1T6NA

Crystal structure of the n-terminal domain of human uap56
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase
publication title Crystal Structure of UAP56, a DExD/H-Box Protein Involved in Pre-mRNA Splicing and mRNA Export
pubmed doi rcsb
source organism Homo sapiens
molecule tags Pre-mrna processing protein
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t6nA00
2PJZA 2OCPA 2IW3A 2P2LA 1ESNA 4M22A 621PA 2ZSBA 1R8SA 3NH6A 4BZQA 1TU4A 3GFOA 4NCNA 4OBEA 4RVCA 1XDBA 3C5HA 2ZRAA 5HE9A 4ITRC 2GJSA 4RCYA 4EAQA 1OT3A 3CNLA 4KYUA 1OV4A 3C8UA 2P6RA 2NPFA 3ZVMA 2O8EA 1CF4A 4A4DA 1DOAA 2CHQA 2QUZA 3R7WA 1Q3TA 3ADDA 3PJRA 1NF3A 1S8FA 2IF0A 4V0ME 5EXPA 1UJ2A 4Z8XA 1KKLA 4LDJA 3L2OB 2G83A 1I2DA 1KI2A 3PITA 1ELOA 3OE7D 3AP1A 4LBYA 2WWGA 4B2IA 3GEIA 3VAAA 3FFBA 1HA3A 3A1WA 5EZ5A 3RS7A 1IJEA 2QPAA 3GP8A 3IBGA 2ODBA 1SVLA 1E2JA 2XZPA 2RGGA 4LI0A 2PLFA 2G0NA 3CF2A 4B3FX 1NIJA 3I32A 4KLNA 1M1YE 2BKUA 1E3MA 2WMNB 1RRFA 2QRZA 5BN5A 1NJGA 5HTKA 3K8YA 1D8TA 3LQRA 3IEUA 3QF4A 1E0SA 1S3GA 4TMZA 3BD9A 3K9HA 1H8EA 4MRSA 3B8HA 2ZPTX 4GP7A 5C4GB 2Q9CA 2YOGA 4IHQA 5CJ2A 1TF5A 3REGA 1Z29A 1FOEB 3MUFA 4TMTA 2X2EA 5DI3A 3IGFA 3L0SA 2QORA 3SBDA 3EIQA 1SXJE 2JDIA 1N6PA 1KIMA 1OLOA 1ZM3A 4DRZA 4KSBA 5FOTA 5H68A 4BLPA 1CBUA 1OW3B 4BECA 4F4JA 1HYQA 1QHNA 2CNWA 2FEMA 2UKDA 2O8FA 1WP9A 1G18A 4JKIA 1HURA 3QENA 4TQAA 3BFKA 3IIJA 5B2ZA 4Q4LA 4TYNA 1WB9A 1G291 4JBYA 3FTQA 4Q9KA 2CMKA 5GVSA 5E7MA 1XJ0A 2WJGA 3B1YA 1P61B 4MRRA 2GWHA 4OJKA 1DG1G 4I1SA 3DPUA 4Q48A 1IBRA 3W3ZB 1P9RA 3SOPA 4YMUA 3DVLA 3EWAA 3BH0A 5K8UA 3SDZA 5C18A 4QJ5A 2YWEA 1XB2A 1DO0A 2ZVQX 2Q9AA 4TQ9A 3AM1A 1G8HA 1N25A 3GQBA 4Q4HA 3TVTA 2ZRJA 2JIZA 3GFPA 4URUR 1JR3A 3I62A 3QXCA 3U2QA 1SVSA 3K0AA 1Z22A 1MR3F 2GRJA 2IC5A 4WZAE 3EXAA 4IXMA 3GPLA 4HLCA 8OHMA 1Z3IX 1XTQA 4F7WA 2BJVA 2FX3A 3OEED 4B48A 1EWRA 5IK2D 5D3MA 1CLUA 1OFHA 4P4UA 1JXOA 1A2KC 1DBSA 1Q1ZA 3DZDA 3L8ZA 3THOA 4C2TA 1LTQA 4AYWA 1R0YA 4RZUA 3ZGXA 3KKQA 4JSYA 1Q12A 4IXNA 5FTNA 1YR6A 4A0RA 4CEHB 5LB4A 3K0FA 3P32A 5GJVC 1KJZA 1N6HA 3KKPA 2F3TA 1GIAA 4E22A 4JJKA 3OFNA 4PC7A 4B76A 4RD4A 1G3QA 2IA5A 2VO1A 4R2IA 3KL4A 4ZI3A 1QHHA 3TIFA 4LHYA 1MH1A 1DE0A 2RHDA 4L5BA 3BJIC 1XD2B 4Q1BA 4PC6A 1YZLA 2GK6A 3B60A 3DKPA 4ERNA 4A82A 2JCSA 4NYIR 2HYDA 1I4LD 1TADA 5IHPA 2JAQA 4M1WA 1W5TA 4XJXA 3QNUA 4HI0E 3A37A 1E2IA 2ZIAA 4LGMA 5AJVB 5EXTA 1VIYA 2BCJQ 3WHKA 4MGKR 4BUJA 2MMCA 4MYUA 3ZIAA 2FFBA 2JLYA 3NTUA 2ZAOA 4PC2A 1RYHA 1S3SA 2FNAA 4MKHA 4ZIRA 5KPJA 3P27A 4I4LA 1J8MF 1SGWA 1ZNXA 4LV6A 4KFTA 3Q72A 4XWAA 1GSIA 3U7GA 1IQPA 4R98A 5EE0A 1E1RD 3FE2A 4PQRA 5FI1B 2VHUA 4DCUA 3I8XA 2ZRDA 1LS1A 4AIIA 1Z8FA 3CONA 5KSYA 3OEHD 1P2SA 2EFHB 3I4LA 2B7BA 1UDWA 1XMIA 2BOVA 2R6FA 1Z0KA 1JEDA 2PH1A 2CLSA 2XITA 3BFXA 4ZCMA 1AK2A 5A0FA 2WHXA 1DAKA 1CXZA 3T15A 1BS1A 3QUSA 1VCMA 1T8TA 4Q18A 4C0SA 4M9SA 1OHHD 5JEDA 1G5PA 4HB4A 4GMDA 4TLDA 4TWZA 5HCIA 2PZGA 3ZZUA 5LD2C 1Z28A 1G64A 1A2BA 4NYMQ 4PQFA 4QC2A 1OYYA 4M1KA 1E9SA 2ZVPX 5B30A 3J81k 4ZO4A 5JI2E 4IDOA 4HUTA 4XTCS 4XH9B 5C46F 1GRQA 1H8ED 3QKRA 5F9FA 1ZBDA 2C2HA 1RRGA 2FPMA 1YHNA 4FCVA 1M7HA 1XEXB 3L0OA 4Q02A 3CKLA 3HYTA 3SYKA 3U3MA 4MRNA 4TSFA 4Q4AA 3WMEA 5CB8A 4GOJA 5FUVA 1MO4A 4NONA 2SHKA 3I92A 2JDID 3SC3A 2AFHE 4M1MA 1TUIA 2W0MA 1NBMA 2WIBA 1NIPA 3C14C 3DO6A 3UIEA 4AYTA 3EARA 1UDXA 4K8OA 4NMMA 1MO6A 5KDDA 4AD8A 1KAGA 4DEXA 1G6OA 3V4RA 3GJ4A 2YNMA 1L2TA 4L9WA 4QJ3A 3NC1C 4C0HA 4KVGA 3AGPA 3D6TB 2WOOA 2LKCA 3P4XA 3IDQA 5L3VA 1EFUA 2CL6X 3SFVA 3NEJA 3NBYC 4EQ6A 4D4KA 2QM8A 1C9KA 4FN5A 2FSHA 3FMIA 3KQLA 3OF5A 1F2UB 1D5CA 3RS4A 3FKSA 2ZXUA 4DT1B 4O0MA 5JSZA 3O8BA 1U8ZA 2JIZD 4C7OA 1JR3D 2CCKA 5AUQA 3EA5A 3MJHA 4Z54A 3QKSA 1Q57A 4P4SB 4IDQA 1AS0A 3VU9A 5IT5A 2R6AA 1Z0JA 3BH6A 2CJWA 3UKDA 3K0CC 1E2MA 2J0UB 5KNDA 2W0SA 4C0QC 4Y0VA 1E4YA 4A2PA 4TYWA 2IYLD 2ZSDA 2AWNA 3VNUA 2KBEA 4XWOA 1P60A 2RGNC 1GNQA 3ADKA 5KSZA 3THYB 2XXAB 5CJPA 1X86B 1Z6AA 4UNQA 3B82A 4QRHA 5L3RA 1NKSA 1DADA 1OXUA 4LYHA 5J4VA 3D3QA 5DIFA 4GZLA 2OBLA 4TTQA 4DUGD 1IONA 3E2IA 4LHWA 5IRCD 2Z5FA 2ZEJA 2ZU0C 1TQ4A 2GZDA 4QGAA 2L0XA 4BRWA 4TYYA 3OFND 1MRNA 1RIFA 1JQLB 4NPHA 4BGDA 2O8CA 3AF4A 2BKEA 3DZ8A 2P5SA 2Z0MA 1SHZA 2VL7A 4DEYA 3IEVA 2NZJA 3THWA 1AQUA 4B73A 2JLXA 1E9BA 2FV8A 3K70D 2OFOA 5JZVA 1FP7A 3M1IA 2W83A 4AURA 3HPQA 5FBRB 3R9WA 3AF3A 5JBQA 3AEZA 5FR1A 2GXQA 3SBEA 4CZ2A 4TL7A 1MO5A 2HLDD 5G3YA 3D7MA 4OQXA 2WJIA 4F4CA 3P4YA 1T0HB 5FOXA 1DEKA 2ZRNA 4P4TA 1F2TA 2IK8A 3QVVA 3T06B 4QJ4A 1RYFA 3IHWA 3TRFA 2QT1A 2JJ2D 3A4MA 2QGNA 1IY0A 3T1TA 2J0SA 2ZR0A 1U8AA 1KJWA 2ZSEA 2ZTSA 4DVGA 2R6CA 2JJ1A 4Z1MA 4M21A 1E9DA 3GEEA 2W00A 4P31A 1ZVQA 1SZPA 4S35A 5KTYA 1KNXA 4US2R 3SN6A 1GRRA 3HP1A 3GLHA 1DAGA 1OFIA 221PA 1CKEA 4L8GA 3GLFA 2BIFA 5KOYA 2H17A 1RC8A 4QHYA 4CT4B 4OQMA 1D9XA 4GL2A 2P6NA 4JLOA 1D2NA 1WBDA 4U7DA 2IUUA 3LQQA 1XZPA 4EKDA 3DEFA 2O8BA 2O8EB 3AUYA 1W0KD 3DM5A 4GI7A 2VHQA 1NG1A 4FIDA 1AS3A 3AV0B 4WZBE 4HUQA 3QOFA 4DHEA 5J4KA 1E0AA 1QHYA 1G7TA 3EPKA 1Z6XA 3AKEA 3MJRA 4FWIB 5JJIA 2WVJA 1KY2A 3SQXA 3EZ2A 2QEQA 1XPRA 2IHYA 2AD5A 4A0FA 