2WM8A

Crystal structure of human magnesium-dependent phosphatase 1 of the haloacid dehalogenase superfamily (mgc5987)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GTENLYFQSMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MAGNESIUM-DEPENDENT PHOSPHATASE 1
publication title Crystal Structure of Human Magnesium-Dependent Phosphatase 1 of the Haloacid Dehalogenase Superfamily (Mgc5987)
rcsb
source organism Homo sapiens
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12689 Acid_PPase Acid Phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wm8A00
4Y2PA 2HX1A 2YJ4A 1L8LA 1Z88A 2FI1A 2IA5A 4YCNA 1EK1A 5JJBA 2OA0A 5ALKA 2ODAA 5AW0A 2IOFK 1L8OA 5AKKA 2FPRA 5ALPA 2C9MA 2BDEA 2ZBGA 2ZG6A 3QUCA 3L8HA 3I76A 1TJ3A 3ZVNA 3OPXA 2R8EA 1Z4IA 1ZD2P 3E8MA 4L6CA 2Q4TA 2YMMA 5AKLA 5ALQA 3U7FB 3EPRA 3E84A 2G07A 3R4CA 2YJ3A 2D2VA 2AMYA 5AM2A 2CFRA 4RESA 2IOFA 5ALSA 3OCZA 4UMDA 2FPSA 4OFZA 5A3SA 4DWOA 2JARA 3ZX4A 2C88A 5ALMA 1AQ6A 3KZXA 3ZWKA 2G08A 3ET4A 2RB5A 2B1QA 1IWOA 1Z4JA 2I33A 4YCMA 2CFSA 4IFTA 2NYVA 3D6JA 1N9KA 1L7PA 5AVRA 5AVYA 4NAVA 3S6JA 2OBBA 3ZX5A 1QH9A 2HI0A 3FPSA 3QU2A 3I1YA 1PW5A 2RARA 1NRWA 5AW1A 2WM8A 4HYTA 3QUBA 2PKEA 3A1DA 5IT4A 2G0AA 2EARA 4CNQA 2P11A 1J97A 1RDFA 3L5KA 4OD0A 2NO5A 5AI4A 4NWIA 2P27A 2ZXEA 1S8OA 1ZJJA 1Z4QA 5AM4A 4B6JA 5AKGA 3SHQA 3ESRA 2CN1A 3WK6A 4FYPA 4UM7A 4CF5A 2YN4A 3M9LA 1WZCA 4YCLA 2HEGA 2HF7A 1Q91A 2O2XA 1Z4KA 2O9JA 3L1VA 1Z4NA 3QU7A 4KX3A 2FPXA 5AVZA 2HSZA 3QU4A 4Y2TA 2FPUA 2C4NA 4HAIA 5AVVA 2WF7A 3WGVA 3R09A 1L7MA 2C8KA 4BYGA 1VJ5A 1O08A 3U7HB 3BWVA 5AI6A 2VKQA 2Q4RA 4OCZA 5ALLA 3UMCA 3NUQA 4YH1A 4XQ0A 4AP9A 3L8GA 4UASA 2IOHA 5ALFA 4XOUA 2G80A 5AK6A 3WK7A 4ZEWA 3BA6A 5AI8A 3OCWA 4EX6A 2G1AA 3FPBA 4QJBA 2R8ZA 3RF6A 4J2TA 4YIKA 3WKAA 3ZTYA 1QQ6A 3KDPA 1JUDA 4HGQA 3FM9A 2R8YA 2ZOSA 1YDFA 3OCVA 1RLOA 2W11A 2FEAA 1O03A 4UAUA 4Y2SA 3NALA 3PGVA 1QYIA 4JDPA 5AKJA 2RAVA 2I6XA 5ALZA 3ZTWA 3EWIA 3QUTA 4UM5A 5AVXA 5ALJA 3QYPA 3E58A 5AW9A 4HGOA 4O8CA 4FFDA 3U19A 3QU5A 4MWOA 3FGOA 3ZVLA 5AK4A 3IJ5A 3WKDA 2B1RA 3SLRA 1CQZA 1FEZA 2YJ6A 3PDWA 3J7TA 1Z5GA 4EENA 1U2TA 2BDUA 2YMLA 1J8DA 1LVHA 3L7YA 3MPOA 1ZS9A 1RMTA 1N8NA 4EZEA 3R9KA 1TJ4A 3CNHA 1T9ZA 2JGAA 4NABA 4UU0A 4C4TA 1ZRMA 3WKEA 2OM6A 1Y8AA 3A1EA 1YNSA 1RKVA 4CE6A 1RMYA 5AI5A 4NV0A 2PQ0A 4UMVA 4GXTA 5AW7A 4BX2A 3N07A 3FVVA 4CF4A 4BKMA 4Y2UA 3AR4A 3ZW7A 2W4MA 2FPWA 4L6AA 3ZWDA 4BNDB 3P96A 4J03A 4UARA 5AHXA 1ZD5A 2G06A 3W5BA 2MSNA 5AVUA 5AKEA 5ALNA 5AKIA 5AIAA 1K1EA 4Y2RA 5ALOA 3SMVA 5ALHA 1QQ5A 4UMFA 3RFUA 2HF2A 3L0YA 3AR2A 5ALRA 3I28A 2GO7A 3QXGA 3KC2A 2HHLA 2WF9A 5AVQA 1RMQA 4I9GA 3ZUPA 1SWVA 2WFAA 3WK9A 3L0CA 4Y2JA 5AIBA 2CFTA 3WKBA 4DCCA 3MC1A 1VJRA 5ALDA 2FDRA 2P9JA 2X4DA 2YFYA 1F5SA 1WR8A 4G9BA 3UM9A 2YBDA 3SF0A 2GHQA 4YGYA 2NO4A 3ZI4A 4BEVA 3AR9A 3SKYA 3PGLA 5AI9A 3N28A 5A3RA 3IB6A 4OHFA 5AVTA 3ZVMA 4MUMA 1ZRNA 2G09A 3PCTA 3U7EB 3DDHA 5AM0A 2ZBDA 3WGUA 1U7PA 4GIBA 2I55A 1QQ7A 3EF1A 4CF3A 4Y2XA 4BBJA 1T5TA 4ZEXA 5AW5A 1L7NA 2FUCA 1RLTA 3UMGA 2JAOA 3ET5A 2JAWA 3F9RA 5ALEA 5FP0A 3B9RA 4DFDA 1U2SA 3W5AA 3AR3A 2P69A 5ALVA 3HLTA 3MMZA 4UMEA 2YMQA 1NNLA 3NANA 5AW6A 5ALGA 2GFHA 3QUQA 1EK2A 2C8LA 3ZU6A 5AM5A 5AM1A 4UW9A 1YJ5A 1Z4PX 2WF8A 3N5KA 4Y3UA 2I54A 5A3QA 3ONNA 2IYEA 4Y2VA 2HOQA 1WPGA 2B82A 4KNWA 4Y2YA 4XE5A 3ED5A 3A3YA 1KYTA 2AUTA 2WHEA 1RQNA 3EF0A 3FZQA 2ZBEA 1Z4MA 2B8EA 4KN8A 4NFLA 4ZEVA 3I6BA 1YMQA 5AI0A 3HYCA 1RLMA 3QX7A 2EATA 3B9BA 4AS2A 4DW8A 5ALWA 1U7OA 3AR7A 3IRUA 2OYCA 1XP5A 1Z5UA 3W5DA 5AW3A 5ALXA 3WK5A 2YJ5A 1TA0A 4E88A 5AKZA 5AESA 4C4SA 2I7DA 5ALIA 3WK8A 3DNPA 1ZD4A 4BX3A 1S2OA 3A1CA 1X42A 4QQFA 1Z4OA 5AVWA 1XPJA 5AK5A 1YV9A 3TLMA 2YY6A 2B0CA 3KD3A 3QLEA 4HGNA 4KYTA 3ESQA 3WKCA 3GYGA 5AW2A 2WF5A 5ALYA 1RQLA 4RETA 5AICA 1L6RA 1SU4A 3U26A 3M1YA 3KOOA 3L0BA 3UMBA 1RKQA 4I9FA 1WVIA 1VFPA 2FUEA 4PNHA 1ZOLA 2HCFA 4UATA 3WK4A 1ZD3A 3U7GA 1YS9A 1T5SA 2ZBFA 3AR8A 4C4RA 3AR5A 1TE2A 1RC8A 1RPZA 3B8EA 3SD7A 2WF6A 5ALTA 4Y2QA 5AKHA 3AR6A 5AW4A 2AGVA 5AK3A 3N1UA 1RRCA 3MN1A 3L1UA 1NF2A 3NASA 4UAVA 4UU1A 4EEKA 4H1WA 3DV9A 3OCYA 4YIHA 4JB3A 3OCUA 4BNDA 4F72A 5ALUA 2JAUA 2YMPA 1Z4LA 1Q92A 2HDOA 2R8XA 2AH5A 3OTQA 3SKXA 1XVIA 4FE3A 2DQSA 3KBBA 3L8EA 1LTQA 5IS2A 2QLTA 3CZ4A 2MU1A 4F71A 3U13A 5AKXA 4BEWA 4L57A 3L8FA 4HGRA 5IT0A 4EX7A 1MH9A 2HO4A 2GMWA 3K1ZA 2EAUA 2RBKA 2QYHA 3DAOA 3QNMA 1TJ5A 5AW8A 5AVSA 1U02A 1SWWA 3NIWA 2BY4A 3QGMA 3VAYA 1L7OA 4EELA 2I34A 4G63A 2Q5EA 2B8JA 2W43A 1CR6A 4AS3A 4KNVA 5E0OA 2B30A 5AM3A 5T41A 3OCXA 2GHTA 4HGPA 3W5CA 4KX5A 3N8GA 3E81A 3NAMA 4BX0A 3NRJA 5AKYA 2PR7A 4IG4A 1RKUA 3QU9A 4XPZA
chains in the Genus database with same CATH superfamily
