1T6NA

Crystal structure of the n-terminal domain of human uap56
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase
publication title Crystal Structure of UAP56, a DExD/H-Box Protein Involved in Pre-mRNA Splicing and mRNA Export
pubmed doi rcsb
source organism Homo sapiens
molecule tags Pre-mrna processing protein
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t6nA00
5EE0A 2RGEA 5TB5A 4B76A 3T1VA 5L3SA 1OXSC 2R6CA 1ETUA 5EXPA 4IOJA 1KZ7B 1KSHA 1OXVA 4HZUB 4M4SA 4N0EA 2B7BA 1E2QA 3PEWA 4AKHA 2WJJA 4QFMA 1KNXA 4HAZA 5KDLA 3DO6A 1E2PA 3I62A 1DE0A 1XFAA 3OIWA 4LDJA 4KFUA 4R2IA 3EWSA 3P32A 3WP0A 1R4AA 2JLRA 3AUYA 3K0FA 1RC8A 2VBCA 3GJ7A 5J5CA 5E4FA 5AJYA 5K8TA 1CRPA 3RC3A 3VHLB 4OI1A 1VIAA 2IYWA 3PXGA 3F0TA 3L8ZA 3SYNA 1Z5ZA 3B13B 4Q4JA 3U4QB 1ZM9A 2DWPA 2R8RA 2IEYA 2ZJYA 2NO9A 4HATA 2FN4A 4UNQA 1U8ZA 1ZBDA 3IIKA 2IW3A 4MKGA 3UWOA 1FX0A 4UNPA 1Q3HA 2ZI5A 2QPTA 1CJVC 3QY0A 4MITA 1G8FA 2OXRA 2Z4RA 2GTPA 4PSVA 4B3CA 3CX7A 2HDNB 1XCPA 4LYJA 4O25A 4L8GA 1L4UA 4C0LA 1WBDA 1D2MA 2ZS8A 4NH0A 4MDFA 3DPUA 4DB2A 4QHSA 2CK3D 2IYQA 2RGAA 2R6AA 2QE7A 5GADl 1HY3A 2GAOA 4OK5A 1XJ0A 2J9RA 2O8FB 1XX6A 1CJTC 5K8IA 2IYLD 2AXNA 2D2FA 3Q9LA 2CXXA 3GLHA 1TL7C 3RLFA 1ZP6A 2GZAA 3U60B 4TN1A 4Q21A 3EASA 3FFBA 3A1UA 1N5KA 1P3JA 1X6VA 4IEEA 2WPDD 5CLQA 1Z6GA 2Q0HA 1UFQA 2QT1A 5JCPA 3U44B 3X1DA 1WRBA 4KCGA 3BORA 6Q21A 3ADBA 3MLEA 4EPWA 2SHKA 3QKUA 5HZHA 4A36A 1G8HA 4Q47A 2V1XA 4Q1EA 2ZQ5A 2QGZA 4Z8YA 2EQBA 5HE9A 1L8QA 4H1VA 1BYUA 4B71A 3TGPA 5FL7A 4DCUA 1OT3A 4W5JA 3B7GA 4JBWA 1C4OA 2IUUA 2JGNA 5KDOA 4CEIB 3VNVA 2ZE5A 3LXRA 2QP4A 2J59A 2VQSA 2QORA 2DPXA 1YR6A 3TIFA 4R98A 1SVIA 2QNRA 2AR7A 1P61B 2YINC 4LRWA 3WHLA 4AKIA 2VA8A 4P4UA 1QHYA 3R20A 1IHUA 2H7VA 2QM8A 2JLSA 2ZAMA 3LH5A 4XD7D 5CIWA 2CK3A 4MYTA 1DS6A 1JXOA 2JLYA 2IEZA 2IS1A 1U0LA 1X8JA 4XTCS 3U7EB 4BFTA 2JCSA 3FHCB 4IOKA 2QAGA 4POAA 3LFUA 3T35A 2RCNA 2A30A 1PLJA 3NDBB 4JT2A 3UKDA 4BUJA 1ZUNB 4QM7A 1F6BA 4EQ6A 1GP2A 2GJAA 1LS1A 2GEUA 3AF3A 4AY2A 4V02A 4XOIA 3J81k 1G7CA 1NKSA 3VKGA 3K0CC 2VF7A 3P4XA 4O2RA 4DEXA 1QHHA 4BFSA 2QI9C 1VPLA 1W2GA 3WYAA 1RE0A 5FUWA 3BIFA 4TLAA 1IOZA 3TKLA 4DLUA 1G9XA 5FPKA 2A3RA 2JJ1D 3BFVA 1P75A 1ZNZA 2MSCB 3B78A 4MGKR 2PMKA 5KOYA 4BZXA 4QG7A 5FPYA 2B7CA 1O3YA 4DVGA 1NNEA 1UDXA 3REFA 3RRZA 3UK6A 2AFIE 4XD7A 5DI3B 1RRCA 1YU9A 2X1VA 4QM6A 3NVAA 4YMWA 1Z6TA 1W4AA 2FU5C 2GEVA 3T5GA 4EQ6B 3RS3A 2XSZD 5AJWA 2GF0A 1KSJA 4JJKA 4NYJR 4BFXA 5JI3E 3PEYA 1OB5A 1AZSC 3QG5A 5EUMA 3X1WA 1N0UA 3GCGA 2JAQA 3LBIA 3TVDA 3QXSA 4QKQA 1UDWA 3HR7A 3AF0A 4M9XA 1DAFA 2ZRBA 3Q3JB 1E0AA 1AA9A 2ZVPX 4FMCF 5FL3A 1YZGA 4PQYA 3L0OA 1WE2A 3AKDA 5JHHB 2VF8A 4EPRA 1RVDA 2RMKA 4LHYA 1IN7A 4Z51A 2NPIA 3L2OB 3W8NA 3D6TB 3THWA 4M1KA 4WW0A 1Z08A 5EJEA 2ZRJA 2ZRPA 2DFNA 1XRJA 2GDJA 2GAAA 2B92A 2VSFA 2XB4A 4LYAA 2XTZA 2JJ1A 2ZAOA 3L0IB 2O0KA 3DM9B 2DFKB 4HYYA 1CRQA 2Z4SA 3ZZUA 3R9XA 2OG2A 1NJFA 3CW2A 3SE0A 5CDFE 4ITRC 2D62A 2VP2A 1ZD9A 2FFHA 4MGIR 1TF2A 3FHOA 4LJ9A 2N42A 1S8FA 2KWIA 5GVRA 3C5HA 2V6JA 3W3AA 2R62A 2ZRAA 3CH4B 1J8YF 4B73A 1QG4A 1QDEA 3AH8A 4M8NE 1E9EA 1I2DA 4ZDWA 1JEEA 3D3QA 2ZR0A 4CIDA 5A5GA 1K6MA 2AD1A 4IRUB 3VX3A 1P2TA 2AK2A 4LWZA 3SYKA 1E69A 3C4JA 4QRHA 1FNMA 1DPFA 5GJCA 1GITA 2WKPA 3KQKA 2G3YA 2IHYA 4F92B 1GFIA 3FMPB 1Q1QA 3C16C 4KYUA 3HYRA 4HLQB 621PA 3CX6A 2L0XA 2C8VA 1I4DD 2WVJA 2OAP1 4Q1BA 5IRCD 1ZVQA 2LWIA 2DHRA 1DG3A 5G40A 4MRPA 1CJKC 3AVQA 1E2DA 2YHSA 3TUZC 2ZI9A 4A9AA 1G3MA 2VP6A 1NVXQ 5CYOA 3D7MA 5HCNA 4P31A 3KQHA 1NL3A 3FKQA 4II7A 4O0MA 1KKMA 1Z0KA 3DOFA 4EJSB 4YQFA 3GJ5A 4U00A 3TH5A 3VFDA 4PAQA 5L3QB 1YZTA 4PC7A 1NBMD 4BEBA 5KO2A 1S3GA 4OHYA 1D8TA 1SULA 2XB2A 2O8EA 1RJ9B 2GCOA 4GMXA 4M1WA 2NIPA 4PPNA 1UJ2A 2GILA 3AV0B 1QHIA 4XWAA 4JLKA 1XXHA 5SZIA 3R7WA 4JLVA 3CPEA 3OF5A 2RHMA 2YWHA 2BCJQ 4DLZA 2QMHA 2QUZA 4NDZA 3E1SA 3W34A 1LF0A 2IUSA 1KJWA 1Z6YA 2EVWX 3LXXA 4XVQA 3IO5A 2FEMA 5E3HA 5F98A 2CHGA 2F43A 3ZZTA 4U02A 2XJ4A 3VU9A 2PX3A 3CPHA 1AJEA 1UBFA 2F1IA 2FGJA 4AWXA 5LD2C 2MMCA 1COWD 3CIOA 5GJVC 5F3WB 2QT0A 2W2VA 4OQXA 2RKOA 4OQMA 4A2QA 1YR7A 4Q4AB 5TMPA 2ZUBA 2GCOB 2JASA 3AVXA 4D4JA 5LPNA 1XXHB 2VSXA 3ZYCA 3K70D 2ZRNA 2H5EA 1BS1A 4JSTA 3HPRA 4Q9IA 4QJ3A 4HAWA 4TLDA 4A0RA 1NBMA 2QTVB 3FKSD 1E1QD 4UXJA 3SU8A 2QQEA 2IS2A 3MGCA 1J7KA 2WJYA 4D0LB 4X8LA 4MQBA 2C2HA 2F43B 3BS4A 2JLXA 1JNYA 2A5GA 2GHIA 4PZZA 3HWSA 2DWQA 2QPOA 4S35A 1FQJA 3VU9B 4JLAA 1FTSA 3D8BA 4DEYA 3ZD7A 5BN5A 2IYYA 1PUIA 5LB4A 1YRBA 2NG1A 1KK2A 1G7TA 5FBWB 3A36A 1N0VC 1J2JA 2R2AA 3SJCA 1XPUA 2EFEB 4KITB 3SHWA 1ZUIA 1OH7A 1Y63A 4OQFA 3EZ7A 3A37A 2CCJA 2J87A 1DBSA 1J90A 3PUVA 1COWA 2GNOA 2IT1A 4RCYA 2J1LA 1KIMA 2A78A 4O2LA 4YXWD 1CLUA 3DDCA 4Q48A 2H92A 1RW4A 2PX0A 3OHMA 5DE3A 2G83A 3LNCA 2VH5R 1XZQA 4ZDIA 5KU1A 1GILA 2IF0A 5IK2D 4NP6A 3AVVA 2XJ9A 4ASUA 3WRXC 3FTQA 4NKRA 1XMJA 5FR1A 3THXB 2AL7A 4A82A 4B2IA 2EFCB 4M1SA 1M8PA 4DSOA 2VP5A 3K53A 4JMPA 1VYUA 2B21A 1E1QA 2WKQA 3FKSA 3A1TA 4CZ2A 1KO4A 4L4UA 1E1RD 2IX3A 2PT5A 5FBVB 3RS5A 1G5TA 1KI3A 2QAGC 4C4PA 4EFMA 2HF9A 121PA 3PENA 1Z2CA 2W58A 5TY0A 5B64A 