2WM8A

Crystal structure of human magnesium-dependent phosphatase 1 of the haloacid dehalogenase superfamily (mgc5987)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GTENLYFQSMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAGNESIUM-DEPENDENT PHOSPHATASE 1
publication title Crystal Structure of Human Magnesium-Dependent Phosphatase 1 of the Haloacid Dehalogenase Superfamily (Mgc5987)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12689 Acid_PPase Acid Phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wm8A00
2AMYA 3A3YA 4BNDB 4NV0A 4L6AA 1ZD2P 2WF8A 3L7YA 1X42A 5AI5A 3SF0A 2ZBEA 1QQ7A 3L1VA 3NANA 2W11A 4BNDA 3F9RA 2RARA 3I6BA 3N07A 1WR8A 2PR7A 3N8GA 2C8KA 4BEWA 2R8YA 3MN1A 3WKBA 4NAVA 1KYTA 1YV9A 3L0CA 2ZBDA 2GFHA 4UW9A 1RKVA 2P11A 3A1CA 3IJ5A 4EENA 4EX6A 1T9ZA 3QLEA 4ZEXA 3KDPA 2C88A 3U26A 2FPWA 5AI9A 3ZX5A 2OYCA 2ZG6A 2BDUA 4HGPA 5ALRA 5AKLA 4G63A 3QUCA 2WF5A 1O08A 4JDPA 4L6CA 2P27A 1T5TA 2G06A 3ED5A 4Y2RA 2HX1A 2R8EA 1RDFA 4AS3A 2RAVA 5ALLA 2D2VA 4C4RA 4FFDA 3WK4A 5ALGA 1L6RA 3IB6A 1U2SA 5AVSA 1YS9A 3L8HA 3WK8A 5AM1A 2IOFA 3S6JA 2R8ZA 3W5BA 5AVVA 5T41A 2Q4TA 3WK6A 1XP5A 3PGVA 2B0CA 4IFTA 3ZX4A 2CFSA 3SLRA 3SMVA 3I1YA 1TJ4A 4UAVA 5AW4A 2O9JA 2FPRA 3WK5A 1EK2A 3FPBA 5ALOA 2PKEA 2Q5EA 3AR6A 3KC2A 2NO4A 2GO7A 1FEZA 2FI1A 5AKYA 1RKQA 4Y2QA 3FVVA 2OA0A 3W5CA 3ZVMA 1S2OA 1U02A 3QU5A 5AKXA 3W5AA 4CE6A 1SWWA 2G0AA 3R4CA 4EX7A 4DWOA 2YMPA 1L7OA 2C4NA 5AVYA 1Y8AA 2ZBFA 5AM2A 3L8FA 3QGMA 3EPRA 2CFRA 4DW8A 5AKIA 3ZTWA 4CF4A 4BYGA 1WVIA 2MU1A 5AVRA 3U13A 5ALPA 2FPSA 2ZOSA 3QU9A 1L7MA 5AW1A 4UM7A 1RQLA 1L7PA 1VFPA 4G9BA 2RB5A 3ZVNA 3QNMA 3BA6A 3WKEA 4PNHA 4GIBA 3A1EA 1N8NA 3FZQA 3ESRA 5AW2A 2FDRA 3UMCA 4YCNA 4HGNA 1YNSA 4GXTA 4QQFA 2I54A 4J2TA 5ALYA 2P9JA 4AP9A 1L8LA 5A3SA 4XQ0A 4NWIA 3R9KA 2GHTA 3E84A 3U7GA 3NUQA 2YMMA 2YJ4A 3L1UA 3ONNA 3CZ4A 4YIKA 3HYCA 4Y3UA 4E88A 4C4SA 2WF7A 1N9KA 4XPZA 4EEKA 5AW7A 3UMBA 4KNVA 1CR6A 2FPUA 2HHLA 2WF6A 4Y2UA 4MWOA 3OCUA 4Y2PA 2FEAA 3L0BA 3AR7A 2X4DA 5AW6A 1ZS9A 3E81A 5ALUA 3OCWA 1Z5UA 2BDEA 4KNWA 5ALTA 4NFLA 2IOHA 5ALJA 2AUTA 1QQ5A 4HGOA 3DV9A 3ZTYA 1YMQA 5AESA 3W5DA 2I7DA 1QH9A 1ZOLA 2ODAA 3HLTA 3L0YA 3OCXA 3L8EA 5AKKA 1PW5A 3WKAA 4EZEA 3AR8A 4YGYA 4CNQA 5ALQA 3WKCA 4CF5A 2B1QA 2QYHA 2NYVA 3NIWA 3B8EA 5AW9A 5AK5A 2VKQA 2YMLA 2HSZA 1ZRNA 2DQSA 5A3RA 3OCVA 5AM4A 2MSNA 1NF2A 1Z4MA 5ALKA 2OM6A 2QLTA 2I33A 3AR5A 3FPSA 3E58A 3NASA 3PCTA 3B9BA 4Y2VA 1JUDA 4BX2A 1J97A 3QUTA 1TJ5A 3QUQA 5AKJA 5AM5A 1L8OA 5ALZA 2IYEA 4Y2XA 1RMYA 1ZD3A 2I55A 1RMQA 2O2XA 3L5KA 5AKHA 3ZI4A 4ZEVA 1F5SA 1RLTA 5AKEA 2B82A 3SHQA 1TA0A 1Q91A 3AR9A 2HF2A 4MUMA 1AQ6A 4YIHA 4UARA 3P96A 5AW0A 2WFAA 5AW8A 3PGLA 2HCFA 2I34A 4UMVA 2EATA 2JAOA 4I9FA 5AICA 2AH5A 2G80A 5AVTA 4BX3A 4OD0A 2I6XA 3AR2A 2YJ3A 4XE5A 3ZWKA 3WGUA 4UMEA 5A3QA 1RPZA 5AK4A 5AW3A 2AGVA 1Z4KA 1ZJJA 3DNPA 2YN4A 2WF9A 2C8LA 2JAUA 5ALDA 3EF0A 4JB3A 2P69A 5ALSA 1RRCA 2YFYA 4B6JA 4EELA 4J03A 2GHQA 2JARA 3UMGA 3MPOA 3I28A 2ZXEA 4KX5A 4HYTA 2GMWA 3EF1A 3SKXA 4IG4A 3BWVA 4YCLA 2G07A 2B30A 3QU2A 2BY4A 5E0OA 2HDOA 5AI4A 2EAUA 4H1WA 1S8OA 1QYIA 4QJBA 3WGVA 3U7FB 1L7NA 2W4MA 3WK7A 4F71A 5AVXA 3MC1A 1NNLA 1ZRMA 4UM5A 3NRJA 1XPJA 3OTQA 1Z5GA 5AK6A 4OCZA 2YMQA 1EK1A 1LTQA 4L57A 2JGAA 1Z4NA 1Z88A 4UMFA 3KZXA 4HAIA 1Q92A 1Z4OA 2CN1A 3DAOA 3E8MA 3FGOA 4KN8A 3J7TA 1U2TA 1RC8A 4DCCA 3NALA 5IS2A 1ZD5A 2FUCA 4FE3A 3KD3A 3K1ZA 1T5SA 3D6JA 3PDWA 4UAUA 3IRUA 2WM8A 5ALFA 1CQZA 3N5KA 5AI6A 2YBDA 2C9MA 4NABA 3OCYA 1Z4QA 2EARA 5AHXA 1U7OA 3B9RA 5JJBA 4UASA 4Y2YA 1YDFA 4OHFA 3ZU6A 5ALEA 1J8DA 5ALMA 3AR3A 1Z4PX 3ZUPA 5AIAA 3N1UA 3ET5A 1RLMA 5AVZA 4KYTA 4HGQA 2HF7A 1WZCA 3WK9A 1O03A 1Z4LA 1QQ6A 1SU4A 4BKMA 5IT0A 3QU4A 3MMZA 4AS2A 4ZEWA 1TE2A 3ZW7A 2FPXA 1LVHA 2W43A 2R8XA 2CFTA 3M9LA 3KOOA 2B8EA 4UU0A 3SKYA 4Y2SA 1U7PA 3QX7A 2RBKA 2HEGA 3L8GA 4UMDA 3I76A 2G1AA 5ALWA 4Y2TA 2G09A 5AI0A 3ESQA 4XOUA 4BX0A 3ET4A 3FM9A 1ZD4A 4FYPA 5AW5A 5AVUA 5ALNA 4YH1A 1RMTA 3NAMA 5AK3A 5AKGA 4UATA 4KX3A 1Z4JA 2OBBA 5FP0A 4BEVA 4UU1A 1XVIA 5ALVA 2FUEA 1SWVA 3DDHA 4F72A 3EWIA 2ZBGA 3OCZA 4RETA 1RQNA 5ALIA 5ALHA 2G08A 2B1RA 2IOFK 1MH9A 4C4TA 4Y2JA 1WPGA 3RFUA 3CNHA 1NRWA 4OFZA 3ZWDA 4I9GA 3UM9A 3AR4A 3R09A 3QU7A 3SD7A 3M1YA 5IT4A 5AM0A 4YCMA 2HI0A 2IA5A 1VJ5A 2NO5A 3ZVLA 4O8CA 5AIBA 4DFDA 1IWOA 2YJ5A 5AM3A 3U7EB 3QYPA 3TLMA 3A1DA 4BBJA 1K1EA 1Z4IA 5AKZA 2YJ6A 1RLOA 1VJRA 2B8JA 5AI8A 3GYGA 5AVWA 3U7HB 4CF3A 3QUBA 2YY6A 2Q4RA 3RF6A 1TJ3A 3KBBA 3OPXA 1YJ5A 3N28A 2HO4A 2PQ0A 2HOQA 5AVQA 4HGRA 3VAYA 1RKUA 3QXGA 3U19A 2WHEA 4RESA 5ALXA 3WKDA 2JAWA
chains in the Genus database with same CATH superfamily
