2WM8A

Crystal structure of human magnesium-dependent phosphatase 1 of the haloacid dehalogenase superfamily (mgc5987)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GTENLYFQSMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Magnesium-Dependent Phosphatase 1 of the Haloacid Dehalogenase Superfamily (Mgc5987)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords MAGNESIUM-DEPENDENT PHOSPHATASE 1
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12689 Acid_PPase Acid Phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wm8A00
2JAWA 3IB6A 4Y2JA 3F9RA 3QU9A 4Y2SA 3QXGA 4GIBA 3AR8A 1RPZA 3FZQA 4EELA 1ZD5A 2HX1A 2IA5A 1ZD3A 3UMCA 1RRCA 3E58A 1QYIA 2GHTA 2PKEA 3WK7A 2O2XA 5AKEA 1JUDA 5AVQA 3L8HA 4XPZA 4CE6A 3NIWA 3OTQA 3WKCA 2PR7A 1Z4PX 1Z4QA 5AI6A 2Q4TA 4UASA 2OBBA 1ZJJA 1WZCA 3SLRA 2WM8A 3L8GA 1ZD4A 2I33A 3E8MA 4Y2QA 2WFAA 3DDHA 3ED5A 5ALLA 3DNPA 2FPUA 3L8EA 2GFHA 5ALTA 1TJ5A 3ZU6A 5AI9A 3ZW7A 5AW2A 2W4MA 4UW9A 3AR2A 3B9BA 5ALVA 2MSNA 4XE5A 3OPXA 1L7OA 5FP0A 1T5TA 3ZWDA 1XPJA 1T9ZA 5ALHA 4E88A 3WK8A 3PCTA 4EX7A 1L8OA 1Z88A 2HF2A 1LVHA 4FYPA 3W5DA 4CF5A 2P11A 2FDRA 4UMFA 1QQ6A 3I76A 3SKYA 3WGUA 1L7MA 3EF0A 5ALDA 1TJ4A 1Y8AA 2JAOA 2X4DA 1RQLA 1Z4JA 3ZVLA 3ET4A 5AKYA 1NF2A 3ZX4A 3PGLA 3K1ZA 4UU1A 4I9GA 3QGMA 3FPBA 1YV9A 5A3QA 2RBKA 3NUQA 3R4CA 5AVSA 2FPWA 3L8FA 3UMBA 5T41A 4OHFA 4AS3A 3L7YA 4J03A 3A3YA 3QUQA 4RESA 3PDWA 3ESRA 4NV0A 1VJRA 5AKLA 2OA0A 3L1UA 3L5KA 2YY6A 1SWVA 3NRJA 2C88A 4KN8A 1RKQA 2ZBGA 4H1WA 5ALXA 1N8NA 4BNDB 5AKJA 1XP5A 4PNHA 2CFRA 4EENA 1Z5GA 2B1QA 2RB5A 3L1VA 4DWOA 4Y2XA 4B6JA 4DW8A 2EARA 3ZTYA 4O8CA 2YN4A 2AGVA 4EEKA 1U2SA 2C8KA 4HGRA 5AK4A 1L6RA 2OM6A 5AKXA 4UMEA 1N9KA 2NO4A 5AW8A 1ZRNA 2PQ0A 3NAMA 3ZTWA 5AW0A 2VKQA 3E81A 5AI0A 1RLMA 5ALUA 2CFSA 5ALZA 4EZEA 2WHEA 2P27A 5ALSA 5ALWA 4OD0A 2W43A 1QH9A 1ZS9A 4HGPA 4BEVA 2YMLA 3ZUPA 2HHLA 2Q4RA 4C4SA 3U26A 1S8OA 3MMZA 3FM9A 4Y2UA 2G0AA 3N5KA 4QQFA 3HLTA 4AS2A 4UMDA 1U2TA 2NO5A 2D2VA 5AKHA 2ZBDA 1YDFA 3M1YA 2O9JA 2B0CA 2R8ZA 4J2TA 4UAUA 2BDEA 3MPOA 1L8LA 3WK9A 2HO4A 4YIKA 1Q91A 3W5CA 1Z4NA 2B82A 4OFZA 1Z4LA 2FPRA 3ONNA 5AW4A 3ZX5A 5AW5A 2YFYA 2WF7A 3N8GA 4BX3A 2YMMA 3QU4A 3AR3A 2B8JA 2GHQA 3UM9A 3S6JA 1RKVA 3R9KA 2WF6A 3OCVA 2EATA 3WKAA 2HCFA 1Z5UA 3QUBA 3L0BA 1U7PA 1IWOA 1KYTA 4UM7A 2AH5A 3U13A 3VAYA 5IT0A 1K1EA 3AR5A 1ZD2P 3EPRA 3OCUA 3KBBA 5AI5A 5AVWA 4C4TA 4Y2YA 2HF7A 2IOHA 4FE3A 4ZEVA 2G1AA 2GMWA 1LTQA 1Z4MA 4IFTA 4DFDA 5ALKA 2QYHA 5AW3A 4KNWA 2IOFK 1NRWA 3QU5A 3IRUA 4Y2PA 5AVTA 4CF3A 3QU2A 1AQ6A 3WGVA 5AVUA 3OCXA 3KDPA 1RMQA 4CNQA 1WR8A 4MUMA 2YJ6A 5ALPA 4KX3A 3DV9A 4BKMA 3SHQA 5IT4A 5AW6A 5AVRA 1Z4OA 4BX0A 5AI4A 4YGYA 1QQ5A 4NWIA 4BEWA 5AVVA 2C4NA 3KC2A 3ZI4A 4UAVA 5AM2A 5ALJA 1CQZA 2ZXEA 3FPSA 3QUTA 1SWWA 3ESQA 5JJBA 4Y2VA 5AW9A 2FPSA 2YJ5A 2R8EA 3NASA 4YIHA 3OCZA 2ZOSA 4I9FA 4JDPA 3WKBA 5AM3A 1RC8A 1X42A 1SU4A 3SD7A 1RKUA 3CNHA 3KD3A 1WPGA 3U7GA 2ZBFA 3QU7A 5AIAA 3I1YA 1ZRMA 3RF6A 3PGVA 2C8LA 5AHXA 4Y2RA 4CF4A 2HEGA 5AI8A 3FVVA 5AK6A 1VJ5A 5AK3A 3SF0A 5ALMA 3OCYA 2I6XA 3ZVMA 2C9MA 4HGQA 2FUCA 5AKGA 1F5SA 3L0CA 3R09A 3ET5A 3I6BA 4MWOA 4NFLA 5AKZA 5E0OA 1S2OA 1J8DA 1PW5A 2RAVA 1TJ3A 2I55A 2AUTA 1RMTA 2FUEA 2DQSA 5AKKA 3QYPA 3CZ4A 2FI1A 1XVIA 4FFDA 4IG4A 3W5BA 1RLTA 3BWVA 5AM5A 2R8YA 2WF8A 1MH9A 4OCZA 3RFUA 3N07A 1EK1A 3E84A 3U7FB 3A1EA 5ALFA 2G08A 3QX7A 3WK6A 3ZWKA 1RLOA 3U7HB 4HGNA 2HI0A 1NNLA 2JGAA 4BNDA 2ZBEA 4HAIA 4RETA 3U7EB 5ALNA 1L7PA 3WKDA 2AMYA 2HOQA 3B9RA 3WK5A 2QLTA 1RDFA 1Z4KA 2CFTA 3A1CA 3DAOA 4GXTA 3KOOA 3WKEA 2G80A 2P69A 4KNVA 4JB3A 2RARA 3FGOA 2HSZA 5IS2A 5ALGA 1U7OA 3A1DA 3ZVNA 3QUCA 2BDUA 2B8EA 4BX2A 3L0YA 3MC1A 4EX6A 4UARA 4DCCA 4KYTA 4UATA 4UM5A 4Y3UA 5AM4A 4BBJA 4Y2TA 2G09A 1RQNA 3UMGA 2P9JA 5A3RA 4YCNA 4XQ0A 2NYVA 4YCMA 2ZG6A 4G63A 1RMYA 2G07A 5AW1A 2YMPA 3WK4A 3I28A 1U02A 5AVXA 2G06A 2R8XA 4AP9A 2W11A 2GO7A 5AICA 2YBDA 5AIBA 4BYGA 4ZEXA 2YMQA 2OYCA 5ALOA 3J7TA 3P96A 4HGOA 4L57A 4C4RA 4KX5A 1CR6A 1O08A 3NANA 2EAUA 2BY4A 4UU0A 3D6JA 2JARA 2CN1A 2ODAA 1T5SA 2WF9A 4HYTA 5ALIA 2B30A 4ZEWA 3KZXA 4UMVA 1VFPA 4YH1A 5AW7A 3AR9A 1WVIA 2YJ4A 4F72A 2JAUA 3AR6A 2I34A 3IJ5A 3SMVA 3EF1A 1YMQA 4G9BA 1FEZA 3AR7A 4NABA 3U19A 3BA6A 3QLEA 5ALYA 3N28A 3TLMA 2MU1A 2Q5EA 4NAVA 3N1UA 1Q92A 1O03A 5AKIA 1TA0A 1EK2A 3HYCA 3AR4A 5AVYA 4XOUA 5A3SA 1ZOLA 3GYGA 3NALA 2B1RA 1Z4IA 3B8EA 3M9LA 3QNMA 4YCLA 2FPXA 5ALEA 3OCWA 2I54A 1J97A 1QQ7A 4L6CA 2WF5A 2YJ3A 3SKXA 2FEAA 3MN1A 1YNSA 2IOFA 2IYEA 4L6AA 5AVZA 3W5AA 1L7NA 5ALRA 5AK5A 5ALQA 5AESA 1YJ5A 4QJBA 5AM0A 2HDOA 1YS9A 2I7DA 3EWIA 1TE2A 5AM1A 4F71A
chains in the Genus database with same CATH superfamily