3BC1A 2VP9A 1SVSA 4DSNA 1ZM4A 2OUKA 1E94E 3X1ZA 4GRAA 1W5SA 1E0JA 3EW9A 2WV9A 3FMFA 2PL3A 3RS0A 4M1TA 3EPKA 2ZYTX 4DB4A 2VTKA 4TSFD 5EP1A 4A0HA 4DSTA 3EZ2A 3BJIC 1OJLA 3DKVA 2X19A 2XZPA 4M9QA 1YZLA 4Y0VA 2HXSA 3CONA 1GOTA 4HZIA 4EPVA 1E2IA 1LFDB 2CJWA 2Q6TA 3BXZA 4FMDF 3AKEA 4YXWA 1EG7A 2QEQA 5DIFA 4TL9A 3A1VA 3W6NA 2QY9A 2D74A 3LD9A 3ZJYA 2J0UA 4G5GA 3BOSA 5IK2A 3IQXA 4MDEA 3N70A 1TEXA 3QVVA 1VCOA 2ODBA 3QXXA 3ONWA 3CZPA 2BBSA 1N2CE 3RC8A 1QZXA 2VYFA 1Z28A 5C4MA 4B3DA 4F93B 4PPGA 3ZVLA 2BMJA 4D4LA 2BM1A 1E1RA 1DEKA 3KUCA 1KI6B 1UEJA 1XD8A 2ORIA 2FDCA 1T6NA 4IVRA 4TYWA 1UF9A 2RH5A 3AF4A 3CZQA 1ZIOA 3EZ6A 3AVPA 3M6AA 2PBRA 2OCAA 3E2IA 3AVWA 2ZVQX 3GFPA 4DCNA 1HUQA 1RRPA 1TPZA 4LC1A 3SS8A 4HAUA 2YOFA 2WSSA 3PVSA 4PAOA 2QAJA 2J0UB 4DDUA 4TSFA 2FA9A 3EIHA 1XMVA 4RZ3A 4QGFA 4D0GA 3D31A 1P60A 4DC9A 3ZVMA 4TYYA 4QL3A 3P27A 3OIYA 4PO8A 3UG7A 2OLJA 2FOLA 2QZ4A 2YZ2A 3A4MA 5EP3A 3ND8A 5L8VA 3R8FA 4DSUA 1JQLB 3PG5A 2XAUA 3TUJC 4JLOA 2FX3A 4MKIA 2GWHA 1A1VA 2F3RA 1P7CA 1P2UA 3U5ZB 3OFND 3RSLA 4DUGA 1NY6A 3NBZC 3MWLA 3I8SA 1XEXA 1A5TA 1T3SA 2WBLC 1LNZA 1ZRHA 2FF7A 2RGBA 4HAXA 4KBFA 4C0HA 2ZYWX 1XEWX 2VHJA 4JYCA 4JLBA 1WBBA 2VL7A 2CCGA 2FSFA 2Y8EA 2C96A 3KDSE 4I1SA 4LJ4A 2PEZA 4NONA 5EXTA 5CITA 3ZLJA 2AKYA 2RGCA 1XB2A 3LQQA 4D0NA 3RHFA 3SFZA 2ZPTX 3VR4A 1JPJA 1NF3A 1IN6A 1P9WA 2GBLA 2MMGA 3CF6R 3ZIAA 1GG2A 3ZQ6A 4BZPA 1BIFA 4ARZA 1L7VC 3UG6A 2ZRIA 3TMKA 4CGZA 3A1WA 5E7JA 4L9WA 5DN6D 2BMFA 1CIPA 2AWOA 1GWNA 1Z0JA 5KNCA 4URWR 2ORWA 3BB1A 4NCHA 4W5WA 2RHDA 3UPUA 1JALA 1V5WA 2P0EA 3HPQA 1XEXB 3SI7A 4HUQA 3ZS8A 1G4UR 3UWKA 1P62B 4WXPA 1EK0A 4C0QC 3NEJA 4AG6A 1AKEA 3SR0A 2OE2A 3K9GA 3RS2A 2YOHA 3N5CA 1JR3D 3OFNA 5F2EA 1EFCA 2IYZA 5CB8A 4R7ZA 2Q9AA 3U7GA 1OFTA 1TTTA 1NVWQ 1TUEA 1WQ1R 4K8OA 2IL1A 4OKSA 1D2EA 1IN4A 1J8MF 1KGDA 4R2HA 1BYIA 1JB1A 2VRWA 3K0EA 3UATA 4NZYA 1TX4B 4ABYA 2EFGA 4KU4A 2OT3B 3AP2A 3NTUA 4IEIA 2O0HA 3U3MA 2JLUA 5E7IA 2IF2A 3G0HA 5BXQC 2R44A 3TAUA 4QGGA 4QJ5A 2ZI4A 3OZXA 3GLIE 4Q9LA 3WBKA 3LW7A 2BMEA 2GZDA 2UKDA 3BH0A 3B1ZA 4GSYA 4OHXA 1NLFA 4QHYA 4ZCIA 4EUNA 1DAEA 2J7PD 4KV9A 3LO5A 3K0SA 1FZQA 1J99A 1N0WA 1KHTA 4P4SB 4URZR 1OE0A 4KSCA 4G5OA 2ZE8A 2GA8A 1TF5A 1UBEA 1QG2A 2IK8A 1R0YA 2ZU6A 3CNNA 2OCPA 4IW3B 5FOSA 1G8PA 2CL0X 2V6IA 5H68A 1OPXA 2ZSAA 4BLQA 4JVLA 4RD0A 3V00A 2BVNA 1KAGA 3OESA 4PFSA 4C0JA 4DDWA 4A92A 2RB4A 1JR3A 4RD6A 3T1TA 4XVRA 4ACAA 4IDQA 4MH0R 4RJLA 4DCSA 3U3KA 1XD2A 1ZINA 2V8OA 4KODA 1CTQA 3K9LA 3AGPA 4HB2A 5ANRB 4ESHA 2H57A 2E1RA 3FFAA 2PLRA 1A7JA 2R6DA 4FCTA 1GUAA 2H1LA 3KKNA 5FOTA 1DO2A 1QVAA 1QHXA 2JJ2D 1FUUA 3WXMA 3DOEA 1OLOA 3RANA 3CPJB 4Q02A 4BRUA 4LOAA 4C3ZA 4EIWA 3ZVNA 4JKIA 4GNKA 4RFSA 5KSYA 5JJKA 1IJFA 2BCGY 2QTFA 1FOEB 3V4RA 3GLFE 3IHWA 4E5UA 2BBWA 4BEJA 1WXQA 2G9NA 1NVVQ 2B8TA 1W4BA 2J7PA 3GEIA 2XNSA 2BBOA 2NTYC 1PZNA 1Z29A 3B1WA 1DTSA 5HE8A 1NRJB 3TK1A 1HH4A 2EFDB 3ZQJA 5J4YA 1CEEA 2HLDD 1GL9B 1OHHA 3GLGB 1XTJA 3DZDA 2LCFA 2PMDA 1W36D 1T4GA 1OH5A 4OK6A 3UXMA 1YRAA 4LHVA 1NVUQ 2RGNC 3CRVA 1TQ2A 2TMKA 4TTQA 2IUTA 3CBQA 2DCUA 1T5LA 4IDHA 4Q7KA 5SZHB 3KB1A 5L3VA 3S1AA 1XPOA 4JLJA 2OXCA 2IA5A 2ZS9A 4MGYR 2JDID 3VR2A 1CU1A 5KTYA 2F1RA 4DIEA 2DB3A 1T9HA 4Q7MB 3LRPA 3RDPA 1EFTA 3L43A 2V4ZA 3HJNA 1N6HA 1SXJD 4GZLA 5L3SB 2HUPA 2ZTSA 3O8RA 2ZXUA 4DT1A 2CCKA 3QEOA 1MO6A 2P5TB 2PJZA 1ZM7A 3VKWA 2O8CA 1N6RA 4IJMA 1C9KA 2IC5A 5GJWC 3RYTC 4F91B 3EZFA 3PR1A 4WZ6A 2D2EA 3HP1A 2IWHA 1W44A 4FMDB 5CDFA 2H8KA 1L2TA 3CO5A 3LBHA 4M21A 1R2QA 1YVDA 3K0FB 1U2RA 3DMDA 1EESA 4NHOA 2ZR7A 3LV8A 5EZ5A 1E2GA 3T1QA 2R65A 3WNBA 4K46A 4EKDA 2WHXA 2J45A 1R5NA 3S1AB 1UEIA 5HCIA 2VHCA 2CBZA 5FOVA 5B2ZA 5LD2B 3CH5A 4Q4JB 2R9VA 4ZV4A 1Z0AA 3L0SA 4TMVA 4MA4A 3BAFA 4BFYA 1WA5A 2WWFA 1KI4A 4V0NA 3SEAA 2QM7A 3KKOA 1FX0B 1DAGA 1Q21A 4JBXA 2Z6VA 1JEDA 1JR6A 5G41A 4AYTA 1CXZA 2WWXA 3TRFA 2WJVA 4PPQA 5KUTA 4GPTA 2JDIA 2O0JA 3B1YA 4OJQA 2JLZA 2HT1A 5LB2A 3QQ5A 1OXXK 1UKEA 3B8HA 3UMRA 2UVQA 3FYHA 5EE5B 1ZU5A 1N3BA 2BWJA 1NVVR 1CJMA 3P20A 2Z43A 4I1UA 1CR0A 2O52A 5FUXA 3BFKA 1ZNXA 1DAMA 4B75A 4BGDA 1IXZA 4QC2A 2WSMA 3E70C 3GLHB 2ERXA 2ZSDA 3C7KA 1ESNA 2CHVA 1D9XA 1N25A 2QGNA 2W6JD 2GXQA 4XWKA 4FI3C 4HEJA 2VHQA 4URXR 2REOA 3NHAA 2ODWA 3LX5A 5JWOA 2CL7X 3MWJA 1JBKA 3EA0A 2V7QD 2YOGA 3ECCA 4A6XA 4MGZR 2VEDA 3FVQA 1V43A 1JR3E 2WPDA 1Z06A 5HPYB 2DYKA 4HDCA 3N2EA 1LW7A 4NYIQ 3WY9A 3BB3A 1E6CA 2QP3A 5EE9A 3ICQB 1IN5A 3SZRA 5JFGA 1R8QA 4GOKA 3NWJA 5M04A 1U8YA 2OSBA 3LVQE 1Z22A 1U9IA 1DAHA 4JS0A 5FI1B 1QHGA 3PUYA 4B3BA 3AF1A 721PA 4A6PA 4GZMA 2D7DA 1JECA 1N6KA 4GP6A 1OXUA 2G88A 4KFSA 4U7DA 1T0JB 3SJAA 1HV8A 3CRMA 4JLNA 2IXEA 1M34E 1HURA 1XTRA 2FWRA 2GBLC 1H8ED 4JL5A 2XTMA 2QAGB 4JVMA 1I2MA 5AWFC 2PZFA 4XIGS 1F48A 2KJQA 3CRQA 5G3ZA 1OXTA 4E03A 1X1SA 2CVFA 2W6JA 1MOZA 1MO5A 2EWVA 4BFZA 4OHVA 2B8WA 1RKBA 1F3OA 4OK3A 2XTNA 1KMHA 4HLCA 1Z07A 1R0ZA 1QHHB 1R7RA 5JJIA 2V7QA 4KLNA 1TADA 3U6KA 2C98A 3ZVRA 2BMDA 4D80A 4DCTA 5KSZA 2J0SA 4B3FX 2PEYA 3H84A 2WWIA 4OI2A 3I8XA 5FOXA 3HR8A 2ANBA 3MMPA 1NN1A 1FP7A 2VIIA 2WIAA 1BH2A 3DZ8A 2PCLA 3QVUA 3A4LA 