1T6NA

Crystal structure of the n-terminal domain of human uap56
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of UAP56, a DExD/H-Box Protein Involved in Pre-mRNA Splicing and mRNA Export
pubmed doi rcsb
source organism Homo sapiens
molecule tags Pre-mrna processing protein
molecule keywords Probable ATP-dependent RNA helicase
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t6nA00
4BLRA 4B74A 4B2IA 5JMTA 1O87A 3FFBA 1D2MA 2SHKA 2W00A 4PZZA 1W44A 4YDSA 3ZZTA 1U98A 2IYLD 1SHKA 2PJZA 2ZI4A 5DH9A 4Q9JA 1T91A 4ZI2A 5GJBA 3I92A 1P9RA 1E2DA 1IHUA 2QZ4A 2QMHA 5SZJA 2IUUA 3RDPA 4D4LA 1JPJA 3LQRA 4PZYA 4BLOA 1YZNA 3VHLB 1W7AA 5IHPA 1F5NA 5JJKA 2ZYVX 1COWD 2YOFA 4L15A 2V1UA 2EFGA 1P9NA 4B75A 3F0TA 1XMSA 5ANRB 3I72A 3H84A 5FFMA 3KJHA 1GWNA 2OAP1 4LJYA 4ERNA 2RH5A 1YRBA 3QJYA 5HKKD 3JZMA 2BMFA 1TQDA 5LBIA 4GT1A 3H0KA 1D9XA 1OFIA 5DE3A 1SZPA 2ZI7A 1U8ZA 2JLSA 4MDEA 3T06B 2Q9CA 2QROA 5CK5A 1KZ7B 2PT7A 2VPPA 2J0VA 2V54A 2KJQA 1W0KA 2JDIA 3EC1A 3THWB 4JYBA 4PX9A 3NTUA 1NIJA 5J5CA 5A4JA 4C7OB 2VP9A 1OPXA 2OESA 2F55A 4HLUC 5JZVA 4HAZA 3SHFA 2FH5B 3EPJA 2QU8A 2GZDA 1OYYA 1YZGA 1GG2A 4IFEA 3OZXA 1C4OA 3EXAA 5G3ZA 5AJVB 1M74A 4URWR 4TT3D 1S0UA 3AP2A 3F8TA 3UG7A 5EJEA 2QTFA 1X86B 4R2HA 4RFSA 4R71A 3RSLA 2DY1A 2Z5FA 2PT5A 2FF7A 4KVGA 2R6AA 4AYWA 4HZUA 4YMWA 4DCUA 3D6TB 1IQPA 1G3RA 4RD1A 1NI3A 2F1JA 3BJIC 5K8UA 4LJ9A 2KWIA 1EX7A 5DN6D 1G6OA 2KE5A 4HDCA 2FFQA 3LWNA 2C03A 5JSZB 1NMZA 4C0KA 3RC3A 2X2FA 3IDQA 1R0XA 3K9NA 4I4LA 3JVVA 2NGRA 2GVDC 1IXRC 5CB6A 3PUZA 2ZR9A 4JLKA 4Z1MD 3QPWA 2ZREA 4QNRA 4W7SA 4NTZA 4B3CA 4AYXA 2QPOA 2NIPA 3I32A 4C0QC 4JS0A 4NU0A 2J45A 1GITA 4MGYR 1VDZA 4WOPA 4PC2A 4N0EA 4QBIA 1CJUC 2GCOB 4PFSA 4EPTA 2Q3MA 3TUJC 2OAQ1 3NEJA 2XXAA 1Q21A 2HXSA 3IBGA 3GJ4A 3S1AA 3BIFA 2DBYA 3H2YA 1OIXA 2IYTA 2HYDA 1W4RA 2QRNA 4M1KA 3SU8A 1Q22A 3QXCA 5CK4A 2QY9A 2QQEA 3C15C 4AK9A 4A15A 1E2FA 1G20E 3SZRA 4E03A 5DNYB 3U5ZB 3OEHA 3PEUA 4DSNA 2VH5R 4URZR 1SXJA 5DI3A 4PTLA 3BXZA 4MH0R 2ZJYA 2VBCA 1XEWX 5EE3A 2IYRA 2HJVA 3ADKA 4IOJA 1EK0A 1VG9B 2WOOA 1E2LA 4PC1A 2IA5A 4Q48A 4LK2A 4EJSC 1G8GA 3KXIA 5J4KA 1II0A 1L2TA 3EWSA 4U5XA 2F6RA 5K8LA 3SYLA 1HE8B 2CK3A 3AUXA 3O47A 4RFVA 4BECA 1AS3A 1JEDA 3SE0A 3CNNA 1I4DD 1FUKA 2PLRA 4LYHA 2O8EB 1MV5A 1E2KA 3TIFA 5CYPA 4WZAE 3MJHA 5LB4A 2BJVA 3K9HA 2IW3A 5IDVA 3MSXA 3K53A 3Q7QA 4ITRC 3SQXA 1D2NA 4AURA 4D82A 5E7IA 1XDBA 2VTKA 1II8A 3BH6A 1M1YE 4OHVA 2LKCA 4Q18A 4IVQA 3A4MA 2F3RA 2Z6VA 4RJLA 3R8CA 3SFVA 2IHYA 4V0KA 4OI1A 4XTRA 5EXXA 2W2XA 1IJFA 2ZSFA 2NG1A 5KTYA 1OT3A 4M9XA 3K0AA 1G3MA 2WWWA 2R44A 2WIAA 4BLQA 2R62A 2RGNC 4P32A 2OBNA 3PVSA 1JJVA 1NG1A 1NBMA 3QBTA 2CDNA 1QHIA 3EIEA 2XTMA 3KB1A 4D80A 2QTHA 1E96A 1OHHA 1LF0A 5JCPA 4HAYA 1VHLA 4O25A 2G88A 2VIIA 2QL6A 4JIMA 1M7HA 4NE2A 4DSOA 4DLRA 3CRQA 1GRNA 1XTIA 1E1QA 3RS2A 4US2R 2P6UA 1ANKA 1GM5A 3ZH9B 3NXSA 5EE1A 3KFXA 5L8VA 1NVWQ 4GP6A 4IOLA 3FKSD 2FFHA 2OM2A 3IEUA 2EW1A 2YZ2A 3DM5A 2QSZA 3EZ9A 5CJPA 2WKPA 4OI0A 5HCIA 1YZTA 1Q1QA 3P27A 5TB5A 2XZLA 3GEEA 2JIZD 3OIUA 1NKSA 1ZM7A 2MMCA 3X1WA 4LJAA 5KPJA 3IO5A 3QUSA 1P2VA 2JLVA 4XVQA 2OV2A 3ND8A 1TQ6A 2D7CA 3QG5A 3ASZA 4OQFA 3QF4B 3U6BA 4BFWA 5EZ5A 3UG6A 4MYTA 3P26A 2QPAA 4HZUB 3PFIA 3SFZA 4XD7A 3WY9A 1FPMA 1NSFA 3M4YA 1PVOA 3PUXA 4MDFA 4GMXA 3EZ7A 3HWSA 1OXSC 3LDAA 3MG9A 3KKPA 1N6OA 1OH8A 1A4RA 1XTQA 4Q9IA 1S4QA 2EWWA 4LUCA 2HLDD 1O3YA 3RRYA 4D6PA 3LLMA 1DAKA 4GI7A 4JBXA 4M9QA 2BBTA 2XTZA 4FMCF 4PAMA 3AF2A 2GKSA 4RFSB 5KDDA 3K0FA 3CF0A 4QL3A 4DB4A 1FQKA 1A82A 4DCTA 4Z51A 1QVRA 3IQXA 3I5YA 2W6IA 3AKCA 3UWOA 1PLKA 4IDPA 2B6HA 5BN4A 1HT2E 4B34A 4L9WA 3PUWA 3I62A 1ZMXA 2VA8A 2E1RA 4JBWA 5LDDC 1GVNB 3EPKA 1JR3E 1W36B 2NMVA 2O8BB 3LNCA 3B1YA 2W0MA 3WYGA 4AD8A 2HUPA 1TAGA 3CONA 4GBMA 3NBYC 5KSPA 1XD2B 1FTSA 3CH4B 2JEOA 3EZ6A 3MGCA 4PO1A 2W2VA 5FOTA 1HA3A 1XX6A 3N2EA 1Z22A 3B1XA 4CT4B 4A6XA 2WAXA 2XEXA 3BD9A 5F9HA 1OXUA 2IBMA 1C1YA 3WMEA 4C0LA 1LF5A 4KU4A 5IF9A 1N6IA 1G16A 4U00A 5KOYA 5IRCD 2DFTA 4Q1AA 2RGEA 1ZBDA 1R7RA 1W47A 2QTVB 3NBXX 2DWQA 4F4CA 2IYZA 3ZZ0A 3MLEA 5FBLB 4KV9A 3RS0A 3U44A 1CIPA 5GVSA 2N42A 2QT0A 1TF5A 3AF4A 4QGGA 4TSFD 2F7SA 3AP1A 1CJVC 2REOA 2YVUA 2ECKA 4GPTA 2B7CA 1NRJB 4EPRA 3R9WA 3MWKA 1FP6A 3KXKA 4E09A 3GJXC 2FSHA 1G3UA 4QRHA 1N0VC 4WAUA 3CX7A 2ANCA 1U94A 5EZ6B 5L3SB 3PUYA 1CRPA 2V4ZA 4NCIA 2ERYA 2WPDA 1NKTA 4RCYA 3GCGA 4A82A 4OI4A 1DS6A 2V1XA 4FIDA 2O8FB 1Z47A 3IHWA 4HUQB 4UKDA 2VYFA 2P6RA 2FJUA 2BMDA 3ZVRA 2X19A 2BVNA 3PV0A 4C30A 4M1WA 2R9VA 1JJ7A 1KMHB 3ADDA 2YKGA 2CNWD 4AI6A 2GA8A 4QGFA 2ZUDA 5JRJA 4QJ4A 4E22A 3DDCA 2IYVA 4GOKA 2ZITA 3T5DA 4YDHB 2C04A 1XCGB 3K9GA 4LHZA 4DIEA 3I8XA 1YU9A 1U0HC 1CR2A 1XCMA 4A36A 5IT5A 1N6KA 3CF2A 4EPWA 3BWDD 1KMQA 1YJ5A 2AN9A 4EFNA 2Z83A 2RGGA 1JR3A 4NHOA 3OIYA 1ZC3A 3K0CA 1W48A 2WKQA 1GDDA 1QHXA 1E2PA 2Q0HA 5FR1A 3OEEA 2CCJA 2FZLA 3U7EB 4GDFA 3R20A 1KO1A 4MRVA 2JJ2D 1IOZA 3LA6A 3HR8A 2ZI6A 3CPEA 1LY1A 1FFHA 2NQ2C 1BIFA 3R7WB 4IXMA 4DCNA 3SI7A 4OQNA 3A4NA 2FZ4A 1NLZA 4ZDIA 3OEHD 4HLCA 2AD5A 4IDHA 1T5IA 4M1SA 2GJAA 1CLUA 2C9CA 1E0SA 2IYYA 4HYYA 