4BNGA 4Z6KA 4IF4A 4LJSA 1EVEA 1U2DA 3UK2A 3F9RA 1N6KA 5DDIP 3VU1A 5HRAA 2R85A 3ED1A 3K1YA 3IVCA 4GIBA 3DFIA 4JBNA 3UGTA 1O8CA 2JK0A 5KMGA 5JNSA 1LLFA 1L5VA 3HYTA 1ZIDA 3MQ4A 4KK3A 1YE5A 2HGSA 4AN4A 5C7LO 2GHTA 3OTOB 4OB8A 4RVDA 1GGEA 3L8CA 1EIWA 1KK1A 3Q7SA 3O1JC 4ZZIA 4B4UA 1H2YA 2WWFA 2JCGA 2ZREA 3EEBA 3H5IA 1X7WB 4IWXA 3MXTA 4CEJA 4GR4A 3ADPA 2GN1A 4B2PA 2PGLA 4A5SA 4DJTA 1JGTA 1P81A 1XRSB 3DOFA 3NIWA 4B47A 2J87A 4MO9A 1ZVVA 3ZV7A 3HJRA 3UFXB 3ELBA 3AHGA 3AV0B 2D5CA 4TUYB 4A6EA 2EG5A 4JITA 5J43A 4CIWA 4HI0E 3RABA 4KQJA 5F9FA 3ZJYA 2O8DB 1X7HA 4GP9A 4JBXA 1EFPB 1M34A 3VHRA 1N0HA 1VC2A 1EWKA 5ALTA 1YKFA 9ATCA 4M9UA 2XNHA 2RBGA 4CDNA 5CB8A 1WG8A 5JXHA 1QGDA 5FDFA 3HE3A 5JLJA 1PSZA 1T5TA 2AC4A 3AC0A 4UM9D 1HT3A 3C1AA 4TYPA 2QTFA 4DN6A 1EG2A 2PGAA 3TRHA 4DDVA 4G9EA 1B4DA 4WZ6A 4LJKA 5D3MA 1M7HA 3VFDA 4E2WA 2GYVA 2P11A 1GU1A 1QHXA 2VHWA 2JRCA 3C6XA 2QQ0A 4FFBB 3QWFA 1L7MA 3IA7A 3M83A 5ALDA 4QLBA 1XIVA 1FW6A 2TRSB 1Y8AA 5TV2A 3GJ4A 2X4DA 3ORRA 3WNDA 1P9RA 1NNUA 4INAA 4M1MA 1BYUA 5E4JA 3P0HA 4I3GA 2VRCA 5ITSA 4G1MB 1ETUA 4UU1A 1EUDB 3RVJA 3D4IA 4DLLA 2PZAA 5ITVA 1BXKA 4YFVA 4HO1X 1OILA 1UKYA 4UCFA 4R9SA 2P9CA 2Y2UA 5EL0A 5JD4A 3CRZA 5J4VA 2BKLA 1P2BA 1TC1A 3R4CA 1OX4B 3C3EA 3A4YA 3TG2A 4KXFB 2CZGA 4UTRA 4WK4B 3T15A 4IIYA 2HY7A 5LQUA 3ROXA 1UBLS 1XZKA 4ZPXA 1AOXA 1GTMA 1SVKA 2ZRMA 4L0CA 4B4WA 3DTYA 4DLPA 2XUDA 5KTOA 3QTBA 2WIDA 1N6RA 1N25A 4QRHA 1GA4A 3ND5A 2VK2A 1C0LA 4YO8A 5AVOA 3TOVA 1NHWA 4EJMA 2VDWA 3G13A 3ITDA 3KXPA 3M6XA 2OK8A 3DKVA 2OXRA 3NBYC 2FLVA 1TMOA 4DJAA 4Y9RA 4FGLA 1DX6A 3F6PA 2A67A 4WJZA 4EK9A 2G77B 4P4TA 5JNWA 5EP2A 3R7AA 1XF1A 4KW7A 4NBTA 1H5QA 3ZDYB 2ZM6B 2EYQA 1MTOA 2Z2XA 1AK2A 3ZDFA 5ECYA 5THKA 5CJPA 3LWDA 2W6IA 4BO2A 3MD9A 1P4RA 4E2YA 3IQDB 2OHOA 4LS3A 1W5SA 2B1QA 4QHTA 4C3ZA 4DPKA 2J0QA 4UBKA 3TQQA 3G2MA 4D81A 5JNUA 1IEWA 3IR6A 4QUKA 9ABPA 5GOTA 4NECA 3NJ8A 1NLMA 3OJ0A 3WO1A 3E27A 3NIDB 4X94A 5DWDA 3RC1A 4ZVSA 1D4FA 1PWXA 3QYAA 2ZE6A 5F7XA 3K9LA 2FPMA 4AK9A 4E09A 4ETNA 2DCUA 3KLPX 2CJPA 2QVGA 2WJHA 1LS1A 3I53A 2P5YA 2QIPA 2ZFUA 3D02A 3QFTA 4FHGA 1K8QA 3L7BA 1H9CA 3KKMA 4MW0A 5L3VA 4CR6A 1SR8A 3CR8A 2IPLA 1RIFA 4GLOA 3RYHB 3NTRA 3S2EA 2XKJE 1FDTA 5B3JC 1SBYA 3JQRA 4D3DA 4NCHA 2CVHA 4F84A 1DCKA 3W5VA 1USWA 4D7AA 2KPOA 2PMBA 2Y1CA 3OMWA 5K4GA 5CCEA 3CG4A 2C9CA 5KQLA 1WF6A 2MYPA 4OJTA 1DADA 4N03A 2YCBA 1KH1A 2Q4OA 4X92A 4N0EA 2OPHA 4EHIA 3WJAA 1CJCA 1X39A 3HCOA 3EVNA 2P6NA 4KLCA 3C3CA 4RSMA 1SKMA 2AFHB 2L19A 4OIMA 3L0IB 3R7SA 1YS6A 4M7PA 2KLHA 3R9WA 5AUOB 5EJ7A 3I9MA 4UBIA 4P8RA 1DKQA 4E6PA 2NO5A 5JCOC 5AKHA 3JW8A 5CDGA 3PE3A 4LFBB 3TZKA 3SM3A 2VPTA 1YDFA 2I22A 3HBLA 4E51A 5LQAA 1SJ9A 2B8WA 3WLFA 3D7KA 3DYBA 1E2QA 1AK1A 1ISSA 2DC1A 3BWEA 3EVAA 3KR1A 3LQYA 3NV7A 2QRQA 2EJUA 3NKLA 4O2BB 2IPMA 1Y63A 3FTPA 1A95A 3OOWA 4V0KA 4JLWA 4X0EA 1N9ZA 5DRTA 5JAQA 4YMLA 3IKJA 1Z6ZA 3KVOA 4MGHA 2A9KA 1X1RA 3JQCA 3RT1A 1EX9A 4JC8A 3NH6A 2QVBA 3H1GA 3LFTA 1HQYE 4MLDA 1RYZA 2FP4B 4B79A 2W48A 4UM9B 1O4WA 2WE8A 2Q2NA 1GGMA 4OHUA 3MBOA 3Q6NA 5CM9C 1ECCA 5FTLA 1KSGA 1LDMA 3RRXA 4A26A 4ZMRA 1GTL1 1O6CA 2IEBA 3O7MA 3VR0A 3I45A 1LPBB 4IKPA 5TQ2A 5JECA 1P72A 2H07A 1IIRA 3FMFA 3A6HA 2QMHA 1YSCA 4HVAA 4JI1B 1JS1X 2H5EA 3K2IA 1R18A 4KH0A 4KRXA 5CR9A 4L85A 2GSWA 3G2LA 3I62A 3MWLA 4N8DA 4P32A 4TWZA 1QTNA 3VAYA 2CDRA 5ICGA 5FWNA 1U0RA 4TZ0A 1DRWA 3AR5A 3RR2A 1XMJA 3ZWCA 5L53A 4YXWA 2E3JA 3ZZUA 3SZRA 2BHLA 4KQ6A 3AYZB 2IXTA 2Q5IA 2QG6A 2W9XA 1BFDA 1F8GA 2GN9A 3BILA 3DBLA 1J21A 1X7ZB 2PAAA 3I8SA 2UYYA 4IX9A 4YMTA 1U4OA 1MOQA 4OLHA 1GL9B 1JU9A 2WG1A 3VR3D 2D5BA 3C3JA 3JTMA 2AKAB 2XJ9A 4XH9B 5KPJA 1KEUA 2FPPA 2AWNA 4GQAA 5EE9A 3LIPA 3EPJA 5AD1A 2RGYA 1GFSA 3BD6A 4QELA 3R0IA 4RIHA 4BAGA 2ANCA 5AVTA 2BZ0A 1A9ZA 2K7ZA 2D0PB 2DJ5A 3ABIA 4HNAA 1DX4A 4N82A 4ND8B 4E4RA 1SVWA 2EJWA 1RMQA 4ZQFA 2IH2A 1CRPA 3MWDB 4U39A 2PIDA 4V38A 2I78A 1AGRA 1V35A 2Z9DA 1ANKA 3G0DA 4OTZA 3HN6A 2VF2A 4UUPA 3LBAA 1QKIA 2PSDA 3D7RA 3PR2B 1YL7A 4JBIA 1CUHA 1XK7A 3ND8A 2PUEA 4M7WA 3M70A 1J8MF 3PQ3A 3KJIA 4S12A 4U9IS 3DD1A 2PX0A 1NUHA 2DR0A 3DOOA 4DGQA 2O07A 5I4KA 1J00A 4PC3A 3WLAA 3ZWYA 4F86A 1KNQA 1VCOA 4RJJA 1YQEA 4ZI2A 1E9VA 3ESQA 1JU4A 1SKYB 2AG8A 3IXLA 3MGGA 3HDYA 5B6JA 5E9QA 5I9LA 2CDAA 2NVWA 2GKSA 4HYQA 1NG1A 4IVNA 2PG3A 5H16A 4N5HX 2QPAA 2QK4A 3EDYA 4GXNA 3AV3A 5AM3A 1J8FA 2G5CA 3IR5A 3L0ZA 1CDZA 3ICCA 2IIBA 1RKUA 4ZAVA 3DXZA 4QYMA 5AIAA 3VH1A 2QN1A 2WB2A 4LJ6A 1RWPA 1ZOPA 2AR7A 5CFOA 5IVPA 4GYKA 3GLFA 2HA0A 1SQ0A 3RUCA 3NTOA 1YQWA 1SN7A 2O57A 4RL4A 4IMIB 5COQA 4Q34A 3L04A 4Y2RA 1GL3A 3ZCSA 1C8LA 1V3UA 4DLSA 1NXOA 2X2EA 3EHEA 4I50A 4NCNA 4S3MA 1G1MA 1W5EA 3ULKA 5KYXA 2Y1EA 3GRRA 4B9EA 4CN9A 2PS3A 2YWJA 3NETA 4DQXA 2B4RO 3RFFA 4JA0A 1J8VA 2ZBVA 1HC7A 2PWAA 4YO7A 3JSXA 4FOPA 2CHQA 3RRFA 1HNNA 1NJ8A 2ZJFA 4HGQA 4Q82A 3RIGA 4DLBA 3H9CA 1PV4A 1XTZA 4Y9UA 3DM9B 1V95A 4TGLA 1G8AA 2I3ZA 3B1KA 2ZRBA 3VR5A 1NW5A 3KQMA 4XGIA 2VAMA 4EW2A 3Q98A 2AOWA 3U61B 1P8AA 1RXEA 1X8LA 4LJ9A 5CXXA 5AKZA 1VZ3A 3WSWA 1K5HA 4QVKA 1VG9B 2I62A 4LHVA 2QUHA 2ZYGA 5FOXA 2CJWB 1CP2A 3CIFA 1RLTA 3OOJA 2QLJA 2VQ6A 1H69A 2YFKA 5AH0A 1KERA 5JO0A 2BI4A 2PANA 4PRYA 3IVRA 2OV3A 4TXNA 5JADA 3GT7A 5DHPA 4TL6A 2PUFA 1TT7A 3AI2A 2R6HA 3HCAA 4R0VA 1KI8A 1BXZA 2D2IA 4NFSA 4ZJZA 2XRZA 2PV0A 3QX7A 3C4JA 3VISA 3RE1A 3U7HB 5C8VA 1F8YA 1AN9A 4LISA 1DUIA 3OM9A 4G0XA 2VYVD 2GESA 4BNDA 3GLSA 5KPDA 3DL7A 4FJ2A 1LTHR 3IOCA 3PNOA 4TT8A 1JEJA 2BFPA 3ILSA 1QHEA 2GLXA 3RBZA 4DZZA 1ZC4A 4OB7A 2JZNA 3BBLA 1Y6GA 2FR8C 3K8ZA 5LXTB 3HU5A 3RIHA 3B6IA 