5D3QA 2CDNA 3QUSA 4LV8B 2CLDX 3PV0A 5EQTA 1ZD1A 2WAXA 3ETLA 1YR8A 2BEKA 4JKYA 4GT1A 4TL6A 5JEEA 2PZEA 3Q7PA 1KO7A 2WKRA 1EX6A 4U5XA 4JL8A 2LKCA 1KJZA 1E9BA 2WWWA 2XNDD 3NH6A 1TQ4A 3PIRA 3ZZ0A 4DLWA 4RSGA 3IBGA 3I5XA 1XZPA 2Q3HA 4JT4A 4ZKDA 1IY2A 1H8EA 4CDGA 2GF9A 1KMHB 1E9CA 2H17A 3VNUA 1N6NA 2WIBA 4MKFA 5EP4A 1IXRC 1VCNA 3EAQA 5IDVA 3T12A 4AG5A 2YVUA 2X2EA 1E3MA 2C03A 2ZSEA 4Q4HA 3L82B 2I3BA 4BFUA 2XSZA 5E95A 5FR2A 4NYIR 5JLJA 1G16A 3QF4A 3K9HA 1Q0UA 3M1IA 1N6IA 3PFIA 4RCZA 2GJKA 1JQJC 1R8SA 1LVGA 4R9UC 2MSDB 3F3YA 5AJZA 3RWMB 3THWB 5JHGB 2IYXA 1SQ5A 2QG6A 4TMTA 1Q1BA 3WHKA 1NSFA 5ELXA 4WAUA 4YMVA 4WVFA 1OFUX 5KSPA 1QHNA 4QBFA 3TBKA 4B2LA 5EP2A 3KX2A 3QOFA 1TMKA 5GVSA 1G3RA 2F3TA 3W9YA 5FBRB 1XEFA 2GXAA 1LS6A 1U98A 1Y3AA 3GFOA 1SXJE 3DKPA 3W6PA 1G8YA 1U0HC 5CJPA 4XSGA 1Q22A 3RVBA 3HDTA 3CKLA 4BQSA 1IM2A 4TT3D 4Q5IA 2XNDA 2BC9A 4MRRA 3W8RA 3DHWC 3IBYA 1AM4D 4YLGA 1IXSB 1R0XA 5CM8B 4LBYA 3IUYA 4LJ7A 1KI9A 4MKHA 4F4CA 5KPDA 1XD9A 2W0SA 1ZAKA 4HAYA 1XTIA 4DLVA 1TU3A 1NMZA 1IBRA 1Z6AA 2A9KA 4B47A 1ODFA 1JJ7A 1S9DA 1OFIA 3NIBA 5LDDC 4ZDJA 1SKYE 4UNNA 1KSFX 1NKTA 1W46A 1ZM3A 3TUIC 4LBZA 2IBMA 4MYHA 4C30A 4OHZA 4IXNA 1S96A 3WYFA 4PHHA 2IS4A 4HB0A 1VTKA 3GEHA 1W4RA 2ZJAA 2ZJ8A 1II8A 3TSZA 1W0JD 1YZKA 4QGHA 1XTKA 3HYTA 2O8EB 2WOJA 3CF2A 1PUJA 2ZM5A 2FFQA 4F38A 1DOAA 3R7WB 5AUPB 1GRQA 4HLUA 4J0QA 2IYVA 3TAHA 1G3UA 5SZKB 3REGA 4A8JA 3O8BA 5FL7D 1VCMA 1GRNA 4I99A 3NDPA 5FTNA 3HU1A 2Z5FA 2QU8A 2FSHA 2FMXA 4QBHA 3WNCA 4OBEA 4UXHA 1SVOA 3SDZA 1KDOA 2WTUA 1MT0A 5J40A 1A2KC 3V9PA 1UKVY 4Z8XA 5G53C 2BBTA 4HI0E 4FMBB 3BE4A 2QMUA 1DVRA 1OW3B 4IXMA 3VX4A 4YMUA 1W36C 1G17A 3AUXA 1E4VA 3NHBA 4PC3A 4V0ME 4M53A 5TARA 4Y0AA 1NSTA 4DLRA 3M0EA 2GZHA 4TYQA 2GJ8A 2A5DA 4LK2A 4CEJA 4BLRA 3THOA 2O5VA 2GXSA 1YJ5A 3NC0C 4FINA 2WJHA 1T8UA 4ACBA 2I1VB 4TQ9A 2V54A 1XMSA 4KVGA 4TWZA 3VHXA 1OIVA 4FIDA 4X8OA 4JVNA 2W00A 3LY5A 5BYKA 3PJRA 4GFDA 2GVDC 2FPMA 4HB3A 1G6HA 4CT5A 1ZD8A 1DARA 1E2JA 2RGNA 4BRWA 1C1YA 1E2EA 3GFTA 2Q3MA 3HU3A 5CK4A 1H65A 4UJ5A 2ZJ2A 2AKAB 1G5RA 2ZI6A 3KXKA 1VHTA 3VMFA 4PHGA 3W90A 4AC9A 4BFVA 2XOKD 5FBLB 2QL6A 1OYYA 4RZ2A 4PX9A 4NBSA 4L15A 3K0AA 2EW1A 3THYA 2OAQ1 3QXHA 1KK3A 4WA7A 3NEYA 1XU4A 2GVZC 2PH1A 4C0AC 3NC1C 3KJHA 4N1AA 1CULC 4DXAA 4YC7A 4MUAA 4BWYA 3ADDA 2BKUA 1UBGA 4TQUS 4M1YA 3OE7D 3T61A 3WRYC 2OZEA 3LLUA 1EWQA 1LTQA 5FTMA 4KAXA 3QKSA 3GLIA 1OYWA 1U9IC 2C78A 3RNLA 2HYIC 1LV7A 2E87A 2NPFA 4LSGA 3I5YA 1CS4C 1W4CA 4IVQA 1G1MA 5J4KA 2EFHB 1EFRD 3C5CA 1JPNA 3PCRB 4MRNA 2BIFA 2F6RA 2GRJA 4IHQA 4JJZA 2O8DA 4N3NA 3FHTA 1RRGA 4D6PA 1N5IA 1VDZA 221PA 4M22A 3NXSA 2XEXA 2ZREA 4G5SA 3EA5A 4DLTA 4XVUA 5CYPA 3AVUA 5FTKA 4ZDKA 1UAAA 4LCBA 1XJCA 5K8LA 2ONJA 3BH7A 1ZJ6A 4TMXA 1ZMXA 2X2FA 3KZ1E 3MSXA 4FW9A 1HQYE 2XOKA 4NU0A 1VIYA 2AXPA 4TLEA 1FUKA 1KJYA 3CR7A 4BECA 2WM9B 2JLWA 2ZRCA 4Z1MD 2CJWB 4LPKA 1I4TD 4PC6A 1P2VA 4Q4LA 4TMKA 3G82C 3IQWA 3TE6A 4GDFA 3KXLA 5KDDA 4PC1A 2YC4C 1KZGB 3OE7A 1U94A 3TJZA 4KFTA 5CIQA 4GP7A 3T34A 3TSWA 3GLFA 1SKQA 1F5NA 2WWHA 3QXJA 1P4SA 1XCMA 2C9YA 4JLPA 1ZW6A 3AP1A 3ZH9B 4C7OA 3Q85A 5TVKA 1S3SA 4PSAA 4NPHA 3JZMA 3KJIA 4V0LA 1EFRA 1E2KA 3T1OA 1IY0A 4ZI2A 4Q1FA 4CEHA 1Z0FA 5D3MA 1F2UA 3M4YA 1VG9B 4M0LA 1HE1C 5FFMA 1VCIA 1AN0A 3I4LA 3LLMA 1EXMA 2JA1A 2YNMA 4PXAA 3R9WA 5FPHA 2BEJA 2OFWA 1E99A 4JZKA 4HUTA 2IWRA 1YZUA 4DZZA 5J4LA 4YONB 1ZNWA 2ORVA 2ZSFA 1IQPA 1UKYA 1G5PA 1XTSA 2VP4A 2WAYA 3Q72A 2P6UA 4NCIA 1GKUB 1D6JA 2DR3A 5FOWA 5DHFA 4CYMA 3I32A 4PZYA 4JBYA 2FJUA 4GMDA 3GLFB 3K9NA 4F4IA 5B30A 2VPPA 4MUBA 4B33A 2ZRFA 2FGKA 3KKMA 2QA5A 3MD0A 4YDHB 3SYLA 3W5IA 4E22A 2XX3A 3CRW1 3I72A 3Q5DA 1IAQA 1M7GA 5AK0A 1E32A 1IY1A 3VAAA 1TUIA 4D82A 1E9DA 3Q8XB 4NL4H 1I4LD 5F9FA 2QSYA 2HF8A 3B6EA 2FZLA 5JI2E 4UNSA 3MUFA 5JJLA 1M7BA 3AVYA 4V0OA 1MO3A 2PLFA 3KFVA 3WNDA 2FSIA 5KYKA 1EFHA 2I1QA 1G4AE 1NJGA 3AVTA 3I73A 4ESVA 3EPJA 1N5LA 1AKYA 1DADA 5JZVA 4ZCMA 4Q03A 2D3WA 3VKHA 1HE8B 3IHLA 3QBTA 4IDOA 4HB4A 3TSOA 2WWGA 3SQWA 2ZJBA 4OI0A 1SVMA 4LGMA 2ZJOA 4BFWA 4EAQA 1P6XA 1IONA 1II0A 3BB4A 1NN0A 3AQ4A 2OO7A 4URYR 2J41A 1Q1ZA 3CM0A 2G0NA 2HV8A 2YWFA 2FPLA 4UKDA 1NN3A 3QNUA 3WP1B 1D2NA 4ARZB 4FWTA 4EPTA 1U99A 4H1UA 4XH9B 4QBIA 4RD1A 2P6RA 2NQ2C 3UMSA 3AVOA 2GEDA 3IIMA 4KJZA 3Q5EA 4KBGA 2LKDA 1ANKA 1TQ6A 4E07A 4QNRA 1OB2A 3MAAC 4LJYA 2WJIA 3QEJA 2HT6A 4HUQB 2ZJZA 3LDAA 4H9GA 3UMFA 1Z83A 2QBYA 2FV8A 2BOVA 4KSBA 3IO3A 1MV5A 5BN3A 5DN6A 3ICEA 1T0HB 2OBMA 4FD2A 3KXIA 2H18A 2OV2A 3B1VA 1G3IA 2DFTA 4FCVA 4HLUC 4HDQB 1N6LA 1S9HA 1EWRA 1YZNA 1UM8A 4A8JC 1P9RA 4F7WA 2GXUA 3A8TA 1KOFA 1OF1A 2ONKA 2ZE6A 1P72A 1RYFA 3C41J 5BW8A 1AGRA 1P9NA 2GCPA 3MWKA 2Q3FA 3IPXA 1ZIPA 4LV5B 1G7SA 1WP9A 4ERNA 1H8HD 4CW7A 1M1YE 2YJTD 3EARA 3B5JA 1J70A 3FMOB 3R8CA 5GJBA 1B0UA 3U3RA 1GKYA 4IDPA 5DH9A 5IF9A 2CE7A 3BD9A 2AHOA 2JIZD 2Q9BA 1RYHA 3P26A 5JS7A 2NMVA 3GJ0A 4DDVA 2YWEA 4LX0A 4UQOA 2G1KA 1W5TA 2RGDA 3SC3A 5FOUA 5JECA 1ZNYA 3TNFA 3TW4A 2V3CC 3HU2A 4HZUA 3I3SR 3X1YA 3B2EA 5AUQA 4DHEA 2F55A 1JI0A 1QHSA 1EX7A 2BM0A 1GKIA 4Q66C 1KYIA 2HYDA 1MRSA 1W48A 4A15A 