2J46A 2YHSA 3ZLJA 4HZIA 2PBRA 4IDNA 3AKDA 3BS4A 4U7DA 4M1MA 1XWIA 2FEOA 4JMPA 1A1VA 5L3RA 1MOZA 2O5VA 2BEKA 4I1VA 4D4MA 4TQ9A 4ZKDA 3T1VA 4L4UA 1IBRA 1Q0UA 1S3SA 2IYQA 2Q3FA 3TNFA 3WBKA 3GLHA 4JVNA 3VU9B 2PZGA 4ASUD 1LFDB 1QF9A 3WYFA 4D4JA 1P2SA 1N6LA 5GJVC 1R2QA 1V43A 3DZDA 2O8DA 3CH5A 2GXQA 3GEIA 4LYJA 2O8FA 3VHXA 3FPAA 2ZRHA 4B3XA 2D2EA 1GIAA 3IPXA 2RGCA 4YONB 2VP4A 2ZUCA 4NZYA 5J40A 1YRAA 4Q1CA 1UPTA 3RYTC 3SR0A 4IHQA 1DAIA 3R8FA 1W5SA 5BQ5A 2YOHA 1TQ2A 5IK2A 1KI6A 5HTKA 4CEIB 5TXGA 4TLDA 2J0QA 3R9IA 4G5SA 3P20A 1P6XA 1PZNA 3QENA 2O0HA 1EGAA 2DFLA 1BMFD 1DAEA 1W5TA 1MRNA 4Q1BA 4EAQA 1F2UB 4G1UC 1OH7A 4O2LA 2JLXA 3TE6A 3QSYA 1UEIA 4XWAA 2Q3HA 2Z4SA 3QOFA 1QRAA 2QT1A 1YR7A 2JA1A 2D62A 4M0LA 4QC2A 4B71A 1S1MA 3H1TA 3G5UA 2XOKD 3QXSA 4DIDA 1EFHA 4FMDF 1VYUA 3OESA 4OQLA 3QXHA 2P67A 3N2IA 4BRWA 5C4MA 3OFND 3GP8A 1Q1BA 2EQBA 4DLZA 1XD2A 1ZNZA 4MYUA 4QKQA 2IXGA 1KI2A 2FOLA 4NYMR 4UNSA 1DPFA 4IOKA 2NPFA 1U0JA 4Q4AB 1DAGA 2C99A 8OHMA 2C5LA 2WHXA 5CM9C 1XTSA 1KI7A 2ZAMA 4ACBA 3BERA 2ODBA 2OFWA 2XJ4A 3A1TA 4JLPA 1ZNWA 1X8JA 4MYHA 2ZM5A 4BFVA 3ICQB 2ZU0C 4B43A 4LHYA 2MSDB 3RWMB 1NMYA 5B2ZA 3U7HB 2R6CA 4K46A 2DYKA 1NN3A 3DHWC 4RY2A 5CIWA 4KCGA 2YOGA 4Q9KA 1Z5ZA 3AKYA 3B5JA 1CTQA 3AEZA 4JKIA 5EXPA 1H8HA 5BYKA 5TVKA 4PHGA 3DO6A 2PZFA 1NVVR 5LPNA 2J0UB 2Q9AA 3U3MA 1QVAA 3FMOB 4TYYA 2OSBA 2ORWA 1U90A 3OIWA 5CLQA 2W6ID 3TK1A 2PEYA 3RS3A 4YC7A 1G6HA 3CRW1 3QF4A 3TUZC 4OBEA 2EFCB 4LDJA 1JB1A 2ZS9A 4FCTA 1IONA 5JRZA 4YQFA 1WDTA 1KZGB 1J8YF 1FOEB 1SXJC 621PA 3DKPA 2Q21A 3RANA 3FB4A 4DLUA 4DUGA 4DVGA 3MWJA 3TAHA 4TTRA 4LCBA 3VR6A 2VHJA 3WXMA 5KPDA 1SHZA 2X2EA 3TUIC 2GK6A 4M22A 3NVAA 1K5DA 2ODEA 1UJ2A 1CR0A 2YWGA 4F92B 4BWYA 1KJZA 3GLGB 1E98A 4QG7A 3K9LA 4O2RA 3TR0A 1CEEA 2OCPA 4ZCIA 3A1SA 2ZRKA 4OHYA 3OE7A 1M34E 3QKUA 1Q12A 3W3ZB 1G41A 1L7VC 3Q7PA 2FEMA 3MJRA 4QBGB 4DEXA 2ZSBA 1Y3AA 1R4AA 3KUCA 4RD0A 3QKSB 4M8NE 2IEYA 2WJIA 4NP6A 4LV5B 4TLAA 1Z6YA 3QEOA 3LH5A 2OFXA 2FGKA 2OHFA 3D3QA 1N2CE 2FPKA 1S96A 3EZFA 4CZ2A 1Z0IA 5H1YA 1E9SA 2QAGB 4J0QA 3VFDA 4Y0AA 2GNOA 3KJEA 1E9BA 1ESMA 4YXWA 3D8BA 1W2GA 2GXSA 5TV2A 1Z06A 3SJZA 5BXQC 4LJ4A 1MT0A 1TF2A 2D74A 4I1SA 2FPLA 2IYUA 2VHTA 5SZHB 3GLFA 3NDBB 2Z0MA 1UDWA 3PJRA 2EFHB 1VIYA 4AYTA 4TYPA 3KX2A 2GEVA 3P4XA 4QM6A 1DBSA 4TMZA 2FGJA 1M7GA 2RGBA 1AN0A 1XMJA 4NYIQ 3A1UA 4TQAA 4DUGD 3VTKA 3WNBA 2GAOA 1WA5A 1AQYA 4HB0A 3IGFA 2G1JA 3BC1A 3MWLA 3Q85A 5FPYA 2BBSA 2GRJA 3SHWA 4MRSA 2A5JA 4TL9A 5BW8A 1FZQA 2CVHA 2YC2C 1P75A 1SXJB 2ZYTX 5DI3B 5C1BA 4A0FA 1Z6TA 2CMKA 2GJ8A 4TQUS 4A8JC 1N5KA 4OQXA 2CL7X 3FHTA 2RCNA 4WVFA 1OLOA 3AGQA 3FWYA 1ZM3A 1YZLA 4I99A 2W0SA 4UQOA 1UKVY 2ZVQX 1EWQA 4P31A 2ZYUX 2BV3A 4Q9LA 4EJSA 3JZAA 4B32A 1P72A 4DT1A 4XTCS 2A5FA 3ZVMA 4XVUA 3L82B 4LGMA 1R5OA 2VP6A 2ZRDA 4OI2A 3TAUA 4ARZA 1M7BA 3DVLA 1XEXB 1NVXQ 4I1UA 2ONJA 4D0NA 4X8MA 3ZGXA 3CBQA 3S1AB 1KO4A 1ZUHA 2BCJQ 1QHYA 3N5CA 1NIPA 1W0JD 3AM1A 2GVZC 4BE7B 3A1WA 4OHZA 4Q5IA 1T9HA 4RKEA 5FPTA 3R9XA 2F1IA 4X8HA 2HV8A 3AF0A 4C0BA 4UJ3A 4LC1A 3PEVA 1E9AA 4JLOA 4MGIR 4Y0VA 3RRZA 2J3EA 3WYAA 4WXRA 4TMTA 2J7PD 1KSJA 1G5TA 2OO7A 4V03A 2ZRLA 4UXHA 3DM9B 2V55B 1OB5A 1VECA 2PX3A 1I4TD 3GJ3A 3R7WA 2GF9A 1G1MA 1AGPA 1KSFX 3KL4A 3UMRA 5JBQA 2BC9A 2F1HA 4HAVA 3X1ZA 1AJEA 1XCPA 1KTVA 4TT3A 5E3HA 4P3YA 4UNRA 1E2JA 4IKEA 2ZJBA 1HV8A 4BFTA 3KTAB 4GOXA 5JEEA 4GNKA 4CF7A 2P2LA 4ZIRB 2ZSAA 4XOIA 3SDZA 4LPKA 2ZRCA 3KKQA 3VR3A 3W8NA 4UJ5A 3DZ8A 4JYCA 3K70D 1G3QA 3FTQA 4F91B 2CHQA 3VMFA 2D4HA 4JLVA 3ECCA 5J4VA 3KQNA 2WV9A 1U9IC 1KI3A 2ZAOA 4ZO4A 4HB4A 1SGWA 5DHAA 1GOTA 3CW2A 3Q5DA 2JIZA 1XXHB 2WOJA 2O52A 2WWYA 1BH2A 4KLZA 1Z6XA 2A2ZA 2WVJA 1G7SA 1RKBA 4NBSA 3VKHA 3K0EA 5B58C 1S3GA 2J7PA 3M6AA 1KJYA 3EASA 5AR1A 4H1UA 5DIFA 3OHMA 4C2UA 2NTYC 1C9KA 1PV4A 5JWRA 4LJ7A 1KMHA 3VKGA 1XPOA 1AA9A 4PHFA 2HT6A 4XVRA 5L3SA 4D26A 1U0LA 1RFLA 1G8HA 2RMKA 1XZQA 5CDFE 5EP4A 4XSGA 1T8TA 3P4YA 4PSVA 1F2UA 4OHXA 4RCZA 1GRRA 1CJTC 1UBEA 2DPXA 3CWQA 3C7KA 4DEYA 4DHEA 2CL0X 2I1VB 3ZIAA 2HT1A 3HU1A 5JJIA 1CBUA 3U4QB 3WMFA 1AKEA 2IF2A 4DBLC 3DPUA 2O0KA 4MRNA 2IUSA 1IXSB 1DARA 3K1JA 1IN7A 4CYMA 3LXRA 1XPRA 3AF3A 4LI0A 1NNEA 2WWIA 1W0JA 1V5WA 1Z0FA 3WNCA 4A8JA 3LFUA 4D0LB 3UMFA 1UF9A 3MCAA 1G7RA 3QG1A 3KUDA 4PC3A 5FPKA 3WBJA 4US0R 5JHGB 2AK3A 3ASYA 2WJGA 3RVBA 3BGWA 1KI9A 4GZMA 4TSFA 2JJ1A 3CUEF 2FFBA 2OCYC 1FX0B 1G5PA 2WWHA 5TDHA 5JWOA 1XTKA 5FTJA 4B2LA 3FMPB 2XITA 4FCVA 5IK2D 3EX7C 3BOSA 1CU1A 1BKDR 4D4KA 2GK7A 5F98A 2JASA 1E99A 1WQ1R 1JNYA 5FTMA 2OT3B 2O8BA 4WZ6A 4B73A 2R6GA 3QKSA 3UWKA 1D6JA 4Z8XA 4DB2A 1P5ZB 3GJ7A 2JLYA 2JLZA 4MRPA 3KKNA 5ELXA 4MYCA 1E2MA 1ZIOA 4FN5A 2WJHA 2VSXA 3GLFE 1E1RD 1XMVA 1XNJA 1SVLA 3V4FA 2QUZA 4N3NA 4NYIR 3SEAA 3VR1A 2A7QA 3THXA 3LX5A 4MUAA 1ZUIA 3AP3A 4IEIA 3Q3JB 2G83A 3K09A 3C4JA 2D3WA 4QHTA 3TBKA 5KU1A 1DG1G 3LQQA 4JLDA 4A9AA 4BFZA 1Z28A 4MQBA 2OUKA 5EQTA 2IX3A 2GJSA 2IYSA 2CXXA 1OXTA 4OJQA 1GRQA 1XD8A 3OE7D 1T0HB 5DYGA 2CK3D 721PA 1QG2A 4KBGA 4RD2A 3U7FB 2AHOA 1GTVA 4LC0A 4NPHA 1WB9A 1E2GA 1JR3D 2GBLA 3VR4A 1CS4C 2C78A 4QNMA 5D3MB 4DLVA 