2V3WA 3R5SA 4C4PA 2KHZA 2MMGA 3VYWA 8ADHA 2RE8A 1X39A 2HFKA 1E79A 1QH8A 4NJMA 2CLEB 4KITB 5K3AA 3L0PA 4EF6A 3AUYA 4FIDA 2IXEA 3IQZA 1BWPA 3LZDA 2VDNB 4OK5A 1QF7A 1RZ3A 3O1HB 3PQ6A 1WUJS 1QQ7A 4Q24A 2GF2A 3CZQA 3EAFA 3T5MA 2ZS9A 3AF2A 3WYCA 4AY3A 1HK7A 4S3MA 3URMA 2VDOB 2QORA 1ZGGA 4QJIA 1NUPA 4PC2A 3E8SA 1DXQA 2P9CA 5HKBA 1ZGBA 1UPFA 2YWBA 3ND8A 4NZYA 4TTRA 3RD5A 3UUFA 3O4HA 5BY2A 2PZLA 1KYWA 1YV9A 1LC3A 5CFOA 3IKVA 4XCXA 1I7NA 4L9WA 4O1MA 1BZYA 2XCUA 4TUYB 5BMVF 1RKVA 2W2XA 3W9YA 1XRRA 3KRTA 2HHJA 4Q21A 4BO8A 4IEEA 3QLEA 3VR5A 5TX7A 4BCCA 3TZHA 3PUIA 1C3EA 2VPYA 3C1UA 1ORWA 1QRUA 3G89A 3BTOA 2YN2A 1BG6A 4IRMA 4LYGA 3A2NA 4LGYA 3EZLA 4X7MA 1N3BA 2IHVA 1E7QA 1Q1GA 1T5TA 2IZZA 2OE2A 2PD3A 1GDDA 3I0MA 3KKNA 3E35A 3R2JA 5DXAA 2A92A 3QVWA 4MNTA 3WLOA 3IKTA 2VHYA 4ZKEA 2Q5LA 1WXGA 4LBVA 2AOXA 5AUOB 3DONA 1KO5A 4ZYWA 2ECFA 3USES 1SJ9A 2WQZA 2CUTA 4J4BA 3REFA 3TQIA 4FWTA 2QRQA 2WM2A 2H1OA 4D9NA 4H35A 3R4VA 1JBQA 3AEXA 3DTNA 1NSYA 3IB6A 1OLSA 3E4CA 4F8EA 2UVPB 2REOA 5D1HA 4M6WB 1JJBA 4FNMA 3JAWA 3HEBA 2WTAA 2C8VA 2HA7A 4GOMD 4DRXB 1A4XA 1ZH8A 2P9TA 3AL2A 3ZD9A 2HDNB 3SR4A 4HDSA 5AVVA 5KHAA 5K0JA 4H7KA 4EG5A 1W1UA 4QGHA 3LCMA 2P67A 1XCOA 3H04A 1NNEA 2NACA 1UBUS 3E7PA 3HCAA 1ZIOA 5HVNA 1HE2A 3C7DB 4F2DA 1MC4A 3OZUA 3FPBA 1KE2A 2Q5EA 4JJAA 5I9SA 4EQ6B 4ZDWA 2GO7A 3D2CA 3ORHA 4G97A 1MJGA 3ZV7A 1EYZA 2AZTA 2AX3A 4DR6B 1RZRA 1L4FA 2J3IA 3DFKA 1QLHA 1GZ3A 1RWWA 3BK1A 2WJZB 3CN9A 3PEVA 3PDIA 1H5QA 3QU5A 4EPWA 5K03A 3CTPA 3LFTA 3KOMA 3H11B 4UUMA 1NUTA 2FWIA 3D8HA 1BXRA 1YC5A 3GZNB 1ICIA 3Q3IA 3DMPA 3IR6A 1SUEA 4HDMB 3A4TA 5ITZA 3ANNA 1DG3A 4K5QA 1B23P 2B7CA 1G7TA 1BGVA 2JGEA 3DV0A 3TAHA 2HBYA 5C5CA 1W59A 1VJDA 1EWRA 2YW9A 1BEEA 4QARA 2D2FA 1ECFA 4V0NA 4JI1B 4CCYA 5E2IA 1GKYA 2HWYA 1B0UA 4LZJA 5AW1A 3TCXB 1OBOA 2YDYA 2LZ0A 5CVDA 4RE6A 5LLSA 4JKOA 3I04M 1XTUA 4S1NA 2KE5A 3OX3A 4OHMA 1G8AA 2PX2A 3DKVA 5F7JA 2OGZA 2HNKA 4PG6A 3RS4A 4AROA 4B46A 1E3SA 3MMSA 1DGQA 4FFBA 4H17A 4RY0A 2KYRA 2H1VA 3Q11A 3FZQA 3RV4A 4D74A 3UMCA 2J07A 4LCBA 4YCNA 3NG1A 1KJQA 2Q6VA 2CL5A 4W6ZA 2PUBA 1OU4A 3H9QA 1ACJA 2IHJA 5FTLA 1UBKS 1RR6A 4YBZA 5ALYA 4DJ5X 1C7FA 4WZAE 2XKBA 4MPJA 2GSDA 3LOQA 4NJMB 5EKTA 2Y1FA 1GGVA 2L0XA 3K0BA 5C8XA 3GL9A 3E84A 1M2EA 4YP1A 1J5PA 4FB5A 5L4LA 4AI6A 2OAQ1 4V38A 2P2SA 3CY6A 2PV7A 5LN1A 2VCEA 3EDRA 3WQRA 4Y3UA 1W0CA 3DVLA 2BEJA 1Z82A 4AWBA 4BLRA 2PT7A 4E88A 4X6UA 4EG7A 5LMCA 1EG7A 3B52X 1H6AA 2EDAA 1L5QA 3LDHA 3WL6A 1CNFA 5H82A 4E15A 5AW7A 3F1LA 4DR1B 5EFOA 1DRUA 4B40A 4C6TA 1HURA 4K9MA 2P91A 3RLIA 3DEAA 4E5UA 1NFRA 3A3NA 1WPRA 1L5MA 1XV5A 2NSHA 2D7DA 5AVJA 3RABA 2GZSA 3ETGA 4L50A 3TSOA 2ZULA 3NU1A 1JSXA 1RT9A 4KCGA 5G4KB 1BYUA 3FIJA 4Y0VA 3W3AH 4N12A 3EDOA 3DLHA 5GQSA 1LY1A 4F4CA 2BFFA 4B80A 3PLNA 4CMIB 3RC3A 3IH5A 4HHEA 3VPHA 4Q3CA 4RH0A 1VBMA 2IZ0A 1NW8A 3N2YA 3KZ1E 4W9NC 4YAFA 2OHOA 3PHLA 1HRDA 1Y33E 4Q7JB 1G21E 4U9HS 2WJYA 4PSKA 1N57A 2JCGA 3QKSB 3DTVD 4YCJA 9LDTA 2E89A 3ZE7A 1OA1A 4IHJB 3CH6A 5FEMA 3E5HA 2JLBA 5JI2E 5JATA 1PN3A 3DE4X 4PM4A 2DFNA 2XLBA 4WNCA 1EBBA 4TS3A 4R2LA 4PGFA 2SKDA 1KRHA 1OLSB 2G9UA 5JD3A 1GNQA 3I3SR 1PJTA 1LI4A 1MQSA 2HK8A 3SM9A 2CJWA 2OHVA 1IH8A 3W4IA 5JJCA 3A2KA 4Q0MA 2QU8A 1AGPA 4D9GA 3D6MA 4YYZA 1XNJA 1W29A 2ZTUA 3EY9A 4RJJA 4FLFA 3C6MA 4BX2A 3JYPA 2BT4A 4P0TA 1ISSA 2GDJA 3EOAI 4IQFA 1Q1ZA 4MH0R 4KXUA 2FOXA 1US8A 5ALZA 3P4YA 3FDJA 3M6LA 4G5GA 1EESA 1F5NA 4KG7A 2A5FA 2BFNA 4JHLA 4GD3Q 3GLTA 2ZT7A 4HRAA 2PCJA 5AOBA 3B1FA 4CKBA 1W5AA 1ZVMA 1XA4A 2W6OA 3ZWOA 4OQPA 4ZO6A 1C3VA 2Z8YM 1E5LA 1THTA 2QVCA 1UMDA 2AG8A 3FVTA 5JOQA 2WYUA 3WGIA 1VRWA 2FMIA 4LF7B 1VLHA 1N6HA 2NU7B 1U5AA 4HATA 3UBMA 4GZ5A 1F20A 4PXAA 3TVYA 3PE6A 1G20B 3LYAA 3W5HA 3WZMA 5KTPA 1OB2A 1GGMA 3I6IA 4B6FA 4AUNA 1ZNYA 3EDQA 4PQYA 2FPIA 4OOFA 4UMVA 1KKMA 2FPKA 3CRNA 4P4LA 4BO6A 2JAOA 3LL7A 2DSTA 4XWTA 1QZ3A 1R8SA 3TRHA 1UC5B 3CZAA 3FCUB 1FYWA 2FETA 1UFRA 3A1WA 1U7UA 1A2BA 3O9MA 3Q10A 1D7AA 1IJEA 3MMXA 4D4GA 3WYGA 2EKZA 1QG2A 5CJPA 1JFVA 3WGUA 5GJVC 4KGXA 3VDRA 2QMOA 2IOYA 4FCVA 1QIMA 3U60B 5FB3A 3RHTA 1E92A 5CJJA 1U1IA 4JOQA 1SPBS 1U9JA 3LBYA 4TZTA 5LIPA 4WFKA 4EW1A 3SDBA 4JSTA 5KDOA 1GPH1 3HJGA 3CNNA 1G18A 1U0HC 2OCLA 4G6ZA 1L7VC 1SOWA 3CPSA 1XXHB 2QGZA 3ETLA 1Y4DE 1CUVA 1GADO 1UZAA 1Z28A 2YFYA 5LNK1 1N6PA 1PDVA 3SQMA 1O2DA 2F59A 3GJRA 4QT0A 1AF7A 4F1KA 1DNPA 1SVNA 2J85A 1WDKA 4RY2A 4URZR 3VNRA 2QUAA 4A0QA 5HR5A 1VKOA 1HETA 8ABPA 2XOEA 5BQXA 2C4KA 2VQ6A 5JHGB 1HX7A 2ERYA 2EKDA 1U7WA 1W4LA 1V11B 2O2YA 3GMSA 4ME6A 1QHSA 4JI6B 4GLJA 1BMFA 3SKXA 3QG1A 2BZ0A 1KQ3A 2VHUA 2ZKIA 2G3YA 5HTKA 2G07A 4BQOA 3EEOA 1XZQA 2Z95A 2JGLA 3SHVA 3NONA 4CG2A 2JEZA 2DH5A 1K4KA 3WJ1A 1X7XA 3CRQA 4GUDA 3MIIA 4MAAA 5LMUB 4QAQA 4PO9A 1OPXA 2CXSA 4RHCA 3JPYA 1VLVA 4MXDA 2HF8A 3CU5A 2IPAB 3EG5A 5DGCA 4YXWD 5BN3A 5I7VA 1E2FA 4EEXA 4ARVA 3LY8A 3AEYA 1NBAA 1RWMA 3BGIA 5ELMA 5JRJA 5TGTA 3DXZA 3WQBA 5TQ2A 3O2JA 1QLWA 3TOSA 2GZ1A 2VTVA 1JA1A 1G19A 1ZISA 1QNFA 4NZOA 1ZUWA 4J29A 1N9GA 3C7AA 3NX4A 3NHFA 4O0LA 3JD0A 3K9HA 3QWBA 3V33A 3HXPA 2V0CA 1U28C 1WB4A 3IQIX 1Q1BA 3GJZA 1QB7A 3DZHA 5C9ZA 2WLSA 4NY1A 3ZVRA 1N2GA 2BFFB 2VDKB 1G8YA 1JH8A 4UNQA 4CM6A 2XXAA 4OREX 4TL8A 3RSCA 5DHTA 2OAP1 1PV2A 1WXIA 3ZJUA 1HDZA 1T5SA 4UBKA 4UAUA 4RDIA 4Y6SA 3IRUA 3RVJA 1S2DA 3MTQA 2IYZA 1CQZA 2PH5A 4XWGA 4F5DA 2YBDA 4NFSA 3ZJTA 1WVMA 2EWVA 2O2CA 3FDXA 1E7YA 1LS1A 1TT7A 1V4BA 3FDFA 4MEAA 4NABA 4RVHA 2QWXA 2A14A 3S0JA 4QEDA 2OCGA 4AL4A 3B9RA 5IARA 3ZGOA 2JIQA 4Y2YA 4F4IA 1CU1A 3EGXA 3DBHA 1F1JA 3QXXA 2R6HA 4LWZA 1TU4A 4OQ4A 2XNHA 