4TSFD 1WF3A 5FOWA 1FMJA 1E94E 1JJVA 2ZJ5A 1Q44A 4B3BA 2XX3A 4Q4JB 4CF7A 4MYTA 2ZETA 1KK2A 1G41A 2OG2A 3EAQA 3QKTA 3QPUA 1KO7A 1Y3AA 4D0LB 1BIFA 3GJ0A 1WA5A 2ZJBA 1FZQA 4TLBA 4W5JA 1W4AA 4HSEA 1ZCAA 1AKEA 4YMWA 1T6NA 2C9CA 4OQNA 3EX7C 1P4SA 5FPYA 2ZROA 2F43A 1TF2A 4XVQA 1ZC4A 1LW7A 4NKRA 3GJ6A 4K46A 2ZRIA 5KO2A 4RZXA 4KSCA 3QEJA 4Z8YA 3U4QB 2DYKA 2O8DA 5BWMA 2IS6A 2YOFA 3KUCA 3N70A 2JJ8A 3GLIE 4QHTA 4HDOB 3THXB 4CEIA 4JL5A 2IYVA 4FMCF 5DHAA 4C3ZA 1KO8A 1XCGB 2WWWA 2IT1A 3FKSD 3FMFA 4DDTA 5FBVB 1XTKA 2CL0X 3FDIA 2JLQA 1KZGB 3LBNA 4X8OA 2ZREA 1KYIA 3EZ7A 1Q21A 2CCJA 4B3CA 1B23P 2ZRMA 2O5VA 1MOZA 2RHMA 3FMPB 1HT2E 2ZUBA 3CO5A 2NG1A 1WCV1 1UKVY 2ZE6A 3BRWD 1M7BA 1W0JA 2FFQA 2KI5A 4KVAA 4DLRA 3DOEA 4AYXA 2GCOA 1KOFA 4OI1A 1AM4D 2QENA 3HPRA 1F6BA 4ARZA 1E2GA 4P3YA 2GDJA 3LY5A 4V0MA 3CW2A 5J4HA 3PEVA 4Q4HB 3KTAA 1WQ1R 5GADl 1S1CA 3VR6A 1G3IA 4M9QA 3CB4A 1N5JA 5E4FA 3RYTC 3ADCA 1LY1A 1ODFA 4JLDA 2D62A 4D4MA 1Q1QA 5K8LA 5CK5A 4F4IA 2IEZA 2OCBA 3CX6A 3RRNA 4AK9A 4AKEA 4JVLA 2QSYA 1TQDA 1ESMA 2B6HA 2QMHA 1XF9A 3OAAA 1LNZA 2C95A 4HDCA 2WSMA 1R0XA 1G4UR 4LYAA 2J87A 2CVFA 2BMFA 2XSZA 1TL7C 2KE5A 1E69A 4POAA 4OQFA 4TTRA 5LDDC 2QSZA 3I61A 1YKSA 3LNCA 4G3XA 5EJEA 1HH4A 4JLVA 2REBA 2VSXA 2HDNB 1OFUX 4WXRA 5DGXA 3WNDA 4EPVA 1QZXA 2ATXA 1NN0A 4KHZA 2ASEA 4RD2A 2IS2A 1QHHB 3AKDA 4NYJQ 3WP1B 3QBTA 4LHZA 4MGZR 2GXUA 3MWLA 5D3QA 5EP3A 3T61A 3K70B 1F60A 1RE0A 1KSHA 1T9HA 1AA9A 4EPXA 3U44A 3WRYC 3DDCA 4IVPA 4Z1MD 1U99A 1G3UA 1PLKA 3V4FA 4D0GA 4LJYA 4LPSA 1SVKA 3ZD7A 4LV8B 1E0JA 4BLOA 1E2LA 2ZI3A 2A5JA 1FL9A 2NOAA 4F93B 2G6BA 2Q3HA 2E87A 3FKQA 1ZNZA 3CX8A 4G01B 3M6AA 1US8A 3RS5A 4B44A 4JLJA 2QAGA 2W6JA 5JS7A 1OH5A 3AP3A 4A1FA 2QN6A 5BW8A 1U0JA 1VECA 1L4YA 2ODEA 1UEJA 2J3EA 1WDTA 3EIEA 3X1DA 4FD2A 1P2UA 1KI8A 5KHOC 3K70C 3A1UA 4UNRA 4BFZA 1G3MA 2CXXA 1IOZA 3FMOB 4HATA 4JLKA 4QFMA 1E1QA 5EZ6B 2OUKA 2PZEA 2ZS7A 4JJZA 2HCBA 1KDPA 4BEJA 1R10A 3K53A 2GEDA 4MRPA 1P73A 4S2EA 1ZM4A 3EC2A 1E0KA 3EC1A 4MITA 5CYOA 2A3RA 1YVDA 4RD3A 1VHTA 5FPTA 2OFWA 1KDTA 3QKRB 2PEZA 2H57A 1A5TA 2PZFA 3CUEF 2BBOA 3VTKA 5FOUA 1E2QA 4A8JA 4DB2A 2CLCX 3PCRB 5L3SA 2UZIR 1J90A 1QF9A 5TV2A 3TKLA 2J1LA 1OFTA 3LA6A 4P33A 4B34A 4LOAA 3TGPA 1YZQA 1OF1A 4FCWA 521PA 3SJBA 4JLMA 2IYWA 1UF9A 2QTFA 2RGXA 4JYBA 1BYUA 3C7KA 2AKAB 5UKDA 3PR1A 5J47A 4MDEA 2W58A 4C30A 3UANA 1IN6A 4N0DA 4A6XA 1X6VA 1IN5A 3PUVA 1XXHE 4MA4A 1RZ3A 2XNDA 1YZUA 2QPOA 4JLBA 4B43A 1ETUA 1MT0A 3TUZC 1CU1A 1ZM9A 4LUCA 2NO1A 4MKFA 3R8CA 2RGAA 1R7RA 3BH7A 1XEFA 4FINA 5E7IA 5FFMA 3GMTA 4JL8A 1NI3A 4LBZA 5TY0A 3AUXA 2W6ID 2MSCB 2GESA 4GDFA 4II7A 4EQ6B 3OHMA 3MWYW 5BQ5A 3ZS9A 1O87A 4KFUA 4URZR 1W4CA 1Z6YA 2QQ0A 4Q01A 3UATA 3TSOA 5JSZB 4EPWA 4PSVA 2Z4RA 1YR9A 2KWIA 2YOHA 1ZU4A 1YZTA 1W4RA 1P5ZB 2QNRA 4HZUA 4OHVA 1FX0B 4QM6A 1J70A 3AB3A 1W4BA 3R20A 4FXPA 2QM7A 4B3XA 1SVMA 3KKNA 2VP0A 2FDCA 4D0NA 3BB4A 4B2LA 3IKJA 4FCTA 1R0ZA 1EFHA 3B1VA 2CBZA 1SKYE 4C0AC 2XSZD 4KCGA 1IN8A 3FHTA 4PANA 3BB1A 1A4RA 1W49A 2DWOA 4R7ZA 1RKBA 4HDQB 2ANCA 3CNOA 2IUTA 4DZZA 1ZNWA 2IL1A 1VG1A 1CJTC 4NBSA 2BM0A 2VF8A 4PPGA 1QRAA 4LHVA 2Q9BA 4BFYA 2J9RA 3MSXA 1Z0AA 2ECKA 4G5SA 1IY1A 4KU4A 3V00A 3PIRA 4NCKA 3WRXC 3THWB 4A36A 4DIDA 4OHZA 1JBKA 4KXFB 4HB2A 3QXXA 1N5IA 3I73A 1KDOA 1FTSA 4DLTA 1EFTA 3DM9B 4A0HA 2ZRHA 5E95A 4KO8A 3GEHA 2WMOB 1JPNA 1E2NA 2FMXA 2CCGA 3H0KA 2AFIE 2J41A 2GKSA 4MUBA 1E9EA 1PLJA 4YMTA 2WKPA 4IDHA 1T0JB 1ZINA 2C5LA 3OZXA 5HPYB 4KFSA 4IW3B 4PHTA 2JLVA 1P9WA 4LJ6A 1F2TB 1B0UA 2YWFA 3PUXA 3ZVLA 1BH2A 5JS8A 2QP3A 1GDDA 4E5UA 1AS2A 2AL7A 3PFIA 3PXGA 1N6LA 3QJYA 4BLSA 2YZ2A 4QG7A 1E2PA 2YKGA 1YZGA 1L8QA 4KODA 3UMRA 2ZRPA 4MYCA 3VKHA 4BLTA 2IXEA 2NO0A 3IHLA 1VYVA 4TYQA 2J46A 2YV5A 3TE6A 4I99A 3S1AB 4LWZA 2IYQA 3B7GA 3L0IB 4BLRA 2YINC 1RRPA 2HUPA 4HLDA 3G0HA 1BYIA 3LFUA 2WWFA 3VX3A 2Y8EA 3GLHB 1NRJB 2B8TA 5EP4A 1II9A 1P72A 3ETLA 1N6OA 3W6OA 2EVWX 3RS3A 1AZSC 2W2VA 2HJGA 3NBFA 2X2FA 2VA8A 3CR8A 2VP2A 4PPQA 4C0BA 1KHTA 5CITA 1QG2A 1I2MA 1F5NA 1N6IA 821PA 3NHBA 3ECCA 4KITB 1I4DD 3GJ5A 5CM9C 4O2RA 2O8BB 3BAFA 1QHXA 4F92B 1NVWQ 2DFKB 2OILA 4DLYA 4IRUB 2DFNA 4D81A 3SNHA 1W1WA 1A82A 2WKRA 4HUQB 4PPFA 4M1SA 5AJWA 4N1AA 4NP6A 2EFCB 4RZ2A 1RVDA 4Q9IA 2CEAA 4QBHA 1JAIA 2F9MA 2G3YA 3QVUA 3GLGB 1PJRA 4YXWA 1PLLA 1HQCA 2OBMA 4RY2A 2WPDD 4ESHA 2VH5R 4F38A 1M7GA 2VQSA 3SQWA 3AH8A 3TH5A 1M2OB 4IEEA 1TPZA 2R8RA 3SS8A 1CR0A 2GZAA 4KYIB 1P62B 3QBVA 1M34E 3X1WA 4PC1A 1DVRA 4LZZA 4NYJR 3ZVNA 4Q1AA 2F43B 1KY3A 3GJ3A 3AVVA 1E4VA 3A1SA 3SU8A 1SULA 2X77A 4H1VA 4LBWA 1ZUNB 3Q9LA 2G9NA 5LD2B 1CTQA 2Z4SA 5KSPA 5LB2A 1YJ5A 3T5GA 1S96A 2WWXA 3KJGA 2HT6A 4P0TA 3R9XA 1UKYA 2ORVA 1V43A 4DLSA 1L4UA 5AWFC 3KB2A 1VG9B 3VQTA 4WVFA 4BEBA 1OH7A 5KDOA 2O8DB 1IN4A 2VHTA 1TTTA 3U3OA 4N0EA 4DLWA 2WKQA 4CEIB 4H9GA 2NQ2C 3PV0A 1UBGA 2PT5A 4Q19A 1CR1A 1XEWX 4EPYA 2XTMA 4LJ9A 4QBFA 5JI3E 2JLUA 5AUOB 3AVWA 3L8YA 4OQLA 3E1SA 1KI6B 5JHHB 2BM1A 3VFDA 4IOMA 2H5EA 4ZCIA 2CK3A 2GILA 2WBLC 1UBCA 1U0LA 1EXMA 5FL7A 1G6HA 4Q9HA 3NHAA 2P3SA 3LLMA 1X8LA 4JT4A 1VCOA 4M53A 3G5UA 3LV8A 4B47A 