5TY0A 1E6LA 1KK1A 1PJAA 1DWPA 3ZU5A 5LSAA 2IA5A 3ORFA 4MQEB 5JSZB 4LZLA 3DKRA 2XMPA 1ZONA 2A9OA 2AZ4A 4RJIA 1X70A 4GEGA 2GYWA 4ID9A 2ODAA 1IUPA 3LWDA 5I51A 4D4LA 2BGJA 3QVOA 1CQIB 2GBPA 2I7VA 2Z2JA 2FZ4A 5TPWA 3TIXB 2A5JA 2NZWA 3R3XA 1EK5A 1SCJA 3WGJA 1CY6A 2R84A 2ZSAA 5DN9A 4NBWA 1F6DA 4EB6B 5KQGA 3FI9A 4LSWA 2XKJE 3RSOA 4FFRA 1P9WA 3TM5A 3QE0A 1BGWA 1BE6A 1QOZA 5HUHA 1U0HC 1DP4A 1YR3A 2H54A 1W0KD 4MGKR 5KSZA 5CX1B 5BQPA 3H19A 1NAIA 2BN4A 3CRVA 5C80A 1V5EA 2CCGA 4PANA 3SP1A 5A0FA 4F92B 1J9GA 1UBEA 2UYHA 3QF4A 4X60A 5KC9A 2JVJA 4UFOA 2Q1SA 2ZVPX 3EBPA 2VK1A 2G07A 1NNI1 2HK8A 2JFBA 3KFXA 4W1PA 5JD6A 2O8DA 4B7CA 3DTNA 1KI3A 1MENA 2QUJA 1H4TA 5TSDA 5DJ5A 1DZ3A 3FKQA 3WL7A 4KMRA 1VB5A 4KGDA 2CJYA 3ME5A 5JRJA 4BJHB 3HVRA 5A62A 1C3XA 1NSTA 1NMSA 2P90A 4KU4A 4GHWA 1V37A 4UJ3A 1YA6A 1QE3A 2Q7XA 1YAJA 3GIDA 5SV2A 5MN5A 2C2HA 3BWCA 2NU9B 1FDIA 4DM7A 2QTRA 1N5RA 3WJAA 3TLXA 4BQFA 5E1BA 1RWQA 4OGLA 5TEVA 3CUUA 4MVJG 4CL0A 2A94A 3QBVA 1JKJA 2AR9A 3H84A 5JC8A 1Z4JA 1NY5A 3HJFA 4IFTA 5SYAA 4GUDA 2XZOA 1XD2A 4R51A 2RGNA 2H17A 1KJYA 1ZH8A 4MKZA 2R11A 4X3OA 4B32A 2C2YA 4CM5A 4CLRA 3MFYA 1E1CA 3K9FC 4OF4A 2L2QA 2I8AA 1AZLA 4RJJA 4B74A 1P6QA 2R7MA 4M1YA 4WZAA 4ZO7A 1V8PA 2OCBA 4EKNB 1RZRA 4HYTA 3R7AA 4N6GA 2PKEA 5GV8A 5FWYA 4YAWA 2ZUCA 5EE3A 3QW4B 4NE2A 3WBJA 4L08A 2XGJA 1V9LA 3E23A 3I1FA 3W2HA 1KOGA 3DZJA 1WUYA 3REQB 3X1ZA 2EARA 4ZCQA 4FJ1A 1L3IA 4AS1A 4Z4IA 5I9MA 2FKNA 1E3LA 1VLZA 3F3YA 3PFKA 2VLIA 4AG3A 3W77A 3OZDA 4JODA 1RWMA 1FX0B 2VRNA 4B5KA 1HR0B 4UZFA 5LMNB 3QV2A 2JFQA 4LXUA 1XV5A 1LDYA 1JW9B 4Z1MA 3O1LA 3T35A 2FJ0A 3T38A 3U49A 3NVKI 1JDVA 1L0BA 1WZCA 3A28A 1PNQA 1L1FA 3GLHB 1ZQ9A 1KFCB 1PUIA 2BBOA 1V35A 3NYRA 4FHCA 4JLAA 2OCDA 3BGOS 2F43B 2XA1A 3UAOA 4CG2A 3VJMA 4Q48A 1NLUA 4Y1RB 2NUPA 3FIJA 4KQCA 4Y2TA 5H3LA 1GZ5A 2DPHA 2WK1A 3BMXA 2X5KO 4MROA 3RJTA 4COOA 3K72B 4J0HA 5DW0A 2WP8J 2P7IA 2HDWA 1NJ2A 4HJXA 4XXHA 5B12A 3DA8A 4U0JA 3N2NA 5CIYA 3U80A 3UH0A 1QK4A 3L79A 4RMJA 1J07A 2OO5C 4IPTA 2C8KA 4CDMA 3VR3A 4J3FA 5KNLA 1U2EA 3AP3A 4G23A 4RX1A 1B3RA 1M6NA 1P74A 3KLOA 3W5VA 4DLZA 5ALLA 3H0EA 2A78A 4TLMB 1JMYA 3UUGA 1UOEA 3E5MA 4EP1A 4BPBA 4I50F 3KVNA 1MAWA 1VSVA 3L8GA 4XRRA 4MB2A 1AQLA 4RKYA 4KI0A 2Y27A 2BGMA 2WJIA 3OECA 2VXYA 4KVAA 2H4ZA 4IO1A 4FNMA 4DLWA 5K6AA 3DLIA 4B48A 1FJ2A 4JJFA 1K7CA 2WIKA 5EI5A 5I9TA 1DLIA 2VEOA 2IC5A 4Y6RA 4DILA 2XKKA 3JZIA 2H1IA 3Q85A 4LHVA 4Z3KA 3OOWA 4RCVA 4HGQA 5D5QA 4RQUA 1F2TB 2ZRDA 1NUAA 3EIOA 3OLVA 4UXHA 5DNVA 2HSWA 4WXYB 1OLUB 3KZKA 2B4QA 1E2GA 1EX6A 1K3TA 1RLOA 4XQGA 2NZ8A 2I4RA 1ZK4A 4GYYA 2A8YA 2JGRA 5DOZA 3WADA 4BVGA 3RIHA 3DQQA 5LJIA 3EWNA 4CLDA 3SIRA 2VN8A 4ZHSA 4M99A 1J0XO 3MHTA 4RMIA 4YECA 1NIPA 3I04A 5A6SB 3VDQA 4R16A 4BNYA 4JS0A 1A97A 5G0TA 3TSZA 4IBOA 4F21A 1P3DA 3BMNB 1GFZA 1JHZA 3CQ9A 4QHTA 3ETHA 5DGTA 1UFQA 2Q5CA 3R3UA 3ZY3A 4UFNA 4IHKA 1U3UA 5EPOA 2QVYX 2DSTA 3K15A 1JHRA 1MEEA 5GZ1A 2CGEA 2QMYA 2WHQA 2MINA 1Y1KE 2Y0DA 3M3PA 5T4BA 2LZ0A 1BW9B 2HT6A 1NM5A 3UICA 3IJ5A 2EOAA 2JASA 5CLHA 1Y9JA 4WOBA 4DAEA 4N8EA 3PQ4A 1KU6A 3EDMA 1L7BA 4TZ0A 1JEJA 4J07A 4R1OA 4X6XA 4BVHA 3FCYA 2EW8A 1U2TA 4G5HA 4EENA 3TQOA 5JARA 3MMPA 2EP7A 4J9UE 2DR2A 2FZVA 2P9ZA 5T8KA 5BT9A 3UJ3X 5CEFA 1VZ3A 1I14A 2FZWA 1N8NA 3VDXA 4X1KB 3STWA 1FUIA 1SC9A 4B4WA 1OVGA 1Y5LA 3X44A 4WD3A 3CNHA 3CVVA 4NABA 1BS9A 3KYDA 4G0OA 1WTCA 1QCCA 2H00A 2WNSA 5DYWA 4PFSA 1GNVA 1MJFA 1Z22A 3JD3A 3R23A 1DLJA 3H17A 2I3BA 4ZV7A 3UCFA 2H3HA 4OV6B 1D03A 2YY5A 4U4AA 2PZEA 5KQMA 4LJKA 2C4VA 3ZCRA 1CT9A 4OGKA 3KKNA 5KDLA 2PMEA 1R88A 4HMOA 1WMSA 1UZAA 2DQYA 2WA2A 3CEMA 4LOHA 4US1R 3PTLA 3QHAA 2M6LA 1L5HA 3OP1A 2EZ4A 4Y2UA 1UBKS 4HL6A 2HXGA 4WE3A 1DB3A 2EC5A 3UKJA 2SBTA 4E3ZA 2ZUDA 5FL7D 4OI0A 1SXQA 3TTSA 3ZIUA 1BX0A 4B3BA 4B17A 1NXVA 2FSPA 5AHXA 3ZDBA 2Z4SA 1RPTA 1DJNA 1QFXA 1UJ5A 1AQYA 4LZWA 3TN7A 1J25A 2ZVJA 5CIWA 5JFTA 4WKPA 5ESRA 1BSVA 4FMDF 1W49A 1VPEA 1VRCA 4N39A 5DXAA 3JQFC 4CT4B 4GX5A 4OXKA 4KRXA 1KS2A 1SVLA 2H5IA 2UVPB 2D7JA 3CEHA 1XJ5A 5THXA 2DCUA 1Q15A 3ASUA 1DKLA 1ZCAA 3DZCA 1QQ5A 3TZHA 4EFDA 3CCFA 5CA1F 5HW0A 3HRKA 4M8IA 3ND6A 2NIPA 2HZ7A 3K4PA 4ECAA 2GO7A 3EFBA 4JQOA 2BZ1A 3U3OA 3CVUA 2PFSA 3R7LA 4P5PA 4DDHA 1ZD8A 5KTSA 3M83A 2G63A 3KE9A 4C89A 2GRJA 2G5GX 2RGDA 3Q88A 5K6RA 3AQIA 3DSRA 5B6IA 1N2JA 4RGQA 4LF5B 4HUJA 3VSAA 1BN6A 3HXPA 1PKEA 3LX5A 5F76A 2DLCX 1I2ZA 3E18A 3DAHA 1WMBA 2HYDA 3SF0A 1UMBB 1VMEA 2HDHA 3BDVA 5BVHA 5DIFA 2BGGA 3UQYS 3V8VA 3ON5A 4FOSA 4LYEA 5A0VA 2AQ8A 4WLEA 1C1XA 3F74A 1JEQB 3KOMA 1X6VA 5EWLB 3ZWMA 4BC1A 5HKKD 1KF0A 2FSUA 2Y66A 3KU1A 4EQ6B 3UXMA 1UMDA 3DBRA 1KO8A 1ZZEA 4J6FA 5JNUA 2FKAA 2B1GA 4QU8A 2D7CA 4LQLA 5LB2A 2PSHA 3S0JA 4O4IB 4CU5A 3ILSA 3LU1A 4G25A 4Y2XA 2IIBA 1UKBA 3LD9A 4DMFA 2A67A 2ISCA 1JG6A 2XNCA 3R9XB 3CZQA 4K26A 1PFWA 4X1IB 4X84A 5E3JA 4DIOA 2FZCA 3J7AC 2CDCA 4TTTS 3MTIA 3IQXA 5IKXA 2HU5A 3CH4B 1OU0A 2JAWA 4TM7A 1JA9A 2VDWA 3D8BA 4PLYA 1EGVB 1MA3A 4BVLA 2AI1A 4O25A 5CBPB 1VMAA 4YMLA 3QX8A 1NNLA 5GM1A 4E51A 1DXQA 1JE1A 3D6MA 2D5AA 2QD1A 3GLKA 3M33A 4D42A 4Z7JA 2P40A 3KYIB 3Q3GE 2AUMA 1E99A 4CDNA 16PKA 2FOXA 3DM9B 2RKWA 2JH3A 1XXHA 3UJAA 5E7IA 3D6VA 2CJPA 2JGMA 4PSAA 2FZKA 5CUQA 4TSFA 2GF0A 4H08A 5CDTA 5BWLA 3EIFA 4TWAA 3LX6A 3ZGNA 4NXMB 4UTRA 1H2HA 2IYEA 4YLEA 1OA0A 3LBNA 1INLA 1CEYA 4YXWA 5I01A 4C7BA 3TUJC 4ZAYA 1KH3A 2CUKA 2G9ZA 1VSBA 2OV3A 2QTTA 1LK0A 1E0KA 2GUWA 2DFVA 2VK2A 3JZMA 1CS0A 1QH1B 3CB4A 1RQNA 4BNJA 2Q6VA 3AHHA 1PQPA 3CCBA 4QU9A 4WKNA 4X1YA 7ADHA 5FXMA 3UEOA 2LE0A 3Q40A 4RCZA 1GQFA 3JQBA 