2WM8A

Crystal structure of human magnesium-dependent phosphatase 1 of the haloacid dehalogenase superfamily (mgc5987)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GTENLYFQSMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAGNESIUM-DEPENDENT PHOSPHATASE 1
publication title Crystal Structure of Human Magnesium-Dependent Phosphatase 1 of the Haloacid Dehalogenase Superfamily (Mgc5987)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12689 Acid_PPase Acid Phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wm8A00
3R4CA 1WR8A 2BDUA 5A3SA 1ZRMA 2HCFA 2R8ZA 4CF3A 4Y3UA 2CFTA 2DQSA 4KNVA 1YNSA 4KN8A 2CFRA 5ALOA 1N8NA 2QYHA 4OFZA 2G0AA 5FP0A 1VFPA 1ZD2P 1U7OA 3K1ZA 3EPRA 3OCWA 2NO4A 2C4NA 2YJ4A 2ZBEA 4Y2RA 3DAOA 1NNLA 5ALHA 5AVUA 4PNHA 2HF7A 3N5KA 5AM2A 2G09A 1ZOLA 2HF2A 2MSNA 1EK2A 4MWOA 3AR6A 4Y2QA 4L57A 4YIKA 1RC8A 2JAOA 3NASA 2GHQA 2C8LA 2D2VA 4DFDA 2EAUA 2AMYA 3QUTA 2FDRA 2WM8A 3J7TA 3M9LA 3I28A 4IFTA 1ZD5A 3AR2A 3NALA 4YCNA 4EZEA 4L6CA 5AW4A 1ZRNA 5AW2A 1ZD3A 4XE5A 3NAMA 4J03A 5ALFA 3OCXA 1ZD4A 2EARA 3E58A 2O9JA 2ZOSA 1K1EA 1T5SA 4FE3A 3U26A 1Z5GA 1TA0A 2YMLA 2WF9A 5AI8A 5AVXA 4UAVA 3WK4A 1L7MA 2YMQA 4BX2A 4NAVA 1U7PA 2ZXEA 4Y2SA 5ALLA 1NF2A 1VJ5A 4UMFA 3SKXA 3WKBA 4EX6A 5AW8A 2RBKA 5AKKA 2GHTA 1O03A 2AH5A 1Z4KA 2HX1A 3L0CA 5AKXA 3SMVA 2G80A 2I6XA 3EF0A 3N28A 5T41A 4YIHA 3VAYA 5ALNA 4ZEXA 4FYPA 4OCZA 2B8JA 2ODAA 2P9JA 2RB5A 5ALXA 2IOHA 2IOFK 1J8DA 3FVVA 2G06A 2C8KA 3OCZA 3W5CA 3CNHA 2P11A 1Z4OA 1Z4QA 2EATA 1LVHA 4HGNA 3U7FB 3ONNA 3SD7A 4UW9A 5IT0A 3ZVMA 3L1VA 1N9KA 3AR8A 2WFAA 3I6BA 1VJRA 3ZWDA 2RAVA 5ALJA 4EENA 1SWVA 2YMPA 5AKYA 3OTQA 3BA6A 4AP9A 5ALQA 1RQLA 5AI0A 1L7PA 4XPZA 2GO7A 3HLTA 1XVIA 3OCYA 4UU0A 1KYTA 5IT4A 2CFSA 3L0BA 3WK5A 5ALDA 5AKLA 4KNWA 2B30A 3GYGA 5ALVA 3A1DA 1RMQA 2FI1A 1S8OA 3ZTWA 1TJ5A 4H1WA 2B8EA 2YMMA 2X4DA 5AI4A 1Y8AA 1XP5A 4KX5A 5ALYA 3IJ5A 2I55A 2W11A 5AW1A 4DWOA 3QYPA 1Z4PX 4KX3A 2JAUA 4GIBA 1U2TA 4IG4A 2R8XA 5JJBA 3KBBA 3QU7A 2OBBA 4B6JA 4HGRA 1T9ZA 1TJ4A 2IOFA 1X42A 2YBDA 1L6RA 2ZG6A 5AICA 3ZI4A 1YS9A 3DV9A 3WKEA 3KC2A 2YY6A 2HI0A 3L0YA 1IWOA 3KOOA 1QYIA 1TE2A 2PR7A 3M1YA 4UM5A 5AW7A 1AQ6A 4KYTA 4BYGA 2BY4A 3MN1A 2FPUA 2HHLA 3UMGA 3WGVA 4HGPA 1YDFA 1SWWA 3S6JA 5ALGA 4F72A 2B0CA 1Z4MA 3WKCA 3WK7A 4EELA 3ZVLA 2G08A 5ALKA 1WPGA 5ALIA 3QU5A 2FPRA 3QXGA 1RKUA 4XQ0A 3QU9A 4HGOA 3DNPA 1RLTA 4YH1A 5AK5A 1SU4A 2CN1A 4C4TA 2HSZA 2G07A 3PCTA 4HAIA 4NABA 3RFUA 2Q4RA 4YGYA 1Z4IA 1Z5UA 3IRUA 3NRJA 3FPSA 3L8FA 3A1CA 4AS2A 5ALWA 3QUBA 3W5AA 2QLTA 2PKEA 2IYEA 3AR5A 5ALUA 1YV9A 4I9GA 2HOQA 2NYVA 4Y2YA 1U2SA 4QJBA 3ZX5A 3ZX4A 3QNMA 5AI9A 3TLMA 1EK1A 1Z4JA 4Y2XA 4Y2UA 4DCCA 1F5SA 1Z4NA 5A3QA 3FM9A 5ALEA 2YFYA 3MMZA 3R09A 4UMDA 3B8EA 2PQ0A 3EF1A 4MUMA 4NV0A 4FFDA 5AKJA 5E0OA 3UMBA 3WGUA 5AW9A 1RKQA 3IB6A 1J97A 3MPOA 2WF5A 4BEVA 4G63A 5ALZA 4I9FA 3B9BA 5AK3A 3U13A 4GXTA 4YCLA 3FZQA 1LTQA 2WF6A 5AVRA 3ZWKA 2JARA 1Q91A 1WVIA 3W5DA 4AS3A 2FPSA 2Q5EA 3ET5A 5AK6A 2C88A 5AW0A 2MU1A 2AUTA 2ZBFA 3L8GA 3UMCA 5AW5A 1TJ3A 1WZCA 5AHXA 3N1UA 1S2OA 3N07A 5ALPA 1RKVA 1ZJJA 4YCMA 3I76A 2HEGA 1PW5A 2P69A 2R8EA 1ZS9A 1JUDA 3BWVA 4UMEA 3L5KA 5AM4A 5AVTA 4UM7A 4G9BA 1NRWA 3A1EA 4UU1A 5AVSA 3PDWA 2I33A 3ZU6A 4C4RA 2OA0A 4CE6A 1RMYA 3AR7A 3I1YA 4O8CA 1RLMA 3PGLA 3W5BA 2YJ6A 4C4SA 5AVZA 2I34A 2OM6A 3KDPA 3SHQA 1QQ6A 3FGOA 3QGMA 1CR6A 4E88A 4Y2JA 1RMTA 1QQ5A 2WF7A 2GFHA 5AIAA 1RPZA 2O2XA 4CF5A 1RQNA 3L7YA 2RARA 3D6JA 4UMVA 1XPJA 5AESA 3AR9A 2G1AA 4OHFA 4EX7A 3ZTYA 4NWIA 1QH9A 3ESQA 3OPXA 5ALSA 3OCVA 5AKHA 4UARA 3RF6A 4DW8A 1MH9A 1CQZA 1O08A 2C9MA 2P27A 4JB3A 2YJ3A 2FEAA 3WKAA 3NIWA 3FPBA 2HO4A 4HGQA 1L7NA 2VKQA 1QQ7A 1T5TA 3WKDA 4UAUA 5AIBA 4Y2TA 3SKYA 3L1UA 5AM0A 4BEWA 4UATA 4JDPA 2W43A 2ZBGA 5AM1A 3R9KA 3U7HB 5AW6A 2I7DA 4BNDA 3E81A 2B82A 4NFLA 3OCUA 1Q92A 2FPXA 3F9RA 2FPWA 4F71A 1L8OA 5AVVA 1L7OA 3ESRA 1YJ5A 3QUQA 4QQFA 3MC1A 4Y2VA 5AI6A 4XOUA 2IA5A 2JGAA 1U02A 3E8MA 4RESA 4BBJA 3EWIA 3A3YA 4Y2PA 5A3RA 5AVWA 3AR4A 1RRCA 2WF8A 3CZ4A 2W4MA 3WK6A 3N8GA 3SLRA 3U7EB 2FUEA 3KZXA 4UASA 5AKGA 3NUQA 2YJ5A 3ZUPA 4EEKA 4ZEWA 4BX0A 3ZVNA 1Z88A 3KD3A 4RETA 4L6AA 5ALMA 3UM9A 5AVQA 5AI5A 1FEZA 5ALRA 2YN4A 2HDOA 1L8LA 4J2TA 3E84A 3SF0A 4ZEVA 3L8HA 3HYCA 3ZW7A 3QU2A 3B9RA 3QLEA 3QX7A 4OD0A 1YMQA 3QUCA 5AK4A 1RDFA 2GMWA 3AR3A 5AM5A 2ZBDA 1Z4LA 3DDHA 5AKZA 4CNQA 4CF4A 2B1QA 5AM3A 4BNDB 3U19A 5AW3A 5AVYA 5AKIA 1RLOA 4BKMA 2R8YA 3U7GA 3ET4A 5AKEA 5IS2A 2NO5A 4HYTA 3WK8A 2AGVA 2JAWA 3ED5A 3PGVA 4BX3A 3QU4A 2FUCA 3NANA 2BDEA 5ALTA 3WK9A 3P96A 2Q4TA 2WHEA 2I54A 2OYCA 2B1RA 3L8EA
chains in the Genus database with same CATH superfamily
