5FWAA 1I5EA 3D8UA 3MS4A 3QBDA 2IW3A 2WP8J 2Q0SA 2RGCA 3SEZA 1FFYA 3FWHA 1OE0A 2IE0A 2HDOA 3A4IA 3MWKA 3OCXA 3PUZA 1CS4C 4BP8A 1KFKB 1UDAA 2QMYA 5KNCA 4IFTA 3L07A 3F6YA 1F1JA 1X2EA 5C4MA 2O1EA 3UMMA 4F3NA 1Z12A 2B8JA 3H9CA 4KK4A 3F7NA 1RABA 1XNJA 1XK6A 2QM0A 1A9YA 1PTJA 2V6GA 2VJNA 3ENKA 3H9UA 3NEJA 4JU9A 4KLRA 2FR1A 2BELA 3VR3D 3TQSA 1EWYA 3UIEA 3ZU4A 2W6JD 1QXSA 3R7WB 3S2GA 1ULBA 2A9PA 3N3AC 3D7LA 4DYVA 3IQIX 4YIHA 4TL8A 1GYQA 4FSHA 4QG7A 2XGGA 4EX6A 5DNAA 1M2VA 3E2MA 4DG5A 4PRLA 4RH1A 3Q7RA 4CDGA 3ANYB 3RT1A 1H8ED 1C81A 2YCBA 4FC7A 1C7EA 2ZJZA 5C46F 3LLVA 3DH0A 4XH9B 1SCUA 3K73O 4I55F 3UGQA 3OFND 4TN1A 4B2PA 7YASA 2YNMA 1I80A 2BYTA 1OXUA 4DE5A 1E61A 5BQPA 3ZIAA 3OX2A 1XAHA 3GFGA 3PDWA 3R0JA 3HHEA 1W0CA 2JFVA 2AG5A 1PW7A 2PJZA 3AERA 3MCWA 4ZCQA 4KK3A 4QUEA 3GLIE 4DIDA 1W7AA 3I5UA 4QNMA 1OV4A 4N3NA 2RC5A 4XIGS 4Y1GA 4RMIA 3L0OA 4OKNA 4FYIA 4YRSA 1V6AA 4N3CA 3D4PA 1OLUA 3K0KA 2QTNA 3BZBA 2ALJA 2WIBA 1KYXA 4DLRA 1X2BA 4HT3B 4L95C 2HX1A 5GONF 2A9JA 1CB7A 2J9YB 4IDGA 2JJ1A 2Z8ZA 2XT9A 3T1VA 3TEJA 4C78A 4YRJA 2QROA 2EKBA 3LJKA 3HK2A 2XXJA 4ZCPA 3CRNA 2IGBA 5CA0F 3RSFA 5EERA 1SUPA 1FFAA 4OXXA 5GIOE 3EGXB 1IHUA 2ZBEA 1HT2E 4URZR 3N05A 4M7RA 5IDXA 3V97A 3UV7A 5IAOA 2X5XA 1DOAA 4Z7OB 1EFAA 1T24A 4Q47A 3WNDA 3MUFA 3K0AB 5LM3A 1VIMA 4KRFA 2Q4TA 3OMLA 2BEUA 4RDHA 1C7FA 4RZSA 1JV2B 3AKCA 5JYEA 2WHPA 3DVAB 3JRNA 3PLNA 1FDVA 5BV0A 1H9AA 4PLTA 2GI4A 2IP1A 4OHBA 2HEIA 3SC6A 1Z5NA 4B09A 4GM1A 2VDUE 4FJ0A 5JS2A 2F3RA 2RARA 4C6SA 3K31A 5T57A 3ZGYA 1JEYA 5B30A 2WYVA 1LNSA 2ZJ7A 1Z6ZA 3QVJA 4ZOAA 3HKBB 3VDQA 4DQKA 1BTOA 6YASA 5K4HA 1PL0A 1XMVA 5DHSA 2IT1A 3AV0B 1UC9A 4B1FA 4QYIB 5IBRA 1BWPA 3HDJA 4ZCLA 3UC9A 4M1QA 5JV5A 4JYBA 1B41A 4OU5A 1L7XA 1GTG1 4WL0A 3RVSA 4JJ4A 4NNPA 2FUNB 3AHGA 4ENUA 5BSGA 721PA 5T4FA 1ES9A 3OG9A 2CDCA 1AGYA 1WPQA 3BXPA 3OCWA 3QU7A 1D2AA 2B1RA 2YJ4A 3WHKA 4Y30A 3FJ1A 3WLTA 2PKCA 5DEOA 4JI4B 4GC5A 1Y1QA 1QO0D 4PQEA 3AF5A 1JVSA 3STWA 1E5QA 1NSYA 4JROA 4HNVA 5HSGA 1FRZA 1N6NA 1IVNA 