4UEOA 2QQGA 3W7BA 4NYIR 1XELA 3MUEA 5DHQA 2IW3A 4HAOA 2P6OA 2WHRA 3OE1A 3ZUPA 4IIEA 2RHGB 3D6UA 3DWEX 1FFCA 3WI7A 1IZZA 1GZ7A 3C8DA 4CEJB 1B0AA 3LPMA 4YJHB 4PCLA 4YB8A 5JFTA 3QLUC 1U8YA 1YBAA 1I1HA 1TYZA 1FX1A 2DQZA 2I4OA 3CR7A 1SU4A 4MRNA 4O4JA 4QNNA 4RVNA 4X00A 5EKDA 5ILQA 4MP6A 3H9CA 2DHCA 5BPHA 1HYQA 2I22A 2ZRNA 1WP4A 3RI3A 4QYSA 2O7VA 4D3XA 1V3UA 3R3HA 2FW9A 1NV9A 3JARA 3CNEA 1XCGB 3F4BA 1ZMOA 4CUZA 3DULA 1CRQA 1F0KA 2NZ8A 2R4QA 2X9NA 3G23A 4WK0B 5F76A 5TSDA 2C4MA 2X1VA 2AFHA 3FI0A 1Q6YA 1TADA 1PGJA 4XGKA 4Z4QA 2FPIB 3IIKA 4IJMA 4BKQA 2J5BA 3PK0A 1A4IA 1G6OA 2XQFA 4KQMA 3FH0A 2YICA 3G7SA 1Z8HA 2Q2WA 3KOWA 4A73A 2FUG1 2CDRA 2PUFA 3PIRA 4KMSA 1L7XA 1J2UA 3OLZA 5CVTA 2ZAMA 2ZS7A 4COKA 4AY5A 2J3JA 2P0EA 4C6RA 5A5EA 4KGDA 1DXYA 4GGOA 4EYGA 4Z54A 4JJIA 3A3KA 4DBZA 4TLMB 2JRCA 2NNLD 4I50A 4LFAB 2JPDA 3G8CA 2CVQA 3FYSA 3MYRA 1MC8A 3TW6A 4DL9A 3LT0A 3KOUA 1UPTA 2PZMA 4KMRA 1YQWA 4HDQB 3DZFA 4I6GA 3ASZA 3HU2A 3EISA 4R16A 2ZWOA 5IVPA 2CVPA 3K2IA 4RTKA 2VCHA 4PZLA 1W2GA 1H2AS 2Y6VA 5LP6A 2ODQA 4QYIA 2NIPA 1FSGA 2CHFA 3FUCA 3WBBA 4KR3A 1FTYA 1DC8A 1XC7A 4QUIA 2D3WA 3ELYA 1KO7A 1JSRA 3TO5A 3LYLA 3DF7A 2BKAA 2CVZA 4IP0A 3IMGA 2OT3B 3BC1A 3JQCA 4FJ2A 3GFTA 1MAUA 4L7VA 3GRUA 3AFGA 5E9WA 1DQRA 1A50B 4C7XA 2C7QA 4ZZ0A 1T8YA 1PWHA 1WSAA 2PU7A 4MWBA 1PR4A 3OSUA 4N3GA 2WJPA 3C3AA 2H0AA 4GOOD 4B43A 1U8FO 2CE2X 5K0EA 4N5DA 1MDFA 4YCMA 3PPWA 2HI0A 4FHGA 2CCJA 1PFQA 5CA1A 2C7PA 4G4SO 1UBMS 1NUSA 2XADA 1UDWA 2EC5A 3NOXA 3P1JA 4J1QA 3BD6A 4PYIA 4EHNA 1DEXA 5AIBA 2JATA 2XZPA 4PR3A 1Y7IA 3F3SA 4Q66C 4YRTA 3TSZA 4B2PA 1C1XB 4O4HF 4Y1RA 1IOZA 2JLAA 1GU7A 2I2AA 3D4IA 1NT4A 3NDRA 3D8BA 3KQOA 4ZOEA 5LXTA 1D4AA 1N9GB 4OK3A 4A82A 2V7XA 1PR2A 4FN5A 1XD8A 3DHYA 2CNBA 2GJAA 2YY6A 2JI7A 1JYEA 1TJ3A 3D31A 4XD2A 3V1YA 1YTUA 4ZU3A 3RRXA 2N75A 5ESWA 3VNUA 3FF4A 3O2NA 3QKWA 1P7CA 1ZPDA 2Q3LA 1I36A 3KDSE 4RW0A 3O94A 1DDOA 1NDQA 2IUEA 1Z0UA 1UMCA 2BUBA 2Z9BA 3IS3A 2XXAB 1DKQA 3O9ZA 3QF7A 2GWHA 1AX9A 4R54A 4QGSA 3U5TA 3KV1A 2ZYRA 1GIAA 1XD2A 4KMMA 2GBFA 1R6AA 2WUDA 1CNEA 1H42A 3MWJA 2VP2A 3A3YA 4IILA 3KHUA 3DW3X 3LOUA 4Q5IA 2ORED 4RHUA 4CDGA 1KNQA 4YRLA 1KQFA 4EB3A 1KI4A 1ODIA 2P78A 2RG7A 1QU3A 1IY9A 3FOZA 1KZ7B 3E7DA 3WAKA 5HZGA 4BQIA 5ICFA 3PHCA 4OIFA 1CS0A 4F04A 2IH2A 1U8EA 3ZNQA 4GKVA 4IFIA 4XZ3A 3I6BA 4NK5A 4NXNB 1MRSA 3DPUA 1NMQA 2C4VA 3C97A 2R8YA 1SG0A 1EBUA 3O8OA 3R7FA 1V0JA 1XTJA 3PWKA 3Q7EA 1F12A 1T9BA 3DEIA 1M8FA 1JAZA 2C54A 3EB9A 4OXRA 3WKBA 5J4LA 5K0NA 4ZQBA 2C2MA 1DI0A 4G4JA 1IHUA 1O95D 3W05A 4EW2A 1DFIA 1WHSA 3KNZA 1E2UA 4A0HA 5LNK6 4O4JB 3HJNA 2BR3A 3G82C 3L05A 1IWBB 3EBOA 3WSWA 1P2DA 3T1OA 1TQHA 1X8KA 1P77A 5E8JA 4WFJA 4DCPA 1O08A 1S02A 1BS2A 2A78A 3C41J 4G0PA 3JARB 1H6BA 1PK9A 4OXQA 3RROA 2UDPA 2V96A 2HADA 4A0GA 4BC0A 2V9PA 3DOHA 3GGSA 2QAIA 2MCFA 5GV8A 3KJIA 3KT6A 2VYVA 1NJ8A 2AFHB 4OHXA 2BKXA 3RFTA 1IBMB 3I5UA 2BCGY 2LCQA 1BQEA 3DG9A 2VP6A 1FVFA 3OJEA 5AHOA 3A9CA 1TGVA 5DLQC 2V58A 4HG2A 4OX9Y 1GPBA 2ZDQA 3A31A 4WUTA 2CHVA 1GDTA 2IX3A 4A8JB 4AP5A 1YUMA 1V43A 1J56A 2AN9A 2DOKA 5DYGA 4YRKA 5HUQA 2XXJA 4FYKA 3HZHA 3X1JA 3D8TA 1Y7LA 4ZTZB 2DU8A 3WIBA 2CDAA 1U04A 3MW8A 5A4FS 1J1IA 1UBOS 1LBEA 1XZPA 1S4QA 3WRVA 1OBCA 4WLVA 2WSLA 2AWNA 1QS0B 4PYMA 3ROMA 2IX9A 3ZX4A 2QVLA 2ZJ6A 3G2PA 3BGWA 4TMWA 3B6MA 3GEMA 1USWA 4BFYA 4BO3A 1B16A 3FKQA 4P4GA 4EA6A 2GJSA 2LDXA 3EZXA 3MTIA 4LXIA 4EKGA 1ZHFA 2ZAGA 4GVPA 1PFWA 1NKVA 2D54A 3K35A 1IY1A 4YP0A 3L02A 3QJGA 2PNFA 2Q41A 3ZOZA 3VNQA 3KC2A 3PR3A 1VSUA 4QYIB 5J2UA 1T8SA 2HHCA 2R3SA 4ITUA 2ZUCA 4OBXA 4ZI7F 2JRLA 1WY5A 5AKYA 3S68A 2XQIA 5LR6A 1GCGA 2ZVPX 2A94A 1U02A 5H81A 3KQKA 1ZJ5A 3ZCVA 2OYSA 3RYCA 1Q77A 3AERB 1J49A 1YB7A 2IK8A 2ZJ3A 4NCKA 5TPZA 2XZOA 3DT9A 1NXXA 3STWA 3CUEF 4DWOA 4TTJA 4AJOA 4QJ3A 3DLIA 1R8QA 3VDNB 2ONKA 1EXMA 3FWZA 1FLNA 2IC5A 1M6NA 1WVIA 2IUFA 2IDJA 2IS2A 1MX5A 3C15C 2XUIA 4C76A 1J6UA 5AVRA 5LMNB 4EJ2A 4HLDA 3HCFA 1K0UA 2DPGA 5A2GA 1ICEA 5C51B 4FHFA 4IDNA 3TCNA 3A4MA 2JAXA 4QGFA 3DPSA 4F7DA 2R68A 2ZSEA 5K6RA 4F9EA 1J39A 3D3QA 2WTEA 2H4YA 5KZMB 4B6PA 2R8RA 1SR8A 3T9CA 4AM8A 5IJAA 5DISB 2V7VA 3V7FA 4CXMA 2PAAA 3LPCA 3I2IA 5E1MA 1YCGA 2P5UA 2HCRA 1EPUA 2H85A 4O63O 2CXTA 3OETA 2C5FA 3IHLA 1NR1A 2FN7A 3HRHA 1E2GA 4KWCA 4M8SA 2IXFA 3IOBA 4C20A 3JZIA 1QANA 4JXXA 1C9JA 1Y1RA 4KLNA 1CLEA 2GNPA 2WKPA 4WNYA 3CISA 2FUG6 4BLVA 3U7GA 3O92A 1TCUA 1O0SA 4B7UA 4V1CB 1MT3A 5KQRA 4J4TA 1SC1A 3T41A 3PDJA 1T8WA 2VYNA 3ONVA 3T3OA 3AJ9A 4I1UA 5JSFA 5JBQA 3CZ4A 4RVGA 1SFRA 2WZBA 4C5BA 3OTHA 3ZQUA 3SEAA 2CJXA 2QM7A 2P9ZA 4Y6QA 4R51A 4CG3A 1E6UA 2HXSA 1MXFA 4K6CA 4K9QA 3HWWA 4G0UA 2C3UA 2QMZA 4ICIA 4J3JA 3RE1A 4C0HA 3SSOA 1II9A 3ICEA 1TF5A 4OHYA 1MJ5A 3H3FA 3O3MB 6ABPA 3JR7A 3GCZA 1HTWA 3SX2A 1O96A 3F9IA 4W1PA 4FGWA 1M6HA 1P80A 1TEVA 3AR7A 1EEXB 5BV7A 4M4SA 3H6HA 1HEUA 3OQ1A 4PFKA 4BMXA 3UJAA 3EPKA 3HM2A 4AUKA 2J67A 2IOHA 1FJXA 1JWLA 2D1FA 4S1TA 2QHXA 5L3RA 4Q3DA 4O4HB 5KSWB 1YMQA 1HDCA 4BO1A 3VKVA 2YV4A 4EZEA 1EUZA 4Q3NA 3EEYA 5AKKA 3TSCA 3WKAA 4YGYA 3E22B 2YUIA 3JQQA 4JLPA 2OZKA 4P58A 1KTVA 2CDBA 1ODCA 2QYHA 2WIJA 1VLLA 3R74A 4EDHA 