4TL6A 4LWZA 2JJ1D 4MUBA 4KFTA 4Q4LA 1KY2A 5A0FA 4CT5A 4DLSA 3ICEA 5CYOA 5SZKB 2C8VA 2ZRBA 2J9RA 3CM0A 3LY5A 1EFTA 4PAOA 2KB0A 3AVQA 1G8FA 1KDRA 2CLCX 4KSBA 1Z0JA 4HUTA 4PPQA 2OCAA 1TEVA 1DVRA 2HJGA 2D2FA 3SJAA 3L0PA 1G17A 1Q1EA 3GJ5A 1AS0A 2FSGA 2OZEA 4LYFA 5J4LA 2WPDD 1KSHA 4RD3A 5FI0B 5AUNB 2OBMA 2AXPA 1Q3HA 5JS8A 1KSGA 3U60B 5BWMA 1RJ9B 1SVWA 3TLXA 2FDCA 5FL7D 3JVUA 3KKMA 3L0IB 2HF8A 3RSOA 1T5LA 5CITA 1XEWY 1OXVA 2A5DA 2V6IA 4KFRA 2UZ3A 3QE0A 4KYUA 1X1RA 3RHFA 4ARZB 2HYIC 4QJ5A 4D81A 4M2LA 2NO0A 4GP7A 3CRMA 3BB4A 3OAAD 4DT1B 3QVVA 3AVTA 4AKEA 1TF7A 4URVR 1DAMA 1E3MA 3EC2A 1GFIA 1Z0KA 2YNMA 4NYJR 1GL9B 4TZ6A 3EPLA 4ZDJA 4O3MA 2BEJA 1I2MA 1AM4D 2C9YA 3B2EA 1E32A 3AVPA 1KNQA 2CHVA 1OKKA 2CJWB 2I4IA 2WWFA 4QBHA 3WP0A 3I4LA 5BN5A 1E69A 4TLBA 3MUFA 4JVMA 4TMKA 2BBOA 4XIGS 1YE8A 2V3CC 2W6JA 4ZV4A 5FBWB 2IS2A 1R0WA 3IPYA 3E5HA 3ZD6A 4A4DA 1A2KC 2QQ0A 4JVSB 4ABYA 4LBWA 1GKIA 4LV6A 4E5UA 1YR8A 3O8RA 4LX0A 4XD7D 1E1RA 4MKFA 1KAOA 3EZ2A 4URUR 2ZSEA 1E0JA 1WBBA 1P62B 4Q7KA 3NKVA 4PSKA 2JLRA 3KJGA 1G64A 4GFDA 3LX8A 1KI8A 1TADA 3NBZC 2YINC 2GJ9A 1ZUNB 4TL7A 5EXSA 3WRXC 1QBKC 3D7MA 4FCWA 4LJ8A 1A5TA 5DLQC 2IS6A 4JL5A 4H1VA 1DELA 1FTNA 2BM0A 2WJJA 5J47A 4JT4A 1COWA 5FUXA 3CZPA 1JI0A 1OFTA 3QBVA 5HZKA 4CEHB 1X6VA 1N6NA 3FKQA 3BB1A 3AVXA 2REXB 3U7GA 2R6DA 4URYR 1Z29A 1GNPA 4TN1A 2DFNA 1L4YA 1HQYE 2JDID 3X1DA 1T3LA 4TYNA 1YQTA 3RC8A 1R6BX 2VL7A 2ANBA 4XJXA 2C9OA 4HEJA 2BM1A 1FNNA 1JPNA 2DFKB 2QP4A 5FL3A 1XJQA 2HCBA 1HH4A 3W5JA 1XB2A 4LBYA 1XFAA 3B60A 2XJ9A 1RPZA 3DOFA 2AFHE 5JI3E 4MA4A 1MH1A 4OKSA 4IJMA 4LBVA 5EP3A 2OE2A 1BOFA 3B7GA 3X1XA 1Q44A 1W36C 4BFYA 2BJWA 3GLIE 1KI4A 1IY2A 1ZD9A 2OXRA 3ZQ6A 4B35A 2J1LA 2KI5A 121PA 1CJKC 2AKAB 2GHIA 3ONWA 3UKDA 5GADl 1GILA 3PR1A 4OQMA 5FBVB 3PENA 5JSZA 1WRBA 1GNRA 1HY3A 1UDXA 3RS5A 2UKDA 4POAA 4QGHA 1RRPA 3OIVA 1EXMA 3QY0A 4PXAA 4DRZA 2WKRA 5EE0A 3AKEA 3ZVNA 1E9RA 1SVOA 3CPHA 2XZOA 4FI3C 1JBKA 2O8CA 1ZRHA 3BFKA 2PZEA 4PZLA 1RRFA 4Q03A 5LB2A 4W5WA 3P32A 5GVRA 1KHTA 3ZJYA 1J2JA 5B57C 4M53A 3FMIA 1CKEA 2GF0A 4M21A 5CDFA 4G0NA 3UXMA 2P5SA 1D5CA 4ZCLA 5AUPB 1TL7C 2JLWA 2I1QA 3J81k 1TTTA 4CEHA 1NJFA 4B2PA 2EYQA 4C7OA 1EG7A 1UEJA 2ZANA 3GEHA 2OLKA 2QNRA 3WMGA 4AKGA 3B6EA 3A4LA 4W9MC 4EDHA 3BFVA 4JLAA 2RHDA 1ZAKA 5KSZA 1VYVA 1H8ED 4A2QA 2J59A 4HAXA 4DLWA 2WAYA 1SVMA 4JKYA 2R6FA 1SVKA 3G82C 5DISB 3HR7A 1VMAA 4JJKA 2ZIAA 1U99A 4JLBA 2ZJ8A 3A6PC 1D9ZA 4KBFA 2NO9A 1E4YA 4DSTA 3KQKA 2CCKA 521PA 4DCVA 4Z54A 4NCJA 3GFOA 2YWHA 1ZU4A 4PPFA 3NBFA 5GJWC 1KDPA 1I2DA 1WMSA 3BRWD 2ZJAA 3PUVA 2G9NA 4NL4H 2VP2A 3IUYA 3I1FA 1FL9A 5KUTA 1YKSA 2GCNA 3I8SA 4Z8YA 3KFVA 1M6NA 3LW7A 3UANA 4AG6A 2IHBA 4DJTA 1KI6B 3IKJA 4X8OA 4JSYA 3WHKA 5DGXA 4IOMA 4CEIA 1IY0A 1OFHA 2GESA 4MITA 4G01B 1VIAA 4WA7A 2P0EA 2XSZD 2DCUA 1XJCA 2ZROA 4FW9A 2FMXA 5HZHA 1Z6AA 2ERXA 2GCPA 2H57A 2GTPA 5FTLA 3EIQA 3M1IA 4HDQB 2PX0A 4F93B 1G291 2VHUA 4DWJA 2B7BA 2GZHA 5FPSA 2VF8A 3QNUA 1TQ4A 5CJ2A 1Q20A 2LWIA 2V7QD 2ZTSA 2H5EA 4ZPXA 1NN0A 3IIJA 4X8LA 2GILA 2HEIA 1KNXA 3EPHA 3MMPA 3GFPA 2G0TA 3TSOA 1FW6A 2HXYA 2JJ2A 4JJZA 3SQWA 4PQYA 4P4SB 2VO1A 3KJIA 3FKSA 3SJBA 1JXMA 2OLJA 4Q19A 4UNQA 1HTWA 3VX3A 2GXUA 1S2MA 2FX3A 1HUQA 1XMIA 4DC9A 3KQLA 3T5GA 1CRQA 4BEBA 2I3BA 2CCGA 2UZIR 5CLLA 1KKLA 3TVTA 3LV8A 5DI9A 2WSSA 1SVSA 4XWOA 2JCSA 3CZQA 3VNUA 3IIKA 5CIQA 3MFYA 3BH7A 1XTRA 3CNLA 4LHVA 3U3KA 4PANA 1KKMA 4B76A 1M2OB 1H8EA 4UNPA 5FOUA 4M9SA 2R65A 3TKLA 3EIHA 5HPYB 1JQJC 4A0RA 1XXHE 5EUMA 1E0KA 1U8YA 4IEEA 3RRMA 3E70C 5F9FA 1NY6A 3H86A 1FMLA 1UKYA 3SS8A 2VF7A 3V4RA 2FA9A 3AVVA 1KK1A 3ZVLA 1G7TA 1S9DA 1CJMA 1E4VA 2KSQA 3EW9A 4HB2A 1QG4A 5KSOA 4FINA 4C0HA 2QA5A 3K09C 1DTSA 4A0GA 1W1WA 4TTQA 3VKWA 1CF4A 2FG5A 4B3BA 1KK2A 3ADBA 4NKRA 3RS4A 3TW4A 3VNVA 1RW4A 1BMFA 3NH9A 1P9WA 2FPMA 1MRSA 1BYUA 2CLSA 4A2PA 1VCMA 3W3AA 2FWRA 2XZPA 4MKGA 3U6KA 3K70C 5SZIA 1Q1ZA 1TEXA 2QRZA 2X8AA 1G3IA 2F1RA 2WICA 3I3SR 4LOAA 1H65A 3WNDA 4CVNA 2QPTA 2MSCB 3K0SA 2GXAA 3C8UA 2G6BA 3NC1C 1P2UA 2VLIA 2VSOA 2WSSD 2RGAA 2ZRNA 3A36A 4RZ2A 1RRCA 2AFIE 4AKIA 4HAWA 5KNCA 3LLUA 1OFUX 2AK2A 2W2TA 4BQSA 1F6BA 1RE0A 2IXEA 3KZ1E 1DADA 2BDTA 3E1SA 2YYZA 3LBNA 3A8TA 221PA 3AF1A 2GAAA 4K8OA 2H92A 1VCNA 3W5IA 2NO6A 3KDSE 5JHHB 4B47A 2TMKA 2GZAA 2WSMA 4P4TA 1B0UA 2AL7A 2CHGA 3EG5A 2QE7D 3U44B 2QBYA 4LPSA 1PUJA 4JT2A 2IWRA 1Z8FA 3A37A 2O8EA 3B1WA 4D2IA 2ZJ5A 3SBDA 2ZR0A 3AVYA 1ZD1A 3GJ6A 4P33A 4EPXA 3NWJA 2Z43A 3NDPA 5G40A 1IN5A 3OEED 4PSAA 2OCBA 2N1BA 1Y63A 3F5FA 2ATVA 1XRJA 1NF3A 3OAAA 2QAGC 3EA0A 4ZKEA 2OEPA 1Z0DA 1N25A 4NCKA 2ZSDA 4M4SA 1OHHD 1AZSC 1YR6A 4L9SA 3VR2A 5E95A 4CDGA 2ZEJA 1QHHB 5L3VA 2CNWA 821PA 1ETUA 1II9A 2IK8A 5HE8A 2ZE5A 5LD2C 4TZ0A 1OH6A 4WBSA 4O0MA 1GUAA 1N6PA 4NONA 2QMEA 3FMFA 2V9PA 3GQBA 1RIFA 1GKUB 4OK5A 1F2TB 4M1YA 1GL7A 2R8RA 3ZS9A 1YZKA 2G3YA 2IUTA 4QBFA 3ETLA 1KYIA 1Z0AA 2IYWA 5TARA 4JSTA 1VG0B 2E87A 5FI1B 2H7VA 3TSWA 2PCLA 4KFUA 3CR7A 4GSYA 2KBEA 3WP1B 2VSFA 3LAWA 4DDUA 3LXXA 2ZI5A 1KO8A 1ZINA 2K5UA 5L3QB 4GL2A 2AKYA 4Q9HA 3CX6A 2WMNB 5FOXA 5JECA 5E7MA 2DHRA 1MABA 1W0KD 3T1QA 