1VGRA 2JPDA 1CY4A 3GFBA 3KR1A 5D1NA 5A6SB 1K6XA 1TQ2A 5DBEX 4EVQA 1H4SA 3R5SA 1GNLA 2I78A 2VFAA 1DKRA 3ZTTA 3DDZX 3IQXA 4E4TA 4X00A 4O29A 3SBOA 2Z5LA 2P79A 3DLAA 3G9ZA 3IP6A 3U31A 3CB4A 3TTTA 3ZQKA 5E9JA 3T3NA 3QEAZ 1WZ2A 1ZXXA 1JMYA 1Q7TA 1U0LA 1FUEA 1R0RE 3NIBA 3OWOA 4J91A 3R9IA 3VV3A 1IBLB 3FDJA 4E2ZA 2X0EA 5BQFA 2GJSA 1FMTA 3I2JA 4ZT4A 3ZHBA 1UCFA 1G5HA 2CB9A 2ZB7A 1QO9A 3MYYA 3KUUA 4TTQA 1CUVA 4LY6A 1FLAA 1TEXA 1LPMA 1SCKA 5I01A 4XWWA 1KMMA 1SB9A 2DFVA 5DV9A 2RGBA 1XCBA 3B1KA 4CLRA 2B35A 5CJPA 5DCYA 2G1AA 7ADHA 2PX2A 4IFIA 1ORDA 1TI7A 1V1RA 4I7EA 4RM3A 2QYHA 1T0BA 2NO4A 1E2BA 3C4VA 3PENA 2FWNA 2O3TA 3PYLA 5JAQA 4DW8A 1GITA 1QV7A 4FYXA 3W7VA 3A4VA 3EVEA 1EE9A 4NMMA 2AE1A 5A02A 1NYRA 3TL2A 2VHYA 3KAKA 2C5BA 4BFLA 4D8TA 4TTSA 5FPQA 3WIBA 3WLRA 3ADPA 5IF9A 3TDKA 3RJ5A 1XX6A 5M5BA 4MQEA 5DPMA 3W3ZB 3SDZA 1XZQA 2PT6A 1XL1A 1A7AA 2ONKA 5DXJA 3BYZA 5DOVA 3SVLA 2A59A 4P92A 3VDRA 2MSEB 3NX4A 1GPWB 5DTEA 5JVDA 4JUIA 2HY7A 3OZXA 4I6GA 1F20A 1COWA 3TM5A 1XZHA 2ZJ2A 4TMKA 1FNMA 4LFCB 3U49A 5KHOC 1KEPA 1R0WA 1LD3A 1AT1A 2DQ4A 2RK3A 1V8PA 3F4BA 3WIOA 2ATVA 5I45A 3U6KA 3DPUA 5J63A 4BNTA 1Q92A 3FYUC 3TL6A 2ZR9A 3IL2A 4L3OA 2W2LA 3A05A 4ME6A 2F00A 2B4KA 2C20A 1EB8A 1ZU4A 2PSDA 3FR8A 2P7HA 4M9QA 4I55B 3TSOA 5AM3A 3RVRA 3MCVA 4BB6A 4F5DA 1Y4UA 5DM4A 5CB4F 2M6RA 1SG6A 2OO5C 4IZIA 5JO0A 1E77A 3K5HA 3E2IA 1RFGE 4TUYF 5AMXA 1VYUA 4KIWA 1NDHA 4MNTA 1N5MA 3ZCRA 5E4JA 5AJZA 1OZAA 1X92A 2P30A 2TS1A 4EY3A 1B8NA 3VVLA 4H4DA 1DINA 1JXMA 4LJ8A 1Q0HA 4HGRA 4E15A 4UXJA 4P1ZA 4TWBA 4ED9A 1KZ9A 3ZIDA 5CDTA 1O9GA 2OORC 4CRWB 2JAPA 4KQJA 3WNVA 3U7GA 2QN9A 4GHWA 1GV1A 3Q12A 2XQKA 4B5LA 2Z56A 2ZJ8A 4M7WA 2WIJA 3IXMA 4PYOA 2CVFA 3VX4A 5KWIA 5BN5B 3OQHA 2NO5A 3B1ZA 4IZOA 1YKSA 4C1NA 4RACA 4BEWA 4DDVA 3IODA 3FN4A 1CPYA 1L4LA 2W7TA 3P9XA 3DZFA 4IDAA 4MV8A 4X1IB 4D43A 5CA0B 3FZEA 1L5GB 1K3FA 3HR7A 2GLTA 3O8QA 5IJXA 2G40A 2PUDA 3O8OA 4B8ZA 1UJ5A 1V43A 4R84A 4WGFA 1SD5A 2IYAA 3QEJA 4NZNA 2Q6KA 5EXPA 3O8BA 3ZKWB 1XTSA 