2WM8A

Crystal structure of human magnesium-dependent phosphatase 1 of the haloacid dehalogenase superfamily (mgc5987)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GTENLYFQSMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Magnesium-Dependent Phosphatase 1 of the Haloacid Dehalogenase Superfamily (Mgc5987)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords MAGNESIUM-DEPENDENT PHOSPHATASE 1
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12689 Acid_PPase Acid Phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wm8A00
4NFLA 1U7OA 3L8GA 1Y8AA 2O9JA 4NV0A 1VFPA 4JDPA 1Z4IA 2PQ0A 5ALMA 2IOFA 2PKEA 3QUTA 4ZEWA 1Z4QA 1RMQA 4L57A 5AW4A 1WVIA 1S8OA 2R8ZA 5ALKA 3UMGA 2P9JA 2JAWA 5ALWA 1YDFA 1Z4MA 4ZEXA 5AVWA 3DAOA 4BX2A 2R8EA 2B8EA 5ALZA 2G06A 3WKCA 5A3QA 4H1WA 2GHQA 2RAVA 4RESA 2AMYA 5AK4A 1ZJJA 3AR9A 1RC8A 3MPOA 5FP0A 3SMVA 3IRUA 3QU4A 1SWWA 4L6AA 5AKJA 4YCNA 1RQLA 4DWOA 1LVHA 1EK2A 4XQ0A 3B8EA 3N5KA 3OCVA 4UU1A 3L1UA 5AM1A 2NYVA 1Z4KA 2W4MA 3MMZA 4YH1A 4UASA 1RKVA 3B9RA 3ZW7A 5AKGA 2HI0A 4GXTA 4JB3A 1L7MA 3QX7A 1WR8A 4C4RA 5AIAA 2ZBGA 3N28A 3TLMA 3WGUA 4F71A 2FPXA 2ZXEA 2ZOSA 5AM2A 2OYCA 1Q92A 1ZD2P 5AESA 3QU2A 3ZTYA 1XPJA 4UATA 2JGAA 2WF9A 4Y2PA 2X4DA 4HYTA 4FYPA 5A3RA 5ALHA 3B9BA 5E0OA 3N07A 4OHFA 3QYPA 2W43A 3NALA 1Z88A 3WKBA 4UAUA 5IT0A 5AM4A 4C4TA 5AI5A 3WK6A 4OFZA 4Y2TA 2CFTA 5AHXA 5AI4A 3DNPA 3ESRA 3NAMA 2Q5EA 2BDEA 3L0YA 2IOFK 3NASA 4EEKA 1RKUA 2G07A 4UM5A 2I7DA 3AR8A 3WK5A 4C4SA 1RRCA 3WK7A 3FVVA 1T9ZA 3KD3A 5ALXA 3I76A 2YJ5A 1NRWA 5AKYA 1MH9A 3BA6A 2ODAA 3MN1A 3OTQA 4HGOA 3ED5A 2G09A 2QYHA 3ESQA 4O8CA 1TA0A 2G80A 3KC2A 4EELA 1RKQA 3NRJA 4EX7A 3OCYA 4KYTA 3GYGA 2OA0A 2P11A 5AW0A 4OD0A 4UM7A 3OCZA 4KNVA 2B8JA 3N8GA 5ALEA 2C9MA 4G63A 4G9BA 3PDWA 2R8XA 3ZU6A 3U7FB 3K1ZA 3U26A 3WK4A 1SU4A 2EATA 5AKHA 5AKKA 3MC1A 2YMPA 1RMYA 3AR7A 1O03A 3FPBA 4Y2UA 3WKAA 2YJ4A 3EWIA 3W5AA 1RLOA 5ALGA 4Y2JA 5AM3A 2GMWA 1WZCA 1ZD4A 3NUQA 4QQFA 3M9LA 2HDOA 3ZI4A 4BNDB 3W5CA 4HGPA 1T5SA 4YGYA 1S2OA 3QU5A 1QQ7A 2HO4A 1L7OA 2G0AA 5AK6A 3SF0A 2R8YA 5ALDA 3UMBA 5ALVA 4OCZA 5ALNA 5ALUA 2P27A 2W11A 3KOOA 2IOHA 2FUEA 2WHEA 1CR6A 4HGQA 3WK8A 4CE6A 1Z4PX 1U02A 4Y2RA 1U2SA 3AR6A 5AI8A 3OCWA 2JARA 4J03A 5AM5A 2O2XA 1J8DA 2I34A 2HEGA 4HAIA 4BKMA 1NNLA 3QUBA 1K1EA 4XOUA 1WPGA 4ZEVA 4YIHA 1RPZA 5AI6A 1Z4NA 3AR4A 1YV9A 3F9RA 2C4NA 1F5SA 3AR3A 3WKEA 1YNSA 1ZD5A 2NO4A 5AKIA 2I54A 4F72A 3NANA 2HX1A 5AKLA 3BWVA 3ZWDA 5ALJA 3EPRA 1TJ3A 2ZBFA 1YS9A 2HSZA 3QNMA 3KDPA 2IA5A 2NO5A 3WKDA 5AVZA 3IJ5A 3E58A 3FGOA 1YJ5A 2D2VA 2AGVA 3FZQA 4KX3A 2EARA 4BEVA 3ZVNA 1VJRA 3NIWA 1YMQA 4NWIA 2ZBDA 2ZG6A 4RETA 1IWOA 2OM6A 4BBJA 4AS3A 3R9KA 1Z4LA 3A1DA 3DDHA 2MSNA 3L7YA 3E81A 2HF2A 4XE5A 2FPSA 1N8NA 4UMFA 3UMCA 4UMVA 3L0BA 4BYGA 1Q91A 1L6RA 4HGNA 3ZWKA 3VAYA 3FM9A 1Z4JA 5AVSA 1RMTA 3L8HA 2IYEA 2ZBEA 3SLRA 4NABA 4NAVA 3A1CA 4MWOA 2FPUA 3SD7A 5AW7A 5ALQA 3ZX4A 4DCCA 3ET4A 4KX5A 3OCUA 1LTQA 5AK3A 1XVIA 1TE2A 5AVTA 2QLTA 4HGRA 2HF7A 3I1YA 5AVUA 2FDRA 1ZD3A 3SHQA 2I33A 3CZ4A 4E88A 5AIBA 3PGLA 4BX3A 1PW5A 5AVVA 3ONNA 1ZS9A 3ZUPA 5ALFA 5AW9A 2C8LA 4Y2SA 1U7PA 3W5DA 3U7HB 1XP5A 5AKXA 3UM9A 4QJBA 4FE3A 2B0CA 2C8KA 4UMDA 3HLTA 5AW8A 1JUDA 2RARA 3QLEA 3L0CA 4I9FA 4CF3A 2PR7A 4YIKA 3ET5A 2B1QA 5AKEA 1FEZA 2AH5A 1RLTA 4IFTA 3P96A 3ZTWA 2YY6A 1L7PA 1QQ6A 4UMEA 3L8FA 3FPSA 1QQ5A 3A1EA 3N1UA 4BX0A 1Z5UA 4B6JA 2OBBA 1TJ5A 4EZEA 2CN1A 2B82A 2B1RA 5ALSA 2Q4TA 5AW3A 4I9GA 3S6JA 1SWVA 4MUMA 1T5TA 2JAUA 3HYCA 1VJ5A 4BNDA 4EX6A 4UAVA 4AP9A 1RLMA 2VKQA 3L5KA 1L8LA 4UU0A 1KYTA 4J2TA 1RQNA 4CF5A 2FI1A 5IT4A 3U7EB 3I28A 2C88A 3U19A 2WF5A 3PCTA 2FPRA 4EENA 1Z5GA 3L1VA 4XPZA 5AKZA 5ALYA 5AW1A 5AI9A 4L6CA 4DW8A 3U13A 2YN4A 5AVYA 2I6XA 1ZRMA 2Q4RA 2B30A 3E8MA 3WGVA 3M1YA 2JAOA 3CNHA 1L7NA 1QYIA 5AK5A 4AS2A 1L8OA 5JJBA 2CFSA 3WK9A 5AW5A 2WF7A 5ALPA 5AW2A 3QXGA 2AUTA 3A3YA 5ALRA 3L8EA 5AVXA 3U7GA 3R09A 3AR5A 2BY4A 4FFDA 2DQSA 5AVRA 4CNQA 3D6JA 2HHLA 5AVQA 1X42A 2WF8A 2YMLA 4Y2VA 1QH9A 3KZXA 2EAUA 4UW9A 1TJ4A 2I55A 3I6BA 2G08A 2RB5A 4GIBA 4DFDA 5ALLA 5T41A 2GHTA 3QUCA 1EK1A 2YMQA 2WM8A 3QUQA 3EF0A 5ALIA 3OPXA 3PGVA 3OCXA 4KN8A 4KNWA 5AM0A 1CQZA 3KBBA 2P69A 3QU7A 5AI0A 2HCFA 2YBDA 4YCMA 4Y2YA 3QU9A 5AICA 1N9KA 2FEAA 2YJ3A 4PNHA 4Y2QA 3SKXA 1U2TA 3RFUA 3ZX5A 2YFYA 2MU1A 3ZVMA 2YMMA 2G1AA 5A3SA 1AQ6A 2GO7A 5AW6A 4UARA 1Z4OA 3R4CA 3W5BA 1O08A 3IB6A 1ZRNA 1J97A 2HOQA 1RDFA 4CF4A 4IG4A 1NF2A 3ZVLA 2GFHA 3QGMA 2FPWA 3E84A 3RF6A 4YCLA 2WF6A 1ZOLA 2CFRA 3EF1A 2YJ6A 2BDUA 3J7TA 5ALOA 2WFAA 4Y3UA 4Y2XA 5ALTA 4BEWA 3DV9A 5IS2A 2FUCA 3SKYA 2RBKA 3AR2A
chains in the Genus database with same CATH superfamily