1E2IA 2P6NA 2VP0A 2BBWA 5A5GA 1NLFA 2QG6A 3TGPA 4Q1EA 2F43A 4V0MA 4MGKR 1E9EA 4EIWA 3I73A 3TH5A 4CEJA 1JECA 4PQRA 3AGPA 2DB3A 2G1KA 3LVRE 3B9QA 3MD0A 3REGA 4Q7LA 1GL6A 1R5NA 1L4UA 3IIMA 3T35A 5C2JB 3AVOA 1TUIA 1XU4A 3HU2A 2PMDA 3OF5A 2LCFA 4Q01A 2GETA 2ZRFA 1E79A 5KO2A 2J0UA 3VR5A 1ZU5A 1OJLA 1M8PA 2BCGY 2CL6X 4G5RA 3THXB 1E9DA 1KK0A 3U3RA 3FHOA 4DDTA 1GNQA 2A3RA 1IN6A 2EU8A 2VEDA 4HLQB 3K70B 4PHTA 1CR4A 1OXXK 4QJ3A 2F3TA 2X77A 2B92A 4MKIA 3W90A 6Q21A 3D31A 2IS1A 2O0JA 2NPIA 1ESNA 2IF0A 4DZZA 1PLLA 2VHCA 4MGZR 3QEJA 4OJKA 5H68A 1QHHA 3TW8B 4G3XA 5C46F 4BLSA 3ZD7A 3CRVA 1LW7A 2ONKA 3DOEA 3W6OA 3PEWA 4Q4AA 4BLTA 2P5TB 2CE2X 4N1AA 4PO9A 4QFMA 4Q00A 5DN6A 3SYNA 1ODFA 1RC8A 1IJEA 1LVGA 2C77A 2QSYA 1FP7A 3U3OA 2VQSA 2V7QA 3BAFA 2YWEA 2W6JD 1Z2AA 1G19A 1HEIA 2W58A 3SN6A 4BPBA 4F4JA 1SXJD 5FOSA 1G18A 4EPVA 2ZJ2A 3HDTA 3QXJA 3FYHA 5FL7A 5FUYA 1BO6A 1AZTA 1T4GA 5C4GB 2X1VA 1MO4A 1TX4B 1XZPA 1RYFA 1TMKA 5B30A 3IO3A 3FHCB 2H17A 3W9YA 3QXXA 4DDVA 2H16A 3L0SA 2XSZA 2AWNA 4ESVA 2EYUA 3QPVA 4JLJA 3SYKA 3I61A 1JR6A 4KODA 4RZXA 1E2QA 2FSFA 2D7DA 1BYIA 1DG3A 1K5GA 2QAGA 2YJTD 1KK3A 3IBYA 2YWFA 1AQUA 1G5RA 4CGZA 1W36D 2W83A 3AQ4A 3TQFA 5AJXA 3GFTA 3PQCA 3PXGA 1J7KA 3CNOA 2ZR7A 1YZQA 1TNDA 1KY3A 4KXFB 5KDOA 4Q21A 2QGNA 2O8CB 4HLDA 3ZYCA 4QHYA 2G77B 4BUJA 1LS1A 4F38A 1BS1A 1XD9A 2P3SA 1NL3A 1E9FA 2CBZA 3L0OA 3LBHA 1G7CA 3CR8A 5JS7A 1SKYE 2H1LA 4HB3A 3T61A 2QM8A 4KFSA 2A78A 4PC7A 1DO0A 2WIBA 5TY0A 4PR0A 3CB4A 1YR9A 1VTKA 4D0GA 1W49A 1OB2A 3O8BA 1OIWA 1ZVQA 2F43B 2HF9A 4KAXA 2EVWX 1ELOA 2RGNA 3N70A 4H9GA 3BE4A 1P73A 5C18A 4ZIRA 1TUEA 4Q4JA 3U3JA 3FGNA 4V0NA 2ODWA 2MSEB 2QI9C 4YXWD 1PLJA 3THYB 5AJWA 4TMXA 5L3QA 1S9HA 4EFLA 3DL0A 1QZXA 2ZETA 3DKVA 4EQ6B 2A5YB 4FWIB 1Z6GA 2ZRAA 2JGNA 4QGAA 2VP5A 3NIBA 5HKKA 4ON9A 1ZC4A 2JATA 3KKOA 1SULA 3REFA 4BZPA 4P0TA 3GLIA 4JL6A 5E4FA 2L0XA 2MMGA 2AXNA 2QMUA 4B6EA 4BEJA 5JJLA 2DWOA 2NO7A 2QEQA 3F3YA 1SQ5A 2EWVA 1P61B 5JI2E 2UVQA 4C3ZA 1ZJ6A 3GD7A 4NCHA 2N46A 1NN1A 1NMXA 5KNBA 3B9PA 3MRSA 4A1FA 1T3SA 5UKDA 3CO5A 2FFAA 3PEYA 3CIOA 3ZZUA 1CP2A 1G4UR 4MRRA 1YVDA 4DXAA 2CE7A 1YHNA 4ILEA 4Q1DA 5JCZA 5BYJA 3QKTA 1HURA 2FSIA 2V8OA 2ZRPA 2ZQ5A 1UADA 3DMDA 4BGDA 4JLMA 4Q4HB 3O8CA 4HUQA 3MWYW 4KHZA 5JWHA 3TVDA 1LS6A 5EP2A 5P21A 4ACAA 2NO1A 4B6FA 1ZM4A 1E2EA 3U4QA 1NVVQ 1TU4A 3BFXA 4EPYA 4IFBA 2CJWA 2ATXA 1N3BA 2OXCA 1LNZA 4Q7MB 4EKDA 5FOWA 2XOKA 3Q9LA 1P3JA 4LHWA 2FN4A 3W6PA 1FNMA 1UBFA 4ZDWA 1OE0A 4XSHA 421PA 2GJKA 5J4HA 1CXZA 3UK6A 5FTNA 4ZDKA 1R10A 4KVAA 4R2IA 2NZJA 4L16A 1NY5A 4WXPA 4D25A 3QIAA 4OK3A 3L2OB 1KDTA 3BK7A 1U81A 3ND9A 5KHOC 1WBDA 3UIEA 1MO6A 1NN5A 1K6MA 4GZLA 1Z63A 2PJRA 4F7WA 1P4SA 2A30A 2QORA 1E94E 2QP3A 2Z4RA 3B1VA 2O8DB 1XJ0A 4FD2A 5JFGA 4HATA 2BHRA 5H70A 1N0WA 2XTNA 2PEZA 1XXHA 1GKYA 1UAAA 2ZRIA 4AG5A 3ADCA 1IXZA 1IN8A 2DWPA 4PPGA 2OG2A 4HDOB 1E6CA 4Q1FA 1CR1A 2BIFA 2XB4A 4IXNA 4CIDA 1DAFA 3A58B 2ZS8A 3FVQA 3GLIB 4BFSA 3AVWA 2NZ8A 3K0FB 3FOZA 1OYWA 4PQFA 2C98A 5LD2B 3BH0A 1SKYB 4DLXA 1ZM9A 4BRUA 5D3MA 3HU3A 1WF3A 1MKYA 1OSNA 1XBTA 3SOPA 3W6NA 1H8HD 1NVUQ 2C96A 2XX3A 2EFDB 1Q3TA 3GPLA 1G9XA 3IILA 2A9KA 4PAQA 4RD4A 1N5JA 3QKRA 4LJ6A 1RZ3A 1OIVA 2WZQA 5JEDA 4ZI3A 1DEKA 1Z3IX 4EQ6A 1AS2A 1FUUA 2D06A 4A0HA 2P65A 1LTQA 3CRRA 4TLCA 1E2NA 1WP9A 5EP1A 2GEDA 5FOVA 4TL8A 5AK0A 3WHLA 4KITB 4YMVA 4P4SA 1X3SA 5FR2A 1I4LD 4Q47A 2ASEA 3C5HA 1E79D 3W8RA 2BMEA 4AY2A 1KGDA 4YMSA 1ZM2A 4KLNA 3SNHA 1S8FA 4AC9A 1HYQA 4A92A 2F9LA 3HJNA 3NEYA 1Z83A 1IM2A 1JAIA 4IVRA 4N0DA 2JLUA 5FBQB 1OKKD 1R5BA 4QHSA 1RVDA 2B8WA 2EFEB 2ORIA 2PMKA 1WCV1 4CW7A 3E2IA 1B23P 4OYHA 3SJCA 4A2WA 1IN4A 2YC4C 4LY6A 1MR3F 4G5QA 4U02A 4UNNA 3RABA 4C0AC 4PO8A 1G4AE 4EJSB 3W34A 4WZBE 4TWZA 1HQCA 1OF1A 1VG8A 1AK2A 5CB8A 3CF6R 2B21A 2Y8EA 5FUWA 3KQUA 3ZDQA 1NSTA 1UKZA 1NBMD 3UPUA 4YMTA 2WMOB 4DKXA 4LYAA 1DO2A 4C0JA 2JLQA 1NG9A 2AR7A 1EWRA 4BZQA 1VKJA 1UFQA 2V6JA 1L8QA 4I81A 3L8ZA 4XWKA 3K0AB 2BKEA 3TRFA 4LJ5A 1AIPA 3M0EA 3EARA 1ZNXA 2XNSA 3SC3A 2BOVA 1ZCBA 2ZUBA 5G41A 2REBA 2IS4A 2FE4A 2QM7A 2WBLC 2ZJZA 1W46A 4L5BA 5AWFC 1NBME 4NDZA 4TMVA 5FBRB 4BFXA 3IHLA 4RZ3A 1P2TA 1ZD8A 4UXIA 4Q4HA 5EXTA 3ZIAD 1AGRA 4JVLA 1D2EA 1R0YA 3QQ5A 4B3FX 3HYTA 3NHBA 2AX4A 3P1JA 3ZQJA 4US1R 3KB2A 4ESHA 3GLHE 3B78A 2JAQA 2ZPTX 1ZP6A 2ORVA 1OW3B 4QXAA 3FFAA 4S35A 4C9BA 1MO3A 3GLFB 4V0OA 1JAHA 2IYXA 4LHXA 4M9ZA 4KJZA 1DOAA 1W4CA 2ZRGA 1U9IA 3GJ8A 1WE2A 1RRGA 2OILA 2WJYA 2ZJOA 3EWAA 2QAJA 2G0NA 2Q6TA 3H4MA 1AKYA 2IXFA 3QVUA 4RVCA 3CWZA 5DHFA 1XEFA 2QE7A 1FQJA 2HDNB 1HT1E 3GLGA 1K8RA 2GDJA 3V00A 2QP9X 1ZCAA 4C2TA 1TU3A 3VQTA 1X1SA 2VHQA 4FMBB 3QI2A 1KAGA 4B44A 3HP1A 1XPUA 1R8QA 1QHNA 1T6NA 3UATA 4KI0A 4R98A 3THYA 2JJ8A 4CEJB 2GCOA 1US8B 4R7ZA 2XXAB 5FPHA 1KO5A 3CKLA 3Q8XB 1NP6A 1RYHA 1ZNYA 4W5JA 3TQCA 3X1YA 4GOJA 3G0HA 4A6PA 1VYTA 1GSIA 4NCNA 5FTKA 4QOSA 5AUQA 4DSUA 1S1CA 5AJZA 4E07A 1ZIPA 2QGZA 4NH0A 4CRWB 1KO7A 2FU5C 2GWHA 3WRYC 1KOFA 2ZE7A 4QM7A 4LBZA 4PC6A 4Z1MA 4TMWA 4TTPA 1KJWA 2QENA 3IEVA 2ZI9A 3HYRA 1J8MF 1PJRA 4AKHA 3NG1A 4B33A 2IEZA 1US8A 1QDEA 5CM8B 3Q5EA 2IC5A 