1ORTA 4J0GA 5EHXA 3TGLA 5CVEA 5C18A 2NPOA 3AYXB 1QZ3A 4JU9A 1HF3A 5F98A 4K86A 2CF6A 2FZLA 4HDNA 3W8EA 5ADHA 3IRUA 3AR7A 3HVJA 2OYCA 3LUAA 4D9GA 3EEBA 4DLUA 3DCNA 2BGUA 1D9ZA 3TJMA 2YWFA 1UH5A 4NQRA 2IF0A 2YJ5A 3NC0C 4RD1A 4XDGA 5ALXA 1B23P 2BWJA 3O2SB 4OQFA 2XWQA 1CUDA 4MI1A 4XDZA 5EZQA 3V1YA 5DYYA 5CDFE 3UJNA 3VO2A 3SC4A 4OA8A 1JU3A 2QPAA 4D9JA 2CLHB 3OU7A 4JP5A 4M7WA 1G9XA 1QB8A 4ZI7A 1G21E 5U4XA 5EUMA 4RFSA 1KJZA 1NULA 2P1DA 2ZRKA 4LY0A 3WL3A 5D86A 5BWMA 4AJ1A 1G2IA 2W2OA 3H5VA 3MXTA 4PC2A 4DJAA 1N92A 3GUHA 1Z47A 5JFOA 4DZZA 4MLPA 3U4HA 4HGNA 5IH3A 2HIMA 1U04A 2GD0A 3CJTA 4K6FA 4TYNA 3WIVA 1GZHB 1WB4A 1GIAA 3BCHA 3GZTB 1RQLA 2VF5X 4YRFA 3HO6A 3T95A 1QBKC 1ENPA 2VAPA 3KQYA 3MJRA 3DKIA 2F7SA 4AUMA 3B82A 4WCDA 1C3LA 2BGTA 1E1DA 1WVIA 2E4XA 4KR3A 1XZAA 4MPRA 2VJMA 3GAMA 4E03A 4RHYA 2ZRHA 1IOZA 1N0HA 1DG3A 4R2WA 1KK3A 3THOA 5LBIA 3TQIA 3FFTA 1XEAA 5ALTA 3AUSA 3M6UA 4OJYA 5B1IA 3I2FA 4PSUA 4E94A 2EERA 2BIFA 2F9LA 2Z9CA 5F5LA 4F5DA 5H1YA 5J43A 3U7QA 3OFJA 5B1SA 1P91A 8GPBA 1WW8A 3GUUA 5CLLA 1H2BA 3PVCA 1YE3A 1QAQA 1IEQA 2A92A 3M1LA 3Q12A 4GLJA 2IYVA 4JB3A 2DPGA 1VG8A 1NVDA 4R1QA 3B1WA 2P78A 4MGEA 3EIEA 4MUIA 1FVHA 5WRFA 5EYPB 4H7JA 1K5DA 4JBLA 1QIKA 1JLSA 5A9SB 3IBSA 1R3UA 1HNZB 2E6KA 4RTNA 2IYTA 2SKCA 1P72A 1BWRA 2WABA 2QJWA 3GLQA 1A9QA 1TQ4A 1XVIA 2E5FA 2QL7A 4FE3A 2XVMA 3USCS 3O83A 1AK2A 3R5TA 1SKAA 2DFLA 4IM7A 1ZX1A 1LTQA 3NPMA 4TTVA 4UHJA 4TTSA 1ADBA 3B3GA 3LLVA 4GM1A 1PR2A 4I19A 4QFCA 2D00A 4BRWA 5GGYA 3TSWA 3OO0A 4UEKA 3LC2O 5SYNA 1Z6GA 2WJVA 3NBKA 1KEEA 4Z54A 4MV5A 2BC9A 2RGBA 1IOLA 3IB3A 2NZ2A 4MLCA 5CB8A 4NYIR 1SB9A 3K1ZA 4ZOCA 4JUAA 2IHTA 4OB8A 2N9UA 5HKKA 3M82A 2P9QA 1KY5A 2AE1A 1GPH1 4FCCA 2PUHA 3WO1A 1R0WA 3ICEA 1XTUA 3JCZA 3HU3A 4ZJZA 1RXUA 3CSUA 1QHYA 1Z6ZA 1NQ5A 3VR1A 2POQX 2RGNC 2ZSJA 4BVFA 2QUAA 5GONF 4XX0A 1ATZA 2Q3FA 4JZYA 4CM4A 1JQEA 1VL1A 2GAFA 1OX5A 3OQPA 4I3GA 5DM70 3O0DA 5CYFA 3FYUA 1H4VB 3D8UA 3EQ6A 2R96A 2QMEA 3GJRA 4H60A 1HYHA 4DV2B 2DFNA 1K8XB 1ZC3A 2OCLA 3GFOA 3RS0A 2QVBA 2APJA 2PPVA 4MWGA 1JPNA 1KPIA 2XDYA 3D1VA 4NOKA 3BB1A 5EXDA 3Q1KA 3UOGA 1W1IA 4BFYA 5K8UA 2JGDB 3KDSE 1UQUA 4B3RB 1I3CA 2J9YB 4QASA 2OXRA 2ZBRA 1TA4A 1NR7A 2O52A 4KV9A 1ORWA 5AJYA 1RPNA 2NGRA 2J5XA 3U3JA 1C2YA 4XTRA 4GPIB 3TO5A 4R3UC 3TSOA 1Q0LA 1DELA 4TXJA 4UVDA 1SY7A 3UV7A 4AO6A 2A9JA 3UK1A 1X7DA 5F7OA 1COZA 3C4QA 3PWZA 1IVYA 4ZARA 3STUA 1N6KA 3IR6A 1G17A 4IS2A 4JVNA 1C9NA 4MMYB 3TB4A 3M5DA 2G9VA 1LBHA 4UUNA 3GMSA 4W5QA 2ZBGA 5ENVA 1E79A 2H4XA 4ZYWA 3RU9A 4KFTA 3OQNA 1TJ3A 2ZZKA 4JLKA 2OHOA 1VYVA 1EKXA 4TS1A 4KQKA 4MOWA 4P4GA 4RVHA 2ZIXA 4B81A 2PX4A 3KWMA 4DLTA 2BFOA 1XRRA 3GEEA 5HCIA 1H2YA 1QHGA 3RM3A 3H5OA 4ZMBA 4GD3Q 1FNCA 3CLKA 3U1VA 3ZNPA 1QCZA 4DANA 3R9WA 2OG2A 1E2BA 4YT2A 4WY5A 5BQXA 5ARBA 4P2GA 5AM2A 1PU2A 2IS6A 1MB0A 1ZC4A 2FPSA 3LFUA 3IKMB 1PGQA 4KXVA 3NHMA 1OW3B 1B41A 1WEKA 2X9QA 2V4ZA 3SSMA 1HK7A 2Q99A 5C8ZA 1K68A 2P9TA 1N5DA 3H1BA 3KZXA 3N6RA 2H2DA 1XKQA 2CLKB 3WZ2A 3ZWKA 4C9BA 1MORA 3CZAA 4JUIA 1JYEA 1Z8FA 1R8SA 1RYDA 3IAM1 3P9KA 1XLTA 3EIWA 1Y82A 1Y3HA 2I76A 2PG3A 1U1FA 3E22B 2ODNA 5AVRA 3ROPA 1OB5A 4JEUA 4KXWA 3RSSA 3AK4A 3NQ41 3QEOA 4LRYA 4BJ1A 4P36A 2JLRA 2B25A 4OIMA 1D04A 1ODLA 4JX8A 4Y2GA 5M5BA 5J4HA 2WKQA 3MWGA 2QT1A 4O4LA 1GXSB 1KY4A 3FDZB 4FGKA 5CFZA 4YNBA 4X45A 1LPMA 4QUIA 5L3QB 3OP4A 3PC2A 2NUBA 3I1IA 4GMDA 2ZTHA 2G72A 5G0SA 5HHTA 1OYWA 2WWYA 1WCWA 4GSYA 5CB4A 2LD4A 2HU2A 5CEJA 1OREA 2HQRA 2QP3A 2JKYA 3ISTA 5TF4A 4HAYA 4M4SA 2FF7A 1NM5C 1ZN8A 2PBFA 3GUCA 4YS6A 2C9OA 5HIAA 2D0OB 1Z37A 4RACA 4Y2HA 1V3UA 4UM7A 4QXOA 4ENPA 1ECPA 2P5YA 5J2TB 4RTKA 5ER6A 3N86A 3BFXA 4CHGA 2R6ZA 4D45A 5BT8A 5CDSA 4DPKA 3F6PA 3RFVA 1Q91A 4RYLA 2VYCA 4I4NA 5T8KC 1JKMA 1USKA 3WS7A 2DBYA 2X23A 1VA5A 3FJYA 4S12A 3TRDA 1BKYA 1DSSG 3ONEA 3TDMA 5M2QA 1G7SA 2PGOA 2BHLA 2TSYB 4HO1X 4A91A 4CM9A 5IKPA 2GX6A 3GFQA 3SC2A 3OOEA 5CDHA 3SYNA 1Z0KA 3OOHA 1S96A 2XCLA 8OHMA 3S8MA 3G0GA 1ACMA 1G20B 1YZQA 2QD4A 2MYNA 3PDIB 4ZXPA 3WYCA 3U1BA 3GVPA 4TMKA 4LNAA 4Q7JB 3EGDA 1FFBA 3EB9A 1RQ2A 1NYRA 3C8UA 3H1TA 5EJGA 4A6XA 4ITRC 1I2CA 4MGYR 2GJ9A 4CFSA 1S4MA 3V46A 4RTOA 4RHFA 3NUQA 4EHBA 3HXKA 3TPCA 1WABA 2WKWA 3MTEA 2WQ6A 4JV5B 5CM2Z 1NE7A 4TYYA 4XOUA 2BFDA 4MIOA 4RHXA 3SYMA 5AUNB 3DBHA 1B74A 5KTPA 4AN1A 1EVEA 3GPBA 4FVTA 4MS1A 1JP7A 2WAAA 4YQYA 3FZGA 1L5QA 3CRRA 3IIKA 5FHRA 4TQAA 4L28A 4WCFA 3OZFA 1IUOA 2C29D 4YIKA 4ZCRA 1LVGA 4EB8A 1E9CA 4BLRA 1BXGA 2O1EA 2QRPA 5LL6P 3HKDB 2ZETA 3HL0A 4W99A 4BWFB 1AXGA 2VHQA 3ETLA 3L8MA 1YULA 2W11A 3OLQA 4NHOA 3WLIA 2ZRQA 4REMA 3TQCA 4DT1A 3H42B 5KWIA 4JOQA 5AOVA 4F11A 3GX1A 4RPHA 1RZVA 3AJRA 2RAVA 3VR2A 1US8B 2LUOA 4LDQA 5IH7A 1HDZA 1UZMA 4OQMA 1SG0A 2R6FA 2K87A 3K9GA 3ZN2A 3FZEA 4KGZA 5BN4B 3E58A 3VZBA 3OEEA 4N7MA 1PJRA 2JLXA 2CE7A 4XKJA 3JQAA 4P5DA 4V03A 2RE8A 3IQEA 3RRMA 4A0QA 3N05A 4YPVA 1WVGA 3JQ6A 1OMOA 2X3FA 1VOTA 1EBBA 3BK2A 1UM9B 2EKQA 3KKPA 2V9PA 1IULA 2F9MA 3HQ4O 3WIOA 1BVHA 3Q2IA 1A5BB 1QRDA 4U3JB 3U4QA 1GZUA 1OXKB 3DO8A 3GBSA 3B3QA 3U40A 1UDWA 1MIOB 4HWKA 4GXNA 2O7NA 2FY8A 3K9CA 3ZCQA 4K2AA 4BVAA 1E2QA 2G25A 