1T6NA

Crystal structure of the n-terminal domain of human uap56
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pre-mrna processing protein
molecule keywords Probable ATP-dependent RNA helicase
publication title Crystal Structure of UAP56, a DExD/H-Box Protein Involved in Pre-mRNA Splicing and mRNA Export
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t6nA00
2B8WA 2UZ3A 3BK7A 4YDSA 2YWEA 4LSGA 1RKBA 3IIJA 1U2RA 2IXEA 1Z5ZA 2XXAB 2FNAA 1G3RA 5DYGA 1U9IC 2NO1A 2WV9A 1AQYA 1X6VA 3QXSA 2YZ2A 5EUMA 2OUKA 2QL6A 2V55B 4DRZA 3CNLA 5TMPA 3CX6A 2NO9A 4W5JA 2J41A 4EPXA 1XZQA 1KI3A 1S96A 1R7RA 1D2EA 1ZNWA 2UKDA 3G82C 5C4GB 3ZS8A 1LV7A 4US1R 3EWAA 2CEAA 4PAOA 5J4KA 3SS8A 1KSGA 2FSHA 2J7PA 3KL4A 5EQTA 1LNZA 3FFBA 2FSIA 2W2XA 1G41A 3DZDA 1XB2A 2ZR9A 1R8SA 1FQJA 2DWQA 3J81k 1ESMA 3L0PA 2GRJA 3KB2A 4A92A 1G291 4R2HA 1FMJA 1Z8FA 3RS4A 5DNYB 4OK6A 1UBEA 4LC1A 1KMQA 3F0TA 2WWWA 1WP9A 1MABA 2OAQ1 4W9MC 1G20E 5KOYA 2HV8A 3NHBA 1LS1A 2W2VA 3MWLA 3VR6A 2WWXA 1ZYUA 4DDTA 3W8RA 1SXJC 1E4VA 5LB4A 1WBBA 5J4LA 4KHZA 3A37A 4MRVA 4O3MA 2ZR0A 5JBQA 1QVRA 4NL4H 3KKMA 2O8BA 2IF0A 1CKEA 3WHKA 4A2PA 1Z0IA 1ZUHA 2E1RA 2QM8A 3QNUA 3LX5A 3SBEA 3ZVRA 3K70D 1JB1A 2PX0A 3QIAA 3SZRA 1MV5A 3AF1A 2XSZA 5AK0A 1F2TA 4LBYA 2AXNA 1ZMXA 1FP7A 2KI5A 3SC3A 4IJMA 2QUZA 4QM6A 4A6PA 2V1XA 4RD4A 4XSGA 1ZC3A 1CLUA 3EA0A 1GRNA 1E2MA 3CH4B 2VIIA 2NIPA 3VNVA 2QP9X 1ELOA 3OEHD 1IXRC 2PX3A 3I3SR 2VRWA 4P32A 5L3QB 1GM5A 5F3WB 2REXB 5JS8A 1DBSA 3LFUA 3GP8A 3RSLA 1IXSB 3I72A 3VKWA 3TSZA 3M0EA 4CGZA 3QKRB 3ZVMA 121PA 1TQDA 2BJVA 1T3HA 3O8CA 1G6OA 2FOLA 2EYUA 3LBHA 1XFAA 4KFTA 4M4SA 1XPOA 2JGNA 5M04A 4B73A 4ITRC 3KZ1E 4OJQA 3CWQA 1VG8A 3F8TA 4NE2A 2ORWA 3L43A 2QQEA 1OF1A 4MYCA 3QEOA 5IF9A 4GSYA 2FPKA 2XOKA 1MRNA 4PSVA 2ZRDA 1OHHD 2WVJA 4XH9B 5JWHA 4E07A 4C7OB 2ZPTX 1W48A 5EXXA 3R7WA 3BFKA 1ODFA 4XTRA 4DXAA 2OV2A 5LD2C 1N5JA 5DGXA 5AUOB 3W6PA 5KSZA 2GXAA 1YRBA 4BPBA 1KI7A 4HLQB 2OM2A 5EE5B 4F38A 1UKZA 1VG0B 2EWWA 3LVRE 1T3LA 5A4JA 1H8HD 2WTUA 1DE0A 1WXQA 1NN3A 4GT1A 2FZLA 4TYPA 4B3DA 3GLGB 3ZIAA 1FOEB 4A0HA 1II8B 2VLIA 4JLBA 3REFA 3PEYA 5EP4A 2EFHB 2C8VA 3ADKA 1RIFA 821PA 4TN1A 4A4DA 4EJSA 5F9FA 1HURA 4I1UA 1PUIA 3UXMA 3HU3A 2ZITA 2XTMA 1V5WA 3W9YA 3ASYA 1E98A 1X1RA 2DFTA 2GCOB 5TXGA 1E2GA 1HE1C 2F9MA 3Q85A 3KJGA 1I2MA 1GTVA 2ATVA 2C96A 3GJ7A 3B13B 5EJEA 2OEPA 2RGNC 4PO9A 2ZYTX 5FPYA 4LBWA 2Q9CA 2RKOA 5DE3A 1XMJA 1OSNA 4X8LA 4S2EA 4JBYA 3ZZUA 3BB4A 1OT3A 4HYYA 2N46A 4Q4HB 4DBLC 5HKKD 4WZAE 4BFTA 5DSZA 2HJGA 4Q01A 1E2DA 1N5IA 2B21A 2LKDA 3Q9LA 5SZIA 1OPXA 4R71A 4NZYA 1Q1QA 4V0LA 3LX8A 1NG9A 3E70C 1J90A 3RWMB 1QG4A 1RZ3A 3KQHA 1OH6A 2MMCA 3PITA 4IOJA 2HF9A 2IYSA 3A8TA 1SVKA 4NCKA 2ZRGA 2H7VA 3QKRA 4YMVA 3U7EB 4F4JA 1KHTA 2W0MA 2R8RA 2F55A 4GL2A 1AS0A 5DI3B 5TARA 2DBYA 5E3HA 3TR0A 4KLZA 4UQOA 2CMKA 5CJ2A 2OAP1 4L4UA 2BMDA 4KU4A 1SGWA 1BYIA 3THWB 4FI3C 1GKYA 5J4VA 5EE1A 5AUPB 2W6ID 1OXSC 2XITA 5KNDA 3CM0A 5JJLA 1M7GA 2AWNA 2B92A 4Z8YA 2VO1A 3RRYA 5IDVA 1GL7A 1N3BA 1R8QA 1Z3IX 3M6AA 3SEAA 4KBGA 5CLQA 1R2QA 5CJPA 5TY0A 2YYZA 5AJVB 1GL9B 4Q1FA 4C7OA 4D25A 2JLQA 1I4LD 1GILA 1AS3A 1HE8B 4NU0A 1BIFA 2WWFA 2F6RA 1Q0UA 4JLAA 3IQXA 2O8DA 4M1YA 2BC9A 1W0JA 1T8UA 4CT5A 4LJYA 2NPIA 1EK0A 2IYYA 1D6JA 1Z0KA 4Q7MB 2OILA 3CR7A 4FMCF 1QVAA 2YKGA 1QHGA 3KTAA 5FBQB 1AZSC 3K9GA 4LJAA 4QBFA 4HB2A 4XWOA 3HYTA 2JA1A 1KO7A 3AVOA 3IBYA 3WYAA 5FL7A 1N6LA 4OKSA 4TSFD 3U2QA 2KE5A 1YZQA 3X1DA 1CTQA 1R0WA 5DYIA 1G3QA 1IN7A 2EU8A 1SKQA 1TTTA 2GNOA 2GCOA 3AF0A 1KTVA 4AG5A 3NVAA 4OI0A 2OLKA 3SN6A 3F5FA 2NOAA 3I62A 4D4KA 3P20A 3PIRA 4KFSA 4C2UA 3QPWA 3P27A 2ZS9A 4P0TA 1Z07A 2G0TA 3IHLA 4LRWA 1U94A 3MAAC 1KYIA 3RWOA 1Z2CA 2ZU6A 1CEEA 2PJRA 4YC7A 2VBCA 4Q9HA 4JYCA 1SVOA 2B6HA 2G6BA 4TLCA 2W6JD 4MA4A 5HE9A 3RNLA 3U44A 1KI9A 4DCSA 5TVKA 2Q21A 2P65A 5B64A 1TF2A 4AKEA 2JIZA 4B3CA 1XD8A 3LA6A 4URYR 1AM4D 4NDZA 1EWQA 2LKCA 2PCJA 4IVQA 1LY1A 4JVLA 5GJCA 8OHMA 4JT4A 2BVNA 3H86A 4Q9LA 3MJRA 4Q9IA 1NP6A 2PMDA 2UVQA 2G3YA 4UXJA 3K9HA 4UJ3A 2XAUA 4NYIR 2P5TB 4X8MA 1DG1G 3AUYA 3L0IB 1YVDA 4HLUA 1HTWA 4Q48A 4LYAA 3I1FA 4RFSB 4A1FA 2WOOA 4NHOA 3U3MA 4DLWA 4I1OA 1EFRA 3LW8A 3M1IA 1XJQA 4GNKA 2QE7A 4N1AA 3MFYA 3P4XA 2ZIAA 1QZXA 1IY0A 1ZIPA 1UADA 3O47A 4DEXA 5KSOA 1ANKA 2PLFA 3IHWA 1KAOA 2DFNA 3LXXA 2SHKA 4JT2A 4LWZA 4LZZA 4DB4A 3O8BA 3VHXA 1R4AA 3TUIC 1R5BA 2GEDA 3L82B 4ZKEA 4B3FX 2V3CC 1G1MA 1YZTA 1FFHA 5L8VA 1MH1A 2QBYB 4FIDA 4D6PA 4TYWA 5JECA 2WAXA 2ZE7A 5FOUA 2ZE8A 4MKFA 3ZD6A 3GJ6A 1S2MA 4LY6A 4A8JB 4DT1B 4XOIA 4U5XA 3WNDA 3OIYA 4BFZA 1YJ5A 2PH1A 1KNQA 3K70C 2QA5A 2CNWD 5GJBA 2Q6TA 3NC1C 2XB4A 5CM8B 4AK9A 2IS6A 2GESA 3CIOA 1XXHE 2B7CA 5CIQA 5BN4A 3FTQA 1ZM3A 1SVSA 1TNDA 3PUYA 1XJ0A 5JHHB 2JLZA 4JZKA 3T15A 2KJQA 1JR3D 1LFDB 2QRZA 4XWAA 1G6HA 2EWVA 4QGFA 3BWDD 4LUCA 5A0FA 2ZI9A 2GVZC 1G7CA 1KJWA 1XZPA 4UJ5A 1NKSA 2QPAA 2RGBA 2GVDC 4G5QA 4B43A 5K8IA 2PBRA 2VL7A 3FFAA 1E32A 4NBSA 3B7GA 3U5ZB 4V0KA 1KDTA 2QN6A 4Q7JB 4JL6A 1Z0DA 2ZUBA 3ZLJA 3U6BA 1FTSA 4ARZB 4Q00A 2BKUA 4DHEA 1CRPA 2AKYA 5JEEA 3EARA 3KFVA 4ESVA 3BFVA 