3MAAC 2ZS7A 2ODNA 3CLVA 4NMMA 3QPUA 4EFMA 2RGXA 2PH1A 1HE1C 1XEXA 1YZUA 2XNDA 1N6HA 2OFOA 3RAPR 4YLGA 1F48A 2CLDX 2ZE6A 3UMSA 2ZXUA 3SBEA 1CULC 2DR3A 3BORA 1J70A 1F2TA 4IDQA 5DSZA 1GAJA 1EESA 4BZXA 4LV8B 1VCIA 4LZZA 4KSCA 4TLEA 5K8TA 1R0ZA 4MKHA 3K8YA 3O8DA 5KSYA 3B13B 3AV0B 1G21E 2A5GA 3RNLA 4V0ME 2B8TA 3BB3A 4WW0A 1J90A 5EE9A 2ZRMA 5HR5A 3U2QA 4NYJQ 3PIRA 4OK6A 4IW3B 3VX4A 4AIIA 3PITA 4PHHA 4C0SA 1E0AA 4FXPA 5EUQB 1X8LA 1II8B 2H18A 2YV5A 2ZVPX 4WIAA 3THWA 3T15A 1N6RA 4IDOA 3T34A 3GLGE 2RKOA 4FMCB 1T3HA 2GEUA 4FWTA 1N0UA 3EA5A 3IQWA 5FH9A 1P60A 3PG5A 2FV8A 1NJGA 3L8YA 3X2SA 1GP2A 1EFRD 2XGJA 1Z08A 3OFNA 4P4UA 4II7A 2ZU6A 1W4BA 4UXJA 4DDWA 2WWGA 3AUYA 2GBLC 2ZRJA 2ZI3A 3LRPA 3RS7A 3I5XA 1OV4A 2HCJB 2IWHA 1E2HA 1VG1A 5F2EA 1F60A 3U61B 5KDLA 3NH6A 3C14C 5DYIA 2BKUA 4B3GA 5EE5B 2QBYB 4F4IA 1XF9A 3C41J 2ZYWX 1R8SA 4G5OA 4GRAA 4W5HA 3T1OA 5AUOB 4BASA 4OL0A 3KQHA 4V02A 1QHSA 4HI0E 3AVUA 1EX6A 5M04A 1OH5A 2J0SA 1IAQA 3B85A 2WWXA 3LVQE 2XAUA 4JBYA 4B48A 3K0CC 4G5GA 4Q66C 2E9SA 1VHTA 3GMTA 4I1OA 3C16C 4B3DA 3AH8A 3GLHB 1PUIA 5HE9A 2ZE8A 5E7JA 3NHAA 1KDOA 1VCOA 2VRWA 4RZUA 3LBIA 5KNDA 2BWJA 4GMDA 3CPJB 3BBPA 3VU9A 1FMJA 1P7CA 3KXLA 4JZKA 1ONBA 1Z07A 2LKDA 3ZS8A 4HLUA 1RJ9A 2PL3A 1SVIA 5AJYA 5FUVA 1XTJA 1W4AA 3B1ZA 2HLDA 4Q02A 5J4YA 5JLJA 1J99A 1UM8A 2AWOA 4ASUA 4DLYA 4DLTA 4LRWA 4BFUA 3C5CA 1SXJE 4R9UC 4PPNA 4V0LA 4HSEA 4OHWA 2J7KA 1KI1A 4XH9B 1KIMA 1IY1A 4JL8A 4IVPA 2OBLA 2RB4A 3QF7A 3THOA 2WTUA 2QN6A 2FNAA 3B8HA 4ZCMA 1EFUA 4JLNA 1U2RA 2XB2A 2RAPA 3PCRB 1U8AA 1MABB 3RRNA 5K8IA 3CX8A 2RGDA 3KTAA 5D3QA 1WXQA 5DO9A 5TMPA 1D8TA 1T8UA 1UBCA 2BMJA 4FMDB 1W2HA 3HPRA 1Z2CA 1ZW6A 2WM9B 2C2HA 1JQLB 3T12A 4DCSA 1T0JB 3B82A 3RWOA 3FDIA 3HPQA 1UBGA 1G8PA 2PLFA 3RLFA 3EAQA 4M1TA 2IT1A 3GJ0A 5GJCA 1DAHA 5B64A 4RKFA 3L43A 3TMKA 4BLPA 4HAUA 4Q4JB 3QKRB 2J87A 2PCJA 1LV7A 4TYQA 3DMNA 1XP8A 3A1VA 5BN3A 2RHMA 1VPLA 4TYWA 1G8YA 4URXR 2F9MA 1JXOA 5H8WA 3VAAA 1SKQA 5KYKA 5F3WB 3TJZA 1E1QD 4LSGA 3T1TA 2Q9BA 2J5XA 1X8KA 2WJVA 4IRUB 3FE2A 1JEEA 4RSGA 4KO8A 4NYMQ 2IL1A 1F3OA 4YMUA 1NLYA 3LW8A 1EFRA 4KYIB 1A7JA 4L8GA 1E9CA 1LB1B 1GZSA 1MO5A 4S2EA 1ZYUA 2NOAA 3AB3A 2XNDD 1EFCA 2C95A 3NC0C 3TR5A 5G3YA 1UKEA 3LD9A 2J41A 4M1OA 1Q57A 3DEFA 1A2BA 2AD1A 2CVFA 4AWXA 1JALA 2H8KA 2R2AA 1FX0A 4A8JB 4K81B 3TSZA 2CEAA 2KBFA 1DE0A 3V9PA 4Q7JB 5G53C 3LO5A 1N5IA 1N5LA 2QMOA 5HCNA 4EUNA 4C4PA 3Q72A 4RD6A 1QHGA 1TPZA
chains in the Genus database with same CATH superfamily
3W79A 1CZUA 2B5OA 2FPWA 3CZ4A 4B74A 4B2IA 3ROXA 2OV8A 4OPMA 4U7JA 5IN5A 3SG0A 1X70A 1E3WB 4PZZA 4O4LF 5THKA 1JVSA 4N8EA 1L5WA 1U98A 2R3SA 1SHKA 5I8ZA 1WSWA 5KYGA 1WHTB 3ORQA 1RM5A 4Q9JA 4D45A 4RULA 2QZ4A 3LT4A 2MTBA 5SZJA 3L6RA 1YFJA 2ZUSA 3VHLB 4ARBA 4J43A 4ARCA 4TTJA 1JG3A 3AHFA 5I4CA 2ZYVX 1YGYA 2XADA 2YOFA 5F5NA 1P9NA 4OXNA 5ECYA 1UFVA 4CR6A 1CEYA 1OT5A 3CUKA 1LK5A 3GZNB 2XT0A 5CNKA 2QDKA 2WQ6A 2IPNA 3KJHA 4Y6OA 5G0SA 1D2CA 2H6EA 2GA9A 3GFVA 2HAEA 2RH5A 3IJRA 4I4TA 4C2AA 4CFSA 3AZPA 3JZMA 2BMFA 3H0KA 3H65A 3MTBA 3KWFA 5DE3A 3VJMA 3HY3A 4XM1A 1GGKA 3T06B 4EUFA 1LTHR 5CK5A 1PT7A 1VP3A 2ZWVA 4MINA 4L8WB 5EOVA 5LBUA 3SHOA 3CTMA 2FWNA 2VRCD 4JLWA 1N4AA 4JYBA 1QK5A 3HBJA 3NTUA 3OOEA 4EVIA 3THWB 2Q0QA 2VP9A 2YJ3A 2H1FA 2CVQA 3FUVA 4LOKA 4A26A 2J6HA 3UXEA 2O7SA 3OCYA 1C4OA 3QVKA 4EYQA 1M74A 1WR8A 3ABSB 5C5IA 1P18A 3AP2A 3PZRA 4NENA 3LC2O 2HN9A 1JFSA 5EJEA 2QTFA 2H1CA 1C2TA 1D2GA 2XYHA 1JLSA 4F2PA 1ECGA 1D4AA 2PT5A 3NETA 4CMGA 2R6AA 4E13A 2CBGA 3IEIA 4IDFA 3UMGA 4ER3A 3H97A 4PLWA 3CBGA 4QOHA 1VGRA 4LRYA 1ZVJA 2Q50A 4ZYLA 2VTEA 3FTFA 3D6TB 3IKVA 1IQPA 1G3RA 1XNGA 4RD1A 5HF8A 1YL5A 4HOYA 4PR3A 1GKKA 1OC4A 2Q8QA 4GUAA 3JW8A 4L75A 3FVTA 2WIFA 2PMFA 1YUBA 2KE5A 5JCJA 5IKEA 4JOBA 2EJBA 3UW1A 2UZAA 3PF8A 1TA9A 3ESRA 3LWNA 2K87A 5JSZB 3U31A 1U7PA 1WPGA 4QGBA 4IUBS 1VE5A 4BS9A 4FOPA 4I4LA 3REQA 1G21A 3GT4A 1KBZA 4J7UA 3NHYA 1IXRC 2TECE 4D9JA 3URMA 5CB6A 1N77A 5GY7A 3O3CA 4I8IA 4TYMA 4NTZA 4WNIA 1MG5A 3AVWA 5EVCA 4XKJA 3FZQA 3F9IA 3T54A 1USUA 3ZWAA 1Z5UA 3GH3A 1G2OA 1ZH6A 4YIKA 1XMOB 1JQBA 1WXDA 4JC8A 3B48A 1QONA 3O82A 3WLOA 1E3SA 4CM7A 2HXSA 3ZE1B 1E8NA 1WPRA 5BSWA 3SMVA 3S1AA 3V8PA 3G2IA 2DBYA 3H2YA 3STXA 1JWBB 3PK0A 1UXGA 1XP5A 2JZNA 3R3JA 3SU8A 3UAYA 1XKXA 3VNAA 1Q22A 4R41A 4DNFA 1O4WA 1GQFA 2QY9A 2VBIA 2N3ZA 3C15C 4Q7EA 4A15A 1ZOOA 1E2FA 1O1YA 3FM9A 3P9RA 1F9EA 3GWGA 4PCVA 3SZRA 2IDJA 1XLWA 4H3SA 4DSNA 1SB9A 4GPIB 1M9NA 2HFJA 4QUHA 4URZR 3F7TA 5DI3A 4L9AA 2QTZA 3DS8A 3MW8A 3BXZA 2WM2A 1JQ5A 5LXTB 4K6MA 2R97A 3UBTA 3I9JA 1QIMA 4OQEA 4G1BA 4F4DA 4RZSA 2AE1A 2DLDA 5LJLA 4FFPA 1EK0A 2YASA 2OAGA 1QC5A 4S1WA 1K0UA 3B89A 4GUDA 3OY2A 4DA9A 5HGJA 1ST3A 3LECA 4PC1A 2FPOA 1P7WA 2HZ7A 1VLHA 2IW1A 1Q7CA 3KXIA 1II0A 2Q1WA 2VK2A 4RKYA 2CDRA 4WN3A 4XASA 3ASUA 5ES3A 1DAOA 3F71A 1JHQA 1HE8B 3R5JA 3AUXA 4RFVA 3JD3A 2AKEA 1Z0UA 1W25A 2A4KA 1YKGA 4YHBA 1HX7A 3HYNA 3ORRA 2FSUA 2I8CA 4N49A 3TIFA 2NUPB 5JE8A 5LB4A 5DSXA 2ABWA 3P5BA 3RVOA 3ER9A 3MSXA 5EJ8A 3HRIA 1TFRA 4RDHA 2ATEA 4YUWA 4FUTA 2AZDA 2H00A 5E7IA 1Y33E 1RWOA 2X7HA 