4S2EA 4ZT3A 4X0EA 4KLAA 2HLDD 1ETHA 3RNOA 3NWJA 2WVHA 3O9ZA 2C2BA 1Z39A 3PLRA 2O14A 5H4HA 2FMHA 2NP7A 2OQIA 3M4ZA 3KLMX 3D0RA 3A31A 1O6GA 3AM4A 1Q0RA 3G0DA 4C06A 4DRXA 2PUJA 1PS8A 2DHEA 1IBKB 1A5AB 3VH2A 4YRMA 5JNRA 4HVTA 5AQEA 13PKA 1YB4A 5LZ5A 1RWOA 2PQ0A 4N3GA 1FX1A 1PHPA 4UMVA 4L9RA 3D7RA 1TX4B 3P0RA 1TK3A 3RJZA 1C2TA 1HV8A 1GDDA 2QRQA 4HPJB 2PM8A 4BX2A 5DWQA 3F5DA 3O8CA 2AC7A 2OVBA 3O8OA 1NV9A 2Q6TA 3BREA 3KQTA 2W4MA 4RVOA 1RJ9B 1RXSA 1YDHA 4B8ZA 2CXPA 3WWEA 5HMLA 3ZWNA 3VSCA 1IOWA 2PRJA 1WZ2A 4YVFA 2V55B 4DYDA 5F3RA 5JBIA 1P80A 1BCRA 1QIHA 4Y8VA 3MOSA 1K1EA 4JFAA 2Y0BA 3KKEA 1N2IA 4P7KA 1T3TA 1I36A 4LQ4A 1K7XB 3IURA 1V8DA 2AN1A 3B78A 2ZYVX 5L8VA 4KAXA 2E82A 5EKXA 3F4KA 2PKRA 5JG7A 2P9HA 3R2JA 2Q3CA 2VOEA 4IQ4A 3JQBC 3R3VA 3GVHA 4YRPA 3EXG2 2ACEA 4O2AF 3MUEA 1WQ3A 3QXGA 4JI1B 3VSEA 3H5LA 5JCZA 2WIFA 4PWZA 2CVQA 3L40A 1XNJA 1RMQA 5FBZA 3IKVA 4YPFA 2QPLA 3IUJA 1BWSA 4Q19A 4EYGA 5JATA 1GLVA 3BL8A 2Q6OA 2IQIA 1L4FA 1PYDA 1WOYA 4IVQA 3VPBA 4EKYA 4N0PA 3QKRB 1B00A 2QNRA 3DNFA 3I9V1 3CISA 3RIGA 2XIQA 3CZCA 2ZDQA 4HDMA 2ZJYA 3MRVA 4G1CA 1Z6QA 5E1DA 2YFYA 4BO9A 3ETGA 4HZGA 4F4IA 5EC8A 2ORED 3MRXA 5T5QA 3IILA 4BEVA 4F1WA 1OLSA 3A6DA 3GFPA 5H16A 4OL0A 4TKUB 2ZJ3A 3WRXA 1F1JA 4E1AA 1UQRA 4TTAA 1EQAA 3WA6A 5CGQB 3TGWA 3OLYA 3IGFA 4ZVQA 5IT5A 5ESDA 3N0TA 4M0LA 5BNFA 4KOAA 3BG5A 2QTMA 1W59A 3PCTA 1Q7RA 3U7EB 4KP7A 1RYBA 4MO2A 2QJRA 4AJIA 4BLVA 3WGUA 2X8JA 2IYZA 2H08A 1K0UA 2O7VA 2PDAA 3HBJA 3EQ2A 1YXMA 2IBMA 3D7MA 1TM7E 3E3MA 3GDOA 3PXGA 3RAFC 2Q46A 5FLKA 2X2OA 3MQ2A 4I5EA 1YOVA 5JH7A 1HO3A 1K6IA 3DD5A 1AHIA 3O31A 4UQPA 1IZ9A 1N7IA 1C9JA 4RVFA 3G8YA 3ZWPA 4JL6A 1KORA 4G1UC 1ORVA 4QYIB 4S1TA 3MMZA 4URYR 4BO7A 1MO5A 1SJ9A 2CV2A 5L4LA 1GUBA 1K75A 1R2QA 2PXXA 2QSUA 10MHA 7MHTA 1P75A 2YWEA 2E5LB 5F1YA 2AN3A 2CXRA 1DRUA 3NNNA 4FFNA 4MGZR 4XLZA 4JOBA 1OXVA 2C2WA 3P1JA 4LUCA 1P7ZA 2J31A 5AM1A 3RTAA 3WQRA 5FL3A 1UIRA 2H31A 2H5EA 2WF8A 4OU4A 4Y67A 4AZVA 2QXTA 4E14A 3VX4A 2AJDA 5COBA 3FFBA 1XQWA 1VCNA 3D7LA 4HYQA 2BAGA 3QBEA 1AU9A 2BEUA 4FKZA 4GECA 2GKGA 3OZBA 4ITVA 5C1PA 3IDFA 4KNWA 2XXAB 2W58A 2I29A 1KK2A 1KZ4A 1S9HA 1YU6A 3QW2A 1SCNE 4JUBA 4LKOA 5AVWA 5ITWA 2E37A 3BORA 4TV9B 2ZUSA 2ZBQA 4TTIA 1MQ9A 3FZQA 3ZHUA 2ODWA 1EWQA 1A82A 2M1XA 2XR1A 4K81B 2A4MA 3I8SA 4XPIB 4E5PA 4F4DA 1Y5NA 1N8TA 1LD3A 1DIGA 3BAZA 4D43A 2GCOA 5BSFA 4Z8YA 5K7SA 5TQVA 3U3ZA 2EATA 5FBHA 3I4CA 2RBGA 4N5HX 2HZBA 4DW8A 2XT9A 4YP0A 1R64A 3WX0A 2H8KA 1GR0A 5LJLA 1Z0FA 1GSHA 4DUZB 3FH0A 2FMTA 1OC2A 4OQZA 1G5IA 2IHKA 3IDOA 4B2PA 1H93A 1C3EA 1TFRA 2R79A 4GO1A 1E9AA 2O07A 3CGGA 4LRTB 3BHMA 4LXTA 1W7AA 4FS8A 1KQFA 2YHAA 3WK8A 3MIZA 3ORSA 4J9VA 3WGZA 2PL9A 1F7VA 3H2ZA 1P60A 1PN3A 1S2OA 5BOSB 1PV4A 5ARCA 4BNVA 3AL0C 2H07A 1P77A 1XL0A 2Y1DA 3DJYA 1C5KA 2AFHB 3M6FA 3MCTA 3MGKA 3QE2A 1UXHA 1ZBQA 2VAMA 3SEFA 2CLCX 3IKTA 1PZEA 5BN1A 2YY6A 3SOPA 3LBYA 3LGSA 1A2OA 4KMOA 3LZCA 1FTWA 1EI9A 3FBWA 1RWPA 1E3QA 1T5OA 3GF4A 1MXHA 1JIIA 3FYUC 3M6MD 2B35A 1VE9A 1KFEB 1RP1A 3PZBA 2Q0QA 2V7EA 2Z8YA 3T3GA 4RLSA 4GH5A 4M36A 2Y9MB 3M0EA 3D3KA 1YD7A 3OF3A 4CHTA 3K9NA 3BXZA 2QNIA 1MAHA 5K9ZA 1C4KA 3QWIA 1CY1A 3FWKA 3RC7A 3DWEX 2XCRB 2V9CA 1DC6A 1CWUA 4RIHA 5HCUA 2BBTA 3B8EA 1SPBS 3WL6A 3WOVA 2RH5A 3ZY2A 4LK2A 1WD5A 3QFHA 4BZXA 4CMEA 4DSTA 4RD4A 4HTAA 4KVZA 2HADA 1HPLA 1LDNA 2ZB8A 2ZJ1A 1ISIA 2ONYA 3NG1A 1AN0A 4IXWA 2NZUG 1V6AA 4F0JA 4TXMA 3P2OA 2PUVA 2PSDA 4ZOLA 1NMZA 3T7EA 1NUTA 3L1UA 1H1DA 2GXUA 3UJPA 3II6X 1BHSA 4E31A 1R0XA 3W5UA 3WZLA 3K0FB 4JGGA 4YRGA 4YJ2A 2JFFA 3FTCA 1SC1A 4LMPA 1A5ZA 4MVJA 4CQNA 1M34A 1Z4LA 1MJ5A 2EF1A 2J3MA 2RIRA 3AJEA 3B89A 3BCSA 2YFHA 3H9GA 2R8XA 2QZZA 2X0JA 1V6SA 5JMPA 1VG9B 2WI8A 2WB2A 2ZW9A 1WCIB 2FZ5A 3VGPA 3QBJA 2GN4A 2PIAA 4FDLA 4B3FX 3QFFA 1J8QA 3E7DA 5DXFA 4EH1A 5TQ0A 1U0OC 3J81A 2RGWA 3IXLA 1W87A 1WF6A 1JMKC 3JD0A 3ONDA 4ZOBA 1RWKA 3EXHB 4UTVA 1JWAB 4G8JA 1WMDA 4AWBA 3VSBA 1C80A 2AK2A 3B51X 5DRYA 3Q3HA 3EVNA 1MH9A 2HO4A 3G17A 4PC1A 4GPD1 4OLBA 1FP7A 1T1EA 3AY6A 2BUBA 3QPDA 5EHZA 1COWD 4US0R 2R2GA 1G7CA 2ZT6A 5I5EA 4I14A 3TR6A 1L7DA 3CVJA 5K8LA 1OT5A 2X0FA 1Y63A 3DAPA 4RDIA 3P4YA 1S89A 3UBTA 1EE1A 3TX6A 1YRWA 4ZYUA 1XLTC 1KR2A 1QGUA 1CF4A 1KZ1A 3E3AA 4UEJA 5IF9A 4B3IA 3C45A 3KJNA 3AHCA 1V11A 5E0OA 4XJTA 3E9QA 3KOXA 5AHOA 2P4HX 1R6VA 2JFWA 5HS4A 3QEBZ 4X3PA 4HGPA 2R60A 3EBLA 3JAMA 5EJ5A 1IQ0A 1E98A 3A3NA 1H05A 2E1PA 5A9RA 1M2FA 4V3CA 3LHFA 3MCVA 4V0SA 2OXCA 2W6NA 4Q18A 4Q3DA 4Y2PA 5F2NA 1W96A 3H2BA 3HJAA 4QELA 4BECA 4NDZA 2ZKIA 4AKSA 4H27A 4JHXA 5JQGB 3JAKA 4UFPA 3AETB 1MO2A 5T4EA 2OO3A 3FWHA 3LWBA 3QNUA 1DDIA 3CX7A 2IK8A 2HMAA 1C8VB 1JG1A 1CJCA 1L8OA 3B1KA 4JLSA 3SC6A 2VZEA 4V02A 2BW0A 2WT8A 2FPRA 1LRLA 4NATA 1DRWA 1GNPA 3UJCA 4JOSA 1B1AA 3DBOB 1MRZA 4CCYA 4DLYA 5HFNA 5HGJA 3NAGA 3H11A 2IU3A 4FYHA 3GNLA 2ZCUA 2QD3A 3B48A 1W2HA 3GJ3A 1J2UA 3OPXA 4C20A 3D59A 1Q11A 2XSZA 2H7CA 2X0IA 4YCDA 2YHIB 2EIHA 4WJKB 3GRVA 3RC9A 3MB8A 2H48A 3TLJA 3QVVA 3IHKA 2AW3A 4RDCA 4UAGA 2UYOA 1VPLA 1U5AA 3LSYA 4Q9DA 1OPXA 3PRHA 5E3HA 4MR8B 5KU1A 2J32A 1DXYA 4X90A 4ZVRA 4NG5A 3A6GA 3AWIA 2IOFA 1G59A 1N5IA 