5HUHA 1KI1A 2JIOA 2B35A 1EFHA 3GD5A 4Q9HA 3TW8B 1QU3A 3ABRB 3EEQA 1MU0A 1U2EA 3UJNA 5DGDA 4FMDF 1H2AS 1BMFA 4H27A 4WFIA 4YMSA 1G8GA 3WZLA 621PA 1MC4A 4IDBA 4WTOA 1IYZA 2VR1A 2XMPA 1VIDA 2DG2A 3QLJA 1ESZA 1JIJA 2P78A 5IXSA 2WTEA 3S7TA 4E21A 1YK1A 4AKSA 5GZ3A 2ZRQA 2R6JA 3TBKA 4Q4DA 4FYIA 4S1WA 4KV9A 4CMIB 2PMEA 2JFUA 5E3IA 1JDSA 3LQRA 4RZ3A 2K7FA 1SZPA 1CQXA 2XIQA 4LYAA 1PUIA 2QSYA 3RSGA 1NZDA 2H85A 3GA5A 3PUXA 2WUDA 3T0GA 3ZHZA 1ENOA 3ZHQA 4BO3A 4CLHA 2CJFA 2GHRA 3ABZA 2RC5A 1KRWA 1SG6A 1QOQB 4G8CA 4QOEA 5G02A 5FH9A 3Q9NA 1U3TA 4QO8A 4C7XA 2XMDA 3F3YA 3QKTA 4QU5A 3UOGA 3T3DA 2IBMA 2R8XA 3KQYA 4OHMA 1E2FA 1HYGA 1SC3A 3EZ7A 5K0LA 3I5XA 1TEXA 1IRXA 1JKJA 1XT6A 5AIBA 2IHJA 3T1NA 3HO1A 2YMQA 3UT0A 5JJIA 5JSYA 2H57A 3QPVA 4I19A 2C3OA 3OQBA 2CXNA 3FYDA 4HDRA 5DI3A 5EUBA 4AL4A 1VRVA 2LKCA 3KZ1E 3QUAA 4LDNA 2PXHA 2JEYA 4JDUA 1NNI1 1CC1S 4Y1FA 1KI6B 3RVMA 3UT6A 5CDYA 3DZCA 3TCXB 1LEHA 5GIPE 2GDZA 5LMUB 5TF0A 4ZU6X 4DT1B 2QLLA 2O8FA 4IIVA 5CEEA 1S9HA 3I05A 1W73A 1AHHA 2CN1A 1NRIA 3HUDA 2J3DA 1C9JA 1LBHA 1QFXA 2CNWA 4ZICA 3K05A 2ANBA 3PITA 3GNTA 3RSSA 2I0FA 2PZLA 3E5NA 1TW3A 1H1DA 1HL3A 2AZMA 3K6RA 4G5QA 4OL0A 3V9AA 1QRUA 5BR7A 3F74A 2WD9A 1CZOA 1XZDA 1ZIPA 2P4QA 3UA4A 1JEYB 3T99A 1WU7A 5JYEA 2BEVA 1CFJA 1YI0A 4DDHA 1Z5OA 3EFEA 4Z54A 3LYUA 2B98A 2PJUA 4HWKA 5LC1A 4XPIB 1FRNA 1M8KA 2ID7A 3CLRC 3OMXA 1JH8A 1NJ1A 2FW9A 4KN9S 3IV9A 1JEEA 4IAOA 3Q8LA 4UD6A 3FSJX 1JVNA 2WE7A 4BFCA 4TSFD 3PXGA 4TTTS 1YBMA 2ZR0A 3GCZA 3AL2A 3EDCA 3O26A 3QMWA 4PO1A 3NOXA 1BOFA 3UUFA 3TIGA 1MB4A 1UZMA 2H54A 1SHLA 2X7HA 5IC4A 4AMVA 3TZHA 1NLFA 2DRIA 3IKVA 4YJHB 3CUYA 2VPYA 1JT2A 2IU0A 3AIOA 4RY8A 3RVDA 4E2XA 1EVLA 3B8EA 4EYGA 4YQFA 2CNOA 3V4RA 3IAHA 4AYWA 4FDTA 2Q7XA 3PC6A 3F90A 3OIDA 4GT1A 2FZGA 1GADO 1E79A 2FMFA 3EXIB 2G8NA 3IE2A 1OH7A 2RGEA 2BHSA 3DE0X 3EG9A 2C59A 3W5IA 4CUKA 1UBOS 2YWDA 1E5DA 3U16A 1PDWA 2BSQA 3ES9A 5JO9A 3O74A 1TW2A 4I1RA 1O7JA 1JH9A 3EYAA 2KB0A 2J0VA 2JBAB 4OGWA 2BP7A 1PN3A 2PAFA 4UULA 1XRLA 3W34A 3RS3A 4KG7A 3WBJA 1LSSA 3BDIA 3UF0A 4DQKA 4RWEA 2D00A 3IB6A 3Q9SA 3FJYA 1GGKA 2BE9A 4RAQA 1Y48E 4L07A 1HO3A 1V8BA 2IODA 2ZWIA 4NL4H 4ZANA 1GU7A 2QNBA 3MTIA 2F59A 5DGIA 2P1ZA 3RBXA 1D8TA 4ZCRA 4ZHQF 3EZNA 3EDOA 3LJKA 2HMSA 2GJ8A 1HFJA 1TZ2A 2DSTA 3CJQA 3NTUA 4QWMA 3NDPA 1VHDA 4RKRA 5JH7B 1YR8A 4ZT2A 1PF7E 2GOYA 4RQUA 4X84A 1PT6A 1SXGA 4YUWA 2XE6A 3NHRA 4IP0A 2EBUA 2PL5A 2COEA 4GMHA 1B74A 1P2GA 4PQYA 3HY4A 3JZIA 5DIFA 5BSFA 2QM8A 4J91A 3RQIA 3BWBA 4EPRA 1EVJA 1YZNA 2C04A 3IEUA 2OBBA 1FS4A 4FFRA 4BX9A 5KQSA 2QTZA 3KKEA 3I2IA 3OU7A 1VPVA 4O0LA 4FOOA 5FI5A 5ALLA 2E4AA 3ORQA 3CVWA 4FZ3A 1WHSB 2B2CA 4F3NA 2FR8A 4G1FA 3ZHYA 2B8TA 3NB0A 1YHZA 2MMCA 4YDQA 4V1CA 2JEZA 2W4MA 1UZUA 4FMBB 4NU6A 4HBZA 2D7JA 2ILVA 2F55A 2FN7A 2IU4A 1C7RA 2O1XA 1H6AA 4EB8A 2C4VA 3AJEA 2QVYX 1GDTA 4AICA 2HF2A 3WFZA 2XNDD 1NQAO 4BPBA 2ZUVA 4RCZA 1K8YB 5I9TA 4AB1A 1E2IA 2YUIA 2GNPA 3V3KA 2IWRA 2FSGA 3I76A 1KH2A 1W36B 2DE0X 2RAUA 4Z4CA 3FSRA 1T2EA 1OLUA 2VG8A 1Z4JA 2XIJA 2ZUDA 1XRQA 3N8NA 1CYDA 1HT1E 3E0XA 3RTCA 3WQRA 5B3KA 3KFXA 3DLHA 3O0DA 1GCIA 5REQB 1B00A 4BO6A 3R6GA 4KVGA 5IKPA 4UJ3A 3MD0A 5BV2P 1JG7A 2Z8XA 4G2NA 1L5OA 3JVVA 2VTBB 2B7LA 4Z99A 2YCLA 2ZJYA 5KNDA 2BCGY 1F2TA 1U7TA 2IYNA 2FQQA 2ZRGA 5AVSA 2HA3A 4PFJA 3MJSA 4L4ZA 5IDWA 3OX1A 2V96A 5FBKA 5DBGA 2YC2C 4MK4A 3OE7A 2X7XA 4E11A 4NJEB 1RJDA 2PKQO 3I04A 1OYWA 1FSPA 3ADDA 3R5XA 1UMCA 3PXBA 1ZUHA 4GMGA 4O4IB 4E5DA 2WI8A 2OBLA 4YCBA 5EUMA 1Y8CA 1ZRHA 4NH0A 3KPVA 4MZXA 4BNLA 4KJXA 2P2ZA 3X44A 3OICA 1ZEJA 4GVPA 4K6CA 3O47A 4BP1A 2OYRA 5I01A 3QFCA 3ZE9A 4X97A 4ZYYA 4MYRA 2ZUWA 2AHOA 1IJBA 5AKJA 2XBLA 3C3BA 1ZKDA 4BJ1A 3GARA 4DWJA 5HKAA 2AMFA 5BUZA 2IL1A 2FUKA 3D8SA 4CM1A 3P20A 3JQ8A 1X9GA 5BUCA 1RE1A 3DQPA 2Y1DA 3PRJA 2HCBA 3LBHA 4CM8B 3U7QA 2SBTA 3N5CA 2WWRA 3ISTA 4IX1A 4X20B 5FTJA 2R25B 4G0WA 2QTGA 3SZGA 2GAJA 4HDKB 2Q5LA 1VA4A 1YQUA 4V3BA 1DC5A 5AK4A 5BQ5A 3ER6A 2NO4A 2PPLA 1ENZA 4Q01A 3WIBA 3UMYA 3ZJVA 1KC1A 4F3TA 1CEYA 1E6LA 5MN4A 4E08A 3KXDA 5I5GA 4I4CA 5AI0A 1ZZGA 5C32A 1UEJA 2V58A 5I45A 3AFGA 5IHPA 5IRCD 2GPTA 5EJEA 3AG5A 5DEOA 5FF9A 4U6SA 4AVYA 2GFIA 4IIFA 4UQOA 3KFLA 5FJIA 4EZEA 5JS8A 3D8RA 5ALSA 3WMFA 4CCSA 1XXHA 5EEHA 1VPDA 5JQGA 5FAKA 3O8DA 3F6YA 4KCGA 3T7AA 2QBYB 1PJZA 4G5RA 4JT2A 4KWTA 2ATIA 4DMHA 2Q0SA 3A9UA 3UAZA 2GD2A 3ZKWA 5AOCA 1W2HA 5IABA 1JHUA 2ZBUA 3FCOA 1PIWA 1RCUA 2KSQA 3B5IA 4IHAA 1QG4A 2RC6A 3A9SA 4QHSA 3H42B 3IT0A 4UTXA 2Z1MA 4JENA 3ANXA 2FOLA 4AS2A 1U2TA 3B53X 4I4TF 4L5IA 4NMLA 4G0MA 5H81A 3EW9A 4J7XA 2RHOA 3BWYA 1M2VA 1YR2A 4HRXA 4DG5A 2PUJA 3NPAA 5PNTA 4EKNB 1U7WA 2HPHA 3DKRA 3ENKA 1NURA 1VHQA 3KLBA 3OLXA 1V2GA 3HXKA 4UZEA 1ZMOA 1XTUA 1A2KC 4IWNA 3R7BA 1W2GA 3ERCA 1NUSA 4QTZA 4S05A 1J2YA 4QXAA 5FBLB 1ZAKA 4ZCQA 1NMZA 1C0IA 3ZD8A 3AVWA 2RGNC 5K8LA 1Z4NA 3A31A 3REGA 1O0BA 1G2OA 4HSEA 2YHBA 1WVMA 5AW4A 3A26A 3HKEA 5JRDS 2P77A 1FDUA 4HHEA 1E4VA 3N8GA 5JRJA 4QT4A 4O08A 3UT5A 1A9OA 3HFSA 3BIOA 2BH2A 2IOYA 5DTRA 3RKRA 2J0EA 3FF1A 1RKVA 3R9KA 1GPAA 1MVOA 3WNBA 4QXPA 3WR5A 2NAFA 3KETA 2ATCA 3HPRA 3QUBA 4RV4A 4Z9BA 