1E96A 1ZUHA 3H86A 2QMOA 1CJUC 1ZM2A 4DCVA 2OILA 1KSGA 3H4MA 4Q9HA 4DRZA 1G6OA 4PQFA 4DLYA 2E9SA 3K70C 1XD2B 4XSHA 1TEVA 3OIVA 2WOOA 3QI2A 1R5OA 1NLYA 1DO0A 2ECKA 4B48A 1H8HA 5DHAA 3H2YA 4LPSA 3ZS9A 1FW6A 2OBLA 4QJ4A 4D81A 4RFSB 4C0SA 4ZI3A 2ZIAA 3SBDA 1MRNA 3KTAA 2FG5A 2RGGA 3OAAD 1Z3IX 2JLVA 2BKEA 2JIZA 3FDIA 2ZRHA 2O8FA 5CM9C 3AM1A 1EFUA 1TF7A 2JJ2A 1XPRA 2EYUA 4B2PA 5DLQC 3GQBA 5B58C 1O87A 3DEFA 2ERYA 4BLTA 2IXGA 4ZKEA 5JBQA 2A5JA 2KBFA 4V0KA 3SJZA 4XWOA 4X8MA 2GKSA 3LX8A 3U44A 2W2XA 2FFAA 4NE2A 4DIDA 5J4HA 2J3EA 5DSZA 2XITA 1Q1EA 1U8AA 3C15C 1E79D 1SHZA 5AJXA 3ASZA 4YDSA 4I1VA 2HLDA 4PPFA 5IT5A 1UKZA 5J4VA 4Q00A 2WZQA 1KMQA 2PCJA 2FZ4A 4QOSA 4RD3A 4R71A 4FXPA 3KTAB 1AIPA 3ASYA 3K8YA 3RRNA 3FOZA 4CEIA 4WBSA 1G8GA 2ODNA 2WJGA 2XZOA 2IS6A 5EE3A 4D2IA 1Q44A 3NBFA 1GZSA 4DT1B 2OHFA 1FMJA 4KLZA 2G1JA 4A0GA 1G19A 3EPHA 2O8CB 4E09A 3GJXC 3EX7C 5DGXA 3SN6A 5HR5A 3QE0A 3OAAA 5EE1A 3SNHA 1NMYA 3X1XA 1N6OA 1SXJA 4LBVA 4L5BA 5TV2A 3VR5A 2PZGA 2ZRLA 4NYJQ 4LUCA 5UKDA 2F9LA 2FPKA 4EPYA 3KB2A 2HEIA 1S2MA 5C18A 1PV4A 1M6NA 1G20E 1W36B 1NIJA 2OESA 4RZXA 5KSOA 4WOPA 4M2LA 1ZCAA 1GM5A 1XEWY 3K09C 3MCAA 4PZLA 1E79A 2G77B 5FUVA 1OKKD 5JS8A 3A6PC 3QIAA 2D4HA 4HDOB 1WMSA 2QTHA 4W7SA 2NO6A 2QPAA 3KUDA 4Q1AA 2F7SA 1FPMA 1II9A 2FSGA 2QRZA 2ZSBA 1W2HA 3AP3A 4JL6A 4OHWA 2NO7A 1AQYA 2QP9X 2QQ0A 3DVLA 2O8BA 1Z6XA 2FFBA 2OCBA 2CL6X 4PHTA 3IGFA 2X77A 1SXJB 1AK2A 1T5IA 1KY3A 3MJRA 2YC2C 1E0SA 3GJ8A 5KHOC 4D26A 5FPSA 3BBPA 3IEUA 5FUYA 2J46A 4LHXA 1KDTA 5DI3A 3OIUA 4RKFA 4CF7A 3F5FA 2A5YB 4IFEA 2HJVA 5P21A 1B23P 4PTLA 4WIAA 1AGPA 2W0MA 1WCV1 4KO8A 2VP0A 1UADA 3GLGE 1M74A 1Q20A 1FNNA 1AS0A 1GDDA 3DM5A 2OM2A 3T15A 3U3JA 4BLPA 1XJQA 3OEED 4IOLA 4TYPA 4M9ZA 4US1R 5SZJA 1JAIA 1XF9A 4LY6A 3EIEA 3EPLA 4AYWA 5C46F 3GJ3A 1W49A 4P0TA 2VSOA 2O8BB 1SKYB 3KL4A 2P5SA 2CHQA 2OFOA 4LV6A 4B6EA 1RIFA 1OKKA 3GD7A 3JZAA 4P33A 3TVTA 1X86B 1TQDA 4OI4A 3T5DA 2ZUCA 4AYXA 2GETA 3QBVA 5IHPA 1A82A 1E9AA 2REBA 3BRWD 1PLLA 4V0MA 4M1OA 1U81A 3GEEA 4G1UC 2Q21A 1Z8FA 3MRSA 3NBXX 3B1XA 4TMZA 1M7HA 1TNDA 3SJBA 4MRVA 1Q3TA 4URVR 3GJ6A 5C1BA 1F2TA 4IOMA 3U7HB 2G0TA 4MRSA 4C0BA 1QBKC 2ZRMA 2AFHE 4UJ3A 3CLVA 5EZ6B 1OSNA 1WF3A 3N2IA 3QPWA 5CK5A 4PHFA 4WXRA 5FPTA 5KNDA 4B35A 2PJRA 2WICA 3EC2A 4PAMA 4TLCA 1GL6A 1XP8A 3PUZA 1ZYUA 3KKPA 3OEEA 2XXAA 1AQUA 4PO1A 4Z54A 1T3HA 1G18A 4TMWA 2ZANA 2YYZA 5KPJA 2MSEB 4G0NA 3X2SA 1HEIA 2GJSA 4DLSA 4NCNA 5FTLA 1ESMA 2HCJB 4URUR 1G7RA 2KBEA 1X8KA 1ZC3A 3B60A 4AK9A 2UZIR 5FTJA 3ZGXA 821PA 2D7CA 4W9MC 5JRZA 3QENA 3WBJA 1GAJA 3U61B 2BJVA 2CMKA 4D4KA 2NZJA 5JSZA 4GI7A 1F2TB 1VYVA 4GOJA 5C4GB 1US8A 1S1CA 4EJSA 1YQTA 2OFXA 2IYSA 5H70A 3UIEA 2JLQA 4FN5A 5DYIA 1VMAA 4C9BA 1GNRA 3GLHE 4NYMQ 5L3QA 4P32A 3LW8A 4JLMA 4Q9JA 1FQKA 3TQFA 2DY1A 1BKDR 3SOPA 5DO9A 1RJ9A 2KB0A 4RKEA 1E4YA 1SVWA 2XXAB 4JLDA 3KJGA 5AR1A 2QENA 3A1SA 3RS4A 3PITA 5K8UA 5AUNB 1KI8A 3SQXA 2J7KA 4Q4HB 5DNYB 3EG5A 1SHKA 2DFLA 4HSEA 1K5GA 4X8HA 4LBWA 2VLIA 1SZPA 3OEHD 3QF4B 3AGQA 2AWNA 4TL7A 3C8UA 2V1UA 4G5QA 1NP6A 3CF0A 1ONBA 4ZIRA 5DYGA 4K81B 5G3YA 4Q01A 3ADKA 4S2EA 5JSZB 4TLBA 3L8YA 4TZ0A 1Z0IA 1US8B 4ZCLA 5A0FA 1NG9A 1KDRA 5EUQB 1HQCA 2VO1A 2CEAA 5BQ5A 1NIPA 4A0FA 1YE8A 3SFVA 1VHLA 5C2JB 3VR3A 4KYIB 4Q4AA 2R6GA 1FFHA 3NH9A 3EC1A 2ZETA 4CVNA 1KO5A 1T8TA 3Q7QA 5AUOB 1VG8A 1DELA 2PT7A 2Q9CA 4CT4B 4OJKA 1GTVA 1U90A 2HCBA 4FWIB 2R6FA 1R6BX 1CR4A 4B44A 3U7FB 4ZIRB 3CUEF 1R10A 4I1OA 1D9ZA 2NO1A 1F60A 1Z47A 3P1JA 4TT3A 1A4RA 1MABA 1XTQA 3VR1A 5FH9A 5LBIA 2FNAA 2ZYUX 4HLDA 1XMIA 2X8AA 4IDNA 3OEHA 1KAOA 1ZC4A 3BK7A 3NBYC 3W6OA 2QN6A 1VG1A 4BZQA 4YMTA 4B3GA 2ZROA 3BWDD 4QBGB 5CB6A 8OHMA 2H16A 4ILEA 4B43A 3H0KA 4ASUD 5HKKD 5JWRA 2V9PA 2J0VA 1HA3A 1SVLA 2GK7A 2OCYC 2ZI7A 1E9SA 1XBTA 1BOFA 4LJ8A 5JWHA 4NYMR 3WMFA 1II8B 4RD2A 3WMGA 1G64A 3L0PA 1PJRA 4NTZA 5DI9A 3U3OA 4Q18A 5EXSA 5BYJA 2ZUDA 3I61A 3KQNA 3O8DA 1XWIA 4TL8A 4FCWA 3QKRA 5CLLA 3THXA 4Q7LA 1MR3F 3W5JA 4QXAA 2YV5A 4A1FA 4A8JB 1W0KD 2ZR9A 1MO4A 1W0JA 1E9RA 1K8RA 2B6HA 1MABB 3FGNA 3MWYW 4BASA 2ZEJA 1D5CA 4LI0A 2ZS7A 1SXJC 3NKVA 4XTRA 2C9CA 2GESA 2P65A 4PC2A 4Q7JB 5E7MA 4PQRA 1S0UA 1GNQA 2WWYA 1G3QA 2WMNB 1W1WA 3IIJA 3CNLA 1HYQA 3V4FA 2C04A 1HTWA 1KY2A 3R9IA 2XZLA 4AKGA 4MYCA 1Z2AA 3GJ4A 1QRAA 1G291 1N6PA 2JATA 3TLXA 3LA6A 3IILA 1PVOA 5J47A 3CX8A 1X3SA 4Q1CA 2AX4A 1RZ3A 2FH5B 2GK6A 5HKKA 3QKRB 3CB4A 4CEJB 1N5JA 5FBQB 2QRNA 1KO1A 2GJ9A 2NGRA 3JVUA 3KKQA 4F4JA 1XNJA 3PQCA 4HAVA 4LJ5A 2A2ZA 2C99A 1GVNB 3FE2A 4UXIA 3LAWA 4LZZA 5HTKA 1M2OB 4OQLA 3VQTA 3ADCA 1YHNA 3EWAA 1QF9A 1NN5A 3B85A 1KK0A 1KI1A 2N46A 2OEPA 3FMIA 1L4YA 1OV4A 3QXCA 4LHWA 1G21E 2ATXA 3K70B 4DBLC 4A2PA 1W0KA 2CLSA 4JSYA 1X1RA 1QVRA 2VHUA 3PUWA 4RFVA 3LQRA 1GSIA 1WDTA 1NI3A 1X8LA 3QKTA 1E9FA 3ZDQA 2BJWA 3SBEA 2C95A 2Z0MA 4G5RA 3QG1A 3PEUA 1ZU4A 2A5FA 4L9SA 4LJ6A 3TW8B 2KE5A 1KI6A 2FEOA 3B9QA 4Q1DA 1WB9A 2WSSD 4DJTA 2ZU0C 4CRWB 4EDHA 1P73A 1KKLA 3EIQA 4Q19A 2ZRDA 4DDTA 1IN8A 3QPUA 2CVHA 4V03A 3W3ZB 4BLSA 5B57C 3AKYA 1E2HA 2YWGA 3THYB 2BDTA 3K0AB 4GBMA 4LYFA 2OLKA 5H1YA 2P2LA 421PA 3GPLA 