5IKPA 3BH6A 4OHVA 1M1YE 2LKCA 4TWJA 2F3RA 2YVAA 2RHLA 3Q7SA 4J03A 4OI1A 4PZCA 4XTRA 2NG1A 1AY0A 3AR3A 1U3UA 3UV6A 1P2GA 4D97A 4BLQA 2WIAA 5JIBA 5LXTA 3L05A 4JMLA 4E6PA 3H2SA 2GPJA 2I2CA 3QBTA 2X0RA 4YAEA 3EIEA 4EY7A 3RIMA 2FWBA 2QTHA 3U3DA 4TPKA 3EEQA 1EH5A 2VNKA 1R4NB 2AUMA 1OY1A 3NHFA 4C4TA 1GQ2A 4NE2A 3WGNA 4CKYA 4CL8A 2VDPB 2VJKA 3KV1A 2HD4A 3RS2A 4MV0A 4JXKA 5HS4A 1RBMA 3O26A 3RS9A 5EMHA 3CX4A 5L8VA 1O9HA 3BMOA 1WUJS 1E7SA 4FX5A 2PRJA 4BNMA 2EW1A 2R1VB 4MEAA 2YZ2A 3DM5A 3GY0A 5F1PA 4ZEMA 2QSZA 4PN3A 1CNMA 2VHYA 1Q1QA 5TB5A 5IBCA 1KQPA 2JGKA 2JIZD 3GG9A 1MTOA 2Q07A 1J1UA 2OWEA 4NZPA 3CQ9A 3H9GA 2QUBA 3R9KA 2OV2A 4ZPJA 1LJUA 1BRTA 5IVDA 1G21B 1JLHA 1KYXA 2DG2A 3Q3CA 4MQMA 4Y98A 4CIVA 1N9GA 2FRXA 1L5QA 3DT9A 1UEXC 3D7LA 3D81A 4UHKA 4B4KA 5B6IA 1Z37A 3UJPA 3U6BA 3ZHVA 1PHRA 4MWCA 3I52A 1RU3A 4QYXA 4UDOA 8ABPA 4CL2A 2QPAA 2X0KA 4RGVA 5HK8A 2YZGA 4TM8A 4XD7A 2WYVA 1Y37A 4QLBA 4M0KA 2I6UA 3BRCA 3Q9UA 4MDFA 1QRTA 1XTPA 3GUUA 2JLVA 1E2BA 2Q4TA 3EZ7A 3HWSA 4PGFA 1Q6YA 1XNRB 3MG9A 3KKPA 2G07A 3DPIA 3EBLA 3R3VA 5CP8A 3KEQA 5ERGB 4Q9IA 5L51A 2X4GA 1NR1A 2O9JA 3R5SA 2OHOA 3N2ZB 2PRKA 4LUCA 5E1MA 2BFEA 2O2JA 3IT2A 2QX4A 3ILSA 4U9UA 4FGLA 3HMKA 4A0QA 4P1ZA 4CKEA 2BBTA 3GZ4A 2XTZA 4R3UC 5AXAA 3URKA 3AF2A 2GKSA 4DUPA 3RAEC 3VO1A 2XWQA 4QL3A 2AG8A 2HL6A 5IDQA 1PR3A 2GZMA 3IQXA 1DU4A 2IELA 3ZH2A 2F4NA 5DSTA 3RUCA 1IIBA 5I01A 1DRVA 1JU3A 1NWHA 4D98A 4L9WA 2JAUA 3ZIDA 2AI3A 2E1RA 2JJQA 3P0RA 3L7DA 3U19A 1E6KA 1SRQA 1JR3E 5JYEA 2O8BB 4KOAA 3BRQA 4QQFA 3WYGA 1ENOA 1QQ6A 2R4QA 2FW7A 2OHVA 5KSPA 3H1FA 4E3ZA 1XD2B 5IUJC 2Q7XA 3ZDFA 2O5EA 2DMRA 3MGCA 4KV7A 3WOVA 3LUCA 5A3RA 2YWDA 2DBQA 3DLBA 5ALSA 3K05A 3RSCA 2IH5A 1NASA 1Z22A 3B1XA 4CT4B 2BEUB 2GN0A 2GTIA 3AFIA 4MV5A 3DPSA 4A16A 3R75A 4NBKA 4AZ0A 1S8AA 1I3MA 3BD9A 1DDOA 3A05A 4WESB 3SM3A 3AEQB 5AVZA 5KS2A 1B2RA 1F7VA 5IF9A 3ZCVA 5BR7A 4U00A 3CXUA 5KOYA 4HJRA 4XJVA 2RGEA 3RUEA 2VUUA 3NBXX 4EF5A 1Z36A 2IYZA 5KB3A 3MLEA 4RPLA 4KV9A 5DLYA 3RS0A 3U44A 2N42A 4U6SA 5IAEA 3D4LA 2Y93A 4QGGA 3UB2A 2I62A 4BN5A 1IAVA 4LXQA 1A2OA 2EOAA 4HPJB 3VDRA 3N0VA 2B7CA 4M88A 3R9WA 3DUFB 3MWKA 3KXKA 2IEDA 2VEOA 3GJXC 1BU5A 2FSHA 2D5LA 3N6VA 4R0VA 4ZEVA 3T9AA 1OZFA 4TMYA 1UUFA 4DLKA 5BW5A 1PR2A 5L3SB 4B5LA 3LK7A 4NCIA 1DLIA 2JK1A 2ERYA 1DC8A 1H5NA 4YH1A 3DA8A 4TWAA 4PPYA 3WK7A 3C70A 1KZ9A 3N2YA 1DS6A 2DR2A 4ZFNA 4FIDA 5JG7A 2MINB 3TJMA 1HDOA 5A5EA 3G1WA 4C30A 4M1WA 4BBAA 2YKGA 4ALLA 4AI6A 1RKVA 4A91A 1N75A 1K8YB 4EP1A 1HZJA 3DDCA 2IYVA 3IXLA 3S1LA 1PR1A 4I3FA 3F7OA 3E6AA 2Y0CA 4RABA 2C4UA 3FPLA 2JZOA 2WG2A 3FW1A 1W87A 2F59A 2C58A 3K9GA 3OO1A 4LHZA 1V11B 3ZLTA 5ECDA 5J2UF 3EMVA 4KIWA 5FO1A 4EPWA 3VPHA 4LSMA 1YJ5A 3RC1A 1KXJA 4EFNA 3DAYA 1O6GA 3N8KA 3ZI4A 2AYZA 2LD4A 4IHJB 3V34A 2ZDHA 3HWRA 4G5FA 4EHLA 3N3AC 3E9MA 3RVQA 3K0CA 4ZA2A 5DYYA 5FORA 3ROPA 3WQSB 1U80A 4PX2A 4FNMA 3HVIA 4ZYYA 5KX5A 2R87A 1UK7A 3D4OA 5BR4A 1YXMA 2CHUA 4UHEA 1FVXA 3MWDA 1H1TA 1DBVO 1JA9A 1QG6A 1W75A 2HLPA 2OVBA 2UUOA 1M1UA 3QFSA 5KNLA 3IR7A 2DQYA 4RA6B 4ALNA 4G1FA 4BO6A 3A11A 4K3UA 2I22A 1KVSA 2WF7A 1LY1A 3R7WB 1BIFA 1T2UA 2QN8A 2Z04A 4L50A 1PNVA 3V1MA 4OQNA 3VC7A 2FZ4A 3P9KA 4Y6RA 4YJDA 2NZVG 4J0HA 4XAQA 4NK4A 3A4VA 2GJAA 2LDBA 2C9CA 2Y1EA 3AHIA 4S1NA 3EXG1 2WFLB 3FPFA 5G4KB 1N1GA 1YHZA 1DC6A 3E7FA 2PU5A 1IIRA 1MQSA 4HZIA 3T4EA 1GG9A 5IS2A 3AKDA 3WIVA 1ZEMA 1IVYA 3D6FA 4PQEA 4AJNA 4GX1A 2ADOA 4OP2A 3TNJA 3D3EA 3EQ7A 2NUTB 1PCXA 1A1VA 4EJFA 5L3RA 5F51A 4HT3B 1WCIA 3U0BA 1BNCA 1I1HA 4KUGA 4O4LB 4TQ9A 4GRIA 3T1VA 4FOLA 4L4UA 2IYQA 4IDGA 3PUIA 4K6OA 3TNFA 3EBOA 2WTXA 3KWLA 4TWRA 5E2IA 4BVLA 5C80A 4TSRA 4CQLA 4YR9A 1LFDB 1EFVB 2VQEB 5CD1A 2BGTA 1AUOA 4F2DA 2PS9A 3GLVA 2FRVA 4Z4IA 1V43A 1VA4A 3RVDA 4RBNA 3ZUGA 3P71T 5CYGA 2YCLA 1SBCA 1BHSA 1O97C 4YUXA 2OXFA 4PG5A 3UFXB 4UM7A 1RWQA 4I5IA 4B3SB 4U63A 2ZRHA 4X1KB 5EA2A 4KUHA 1I6LA 3JASA 3KYDB 2WYWA 2ZUCA 2C29D 1Z0SA 3RKRA 4K9QA 1JBQA 3CJTA 1L5FA 4Q1CA 1UPTA 4QEZA 3PL1A 4ZAZA 4H35A 3FJ1A 1O77A 3STWA 5IK2A 1T1SA 5SICE 1NW4A 2ZYGA 4UBLA 5HTKA 5IKOA 5TXGA 2G6TA 4TLDA 3COPA 3VH4A 2D6FA 2DFLA 2VJOA 1DAEA 5AW5A 5K4HA 2Q5EA 4J2OA 5C52B 1MRNA 3WWPA 1NVTA 1F2UB 4O2LA 4OMUA 1CIVA 2JLXA 1FYFA 4MVJG 3VNQA 3CXRA 2Q3HA 1IVNA 4MKZA 1FDSA 3K9BA 3EPRA 3WFJA 4YP7A 1CQIA 3G5UA 2XOKD 3ENNA 2V7BA 2W6OA 3KOMA 4XE5A 1EFHA 1SA0A 1E61A 5IJAA 4OQLA 2WF6A 3QXHA 3UUEA 1XWWA 3ZQ4A 4ENWA 3OFND 4M6WA 1R6UA 4QE3A 4QNNA 1ILWA 5CA1F 3ERCA 4MYUA 1C9YA 2IXGA 1JAXA 2Q1XA 3UAOA 3UFBA 4MCAA 4UNSA 3G9ZA 2V9CA 1TYEB 3HVKA 3WHIA 1LI4A 2A9QA 5FUMA 1DAGA 3AUTA 1CQJB 4I9NA 4ACBA 2BFDB 1DEAA 1DQZA 3ZLVA 2Z8ZA 3JWGA 1MENA 2XJ4A 4DCMA 5A7FA 3ZDCA 4MR9A 5JPDA 1OGJA 2PX6A 3PEFA 4L57A 1VL2A 4OM7A 2H7XA 5BN3B 2MSDB 2B37A 2QT9A 3U7HB 4HO1X 3NWOA 1KH3A 1B6SA 1JUDA 3NOVA 4K46A 2G8NA 4MUNA 5FQNA 1HM5A 5CH3A 1NN3A 5CIWA 1ZCJA 4M8LA 4KCGA 2YOGA 4X90A 3ONFA 4Q9KA 3TD2A 4NR0A 3IPCA 1XDZA 4E2YA 3RSFA 1ZD2P 1VBFA 4J75A 4DIFA 1AH2A 4EB6B 4K9DA 4IDEA 3PD1A 1H8HA 2Y0EA 2OK8A 3FPGA 3I01A 5EXPA 5I8WA 2P4HX 4OQDA 1TYZA 3PYXA 3DO6A 5FA6A 2PZFA 5LPNA 1C29B 2E18A 