4FIDA 1X8XA 3FPHA 5LYJF 1DQPA 4UEWA 2P2YA 2NZWA 1MN6A 1FNSA 2XYRA 3PQ6A 3GRYA 3HYLA 1RFLA 3CF6R 3RDPA 3U4QB 2ZE7A 1O1YA 3M6LA 5TEVA 5A5FA 2F9LA 1BCRB 3KOUA 1WJGA 4G1UC 4M83A 4MKHA 3TIVA 2Y99A 3W4IA 4RORA 1LNQA 1X7GA 2LUOA 2JIRA 1QO0A 2C2MA 3SICE 5IWAB 2IUYA 1JLRA 3FI0A 1WDKA 4G9GA 4IZOA 3V7WA 1VHTA 2F2TA 2YWCA 3HFJA 4U3JB 2AT1A 2C2KA 1COZA 2I6FA 4ZARA 2APJA 2G6TA 3T7JA 3RS5A 3SZ3A 3F6RA 2YN2A 5CMLA 3SAJA 1GQSA 3P0IA 1LXCA 2CKDA 3X3HA 5DSXA 4MR7B 4QYWA 2OCXA 4MW9A 5A1TA 3U1TA 5DM70 2NNWB 4UTZA 1NGSA 2Z4RA 4IV0A 2NUTA 3EIEA 2CV2A 4C43A 2DPHA 3K5WA 3HH8A 1Z3CA 2V9ZA 3WSVA 5AVRA 1IE3A 3TK1A 4R41A 2WHRA 3GP5A 1FXSA 1HT2E 3ASUA 4FEYA 4RU1A 2UUBB 4JC0A 4HTAA 1FTNA 4FFOA 3TVTA 4L4XA 2VJNA 5AVVA 5M04A 3K32A 5KWVA 1SQ5A 3R3XA 2ZWAA 5IDVA 4V0SA 2DLDA 5H5JA 5JTTA 3UH0A 5FA8A 1CRZA 1TOAA 1F2DA 1A5BB 3QUTA 2ZUUA 3HBNA 3ZDXB 1MHPA 3LU1A 3O0TA 3MNFA 2FGKA 2O1SA 2YRFA 2WJ6A 3QBTA 3MJ4A 4Y2VA 5AW9A 1B14A 2BR4A 4E5NA 3K8OE 3ZGLA 1I3NA 4JMPA 3HNOA 3PGA1 3N2GA 3RUFA 1PZEA 1QS0A 3PDCA 4M49A 4I9FA 2W6MA 2VK1A 4JDPA 2ZPAA 1T34A 2V9CA 3RVLA 4BMCA 2XV1A 1P18A 2ZBFA 3QU7A 3T5CA 3DS8A 5JS7A 1XZ8A 3BL5A 1NMEA 2XNJA 2IPNA 3I1YA 1V4NA 1X1TA 1UJ2A 3M2TA 4I5EA 3TI9A 4HWSA 5SY6A 1H8HA 3RYIB 1CJBA 3WYGA 4W5JA 4Z3DA 5JH7A 3HNPA 3H2HA 3ZXXA 4F8EA 2JVJA 1CS4C 1HKUA 5G0WA 3KSUA 3S2FA 2F3SA 3AQIA 3N2LA 2FFRA 1VL5A 3O2JA 3KD2A 1RIIA 3TW6A 3W05A 2DKFA 1CUAA 2FUG6 4EPXA 3DV2A 5D6NA 3FAKA 3AUAA 3H8VA 5B2ZA 1SUDA 2L69A 4JIMA 3OCYA 3T4PA 2I6XA 1R0XA 1E3MA 3EFOA 1ZR2A 3GF4A 4N7JA 1F5SA 3L0CA 1ADJA 3GA0A 3N53A 2QGZA 5FTWA 1V41E 2CLMB 4LI0A 4B3JA 4Z1MD 3R7WB 1CZNA 1KMHA 1RJ9A 1X38A 1Z35A 3VTAA 5MGNA 5IAAA 5IKXA 1TJ3A 2BFCB 2OHVA 1MNAA 3A9TA 4FTWA 4JC4A 4LE0A 4KO3S 4F38A 3N3BC 1XTQA 3C6ZA 3BJRA 4HFJA 4YAEA 1S2MA 4RDXA 4QECA 1I36A 3FOBA 1RYDA 2BGKA 2X0KA 1PS8A 4RX1A 4YJHA 4JUCA 1DAMA 3LBFA 3TR5A 3SBEA 1UKAA 1AA6A 1VE1A 2NUPB 3H9GA 2VH1A 2AEEA 1USVA 3RAJA 3RFUA 3N07A 3PBKA 1DTWB 4DQVA 1NTRA 1E1CA 2P68A 2POQX 2VVTA 1UM9B 2ZRCA 3D0KA 3QY0A 4PAOA 3WK6A 5KYYA 2JATA 4OYYA 2B69A 1H66A 3UGQA 4HMQA 5JASA 2IZOA 4K9OA 4PBRA 1H9BA 2F48A 2JLQA 2J30A 3RGGA 5JHHB 2PX4A 2XSZA 3QJ5A 5J63A 5KZMB 4GKKB 3WIUA 4DLNA 1MRZA 1Y9JA 4RETA 2WTNA 3C14C 4O1HA 2QE7D 4F3YA 3OUTA 3DTVA 3L93A 5E95A 3U0BA 4ECEA 1P45A 3GGCA 3K2BA 1L7PA 3NDBB 3GH3A 1CZRA 3L5OA 2G1JA 4Z0TA 3AKCA 4B1FA 4AAYA 1KJ9A 1V0JA 3DAOA 3WIVA 2V4UA 5EIEA 3OVMA 4HEJA 1ES9A 1A4XA 1KARA 1NVAA 1YRQA 2VDPB 3JD2A 1LRKA 1MO3A 4BC0A 2J5QA 3WKEA 3LAWA 4HWPA 5SYMA 3VZPA 2A84A 3KVVA 3ESAA 2ZM5A 3ZNPA 1DP4A 1DKPA 1WMFA 2P1DA 1HZJA 2X9NA 3KR9A 3LCRA 4LI3X 1A8HA 1U0TA 4QAQA 1P8JA 4WZBB 1U7XA 2GUWA 4DHWA 3M7IA 3MOIA 4RS4A 5H68A 4A8HA 1G42A 2C3MA 2ZJ6A 3TTUA 5B53A 3AESB 4AJNA 2ISSD 4TKUA 3HEBA 3W2TA 5KDDA 4MP6A 4IY1A 2B5VA 4B3TB 3PENA 5EJAA 2ZYVX 4EW1A 3W2FA 1SD5A 2ZTVA 2OQRA 4KR9A 1G7CA 4LAFA 3Q0IA 4N5MA 2OKGA 3GV0A 2HT1A 4G4SP 4IYRA 1CVRA 1SEVA 3L0SA 1M1YB 1LJUA 4FC7A 4BNFA 4QEDA 2DLCX 4G81A 2C4WA 2EJBA 5AW1A 1TM1E 5CRIA 1L5LA 1C30B 3H5OA 3K70C 3OQ1A 4CM6A 4HVLA 2Z30A 2J07A 2VDLB 2Y6UA 3QFRA 3LDHA 2IZZA 5JOQA 1Y7TA 2CMDA 3MWYW 2CDNA 3F9CA 2OK7A 2O3QA 4TSRA 3DVAA 3L7OA 3WJ2A 4BO1A 4D0LB 2VSQA 2EKDA 3BWXA 4LYJA 3H0CA 1J0AA 2D1YA 4NIMA 4CEIA 1ZK4A 2FEKA 2GBPA 4RZIA 3H11B 4IDEA 4WHMA 3U4HA 3V1TC 1VBFA 2GCPA 4IO0A 1JHPA 3K31A 4O4LB 1PZXA 5A71A 1KZ7B 4NPHA 3CNBA 5IM5A 4ARZA 3INGA 1CUSA 4F5EA 2DHEA 3ZDRA 3IIJA 4JLUA 1SXJC 5BR8B 4MQUA 3HB4X 4D9KA 4I5DA 2C1XA 3JD3A 5KCMA 2ODAA 1T5SA 2XA9A 2B30A 1JA0A 3N74A 1QPGA 1VL6A 3VHXB 4COOA 5JTUA 3IKMB 3H9UA 1QG2A 2PH5A 1FYXA 4UMVA 3LIIA 2R6AA 2GXSA 3NGLA 4KE6A 4E46A 2Q50A 3CH5A 3KJZA 2WAMA 3LGSA 4K2AA 1POWA 2GVZC 5HJEA 1R8XA 3TQCA 4IQGA 3VAZA 4IHKA 1F1BA 1U8EA 1YZLA 2AOTA 3U44B 8MHTA 4HDKA 3G79A 4F97A 5CYFA 1FJGB 2MR6A 3WHLA 2HO5A 3B6ZA 3GROA 5T4BA 3ZK7A 3AWDA 4S1PA 2WG0A 4IW3B 4N1AA 1V71A 4QBTA 4TV8B 3MCUA 4CEHA 4QM6A 4LHXA 3RKSA 4EL0A 2NACA 1AJEA 3N1UA 2QL5A 1HFKA 4NEQA 2N9UA 3O3CA 1ADFA 3PC8A 1QKJA 2KHZA 1QLJA 1QONA 1AMNA 2AZTA 1R5JA 4YK7A 3V8BA 1E9FA 1IPEA 1HE4A 4G0VA 3VA7A 4WXPA 4KFSA 1DQSA 1DV1A 4FXOA 5HTKA 2GHIA 4ENRA 4AKTA 3IL2A 4K6KA 2GN0A 1D6JA 2I2DA 2JPDA 3WLTA 3NJ4A 3TQTA 4XD7D 1GLNA 3A6LA 1B23P 5GONF 1E7QA 1J97A 2I54A 3F8WA 3VYWA 4K1LA 3RF7A 1FSSA 2XGJA 2YJ3A 1VSQA 3U4MA 3BF8A 3R76A 3K0FB 1EGAA 3H9JA 1JJFA 1YRBA 2KMLA 4FFMA 4DJFC 1RHUA 2DCMA 2WLSA 1ZSYA 4JVLA 2AG5A 1JZTA 5BNTA 1BW9B 1NXTA 2O2DA 5BORA 1PHRA 4JNKA 4ZI7F 1UDBA 1T5BA 2VP6A 4FR0A 1C2TA 4RKWA 5GJCA 4ZI5A 3SX4A 4KQ1A 2H3EA 3PWKA 3ZWNA 4MGIR 4AF7A 2OHJA 4G89A 3DC2A 2CXUA 4LDAA 1IDN1 2H18A 4FPXA 3TDKA 1MJGM 4IJKA 3K0SA 3OETA 2O2IA 5TMBA 2JK1A 3D3EA 3SS9X 3GJTA 3S1SA 3M81A 4HH0A 2WYHA 4XFKA 1OR8A 2HJWA 3UMCA 1UBJS 4KO4S 2X0JA 4K26A 3F9IA 4E33A 3BUSA 1KTVA 2W90A 1CHDA 4IOKA 5KUTA 2BFFB 2O1WA 2X9LA 1XMXA 2X8JA 3ACDA 3BRCA 3MILA 2BHTA 4QHYA 4AZTA 2KYRA 1KA9H 4U0JA 1N2GA 2OGWA 3GDHA 3R0ZA 1EUZA 3BQNB 5KNBH 4MQFA 2FWNA 4B3BA 4RY2A 1ZJJA 4IQ0A 4PPFA 1Y5MA 4FUQA 2II6A 1AKYA 3WMXA 1U1EA 3MT7A 1GZ4A 2G9UA 2WYOA 1NW7A 3DNPA 4WESA 3V48A 3X0DA 4LWOA 2XB6A 4OXNA 3P45A 4RFLA 