3F6SA 4DR3B 4ER6A 3NYRA 4F86A 2O2ZA 1G291 2XNDD 1TFRA 3AY7A 3VYUB 2VPPA 3WMGA 1IEQA 2H29A 2ZRLA 3UNXA 4C0JA 3TQCA 3IHTA 2G88A 2WT8A 1LDGA 4AWAA 3IAHA 2FN9A 2X2FA 3II6X 3FNBA 4EJSA 3CX8A 1QGZA 1NXXA 3EZ6A 4X8HA 1VFPA 4WESA 3LP5A 4Q1DA 3TRKA 3TXAA 3UMJA 1DL5A 2WJPA 3MHPA 1EQUA 2X3UA 1YRWA 3AB3A 1PJ2A 4BUJA 1LSJA 1OZGA 1VJDA 2OQVA 1SXJD 1R3UA 5TMDA 2XTNA 5K3BA 1NDQA 1IBSA 2I4TA 5A6SB 4Q47A 5KJFA 5KNDD 3IVMA 1DC8A 4OVKA 1L4YA 2HF7A 1M54A 1A04A 3RAPR 4LQ4A 3GRYA 3A9UA 2AG5A 2C2YA 3KKEA 1JTFA 5JS2A 4BJHB 2FW1A 4RVFA 3ORHA 5A06A 3UMYA 4UBJA 1E89A 4Y2QA 1U99A 2O0KA 4L57A 2IHTA 4X7BA 3T8YA 2JAOA 5BW5A 5LQUA 1RXWA 1OVGA 2WVGA 2D2VA 3IIKA 4YAOA 3L1HA 4JT9A 1E2FA 1EDZA 1W1UA 2JFYA 1XDUA 3JQDA 4LVUA 3VV3A 1YS4A 4O2BB 4EZEA 4FZ5A 3D4NA 1A82A 3K9WA 4Q7QA 1ZD3A 2QX4A 2RH4A 3PJDA 4L4YA 4LCEA 1RI1A 1BTOA 2WABA 3P2IA 4JAVC 4Q37A 2H2HA 5TF0A 1E6LA 2A33A 3OCXA 3KO8A 2H4XA 3WRYA 2XE4A 3UBMA 1TPZA 1O0BA 1DC5A 3PC2A 4GOLD 4I14A 4AYWA 4AJPA 5K05A 2IDJA 3AXSA 1OBVA 5BWMA 4TT3D 1HA3A 3MAGA 3EZYA 2Q0SA 1UXOA 3WWPA 1M9NA 2PRIA 2R8RA 3IQZA 4DLAA 4EGJA 3T5MA 2RCYA 4LOHA 1NF2A 3N6XA 4AY3A 4PYIA 2F8LA 4FFVA 4D4HA 4LKOA 4YASA 3LLSA 4C0BA 1DEOA 2Q0HA 1HYHA 1UPUA 3KFVA 4M1OA 2HA0A 2Q0QA 1RBMA 2GASA 3NPAA 2RGAA 3L8YA 2AD5A 2FPPB 1H42A 1YZFA 4GM1A 3BOSA 4N5IX 2GCOB 3ROEA 4YRRA 4RGYA 3U37A 4GM4A 2FN3A 4P4GA 3AJ9A 2RB5A 4LWZA 4X7PA 2H1HA 2F3UA 2O50A 1KE2A 3FNHA 1J0BA 2G4CA 4JA0A 5CT9A 4F1KA 1A5AB 1T2VA 9ATCA 4G1BA 4X64B 1ZJWA 1WW2A 1W5AA 3T1TA 2XODA 3QBEA 3HABA 4GICA 4E07A 1MOQA 2ECOA 1ENYA 2I3BA 1V26A 5AHOA 4G41A 5LP6F 4DYVA 2ORVA 4Q6BA 1RIFA 1KH3A 2ZYWX 5K4AA 3OZDA 3KYCB 1LWOA 3K1AA 3MS7A 1TC1A 5M34A 4CQMD 3ZWDA 1PD0A 5CA0B 1OI2A 2YRXA 1ZINA 4B2IA 5JS7A 4CL0A 4Q15A 4F21A 4UCWA 5B6IA 1INLA 3DKIA 1NPYA 3N8KA 4PSAA 5AKYA 3I4LA 1CUUA 4E30A 3A37A 2QV7A 3V97A 1Z0KA 5A6VA 3KLOA 2ZQ5A 3A04A 4I3FA 1XR3A 2I65A 2HSGA 2W0MA 3HH8A 4JROA 5BVGB 2CLHB 4C5CA 1M72A 2ASEA 3WO1A 3WDLA 4R68A 1G4UR 5DE3A 5DTEA 4KR6A 2H92A 3HWWA 4HPWA 3AC0A 5FTNA 5HFAA 1J99A 2BMDA 4EYEA 1S8OA 3AKCA 1NAHA 1GPLA 1RZ3A 2JATA 4LYGA 4TMZA 5EHNA 4CEIA 4ESEA 1L5YA 3JVEA 1FRZA 1US8B 3N2ZB 1NVVR 4W5JA 3O31A 1W9MA 4NICA 4AJ2A 1MDFA 3EGOA 4JYMA 3ILHA 5JLAA 5CCBA 3RHFA 3U0VA 3IDOA 1U3VA 4MQ5A 3OJFA 4UKDA 1Q50A 2XUFA 3WRYC 3CVXA 2JAUA 3HBNA 4GIBA 4HWSA 4EA6A 1IXSB 4FCCA 4COKA 1G8PA 1DTWA 2I7TA 3MZ0A 3VM6A 4B6JA 2VRWA 3BRWD 5DM1A 1FYVA 3DOUA 2WHPA 2PIAA 1DBVO 3OJXA 1X13A 2CEAA 2DPHA 3A6DA 3LQRA 4DMGA 5MGNA 3S81A 4GM0A 4YAFA 3WNBA 3NOXA 3DV9A 3TLEA 4ZI7B 3DOIA 1ZL2A 3DE6X 3KC2A 3UTDA 3L0YA 1XXHB 2NAFA 3OPVA 3OZFA 3TI7A 1WJGA 2NU7A 2PBLA 1HDEA 2VWQA 3BIWA 5DBFA 3SZGA 3FDFA 4G4SP 1DLJA 2AOTB 1S89A 4N5LA 2FEOA 4DWJA 2AEFA 3Q9UA 2FF5A 3AI2A 3LAWA 2ZWMA 1G2QA 4R2HA 1O97C 1M0SA 3FSEA 4FBGA 4NEQA 5A5DA 1O9HA 2ZW9A 4G89A 1DX9A 3ZGLA 1XZHA 1E79D 1X8LA 3A0RB 1RAEA 1OXXK 2IGBA 3EASA 1DKLA 4CTNA 3OEHA 2PSHA 4ZOAA 3TDMA 3WIUA 3AJAA 4P84A 3QU5A 1HL7A 4W7HA 5DISB 3E0QA 1G6OA 2CK3A 3A58B 4FR0A 4PBTA 4XQ0A 3GEGA 3IPYA 3MGBA 4D1YA 4DIOA 1AN0A 2PX0A 4RKWA 1QC5B 3SXUB 1VMEA 2X4IA 1EDBA 2WTMA 3FDXA 2O4UX 1GVHA 1UIRA 3FROA 1CF4A 4X9XA 1P4RA 1JEDA 5BSHA 1K89A 2D7CA 4GPEA 1HDRA 3W9YA 4E2YA 2D6FA 1SUSA 1NULA 4J0FA 4R05A 3W5AA 1YDGA 2PKEA 1KP2A 1P18A 3AFMA 4AN4A 3OMWA 4ND3A 1X2BA 1FY2A 4AY4A 3JU3A 3TIFA 5A9RA 5HTOA 2XZTA 4CMIA 3BBPA 3G5LA 5CDHA 1NVWQ 3SFVA 4DTIA 1XRSB 3DKRA 1QWSA 1UBOS 1IUPA 2C84A 3CX7A 4WZAB 3SBOA 3P0RA 5CURA 3U4QA 1CZNA 4F91B 4P4LA 1VPWA 4JI8B 4GOMD 1ORVA 1LPNA 1ZMOA 3MWEB 1GL3A 2ASVA 2JGMA 2WE8A 4FWIB 4KDRA 3RVDA 1UPTA 4CL8A 4JR0A 4EYGA 4MDFA 2AKEA 3PDIB 3EMBA 4RGBA 2JJ2D 3UMBA 1M2WA 4Q66C 1CRPA 5REQB 1B2RA 1EVIA 3CGWA 4KL8S 3M7IA 3OZSA 5KDLA 3MPOA 2QYTA 4IMPA 5F1PA 4YP9A 2CC2A 5HRUA 3CVVA 3K0BA 1KFCB 4RVGA 4I9FA 4ZPJA 3RJTA 1KYVA 3WQRA 2ONCA 5LNK6 1P91A 3C1OA 3LX5A 1W0KA 2GUWA 2VP4A 3K6KA 5G2OA 1DAKA 1GUBA 3HRKA 4DSAA 5TGTA 2VK8A 4PRKA 1M2KA 1OLXB 1FS5A 4UD6A 5A05A 5HUJA 3N0RA 3T3NA 4U7JA 3OJ0A 5JXHA 3GR6A 4JI2B 2FPSA 1RI3A 4FYXA 4DDMA 3PVSA 4LRUA 4JI4B 1D2RA 2P6MA 1AHNA 1V96A 4UJ3A 4RIFA 4DA9A 2PEZA 2PCLA 1P9RA 2DQKA 1WV0A 4IIJB 2ZTSA 1SKUA 5J43A 3O94A 2FZWA 5AHXA 4E33A 3LHFA 4NNOA 3R5SA 1NW9B 1SCQA 1K7XB 2ZPUA 4LJ6A 2HA7A 4G0NA 1YZGA 5CNJA 2QTVB 1EGAA 3DMHA 3MEQA 3GRZA 2Z6VA 2O1WA 3LCUA 5F4ZA 1V35A 4L5JA 5D5HA 3TECE 4D57A 5KUTA 1ID8A 2JKYA 3H3XA 4JC4A 4L28A 3Q8MA 1XCMA 4IF6A 1GZ6A 1SELA 1RI2A 1K8QA 2I3DA 4RCZA 3SJZA 5BN3B 4YPFA 1NKVA 2C5BA 3WAJA 3C7KA 3NU1A 5CXXA 3THWB 1K9VF 1ZVJA 3VTFA 5BWCA 1CNMA 4F3TA 3C70A 5DNVA 1N36B 4QFBA 1QXSA 3CZAA 4Q4LA 4X8MA 3VBEA 1JDTA 5ECGC 2DETA 2FMTA 4X97A 3DV0B 3QXCA 2I4OA 4LJ5A 2IXGA 4JI1B 4ODIA 4QVKA 2CFOA 3VO1A 3L93A 1OIXA 4LAFA 2AF4C 4IDFA 1YC2A 5E2IA 5DNUA 3EVCA 2CE7A 4GKVA 3IKTA 3WQSB 4K2AA 1PT9A 1YASA 5J2UF 1QORA 3EW9A 4YXWD 1ZU4A 2PZAA 3DYIA 4QHTA 1ZR4A 1Y34E 4DJJA 2XR1A 3KDPA 1J42A 4C88A 1Z56C 4BLTA 3GNSA 3N3AC 5LQDA 3RS8A 5G02A 4MV5A 2BHSA 5F5LA 4C4AA 4D5GA 4BZXA 3QEMA 3FTCA 3N0TA 5HE9A 3S5UA 2EJBA 3P4YA 5AH0A 2IELA 4WE3A 1BC5A 1LPAB 1NJ5A 4MVJA 5SZIA 5LMUB 3ESAA 1FXSA 4KR2A 1XALA 1PJRA 1A0OA 4LC1A 3DMFA 2D1FA 4ZT3A 1M1XB 1EK5A 1Z16A 3I09A 3N53A 1FXWA 1RPJA 4PIVA 4BRWA 5BOVA 4DWVA 2L42A 3M2PA 2E85A 2AR7A 3NIDB 2RBEA 1EFPA 5DHUA 3VVBA 4ZCMA 2GEUA 2WP8J 3PUJA 4P3YA 1T3ZA 1VJ0A 3CCBA 4EUFA 1VMIA 5IDXA 1RXUA 2H0RA 3SQOA 2GAFA 1R1DA 2QGZA 4JUFA 4NWIA 4XPIB 2P4UA 4KUEA 4ZT6A 1U7TA 3LQFA 3JWHA 4TV8B 3SDBA 4EFDA 4KXXA 5FBVB 5BVHA 2BR4A 4UXHA 3UCEA 3A6ZA 5BUZA 5C1DA 1MH9A 2FN7A 2E89A 2VRBA 1SVWA 3Q3EA 1E4EB 