4JJ8A 2AT1A 4OHMA 4TZKA 4AJ2A 2JLWA 1H1TA 3JQCA 4V0OA 1QAOA 4JGBA 3NCHA 4PCUA 3G7SA 3PUVA 3S1SA 1LSOA 1PZMA 4A1FA 3IFSA 5EMKA 3U17A 2QT9A 4REQB 4TUYA 5J63A 3K1AB 3VUEA 4BEBA 1X7WB 1E2HA 3BMCA 3ET4A 4LJ5A 4HGZA 1Z7BA 2WJPA 3JW8A 4QRHA 2AFIB 4NBNA 1P31A 1QJ4A 2W6PA 3FA2A 2VP5A 3IUPA 4PRLA 4WCFC 3TLEA 3ZHRA 5I7FA 2IH4A 5DGHA 5CVDA 4IHJB 4YUVA 2AEJA 4IDHA 4D92A 1J06A 4F91B 4W9RA 3DHWC 5K8JB 2QX8A 2Z4TA 5EQJB 2O2JA 3CUSA 2Q5IA 3C5HA 3IKJA 5IW8A 4PX3A 1REQB 1M75A 2WYIA 4PVDA 4WUTA 4QEKA 3SYRA 1CEEA 2YXBA 3BIJA 3ECSA 3N7TA 5AW1A 3G7NA 3P0IA 3TS1A 1U0LA 4FXPA 2YZ2A 4OU5A 4WDRA 4FEEA 2PEZA 1GOTA 3DEFA 4BKPA 3F9IA 1PLLA 1FDVA 1DDOA 4OO3A 2C2ZA 2O5VA 4LAFA 4LV6A 4HN4B 2QAJA 2A0XA 2GK6A 2W90A 4PZDA 1UFVA 2D5LA 4O0LA 3OY7A 3U09A 2Z2IA 4BQEA 4FZ5A 1VYHA 4H0FA 1TEVA 2Z0MA 1AX9A 1Z08A 4I46A 1JAIA 1ULSA 2CN1A 1M2VA 4BB9A 4I4CA 4G81A 3T41A 5FH9A 4EJ0A 1Z7WA 4ZVNA 5H82A 3ZHOA 1M2EA 1RCUA 3GD7A 2H2HA 1J1UA 1JG4A 1EFHA 1XWIA 1KMHB 3BS4A 4U2BA 1E0AA 1MEJA 4HG2A 2XUAA 4WX2B 3DVAA 1SVOA 2XYHA 4F46A 1Z73A 5EXXA 3V1NA 4N5NA 4GPZA 2CHFA 4I4TF 2QI9C 1KTVA 4B31A 4ZXFA 1HT0A 1NJ8A 4OA5A 5H4GA 3KZVA 5HGXA 1W5EA 1G8KA 5KYUA 5K5EA 3AUUA 4XYEA 3DAYA 2XUPA 4URHA 1YO6A 2GPYA 8AT1A 1OFTA 1XQ1A 4X8MA 2YHUA 1BDIA 3NTUA 4ZAVA 2CHGA 3IPYA 4ZN6A 2DKOA 3M81A 5JPCA 1ITZA 2R6GA 1COWA 3HA3A 1E6WA 3QUAA 3KZOA 4WADA 5DI3A 4DXAA 3GDGA 2I99A 5C1OA 2EP5A 3CX4A 5E6SA 2O3TA 5FCDA 3UJ6A 3UMCA 1F2UA 4UCFA 5KEIA 3CFYA 3A26A 4EJ6A 3JWEA 3FPEA 1NXSA 2IOHA 1ZICA 2G80A 5ALFA 3LNCA 1PZGA 2FSFA 3OTIA 3PT9A 5DOVA 3UMVA 1KYIA 4K87A 2AZDA 2CSUA 1JLLB 3CLUC 1WTAA 2HWYA 3CPEA 3W8FA 4DLBA 4OGFA 4HOYA 1T8RA 3BA6A 5JO9A 3OICA 2ONJA 1IBMB 1T1JA 1G8SA 4OQYA 2PCLA 2QR2A 3OPYB 1PG2A 3QI2A 3R20A 4L6IA 3ZG6A 2WLSA 5T6MA 4AULA 1GL6A 4EJSA 3ZQUA 5CHEA 1R4NA 2Q3HA 2R6AA 3JR3A 4EGAA 3W3AD 4ZEMA 1YZ3A 4JLJA 3EJ6A 2H4FA 3P71T 3P9SA 4Q4CA 1QTIA 3TMAA 5C9ZA 2OHHA 3G5MA 1J00A 4IQ0A 3T9EA 2NVBA 4CETA 4CL8A 4ZCIA 3UK2A 1V45E 4XOIA 3D02A 3HB5X 5T57A 3C0KA 4AURA 5BSEA 1SVSA 2WWFA 1P81A 4CM8A 3UJDA 1B2RA 5LP6B 4HNVA 5U9CA 1Y4UA 3CW9A 4TKLA 3EA4A 4Q16A 1QHXA 2D1YA 1HE1C 2WOOA 4P4NA 4NESA 4GDFA 1JIQA 1O97D 3D6UA 5AW9A 3OO1A 5C1IA 3RHTA 3L7BA 2C5AA 4F3NA 2AE2A 2O1XA 2IYOA 1U5BA 2XUHA 1IC6A 2II6A 1TQDA 2P3QA 421PA 2PKWA 2Q2VA 1GT91 2B7LA 1OHHD 2ZRMA 4PYLA 3EDOA 4TX1A 4ACAA 3QBDA 3X1JA 3WRXC 1QOQB 1AVTA 4NBVA 4QPDA 1W8IA 1YNOA 1OFVA 3B5JA 1Z82A 3K92A 1QF9A 3LP6A 3PDWA 2FPIA 5KYGA 1A69A 1AQUA 4OPMA 3NBYC 1EXMA 3O8LA 2VNJA 1P4HA 4TYMA 2Q2NA 1XTVA 2JJ1A 3C16C 1EFUA 3UFBA 4ER5A 3KXPA 4CTNA 1AOXA 2MWMA 2MYUA 1Q5PA 3QYJA 1BD4A 3E27A 4NMWA 4P33A 4LHEA 1WBDA 3UHPA 2WU3A 1GFSA 3SWWA 4ABYA 1TO6A 3HNRA 4WBNB 4OHWA 1URPA 3D8SA 2W6ZA 1GZ6A 5LIRA 3L7LA 1SKQA 2F1OA 4ANFA 3F5QA 3TQHA 4GR4A 2RI0A 1ZZGA 1KY2A 2WYVA 3B2QA 2NUAB 1X9HA 4E13A 4YDQA 4XTCS 1SQFA 2QTNA 1EINA 3SE0A 1E9VA 3HGTA 5LCXA 1XTKA 2IHVA 2I1VB 4Q4JB 1XMVA 4NV1A 1GY8A 2Q07A 1B8PA 5AR1A 3W9SA 4WY2A 3OZXA 1ZVMA 3D0QA 1ZMXA 1CQJA 3R0IA 5HUQA 2NV0A 3P9XA 5KSYA 4ZIRA 4C78A 1CZUA 2YASA 2ZK7A 1EU1A 4NJOA 3SVZA 3IT3A 2ZSHA 2RHTA 1ZJZA 1ULHA 3NRCA 4WBXC 2XCSB 3Q41A 2A84A 4G41A 2Q27A 3KFLA 3GLGA 3F8WA 3ZH2A 4L8YA 5THKA 4PIPA 5AIAA 2FW7A 4HDOB 4EHIA 2OVFA 3NIGB 5ALOA 4MW0A 3NHFA 2BF4A 4JXJA 4H7EA 4WXEA 4ON9A 5HILA 4J7UA 3SFVA 3EG9A 3ASYA 3I2IA 3KD2A 2Y4OA 4IIEA 1E2IA 2J9FB 1GADO 4QU5A 1D2GA 4U7HA 1ACJA 4R3NA 1WNFA 5CA0F 4YAJA 4W5WA 5AUPB 2X8LA 3FMPB 1R16A 1U81A 1USWA 3O6VA 3PEUA 1KARA 3FNGA 3OC6A 3PGA1 1ISFA 3KEQA 5F78A 3PXEA 3HDYA 3REFA 1J1IA 3MMSA 4DCGA 1JSRA 4D96A 5KTOA 5JUWA 1GLNA 1NL3A 3ECAA 3H9UA 2DPMA 2R8PA 3DMYA 3K0CA 4HNAB 4MX8A 4U9HS 2IZ6A 3CVYA 1UPFA 2ODBA 1F5SA 2AOXA 3CNOA 3H8JA 4NH0A 4OAPA 3ZI4A 3IOBA 4IYRA 2O8BA 4CF7A 3MELA 3PPWA 4Q5IA 4X9XA 4JX9A 3QX3A 3PHGA 2L18A 1G8HA 2OCYC 4R8KA 1OFUA 3NBMA 1BMFA 2RHJA 3PZRA 4HAUA 4K28A 4LXGA 3MJEA 2QV7A 1JTFA 3UOWA 3FYDA 4PAOA 4XWAA 2VYVA 1TKBA 2CD7A 1XZFA 2DYKA 3CY6A 4MQFB 1RKXA 1VKNA 2YINC 4N40A 5F1OA 5E8JA 3RGGA 1QQ7A 1E5VA 2WNHA 4RTQA 3ZDEA 4UBJA 1UDCA 3QM1A 2WIAA 3QVWA 1DZIA 3LG2A 4I6JA 4C2TA 1W46A 1R0SA 2G40A 4ZYXA 2UXBB 3WLOA 2EIXA 1PWYE 3M6AA 3DEAA 3FPFA 3VC2A 3QE9Y 1RQXA 2CUZA 4CQMA 4XCXA 4ESHA 1Q19A 1W9HA 2LW7A 1BKDR 4XUCA 3S3TA 3WMWA 2DBVO 1QDEA 1I51A 3EMDA 1V7ZA 1WOMA 4R05A 2ICAA 2XW6A 3NKVA 1OZGA 3T1QA 3TRHA 2Y71A 4J4HA 3L7NA 4F38A 4CMEC 4CEJB 1F7UA 3O8QA 5IBQA 2QRVB 4XGRA 1DT3A 4RPLA 2YCLA 1ZNZA 4WK4B 4ZYYA 3CMCO 1M6EX 2JK0A 3NWEA 3UHJA 2W6CX 1Y42X 4IICA 4A92A 4HQOA 3V4SA 2JH8A 5JCOA 4J43A 2AN9A 5CLIA 1RM3A 4LZOA 1M72A 1NXOA 1I01A 3RWOA 4JI6B 3SX0A 2BSXA 1YZHA 4RO0A 3PHJA 1AQIA 3UWDA 1UBJS 4BTVA 3SHOA 5JSQA 3T52A 3CE9A 4WDQA 3WWOA 4TKZA 5FF9A 4A03A 3I5YA 2FSSA 2GESA 1E9SA 3A3YA 4A5SA 1GTSA 3K31A 1G8AA 4CFZA 1I1QB 4V3BA 2C5BA 2V59A 1K7FB 2PH5A 1Z4MA 2W98A 4CLOA 1EGHA 4ZU1X 1ZH4A 5AUQA 4CDGA 4LPSA 4FEAA 1W4RA 3CEAA 5CIQA 1RJDA 3U9TA 3I5XA 2QTWB 1CUGA 3NTQA 1ZISA 4M37A 2K7ZA 1UWLA 4YUZA 1CP2A 1E4EA 4DJDC 3IDSA 3QIVA 3ND5A 4YI5A 4FB5A 1EG2A 4NK4A 2FLVA 3S4YA 1C30B 5KPJA 3W5DA 3ZLJA 1HYEA 2WAXA 3C5CA 3DO6A 4OAOA 3AF2A 2ECOA 1EFDN 