3ROQA 3RSLA 3U6BA 4LZLA 1PEDA 2NQ2C 2I3DA 3QLTA 3PI6A 5JXWA 2QAIA 4Q18A 5ITZB 1CR4A 2NTJA 1RM5A 2WC1A 1UKCA 4M8NE 3ZC3A 1JIQA 5JJ5A 4PG4A 4XCQA 4ASUD 3C7AA 4EX7A 1KFEB 2ZR7A 4JJ7A 2G9ZA 2GN2A 5KSPA 3QTLA 4YWHA 2YXDA 3BC1A 4H31A 4TV9F 2YYSA 5U4QA 2RH5A 3L92A 4GMKA 3HDJA 1ZHHA 2AUNA 4KLNA 1FJ2A 4B75A 1DKUA 2MR5A 3EF0A 3TEMA 4E7PA 2FPGB 5JNRA 1XRJA 1Z8NA 2WU3A 1JNYA 7MHTA 4FCCA 2QD4A 2PFGA 4JGIA 3W7VA 2X7JA 3DO8A 3ET4A 4EGJA 3WRYC 3KQNA 1R50A 4JOQA 4DPMA 1FDOA 4PXSA 4OHBA 2I7XA 1W4AA 1GAWA 3OC0A 4A6DA 4D4GA 2GVDC 5JBQA 3Q88A 4IF6A 1FLAA 4W8GA 5D85A 4MV3A 4ZV7A 5C1DA 3O83A 1K4MA 3U4DA 2VAPA 3SX0A 5F98A 4YTEA 4ZVMA 2Z3ZA 5GMOA 4OL9A 1OH5A 1YUMA 1ZHOA 5KHLB 1LC3A 4KBFA 1R0SA 2EZUA 2Q3CA 2ZI5A 1A1VA 2KM1A 1E9CA 4LNUA 3WA6A 2FSHA 3NORA 3S0JA 1IY2A 1X1DA 3TDNA 2DT8A 3L1JA 3HA5A 4LX0A 5K8UA 2X42A 2V03A 1DL5A 4R1SA 1H9AA 1PBNA 3PUIA 2GB4A 3ENNA 3NOOA 3C6KA 4YDSA 4EG5A 1YS2X 3QX9A 2A1TS 2F3UA 2H4WA 3BTSA 4BNDB 3SIPA 1SHJA 4RF4A 2HQ1A 3CY6A 5IJ0A 4R31A 5JSFA 4OP1A 3H65A 1GXSB 3QOFA 2LIVA 3HVHA 4M7OA 2XOEA 5TQJA 4M3NA 5KC8A 1Q19A 1AB5A 1PLLA 3TFWA 4DDKA 4Z4HA 3BFJA 3FPAA 1I1NA 4YPFA 1LVUA 1T9KA 2I8AA 4BNTA 4MRNA 4K8RB 4O8CA 5F3DA 1WEHA 2PBRA 3LRXA 3JAWB 5A6SB 5U4XA 5JS6A 4MUEA 2XMQA 1XZQA 4RZXA 2DAPA 3ZWXA 1GL7A 2H0RA 4BQOA 4M1ZA 4HYEA 2Z2IA 1CJVC 3HB1A 4PYRA 4TLCA 4BS9A 2HWYA 3DZKA 5IXYA 2EJTA 3P0RA 4D26A 1R0LA 4DA9A 2HQBA 2D1SA 2JHAA 5K0JA 1Y6FA 2AE2A 2KX7A 1WXXA 2WJAA 4L27A 2HSGA 2X86A 1RLMA 3CW8X 4L4SA 1HZZC 3IBCA 4RZSA 5CNMA 5DF1A 3RK0A 2ECFA 4XM0A 5CUQA 4TVBA 2G04A 3RTDA 4WBNA 2F62A 1MMFB 1HYHA 1YK0A 2FWPA 2RGAA 2M32A 2VS1A 5DM4A 4EVIA 2O8CA 2PYIA 2XDQA 3LDFA 1JJ7A 4ACAA 2QM0A 1X3SA 2Q1SA 3UXYA 5ELMA 3ND9A 1XXHB 3G8BA 2NYAA 4FHEA 1PWZA 4DNOA 1S1MA 1YOBA 3A6KA 4UUMA 1KO4A 2QRGA 4L73A 5A5GA 4DSAA 5KQPA 3KK0A 3KYCA 3EVTA 4ACBA 1JX6A 3SR4A 4MI9A 3O1IC 1N2ZA 1VLZA 1AS0A 4DSUA 4QQFA 5D01A 2WJWA 1U6IA 3DVAB 2V5UA 3BSWA 4PV7A 5AXAA 3S27A 4DMMA 2CVFA 4PR3A 3Q8XB 4XYMA 1CE8B 3M1YA 4JYAB 2E4WA 2ZU6A 1Q6YA 3KB8A 2F4VB 2C5GA 1NY5A 2QLFA 2ZI9A 4MWSA 3PWSA 2YL2A 2WDZA 5LUAA 1S8FA 1Y8QB 4M0KA 4MMYB 4U9HS 2HHHB 1L7AA 4LY3A 2J3KA 4REMA 5JLAA 4MS3A 2HO4A 4TS3A 3W5CA 5C4GB 5BRJA 5DZSA 4Q1VA 2CL6X 1US8A 1NX6A 5EZSA 3IBGA 4L4RA 4LJ5A 5T7BA 3RAFC 3IIMA 4LXYA 1EHYA 2ABWA 4E5PA 2ZR9A 2HN9A 3FSEA 3UM9A 4W9MC 2C9ZA 1DDGA 1ZK2A 2I1VB 1NX9A 1Y1TA 2JFFA 3JX9A 4JLSA 1R0KA 1K7CA 3DMTA 4Z7JA 1LB1B 1Y6RA 3HGTA 2B2XA 1QVRA 4FZVA 4L8LA 1UWCA 1XR3A 3JZFA 4IEEA 5BVGA 1U7PA 3WG9A 1PD0A 4D3XA 5FBHA 2VDOB 3R5HA 2JF0A 1HXHA 1ZISA 2GD0A 3IAEA 2VLIA 3OP1A 3PFBA 4LHWA 2VDWB 5DTQA 4Y18A 4RIIA 1IK4A 4YJGB 1XZAA 4CTMA 3FNGA 4WLFA 4BN5A 2GEDA 3KBOA 4ZIRB 3UPTA 3U4QA 1QB7A 4I14A 1TKCA 3G8CA 2W8BB 5KU7A 4RD0A 5HIAA 2WZCA 3RIEA 1E2LA 2HIAA 4LC1A 3WV4A 1OUMA 1DKRA 3HA3A 4WBXC 4TXJA 4HBGA 5JAZA 4NQRA 4I9HA 1E0JA 4BJ5A 1EK5A 1MJGA 3BBPA 3W6OA 1QTIA 1E7YA 2GBLC 2R1VB 2WW8A 4N3BA 5BV0A 3U81A 3VOAA 4DL9A 4M53A 4OMUA 2QD5A 4QGAA 1F20A 2VRCD 2Q3EA 2JLBA 1H0HA 4FU0A 4R2KA 4HPWA 4UKDA 1WDTA 3HACA 1TK9A 3BSYA 1D0VA 5GPBA 2AOXA 2A57A 3TB4A 3OJXA 1PNTA 4ZAWA 3R5JA 1JQKA 1ZDMA 2YJ6A 2QMYA 2X14A 1YIDA 2B34A 3DV9A 3I39X 3K9BA 2ATXA 3LC2O 4HWRA 4JASB 5LMNB 4M1TA 5MFPA 2JH9A 5ENVA 3ACCA 4BKPA 1M74A 4MV6A 4HAOA 2BFCA 4GZMA 4DUGD 1M2WA 3VH4A 2C5AA 2ENUA 4QBGB 3ETDA 3HWWA 3CISA 1NYRA 3Q8WA 5FLKA 2UYQA 4QWWA 3DO5A 3OG9A 3ZGYA 4A7PA 3GVPA 2WTAA 3UV7A 4MVJP 3HWRA 2QX9A 4PLCA 2OB2A 1SUCA 2FJ0A 2QU8A 2VZEA 3FDJA 5ALJA 4JI5B 4ALLA 1PO7A 2EQAA 4RGQA 3OJFA 3ZKWB 4W6QA 5BNZA 1C3VA 1XZCA 3F4BA 3PYXA 3K6SB 1PK9A 2XUIA 1FVOA 1Z2PX 3ITKA 2EHJA 5EE5B 2B3TA 2A0XA 5HK8A 3GPLA 2RHBA 3CE6A 1V5WA 3R7LA 4YIHA 4K81B 3QHAA 2UVQA 2O2GA 4WKGA 1ZGAA 4II3A 1NF3A 3WTCA 3EGXA 2AXQA 4Q1DA 4HGYA 1QPZA 2WVAA 2K87A 4Z0NA 4O4IF 3U7GA 2DFLA 2QX7A 2HCRA 1V96A 4G5HA 2Q27A 5E9JA 2O0MA 4MQ6A 4D1YA 1CV2A 2VDUE 3M4JA 1I9GA 4BQSA 2YH2A 3O5AA 3V4ZA 3EPHA 2YTZA 4HZUA 4P86A 1U0OC 4JKYA 4BB0A 4NNJA 3NM6B 1XQVA 2MIIA 2FJUA 4NAUA 4X1IB 2PVSA 3V8QA 3GLGE 2E4XA 3T4EA 3JWGA 1QRSA 1C8VB 1DO8A 1Q77A 1QIFA 3FVVA 4UM8B 4D44A 1IN7A 3T5MA 2C4UA 2ADFA 3ESDA 4UVGA 2ZZMA 4UUQA 6ABPA 3URMA 3GNLA 3DE7X 1DQNA 3DT6A 3MMXA 1EPUA 2HYDA 4MJ7A 2JKVA 1G6KA 4BNKA 4EPWA 3DP9A 3R3HA 1M7BA 1CY2A 2PKWA 3OSUA 1JWLA 4EKGA 3BICA 4YBRA 5BSEA 3F6CA 2PT7A 1NBOA 1DOHA 3HJCA 5CCBA 4G0UA 3ISJA 1TPZA 2Z4SA 3T3OA 3FLBA 1BX0A 2PKXA 3ZXYA 3E9ZA 1RMTA 3DL4A 4QQRA 5E1BA 3HUFA 1TF5A 5EESA 1Z38A 1I5OA 2OZLB 1BD3A 2WKPA 3C6QA 3G5MA 4D9FA 3HXOA 2W93A 4DY4A 3CZQA 5CT5A 1TEHA 1DUSA 3BXHA 1ODFA 4MIOA 3WAGA 4FSHA 1MH9A 3MQ2A 5I9NA 4P3YA 3CIOA 4ZRDA 3ZE0B 1G21B 2ZT8A 3T5DA 1VE5A 1B8OA 4HGNA 4LMBA 1NNLA 1H6BA 1OXSC 1GPMA 1D2GA 3B2EA 3OWHA 5CTAA 5D2CA 5P8WA 4C6SA 4XVRA 2ICAA 1XV5A 2JGAA 3WS7A 2ZBEA 2XXBA 4JLDA 1CJKC 1BH6A 5BV8A 2ZQ5A 4WMLA 5HOEA 2VHXA 3FMOB 4K9QA 2W6CX 2X0IA 3K1TA 4HZGA 4RV9A 3W6UA 3WK5A 5KBYA 1Z4KA 3HDGA 3SHTA 4PR0A 2FF5A 3JWIA 2ZYUX 3AMVA 2YYAA 1M6WA 1F2UB 5C0OE 4GRDA 1QB8A 1X3LA 2ZI3A 2DKOA 4YDRA 3TZCA 4CM4B 1XDSA 3U49A 4EGCB 5A2QA 5K3OA 2FU5C 1V8ZA 1Y6QA 2RARA 1GKUB 3F1KA 1LRJA 3FXAA 