1MH1A 4TZ6A 3WMEA 1KDPA 1VG0B 3E5HA 2QMEA 1OH6A 1W47A 3RAPR 4G3XA 5CJ2A 1FMLA 2BHRA 2NO0A 4M9SA 1DAIA 4P3YA 4KHZA 3A4NA 2JJ8A 3QKSB 3GLIB 1KTVA 4JIMA 1BMFD 1Z63A 1Q57A 4TQAA 4QNMA 4DUGD 4BPBA 2N1BA 2F1JA 4AD8A 1NLZA 1E2NA 1XXHE 4EPXA 3AEZA 1FL9A 2ZYVX 2EU8A 1CBUA 5JCZA 1RRFA 4GL2A 2O8DB 2HXYA 1E2MA 2IYRA 1EGAA 3AF2A 3SHFA 3BH6A 4DKXA 2KSQA 4US0R 4B32A 5JEDA 4D25A 3KQUA 3BERA 4OYHA 2C9OA 4TTRA 1GRRA 1G41A 4IKEA 5KNBA 5F9HA 3K09A 2I4IA 2KI5A 3KJEA 4FMCB 1MKYA 3O8CA 2AN9A 5JMTA 4PANA 2P6NA 3UANA 1CR1A 3ZIAD 1VECA 2IXFA 4RZUA 1E0KA 4GOXA 1DAKA 3I1FA 4LJAA 2GCNA 1ZCBA 4P4TA 2OBNA 4M1MA 2ZI3A 3MJHA 1R5BA 2IYUA 2IYTA 3U6BA 4AI6A 1BO6A 1ELOA 1NMXA 3BFXA 3G5UA 2HJGA 3I92A 3LWNA 1CF4A 3FWYA 2NZ8A 4RY2A 1NBME 3H1TA 4BLOA 2ATVA 2ANCA 4RD4A 4Z1MA 4EFLA 1BMFA 1AS3A 1Z0DA 2JEOA 2RAPA 4DLXA 4EJSC 1T91A 4C7OB 5FI0B 4AKEA 2CNWD 2W6ID 3VTKA 3QJYA 4TYNA 3IPYA 2W2TA 1SVKA 3CWZA 3QPVA 2QROA 5H8WA 3GP8A 2ZRGA 3K0CA 4CEHB 1AZTA 5D3MB 5DISB 521PA 1F2UB 3C14C 3IEVA 1KI2A 4ZO4A 1RPZA 3CNOA 1YR9A 2EYQA 2D06A 3CRRA 4C0KA 1FTNA 1LB1B 4C2UA 3PEVA 4NCJA 1OIXA 2IHBA 3ZD6A 3FPAA 2DBYA 3A58B 3MFYA 3CR8A 4JYBA 2G6BA 2NOAA 1W7AA 1T3LA 4AURA 2DWOA 3VR6A 4PR0A 1NG1A 2ZJ5A 4YMSA 5BN4A 2F9MA 1PLKA 1RFLA 1YKSA 4XJXA 4C2TA 4NCKA 3TR5A 3AKCA 2P67A 1K5DA 2J0QA 3PUXA 1NY5A 1S4QA 1P2SA 1YZQA 4LHZA 4MYUA 2XGJA 4TTPA 3B82A 3IDQA 4IFBA 4ON9A 5L3RA 4P4SA 1R0WA 1VKJA 4PO9A 1GIAA 3T06B 3CWQA 1AS2A 3QF7A 4N0DA 1HT2E 3WYGA 2FE4A 3DL0A 2C77A 1TAGA 2AK3A 2QSZA 4LC0A 2CNWA 4UNRA 1GNPA 2W6IA 3KFXA 4NMMA 3RSOA 4B6FA 4LYHA 3TQCA 1JAHA 2ZRKA 1KI7A 2ZITA 2K5UA 3RRYA 4DWJA 1UBCA 4Q9KA 1CKEA 1XCGB 1E2LA 1E98A 3JVVA 4ZPXA 5A4JA 3LVRE 2W83A 3EZ9A 1HT1E 1IJEA 4KI0A 1KO8A 1LF5A 3F8TA 4I81A 2ZE7A 4EFNA 3O47A 4QGAA 1FP6A 3IKJA 4US2R 2BV3A 4IVPA 3DMNA 3EXAA 2A7QA 1KK1A 1OH8A 4KXFB 4QHTA 3LBNA 1U0JA 3RABA 5TDHA 4BE7B 2RGXA 3NG1A 4O3MA 3BGWA 3U2QA 3KQLA 1CP2A 4B74A 1E2FA 1OHHD 1KNQA 4RVCA 1P5ZB 2YKGA 3B9PA 4I4LA 1S1MA 2QBYB 1Q12A 4A2WA 1GL7A 1OIWA 4G01B 5HZKA 3RWOA 3K1JA 2AD5A 3MG9A 4WZBE 2Z83A 1UPTA 1XDBA 4JVSB 1DG1G 2ODEA 2WMOB 3GLGA 4WZAE 3RS7A 4OL0A 5BWMA 3TR0A 4B34A 2CE2X 2CLCX 1A2BA 1OFHA 3ND9A 3AB3A 4PSKA 4A4DA 3P4YA 2EWWA 4KFRA 5JRJA 2REXB 2P3SA 4KVAA 3GMTA 1SGWA 4OQNA 4W5HA 5AJVB 4AIIA 2VHTA 4D4MA 2J5XA 4B3XA 3QSYA 3RRMA 3U4QA 2F1HA 1TU4A 5EXXA 2C5LA 1JXMA 2V55B 3FB4A 4L16A 5TXGA 2QE7D 1CR2A 1VYTA 1LY1A 2ASEA 1JJVA 2UZ3A
chains in the Genus database with same CATH superfamily
3ZWNA 3QUBA 1YV9A 4IX9A 2QJWA 3B5EA 4C05A 4NSNA 5TB5A 4F97A 2YFYA 1OXSC 2R6CA 1ETUA 3WICA 2AFIA 2R66A 4YT4A 1KQFA 2A1UA 2RE8A 5EXPA 3FUUA 3LUJA 1K88A 4RKRA 3W4KA 4IQ0A 5JSYA 3SLGA 2Q1XA 4D8XA 1Q7RA 2C7BA 3GO4A 2AG6A 2GPAA 4GNRA 1V3QE 4QFMA 4QLAA 3U39A 1RI5A 3DO6A 5CYGA 4BXOB 1E2PA 2DERA 4LDJA 2PBZA 1U2GA 4G1MB 3EWSA 3G13A 4EW3A 2GUWA 3LRTA 2JLRA 2VBCA 3EPRA 2JD2A 4MOWA 4YO8A 2FEXA 4ZHSA 2PUTA 1KC3A 4ZZ3A 2IYWA 2NVOA 2IW1A 3PXGA 3ZGOA 4DOMA 3IV9A 5TSDA 3F0TA 3SYNA 4N18A 1A97A 5CVUA 3BZWA 1A9TA 5LQNA 1E6EA 3U4QB 2V3WA 4KO1S 2WY2D 4HATA 1TM2A 2IEYA 2NO9A 1X3LA 2CFTA 4H4DA 1ZBDA 4MW9A 3IIKA 1GPH1 2IW3A 1ULBA 1FX0A 2EF0A 5AK3A 1E6KA 2X0IA 4MITA 1PF7E 1OROA 1Y1PA 2OXRA 4I9NA 4PSVA 2YCLA 4OP1A 4JNKA 1EM8B 3AFIA 4HVLA 1LX6A 4BNDB 1I32A 1L4UA 3HMKA 2ZS8A 4ZQHA 4IHAA 2BGKA 2LNDA 3F6RA 3UMVA 1ZAYA 1P7YA 4RETA 2WRZA 2GLXA 3CZRA 5DP2A 1BE6A 1XDWA 1ODIA 1XJ0A 2WYIA 3ZY6A 1XX6A 4TX1A 5AW0A 3W05A 1P18A 2Y93A 3O26A 3V4VB 3V5NA 3VR5H 1FC0A 4H59A 3NUGA 4P7JA 1X7DA 4R40A 5TS2A 4CLOB 2D2FA 2H4ZA 2QL7A 1U0SY 2CXXA 3RUHA 3WL8A 4EMUA 2CV1A 3TL2A 1NVEA 1ZP6A 1NT2A 4LZLA 4DM7A 3U60B 3O2QB 1JEAA 1LGYA 3R0VA 4ZA2A 1PW7A 4P82A 3A1UA 1WB5A 1X6VA 4GKAA 4F3NA 1JEOA 3H8SA 4IEEA 2G63A 4KQHA 5SYAA 2X4LA 3OU6A 3TYXA 2X9LA 1LSOA 2O1SA 4Z4CA 1AKUA 4ER0A 1O54A 2I8LA 2JPDA 4PNEA 2VT2A 2SHKA 4J7CA 3SXUA 1GCIA 2VH2A 3T7EA 3AI1A 2FPSA 3GVCA 4Q47A 2V1XA 1WCWA 1V9LA 2WU0A 2YL2A 3N2KB 4EO4A 1D4AA 1I30A 3BF7A 1L8QA 1RBYA 1BYUA 2R7MA 2WTNA 3O21A 4WRRA 2FZGA 2O8NA 4DCUA 4EHIA 3H2JA 5K05A 3COZA 1CUGA 5KDOA 4CEIB 3VNVA 1YL6A 4P53A 5I4KA 1U0BB 1NR5A 2KLHA 2SKDA 4FNOA 4NMWA 1YR6A 4R98A 4FYHA 1N5OX 3I1IA 4RSMA 2O3RA 1PV1A 2LZ0A 2VA8A 1CEYA 1OJ7A 1USGA 4JFRA 1IHUA 3LH5A 5CIWA 1QUFA 4S1OA 3K0HA 1DS6A 1JXOA 3S7TA 3ZHZA 1KJQA 2IS1A 3AR5A 3GT4A 4N65A 3E3LA 1ST2A 3VOSA 4BFTA 1D03A 4NULA 5DXJA 3Q6NA 3CUYA 1U0EA 2QAGA 2COEA 2OV3A 4POAA 3T35A 3NJRA 3B8EA 1WR8A 1PFVA 3NYRA 5BSRA 3W1WA 2J9YB 3NDBB 1PLJA 1Z88A 4Z9YA 2CBXA 4JT2A 4CM3A 4ARCA 4EY7A 2Y0PA 4BUJA 1VKOA 2VDRB 1ZUNB 2C3MA 1XVTA 1AQ6A 2NT4A 3LCUA 4KXQA 5HA5A 2ZCJA 2R8EA 4A8PA 1LS1A 8GPBA 3AF3A 5HDQA 2V7UA 1M8JA 2GYVA 4V02A 3TPFA 4D02A 2QSUA 1HZZC 3PRJA 1Y3BE 5I48A 2R751 4Z4EA 3VKGA 1C7JA 3K0CC 3PNPA 4O2RA 3MWFA 3OPMA 3RUCA 1QHHA 4NEGA 5BMVB 2QI9C 3RC7A 2FWBA 1N7GA 2V65A 1W2GA 2WF9A 3F5DA 4FIZA 4P5EA 1RE0A 1T36A 1RJWA 4E88A 2PUWA 3FY4A 4EHFA 1YFJA 4B80A 1NDUA 3TJRA 1PGJA 2FUG1 4DLUA 4BLWA 2PWAA 1V4VA 4NPCA 5B2EA 1JJIA 3QTTA 1QRDA 2XDQA 1XELA 5HBGA 4HH1A 4NH4A 1C2TA 3OZUA 4H17A 3TKAA 3IPLA 3SZGA 1QV9A 4DVGA 