4DSNA 4MUAA 4BGDA 2GTPA 2D7CA 1IN8A 2ANCA 2BMJA 5SZHB 4PPNA 2OFWA 5CYOA 1JPNA 3U3RA 1QBKC 1IN6A 1W2HA 3QXHA 1P2VA 2XZPA 2VP5A 1E9BA 3D31A 2IYLD 1OIWA 4QGGA 4D4JA 1IONA 2ZU0C 2XTZA 2NO6A 2HJVA 3GLFA 3B8HA 1XMIA 1XEXA 2VH5R 3GD7A 1WCV1 2JDID 4HUQB 2IYXA 1P9RA 2P3SA 4Z8XA 3KKNA 1KOFA 5EXSA 5DHAA 1L4UA 4HB4A 3PVSA 3CKLA 3H84A 2C9YA 4KODA 2VHUA 3NBFA 3L8ZA 4F93B 4BZQA 3DMNA 2DYKA 2PZEA 3FKSA 1ZU5A 4NCNA 1G5RA 4OK3A 3SYLA 4DDVA 1A4RA 2EFEB 5DIFA 3AVUA 3OFNA 2AKAB 3R20A 1S9HA 4A8JA 1TF7A 3DMDA 1EGAA 3DPUA 2VF8A 1GITA 2WAYA 4URWR 3QENA 2BEKA 4DUGA 5FI0B 5KUTA 3LQRA 4X8HA 3AVPA 4AG6A 5HCNA 5AUNB 1N6OA 1Z28A 4YDHB 3PENA 1ZU4A 2R6FA 3KJIA 3AP3A 1Q21A 4GZMA 4G5RA 4IFEA 4TMXA 2BMFA 4NP6A 4DSUA 1AKEA 2JLUA 1RPZA 2JLVA 5EZ6B 3TSOA 1BOFA 4D0GA 4P31A 4TZ0A 2B8TA 4WXPA 3CRQA 4WZBE 1JR6A 4Q4AA 4Q1EA 1OFTA 3QF4B 3QKUA 4MYTA 3QG5A 2VF7A 3REGA 1GFIA 3EAQA 1E2HA 2QZ4A 2DWOA 2GXSA 3U4QB 4QBIA 2WMNB 3SR0A 4OHVA 4IW3B 4ARZA 2GCNA 1IQPA 4C0JA 2ZRJA 1Z6GA 2EQBA 2VPPA 1SKYE 3GLFE 1JECA 4OK5A 1KY3A 3BC1A 1Q3HA 4I99A 3W90A 1ZUNB 2YJTD 2GZHA 3K0SA 2IS2A 4JJKA 4BLPA 4D4MA 4OHYA 1OYWA 2WBLC 1FTNA 1YZGA 4EPRA 5H1YA 1CR0A 1II0A 2VHTA 4JKIA 3CPHA 3CX7A 3QI2A 5JMTA 3SNHA 2QORA 4FWIB 3ZH9B 4BFSA 3THOA 4PZYA 3OEED 1ZUIA 4B71A 4OBEA 1YR6A 4HUQA 2A30A 3T1QA 1XCGB 4UNSA 3LBIA 3MSXA 3KFXA 4Q4JA 3B85A 1CJUC 2ECKA 2R9VA 1VCIA 3B6EA 4FMCB 2ZI3A 1E9AA 3KJHA 1UF9A 2VP6A 4WXRA 5JHGB 4P4UA 4PSAA 1NVVQ 2GXUA 1TQ4A 2ZI5A 3DM5A 1ZD9A 1G5TA 2G0NA 3CONA 1QG2A 3WP0A 2PEZA 3WHLA 2A78A 4JSTA 1DAKA 2AD1A 5DH9A 1TAGA 1W0KA 4XTCS 1DVRA 2OFXA 4M1TA 3AKDA 1W4CA 3EC2A 1GWNA 1ZD8A 3FOZA 3WMFA 1R10A 3LW7A 4HAVA 3IUYA 1ZINA 4L9SA 1G21E 2PCLA 4ZI3A 2ZSDA 4TWZA 2Q9BA 4XD7D 3FPAA 2ORVA 3UWOA 2R6AA 3ZS9A 4UNNA 2WHXA 2ZS7A 5EZ5A 1K5DA 2GK6A 1AJEA 2DB3A 2A5FA 3B78A 4G5OA 2ZRKA 4EPTA 1Q20A 1MABB 5FOSA 1D5CA 1JPJA 1Q1BA 3CPEA 1O87A 4PQFA 4Q1BA 3SOPA 1ZW6A 4A82A 3FHTA 2AX4A 4OJKA 4LV6A 1FX0B 5JEDA 2ZYUX 3PUZA 3RLFA 4OQNA 4MRSA 1W47A 3JZAA 1BMFA 3QPUA 5KTYA 2D2EA 2GBLC 2DFKB 1P61B 5KDDA 2J7KA 2O8BB 1JBKA 3B2EA 4HB0A 2ZS8A 3I5YA 1TEVA 4IXNA 3E2IA 1F2TB 1Q1ZA 3HR8A 3VX4A 3FDIA 2R62A 3NG1A 5G3ZA 1KSHA 1WDTA 1BO6A 1DO0A 1KGDA 3BRWD 1CBUA 5HCIA 4BE7B 3IEVA 2PMKA 1KI4A 2OCBA 4DLUA 1H65A 5AR1A 2BWJA 1TX4B 3SI7A 1CULC 4ESHA 1D2NA 5BN3A 1J2JA 1JQLB 1B23P 4LYJA 2ASEA 4IDHA 2L0XA 2DY1A 2HYIC 1KKLA 2RCNA 1VPLA 621PA 4URXR 4EFLA 3C15C 2NO7A 5DHFA 4FWTA 3EIQA 2D2FA 3OEHA 3CRMA 5F98A 5HTKA 1X86B 2WM9B 3CUEF 5L3VA 1JQJC 1LS6A 4AY2A 2GXQA 4M0LA 1FL9A 1NLZA 3U3JA 3PEUA 4QM7A 1E99A 2P67A 3W3ZB 4MKIA 5JRZA 2W00A 3I8XA 3EPKA 4Q66C 3AH8A 2I4IA 1HT1E 1W2GA 4BFWA 4ACBA 4TLEA 1U81A 1IJFA 3MUFA 4XIGS 4ZKDA 5GVRA 2CK3A 4QGAA 5K8TA 1GRRA 3R8CA 5C2JB 2IS4A 2X77A 5CLLA 4Q03A 2OCAA 3R7WB 4IHQA 1ZM9A 3BH7A 3CRVA 3GPLA 2F1RA 2XNDA 4EIWA 5FOVA 4AKHA 5A5GA 2QAGC 1ZM2A 4L9WA 3I5XA 2KSQA 4CEHA 1DELA 3EG5A 5FH9A 1IAQA 4TT3D 2MSDB 2QP3A 1E9EA 2EW1A 2F1JA 3OF5A 5B30A 1X8JA 5FBWB 3QOFA 2MSCB 1WA5A 1FX0A 1H8EA 3AVXA 4BLOA 4D4LA 4E03A 4QHYA 4EJSB 1G7TA 2Q0HA 3LRPA 5E7JA 3CF6R 3RRNA 5DLQC 3NKVA 4U7DA 1EX6A 5CB8A 4BLRA 4JLOA 3VR3A 3KUCA 3W5IA 3L2OB 4AWXA 1AIPA 1L7VC 2FG5A 2IYQA 4U02A 4N0DA 1XP8A 2AD5A 3A1VA 4TL6A 2FV8A 2GDJA 2ZETA 2JLYA 1VIAA 4B6FA 2IW3A 2ONJA 2WPDD 2O5VA 3TJZA 5D3MB 1RC8A 3SQXA 2JJ2A 1N0VC 2BBWA 2QSZA 1EXMA 4HI0E 4KSBA 5G53C 1P3JA 1GRQA 1E69A 1AGPA 2MMGA 3PUXA 2GJSA 4CVNA 5HKKA 1EFUA 1HV8A 2F3TA 4B2IA 2QTVB 521PA 3T34A 3PFIA 2D74A 1XJCA 3I73A 2VP4A 2QP4A 4TMTA 3VFDA 2IEZA 3TQCA 1E0KA 1ZD1A 1OE0A 4TTRA 3EASA 4M22A 2LCFA 3WP1B 3SJCA 4EDHA 2YINC 3EX7C 2WJVA 4ZI2A 1Z47A 2A5YB 3QVVA 1D2MA 3SFZA 2D7DA 4TLBA 1FMLA 1YZUA 4IOKA 1OJLA 4ABYA 2ZSEA 5EE9A 4IDQA 1PUJA 3EIEA 4ON9A 4FMDF 2JLSA 5GJVC 2OXRA 1KSFX 1YR8A 4GRAA 3OAAA 4NONA 2FEMA 4HZUA 3Q7PA 4L5BA 1BH2A 3SHFA 2R2AA 2QMUA 2ZJYA 1KJYA 1E79A 5FBVB 1LF0A 4I81A 5CITA 5EE3A 4BEJA 5KNBA 3G0HA 3KB1A 3T61A 2RGAA 2V1UA 4NTZA 3TR5A 1CJMA 2C04A 2J7PD 3T1OA 1KZGB 5GADl 5KDOA 2JLRA 1HQCA 2XJ4A 2O8DB 4HDOB 1G3IA 5DN6A 3T5GA 3WBKA 4CYMA 5AJZA 1AA9A 2CHQA 1QHSA 3AV0B 3B5JA 3LBNA 1YHNA 4LJ7A 2YVUA 4C3ZA 4Q4LA 2DPXA 2VP0A 3KTAB 4DLXA 5D3QA 4G5SA 2WWGA 2X19A 2F3RA 1N5LA 2A5DA 4QG7A 3B82A 1D9ZA 3K9NA 2PT5A 3GFOA 1N6HA 1R6BX 4TTPA 3N2IA 1CR1A 4BUJA 2ZRIA 1A2BA 4CEJB 3BORA 5FPSA 1PV4A 4P3YA 4ASUD 4C0LA 1XTSA 2OZEA 1E6CA 1COWA 1XD9A 4H9GA 3I92A 2IYTA 4NYMR 4B2PA 5D3MA 4XVUA 2WSSA 3SBDA 5DI9A 2YC4C 3U3KA 4F7WA 3GEHA 4ZV4A 2DFLA 3C8UA 3AVWA 3DEFA 1FZQA 2XSZD 2AHOA 3CBQA 1QHHA 4LPKA 5FR1A 3X1YA 3U44B 1VIYA 4GI7A 3GFTA 1DAHA 1XXHB 1YRAA 1SVLA 2OCYC 2O8CA 3T1VA 1P5ZB 4KYUA 1CJTC 1E96A 1NKTA 1M7BA 1L8QA 4RZUA 4QKQA 2A9KA 2IF2A 1ZJ6A 3TW8B 3CPJB 3IILA 2BV3A 4B48A 4YMTA 1DTSA 3QF7A 3RS7A 4ZIRA 3KQNA 1M7HA 5H70A 1VCMA 1KZ7B 3BD9A 3OE7A 4P4TA 5JLJA 3GJ8A 1NJFA 2ERXA 1ZAKA 4PX9A 1MO3A 2H92A 2HYDA 4YONB 4JL5A 2WJGA 3RS3A 4F4IA 1XPRA 2W2TA 2GBLA 3O8DA 3DOFA 2XZLA 1QHYA 2CCJA 2GCPA 1HT2E 1A5TA 2ATXA 2J0VA 4V02A 3HU1A 2FU5C 4TMKA 4D0NA 2CL0X 5IHPA 2F1HA 2FZ4A 4BECA 3K09C 1US8A 3Q7QA 4WVFA 1GL6A 1Z2AA 