1IBRA 4IIHA 3TYXA 1LLDA 1VG9B 1B1CA 2VQFB 1J2RA 1E1RA 2Q3MA 3SWWA 1ZSVA 5FLKA 1G60A 3PVZA 3T52A 2VKQA 3ZGYA 1M6EX 4ISCA 1ISMA 1ZRNA 2OFOA 2NV2B 1UEJA 2ZITA 4HGZA 1NVFA 1G8HA 4LN1A 3C48A 3UAZA 1MZVA 5C7YA 1RHUA 4ZTUB 5LL6P 3OJWA 1BKSB 5C1DA 1VXRA 4BBPA 4LNAA 1E94E 3DC2A 1C4WA 5KPJA 2YWJA 4PQRA 2PRSA 2CJYA 2Q49A 2W6QA 2ZR8A 1XMQB 3H86A 2A35A 3CRRA 3VXKA 4DV1B 2VRBA 1URPA 1LV8A 1P19A 2NQTA 4MA5A 4PPQA 3R7BA 3DZKA 4F9FA 1CUYA 3N7UA 3ZI4A 1I80A 3CRW1 3JXEA 5FQNA 3TR0A 3O3OB 8LDHA 1DAEA 2GEUA 3QM1A 1I4TD 1KDZA 5EP2A 1FJGB 4MQLA 4D0GA 1EVQA 3IUEA 2FH5B 2O57A 3OZGA 4HDKA 4CHGA 4F5WA 5F3RA 4B34A 4OF4A 5HF9A 4F3YA 3BDIA 3CW9A 2LTAA 2EX0A 1SU7A 3FHLA 2DGDA 5IDQA 1E7SA 1N0VC 1WP9A 3KB6A 3UK2A 3N6VA 3K15A 1EUDA 1I2AA 2BSXA 2IYXA 4L75A 4RH3A 3ORSA 4JENA 1KIFA 3D6VA 3TCKA 5KKCA 1E0AA 5GVRA 5IN5A 2FMXA 2R65A 5BPFA 3GROA 1U1CA 4FGSA 2PM8A 3IE1A 2IODA 1FMTA 3QK7A 3ILYA 4XSVA 4ZCIA 4DG5A 1NGSA 3EN0A 3NFYA 3MT7A 3PS9A 4WWHA 1OE0A 3C3EA 3MIZA 3WL5A 3QUSA 3O6VA 3VX3A 3O4FA 2ZIUB 3P4UA 1NTRA 1VYTA 6NULA 3NI2A 1H2WA 1Z62A 3EMDA 4DWVA 1PZHA 2Z04A 1G2IA 4BFLA 1V35A 4K1XA 4PYJA 5HJEA 1UMBA 1NRJB 5B7PA 4JB3A 1U94A 2N9UA 1AKQA 1U5BA 3GLRA 3DMYA 4RK0A 4S2EA 4B73A 1SCBA 3SFVA 5JMOA 1RYHA 5A0FA 2OMKA 2ZYVX 1ITZA 4B6JA 2IHNA 1VIMA 1Y1QA 2YZNA 3EXFA 5D3ZA 2WJWA 3NLLA 4AJ2A 3NMUF 4J03A 4S35A 3THXB 4FKMA 5PGMA 1R6TA 3LYUA 4KK4A 3MPOA 4EUKA 2GHRA 4YPVA 4L95C 2DM6A 3GMDA 5IDYA 1GT91 1KZ9A 3U3MA 3H4MA 2FW1A 1UT6A 2QPLA 4TLLB 4KQ9A 1KJYA 3KKZA 3HXMA 3NYQA 2Q3DA 4MDHA 2WJAA 3JQRA 3HYSA 1DXHA 4J8PA 1DZIA 1JG3A 3OF5A 4Q15A 4CMJA 4TMTA 3E7FA 4UD2A 5ERYA 2XYQA 2WD7B 4HQ0A 3R6DA 4MYDA 1GLGA 3R3WA 3LWZA 3MJVA 4OVKA 3W1VA 2POQX 3H18A 1JDZA 4JQCA 5THXA 1HYGA 3WLJA 4KRFA 2E6UX 1A9ZA 2RGDA 3FYUB 1R8JA 2W2NA 5DNYB 2FZEA 2FLVA 4PZCA 5TB5A 3SP1A 4RMHA 3ZG6A 3OTQA 2G9NA 1ID1A 4JIMA 4XWKA 4KJZA 4D56A 1OYOA 4AN0A 1EK1A 3OIFA 3SVTA 2IRWA 1Q20A 2C7BA 3PJEA 1BCSB 2OESA 4FBGA 4LYDA 4MB0A 5DFAA 2XCTB 3IEPA 4HAIA 3ETEA 2X1LA 4ZHQF 3U9LA 4L4YA 1B8OA 3G2MA 4QU8A 1ZP6A 2HIGA 2I1QA 1BIFA 3PFCA 5AUQA 5EJ8A 1UBGA 1AUPA 1SXJA 1ZITA 2CL6X 3DAOA 3FNGA 3P5BA 4GEGA 3PGA1 1GAWA 1R6BX 3HTXA 1WBJB 3RKSA 3O0DA 3ZZ1A 5K05A 5FO1A 5GGXA 4EHKA 1Z73A 3OFVA 5IAAA 1FFXA 2VDUE 5CT9A 1L1FA 3RVMA 1P33A 3UTDA 2FE1A 5BWMA 2CJPA 4RQBA 1Y6ZA 1SC6A 3F6BX 4KWHA 2QAGA 4QOJA 1AHIA 1RBQA 2NT3A 1A27A 3F49S 1OHHA 4WN3A 3S2UA 1KU6A 4WIAA 1FDTA 3PHJA 1JQAA 4D4KA 2AKYA 4LOAA 5P21A 4J75A 1T9GR 4UASA 4EAAA 2D1RA 2ZLBA 4FWIB 4PVCA 3U56A 2Q5JA 1HDEA 3RIMA 4M1QA 5TMDA 3PDCA 4Q01A 3V1NA 4BATA 5ALEA 3DR3A 2EYUA 1JRLA 2ZB4A 2WWYA 1OXVA 4L5BA 2FG6C 4RTJA 3LZCA 4BPRA 2OWEA 1MGPA 5BSEA 3I2FA 1G4AE 4YDQA 2WPDD 2QRGA 1PZXA 1P29A 2J1LA 4JYBA 3ET5A 4GI7A 1HLGA 1NXQA 5CVCA 2X8LA 1PR1A 1YQTA 1ZC3A 2PYZA 3JATA 3UCXA 4MVJP 4UU8A 1CR4A 1O03A 3M6XA 1UOPA 4RM2A 3I09A 5HYVA 3OLWA 5M29A 1J0CA 1E2MA 1FSSA 1T0IA 4KDFA 2FJ0A 1T5BA 1Y8ZA 3NW9A 3EAGA 3RJ5A 2P2ZA 2CBGA 4PYKA 1MBZA 1AGXA 1LUAA 2DJIA 2PJUA 3PUHA 5ER6A 4YHHB 4F6CA 1JPJA 2QN8A 1R3UA 2JNWA 1KWGA 1MMFB 4EUSA 9LDBA 2WYWA 5C8VA 3OPQA 3UHFA 1FYXA 3ISVA 1QNLA 4G9GA 4WJKB 3D9QX 2ZCUA 1V5GA 4ETWA 4X92A 3DBOB 2C2XA 1FU7A 2Z5GA 1JFLA 2YFKA 3IJEB 3DBLB 4CIXA 3V8RA 3D64A 3GLFA 1QRTA 1E20A 3S7ZA 2FQYA 6GPBA 3WTBA 2VSNA 3WNQA 1H69A 3IRVA 3PFGA 5EIWA 5CYFA 4E5YA 1QH1B 5TQJA 5H70A 4PNPA 1YA6A 3D43A 2O0JA 4Y9SA 5A03A 3CKYA 1KMQA 3TF5A 5C1OA 4CEHB 3VR1A 1GL9B 3R3XA 4UTRA 2NXEA 1V5FA 5C32A 2VL7A 5JYDA 3N86A 1OFTA 1QV6A 1NVXQ 1ZM2A 2NXJA 3WLRA 5A5FA 1MIHA 2OZVA 1UMBB 2DBVO 2WRZA 2ENUA 5HBGA 1Q12A 4BKRA 4AJ4A 3LV8A 4BX0A 1X14A 3OQMA 1WXWA 4E03A 4EB6A 2FVYA 2PX6A 3LD9A 5AW5A 3RVKA 3SJBA 4AKHA 3AX6A 3A9UA 1XVLA 2O8BB 4KX3A 1X0VA 2OBBA 4GSKA 1IY2A 1GITA 5DBIA 3ZE1B 4YEDA 1J07A 4X60A 3L93A 2ZI6A 1Z06A 2F8MA 3VC1A 4UOQA 3O74A 4M83A 3GG2A 2JFGA 2W6MA 4ZK6A 1BX0A 1PHPA 3JWJA 1NI5A 3IAUA 1S2NA 6PFKA 2BKEA 4CKCA 3NM6B 1EA7A 1XQYA 5ALHA 2G08A 5CTJA 3QXHA 4YCSA 4HUQA 5D5QA 5G1PA 4JC8A 1NM5A 2C95A 1DKOA 1XQWA 5LA6F 2OECA 4EL0A 2FMKA 5GJWC 1BDHA 1AZLA 4BNGA 2MYPA 5AK0A 3HP4A 4C0LA 3CWCA 1VMEA 3R09A 1E96A 2QOEA 3H2BA 3UW3A 1F51E 3NGXA 4S1WA 3E7WA 1FLDA 3UF0A 4CCWA 2VYCA 4DMCA 2XITA 1IAQA 1NW4A 2QY9A 3I9OA 3KSUA 1IYZA 5BYJA 2VQEB 2R7KA 3PC6A 3S29A 2XCRB 4C0SA 1EDEA 2PSFA 1IPFA 3KYDA 3OAAD 4OGLA 4DMRA 2PDAA 2C97A 1HNZB 3SYLA 1S2MA 4PIVA 1P1HA 2G70A 1O97D 3ICWA 4DCJA 5KMGA 3PR1A 5EMLA 4HGRA 3B2NA 4B4KA 3A1UA 2WDPA 2OV6A 3H6GA 3RK1A 3R8CA 1Z68A 5H83A 3BKWA 3CUSA 2BE7A 4JUFA 4LPKA 4ALJA 4CMKA 2QMQA 3AIKA 1QTIA 4FR2A 4IDHA 1RM0A 4KE8A 2AOUB 2XT9A 3UMMA 3ZHCA 4Y6RA 3WV4A 1QIHA 4I9HA 1SHKA 5D1NA 1ND5A 4MZXA 3FOFC 1Q0ZA 2A5LA 2C9DA 3VM6A 3OJXA 2VPPA 3L7YA 4TN1A 3KFVA 1GA1A 1KEWA 3AFMA 3LPNA 3TAXA 3FUVA 5LPNA 1RIFA 1NFFA 3HEAA 1J0BA 2X5XA 2ZATA 1RRMA 3DT6A 1YVUA 1ZC4A 1YUNA 4OFBA 1VKNA 4P3NA 1G7CA 4LHYA 4MP3A 1EVKA 1QAMA 4EHBA 1AHPA 1T2UA 2DSNA 1ZHHA 4OUDB 4DC9A 4NAVA 4OI2A 5G0TA 5LUBA 4KWTA 3L4BA 2OLKA 2HAEA 3HB9A 4QELA 3C39A 4IPTA 4KGVA 2P1DA 4U7GA 1CKEA 1A4UA 1Y9ZA 1GTL1 2BF4A 2EJWA 2PQMA 3U26A 2IU4A 2YC2C 3ZDZB 5KNCH 3FFWA 4Q9IA 1XRLA 