1JAZA 3EFEA 1UDXA 2MJLA 5CFZA 1B2RA 1TKBA 2X2OA 4BB6A 3GA5A 1ZO8A 1ZH6A 2FFJA 2NADA 3A3NA 5J2UA 3IBSA 4QM6A 5AFSA 2V0CA 4NICA 5KNDH 1W4AA 4GWKA 3VYRB 2PLAA 3DTVD 5JCOC 4EQ6B 2WIGA 3ISVA 4DQLA 4GXTA 4JJKA 1BCSA 4HX9A 4HBZA 4NYJR 4ZOAA 3PEYA 1OB5A 4RELA 4ISBA 1QO0A 3CLTC 3G1TA 3QG5A 1EBFA 4RTRA 3X1WA 2EWMA 4QEKA 4ENSA 5J58A 1IWPB 3GCGA 2AR9A 4MUIA 1C8KA 5THQA 1RPJA 2CFIA 1UDWA 1W93A 2F1KA 1N2ZA 4MLZA 4QU5A 3AF0A 2XWBF 3IR5A 1RABA 4FC6A 1LW6E 3LP5A 1KZ4A 1E0AA 2Y1DA 3WK9A 1X1DA 2ZVPX 4PQYA 1J24A 3PP8A 5A62A 4GM0A 4UQPA 3JRNA 3C6QA 1TUBB 4MWDA 3WLPA 1RVDA 5GWXA 2VA9A 1CC1S 2NPIA 1XMOB 1NQWA 4MS3A 3THWA 4M1KA 1Z08A 5EJEA 4M83A 4DM3A 3GRPA 2IVFA 3F6PA 3ZU6A 2GDJA 1ML4A 2O2DA 3C7AA 2JJ1A 1MAUA 2ZAOA 2PRIA 2PSHA 3BKXA 4C4XA 4LZOA 1EH5A 5F1PA 2Z4SA 3IJ5A 3D6JA 3RVQA 1KU0A 4C22A 3SE0A 3AM3A 5EJ7A 2BTQB 4GH5A 3EZLA 4U63A 5D7NA 1ZD9A 2FFHA 3UMMA 4MW6A 3HM9A 2JZNA 1N5RA 1S8FA 2KWIA 2ZXFA 3BRWA 5CA1A 4L22A 4CQMD 2RKWA 4XE5A 2ZRAA 1DHRA 2A35A 2GRUA 4B73A 1QG4A 1QDEA 1WCXA 1I2DA 5HKLA 2F8TA 3AIMA 3PKZA 4RMGA 3VRHA 4P7GA 4BNJA 3B7PA 4CDNA 1MXFA 7YASA 3KSBC 1FFYA 4DXDA 4CIDA 2F90A 3LT0A 3RB8A 3VX3A 4PVDA 3SYKA 1OFGA 5AICA 1FLVA 2XH8A 1DPFA 2AZ4A 4AQYB 1GZ5A 1HZJA 2VTVA 2PV7A 2IHYA 4Y2XA 1NW9B 1NFFA 3GN2A 4DMRA 1Q1QA 1RTKA 4F92B 1AUVA 1L5QA 4WK2B 5BQXA 4PG4A 4NVRA 4RWZA 3GFQA 1FJ2A 3AR2A 1I4DD 1AKWA 5IRCD 3ZCXA 1DG3A 1QTRA 2I2BA 1NWCA 4ESEA 1CUYA 1C3XA 4IQGA 2WD8A 2IU0A 1PQUA 2ZI9A 1MHTA 1TC2A 2PS3A 2VP6A 1NVXQ 3EN0A 3D7MA 4XR9A 3VKFA 3S0JA 4MAFA 3VOAA 3FKQA 4V0SA 3DOFA 1Z0KA 3KE8A 5IULC 3GJ5A 2DULA 3D7LA 4WX2B 3TH5A 4PAQA 1XF1A 3KR9A 4D57A 4ENRA 5L3QB 3KG2A 5KO2A 1XDZA 2BF7A 2GZ1A 3D5EA 2O8EA 1RJ9B 2GCOA 4RTMA 4QDZA 4YAJA 1G21B 1EBUA 3CISA 3NDJA 3ZU2A 1QF6A 4MWOA 3A6EA 4XWAA 5SZIA 4JLKA 3VYUB 3CF4A 1SB8A 3T3OA 3IJPA 1ZI8A 3Q3CA 4LTMA 3ONFA 4HT3B 3OF5A 5KX5B 2YWHA 2GEBA 2BCJQ 4MQ5A 1TM1E 2QMHA 4G37A 4QPDA 1J8QA 4LVUA 4NDZA 1E5TA 3QMPA 2EVWX 2FDXA 3WB2A 1UJ6A 4KIWA 2HV9A 4QOGA 1C0IA 1FS5A 1XZDA 2QVCA 4KXLA 2CHGA 3ENWA 4R51A 2LXNA 5D84A 1EXVA 3RYFA 1E2BA 2CFRA 4E1VA 3D8SA 3OPVA 5ALMA 1Y4ZA 1UPFA 1GGJA 4ESOA 4MMXB 2PX3A 5AM3A 2AC7A 1N2XA 3HJRA 2F1IA 5LD2C 1YFZA 2RJ3A 4R1QA 4DQKA 1CV2A 3TOZA 5ER6A 5GJVC 3LZDA 2QT0A 1V9SA 4EO9A 2W2VA 1RQNA 1HDRA 2XVXA 4ZVMA 1W30A 4I1IA 1YR7A 1YB2A 3H5OA 2GWRA 3KYIB 5TMPA 2WF7A 1JFSA 1VQ1A 4DXHA 3V80A 2E5FA 2JASA 3EXIB 3AVXA 5IDXA 1SBTA 4D4JA 1FMTA 4Y67A 4Z4HA 1LXCA 2ZBDA 1YUBA 3RH0A 1BS1A 5EESA 3NOXA 4JSTA 2M6LA 3ZWPA 3UJDA 1NBMA 2QTVB 2WG0A 1E1QD 2J6IA 3K4HA 5DKFA 4ZEOA 3O73A 2ZQZA 3H5TA 1CVRA 1NXXA 2WJYA 3EEYA 3H5WA 4I50B 4D0LB 4WDRA 4EEKA 4GYKA 4R7GA 1NDHA 2XCOA 3OM9A 4MQBA 1SY7A 3VH4A 2QTBA 3BS4A 3RROA 4L76A 1TD9A 2O07A 2EW8A 1IJBA 1MB4A 2H2HA 2P41A 4A5OA 2DWQA 1B6GA 1U8FO 2QPOA 2X58A 3VU9B 3U62A 3JARB 2Q6IA 1PUIA 5KQLA 3EGIA 3FCAA 3ADPA 2IOFK 2P1ZA 3I2IA 4YT5A 3ILSA 3SKXA 5HS4A 3A36A 1N0VC 1Q95A 2OGSA 4K0RA 4TTSA 1EQAA 4KITB 1C3OB 3AU8A 1OH7A 1PV2A 3SIXA 2P11A 1MVNA 3A37A 3EZ7A 5KTTA 3LMKA 1V2GA 2J87A 4X7PA 2IEIA 2PWPA 3OWHA 3FSEA 4HDRA 1PSWA 2XMZA 2GNOA 1XN4A 3H9BA 4RHEA 2I6TA 1YCFA 1KIMA 3HL0A 1Y6JA 4H7IA 3WQHA 5A7GA 4Q48A 1JHUA 1RW4A 1JWLA 1SCQA 1XCOA 4HFMA 3LNCA 5AW8A 2Z8XA 1PEDA 1TYBE 1GRCA 2VH5R 1XZQA 3TL3A 5L53A 3H5NA 1DT5A 4BTVA 1NU6A 4NP6A 5GZ6A 4O4LA 4U2GA 4YRIA 2XJ9A 3D3JA 1UINA 2C4UA 3BILA 5PNTA 2EHDA 3P9CA 4CKXA 3KLOA 5IVPA 4MP8A 2AL7A 3WOHA 4B2IA 3R4VA 1NYLA 3EGVA 4DSOA 2DU8A 1JQEA 1R12A 1TXGA 1OV6A 2VP5A 1IK6A 2WMDA 2WYHA 3ISTA 4JNCA 5JY1A 2B21A 1QJCA 2C0CA 2BF4A 2G9VA 3A1TA 3FKSA 4XQEA 1KO4A 3BQMB 3ZX5A 4ZHQB 1E1RD 2NQTA 2QB5A 2PT5A 2ZW9A 4J2HA 4JP2A 3DV2A 1YI0A 2IXAA 2JC3A 1G5TA 1C1HA 4WCFA 1UBSB 4J0JA 4C4PA 1NBHA 3DBRB 121PA 1M10A 2VHYA 2O7NA 1Y0BA 3PENA 5LOVF 2IV3A 5B64A 1JHRA 2Z04A 5B58T 4DSNA 2PUBA 5T7BA 4ETIA 4JJ8A 1O6BA 1R6TA 1LK5A 2ECFA 2QZSA 5AHRA 2WV9A 2PZLA 3ELBA 1KFBB 1X7WA 1PNOA 2DQSA 2O7VA 1QV7A 3FMFA 4FOPA 4HVCA 1BE1A 2PL3A 3BXOA 4M1TA 4CKWB 5AD1A 2D2XA 3EPKA 3K6SA 2B37A 1T15A 4TSFD 4DSTA 1FJHA 3DKVA 3LUCA 4M9QA 1JAYA 2AMVA 3WBBA 1GOTA 4QBKA 1LRKA 1X0VA 4ER3A 2UUCB 1K3TA 3QA9A 2I6UA 4MULA 1OY1A 3W6NA 3DYBA 2V5UA 5IXJA 2J0UA 3O74A 1PGQA 4LF8B 3D0RA 3SJ7A 3BOSA 3L8DA 1R0RE 5IK2A 3IQXA 4IJWA 5A6SB 3VJMA 2E7ZA 5KWEA 1TEXA 3QVVA 1U2PA 2ODBA 1UDBA 3QXXA 2BFNA 3UJAA 4P84A 4A2CA 5JO0A 3TRJA 3Q0IA 2BGJA 1QZXA 1AQLA 1TECE 1QX4A 2IP1A 2HMSA 2D1TA 3Q8KA 4B3DA 3NP7A 3OM0A 3QVJA 2P5UA 4GLLA 4J94A 5LLDA 1SWWA 1ZEJA 1KERA 4F12A 3FLBA 1XU9A 1K06A 2TMDA 4NI5A 4RV9A 2FDCA 4G0OA 4W1RA 3A04A 2WJWA 4IVRA 3OKAA 4F3KA 1FFBA 3EIUA 4P0PB 2JEZA 3MS4A 2ETXA 3WS7A 1ZIOA 3M6AA 1BEZA 2BELA 4PLZA 4TTIA 3RUDA 5EWLA 3PC4A 4OU4A 5DOVA 2I8AA 3TOVA 1PS0A 3R9KA 3CEPB 1HUQA 1SBCA 2JFFA 3MIZA 2O6LA 3VR4D 4HAUA 1P3Y1 1XI2A 1F1JA 2L19A 4IDCA 3HUFA 3T8YA 4ARIA 3NT4A 1PFUA 1YA6A 5H3LA 2XYRA 1XMVA 3RS8A 3FI9A 3PD1A 1DCFA 4JH0A 4LY9A 2AN5A 4RZ3A 5LLSA 3QYPA 5EHZA 4W4TA 1M6YA 3RWBA 5KNCD 2VZ9A 4DC9A 2LR0A 2AE2A 1H9AA 1UFRA 3WZLA 4QPJC 3UM9A 5KVVA 4PO8A 4LF6B 3UG7A 2ZR8A 2FOLA 2E49A 5H02A 4WK0B 1S8OA 4BVGA 