4G0NA 3VTKA 5P21A 2ZANA 1D8TA 3BIFA 1NN5A 5FPKA 2E9SA 3CR8A 4A36A 3DOEA 3VR5A 2O8EA 3QKSA 2WOJA 1G8GA 3G5UA 2IWHA 2V6IA 1UBGA 3GJ0A 4KVGA 4Q02A 2JJ8A 4JS0A 2ZRLA 2NGRA 4N0EA 5FTNA 2BMEA 1KIMA 2MSEB 1R0XA 2BIFA 1VHTA 1DAFA 3MWKA 3CO5A 4Q21A 5C4MA 1HYQA 1U9IA 4IKEA 4PTLA 5AJYA 4DCTA 2W83A 4LPSA 3TMKA 4QC2A 1UEIA 2ZI6A 4AURA 2FEOA 4FN5A 4CEJA 3FMOB 1HH4A 2I3BA 1P75A 4PC2A 5FBLB 4A0GA 4AC9A 4HLCA 3FVQA 1G7SA 4US0R 5FFMA 2R6GA 3UG6A 1J8MF 2A5GA 2D62A 2YOHA 1S0UA 1Q1EA 1Z0JA 4DSOA 5FOTA 1CF4A 1AKYA 2A3RA 1NY5A 4M9ZA 1E3MA 2ZSAA 3M4YA 2H57A 2BM1A 4C0BA 1XXHA 1IBRA 4MKHA 4NCHA 3HYRA 5LD2B 4P4SB 3IIKA 2ZJ5A 4QJ5A 1CR2A 4B74A 2QMOA 4LHZA 4UKDA 1U90A 4QXAA 3TAHA 4RD1A 1SULA 5FUXA 2BBSA 1E1QA 4JSYA 4C4PA 4G1UC 2QROA 2IYUA 2QRNA 2JASA 2J59A 2ZYVX 1OH8A 221PA 1MKYA 1Q22A 3OIWA 4QNRA 2ZSFA 3K0FA 4I1SA 4TQ9A 4RY2A 4RD3A 1SXJA 3UG7A 2F43A 4W5HA 2G9NA 4LDJA 1Z22A 3AGPA 3RRMA 2HLDA 4Z54A 1XMVA 1ZNXA 3A36A 3RDPA 5AJXA 6Q21A 4Q9KA 1J7KA 2G88A 1XEFA 1JXMA 1N6RA 1SHKA 1F2UA 2CVFA 1SKYB 1R0YA 1U0HC 1XMSA 1XEXB 2D3WA 3GLFB 3VKGA 2CE7A 3GMTA 4Q1DA 1W7AA 1L4YA 3L8YA 2EFCB 3DHWC 3WY9A 3EZ9A 2F7SA 1IJEA 2Z4SA 1KK3A 1T5LA 4KV9A 4MDEA 1XD2A 5JCZA 4IDPA 4OQLA 1IHUA 1I4TD 4V0NA 2XX3A 3A1WA 1FP6A 1GNPA 1GIAA 4IFBA 1W4BA 2WMOB 2PJZA 1G8YA 3QBTA 2RGEA 2WWYA 3Q3JB 1W0JD 1E9CA 2OBLA 3AGQA 2VHQA 3L0OA 4C0AC 3EPJA 3ZZ0A 1RJ9A 2FE4A 3IO3A 1WB9A 3MJHA 3NH6A 1C9KA 2J46A 1OIVA 4FW9A 4LOAA 2ZM5A 2VHJA 3TLXA 1E2LA 3ZVNA 4KFUA 2V7QA 1ESNA 3C7KA 5FL7D 1NY6A 3ZJYA 5JFGA 4C2TA 2GJ9A 3WYFA 1XRJA 3OHMA 5FI1B 4B35A 4OL0A 5ANRB 1L2TA 4ZDKA 1KDPA 3KQKA 1JEEA 2FGJA 3LNCA 4HLDA 4II7A 2BDTA 1AK2A 2FSFA 2CHGA 1AS2A 2IBMA 4G01B 4NYIQ 1OIXA 2OCPA 2PL3A 2ZVQX 3K0EA 3ONWA 5IK2A 1N2CE 2Z83A 1E9FA 4Q4AB 3FB4A 1WQ1R 1ZVQA 4URUR 1SXJE 1XTRA 2OSBA 2FH5B 3R8FA 1GDDA 4MRPA 4P4SA 5C46F 4WA7A 1QF9A 3KXLA 1UM8A 3TKLA 2J0QA 2WKQA 4CDGA 4GOJA 2FFHA 2AFHE 2IYWA 1W36B 2O0HA 5AUQA 4TMVA 4G5GA 3TAUA 4M2LA 1DO2A 3C5HA 3RS5A 4MYUA 3H1TA 4DLRA 2ZAOA 2JIZD 2ZI4A 3AF3A 4FMDB 4LV5B 4R2IA 3EPLA 4PXAA 4OI2A 2BEJA 5J4HA 3O8RA 3NHAA 3GCGA 1IN5A 3BH0A 1QRAA 5B2ZA 2RHDA 2OFOA 3HWSA 4YXWA 2GKSA 4Y0AA 1TUEA 4CIDA 1TF5A 5BW8A 1ZM4A 1S1CA 2H18A 2J3EA 1NI3A 3PUVA 1JI0A 5CB6A 5E7IA 3THXA 4DSTA 4DEYA 4PC3A 2RGNA 2EFGA 1S8FA 1S1MA 1U8AA 2F1IA 1NIPA 4ZCLA 3KXIA 1XTIA 4GMDA 4PPQA 4HB3A 1DPFA 1NRJB 1YZKA 2DR3A 4QJ4A 4Q4JB 2GF0A 2X2FA 1XWIA 3CH5A 3LV8A 3MRSA 4TYYA 3PJRA 2IUSA 4M9QA 2YHSA 4LJ9A 3TSWA 4DIEA 5C1BA 2OT3B 4LGMA 1QHXA 5FOWA 3DVLA 4GP7A 5KPJA 3PCRB 4QHTA 2X2EA 4R7ZA 1GZSA 2G1JA 3V00A 5C18A 5L3SB 1OW3B 1P9WA 4OI4A 1YKSA 3A4LA 1E2IA 4HSEA 2WWIA 1G7RA 4MUBA 1HUQA 3D8BA 1TUIA 4JVMA 4RKFA 2ZXUA 3MWYW 2OO7A 4D82A 4KCGA 1M6NA 2NQ2C 2IYRA 3AVQA 3RABA 3UATA 4WW0A 5KO2A 2O0JA 3BB3A 3OESA 2YNMA 2C2HA 1F3OA 5DISB 2NZ8A 3PG5A 2IWRA 1RYHA 3FHCB 4BWYA 1VMAA 1UDXA 3IGFA 4K81B 4OQFA 4MRNA 5FUYA 1LB1B 2FPMA 2VSXA 5LB2A 3LY5A 3W6OA 4YLGA 3BJIC 4B2LA 2QY9A 1W44A 3KKOA 4B6EA 1ZCBA 2JJ1A 2ZEJA 4LJ8A 2FPLA 4KXFB 3T12A 1JJ7A 2IC5A 2KWIA 2XGJA 1SVWA 3DO6A 1RRGA 1JJVA 2PZFA 4AYTA 1U99A 3IQWA 3KUDA 5CYPA 1OXVA 1J70A 1E2EA 2DWPA 3A4MA 4O2RA 5J5CA 1NVVR 3LDAA 3B60A 2ZUCA 4OHXA 4LYHA 1N6KA 1N6PA 4GFDA 4U00A 2I1VB 4PR0A 5HPYB 3LQQA 1NBMA 4GOXA 3GLHA 3NBXX 3HR7A 2P2LA 4CZ2A 3W6NA 2C5LA 3B1VA 3KQLA 4LJ4A 1OKKA 2OESA 2IUTA 1R5OA 1E1RA 1GOTA 5JRJA 1KO8A 2ZRMA 3DL0A 4DIDA 3K70B 3H2YA 4TTQA 4XVRA 3RS2A 4DWJA 1IXZA 3EA5A 5IT5A 1P2SA 4FCVA 4RCYA 5LDDC 5GVSA 3SU8A 3THYB 1K5GA 2DHRA 2CL7X 1VKJA 2QAJA 4EPVA 3MMPA 2ZJBA 1OLOA 1RRPA 2WKPA 2CJWB 1SVIA 1NF3A 3FKQA 4O2LA 1XCMA 4MGZR 4Q1CA 3MWJA 5FOXA 1OYYA 4MQBA 4DZZA 4EKDA 2PZGA 3ZD7A 5CIWA 3AQ4A 3QSYA 1GSIA 1U8ZA 4QFMA 4CRWB 3S1AA 4LK2A 2QG6A 4RZ2A 5GJWC 4BFXA 1VHLA 1N6NA 5HZKA 2ZJZA 5EP1A 4J0QA 1T6NA 2BKEA 3W8NA 1BKDR 1GNQA 4AI6A 3EW9A 4E22A 3AUXA 3TNFA 3AB3A 1Y3AA 5L3SA 3TGPA 2B7BA 3KQUA 4A15A 1KI1A 2O8FB 1E9DA 3CRW1 3FKSD 1UAAA 1EFHA 5TB5A 1EG7A 1KO5A 4TLAA 1Z6YA 4IXMA 3T1TA 4EJSC 2IK8A 1T4GA 4IEEA 2ODBA 2WJHA 4OI1A 3PEVA 4HAYA 1W5TA 3H0KA 3X1XA 2ZYWX 4PAMA 4NYJQ 2O0KA 3GQBA 3K0AA 1EESA 1EX7A 1FQKA 3GEEA 2H16A 3BOSA 1CU1A 3AKCA 4JLPA 5EP3A 3RSOA 4B76A 2FFBA 4DUGD 2YV5A 3CF0A 2ZVPX 1N5KA 4KO8A 3SJZA 4YMUA 4ZDIA 1NBME 1UBCA 3GLHE 4CEHB 3UMRA 4JLMA 1EWRA 3DKPA 1W1WA 2QM7A 3N2EA 4LC0A 5BYKA 2QMEA 4NMMA 2WZQA 4DDUA 4Q1AA 3KXKA 5BYJA 4F91B 5EXTA 3LAWA 3H4MA 2NTYC 4LYFA 5EP2A 5LPNA 2NPFA 3UMFA 3PUWA 3FMPB 4X8OA 2ANBA 2IXFA 1II9A 3UPUA 1EFCA 5JSZB 3KX2A 2FF7A 1W36D 4K46A 4Q9JA 2QEQA 2FSGA 1KMHB 3VNUA 4I1VA 2VQSA 4IOMA 3I32A 4HAZA 4QRHA 4KITB 3AVYA 2GILA 3THYA 4IDOA 3U3OA 4RD6A 3VU9A 4AIIA 3AM1A 4DCNA 2CJWA 1T8TA 1FNMA 1ONBA 3PV0A 2NZJA 2CHVA 4RD0A 3E5HA 4M8NE 2JLXA 4Q7KA 3JVUA 3GLIB 3EWSA 2QGNA 1E9SA 3B1ZA 4V0MA 1NN1A 2IUUA 3WNBA 3QXCA 4JL8A 4AD8A 4DC9A 1E0SA 1AZTA 1MR3F 1KJZA 3T06B 4QBGB 3IDQA 4DDWA 3EXAA 1LVGA 3SJAA 3R9WA 1C4OA 2H5EA 2HEIA 1GUAA 4JVNA 2O8FA 4PPFA 4LBVA 3T35A 3AVVA 2HF8A 1G3MA 5AWFC 1S9DA 2EYQA 3HP1A 3CZQA 1RFLA 4XVQA 1T3SA 4HZUB 2V8OA 1Z83A 1VG1A 2P0EA 3QG1A 4V0OA 3VQTA 4O25A 