1T6NA

Crystal structure of the n-terminal domain of human uap56
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
b'SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase
publication title Crystal Structure of UAP56, a DExD/H-Box Protein Involved in Pre-mRNA Splicing and mRNA Export
pubmed doi rcsb
source organism Homo sapiens
molecule tags Pre-mrna processing protein
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t6nA00
1NSFA 4CT5A 1OH8A 1IXRC 2BBSA 3AF1A 3K70B 1F2UB 1E9FA 1HTWA 4X8MA 4LHVA 2WWIA 1GAJA 5J47A 1Z0JA 1J2JA 1XTSA 1ZU4A 3SJAA 2L0XA 1RJ9A 2EYQA 2FGJA 3BH0A 1EX7A 2WWYA 3THWB 3D3QA 2OILA 1WP9A 4NCHA 2QAGB 2G0NA 2ERXA 4KCGA 1NJGA 4POAA 4R7ZA 5CIWA 2ZSFA 1X8LA 2EFEB 5K8IA 3IHLA 1N5IA 4PC1A 1E2EA 3H86A 2MSDB 2Q3MA 1K5DA 2WICA 5KNCA 2QBYB 2JLXA 3QEJA 1X8KA 1GOTA 5B58C 5F3WB 1VPLA 2F3RA 2ZE7A 3KKMA 2CHVA 4HLUA 4JKIA 5FOWA 2VTKA 3D31A 3OEEA 2R6DA 2BMJA 4QRHA 3WNDA 3BB4A 2W6JA 1DAKA 1GIAA 1VG1A 1YZNA 3AM1A 1QDEA 2GZHA 4DBLC 3O8RA 1Q12A 1V5WA 1KJYA 1Q20A 1ZIPA 3SS8A 4OBEA 1NL3A 1X86B 4UNQA 4I81A 3C7KA 1II0A 2QMEA 2DFLA 3QXSA 3TW4A 4BFYA 4ZO4A 2XZPA 4MKIA 1IXZA 2N46A 4O3MA 4B3BA 5EE3A 4ZDWA 3CRMA 4WXRA 1TF7A 3N2EA 3AUXA 3EZ9A 3HP1A 3RRYA 2C99A 1TEXA 1K8RA 3KQUA 2F43A 4LJ6A 2ZI3A 4M21A 3WBJA 2CE7A 4Q18A 2DB3A 1X1RA 1ZM2A 2Q21A 2KWIA 2X2EA 3OAAA 3SFZA 4B43A 3QEOA 5CK5A 2FDCA 1J7KA 4GPTA 5FBRB 3Q3JB 4URYR 3B82A 1EXMA 1DAFA 2PMKA 2GILA 3Q72A 4Q4HB 5P21A 4TLAA 1GZSA 4HDOB 2G1JA 2WWFA 2CL0X 2AD1A 1OSNA 4XSHA 1ZD1A 1WXQA 1SVMA 3H2YA 3SN6A 2YC2C 3IGFA 3PUVA 1YJ5A 4D4MA 2GA8A 3KKPA 4Q4HA 4DSNA 1GL6A 1EFTA 2CL7X 1E3MA 4AYXA 3K09A 3MWKA 4XH9B 5J4KA 2QP4A 4B3CA 4LI0A 1JEEA 4OHVA 5HE9A 4DB2A 2BMDA 1QBKC 1KY3A 2GXSA 4QBHA 4QM7A 1O87A 5CYPA 2IK8A 3TSWA 4C9BA 3NXSA 3AGQA 5H68A 4BASA 2AN9A 5EP2A 1VHLA 2TMKA 3PUYA 1Q21A 2I3BA 5SZJA 3GD7A 3C4JA 3EASA 3U3OA 2W2XA 1Z6GA 1QZXA 2HCBA 4CEIB 3SR0A 1ZUHA 4NMMA 1U8ZA 1RRFA 3FTQA 3GEIA 5TB5A 2H8KA 