3CR7A 4NFLA 4R9RA 1XX6A 4PBRA 3IBSA 3K5IA 1LQ2A 2W0SA 4I9NA 3OM9A 1XHLA 4V1CA 2NAFA 5H02A 4UHJA 3WBKA 1IVYA 4BE7B 3OT1B 1ZWLA 2PFSA 3FKJA 1YRHA 5E0KB 4LJ5A 2AG5A 3FOZA 2W2MA 3OEED 2VHJA 1P7VA 1EVLA 2VDJA 1L5GB 5KOIA 1NURA 2GF0A 1Z4MA 5ESDA 2XW6A 2XF8A 3RODA 3UF0A 3UUFA 4BGDA 1JU4A 5AVWA 4PG5A 5I7UA 4OQLA 3Q9UA 1DG3A 2R8EA 1OH6A 13PKA 2O5RA 4EJ0A 3S55A 1DJMA 2B9EA 3DTVA 2GHQA 3FXAA 3ZCPA 4NCIA 2JEOA 1GZ4A 1ZJJA 2IZ0A 5KX5A 3TRKA 2Q5IA 3ZHQA 2PEZA 1TFUA 3IRUA 1ZRHA 1SWWA 5AFSA 4U2EA 1O4WA 3VJLA 3DP7A 3HSKA 3OTOB 2QTGA 1P62B 4OHKA 2HV8A 4URFA 1UJ4A 1YE5A 3MTEA 1FDUA 2P6NA 3CTPA 4CXMA 1AKMA 2C3UA 2IEYA 1JB1A 3OWOA 4E7PA 3R76A 2ZJ8A 3I5YA 1XYVA 3Q3JB 3HHPA 1FNSA 1M8KA 5CDHA 3BK1A 2CMHA 2IYOA 1AXGA 2IXBA 2QQGA 3F9CA 4FYHA 3DVLA 3A3PA 5JNTA 1T36A 1CUXA 3IQFA 4CLEA 1LD3A 4MW2A 2P6PA 3CF6R 1KEEB 2AJ8A 4ZWNA 5I9BA 4YGXB 3MWEB 2R68A 1M34E 1SH7A 1GGVA 3T0IA 4UHKA 1QFXA 4EB3A 3ZVRA 3VR2A 1MO2A 1SAYA 1NKTA 4W8OA 4OGWA 1AKTA 2QU8A 1ZNZA 5FHRA 1ZD2P 2A5DA 1RI5A 2HQRA 1FRFS 2VPTA 3H1GA 4ZC1A 3S2IA 1YR8A 4QTZA 3UMVA 1UDAA 2PQMA 2W9XA 1VIVA 4XSHA 1KEZA 3VYSB 5JVDA 5K0GA 3ZW9A 1F4LA 3GNTA 4ZVLA 4DR1B 3I1JA 4EKGA 5JBIA 2IVZA 3A7DA 3IP8A 4J2HA 1XNJA 3TIIA 4MW7A 1GSOA 2IKSA 5ER6A 4UTVA 3KEMA 4YECA 1NQTA 4MP6A 3GX1A 4INZA 5GQSA 3NU1A 4ZODA 3D59A 2WWTA 4N0PA 3O4GA 2M6RA 1C9YA 2OV1A 4MI9A 4NBVA 3LHDA 1H6CA 4DMCA 4BNWA 5JH7B 2OT3B 2O0HA 4ZAZA 4M9RA 3TB6A 2R25B 3L0YA 4M8SA 1SKMA 2BMWA 4YS6A 4ESHA 3MWJA 4XUEA 3HI4A 4V0NA 3WXBA 4JEHA 2QUAA 1B8OA 4C08A 2XIQA 5A1JA 4OX9Y 1G21B 4G25A 4YC7A 4EHBA 2B25A 3GFOA 4UUMA 3KT8A 1UK9A 5D84A 3KZCA 1DAGA 2XAUA 3D3EA 3I76A 3PQ3A 4I19A 2PHZA 3E3LA 4W5WA 1A8HA 2XKBA 3D8HA 3CZMA 1GNQA 2EX1A 2E6UX 1ZM9A 3TDNA 1BNCA 1QGED 1KMHB 3FB4A 3FFBA 1S1MA 3LP6A 4C3OB 4MB2A 4ZZ0A 4Z4QA 4J0HA 5CA0B 3PD7A 3GO4A 4V38A 1YRLA 1KVRA 4UULA 3FIUA 4HQRA 4Y9RA 3RKSA 1ZCAA 1NW4A 3RK4A 4D8VA 5EMNA 3UAZA 2FNAA 4S3MA 4EVSA 1T8WA 3FR8A 1GPJA 1L2TA 3FOCA 4LYGA 3FPGA 3K16A 4DBLE 4L95C 3DM5A 3TNJA 3PE6A 1V5IA 4QM6A 1WRBA 5I47A 4JOBA 2D1FA 2WRZA 1VE3A 3URMA 1JI3A 1PL8A 4NOJA 4Z86A 2DUWA 4HNSA 3VYWA 3WGTA 3NFRA 4PYLA 1CNEA 3SSNA 4BUJA 3I9MA 3E53A 1XNRB 1TM3E 4RDHA 4C7BA 1MQ8B 3LQYA 4YXWD 4G63A 3D6MA 1OFIA 3WL4A 2COEA 3MWDB 3B8HA 4F91B 4NBTA 5L7WA 3TPFA 5EJEA 2IS4A 3OOHA 1YNOA 1W19A 3IODA 4IHJA 4DLYA 1FUKA 1LX6A 4X8MA 3DO5A 5FPYA 3AKCA 1E99A 1HGXA 1XYGA 2MYPA 2C5EA 4Q3NA 4LRQA 4UNQA 3EASA 4ZOCA 4IDCA 1FSFA 4NK5A 4QQFA 4A0HA 4JLNA 4AROA 1U3GA 3ZQ6A 1FZTA 4RK7A 3EGIA 3OFJA 1LW7A 4CEIB 1DLIA 2CT8A 3W5CA 1Q0PA 4CT0A 3OX2A 1AHPA 1HT3A 3ZHTA 4EO9A 4URZR 2O1SA 2JFNA 3QIAA 3TS1A 1UZAA 5ALDA 1B6SA 5F1KA 3ADKA 3VNQA 2HEIA 3G88A 3WGQA 4RF4A 4BVBA 2ADMA 5ALNA 3ETCA 4O1MA 2W11A 1H4QA 3A6JA 2PUAA 1M8JA 3BE5A 4QJ3A 1QDLB 3ROMA 7ADHA 2AXPA 2W6ID 3HKEB 4K6MA 1TF5A 1G9XA 2VUSA 3OOJA 1J06A 1R18A 3VPBA 5JAIA 1GPKA 1WS6A 2CGEA 3AK4A 2HRZA 3T1OA 1DCMA 3CRZA 1DJPA 1PFQA 5FADA 2WWHA 5JSKA 2GN8A 1DKQA 3P9IA 3EVZA 2BMEA 3I45A 3O3MB 2DT5A 3GVXA 3QH4A 3ZWCA 1Y7IA 2ZJ1A 3OTGA 3SQDA 4AWBA 4RSGA 5J2UF 4HDNB 2IW3A 5JAPA 2P6OA 4F6RA 1EVQA 3GJZA 4R1QA 5LBIA 2QZPA 2NGRA 3UBTA 5B58T 1J8VA 4UFPA 1FFYA 2V7PA 3PC3A 3GLHE 1JHVA 1C3LA 2OAQ1 3EOAI 2WWFA 3KYJB 3ZK8A 1K5DA 3HVRA 3BWVA 2OVBA 3M6MD 4HFJA 4RS4A 3TQIA 4D7AA 4CYMA 3GDWA 4IOKA 3NHUA 1T3SA 1KDVA 3DFZA 4RHCA 3WXMA 1Z2PX 4LFCB 1J2TA 1E20A 2I3GA 4NBSA 1JJ7A 2I71A 3AFOA 4IY1A 1NJ6A 4OH7A 4U2BA 3IEMA 3FI9A 4JLSA 2JANA 2AGVA 1D6MA 3EQ9A 2ZSKA 3PICA 1PX2A 4CE6A 9LDBA 3RRJA 1LXCA 5JATA 3LPCA 1KPGA 5KSPA 4BLVA 3QELA 1O6FA 1WB5A 3ULKA 2A5GA 3RVJA 1EXNA 2EBUA 3MD0A 1F8GA 5I9MA 5A3VA 4AS3A 1ONOA 1U0JA 1VI5A 4ARBA 3DDHA 1Q3TA 4QFMA 1VGRA 2RC6A 3HR7A 2WUFA 1GGNA 4I1VA 4XB2A 2P9QA 3D0QA 5IEBA 4LIPD 3MWGA 2MT9A 4UZFA 1WOMA 4ND5A 2AMJA 3E7FA 1VFNA 2N1MA 4LOAA 1TCAA 1E61A 5HQTA 1YBMA 2XGMA 1X7XA 3M81A 3QHPA 3MOSA 3D7KA 2OPHA 3OPQA 4GPIB 4NK4A 4OKNA 2I4RA 2XXAA 2C92A 3H5VA 2I7TA 4V0MA 1M2KA 4PCVA 3U80A 4PGGA 3M6XA 5DCYA 2BI8A 3H1PA 3H7AA 5JXWA 4MGIR 2HU8A 121PA 1EZ4A 2KPOA 3HKDA 3TXAA 4F6CA 5LLTA 3IYLW 5BSMA 4B8ZA 1V3VA 5HZKA 2IQIA 1YTUA 3OLCX 4B4UA 4FSDA 1IAVA 5BR7A 1V8BA 3GJ5A 1R6UA 5KYUB 1PR4A 4JQYA 1ODKA 1XHEA 1GUFA 1ZZEA 4NAVA 1M2FA 2BGRA 3ORSA 3SD7A 4MB0A 5ETJA 3VX3A 1F2VA 1WAMA 2B5WA 1Z5NA 4DRXB 1C3XA 4JJ8A 3V5NA 5K0JA 1DFGA 1XVIA 1L8QA 1C2TA 4M60A 2ANBA 3EIUA 3X1JA 2FWIA 2UYQA 2QMUA 4BWVA 5HQ3B 4CMCA 4KGXA 2AZ4A 4XGRA 2Y0CA 5BMVB 2UZ4A 1Y33E 1ZN2A 1F2DA 2WJAA 3EEFA 3TNLA 4LOLA 1G2OA 2AQ8A 2VN8A 2XQKA 3OQ1A 5JQGA 3PGLA 2D06A 3ABRB 3PV0A 2N46A 1IUKA 4ND8B 1CR0A 4D92A 4Q1EA 5ALFA 4CDNA 1U2ZA 2GBGA 4UPDA 1RC0A 1EHYA 3DZ8A 5E9WA 3RG2A 4P08A 4FCCA 3TM5A 1WDMA 2QF7A 4TTJA 1J0AA 3G17A 5CD1A 2LCIA 5ICEA 2WG1A 3FW1A 3E1KA 4TYWA 4PO1A 1MNQA 1XLWA 3HCOA 3V33A 5HM8A 4UOZA 3CLHA 3ICCA 3IUMA 2OBFA 3OFSA 3KVYA 4I1UA 1S8AA 1F7VA 4IUBS 2CCGA 3AI1A 2VRNA 3MXOA 4D6PA 4F6RB 2D2EA 4RS3A 3CF2A 2C1ZA 4F21A 1J21A 3A2KA 1FL9A 1FU4A 5LZ8A 5JC1A 2QG4A 3OZDA 3D8TA 5KOHB 1XMIA 2XBMA 2A86A 1QQ5A 3G8DA 3BHJA 2Q8QA 3QSGA 4MS3A 5FO1A 5JFGA 2WV9A 4PPNA 3S99A 2Z9BA 5TGDA 1AQNA 2HMYB 2D3WA 4D3ZA 3WIDA 4ITUA 2FEKA 4RLSA 5E7JA 3PL1A 1NMEA 3P2EA 3GGCA 5EIFA 2BCGY 2IEAA 5JXHA 4G4IA 3AU8A 3BVPA 5KJFA 2IXTA 4E5MA 1EQ2A 4PYQA 5JNWA 4XGNA 3DE7X 3UOGA 4A16A 5JNRA 2BYTA 1ZFNA 1SGWA 3BSYA 4KU4A 1RYHA 1QOQB 1QV6A 4YTEA 1EM6A 3JALA 3D02A 5AUOB 1A8UA 1B43A 2PA3A 2VH5R 2WNSA 4P53A 3WTCA 2QZZA 1EUDB 1SKYB 1ZNYA 3GJXC 1LTHR 2AKEA 4MTCA 2ZAIA 3FLEA 1EQAA 1OHHA 3L5KA 3AFGA 5DN6A 4AMYA 4MUXA 1I30A 2P3LA 2ZYUX 4KQ9A 3M89A 