3A9WA 2Q9AA 2X0FA 3U3MA 3GJZA 3VVMA 4TV8A 3WGKA 2P2ZA 1NQXA 1ZWKA 4ZJUA 3FMOB 2W90A 3UWMA 1J1ZA 4LDAA 2OSBA 2OCIA 1P7ZA 4LRXA 4TYYA 2Y99A 3E0QA 1U90A 1U1CA 2YWJA 5CLQA 5EWMA 1TM3E 1VHDA 3NOOA 1OAOC 2I2WA 3RS3A 4CKBB 3RJ5A 5DNAA 3CRW1 2VHWA 3QF4A 2R1VA 4OF4A 4AF6A 4MCIA 2ZS9A 3FYSA 5EFOA 4JEHA 1B8VA 5BR8B 1CCWA 3D7NA 5B3JC 1DIGA 1JF8A 2K7FA 1Y4ZA 2AVDA 3RBAA 5GGXA 5SYMA 3QNMA 3ZDBA 4G65A 621PA 4MUMA 3HCBA 2FZKA 1KY5A 3FB4A 4DUGA 3PNOA 3G88A 5KNBH 1U2DC 5KYXA 3NVAA 2HW8A 1TDJA 4OKIA 5LQNA 1CR0A 3FFXA 4BWYA 3FPSA 3TG8A 1E98A 3HBFA 3KPUA 1XLUA 3K9LA 1CEEA 2B4AA 2F3QA 3DE2X 1JAYA 1DXQA 4ZCIA 1OASA 2I6GA 3EGDB 3BCHA 5IAJA 1BXKA 2NVUB 2ZIXB 1I5RA 1Y9ZA 1T4BA 1TLTA 2HMAA 1GY8A 3I6IA 3QKUA 2H1OA 1Q12A 4MJLA 1BDIA 1EFDN 2CWDA 2FEMA 3P0IA 3OOYA 2HU5A 3FA2A 5IWAB 3QKSB 2WJIA 2ZZMA 4UU8A 3UGJA 4LV5B 4BLUA 2SKCA 5LL6P 3QEOA 2ID4A 1N36B 3LH5A 2ZZNA 2OFXA 2Q5JA 2OHFA 2AMLA 3D3QA 3AM4A 3EZFA 3IDOA 1I24A 4ITUA 4RW0A 4CQMB 1T0IA 1C7IA 4RJIA 1Z0IA 5H1YA 4EI8A 2QAGB 2JEYA 1RHUA 4XIYA 1PT6A 1C0KA 2GNOA 2KW5A 4ZT4A 4URHA 1ESMA 1RHMA 1PR5A 5DDIP 2GXSA 3P9PA 4J91A 5AVTA 1SKBA 1E77A 4BVHA 4N82A 5JFOA 3R5XA 2RSLA 2IYUA 2VHTA 3O2QB 3HB7A 3GLFA 3OZFA 1YZVA 2XR1A 4INZA 1UT6A 3TBFA 4E2XA 3JSXA 3KX2A 2GEVA 5TMBA 1UFKA 3NHJA 4Z7NB 1HR0B 1QH9A 1ZSNA 1AN0A 2G5TA 4DUGD 5H5JA 3ZY6A 4FYHA 4AQYB 1I4OA 1VB3A 5AJUA 1KARA 2GAOA 4KWEA 2X7JA 3WGUA 5JY6A 1WA5A 4HB0A 3K73O 1GLGA 2G1JA 3IGFA 3L4SO 1DIBA 2BBSA 2VJBA 2XODA 3TINA 2CD9A 4K28A 1HFEL 1BGXT 2A5JA 2RARA 3RTGA 3LQKA 3LC1O 1QGED 5AOVA 3KJFA 1P75A 4UBMA 2C57A 5DI3B 4WGGA 2WNIA 3PFCA 4GI1A 4UNIA 4F3CA 1TJ3A 1Z6TA 2CMKA 1FVFA 3CSUA 3O31A 4TQUS 3GRRA 2CL7X 5T41A 5J2UB 3T9CA 3G5AA 1ODIA 4ZVUA 2ZCJA 3AGQA 2D13A 3SP1A 1Z15A 3TW0A 1R16A 4AAYA 5LLDA 5B58T 1AD2A 2ZYUX 3CR3C 1Y8RB 2B35A 2EJWA 1CUWA 5J2TF 3SC6A 3SYMA 2JI4A 3JZAA 4MP6A 3UKJA 3VMMA 1FTGA 1P72A 3OPYB 3EGIA 4DCOA 4MQ5A 4IINA 3TECE 1EX9A 2A5FA 3IQIX 1ZGHA 4NAVA 2Q5IA 2BKAA 1N2ZA 3V8BA 3ZK9A 2Y1DA 4B81A 5HJ7A 1K63A 5KC8A 1R5OA 1PJLA 2B25A 4OI2A 4Q0MA 3DMRA 2OV6A 3DVLA 1XEXB 4NFSA 4BWFB 5IJZA 2ONJA 1Q6ZA 2JAXA 5CPBA 2MSNA 4KMMA 1YBAA 1VBKA 1ZUHA 1GTL1 3TX6A 1QHYA 4FVTA 4BB5A 5C35A 2R0QC 3N5CA 4AJLA 4MKXA 5JAQA 3DKKA 1W0JD 4BE7B 3A1WA 1JYSA 3AR2A 3C5WP 3QKIA 4QFBA 4OHZA 1T9HA 3WMWA 5FPTA 3TTYA 1EP3B 3VNRA 5EJFA 3OPNA 4UJ3A 1OA1A 3MLAA 2HMTA 4Y2UA 7ADHA 3OQVA 3ETEA 2GTHA 1HYEA 4FGZA 4REOA 1EK1A 1DJPA 1N9ZA 3O74A 1RAAA 1DIHA 1P1FA 4KDEA 1SOMA 1E6MA 3ROKA 1B74A 1H6AA 4TUYA 2Q62A 3D1LA 1U7ZA 4EG6A 4C1BA 3GGCA 1K1EA 1I4TD 1XFDA 2CMDA 2GF9A 1U0OC 2FUNB 3KETA 4RKWA 1L8AA 4KXQA 4KW7A 4ND3A 5JBQA 4TZKA 2H1VA 3U09A 3HY4A 3X1ZA 1W30A 3V5NA 2JL1A 3FZEA 4OFWA 4R9SA 4EW2A 3ZGNA 1J8FA 1YIAA 1E2JA 3A0UA 4I5GA 4XCQA 3BHNA 1WHSA 2YHIB 3BQ9A 2B1GA 3W7BA 3O0DA 1FTWA 1I9GA 1RI5A 3LOQA 3ROTA 1B3RA 4QDKA 5DCWA 4C76A 3ZYZA 1GCGA 3ES9A 3NDRA 4XOIA 1LEHA 3TZ6A 1F20A 1ZBQA 4QQNA 3VR3A 2FG6C 3GRAA 5AVSA 3ZZ1A 4E33A 2R00C 3VMFA 5BV2P 1FLDA 3DWIA 4G4SP 3UHOA 2PUGA 2C4MA 2B30A 1F4PA 5SYNA 1KI3A 1XZAA 1O94D 2ZAOA 1SGWA 3FWZA 3OU7A 4Q6WA 4X92A 5IPFA 1C7FA 3Q2OA 3R2JA 4GO1A 1JR4A 1XXHB 3QHAA 4F46A 1L5YA 5KCZA 4QPCA 4KPYA 1JHYA 5BSMA 1U5CA 2XI4A 1C3EA 2F90A 1Z6XA 1KTIA 1G7SA 1RKBA 2JA2A 5FNVA 3K0EA 1UXKA 3DAHA 4UMVA 2ZDGA 5FA5A 5H3LA 5B58C 1XYYA 5HIAA 3EASA 1I7DA 2J08A 4IS3A 4DRYA 1XAIA 5DIFA 5KPJA 1RXSA 2C0QA 2CC2A 2NTYC 1JKFA 1PV4A 1K4KA 2ZYRA 4RV4A 4FEAA 2FN3A 5DYNA 4N9WA 5BSFA 1XO1A 4MXDA 3I45A 1XRQA 3A4TA 4XVRA 4D26A 5KSWB 3IAEA 1PK7A 4R2MA 5E9JA 2GFIA 5CDFE 2B4RO 4XSGA 5FUBA 2OMEA 3LLSA 3W1WA 4BNKA 4AMGA 5JC1A 1OBCA 3P4YA 13PKA 3G7SA 2YIDA 3DCJA 1VJGA 3ET4A 3NRCA 2C1XA 4OHXA 1GRRA 4G67A 1L4NA 3CWQA 4DADA 3U7EB 5K5EA 4C6TA 2W93A 3EXHC 2MYPA 4DHEA 2CL0X 3IVCA 1YONA 1QCZA 3ZIAA 1EXNA 5AW2A 1CBUA 3RUFA 3C1UA 2YR0A 4D8XA 4HQKA 3COVA 4K9RA 3GB9A 4UDNA 4K9MA 4KP7A 5JNRA 1BKSB 5I7VA 4AF8A 3K6SA 4PSDA 3WLMA 1DARA 1X7HA 1S3IA 2VUHB 4Q37A 1A5AB 1SC1A 3I6YA 3K1JA 1ZS9A 1EBFA 4C6TB 1IN7A 3B36A 4LNAA 3ZOZA 4UDYX 2EBFX 4CYMA 4E15A 4I4NA 4LI0A 1ZGCA 1OWMA 1XPRA 2BEWA 1NNEA 1F1JA 3D6VA 2Q41A 3WNCA 4A8JA 4D57A 4YYEA 1QKKA 1EB9A 4W8OA 4D0LB 1UF9A 5LYJF 3HCAA 4OJTA 1F38A 2OVFA 3KUDA 4EK9A 3HDYA 2F3PA 4US0R 1UWVA 2HBYA 1YDEA 5DN9A 5JDCA 4JP8A 2O19A 2JJ1A 1MJNA 4RE5A 5T7BA 4AIRA 2V7PA 5F12A 1FZTA 1WDWB 1G5PA 1XQVA 1QM5A 5KWSA 5LKRA 5IF3A 1J0EA 3T4UA 3HTXA 2XLBA 3IAHA 2XITA 2XUOA 5DVZA 3MTGA 3RT1A 4RSMA 2BGRA 3BF7A 2GHRA 3CW8X 1BKDR 3QUTA 4KXYA 2Q5HA 4WERA 4XGRA 4DNPA 5AVXA 1VMKA 3FSEA 1WPXA 2H31A 3PB3A 2C3PA 3VI4B 3WYEA 4O4JA 2Q7OE 3QKSA 2J3KA 1BN6A 4AY4A 4MARA 2JLZA 3KKNA 5TJ9A 4MYCA 1G5HA 1DBWA 4MV4A 5LQKA 4FN5A 5DW0A 2WJHA 3FCEA 4BZWA 3I6ZA 2XUKA 3GLFE 2MIIA 2PQ0A 4N3NA 3SBOA 5B4TA 2KLHA 2A7QA 1NUUA 3BE6A 5BWLA 3LX5A 1OU0A 4MK4A 3X2EA 2QMYA 1ZUIA 1OZHA 4QREA 4U8GA 3K09A 2FPIB 2GERA 4QHTA 5TLSA 3PQEA 3LKVA 3EF3A 3RFVA 1HZZA 3JVEA 4RLQA 3VYWA 2QLTA 4C7KA 4MQBA 1Z56C 1TT5A 1QYDA 3JD1A 3V4SA 1WHSB 4C3UA 4X0EA 3KVRA 1OXTA 2HH9A 2QXYA 5K0SA 4ZOLB 4KPFC 4MUFA 5BRAA 3U7FB 1XAJA 1KZ6A 1U2TA 4CHGA 2IU4A 