2QRPA 5KWEA 3T5BA 2A1UB 1VA5A 5AKLA 1PGNA 1BVUA 3JQGB 3NDJA 2B3DA 2BHTA 1EFKA 1K6EA 1QGED 1ZOIA 3IMCA 5U4QA 1FQWA 3OURA 2YJNA 3ODGA 3J81A 5J1SB 2G9QA 4GRDA 4W63A 4REQB 5DBGA 1VL5A 4PIPA 2CC2A 1NWCA 2HA5A 2I03A 1D2AA 3PQ5A 4QBFA 5DM1A 3S2GA 4OB7A 3QPWA 4ZK2A 2F1HA 1UBFA 4MKHA 3GJSA 3OSZA 4BP1A 2C3YA 3A9TA 1H2RS 3IQGX 4OFWA 2A30A 1TXGA 3JALB 4QDTA 3OQIB 3IUNA 3P2OA 4R9RA 5EHGA 3VR3D 4AY2A 3NAQA 3GARA 2ZP1A 3WZ2A 1M2VB 1X92A 4RVOA 2C2GA 1KQPA 2QNIA 2FOLA 2O06A 2BFBB 2YWFA 2Y3IA 3LGSA 1DJNA 1PGQA 4UCQA 5J2TF 5DBEX 2IV3A 3ZD7A 2PT6A 5CGZA 1A8QA 1WY7A 3NXSA 5JCJA 3SBDA 3VOTA 4JYPA 4LRSB 4RUKA 3DLAA 3RV3A 7GPBA 1NJ5A 2WIDA 3H3JA 3Q4GA 4CDRA 3AQIA 3UGKA 2B6HA 2OFFA 5T41A 5WRFA 2Q4TA 1HH4A 3U81A 3UK6A 3JQAA 5MN6A 5BT8A 4FZVA 4XEUA 3I01M 1XHFA 5BR8B 3BXEA 1MQ8B 4A2CA 2W42A 4EB6B 2UZIR 4HP8A 2CSXA 4OM8A 2O5EA 4DMKA 4TTPA 4UPDA 5MFZA 5EJIA 3F46A 5ITWA 1PEYA 4CTKA 1BVYF 1XVTA 3LZ6A 5JFGA 2WVAA 4QQRA 1RYDA 4RHFA 2X5JO 1GDHA 2HIMA 3Q85A 1PK8A 4EYQA 5LU8A 1PZGA 3L46A 3L6RA 1WOYA 1YFJA 1RKXA 4PYOA 1A3CA 4Y2QA 3SHWA 4UTVA 4YXFA 4CKCB 5CM8B 2G1PA 1CZOA 2EL7A 3SAJA 1NVAA 4M9CA 3IKLA 2C4UA 4HUQB 4MLPA 4M88A 5FPPA 1U0LA 2CY0A 2EJTA 1E1YA 1XL0A 3JV7A 3SEQA 4Q34A 4C0JA 2OWDA 3QVGA 2IYPA 2YDXA 1ZZGA 4G01B 3SU8A 5GZ3A 3FCOA 2R62A 3ZNPA 3AVWA 5AM2A 2PBZA 4RFSB 3B6EA 3KU4A 2HMSA 1WOMA 3EBLA 3W8NA 1NA5A 1Z7GA 1H0KA 2NO6A 3DBIA 2DP4E 4GT1A 1E9RA 4BYGA 5K0CA 5TJ9A 4LVCA 3UMFA 3U6BA 1SKYB 2ODNA 4N4AA 1YVDA 3AM3A 1YS6A 3Q3CA 1S1CA 3PD7A 4RANA 4BJ3A 2IHZA 3RRZA 4WZBA 2XB8A 3THSA 2Y0DA 1QOPB 2PZKA 2XD4A 3G0BA 3WX0A 1NN5A 1UZNA 1ZEMA 4YJ3F 4PC3A 2VLBA 3TIFA 4S0ZA 2GWRA 3IDOA 4FN4A 4MUKA 1M8PA 2IYRA 3ETDA 3V7YA 5BW6B 1PWYE 1XMSA 2Z98A 3I23A 3IDZA 5F3DA 4V0LA 5C8YA 3PCXA 4QLBA 2DHDA 5KMGB 1V5IA 2ZREA 5D00A 5CB0A 4NZMA 4UE2A 1E5VA 1DS6A 4HGNA 4LJSA 1LNQA 1W6UA 3GX1A 1S8NA 3R7LA 3WHPA 4R2HA 2X3UA 5AJVB 4HQRA 2QX7A 2OV8A 1PL0A 1FC0A 2VUSA 5IUNC 3IP3A 5KYYA 3CLHA 4GP9A 3GZ4A 2FJUA 4C21A 4C22A 4LHEA 2E3JA 2VBFA 1NQWA 1Z5NA 1FRQA 2QM8A 2Y76A 5BQFA 2PZ8A 2VOJA 1KYZA 1SC4A 4RCVA 3NEJA 4YROA 3WJ2A 4ZO7A 3F97A 3WZLA 1OGIA 4Z8XA 3R9WA 3QXSA 4BOYA 4F84A 3U3DA 1U0RA 5J9FA 2KBEA 3TM5A 1ORVA 5JC8A 3PKJA 1TVEA 2J87A 4EECA 5ED4A 4G9EA 1V3TA 1P1KA 2C2KA 1XAIA 5H4HA 1ECCA 2C92A 5B58T 3BX1A 2ORVA 2E49A 4WY8A 3D8NA 2BJHA 1WU7A 1PX2A 4MWDA 1RXEA 3OCUA 3DH0A 1KMCA 4RXTA 1U8TA 2VJLA 2UVQA 2X4DA 4GVXA 1ACMA 1O77A 1SHLA 3F3YA 1BYIA 2J46A 1H4QA 3O8LA 1POXA 1FBNA 4TLEA 4FOOA 1B8NA 1U2DA 2EOAA 1NNUA 1XDGA 2G9RA 3P9IA 4RADA 4A0SA 1KYQA 2CVFA 3E5RA 4GLFA 1UBSB 2LCFA 3M8KA 2RH4A 1BJKA 3HLTA 1GRRA 3BGSA 3K2QA 4KVZA 3DCYA 1ID8A 4OGWA 3NR2A 3KKEA 2JDID 4I5EA 3VYSB 2OVBA 2ZIAA 1W5TA 4E5KA 4O2BA 3TKAA 2VRNA 2XUQA 2PGXA 1IAVA 4U2CA 3V2UA 1ZGJA 1H05A 1SY7A 5CT5A 2QYOA 3N2IA 4D4LA 2XQVA 5FX2A 4TWAA 5AK5A 1YZTA 4CQMA 4BDTA 3MJCA 3QKIA 4GECA 1SRQA 2P9FA 1DV1A 2DQSA 3KPVA 4Y6LA 4AJLA 2C58A 3K0AA 1F38A 3QE4A 4UE6A 5AM4A 4YP6A 4DV5B 1SO8A 2R6DA 2KMLA 3V48A 4Z2AA 5IF3A 2IUSA 1Z4MA 2PS3A 4WLEA 5PNTA 1NNI1 2OGUA 4C07A 4JJFA 3E58A 6YASA 5FKJA 1KYVA 2OKCA 3JX9A 3IV6A 4LDJA 5EWJB 1LBHA 2Y1OA 3U44B 5IJ0B 1AHHA 1IUOA 1NG9A 2XGOA 1TO6A 3IIMA 3SLGA 1KHHA 1K63A 2QN3A 4JXJA 4FSXA 1NMZA 3EXG2 4G5FA 2BFDA 2RHCA 1IQUA 4B7AA 1UKBA 2HRCA 2JLCA 1TK2A 1I10A 1F5SA 2H0RA 2Q4OA 2B82A 4KO2S 2VJQA 4D2IA 3W7VA 4X24A 4FYJA 1C3OA 3IPCA 4IDQA 4WK6A 3GIWA 1O6ZA 2P0YA 2QPTA 2O14A 3EG9A 2ZJ5A 3ADOA 4RHEA 4Y2HA 1W52X 2PXXA 2HLPA 3IP6A 3TVTA 1RP7A 2VIIA 1LBQA 4JLVA 2WQ7A 1NVVR 1BN7A 1J0AA 2WFAA 3TQTA 5JCXA 3PGMA 2HCFA 2A3RA 4JJ6A 3M4NA 1RWVA 3MPUA 1SQ0A 3WFJA 5AVTA 1F8FA 2H2GA 1MQ9A 3QVGB 2FQXA 4Y9UA 3X2FA 4EVQA 1GQ2A 1P3JA 1VIAA 4GPBA 2W7TA 5EINA 5JAOA 1VJ0A 4XIFA 3II6X 4WLUA 1LZLA 4MW2A 5GINE 4UHJA 2CMHA 3LJKA 2Y67A 1YDEA 3GGGA 3AWDA 5HFJA 3JRWA 2W70A 5L95A 5A6SA 1L7BA 3BM5A 5AWFC 3TTYA 5DX0A 5IAKA 4QM6A 3DE7X 1WJGA 3M4XA 3RTAA 2PS0A 1T1RA 4TSFD 3H17A 2FPGA 1I33A 1XJ0A 1OV4A 5C34B 2Q21A 3UICA 3BL6A 5KTMA 1G38A 4BQNA 4EM6A 2NP6A 5J2TB 5CNIA 1UK8A 2NUPA 1GCUA 2H1SA 2VWPA 3BXHA 1E5TA 4B47A 3VA7A 2FNAA 1JHRA 3L0ZA 2IHUA 3L7MA 4QXRA 2RJNA 4BZXA 3OE5A 1GYQA 2EEZA 1K8QA 2Y1EA 3H9UA 4H77A 4JLJA 2X4LA 4TV9A 5HILA 4ANFA 1U9CA 3BWXA 4MZDA 3HO1A 1B74A 4G0ZA 2ZYIA 3ZDCA 1YH3A 4US1R 4FYHA 1WKCA 2C5SA 3I9LA 4OKSA 4P3OA 4KX5A 1FFDA 3VDMA 4D25A 2ALJA 2WU3A 4MW0A 2VSXA 2XV1A 2ZJ8A 1OI4A 5KYYB 3LT4A 2C4TA 2QIOA 3I5YA 4Z51A 3OPVA 2VDPB 3E9QA 5EJ4A 1V5WA 5JW6A 5IEJA 1AZSC 1YCHA 5IN4A 1KI9A 2PL3A 4LC9A 1S2LA 1A76A 3T9DA 4ERXA 1AD2A 5HIKA 3PI7A 3O82A 2GGSA 2GILA 3WJAA 4Q4JA 3PUKA 4I3FA 1N6IA 1H2BA 4DXAA 1L1RA 5FO0A 5I9NA 4C7JA 5CFQA 4C08A 2WKRA 2B94A 2ECQA 2NUBA 2Z43A 3VR2D 3VO8A 2O7NA 1SA0A 3R0JA 3LQYA 4IUYA 4M60A 2JFHA 1U2RA 3JYOA 1ZN9A 1XB2A 4FJ0A 2GN8A 2WJHA 2XDQA 3CSSA 4J16A 4LDNA 3AONB 4MGEA 1KI6A 1L8AA 2VJMB 1ACLA 2PBRA 2ZUVA 5KJEA 1Z4OA 4D3FA 1MVLA 1GGKA 4PLTA 1EFRA 4XD7D 2HV8A 3S70A 2EP5A 5LJIA 1BWSA 4YJ3B 4B1FA 1QG6A 4IWNA 1RC8A 1EHYA 5GJBA 3NALA 2YH2A 5F4ZA 3RJTA 2FDCA 2PUGA 1V25A 3D6JA 3KXPA 2XUAA 1UDRA 2D5IA 1DBWA 2LPMA 3BJMA 3HFRA 4NQZA 4O2BB 4P98A 