3HDTA 2R87A 3A6KA 3CZPA 1V5FA 1W5BA 3JS5A 3R0QA 5KYKA 2ZWPA 1VTKA 2QN2A 3VU1A 5LZ4A 5MFPA 4O33A 1SCBA 4RVSA 3O1IC 4W7IA 2F64A 4NE2A 5JE8A 3EWAA 4QUEA 3UJPA 4ARSA 2EXXA 1UBHS 1X0XA 4RGVA 4RF2A 3FRJA 3JPYA 1KIFA 4KR9A 4K9KA 2IH4A 1EVJA 1QUFA 4J4HA 4PYKA 2G8NA 5AJWA 2Q4RA 3SZOA 3E9ZA 3WJ1A 4BPBA 5GV7A 4EF4A 1D0SA 2R4QA 2JAOA 2VO1A 2FRDC 2ZPAA 4KQKA 2OCGA 3L0OA 4OU5A 3FGZA 4QPNA 2PT5A 1D2MA 1U3CA 3GGOA 2GBIA 3IAFA 3LP8A 4V24A 4WACA 1J70A 3CG4A 2AYYA 2C97A 1RHMA 3VH3A 4KUEA 4P0QB 1N9GB 5FV4A 2JW5A 4XIIA 3JQ7A 2XUPA 3A9UA 4KQWA 4OGFA 3TK1A 5HRAA 1F2UA 3RU3A 1KVUA 4RHYA 3V8NA 4MYDA 2O8EB 4L72A 3VC2A 2FYTA 1NXTA 1X42A 4X7PA 4HPWA 5ADHA 3OZSA 1KK1A 1LSUA 3KZXA 4TV8A 2JLRA 5B6IA 3EDCA 4DC0A 4YAEA 1HPLA 3E8SA 1SXPA 4O4HA 2H7VA 2PUHA 1O95C 1MFPA 2CDNA 1T5DX 4LF9B 4HUJA 2CLOB 3KSUA 4IF6A 2XZLA 3IVRA 3LWZA 3ZTTA 2AJBA 3ZHUA 2QD2A 4GVXA 5GONA 5ANRB 1D5WA 2QSZA 1ZESA 3A6HA 4W1PA 5KYWB 4G81A 5JDCA 1DI0A 1W4CA 2CK3A 2Y77A 4KRFA 3E9RA 2P2DA 4BNVA 3KBBA 1NUAA 3HVKA 3M6AA 3PUKA 1QPBA 4EVQA 4EJFA 3COJA 1NVFA 4HS4A 2CXSA 5K3EA 3EIWA 5BN3B 1PJQA 3RNOA 4PNHA 1KEKA 1JQLB 4UVEA 4YJHB 3OSUA 4YUZA 1SURA 5ELXA 2LIVA 1GA4A 1KJQA 4PGAA 3LDAA 3UY4A 6GPBA 5KMGB 2OZLA 3O03A 4PZPA 1I7PA 5KYYA 3AVTA 4G8BA 1PFYA 2NTVA 3UXEA 3FTQA 4HBZA 3VRHA 2R7LA 4RXMA 4HWTA 4CVNA 4BFSA 5L53A 1YHYA 2CZCA 5K8CA 1ZC4A 4TXJA 1N1GA 5CCEA 4JR2A 5AW6A 2YN2A 1N6LA 1KI3A 2QDXA 1L5FA 2W2XA 3I72A 3ZCTA 1A9RA 1DPGA 1MDFA 2CNNA 2ZKIA 3FSEA 2HPZA 3GJ4A 3IB6A 3TVDA 5C4IA 4EY3A 5BUCA 1JDZA 3ONDA 3ZK7A 1T36B 3SZGA 3U44A 4O1IA 4F5YA 5FBLB 1R5BA 2AG6A 1EG2A 2EIXA 5EXTA 1LLFA 3Q3CA 2OGSA 4P8RA 3NHSA 5D6OA 5FBZA 4E1BA 2XODA 5HBGA 3R5HA 1LUAA 4NCNA 3KSAC 1ZXLA 2W71A 1W59A 2R44A 5B30A 2CUNA 2CCJA 1LFAA 3G9QA 1U7ZA 5ALTA 2Y9PB 3W8EA 4PW0A 4IDEA 3DV9A 1YMUA 4WRRA 3KVVA 4EGQA 2AN3A 3IOCA 4RFSB 5IH3A 5GJCA 1DS6A 3W9SA 4AN4A 3VR1A 4HN2A 1GRCA 1ADJA 1CQJB 1NOJA 1FQWA 2V7XA 1M2VB 3C7AA 4RK0A 2UYOA 5KKCA 1YJXA 3DUWA 4XDGA 3TG2A 3GVIA 4CV2A 5IKMA 3KQNA 1U0LA 3MJHA 4Z4CA 4GQBA 3LS2A 1PN3A 1YS2X 1BZYA 1DTWB 1H05A 1KP2A 1SKQA 1WZEA 2QTFA 1WL8A 2VUHB 3QPDA 4ZEXA 5DF1A 4F4DA 2PJRA 3JQ9C 4RGQA 2HB6A 2IPMA 3L0ZA 2DY1A 4AECA 5BPHA 3IHTA 4RJLA 3QV1A 3ANLA 1H93A 3G82C 2GXQA 3WNQA 5F3WB 4DR5B 4Q24A 4P7JA 3VZCA 1RWPA 1ZU5A 3B13B 3D7MA 4HNGA 1NG1A 4WW0A 3OT1A 2QW1A 3VBEA 1M8GA 3UOWA 4V1CB 2Q4BA 1Z0FA 1KY5A 2ZRMA 3MA0A 4PWYA 4Q19A 1KU0A 2HC9A 4Q1BA 3WQBA 3WBJA 1LVHA 5B1SA 2Z2KA 2AYZA 2PLFA 4L3OA 4O0LA 3KCQA 5DNYB 1U0EA 2ZJ3A 3IOBA 1Q20A 5CG2A 3CH5A 1SXIA 1XRRA 3SJ7A 3N70A 1AKVA 2Z43A 4KB5A 2HIHA 1ZBDA 3BIOA 3IUNA 4GEKA 3WSWA 4ZHQB 3FWYA 1QGDA 1OF1A 2ZPTX 1W25A 1RKVA 3O2JA 2X5KO 2IGTA 3K3PA 3MBIA 2RHWA 3CZAA 3VKWA 2QP9X 4B2PA 1MTZA 2AUMA 3CNBA 2P6UA 3NC4A 4AXXA 3L7OA 3GLFA 3E15A 2HA3A 2CJPA 2AF4C 3AW9A 2IPXA 2VCYA 2QTCA 1E9RA 2XNCA 3K0AB 4GOKA 2R79A 3KFXA 2ZYGA 2MINA 2J3MA 2VSFA 4QJ5A 2ZYIA 4TZKA 2P41A 4CR6A 3KO8A 2QVLA 1PBTA 1K0FA 5JASA 1FUUA 2AG0A 4W7HA 4MR8B 4BE9A 1PYOA 3O8NA 4Y2PA 3QVMA 2YUTA 4BNTA 2HXGA 3ND9A 4BTLA 1O5TA 1G2IA 2EC5A 4GWKA 3Q8MA 4Y1RB 1RP7A 3LT1A 4JI5B 1VIYA 4OHFA 5FEMA 2FWBA 2C7GA 3CVVA 1IBCA 2HUPA 4MKFA 5DTIA 4WY5A 5IT0A 1XPUA 3S2EA 2PD6A 3DMFA 1MV5A 4IGAA 4AYTA 3R23A 1KVSA 4X41A 4IHKA 3VC7A 1ORVA 2PSSA 3IKVA 1X7WB 1BQ3A 1JLKA 1A9QA 2HF8A 5HTOA 3G3EA 3DLHA 2A4MA 2J0SA 3IEPA 3Q3GE 4A6EA 4BO0A 1RKUA 4OQEA 4MQ6A 3R6TA 1C8BA 4H59A 4IMRA 1L5KA 1FRVA 3FOEC 2PD4A 1UODA 1UJNA 3W9YA 1G9SA 1QH0A 3VR5H 5BORA 2X5OA 5COBA 3UAWA 2VWGA 1QIIA 1PJ4A 1FX0B 1XDWA 2Q5OA 1ZZGA 3MS4A 4QU8A 3ZD7A 2WVAA 1WNFA 2CDAA 5KVVA 1JJBA 2WT8A 2PXAA 3MGKA 1A5TA 4M9CA 5FOXA 3GARA 3KVOA 2FR8C 3IDSA 5P21A 1YHZA 1ZG3A 1EDOA 3A2LA 4FKBA 5CVJA 1M7HA 4JZKA 3W04A 1UMKA 4ARZB 4D82A 1Q74A 1JYSA 6AT1A 2QSUA 1IOLA 3GEIA 3PRHA 1GFSA 2I6SA 4KXVA 3SDZA 3EG9B 4QLBA 4O8CA 4WXRA 4EGJA 1VL6A 5JQWA 2UYHA 1X3SA 5JMOA 1L4LA 4QSHA 4N3BA 3COZA 3LG2A 1NW3A 4NHEA 3DEIA 2PZAA 4G0NA 3HBMA 3CVXA 3VU3A 4D74A 3P20A 3DEFA 4JI1B 1L4BA 3LL4A 3HC7A 1N33B 3NBFA 4IIBA 3HCFA 4Y1RA 4FEYA 3JTEA 4QYWA 4HNAA 1W34A 2EYQA 2GN1A 2JFBA 5I7FA 3SX2A 3F97A 3ZGZA 3PDWA 4DXDA 1ZY2A 1UKEA 3AHJA 2R8XA 3NHWA 4FIZA 5TIIA 1Z25A 5JCPA 4H3SA 2BEUB 3IVAA 4LOKA 3MG9A 4J3NA 3TSAA 1QZUA 5DYIA 4DA6A 3K0AA 4WKGA 1QXSA 1T6BY 4P5PA 3ZHBA 4HNRA 1FE8A 4ENSA 5ADWA 1D2AA 2QTVB 2FRVA 3NWPA 2Q29A 3AR7A 1V7QA 3D8RA 3WGKA 1E6LA 2A6PA 5HIAA 1EUQA 3E0XA 3V8RA 2QS9A 1O54A 1Y6RA 1JT9A 5ELLA 4ZEMA 2GMWA 5ENZA 1YQTA 2POQX 2PIDA 1M7GA 1C7JA 3FLBA 1YQWA 1FK8A 5BVGB 3FNEA 4BLSA 1PDWA 2ZJZA 5SZKB 3RVPA 3S2FA 4GI5A 1KO7A 2I3DA 4WCDA 5C8YF 5TB5A 3FSRA 2DPLA 1NJ2A 1OCEA 5C4MA 3DEJA 4LOIA 4DMFA 4E13A 5ALUA 2V59A 2YVUA 4YUYA 3TAXA 4YJ3A 2Q8NA 2QJOA 3DGEC 1MRNA 2WSSD 4UFOA 3FWKA 3EMDA 3ST7A 4A6PA 5JSUA 1T5OA 1X87A 2WT4A 1GGEA 2IOQA 1QO0D 1N2CE 1NNLA 1WKVA 2FZWA 4CLOA 4DUYB 1W5TA 3AKYA 3EFBA 3TM4A 5LKAA 2I6UA 4D8XA 4W5JA 4EKYA 5MGNA 3EODA 5DCWA 2E4AA 4ALJA 1UBLS 4L4RA 3U3ZA 5HIJA 5JH7F 2XYQA 1WMAA 3BBLA 2V1UA 2FV8A 1R5JA 1QCYA 3R7SA 1JTEA 5FH9A 4TPKA 1MOSA 2NYRA 4Q05A 2J3IA 5FBWB 1NL3A 5EP3A 1REQB 2I54A 2G04A 3NANA 4F72A 5CFOA 