3AETA 2BWJA 4IMRA 4MW9A 2QUJA 3SG0A 4ZV9A 2WMYA 5HR5A 1HMYA 4HKTA 1NXWA 5EZ6B 1Z74A 4JBYA 4D8XA 3GJTA 4KE9A 4PIPA 1LQ2A 3VO9A 1X7ZB 1RP7A 3IDZA 4CFSA 3U1VA 2RE8A 4MYDA 1L4YA 2QAGC 5KC9A 1RWOA 2Z30A 2PMEA 2YY7A 4CDNA 1I4EB 4ZCMA 3MMXA 4CV0A 4MR9A 2XCQA 1N25A 3I2KA 4A8PA 1Q1NA 2Q8NA 4JOBA 3SZ3A 1N9ZA 2SKCA 1GPH1 2NAPA 2CEKA 4LWZA 1V1MB 3SFZA 4Y6PA 2V7QD 3C5HA 4W9NA 2DBZA 3IDOA 3U7RA 2RJ3A 3ORSA 5I48A 4FYHA 2BSQA 1V16B 2N1BA 3KEGA 3WWCA 5GVSA 4B6RA 4PU0A 4OM8A 3GJ6A 5CU7A 3CT4A 1HRKA 2R85A 3EVCA 3D7KA 1PWHA 5F78A 4L5AA 4BQFA 2PH7A 5SYNA 1UPFA 2QU7A 2MYNA 3IAM6 5LZ4A 2EW1A 5A7HA 2JCXA 2W0MA 4ARSA 2IIPA 4HS4A 5LIRA 4BBJA 1I10A 3MRVA 4RV9A 3SC4A 4V0MA 4GX5A 1M83A 2BISA 3MIIA 1EVYA 4PHFA 1XCPA 1WUKS 5AI8A 1UOQA 3OBIA 4N8EA 3S8MA 1JH9A 1B8VA 2FVXA 1F6WA 2IPXA 2RH8A 2X5OA 4FLMA 2B1GA 4IM7A 3FDXA 4XGQA 3SPXA 1QNLA 3NTQA 3PFBA 4MW0A 4DJ5X 1NHGA 2Q9CA 1U3WA 1XZIA 1TXGA 2P2SA 1I32A 1EM8B 2W70A 4BX9A 4HWTA 4IL5A 5P21A 3OO1A 1C9YA 5FOSA 5DM0A 1BEZA 1NW9B 4RJIA 4KYIB 2AL7A 3NFRA 4W9MC 3KR2A 3P0RA 3ZZ0A 2IU3A 5JI3E 3QBVA 3ZW7A 8ATCA 4NZPA 5JHGB 1RXWA 3IP5A 2ZDHA 3PDUA 3B2EA 4JB2A 4DJTA 3Q41A 3V8QA 4ZI7A 5F2KA 2GOYA 4J94A 3R44A 1RIFA 3FPSA 2OECA 2I6FA 3AJEA 3IAUA 3B3GA 2UYOA 3EMBA 3IILA 2H2FA 1UODA 3VR2A 4CF3A 2WG2A 1G7RA 1TVKA 3KHTA 3B9PA 3HFRA 3P8ZA 3F46A 3QZUA 1GG8A 3JYLA 4J6EA 3WRVA 4S2UA 1PUXA 3IUPA 4WXRA 3FB4A 1CBUA 2ZE5A 2HU7A 1XLWA 2EZ4A 4RGQA 5G1OA 4TM7A 4DUGA 4LDQA 1NURA 1U2ZA 5IS2A 1IQ0A 2TMYA 1M34B 3O8NA 4FXOA 4A23A 2QD2A 1ACLA 2I34A 3CXUA 3NGLA 2E4XA 1WXGA 3LDUA 4TVSA 4PLPA 4CMBA 4ABTA 3LO5A 4B3IA 3CYFA 4H60A 2PA3A 1KDTA 4NHOA 5SZJA 1TA9A 2FCAA 1NUPA 3L8MA 4ITUA 4ZU1X 1NUHA 1XDGA 3UN1A 3W34A 2P4UA 1T34A 3VHXB 1AGRA 1M1YA 1Y1PA 1YS9A 2EJCA 3NAZA 4TXHA 1PF7E 4CM8A 4JUDX 3NCTA 2FWPA 1RD4A 1TK3A 2FUG1 3NDJA 2A6PA 3BWYA 1TCVA 2W4MA 3OKAA 1Y8QA 4HFRA 4PLZA 5B3AA 1GVNB 1L7AA 4QG3A 3KKPA 1EFRD 4N5IX 4Z2AA 1NUQA 4G4SP 1DDGA 1ZBQA 2G06A 3DYBA 2BJVA 1CF2O 4KU4A 4XWKA 5AVUA 1IZ0A 3KYJB 5LQAA 3OAAA 