1RHKA 3WL4A 3GLIB 4PRZA 1I3MA 2GARA 2BAGA 4ZVMA 2PUCA 1D2GA 2I71A 4RF2A 3JARA 4NU6A 4XCQA 2R6CA 3PNYA 5BNZA 5FV7A 1MP0A 4MV6A 1NWCA 2PD4A 4RE6A 4B7ZA 5CCXA 1JVNA 1HTWA 3H17A 1M0TA 4C29A 4LXXA 3EPKA 2VR1A 1SBTA 3M81A 3ESCA 4J90A 4IYJA 5KX5A 4DR6B 3CEMA 1QH8B 2FB9A 2AMFA 3SBEA 1IQ0A 3A9WA 4W9NC 1DJPA 2VBFA 1P4AA 2ZDQA 3PFNA 1XDGA 3DZ8A 1SQFA 3LT4A 3UANA 3E82A 3DFUA 3L7NA 1WV1A 3DW3X 4CDMA 5AW6A 3FBWA 3M6VA 3O1HB 1F0YA 4A92A 1YZUA 3BE8A 1V3UA 4OGLA 3P9QA 2HKIA 3U4AA 3IOMA 1LXCA 4OBEA 4TTPA 1MZPA 5EHGA 2FN4A 1B3RA 2JGEA 4M7OA 4JR1A 4AICA 3K0FA 1TQHA 2WRZA 4P0TA 4Y2VA 3JYPA 4YDRA 1WHTA 5TB5A 3WLPA 4DR1B 4PV7A 3RIYA 1PI3A 5LA6B 3JQ7B 5NLLA 3R8CA 4PZ0A 3S8MA 3M1AA 4E4RA 3EGCA 3PQCA 2AA3A 1I3CA 2PZLA 1HLFA 4HEJA 3NAQA 3SFZA 1NE2A 2Q3BA 4ND1A 4JB0A 4ZVUA 4F7WA 1O0SA 2RHGB 3GUCA 5EP1A 3G13A 4EA8A 5CYPA 3GLHA 5FIUA 2AJDA 4KH0A 2H31A 3N8GA 5ED0A 3WK6A 3C87A 4CR7A 4QUDA 5MF6A 1RM5A 3DW1X 2R4QA 3CPEA 2IV7A 5AKGA 3V4LA 2YCLA 3MS4A 2P9HA 4KI7A 3DFIA 1FYFA 1IY0A 3ND7A 1J2RA 2RSLA 3TLYA 3V9AA 3MK31 4AZWA 4UTPA 3VO9A 4B7XA 5B7PA 4J7CA 4CG2A 4HYQA 5CB0A 5DV9A 1H3FA 3W8EA 3VR1A 5EMKA 4AJ1A 5JDIA 4L5YA 1QCZA 4LPKA 3KU1A 1ZU5A 2FG5A 1C1YA 3OF2A 5CLGA 2E82A 5FWYA 3ZIUA 4DPMA 4KQFA 5F3WB 2ACEA 3D4BA 3E15A 3T3IA 3PPVA 1JDBB 1BEZA 3I2FA 3CWQA 4Q4JA 5KQRA 3T34A 2ZRFA 5H81A 5D7NA 4QLBA 1RDFA 4BQQA 4CIYA 2BELA 1M6NA 3DDHA 5T4HA 1P61B 4FFMA 3T5AA 4CNQA 2KPOA 3VXKA 3AESB 3OFND 4ZO6A 1ACJA 1OC4A 4H77A 3U19A 4EUSA 4M2LA 4OLAA 2P9BA 2Y4OA 4HAYA 4C05A 4ZZ3A 2QX9A 2FK8A 2VKTA 1NBWB 1D8TA 2W6JA 1PS0A 2IYUA 2JAWA 2B36A 2OXCA 3P0IA 5P8WA 3OI7A 4KG7A 16PKA 1C7JA 4UNQA 1YD7A 1QLHA 4C2TA 3GP3A 1ML4A 2YNMC 3EQ8A 2Q4OA 5GV7A 4Q18A 3H6HA 1FDVA 1M83A 3VUFA 5K0CA 4BNMA 1LPBB 3WIOA 4J9VA 1N5IA 1AKWA 1RXCA 4N5NA 3PUIA 1EM8B 4HAUA 2QMHA 3RNLA 3GGJA 3JQPA 5JRDS 1IPEA 1VJTA 1NW6A 1WR8A 5G1OA 2GESA 1JBQA 4TM7A 1G9SA 3AEXA 1OU0A 2DECA 3PKIA 3W8NA 3KUUA 3L49A 4PIMA 3PBKA 3THOA 5KYYB 4Y3UA 4K9PA 4EUHA 2B21A 2CFTA 2BM0A 4A8HA 3O4HA 3FE2A 4MUNA 1OWNA 3VZRA 1G3RA 3ORQA 3FUVA 1X8XA 1FFEA 3K05A 1KDTA 1S7GA 5LDDC 3D8BA 2JLWA 5F2KA 4HAZA 4E1VA 2CY0A 1SB8A 1O94D 4O4JA 3KDSE 4P5PA 1TM2A 4RXMA 3O91A 1I6LA 5IWCA 1A88A 1UOPA 2KLHA 1UJNA 1A97A 2QY6A 2Y05A 4IKEA 4ON9A 1NMSA 5DHRA 2J32A 3FSRA 3X1MA 2QXYA 5ICMA 2I9PA 1VIVA 1XVTA 1JJVA 2JF0A 3EDCA 4B8YA 1WOYA 4EQ6B 4K9SA 3VPFA 4JI0B 4QXAA 4IWYA 5GJBA 5CHYA 1EK2A 4V39A 2R1VA 3Q10A 3T95A 1C30B 1MB9A 2DBYA 2IHVA 3SC4A 3QLTA 5FOWA 3BJRA 4KACA 5FBRB 4JB8A 3CH7A 5B3JA 3DEIA 4AMGA 1I5OA 1L5GB 1ZNZA 1YA8A 1OSNA 1UMDA 5JDIC 1R0KA 3PZRA 1AUPA 4DXHA 2Y1OA 3CY6A 5HMLA 3THXB 3NTXA 4KHZA 2G1PA 1XJ5A 2ATXA 3KAJA 1UEJA 4QBHA 4K9RA 3RHZA 2GAAA 3V8MA 3Q7TA 4L6CA 4A27A 5DNYB 2X0DA 4EA9A 1PSZA 2G40A 4F3RA 1OXSC 1U4NA 2GOYA 5T4BA 3UH0A 2QQGA 4CWAA 1U1GA 1GLGA 1CRQA 5ALFA 3D3WA 2YX1A 4MGIR 5G1NA 4TYQA 3JAKA 3BEOA 4NCIA 4ARZB 3E8SA 4J3NA 3V33A 4ALLA 3Q9NA 3EVGA 2OBXA 4R1QA 2GAJA 2OB1A 1T1EA 2R7LA 3U26A 3KIPA 4PHCA 3KELA 1JAIA 2IS4A 4UAVA 4TTRA 2LCIA 5JECA 3I8SA 4BX2A 3QPWA 2JZCA 4WEQA 3WKBA 3SKXA 5JI2E 4FLEA 1GT6A 3M83A 1P0CA 3N8HA 3FFBA 2W6MA 2GHTA 5I9IA 5KDOA 5EIHA 3UK6A 5JXIA 2V6MA 3CLKA 4EJSB 3TQRA 2P2LA 4EPVA 4W5QA 1J0CA 3OPYA 2WIGA 3H65A 1GFSA 1K08A 2VJCA 1U2EA 2ZU0C 2HU7A 3HU2A 2C57A 3LE8A 4CDRA 1MBZA 4GG1A 3KSMA 2RK6A 4IXTA 1AXGA 2JAHA 3C7TA 3IILA 2J9FA 4L8FA 1E2HA 4DHWA 2Q4EA 2K4MA 1FYWA 3NETA 4RHXA 5D1NA 5KWIA 1LFAA 4BKQA 3KPYA 3IURA 4DQLA 3HG7A 4XWGA 2Q5LA 4YV0A 4RGVA 2QX6A 4B6EA 2IU6A 4YQEA 1LLUA 3RRZA 1S2LA 1SD5A 5C8VA 5I9MA 3T5DA 2I1VB 1GL9B 3KZCA 3ORYA 2SCUB 3AUXA 3ZW8A 2DX7A 4RFSA 2FZLA 4B17A 3WLIA 1SCJA 4X62B 2RAVA 4FHFA 5L3ZA 2BF4A 2PYZA 4MCIA 1ABFA 3ZV4A 4DIEA 2AI3A 4BNIA 4OSOA 1C3OA 3SOZA 4WY8A 1U11A 3CH4B 3V1MA 4AWBA 2W83A 1A96A 2BYTA 1TQ8A 3DC7A 3AFNA 5FOQA 2XTJA 1FIUA 5B3JC 3U09A 2GDZA 1VCIA 2XYPA 4V0SA 1HDIA 4OMDA 4IXDA 4FM9A 1WSAA 2H06A 3UGTA 5IKXA 6REQA 5HJ5A 3ZTWA 1HDOA 3WMXA 4BNJA 3TTSA 1ZG3A 1EGHA 1RP7A 3PFKA 4D98A 3W5VA 5K0EA 2JK1A 3M4JA 4PF1A 1HRKA 3N76A 3ZCSA 1JQEA 3QSGA 1W4RA 4ED9A 1VHDA 2H52A 3H2YA 3VGJA 4Q5IA 3W8FA 4TYWA 4AN0A 4BO3A 2IIPA 2BD0A 1E6UA 5DSXA 1W75A 3JQGA 4PQFA 5FL7A 3RFTA 2MYTA 4ZI2A 1O77A 3QU7A 2QSJA 1BVRA 2H18A 4Q1AA 1TJ4A 1VGRA 3RROA 1NVEA 2OHXA 5BR4A 4UVGA 1TGYA 1LNSA 4TMYA 4DDHA 2SKEA 3PPWA 2GRUA 3WL6A 1UK7A 4REMA 1QP7A 3KOOA 2FXIA 1G20A 3TEMA 3ZLUA 1USIA 3DZCA 4RA6A 3DZGA 1KDZA 3AM5A 1ISRA 3UB4A 4JLVA 4GI2A 2BY4A 3CUTA 3ZHTA 5IYZB 3W9SA 4OUKX 2XZDA 3PWKA 1G21A 5FAKA 2VHJA 2VTVA 5BSMA 3QV2A 5FFMA 1J2UA 3K1AB 5IJZA 4NZ9A 1YHNA 2VH2A 5K2OA 3BQNB 1G0NA 3DTNA 2F00A 1CIJA 3HPRA 3ND5A 2XCRB 3DB1A 2JVIA 1CB7A 3D4PA 2CLOB 3D59A 3L4BA 1KZYC 2IEZA 5FTJA 3WXMA 1Y7PA 2MCFA 2O3SA 4Q82A 2RD2A 2B9VA 2W6NA 3ELBA 4M86A 1SQ0A 4EI8A 4K9LA 3MBKA 5AK5A 1U0FA 2NYRA 3ZHCA 4CG3A 1R6AA 1KO8A 1XU9A 2NV2B 2XECA 3EVAA 3IAM1 3KR0A 4TMXA 1G6KA 2VUSA 1CZRA 2KJQA 2ZULA 3EN0A 4FCWA 4NABA 3EXHA 5EKTA 3SQXA 3CO5A 1BKSB 2W2MA 4MVJI 4UBKA 3HO6A 1QFZA 5TSDA 1ODIA 3LK6A 1ZJ4A 3PR3A 3GLGE 1XQYA 3CRVA 2HY7A 4GZLA 5LCXA 3WDSA 4CEIB 1AGPA 1Y3AA 1G5FA 1Y4UA 3D6AA 3PXDA 