1SOUA 2C0QA 1H2XA 1GYRA 3R8CA 1E4VA 2C00A 5FBQB 3D4OA 3FROA 3NBYC 1MEJA 1B6RA 1W5AA 2Q5LA 3IOMA 3N59A 2WTMA 4IRUB 3KUCA 5EE5B 4NQZA 1R3UA 3O0TA 3OJEA 5JD4A 1HG1A 4C2AA 4U02A 1QGUA 5KUTA 5IKPA 1OFUX 3U6KA 1GTRA 2FF5A 4W6ZA 2EIHA 4JJEA 2H4YA 4C7JA 4W7SA 4TTAA 2C0PA 3LVFO 4HFRA 4KQFA 1BQEA 2HH9A 7AT1A 1SPXA 2BCEA 3GXOA 4H77A 1GSAA 4ZOQI 3FLAA 1ZKDA 3R9KA 3E82A 1Z45A 3A1DA 1E0SA 3LWNA 1PEKE 4MKRA 4MP8A 5D00A 5EKXA 3TVYA 2PLAA 1NVAA 1CETA 2WMDA 3DFKA 4B09A 5KVAA 1JHQA 3L9WA 5KKAA 1XZGA 4X92A 4XE5A 4GECA 4ZAWA 3MOIA 1Q6ZA 5AK0A 4JUIA 1OYWA 4L16A 1VLMA 2ID7A 2A14A 1X2EA 4MW9A 3ISTA 3MFQA 2QQ5A 3AMVA 4UMFA 5H3HA 3VU9B 1OY1A 1PUJA 4OAOA 4LRSB 3DWIA 4DG9A 5CDSA 5JPDA 4NQRA 2FSUA 3HFJA 1KO8A 3U60B 3Q11A 3A70A 4K8OA 4CIXA 1RU3A 2QX7A 1CHNA 4ALMA 4OI0A 1WULS 1GDHA 4XPIB 5BW6B 1TECE 1OASA 4FGJA 4DYHA 3F4LA 1P7PA 1K6MA 2W2OA 4YRZA 3HKCB 1SXJB 1JAYA 1W93A 5CDFE 2UAGA 4C30A 1MIHA 4V0QA 3DWFA 4P84A 5ALQA 5LQAA 4BFXA 3ZX4A 2ZCVA 2ZRAA 4RELA 1G4AE 3PKZA 1EGQA 3PEVA 1F51E 1FFXB 4D4MA 2D0OB 4KO4S 4UM9B 2F6RA 5I7EA 5HTKA 4H7PA 2IYNA 2J3HA 4MI6A 2NU6B 5JT1A 3D3JA 1RWNA 1O97C 1HNNA 4L0MA 5K3DA 3PHCA 2C0CA 2WKRA 2VATA 4ZIRB 4DAOA 4MITA 2OHXA 5BNFA 3SU8A 1K2WA 2M32A 2YXBA 3OECA 3AVPA 5CT9A 3KV3O 4TV8B 5INTA 1U5AA 2GEBA 4C05A 3O8OA 4QGFA 2MYTA 2OPBA 2EZUA 4UNNA 1G5TA 1SXJC 3RJZA 2A0WA 4F2HA 5CD9A 2IEGA 5EJ2A 2BFNA 5H4HA 5B3JA 2V7GA 1KKUA 4U39A 3K20A 1K97A 3RREA 5K0BA 3C3XA 1JUDA 2PZBA 1PEAA 4YJGA 3MEQA 2EQBA 1A1VA 3L0CA 2RSLA 1ADYA 5DLPA 1GSIA 2X2EA 5LD2C 4TTTS 4ID3A 1RPJA 2EL9A 1QK4A 3VKUA 2PQ6A 3F5SA 3TG8A 4G56A 2RG1A 1R0WA 2O14A 3MB8A 5D86A 1QORA 2ZETA 1M2GA 1PYDA 1ZM3A 3CYFA 3VGPA 5IKEA 1JBQA 2JFFA 2YOFA 2LTAA 2WIBA 3VPGA 1I3NA 1WHSA 1Z2DA 2X23A 4TKMA 2QY6A 2PO5A 3AL3A 5CAEB 4AVYA 1YQDA 4H7FA 4R9UC 2IBSA 3DO6A 2EVWX 1A27A 1IULA 2ZRJA 3M3DA 1HDGO 1OU0A 1JDPA 2O2IA 4BP1A 4A2CA 1OFVA 3RQSA 3EVEA 1QLHA 1EFPB 3HRHA 3G7SA 4J16C 3AHDA 1R8JA 4B48A 5I3ZA 3A0RB 3GLFE 3JW8A 1R6AA 3Q5EA 2XD4A 3ELUA 4TT8A 1ABEA 3GU3A 4J16A 1ZW1A 5LBUA 3ZGLA 1MZPA 1DC3A 4JP5A 5DX8A 3TKYA 4BPRA 1CYDA 4U7PB 2ZIUB 3MGGA 3IKMB 2OORC 5F5LA 3PEUA 2PWBA 4ZGBA 3HN2A 4Z5XA 2QEQA 3JSAA 1X9HA 3FYCA 1KFEB 3IDFA 2CEKA 2C5SA 3RHFA 4D56A 1DBRA 4MYSA 4HAUA 4AO8A 5LMUB 4MVJG 2A57A 2D3TA 4QOJA 2EW2A 4IDBA 2Z04A 4RZQA 3H5LA 4PC3A 4DB4A 1JS1X 4LSGA 4OHYA 3CJRA 3MIIA 3BDAA 1PZXA 3TW0A 1G8AA 2A5LA 3JR3A 1L1RA 3QE3A 4DM3A 2C8VA 2ATEA 4WFQA 1Y9EA 2XOKA 3PLAE 3F9IA 2I6XA 4LVOA 1TRKA 5DB4A 3KV1A 4O2RA 3OJOA 4I50F 3AT1A 4F9FA 1KTIA 1XU4A 1RFLA 3V4PB 5TEWA 1J2RA 4ND4A 5EQFA 4WBNA 1Q19A 3F0TA 1E96A 2I78A 4X8HA 4BFVA 3T7RA 2W93A 4PQRA 3U3KA 3FKSA 4X1KB 1C1YA 4C0LA 1NDQA 5ER9A 3KQOA 1D4OA 2H1SA 2C83A 2J6CA 5CYOA 5JCJA 2IRWA 3LLVA 3SNHA 2HHAA 1N6PA 1P1RA 1XEAA 1U2PA 4X6UA 1TC1A 1BRTA 3L0IB 3R74A 4KREA 2PS1A 2H2HA 1OLUA 2AX3A 4XVHA 1OH7A 1MJNA 1EFLA 2HA4A 2X0KA 2ZFUA 3ESZA 2GPWA 5CT6A 4AKSA 4F1WA 5I7HA 4KIFA 3AJDA 4S1VA 1E3JA 1I2CA 1JXMA 3RHSA 3LSTA 2EAUA 4J8PA 3N2NA 5I9IA 4OQZA 1OSNA 1V25A 3WQRA 1SQ0A 3LPDA 4R2IA 3TB4A 2V6JA 1PDVA 4J0IA 2ZTUA 2B36A 4FC6A 4YMHA 1RRVA 4DJFC 4PG7A 1Z5VA 3QUCA 2AQKA 1H8ED 4ZQCB 5B53A 2YMQA 5BOSB 3AVXA 1GZDA 5EJGA 4M1WA 2H31A 3PGVA 3PT9A 5HQ3A 4X3OA 5KQSA 3UWOA 2GNAA 2V3WA 3PB3A 3PHBE 3ZCQA 1RQPA 5LQJA 4FYWA 1BGWA 1K68A 3WICA 3GGGA 4DIEA 3H8VA 3JASB 1GNRA 4UCQA 4DLPA 4B7CA 4PY2A 1S7CA 4Y2YA 1KE2A 3DZBA 1OREA 4XM2A 1RRGA 3LC7O 4F93B 2Z1NA 5KYUA 1XU9A 2LKDA 2XEDA 3BWBA 3PA8A 3LAWA 1DSSG 5A9TA 2FRXA 1EGMB 2ZXUA 2YMMA 5DCLA 2XD9A 3L93A 1TT7A 1A7JA 2WD8A 4RXTA 4H1UA 5CFNA 4YRBA 1R9NA 2V4UA 2WTBA 3EULA 3N8DA 4WESB 2RHOA 3LKZA 4P4TA 4I14A 3ND6A 5FBHA 2O0JA 2OCIA 4UUAA 4CKWB 2P8SA 1DJOA 3VTZA 1V1RA 2J9FA 3WMXA 4RQTA 3RK1A 3HA2A 4XR4A 4K81B 1Z6YA 3SOPA 4FD3A 4FYMA 4DLUA 2BUCA 4ID9A 5EESA 1X1EA 3GP5A 4BQNA 2FXIA 2D8MA 4EG1A 3FN4A 4XW2A 3SI7A 2H5EA 1E1KA 2ZATA 2XOKD 4S0ZA 3KQUA 3ZVLA 4F0JA 1QB8A 3LUGA 9MHTA 3RF6A 2H52A 3OEEA 5DU2A 5FWXB 2WF6A 4R1SA 5CHYA 3QELB 5DM1A 1RYBA 2YW9A 4PHCA 2IPNA 1RRKA 4REMA 5SZJA 4MWTA 4A1OA 1VYTA 3GRYA 5HOEA 1EEXB 3OQHA 1O7JA 4XI9A 1UJ5A 2AJCA 2BCJQ 3A1TA 3I5XA 1JDTA 4N03A 1P0MA 4TVOA 4RZ3A 2A9OA 5SYAA 2IHNA 3ES9A 3EMVA 2CJYA 3ICVA 2ZB4A 2O2DA 3B6ZA 3H2BA 3PYXA 3RTAA 2FKAA 4X9XA 3TGWA 1VG8A 1XKXA 3EAQA 4JC4A 4G1EB 4IIUA 1RMQA 1WVIA 2B8TA 3SHVA 3VI3B 4KVGA 4M7OA 1TCBA 1YUMA 4M8IA 3WYDA 2VA8A 1YS6A 3DHYA 5DTQA 3TF5A 3V80A 3DAOA 4N0EA 1RWWA 3LVBA 3RLIA 4BX2A 4UBJA 5H82A 2Q7DA 3ESCA 1I7SB 4QREA 1J49A 2BR3A 3UKJA 4YCSA 4OB8A 4H1WA 5A3QA 5BQ3A 1UBOS 2AMYA 1I1OA 1JR3D 4WDQA 1ECFA 1OVMA 3L18A 3PT5A 5KCMA 3T5PA 1M1YB 2FUKA 1IY9A 4O5OA 1D2GA 1I3MA 1VA5A 4BO4A 3QVJA 2PGDA 1RM0A 4J76A 4WN9B 3U0VA 2IHUA 1UXOA 2J6HA 3AIIA 4GP7A 1D6SA 1E89A 4MR7B 5E9AA 2OBMA 1UKBA 2O2JA 3L3BA 4ZVTA 4DTIA 1IMJA 1IXZA 3Q87B 3NBMA 4LFAB 3WL8A 2JRCA 2NPOA 2PL9A 4P7KA 4H7HA 5FNZA 1TCVA 4FYJA 1FRNA 4Q3OA 1FA9A 2V9PA 3RSFA 1UBUS 4PZZA 1OU4A 2VHTA 4YAWA 3S3TA 5J4VA 3OKAA 2X13A 3L4BA 2QY9A 3V00A 5CTJA 2JGFA 2W4MA 3O9MA 1TK2A 2GN4A 3K8QA 3MMZA 3W2FA 3TMAA 2O8VA 3ANXA 2HI0A 4GKVA 3MUEA 1NJGA 3ONWA 3RUIA 1KS9A 4KPYA 