2FSHA 3B1WA 2EEZA 2ZWVA 5CBKA 5IAGA 4TUYB 1R5OA 4TSRA 5LIPA 4ZANA 1XTJA 1VCMA 2CE7A 2GAFA 1XMSA 3W6ZA 4IJQA 3WLLA 5EYPA 1ZP6A 2OOSA 1Y48E 2C2BA 4BX8A 3W6OA 3ER8A 2YV5A 3RRNA 3WRWA 1ZNQO 3W8EA 1I1HA 3DMHA 1NM5C 5FTNA 3VDXA 1KOGA 1JPNA 4M88A 1C29B 4LXHA 1KEVA 4BVAA 1OIXA 1CFZA 1FOEB 2Y77A 1G4UR 4R2KA 4YUAA 5CXXA 2O3QA 3B51X 4TMTA 1XTKA 3E22A 4GMFA 4GOJA 4EVRA 1SU4A 5DYWA 3BD7A 5JIBA 1VOTA 2D1YA 3EDRA 1YFJA 2V7VA 4KZPA 4D8UA 4I36A 4EMUA 4WA8A 1GR1A 1DKMA 1Z0SA 2WD8A 3AF0A 4FFNA 1EA5A 5CK5A 3UXYA 3K8YA 3BWBA 4AX8A 5AR1A 2GVNA 3GFOA 3MERA 2Z95A 2FFAA 4PNZA 3TQFA 3HBNA 3ZCSA 3QRWA 3P4UA 5JE8A 4FE7A 1UUFA 1UPBA 2CD7A 3ZDRA 1XRQA 5EINA 4I9UA 1P7ZA 3E4DA 2I66A 1JKIA 5B4TA 3D2BA 3KOYA 2ZCJA 2FI1A 4EPTA 2VYQA 4QBHA 4MZDA 1HZZA 4MQ5A 4WCDA 3V9AA 3QM1A 1WB5A 3ANLA 3EULA 2VDLB 3AVQA 3ANSA 4XJVA 3BKXA 1CP3A 5DRTA 3EF0A 5DN9A 4IO0A 4RTQA 5A2QA 2QL6A 2ECKA 3O5AA 3SR4A 1ITZA 1O6GA 3MOIA 1EUDA 1CULC 1ONOA 2C3UA 1A4UA 2XAAA 4AJ2A 3B70A 2XQGA 3BMCA 1FP2A 3FWZA 3N28A 1Z33A 1RVV1 2SNIE 2X1MA 4XQ9A 2Q28A 1EXNA 3M9XA 4WFQA 2VSNA 1YS6A 2DPMA 3IOYA 1T1SA 4BC1A 1W4CA 4Y9DA 3WMWA 5KNLA 3UHAA 3CKYA 4KKXB 2GZSA 3ZGOA 3K35A 1JQ5A 3HBLA 1IPHA 3AF2A 3L40A 4JODA 2AC4A 3WK5A 5AUOB 3NHYA 4Y0NA 3GF4A 1CUIA 5DSXA 2HMUA 4V2UA 1FYDA 3RSGA 5B1DA 1EE2A 1V25A 4R0VA 5CDFE 2DCUA 3AVPA 3REQB 4WOJA 3OPNA 5I3CA 5KYXB 2W9XA 4QTUB 3GD5A 1XEFA 1X1QA 1S8OA 4IHKA 4NECA 4WBNB 1ADFA 3B6KA 2IUYA 2VQSA 3AUUA 1HNWB 4BRWA 4J3FA 3RS7A 2NX2A 4JUFA 1KYTA 3PJEA 4HLDA 3ERCA 2G5TA 4QEZA 3G0DA 3AYZB 2PGAA 2P3SA 3VOSA 1FQJA 2AOTA 4LJ6A 1CQWA 4G0ZA 2WWIA 3X1MA 4DIMA 2ZW9A 4Y1RA 3OETA 3RYHA 4GKKB 1H2XA 1A2OA 2P0YA 4V0KA 3ZWVA 2OWDA 4JYMA 2NO9A 4TZ0A 3ESAA 1CE8A 2CHQA 4MJ3A 4S12A 3TZHA 4CR8A 2BMFA 1OREA 4XARA 2WAXA 2YHSA 2ZGVA 3DMDA 3B85A 2WPDA 3DOHA 1O95A 1QCDA 3D3QA 5CH8A 4A92A 1NR5A 3KXKA 3QX8A 4KXVA 4ZP1A 2DLNA 2HSEA 4A8JB 2ZJAA 1VBFA 3G82C 1JP7A 2DSTA 4L8YA 1SZDA 2GF2A 2RG7A 1PQPA 3E9YA 1V4BA 4HDMB 3IIJA 4HMQA 1QRAA 4XUGB 1JIIA 4GI7A 4HRYA 2M1ZA 