2ORIA 3BERA 2CXXA 3MGCA 2CLSA 2GZDA 4YMWA 4PAQA 3RC8A 3B1WA 1UBFA 4IVPA 3SDZA 1W0KD 4Z51A 2BOVA 2KB0A 3EZFA 4B34A 3UANA 3VKHA 4EUNA 1GKUB 2OLJA 4PQYA 4GOKA 4Q19A 1P9NA 1UJ2A 1OHHA 4JIMA 2OHFA 1J8YF 1JAIA 3IPXA 1HY3A 3DKVA 2NMVA 5FR2A 3E1SA 1MT0A 1UEJA 2C78A 1ZM7A 4KI0A 1YZLA 3K1JA 5JS7A 3CB4A 4WIAA 1XU4A 3A4NA 1UPTA 1TADA 2QPTA 4BRUA 1YQTA 4RZXA 3QPVA 5G40A 1H8HA 1YU9A 2OG2A 1NLFA 4PANA 3PQCA 4NCJA 2E87A 1IN4A 4OHWA 1P6XA 1XNJA 2YOGA 2HDNB 2J87A 2LWIA 3P1JA 3DZ8A 4OQMA 2IHBA 4L8GA 4H1VA 3PR1A 4ZPXA 3L0SA 1P7CA 4W5WA 5FTJA 4KJZA 4DLTA 3N70A 5JSZA 1BMFD 3CNOA 3EC1A 1KMHA 4TYQA 3ADCA 2Z0MA 5F9HA 2P6NA 4V0ME 1RRFA 1KK0A 2REBA 4HLUC 2GAAA 2H1LA 2WIBA 4LBZA 4ASUA 4B75A 4EPYA 3GJXC 2ZSBA 1P73A 2C9CA 3WYGA 1QHHB 1Z6TA 4CW7A 2J0UA 5EUQB 2XJ9A 2UZIR 1R0ZA 4JLVA 2W58A 4ZCIA 4Z1MD 3X2SA 2O8CB 3IBGA 3GLIA 3NWJA 3RYTC 2FA9A 4M53A 1VTKA 2DCUA 2VSOA 5LBIA 1X1SA 3BAFA 1DOAA 4UNPA 4RKEA 2FFQA 5HR5A 3IEUA 2VHCA 4PHGA 4ZIRB 1PLKA 1FUKA 3HPQA 2VA8A 3LVQE 3TVTA 5KU1A 1G8HA 1ZRHA 4F92B 4ZCMA 1P2TA 3NDPA 3K0CC 3BFXA 1TPZA 2WJJA 4ILEA 5KHOC 2GETA 4RCZA 4TQAA 4PPGA 4AKIA 2KBFA 2GJ8A 1V43A 1MO5A 2C98A 1G3UA 2QGZA 1NNEA 1W5SA 3EPHA 4TL8A 2N42A 1VYTA 2P5SA 1DARA 1MOZA 1MO4A 1NJGA 2ZJ2A 4WZ6A 2W6IA 2XXAA 4JLNA 1SVMA 1KAGA 1LW7A 1G4AE 1M74A 5KSYA 2ZREA 3CW2A 2YWFA 4ZDJA 1US8B 4JYBA 3ICEA 3X1ZA 3CZPA 3VX3A 2CK3D 1M8PA 2GAOA 3IPYA 4LCBA 2ZROA 1K8RA 2RGCA 4K8OA 4LV8B 2O8EB 3QKSB 4AKGA 3BS4A 1KSJA 3Q5EA 4GBMA 4B32A 3X1WA 1U0JA 2REOA 3FWYA 4JLJA 3RC3A 2XNDD 1IY1A 3D3QA 2V54A 1VCNA 3JZMA 1DS6A 3C41J 3LH5A 4WAUA 1SQ5A 3QUSA 5JJIA 1OFUX 4AYWA 3TIFA 1XTJA 4DCVA 1KNXA 2AL7A 4R9UC 3A1TA 2FGKA 1I2DA 3NBZC 421PA 4UNRA 2HCBA 1KY2A 1NMZA 2G77B 2Z43A 3ZGXA 5JWOA 2RHMA 1H8ED 2AXPA 4HDCA 1T0HB 3CWZA 4HATA 4N3NA 3LLUA 4TSFA 1D9XA 5FTLA 2AK3A 2HUPA 1OH7A 3TBKA 3QXXA 2IYZA 4PC1A 3CX8A 1TQ6A 1UKVY 4W7SA 1YZNA 4JLKA 2NO0A 3GLIE 1QHIA 3BXZA 1RW4A 2IEYA 4HDQB 2AK2A 3P26A 4TZ6A 3P32A 3K53A 2HCJB 1N25A 4KLNA 1X8KA 1KI6B 2Q3HA 1NIJA 2PT7A 3AF2A 4A2QA 1OB2A 2ZRBA 1S4QA 3V9PA 3ZQ6A 1W46A 2OE2A 2ZJOA 1NG1A 1A7JA 2HXSA 3W3AA 3SFVA 2GEUA 2JJ2D 3EZ7A 2QAGB 1KDRA 2W6JA 5UKDA 4URVR 3I8SA 4L15A 3ZYCA 2KBEA 3CRRA 2CBZA 2D06A 2VP9A 1AQUA 2RGGA 1LTQA 4PSKA 2XTNA 5L3QA 1RE0A 3K0FB 4OQXA 1SXJB 3R9IA 2F43B 4MGYR 4B3BA 3PXGA 3AKYA 1R5NA 1DEKA 2OBMA 5JI2E 1NN0A 1TQ2A 3VAAA 2GA8A 1FUUA 4A8JC 1IY2A 1N0WA 4HUTA 3W5JA 3VMFA 1B0UA 3ZDQA 1BYUA 1F2UB 3TVDA 2FFAA 2VEDA 3MLEA 3OAAD 1KKMA 2ODWA 4PO1A 1NVXQ 3AP1A 3TE6A 4US2R 4JKYA 2F9LA 4V03A 4FINA 2XOKD 4WBSA 2IYVA 1W4AA 4DJTA 2CLCX 2FX3A 3ASZA 4M1KA 4JVSB 1LF5A 3NIBA 4EQ6B 1E79D 1SHZA 4LX0A 1E2FA 1X3SA 1XD2B 4IEIA 2BHRA 4M1OA 4URZR 3EZ2A 3KJEA 4PO8A 2Q3MA 3VR1A 1E2NA 5KPDA 2G1KA 3OIUA 4A6XA 2C99A 4NYMQ 3UMSA 2ZTSA 4UXHA 1GP2A 5TV2A 4D0LB 3BBPA 4MGKR 2HT6A 2GEVA 4JMPA 5DN6D 4CEIB 2IT1A 1KK2A 4ERNA 1XTQA 1RJ9B 1OFIA 2GZAA 1VYVA 2EVWX 2PEYA 4TMZA 5FUWA 3ZIAD 5JCPA 4GDFA 1CS4C 2C77A 1TU4A 4Q18A 3WRYC 5HZHA 4KSCA 2CVHA 2YWGA 2BBOA 1EFTA 3GJ4A 1W36C 1E2JA 5BWMA 3Q72A 1A2KC 3GLGA 1FPMA 3Q8XB 1II8A 2CNWA 1E2PA 5BXQC 2QQ0A 5G3YA 3U60B 2WICA 2ERYA 4RD2A 1KI6A 4R98A 3VR2A 1DAGA 2CE2X 4B47A 4BFUA 1N0UA 2QTFA 1JR3A 2ZRAA 2H17A 3QEJA 1COWD 3K9LA 4C30A 4NKRA 3C16C 3SYKA 4HAWA 1S3GA 3CNNA 4XWKA 2WSSD 2WKRA 5FTKA 1E0AA 2QAGA 1Z6AA 3I4LA 4NCIA 4B44A 4JLDA 4C9BA 1PZNA 4M1WA 3SE0A 1OXXK 1P4SA 3FYHA 1DAMA 5CK4A 3RS0A 1Q57A 4LHWA 4FMBB 4TMWA 5E4FA 1Z29A 4Q4HA 1S3SA 2O52A 2QNRA 4XSHA 2ZRFA 1NVUQ 3NTUA 3SHWA 2JEOA 1X8LA 4TYNA 1E4YA 2CL6X 3B9QA 1J99A 1E0JA 2NG1A 3OE7D 1Z06A 1SZPA 3FE2A 5H8WA 3FGNA 1ZC4A 3A58B 4Q5IA 4IOLA 4IRUB 3TH5A 3CF2A 1VYUA 2QPOA 4MRRA 5K8UA 3QQ5A 3THXB 1JALA 5DI3A 4KYIB 4FD2A 1AGRA 1U0LA 5KNCA 2JLWA 1KO4A 2YOFA 2A5JA 3THWA 4QBHA 3MG9A 2XNSA 5G41A 1JXOA 721PA 5CDFA 1F48A 5EE0A 4EQ6A 2GK7A 1BS1A 3ICQB 2IL1A 4JBXA 2ZRPA 4E5UA 2Q9AA 2J1LA 4KVAA 2AN9A 2JDIA 1Z6XA 4BZXA 3Q5DA 2BJWA 3QXJA 4M1SA 4GP6A 3B9PA 3GLGE 3OZXA 1PLJA 3C5CA 5F2EA 3TUJC 2WWHA 5J4YA 3RANA 3UIEA 4D2IA 1KDOA 1T9HA 4CEIA 4GPTA 2G83A 5J40A 2AWOA 2V4ZA 1UKEA 2YC2C 4I4LA 1WBDA 3NDBB 1Z08A 1JR3E 4TLDA 4BLTA 2WIAA 2ONKA 4MGIR 3TK1A 4RZ3A 1JNYA 2C03A 3GJ5A 3ECCA 3IO5A 3N5CA 4AYXA 2P6UA 2Z4RA 4DCUA 2WJIA 3EIHA 1XF9A 3K0CA 1RVDA 4LHVA 2HT1A 2OXCA 3QE0A 3I61A 1UFQA 1ZNZA 4ZDWA 3V4RA 4DVGA 2J0SA 5JJKA 2BBTA 4JBWA 4HZIA 2GJKA 2GHIA 2QT1A 3PEWA 2R44A 1T5IA 3NC0C 1QHNA 1A82A 1U8YA 4B3GA 3HDTA 3T5DA 1Q44A 2RGXA 3LO5A 5KSPA 1OH5A 2WJYA 1XTKA 4D26A 1ZCAA 3GJ3A 3QJYA 2FWRA 4EPWA 2R6CA 4YQFA 1NMYA 2JATA 4G3XA 4PC6A 2RH5A 1HQYE 4PZZA 3NH9A 3K8YA 4Y0VA 4GZLA 3AEZA 4O0MA 3D7MA 4C0KA 4DLSA 2X1VA 4BEBA 1ETUA 1TMKA 1M1YE 3FMFA 3HU2A 3WRXC 5FL3A 2J5XA 1IM2A 5E7MA 4Q7LA 3GLHB 3CLVA 2ZE6A 3U7FB 1WMSA 2Q3FA 4TL7A 1E9RA 1P60A 5CDFE 1IOZA 2I1QA 4TL9A 5BQ5A 1OFHA 1E1QD 1PJRA 2GJAA 2IA5A 2JCSA 1Q3TA 1WE2A 2FDCA 4WOPA 1Z0AA 5EXPA 2A7QA 3DDCA 3JVVA 1YR9A 1ZNYA 1GKIA 3KKPA 4MKGA 1SXJD 2FJUA 4Q47A 2VSFA 1G9XA 3MD0A 4A2WA 3BH6A 2HLDD 3ZQJA 1EFRD 3KDSE 2R65A 2QE7D 3ADDA 4CF7A 4PC7A 5CK5A 1CJKC 1KK1A 3OEEA 4RFSA 3UKDA 