1MABA 5CIQA 2W2TA 3CPHA 2FFAA 2GCOB 4LHXA 4ZDIA 5CLQA 2HYIC 4ARZB 1KMHA 3WYGA 2JATA 3AP2A 2OCAA 4JL6A 3KTAB 4JSTA 2WWHA 1ZD9A 3FHCB 4LJ4A 1ZP6A 1G7CA 4Q00A 5G41A 2I4IA 3SI7A 3WXMA 4ACBA 4GSYA 3ADBA 2IYXA 1FQKA 4LYFA 3AVPA 1GNPA 1CJMA 2F6RA 1I4TD 1D9ZA 1W48A 4O25A 4HAWA 3KB1A 4ON9A 1N3BA 5J4YA 1X3SA 1E2EA 4QL3A 4B32A 3EIHA 2PBRA 4GRAA 1G9XA 1TQ2A 3W90A 3IUYA 3EA0A 3CF0A 1N5KA 2CNWD 3TLXA 1GM5A 3WP0A 3W3AA 5DHFA 4OI4A 1YU9A 2A5GA 2DR3A 4Q1DA 1FMLA 5JRZA 3BK7A 2RH5A 1NVUQ 4KV9A 2AK3A 4DCTA 4LC1A 1ZM7A 2ZI9A 2IWHA 4LPKA 4PZLA 2GF9A 2V4ZA 3RLFA 4LJ7A 421PA 1E9CA 2O52A 3RAPR 4OI0A 4EIWA 2ZU6A 5DYGA 2AWOA 4JMPA 2Q3FA 3OIVA 1YZKA 3RS2A 2QBYA 2GVZC 4TYPA 1SVOA 2HEIA 3U7EB 4W5WA 2ONKA 4L15A 2O0JA 3GLIA 1NN1A 1KTVA 1FNMA 2P67A 2AXPA 2QQEA 4BASA 1ZRHA 4QHSA 1ZJ6A 3X2SA 3T1QA 3JVVA 1E2DA 1KKMA 1OXVA 2BBSA 3FPAA 2QMUA 4HAUA 2IX3A 1SVWA 3CH5A 4RFSA 2QA5A 3SHFA 1NN3A 1IHUA 4JVNA 3NBZC 3K9GA 1Z06A 2RCNA 5EQTA 1RPZA 1OIWA 2ZSFA 3B13B 4IDPA 2D3WA 2QAGB 2JLWA 3UG7A 2C03A 5L3QB 3IPYA 2ZS8A 2ZI7A 1JR3E 1QVAA 4CEJB 2GETA 4PR0A 2V8OA 2P0EA 2VPPA 1DAHA 3CWZA 5B57C 1VYUA 1PUJA 4PSKA 5HE8A 2PEYA 1E79A 4DLUA 3LVQE 3WY9A 1P2VA 4YQFA 1Z0DA 1JAHA 1R4AA 1DAIA 4BFVA 1FP6A 2QMOA 5EE9A 2VSFA 4M1YA 1KAOA 1ZU5A 2GF0A 3NDBB 2VTKA 3PEYA 1S9HA 3B2EA 2ZAMA 1VCIA 4V0KA 2GTPA 1T3SA 4HB0A 3WBKA 1KI9A 5FOVA 3QXJA 2IXGA 4YONB 2OXCA 2QAGC 3ZIAD 5K8IA 1Q1BA 2ZRLA 1OPXA 2F1JA 1NG9A 1S9DA 4I81A 3EWSA 4C0KA 4UXHA 3LWNA 4A8JB 2OEPA 5L3SB 2ODWA 1HE8B 4PAQA 2CHGA 1II8B 4TMXA 4CW7A 1HY3A 1GL6A 3BGWA 5G40A 1E99A 2V6IA 1XTIA 1HT1E 1P3JA 3V9PA 3OIUA 4MRVA 5B58C 1EFCA 2ZYTX 2RAPA 5BN3A 4TMWA 2MMGA 4ASUA 3QE0A 4LRWA 4B71A 4C2UA 2CVHA 2WICA 4CIDA 2NPIA 4RKEA 4YMSA 4DCVA 4GP6A 1E98A 5FL7D 1SKQA 4J0QA 4TMVA 2X19A 4O3MA 2A5DA 3UMFA 2C04A 3C16C 4CGZA 1D6JA 3MWKA 2FN4A 3FOZA 3BBPA 1GRNA 2VHCA 4URYR 4H1UA 4QGHA 4OYHA 4DB4A 4AI6A 3AF2A 1G1MA 2WTUA 3R7WB 3BIFA 4DDVA 1QHGA 2XAUA 1TF7A 4A8JC 4G5OA 4EFLA 2EFEB 2VP5A 2OZEA 4DLZA 4M1TA 5CK4A 2O0HA 2FGKA 1YR7A 4OK3A 1A7JA 3GJXC 2RGBA 2ZUCA 2ZRGA 5E7JA 2WWIA 3AVYA 2ZI4A 2I1QA 3QY0A 1G17A 4HZUB 1Z0FA 1VHLA 3A8TA 3ONWA 4TL9A 3K09A 4B6EA 4JIMA 1XNJA 5H70A 2OSBA 1G19A 2Q6TA 2ZI6A 1JPJA 2OLKA 4BFSA 2P65A 3QEOA 2EW1A 2QT0A 4DSTA 1NBMD 3ASYA 4FMCB 1R6BX 2R2AA 2R6DA 4YDSA 3QIAA 1NKTA 2GHIA 1R0WA 2GNOA 1GL7A 4N3NA 2PX3A 2VRWA 3BOSA 3QF4B 3AVQA 1E96A 1GILA 1NMZA 5EXSA 1FUUA 3A36A 4DDUA 1U2RA 1G8YA 3BB3A 3MGCA 4JYCA 2IYYA 2EWWA 1KI3A 1XD2A 2ZE5A 2IS4A 1Q22A 4BFTA 2FE4A 4EUNA 4XIGS 4D82A 3BC1A 2EFGA 2BC9A 2BVNA 4US1R 5DI3B 3Q5EA 3W6NA 1XTSA 3QG5A 4G5QA 3ASZA 4LK2A 3EZ9A 1OIVA 2D2FA 4XVUA 4E07A 1N0UA 1WMSA 3MCAA 4PO9A 3F8TA 1AJEA 2JA1A 1XMSA 1DAEA 3VX4A 1ZYUA 2AX4A 2LCFA 3AVTA 2VP4A 3NEYA 2IYTA 2V7QA 3SJZA 2O8FB 3H1TA 2WJVA 3ZLJA 1T5LA 2E1RA 1U8YA 2ZYUX 5DH9A 1OB5A 1Q3HA 2JLRA 2FG5A 1TEVA 3U6KA 2KSQA 2GZHA 1XXHA 1ZAKA 1FQJA 5BN4A 2AHOA 2QL6A 4AKGA 2BCGY 1XX6A 2FSIA 3RC3A 2NO9A 3HU1A 4NTZA 3B6EA 2OLJA 4WBSA 3ND9A 2WWYA 1HTWA 1U94A 1J8YF 1XU4A 4XSGA 2NGRA 2DFTA 1XMVA 3U3RA 3SEAA 2YJTD 2ZUDA 2B21A 3KJEA 3A4NA 3T34A 5A4JA 1E32A 3KDSE 5SZKB 3ZYCA 2WSSA 3K0AB 1YE8A 5TARA 5JHGB 3WNBA 3A1TA 3ZDQA 3DHWC 3OIWA 2UVQA 3PVSA 4L9SA 1CR2A 4URXR 1KO5A 3PQCA 4AG5A 3KQHA 2FSFA 4JLPA 4IOKA 5D3MB 1IXZA 1GTVA 2C9OA 3TR5A 3AVXA 2FOLA 2Z6VA 1X8KA 4MYHA 4A9AA 2OHFA 5IDVA 4D26A 2JLZA 2EWVA 2XZOA 3OE7A 2BWJA 3C4JA 1HEIA 4JVSB 4JLNA 3K0FB 3WNCA 3W6PA 4IFBA 1G8PA 1Z83A 4IJMA 1NJFA 2HCJB 4PHGA 3TQFA 3K9NA 5FTJA 1CR4A 4PSAA 2PMKA 4OKSA 3TW8B 2AKYA 1W46A 5FR2A 1CEEA 1JI0A 1GUAA 1OH6A 1SXJA 1IXSB 2VIIA 3M4YA 3FVQA 2JJ1D 2OT3B 3NXSA 4HAYA 4JBWA 4UXJA 3IO5A 1Z5ZA 2H92A 5BYKA 5EUQB 2IHBA 1VCNA 2WV9A 1AZTA 1II0A 3KKOA 3EZ6A 4NU0A 3U7FB 4ASUD 3BE4A 4D6PA 1Z6TA 1GITA 1YRAA 3KUDA 1EGAA 2OFXA 4HAVA 3WMFA 1RJ9A 3AKYA 3LBIA 1GKYA 4Q47A 2FU5C 4ZIRB 4QXAA 1EFRA 2ATVA 2QTHA 3UWKA 4EJSA 4WOPA 2ZRFA 3LBHA 2NO7A 2PCLA 1N2CE 4I1OA 4AWXA 1A1VA 3VR5A 2CE2X 1RW4A 1J99A 3KX2A 3NVAA 3PUYA 1U81A 5FI0B 5FPSA 1H65A 3SJAA 1NNEA 3AF1A 4BWYA 5AUNB 4M2LA 4C0LA 2ORIA 5M04A 1X1SA 2GAAA 5J5CA 4Q7MB 4LV5B 3I1FA 3GLHE 4Q7JB 4IOLA 4GZMA 1GP2A 2FSGA 3X1YA 1GL9B 4X8MA 1ZIOA 2R44A 3IQWA 3Q3JB 3ICEA 3CH4B 5EE3A 2QGZA 2NO6A 3TUJC 3EPJA 3CZPA 1LVGA 2XJ9A 4X8LA 2V3CC 4IKEA 2C78A 3U60B 1YR8A 2JEOA 3THYA 4UJ3A 3MWJA 3CPJB 2XXAA 2Z83A 5C4MA 2JLSA 2D2EA 1MABB 2VSOA 3UWOA 1P9NA 4PO1A 3RRMA 3I8SA 1CJKC 1OXXK 1E6CA 3I72A 2IYSA 3E5HA 3GLGE 3U5ZB 2RB4A 2QROA 2CLDX 1ANKA 3AGQA 3MLEA 3R8FA 2E9SA 3FB4A 2ONJA 4K81B 1JXMA 3SYNA 4PFSA 3KQNA 3SJCA 1Q0UA 4HB3A 5SZJA 2F1RA 5CB6A 1LF5A 2VF7A 2GCPA 2VP9A 4IFEA 3IIKA 5IK2A 4QGFA 2NIPA 5AJYA 5TDHA 2Q0HA 4Q4AB 5IF9A 4A0GA 1NN5A 1DAMA 1VTKA 4MGYR 3KQUA 2REXB 3MMPA 4JVMA 1W36D 1T5IA 3SFZA 1CRPA 4TMKA 5FTLA 4FI3C 1KSGA 3VR1A 2G1JA 1JQJC 4TLAA 2P6UA 1C1YA 4IOJA 4B6FA 2FPLA 1T4GA 1ZIPA 4FWTA 1UKZA 1IN7A 3N2IA 5DYIA 1G5RA 4JS0A 4GFDA 4ZKEA 3HYRA 4LSGA 2ORWA 2ZYWX 4W7SA 2OE2A 4KI0A 4LCBA 3I3SR 5HKKA 5BXQC 2ANBA 1W0JD 2AD1A 1ZNYA 3B9QA 4V03A 2PX0A 2QBYB 1KK0A 4A2QA 2FA9A 5TB5A 3BWDD 2ZE7A 1NLYA 