3UJ8A 2C9MA 1SXJC 4J0IA 5LQSA 3RHFA 4BMVA 3OCYA 4DZZA 3BIOA 3U0VA 2GM5A 3ZHYA 2OBFA 5J23A 3FZYA 1OH5A 1KPHA 3JW8A 5JVDA 2C0CA 1FYVA 1U3FA 2FZLA 3INTA 3P8ZA 1YIAA 2QTWB 3EUWA 3K0AB 1T1EA 4NYJQ 2BAGA 3H1FA 3MHPA 3QLJA 3RUEA 3U48A 5CCEA 2HSJA 2QAGC 1DC5A 3WGTA 1Y42X 3RGWS 2J48A 5CD1A 3EXIB 3X1MA 5EMNA 1LSSA 3RR2A 3V3TA 1NXTA 4Q1AA 4S1OA 3TD2A 3WNBA 3T9BA 4INOA 1X7HA 4YX9A 2WMDA 3EZNA 3K0KA 4B2YA 3GD7A 3GF4A 4P0QB 1XTIA 4NOJA 1Q17A 1YNOA 1VHDA 1COWD 3ACBA 3OQ6A 5AJXA 3FVRA 3O4JA 1BAPA 3S1LA 4A2QA 1XZJA 4UU7A 2DHQA 1HSOA 1Z0ZA 3C74A 4ZDJA 3SF8A 1H66A 1C3OB 3MMZA 1CJUC 4CTNA 1Z0KA 5BOVA 1K6XA 3EG9B 4QC2A 2ZK7A 3E15A 1AB5A 1PFUA 1PR3A 2NXCA 1K66A 3FBGA 3ZD6A 4PAOA 3GAMA 3TB6A 2P3SA 1SIWA 3FA2A 1OXSC 1Z5PA 3GUVA 4G8JA 3UKDA 4FZRA 4DRZA 5EHXA 4B5LA 2IXTA 4WXRA 4OOEA 3TMAA 1Y3FE 5AYVA 4DIDA 1GZHB 4EKYA 3H99A 3Q8KA 1WSDA 3SKYA 4MROA 3GGJA 4KRXA 5DRTA 5ESRA 3U40A 4D82A 2VTBA 3PX7A 5HXAA 4ASUA 3AC0A 3TN7A 2B1JA 2QR3A 4WNAA 5F2KA 4HT3B 2J9FA 3FR7A 1KGDA 3QBJA 4KDCA 4V3BA 4DCVA 3DYVA 1FNBA 5A6SB 2XMRA 4FM9A 1RPJA 1DWOA 2G09A 3ZDBA 3DDCA 3A6ZA 5HFNA 1A0OA 3GA0A 3RUIA 4XXHA 5JO0A 1GL7A 3BDVA 4M0EA 4BO7A 3PEWA 3AVTA 4O5OA 3REOA 3PHHA 2GPAA 1MG0A 4NE7A 1HE1C 4MUGA 1XHLA 3R7SA 3J81k 1UP7A 5ILGA 2JLQA 1GU0A 2XCQA 1C8VB 4Z1MA 4UATA 5A3VA 1GL3A 4BNYA 4HDOB 4EMBA 2RGWA 4H4DA 5DOVA 3WRWA 1YD7A 3ZU3A 3ZDQA 3H4VA 4DY6A 4F72A 1D5CA 5ENZA 4DRYA 1CQIB 2ZRMA 1R18A 3FSRA 1DJLA 3M3PA 4NKRA 4ZAVA 3X44A 3NHRA 1DCFA 3DVAB 1U6JA 1J9GA 4URFA 1DXOA 1WIWA 2DHEA 2H0QA 1XZIA 3DLTA 4MWGA 5E1DA 4Q7MB 1GN9A 1FSFA 1P60A 2H4JA 1YU9A 4MVJF 4C4XA 4YQEA 1DLJA 1N2ZA 4EWLA 2ZI5A 4MUAA 3T3PB 3TJMA 5A4DA 4EPYA 4B3RB 4JELA 1T34A 1XWFA 4Q12A 1E6KA 3H1EA 4NF2A 4RTNA 4FDLA 2IXGA 1ZA2A 1M1NA 3N0XA 5KU7A 4KWIA 1NM5C 4G67A 3A6KA 2B20A 2J6IA 2ONYA 2YS7A 3FMIA 4QVIA 5E4JA 1JLLA 3NC0C 1PSWA 4EJSA 4RKYA 5KOJA 4BRUA 3R7AA 3PVSA 2OLEA 1FQKA 2PSJA 4N47A 4RPGA 4JVMA 4CF3A 1QG4A 2XDQB 3RAJA 3R0QA 1YQEA 3K1TA 1TM5E 1KI6B 2C00A 2J9RA 2PSEA 2YINC 4FP9A 4FSHA 4OPMA 1I3LA 3PV0A 1ZAYA 1G66A 4FGJA 4INPA 2AEJA 4XWYA 2B7LA 3UUGA 2K5UA 1H9AA 1RWBA 2EFCB 2QUHA 4TQAA 4ENQA 2BZ1A 5DM60 5DHFA 4ACAA 5KB3A 2FR1A 1WLYA 1ISJA 1P2TA 3S99A 3SX4A 1ONSA 1QH0A 1R4AA 3BSWA 1TVKA 2VJKA 5ETJA 4FK8A 3SGLA 1KAEA 1EK5A 4YJ2A 1TQ2A 3MD0A 4PGHA 4DVJA 1X9HA 5U9CA 2HRBA 2M6LA 4JOCA 5HRUA 4R2XA 3PC7A 4JFAA 5EGNA 3TQOA 1ZMXA 1ADCA 3N0WA 3TBHA 4YLYA 2IF0A 1HE5A 3DE6X 3H1BA 3IDFA 5J5AA 3GAZA 3MS7A 2ZJBA 2O48X 2QXYA 3K1YA 4HAUA 4LE1A 4NBVA 4ND8A 5FOUA 3IVRA 2QMHA 3GEEA 4FGUA 4BFZA 2EFHB 3FTQA 3IIIA 2P4SA 4M1ZA 4P53A 4R31A 3FSGD 4YMLA 5DX1A 2XJ4A 3RW9A 5CDGA 2GFHA 3NVDA 2WB2A 2I6TA 1NVKA 1EG2A 3PEYA 5HFAA 1T8TA 1O4VA 3Q12A 3LVFO 1F48A 2ZIGA 5A1TA 4I2NA 1L5FA 1Y5IA 3TVDA 5IJ9B 3X1ZA 3D7MA 5K45A 3EIWA 1SBNE 3L4BC 1U1DA 1VSTA 4MVWA 4UQOA 4DC1A 4L6CA 1DUIA 2PXAA 3C14C 1XZDA 2G06A 5CH8A 1NLYA 1TM1E 1NZDA 1J9ZA 1M76A 3M2PA 3ZZTA 3WA6A 4GDMA 1SXPA 3G17A 5IXYA 2DLDA 3F6RA 3K0CA 2H65A 5M2QA 1GAJA 1GCIA 4R6XA 3FDZB 3JQFA 2HUPA 221PA 3L4EA 2IU0A 4D9JA 4FFDA 2IH4A 3ZJVA 3T95A 2G76A 3CWZA 4ZTBA 2VTBB 3LUPA 3LUGA 4QD3A 3VR4D 3DM9B 1P2UA 1WW8A 1N2HA 2V6JA 4URHA 4CLXA 2IBTA 4J4HA 2FPPA 2J9FB 3H2YA 3KHSA 2GKSA 2HN9A 2IQIA 1ESNA 5TV2A 3FN4A 5AM1A 4DUGA 1DAPA 3JQ8B 4M7PA 4JLAA 4ISBA 3F6YA 1K6MA 3KVVA 4FC6A 4HTFA 1SB8A 1KI2A 4R1MA 5L3SA 4GSYA 1R66A 2G9ZA 2WFLB 2ERCA 2TRSB 3BHNA 4DSZA 2AVDA 2XOKA 3UENA 1LSJA 2QDKA 1EJBA 2X0KA 1DQYA 1Z3IX 1JB1A 3QIAA 1DWUA 1MJHA 4D9EA 2GVZC 2H2DA 3T3HA 1KI7A 2BFEA 2GA9A 4GE3A 5DLYA 5HUJA 2JJYA 2O2IA 1FP4B 3T7DA 1IN1A 3DZCA 3SZRA 3DE0X 1ES9A 4H6VA 5B1YA 1U80A 2JS7A 1GXSA 4L27A 4OI4A 4P0PB 4E14A 2BHLA 4GX5A 3RRNA 4MKIA 3VSDA 3T3IA 3PTZA 4MRMA 2WLTA 3E0QA 3GEHA 3BTUA 3MF4A 1E9BA 3OM8A 4JC4A 2ID9A 2WT9A 3CURA 1XZGA 4QDUA 3FNEA 3S27A 4F9TA 1Y3DE 4MUBA 2ODBA 4TVOA 3WL8A 1GZ6A 4CV1A 1DO8A 1F60A 1MX3A 3ELWA 1H8HA 2BEKA 3L8FA 2WE8A 1F4VA 3AHJA 3BJZA 2WUFA 3FYTA 3OP4A 4KI0A 4LDPA 2NWQA 3L7IA 4BJ5A 1CZNA 4NMWA 3ZTWA 5A9RA 5ECYA 4CL0A 1M1NB 5BN1A 4NK4A 2UXDB 2MSCB 3EULA 4PRZA 4R1OA 2G1UA 3QFCA 5FUBA 2H3EA 4IUCS 4LYJA 3KE8A 5AVOA 3EDYA 1WE2A 4AZSA 1BNCA 3D3NA 4UM7A 4DA0A 1W4CA 2AWOA 1V16B 2ZRJA 4PONA 1SG6A 2JBAA 2XUKA 3BMOA 2RB5A 3UHPA 1HG0A 1I14A 2O50A 1VLMA 2RGNA 5JECA 4MW9A 1XTPA 2HRZA 3MB8A 4HN9A 2Q28A 4U3JA 3WKEA 2J9GA 1CJCA 3LC1O 5AR1A 4DSOA 4E4TA 3LXRA 3AKZA 2DXIA 1CYEA 4D46A 4S04A 4IMIB 3WLKX 4ZVOA 2HQRA 5E3HA 1A9YA 1J21A 2GN1A 3JSAA 4OFXA 3X1WA 2IS1A 4H1TA 2Q07A 1JIUA 3LECA 1EK0A 4E4RA 2DPYA 2WE7A 4QQNA 1QAOA 1T0UA 1E79D 4TV8F 4JLBA 1AA6A 4E3WA 4BUJA 4XQ0A 4BNWA 1BRMA 1P5HA 1GR0A 2IEDA 3QE0A 2VH5R 2H2FA 4LXHA 4S12A 1DKRA 1GD1O 3PXDA 4XFJA 1EX9A 3AUUA 5JBIA 1SUSA 2PZFA 5KTSA 4X9XA 3CFYA 5LB4A 2AD1A 4ND8B 2WOJA 1ESCA 2WYHA 2NTJA 4OP3A 2YW2A 1UK6A 2FVXA 3HLYA 1ZCBA 1IJBA 1LFAA 3ONDA 4QYTA 5IYZF 1IUPA 1V4VA 1D4FA 4RAQA 2FPUA 3C3CA 4KXNA 2IS6A 4BFUA 2XW6A 2AFRA 4HBZA 3AFHA 5FI3A 3DKIA 4AD8A 2OZEA 1T3LA 1UIMA 1NBHA 4U8GA 1U0JA 2QPAA 3GOQA 4NCJA 4W4TA 3V9AA 2WIFA 2QYTA 4HGOA 3ZHRA 2G5PA 3C3BA 1IHDA 4MS3B 3L8EA 3AJAA 3K0EA 1XDDA 3H7AA 