1KDPA 1QR2A 5IDVA 3D8SA 2REQB 5F5NA 3TRJA 1G3MA 1SM4A 1WSBA 1ZL0A 4JK3A 3HO6A 1BXZA 4KDFA 4M1EA 4UUQA 2AA3A 2YRFA 5DX8A 2C7OA 2A5JA 3DE2X 3FNIA 4ZXPA 1FLDA 5C8YA 4QECA 3BJIC 4DC1A 2AK2A 1P5JA 3O7MA 5IN5A 1RPJA 1P6UA 2R5WA 1MX1A 2VPPA 1XTBA 5KMGB 1GKLA 4M76B 1RNLA 2R6FA 3ZHRA 5ARCA 1PZXA 4GXQA 4QYSA 2E37A 3RI3A 2JGDA 4K2AA 1U4OA 4L4YA 2J7PD 3GUZA 4LOLA 3RHZA 4A0FA 4B34A 2JLZA 4G36A 4BFSA 2OEPA 3DE3X 4W8HA 1CUSA 1Y4DE 4C7VA 2OG1A 3MJSA 1P9RA 1I24A 5CT4A 4KQEA 2R79A 4PG6A 5FR1A 1WMSA 2IYQA 5FLEX 4YWJA 1T3GA 2OILA 2W8ZA 3RROA 1OFGA 3P7MA 4NR0A 4QOIA 4AYTA 3EWAA 5HM8A 4R9RA 3UWOA 1QFZA 3LXMA 3OUZA 4OHRA 5EIBC 4BVBA 1MD9A 3RRFA 1G6Q1 1GGMA 1NVVQ 1GGVA 2GCIA 1PYOA 2R68A 4FYVA 1T10A 3WKCA 1H4VB 2Q99A 4KREA 1SCNE 5J2UF 3JAWA 3BJEA 1JLMA 1N2XA 4Q19A 4EECA 2V4UA 2P4QA 2E1PA 1AN0A 2NYAA 2C2XA 2F3UA 2I22A 5F5LA 4URXR 2C7QA 3W0LB 2AR9A 2XYQA 5DYGA 2QVGA 1K5DA 1ID8A 1V8OA 2QRGA 5DOZA 3H6HA 3WDSA 1X7HA 2JB9A 3RIYA 5IXJA 4BGIA 4KFUA 2XYGA 3NBAA 2VUSA 4KPGA 4FB5A 2ZOSA 1ZD1A 3QVSA 4GEKA 3HJBA 4I9NA 3BRQA 4PFKA 2F8MA 4KO8A 3VX3A 1MHTA 2VNHA 1MXFA 2Q62A 4G65A 4DPLA 3R6GA 1P4GA 2ZYVX 4G8JA 4NU6A 3AHDA 3WZ2A 2RHDA 5HIJA 3RJMA 1LW7A 4OV6B 4WCFA 3QJGA 2Y27A 4YB8A 5D3MA 2XB6A 3QMWA 2EWVA 2HREA 1NSTA 3BH7A 4OYLA 3CNQS 3KD2A 5E0OA 1ZM3A 3GJ7A 1A5ZA 1KR2A 1ZI6A 3DE0X 3G3EA 3D4NA 3GJ8A 4I08A 1EFLA 2BRUC 3PQ3A 1U7TA 2YWJA 3MW8A 4Y2SA 4C4PA 1NVVR 1V9CA 2HHJA 2FUEA 1JHQA 2GTPA 4BDTA 1Z5VA 3AEQA 1KYVA 1OJLA 4ESOA 1N9GA 3E5MA 4Q3CA 1QVVA 4ZODA 2D06A 2XLCA 3T3PB 1ZJZA 4TLAA 4RFVA 1DI0A 1NXPA 1TFRA 3AV3A 3IGFA 3T9EA 3AVOA 4FFBA 5CA1F 4D3DA 3N74A 2ZJOA 3O4GA 3QNWA 4R2MA 1X74A 3ZV7A 4ZKEA 5T41A 3UT5A 3TLBA 5LMUB 4WNAA 5TJ9A 2F55A 1NOKA 1D8AA 2GHTA 4FQ5A 1FFXB 4FHFA 2RH4A 3QXHA 1Z45A 3RJTA 3IAAA 1G63A 5HHTA 2TMKA 1ODIA 4HDRA 3SDSA 1VJDA 2NZVG 2QTMA 3KXIA 3LRPA 3EG9A 5KSYA 3GCXA 4NFYA 3MELA 1SXJB 2O06A 5DN6D 3K1AB 1YVUA 5C8VA 2XYPA 1Z2AA 3QLEA 5CFOA 1N5RA 1RAGA 3OZUA 1OD6A 4C4AA 4EKNB 1Y5MA 1OFVA 1Y6FA 5CNKA 2BE7A 