3O8RA 1FW6A 2V1XA 2ZQ5A 1NY5A 1UADA 3C5CA 1KZ7B 3H4MA 3H86A 3QQ5A 4JLAA 3X1ZA 3OIYA 4ZDKA 5F98A 3K0SA 5JLJA 1KO4A 2KB0A 2VYFA 3O47A 3QG1A 2XEXA 2ZRKA 1U9IA 4MGIR 4C7OB 2WSSD 2C99A 1JR6A 4HAXA 5JWRA 3QKSB 1R8QA 2ODNA 4M8NE 4RCZA 5FL3A 2XJ4A 2YC4C 2N42A 4WAUA 4RFSB 3VU9B 4AY2A 4Z51A 1G20E 2B7CA 2NMVA 4D2IA 5CDFE 1XD8A 1XTRA 1X8JA 4NZYA 2CJWB 3K1JA 3KXIA 5FUYA 4LJAA 5H8WA 1BMFA 1CIPA 1VIAA 3HR8A 3OAAD 5GJBA 4QM7A 3B1XA 1E1RA 1Q1EA 4HEJA 5DNYB 1GWNA 4ACAA 4WXPA 5EP1A 3IO3A 2VP6A 3RNLA 3VHXA 5JRJA 1G8FA 4TL6A 4L16A 3OEHA 2A78A 3NC0C 3B85A 4OL0A 2IUSA 4CRWB 2PJRA 3VNVA 3RVBA 2JASA 3ZQJA 2OO7A 4MH0R 2FGJA 4PZZA 3MFYA 4MQBA 4ABYA 1NSTA 3VHLB 2O8CB 1DARA 4Q4JA 2DCUA 1QHSA 1E9RA 2EFDB 1QG4A 1OHHA 3EW9A 4ZV4A 1EG7A 3KQKA 2X8AA 2ZITA 1KNQA 1SXJD 5JJLA 1TUEA 1G21E 1HE1C 4UKDA 2DBYA 1E9FA 1FTNA 1P75A 1UFQA 2WJJA 1GVNB 1IM2A 1Z2CA 1EWQA 3WBJA 4XD7A 4BPBA 2PCJA 2D4HA 2IS1A 4B3GA 3CWQA 3IIMA 4QNMA 2A2ZA 5EE5B 4YMVA 1IXRC 4GT1A 1ZD8A 3D31A 3U4QA 1EFRD 3B78A 4PAMA 1WBBA 4DCSA 2GVDC 2H8KA 5E3HA 2A9KA 2D7CA 3LLUA 3PUZA 5JECA 1R5NA 5DISB 3LO5A 2W6JD 5FTMA 1S2MA 3THXA 3SHWA 721PA 4DJTA 4OHYA 2F1IA 1NMXA 1M8PA 2A30A 2QZ4A 4GNKA 5ELXA 4TZ0A 6Q21A 1K6MA 3VMFA 1ZCBA 1E9AA 2F3RA 1W5SA 2ZJZA 2D7DA 1XCPA 2R9VA 3RANA 3D8BA 4CT5A 5B64A 2V54A 2IF2A 1U90A 3EZFA 1DO2A 2GEVA 3DKVA 4P32A 2KBFA 5CM8B 3ZD6A 4R2HA 1O3YA 1XD9A 4WIAA 3HU2A 3GLFB 5KU1A 2HT1A 2FPKA 1FFHA 3IQXA 3WMGA 2I3BA 1OB2A 1E1QD 3ZZTA 2IYZA 2ZS9A 1NMYA 2BBWA 2BHRA 3O8CA 2GXAA 1NVXQ 2BBTA 2ERXA 2ZRCA 1EESA 1NVVR 1MO3A 1BOFA 1JEEA 4EPTA 5F2EA 2GAOA 4W5HA 2YHSA 4YC7A 5TVKA 5BYJA 3RWOA 4Y0AA 3BXZA 5A5GA 4NHOA 3FHOA 1TU3A 3LW7A 1NSFA 1Q20A 5DE3A 4ZCLA 4FMDB 3LH5A 3ICQB 4Q9JA 2ERYA 5GJWC 3CRVA 1R5BA 1G4AE 4AG6A 4IEIA 5JWOA 2IXFA 3DMNA 3VR4A 1BKDR 3H84A 1Z47A 2UZ3A 4F91B 2DB3A 2D06A 3CNNA 3L0PA 3TW4A 4DUGA 1VG0B 1GAJA 2GK7A 2OXRA 1ZUIA 1YZNA 1P2TA 4Q1CA 3K9LA 1PZNA 3WYAA 1KGDA 2DFLA 4RZ3A 3X1XA 4BRUA 4QKQA 2XNDD 5FPKA 2NTYC 1PVOA 4PXAA 1UKEA 4EPRA 3B5JA 4FMDF 5HKKD 2YYZA 5KDLA 1KSFX 2GJAA 2IYUA 2RGEA 1U98A 4OJQA 1XCMA 4ZI2A 3ZZ0A 1KJYA 1W36B 1D2MA 2JGNA 1LB1B 3HU3A 1J7KA 3BORA 1W47A 3JVUA 4TTPA 4Q7LA 2HLDA 2K5UA 1P6XA 5HR5A 5P21A 3K09C 1XJCA 2J7PA 4KAXA 4HLUA 3LW8A 3KFXA 3TR0A 1AN0A 4U00A 3VKGA 2OAP1 4PO8A 4RD6A 1ZM2A 4DSNA 1XFAA 2OM2A 4LBVA 1XXHB 3W8RA 3KJIA 4AKIA 2JJ2A 1M74A 3B1ZA 4XWKA 2FWRA 4V0LA 3CPEA 1BMFD 1HQYE 1JECA 3LVRE 5KYKA 1NL3A 2A5YB 4GOKA 2OCYC 1NY6A 4MDFA 4KBGA 5DSZA 1DS6A 4TT3A 1Z6GA 4LY6A 2PT7A 3TQCA 5J4LA 1SQ5A 1F48A 2H18A 1KI7A 1P7CA 2BEJA 2GBLA 2WOJA 1S1MA 4G0NA 2QE7A 1W36C 1MKYA 2C9YA 1RFLA 3EPHA 5EXXA 4BQSA 2QTVB 4NDZA 2ZJ2A 4AC9A 2CL7X 5AR1A 3T35A 2EYQA 4V0NA 3Q5DA 3A6PC 4O2LA 4PTLA 4I1VA 1G7RA 5KPDA 1W0KA 3LD9A 4LX0A 3T12A 2QP9X 4KJZA 3UMSA 4L4UA 5KNBA 1XPUA 4PZYA 3TAHA 4DSOA 3NH9A 3DOFA 2ZSAA 5FH9A 4CYMA 1SKYB 2YWHA 3BERA 2B92A 4XD7D 1XTJA 2PLRA 3BS4A 5EE1A 4DXAA 1FUKA 2AXNA 3W34A 2DWQA 2J5XA 4JT2A 2YC2C 1NLZA 3CR7A 4RFVA 3SYLA 2PMDA 4B33A 4IDNA 3KJHA 4TL8A 2ZANA 4E03A 3R9IA 4NL4H 4LYJA 1XMJA 2V55B 5JCPA 1QDEA 1KK3A 2XOKA 2MSEB 3IILA 1CJVC 3QXHA 2BMEA 4UNPA 2VHJA 3HDTA 1SXJB 3EPLA 1W2GA 4Q21A 4TLEA 3U44B 2AN9A 3TVDA 4D4JA 1GZSA 1DTSA 2GEUA 3CRMA 4XOIA 3ZQ6A 4B3DA 3CX7A 3HJNA 1G7SA 2AR7A 2PL3A 2IEYA 4FW9A 4V02A 2J45A 1GOTA 3KFVA 1N0WA 1RJ9B 2FH5B 3N5CA 3G82C 4TN1A 3QKUA 2XGJA 4GPTA 4EJSB 4LJ8A 2OBNA 1US8B 1MV5A 3CRQA 5DN6A 3MRSA 2VLIA 3AVUA 4PHFA 5G3ZA 1LS6A 4U5XA 2QG6A 3PENA 1KI1A 3CRW1 4DCNA 4Q7KA 1R2QA 4EFMA 5TMPA 4GBMA 3I5YA 2KJQA 4RJLA 3W5JA 1KO1A 3GJ8A 1FX0A 2G88A 1XRJA 2BMDA 2EYUA 3P1JA 1SXJC 3CRRA 4OK5A 4Q1FA 4FMBB 4HZIA 4YXWD 4YLGA 1TX4B 4NCIA 3A1VA 1N6KA 2D74A 5KNCA 4JKYA 4XTRA 1TQ6A 2HF8A 2REOA 3F5FA 4PPNA 3TBKA 2F9LA 1GFIA 4HLQB 1XBTA 2GXSA 2EQBA 3KZ1E 3JZAA 1H8HA 4DC9A 2ZJ8A 3MD0A 2WAYA 3MG9A 2R6GA 4EJSC 2WJYA 1G16A 2AK2A 2ZM5A 2N46A 4M1OA 4DLXA 1KI4A 1CP2A 1K5DA 4TZ6A 3QSYA 1COWA 2N1BA 3E70C 2G77B 2GJ8A 3NIBA 2Q21A 4Q9LA 4HAZA 2ZJOA 2QU8A 3LX5A 2V6JA 4D4LA 2OAQ1 4MKIA 5JWHA 5AK0A 1OSNA 3REFA 4ESVA 2ZR9A 2WJHA 1KK1A 4QBIA 5EUMA 1OXSC 2X1VA 2XB4A 4ZDJA 2J0QA 2TMKA 2YWGA 4RD1A 3DL0A 4BFWA 5FBLB 3LDAA 4QOSA 2H1LA 1XPOA 2Q3MA 4GOXA 2DWPA 2GJKA 1XEWY 2J7PD 3N2EA 1TNDA 2V9PA 4A2WA 2XZLA 1WRBA 5KSOA 1S4QA 4NCJA 4ZPXA 1AIPA 1EX7A 3SE0A 1WXQA 3PUWA 3CZQA 2CK3D 4BFUA 5L8VA 4G5GA 2FFHA 2GA8A 3NDPA 5CLLA 4C4PA 2FZLA 3TK1A 2ZJYA 4MKGA 1AQYA 1XP8A 1OJLA 2MSDB 3A4LA 5AJZA 3U7HB 2ZI5A 1TEXA 3AKCA 4RD0A 4V0OA 5G53C 5AUPB 2WAXA 3GFTA 4E09A 1J2JA 1OXTA 1VG8A 1N6NA 4BLQA 1YQTA 4TT3D 3S1AA 2EU8A 1T3HA 1T91A 1UPTA 2WZQA 3BFVA 4JZKA 3AVOA 3LXRA 2QE7D 4Q1EA 1CS4C 1UBFA 5HCNA 1Y63A 5LPNA 3VKWA 3RS0A 1ZUHA 1JJ7A 3K0EA 1Z2AA 1ONBA 1HUQA 2QMEA 3QPWA 3DMDA 3RWMB 1GKUB 1WE2A 4M4SA 3ZS8A 4BFXA 1QHIA 4CEHA 1ZW6A 3T1VA 3TJZA 3B9PA 3EG5A 2H16A 1LF0A 1IAQA 3GLGA 1YRBA 2A5FA 2J7KA 4M0LA 4B74A 5JCZA 4DKXA 4AKHA 2YVUA 4PAOA 4KFRA 1EX6A 4URWR 4ZDWA 1G5TA 5JMTA 4LC0A 1ZC3A 1XZQA 2XNSA 3T5DA 1JNYA 2C77A 1Z08A 4B2PA 1NBME 5J40A 1OH8A 2XOKD 2W2XA 4MUAA 3VR2A 5C2JB 1U9IC 4HYYA 1E2HA 4PC3A 4Q5IA 