2O07A 3NM4A 1YC2A 4LHWA 2GK4A 5AUPB 5LQNA 3WKCA 3EGVA 1JMVA 4F1JA 4NZ9A 1U2DC 2OTCA 1IN6A 2ZR0A 3DQQA 3VH1A 1EJ0A 1WU8A 5A5VA 3QEAZ 3N0VA 2IEBA 2R5NA 5JLAA 4F2GA 3EIHA 4QOHA 2IH5A 4IGKA 5BNZA 3NGMA 1C8BA 2BWJA 2CXOA 5KYKA 4ZOLF 4JODA 3PB3A 1N9ZA 2BVNA 4FD2A 2FA9A 2ROQA 1Y1LA 3QPAA 3K4HA 1CP2A 4BNJA 1Q7TA 1XA3A 1NI4A 5H59A 1GFWA 1V8PA 1WO8A 3OJFA 3PFKA 3OHSX 4DM4A 2XD9A 1YJAA 4PSCA 1IG0A 4JOBA 1T9DA 2GM4A 3G7UA 1CJMA 1LPSA 1CUIA 1OFUX 1QE5A 1U3CA 1OXBB 4M0DA 5T6BA 5K1ZA 1CIPA 1CNMA 4F60A 2IXDA 2H92A 3KLPX 3R8XA 1A8HA 2QTLA 1ZD3A 1VJTA 5IVHA 3HACA 3G8YA 2CL0X 2WUWE 3ENZA 4R81A 3GJYA 1RLTA 3KZKA 4NARA 3VI4B 1HFKA 1UF9A 3PRHA 3IXLA 1NYTA 3SIWA 5B5SA 3OX1A 2FK7A 4DUZB 3P2JA 4EG1A 4L0CA 1CR0A 3QY9A 4MUMA 3OKCA 4QBTA 1LPOA 4W5JA 3NHKA 3E1SA 3P96A 1RZRD 2XVYA 4XGRA 4KO8A 3KVNA 5I7SA 3WXMA 3CX4A 3NKLA 3PGLA 2HLDA 2I34A 3BAFA 4F5EA 4F85A 3BZBA 3FCEA 1ANKA 5LDHA 1H94A 1I8TA 1OXUA 3Q41A 1C30B 1KORA 3N70A 1E69A 4Q1VA 1Z0AA 1T4CA 2VQSA 3AMVA 2VPWA 4HLQB 4F6LA 1KEEA 4A27A 3VU9B 5F23A 1NZJA 2EFEB 3ACDA 3B89A 1OBFO 3CM0A 2RHBA 4X95A 4M7RA 4OYLA 3RBAA 3T7EA 1RXVA 3CPJB 3RAPR 3QOFA 1L7RA 4PLZA 3UEOA 3WMEA 3HJUA 2XBUA 3C7KA 4OYHA 4PWZA 3V1MA 4C0QC 1XZNA 2XTNA 4CRWB 2AGVA 3I0NA 3LBAA 5BSFA 5FD8A 3BS4A 1XTVA 3BMOB 3SG0A 3EIFA 2FF7A 4YRZA 5CB4B 4L74A 4R2JA 5C7LO 1MO4A 2IYTA 2PWBA 4QDZA 4U3JB 5K9ZA 4H7EA 2XF8A 4Y0NA 4HV4A 3BE6A 3F78A 2BFOA 3M7IA 5J63A 4URYR 4ZHQB 3COJA 2VATA 3EPLA 3ME5A 2H4FA 2ZB3A 4WASA 5CBPA 3GGPA 2WEKA 3KWJA 5JPCA 2RK4A 4RCZA 1YDHA 4P81A 5JTUA 3CR8A 5HMLA 1RLIA 5H02A 5JE8A 1CXZA 3ITDA 1W47A 4F4UA 3RS9A 4C05A 1OX6A 1K2WA 2D1SA 2VJAA 3TWOA 2B6NA 1F3OA 2EFGA 2AFIB 2H8KA 4PQEA 4KKXB 4G0WA 1NYRA 3WSTA 1O4WA 2WTBA 5ESXA 1YJBA 4IDEA 5ICSA 3ZZ0A 1E3LA 1LJLA 4M46A 4PU0A 5J5CA 4EI7A 1FPQA 2CV1A 1L5SA 3U3XA 3VHQA 3U7FB 5SZHB 4ER7A 3TG2A 4ND4A 5IT9A 3BTVA 3N2GB 2GQ0A 4RA6B 2WA2A 5JT1A 2ZRFA 3H8VA 1SRRA 1ETHA 2EWMA 3GFGA 2DC1A 4U2GA 3MAAC 5KNCA 2IP1A 1SK8A 3CNQS 3T3NA 2HU2A 3O3NB 3B6ZA 1TTPB 4OCZA 2OZLB 1R5OA 4H4CA 2P75A 4E3ZA 5I9TA 4AWAA 4YUXA 5EJGA 2AFHE 1Z88A 4YONB 5DLEA 2HA4A 1YAJA 2OP0A 2GZRA 1N0HA 3OT1B 3QF4B 2CZGA 2YIVX 3LW8A 1ZOOA 2AD5A 3CPEA 2H57A 4GO1A 4I81A 5GAJA 1UBCA 3RVBA 3G59A 5LC1A 3P9RA 1ZXBA 2OORC 2WG0A 2Y0CA 3BWMA 3NHJA 3O2QB 2AG1A 2QTRA 1FXWA 1KJ9A 3O8BA 4J16C 4OLJA 4P92A 1XZLA 1H2HA 3MA0A 1YS7A 2RI6A 3A7DA 3UCEA 4ILKA 1NYLA 1VPVA 1CUUA 4JS0A 4MQFB 1F0PA 1VE6A 2R6CA 3O1IC 3OT4A 4Q4HA 1EZ4A 1SOAA 3KQQA 4ON9A 2N46A 3GUZA 4P93A 1IZ7A 3RS2A 2BI8A 2TMYA 1XEWY 4XIIA 1Y3BE 1GYRA 3I53A 1Q0RA 2ZRPA 4TV8B 5CNMA 1UODA 5ICEA 4GKKB 2OV1A 4YHBA 5DTMA 2A86A 4EEZA 5KVAA 1SURA 1F2TA 2OD2A 3A14A 2GEDA 1GPWB 4ND5A 1Z4PX 2OHHA 4GR5A 1XCMA 1E77A 1ULHA 1BFKA 1J2TA 3T4EA 4EUFA 4MUXA 4G0MA 3CH7A 3UNXA 3SJAA 4KH0A 1VC2A 2I4MA 4NI5A 4BLSA 5FXMA 2FEMA 2NXNA 3GCWA 1YQUA 2GAFA 3G9TA 5IULC 4HB0A 2DWQA 2DKFA 4KW7A 5IYZB 4BLPA 1YI1A 3HDGA 1OYYA 2PJRA 1VBNA 3ZKWA 2GD0A 5EMMA 2QLLA 3G2IA 5E7JA 3OO1A 1FFSA 3KHKA 5JY1A 1DOAA 1JQLB 2QP4A 3L79A 4BV9A 1RXIA 2BW0A 4QRIA 1QONA 4KR7A 1G8KA 4H7IA 4DMMA 1Y7PA 1ZVJA 1Q16A 1ZG3A 2PVCA 1QIGA 5M5BA 3OQVA 4UU0A 4KQWA 1XTTA 2Q8NA 5CVJA 2MYNA 2ZJZA 4IWXA 1KEEB 4UFOA 1F14A 4ZQFA 5SYNA 4WBNA 5CEJA 1Y6GA 3FPLA 2PMCA 5KYUA 2PWZA 2Y93A 4ZOBA 5ALWA 1DARA 1N6RA 3BMQA 3PGJA 4AKGA 1MOQA 4BYMA 3LC7O 2RGBA 3CO5A 3FRJA 4FKZA 3V4ZA 1R0YA 2XIQA 4JXKA 3T7SA 1UKYA 1NG1A 1XA0A 4I1IA 3TIIA 1L7DA 4ZOLB 4MEJA 1K68A 4D8VA 2BUAA 1I3OA 1KY3A 4K9LA 3K9CA 1EFVA 1Z2DA 3ET4A 3DXFA 1K7EB 3TTXA 5ELXA 2AR9A 1GPLA 3HB1A 1RMTA 3QWHA 3ZXXA 1YB4A 2C5GA 2GB4A 4H59A 1ZRSA 3R3SA 4JBLA 5FP0A 5BUSA 1XDWA 2O5CA 1PTJC 1XVIA 4KAAA 4MKZA 1MH1A 4QL3A 3S2IA 2RMKA 1YT5A 2P7HA 3IMEA 4OLHA 1RRKA 2ZBGA 4R7ZA 3HG7A 1BMFD 4DT1B 2JCVA 3KVYA 2FEKA 3EQ7A 2EGUA 4QIHA 4TLCA 4KXVA 5MHTA 3UGQA 1BCRB 1WDLA 1X15A 3NIBA 3K9FC 2AR7A 1JG1A 3NTLA 4OFZA 2VBCA 4B83A 5I3ZA 1JEYB 4JI8B 2NU8A 1KFEB 4I9GA 3ZWDA 1GVNB 4KQIA 3SD7A 3NGLA 2IBSA 3PIIA 4BMYA 2EW1A 2QTCA 5JRZA 5F1OA 4IYRA 1WXHA 3DBRB 3IAXA 4MS4A 3V4LA 3ADCA 3FTDA 4DMLA 1M34B 5E8RA 4TTQA 4GXRA 3V8BA 3TTSA 4F96A 2VVTA 4FYIA 2RB4A 2ZRKA 2ZZKA 1Y1KE 1XLUA 3UFXA 1FMJA 3ZDRA 3B3QA 3IFSA 2ATXA 2J7KA 4JIGA 2BEWA 4I6EA 1NX6A 1BU5A 3AINA 3HVJA 4IJVA 4OXIA 2ZPTX 3N28A 1I3NA 3N2NA 4D81A 3K7EA 4I1SA 4EJSC 1E4YA 2HQOA 3RGGA 1OAAA 1NRXA 2FN3A 3A10A 1V5EA 4OJKA 4Y1GA 4NYMR 1OIVA 1XLTA 2PKRA 2X0IA 1KFKB 4XVQA 1TGYA 4Q9LA 2BZSA 1A69A 1QIJA 5C35A 1XQXA 3WHIA 1EAMA 4NZZA 4CUKA 4ZV7A 3WIVA 1TLLA 1W87A 5A5GA 4JL8A 3F74A 2OUKA 1VI5A 1CE8B 1P7PA 2NM0A 4GMHA 5E7MA 5H16A 5EQFA 4DYHA 5D5HA 1JDBC 4NV0A 3BGOS 1ZCJA 4L6AA 4Q4HB 4Z4HA 4OJTA 4IDAA 3LO5A 1W30A 1F8XA 4QVGA 3RBVA 4DE5A 2W11A 1GQSA 1N0UA 3SMQA 1ISPA 3F9RA 5CLHA 3DB2A 5CG1A 1Q83A 2DQKA 2ILTA 2J32A 2GFIA 1I2MA 5DLPA 5KSPA 4P84A 2BEUA 2GT1A 4MPDA 1O5TA 1V2HE 1F2TB 1TI7A 3EIOA 3Q6MA 5F5LA 3BFVA 4EKIA 5I7HA 1XNRB 1W5FA 1WS6A 3PLRA 1ONNA 2DAPA 3WC4A 2AJCA 1RQGA 4DZRA 2Y2UA 3KVRA 5AO9A 4AN4A 3PJFA 5EPOA 1LW6E 1AKWA 3A1CA 3T7CA 2W8BA 5L9AA 4ZEXA 1TFRA 1FJHA 1XOIA 1SUCA 3G1WA 5EZSA 3RVNA 4CM1A 1QCDA 4ZJZA 1X8JA 