4D81A 1GNRA 1JEDA 2PLRA 2ZRNA 3NEJA 4RSGA 3S1AB 3TUZC 1TEXA 3HJNA 3FMIA 5ELXA 4GMXA 1F6BA 3TW4A 4DKXA 3UK6A 1MRSA 1F60A 3RHFA 1XBTA 3AF4A 1E2QA 2QSYA 2XB2A 3WMEA 2GWHA 4M9XA 5BN5A 1O3YA 2FN4A 4DLVA 1E94E 2ZE5A 3BGWA 5KDLA 5L3RA 1P62B 2QBYA 3AKEA 2ZQ5A 2ZRHA 3EZ6A 3K0AB 1I4DD 2OBNA 3UWKA 4UNQA 4ZO4A 4QHSA 4DT1A 4LHXA 4M9SA 2V7QD 2ZUDA 2YWHA 2QT0A 4XD7A 4PFSA 3A1UA 4YMSA 1DAEA 4BLSA 2A2ZA 1PVOA 4BQSA 4PHHA 4MH0R 3RAPR 5B58C 3K09A 1Z0FA 1FW6A 1DAIA 4A9AA 4CT4B 2QENA 2XZOA 4H1UA 3A6PC 3VHLB 1AN0A 3SYNA 4ACAA 4P33A 2CCGA 4S35A 1N6IA 1WRBA 5IK2D 4PZLA 3SQWA 3IKJA 4QGHA 1PLLA 4QL3A 3IIMA 2IHYA 2QMHA 3NBYC 4HEJA 1P2UA 2EFDB 5H68A 4QNMA 2TMKA 1UKYA 4FCTA 4HAUA 4C0SA 3U6KA 4PQRA 1G4UR 4MDFA 1Q12A 4KFRA 4B33A 3F3YA 2QU8A 3QVUA 4LHYA 2AFIE 4RVCA 4DLZA 2XEXA 2WSMA 1G64A 1KI8A 2V6JA 4C0HA 1OXUA 1FNNA 2C9OA 1XEWY 4PHFA 1Z63A 1CR4A 4DLYA 2CLDX 2BM0A 3SJBA 4PHTA 4NYJR 3ETLA 4NPHA 1CIPA 2CDNA 3AVTA 3GFPA 3TQFA 4IDNA 3LD9A 3VU9B 5KYKA 4FXPA 5JZVA 2ZJ8A 1T0JB 1U98A 1MO6A 1KO1A 5SZJA 2ODEA 3MCAA 1A1VA 1OB5A 3ZZTA 2IS1A 3C14C 5J47A 4YXWD 3OIVA 5AJWA 5B57C 1RYFA 1VECA 3FHOA 2P6RA 2VTKA 3WNCA 2Y8EA 3BB1A 1T91A 2Z5FA 1G18A 2V9PA 1VG9B 3C4JA 4D80A 1QDEA 3AP2A 4EFNA 1VCOA 3B1XA 1XX6A 4QOSA 3R9XA 1F5NA 3KKQA 1NL3A 2HXYA 5FBRB 3QKTA 5E95A 4C0QC 1NSFA 4A0RA 2QTHA 1DADA 5JWRA 1TU3A 3OFND 1VDZA 2VP2A 4DB2A 2N1BA 4RFVA 1ZP6A 4BZPA 2JAQA 4QJ3A 4LJ6A 2RAPA 2ZI7A 4F4CA 3P4YA 5FPHA 4M21A 2J9RA 1P72A 4MITA 4OHZA 3WXMA 4BFVA 1M2OB 1KI2A 2ZJAA 1YE8A 2BCGY 2GF9A 3HPRA 3QBVA 4NH0A 1XDBA 2FMXA 1WF3A 2IX3A 4JJZA 1Y63A 3W34A 3LXRA 2VYFA 4M1MA 3ADBA 2J45A 3DM9B 1W49A 2QI9C 2H8KA 4LJ5A 1HA3A 1K6MA 2R6DA 4A0FA 4TT3A 2Z6VA 3QY0A 1CRQA 1DG3A 2JJ1D 4BFYA 1RRCA 1UDWA 1E2KA 3U7HB 5FUVA 3ZVLA 5HE8A 4EAQA 1W4RA 5DO9A 3LWNA 3VR4A 1JAHA 2ZRCA 3GEIA 2AR7A 2K5UA 3D6TB 1G8FA 1NMXA 3U61B 3QF4A 1XCPA 5K8LA 3LLMA 3ND8A 4XJXA 1OV4A 1G5PA 1GAJA 1XEWX 2W0SA 3U4QA 3B1YA 3BE4A 1NBMD 5FPTA 4OYHA 4LI0A 5FTMA 3V4FA 1NSTA 2ZR7A 1OXTA 3ND9A 4BASA 1G17A 1CJVC 3NXSA 1HEIA 1OKKD 4L16A 3RVBA 3U7GA 5IRCD 5JI3E 1E1RD 1C1YA 2ODNA 2RGDA 2WPDA 2X8AA 4FCWA 2J0UB 5SZKB 4HAXA 4BRWA 2ZAMA 4MYHA 3A1SA 4POAA 4UXIA 4E09A 1CXZA 1G16A 1G8PA 4EFMA 4B3XA 2D4HA 1ZBDA 1M34E 3NEYA 4KBFA 1XPUA 1YR7A 3RRZA 3WBJA 4RJLA 2RMKA 4IVRA 1CP2A 4Z1MA 2C95A 1GG2A 2CCKA 4KAXA 1ZIOA 1NLYA 2BCJQ 1G19A 3WMGA 2IXGA 4TQUS 1NVWQ 3TRFA 1TL7C 1GVNB 2RB4A 4BLQA 5TDHA 5CM9C
chains in the Genus database with same CATH superfamily
1YC2A 3BE5A 4ZVOA 1AQIA 2EJTA 5AJUA 2WPNA 4B3HA 1T1EA 4ROTA 1FLNA 3A2NA 1PTJC 4BLWA 2Y66A 1V1JA 1DXYA 1SJ9A 1T9KA 3UMYA 1I3NA 4KQMA 3HBNA 2FNAA 1G3RA 4OXQA 1U9IC 2NO1A 1WW2A 2WV9A 4ESOA 2BUBA 2JB9A 3ZU5A 1AQYA 5ENDA 1X6VA 1M2JA 2AS0A 3KE9A 2ETXA 5EUMA 2OUKA 2V55B 4DRZA 4Q16A 3D0KA 2REQB 1KI3A 1S96A 2WA1A 4Z7JA 5DU2A 3SSOA 3ZV6A 2DBRA 2QVBA 3MD9A 4FDLA 4OF4A 4IIJB 4RHCA 1RLUA 2P2CA 1ZICA 4NBNA 4G5YA 3JQGA 4J76A 1HE3A 2CD7A 2O3SA 4CDRA 3BMQB 5M29A 5J4KA 1KSGA 3QNWA 5BUSA 2QVCA 1XK6A 4HH0A 4RPGA 2B3DA 3TDMA 1QIDA 5EQTA 3QPDA 3IAHA 3D7SA 1HZJA 3DZDA 4HQOA 2C5FA 5JT1A 1FNCA 1CUHA 2Z30A 4K1LA 5BSUA 1QH1B 2DWQA 1UBOS 1A77A 1GG9A 2GRJA 1SUPA 3CZMA 5KTPA 1G291 1Z8FA 4FHCA 5DNYB 3Q3CA 4DBVO 3PGA1 4X92A 2IV7A 2FSSA 1QGZA 4UAUA 3NWOA 1T29A 1UWKA 2QYTA 1ZS9A 1BNCA 3A9RA 2OAQ1 5B36A 5EJ6A 4L7VA 5J3JA 1ND6A 5EUCA 5KOYA 1SXHA 3I6MA 2Y2UA 4RJ2A 2GERA 4K7JA 2FZKA 3VR6A 2WWXA 1MC1A 2C29D 4FLEA 3W8RA 1ENPA 3VV3A 2PZJA 1IWPB 1YZHA 1LCIA 5EYPB 1W6UA 4B87A 3LC0A 1K8XB 3Q9SA 4O3MA 2ZR0A 2HUNA 1B0AA 1XVIA 3E1KA 4GI2A 4GX5A 4I4TA 2O8BA 4GQIA 2IF0A 1Z17A 1LX6A 4H7JA 4A2PA 3KVOA 5C7YA 3K70D 3QNUA 3C39A 3ZJ5A 1JB1A 2ZUWA 3QIAA 1SHUX 1GGMA 4FYWA 4WADA 4YJGA 8ADHA 1CY0A 1F2TA 4LBYA 2O8VA 4I36A 4RE5A 4TVSA 1N2BA 2QLBA 3QI7A 3DB2A 4KOAA 4QOFA 4BRSA 4QM6A 2QUZA 4UAGA 1GCAA 3A6GA 2V1XA 1EM8A 4NFLA 1PS9A 4FR2A 3EXEB 4PQGA 4XSGA 2PT9A 2W22A 1LBEA 3H9EO 4D4IA 2C5BA 3HFJA 1R0LA 1W4LA 2NIPA 4G37A 4KXLA 3MINA 2A35A 4PX3A 4WACA 4AFNA 5KYUB 4M9CA 3OEHD 1IXRC 1KFBB 1T8YA 2VRWA 3NXKA 4JGBA 4Z3KA 4ZZIA 1O96B 1OAOA 2REXB 5DNVA 3N0RA 5JS8A 2K6GA 2EHDA 4NBUA 3LFUA 3GP8A 4ARIA 2X2OA 1XYGA 2CZGA 4DJFC 3GUHA 3SNKA 4FP9A 4AJJA 2DWUA 5CG2A 2BFEA 3M0EA 3V2GA 3COPA 3U7QA 1TQDA 3TW0A 3O8CA 1C3VA 2DERA 4M4SA 2XQKA 3M82A 4YCDA 1GR0A 2OORA 1JDNA 1MFPA 2JIDA 4QJIA 5M04A 4B73A 1CUJA 4YAIA 3CLRD 4OJQA 5LOVB 4DNPA 1YBMA 4FZ5A 4NE2A 5C31A 1ATIA 1H2FA 1OUMA 2AN4A 2J3LA 3D81A 4XEUA 3V4ZA 3WTBA 1OF1A 2QLJA 2HBZA 3T7AA 2BW0A 1Z7GA 4EA6A 3QEOA 4UUMA 5LIRA 2XUFA 4Q37A 4RTRA 1S2DA 1L4BA 1OHHD 1BE8A 4EECA 3QVJA 2JHPA 2RCYA 5DRYA 5HJ5A 1W48A 3MTGA 1ODFA 1EDDA 3G7NA 3JVIA 3FXAA 4JJ6A 4DXAA 4TRNA 2I2AA 2VRCD 2O2IA 2HMVA 2P7HA 3KQYA 4NOMA 4DSZA 3W6PA 2E4ZA 4A73A 1R6AA 3DXFA 2EBUA 3ANMA 1VC2A 2OY0A 1LX7A 5EE5B 4F38A 1VG0B 2NVUA 1Z4KA 3DMTC 3HB0A 3CLKA 2XXJA 4GDMA 1T3LA 2WG1A 1H8HD 1GV1A 1MX1A 1Y98A 3QSGA 4O33A 1DE0A 4WGGA 2I33A 5BQXA 2G70A 4TYPA 4B3DA 1GDTA 3HKEA 5AXBA 2XQFA 3ZIAA 4ZI7B 5H82A 2H51A 4DRXA 2ECFA 5AKYA 4PR3A 2EFHB 2KMLA 5EP4A 2GK4A 1HFEL 5SV2A 3G5TA 5F9FA 1IHDA 