5EAIA 2ICAA 3G2PA 1UXIA 3AETB 3R8FA 2XAUA 4HQNA 4LKOA 3S8MA 1YQ9A 4DMGA 1DFIA 5CTAA 3OM1A 4Z3DA 4FNAA 1RM0A 1DJQA 3KB8A 3OPXA 3OFND 1K75A 3KS9A 3L8EA 1YDFA 1KS9A 2Y0DA 4L2IA 4PN3A 1W29A 1N2JA 3K32A 1BX1A 4Q9DA 4C43A 2VQDA 4JR2A 4O2AF 2ZUEA 1FX1A 2DHDA 4HRYA 5E4TA 2EKLA 4KBFA 1XEWX 5FD8A 5T64A 2JVIA 2EV9A 5ETJA 2JKZA 1O4VA 3PPVA 4JLBA 4QEDA 5FWYB 5MN4A 2GM4A 4ZCTA 2ZDQA 1WBBA 3EVZA 3U7JA 2CCGA 4BO2A 2W4MA 4I1SA 5F1YA 1LSUA 3UGQA 3WC4A 1U0FA 2AKYA 1UQTA 2RGCA 3E84A 5FX2A 2HREA 2QHXA 3QELA 3I39X 5A4DA 1SOWA 1L5GB 3FF1A 2C4NA 1VLHA 2GBLA 2VRNA 3H2SA 3ZQ6A 3ZIAA 1PEAA 3G9UA 3ANMA 1RDFA 4BZPA 2X4DA 2ZRIA 3TMKA 1VJTA 3RTCA 3HJTA 2BMFA 4NV1A 2AWOA 3D7RA 2O5EA 1M6HA 5AHWA 2ZZMA 1DBPA 4URWR 4GOMD 3BB1A 3GP5A 3OQOA 4EA7A 2OO3A 1UIRA 2BR5A 4W5WA 1I94B 3HPQA 2P0EA 1XEXB 3K5HA 1ECPA 3PWTA 3JWJA 4HUQA 3VJRA 2XXJA 3T7CA 4HR7A 2YFKA 5IYZB 4JUCA 2OHHA 3SR0A 2OE2A 1WX1A 1JR3D 3ZGVA 2ZJ0A 4GM1A 3LHKA 4PLCA 2J3JA 2QRQA 3MZ0A 5F52A 1FRVA 1TTTA 1WQ1R 2H1CA 3M1AA 2IL1A 1EDBA 2FI1A 3IUPA 3LC2O 4LMAA 1IBMB 1IN4A 2B2XA 4WADA 4DANA 3MWDA 1JUDA 2B20A 1TX4B 2VYNA 2EFGA 4M8IA 4QODA 5SY9A 4ZYLA 5IWCA 4RS3A 1BCRA 3AP2A 4IEIA 3CN9A 3CNQS 1ISIA 1D09A 1WDWB 2B94A 2O0HA 4LXUA 4N8DA 5TVGA 4CL2A 1AY0A 2ZGVA 4F9TA 2ZKLA 3D64A 4D8TA 3D0OA 4QGGA 4QJ5A 3G0HA 4LQ4A 2C9DA 5H3HA 1J0DA 1SBQA 1IOLA 2FVXA 2BUCA 5DP1A 4AMVA 5JT1A 5DM2A 2CVPA 2C42A 3JQBC 3OCUA 4QHYA 1EB8A 1NLFA 1TPYA 4OHXA 5KJCA 3K0SA 3LO5A 3JYNA 1DKRA 2ZWMA 1P80A 1KHTA 1GA6A 4ZI7A 4TXMA 5D8DA 4A6EA 4NOJA 2H4XA 4KSCA 1UMBA 4G5OA 2VNKA 2ZE8A 5T57A 1KS2A 1PR2A 2GA8A 2E37A 1Z56C 4WASA 3CNNA 4IW3B 2I65A 2OCPA 1CY1A 2BFMA 3I58A 1LJLA 3PX3A 4IS2A 4X20B 4ZQBA 3ZK8A 3FA2A 4KOEC 3INNA 4IQFA 4DGSA 4QOEA 4YJFA 3TCNA 4JJ7A 3REOA 2AS0A 2ZSAA 3AHIA 3EQ9A 1VMIA 4Y6SA 1W9MA 2KQUA 4DDWA 3ZUPA 3DUWA 3OH8A 4A92A 5AO9A 1TLLA 3DV0A 1EUDB 3VO9A 4RH3A 4YDQA 4FYIA 4Y1GA 1NHWA 4LA4A 3LIIA 4MH0R 4RJLA 3IP5A 1XD2A 1SC4A 1ZKMA 4CI9A 3KETA 1CD5A 4KODA 4RK5A 3K9LA 1QIIA 3JQAA 5I51A 4HB2A 3CVVA 1IUPA 2H57A 2E1RA 1M2VA 1KVTA 2PH3A 3FFAA 1GL3A 2JRCA 3LUHA 3P9QA 4Q16A 4HTAA 4UU0A 3NVKI 1QHXA 1Z2EA 1FUUA 2V6FA 4NNJA 4ZJYA 4Q02A 2DZDA 4LOAA 3VNSA 1FFSA 2VBIA 4EIWA 3ZVNA 2DPYA 3OX2A 4JKIA 2B78A 2IIQA 5H5JA 1U04A 3HKDB 3HRIA 1OBFO 5EJAA 1WZEA 4OQZA 5HZGA 1K8XB 2BBWA 3KVVA 1WXQA 4Z0TA 2OWDA 2G9NA 1DXQA 1U8UA 1QTNA 2QNBA 2B8TA 1IQRA 2J7PA 3MIIA 2BBOA 5EZSA 1U3WA 4EECA 2NTYC 3LQYA 4TTVA 3B1WA 3H6GA 2E82A 5HGJA 3MF4A 2IY9A 3SZUA 1PR1A 2EFDB 4YJHA 3MTEA 1FSSA 2VDVE 4HMOA 4K1LA 1GL9B 4S3MA 4X66B 3GLGB 3CLKA 5E6UA 4GVPA 4WLUA 5IF3A 5AKZA 5DNAA 2Y77A 1W36D 3IQDB 4GPEA 2AW5A 4WKOA 1OH5A 3ONNA 5K3FA 1X39A 1UANA 2Q5JA 3BZUA 5CH8A 1T9BA 4V24A 3WLOA 1TQ2A 3HWX1 4RX1A 4NE9A 3UGTA 3ZJUA 5JH7F 2ET6A 4M0FA 3W2IA 4EX6A 1MTZA 3A9TA 3DDOA 5EZYF 4K40A 3OKFA 3GLQA 4ZCQA 3S1AA 3ZDFA 2LIPA 1T2EA 2OXCA 3RTDA 2O5CA 4MGYR 2NNLD 5F7ZA 4BO8A 3J7AC 4OH7A 1CU1A 1TVKA 5KTYA 1YJCA 4DIEA 1WY5A 4FOLA 2D59A 4Q7MB 4KKXB 4G5HA 1IBLB 3RDPA 1EFTA 2J0EA 3LZ6A 1N6HA 1T2UA 1ZVMA 2E4YA 4F84A 5L3SB 2ZTSA 3UJ9A 1UPXA 2CCKA 3L7DA 3H05A 5LU8A 2VJCA 5D5QA 3KO8A 3VKWA 1ZM7A 2AG8A 1M5RA 3S2EA 3FCCA 4ANFA 3QUQA 1C9KA 3F6YA 5KVCA 2QYOA 2D2EA 1IJKA 4FMDB 5C8YF 2BKAA 3IXMA 2P30A 2Y05A 3ZHRA 5EIEA 4WNAB 3UJ8A 2HF7A 3LG2A 2I22A 3FR8A 1X80A 1YK1A 3G2JA 4NHOA 2B3TA 3LV8A 4WOKA 5ARDA 1ZA2A 3ABIA 3T1QA 3WNBA 4EKDA 2WHXA 2J45A 4EGAA 3O9VA 3L05A 3TQTA 1C8LA 5FOVA 3F71A 1I4WA 1QIDA 4Q4JB 2R9VA 4ZV4A 1JDSA 5EERA 1Z0AA 2WDZA 2ZWIA 3L0SA 5KMGB 2ID8A 2J5QA 5LFAA 5E6SB 3HKEB 1DKLA 1DAGA 4CKCA 4E11A 5KQGA 3I5AA 3AOGA 5MGBA 3CF4G 3N76A 2WWXA 1WEHA 4PPQA 1EJ0A 5KUTA 3UAYA 3ZV5A 2O0JA 4OJQA 4AO6A 1GQ2A 5HJ2A 3BRSA 2JLZA 1X13A 2WZBA 4RACA 5A05A 2Z57A 4BV2A 1X7XA 3FMVA 2A5LA 4PZPA 5EE5B 2P77A 1OZFA 1FDVA 4ZV7A 3P0JA 2TSYB 2O52A 3OU7A 2JAWA 1BWPA 1E5LA 3BFKA 2AVDA 3JZFA 1Z0SA 1DAMA 1RKQA 3EVNA 3DE2X 3JALB 2YHUA 3JD4A 3FBWA 3M5CA 4MX8A 4F4FA 3GLHB 3A6DA 1KR5A 3C7KA 2JI8A 2CHVA 3ZBPA 1MIOA 1GUZA 1ADJA 4Y6PA 1MPXA 4AY5A 2H0RA 1KAEA 5EIWA 3DZIA 4JC8A 3OLYA 5JNVA 1QPBA 3OP4A 4JLUA 1H3EA 1KAMA 4B3TB 3LX5A 4JHLA 4EB6B 5JWOA 1XR3A 2ETVA 5GM2A 3MWJA 3EA0A 3Q15C 2G6TA 2YOGA 2WLSA 1ORIA 2PIDA 3T1HB 1WPGA 3DEYX 3FW1A 2FHPA 1WXGA 3FVQA 1RP7A 4X3PA 4HWPA 3PFCA 4FD3A 3WLFA 1DLJA 1PX0A 1WSWA 3FUTA 4MR7B 1FQOA 3HA3A 5C34B 4Q3EA 1ECJA 3SZRA 2W2NA 2R4TA 3L8CA 3LUKA 1MGOA 4YLEA 4GOKA 4NCBA 5M04A 4DV7B 3KYDB 1K92A 2OSBA 4QSMA 2D4AA 1YO6A 4R01A 1OX6A 2C57A 4IIYA 5L3ZA 3LPCA 5TR9A 2ZBUA 3AF1A 4OU5A 2BE9A 3HFJA 3LKZA 4A6PA 2YXEA 1JECA 721PA 4JI0B 2G88A 4CV3A 1HTBA 5FBHA 2HM7A 3L1HA 3QTBA 1CUUA 2PUEA 4MJ7A 1KOJA 4PZCA 4E5YA 1ZGCA 2FWRA 2FZVA 2NQ8A 3MCVA 2XQJA 4QYSA 1YIAA 5AWFC 4AIRA 1B4DA 4NENA 3RS9A 1XTBA 3CJQA 1PNRA 2HN9A 3RSCA 3UW3A 4EHLA 2YXBA 1KPIA 3CRQA 3ZBQA 2PGXA 2EG9A 4E03A 1E8DA 1CY7A 2JFNA 1XZAA 1MO5A 3BCHA 4LG1A 3O0DA 3WWZA 1WPQA 2ZLBA 2HZ7A 2QUKA 2GNPA 3E82A 3HGTA 3O31A 4K6GA 3HXQA 2V7QA 3CEJA 1KJIA 1TADA 4NV3A 4OXKA 2QYHA 3ZQ4A 2UYCA 2C98A 1PJ2A 3DLTA 4ED9A 1M8GA 1TK9A 2BMDA 1A9XB 3PQ4A 3I6ZA 3JYQA 4N7RA 4UHCA 