3PEWA 2HXSA 2OV2A 3NKVA 2C8VA 1DPFA 5TXGA 4QGGA 4U02A 1R5OA 1FNNA 4A15A 1Z07A 1OKKA 2VEDA 2LKDA 4R9UC 4QBGB 1VPLA 5DLQC 3U61B 5GVRA 2ZRBA 3KXKA 4OHXA 4OK6A 2QRNA 3U6BA 3W9YA 3CLVA 4NH0A 4UQOA 5FBWB 4WZ6A 3VR3A 1GG2A 1PV4A 1KMQA 3QXSA 1AGRA 3F0TA 1N5LA 4UJ5A 3RRYA 3UK6A 5DN6D 1N0VC 3OESA 1W2HA 1K8RA 5F9HA 4B75A 4BE7B 4GMXA 4G5RA 1CRQA 4QNRA 3ZVRA 4D25A 3FFAA 4YDHB 5AJXA 1KI6A 1OIXA 3Q7PA 1EK0A 1QVRA 1SHKA 4I1UA 4W9MC 3NBXX 1JB1A 4PQYA 2P5TB 4NE2A 5DO9A 4DBLC 3AQ4A 5FPHA 5ANRB 1W44A 4UNSA 1E79D 3C15C 1NVVQ 2CDNA 3QI2A 3TMKA 4WW0A 3F3YA 4JBXA 4NCHA 4WA7A 1DELA 1AKYA 2WIAA 3LRPA 1W7AA 3A58B 1ZD1A 3JZMA 1NP6A 5CDFA 1FPMA 1V5WA 1VDZA 1UM8A 2CE7A 2W6IA 3FGNA 3RABA 5GJCA 1RRCA 3CBQA 1H8HD 3Q7QA 3RDPA 4DSUA 1DAFA 2BDTA 2RMKA 4IVRA 2FZ4A 2DY1A 5H1YA 2FEOA 1UBEA 1ZMXA 4Q66C 4RSGA 3FYHA 1D2EA 1XEXA 3RC8A 4NYMR 1K5GA 3RSOA 4EDHA 4EFNA 1F3OA 4UNNA 4KLZA 3UXMA 3LX8A 3H2YA 5F3WB 5SZHB 1COWD 1DG3A 3WHLA 3P20A 3ZH9B 5FBQB 5JFGA 1UAAA 3CIOA 1TMKA 4KBFA 1AGPA 4DLVA 3PEUA 1X1RA 2DPXA 3NWJA 3RHFA 2GCNA 2IBMA 1S0UA 2FJUA 5FOSA 3M0EA 4M9ZA 3K0CA 2RGCA 3HWSA 1E2FA 2HJVA 3O8DA 2GJ9A 1E2KA 2BV3A 1LFDB 2RGNA 4IVQA 5CIWA 1OE0A 4TLCA 3PG5A 1U0HC 4PX9A 4NYIQ 2NZ8A 2QI9C 1KSJA 5CYPA 5K8TA 2J59A 3NG1A 2G1KA 3L43A 2FF7A 4C0JA 3C41J 2F7SA 1HV8A 2A7QA 2WM9B 3W8NA 2R65A 2ZE8A 3RSLA 2BJWA 4X8HA 5FUXA 1F2UA 2QP4A 1VYTA 4A6PA 4DT1A 2XB2A 5FTKA 4R71A 1NLFA 4CVNA 2XTNA 3AF0A 2F1HA 4Q03A 1C4OA 3GLFE 4OHWA 1TAGA 4ILEA 3ND8A 4P4SA 5SZIA 2IWRA 2F55A 3FWYA 3QF7A 4XVRA 1T8UA 2Z43A 4A92A 4D80A 2J0UA 3GJ7A 2V1UA 1VKJA 3B1WA 3LAWA 2OESA 5HZKA 3P26A 1Z63A 1IY2A 3KXLA 1Z0IA 3EASA 3TNFA 4BZPA 2G0TA 5L3QA 2J0VA 4DDWA 5JEEA 3RRZA 1JALA 4DWJA 3MAAC 4CEJA 3SZRA 2I1VB 5FUWA 1SVIA 3WYFA 3IPXA 1KMHB 5EP2A 3U3JA 2RKOA 1IJFA 4ZKDA 1KDRA 2DHRA 3GCGA 3W5IA 3QPVA 2CHVA 2HV8A 4LJ5A 5DI9A 1G8GA 1BO6A 1OYWA 2IYRA 1UEIA 2R62A 4UXIA 4PHHA 3LXXA 2QAJA 3TUIC 1PUIA 3I5XA 3CM0A 3OEEA 4G1UC 4RKFA 4OI2A 1XJQA 2HF9A 4HLUC 1CJUC 3TSZA 3Q85A 4US0R 3TSWA 1XWIA 3UG6A 4M9XA 2BMJA 3KKMA 1T3LA 2QY9A 4C9BA 2C96A 1LV7A 1GKIA 4URVR 1G3RA 3HR7A 4DIEA 4B35A 2ZR7A 1CULC 2XTZA 3U3KA 1OKKD 4CDGA 2V7QD 1VMAA 1N6RA 2HXYA 2C98A 3UPUA 4XSHA 2WPDA 2QPTA 3CF6R 1L7VC 3IBYA 2B8WA 3L82B 2ZJAA 1QBKC 2LWIA 121PA 2O0KA 2VBCA 1II8A 4TQUS 3T1OA 1MRSA 2GBLC 5C1BA 5JJKA 2H7VA 3Q8XB 3TAUA 3ZJYA 1M6NA 2ZYVX 5KUTA 3GLIB 4BZXA 3SR0A 1GNRA 2BEKA 2RGDA 5HZHA 5LBIA 3GD7A
chains in the Genus database with same CATH superfamily
5A6SB 1XNGA 3WIDA 4YUYA 1J2YA 2OCPA 5E9AA 2P2LA 3T7EA 1ESNA 2QW8A 1AZWA 4O1HA 3MGBA 1BWQA 1TU4A 5DM0A 4G63A 4IGKA 3VKFA 4QPDA 3V1TC 3AFMA 2XRMA 1FYFA 2GJSA 2GNPA 4GWGA 3EIUA 1P77A 1H4VB 2P8JA 2P6RA 2X8LA 4GU5A 3WLTA 2NPFA 2XUAA 4BO5A 1Y9AA 7ADHA 2DX7A 3R76A 3D6FA 2V6FA 4C0XA 2UXDB 2CHQA 3ADDA 4GBGA 1PGOA 2V98A 4V0ME 1DSSG 1U9ZA 1YI8A 3KK0A 4BL5A 4Y9TA 2I8AA 2JVKA 2PS1A 5KKAA 3M3DA 1H5NA 1KA9H 2FZKA 2V7WA 1TQ8A 2I62A 3P2YA 3EVCA 1GG9A 3IOYA 4HFRA 1WMDA 4ZQCB 3KLMX 1UC4B 2ASVA 2QN1A 3PITA 4YJ3B 1ELOA 4NCXA 2FF5A 2WWGA 4LBYA 7AT1A 2WLSA 3QV1A 2R68A 2G72A 3IMKA 1HA3A 1RCTE 3HO1A 3TW6A 3AR9A 4OXQA 4YCJA 1N0HA 2L82A 3RS7A 4EGFA 2I9KA 5C32A 3IBGA 5AVSA 1E2JA 3EZXA 2G82A 4LI0A 4PHCA 4EW2A 4UTRA 3CF2A 4JB3A 1BD4A 1T2EA 2XBLA 3F1KA 1DMSA 4N5MA 1H22A 3NYWA 4ZALA 4BGUA 5HKBA 1JVSA 5KVSA 4QE3A 2QRZA 1O97C 3VYTB 3ZD9A 3PLAE 3OFSA 1AK9A 4G23A 3LCRA 4Z53A 4DADA 3ZTTA 2O59A 1YVPA 2H4WA 4MDHA 1AKUA 1W581 3HM2A 1EYZA 4ZK6A 2PUWA 4UBMA 2ZIFA 5I9BA 5JNVA 3WA7A 4M76B 1H8EA 3M4ZA 4MRSA 2ZPTX 1KQFA 4D8UA 4MW0A 4G07A 4BIIA 5ICSA 1MCZA 3DZFA 2Z8YM 4GP7A 4JBLA 2DSNA 1RDFA 3G89A 4EHDA 1DPGA 1DC4A 1SWVA 3HMKA 4AN1A 5BVHB 5CJ2A 4D8TA 2YJ4A 1TF5A 3MUFA 3RKRA 3HCCA 4J0FA 1ZNQO 5DI3A 3ZDFA 2IIVA 3EIQA 3O4IA 3TTYA 4RA6B 3U7QB 2UUBB 1KIMA 1TAHA 3HNRA 1CBUA 1OW3B 4FEYA 1B26A 1QRSA 4F4JA 5I8PA 3JAKB 1HYQA 3PFNA 1JWLA 1WP9A 4JUIA 4QOJA 3MELA 5FWYA 3QENA 4TYNA 1WB9A 1JRLA 1U1DA 1ZN7A 4BXOA 2P40A 5BN3B 5HKAA 3OTIA 4PSUA 2WJGA 1GUZA 1F38A 3WNZA 1P61B 4KC0A 1YBHA 2Q3BA 2GWHA 3FD8A 3RARA 3W2EA 4I1SA 4IJUA 4BV3A 1CB7A 2NTVA 4Q48A 1IBRA 4U6SA 5BMOA 2MYPA 5JCJD 2Q0QA 2PZMA 5TE9A 1M1NB 2H00A 1NJSA 2EJUA 1KS2A 1M8KA 2Q5LA 3AESB 3CKKA 4MAFA 1DO0A 1VI6A 2Q9AA 2ZVQX 1QFZA 1G8HA 2YYSA 3HBFA 3K4HA 3L8EA 4TQ9A 3RSZA 1D07A 1X15A 3CE6A 1XYVA 3MZ0A 4QDJA 5IDYA 3I39X 2X5JO 1Y1LA 2YIVX 4H7HA 3QXCA 1HL3A 1MR3F 4IBOA 2F3PA 2IC5A 2LE0A 5EJAA 1SB8A 5T3UA 4R81A 1XJ5A 2QVZX 1R18A 5A4FS 1XTQA 4F7WA 2J3QA 3BZWA 4HWKA 1RKVA 2YUTA 5HRUA 4KPFC 2EZ4A 2GN9A 3IVRA 4IIXA 5D3MA 4G0PA 2Y6VA 3SHQA 1A2KC 4ZO9A 1Q1ZA 4YRZA 4W5OA 4C2TA 2G6TA 2NVOA 3PNSA 3I64A 4ISBA 4P22A 2Y1XA 4LS3A 1SM4A 4R3WA 4JXZA 2OYSA 1DJLA 2WG2A 4A0RA 3PVZA 3L8MA 2BELA 1GPNA 1W88A 2FN9A 3TIVA 2DFVA 2MR6A 3P32A 3TQRA 4YP1A 1KJZA 4YUAA 3KKPA 2P7IA 4UVIA 4E22A 3H9EO 3OFNA 3ONVA 4PC7A 4RD4A 2EBUA 5BORA 4YPFA 2BGWA 3NDIA 3KL4A 1QVZA 4FYMA 3DEKA 4ZI3A 3A9TA 2H51A 2XQGA 1QHHA 1AX9A 3TIFA 1JG6A 5F3RA 1DE0A 3CMMA 5ALLA 4EA9A 3LY9A 2CYAA 4NU5A 3UTCA 4Q1BA 4LVOA 4DYHA 3FX2A 2EL9A 3DKPA 1W35A 3KVRA 4BJHB 1GHTA 3LGAA 