1KF0A 4I1UA 5HRCA 4OOEA 1ZGJA 1NUAA 2XTMA 1TYEB 1V5WA 1V8OA 3PPVA 3ASYA 5L4SA 1F12A 2GCOB 3KU1A 4QWMA 5JXGA 4C7VA 2IDJA 4QPJC 3RYCA 2FYTA 2H5JA 3B13B 3HBLA 3PWKA 4JLSA 2RGNC 4PO9A 2CVOA 4FM9A 1W1UA 1YNSA 4Y9TA 1JHPA 3KCNA 4ZVTA 3RAJA 2Q9CA 2O7RA 3VZQA 3JQ8B 5DE3A 1OSNA 1JKMA 1M5TA 5IP5A 4UM9D 4JBYA 3E23A 5A02A 3GEPA 1T34A 1UJCA 3QMVA 1CRWG 2N46A 4MV6A 3P8ZA 1JW9B 1JMVA 4E88A 3V97A 2YMPA 2DSNA 3OOSA 1O77A 4IIDA 4Q01A 2LKDA 1L4FA 4REOA 1OPXA 4RXUA 4NZYA 4V0LA 5DM1A 4OLAA 3QHQA 1J90A 1YAHA 1RZ3A 1U8TA 2QTVA 4OB6A 4MS3B 2DOKA 4KGZA 1WIWA 1Y9ZA 2MMCA 1J0DA 3BXFA 5TRTA 3SLRA 4EO7A 2CSXA 1SU7A 4M83A 3AL0C 1FRNA 1KQOA 2H7VA 5ESWA 4Z7OB 3MCZA 4F4JA 1T5DX 2VOEA 2R8RA 2FUCA 4I14A 3ICVA 3MJEA 3C2QA 3OLWA 3FRIA 4NJEA 3L4BA 1AS0A 2Q3CA 7GPBA 3CY6A 2EDAA 4HHEA 4LYYA 4QNNA 4KLZA 4UQOA 3TXXA 3EGDA 3N59A 2OAP1 3BGDA 1HM5A 2ZB4A 3F46A 2VUHB 1BYIA 3THWB 2JAOA 5J4VA 1TMYA 2L2QA 1ADJA 2YMQA 1K9SA 1OXSC 5EE1A 2Q7OE 2XCRB 5EN4A 5EWLB 5JJLA 5ELLA 1M7GA 2XEDA 2VO1A 2H06A 3I2YX 2PS1A 5KNBD 4NU5A 4G4GA 2LR0A 1SUDA 3DBLA 4A3SA 5CLQA 2EXXA 5AJVB 4W82A 3H11A 4G0ZA 4Q1FA 3FCYA 3LQYA 2JLQA 1I4LD 5CUQA 1RXEA 3A28A 1PDWA 1HE8B 4NU0A 3VOSA 3CLSD 4Y2UA 1KERA 4DABA 1XT6A 2FX5A 1T6BY 1NP7A 1P0QA 3ESQA 1SCUB 3CVJA 4GKKB 2QLTA 3UMJA 2NUAA 3B1KA 2PWPA 1A27A 1Z0KA 3PUIA 1K2VN 1RAAA 1SUFA 3NBMA 1G8KA 3LGXA 4FMCF 2P6MA 2DPMA 3KTAA 3RU2A 1DKOA 2IU0A 3ZE1B 4QBFA 5M34A 4HB2A 3HYTA 1GFZA 1KO7A 1TO2E 1V6AA 3H9QA 5CH8A 4OKSA 4YRLA 3U2QA 3X1DA 5JFOA 3HUFA 1CTQA 1FXSA 3AB8A 1ILWA 1IDN1 1G3QA 1XJ5A 3R3ZA 4R8LA 5DYIA 4ZYTA 1SO8A 2H00A 1OILA 3HSSA 2POQX 4B4DA 1RI4A 3WY9A 5C8XA 4FSXA 1A8IA 4J0HA 4AG5A 4B2YA 2H4WA 2A0WA 1EK6A 3NVAA 3DVSX 4NDAA 3V1TC 3GA7A 3URMA 1SCAA 4ETNA 3P52A 4H2DA 2FN8A 1RHKA 3CEAA 3PIRA 4KFSA 5DCYA 1J0BA 5LWQA 5EZ5A 3CLTC 4LRWA 2JFWA 2WC1A 3HJAA 5L4NA 1CY6A 3RO7A 2GX6A 4WFKA 3H6KA 2N1MA 1WF6A 1ULZA 3EXG2 1JA9A 2OO5C 1CT9A 2VBCA 3K0BA 4YC7A 5C8YA 4JYCA 4BO6A 1YQ9A 3I9MA 3L6OO 1XZAA 4X64B 1SKBA 2G6BA 3BIOA 2W6JD 1WR8A 3BHNA 1PCXA 1Z7EA 4GKAA 4O5OA 5EHGA 4DCSA 4ENTA 3N2GB 2NZVG 4YTEA 4E14A 1D0VA 4IBOA 4LXQA 3UK0A 5CXQA 3MCTA 3PQ3A 4Z0PA 3F67A 1RADA 5AKHA 1K0UA 3GRVA 4B3CA 1XD8A 1Z68A 2H11A 3A4VA 2E4YA 1OZFA 3USES 2MYPA 1QNLA 1LY1A 2BFCA 4JVLA 1VL5A 3SGLA 3TTYA 3SHQA 1M1YA 5F23A 3H86A 4Q9IA 2OCLA 1GQSA 2J09A 2W2KA 4EUFA 2B82A 1WLYA 4RK4A 1T9GS 1J23A 4DR1B 4X8MA 3K94A 3PZRA 4NZNA 2AFIB 1HTWA 1ZUWA 4JQCA 4LYAA 4F97A 3ANXA 3V3KA 4IWXA 2YUTA 2K7ZA 2BTQA 5FNVF 2IYOA 4BO4A 5BN1A 2JBAB 3LXUX 3ZU4A 2IKSA 3GDWA 4GNKA 4B40A 1ICEA 1NW4A 4Z2YA 3EGWA 3W6ZA 3MFYA 3P4XA 5KYWA 4R2JA 1ESEA 3UTDA 3AM5A 3K6SA 3KUUA 5B58T 3PRKE 2CJPA 5IAJA 4MEAA 1SD2A 2SHKA 3O8BA 3LUFA 3VHXA 1MX9A 1R4AA 1K4YA 3ITDA 2GEDA 3IXLA 3Q0TA 1XA3A 4HDMB 3AHEA 3BGOS 4M46A 2CD9A 1ZI9A 1ZHHA 4UHCA 2VSQA 3AR3A 3LL4A 1G1MA 2V3CC 3UPTA 1SKAA 3GT0A 5CFQA 4F56A 3AY0A 1E89A 1QFXA 3LGAA 4P7FA 3C3XA 3E82A 2BZGA 4HEHA 3Q3VA 1Y7IA 3FVRA 1N36B 1M0SA 1BKSB 1G6Q1 2XWJI 3D3JA 2ZE8A 3STUA 3DVQX 5C4IA 3ZD6A 2P5YA 4A8JB 4XOIA 2I87A 4LI3X 2UZ1B 2NUPA 2PH1A 3D3EA 1Q0HA 5E6RB 5THKA 3GDOA 2XB4A 1ZJYA 1J20A 3I5UA 2EERA 2A92A 2VXCA 3GLKA 1XXHE 3PGVA 5BN4A 1PGOA 2GBGA 5H9VA 3FTQA 3VR2D 1TNDA 1Q7TA 3GPBA 3IDAA 4FOSA 4RY0A 5IKXA 1JR3D 1PV2A 4XB6B 2A33A 1G6HA 2EWVA 3S1SA 1CVLA 2OLEA 4G5HA 1KJWA 1N2SA 3OCJA 2WQ7A 1Z73A 1X1EA 2PAFA 2ODAA 3RVRA 4JDPA 4I9GA 1OZ0A 3HP4A 2VLBA 1TK3A 2COEA 2MYUA 3AUTA 4OFXA 1L8XA 1Y7HA 2PBRA 3PUHA 1SUEA 3L8CA 4KWIA 3TIXB 1AF7A 1FFCA 1H6CA 1DB3A 3KTDA 3EDCA 1W19A 4Y6RA 1LV8A 1FTGA 1SBCA 1BRTA 1G21B 3M4XA 4Q7JB 4S3MA 3NT5A 4HVAA 4MWCA 4TTVA 1MHTA 2ZUBA 3AZQA 1FTSA 3C97A 2X0KA 3KR1A 4J9VA 2PMWB 5AI8A 1T2DA 5JYCA 3RJ5A 5K7SA 1GPMA 4NBVA 3DZFA 2HA7A 3WFJA 2DBQA 4EY3A 3QU2A 3K73O 4WZBA 3C6MA 4MARA 1K4KA 1IN8A 2D7CA 4H6XA 1YFJA 2FTKE 4EY7A 3ZWNA 3FIUA 5IDXA 4QREA 1CPYA 1JPNA 5K3FB 2OKCA 3RS8A 5JYEA 1P45A 2DLDA 3DKIA 1W2HA 3QXHA 2HZ7A 2VP5A 1E9BA 1MW9X 4QEZA 2IYLD 5IBRA 4P36A 2NUTA 4PGHA 1RCFA 3U56A 4ZT5A 3O3CA 1FLVA 5EKTA 3PI7A 4N7RA 4DQLA 5DNDA 2PAAA 1IONA 1SC3A 2FW0A 1DTWA 5I4BA 2XTZA 3V8MA 2HJVA 1T5OA 4ITVA 5CP8A 4YALA 3RKSA 3GD7A 2H48A 3ICPA 4BZWA 3UFXA 2IYXA 2CZQA 3UQZA 3FZEA 1GQFA 3I76A 1L4UA 2C7RA 4KNWA 4LMPA 2EJBA 2QN9A 4TZTA 4WLOA 2C9YA 2TMDA 3EA4A 3H2JA 4KRGA 4HF7A 4I6JA 3EIWA 3WXBA 1QONA 4WJLA 1L7DA 1RXYA 3HDVA 2PXAA 5I7UA 1G5RA 4OK3A 2Q2QA 2C7VA 1A4RA 3CHYA 4MV7A 5DIFA 2GPSA 4RZHA 3VPDA 5CBPA 5CFNA 3H42B 3OFNA 3R5JA 2HTFA 1TKBA 2OVFA 1DQZA 3DFFA 3R20A 3O6VA 1L5HB 1TF7A 1QV7A 3GRPA 1HZZC 1R9GA 4JD5A 3D02A 1B42A 1EGHA 3NIDB 1CIVA 1GITA 2WAYA 3ORRA 1ID1A 3FCOA 4URWR 4DA8A 5HVNA 3SM9A 3ANSA 2BEKA 1T8RA 4XDHA 3IPCA 3U9SA 3O5AA 1AURA 3LQRA 4ZGBA 3AVPA 5AUNB 5HCNA 4IDGA 5T67A 4HRVA 4UMVA 1P1JA 5KVQA 3QLUA 2P69A 3BRSA 1Q21A 4GR5A 4GZMA 3SF0A 1VSBA 1VXRA 3Q41A 1XGKA 3HYNA 1OMOA 5FX2A 1FFBA 3HJGA 1GSAA 3OQ1A 1P0MA 4FQ7A 4MNTA 4WE3A 5DM0A 5M3BA 1U7UA 4U6NA 1RPZA 2JLUA 5C0OE 1KYQA 1NI4A 4OGFA 3TSOA 1BOFA 1AKWA 1AC5A 1CY2A 1DCMA 5BVHB 3RSQA 4WZBE 1ZH0A 4Q4AA 2DH5A 2Q5FA 3QF4B 4G0OA 4MYTA 3QG5A 5GINE 