4ZC1A 4DCTA 5KSZA 4RK6A 4D9JA 1O94D 3AHEA 4CMHA 4ZTBA 4KIUA 1Q6YA 2ZVDA 3GCWA 1O8CA 2UYQA 2DGDA 4D43A 5C1DA 1BH2A 1GLNA 5D5PA 1HG1A 1XDGA 5HQJA 3BMCA 3QVUA 2QN1A 3A1NA 3LY8A 3QUSA 5EZYB 2ZVJA 5HIAA 5LZ2A 1WZUA 3AFGA 2WAXA 2VXOA 1YR8A 2BEKA 3KOXA 2WHPB 2X0FA 3BZBA 2HA4A 3Q7PA 3W3AH 1EX6A 1ZGJA 4U5XA 4PLFA 4PYJA 4D0SA 4ZQEA 3ZZ0A 1SQSA 5DWDA 3AM5A 3MINA 4ALNA 1PT5A 5LP6F 3P9KA 3EHDA 4RQAA 2W6QA 3PQ6A 4LE2A 1PP4A 5FCDA 1IY2A 1H8EA 3ZTYA 2Y27A 1JEJA 1N6NA 4C07A 2FXIA 2V4UA 4MKFA 1K5PA 4AMUA 4W63A 4RTLA 1TIPA 3OO0A 2XRZA 5AJHA 1Z4IA 2NWQA 2RK3A 3KR0A 4V0RA 2X6TA 2YVUA 2PZMA 5IDVA 3T12A 5FHRA 5JZBA 3DC7A 1NPDA 4IIJB 3IDAA 2Q27A 2VTBB 3ZOKA 3U4HA 4BFUA 3CSDA 1N57A 5E95A 5FXMA 1DKUA 3KZXA 5EINA 5FR2A 5SYNA 1N1EA 3QF4A 4TOIA 4ZT2A 4BCBA 5KIAA 1G38A 5K0LA 5KOHA 4OX9Y 3K1AB 1JQJC 3MPUA 1GGHA 2MSDB 3RWMB 2RC6A 3INTA 3G02A 4XASA 3QU9A 3IAS1 1SQ5A 2XMCA 2QG6A 1KVQA 2ZIXB 3AUTA 3B7WA 4LTDA 1NSFA 4BEWA 2JI6A 3GAMA 5KYWA 1BJTA 5G1PA 1PJCA 3WGQA 2ENWA 5EIXA 1QHNA 4FI3F 3T3MB 5DGCA 4M54A 3NFRA 4Z2YA 1WF6A 1PHPA 3PJDA 2CFCA 1G3RA 2J30A 2VQ3A 4J76A 1U7ZA 2A33A 5FBRB 5BSWA 4N5LA 3R9XB 1LS6A 1I6LA 1MC8A 1QANA 3G7SA 2WIKA 1BROA 2X41A 1KFEB 3CXUA 1CUVA 5CJPA 3HC7A 3VYWA 1XAIA 1ZUWA 1Q22A 2NTJA 4JHXA 4QAJA 3L0BA 1ORWA 3DZFA 4ZQGA 1GNSA 4QFDA 1LLQA 3I34X 4UHEA 2IE0A 3T95A 1G2PA 2PRZA 3URMA 3DHWC 2POQX 4OKIA 4CNQA 4DCJA 1AM4D 4RSRA 4DUYB 3CUWA 2WTXA 1YFLA 3ECAA 1W25A 4MKHA 1FDIA 5ALJA 5KPDA 1HSOA 4TRMA 2G25A 4YRFA 4FT4A 4ZXFA 1ZAKA 1QP0A 5IEJA 1SB9A 2QRMA 3ZN2A 4BY9E 3L7KA 1NMZA 5LSAA 3FSGD 4CG3A 1UBUS 1L4FA 1MX3A 2JBAB 3GW8A 4QDKA 4PFJA 2ON6A 4G1VA 1P4GA 1I3OA 1KEKA 4L6CA 2FPPA 4OXXA 2V6MA 3OX4A 4Q4CA 2PL5A 3O7MA 1SQ6A 3CU5A 4AMGA 3FZGA 3A14A 2XUJA 3MTIA 1ZK2A 4BMOB 1KSFX 1W46A 3I2FA 3TUIC 3U17A 5IN4A 2JZOA 4OHZA 4IXNA 2XCSB 3WYFA 2Q41A 4CIBA 3JYPA 1VPTA 2IS4A 1GGEA 1DEHA 3JV7A 1LLCA 3QVGB 1J33A 3DQPA 2VHXA 3GEHA 4PZ9A 5KB3A 3EG9B 1JDPA 1IZ9A 1F14A 1TMYA 2ZJ8A 1OX4B 2JA2A 3HABA 3HBNA 4Y9TA 3W7AA 3WK8A 1ZFNA 4QGHA 3USZA 3F47A 3ENKA 3ENZA 4JYPA 5H9VA 2DE0X 3DE5X 5FQOA 5TPWA 3F7MA 2CLEB 4FYYA 3PTZA 3TPZA 3OJCA 3QHQA 3D3NA 4PINA 3A7DA 3R7WB 1W87A 3PLNA 2R4QA 4YCAA 4ZVUA 3GGSA 2X8JB 3AU9A 3DQZA 4I99A 1NXTA 3S2UA 2VXBA 2Z5FA 1KIFA 3ED5A 3G2KA 3V2UA 3WNCA 1SU7A 4YJGB 4F1JA 4F85A 1FIUA 4E0BA 4OBEA 1TYZA 4FFBA 3ZNOA 4HUJA 2PVCA 5DBIA 1KDOA 3KEMA 2ZYAA 2PM8A 2R60A 1A2KC 4HAOA 3LI2A 1QS0B 4EZBA 2MU1A 4Z8XA 4W6ZA 3ZHXA 1ZXXA 3BE4A 5ICSA 4DQXA 1OW3B 1YUMA 5CA0A 2Y1GA 4YMUA 1W36C 2HWYA 4LVCA 5FUMA 3KOWA 4ALKA 2REQB 3ODPA 4B8YA 1FYVA 1Y8RB 5BV2P 4ARBA 4PGHA 2WSLA 4IDDA 1T3GA 5K3AA 3SF8B 3WLNA 1ECGA 4GICA 1AOXA 3PICA 3JWHA 2CJXA 1LJ8A 1QBGA 2A5DA 3PRKE 4YA6A 2OXIA 4ARUA 1K9SA 4BLRA 5EJ8A 1U4OA 5CT4A 2GXSA 1DRWA 2HEGA 1FLDA 4KX3A 5K6TA 1ODCA 3E9DA 1QYCA 1XHEA 2FZEA 3HRHA 4AJLA 2VDPB 2WJHA 4E15A 2PH7A 1M2OA 3DV9A 3H16A 4GMFA 2WA2A 4KI7A 4TQ9A 1OLUB 1XMSA 2HNBA 3P19A 4WKCA 5KQMA 1CUHA 5FOQA 3MVEA 5JXWA 3SHTA 1WBJB 3EY9A 4AZ3A 1Y81A 1ZK3A 1COZA 2VHWA 3GUZA 4TKUB 2FPMA 1NP3A 1G6HA 2GLUA 2PA0A 1AT1A 5ITSA 4TYMA 1J0XO 1KYXA 5BN5B 1DARA 1NUUA 1E18A 3GEMA 1E2EA 2KPOA 3GFTA 3HU3A 3KQVA 3RPEA 4FYMA 1Z6ZA 1G5RA 3KXKA 4NJEA 3VMFA 2ZAIA 1J0AA 3ACCA 2JBWA 2XOKD 2E2WA 4RC9A 4QQNA 2B1QA 2QF7A 3N3AC 1LBTA 3CCCA 4PX9A 4L15A 2GZRA 1E3IA 2I3AA 2B5WA 3HR4A 1I1NA 3QXHA 1M73E 4NS1A 4NFHA 3HKBB 1TFUA 2PE5A 4J75A 2PH1A 4ZTUB 3NC1C 4EW2A 5F51A 2WT4A 1FFXA 3H4IA 4FGUA 1WUJS 2NSDA 5KBYA 3ADDA 1UBGA 3FPBA 4WLEA 1QYWA 4M1YA 1UM9A 1L5VA 1AD2A 1RACA 1Q83A 2UZ1B 3GD5A 3WRYC 2VJOA 1VIMA 3LDGA 3PF8A 4HNSA 3NAMA 1MB2A 2E87A 2FSSA 2I78A 3EWIA 3ACBA 4J2TA 4MWEA 3I5YA 5CVCA 3V97A 1NI5A 2XDYA 3DLIA 5BUSA 1M1NB 2C3YA 5D5HA 4PVCA 3FFXA 2EFHB 4B7ZA 4X3OA 2ZTHA 4MI1A 3S81A 2BIFA 4DE5A 2F6RA 2GRJA 3C7DB 4GM4A 1QH8B 4JJZA 1B16A 2A6PA 2XI4A 3A2LA 4BNHA 4FLMA 4RE5A 4X1KA 3EOAI 1TYDE 4D6PA 1N5IA 1VDZA 3T3IA 5LMUB 2XEXA 2ZREA 2GCGA 3EA5A 3NLLA 4NY1A 3AB7A 1W8DA 4L5JA 4HL6A 4J9VA 5FTKA 3S4YA 5I5EA 5KYYA 5AVVA 4AT1A 4MV5A 3UT6A 3WIOA 3DBOB 5IDWA 5DWQA 1WB4A 3IVCA 1RPNA 2X2FA 3CLHA 4M60A 2V0GA 4MQLA 4NU0A 1S2NA 1V8FA 5IFLA 2Q6VA 1H1LA 1CYEA 2JCYA 3FNFA 1TRKA 4XDHA 5CGZA 5DMXA 1K9VF 1CDEA 3EW7A 2C88A 2G5PA 5I01A 1IZ7A 1K8ZB 5C31A 3IP8A 4PC6A 1I4TD 2WWTA 4Z1MD 3UN1A 5HEKA 3UFXB 2O54A 2OHVA 1NC1A 4N5NA 4BNNA 2QD2A 5AKHA 5ALXA 3K8OE 5CVEA 4G6ZA 5B3JC 2D00A 3OE7A 2WD9A 2XY4A 3FJYA 3AEKA 3C1UA 1GCGA 2NU8A 4MV3A 3GLFA 3DGEC 5A71A 1F5NA 3KOMA 4Q9NA 1FXSA 1UOPA 1XCMA 3U40A 3CEMA 2UAGA 3Q85A 4I2VA 7REQB 4B7XA 4PSAA 4MAAA 4J3FA 3OPYB 4BNVA 1EFRA 2BEWA 1YXMA 1UKCA 3KHKA 2YXPX 2F8LA 2VK1A 1HMYA 4ZI2A 2XUIA 4OQEA 1Z0FA 2F3UA 1Y7TA 3KQYA 4ICIA 4JDPA 1QH1A 3VHQA 2VPQA 4BQPA 1QVVA 1M2EA 4QYXA 3HHPA 1SR8A 3VR6D 3WWOA 1VCIA 4KNYA 3DR3A 3DXFA 4GZ6A 3C8MA 3I4LA 1T6XA 3R9WA 2YNMA 3O75A 1NX6A 1RTTA 4OIMA 3HV0A 3P0EA 1FUIA 4QPNA 1YDMA 1RM3A 3RD5A 2F8SA 3FDXA 4JZKA 3U09A 2AF4C 3LY9A 4JI8B 2PFKA 4HUTA 2IWRA 3V3TA 5J4LA 3IEMA 1ZNWA 2ADFA 2ZSFA 3ME5A 2FRDC 3QE2A 5KINB 2ABWA 3O8NA 5JJCA 2Q5CA 4ZVKA 1GKUB 4CM8A 3KOZA 4I0WB 2SNIE 2R47A