3QVTA 4ZGGA 2J59A 3BQ9A 4GSKA 3A1DA 3KKOA 4DB4A 2Z2ZA 3HPQA 3QBVA 1TVMA 1MIOA 3NU1A 4AULA 1EFKA 5IJ9B 4DCCA 5C5EA 4FQ8A 1A2BA 3W9UA 1VL8A 3MTDA 5K0EA 1NQTA 2R1TB 2XDAA 1MX3A 3I2FA 1O94D 4CKEA 3PKIA 3Q5GA 1HDIA 2YDXA 3L9XA 4YAJA 1NV9A 1JHDA 1VI6A 5A03A 4RPIA 4GDFA 4UTVA 1T1GA 4G2TA 4JJAA 3WBBA 3RAEC 2VWQA 2P2LA 3K92A 2NYVA 1XTKA 2YW9A 2PX6A 2IELA 5KCZA 3QSYA 4FFBA 4HH1A 4JJ8A 3BL6A 3ZV3A 5I6DA 3WK4A 1OYVA 2GD1O 1YO6A 2PLAA 1A5SB 1L4MA 1U02A 3NJRA 4HYYA 2HRZA 3K6JA 2JGRA 3DSRA 3EMKA 4LSMA 3UY4A 4EG6A 5L8VA 2PGNA 1JEYA 3AQ4A 2CUTA 2IHKA 5IT5A 1PQ4A 2I4IA 1H8HD 3L3BA 2GBCA 2QN7A 1L5MA 5D7BA 4KFRA 1YMUA 1DAPA 3IRVA 4DC0A 4EUKA 4MGEA 4L6IA 2SECE 1PV2A 3RK4A 1F5NA 1EFPA 1JQEA 3LX8A 5IULC 1ZKMA 3KDAA 1JN0A 3BE4A 3KPYA 4Y6PA 3TR0A 1IUNA 2LW7A 3OEHA 4I4NA 4KWCA 4R3NA 2E48A 5C4IA 2QBYA 1E64A 4V39A 2BFAA 1PFUA 3FRHA 2VIIA 1CR6A 1OYOA 3THSA 4ZO7A 3D7SA 4UU0A 4S1NA 4U2DA 4MUNA 4DOMA 1F6WA 2IPOA 1M1UA 2JARA 5BSUA 1FRZA 2DPLA 2WF9A 4HYTA 4NDAA 5C31A 2VJQA 2FXIA 4HUQB 1UP4A 2GCEA 3O93A 2GRJA 3CRQA 4HG2A 5L40A 1IWPB 1MZVA 3VPBA 4LJYA 2QT0A 4Z1MA 2OLKA 1JI3A 1VJGA 1RTKA 4F72A 5LMZA 4EH1A 1YZQA 2PL1A 5KAPA 2JLRA 2I1WA 4Y0VA 2W42A 1R8YA 2LPMA 5JSQA 2VQ3A 2ZUEA 4IXTA 3KEQA 3BL8A 4LF4B 1N5JA 2DFVA 2WPDD 5TGZA 3TXAA 1BDHA 5JDIC 1HQDA 3BMCB 3N0XA 5TRTA 4JKIA 3MT9A 2AC2A 2PWPA 2YDYA 4Z2AA 4AECA 1XCJA 1C3OA 2JH3A 2OILA 2PZBA 5IG2A 1MO4A 4QTXA 4WX2B 4XARA 1Q92A 1RJFA 3AUSA 2QL7A 2XQFA 3NIGB 2IYTA 3OP4A 2C2HA 5EXPA 3G9XA 3QG1A 2JGLA 4M0PA 2YIMA 4J7CA 1LJLA 5A3SA 3DF9A 4LJ7A 4LQLA 4BPRA 4PG8A 1U04A 4MGZR 4EG8A 3CVXA 4DZTA 1JT9A 5HQJA 1HUQA 2FJPA 1JR3A 3A37A 5H83A 1RZRD 3T7EA 4FYXA 1O97D 2FEAA 1XTSA 2IOFA 3HP1A 3B51X 2VBGA 4O02B 2H52A 4R5HA 4O4JF 2VBFA 2X22A 4K88A 4REQA 5ALQA 3ZWPA 4M36A 2REQB 4JLKA 1HE1C 3N76A 4D56A 2AX3A 1AQUA 1TE2A 4R71A 1L5FA 2ZU0C 1YFJA 1P4HA 1TDJA 4PFKA 4LZJA 2CC2A 4PNPA 2MSKA 1XLUA 3VPGA 5KYXB 5HS4A 1H4QA 2P35A 5E7MA 5DMHA 3REQA 2A3RA 2DR3A 3AR8A 2ZVJA 4XGQA 2OGZA 3ZBTA 3EGCA 3FF4A 2PXXA 4B32A 4C2TA 5AOVA 1W6RA 3ZLBA 1P6QA 3MGKA 3RASA 4XSHA 3U62A 1E9AA 1T1EA 2Q9CA 1XHFA 2I2CA 3THXB 3B5JA 2AD5A 2CXOA 2OUKA 1GL6A 2FHSA 1D04A 4KYUA 4PU0A 1K75A 3BB4A 2DJIA 1ZVQA 3I5MA 3PFCA 4FMCB 4TWBA 5DX1A 3E4CA 4C22A 3GFSA 1U8XX 3O9MA 2QL9A 3ROKA 5JZVA 2OC4A 1KZ1A 4JLAA 3P9IA 1MX9A 1DCMA 1W5FA 3I01A 3PDHA 4EM6A 3B1XA 3EX7C 4QL3A 1XAIA 4RPHA 1OLSB 1LU9A 5DCLA 1KMCA 2FK7A 1NXWA 3A6DA 3EBPA 4ZVRA 2O8NA 3VSDA 2JGMA 3FTEA 1CUUA 1QE0A 1VZ2A 2FRDA 3X1XA 1R3UA 2ZROA 5K45A 3MINA 2HFKA 1OJ7A 1Y4AE 3NUGA 5CPFA 1KP2A 4YN3A 3BT7A 2EQ5A 2PUWA 1FU8A 3AR2A 2JVKA 3EZFA 5BW6B 1JALA 1J5PA 1GPLA 3OX2A 4WW0A 5GZ1A 1CRQA 1N3YA 1FP4B 3MT8A 4MAMA 4HXEB 1VYUA 4CUZA 3T94A 4BWVA 1NUPA 3PCTA 1EFDN 1KRXA 4O4LF 4TWAA 2AJ8A 4X93A 2BGMA 4FYPA 4ZCIA 4W1RA 3VGPA 4KI7A 5J58A 5FOWA 4OI2A 1Y4SA 2VZ0A 5FPYA 1TZBA 1KQOA 4UMFA 1QQ6A 3P4XA 5T57A 3KT3A 3SK0A 4B6SA 4ZQCB 1L7DA 1HLPA 1QPBA 2RIPA 3BSSA 5B64A 3ZK8A 3PXXA 1BWPA 2E6KA 4YB8A 4WCFA 5IAJA 1G38A 3MT0A 4AUEA 4ZYWA 2YS6A 4I81A 4J29A 1DI0A 4NI5A 4QLOA 3E82A 1QG0A 4MWGA 1SQFA 1U1DA 1L4UA 2RBKA 3LHKA 3IOBA 5TC4A 3LFUA 4MW4A 4Z9FA 3Q7PA 4IDQA 4B82A 2A4MA 3FMVA 5A4AA 3W0LB 2QVZX 2HQOA 2J6CA 1TTPB 1EP2B 2PZJA 1I7SB 1VE3A 4FUTA 3UUEA 2BAGA 3GZ4A 1GPNA 1W94A 4I5GA 4JGGA 4R9NA 3VX3A 3J80A 3PNQA 3SNKA 3GRCA 2N47A 1SG9A 3LRTA 4YBZA 1ZD8A 3OAAA 1UJMA 3H84A 3GGGA 1I2DA 3HL0A 4CBVA 1FFYA 2QN6A 4EY3A 3G89A 2ZE8A 5GM2A 4Q3DA 2ZB4A 2R7KA 3K2QA 4IUDS 3PHLA 4Z2YA 2RK6A 4NMHA 4U00A 1DAOA 3GJYA 4KN8A 4ZDIA 1TRKA 3DBHB 1UBTS 3OQPA 4NQZA 4QOSA 4YQZA 5IF3A 3OQIB 4V3CA 2X4LA 4CQNA 2J9RA 1HGXA 1MAWA 4C0QC 3DVLA 8ABPA 1M0EA 2FR0A 1XN1A 1SPXA 3BXEA 3WYDA 2FEXA 2HK9A 1F6BA 4HNAB 2IZ6A 2Q4DA 2QE7A 3UXHA 2CW5A 5CGQB 4LYHA 3AZQA 3ZBPA 4B6JA 1U6KA 2Q6IA 3L41A 4DW8A 3HXLA 3GDWA 5JEDA 3A0RB 2R79A 3FRIA 4D82A 2HL6A 1G18A 1R4AA 1GVHA 8LDHA 1QG6A 1ZIOA 1AGPA 3EZXA 1IY0A 1FLDA 2CXSA 3ETHA 5A0TA 1M0WA 3F7NA 7REQB 1D2AA 3ZGNA 4RWZA 1QGOA 3L4BA 4FZJA 1Y42X 2JIMA 1HETA 4B9AA 3MJRA 3I92A 2O5CA 1M8FA 4C08A 5EP4A 4X60A 3I9FA 5KOHA 4YCDA 2Y0DA 4JYZA 1ZCJA 1BFKA 2C3YA 1E0AA 1DC6A 3L8YA 5LYYA 3E18A 1F8XA 5CIWA 1NW4A 4UFOA 3A27A 1IEQA 2X58A 4KAAA 4AJKA 1GCAA 1L5GB 2GF2A 4N8SA 2A9JA 4W5NA 2OZPA 3KFVA 2HWKA 2QQ5A 2DU8A 1GHTA 2Y1GA 1NN0A 1QH9A 2FUG1 2PEZA 4JWKA 4K9LA 5FAXA 4NR0A 3ELWA 3QYFA 1YZVA 3FFWA 4P3NA 5DMXA 4FLEA 5FWXA 4PFQA 3TYXA 5JAPA 5LNK6 1OCEA 4OSOA 4J0EA 2AQIA 4PIVA 2OORC 4HLNA 2ZZNA 2CMFA 1SBNE 1DQYA 1GFWA 4EYOA 4WKNA 5CBPA 4WZBE 4QQKA 2FNAA 2ZBDA 4CKWA 1VPTA 1BX3A 4RSHA 5EIFA 5IW8A 5TE9A 5A3JA 2EBHX 3S8MA 3HCFA 1QRDA 2QY6A 3D6TB 2E1PA 1R6XA 1ZN7A 4P31A 4QDKA 3V4VB 1FFGA 1A5ZA 4Z53A 2O8VA 3H9QA 3S2GA 3VBCA 2BHNA 1RBZA 3CUEF 2VJOA 3CZRA 4K9NA 5FA6A 3TZQA 4FB5A 5KTNA 4E22A 1YDHA 3WLQA 3SBDA 1W93A 3L0OA 4DCSA 1M1YE 2HPVA 2EFDB 3BCRA 3G8AA 3QU4A 1QR2A 3C3YA 1X2BA 2PVPA 2WWGA 1NKSA 4O2BF 2QTNA 3TQFA 4LE1A 1E5XA 1L3BA 3GMTA 2QZJA 1JEQA 4ZC8A 4HS4A 2QVCA 1S0UA 1A04A 2QX6A 3IPAA 5LCXA 1QWOA 3ZIAA 3V2GA 2Q21A 4NJMA 2ENWA 2CSXA 4NYMR 1KK2A 5BR1A 4OM7A 4YASA 2WQ7A 3LNCA 3UN1A 4LN1A 2Y66A 1ISHA 