1FQWA 4XLZA 5H02A 1RTTA 1XHEA 4PIPA 4W1SA 5D3MB 3ILVA 4BO3A 3LK6A 3QU5A 1UBNA 4AP6A 2JJ1D 3EQ8A 4CT5A 4S3MA 1CVLA 3RYCA 2GRAA 5CYOA 1HDEA 2G67A 2HJSA 1QS0B 3QE4A 4CM8A 2IKQA 4WV3A 3LY5A 1YULA 4OQQA 4P81A 4PAOA 4MPDA 3SK0A 2KB0A 5A4DA 3FWPA 1OGYA 3TG2A 1KDRA 1TCUA 1S6YA 2BH9A 4GQIA 5L45A 4IYJA 1TEVA 2HJGA 2Z8YM 4F3RA 5JSYA 5K9ZA 4MUIA 2VPIA 2FSGA 2OZEA 1NVDA 2WHPA 4L76A 4LYFA 5J4LA 5KNDH 1Y5NA 3PXAA 3D0OA 5M34A 4LN1A 4JDUA 4CL3A 2AMJA 4Z4CA 5JCXA 2AXPA 1M6HA 1Q3HA 3L41A 3LYHA 4LNHA 4BOYA 1SVWA 3TLXA 1RXYA 5JS8A 2AX3A 3TO5A 3KKMA 1AT1A 2TS1A 3RSOA 3WDSA 3I2IA 1A76A 4CIBA 2WC1A 4HNUA 1NW6A 2JFZA 1Z39A 1ZK1A 1ZQ9A 2RAFA 4PYMA 3ZHXA 1AVTA 4YR7A 3IAXA 2XA1A 3QE0A 4M55A 1X1RA 3ZXYA 2HYIC 3SZOA 4ZXPA 1T13A 5K0GA 1ZK4A 5DTMA 1B93A 1LLQA 5AVWA 1MEEA 1YOBA 3CRMA 5JQGB 3OAAD 2LDXA 3ISTA 3Q7EA 1WM1A 4MUKA 4AKEA 5CNIA 1SY7A 3ROFA 3U4GA 1E3MA 3LUDA 2I29A 5EWJB 2M32A 1GFIA 2JI9A 2YNMA 4DEVA 1QE5A 4NYJR 2UXDB 4WJLA 2EC5A 4ZDJA 1YQ9A 4O2AA 1JFVA 1LDGA 3B2EA 1E32A 3FAKA 1XCJA 2FFRA 2BLLA 4D0RA 1W1UA 1HLFA 1OKKA 4QBHA 3WP0A 3OJFA 5BN5A 1YRHA 3PT5A 1E69A 1J8QA 3ZHRA 3MUFA 3CA8A 4YI5A 4ZV4A 3K9QO 5FBWB 4CMHA 4DL9A 1F51E 2DFPA 3GXOA 1USGA 4Z3DA 1ECLA 3GFQA 2I2BA 2ZYDA 3OT1B 4E21A 4UM9B 4KRGA 4E5UA 3E1KA 1I3OA 3NHZA 3O9MA 5EJMA 1HT3A 4FEYA 2D5BA 2V6BA 4XD7D 3O8RA 2R1UA 5IC4A 2CXNA 2W7TA 4URUR 5HZGA 2FCRA 2VCYA 3GHHA 2RHRA 5TPZA 1P62B 3PDHA 3VPSA 5CTJA 1EUDA 2PKEA 3NTXA 3I9KA 4Q7KA 5J23A 1V8BA 4DQ0A 4PBSA 3NKVA 4UTOA 3CJQA 3ROGA 1YFKA 3G0BA 4UW9A 1J06A 1T8RA 1TADA 5G0WA 1TXGA 4GBJA 1ZUNB 5EXSA 3OA2A 1XQXA 4Z0NA 3VHRA 3AHDA 4LWQA 2PH3A 2XGSA 4LZPA 2WJJA 1FXUA 1GTZA 2YMLA 4JT4A 5CFLA 3GROA 5C32A 3E7WA 1P1JA 1A8QA 1E5TA 1GA1A 4NBVA 1OFTA 3W8DA 4EYGA 3JRWA 4KNYA 4CEHB 2AA3A 2QU7A 2WNSA 3BB1A 4L5IA 4F8YA 4AMVA 2IX9A 4BNVA 1YS7A 5JSFA 1NQTA 4UTZA 3UJAA 3VBEA 2CY0A 1J1IA 1E2UA 2XWBF 4FDLA 4MR7B 4F9FA 1L4YA 1W35A 2O54A 2JDID 4YRKA 3X1DA 3RC8A 1YBVA 1YQTA 1EFVA 4DA4A 3GAAA 4FDTA 1FE8A 2VL7A 4BMCA 4D4IA 4GKKB 1R88A 2BM1A 1JPNA 2JGEA 1XJQA 1RSZA 3GGSA 1P3Y1 5EN4A 2Z57A 4IH1A 3T3DA 3ZWMA 4C21A 4QDJA 1XVIA 1XB2A 1CY8A 2GZ2A 3EFOA 2FVXA 3TQIA 4BNHA 3B60A 2XJ9A 2V97A 2ZRQA 3DOFA 5JI3E 3L04A 2UXCB 3H8VA 2NN3C 2D1QA 4LBVA 2IU3A 1OTYA 2OE2A 3QX7A 4QOEA 4CN8A 5C0OE 2H54A 2EHDA 3I9FA 4ZO9A 3DDWA 5ALRA 4BFYA 5K0TA 3ZWWA 4YJKA 3GLIE 3HNRA 4GXRA 5JMPA 5GZ6A 1ZD9A 3I0MA 4QPPA 1EZ4A 5CDSA 1R8XA 1L7RA 4PU0A 3ZCUA 2FK8A 5ALXA 1X1TA 1ZI9A 5GADl 4AQ7A 3V7WA 1I13A 1NP3A 1P4HA 2H5LA 3DG9A 4OQMA 1PD0A 3IVAA 3MCVA 3PENA 1TCVA 2NX2A 1HY3A 3EISA 3OZ7A 1SU4A 2FQXA 5CBPB 3LYLA 2UKDA 5KYVA 2IPOA 4BLWA 2BRUA 4IDAA 5KBYA 1MPXA 3HCEA 1G38A 1VGQA 3BT7A 1R15A 2PY6A 2G1AA 5ALKA 3AKEA 4RHYA 1E9RA 5ICFA 4E7OA 2XZOA 1J25A 1HSZA 3BFKA 3ZWXA 1N7HA 2PZEA 4JC4A 1RRFA 4Q03A 5LB2A 1CWUA 3UH0A 9GPBA 3CUYA 2BFOA 1E8MA 3G2HA 3UY4A 4WINA 2PO7A 4IUYA 3FKJA 3VUEA 5A6SA 5B57C 4M53A 1HQKA 2ZIWB 4M21A 5AUPB 3EXIA 1D5CA 3E8MA 4M7RA 2IGTA 5CCEA 2DVMA 3ZXXA 2JLWA 4OB7A 4MI1A 1KAMA 3PFFA 4B2PA 2EYQA 4C7OA 1K8QA 3TB6A 2TYSB 3IMEA 4MUHA 1P91A 3M70A 4J1SA 3T4PA 3LPCA 3NPMA 2RBGA 1ECCA 1RYMA 3O38A 4RTRA 4AKGA 3A4LA 3T94A 3H83A 3IH5A 3KQTA 4AG3A 5JTTA 3OKAA 4EGJA 4IIVA 1E64A 2NZ2A 4L5YA 3DF7A 1X2EA 2HI0A 4NSNA 1ZOSA 4HFNA 5A04A 3WO1A 3OD1A 1IRIA 3OTGA 4X7BA 1MHPA 2BUAA 2LE0A 1ZR2A 3HN6A 2GKGA 1M5TA 1D9ZA 3KQYA 3ZNNA 3ZN2A 3A6PC 1EE2A 1EKXA 2X9QA 1RYDA 3WLNA 4DSTA 5AKGA 4JOSA 5BMVA 3WA7A 521PA 5K09A 1O89A 2YWHA 1ZU4A 3GFOA 2M6SA 3FCAA 3OEYA 1PFWA 3BGVA 1I2DA 3DHYA 1ZVKA 1P0IA 3BRWD 1FCJA 5FNZA 3LM8A 4BVJA 4BMSA 2YJ5A 3G02A 3NI2A 1CZOA 2Z09A 3I1FA 1FL9A 1HDIA 2P6MA 4BQNA 5FNVF 3KFVA 3TRJA 3VR0A 4NMXB 3K6RA 2MYTA 3KLMX 3KOZA 4TGLA 2QDXA 5ILGA 4ZAWA 5ICCA 1EJBA 4JSYA 3OKFA 2WY2D 1CQPA 1OFHA 1IEXA 1X7YB 4DV6B 1P74A 4G01B 2IZ1A 3ZEAA 1EXDA 4D79A 3MJTA 2F62A 4UUAA 3D8UA 2ZM6B 1JSZA 4WA7A 2B1RA 2LW7A 2X5NA 1CNEA 3HB0A 4X9XA 3BMQB 4QICA 1N5DA 1EHCA 5LZ8A 2GCPA 1RQ2A 3H9QA 4JYPA 1AKVA 3M1IA 2PX0A 5FWXA 4F93B 4OOFA 2FPSA 2ZAIA 3O0TA 4OQ4A 4RZIA 2Q2OA 2B7BA 5DKFA 2XVAA 2VF8A 3B70A 4RVGA 5KTRA 1DWQA 2Q5QA 4FHFA 1NN0A 1P2FA 3UC9A 4N6NA 4PNHA 4DIOA 3GFPA 4KAFA 3TSOA 4F4UA 1FW6A 3QVTA 2JJ2A 3SQWA 3MM4A 3QP9A 1OLXB 3PUHA 4FZ3A 1NW3A 4HDMB 4PQYA 1RYZA 4DYHA 3SKVA 3WLTA 3N8GA 3PDUA 1P1IA 4Q19A 3BRWA 4W5RA 3C0KA 4J07A 3TLZA 3LC0A 1HUQA 3T95A 2PAAA 3M1LA 1AUQA 4J7XA 2HSEA 2I3BA 1CY2A 4RH0A 4GAEA 3T5MA 1KKLA 2EL9A 3PX2A 4TS9A 5DI9A 2K7ZA 4X1IA 1XOIA 2A1UA 2ZIFA 3VC1A 1PGNA 3TL3A 2JCYA 2HWYA 1WS6A 5AM4A 3C3MA 5DK6A 4NBTA 4DV1B 3CLUD 3MFYA 3BH7A 3PQ5A 5THXA 4YMLA 2REQB 1YI1A 1Y3BE 2R8XA 3L4BA 1RYYA 5LDGA 5MFPA 2VK8A 3MT0A 5A9TA 5L4SA 1K2VN 3NBMA 3N53A 4JP2A 4YTEA 2OFFA 3S29A 4IV8A 1NFQA 3EBPA 5HPYB 5GIPE 2AN4A 3PUJA 1E0KA 5FTWA 3HCPA 3E70C 3VV3A 1FMLA 3LDFA 5ETJA 3RYHB 2XH8A 4JNCA 4LRTB 1QB7A 4RPHA 3F2IA 5DNWA 4BV9A 5L6LB 2QSUA 3I8OA 1C0IA 5JVDF 1TUGA 3HO6A 3ZVLA 1S9DA 3U7QA 1CJMA 1E4VA 2JJMA 2KSQA 5TEVA 4HB2A 2Y9PB 3WWCA 1QG4A 1Z6PA 2OYSA 5FXMA 4C0HA 2ECOA 2VT2A 3K09C 1AXGA 2WTNA 2H2GA 5HFNA 3RRFA 1L7EA 4BDTA 2LTAA 1DBRA 4YYZA