3VVCA 4LEIA 1UBSB 4NE7A 3LQQA 3SZLA 3WNCA 3X1WA 4BNYA 4QLBA 3NAQA 7REQB 2X8JA 4IAOA 5FNVF 5B1EA 1V41E 4PSKA 2Z3VA 2FR8C 1WY5A 4P22A 1JQKA 4IUBS 3CIFA 4B4DA 5DHFA 1DRJA 3EQ7A 3HFJA 3K92A 3HDTA 5I8ZA 4X7PA 2OGSA 4Q39A 5LQRA 1GU7A 1H2ZA 4D9CA 3H2YA 3JD3A 4LK3A 3RAEC 4UVDA 2YXLA 4KVZA 1Z6PA 4YJ3A 3N6RA 4BASA 1VE9A 3FNBA 1P2FA 2G1PA 3RYFA 3V46A 2AUMA 2OB2A 5DT2A 4FFWA 4DJFC 4KACA 2X2OA 2Y9PB 1ECJA 1FFEA 1LTHR 2QX9A 4RSHA 5CT6A 5F35A 4D79A 1TAQA 3NWPA 1IXZA 3KAQA 2GD2A 2PZGA 2ZBFA 1GNQA 2RGWA 3WJ1A 4Y7DA 2GEFA 5B3LA 3TKYA 2GVDC 3GUCA 3HQ4O 2QQFA 1AC5A 3E58A 3HL4A 1CVRA 2ZATA 1VPDA 3QW4B 4GMHA 4YPOA 4FMPA 3I62A 2ZWMA 3JQAB 3AT1A 4MW2A 2ECQA 4F7DA 5ITSA 2CHUA 2YC4C 2ZKIA 1DPFA 2ZIVB 4L2IA 5AI9A 2VRBA 2CLLB 4B7CA 3IUBA 1QLJA 2I4TA 3SJ7A 1AS0A 16PKA 2ECPA 1APBA 4IQGA 1FTSA 3EW9A 1KQ3A 1MAWA 1VJ0A 1SC1A 4REQB 4XM0A 1NRIA 3BMNB 5FRDA 3I37X 1CWUA 3TMAA 3REFA 3VJMA 2XE4A 3DZJA 4M1YA 2AEMA 1C1XB 2ZUCA 3CONA 4JI6B 1N2SA 1P73A 4K5QA 3UJNA 2FZEA 3AL2A 2ON6A 3JQ8B 4JR0A 4XLTA 1LRLA 1K98A 2P9QA 4L3WA 4BBAA 2O2CA 4K3UA 4JXXA 2WUDA 4XX0B 4KUHA 5KNDD 5FUYA 3VM6A 4AN1A 1U8TA 1T9CA 3Q5EA 5A3QA 1K7CA 4KTTE 1E4EA 3RTAA 3B48A 4UCQA 1H0KA 1UFKA 2FMHA 2Y6VA 3DUWA 3F2IA 3F67A 4R05A 4RJKA 5J2UB 4KHPB 1WBJB 2GXSA 3ICOA 5JRZA 1YR2A 1I6LA 2OZLB 1XU7A 2O1WA 1CUGA 2P9YA 5JCJA 1E2EA 2ZBQA 2ZRFA 4XQCA 1G7TA 3HB7A 1AZWA 1SUSA 5AXBA 1PG5A 1TM1E 4DSTA 3KHSA 3V6LA 5JCPA 1MAUA 3LX4A 3U3DA 1HDEA 1Y98A 1Y3BE 4CI9A 4D9NA 2JHCA 3WK8A 1PJSA 4E1AA 1UDXA 4KEAA 4LHXA 2VPYA 5AFSA 1E9FA 5ALTA 4JD5A 5JRJA 2QRVB 1TRKA 1VKNA 4EUKA 5TQJA 3E9EA 2NVBA 4PTLA 5SY6A 3WOVA 2H92A 4BQQA 2D4AA 3LSTA 1KEWA 3CJRA 2EKQA 3IJRA 1EFPA 4UU8A 5AW5A 2I33A 4L51A 1YDGA 1V9SA 1UPXA 3BF7A 3MN1A 3OF2A 1QX3A 2BKEA 1YFKA 3TLGA 2CB0A 3TM4A 4EYGA 5DYTA 1XLTC 2BUAA 1KDYA 5JSQA 3LG2A 4O3FA 3NWBA 4RK4A 2V7EA 4WBSA 3S5UA 1F14A 4YLYA 5AQ1A 1MO2A 5FQNA 4ZAVA 3TNYA 3VC2A 4ZYZA 3QF4A 5JCXA 4Q82A 2YHAA 3PE3A 4US0R 1C1HA 5I4BA 1PWYE 1W5TA 3A6HA 3TR5A 1N1DA 1T3HA 3TCXB 2REXB 