1H2XA 1ZOOA 1PGPA 1TCCA 2IX9A 3Q9LA 2HK8A 3W2IA 3GLRA 2JLAA 4KVZA 3LQFA 2NWQA 3H19A 3UO8B 4JNCA 2ECPA 3EXFB 1C29B 5ELLA 4RCVA 5BVHA 4UEQA 1G9SA 2R4TA 3FKQA 3GJQA 3GNSA 1PR3A 1W29A 1CD5A 1P4JA 2W2VA 5BR4A 3DPUA 1RACA 2RJNA 3B7PA 3K5PA 3I0ZA 3E5RA 1NRWA 3ZYCA 3IRUA 5KNDH 3FB4A 1T36A 1GGFA 2PD4A 4DA0A 1Y89A 5HFNA 4IILA 3KSRA 4DEVA 1WB5A 4K6OA 3NYRA 4NBSA 1K2VN 4DA6A 2QZZA 2W6JD 4ZVKA 4U7FA 1WOMA 4HGZA 5HK9A 4CEHB 3B9QA 1K7SN 3BXXA 4MS4A 2VJKA 1LDEA 2BYTA 3PTZA 1OT3A 3AVQA 3TL2A 3HNRA 1QYWA 2A0FA 4YRZA 3OPNA 1SFRA 3A25A 3FDZA 4MKFA 1LSOA 4KQMA 1SCAA 1Z4OA 5CTJA 1IY8A 4JJZA 4LZPA 1HPLA 4WV3A 3Q7QA 3F7TA 4LBVA 3THOA 2FW1A 1XU4A 1NPDA 4BEWA 2PUCA 1M83A 2R4QA 2C4NA 4HADA 1NF9A 3ZDEA 3ZI4A 5I7HA 3UT5B 1NSTA 2FFAA 3K9WA 1PEAA 4QFDA 4C6TB 1ZXBA 3HUEA 3ZR4B 1UBRS 1A8SA 1ARZA 3DZDA 1Q14A 3FPSA 1YHNA 3HKEB 3IA2A 4WXYB 4XCXA 5GTDA 4H3VA 3LY9A 4H6XA 3NQ41 3A1SA 2HA4A 1PFQA 4U63A 2BTEA 4L7VA 3TTVA 2XECA 1TUBA 3Q3JB 1SD2A 3SLGA 3UUWA 1MC8A 2BRUC 2VHZA 4HDOB 5BXQC 2IEIA 1ETHA 4MRMA 5CHYA 3FOZA 1KAOA 2C3PA 1N77A 3QXCA 5EEGA 1RWWA 4E31A 1NT4A 2SHKA 5JYBA 4LYEA 1ZRSA 1OVMA 2B21A 2PX2A 4Q7KA 5AT1A 3TPZA 1KHHA 2IUEA 1OROA 3IB3A 4DMLA 4RE6A 2Z98A 1E96A 3P9RA 4XWAA 4DPLA 3S8YA 1Z62A 4OXXA 4PPYA 3HVUA 1GAJA 2WHYA 1IN8A 3KVRA 4HLQB 5L6LB 2X5NA 1MX1A 3BF7A 3UCEA 2NQ8A 4RZQA 4CHTA 1WM1A 4EGFA 3WGTA 1OT5A 3KTAB 4MGYR 4LWQA 4Z9XA 5IMBA 1L8QA 5LUBA 1XFDA 5FI3A 1EJ6A 5LQRA 2XCTB 1Q12A 2I5PO 3ZE6A 2VPIA 1PNQA 4P83A 1K2WA 2F1HA 1PL0A 1VLJA 2XAUA 4MARA 5EZYF 1GZ6A 4GM0A 4PZLA 2PUDA 2AR0A 3H2KA 1NW6A 2REQA 1CB0A 3K16A 2RJOA 4K86A 1V1RB 4MLPA 4C2UA 4XWKA 1TTTA 1V26A 2DWUA 3T0IA 3IOEA 2R87A 2V6FA 4D9IA 4GUDA 5KTSA 1QR6A 2AC7A 2DLNA 2OPBA 2P1RA 1Z06A 3B1FA 3GUCA 3Q12A 3RYFB 4RTPA 1I4TD 2JFWA 2UVPA 2RAVA 2Y2VA 3SHOA 3MXOA 4XUGB 1HNXB 3QVMA 3QYPA 3FY4A 1ZZEA 4D8WA 3T5TA 1XVIA 1QIHA 1F8FA 1DB3A 4P0TA 2RKWA 1ZD9A 4E6EA 3JD0A 1YIOA 1CP3A 1KI7A 2C2ZA 3UW3A 2IYVA 3GRAA 4EABA 1ULSA 4OQ4A 4DMRA 1I30A 3NOQA 4F9FA 3THXA 4AY6A 2X76A 3GMDA 3IUYA 4H1HA 1Z18A 4KSYA 2I7CA 521PA 3SHWA 5IC6A 3AZOA 1RLOA 4M9SA 2ZJ7A 3N2IA 4BQPA 4ZI7A 4CLRB 2J46A 1EGHA 1SZCA 4EY8A 2VCEA 4XVHA 1J42A 1U1IA 1W4LA 1XZBA 4IIDA 4ZRNA 2HU5A 1IHUA 1SOMA 1Z74A 3REQB 1U5BB 3INNA 5JAUA 2YHIA 1ADBA 2PX3A 2Z9BA 4ZGWA 5J4HA 3FI9A 1VBMA 1P39A 1QE5A 2QLTA 3AVOA 3CV3A 2Q9UA 4EY4A 4YRDA 5FFFA 1RAFA 3MJVA 5E3JA 3ROPA 1OXUA 3E5MA 1YNOA 4MB2A 2E89A 3DAPA 5FV7A 2P2GA 3GLUA 1N3LA 1M34E 1NIPA 2QAGA 2VBIA 5AFSA 3GLIE 3JV7A 4R8MA 4OGGA 1LH0A 4D9JA 2HSZA 4CQMD 3QI2A 5ALGA 3PKJA 1WMDA 1A72A 2DBVO 2VAVA 4HAVA 2BDUA 4PZPA 3C1TA 3CPJB 1TTHA 3IEKA 1IBMB 1EA5A 3SFTA 1YR9A 1HMYA 1Q21A 2XE4A 3W2GA 4KAFA 4M88A 4R0MA 4CKCB 5ADHA 2NP7A 1M8JA 2JGFA 1ZM2A 1TGVA 3TUIC 1C3JA 2QZ9A 1Q0PA 1VXOA 1WOYA 3HP4A 1PZHA 4YRQA 1QXSA 1DC8A 3G0OA 2IV3A 4KU4A 4A0FA 2EX1A 2FY8A 4OQXA 3O75A 2XQGA 4I08A 1E1CB 1GA6A 4X90A 3UHOA 4C0AC 1JQJC 1P6XA 2EF1A 1V43A 2WJGA 5EVCA 4PX3A 5GAJA 3CCCA 1V2HE 3G8YA 4R3WA 3DDNA 4Y0NA 1CY7A 1Z17A 1VG0B 4MPTA 2P2NA 3AVUA 2G36A 1JE1A 1X15A 1ECBA 2PN1A 3D2AA 4YRPA 3AU8A 5CA1B 1Z9BA 1XYYA 2CWWA 4Z3OA 1JZQA 1Y4DE 2ZSFA 1T8RA 1CUXA 3K15A 1GVNB 4QKQA 5AVXA 4L8FA 2GO7A 2BD0A 3PLNA 5JDCA 4IBOA 5HKOA 5G0SA 2SKCA 2IYSA 3B13B 4DIKA 3DLAA 3QOWA 2D1FA 4R3UC 3CH4B 1OFIA 4PZZA 2EWMA 3PKZA 2O3UA 5FWXB 4LDPA 3U3XA 4MRRA 2XB2A 1CUWA 5KTKA 4MV5A 4CKXA 1C7EA 4MQEB 1ZLYA 2CMHA 2VDNB 1FDWA 3BAZA 1TUBB 1JPVA 4L95C 2LTAA 3B36A 2NU9B 4BJ6A 4FZ5A 5CCXA 3BERA 1OWOA 1OW3B 1UPUA 4PZ9A 2DERA 1JXQA 2MSLA 5SV2A 4YVFA 1G8KA 4G5XA 3KZXA 1UJ5A 1I3MA 3FSGA 4ZJUA 4YCAA 1H4TA 4RF3A 5CLFA 1S7CA 1UBHS 4FNMA 1VJTA 4PINA 4WN9B 1E1NA 4URVR 1C1HA 4HS9A 5GV7A 5LP1A 5KTTA 2PS1A 2I34A 5THQA 4II7A 2OWDA 1RTTA 2QYTA 2SKDA 4NNPA 4IIJA 4KTTE 4DEYA 1HYEA 2Q6LA 4F04A 4A0HA 2PRZA 4JR1A 3QFSA 5JRZA 2Q5EA 5KVSA 1H94A 3EDQA 4B7UA 5K3DA 2JNWA 4ILEA 3EVDA 3D6FA 1JTFA 2G67A 3SC4A 3AX6A 4PZ0A 4YT5A 1XN4A 5EI5A 3T41A 1SVUA 1GGVA 2R1TA 2QIOA 3AR4A 3KPWA 4B87A 4D96A 5B4UA 5AVYA 1SXJB 1BG6A 1P6UA 2BGNA 2L18A 1QAOA 1G20E 2MJLA 5DB4A 3RSFA 1RI2A 3NALA 1PG5A 1EEXB 1IU9A 1K6IA 2IEYA 3BGIA 3QQ5A 1KIMA 2J09A 3KAJA 5HCIA 2W2KB 5K0BA 2XYQA 4L6CA 2FA9A 2R5FA 4Q93A 4E4YA 2WF5A 4MVJM 5E6UB 3MJFA 4FGJA 2F43B 1BKYA 4BASA 5EUCA 13PKA 1G8MA 4IICA 1BE0A 2Q5CA 4J7AA 4YUVA 4J1NA 4TL8A 1P62B 5AM0A 2HJGA 2PS0A 3NHJA 1U0FA 2IVZA 1AKRA 3O8OA 1KIFA 2QSUA 3RBAA 3Q41A 4AJHA 4U3JA 4P4NA 3FMGA 3N9IA 1JECA 4JQOA 5ERGB 3EQ6A 4Y2GA 2J5BA 2QUIA 3CWZA 4AJ1A 3EB9A 1GTVA 4OAQA 3S2ZA 1U0HC 4AS1A 4DY6A 2HX1A 1VL2A 1QYRA 1ZD3A 1N9GB 4BMYA 4U2KA 2OHFA 2XEDA 5JR3A 1ZL2A 4FD2A 4IIBA 4WOBA 1TAHA 4EQZA 4KSBA 4X8HA 1ZK0A 1ZUNA 3UV3A 2XGOA 4D42A 4DIOA 1CQWA 1G5HA 3MWJA 5B1DA 1OSNA 1GITA 1W0KA 3RVKA 3RK1A 3JQ9C 4IZ6A 4FBMA 3ZHUA 3V6LA 1KMMA 1UJ4A 2D0OB 5E1OA 1DWPA 1I1QB 3H97A 4CMAA 4KOAA 3F71A 4UQPA 3T8YA 2X1LA 2CEKA 1PJ2A 1RWMA 5AJVB 3ZWVA 3GR6A 2HDWA 2Y77A 3EVFA 3MELA 3NV9A 1K9SA 5B55A 1EI9A 2WNHA 4DDTA 3I9NA 2CF5A 4WY2A 4YACA 3FGZA 3W8FA 4FQ5A 3L8EA 3JQGB 1M6VB 2Z8YM 1E5LA 4O2RA 3USCS 3ECCA 5ES3A 3W2HA 2PU5A 4L0MA 4CMJA 4CRWB 2EZ4A 2PUVA 