2HMUA 3KKZA 1F20A 2J6CA 3IOCA 4E5NA 3DLHA 1TADA 4B3HA 1W5TA 4XJXA 1EVIA 3NTQA 3QNUA 3UH0A 3A37A 1E2IA 2VPTA 4XIFA 5EWJB 3FF4A 4RK6A 4BUJA 3LRTA 3GRUA 4KPUA 3LU1A 1UBJS 2PKQO 4RVNA 4B79A 1HKHA 1EE1A 1VB5A 3GIDA 2ZR8A 4MZXA 4PC2A 3V3KA 2FNAA 2W48A 3M1LA 4ZIRA 1D6SA 3P27A 4I4LA 1J8MF 3TEFA 1A50B 1JXQA 1NXSA 2WDZA 5CR9A 1EHCA 2PIAA 3LF2A 1OC4A 2UV8A 3FI0A 3ZH2A 1BTOA 2C8LA 2QXUA 2GARA 2ZSUA 3JVDA 3Q72A 2IPNA 3T9AA 4ECEA 4S0ZA 1QIMA 2VPXA 3H9BA 3RSHA 1WL8A 3VGJA 1K6XA 4JBIA 3QU4A 4GP9A 2W71A 3HCOA 4KPGA 4X3OA 3TE7A 2INGX 2W2OA 5EE0A 4ARAA 3FE2A 1O77A 3KVYA 5J4HA 3QA9A 4MW7A 4PQRA 3F5DA 5F4ZA 3DKKA 2VHUA 3IKMB 5ENZA 3UZUA 3AHFA 4DCUA 1L1RA 3IV6A 4IX9A 5KSYA 3ROFA 3OEHD 2W42A 5DRTA 2EFHB 3I4LA 1UDWA 1IBSA 2H29A 2PA3A 3EGCA 1JEDA 4YRDA 2XITA 2IH5A 5EY5B 5ITVA 4R2LA 1J09A 1DAKA 1WG8A 1CXZA 3Q7EA 4H17A 1R0CA 3QUSA 4C4RA 1RRVA 3CO0S 4C0SA 4M9SA 2FWMX 2OQ2A 2EBWA 5JEDA 4GLFA 4TLDA 2PZGA 3ZZUA 1HDYA 1Y9JA 1AK1A 1Z28A 2Z3VA 3GDOA 4OMCA 1RYEA 2NNLD 1V16B 1SFRA 5HZGA 1LJ8A 1CX9B 1ICIA 1E9SA 1P1RA 4M1KA 5TQJA 5I5EA 3J81k 2B0CA 4ZO4A 2XADA 3E5RA 5F51A 5LKRA 4J90A 3UYKA 3DFZA 3R44A 4HUTA 4XTCS 2PVCA 1Q7EA 3ZBUA 2PSDA 5C46F 4OXIA 5F9FA 1ZBDA 2P9EA 4IP0A 5EMLA 2VF4X 1I3KA 2FPMA 2XV1A 3L0OA 4EG7A 3CKLA 4U0JA 3U3MA 4O2AB 4RNDB 3E58A 4NZZA 3BD6A 4IZ6A 2IIPA 3DO5A 1L5QA 1PK7A 2PGJA 4GOJA 4RL6A 5FUVA 5GONF 1MO4A 5BQOA 1IJKA 3D2LA 5IDQA 3ND7A 3ZU3A 3WHIA 3A6HA 5FFFA 1V8BA 4Q24A 1TUIA 3U0BA 2JVIA 4YUZA 1GZUA 1MHPA 1NIPA 1ODJA 2XUGA 3C14C 3KJNA 2ID7A 1H4QA 1A8HA 2Y71A 3CEAA 3DPSA 3OU2A 5KJFA 4E1BA 4DCPA 1MQAA 2IPMA 3I9LA 4NMMA 3TINA 5KDDA 4ND1A 4OBBA 3HSKA 5TNXA 3IE1A 1DKPA 3GJ4A 2UZ0A 1GZ3A 2QL5A 3ZIDA 5FIUA 3ANTA 1VKNA 3PDUA 3OOWA 1FK8A 4Q82A 4QU5A 3OHPA 3ZK8A 4QJ3A 4KVGA 1CHNA 4IV8A 3LC0A 1V7QA 1ZEJA 4G09A 4BTLA 3P4XA 4UEKA 1OOEA 3IDQA 3IQEA 5EUBA 3S55A 3H05A 2XA1A 5CIYA 3OZDA 5BSTA 3SFVA 3NBYC 2H5JA 1FP2A 1F8UA 5K7SA 5LL6P 4YBRA 1WZCA 4MQ6A 2N47A 2AJLI 4QYIA 3TIXB 5BNFA 3UMJA 5AK3A 4KBYA 3PVCA 3NASA 5DASA 1QHFA 1R6VA 1X38A 1UZAA 3S0JA 5JCXA 2GN8A 2JIZD 4CG3A 1IHOA 3EA5A 5KYNA 3KSAC 2XUPA 5DNWA 4AX8A 1I1NA 3ZBPA 3QELA 4YRCA 3HM9A 3VU9A 2DHQA 1QS0A 3P2JA 4JH0A 2D0IA 5HIKA 4ZAXA 3TLGB 3V1LA 2J0UB 3TPCA 4PYKA 2W0SA 1ILWA 4Y0VA 4HNGA 1JDBB 4IUYA 3AFHA 1WPGA 1DJPA 3VKUA 3EXHA 4O0LA 3ZV6A 1ECFA 3QWIA 1YR3A 1QPGA 1Z6AA 3BJRA 1DADA 1OXUA 2CXRA 2Q8NA 3CB2A 2VWHA 3ORSA 4H31A 3HBJA 2XQFA 4LQLA 4MWDA 3N2LA 3E2IA 2Z5FA 2PE5A 3LUAA 1PNTA 5LOVB 4FFPA 3AFOA 1TQ4A 1Y8RB 1Z2OX 2X0KA 3VR5H 4FYIA 2L0XA 4BQRA 4BRWA 4CQMD 3UB3A 1MRNA 1JP7A 3V7UA 1S3IA 2VCEA 3KAKA 4ZZ2A 4NZNA 2WI8A 2BKEA 4KUHA 2FN3A 3FMVA 2HMTA 2QX7A 3VOAA 3E3MA 3K30A 3PLNA 2C4KA 3UB4A 3THWA 4KUGA 1AQUA 3AIIA 4GMKA 2XQKA 4B73A 3L0DA 1U7XA 2OFOA 5JZVA 5K99A 3A9CA 5M3BA 3HPQA 1D2RA 1C9YA 2I87A 5JBQA 3HHPA 2BMAA 4D8XA 4FHEA 3WGQA 1M54A 4EENA 2GXQA 4JNCA 3SBEA 5CFQA 3H2IA 4AJ4A 4PBTA 5MDHA 3Q1KA 1MO5A 4ZVPA 1FA9A 1UBTS 4IX1A 3LPMA 1P4RA 2WJIA 3HP7A 2Z2JA 4F4CA 1T0HB 4FFDA 2FB9A 1QU2A 5DEOA 1SKUA 1YE5A 2ZW9A 3QVVA 1QRDA 4K9DA 4LE0A 4NECA 4ZQHA 1VPVA 4YRKA 5I7EA 2FWBA 5K8CA 3QWBA 3PBKA 1ORWA 2QT1A 2PZJA 2QMYA 1YKFA 2JJ2D 3IEPA 3JASA 3RUPA 2NLOA 3A4MA 1UBUS 2H7CA 2PUCA 2G9ZA 5K3AA 2X1MA 2AMLA 2P78A 2WAAA 1SQFA 3H2SA 1G8JA 1I4WA 1PW7A 4DV6B 1Y89A 2Q99A 3H75A 1E9DA 2A7XA 1A8QA 3UJ9A 4LOJA 4S35A 2H2HA 2AN5A 3WJ2A 1P3DA 1KNXA 4DV2B 5EWMA 3SN6A 4MV0A 1I3LA 3PC2A 4U9UA 1CKEA 4L8GA 1WZ2A 5KOYA 1FLVA 4FZ3A 1QWOA 4YAUA 3OQMA 4ZEMA 5B4UA 3U80A 4L22A 1TGYA 3BPSA 3F2IA 3OKAA 5G4KA 2HMYB 3TM5A 4CWAA 3AJ8A 3P52A 5IZCC 4BVKA 2O23A 3K96A 1KJ8A 1Q14A 2P6NA 3AJ9A 4OGGA 5G4LA 3LHSA 3TLCA 1MAWA 4NAUA 4K9PA 4MS3B 1XZPA 3WL5A 2FW0A 2WUGA 1W0KD 3DM5A 4NXMB 4AJLA 3AFIA 5HM6A 4BO0A 4NI5A 3R3JA 3Q11A 1AS3A 2WMYA 2QG9A 4LXTA 4NWIA 5J4KA 1E0AA 4BNTA 1HDXA 3DLCA 3P0EA 3UMMA 2H59A 3AKEA 4KRXA 1SCKA 4FWIB 4G4IA 2PS3A 5MF6A 3OE4A 4D9BA 2E0IA 3HDGA 3TLZA 2IHYA 3H9GA 1Y1TA 3BDIA 2FTKE 3H16A 5HW0A 1M5RA 1B8NA 4RM2A 4TSFD 3UGJA 2XI4A 2JL1A 1C1XA 4TUYA 5ES3A 2ZJ5A 1LGYA 3NRCA 1DEXA 1EK2A 3H1PA 4JR1A 2AC7A 4CM1A 1G41A 2QNIA 3HJFA 3E5NA 3DMPA 3RS8A 5A5VA 1JFTA 3HNOA 3QQPA 3VAYA 1UPXA 8LDHA 3GJ0A 1WA5A 1FZQA 4BLVA 4ENUA 3E0QA 4HSEA 2PGDA 4FGJA 3GT4A 4XXHA 1KRWA 2QLJA 3DWFA 3EX7C 1Y7LA 2QRHA 4GVLA 1P4SA 3LIPA 3RJ9A 2WWVD 2FPIA 5IH7A 1TF2A 1IVYA 5DV9A 1DZ3A 2X7XA 3EDYA 4QQKA 4NKRA 3U26A 1NZDA 3USES 1HL7A 3L46A 3PDIB 1ECLA 4GE3A 4GLBA 1X7XA 2I34A 3D54D 1HK7A 4M8SA 4KSCA 1JBEA 3CT4A 1YHZA 5A9SB 1A9YA 1YC5A 5K0JA 3IBFA 4U9IS 5JCJA 1U7ZA 1AO0A 2N0SA 1L4EA 3OLQA 1Y3HA 4RLQA 2P2GA 3GLIE 1H6AA 3WE7A 3BMCB 2WU0A 4BB9A 2JPDA 2IYVA 4ZOBA 4C3ZA 5F1OA 3FMFA 3AJAA 4JQYA 2CL0X 3FDIA 1KAMA 1RWQA 1SJ9A 4RVGA 4YRGA 5DM70 5DTEA 4KYTA 5IG2A 4XPZA 1A8PA 1Z0SA 3SEZA 1KJJA 4D97A 2XOEA 1MOZA 4ARSA 3FMPB 3QPDA 5BYBA 1W9HA 5CAEB 4L1KA 4AUEA 1F8FA 2ZE6A 3BRWD 3VYRB 2BEVB 4MCIA 4OYLA 5KNDD 2FJ0A 1N1MA 4AO7A 2JGAA 1A3CA 4LCJA 3DOEA 3UF0A 4B6RA 3N74A 4C89A 2GCOA 4DLRA 3C74A 4OI1A 4BFLA 4PLHA 4C6TA 3QP9A 1ENZA 1BE8A 4HGQA 1I9GA 2I78A 4P3KA 4BVLA 3CW2A 2B7LA 3QWAA 