2Q1WA 5CA1A 5HR5A 5EPEA 3H9GA 3IP8A 2K5UA 1P7CA 3E1KA 3KQLA 4AD8A 2E21A 3MT9A 4P08A 5FI3A 4MVYA 4EBFA 1ZFNA 2C4TA 4DARA 3F47A 1Q3KA 1DTWB 3K6JA 4L4XA 4B33A 2OKCA 2UUCB 4RZIA 4MYDA 6ADHA 2YFYA 4OOFA 1A9XA 1UQUA 1XSEA 1Q5PA 4MQ4A 1MB0A 1IQUA 2WHPB 4MUMA 1KZ9A 1F0KA 3SYLA 4ZK2A 1QYVA 3L0OA 4MUGA 2VUHB 3DOOA 2NTVA 2X2PA 3HY4A 3UK7A 1OFTA 3WB2A 4KHPB 4I5EA 2Z5GA 2NU7B 2Z30A 1O2DA 2FJ0A 3EA4A 1V5EA 2R5NA 3LUHA 3PXXA 4PZUA 5KVCA 2A92A 3U3ZA 2GPWA 4F7DA 4YRIA 1NV9A 3V7YA 5KNCD 4XUEA 3R40A 2NQ2C 4M8SA 3K2EA 3USCS 1TRKA 2FYTA 4BX9A 2M1ZA 4DS3A 1VHQA 5BURA 1D0VA 3ZWKA 2XHZA 3SMQA 4INAA 2C29D 1ZMBA 2XKJE 3HJTA 1F6BA 1VP9A 3QOWA 4ZVTA 1KSGA 2C2BA 3VJKA 1GRRA 5ERXA 3GY0A 3FKSA 4GMDA 4NJOA 1P9OA 4D9MA 5IW8A 1RABA 4DZTA 2LZ0A 2HSJA 2JIQA 2IXTA 5UKDA 4A0GA 1TLTA 5E7IA 5AK6A 4UUQA 5KDDA 2C3PA 4YRPA 2Y0BA 1K8YB 1TJ3A 1U7UA 4KNYA 1FTQA 1RP1A 5BSFA 3LECA 4QT0A 1Z6YA 3ZXSA 2YIJA 3L7LA 4D8WA 2M1XA 4PNZA 3WNZA 1LW7A 1RPNA 3LTNC 1E98A 2WYOA 1OFIA 3I05A 3MLEA 2O23A 4L0DA 4A15A 1Q17A 1AHIA 2CNLA 3H4TA 3PHBE 3A7DA 2EVWX 4IUDS 4KYUA 1DO2A 3AV0B 4X84A 4CMIB 2IZ7A 2PAAA 2HTEA 1I7DA 4NU8X 1AZSC 4IGKA 3HEMA 4HJXA 4C1BA 2YXNA 5EZQA 2IY8A 1NUTA 1ZI6A 2P69A 2C1ZA 3CNEA 3U4QB 1LRKA 4HADA 1JUDA 3EXHC 4N41A 2A5JA 2FWNA 1QFJA 3CVUA 1UEIA 5AVTA 1UXIA 3ZE2B 4A8JA 3DLAA 5AVSA 2IDKA 1YIOA 1E9SA 2LVBA 4MUFA 2I80A 1L5NA 4AAYA 1URPA 3A1UA 5LOVB 2J5KA 3DZJA 4NARA 2ZUSA 4ENWA 3ZK9A 3EPLA 3ABSB 5JQWA 1SK9A 2FK7A 2G1KA 2OL4A 4MWBA 2A5FA 3T0GA 2EKBA 5AVZA 3ZE0B 3MMPA 4JUCA 5EESA 3VOBA 4LY0A 1CPYA 5FPSA 4B74A 4ZMSA 4U7FA 1PQWA 1U2QA 4G4SO 1NXOA 5CIWA 5KYNA 2C5LA 3QE3A 3UOGA 2RK3A 1IUKA 3QGMA 4B3MB 4KI0A 2R7KA 1J20A 2WTBA 2AG6A 2WQZA 2XMRA 4OFXA 1D1SA 2QTFA 3HCBA 4MWSA 4YC7A 3NBAA 1NTOA 1KSHA 3F98A 3G9QA 1CS0A 1OASA 4YUWA 1DKPA 3R0ZA 4PSUA 1ZW1A 2ZAYA 3BE6A 4JN6B 4L08A 2WQ6A 3CU5A 3IXMA 5JHGB 2P65A 1TYBE 1VL5A 1IZYA 2JGRA 1CQIA 1OBHA 2I7CA 3DUFB 3OZIA 1FLNA 3KL4A 5EXPA 4EG7A 1YBHA 1GR0A 1NA5A 5E7MA 1KQNA 3STUA 1SGWA 1VCNA 1IN8A 2YOHA 5KMGA 1VSTA 2C07A 3GQBA 5DW0A 5F1KA 2C61A 3W7VA 4CIBA 4E51A 3UGKA 2QZZA 2Q1UA 2Y0EA 3OHMA 3G6KA 1IQPA 1E1NA 1E5QA 1PDVA 1YK0A 4P4UA 2EP8A 1A95A 5BQ3A 5CFNA 4B1FA 3VYTB 1QRSA 3IESA 3MCUA 2XGGA 3RF6A 1VYTA 4WBNF 2GN8A 2A2ZA 3B2EA 1NT2A 1ONBA 2O7VA 1RYNA 2OHFA 2ZRBA 2XJ4A 1QP4A 5E7QA 3HMQA 1D0SA 2C9MA 1HQKA 2LKDA 4ISBA 1RACA 2PBFA 3FPBA 3GZJA 1UOQA 1SZPA 2QRGA 2ZITA 3T61A 1EG7A 1Y5IA 4B48A 5ED4A 3B1YA 2HIMA 3KSBC 1C7FA 1VPLA 3BYZA 3QVKA 4IHJB 4Q1FA 5G4KA 3VPCA 3ZE7A 1E3EA 1XEWY 4PAQA 3B53X 1ZO8A 1XV5A 3S3TA 3CGGA 4KPUB 4C1NA 5I7UA 3GT3A 3QPUA 4Y1EA 3PNBA 3GFGA 3Q6MA 1SVNA 2A67A 1JSXA 2Y92A 1OZHA 3NV9A 3QVSA 3SEFA 4RTQA 1G2OA 1OJLA 2YYAA 1HLGA 1C8KA 1WMSA 3NHPA 3OZAA 2V0CA 3PFBA 2H54A 3V8EA 2ARKA 3QEMB 2V6BA 3PQ3A 2NXWA 3FJOA 5MHTA 4ZAZA 2P8SA 1L7OA 4P92A 2AS0A 4IFBA 4WOBA 3UMSA 1W4ZA 4F5WA 2NSDA 4QQFA 4JKOA 3VR5D 5AI6A 2GLUA 1XZMA 3CZMA 1K6JA 4N3AA 5ARDA 1QBKC 4QWWA 3TZHA 5JD6A 1U5BA 2CMGA 1EFPB 2J6CA 3NHYA 4FYHA 2IBMA 4S0XA 5BP7A 4Y2PA 1Q0UA 1S3GA 1VHWA 3THSA 1V2GA 2IT1A 5EJ7A 1VCOA 2VF5X 1TMOA 1I3LA 1D4ZA 2JAQA 4PLTA 2VJYA 2XITA 5C5IA 2ODPA 3P9KA 3H4IA 2YYYA 3W8DA 1O96A 2G17A 3P45A 2IYFA 1XX6A 3AUSA 3Q5DA 1CQPA 5BVHB 3FRHA 3KTAA 4AVYA 5DCYA 3FMFA 3OOSA 1RLIA 1E6WA 1XTJA 3LP6A 2ET6A 3HP1A 1E92A 3ZU3A 2PMDA 3JARB 2X1HA 3WYNA 5G0WA 4MQUA 3S1LA 4B0PA 3Q9LA 2FFQA 5JTTA 4J8PA 4CRWB 1GILA 5KSYA 1QTNA 3OPYI 2J3HA 4UZEA 5B58C 1OH7A 2I03A 3B9RA 5KX5B 1H05A 3R3SA 4GOOD 4LNUA 3QLEA 4EPTA 1NG1A 4YCBA 5JS1A 2CLMB 5CPFA 1YMQA 2LTAA 2HDHA 3O0TA 3FYDA 2HR1A 1V45E 2WW8A 4ARSA 2WWFA 1Q1EA 4KXWA 4AUKA 4MV1A 2ON6A 3KQOA 2PFGA 2W71A 2ZBPA 2YYZA 5CXSA 3VPXA 1QR6A 5DIZA 1XQVA 4DLXA 4NMWA 2CLSA 3W3ZB 4I4CA 4BKMA 5EEGA 1D2AA 5AKEA 3WZLA 3RUFA 3OCCA 4FP9A 1Y5LA 3LPNA 5JG7A 3VZCA 4TYNA 3L7CA 1ML3A 2XMSA 2YHBA 3DHEA 3K0FB 2CMDA 3ROPA 1N1DA 2PLNA 1RCFA 2PGDA 3VYWA 4F5YA 3FAZA 3M6FA 3RIXA 1GIAA 3DZDA 3NEJA 1JLKA 2FUCA 2YWEA 2IWRA 4D9JA 2X6RA 2DR0A 2GBCA 4Q02A 3MT8A 3Q6IA 1UBRS 1DAIA 4R7GA 1WZIA 2F67A 5JXJA 5C1OA 1JALA 3TD6A 2B1GA 5FXMA 4QUKA 3AB8A 2IEYA 3BD7A 2DP4E 3RSOA 1T15A 2P8JA 3PF8A 3R4CA 2HO5A 1EWYA 3EVDA 4ZYXA 3GLHB 2HCFA 3AJRA 3GJ4A 5JNVA 4GP6A 3RSZA 4YP1A 1GOTA 4CMHA 1DPGA 4NOMA 3KQHA 3KUCA 2NQ8A 4PLHA 1XKXA 3UCXA 4CM3A 3WB9A 3SWWA 4OFZA 3LLVA 2V9ZA 3OFSA 1QNLA 1BMTA 1B8OA 2XIQA 2E6KA 1DO0A 5J58A 3CNNA 1JB1A 2A78A 4FYWA 4Y9DA 4YLEA 5CTAA 3ENKA 4RF5A 5FWYB 5ITVA 5EWLA 1IB0A 1BE8A 1Z8FA 2Z1NA 2M98A 4PNHA 5ESWA 5AVUA 2RGXA 4QHYA 3JQBC 1FDSA 3GXBA 4PPFA 3C5VA 4H7KA 1MTOA 1J07A 1PN3A 2OLEA 2WHYA 4ETMA 1NXTA 4BS9A 3GGCA 1VHLA 3AWDA 5LP6A 4HXEB 1ONNA 4X45A 2RKBA 3LJKA 2PE5A 1KHTA 3FFWA 1UT8A 4L5CA 3RTGA 1Y1RA 2W2XA 3MCTA 2O0JA 2ZTLA 3MT7A 3WL5A 3ZTTA 1BHQ1 2B78A 4BNTA 3PI7A 5BMVA 3CE6A 1G8AA 1VG0B 3G49A 2YW9A 2V7BA 4UVHA 4X24A 2REXB 4KN6A 1T5OA 2O2SA 3NALA 1DELA 4L02A 2OV8A 1ZAYA 3FPLA 5KTKA 1M73E 3CLRD 4OIFA 5A3VA 3T9FA 4DZZA 4EFMA 4HVAA 1DEXA 1UBLS 2QN9A 3MPUA 2H0AA 3PQ8A 4RK7A 1KEEA 2XVAA 2Q3DA 3H11A 2ZXUA 3B1ZA 4MS4A 3GXOA 1V3TA 1CR1A 3DOFA 4R7TA 1QRTA 3E2IA 5EXEA 4ARVA 1ZCAA 