3F78A 3GP3A 1OIXA 2LKCA 1UXHA 5EUBA 4G09A 5KTPA 4YMTA 3OT4A 3HVIA 4AN0A 3TECE 4LYHA 3W78A 4X90A 5CVVA 2Z1DA 1GTSA 2O54A 2NU7B 3BHIA 3OAAD 1FNNA 5IYZF 3U1VA 2IP1A 3BCHA 3HCPA 4KGVA 4LCJA 4UREA 5B57C 3DAGA 4FONA 3C6KA 5K0TA 5KSZA 5A5FA 5L3SA 2HY7A 3FNBA 5EIOA 1KQGA 3FD8A 1XPJA 3F49S 4YAFA 4DCSA 4QG3A 1FX1A 3PWSA 3UGJA 2WF9A 4RD1A 3VHXB 1EM8B 2ESRA 3C1AA 4FYPA 2CY0A 4LOHA 3EQZA 4CMBA 2H92A 5E0OA 2R1TA 3WR5A 1KBZA 2A9KA 4CM3A 4U9IS 4N8SA 1OBFO 3DBHA 5BURA 5ISMA 4X24A 1FTYA 4ZYWA 3SM9A 3EGCA 4LY3A 4C6HA 3T7DA 2QZ4A 3WLNA 3DFMA 4GYJA 4YREA 1JFRA 1U8UA 1NAIA 1UFOA 2PMWB 4C29A 4QXRA 5A06A 1OBHA 3R0XA 4DEVA 3PGKA 4S05A 3DNPA 1KR2A 5CA0A 3QEOA 4PR0A 1LSSA 3NASA 1G6OA 5ESWA 3F6EX 1AGNA 1P2SA 4JP1A 2I7DA 3QG1A 3GLVA 3GGJA 4R51A 1EPUA 3EB9A 3A9RA 3HRKA 2HK6A 2O4UX 4MGHA 1E8DA 1YFZA 2VNIA 2GGSA 1A4RA 3PDCA 1NP3A 1JH9A 2G25A 4DG8A 3L7KA 2BEWB 4ZYLA 1ULTA 1S3FA 2PG3A 1SVMA 4X44A 5C1BA 1P6UA 2JGEA 2GAAA 1FYWA 2OKGA 1MAUA 1E2UA 2PS9A 2QTZA 3DR3A 3ED1A 3HJAA 3MMSA 3NTUA 4HK4A 1T4MA 5A6SA 2PJDA 4KIJA 4MV6A 4OF4A 1ULZA 3TN7A 4AY2A 2GBLC 4ETWA 4QPJC 1NA5A 2G09A 4BLOA 4CT4B 3TQQA 4DMHA 5B7GA 3DLCA 1MX9A 4HN9A 3LIPA 3NTQA 2PVSA 4GOJA 4RACA 3MBOA 4FFSA 1IU9A 3TZCA 3JQRA 1LF5A 1W94A 1EBFA 1EZ1A 4EX7A 5M29A 2PH1A 4BCCA 2Z8ZA 1V11A 3VOAA 3CX3A 4CTNA 4NZMA 5HP4A 3ZZ0A 4D41A 4WXMA 1TZJA 3IT3A 3BMQB 5HKLA 1PAUA 2NV2B 4I55B 5ALEA 5J1SB 3QKUA 1Y8RA 3NBZC 3ZJVA 1E32A 3GAFA 4QM7A 2OCKA 3KTAB 2KBEA 4KIGA 1RJFA 1YI8A 1WMEA 3ZKAA 1AKYA 3PC7A 1HI9A 1EQUA 4GZ3A 1GR1A 2QVCA 2J07A 3I4LA 3KU1A 3LC0A 2I62A 2YVKA 2PT9A 4II2A 4PXSA 3QA9A 4XSVA 4R3WA 3QVUA 1XBTA 1Y63A 5AKHA 4US1R 1EE2A 3GIDA 3IRVA 4ZQFA 1N1DA 5EIBC 4BU1A 1JIJA 3BQMB 4TXMA 3EPHA 1RMYA 3HDVA 4NH0A 3DBVO 5BW5A 3MWEA 4H2DA 4TTRA 1RLOA 2VHEA 3C43A 2DG2A 2ZJOA 3Q0EA 3NWJA 4AY6A 1WBDA 3OOSA 2E7ZA 4V1CI 3I2IA 1Z15A 1UOOA 4PPGA 1EU1A 3D64A 1O4VA 4UBIA 2Z6AA 4KQ6A 5H70A 3U16A 3AF2A 3EUEA 4DMKA 4N7MA 2IFTA 4KXFB 4P22A 4G9EA 3K5WA 4XGQA 4AJNA 3WQHA 4OCZA 1O8BA 3D0RA 5DOZA 1Z8HA 2FUEA 3D0OA 5HF6A 4XX0B 5JMPA 2X0JA 4B35A 2EFHB 1AO3A 1C7QA 1T43A 1OX4A 4GOND 4GR4A 1UPFA 1OAOC 4R0NA 3OZGA 5E38A 5JQGF 1YQGA 4LVNA 5AI8A 3IJPA 2OBNA 4C6RA 2PWYA 2OV4A 2XYVA 2F2TA 3I2HA 4JGBA 4P92A 4B75A 4YX9A 1UCFA 2E55A 4R2LA 3WV4A 3CN9A 1OIVA 1OZ0A 3A4LA 4FT4A 3CZCA 3V1LA 5GTDA 4DQUA 5K8JB 3LFTA 1KS2A 4NNPA 4DREA 3ZCRA 4CL0A 2DSTA 1RM4A 1DC6A 4N82A 5LCXA 1GP2A 4JGGA 2NOAA 3MYYA 3K0EA 3RO7A 5D1NA 2I6GA 3K2EA 3R6WA 4IW3B 4NZOA 4RH0A 1C1DA 4OU4A 4WFIA 3QFTA 4F4UA 2RBGA 4Z3KA 2Q9AA 4LF7B 2B7LA 4JXZA 1QX4A 1OFHA 1TL7C 4FMCB 2C2WA 1L4NA 2ONKA 3W8NA 1XLVA 2ZRGA 1JALA 3DOUA 4RHUA 2VWPA 2QTWB 4LSZA 2XMZA 1L9KA 1YB1A 3QNMA 2DKFA 3V9PA 1YR3A 4BMSA 1WF3A 2CHEA 4GUAA 5T6MA 1KFJB 4FFBB 3SVLA 1E1LA 3E58A 3IV7A 4OBEA 3SSMA 4BKPA 1BE6A 4FM9A 4LDAA 2I2BA 5FPHA 5BOVA 1R0KA 3KEOA 1OV4A 1ZHFA 1YD7A 3FPKA 1OZHA 3B36A 4LY0A 4MW6A 4EG4A 2XT6A 2WYHA 2G9RA 5A4KA 2DPHA 1KTVA 3KYBA 1N6IA 5HJ5A 1J99A 1Z4LA 5DX1A 2C2HA 4BVGA 1SK9A 3RDPA 2G67A 3UK6A 2V1XA 5FKJA 4RA9A 5FDFA 1OBCA 5C7YA 1ELOA 2RI0A 2W2NA 4OJNA 3CLUC 3SGLA 3L7YA 2BFOA 2IQ5A 3RM3A 1NYLA 4FUTA 1BS1A 3NTVA 3U4IA 1MGOA 4GVPA 5DYYA 2LV8A 2IYSA 2R6ZA 3W5VA 1QIFA 5EUQB 1XZBA 2XITA 2O3SA 4IOMA 1CJTC 2ILVA 1WBJB 3QVWA 5IZCA 2DR2A 4MHTA 4OA5A 2H85A 1ECGA 3ZHRA 1UMCB 2GN0A 1T1SA 2WMYA 3VO2A 4N4AA 3S27A 1K7SN 1MJFA 4JWKA 3TTXA 3OC0A 4YRCA 4JOSA 1OKKA 3ND8A 3ZS9A 4EF6A 1N2OA 1SQSA 2UVPB 4PGFA 1YI0A 5LP1A 2CUKA 1KSHA 3WDMA 2ZIWB 2YWXA 3EVFA 3H1BA 5F77A 5C0OE 2YVQA 4JU9A 3R5FA 4ND7A 3IP6A 2Z8XA 3HADA 3ZIAA 1J23A 4ENWA 2Y9MB 4DG5A 4IJ5A 4FLEA 3DVAA 3M2TA 1DQRA 1NU6A 2FZGA 2H6EA 3G5LA 5AOAA 1KZHA 2F55A 4B82A 2AOUB 1OWMA 4KX5A 4KWTA 2QRZA 3CBQA 1HQKA 1NR7A 5KSOA 2Q1YA 1N4DA 2FEPA 3ISJA 3N6VA 4ODIA 2RK4A 3BGOS 4KQHA 4EGFA 4FLMA 2I7XA 2E5FA 1HQYE 2IUSA 4HGRA 2GN6A 5TPWB 3T94A 2FMTA 1PV4A 4B17A 5HGJA 2JKZA 3DZJA 4NBKA 3VKVA 4KMSA 4G36A 2YC4C 4RY9A 1EGHA 3NNSA 4KE9A 4LE0A 5BSTA 4LMPA 4DCPA 1N8TA 3DNMA 2IPLA 1TW3A 4LQDA 1WCIB 3CH4B 3FYSA 1A5AB 3TR6A 1U4OA 3L7AA 1U7PA 3DEAA 2GNPA 3IURA 4RVFA 2VF7A 3W5DA 4Z4GA 1J5XA 3ROKA 1QVAA 2VYQA 2J4CA 3K9WA 3O8QB 3ZY5A 1CZNA 2YUIA 3PX3A 4GR5A 4XJVA 3I83A 4BNXA 2XWPA 1ML3A 4OOEA 3ZPXA 3ICQB 3W77A 1PR0A 3N2LA 4R5MA 1BFDA 3IVCA 3NM4A 2PY6A 5ADVA 5JRDS 4I9FA 5IVKA 3EUAA 1JPVA 5EZYA 1X8XA 3VPFA 3WV5A 1KJYA 2J3LA 1LLCA 2NZWA 4KSYA 3VYUB 4DMMA 1P4SA 2JHCA 1D2EA 2NV0A 1BCRA 4R81A 2WIGA 1RLTA 1FFHA 4JDUA 1MHPA 4B87A 4EW6A 1JHDA 2RDMA 2FPGA 2CXPA 2GXSA 3HPRA 5T8KC 2AEFA 5IC4A 2C4HA 2JCSA 2PJZA 2Q6VA 4O6VA 3X43A 3AHHA 2YHIA 1USIA 2P9YA 1S2LA 4LYEA 3X2EA 2BUBA 2C07A 5JIBA 3I1FA 6Q21A 2TMGA 3WIVA 2X5JO 1EJ6A 3GFRA 3AHCA 3HBJA 1X94A 2Q6LA 3LBYA 4DJ5X 2XKKA 4KDCA 4ZI2A 2O8NA 2FUNB 3P1JA 3S6JA 3V97A 3M2PA 3C74A 1EVKA 1N2BA 3O6VA 2VK8A 3IE0A 3NEYA 5AQEA 4YVFA 3RS2A 1T5TA 1ZC3A 4CR8A 4Z7QB 4GPBA 2R85A 4BNDA 1FBTA 2W83A 2RGRA 3R9IA 4Y0NA 5DM4A 1OJLA 4PIPA 2VKQA 2MR6A 5JRZA 2DUNA 3RIYA 2ZS9A 2CWDA 1XD8A 3H97A 4Y9TA 4PTZA 5AVKA 2ZSIA 1TQ2A 3HHEA 4AJOA 1BROA 4DGSA 3DG9A 1H2RS 4R54A 4ZCIA 1KI2A 2C2GA 4Q16A 2BKAA 1KAGA 