1V5GA 2VF7A 4JC8A 4JUFA 3REGA 5KBYA 4HWRA 1QE3A 1LTHR 1NDHA 3U4QB 2WMNB 3NOXA 4KGVA 4RVHA 3SR0A 3UW3A 3DP7A 3GH3A 3GEMA 4ARZA 4DF3A 2JK0A 2NSHA 3GDHA 1AK9A 1ECCA 1HOXA 4O5AA 3H5WA 4WBNF 1M2EA 2ZRJA 4BY9E 5DV9A 4ISCA 3FOEC 1J24A 1R0SA 1JECA 3TDKA 1ZL2A 1FF9A 2JGFA 3TKAA 1Q3HA 2BEUA 2ZPAA 4BGVA 3NHSA 2FOXA 4IEFB 2Y0BA 3K0SA 1JSXA 1QGED 3ELBA 3RRXA 2IS2A 5ALTA 4PBSA 5IBQA 4BLPA 2EFYA 5LQAA 6REQB 1N1DA 1XMQB 1CLEA 1EPUA 3QA9A 3EZGA 3OZEA 1FTNA 3LYHA 4J8PA 1UMDB 1ZIXA 1WXIA 5K3BA 4RULA 2YHBA 3HNRA 4ZAZA 4EPRA 1YRWA 2VHTA 5DP2A 1K7YA 1QFMA 2OP1A 1JG3A 3PJFA 3QI2A 4MK4A 5JMTA 1EBUA 2IGTA 2WUVA 2XBLA 4FWIB 4MJ3A 3T3GA 1EB8A 4BMVA 1U5CA 4D9GA 1EB9A 3KDAA 1PSDA 5BNTA 1GEGA 4W7HA 4DLBA 4HUQA 2A30A 3TWOA 2PK3A 1PNQA 3MIIA 2VJMB 4UNSA 1T8WA 2QRKA 2I29A 2DKNA 6AT1A 1CJUC 2OCXA 4NG4A 2JJYA 1RM0A 2VDLB 3AU8A 1YMVA 1YVUA 3H17A 4FMCB 4ZVNA 1E9AA 1M73E 2C2ZA 4WXRA 3LLVA 5JHGB 5B4UA 1JWLA 3ZLVA 1FU4A 3PRHA 4XKJA 4Z4HA 3O83A 3M6VA 4L3OA 2VCYA 3EEBA 4HFJA 4MVJA 3UT5B 1G5TA 2G0NA 4L0DA 4BMPB 1O7JA 2M1XA 3CONA 3WP0A 3V32A 5HF6A 1SG0A 2HM7A 3HHEA 2ISSD 3G2LA 3KQWA 1V95A 4E5DA 3U62A 4TOIA 1DVRA 1Z7WA 2QD5A 3DPIA 4OP2A 2PY6A 2NT4A 1W4CA 3JQAA 4FSDA 4PYLA 4RMNA 1NPTO 1ECPA 1GWNA 1XP5A 4GSKA 1VPTA 2YX1A 3CLUD 1OWOA 2ZDGA 5CEJA 1MTZA 3M89A 4TXJA 1EUDA 3BSSA 4JNKA 4ZI3A 5KTTA 2OCGA 1KY4A 4H3HB 3FPAA 2ORVA 1M2FA 4RPKA 3EVTA 1E61A 3WLSA 4R1SA 5GONA 2XOEA 4RJIA 1RJEA 1X7DA 4ZCRA 1CQPA 4UNNA 2WHXA 2ZS7A 5CGQB 1Z16A 3D6NB 4H7EA 3AEXA 2D8AA 2H1SA 3R5KA 5CX1A 2QY6A 4UD2A 1K5DA 4ALIA 2P91A 2JLAA 4K9SA 5K0GA 2A5FA 2A58A 4CKEA 4IM7A 1ZZEA 2I22A 3K1AB 3L01A 4G5OA 4RTSA 1SUWA 5FOSA 1Y4UA 1AB6A 5HHTA 4C29A 2EKZA 2XYGA 1O87A 2IZ5A 4G97A 4IQ8A 4QTXA 3O9VA 1DI0A 3DMPA 5A9TA 3NIFB 4RTPA 1HNNA 1L7BA 1NT2A 3AC0A 3NX4A 3DLIA 4OJKA 3RKRA 4EB6B 3OEYA 3S8EA 4GYKA 3PNOA 4YRNA 4I9HA 3IE1A 2ZYUX 1RNLA 3LDHA 1OASA 3PUZA 1KY5A 2PMBA 3VPGA 2OWEA 1E92A 4UEWA 5LUBA 2B1QA 4GG1A 1XRRA 3GHYA 4MWGA 2GMWA 1NW6A 1N4AA 5KVSA 5JNRA 3HFRA 5T4HA 1D7OA 1X7WB 3U4GA 5IZCC 5TF0A 3I23A 3N0WA 4NZPA 2ZS8A 2DUNA 4ENUA 2NZWA 1UBJS 1YE5A 1MNAA 3A4TA 2XUZA 3PL1A 4OGLA 4D3SA 4EHLA 1E7SA 2OQIA 4PYNA 3DWFA 3D7RA 3ID6C 5FNVB 1E3EA 4R7GA 5PNTA 2L69A 1T4BA 2WUWE 3HR8A 3VDNB 2R62A 1M8GA 1TZMA 1BDJA 3B48A 1BO6A 4YQYA 2M32A 1REQB 2J5BA 4U9IS 1E58A 5CCEA 2PMKA 2OCBA 5IVPA 2AB0A 3PIIA 1H65A 1TX4B 4ESHA 1B23P 5IUKC 3DBHB 4RPJA 5DULA 1KYTA 2L0XA 3JQDA 2Y3IA 3AFNA 1NXVA 3BGVA 4IKPA 2RCNA 4YROA 3L7JA 2RHRA 2DEUA 4J3FA 2GLXA 5DNAA 1NI5A 3UAOA 3C15C 2NO7A 2I67A 1V3QE 1ABFA 2J3IA 1U8CB 3EXFA 4J49A 1N3IA 3OEHA 4ND7A 4RA9B 3Q3EA 2BP7A 4XAQA 5L3VA 5IU6A 1KJQA 1FIUA 4B17A 1P6UA 2D7JA 4XZ3A 3KSDO 2PR7A 1RHRA 1U02A 4MKIA 1GTZA 2W00A 2ZIZA 1I7DA 3VNRA 2XMCA 1EFKA 1G9TA 2I4IA 5BSWA 4C04A 1JIXA 1RJDA 1UMKA 4S12A 1UJBA 1ZITA 3DT9A 1U81A 4DXDA 3DDNA 2HHLA 3MUFA 4XD2A 3H5OA 3TL6A 1R4MB 5HBRA 5JG7A 1JFRA 1GRRA 1KJ9A 3R8CA 1LLCA 5C2JB 5ED4A 4Q3EA 2XIJA 3HDGA 2JAHA 1VM6A 2VUIB 3UF0A 3WYCA 1T2EA 5LMUB 4MOWA 4AF7A 1GSHA 3S2YA 4PWYA 5F2NA 2FPSA 4YUAA 1ZM9A 3BH7A 4YBZA 5EZSA 4REQA 2ORYA 4CM1A 4EIWA 1EG2A 2JFFA 1RLMA 4RUKA 2HGZA 4JFRA 4TT8A 4L9WA 3A9SA 2KSQA 1DELA 2R8YA 3NFYA 1IAQA 3F74A 1DT3A 2MSDB 2J9YB 1WXDA 1C7JA 1E9EA 2EW1A 1C1DB 1AY0A 2V0CA 3I2FA 3MXTA 5DN9A 1ENZA 1M8FA 4HDRB 2QJOA 5FBWB 5SY6A 3SIWA 5B30A 4EENA 1FX0A 3BMNB 4BLOA 2Q2NA 4IWNA 1YQGA 2VH2A 2BFAA 5U4XA 3ABZA 3GARA 3GZNB 4EJSB 4UU7A 1CUAA 2Q0HA 2CV2A 2VDQB 1MJNA 4MXDA 2NAFA 1FNSA 4E13A 5D8DA 5BSHA 4FDTA 3AHFA 4ZC1A 4DWWA 3AERA 2DUJA 4YUVA 3GIWA 5CB8A 2Q4BA 3CH7A 2IOFK 4G23A 3T3NA 3EWIA 1Y5IA 1Q7BA 1WZEA 2AEJA 3OOJA 3WQQA 1JHAA 3JD0A 3C3DA 1E60A 1AIPA 1ONSA 2FG5A 3PLNA 4E6EA 1S2NA 3ZOZA 1DX4A 1XP8A 3VISA 3ESDA 1KL7A 4KTVE 2VNKA 4TL6A 1XRPA 2FV8A 1Z4JA 2H63A 4QXQA 3ICCA 5BRNA 1XZMA 2IW3A 2O3JA 2WPDD 2QKYA 3IP9A 4NVRA 2ZR8A 5K2MA 3DOUA 1IEQA 2BBWA 4MVCA 5K4AA 1PQPA 3UCXA 4YJHB 2Z5VA 1DKLA 5E7QA 4UM7A 1E69A 5HKLA 2MMGA 5DM70 4IZIA 4AZ0B 4X97A 4D8TA 1IK6A 3T9DA 1HV8A 5BYBA 1GCIA 3TBHA 1DINA 3PDWA 2QJWA 3GQVA 5EIXA 2G08A 4PLWA 1ULSA 3P9SA 2FG6C 1PI3A 2BI7A 1XJCA 4Q3NA 4B0OA 2EKPA 1KMIY 1N9KA 2DKOA 1UFRA 2QP4A 4W6QA 1GGFA 4AN4A 2RGRA 1TA4A 4EF5A 2YBDA 1IM8A 1E0KA 1ETHA 1JMKC 1OE0A 3RS9A 4W5TA 5AXDA 2PFSA 4J0GA 4EDHA 5JS2A 2YINC 1B6RA 4JJFA 4MWZA 4YREA 2Y1CA 4ZI2A 3QVVA 1D2MA 3SFZA 4TLBA 1FMLA 4IOKA 1OJLA 2V6FA 4ABYA 1K6EA 2ZSEA 4IDQA 2XKJE 4NAVA 5EE9A 4JT8A 5EWJB 3H1EA 2YYYA 3PNSA 3WK4A 4FMDF 3IL2A 4R3NA 1PW7A 1YR8A 2MHCA 3FD8A 3L1UA 4N5IX 3EDOA 4NONA 4PS1A 1YA4A 3BILA 3QK7A 4J16A 4BU1A 3VC2A 2HIHA 5EJIA 1SCDA 3FNGA 3TN7A 1Y9AA 3S28A 3ANNA 5CLFA 4MS1A 4OHPA 1WQ3A 1E79A 5NLLA 1HRKA 4OGKA 4UTXA 5ALLA 2VNSA 3U37A 5KNBA 5KYTA 4EX6A 3KO8A 2OHVA 2AC2A 5DLPA 4EB0A 3IMGA 4JBGA 5KYXA 3ESXA 3V42A 2V1UA 4J2OA 2DB3A 2BL4A 1IUPA 5GADl 4GOOD 1WUKS 2H08A 2O23A 4DE5A 1PJAA 1SAYA 5DN6A 3T5GA 4CYMA 4ZQEA 2FMIA 3GB9A 3PHIA 2OMKA 3LWDA 1QFSA 1Y3HA 2YVUA 1KKUA 1CQWA 2HWXA 5HILA 4JI5B 2DPXA 2YWDA 3N7AA 2B2XA 3R3JA 5D3QA 4HN4B 2I4MA 2WWGA 1S02A 2JLCA 4BCDA 4WBNB 5KX5F 1W8DA 2A5DA 1M2NA 1ACJA 