5G0VA 3P9QA 2BF7A 3CZAA 3IBTA 3LUBA 3MWYW 3ANMA 2CXSA 1J2JA 1OYWA 2RI1A 4AZ3A 4DQVA 3R40A 4MWTA 2D5AA 2M6SA 3IRVA 4LRXA 3I3OA 3OQIB 1FPQA 1WUYA 4WINA 4DG9A 2CYCA 2J9XB 4NU5A 3EH2A 1DAOA 1DZ3A 3LYLA 4ND8A 5L95A 4OLHA 1GYPA 3V34A 2PKQO 2X9NA 1U2EA 4ZCSA 1N92A 4KXLA 2XNSA 4CM1A 2WU8A 2BBOA 1OW3B 1QIIA 2C3OA 3P9NA 4TSFD 4IUYA 3SHTA 3QKSB 1RKXA 4TKVB 1QZXA 5BV8A 5M34A 2W48A 5E2IA 4E5UA 3QWIA 4JH0A 2DWPA 3KB8A 4IINA 3ZE8A 3YASA 4NEGA 4DSNA 3GIDA 5KHAA 5C3MA 3PWKA 2R6AA 3C7CB 1AF4A 3DFIA 2O8BA 3GJ5A 4PCUA 5EIBD 1BEEA 1WXWA 3T5MA 4HX2A 3G5UA 1DC4A 4X3PA 1YUMA 1E3LA 1K66A 2H85A 3OHPA 4Q3LA 3HYTA 5F77A 4CWAA 5FNVB 3QELB 4HQ0A 5BUSA 2WR8A 1SVMA 1VGVA 2AEJA 4M60A 4HN2A 2ZTLA 3RK0A 4MRNA 2QI9F 9LDBA 3G2KA 4KN5A 3TW4A 1E1QD 5IT4A 2V03A 2ZT6A 4NNOA 4KODA 4LE1A 5CXUA 2YFHA 2XKAA 5KJCA 2PBFA 2JFWA 4YAEA 3T7IA 1U1GA 2Q41A 3M1LA 3X2FA 4DBVO 3AKZA 3A3PA 1LTQA 2CDNA 1S9DA 1J5PA 1GCAA 2Y1GA 4M54A 3LQKA 1O4VA 3CX3A 2LVBA 2W2QA 3IPXA 4MV7A 4OJMX 3NM5A 2KJQA 2XRYA 2G9RA 2AH5A 1CB0A 2BTQA 3SJAA 3F3KA 5L4NA 4XTRA 5BOSB 1BS1A 2GZRA 2G8NA 1VJTA 2HDNB 3GMIA 4II3A 1DBQA 1MDBA 4XASA 4E3WA 3GLFB 1R0KA 4DMRA 2TSYB 1HDRA 1Z82A 3D0OA 1FS4A 3NHAA 4NBKA 1JSRA 2HRCA 1L9XA 4TWZA 4P33A 1U3UA 2HV8A 1ACJA 5BNZA 1ZZEA 2JAOA 4PQRA 5C80A 1LDEA 4G4IA 3U7IA 2OO3A 5JADA 5CB6A 2JZCA 2BEWA 3RVNA 1H42A 3ESZA 4AX4A 4NYMQ 2LDBA 1TQ6A 4D92A 2SICE 3B5EA 4EGCB 4V0NA 3ZWXA 2VDKB 3P2JA 3NHBA 4UM9B 1OZFA 3R7NA 1RDFA 5CX1A 3BFKA 1R12A 1XD8A 2XZTA 3BRWA 3IP8A 1MKYA 4OQFA 5K3FA 4G41A 3L0ZA 3AY7A 5CB0A 1CJMA 1FX0A 2PUTA 3TXXA 1T8WA 1V48A 3WWOA 1PD1A 4LN1A 3PR3A 4TVKA 4C0BA 4HI0E 4P4SA 2DUUA 9ABPA 5JNLA 1I36A 1KKLA 4EEKA 4E6PA 4KVGA 3WWEA 3ITEA 1VLHA 1DJMA 2OHIA 1UQUA 1LLCA 3URMA 2HN9A 4HRAA 4MVJP 2P1RA 3EEQA 1JH8A 2PYIA 1U2TA 1S3GA 2E87A 2IOFK 4OP2A 1PZHA 5DHQA 1SA0B 3ZXXA 2ZTMA 3QPBA 2PS1A 1V3VA 3RC2A 3MCUA 1IL0A 4ISCA 3H2IA 3WSTA 2WAYA 2P27A 2P65A 3CJTA 4FJ1A 3SQNA 4AFNA 4ZZ2A 5HZGA 1B6GA 1WDLA 3NHMA 3H2ZA 1IMOA 3AG5A 4GBMA 4UEJA 2C5EA 2ZTHA 