4ITRC 2CNKA 1G3RA 2H54A 1ZH2A 2FQXA 3ML1A 4OQDA 4QDZA 3H3XA 5A6VA 2RGAA 4LTDA 4M98A 1ZL2A 2W6JD 3FCCA 3K9CA 2H7CA 1IY2A 1HBJA 1HKHA 3MTBA 4G97A 1TM7E 1R4ZA 3O91A 3OD5A 4TWJA 4ALKA 4F3RA 3QMPA 3CEHA 1NUQA 2X4GA 4GM0A 4P4LA 5ALYA 5E6SA 4AJEA 4JEUA 3JQFC 5FR1A 4R7ZA 3ZWMA 5DXJA 4DW8A 3VKFA 4HX9A 3PDJA 2B4TO 3OZTA 4RD0A 4YHBA 3VJMA 5A5DA 2J4FA 4R9NA 4DUGA 1I6MA 1Y1KE 4OIMA 4ZAYA 4OSOA 1NXWA 1DBIA 5FUVA 5CFQA 4JYZA 4ZQGA 2XGOA 1KYIA 1JR4A 3GPIA 1ZISA 1PQUA 1L4HA 3MFYA 2UV8A 3WK9A 2LXNA 3NI2A 4KITB 5F78A 3TPCA 3OPYB 1TW2A 2QT1A 3WG9A 1S5PA 2P5SA 1A8IA 1XTBA 1YCFA 4R2WA 3WHIA 1QHEA 1TO6A 1QYXA 2BY4A 1A98A 3VOSA 2ZTSA 5EJ6A 3UNXA 3GLGE 3B1YA 4R8KA 2H3HA 4CUZA 4BNYA 4EMBA 1Z22A 5CH8A 3QKSA 2EJWA 3ESDA 1XKQA 3OLWA 1RWOA 1MX1A 2F3QA 1BHQ1 2R84A 3IA2A 4I2VA 1I94B 2O19A 2QNRA 1RXEA 3INTA 4BZWA 2WYUA 4LTMA 5LP6B 2CYAA 4PZDA 4K3UA 3PC8C 4NCXA 2JHGA 2V8BA 2BN4A 1Y42X 1CUVA 1XFAA 4BGIA 4CM8A 2FCAA 1ORDA 2K6GA 5ALLA 1BJRE 4B7UA 3ILVA 1B3BA 2CLKB 4WINA 3GEPA 2AIRA 4PO3X 4ML3A 3QUQA 2Z4RA 4R0MA 2COUA 5ALIA 4PNZA 2WAMA 4JBNA 3OCXA 1H3NA 1Q44A 3H0KA 3H2HA 4PGMA 4CI9A 2H5JA 4DJDC 1QQAA 2XOXA 3KKZA 3HN7A 1YZNA 2DUUA 5FLKA 3E03A 3R7BA 4ZHQF 3UB3A 5JOQA 4Q4AA 1BEZA 2GD0A 3STUA 5KNCH 4PAOA 3ZBQA 4W1QA 1B26A 1LLDA 2H18A 4I7EA 3ZBTA 1C4XA 5AICA 1K6XA 5EWMB 1IM8A 2EP8A 5F3DA 3SYRA 1N2CB 4C9BA 4ZDIA 7MDHA 1N2XA 2Y0DA 3R41A 4QRIA 3KXPA 5BUQA 2ZRIA 4LJ4A 4MRAA 4D3FA 1T4CA 2PX0A 3HMKA 5CT8A 1DCTA 1P1IA 1UAAA 2D0PB 4R71A 4Y7DA 4ESOA 2HREA 4S0XA 1FLNA 2GJAA 4PFSA 1C7FA 2JAPA 2Y6UA 2Z3WA 3ELBA 2GO7A 3ZWBA 2YBEA 3RTGA 2GHIA 4ZCSA 4EO4A 3CKMA 5DNDA 2PGIA 5D7BA 2VQFB 4Q7EA 3ZHCA 4RVHA 2REBA 1DQPA 4DYDA 1L5WA 3NWBA 4QZVA 1EEHA 3FTPA 4UD6A 3JQGA 1H2EA 2SICE 2SCUB 5FAXA 3ADCA 2V6GA 1R0SA 1IPHA 3MJFA 5CB6A 1QKIA 2Q7OE 2IZOA 3ZKWA 1NC3A 3FFTA 4TS1A 5EE3A 1QAMA 4MB6A 2XQGA 3AYXB 3CT4A 1M0TA 3FFAA 1CQPA 4CCSA 1CNFA 4EHJA 2COKA 4JY7A 3DOFA 1NKSA 3J7TA 3G2OA 3SYNA 2HYDA 4G0PA 3U62A 3H2SA 1F38A 4PU0A 3UH0A 1CYEA 4BEWA 2IYPA 4L5JA 3QE9Y 2FHPA 2OFFA 1E69A 3N3AC 2CXHA 3U9SA 4C7VA 4DA7A 2UUBB 1SUSA 1N2GA 2A88A 4HEA6 3GRAA 2WIAA 3LY8A 3CLRC 5EKUA 4CQLA 2QENA 3QMWA 4O25A 3G2QA 4HH0A 2ACEA 4JOQA 3V7UA 1WU7A 3U39A 3UIEA 2OCAA 2I87A 4D3SA 4X7BA 2VJKA 5IJXA 4L9WA 1ABBA 3VNVA 4URWR 2A0XA 4LCEA 2BHSA 2PZKA 5CFZA 1TYBE 1ZVJA 1P3Y1 4J7AA 1NFQA 2P78A 1G66A 4KHPB 2CXTA 3QMMA 2RG7A 2O8DB 1JA9A 2QZJA 2PWPA 1LDBA 1NATA 2H3EA 3DDOA 1T3LA 3NETA 1OI7A 4JENA 4UDXX 3R4VA 5FPQA 3RTBA 4BWYA 2F43A 2FXVA 4EHDA 1XEFA 4BQOA 4KH0A 2XBLA 5CFMA 1CBUA 4Q93A 5BMOA 1BOOA 2P2YA 2JL1A 1T35A 1S2MA 4Y98A 3KD2A 1H2ZA 3I2KA 4YAJA 4HDMB 3W9BA 4PR3A 4AURA 1G0NA 1NKVA 2XYPA 3L02A 3TNFA 3QSYA 3U4HA 2PAAA 4X1OA 3WSTA 4Q3EA 4ETIA 1IG3A 4LK3A 4DNQA 4UASA 3AERB 2XX3A 2X22A 4QU5A 4XAQA 3I52A 2XBUA 3ESYA 1ZLXA 3GK3A 3BB1A 4ZXPA 3DVSX 4IP0A 4CLRA 1BHJA 1UKAA 4ER5A 4PYNA 5KC8A 1BMDA 2ZTVA 2O3JA 4ZPXA 4E2ZA 4MLDA 1QIKA 3PI7A 3IELA 2PUDA 4U9UA 3T6KA 2AFIB 3SHTA 1RCTE 5F5NA 1KWGA 3U09A 3KPVA 3V6LA 1X86B 2RKWA 3GR6A 2PL1A 2W2KB 2B20A 4ZVRA 4J90A 3PJDA 6NULA 4UM8B 4LFBB 3B7GA 2WMOB 1M75A 5KYXA 2BBTA 3HCRA 4LI3X 5DH9A 2VLIA 3L4EA 1JBKA 2DPYA 3D3WB 3K09A 4H6XA 2J87A 4H08A 1NQWA 4ZT4A 3ZXXA 2OAEA 1T2DA 1RP1A 1VKOA 3DB1A 2YHSA 4ED9A 1NXPA 4BQQA 1O0SA 1R15A 2CHVA 1R8SA 5DXAA 3FZYA 1ZM7A 1SVWA 3AB7A 3DL0A 4TYMA 1TGYA 1KZ9A 1MW9X 1AA9A 1B0UA 2GPTA 3SF8A 4EMSA 1V6CA 2OD7A 4L51A 5EYPB 3UFXA 1E2HA 1H3FA 3ZXIA 4K5QA 4IOJA 1W2GA 1E6CA 2JH9A 3IP9A 4MRRA 4OL9A 2CL6X 4FFNA 4YRRA 5ED0A 5IWAB 3WISA 1NDUA 1CY1A 5G02A 1DKRA 4G5OA 1K86A 3G2NA 4OQYA 3CRVA 4DV2B 2ZAMA 1VL0A 2NMVA 2ET6A 2A0FA 5J63A 2NUTB 5K8VA 2JIMA 3QV2A 2G5CA 5CYGA 4UQPA 4QYIA 1M6VA 1YVEI 4FGZA 2WSSA 3MQFA 4OEHA 1FSPA 2AA3A 5FPTA 2YNMD 1YRYE 1NWCA 1HLPA 3DKVA 2HJRA 3QHAA 2HGZA 3VOTA 4BVFA 4PEVA 4FCVA 1XK7A 3MCZA 4L3WA 3TZQA 3OTQA 4FTWA 3VDRA 4BKRA 1YZ3A 2JHAA 5EUCA 2PU5A 4RDIA 1FFCA 5DHUA 3S2SA 4CQLB 3ZHOA 4BJ3A 1CKEA 4AC9A 1F06A 2HRQA 2PSJA 4J91A 4EUEA 2QZSA 5CFPA 1WDTA 3EFOA 4OUKX 1QGZA 5FXMA 3ROTA 3JQAD 3EPPA 3BIJA 3KT0A 4C20A 4BXOB 2ZR8A 4IMIB 2AI2A 4YP1A 1R0ZA 4B9EA 5B7NA 4OAQA 1MLDA 3PWZA 1T9DA 5IJ9A 4X61A 4YROA 1OI3A 3R5KA 2SECE 4P3PA 3HEAA 2BW0A 1DAMA 2ZUSA 1IZ8A 4BECA 2G82A 1MAHA 1XN4A 2PPVA 4I3FA 5DNCA 3UMYA 2BL4A 2E85A 1YHNA 2H9YA 3QQ5A 4BVAA 1EK5A 1RI3A 2XCIA 1WDWB 4NTZA 2G8LA 2VL7A 1LCIA 4GWLA 4NJMA 1HY3A 2XE8A 3CRMA 3UV6A 1XTJA 5I9LA 2AS0A 1WW8A 2P5UA 1Z68A 1T2NA 3DZCA 3I4FA 4IFIA 5P8WA 1FSGA 4YP0A 3SLKA 5TQ0A 1QG6A 4W5QA 4BZZA 2V5AA 2V97A 1BDIA 2C5GA 1VBMA 4RJJA 5J4LA 4LWPA 1WVGA 1Z28A 2P4UA 2R6CA 4WCFB 4Y1FA 5D3QA 4MQFA 3NUQA 3CJQA 3DR5A 4HAYA 4IXNA 4QDTA 5G41A 4Z1MD 3WLHA 2EG9A 1HORA 4EPYA 3D3QA 2Q3JA 4YRLA 4U63A 2G76A 4KO1S 3ZI4A 4B0OA 2CB9A 2LDXA 1F8FA 1KHHA 2Q1SA 2VNHA 1N2CA 1H5NA 3IOEA 4FOTA 3IX7A 1Y34E 4DE5A 1C9MA 1SUFA 2W4IA 3R7FA 4MW0A 1E18A 3LLSA 4P58A 2RGUA 4F4JA 2VAXA 5IX8A 2PLRA 3F1KA 5BSUA 1RLIA 4G6ZA 1GU0A 1IDN1 4WK2B 4LF4B 3AR6A 1WKBA 1TU3A 3VUFA 3ZGVA 4JI7B 2CK3D 4POOA 4B2IA 2VJYA 4LZPA 4LS3A 1MF7A 4P82A 1BG6A 1K1EA 2CXUA 1JR3A 3BMOB 3EFHA 1E4EB 3LT5A 4AJ2A 4O4HF 