2QRPA 4QG7A 2NU9B 2WJ4A 3B82A 1D9ZA 3FWZA 2PT5A 5GIOE 1CDOA 3GFOA 1R6BX 4WK6A 4HXYA 1T1RA 4GI1A 5DHTA 5AD1A 1QYXA 1Z2OX 1Z6PA 3HHPA 2QUBA 4O0LA 5DZSA 4F5WA 4NQRA 4F4UA 4LE2A 1PV4A 4JXZA 1N32B 3KLBA 5DM2A 3B2QA 3C43A 4FEEA 4D97A 1JFFB 4GU5A 1E6CA 2F1KA 1XD9A 4H9GA 1MIOB 2MU1A 3B12A 3DL7A 5D3MA 4B2PA 2ZTMA 3PNPA 1RPAA 1U4SA 4JX8A 1J22A 3UAGA 9MHTA 1R3DA 1CJSA 2AEMA 2YV1A 4ER6A 2C59A 3VSEA 3CV3A 3C8UA 3OVMA 2ET6A 1GPWB 3DEFA 4H27A 2XSZD 3CB2A 3OZ7A 3CBQA 3PIDA 4WGFA 3U44B 4CNQA 1S6YA 1VIYA 4YYEA 1XZEA 4U2KA 5FF9A 1DAHA 1I2AA 1PRYA 1QGUA 3JYPA 4EO4A 1KEPA 1HORA 2O8CA 1OWNA 3ZYZA 4HQKA 3H8VA 4HEA1 4C5AA 1LEHA 3QWIA 1N92A 1M7BA 4RZUA 2IF2A 3IILA 4IMJB 5ALSA 3KKEA 1ESDA 1DTSA 1RWQA 4NE7A 1GZDA 2B2CA 3G0OA 4JSRA 4QELA 2WJ3A 3RS7A 5EIHA 4ZIRA 3KQNA 1M7HA 3N7TA 1FFEA 1VCMA 3BD9A 1Y1TA 1ECLA 3OE7A 4OTZA 4P4TA 1R15A 1X94A 5CVJA 4CU2A 2X4IA 2YZMA 5GZ1A 3GIDA 3BMCA 4UUQA 4LRQA 1XRQA 3BGSA 4JL5A 1S8NA 2WJGA 3R0QA 4UOQA 5B2FA 3AQIA 3N39C 2DXIA 2GBLA 2H3EA 3ULKA 4D5EA 1KQPA 1ZJ4A 1NC3A 2FPOA 4V02A 3HU1A 3ND5A 4KE8A 2AFHB 2CL0X 5HIKA 1KU6A 2FSPA 2Z2XA 2QJTA 3SVZA 5GZ6A 4C5BA 4RVSA 5A06A 3FUVA 4ZT6A 1QDLB 4GLOA 5K05A 5BT9A 3IAEA 2G9QA 5AVRA 3LL7A 3B5EA 2Y1GA 4ZARA 5AK3A 5A03A 2IRWA 4BMCA 1I6LA 1M10A 1JIJA 2WOJA 3B5IA 1XU7A 4OVKA 1JU4A 5CDGA 2IWHA 4R8VA 3KAJA 4MW4A 4UW9A 5H02A 4ERXA 3BTSA 5EXEA 4KVGA 4OD0A 4WERA 5C35A 1B15A 2ZRLA 4FXOA 4BKOA 1UWCA 3GNLA 5CLHA 4HNSA 4LN1A 1PTJA 1AVTA 3K5HA 1JHZA 3I01A 4NRDA 4IIUA 4JP1A 2FPWA 3FI0A 1B74A 1LPBB 1O6CA 3MWKA 3R5SA 4Q21A 4RK0A 3F96A 1U9IA 5C4MA 5AJYA 5A9RA 2XWBF 4MVJP 4DCTA 5C5DA 1M6VA 2RHWA 4AURA 2PS0A 1KJNA 1GU1A 4Z6KA 5BXYA 3EPRA 4ZTUB 4PC2A 3A9CA 1B1CA 4F5DA 3D4BA 4IZ6A 4AC9A 4US0R 5FFMA 2R6GA 2WT4A 4ANFA 3A25A 2A5GA 1E1CB 2YN2A 2ODTX 1Z0JA 2VCEA 3H2SA 3EGEA 4DSOA 5K8LA 1QH0A 1YKFA 3LI2A 1ZIDA 3EVGA 1YUNA 2ZBPA 3LKZA 4P5DA 1CS0A 3LOPA 3RRBA 4M9ZA 4CUZA 1C9JA 1EUYA 1X80A 1E3MA 2H57A 2VS1A 3QMPA 3TJMA 1OXKB 5DBIA 4NV0A 4NCHA 1IBRA 4EVSA 4EKEA 1OJ7A 3HYRA 4AMBA 2VDRB 3IIKA 3QWFA 4D42A 1GT6A 2J85A 1MLDA 3Q0IA 4UKDA 3S2UA 2J9FA 5GMOA 1SULA 2W11A 1O6BA 4BPRA 1PBTA 3OZGA 3E05A 5IWAB 4F4HA 1E1QA 3O4GA 3Q7IA 4JSYA 4X90A 4UVHA 2ILVA 2JASA 2QRNA 2J59A 2ZBRA 2Z1DA 5KNBH 3M5DA 1KOGA 1MKYA 1V3UA 4WFQA 1TPYA 2GD2A 1IJKA 1DEHA 3R7AA 3ONFA 2B1RA 4W5HA 2G9NA 5KMGA 3OWXA 5IM4A 1TCBA 3E2MA 2H9IA 1CFJA 4JAVC 5FWNA 2I65A 1XMVA 1ZNXA 3A36A 5F2KA 2IH4A 2O14A 5EHQA 3AEKA 4DY4A 1JXMA 1XEFA 1N6RA 4Q6WA 1USWA 5KNDD 3PKZA 4NZZA 3CFYA 1JXQA 2AI1A 1FSSA 1XMSA 2J9XB 3D7LA 2D3WA 3C87A 3VAYA 3JD4A 3QPAA 4ZOLF 4JMLA 3UJ6A 3QTLA 3VKGA 1W7AA 1MDFA 3VU0A 2D0OB 3NUQA 3EZ9A 3OQVA 1C29B 3REQA 5IDQA 3GELA 2EL9A 1IJEA 2Z8XA 4WY5A 4A6EA 4AN1A 4IDPA 1R4NB 1J2UA 2PKXA 1DFGA 1QFJA 2XLBA 4M1ZA 3E7PA 1GNPA 3QJ5A 5ILQA 4MSUA 1W4BA 4XWYA 2WYHA 2PJZA 4BB0A 4QQ8A 4Y67A 3QBTA 5BUZA 5JZMA 1W0JD 1QGOA 5COQA 1U8FO 2VHQA 2IPXA 2VKQA 3NOVA 3AIOA 3D43A 4C0AC 1JDJA 3EPJA 3ZZ0A 1RJ9A 4R2WA 5B7QA 4TWRA 1X42A 3MJHA 3RI3A 3M3DA 1OIVA 2VHJA 4F86A 4YRRA 3T3DA 3TLXA 3ZVNA 1BHO1 1YDWA 1OXBB 1ESNA 2FFJA 5IKEA 4WN9A 5FL7D 4TZKA 5SYAA 3KYCB 1BD3A 1PR4A 1LQ2A 3O1LA 4PYOA 3WYFA 1U3UA 3WJAA 4QOEA 5FI1B 5KOHB 5ANRB 1TYBE 1YBFA 3KZOA 3KQKA 3D4NA 3LNCA 5H83A 1MMFB 3IOMA 1QTNA 3GGCA 1DIOB 1Q6ZA 3AL2A 5DP1A 3WGTA 2QLFA 1IZYA 1V16B 4FNAA 4UE3S 2OCPA 3T4UA 2ALJA 4GX0A 3UAVA 2G28A 2I71A 3AI3A 3RBXA 1XDWA 4URUR 4YCCA 1XTRA 2R6R1 4CIVA 4MVWA 3M70A 3U61B 5KQMA 4MRPA 4WA7A 3E5NA 1W73A 3MHTA 2CFSA 3KXLA 4ZPJA 5TPWA 3UO8B 2J0QA 1V1RA 2HH9A 2WF9A 2P90A 3QYPA 3MA0A 5JNVA 4F9FA 4BBJA 1ZA1A 2FFHA 4EZIA 4FFLA 1FUYB 1KZ9A 2JAWA 3LT5A 4C06A 3SPXA 3AJRA 3T9CA 1VJCA 3NTOA 4G5GA 2C94A 1KVRA 5KHLB 4IZOA 4F72A 3CINA 3PA6A 4DC1A 4DLRA 5EIEA 4FMDB 1O6GA 2KW5A 3AF3A 4LV5B 4DNXA 5I9LA 3W9SA 3EPLA 2XBUA 1P8AA 2BY4A 4BOYA 1RI1A 2X7JA 4CMIA 4FT4A 2VG8A 1XVVA 2XUKA 2YV3A 3Q88A 3EDMA 5B2ZA 5KNCD 2OFOA 2O3TA 2VZ8A 4CIDA 5BNIA 1TUEA 5BW8A 1TF5A 4CM8A 5A5VA 1NI3A 4FC6A 1NOJA 5E7IA 3STYA 3I9FA 4QYTA 5AVWA 5KVVA 2WNSA 1XKLA 2RGNA 3AB7A 3FSGA 4JR1A 4PC3A 4WFJA 1YAJA 5DTRA 4ZD6A 3BRQA 4MRMA 3T94A 2IYNA 2QX8A 4MIOA 2HZBA 2YHIB 2QZJA 1MTOA 4PZUA 2PN1A 1OD6A 4GM1A 4HB3A 1E1YA 1NRJB 4PPQA 4Q4JB 6GPBA 3ZJ4A 4AY4A 1KETA 1EFVA 1MPTA 1ZD3A 3RVPA 2HSGA 4E1BA 1VYHA 1K8QA 2GGSA 2YHSA 4WKOA 2Y0EA 5KX5B 4GP7A 5HIMA 1RCUA 5CNIA 4G1BA 3FY4A 4H31A 4I5FA 2AFRA 2GLUA 5LP6F 4R7ZA 2X2EA 1THMA 2P1RA 3SKXA 2UZ4A 2JD1A 5F3DA 1P9WA 2O1EA 4NF2A 2YY6A 2PLWA 3A10A 3AJ8A 1AXEA 1K7SN 3QVWA 4HSEA 4MUBA 4G56A 4RKFA 4JVMA 7MDHA 1KMNA 1KZYC 4UTNA 5FTWA 4D82A 3AVQA 1QSGA 1UC8A 2CBXA 2B4TO 3UATA 1EEHA 1XF1A 3CXUA 1HNXB 2GO1A 3D0RA 2HQ1A 2C8LA 4NBLA 1J09A 3UY4A 1A88A 1U0TA 3VU1A 4AUKA 1WMFA 4QYXA 1FU8A 4CM7A 2QTTA 3FWNA 4X7MA 1CJCA 3FG9A 2IWRA 5KB3A 3W5BA 5IN5A 1I1HA 1UDXA 2YW9A 1L9XA 3QV1A 4OQFA 3O21A 1WY7A 2FPMA 4R8MA 5LB2A 5E2BA 3ROEA 1U3GA 2VK8A 2ZTVA 1BMTA 3AWDA 2OV1A 4PCVA 4RSHA 2QY9A 4YLGA 3HB4X 3SEFA 5I9IA 4B6EA 5CXXA 3E9QA 1ZCBA 2C31A 1ST2A 1DIRA 4B4VA 1FA9A 1UMBA 4D46A 1TYDE 2IC5A 3QBDA 1SVWA 5E1DA 1CVRA 3M2TA 1KJ8A