2V6FA 1BH2A 1Z75A 1C29B 4BB6A 1CX9B 2QTMA 3A06A 3PWSA 5I4KA 4ZODA 1VL2A 2R0QC 4LN1A 4NAVA 3K70C 2MYUA 1E9EA 2HA6A 1RZRD 1ORTA 3B7GA 3IV9A 3KOXA 3H5IA 1I80A 3S2UA 2KWIA 2I2XB 3PHCA 1M2GA 4PM4A 5G41A 4R1UA 3W78A 2COEA 1KJYA 2CF6A 2QX8A 5TVKA 1LQ2A 2VXYA 1T6XA 4O4JB 1P60A 4J7XA 5F9FA 3FBGA 2CV2A 1B6TA 4FOOA 4MS3A 1KFKB 2H11A 1ILWA 3RUIA 4J0HA 5B3AA 2MINA 2ZB7A 4OGWA 3DFZA 4QUJA 2IYNA 4JP2A 2BR5A 3V8BA 1LV7A 2O2CA 3G9TA 2ZRKA 3GBPA 4MB2A 5CDSA 1AKVA 4BVAA 3W5CA 2M6KA 1Z62A 2P11A 2QBYA 4MP6A 1ORRA 2IPMA 3G5MA 4YGXB 3EYWA 1J4AA 4FZVA 4HUQA 2C4MA 2E2WA 2R1VB 3UAWA 3CRNA 2PNFA 4UXJA 1ZBDA 3CF4A 3I01A 5B6PA 1QKIA 4I6EA 1YQDA 5IASA 1NAIA 5LD2C 4I2NA 4K0KB 3TEFA 1A4RA 4NONA 4EMBA 5H9VA 2WUDA 1AURA 2NZYA 3I6BA 1UMDB 4Z7JA 3GHHA 3WIVA 3OTGA 2ZIUB 2WM2A 1NVKA 2CYBA 4FR2A 2IHNA 5AJYA 1E61A 3TAXA 3X2SA 3IKLA 5IULC 1E9RA 3VTZA 3RVNA 4EENA 1PL8A 2JRCA 5EPOA 2I5PO 1E66A 3EGXA 4PZCA 4E2ZA 1BXRA 1CJMA 1P19A 2X8BA 5F5XA 3D3WB 1JFRA 1EWTA 2FRDA 3GH3A 3NATA 3JAKB 4FHDA 5LP6C 2G9NA 3ZXXA 1LLDA 1JVSA 2VBCA 2XWQA 3NHSA 3TNLA 1GSIA 3HVKA 3D43A 3L0BA 1N4AA 2WHRA 1FUKA 1VZ3A 3FRIA 2FR8A 3W0LB 3OQIA 4OQFA 1DBIA 4FLMA 2Y93A 1CUDA 1SCIA 1R12A 4IWXA 3T7IA 2CNDA 2I91A 4NV3A 3LPMA 1U0JA 2Z2YA 1WBDA 4A0FA 4QRHA 2YMMA 3K92A 1BEEA 2BBSA 3H8VA 3VPGA 4GR4A 4Q3NA 3I73A 4S0ZA 3KQMA 5IDWA 1XQ6A 2VDNB 3OPYB 1U2TA 2H5EA 2IFTA 1NXPA 1RWVA 1WCWA 3ADOA 1JKJA 1XI2A 3LHIA 3LZ6A 4RACA 4XR4A 5DF1A 1T4DA 5EC8A 4D9NA 1U3CA 5IM4F 5I3ZA 3GIWA 3QWFA 4EATA 2CVFA 1E77A 3K5HA 4AKGA 2J9FB 5K8VA 3D6UA 3OX3A 4CCWA 2YY6A 4CMBA 5HGJA 3OMLA 3ZE6A 1CUSA 1UFKA 1AUVA 1TLLA 5FOXA 2WVJA 2FCRA 3P1JA 3WXBA 2WMOB 2WFMA 3MB5A 3M1YA 2HW8A 4JYZA 2JFFA 1VE9A 5H5JA 3UMGA 5BR1A 5IVDA 2VDKB 3DD1A 3ERCA 1YVEI 2W6QA 4US1R 1AS0A 1CJSA 1PP4A 2OECA 2QTRA 3GVIA 4RFSB 1XJWA 3IVAA 3LXRA 1Z4MA 1BWPA 2AIRA 4S24A 4UHEA 2ZYDA 1L7AA 2A14A 3KJGA 3LX4A 4NDAA 1C3OB 4EEXA 1KMNA 2G08A 1C14A 2JCSA 4JEUA 2PX5A 1XYYA 5ALKA 2WD9A 4WRRA 3DL4A 2NX2A 1GNLA 1J0EA 1PSDA 4RIIA 1K0FA 2O2IA 2XH8A 3KSUA 3QU9A 4HX9A 1IFXA 1OAOA 4FE4A 4PZLA 5FI5A 3CPJB 3ZCVA 2QJRA 1JBEA 4I99A 4C4TA 1V3VA 4R3UC 2PX6A 2X3FA 3DWEX 3ASZA 5DYTA 3JSAA 5IKPA 4QRIA 4EDHA 2GZ3A 1CC1S 1GCIA 2I2FA 4GYWA 2B8WA 2Y0PA 4ME6A 1XAHA 2ZIAA 1XJQA 1Z5UA 2QSUA 1DWUA 2FGJA 3K9BA 3I2GA 3Q7EA 4MCHA 3IKMB 4QBTA 2XUPA 3FPSA 3A1CA 4V0LA 3T5GA 2QLTA 1Y9EA 2IYEA 5TS3A 3ZHZA 4C43A 4HDKA 1GZDA 1YV9A 2OP1A 1NJSA 1YR9A 5AJXA 5ULLA 3WIDA 4B40A 1SHJA 5LJLA 1KI7A 2B20A 1O95D 1WHSA 3H5TA 1H4TA 2FRDC 1IIBA 2J85A 4JIGA 1K3UB 1OJ7A 1Z4JA 3MGGA 4L8GA 5DEIA 1X74A 1F8FA 2IYWA 3DXFA 3JQGB 4MKFA 4OHRA 1FTWA 4Y2UA 7ABPA 1ZN9A 3AM3A 3GA0A 4NV1A 2OXTA 4PXAA 2FR8C 3Q15C 4ETIA 3B8EA 5EIEA 3IDFA 1JXOA 2V65A 1IM5A 2X4GA 3BRCA 3OQBA 4HH4A 2O0MA 4NJMA 1FSGA 5EPUA 3TL6A 4QEZA 3QVVA 1PQ4A 3CX4A 5B36A 1W6RA 1G20B 4OP3A 3N2KA 5EXDA 1ZI8A 4H17A 3RM3A 4RA6B 5K3OA 5J2UA 3SKVA 1GO2A 5DK6A 1QUEA 4HWOA 2VJNA 1M2OA 2CXQA 5KWSA 1G21B 5K1ZA 3QEBZ 2O3JA 5ILGA 3PGJA 3RASA 1I9CA 4IVNA 1U3TA 3E9NA 4GP7A 3TD9A 2CVHA 5JRJA 5JSHA 2BFBA 3B8HA 1N3IA 1W19A 4GPBA 3EBLA 2J67A 3IULA 4LJ9A 3ZNNA 4D3ZA 5JV5A 3DC2A 1NVFA 1E32A 4G9EA 3ZI0A 3KOUA 2PYIA 4MARA 4W5HA 1XTVA 5FJIA 1KQFA 1PEDA 2MU1A 4L9WA 1BXGA 1ZIOA 5GJWC 2V4ZA 3UMCA 4LF9B 4MQBA 4ENRA 4UPEA 4GOXA 3EXHB 4QO7A 3DCNA 4MO2A 4GLBA 3ZU4A 1YZQA 4GBGA 5DLQC 2QM8A 3G0OA 2X0JA 4LDPA 4XGKA 1FNDA 3OJEA 3FFTA 3TNJA 1PV1A 1O5OA 5CA1B 2DTXA 1N9GA 1KY3A 2PK3A 4S1PA 3CLHA 4AT1A 3FZNA 2QN8A 5GJVC 1QNFA 2PZEA 2BGJA 2HEGA 2VCYA 3H0CA 3KD2A 2ENUA 4G4GA 1OAOC 1WMFA 2XVYA 4KB5A 4PG4A 3RT7A 3TE6A 3X1KA 2B4KA 1A4IA 3C6QA 3OAAA 6AT1A 1XC7A 1ISFA 1A9XB 3P9ZA 2DBVO 4EH1A 2GZ2A 2Z09A 3F7MA 4G8JA 4IMIB 5AM4A 2VJQA 3TLKA 1UBEA 3GEEA 1CEEA 4TQAA 1P0QA 4ESOA 2DTEA 5BXYA 3BDVA 1VL0A 1WY7A 4GRDA 5LMZA 3I0MA 3NVKI 4QDXA 3UG7A 4R54A 4NP6A 3RJZA 4YV7A 3KQYA 2FETA 3I1YA 2G83A 2W6PA 5CDYA 1BQ3A 1EB8A 2FPKA 3RUCA 2WBLC 3CINA 4OP2A 1SFRA 3EEBA 3TIIA 4IIBA 4C04A 5LUBA 4MLCA 4TSFA 2I8AA 4F1JA 3DAYA 2P91A 2JI7A 1X0XA 1UIMA 2JD0A 3GCDA 4P8RA 3DZKA 3ZDRA 2PTHA 3CW8X 1QQ6A 3MSCA 2EC5A 5AQEA 3OKAA 4GX1A 1G5IA 4RK1A 4C89A 1XCPA 2P30A 4F04A 3QI2A 4RUKA 2NTNA 5BOSA 3VTAA 3GG2A 5ICCA 2EF0A 2VL7A 5B57C 2R2AA 4YMSA 3JVDA 1PEAA 5BXQC 5DHAA 3AVOA 4UQLA 2WF7A 5JAHA 2C5EA 5HPYB 2NW6A 1ND6A 4OB6A 5FBWB 3F73A 3JQ6A 4FMDB 4QRDA 4B3GA 3CVJA 1CUBA 1F5NA 3JZAA 2F6RA 2G63A 4BNGA 5JW6A 3PNMA 5FBLB 3IQFA 5A0FA 3TPFA 2JI6A 1E1RD 2HPZA 3T4UA 1NBHA 1WUHS 4X63A 5HS6A 1R0LA 1BCSA 3RUAA 1EP3B 4NCHA 5JSFA 1GSOA 2OVBA 2QRVA 2D5AA 2VUUA 3U49A 1F4PA 3LHSA 1B4DA 3I01M 4JI3B 4C06A 1WB9A 2GEFA 1VE7A 3ZLVA 2RI6A 2QPAA 4S04A 5AKHA 5JAUA 3IBGA 3F8TA 1AX9A 4BQFA 5C5EA 2VYNA 4YP0A 4PGHA 1N5KA 5A4KA 1JZSA 4EY4A 4WOKA 2OPHA 4E5KA 1R4MA 1RE1A 4NBUA 2FEAA 3RVKA 4A2WA 2WUVA 1KBZA 1PZFA 2JHGA 3T15A 1BX0A 5F23A 1TVKA 2LE0A 3VVMA 5TQ2A 1AS3A 3ROGA 3WKDA 4EECA 1Y8RA 2MSKA 3O6VA 3SOPA 4DQUA 1IMJA 2XA9A 2XEDA 5CNKA 1JHXA 1H0HA 2C83A 2HQRA 3HRIA 1H69A 4AB1A 2GM5A 4YTEA 4QL3A 4Q1EA 3R0XA 1I4TD 1JVBA 2NV6A 1W34A 3I9OA 1YVRA 4GQIA 4J3FA 4FUTA 1L5VA 3AOEA 4RPCA 3QX8A 5C8XA 2I1QA 