2PYZA 3EARA 3TRHA 2Q07A 4N5IX 2JLCA 1Z4NA 3D5TA 4CDMA 4ZQBA 1AHNA 1DZIA 4CM8B 2EKLA 1KMQA 2XPCA 2C4NA 3F9RA 2PUEA 5F51A 2OECA 4JNCA 2FN7A 4F3YA 4L5IA 4YCCA 3DP9A 3PXXA 5EXXA 4WECA 2P9BA 2DWCA 1A2OA 2I29A 3O1JC 4BB6A 3GLIA 5KTSA 3QKSB 4E5KA 4E5YA 2IHVA 2D4AA 2PE5A 4YRQA 1A7UA 4A5OA 2OP1A 3X1WA 4QGSA 2FJPA 1ZGZA 3EDOA 1NASA 4J0CA 5DSZA 2P65A 3ZHZA 3T15A 3O3NB 3ACBA 2YC2C 1WA5A 1EX7A 1TIPA 1AUPA 3Q10A 4MUNA 3OPYA 5IC6A 5KTNA 1I1QB 1EB8A 1QSGA 3GBSA 2PRZA 4ROSA 3R75A 5BWCA 3EGDA 1RKXA 5BYJA 2CFOA 2PV7A 3FYTA 3ZVNA 3UMJA 1QC5A 1TZCA 2EZTA 2GM4A 4R6XA 1E3WA 4NCHA 2F48A 1VPWA 3P2MA 2ZW9A 3D2BA 4L78A 4GR9A 4MKXA 3RBZA 1ZEMA 4F9TA 3BG5A 2DR3A 3E9DA 1UQRA 4JJ6A 4L4YA 2WQ6A 5UKDA 1N1MA 3U4CA 3UW1A 2WUDA 3KQQA 2MSNA 2OCXA 5HYVA 3VH4A 4UU8A 5IAEA 3LP5A 2VPPA 1KI1A 1CEQA 2P0EA 1BN7A 2W8BA 1U8AA 1JT2A 1MFZA 1YVDA 3AF1A 2NO0A 3K4HA 4YNBA 1I4DD 3VH1A 3EH2A 1A4XA 2JD1A 5LLDA 2BF4A 2PZFA 5HW0A 1GN8A 1IXSB 4IEEA 4O4IF 3THSA 2WYIA 4UMVA 2WTEA 4H4EA 3V1KA 1OOEA 1L6RA 1TUIA 1S1CA 3DKRA 5CPFA 3WYFA 4B5LA 2X7JA 2DU8A 3DEHA 4NEGA 5CYPA 4CM4A 1KK2A 2X3UA 3LUDA 4C0HA 2O0LA 3QNUA 1OTYA 1FSSA 2QTAA 4WKNA 1TM2A 2A9QA 4INAA 5JY6A 2QRLA 3B2EA 2WUGA 1QONA 3PRYA 4V0OA 1XQVA 1U3FA 1V47A 1EB9A 1SVOA 3SYMA 5DYTA 1EFCA 1TO2E 2R1VB 1HOXA 1U3WA 3CSUA 4KW7A 1T9BA 1X14A 4LX8A 4ZCLA 3W1WA 2RBEA 3L8YA 4JVLA 4D2IA 3GRFA 4C06A 3OCUA 3D1VA 1JR2A 3DXYA 1A8QA 3VVCA 1JZQA 1JWLA 1MH1A 4CM6A 5FTJA 5AVTA 1MW8X 1G38A 2YXPX 2TECE 4AY5A 5C53B 4OP2A 1JEEA 4NRDA 2DTEA 4KSCA 1H23A 4R1NA 4R16A 2X0DA 1F4PA 4Z9FA 1AQJA 3C3JA 3H7IA 4NG4A 4WVFA 1NNI1 4IYJA 4KO3S 2GN9A 3N7AA 3PDIA 3PXAA 2AW3A 1QC5B 1TXGA 3H6HA 4EG5A 4ZTZB 1YFLA 4Q00A 1B76A 1YA8A 2BSAA 3R7DA 1I4LD 2EJTA 3DCIA 4HDSB 2GETA 4QGHA 2CMFA 2AUNA 1K3FA 1BCRB 1ZSVA 3AP2A 3I9KA 1DHTA 3HZOA 2O0MA 3NYRA 2R86A 4NMHA 4Y2SA 3ZD6A 4BQSA 4RPLA 1U9YA 2ZR9A 4DZTA 1HX7A 4TUYA 2A0KA 1TPYA 1HDXA 1DTSA 4FGUA 1OVGA 4OMCA 3HLTA 3WLMA 4EKEA 4FE4A 4W9NC 2OHVA 2F1RA 3OHMA 1UJ2A 4MP3A 4RM3A 4MAFA 1ZNXA 1CXZA 2PL5A 1KP9A 3P9ZA 1X1SA 1W9MA 1BGXT 1WCIA 2AMFA 3VNRA 3IUSA 4U2CA 4DF3A 1D7AA 1XTPA 3MBKA 3PQFA 3RROA 2DQYA 1V4VA 1W1IA 4OHVA 4NCJA 3S1AB 1U8CB 1GTZA 4PYMA 1WSBA 3CHYA 3K6RA 4TVKA 1CJUC 1ZO8A 1GQFA 1XZHA 2AN9A 2NXJA 2RHLA 1ZGJA 2WM2A 2PNFA 2B82A 3KKMA 2BFEB 4OAPA 1T5LA 1WE2A 4PX3A 4BZPA 5A4MS 1N5OX 1AD2A 2WJGA 1KOLA 3EAGA 5BSVA 3GA5A 1AKEA 1SBNE 1HT1E 1Z5PA 5JLJA 1N5LA 1TEVA 2ZSAA 5I8ZA 3KKPA 1JILA 4BWGA 1SELA 2WJ4A 4KMRA 2YIVX 3CW8X 3DVAB 4X71A 5J1TB 1KMMA 4Q4HB 4U7JA 2A59A 2FQYA 3HLYA 2OL4A 1JE0A 2OG2A 3JAMA 4EX6A 2R8BA 2IITA 3TSOA 4QPCA 2ZWIA 4EDHA 1NJSA 1N0UA 3PFBA 5TE9A 4B3MB 3LUJA 5CCBA 2UVPA 2A84A 4JI3B 2JFPA 2Y6VA 3BGIA 3JWIA 2E18A 2O2CA 3KBOA 3DBRA 2ZLBA 3AL2A 5JSQA 2VTVA 2WF5A 3PCTA 2DWUA 4CNBA 1UMCA 4EENA 2IS1A 4FDMA 1TJPB 4YRGA 3BJEA 3NO4A 2G1PA 2DFLA 2OYSA 2PAFA 4GM1A 4HL6A 2FWAA 4YR9A 4MUHA 4BFZA 3ILYA 5KREA 2AFHA 2JCYA 3Q7RA 3FGPA 2VPZA 4RVGA 2OWEA 4ZCPA 1T9HA 3BJRA 4J0GA 2VS1A 2PMDA 1ZOIA 3E8MA 1DAPA 1R4AA 4BDTA 1JIKA 2HLNA 3TZKA 2BZGA 1BDHA 4FW9A 1NPDA 1YR7A 5JPIA 3HFSA 4KR7A 1P1BA 3O84A 5AK5A 2YQZA 3A1SA 1NQVA 1M8PA 4KIWA 3OH8A 3N0VA 4MIOA 3EK2A 4FFBA 4XRGA 5HDBB 3B6MA 3NGXA 2EEPA 3OJWA 5E6UB 2FWPA 2MOKA 2FR0A 1QV9A 1I7LA 1DKUA 1S9DA 2QP3A 3LHIA 1DOHA 3F98A 4PZ9A 1Z2OX 2WF8A 1SC3A 3ZS8A 1C1DB 2GS9A 3SIWA 2D7JA 2B3DA 2W6MA 5E9QA 3HK2A 2XUFA 4D9HA 4U0JA 1A7AA 1D09A 1PL7A 1U1GA 1V9CA 3AB8A 2OB1A 3EXIA 3CISA 2RH5A 4MRSA 3HQ4O 3JZIA 3BMNA 4ZYZA 2YV1A 1EDBA 4P0TA 4PSAA 3T3MB 3ZI0A 4CGYA 2PVCA 2HO5A 1BJKA 1KAMA 2GHTA 2XOEA 3KHTA 1CVIA 2ZUEA 3UEOA 3DE5X 4W6QA 1XLTC 4YMSA 4QBKA 2XAAA 3EF0A 1CD5A 3M3HA 4MH0R 4D4JA 3AVQA 4K6HA 1I1HA 1P1FA 4HQOA 1UBNA 4NI5A 3UHPA 1T5HX 4KLRA 4EZBA 2QBYA 2W58A 2Z2YA 2GNOA 1J4AA 2ISSD 5IDYA 1OX4B 5K4HA 5DASA 1DIHA 1QZTA 1E5DA 3I8OA 1NW9B 4XX0A 5TEVA 721PA 2JLZA 4N76A 4ZU3A 3TRFA 4GSKA 1TT5A 2H17A 2QVYX 4L0DA 2J09A 1MO4A 5DX0A 3S5JA 2Y66A 2QN6A 1X92A 4EYEA 3SKXA 4LGVA 1ECBA 3GEHA 1JJAA 2F90A 3D31A 3P4XA 1ZJZA 1IJBA 1FLVA 2AJDA 4MWZA 4XIFA 5HCNA 3PD0A 4PSDA 5KQGA 3L07A 2YXNA 2DEUA 4JB0A 1F7UA 2O7QA 1H4SA 3NHBA 4BRSA 3CCFA 2PR2A 1HSOA 2W2KA 5EEHA 2W42A 4MIEA 1QFJA 1NLMA 1Z0AA 2DBYA 2HLHA 3MZ0A 1XO1A 4S1WA 4WNCA 1R66A 1P0PA 1ESDA 1UKYA 3CIFA 4DMRA 3WTBA 3T99A 1T15A 3UTDA 2VNJA 3WOVA 2R00C 1U2GA 4NSNA 3M0EA 5DLQC 3ZH9B 3QVTA 1U5CA 2GYWA 1FB5A 2VBGA 3IVMA 4K86A 1GT91 2V6BA 3TBHA 5IN4A 3V1UA 1NF9A 1B7GO 1NV8A 4S1TA 2IPAB 3EH1A 4G67A 2CBGA 2PNJA 2KM1A 5EC8A 1S3SA 5KBYA 3PHGA 5BR1A 4PCUA 1TYAE 5DLEA 1KETA 5FNVA 1YK1A 4EGAA 2BRUC 4LHVA 3LRXA 2FX2A 5IS2A 4H7IA 3KSMA 1MJHA 1YOBA 2B4QA 1ZI6A 3HZZA 3FPJA 4X0EA 3DH0A 3KLNA 2EP7A 3A14A 2GHRA 1CUFA 1HMPA 1VFPA 1CIPA 2F43B 3IA7A 2AL7A 4UEKA 4UCFA 5FFFA 3LUFA 3U7QB 3FPLA 4MDEA 4WERA 4GOLD 1ZIYA 4L57A 4ZEWA 4JP8A 3C15C 1EFKA 1U3VA 2FWMX 4BVKA 4REQB 4G0WA 4B3JA 3D6AA 4W5NA 1NF8A 2WOJA 4L2IB 3LVRE 4X8OA 1A9OA 3KRTA 3I5UA 2VT6A 3SBXA 2C9YA 2ASVA 2PU7A 3L6UA 3TI7A 3I23A 3IHWA 4BVLA 1E92A 1MVLA 3L6OO 4MXDA 2HJVA 3VSCA 1XMSA 3WADA 3IEXA 2KLHA 1N8KA 3MMXA 1QKJA 4OL0A 3SMVA 4A3SA 3C1TA 1U6JA 