3PHJA 4N0MA 4P2BA 4ESEA 4IRUB 3C15C 3BDAA 3AP1A 5F23A 4L8GA 1KSFX 3ISVA 1L8OA 3VO8A 1J0DA 2ACVA 1NDQA 2ZJ0A 4ENQA 2B6HA 2QN2A 2XX3A 4IFIA 3IURA 4UHHA 4CF5A 1RRPA 3CTMA 4BE7B 2DKNA 3O82A 3OX3A 4GEGA 2G9RA 4GC9A 2BFFA 3B7WA 1S2IA 3U3KA 3TJZA 1XZLA 1PGJA 4GWLA 3BJZA 3TTWA 1R6DA 3G9UA 3DZHA 5JSHA 5T5QA 3ZX4A 1B0PA 3LZDA 5LDDC 1B8PA 3OFND 2ECKA 2IUSA 2P5UA 5JCJA 3SZUA 5HCUA 3TE6A 3MW8A 5LQMA 1YV9A 1Q0QA 2AZ4A 2XB4A 3G6KA 4MR8B 1LDNA 1YD7A 3U7RA 4EVRA 5JC8A 1I8TA 1OJLA 3G9QA 2H92A 1C41A 4JQCA 3R8FA 4JI2B 3KZVA 4FFPA 4XWTA 4BO4A 2XCRB 3LP8A 4NFHA 2G8LA 1X7YA 4TMKA 1BCRA 3PDWA 4CI0B 3OZBA 3TW4A 4YR7A 3LP5A 2JRLA 4C7KA 1COWD 4M98A 4F91B 1OFHA 1NRJB 3PQ2A 2ZI4A 2IDMA 2PJDA 4JKOA 4JB2A 3R9IA 4K8OA 4Y67A 4DB2A 2VWPA 4AXXA 1RJGA 5GINE 1NRXA 3EAQA 2H9YA 2OZLA 5D87A 5TXGA 2PZFA 1IB0A 5BVGB 1PJRA 4DR6B 4DILA 3PDJA 2Y0CA 5DO9A 3M6FA 1VSBA 3PHIA 4URFA 1G2IA 1RPJA 1UODA 2OAGA 4R7TA 4XM1A 3UAVA 3BXOA 2UVPB 3ORFA 3PQEA 1W7AA 3CQ9A 1N8NA 1OTXA 2ONCA 4G4JA 4R1NA 4E30A 3F2IA 3HA7A 1A9SA 4BV3A 4A15A 1M10A 4UPVA 2GLUA 3E5HA 3PUJA 1E79D 4EENA 1X77A 3LP6A 3ND6A 4A1FA 1TJPB 2QS9A 3AEKA 3IFSA 1MUUA 2XWPA 1SD1A 3T12A 1K27A 1I4WA 1NAHA 3LUFA 4Q4JB 1X2EA 1C9MA 1NE7A 1ZNQO 2YZKA 1RQGA 3TO5A 3TNFA 1GSAA 4PQFA 3FA2A 5DGTA 3ZHTA 5BP7A 4QEZA 5A9SB 3S1LA 1BN6A 1NWCA 2VSNA 1YZGA 2X41A 1MFZA 2Z1NA 4I36A 2OQVA 4WDRA 1OHHD 5LOVB 2PQ0A 1JHZA 3ZTWA 3LYAA 3TWOA 4KIWA 2ZYIA 2AOVA 4AIRA 2XCLA 1F3OA 2YXPX 1YE8A 5MDHA 4ZOAA 4BMPB 3R5SA 4WBNF 3ESBA 4BVKA 2HHCA 1FSZA 1JFTA 1THGA 1G4UR 1NP6A 2P27A 4FWTA 3FBGA 5ALWA 3E3AA 3DR3A 4RMGA 2XVXA 4TT3D 3IEPA 4OA8A 1XA0A 3KQUA 1H8ED 1ZS9A 4QLAA 3P9PA 5B1SA 1IHOA 3ZUPA 5LA6A 1X1QA 2NNLD 2ZJZA 1QH1B 3B8HA 3NFRA 4JLBA 5JMWA 4WKCA 2BN4A 5IM4A 4X66B 1II8B 1ZJ5A 4MW7A 5DXAA 3UA3A 4YLGA 4AQYB 4QTYA 2C96A 4EGQA 5IKEA 1ZJWA 2XCOA 2GBLA 3N5KA 1CG6A 3HLTA 1QC5A 3EHDA 4BCBA 2Q1TA 4BTLA 2UXBB 4BBAA 1BVRA 3V4FA 4DV1B 1IQPA 4LK2A 1EFTA 3ZY4A 1PLKA 1AHPA 1R6TA 1DDOA 2R2GA 4FQ7A 5C1BA 2PQMA 3I6YA 4E3ZA 3TAHA 2WUFA 4P4UA 3ICQB 1UK8A 1U0LA 1VI2A 2ZUTA 3I37X 1QS0B 3X2SA 1L7VC 5A6SA 4ON9A 1FFEA 4Y6SA 5FCDA 3U7QB 1VP9A 3ICWA 4MMXB 2P5SA 1W5AA 3HSKA 1VB5A 2ID9A 1X8KA 3HUTA 5LZ5A 2HF8A 3D0RA 4PPGA 4NULA 3ONNA 4C5BA 5HPYB 2B7CA 5HQ3A 2GF0A 3HCRA 4WH0A 1XCPA 1IEXA 3JVUA 4G0OA 3LRPA 5DBOA 5AW5A 1X8JA 3A1WA 3FPGA 2C00A 4QOIA 1JWAB 1Q50A 5ANRB 5J9FA 3V8MA 4EYEA 2HA2A 5DHTA 3T52A 2JIPA 4HRYA 1F4PA 1SCNE 4X7PA 1C50A 1G3RA 1I0LA 3BK1A 3ER8A 1QRAA 2VP2A 4IKEA 4WVFA 1V6AA 1MJ5A 1YDGA 2C20A 1Q20A 2JGKA 2CZCA 1YT5A 2H4ZA 4NU8X 2EERA 2D3TA 2G7ZA 2O4UX 3IUEA 5EJ2A 1Q7EA 3FDIA 3VI3B 1D2HA 2W8ZA 4RLQA 3DWGA 3VNUA 1SVOA 1X80B 4EKDA 1VMIA 1XRPA 4G3XA 3OCUA 3MMPA 5EYPA 3N8DA 2WWTA 1E1RA 3RREA 4LK3A 2WPNA 5K3BA 2HLDA 4NZNA 2FMTA 3BXFA 4IDPA 2CUKA 5HDQA 4QUEA 4XASA 3T61A 5J2TA 3IPCA 2A14A 2HZBA 1XMQB 1ZM3A 4LRWA 3ZXUB 4BZQA 2PU7A 1DE0A 2C8VA 2RHMA 1G21A 1AQLA 1WB9A 4RHYA 4PQGA 1QYVA 1SB9A 5B12A 2OFWA 1SKBA 4N0DA 2LV8A 5TPZA 1XNQB 4N5DA 1EP3B 2PS9A 1TAQA 1MQ9A 3VC7A 5LIPA 1JYSA 3AHIA 3C39A 4V0LA 3EA4A 1Y8QA 4D57A 4NBRA 3ZCRA 4RANA 5CPBA 1M2NA 1Q0LA 4MPRA 1I24A 2FFQA 1W76A 1N1GA 2HRBA 1YJCA 3N7AA 1P75A 1RFGE 1HF3A 2LBPA 2AF4C 1Q2UA 4LEIA 1RZUA 4NWIA 5CYPA 3HJFA 4GGPA 3CN9A 4PZDA 4DR3B 4S24A 4RTJA 3K0CA 4ARSA 4HAZA 2J5XA 5E3HA 3UPUA 1U9JA 2Z5FA 4LTDA 5EERA 3QG5A 3AM5A 1QLHA 1W4ZA 3KYCB 1T2NA 1V11A 1CQZA 1PG0A 3IUJA 3NOVA 4FBGA 4FCTA 3Q85A 4K3VA 1IHYA 1E1YA 2O2ZA 5T64A 3QXXA 4EHHA 4R16A 4YHHB 1PSWA 3VO1A 821PA 3ON5A 1YJQA 4YRRA 3PEVA 4F4DA 2FF7A 2YVAA 1T9AA 3PF8A 4DYHA 1RC8A 2BDTA 1LWNA 4TLEA 4WXEA 5DI3B 4AP6A 1RWXA 3A8TA 3OF2A 1YKGA 2P4SA 3V2IA 3A1TA 4ZVQA 5SZIA 3QKIA 4LX8A 2F8SA 3GO4A 3QE2A 1EMDA 4J1TA 1JAHA 1U1FA 1KJWA 2DY1A 1UBCA 2HEGA 3TD6A 3TXXA 3N0RA 3Q0TA 3QKSB 2VL7A 4YDHB 3TZ6A 1BN7A 1TVKB 5CYOA 2FN3A 3I2GA 4UDNA 1OVGA 3T3PB 4L4YA 1P9OA 3VTKA 5HQTA 3Q3EA 1W581 3OECA 3HVRA 2EOAA 3D3KA 2OG1A 4PW0A 3SF0A 4BMSA 3K70B 2E4YA 2BMEA 2QOEA 2P91A 5BOVA 3MJTA 2EXXA 1QRTA 4P5PA 2VJYA 4NE2A 1JDZA 5C81A 3R09A 2R6GA 6REQB 1ISMA 1MQ8B 3EG9B 1ML4A 1N2CE 1XJ0A 3HBAA 4IV5A 3TLGB 2RMKA 4NFLA 4X6YA 1DOAA 1KZHA 2Q3FA 3DTVD 1J8DA 1KAHA 4I9UA 1SOWA 4WRRA 3WBKA 1Y33E 2P4HX 4IVQA 5LL6P 3HK2A 1D2EA 1L7QA 3CZ4A 3WE7A 5LZ4A 4IOLA 4XQEA 5BRAA 2OT3B 2FV8A 1GU0A 3RROA 5AM5A 1ECGA 1GV1A 3MOSA 5IJWA 4GOKA 16PKA 1CF9A 2Z2KA 5BUSA 4PLZA 3TZEA 5A5DA 1TKBA 1P17A 2Q5JA 3R9XA 4GZ3A 4BO0A 2ZTUA 1Y3AA 2VJCA 3ORHA 4M1OA 4N3AA 4YXFA 1WCIA 5LQNA 4IWYA 4EUNA 4UBJA 1D03A 1YASA 2XUGA 4PN7A 1W8DA 2A86A 2GBIA 4KR6A 2ZDGA 2XXAB 1H65A 3CPEA 2QTRA 4ZAGA 1WCYA 2OGTA 3I32A 5CDFA 3W6PA 1KO1A 2HM7A 4RD3A 3SBXA 3V1NA 3LA6A 4KFTA 3UG7A 2W70A 1THZA 2B4AA 3T5AA 5LM3A 3FDXA 1KFCB 4QRDA 2IPAB 7ABPA 1V5FA 3LCJA 2IVFA 1ENYA 2X77A 3DOIA 1E3LA 3KOZA 3UK7A 2EZ8A 4CMCA 1QK3A 2WD7B 4V02A 4P4SB 3BIFA 4X71A 2LZ0A 3K0FA 4HQNA 4KNVA 5JNLA 1X7YB 3RFVA 1E9DA 5LKAA 5G0UA 3JASA 1H5NA 3A3OA 1MJFA 3AZPA 4QARA 2MT9A 3ZVNA 3H3XA 4TWJA 3V80A 4CT4B 5C80A 3QWHA 1V1MB 1C9KA 1YB4A 2XUKA 1DEAA 3Q72A 4QGHA 2YN0A 1QF6A 1T9BA 5E2BA 2AK2A 4OHOA 3KNZA 3DEZA 3DDWA 2C4HA 1H0SA