1ZCFA 2D4HA 4RSRA 3JASA 2NVUA 4UDYX 4GL2A 1IN1A 4BX3A 1Y1QA 3E5RA 1X80B 2OHIA 1QTRA 2YTZA 2F48A 2HFKA 1YBAA 2PH7A 3KJEA 1GUAA 3EDRA 4POOA 3HDTA 3VHXA 4O5AA 1XMSA 2O1SA 3HR8A 1E9EA 1XCJA 1GZSA 2PSFA 2IV3A 3G1UA 5T7BA 4RSMA 2A5YB 3DOOA 4MWSA 1V71A 1UWKA 3CRQA 1YR2A 2C31A 1GGHA 5CPBA 1U0BB 2DB3A 3RG8A 1AUVA 3VPCA 4B7ZA 5AXBA 2VHUA 2WE7A 1R4MA 5F1PA 3WLPA 1ZJYA 5CA1A 3PKJA 3TJRA 3DCJA 1DIBA 3L46A 2CFIA 4V1CB 4AIRA 2RGGA 2X9GA 4TMWA 2B83A 1KVTA 1ZD3A 3UMJA 6LDHA 2A3RA 1NWHA 3GIWA 3ZNOA 2V1XA 1QF7A 1T5SA 3C3XA 3EH1A 2BSQA 3GI1A 3UKDA 1RPZA 1SEPA 3VPDA 1GA1A 1TKAA 1TCCA 5JZBA 4HVCA 1OJLA 3COJA 1ZH6A 3QOYA 3COWA 3EYWA 3LGAA 3CXRA 2JBAA 4NY1A 2OK7A 4CBVA 2CEAA 1CJUC 3N74A 4GZ6A 4KLRA 2JI4A 3S2GA 4ROTA 4BO8A 1RXEA 2OQ2A 3BXFA 1G8YA 3DOJA 1LC3A 3EF3A 3JQ8B 2Q6KA 1CE8B 3SDSA 4PLGA 1BIFA 7MDHA 4BJ6A 2JHGA 2MIIA 3QQPA 4ZTZB 1EHCA 4WT7A 1JQ5A 9GPBA 1ISMA 2GWHA 2QTHA 5E38A 3ENZA 3V33A 3TLBA 2NW6A 4DQVA 4DMKA 1I7DA 1A98A 3FKSD 1RD4A 2IW1A 3Q2KA 5LUAA 3BMOB 1SXJA 1VGQA 2R44A 4JCCA 3LO5A 5TJ9A 5M3BA 4IUDS 1K27A 1WL8A 2HA6A 4KC0A 2ZE6A 4C88A 5IYZA 1TQ8A 4UNIA 5J2UF 1DRVA 3H6GA 3NDIA 3K8YA 1DPFA 2QM0A 2LNDA 1KI1A 4RMGA 1ISRA 1T9GR 3CZ4A 1NQUA 1H2WA 5B3JA 3GLIA 4AKTA 1OQAA 4XRGA 4HGRA 3IO3A 5IT0A 5L40A 2BP7B 5I7AA 3GCXA 3N2LA 2QPOA 3OPQA 4I4LA 2G83A 3OPYI 3Q3IA 5EKUA 4Z4HA 5JAOA 2HR1A 5BMVB 2SECE 3HN2A 3T4EA 4KO1S 2J0UB 3W9YA 5AW8A 1LI7A 1QB7A 5A4JA 3SS8A 1IXRC 2ECKA 3LQ4A 1QC5A 3MS7A 3OVMA 1AGRA 1P62B 4TWRA 3RK0A 2QW8A 3WR5A 4BQQA 1OPRA 3KFVA 1JBQA 4R54A 4B43A 3OT1A 4FM9A 3RVBA 1TRKA 3O91A 1FNDA 3JRXA 4HUTA 4CQLA 1FJGB 4I8IA 1GSIA 5E4YA 4GYKA 4B76A 1TU0A 4QGAA 3W4JA 5BWNA 6Q21A 1UXGA 3E9MA 3H2SA 3HNOA 1IZZA 1NJ1A 2ZIVB 1XZJA 2P4QA 4MS3A 2LKCA 1U2PA 2GBLA 4QOEA 1ULTA 1HTWA 3NBZC 5KX5F 3TTTA 2H0AA 4RK7A 4MMXB 1Q2UA 4FINA 3NDBB 1G4HA 3C3DA 4RV5A 5DULA 3BZUA 4RWZA 1KMCA 5GJWC 3KKQA 4AB1A 1QRRA 2C77A 2G1UA 1QFMA 4M7OA 2GEFA 2M6KA 3Q7RA 2ZP1A 4TXLA 4NEHB 3S2EA 4JC4A 4KMSA 4OFXA 1SRRA 5FKJA 1IY8A 3SR3A 1KAMA 1XMIA 3CNBA 3EUWA 4HDKB 3T5DA 2FN9A 4P53A 7GPBA 3EDCA 1DOAA 4IDBA 2P4UA 2P6PA 3QEMA 5EHNA 2BTEA 4I55F 3HRHA 4R8VA 4UTNA 3JQGB 3UHFA 2VJQA 1SOUA 3WMFA 3ZIAD 3F78A 1P6UA 2DSNA 3I76A 4QEDA 2GK4A 2OFWA 5BN5A 4JI8B 3BD6A 3D2BA 3WNZA 2Z5LA 3GRUA 4Y0NA 4WZAE 1YQDA 1Y1TA 3MGBA 3NT5A 1LNSA 2VDUE 4H3KB 2I8CA 2QU7A 3C5VA 3UAVA 3K05A 1MG0A 1PSZA 3EPRA 4LC1A 4O4HA 4MPPA 2GZDA 2C83A 3MXOA 5JD3A 4D98A 1MW8X 2X9VA 3A7DA 3A6KA 3HN6A 5COAA 5L95A 3U44B 1KHTA 5BSKA 3RW9A 3LE8A 4KUHA 4RESA 4GX2A 4AY6A 4H3SA 2IYFA 4WZBA 1HT2E 3GELA 3RDPA 1S02A 2CXTA 3EHEA 3UQZA 4TL7A 4Z49A 4QT4A 2FXVA 4OXNA 1VKHA 4AG5A 1T0HB 1YR6A 2HMTA 2QSZA 3CU5A 4H4DA 4Z3OA 2ZI5A 4MUXA 2B1QA 5EJ8A 4WHMA 3VU1A 2QJOA 3PF8A 5IAJA 5JASA 1VBFA 1EGQA 2GD6A 5KOHB 3DMFA 4CMCA 4EJSC 2NU7B 4P81A 5SZHB 1JDSA 4IEFB 3VI4B 3WLKX 4DEVA 1FP4A 2XB6A 5JNWA 2JLZA 1XTZA 4C0QC 2CWDA 1MLDA 2PUWA 3G2IA 4TS4A 5CG2A 1PW5A 1XZQA 4ERXA 1E1KA 2WU8A 4LNHA 4ZICA 1ZUIA 3OJFA 5CD1A 1E0DA 1U8UA 2IITA 2FZEA 1SIUA 3GB9A 4FCWA 3I1JA 4QAJA 5AK0A 4ER0A 5I45A 1HRDA 2R3SA 4J16A 2BH2A 1NQWA 2KLBA 3W34A 4DPMA 1LI4A 1WSBA 4E07A 4TSKA 1MFPA 3LA6A 4QQNA 1EQUA 2HIGA 1X7XB 1PS9A 2GCNA 3AF0A 3ZD9A 4YV1A 1V3TA 1XJ0A 2XMGA 4JK3A 1Y3IA 4R01A 3OJLA 4Q39A 4UCWA 2ZXEA 1OIVA 5DIZA 1GGJA 3CUWA 3PSAA 3TW4A 1X92A 4F5EA 4GKBA 4EGFA 4RJ2A 1W581 1HE3A 1XTJA 3OBIA 1W93A 3SDBA 3VI3B 3DZIA 3L5OA 5AMXA 5KYXB 3I0NA 1A2KC 5KJEA 5HDQA 4DCTA 1TAUA 5JEEA 2Q6LA 3QU7A 1BU5A 1SQ5A 4KX3A 1PJ3A 4JP1A 4WN9A 4L5BA 3ZWXA 5AVZA 4CEIB 1PFKA 4ZI2A 3LZDA 1WP4A 4L5CA 1ZM7A 1J90A 3V9PA 1W85B 4C7XA 4E12A 1U9JA 1UZNA 4OBWA 2X77A 1SHJA 3GAAA 2HRBA 3FZNA 4DQDA 4PQRA 3KOZA 3T1TA 2J85A 4I8XA 4OL9A 2NXJA 1A9OA 3LKVA 4M6WB 1SBIA 2HCBA 2WF7A 1S5PA 2ZFUA 1GZDA 3KJXA 2I4IA 3KT0A 4GBED 4XWWA 2OLEA 1PNRA 2IXBA 2J46A 4JJIA 5JJIA 1K63A 4GOKA 2X6QA 3AO0B 2ORVA 3HPQA 2VKQA 1M5UA 3MAJA 3ICPA 3JAWB 5J23A 2B94A 1X86B 1H1LB 2QTLA 1JHVA 4AP9A 4JXZA 4ZFNA 1I6KA 3IA7A 1O1YA 4M21A 3ROQA 2F1JA 3DBLB 3RF7A 4BASA 4N41A 2CZQA 4HEA6 4FSHA 1XDGA 1U3DA 3ADPA 3F47A 2Y9PB 4WSOA 3OHPA 1Q3KA 1J2TA 2IEAA 3A9SA 3FW1A 1L1QA 5J9FA 4H7IA 1L5MA 3WXMA 3STVA 3ZV4A 3C7AA 2M6SA 2ZE8A 3ZTYA 5JXWA 3E05A 4FWBA 3DH0A 3WAGA 1V16A 4B33A 3LCCA 1LVUA 2F59A 3DZBA 3C8ZA 3KTDA 3OC0A 4L4SA 3ESDA 4ND6A 4NZZA 2D1QA 4QUJA 5LB4A 1TW3A 4M60A 2EG5A 5FFMA 2FP3A 4R2XA 1THTA 3VYTB 4RDXA 3Q11A 4ARCA 4GBMA 1DI0A 4NNJA 3MWDB 3BJZA 4DOMA 2OOSA 3ZGVA 1LRJA 5H8WA 1ZO8A 5DFAA 1C1YA 1L5FA 1EVLA 3AEUB 3EYAA 1XPRA 3AFIA 1U1IA 5JZSA 1PR9A 2D0DA 2WG0A 2C98A 4FMBB 5DTMA 3W5JA 4D46A 1UJBA 3KHSA 3GUZA 3W3ZB 4QYWA 4GGOA 1KNXA 5JW6A 3G9ZA 4D4KA 1B16A 4JNKA 2V6FA 3K0CC 7ABPA 1V9SA 4MTLA 3D0OA 2OESA 4ZT4A 3WWZA 3ILHA 4DJFC 4MINA 2NSYA 1RI2A 2HRZA 4EHNA 3OM0A 1CLEA 1L4YA 2HWXA 2EFGA 4IDPA 4YMGA 5DCUA 3SLRA 3H8SA 2J3HA 3LTEA 5JSZA 4MQEA 2G5TA 2IODA 1DV1A 4DVGA 1TTHA 4NJEB 3SIXA 1GCGA 4OJNA 2RK4A 2QL5A 5F9HA 2VLBA 1U3FA 1U65A 4HH0A 3DDNA 2I65A 1CQIA 1CC1S 1II8B 2XDQB 1XG5A 2UUOA 3OJ0A 4MW2A 1IH8A 4V1CI 4LOIA 2HJWA 4PE5B 1VJGA 4ZU3A 5C8VA 1RMTA 4RBNA 1Q17A 1ST2A 1WWKA 4EB6A 3MGAA 