3WFJA 4TLDA 4EATA 4PN7A 1M2NA 3LLUA 2JVJA 1EP3B 4KODA 5CJJA 5DOVA 3K6SB 3AESB 1TPZA 3H83A 4B74A 3B12A 3K1TA 4XQ0A 5H0IA 4AD8A 1NJ5A 1MGPA 1ZGCA 1VLLA 2BZSA 2AQIA 3EZXA 4ZOEA 2OMEA 3STWA 1Z29A 4WJLA 1WD7A 5CM8B 1R27A 1SUBA 2B5OA 3NEJA 5CVEA 4YRJA 1QIMA 4DRZA 3W0LB 4FNAA 2PFGA 1QHHA 3JAWB 4BL5A 4NS4A 2Q8PA 5AKGA 3L4BC 1XE3A 2CLSA 3CGWA 4RLQA 1LH0A 3L43A 4WPGA 3JQGB 5G4KA 1CE8B 4FR0A 4XD2A 5AT1A 3THRA 4E21A 3IQWA 1TIBA 2UUCB 3AJAA 3HJGA 1MDBA 1VSUA 4XR9A 3G9ZA 3ABZA 5L3SB 2HHHB 2FDXA 2PN1A 4HXEB 3QOXA 3NPAA 2H0RA 4AW9A 1QO7A 4GXRA 2M6LA 1M0EA 2WWXA 1KJIA 4RV9A 2IK8A 3EJWA 1L7XA 4GI1A 4DJAA 4CF7A 1JZTA 1W0KD 3IR5A 3QU2A 4IX1A 1B3RA 4FW8A 5TJ9A 5FFNA 3TE6A 2HMSA 5ITSA 5G0WA 4ZN6A 4JN6B 4IHJF 1C1XB 1SULA 4NCKA 5HM6A 1XTQA 3K1JA 3F5DA 5EJ7A 1CUWA 1EZZA 2XUJA 3KDAA 4RKWA 1AKWA 3G02A 4P83A 3QXSA 2FZEA 2ORIA 2Q41A 4GI7A 3ZIUA 4D5EA 5KU7A 5ILOA 2V0GA 2O8BB 3MLBA 2QAIA 5TDHA 2C9DA 4G5SA 3I9LA 1JGTA 4O4LA 4ZRDA 1XN1A 2G1JA 3QUSA 4P3YA 2VJAA 4A15A 4OQ4A 2ZSJA 1L4FA 1AS0A 1NI4A 5A7GA 2XXJA 4G24A 5AHXA 2XUQA 2GSWA 4K1LA 1I80A 2Q9BA 1JHUA 3PUXA 4TX1A 2C31A 3RSQA 4D0SA 2G36A 1H0SA 4G5FA 5KCZA 4X62B 1H2WA 1M1YE 1MCZA 5U1PA 4HDKA 3WJ7A 4HFMA 1RRCA 4FNOA 3FDFA 2DJ5A 5HNKA 4B31A 1R4MA 4H7JA 5G3YA 1OA0A 1OLSA 5KVSA 4QXMA 3HJFA 1KF0A 1PBNA 1U1EA 3B38A 3OZWA 4JB8A 4G23A 4OK6A 3LO8A 2VWHA 3SE0A 4JIGA 2Q6KA 4BWFB 1PKEA 3RSHA 2R97A 5K0SA 1TF2A 5E7IA 3FCSB 2X4IA 2GZRA 3L7MA 4FJ0A 1DTEA 4PC7A 2GZ3A 1SCNE 2C42A 3A9VA 3CJTA 2NU8B 1I5EA 3DD5A 4MRVA 5DBHX 1XZIA 2PGOA 2X8BA 1GZ3A 3AHEA 2WFMA 3OJ0A 3OQIA 1XEXA 4KXUA 2B1IA 5DI9A 1P8JA 2FY8A 1WZUA 2IY7A 3RI3A 3SG0A 3DHEA 3JWHA 3IS3A 3AJEA 4CU5A 2ZEJA 3JYNA 4JROA 1E59A 2R96A 3A31A 1LC3A 4XDZA 2WWWA 1VE1A 2ZJ2A 4D9GA 4R2XA 3PFWO 3GEDA 4KXYA 1YC2A 2HN9A 4L15A 2VQ6A 2W2QA 3PGXA 1GXSA 4OQXA 5EI5A 4YT5A 4G9BA 2QPAA 4P3KA 1N5DA 2FFJA 4OHXA 3OLYA 1YQQA 5ES4B 1ACJA 4X85A 4ZK2A 2J6IA 2GEUA 4FNMA 2DTDA 1VIMA 3NUGA 4BO6A 2NZXA 2GXAA 2A1UB 1H2YA 4OREX 4NNJA 3DW3X 3N39C 3ZDBA 3G1WA 1JWAB 5AKKA 5JI2E 2GERA 4FUQA 3ZQJA 4YRIA 4B85A 1EDEA 1W1UA 3TL2A 2ZB7A 4ALLA 5CB8A 4ZU1X 4DCJA 3Q7TA 3EAFA 5CR9A 1M8FA 1DWQA 1NU8A 1ZD4A 3GV0A 1E62A 4Z51A 2HSJA 1GEGA 3FDXA 4R7GA 4EA6A 1FTSA 3ENQA 4KWCA 3H5NA 4BNDB 3MD9A 4Y1GA 1CQWA 2JD2A 4XYLA 1IEVA 4KVAA 1QQ7A 1MXFA 4C76A 4C2TA 1QP8A 4WLOA 5KTYA 3A1NA 3RIEA 1P33A 1P75A 1PJZA 1G0OA 2XRFA 2O7SA 1KI9A 2YWRA 4AUMA 3OZVA 1IM5A 2QTMA 4RA6B 1JWBB 1ORTA 3TLGB 4ZVPA 3FCOA 4PYOA 4DDVA 1SKBA 4PNEA 1M1XB 2VIIA 2ZT8A 3H1AA 3INGA 1XT6A 1U2DA 3VPDA 4CM9D 1JAHA 4QWMA 2YCBA 4FFPA 4GGMX 2EFGA 4ZVQA 3GLRA 1W581 4KLAA 4ZEVA 1I8TA 2B0JA 1RPZA 5AI6A 4K0KB 2PTHA 2Y93A 2ORVA 1X7DA 2QGNA 4ZP1A 1N32B 1R6VA 3RAGA 3ZDRA 5JYDA 1ST2A 4RCZA 1XTZA 4FGWA 2CNOA 3WLTA 3GLSA 3VISA 5JARA 5LYJF 4LZNA 4Y6RA 3QVGB 5T57A 5IJ0B 2WZCA 3SIPA 1UPCA 2HZBA 3EC2A 2VF5X 2I4TA 3H87A 3RVNA 3AO0B 1QYDA 1HE2A 4ZAVA 1TMYA 1FRZA 2XGGA 1OLUB 1YIAA 4YQYA 2FDCA 4NFSA 2BISA 2FOIA 3V4VB 2BI7A 1N9ZA 2EJUA 1YB7A 3NOVA 5BT9A 5IARA 4B3HA 3W5UA 1R74A 4C0BA 1SHJA 2D2VA 3P0JA 5JG7A 1U2RA 2ZJFA 4WMLA 2EHJA 5EHQA 5K8UA 3FY4A 5HCUA 5CX1A 3GAAA 1YMQA 2E4YA 4KN5A 4KR3A 5DZSA 5BQ5A 2FSVA 2HIGA 2I2AA 4R84A 2GEVA 1K8QA 5JYCA 1H3EA 3BGDA 1DAFA 1LQTA 3DKPA 4QXPA 1IOZA 4BUZA 3FDZA 4INOA 3BREA 4JODA 4MVJI 4TQAA 3TPZA 4YV7A 4ZI7F 3P0IA 3B3JA 1U3TA 3FJYA 1C30A 1RRFA 2ZU0C 4XTCS 1Z7WA 3PVZA 4RUKA 4M87A 4UPEA 1HA3A 2YV4A 4LXIA 4CQJA 3SDBA 1LPBB 1DRVA 5DBFA 1CY0A 2NO7A 3RVLA 4IMJB 4KEAA 5LYJA 4UU0A 1VB5A 3UMCA 1G5IA 1RYDA 2Z3ZA 4GSLA 4AZ0A 1V4BA 2FOXA 2O50A 4LDZA 4XB1A 3Q3HA 5IP5A 3TTVA 2IYUA 1DDIA 2X8AA 1ESEA 1NHWA 1W35A 1YB5A 3SQMA 1WXWA 4M3NA 5GM2A 3Q15C 2D1QA 3TXYA 2IL1A 4Z2YA 1TYDE 1EFRA 2WZQA 3AEUA 3G6KA 2OXCA 5JAOA 1E1MA 2GK6A 2MWMA 2YX1A 3VR3D 3R7WB 2GFIA 3LBIA 4Z7JA 3K9LA 2VAMA 4GW3A 2R9VA 3ZCUA 3FOAA 1JZSA 4UE2A 2H2FA 3BRSA 5CIWA 4PPFA 2NNWB 3LNCA 2H1OA 1L4YA 3RSCA 5FR2A 1B14A 4KLCA 1J1IA 3BYZA 1VHTA 4FS3A 3H1EA 1E98A 1IHYA 3RS8A 2F9FA 5J40A 1TRHA 1YVRA 4EKNB 1P0CA 1F6BA 4Y0AA 3A4IA 3PUJA 1VSTA 1WHSB 3B1WA 3IALA 4FOPA 5HF8A 4LHXA 1PO7A 5F35A 4DJEC 3DUFB 1Q50A 3BKWA 2VP0A 3PENA 2SKDA 4U8GA 4EL5A 1HE5A 3CWCA 4OXQA 5CXSA 3A27A 2Z5GA 1S01A 2BR5A 2IOYA 3DLIA 3SR3A 2J9GA 3R9XA 1N2SA 3JQAA 3MTGA 4ZI5A 4MRMB 2IF0A 1M33A 2IYXA 1WLYA 4N40A 4U8HA 5L4SA 2JLVA 4A36A 1ZUNB 2EWVA 4CN9A 1XROA 4UBOA 3AG5A 5K4AA 5A7HA 2UZAA 4GX1A 4OQQA 4HV4A 1PJ3A 4PZ0A 4MKIA 1B0AA 3STYA 1HG0A 2DWOA 3C5EA 4G0UA 4L5BA 3CF4G 4OBWA 5LFAA 4AO6A 3IP5A 4ZRMA 1VJGA 3KLPX 2AK2A 2WHRA 1D9XA 1RAGA 3LXXA 1ZVMA 4FQ5A 2EOAA 4CKEB 1C0LA 4DR3B 2IX9A 2GBCA 5EXSA 1QLWA 1QIGA 4C43A 4LC9A 3NLLA 4P4GA 3TFWA 1KH1A 3TJZA 2CW5A 2TYSB 3U3DA 4BX0A 3B20A 2OGTA 5CYFA 4IV0A 3GP8A 2R2GA 3ZHYA 3L6EA 4NESA 1K2VN 3UAVA 3BXFA 3FHJA 2Q46A 2C7OA 1QVRA 4OQPA 1KYQA 1U11A 2R11A 1FFXA 1VGQA 2RK3A 5M3BA 4E33A 1HE3A 3TVTA 4C0SA 4KJXA 1OZFA 5NLLA 1TEHA 3WGGA 2P68A 4DWVA 1SC4A 2VUTA 4Q4JA 1ZHHA 3MJVA 1V8OA 2FTKE 2OZKA 2ZWAA 4QBFA 2PSDA 2YRFA 4MV7A 4UCWA 1RYZA 2EG5A 1G2PA 1UL1X 2DC1A 3B51X 1QP7A 3SOZA 3KEQA 4H1VA 4LQLA 1RQNA 1V1MB 1ZMBA 3BBPA 4C2BA 2AF3C