4Q4HB 4CTNA 3QPBA 4B3TB 1PS8A 2QW1A 2VZEA 3WWZA 3HXMA 2H5IA 4ZV7A 1FS6A 5ALPA 1CUSA 3CUUA 4M9QA 4RDXA 5K5EA 4GPIB 3ADCA 1ODFA 5C5IA 2D62A 3VPAA 2GN1A 1MJGA 5J63A 1TO2E 3E9YA 5CK5A 4F4IA 2JGFA 1HT3A 5CURA 2IEZA 1AN9A 2OCBA 3EGWA 3NUZA 1C9NA 5IU6A 3VC7A 1PZXA 1D7OA 1WVMA 1WETA 2OORA 3RO7A 1SXIA 2EOAA 3S8MA 2LTAA 4X7PA 5DK4A 1FP4B 2YASA 1OBVA 3O03A 2FQQA 2HDOA 2QF7A 2WSMA 4L57A 4V2IA 4GKBA 3ROXA 5JXWA 3UW1A 1U5BA 3MXTA 4PZDA 4I66A 5NULA 2Y99A 4WD3A 1TM7E 1A9ZA 1R8JA 2WIGA 3I61A 2M6RA 1LXCA 2J48A 3PE6A 2A9JA 4JLVA 2V4MA 3VDNB 2REBA 2VSXA 4HQFA 2HDNB 5DGXA 5T6BA 3E6AA 2Z5LA 3L1HA 3RTCA 2R6R1 1QZXA 3BEOA 2ASEA 3GRCA 1VMIA 1UZLA 3HACA 4WFKA 4EO7A 3DEAA 3WP1B 4CCWA 3GCDA 3LTNC 3GGOA 1ECPA 3C45A 3MWLA 4LHZA 4MGZR 2GAFA 1RE0A 1M1ZA 3AIOA 4AP9A 2NU9B 3I5MA 2P1DA 1P31A 4EPXA 5HOEA 3U44A 4QUKA 4IVPA 1Z17A 1G3UA 2WG1A 4QVIA 1RYYA 1PLKA 2CVQA 2ZIZA 3PR2B 3JQ9A 4NLLA 3G9TA 2AV6A 3FA2A 1QP8A 4GI1A 2K87A 4HDSB 4LPSA 1U2EA 1Y9DA 4IFTA 3ZE7A 2UYYA 3I2YX 3M4JA 4UZFA 5KVAA 5K0TA 2GFQA 5BVGA 1VA5A 3PRJA 1U6KA 1GVHA 1MX3A 2RAVA 3NGXA 3BA6A 2Q3LA 3DV0B 2MSKA 1OLXA 4D02A 2VBFA 2G6BA 2WFMA 3OOEA 4D3YA 3TVYA 5E6RB 2Q3HA 2NYRA 5JZ9A 3FKQA 4G01B 1PQYA 1US8A 2LRHA 3LDGA 1R6UA 2JNWA 2BFWA 3L0CA 1A5ZA 3A26A 2QN6A 3DP9A 1T5DX 2ODEA 3WKAA 1UEJA 4B82A 2YR0A 3PFFA 3CUVA 3PTZA 2H9IA 2QDXA 1VLMA 3C3AA 3HCBA 3VKVA 1ZXXA 3K6SA 3QE9Y 5JAIA 4Q0MA 3ZX4A 1KOGA 1IUNA 2LIPA 3SF8B 4UNRA 4HQ0A 4HQOA 5B53A 1G3MA 3ILYA 2GSDA 3SBOA 1JFRA 1QTNA 3OQPA 3VV2A 4M8LA 1LDNA 4ZO6A 5CDUA 2JH3A 5MN6A 2ZUVA 4WECA 1UQRA 1NTRA 2C0QA 3R74A 3U16A 5AOVA 1GLVA 4KGXA 3PQ8A 2BLNA 3AI1A 1WF6A 1T1RA 1EU1A 2HCBA 4ND8B 1E3TA 3W04A 2CLMB 2YMMA 1P73A 5KJ6A 3A2LA 3JALA 2GD6A 3EC1A 3M6WA 3C3KA 4N7MA 3Q2KA 2A3RA 5J5VA 4EKIA 2NYVA 4JEHA 3V2UA 4H60A 1LSUA 1IAVA 1KDTA 3E5MA 3QKRB 1QIDA 2PEZA 3ZEIA 3QMVA 4YJKA 1V95A 1ZLXA 4ALJA 1EXVA 5LQJA 1PT9A 5FOUA 2AS0A 1DTWA 1N2IA 4DB2A 1HNXB 4CV0A 4YUWA 5L3SA 3VVLA 4U2KA 3DKRA 5TV2A 1PE0A 1QF9A 3TKLA 2J1LA 4P33A 1JXAA 2PFSA 2UU9B 2EQAA 1PJZA 5MHTA 2PWAA 4FCWA 5EERA 3SJBA 3ESCA 3SX4A 5LU8A 1F12A 4Y98A 2X9GA 3ZWOA 2XUHA 1U04A 4BQPA 5HXAA 2DWUA 2Z9CA 2H2WA 4EUFA 3JQAD 4E70A 2CDRA 2UVPB 3DD5A 3IQDB 1QYVA 3UANA 2X40A 1Y6JA 2G8LA 2DERA 3AEQB 3ZJ4A 4K8RB 1IN5A 1XROA 2G4CA 3QITA 3PUVA 2PUFA 4KFCA 1O9BA 3I1YA 3OCJA 1HDOA 1YZUA 3GW8A 3L5KA 4JLBA 3FNHA 4EB3A 3TUZC 3SVLA 4TKVB 3TEJA 3R8CA 4MKFA 2IOHA 4EL5A 3FZEA 3D9QX 1Y8CA 4FW8A 4KH0A 2CNBA 4D98A 3B38A 4PYLA 4J91A 3GMTA 1USUA 2SCUB 2AR0A 2H1IA 3KOOA 2W6ID 3MWEB 2AJDA 1JJAA 1WD5A 2GESA 3R0JA 4JB2A 1JQBA 3DS8A 4LTDA 3RAGA 3RU2A 4EQ6B 4F46A 5HUQA 4EUHA 1UUFA 2XTJA 5BQ5A 3X0DA 1O87A 4E46A 2ZJ4A 3IKLA 1LUAA 1DKOA 1U6JA 4WPGA 3UATA 3TSOA 5JSZB 1OTXA 2IE0A 2ZYAA 2HK6A 3HH8A 4OHVA 5LBTA 1E5QA 2NUAA 3OI7A 3AR7A 4OGWA 4UM8B 3GXBA 4OH7A 4OJMX 3CHYA 4UMVA 3TBKA 2PX5A 4MVXA 2VT7A 1QX4A 2HX1A 3FUWA 2VP0A 4V1CB 2PYIA 3BWXA 5CXQA 3LWDA 1VXOA 2NV6A 3U39A 5C8YB 3PPIA 2BHSA 3B1VA 2PZLA 2C94A 4MR9B 3NUGA 1NUHA 3FOBA 4C0AC 5GZ3A 2XSZD 1IN8A 5KQSA 4PANA 3G0GA 4CI9A 1W49A 3E82A 4Y6GB 3H8WA 1SQ6A 3ENWA 1QLWA 3MJCA 4GKAA 4HDQB 4TRJA 2JIRA 3DYIA 1EH5A 4YFYA 2OWDA 5BNZA 3LZ6A 3IDFA 4DIFA 4LNHA 3RVDA 4DZZA 3WGVA 4ES6A 5K6AA 5IS2A 1VG1A 1CJTC 4A2CA 1AGXA 2VF8A 2E82A 2C4UA 3DWEX 4LHVA 5IYZF 1NX6A 2J9RA 4BFYA 2ECKA 1ML3A 2G25A 1J2RA 2ZATA 2AOXA 3PIRA 4NU8X 3FDFA 1M0SA 2I4RA 1SHUX 2EGHA 2IEBA 4NCKA 1WJGA 3WRXC 4M0MA 4V2UA 2ZT6A 4G24A 4OHZA 4B6GA 1JBKA 4P9NA 1C8BA 4KXFB 4HB2A 4WMLA 4V39A 2QZ9A 5B1DA 1RI4A 3GT3A 3I73A 1EA5A 5IXSA 1FTSA 2HZ7A 3DMYA 3IT3A 2Q7XA 2PNJA 3H6KA 1Z26A 3DM9B 1Y4UA 2PLAA 3T6KA 2Z08A 3IELA 4P92A 2D0PB 5KX5F 1JPNA 1BHO1 4GMFA 1JS1X 4DE5A 3CUWA 1ZIYA 1E2UA 2CLKB 2FMXA 2CCGA 3ACDA 3NR2A 4K6HA 3SDSA 3UBMA 3AJEA 3DULA 2WKPA 1I7DA 3BFJA 4JKOA 2RSLA 1XCBA 1ZINA 4EVSA 3GLKA 5HPYB 1KQOA 1DL5A 4IW3B 3ROMA 4FFBA 5A05A 3GZNB 1U3FA 2CD9A 2PKCA 1B0UA 5BN1A 3K2IA 1BH2A 4G8DA 3ZVLA 4CTJA 2QT9A 1NV8A 2QP3A 4HMPA 4HVTA 3PXGA 3ME5A 4BMNA 2GZMA 1BG6A 3IAUA 4KXXA 4H7KA 5KS2A 4U1RA 3SG0A 4HDKB 2VSQA 2YZ2A 4UU1A 4C22A 2QBYB 1A69A 1V1RA 5AHWA 4QYSA 1E2PA 5KOJB 3UMRA 5I48A 3L8HA 2EL7A 1KPHA 1C80A 1YR2A 2I7TA 4TYQA 4DQVA 2J46A 4TGLA 5CX1B 2YV5A 2XY4A 5IAKA 5JSFA 1JAXA 1SH7A 1FVHA 3L0IB 4NOKA 3BYZA 5EPOA 1UFVA 4J2TA 4GPEA 1BYIA 3LFUA 2P4HX 3N2GA 4IHJB 3GLHB 4EKNB 1NRJB 5EIOA 5HKOA 1M6VB 1P72A 4ZJZA 1HOXA 3KQOA 2Y0PA 4XX1A 2P1ZA 4PLPA 4QUAA 1V25A 1AZSC 3EFOB 1LDEA 1MGOA 3NBFA 4ZVQA 5LP6F 4PPQA 4C0BA 2N75A 4E4TA 1RHQA 1QG2A 1OTHA 1DUVG 1N6IA 1G59A 2HJRA 4R1NA 4KITB 5B4VA 1O95C 4HN9A 2ILTA 3LO8A 5CA1F 3K0HA 1NM5A 1NVWQ 3MBKA 4QU9A 4DUYB 2DFNA 3EHDA 1Z37A 4HEHA 3SNHA 5AJWA 3RYCB 3ZGYA 4XCVA 4JXXA 1RYNA 3IJRA 1HYEA 2XD4A 1SVNA 4QBHA 3STYA 5BQFA 2F9MA 4RA9A 4D9KA 2BL4A 2G3YA 3QVUA 4Y9RA 1PJRA 3SKXA 1PLLA 3GLGB 3TD9A 1ORHA 4NBVA 2BFCA 2WPDD 5C1IA 4DPMA 2J4CA 2E4AA 2EEPA 3SZUA 4DWOA 1H1LA 2E6UX 3NHLA 4I19A 1WHSA 1M7GA 3P9RA 3SQWA 2VKTA 3AH8A 3GFBA 4FZJA 4XB2A 2ETVA 4JP5A 1XK6A 1YS9A 1AC5A 3WYDA 1TPZA 1E60A 1JHQA 1CR0A 1ONSA 1G2PA 5LUBA 5GWXA 4DLBA 1QHEA 