2G3YA 3LYLA 3WWDA 3JU3A 3CW2A 2IDZA 1TCUA 2IHYA 4RF3A 1BE8A 1XD8A 1YNSA 4RS3A 2O6HA 2VHXA 1DIOB 2FWJA 3CH7A 4J2OA 1PFGA 5CX1A 1TIBA 3WJ7A 2GNAA 2LCIA 5AI5A 2RCYA 4OYRA 2OEPA 2YQ4A 1BMQA 1UXIA 4D81A 4F8EA 4EEXA 5EEHA 4BFZA 1RHUA 3CHYA 1U7UA 1FJHA 1YQGA 2CCJA 4DB2A 3RS4A 1E32A 2FR8A 3D4OA 5TGDA 1YS7A 3UGJA 4LZAA 4LC9A 3VISA 1Z34A 1IDOA 2R25B 5JCOC 1ILEA 4X24A 1H8ED 1ZITA 3QBTA 4M0PA 3CPSA 4C7JA 4WOCA 2R1UA 3AHIA 4ZQIA 4MPDA 1MJGA 4W9MC 5DGCA 2N1MA 3Q72A 1Y48E 4GLOA 4EZIA 1HOXA 3W79A 2H2GA 4MWZA 2B4TO 2ERXA 1NVKA 1OSNA 3F46A 1N9GB 4EG1A 2R7KA 1XX6A 3T0GA 4X8OA 5D3MB 4YP7A 4TL6A 1WSAA 3M9XA 3N0VA 2UAGA 3AVVA 3BD9A 4DIDA 3PGXA 1XEFA 1NUQA 1IUKA 3NW9A 2X19A 5L45A 2WMNB 1TL7C 4B80A 4TLCA 1XK6A 1OGIA 2JIQA 3L0CA 4UPDA 3WKBA 4YCCA 2H2AA 3DZKA 4QEZA 4A0HA 1IBLB 2KJQA 2GKOA 4Q66C 3HXLA 4AJKA 3IX7A 1JE0A 4UVIA 4WLNA 1C7RA 4P7FA 1GGVA 1VB3A 4Z86A 2VPZA 1C8BA 1IY1A 5TJHA 1XXHE 3V6LA 4EAQA 2CNWD 3REQA 3CO5A 1GPJA 3KXIA 2BLLA 2IVFA 2P2ZA 3RSCA 4W6QA 1XL1A 4DQKA 3OIFA 1J7JA 3TM4A 2J7PD 1D2RA 3OQMA 4Q6WA 1M0EA 1DJPA 2DE0X 1M8KA 4PLTA 1QCYA 4CLXA 4F4HA 2G6BA 1MGPA 3GPLA 3DP9A 3UCXA 1FX0A 1FDOA 6GPBA 4UHKA 1DCTA 2GCIA 3PEEA 5HUJA 1B73A 3HJTA 4BQSA 4G86A 2VPXA 2B92A 4M1SA 3C1AA 4CMHA 2L0XA 4XYBA 4MDYA 1CVIA 1WU7A 3D3QA 1GITA 5L3ZA 2AI3A 2XEDA 3CX6A 1QORA 1TYCA 4LZZA 1F51E 1GGKA 2FG5A 2OO7A 4KQXA 2F43A 1JDBB 3H0KA 3IAS6 1WG8A 4P7GA 3QMVA 3C3CA 2OY0A 4Y1RA 3TVDA 1DBQA 1ZSVA 3GBPA 3UMSA 2XYRA 5A5DA 1E2UA 5GPBA 1T9KA 4MJ3A 4DMUB 2H5LA 1H66A 1M8GA 1AKEA 1N2CB 3NM4A 4G5FA 4L0DA 5TT1A 2W0MA 3F6EX 3FSRA 3GPIA 5KVSA 4K6KA 2YUIA 3N3BC 3RBAA 1EFRA 3KTAB 1ADGA 5EIBC 5G53C 3RUFA 1O58A 2H4JA 3IYLW 1XU9A 1XDZA 3G8CA 1OH8A 3VR6D 1BRTA 1WETA 3GGOA 1TVMA 2H4HA 1E7SA 3DDOA 3K9HA 2GYUA 1KA9H 4MXDA 2ARKA 3TAUA 4CKEA 3KNZA 3ONNA 1DKUA 4LCBA 2FW1A 4OFWA 5BWBA 2QROA 2F6RA 4IMJB 2YJNA 1QV7A 1Z6YA 3MJSA 4LZPA 4B6PA 3O47A 1PI3A 4EUHA 4JVSB 1HE8B 2OM2A 1SXJC 2KX7A 2ZVQX 4P82A 4N3NA 3N87A 1VGRA 5C4GB 3SR4A 4C0BA 4D9IA 5C32A 4B3MB 1H0SA 5LOVB 5E6RB 1GPAA 4Y9DA 2AHOA 5IDQA 5ECGC 2YDYA 5FI0B 4EABA 1F2TA 3QX9A 2B1IA 1YRHA 1OLUA 3IT0A 2PD3A 4JQCA 4LI0A 5CJJA 1T5LA 1U7OA 2H18A 3CW8X 3VH1A 1Z17A 4DS3A 4KVFA 4D57A 3LBHA 5B3JC 4IZIA 5AW3A 2O59A 2RAPA 1P9NA 2IUEA 4W9NA 4YRBA 5JI3E 4ASUD 4OK5A 1ESZA 4EARA 2DRIA 2I4LA 3Q7IA 4KWCA 3I5AA 4GI7A 1XDSA 4XCQA 4BCDA 5A6SA 1EUYA 3QFTA 1TZKA 3PK0A 1E6CA 2HBYA 2KSQA 4OM7A 3NOXA 4X91A 3WLMA 2E21A 2W83A 3BMNA 2V65A 4KWHA 5AJXA 1FTNA 1W48A 2C3MA 2BMDA 3I2HA 2BZSA 4ZHQB 2W00A 2IOQA 4QRDA 1L7RA 4BVEA 3VBEA 3WLAA 1PL7A 4CIXA 2P67A 4F84A 3VH3A 5BRJA 4WOJA 1XTTA 2V7WA 3GYGA 1LPNA 4HRXA 3M8KA 4KCGA 4OBEA 1RVDA 4NENB 4HAVA 4E5SA 4AKGA 4IIGA 3FMOB 5JNVA 3A4NA 3OAAA 3OZAA 3BK1A 3U3DA 4D3DA 2B2NA 3H97A 2Z5FA 3PENA 3GGCA 4E15A 2FG6C 2GBLC 4FFVA 5CFQA 1LKZA 4U00A 4X1KA 2ASVA 5HJEA 4I2NA 4Q9HA 2I62A 3OUUA 4DDVA 2LXNA 2D1RA 4J91A 1YZUA 4FSXA 2K2QB 4HWOA 1GYRA 1E5TA 1WPXA 3NJ4A 4TVBA 5FA5A 3GGPA 4LF6B 1Q3HA 1ISJA 2HH9A 1N0IA 3B6KA 1UIMA 1R6XA 3UPDA 5BP7A 2EVWX 4Q34A 2AKAB 5JI2E 4PM4A 2V9ZA 2YUTA 4RPJA 1AA9A 3R7FA 4EYSA 1T0BA 2XNKA 2NYRA 4KO3S 2OZLB 1UBSB 2DOKA 2GK3A 5TPZD 3GY0A 3L6EA 3D7NA 5IMSA 1BEEA 3NHWA 3OM1A 2RFLA 3FE2A 1GGEA 2FFQA 1KH1A 2QN8A 4JI7B 4AJEA 2CLFB 1L4NA 4FKMA 4H77A 3DTTA 4LJ4A 1OAAA 2BKLA 3G13A 4C03A 4WNYA 2NQ2C 4BFLA 1A50B 2X3UA 4M9QA 2VZ0A 4PPGA 1YA4A 1AK9A 4ZZ2A 1E1YA 1L4BA 4PRKA 1KI7A 3FI0A 1VKOA 1DTEA 4RVNA 2W2KB 4WINA 2WV9A 1IZ0A 1PBNA 2CK3D 2IYQA 2A9KA 2UVPA 1TF7A 3IXMA 3MWEB 3QWBA 4Q9LA 1Y4ZA 3DTVD 1CYEA 5IS2A 2B3DA 1U28A 4P84A 1MHPA 4RKWA 3JWIA 1XZEA 2CNWA 3L8FA 2EX1A 1JYFA 1PQYA 2VO1A 4NBKA 1NBEA 1TAQA 1QHIA 3CJRA 3CWZA 3H8WA 3NXSA 4C5BA 5C8YB 2QYHA 5AOCA 3RLIA 3A6JA 3ZBTA 1FFAA 1HH4A 1SWWA 1AV6A 2JVIA 3HKEB 1PTJA 3P32A 4R71A 4NPHA 1ONOA 3PPVA 4MV8A 3HJHA 3ZQJA 4F5YA 1BDHA 1SIBE 4B1FA 1UMBA 1NLMA 3QWHA 1XN1A 2RHRA 5IDWA 3L77A 2HCJB 3OSUA 2E0IA 5DI9A 4GWKA 4LJ8A 3MMNA 4KNVA 3QEAZ 1Q1ZA 2QG4A 4LTNA 4YC7A 2JRCA 1JEQA 4HV4A 4J94A 5EWLA 2Q5JA 3DYVA 5IKEA 5EOVA 4RZ3A 4EQ6A 5KNBH 1ZIPA 3ZVRA 2H0QA 3AVQA 2J30A 3FPHA 2K5UA 2ZYWX 1Q7TA 3KQVA 2GAOA 3CNQS 3INTA 4YJ3F 5CT6A 4XM2A 3ZOZA 2YL2A 5AKYA 3MRSA 4O4IA 1XZHA 3GAZA 3WYFA 5HRAA 4U2CA 1UM8A 1JQDA 3F7MA 3TJZA 3WNVA 2JBWA 1HLDA 3GMTA 1NSFA 4ND4A 3R9XA 1DCKA 3FTFA 1P8AA 4GRIA 4X1IA 4EMBA 5IVPA 1XJCA 5J4KA 3RU7A 2XTJA 1L5VA 1Z88A 2GJAA 3PWKA 3DF9A 4LBWA 2QX9A 2C0QA 1V1JA 4QDOA 4FB4A 4MEJA 4N0DA 2ZDGA 2F17A 2JLSA 5TX7A 1EUCB 5K45A 1UXKA 3EVFA 3M3HA 1CUXA 2NYAA 3DB1A 3T0FA 5CBPA 5HBGA 4L9SA 3SOZA 2WWGA 1C8KA 3W8RA 3MD0A 3B13B 1UDRA 4QJ4A 2IY8A 1S4QA 4TTRA 1JX6A 5HIJA 3SZOA 3TIIA 2BDEA 2VF4X 1KOLA 2GDJA 3LYUA 2FMUA 3CF2A 4CI0B 1E8NA 4PEVA 1J42A 1FU7A 5IU6A 3W78A 2J9RA 3BH0A 4QJ3A 4U63A 5ES3A 3LVBA 2ZYIA 3G8AA 3IAAA 3RUCA 5G4KB 1ID1A 2ZJ4A 4PPNA 4EHJA 3IE1A 2O3QA 1WBJB 4JEMA 2JG3A 5I4BA 1L5WA 1RWBA 2JDID 3LXMA 4II7A 5AKLA 1DRJA 5HK9A 4JC0A 2VPWA 4LY9A 1CXZA 4RXUA 4TRJA 4EA7A 1S1MA 1HZZA 4YCJA 5A3JA 2E4AA 4MZDA 4YO7A 5FOUA 1GAEO 1S2NA 1B0PA 2I9PA 2ECQA 3AT1A 3O4JA 2HWWA 1MNAA 3O8NA 1QWSA 1WDWB 2P2CA 3FX2A 3PG5A 