2ZG6A 5KCZA 3WBFA 4AMVA 3ZKWB 3QVKA 1Y98A 1KL7A 1IWPB 3MTEA 5K0FA 5CFZA 2E4UA 2EERA 1X2EA 3EMKA 4IIXA 1MLDA 2WZDA 4Z3DA 3DTVB 3T4XA 1Y5RA 3W34A 3WHKA 2PTHA 3EC2A 4PE5B 1UOOA 3EA4A 5DWVA 5EP4A 1JZSA 3GT4A 2HXYA 1WEKA 4KQ1A 4TM8A 3EX7C 2YJTD 3KHTA 3ZY2A 5EJ6A 3R5FA 5CG2A 2HSGA 5ALGA 1Y7HA 1GPNA 1DT3A 4N18A 1T6YA 2ZT5A 3P9YA 4BXOA 3K0CC 3MJRA 1IM5A 3OEHA 3UK7A 4ESEA 2IIBA 4WRRA 3JQFC 1N36B 4KTTE 2UYGA 2ZPAA 5FPSA 1WXEA 4UNPA 5EEGA 2BP7B 5FPHA 4BVJA 4FFRA 3PPYA 3I2KA 5A9SB 1NVDA 3FTPA 5L4NA 1SD1A 1Z26A 3BEOA 3L04A 5CTAA 5FNVA 1Q1EA 2YVAA 2IYFA 4LV6A 1T35A 3EZ2A 5FWXA 3IAAA 4BMPB 1IMOA 2UV8A 4ZODA 4DDTA 2VTDA 3B3FA 4HXGA 2OAEA 3SLRA 2O3QA 3OHMA 3KELA 3V8QA 1L5HB 1TLTA 1JR6A 1RD4A 2X7HA 4IZHA 2YHAA 1UDBA 3W04A 1EK2A 2RGGA 2JZNA 4PGGA 1KAGA 5JO9A 2FMTA 2H00A 2E55A 4GL2A 1JPUA 2DWPA 5JH7F 3EOBI 3NTVA 3PSHA 3FW1A 4FYVA 2VWHA 3IHKA 3K2EA 3A25A 3VGJA 3ZCUA 1VPDA 4LEIA 2HCBA 1RM5A 2OA0A 2I3DA 3ZQ6A 4C5AA 4WTOA 3SZGA 1N32B 4M9UA 3PXAA 1OC4A 4R2IA 3CVUA 5LWQA 3QXJA 4PHTA 3BXFA 2PUWA 3R4CA 4HFNA 2WSSA 2VT7A 1N5LA 4JYMA 1JSCA 4OG2A 4UDYX 1XQVA 2C4NA 3E7XA 3QGMA 4Z6KA 1P4GA 3EPRA 2OXEA 1EZZA 3MCTA 1O6CA 4OAOA 1I01A 4DW8A 4RXMA 1YAHA 2PGDA 1UZLA 3CG0A 2PGIA 1BEUB 4INZA 1CB7A 2ETXA 5FTKA 4LX0A 3B1ZA 3NBXX 3LP8A 2NV0A 1W0JA 3RSZA 1NBIA 3DW1X 4P4SB 2O2SA 4ZFNA 3U1VA 4QREA 3VAAA 3ZPXA 2V1UA 10MHA 2DZDA 4M0MA 3VOAA 5KOHB 1KIMA 2G17A 2OQRA 3HBLA 4IGFA 4K3VA 5EP1A 5A7HA 4PPGA 1SQSA 1GUBA 1YZKA 1YVRA 4IIJA 4V0OA 2C82A 3V9PA 1XMIA 1MB3A 1YRYE 2EZ8A 3A1EA 2KJQA 3TLJA 3ZY6A 3ZV3A 1IQ0A 3FJ1A 4IO0A 3HUEA 5DIZA 1DADA 1PCXA 1Q11A 2RGNC 2XECA 1T5HX 2H7YA 3EUAA 3ILXA 2XMSA 3EXHB 1RRVA 2B83A 4OI1A 1M1YA 4JI2B 1QKJA 4J2TA 3DZBA 4PV7A 4K9SA 5JMTA 2PCLA 5EERA 3BFKA 4JMLA 4EGAA 4E5VA 5FL7A 5JSKA 1CFJA 1ZCFA 2D0DA 2V74B 5KSYA 3IHWA 3L18A 4XYGA 4HVTA 1YULA 3DCNA 4JD5A 4NV3A 4LWOA 3FIUA 1T3HA 2ONZA 3FUUA 2FMFA 4JJKA 2HBZA 3M6WA 4RZ3A 4DSNA 2JVIA 4ID3A 4ZJPA 5KHOC 3CTMA 4YIKA 5C3UA 3JD1A 4TKZA 3JZAA 3BL5A 1I9GA 3A36A 2WF7A 2DWUA 3KEMA 4I2VA 3AHEA 3QVOA 4LV8B 4RL4A 1Q0HA 2FX2A 3MJDA 1RI3A 3GFOA 4D1YA 1CG6A 1C0KA 4Y2UA 1JEEA 2C1XA 2ZTMA 4XM1A 3ZU5A 4K46A 5A2QA 2O0MA 1D6SA 2ANBA 3VYVA 4BVAA 1RYEA 2ZQ5A 2BE9A 1WDWB 1QPBA 2QMUA 3IUMA 5F73A 1JAIA 4GNKA 3ZGXA 4OMUA 2WSBA 4MTCA 4FFMA 1U0EA 4PYQA 4JX9A 1T2VA 2WIGA 5DJ5A 3T7RA 3CKMA 1AS2A 3F5QA 2VUTA 1YHYA 2PXCA 1L4GA 2VF2A 2HDWA 2VYVD 3EPPA 4ZGGA 2X8BA 3MCAA 1OJLA 3ABZA 5B58C 2E6KA 1ECGA 4N7MA 4KPEC 3KSDO 3L8DA 3TR6A 1TQDA 1OZAA 4PZ0A 2JLSA 3OLXA 3IT2A 5JCPA 1T9GS 4TRMA 5ER9A 1UDXA 2IFTA 5EZ6B 3B8EA 3G2JA 5AW9A 4L15A 5K0LA 3ZXYA 4RJTA 2JB9A 1GCOA 2GM9A 4B4VA 2YMLA 3CUTA 1GV0A 3HR7A 4WZAB 3GDFA 3ZWAA 4E32A 2ZYDA 2CB9A 1Q22A 3KV3O 3QVLA 3T3DA 2C5EA 3VYTB 2DFVA 2VWQA 3E3AA 1X80B 1OLOA 2AQHA 3DOEA 2WIKA 4NEGA 3UJHA 4B4UA 4EGQA 5J4HA 1SIBE 5JDCC 4Y2VA 3NASA 3SJ7A 3OIVA 3EZYA 2CZQA 3NRCA 4DV6B 1VLZA 2SKEA 5FNVB 4QTYA 5FWXB 1TJ5A 3IUQA 4R68A 4E13A 3OTWA 4LMAA 4EBFA 1DEHA 4JR1A 2PYDA 3JWHA 3QXCA 2ZSDA 3HA7A 2HPVA 4XH9B 2Z08A 3EE6A 1YDGA 4EPXA 4A1OA 1G4HA 1XTKA 1JMKC 3NV7A 3QBVA 1JLRA 4TROA 4EKEA 2PT9A 3AQ4A 1RRFA 2MWMA 3G0CA 5D84A 2R6R1 1J0XO 2ZE5A 4O4LF 1Q91A 3MMNA 4RA9B 1L5KA 2B4RO 2OFXA 4RS4A 1JPNA 2A9VA 2GPBA 4EHAA 1H9CA 2QG9A 3LT5A 1IQPA 2DPLA 3ECAA 4LF9B 2WHXA 3CEJA 4PLFA 1E62A 4MI6A 2WBLC 1FXUA 2ZXUA 1RC1A 2FP3A 4MR9A 3LDAA 5B1IA 3A6PC 3HN2A 3NOVA 4FNGA 5DTRA 5TPZD 2AXEA 1ZUNA 3HJRA 4Y9DA 1NI3A 2HQ1A 4OA8A 4PNEA 2OCIA 5G41A 1WUKS 3BQNB 2WD8A 1SUAA 2XUFA 2YHUA 1TUEA 2I80A 2XUZA 1HE3A 4EJFA 5EUBA 4CM8B 1KK2A 1C1HA 2AQ8A 2HTEA 2XB9A 3B6JA 4HL6A 1U2QA 4N6NA 3TW8A 1DUVG 2QLBA 3X3HA 1TCVA 3QHQA 5A6VA 1NUHA 4CTOA 1U6KA 1DRKA 1E1NA 2J3MA 4HX9A 2I8LA 1D04A 2VG8A 1SXJE 2WAOA 1N2IA 3MWEA 2DR0A 3WYNA 1N8SA 2AEFA 2OVFA 1UAGA 4IMRA 3KTAA 2WJIA 2ZE6A 1QUEA 1CEYA 1JEQB 6Q21A 3Q1LA 2GASA 2VK8A 3L2OB 4F91B 5BOSA 4R8LA 3SHFA 1JALA 3W2EA 2ZTLA 4Z4IA 2VZLA 3FXAA 1F0YA 3VTAA 5FUQA 4KV7A 1WSBA 2H6EA 4Q05A 4TV9B 5C5IA 1T6XA 1JR3A 1XX6A 5BQOA 5GZ6A 2FEWB 4U0JA 2GPYA 1HOTA 2GN2A 2GCPA 2DUUA 1CY1A 1GQOA 1ISHA 3DEFA 3FOCA 2BY4A 3KYCB 1RM4A 1YZUA 4M1EA 1KRWA 1AKUA 3CR3C 1B8UA 2C7VA 5DO9A 2VYND 5JH7B 2O3TA 1KPIA 1TMGE 1U2PA 2BKLA 1VPTA 2X2FA 3PXBA 4OXXA 4RPCA 5DYTA 1CB0A 4IEFB 3ZLUA 1P73A 2F43B 2JJMA 2D6FA 2M1ZA 3MGKA 5KTTA 2E5LB 4NR0A 5HA5A 1TA4A 5DYWA 1EVJA 5KJFA 4LOLA 1GRCA 2ZANA 1TECE 4X0EA 1YKSA 5IXJA 4L07A 1K4MA 2JGDB 4NG4A 3TZEA 2KBFA 3VKWA 2IYSA 3AHIA 2C4HA 4MQ6A 1VM6A 1VMIA 2R6JA 3LLUA 3R23A 3T94A 1MB2A 3ANMA 1UJNA 1K8ZB 1YE8A 1JW9B 4MA0A 2A8YA 1NBEA 5LA6A 3GLFE 1RXWA 4PSVA 2X9LA 1A9TA 1TYCA 2ZFUA 3D7LA 4BB5A 2DBYA 3DE5X 3OQHA 1SUBA 3O1LA 3QBDA 4UVHA 1LBTA 5TGDA 4WFQA 2FAXA 5FBZA 4GZ6A 3OPYA 1FUYB 3E53A 2CHGA 3NHPA 5ERXA 4C3OB 1E3MA 1TB4A 5ALFA 1VYUA 1P91A 1DMRA 1T13A 4RVSA 1QHGA 1UEXC 4J0FA 1XALA 3K71B 4IH4A 1P74A 2XWPA 2AT1A 4D43A 4IKOA 1WNTA 3TQSA 3L6EA 1J5EB 4FKBA 4L4SA 3M5DA 4Q1CA 1YDFA 1OAOA 3PF8A 2AKAB 5CDHA 3GDOA 3RTGA 5JANA 4UEQA 5L7TA 2FRDA 2Q1XA 4LJ6A 1T0JB 1C4XA 5IM4F 1JXQA 3ZE8A 2GXSA 1CBUA 1G3UA 3HO8A 1W0KA 4U7FA 5CK5A 4DV0B 5F1KA 3WFZA 3AUX