1XYGA 1NONA 1PJSA 2X6QA 2YXEA 4G0PA 4YJGA 1Q20A 1Z8NA 3SE7A 4KWHA 1BD3A 3FPCA 4CKCB 2AJBA 2FPXA 5CT8A 6CHYA 4Z7NB 1E3MA 1DJLA 3QUQA 1CS0B 3L6CA 2O2YA 4RZXA 3UO8B 1W5FA 4I1SA 3H5NA 2JGAA 1DBSA 2TYSB 1N3LA 4FDVA 2O52A 4H7DA 3U3KA 2E49A 3I4CA 4WUVA 1WW3A 1CQIB 1Q83A 1RI5A 1Y1KE 2KMLA 4N9QA 3EWIA 5F35A 3UJPA 1QO0A 2BFAA 3ZXUB 4AX8A 4B4OA 2XYQA 2V96A 4LBWA 2YFHA 4NZOA 4RPJA 1KDPA 1FMLA 3VMFA 5KMGB 2W4MA 1JT2A 1OPXA 4NYMQ 3GQBB 1DE0A 4BE7B 3ZXIA 1D6SA 3KR2A 3MUEA 5HIAA 1H4SA 3CZCA 5LKRA 1GPNA 5HCNA 5IAKA 1A77A 2O8DA 1TFUA 5AO9A 3BJZA 4EEKA 4M83A 2Y9PB 1XZAA 3OM1A 1JDSA 1KVSA 1U9IA 3HL4A 4GSYA 2AWNA 4F11A 4RETA 4ZYYA 3IA2A 1C0LA 4J4TA 1Z15A 5E9WA 1UM9A 2QJFA 3LY7A 2VYQA 1G7SA 1SU8A 3KE8A 3NDJA 2ZE6A 3I6IA 1USWA 2OLKA 2QMZA 3IOEA 3GPBA 1O6BA 1KNXA 1IWBB 3PE3A 4G24A 4K6CA 4X93A 3FLAA 1WUYA 5IUNC 2WMDA 1HNWB 3IO3A 3IUMA 3RIEA 4OEHA 3I72A 1PSWA 1IN4A 5I47A 4MCAA 1DT5A 4U7TB 1QIIA 1P0FA 1OCEA 5G4KB 3KLNA 3C3PA 2W6OA 5AK4A 4RMJA 4BKPA 3H9QA 5BQOA 5TS2A 3EVNA 3AFGA 1DAGA 1SBNE 4URWR 5D01A 1YIAA 2C9BA 3DAGA 3NBFA 1O5TA 5E3JA 1CHDA 3A4IA 3BL6A 3DA8A 4E2WA 2OGSA 3H9JA 3IAS6 4LDJA 2XUAA 4QREA 1TOAA 1Y6QA 5DYWA 4JCOA 2JJ1A 4MTLA 3GLQA 5IS2A 1FOEB 1XEXA 4FN5A 3WK8A 4H0FA 2PDAA 1DXOA 2D0OB 4HN4B 4UEWA 3U61B 4EJMA 2PUJA 1ZXXA 4MP8A 4GUDA 1WCIA 2V9PA 3IPCA 4GWKA 4FS8A 5D51S 3RVPA 2GEBA 4A6EA 1NR1A 4AZSA 1MFZA 2QLLA 3SK0A 2A9VA 2AXQA 4AJJA 1U5BB 3IUEA 4FZJA 4J94A 5D85A 2NYAA 1A4UA 3NIFB 1B15A 2BIFA 2Q5HA 1JHDA 2WHEA 4QFDA 4I50F 4TN1A 5EJ2A 3QX9A 3WGIA 3ACCA 3AEZA 4P7GA 4INPA 3F4LA 2PMCA 4V0KA 9LDTA 3E18A 4M3NA 5FFFA 1KWGA 1EWRA 3M89A 2G36A 3HACA 3O4GA 1O96B 2XT6A 4QGFA 3O0DA 5K4HA 4D41A 2F59A 4IY1A 5GGYA 4FFSA 1GXSA 4L0MA 4KN8A 4Y1RA 4D4JA 1A8UA 2B7BA 5ECDA 4CKWA 1WXIA 2VEOA 3GEHA 3O26A 5A2GA 4QVIA 1TCAA 1EVJA 2NZWA 3K1ZA 1G38A 2VJMA 1W5EA 3OQPA 3COPA 3HRHA 4JJ7A 5LP1A 2CT8A 5IAGA 3WR5A 4GVLA 3V3KA 4B6FA 3WP1B 4MQLA 3G2NA 3EF3A 3ZDAA 2VSOA 1DVRA 3GAAA 3ORFA 4N0DA 2YHAA 3I04A 3O75A 2ZUTA 1E69A 5EMLA 3W5IA 2VTDA 4LNUB 1UMBA 1HM5A 2WEKA 3LQQA 2WB4A 3M5WA 4ZAYA 5BPHA 3AQ4A 3RUDA 5KNDA 3Q3CA 2ATIA 1KR2A 4Y1RB 1IZ7A 3KJEA 4RORA 4S3MA 1ILEA 2QAIA 5KTYA 4OLHA 3ONWA 2GHQA 5TF4A 3AHHA 2BN4A 2QLBA 2XA1A 4NR0A 5G4LA 2EAUA 3GROA 4AO8A 1SVKA 1K7EB 5DTMA 1EI9A 4LJYA 5LQRA 1T6BY 3J7TA 4A1FA 4MV0A 3IVGA 5EJEA 3UBTA 3PFHA 4G5FA 3K70B 1D2EA 4YCNA 1E2DA 1G60A 1I3KA 3ZNPA 1W59A 4CV3A 3JVUA 3ANTA 2IYLD 3CEPB 1XTKA 1AVTA 1QFYA 2CWWA 1DUIA 3CUKA 3T38A 3ULKA 2C00A 1L1QA 3EGDB 5KNBD 5ILQA 3EXG2 1VBKA 1U0SY 1ZD4A 4GAEA 4PC2A 3HJRA 3U0BA 1G16A 2YS7A 5HF8A 3ZR4B 1XU4A 2OMEA 3LBIA 1EXNA 4FGKA 1NUAA 4EAAA 4F06A 1RVDA 1QHHA 4M1SA 3HQ4O 2UAGA 1RTKA 3BM5A 5AOBA 1AQNA 1ZLXA 2FEWB 5ADWA 3R5TA 5KNCH 1L7MA 4CQNA 2I7XA 1TM3E 3EC2A 3OEED 2IVZA 1I1QB 4GPD1 1V8FA 4IIVA 1V25A 1XRJA 3C41J 1ZZGA 2VP2A 3K8ZA 3LXMA 4MAMA 3ZJYA 5AKXA 3DHNA 5IARA 5LD2B 1FPMA 1JGTA 4EPWA 2D54A 3HY6A 4K9KA 1Q0ZA 1XVAA 1LPPA 3MWDA 1SUFA 4IV0A 4ES6A 3AF4A 4MI9A 4EKGA 4C5AA 4DJTA 4EFLA 1CT9A 4O0LA 5EWLB 4PR3A 1NGSA 5ALXA 1ULUA 2V7UA 3PJEA 3H0EA 5JBNA 5KTSA 1WBBA 1CNFA 3T4PA 4G01B 3JAMA 5CDTA 1X7YA 3G9UA 4WKPA 3T9DA 1OGYA 2CZGA 3MYYA 4UW9A 5LP6B 1Z12A 4HWRA 1L9KA 2H9IA 3U4IA 3V8PA 2BBTA 3BMOA 3L6OO 2O8FB 1SVLA 3OKPA 2PWPA 3MGCA 4LEIA 5BMVB 4EHDA 1M10A 1EFLA 4LYJA 1OROA 2DGDA 4OXIA 2KQUA 5DGCA 4B71A 5CR9A 1DGQA 2G8NA 5T4FA 4V24A 1KXZA 2JZOA 4OQ4A 4QPZA 2DYKA 2OCBA 1N75A 1NNSA 2AF3C 4N6NA 1GNVA 2QMUA 4JEMA 3T1QA 1SXJC 4HDOB 2BZGA 3OTQA 5NULA 3D0KA 4RSHA 4CQMA 2ZYIA 4BNNA 1EVLA 1JHYA 2LR0A 3MINA 4UUMA 4D81A 1N2CE 1PK9A 1B1AA 3COZA 3IRVA 4IZOA 5CLFA 3U5ZB 1KEEB 1Q0SA 3IQDB 3H11B 4BEBA 4MS4B 4DA8A 4D02A 1RC1A 4ITRC 4KXQA 1IZ8A 1C9KA 4ER3A 5B7QA 1W47A 3EC1A 1GDTA 1BDJA 4YREA 2PGAA 5LZ8A 1JYFA 3O38A 1BJKA 1UP4A 1CLEA 5E9AA 2ZBRA 5IAJA 2NVUA 2BHNA 3KL2A 3R4VA 4Q34A 3OQMA 3C8DA 4TTIA 4B2YA 3QEAZ 3FMOB 2P3LA 2W11A 3NBUA 1HQCA 1VQ1A 3N2GA 4P54A 4Y7DA 2JA2A 1U3GA 1ABEA 3MJSA 1G18A 2R79A 4XEUA 3SQDA 1R4AA 1HO3A 5JJBA 1ULSA 1X92A 3BGIA 4DMUB 3Q8WA 3UAOA 2HRQA 4MS3B 1RT9A 4MJXA 1X8JA 4JP1A 1LI5A 1X42A 2MINB 3MJDA 5EE1A 5FPTA 5AICA 3EXG1 3A26A 3MRSA 2R6ZA 1J0DA 5JAMA 4GNRA 4OYLA 3BRWA 3SX2A 4R1TA 4S1WA 2E4ZA 1IWOA 5JS8A 1QYIA 5BN5A 5K99A 2CD7A 3M70A 2QBYB 2KBEA 4HUQB 2H7XA 1BH6A 3OIFA 3OIGA 2PR7A 4FMBB 2BEVA 4TS9A 2P2YA 1NQUA 3FNRA 4QXOA 4OK6A 2BI8A 1GCAA 1U0EA 3I0ZA 4KLNA 1DC6A 2PUGA 3QX3A 3A3KA 3WJ2A 4JBNA 3IVXA 1BD4A 4KE8A 3MJCA 2F1IA 2F3SA 4M9UA 4YFYA 2IEBA 3KPVA 5L4LA 3BS4A 2I9KA 5D7BA 3WKCA 3VU8A 3EGXB 1WTAA 1BXRB 2BGIA 4NF2A 1NBAA 1O5IA 5SY6A 4HEQA 1XLWA 4LZOA 2ZRGA 2C4HA 2QRJA 4JX9A 2DQZA 3L06A 3ZJUA 2QTWB 3LYAA 1U80A 3IAFA 3IP9A 3L1JA 3B6KA 2Q4RA 4YGYA 5HMMA 2CDCA 3NWJA 3OQIB 2PYDA 3SC2B 3AOGA 3BXXA 4B44A 2N46A 2QTAA 3PCXA 3KZMA 1VYUA 3RSHA 3R9WA 3I62A 3D0QA 3U6KA 4KQWA 5CD1A 2F55A 4DDTA 1T8UA 3VOAA 5IH7A 2CLEB 1POXA 1SB9A 1UBSB 2P40A 2QZ4A 4ASUA 1OT5A 2NSYA 3QFCA 3D1VA 3FX2A 3KVRA 1GKLA 4JEIA 4M49A 4CZ2A 5CDUA 1CERA 4PYNA 2GH1A 1YOVA 1O9BA 1L5FA 2W2OA 3FNIA 5C3UA 4BRSA 4I46A 1K5DA 3PQEA 1JKJB 4YY3B 1X1EA 2CMFA 1GEGA 4UMDA 4PYLA 