4FYJA 3VTKA 4CG1A 4NMLA 3U9SA 1T1JA 3T7TA 5A3JA 3DMGA 2GK3A 5GV7A 5B64A 2XOXA 4TRMA 1N57A 2QAIA 2CKMA 1QV9A 2HH9A 4UBMA 5BSKA 4IIHA 1OX6A 4AY3A 5BWLA 2G83A 5ERXA 5TQ0A 2BW0A 3W9BA 3WGMA 2EJTA 3QVOA 4RA6A 4TMZA 2BJWA 3HR4A 5AW9A 3PJFA 2N47A 1LC0A 1VG8A 4JB8A 3BFXA 4ZOLF 2ZYWX 3IEUA 3RUPA 2OG2A 2FMKA 1OXKB 2C1ZA 2QM3A 3Q3EA 4UTXA 3ZS8A 3FFTA 2B8TA 4J0GA 2CDAA 3VNSA 5DO9A 2RHMA 4PCLA 1IE3A 1P1BA 3CX6A 1M7GA 1QHYA 4Y67A 3ZWDA 5LOVF 2O50A 5CYPA 2Q2OA 3FNGA 1G64A 4JBWA 4PBSA 1NONA 5ESXA 5F1KA 4U4AA 3LLSA 3FWNA 5AW8A 1GOTA 2FMFA 3CLSD 4P7JA 1MX3A 2DKNA 2VNIA 1RS0A 3EFHA 2V7TA 4XR4A 3RPEA 1R6VA 5A5EA 1USVA 1KS9A 3DC2A 3GJXC 1SUBA 4RY8A 4F9TA 2PTGA 4YMGA 1L3BA 4HNHA 4OP3A 1NUUA 4QYMA 5HW0A 2PUEA 4ARAA 3E15A 2NTEA 1MOSA 1IM8A 3W5VA 4D99A 1M8GA 3A4YA 3T3HA 1NBME 1GPAA 3CNEA 2OKCA 4H7DA 4O1HA 2QPLA 5ED4A 2AZXA 1JJIA 1U9IC 3I6MA 5I5EA 4FGWA 3VR3A 3CW9A 4GP9A 2YKGA 2SKEA 5LZ2A 1TUBB 1GJRA 2W6JA 5GGYA 3T5TA 5B3KA 4D6XA 1ZA1A 2FE4A 4YMWA 4NBNA 1E5TA 3GA0A 3VKWA 5JC1A 1NATA 1Z4NA 2P2CA 3MRTA 1W2GA 3ESQA 3CPJB 3K0FA 3Q5GA 4ZRDA 4Q9HA 3SYLA 5EG5A 3P32A 3BCSA 2YWFA 4DA9A 4PPQA 3T06B 1H8EA 3FM9A 5L6MB 2OCXA 3U5TA 3WYBA 1EH5A 1JTEA 3O92A 3KLNA 1ATIA 4ALNA 1EP9A 3OFNA 2XHEA 3K0BA 2FZVA 2I1LA 2Q0QA 4HWRA 3OZ7A 3NJRA 1OPRA 4WUVA 1HMPA 5SZHB 3L6CA 1PG2A 2LGJA 3T5DA 2VYCA 4RU1A 1WETA 2ST1A 4DEYA 2HPAA 4XLZA 3GH1A 3DE7X 3QPVA 4PYQA 4BLPA 5ELLA 2QL7A 2GR9A 2Z58A 4MZXA 4PF1A 5HKKD 4AY5A 4OPMA 4DV4B 3F8TA 2AMJA 4PZZA 1KMHB 1G9TA 1TQ4A 3CUKA 3NAGA 3P0IA 4LZAA 4OGFA 5LN1A 4Q4JB 2ZQ5A 4I1IA 4DCUA 4YPVA 4JX8A 4X24A 3GFRA 2VS1A 4CM3A 2RI0A 1DBSA 3GY0A 3N76A 4MB6A 1QVRA 3DBVO 3KO8A 3U3OA 1K8XB 2A7QA 4NICA 1GR0A 5BN4B 3A9WA 3LPAA 3FVRA 4Y9UA 4I50A 2KYRA 3A9SA 2IELA 4H6WA 4KLCA 5AVSA 4BLWA 5HX7A 3ZHZA 3K1TA 3B1XA 2F1KA 5J1SB 3DHEA 3AHEA 2IXEA 2WF7A 3TUZC 4C7KA 3R74A 3T5CA 1WS6A 3AUXA 3I53A 4TL7A 2HL6A 1E6LA 3QKRB 3WLSA 1DAGA 4Q3NA 3QOWA 1UH5A 1FYXA 2BI7A 4BVHA 3RHTA 3N2YA 4IRUB 1K97A 1E2MA 1NMYA 2CFSA 2PMCA 5CIWA <