4GLBA 2EW1A 1XVUA 1HNWB 3N7UA 1B42A 4XQ9A 3PF9A 3EZXA 1K2WA 1NW7A 2BFEB 2C88A 2QMQA 1J0EA 3VJLA 1CQWA 3BTOA 3WLLA 4F8JA 3VHQA 1RXCA 2Q5OA 4K6HA 3AIKA 3Q98A 4B79A 3G2LA 4JR2A 3HUEA 4BV9A 1T6XA 1EWTA 4ME6A 5A4AA 3IR7A 4RIIA 4JLVA 1X77A 4BWYA 2QTFA 3ADOA 4EVRA 2MSLA 4IFEA 3L8YA 2OCIA 3CT6A 1IHYA 1ADYA 2EKZA 2C3UA 3SYKA 1MTOA 3WJ1A 1GEEA 2IY9A 5JAUA 3RAEC 3E3OA 3EJWA 3CLSC 3NVAA 4PAQA 4C2UA 1H2EA 4BNTA 3EPKA 3CKMA 4AX4A 2WM8A 4DKXA 3OKPA 3PC7A 4FNOA 3ONFA 1BTOA 1GLGA 2J48A 3BWEA 4FOTA 4O3FA 5CCBA 4R9RA 2Q8PA 4YMIA 1Q1NA 3IJEB 3Q3EA 4QLBA 5I6DA 1YC5A 2LR0A 3A36A 5KJ6A 2DFPA 1CYDA 3KP1A 4BOYA 1ZQ1A 2GSDA 2WILA 2PQ2A 3FSJX 2GZ2A 3WIDA 3WRWA 1D6JA 3K4HA 3KOWA 3UMMA 4JIMA 4CTKA 2YWRA 3ER6A 4XWKA 4MYUA 3FHOA 1ODJA 1C0KA 4FJ0A 2HA0A 2W2VA 4NYMQ 4AKEA 3ZWBA 2AG1A 2WFLB 3TUZC 3F97A 1DINA 1FDRA 4IDGA 2BCGY 3MQFA 4IMRA 4KLZA 1O6ZA 3PFHA 5FBKA 2H7VA 3WP0A 1K4MA 4G0MA 2E85A 2EFHB 3WK6A 2OOKA 4RULA 1F12A 4S1NA 2M1ZA 4YCLA 1O89A 1RFGE 1CJMA 3NT4A 3QKTA 5TQ2B 1J5PA 3STTA 5BYKA 5KTTA 2Y0PA 3QEJA 2O9JA 3L1VA 4RQBA 1PZFA 2ZJ6A 4GZLA 4H17A 3L1IA 2VXBA 2EJVA 3QYAA 5D1HA 3U4IA 3GVCA 1YBVA 3NKFA 3C3PA 1UAAA 3RYIB 1YB6A 1N0VC 1P44A 4MEBA 1KYVA 3ENQA 1USIA 3KQLA 4BX9A 3QE4A 3H5IA 1JSZA 4RS4A 5EYPA 1MN6A 2XNJA 5A9SA 2MYTA 4UQOA 3BWYA 5LMUB 1TVKB 5SY6A 5BXQC 1I5EA 3R09A 5JSHA 4UDXX 4AD8A 4E09A 1HDXA 2IRWA 1OE0A 3WWPA 5BY2A 1ENOA 3BWVA 1IATA 5K8CA 5J3JA 1FUYB 4FFWA 1Y7HA 2FR8C 2WPDA 3ZIDA 1DO8A 1GTJ1 1GZ4A 2JHFA 1UPCA 1DAFA 1TYDE 1E3TA 1LPOA 2DTDA 2ZB2A 3FTDA 1DX6A 4E4YA 3HRIA 4FILA 3LX8A 1UT6A 2H1FA 4DR7B 2XQKA 4PIMA 4FR2A 2G1AA 3CLVA 1F38A 3SFTA 4CR7A 1RAAA 2VC2B 4Z0HO 2JFHA 2OCKA 3BSSA 4WNIA 2YWHA 3THSA 1G42A 4ESVA 1Q14A 4L3OA 2NPFA 4KPFC 3L82B 1TM5E 4GVXA 3A7EA 1L5ZA 3FHLA 3EGWA 4O2RA 1YDFA 2JC3A 3TI7A 1H5QA 4HI0E 2QL9A 2HWKA 3O9MA 1GNLA 2BFWA 3RRJA 3OF5A 2AKYA 4BMSA 2VF7A 3FZYA 3HJRA 4G1EB 1Z2AA 3T3HA 3VX3A 4S0ZA 5ALZA 3UHOA 3FLBA 2MSDB 1XSEA 4Z7QB 1M5RA 3L01A 1VE3A 1QVVA 2GEKA 4H0NA 5K8TA 3A6HA 4G26A 4GPBA 3A8TA 5ESXA 5F9FA 3A1UA 4Y6LA 4EYQA 2QT0A 1PLJA 1GCUA 3FWZA 3JRNA 1R0KA 2QAGB 4RGYA 1OB2A 5EXPA 5FPTA 1UBOS 4A7PA 2HHHB 1N2ZA 2P5SA 1DEXA 1ULAA 4JKIA 1GQ2A 3VTFA 4ZVKA 2I2AA 2G0NA 1VXOA 2JGDA 2PIDA 2VNHA 3BEDA 3FUCA 4PO9A 2HDNB 1QOPB 4MICA 3WSTA 4DA7A 3DMTA 3K70D 1FDSA 1JT9A 1I94B 2C1XA 3ZHTA 2E4YA 4HQ0A 3MNFA 3ZHBA 1E3SA 2QMHA 2YJ6A 3L7CA 2I5PO 1VP9A 2FPGB 4MRMB 2BISA 2BPOA 4XLTA 3ZQ6A 1K08A 3NTOA 1FYVA 1HEIA 1JQAA 1GKIA 3DHVA 4HKTA 1B26A 1SD5A 1H5NA 3CUYA 3GCDA 5FWAA 1EUZA 4EM6A 1CZRA 3L7DA 1EYZA 3WLFA 4EOGA 2QGZA 2PX2A 4KVGA 3NIFB 1CRPA 1DO2A 3WLRA 1BN7A 2R6R1 1DX9A 1VI6A 2I4MA 3KZCA 4PO1A 3WG9A 3GNTA 5DLDA 3EULA 3TZQA 3HWWA 3A4YA 3LPLA 4CV2A 3OM9A 1MJNA 2DPLA 1UP4A 1E58A 5JDCA 1LBEA 2HNKA 3PX3A 5KNCD 2QTBA 3DEKA 3RYHB 1FFGA 3OZCA 3V1UA 4U8HA 1EVJA 4L3VA 1DKPA 2IZ5A 3Q7SA 4EHDA 2YC4C 2QN3A 2NNLD 2QGFA 1VKJA 1GP2A 2OBFA 3ZBPA 1D2EA 1FMLA 1KQ3A 1YKFA 3S99A 1VKZA 4GI5A 2WQZA 5JAHA 3BILA 4E08A 3FCXA 1L9KA 1MUUA 3PICA 2EX0A 3RRFA 3Q9NA 1ZD5A 2ZI7A 1ARZA 1FTYA 2DQZA 5H59A 4DBLC 5CH5A 5AVUA 3JZFA 4D6XA 3PL1A 1MOSA 2QTCA 3FPKA 3IJRA 1WDKA 3SNKA 2QN7A 3KIPA 3ZDRA 1LNQA 3TSCA 4ND3A 1W2GA 4TTQA 4CIWA 3LFHA 4XIFA 5HF8A 5CBKA 3D1JA 1JU4A 3MGCA 4A82A 1NOJA 1L4MA 2OK8A 5C31A 4V0RA 5ILQA 3EUAA 5I8WA 3IT1A 1M2GA 1TGVA 3E22A 1FP6A 1ZK3A 2YICA 4YRKA 1Y3AA 3VR4D 2H59A 2E18A 3FY4A 2PH3A 4RPIA 5EEGA 2XJ9A 5TMEA 2XA9A 1LB1B 3QLVA 4UUBA 2CFTA 5BW5A 1CUFA 4ZRMA 4DCCA 1YS4A 2PX5A 3V4FA 5BWCA 1LWOA 3MC1A 2R6HA 3F6YA 4RELA 4W9NC 5ALDA 1RBQA 2BI8A 1IFXA 3FDZA 3G2OA 3GLRA 4JT4A 1F4VA 2AEFA 2X4DA 5L3QA 1OH7A 2Q5HA 3LNTA 4MIKA 4MGHA 5EZYB 1V47A 4YGYA 1KXJA 2BDTA 1KYWA 2ETVA 3C85A 4LNUB 2XB4A 4DNOA 2ZRGA 2BEWB 4OQLA 3U7JA 1CUIA 2BHNA 5AI9A 1PX0A 4EJ2A 1E2DA 1GRQA 1USVA 4OHFA 3HBMA 1OYVA 2ZS8A 3A06A 3SHWA 2PXCA 2GD1O 4Q1VA 5ERGB 5BYBA 2ERYA 1NXWA 3KLPX 4JI5B 5BYJA 1U7PA 4F2DA 1A8SA 1E9RA 1WQ1R 1QIFA 4Z0TA 5J2TA 4WK6A 1XDUA 3TCKA 2AX3A 3LOQA 2LDXA 4PTZA 1WIWA 3GRFA 1L7NA 2FUCA 5DZSA 3T9AA 3MSXA 5KCZA 5L51A 4K1LA 4MVWA 4W7HA 1N5MA 1I3OA 4CLEA 4K8OA 4M1QA 2R2AA 1V48A 3JX9A 1XEWX 1SBCA 4XYLA 1U2SA 2EZUA 2ZJ7A 2PZFA 4S0XA 1ORIA 5DXJA 2QX4A 1YFJA 3HLTA 5I7UA 1TK9A 1XZKA 2BR3A 2PGJA 1U1DA 2FFAA 2GFHA 3Q9SA 3RVPA 4DMRA 2C2XA 5CEEA 1POXA 2DH6A 2JGNA 1G20A 1D3AA 1F8GA 2Z9BA 3PDIA 1Z5ZA 1GO2A 4UBLA 5AXCA 1E20A 1SZDA 1Z45A 3TI9A 3VU0A 1H65A 4XASA 1K6EA 4BZPA 1P4RA 3TIFA 2FW9A 1YR1A 4FBLA 1O8BA 2VAVA 3C7CB 4IDDA 4FE7A 5BR7A 2OGZA 1CUHA 2VWHA 2XNDA 2HMSA 4TUYF 3SAJA 4RKEA 4B2LA 4D6YA 4ALNA 1SUPA 3NIDB 2FUG1 1QZTA 1Y7IA 2VDRB 2ZRFA 2OCXA 5HF5A 3IPCA 3P9IA 5FV7A 1OJ7A 3EN0A 1K97A 1SBTA 4OQDA 2IOYA 3GN1A 3O74A 1JZQA 1X1EA 5F73A 1KGDA 2BGKA 2IHBA 4P4LA 2R86A 2JD1A 5ER9A 3G5UA 3VUFA 1C3JA 3ZCVA 4KN8A 5KSWB 1WPQA 3HKDA 4YK7A 1Q0ZA 4PRZA 4TRMA 5DX8A 3WYAA 1AXEA 3TUIC 2ROQA 5B2EA 2OZVA 3AH8A 1RJWA 5KHOC 4I6GA 1U28C 2HBQA 3CE6A 1MA0A 2GFIA 5KTNA 3HM9A 3AEQB 3RU3A 3ACDA 3WK5A 1US8A 1HTTA 4HZUB 4YQEA 5AKZA 5FUBA 1QDLB 3IUSA 3H18A 4YDRA 4KIFA 4LE1A 4YQFA 3AFHA 1UBRS 3KVRA 4PX5A 4Y1EA 2FUNB 3U3MA 1VBMA 4LVNA 3SJBA