4HNVA 4LRTB 4BMCA 2QTTA 3BGVA 5FADA 4OLAA 1C8LA 2I3DA 3FLEA 4WX2B 2PQMA 4GSLA 1SG6A 1DVRA 1KL7A 2YXNA 1TRHA 4LZZA 3X1WA 2PRSA 3ZVNA 2GT1A 3D7LA 3JQRA 3KYDA 4KQ2A 4Y0NA 4DABA 3AVVA 1KY3A 4LXIA 2BI4A 1R0RE 3A1SA 1SULA 1ZUNB 4HAOA 1PT8A 3Q9LA 4G37A 1QGUB 2WFAA 3P8ZA 5D5QA 3KRTA 4RF2A 3TZQA 1CTQA 2Q3CA 1F9AA 5DM4A 5JC8A 5JXHA 2CUZA 3T5GA 1ZOSA 3KJGA 2WJ4A 5LZ4A 3R9XA 5ENDA 5HJEA 1TAQA 5JY6A 1W5EA 2MU1A 3NHUA 1V43A 2GOYA 2QD1A 4P86A 2PAAA 3VQTA 4DLSA 1OH7A 2O8DB 5AVQA 5KDOA 4E5YA 1O54A 5CLJA 4YS6A 4Y8VA 2X3FA 3D6MA 3O9VA 4FFRA 5ICCA 4ZT7A 1G9SA 4CEIB 4H9GA 5CHYA 1OAOC 3IQIX 1NRIA 1RMTA 3PV0A 4J16C 2H2AA 5JI3E 4LJ9A 2JLUA 5F3DA 5I4IA 2K4MA 3L8YA 1FYDA 3QK7A 4R1OA 3FR8A 3C6MA 5JHHB 5FLXA 2H5EA 4FKZA 2CK3A 2GILA 2O3SA 1XZIA 2G63A 4J7CA 4XWTA 1LQ2A 3AR6A 1SHJA 5CG2A 1F51E 1W85A 1G6HA 4Q9HA 3NHAA 1N9KA 3OU7A 3M6IA 3OZ7A 3ZCUA 3F6PA 4DMCA 2QXYA 4TV8A 2X5KO 2XYGA 1WTAA 3LV8A 2NT3A 1BE0A 4U7JA 4YCCA 1G20B 2BFDA 2IYEA 1X7WB 2XNHA 3ETJA 5DBFA 4PTYA 4RMIA 4WFQA 3IVAA 4LAFA 1RHJA 4TRRA 3IDOA 3VDRA 3UMYA 5I45A 2JATA 4HK4A 3AP2A 4PYMA 4X7BA 3N2KA 4IKPA 3SZMA 3W78A 4GXNA 4JL6A 5IT0A 3B52X 2R47A 1ZP6A 1Q83A 1E3QA 2I4IA 2YN0A 3BVPA 4P38A 1YACA 2WF9A 2ZAIA 4RPGA 2WSLA 2ACWA 3K6KA 2RHBA 1ISJA 2E4YA 3NB0A 3BCUA 3C6XA 5IVKA 3ONEA 2CT8A 4AQDA 1XG5A 2BGRA 1HE3A 3O1HB 4UC0A 3GRAA 4UZSA 3L7LA 3W5CA 2HLPA 1RLJA 2CV1A 1I4TD 1W48A 1C9EA 1A1SA 4O25A 5C52B 4DZTA 2A1IA 1U3VA 1P6UA 1Z4KA 4Z3OA 1N3BA 1Y0BA 2A86A 4TT8A 1E2EA 5BPHA 1M1YB 1OU0A 2PBRA 3CUKA 3EIHA 1G9XA 2IU4A 1TQ2A 4FZ5A 4GRAA 3W90A 4CMIA 1VI5A 3G68A 1GXSA 3FW1A 1SIBE 1N5KA 4GZ6A 4MNTA 1HTTA 1QC5B 5FWAA 4BO6A 2R6JA 4Q1DA 1F0NA 3BK7A 2CFSA 4KVZA 1G21B 4KV9A 1QBGA 3NOVA 4B2YA 4WCVA 3OD5A 2NSDA 4D96A 2D5BA 4A1OA 1OGIA 1H3EA 4X97A 3E3LA 3EMVA 421PA 3RAPR 4OGLA 4EIWA 3UW3A 5BQ3A 5DNUA 3KLNA 2QLLA 3VNRA 2B0JA 3OIVA 2HV9A 4BAUA 5IKPA 1YZKA 5LVAA 1YBFA 3TFQA 5KHLB 4F06A 2QYOA 4KNVA 4RH0A 4TYPA 4ZO8A 1H4SA 1A5AB 2HEIA 3PF8A 4PZ9A 2QIPA 4F7DA 2OYRA 3WGHA 1NN1A 1KTVA 3K3PA 5EFZA 2OFFA 3CT6A 2P67A 1TFUA 4R2XA 2QQEA 4XM1A 3V1NA 4QHSA 4B8ZA 1H5QA 2CWWA 4UZEA 5B3JA 4ZYLA 4KK4A 1D5WA 1BRTA 1E2DA 1QONA 3HRIA 4GZ3A 2BP7B 2GUGA 3FPAA 1Q50A 3A06A 2FYTA 1ZI6A 2ZBVA 3KB6A 4D6YA 4DV1B 3NT5A 3SHFA 1QP4A 1QIIA 1YK1A 5JYEA 1NN3A 1T2CA 2VHXA 3JQEA 3U48A 4TWRA 3PC7A 3ZX5A 1ZKMA 4BB6A 3AFGA 1RPZA 3TIIA 3WICA 5KWEA 2D3WA 2JLWA 1UWVA 1KVSA 5CNJA 1QIGA 2ZRQA 1XDUA 4Q7QA 2CMDA 3IPYA 4KUEA 3V4SA 3V48A 1QVAA 4FOSA 4Z3KA 1MVNA 2GETA 4PR0A 5I9TA 4LXGA 2V8OA 4TS9A 2G71A 2Z8YA 2P0EA 4Y1RA 1DAHA 4I4TF 4XYGA 1VJCA 1Q15A 5B57C 1FVOA 1U1IA 3W7VA 1LVHA 1EUCA 2JIOA 5AI6A 5HE8A 4YH1A 1KP2A 3FYDA 3ITEA 4ID3A 1HYGA 5DW3A 1R37A 4R2JA 2HWKA 1VQ1A 3KLPX 1T35A 1CZUA 3WY9A 1P2VA 3TZBA 1C0EA 4M86A 1FP6A 4R0VA 5EJIA 3KZOA 1E1DA 5EE9A 4ZRDA 3B8EA 2G4LA 2VSFA 2P3LA 1SZJG 4M1YA 2X4IA 1LPAB 1V1MA 4H08A 3EDMA 3JZIA 2V7XA 2ENWA 1I3CA 1J00A 4CKEA 5EJ7A 5LMZA 3NDBB 3T5AA 3KR2A 4JEMA 1DHTA 3L6RA 2HHAA 3CLKA 1P4GA 4F96A 3V2IA 4HB0A 1RLUA 1YL5A 4AJ9A 4ZJUA 3CZ4A 4YONB 5IXJA 2QAGC 4NRDA 3FOFC 1G8MA 3QHAA 5BSRA 3ZHVA 2F1JA 3E05A 3OM8A 5H4HA 3WMWA 1NG9A 5IM4A 3GPBA 1S9DA 2YZ7A 3HDVA 2RK4A 4JGGA 4EB6B 2Y2VA 4GHWA 1P2DA 3IMGA 3R7AA 4A8JB 2NU8A 3CVXA 3Q8MA 4JYAB 3M82A 4F72A 1XN1A 2VPQA 2Z4TA 2NUTA 2QN8A 3QVXA 1HE8B 4IZOA 4AICA 3D6UA 3CLTC 1ZG3A 2CHGA 2YWJA 4TWJA 3L01A 2JB9A 4NPCA 2Q2NA 2IKSA 3QU2A 3FYCA 3T3GA 2AFVA 4M8KA 4C4SA 2FDXA 3V9PA 4C1BA 3OIUA 1KBZA 4MRVA 2Z8ZA 4O63O 1EFCA 2X58A 1OI2A 2ZYTX 4RGQA 2XE8A 4YRSA 1XWFA 3LUBA 1QH8B 2EV9A 3QZUA 4CM4A 2NU7B 4ZVTA 4EEKA 2D13A 3MYRA 3QE0A 3JQGB 4E1VA 2NO5A 2BGMA 1JHAA 2WICA 4C2UA 4LJLA 4QPNA 2KPOA 2IBSA 4CL0A 2ZUFA 4TTSA 3AHEA 3ZHYA 1SKQA 4YRMA 2VQEB 2A0YA 3UJCA 1JU3A 1X9IA 3O90A 2JZCA 5TQ2B 3ZGVA 1NVEA 4HL6A 3MWKA 4XGNA 3UICA 2VHCA 1NXPA 4HYEA 4H1UA 3BKXA 3MTBA 3BTVA 2IVFA 3NAGA 4FX5A 4NMXB 1VLQA 4DDHA 1V96A 1NNI1 1JBQA 1WXEA 5GM2A 1G1MA 1BJKA 4DR7B 3R7WB 2VCYA 3GARA 4N40A 1XMOB 1QHGA 4TWIA 4YRPA 1TF7A 3STTA 3DR3A 1R88A 5I51A 4FBLA 4HJRA 4M1TA 3L5OA 2XF8A 5JSQA 1HE5A 2FGKA 1YR7A 4OK3A 3VNBA 5LQNA 1GG5A 2FKNA 3SK0A 3AVYA 3AUAA 4I50F 4YO7A 5F78A 1G17A 4HZUB 5JU6A 4Y2UA 3IEMA 1P4AA 3BF8A 4B6EA 4REQA 1L5MA 3B20A 4JIMA 1XNJA 1ISGA 5DBGA 4ZAGA 3OJEA 3FPEA 4IHAA 4OHRA 5FA5A 2L19A 2OLKA 2PLWA 1VHDA 3R4CA 4ETWA 2QUKA 1JSLA 1V9SA 1DAOA 3AR4A 3JQDA 2QT0A 4B09A 4YI5A 4GI3A 2R2AA 3GNQA 3BMNA 1WCIA 2GHIA 3FCOA 1XRRA 5A9TA 1R0WA 4XLZA 1GL7A 3CS3A 4DR6B 2PX3A 1LEHA 4ODIA 4BNGA 1DKQA 1Z38A 1MDFA 4N7BA 1CUDA 1E96A 3IEXA 5HF6A 2G07A 4DDUA 2B98A 3LE8A 3R5XA 4F8YA 4EMUA 5U4XA 2BPOA 1B15A 1MFPA 2VAXA 1U2RA 4I6JA 3TIGA 3EZYA 4DA6A 1UAGA 1ZO8A 3BB3A 1FNCA 1WPRA 2H6EA 4KV7A 4MXDA 1KI3A 3ST7A 3C8MA 4QATA 2IS4A 4F60A 4BFTA 1SRQA 3GFRA 1RM0A 3M5WA 2RIPA 2QM0A 3F6YA 3MAJA 2BC9A 4L9RA 1A9TA 4P4GA 4ZCQA 3CVYA 3QG5A 3FJOA 2YWDA 3EZ9A 1OIVA 3X1MA 4XVUA 2GASA 1CF9A 3JATB 4NDNE 1ZK3A 1CZKA 2CGEA 2B8NA 3H5NA 4GKVA 4J8PA 4GPAA 1IYZA 2JA1A 4ESOA 2WPNA 2AX4A 2LCFA 1P1BA 1YZYA 1UMCB 2VP4A 1G2IA 2O8FB 3ZLJA 2WJVA 4CMBA 2ZYUX 3DFUA 1U8YA 5BY2A 5BO5A