4RQTA 4PZYA 5EUMA 4YMIA 5B55A 1KK1A 5EL0A 5EIFA 4L73A 4JMPA 5F77A 5E0OA 1PR9A 2JASA 5C52B 4OJTA 5E1MA 4LMBA 3I8OA 3AZOA 3N86A 5K3DA 2JJ2A 5T3UA 2EG9A 3RGWS 2A9RA 2AFIE 2BCEA 3WBKA 4AXXA 4AUMA 1JHAA 4B4UA 4B3TB 4OX9B 4YUAA 4H1UA 3E3MA 4FMCF 4FZ3A 3W9UA 4GXTA 4A73A 2H4FA 4OXRA 1BS9A 5KYXA 1P2VA 4XLLA 1JV2B 4ZO4A 1OILA 1R4ZA 3VZBA 1Q91A 1Q1BA 4MINA 1PZXA 4G65A 4Y2GA 1R6BX 2GZHA 5EJAA 4FJ1A 1Z2EA 3NC0C 4MUYA 5E8RA 4BQOA 2VFAA 3AVWA 2X6TA 2Z2KA 1WS6A 4B5LA 5AW0A 3RUHA 2AEEA 4OHBA 4NNJA 4BLSA 1AA9A 4MPDA 4J0JA 4UNPA 1BKYA 2XOEA 4IDGA 4NRDA 1JA0A 5L45A 1VE1A 3SQWA 2XMBA 2NO1A 2A9QA 3WWZA 1EDDA 4RHCA 5FA8A 1K66A 5CB6A 1U8FO 1P39A 3FR8A 3PR1A 2X5JO 3VR2D 5LWHA 1G7RA 1ZY2A 1SAYA 3LLCA 1YCFA 4PLYA 5A5VA 4HDKB 3ZNQA 1EU1A 3URKA 1DG3A 1PHPA 2EJCA 4GPIB 4AU1A 4DQVA 4YAGA 4DILA 3BX1A 3L7KA 4YBRA 1WHSB 2AG0A 4BPBA 3I2IA 1KRXA 1NW7A 4QYMA 2PA3A 4LKRA 2XBLA 5JFGA 5KSPA 4IH4A 3Q8KA 2R8EA 2XUOA 4FPXA 5JY1A 2BMJA 4Z4QA 2C2XA 2QL5A 2EW8A 3BWVA 1PFKA 4OA5A 2FOIA 1UBJS 1R4NA 2H3HA 1JI0A 3L5KA 4HRAA 3C74A 2DHCA 3CA8A 4NJMB 1Z3CA 4ZVSA 1NRWA 1FZQA 2I6QA 3KOMA 4NENA 1W5TA 2YJTD 3QUAA 3ZHBA 1B42A 3HU1A 4FOLA 1U90A 4R0NA 3GUHA 3IALA 3G8DA 4OQPA 3WL8A 5FX2A 1RMYA 1JF8A 3L4EA 3N2KB 1XRRA 5J2UB 4O8CA 4HR7A 3LVQE 3O4RA 4R1OA 3L43A 4LNHA 5EVCA 1PT6A 1MLDA 2WPNA 3H5RA 4J2OA 4K88A 4K6KA 2OWEA 4A0RA 5C51B 1M2OB 1NF3A 4UHJA 5F12A 3ZHXA 1NDUA 1PWEA 1G2PA 2BUAA 4YXWA 3AL0C 3NOQA 3J81k 3KQKA 4D0GA 2PL5A 4GHWA 4C20A 5BV8A 5LLTA 1MQSA 2YWHA 1YULA 1IY2A 1NVMB 5I9TA 1TQ2A 2PKQP 4Y2JA 5CK4A 5KREA 5LJIA 2D7DA 4AKIA 1OV6A 2WNHA 2RGGA 2ZRQA 1GU0A 3AXTA 4WBXC 1BXGB 5IBPA 4E5SA 1JQ5A 2PFSA 4GRAA 3KZ1E 2KW5A 5ICEA 4ARCA 1JH8A 2EFHB 2J3QA 2KSQA 2R97A 4V0ME 3GFTA 1RQNA 3THRA 3OQJA 4E94A 6YASA 2UVPA 3OZWA 3HU5A 3CX3A 3L92A 5AESA 2AMLA 1FB5A 3ER6A 5D86A 2YL2A 2M9MA 2XGSA 3WZMA 3WJ1A 2WJYA 3WNDA 4LA4A 3VU1A 3C39A 3UYKA 1ZH0A 2Y1DA 4TS4A 4KPGA 1MXFA 2V8BA 4MKZA 1N9GB 2C1XA 2V7EA 3LPAA 1Y7HA 3LDGA 3N05A 4F92B 2A9FA 2J3LA 2XYGA 3LDAA 3R6GA 4KVAA 4D6XA 2IBSA 4K81B 4TL9A 3ND9A 2YDYA 3UT0A 1C9NA 1G8SA 4DW8A 5TXGA 4URFA 1OH8A 3OO1A 1N0UA 3QP9A 1ESZA 1ZUD1 4FFBA 2X19A 1QGYA 4MPTA 5F51A 1D2HA 1QIDA 2H1VA 1DOHA 1GPMA 1YZVA 2I3GA 3AWIA 3HJAA 3N39C 3O7WA 4MQFA 5IBRA 1FYXA 4J0QA 1ABBA 1M6VA 5GVSA 4JLAA 1GVNB 2WSIA 3AI3A 5T5QA 2NXCA 2VA8A 4M0LA 1FRVA 1H3NA 4MYHA 3Q7QA 1U1CA 4WOCA 3WGGA 4AMUA 4WN9A 2XRYA 5AIBA 4XKJA 2PRJA 5ITSA 1Y6GA 4I19A 2C9OA 4C6HA 4D0RA 5BO5A 2WWXA 2GK6A 5ELMA 3VOTA 5JQGF 1XCBA 4ZQEA 1ZC3A 1D9ZA 3BE5A 1AKMA 3L4SO 2FWIA 4UM8B 4ER7A 4R8SA 3RR2A 3KYBA 4N47A 3TLAA 5B5SA 3KHUA 1X87A 3ELWA 2UYOA 3W5UA 4QYTA 1E9AA 5BOSB 3SEQA 1HZZA 4ZVLA 4YXFA 3OOEA 2VZEA 3ANXA 1Y6ZA 3JQRA 4HS9A 1L8OA 4Q19A 1PNRA 2RJNA 1E3WA 4B3HA 3GB9A 3AVQA 4WZZA 2X2OA 3NV7A 2I4NA 2DFNA 2VNAA 4NYIQ 3PF9A 3BWMA 1PHRA 2C97A 2EU8A 1R10A 2IA5A 3I6ZA 3LBYA 3LOUA 2Q7OE 1K0UA 2CCKA 3RJ9A 3STVA 1CJBA 5I7FA 5KINB 3ILYA 3LY9A 3I1JA 2SBTA 1AZLA 2FFAA 2VK4A 3SIWA 1U2RA 2FQWA 2FFHA 1L4UA 2LDBA 5AVWA 2O6HA 3TEJA 1BCSB 2D5IA 3IBFA 1OFVA 4YJFA 3TJMA 5DXJA 3ROQA 4BP3A 3QIVA 1K4KA 2QRVB 5F78A 1NZJA 2YC2C 4TYYA 1U9CA 4NDZA 3DZFA 4FSDA 2B4AA 4RLFA 1M33A 4JBYA 3LDFA 5JNSA 3P2MA 1HFEL 3IA7A 1XD9A 1QK3A 4I08A 3TBKA 4ALNA 2B34A 2QYOA 4FKBA 1NYQA 3P9CA 2O07A 3E23A 4PYKA 5BSTA 2HJSA 3WYFA 4D4LA 6Q21A 5CP8A 4KFCA 5K0ZA 2BHTA 1BHJA 2O8CA 1R4MB 5AI5A 1CVIA 2AOVA 2AN3A 4KQ1A 5HBRA 1MO2A 1N5DA 1NJ1A 3W1WA 4J2TA 4YV1A 1GPH1 3LCMA 1SXIA 1OD6A 1TVKB 5BW8A 5TQ2B 2MWMA 4G2TA 5HF9A 3HUDA 3UMVA 2PGXA 2O8VA 3FCYA 2GJ8A 4Q01A 4D9IA 5EJFA 2IK8A 1Y8RB 2XLCA 4WH0A 4B5KA 1NXSA 3M9WA 1ZHHA 2F1RA 2HQBA 1F8XA 2A1TS 2N0SA 3BF8A 3R3ZA 3RUEA 3THYA 2FLVA 3ICEA 3KKQA 2E55A 1MB4A 2FSUA 3K73O 4XGIA 2QVLA 1CS4C 4JS0A 5TPZA 2DR3A 2F64A 2OEPA 4F6LA 2IYQA 4FW9A 2WUEA 1XZGA 1NQOA 1JU9A 3CKKA 4AZ3A 4ZI5A 3ISTA 3OFNA 4RVNA 3JQQA 4TKZA 3O9MA 3ASYA 3B9QA 4HFJA 1RYMA 2ZB8A 4HYTA 3QFHA 1U8CB 1ZH6A 3ED5A 4KMMA 1R0ZA 3BERA 4TV9F 2ZAMA 1ZSNA 2ZBQA 2LRHA 4PRLA 3HDGA 4F4DA 5KKCA 2XQVA 3BICA 3F7NA 1NPDA 1AQIA 1C7QA 2VQSA 4ALMA 3JQ9C 4XJXA 4OHWA 3GUZA 3WISA 5FPKA 2FUKA 4XLTA 3P32A 2Q4TA 1JA9A 5DX1A 2I54A 1HUQA 1KJJA 2YZKA 2BC9A 4FUQA 3NDBB 4IOKA 3V1KA 2HD4A 2QVBA 3H8JA 1IZ0A 5TMEA 3GD7A 1GV0A 1HZZC 1TCVA 2ZWAA 2ZGVA 4X41A 1U5AA 1ZRMA 3RVSA 3UWKA 3VVCA 4G8CA 2VUTA 5FO0A 1OUMA 1BO6A 2HYDA 2OG1A 2EKLA 3LS2A 4DIDA 3WE7A 4J91A 2RAUA 1Z6AA 2O8DB 3KV1A 1LCIA 3HBJA 2P3QA 1KMIY 1Y81A 1M5TA 3RTAA 5LBIA 1QIHA 4LYEA 4M46A 3WG9A 5JROA 1SKQA 3D2AA 4KOAA 3NCTA 1UM9B 4TM8A 3RFVA 2EBHX 3GOQA 1B6RA 1H6CA 2Q49A 1O94A 1HH4A 1VGVA 4MXDA 3FCSB 1M0WA 1UOEA 1XCJA 3AKDA 5DSTA 1N2GA 2P9EA 2R48A 3OEHD 4FVTA 4HEHA 3OTWA 1S0UA 3KTFA 1TQ4A 2MSNA 4PBSA 2ZAGA 3R8XA 2EQ5A 1Z0ZA 4HLNA 1HNZB 3H8WA 5LQAA 4MWDA 1OWMA 1K68A 2YJNA 1YQGA 3GFQA 4EVRA 3PFIA 1H1TA 4YALA 4XX0A 4TPKA 4BVGA 3LUGA 4EB0A 3UWOA 4IG9A 3C5EA 4FGJA 1FFXA 4Y0NA 2P7HA 3LVBA 5I5GA 1XEXB 3RT9A 3AR2A 3B1WA 1JG4A 1BMDA 3SLGA 3RYFB 3TRJA 3ZU5A 3EH1A 3NFRA 1RYYA 2W37A 1C3LA 1FPQA 1UK6A 3D3NA 3P94A 4FXPA 3W6PA 3B6EA 1WCIB 1VSUA 3L9XA 4TMFA 4XE5A 3AUYA 2JRLA 3KCNA 4J03A 3TBFA 1K98A 3IMGA 4MWCA 2BFWA 4P4SA 1GQRA 3E1SA 2EJWA 4MRPA 5HEKA 4J75A 4O4LA 4LFAB 4XFJA 5AVJA 1K1EA 1T5SA 2WB2A 1U7XA 2PT5A 3T3OA 2XTZA 3GPLA 2VK2A 3V2HA 3WWEA 1HYQA 2Q6LA 3BUSA 1G8JA 2GFQA 3DAPA 5HCIA 4CDNA 1V71A 2ZJ7A 3SHTA 1WULS 1ORHA 2HB6A 5F9HA 2PTGA 4HOYA 4U5QA 2FW6A 4YCJA 1GQFA 3IT1A 1PR3A 1GXSB 1U8ZA 1Y3IA 2OAEA 4INJA 5AKKA 1PR2A 3SE0A 3T5CA 4CKWB 5K7SA 3K0SA 3OT1A 2H7YA 2I6XA 5EWMB 2PRSA 4N9WA 1JG2A 3BTUA 5IM4A 3U60B 2HU5A 5JJKA 4JJFA 2IUEA 4ZEXA 5TGZA 2VJMB 4OAQA 2NOAA 1V1RA 2EZ8A 1PKXA 3HI4A 3EX7C 2OGTA 1BQEA 3EZ9A 4TTVA 3G89A 4XGQA 2BFDA 4MLPA 1VE3A 4DNXA 3F9IA 1EVZA 1P2TA 4BX8A 1KO5A 5K0BA 2C95A 1SXJB 1QAMA 3M33A 4EHNA 2NMVA 1N7JA 1UMBB 4PYRA 4B34A 2Z57A 4ETWA 1MF7A 3LA6A 3JQEA 4TTAA 4LF8B 4BQRA 4C4XA 1NQVA 2QI9F 5JAOA 3QFSA 1QZXA 1OC2A 2PT9A 3R7BA 1VE5A 3GH1A 3QG1A 3MJEA 3P0FA 1UQTA 3QE4A 3WWOA 4JGIA 3KETA 3DHYA 3ONVA 1UFRA 2RCNA 3P9YA 4BN0A 1Z08A 3AVPA 3T6KA 4A8PA 4FFWA 5EYPA 3T7JA 3RB8A 4U9HS 1PJAA 1OI7A 1A7KA 1O94C 4I5IA 1QPBA 4JJZA 3O4FA 3VI4B 2H57A 2AQ8A 2POQX 3F7OA 4Y2HA 4IF4A 4OK5A 5AVVA 2PQMA 5DX0A 3MD0A 4JSYA 2IU4A 1WZNA 1L8QA 1SG0A 2QT1A 3C4VA 4IVPA 5JARA 3M82A 4OLFA 3DBOB 1VC2A 3EHDA 4G25A 4J0KA 4WGFA 2GZDA 4YRZA 3VPBA 3WA7A 3BD8A 2VHTA 2AUNA 2Y6UA 4JT8A 4ARBA 1WZEA 3TPZA 5ALDA 3RSSA 4BTLA 4KNWA 2JIZD 3GYGA 4II2A 1QHHB 1QH0A 3SX0A 2QV0A 2Z04A 2NO9A 4KE9A 3U3DA 3OIVA 4NMXB 3EPHA 4O4HF 2C94A 3AUUA 3KJQA 2X4DA 4UFPA 1PL6A 3CNOA 3R5KA 4F9GA 1IN1A 4ZYTA 1BFUA 1D04A 4LZLA 5SICE 1K4MA 2WAXA 3GRUA 3STYA 4L8LA 4LOLA 1SHKA 3T94A 4BO9A 4C6RA 5JWRA 1DCTA 2BCJQ 4IG4A 3HR4A 3K9FC 4G5GA 2AJCA 2Q6OA 2VP5A 5ESXA 3MWDB 1Q0QA 1GAXA 1T4BA 2QZSA 3IUNA 5CDGA 2YBDA 1CYDA 2OZLA 2ZE8A 2WTXA 4XVRA 4IJUA 2Q28A 4B2LA 1L6IA 4W82A 1IZZA 1RM4A 4N39A 1L8AA 3W5HA 3GRAA 1GZSA 5JC8A 1X7YB 5KTNA 1XZPA 4FCVA 1T36A 4F6CA 4XUDA 2GSDA 3VNRA 4HZUA 4R5HA 4CIVA 1SRRA 1HPLA 3SHVA 1EXMA 1AQ6A 4PYMA 4R0VA 2XW6A 4JU9A 2NP7A 3HP4A 1P3DA 2VDUE 2PZFA 3OLZA 3LD9A 4PCVA 2QE6A 1V47A 1E1MA 2N47A 2PXAA 5F3RA 3GELA 4YECA 1TU3A 1JTVA 4HQ0A 4MWEA 6LDHA 2FSHA 2PUWA 2JLUA 3IQIX 3RWBA 4ZI3A 2P5YA 2YXDA 3TKAA 4IIEA 4KBGA 1I3OA 4EELA 3ER8A 3G2PA 4TXHA 3ZVLA 4CQMB 1SNYA 3AF2A 2VYFA 3MINB 4JJ6A 1BFDA 4IH9A 3NEPX 2QMQA 4ZPXA 3PNQA 1RYFA 2IUSA 3A6HA 4IINA 1EE2A 1DEHA 1HOTA 2AN1A 1E8MA 1N1EA 2QZJA 5I48A 4L78A 1UBHS 2FWMX 2JI4A 4B84A 3JVIA 1XP8A 1P44A 4BNKA 4XWWA 3AP3A 1Y5MA 2ISSD 4HDCA 4MRAA 4DGSA 3H9UA 1SZCA 3ZLTA 4R71A 2ZRPA 3KR9A 1UPCA 4R41A 1JWAB 2J30A 3LRPA 3V6MA 3HXOA 2FWBA 2V4MA 4K6OA 3TZLA 5HZHA 1TA4A 1LD3A 5FLXA 1U2SA 3REQA 5KAMA 2CUZA 4IS2A 3C7DB 2C4KA 2QD2A 2VSNA 2HLPA 2J08A 2XT9A 3RS5A 2ID9A 3UJ7A 1EK1A 4CQLB 5KYGA 4JR2A 4DMHA 2QVZX 1JMYA 3T99A 4AC9A 3FWZA 4JUIA 3GAZA 4EKEA 2VHQA 3EULA 2BGNA 2SICE 3H1EA 1H0KA 2YZMA 5CVUA 4HRYA 4Q3AA 3UICA 4DMCA 4WI1A 1JLLA 2QYSA 3PD1A 1MN6A 5F3DA 1U31A 4DCNA 1P17A 2FWPA 1PTJA 2W58A 2ZLBA 5EZ6B 4K3UA 4BMYA 2GZRA 1BXZA 3QFFA 2BTOA 3ZEIA 3JASA 1TEXA 1QRRA 5BN5B 4AFNA 1RWNA 4W5WA 5K0SA 5FWDA 2HJWA 3DO6A 2BEVB 1CKEA 3ZY2A 3WFIA 3B9BA 3KSZO 1QP0A 4BQIA 5EKXA 4B3XA 2PH7A 3B9PA 4K9DA 1X3LA 1JKFA 3K09A 1WKBA 3FZQA 4JQSA 2DFPA 4JQZA 3D8NA 3SLKA 4F4JA 5A1TA 2H4JA 4Q00A 4YR9A 2Q7XA 3V4VB 4DLVA 2OR3A 5KNCA 4L4SA 4AMVA 4DV4B 1DQNA 5CBKA 1TJNA 2XB6A 2R7MA 3GJRA 3CEAA 1U94A 2XB4A 1AKUA 1J9ZA 5FLYA 3D6MA 3O82A 2Q3MA 1FYEA 3EFHA 3X43A 1J8YF 3LKZA 3TVYA 2FLWA 4L3OA 5SY4A 3VUEA 1J2JA 3O9ZA 3AHIA 2GRAA 2CBZA 1T4MA 2OYSA 1MOSA 3HJGA 1DPFA 4CM4A 2YVKA 4J1TA 3KWJA 4XLZA 2C5GA 1EB9A 4QD3A 4CYMA 4CW7A 1P7PA 3UAXA 1XT6A 1YZHA 4L16A 2E4VA 3T1HB 4ZALA 4V38A 3HBLA 3IFSA 3N87A 4G26A 2ZI5A 3BXOA 4KN5A 4M0FA 1S1CA 5EKSA 4KGVA 5JMWA 1YOVB 3RKRA 1RZVA 1APBA 2J6BA 4MV8A 1G8GA 1G8HA 3BZUA 1ND5A 4TRJA 4AUNA 3SZUA 1S9DA 5LLDA 2NZJA 1HDXA 1QS0B 1QQTA 1CWUA 3OP4A 5C4GB 1T8WA 1UDAA 2WWGA 3TGWA 4CNBA 3LDHA 3A2MA 4CIAA 4YO8A 1BHO1 2ZJZA 3RANA 2I2DA 4QDOA 4CE6A 3BH0A 2GDJA 3JS5A 3HFRA 3K20A 1Q7CA 1UJBA 2Q0XA 1MO6A 2BMVA 1JILA 2IY9A 4LJ8A 4CJXA 4FDMA 4M55A 1XDZA 2QB5A 4L27A 4NJEA 1SC4A 4FNAA 4PSCA 2W00A 1DAOA 5F21A 5J23A 2KBFA 5FQNA 5IXJA 1A8QA 4PYQA 1PAUA 3NGXA 1FDWA 1QHXA 4YK7A 4CMGA 5KYXB 5K45A 4AY6A 3SBDA 2VPTA 3RLFA 3BXPA 5EJ5A 5LZ2A 3KV3O 1P33A 1EESA 1ODTC 4NL4H 3NDPA 4PR0A 2V45A 3GFPA 3IT3A 4H7EA 1PTJC 1IL0A 1BYIA 1T5BA 3I6YA 2J59A 4URHA 3ROKA 1M67A 2J7KA 3PYMA 1PJ3A 4FB4A 1FUEA 3CTPA 1CLUA 1T0IA 4OXKA 5JALA 5DJ5A 4GVXA 5A7GA 1NVBA 3V00A 3NTLA 2CNWD 3M4YA 1E99A 4IDHA 5AHKA 3G5AA 2C2OA 4FCTA 4MR8A 5EZSA 1CQJA 2Y67A 5LYJF 4BCDA 4ZYLA 1U0OC 1VDZA 1T3TA 4HMQA 1J2TA 3MIZA 1TK2A 2HPVA 2WJWA 3EE6A 4GO1A 1AF7A 1DQZA 2EGUA 2F9LA 2Y71A 5JXGA 1M34A 4OHFA 4R69A 3K6SA 2A9KA 5ICFA 4ZOLF 5J59A 3MUNA 1HMPA 3T7SA 1JB9A 3CTMA 4QXRA 1FA9A 1P3Y1 2B92A 3FZEA 4Q7JB 4N3CA 1DADA 4HLDA 4PLVA 3WMRA 4NCAA 1MAHA 1TYEB 1W5BA 2FX5A 4TXNA 2PNJA 3UWPA 4IDDA 3HFJA 4R9VA 5DP1A 5KWVA 1DBPA 1ZOPA 3QOXA 3AIIA 3ESQA 1AV7A 4TUYF 4RTMA 5ALSA 3FIUA 5K8LA 4KMOA 2WIDA 1Z33A 3EODA 1AO0A 2QX7A 1R4NB 1Z6GA 1IMOA 3EZ2A 4WFQA 4J1TC 2NXJA 3KBOA 1RYEA 3C1UA 4G5OA 3ZWWA 5KNBH 3RYCB 5GADl 2ZRDA 3KXLA 4KSCA 5I9S