3MSXA 4CT4B 4R71A 5GJBA 1XJCA 5KNBA 2XJ4A 5SZKB 2AHOA 3N5CA 4OI1A 5IK2A 5TVKA 1XD9A 2FFQA 4XVRA 2PJZA 2VSFA 3X1YA 1JALA 4LRWA 4LBYA 4DUGD 2JASA 4M1MA 4D0GA 4D4KA 2JLVA 2RGEA 2BWJA 2KI5A 4D4JA 4KSCA 4YDSA 2CCKA 3I32A 4U5XA 5AJYA 2VF7A 4EUNA 3QKUA 2V1XA 3DZ8A 4RFSB 2ZYTX 3U61B 4M1WA 2PT7A 4OJQA 4XVQA 2IUUA 3UG6A 4PC6A 5EZ5A 2BV3A 2CVFA 3KTAB 4GMXA 2ZR9A 1W7AA 4HAXA 2NZ8A 4LC0A 3MFYA 5FL7D 3W3ZB 4B3FX 4US0R 2HV8A 2XB2A 3ZVLA 3PCRB 3IIMA 3I72A 1T3SA 1Q1ZA 5E95A 4ZDJA 2IW3A 3SJCA 4EQ6B 2H1LA 2ZSBA 2ZRAA 3PG5A 3GEHA 2IYUA 1E0SA 1Z07A 1ZM3A 5AR1A 3TGPA 2CXXA 1A4RA 3QNUA 5JJIA 2V6JA 2PX0A 3LQRA 2ZUCA 5JSZB 3ZS9A 5HZHA 4Q4AA 4DCTA 5DGXA 4YMSA 3E70C 2CHQA 2YOHA 1R7RA 1WRBA 1ZNXA 3X1ZA 2GF0A 4EQ6A 3GCGA 1KDPA 1Z6AA 1QHNA 4AG6A 1G6OA 5JSZA 1QVAA 1OKKD 1Z0FA 4KAXA 1BOFA 1NF3A 4D26A 1TQDA 3QVUA 2IYZA 5TDHA 2D74A 3TQFA 2ZITA 2WJJA 1KI6A 3GMTA 2E87A 5AUOB 4TYWA 2YV5A 2ZUBA 3EPJA 4ASUD 5CDFA 1ZJ6A 1G17A 1PJRA 3NEJA 3WMGA 2CK3D 3SQXA 4TMVA 3L43A 4Q1DA 3B1XA 1GKUB 1XMJA 1E2JA 4A8JC 4HAVA 4FIDA 3BBPA 5FPYA 2C98A 1FX0B 1YZLA 3RVBA 3OFND 3QF4A 1Y3AA 2V1UA 2VQSA 4HI0E 2VHCA 3IQWA 1G5RA 1O3YA 4XWAA 4MKGA 3V9PA 2OG2A 2VRWA 1YR6A 2P67A 4DC9A 3BD9A 1IJFA 6Q21A 4AY2A 2WWGA 1Z22A 1J70A 2WOOA 1FX0A 3PR1A 3A36A 1ZD8A 2OBNA 3LD9A 1KKLA 4I1SA 2VYFA 2FGKA 4KFUA 1OFHA 4LC1A 3ICEA 4YLGA 1D2EA 1TTTA 2QN6A 1Q1BA 4M1SA 1FOEB 3UANA 2J0UB 2R6FA 2XJ9A 5CB6A 3KJHA 4ESVA 1G41A 3B2EA 4K81B 2QTFA 3CWZA 2IWHA 1XZPA 4MRNA 4Q1BA 1KMHB 1FQJA 2OCYC 4ZI2A 2E9SA 4QHTA 4Z51A 2HXSA 3IEUA 2GXQA 4BE7B 4HEJA 1G8PA 5KTYA 3TRFA 1NVWQ 4BZXA 3FHTA 1UKEA 3ND9A 3IILA 2O5VA 4EIWA 3SDZA 2O8BB 1FW6A 3B1ZA 4V0LA 2WSMA 1AQYA 5EUMA 1JEDA 2F3TA 2IEYA 3QE0A 4HUTA 1KMHA 5EE1A 2XSZD 3IKJA 4Q9KA 4LYFA 3QY0A 1FMJA 1XNJA 2YOFA 4PPNA 3RS4A 4B3XA 1S8FA 3FYHA 3CWQA 1W4BA 4B3DA 5FUXA 2A5FA 5EXTA 3EARA 3EPKA 1DADA 1X1SA 3KZ1E 4D80A 3SZRA 4LBZA 1LS1A 2JIZD 2VF8A 4C0LA 4HDCA 5BXQC 3WHKA 2GAOA 4C2UA 5JWHA 4Q03A 4Q19A 2RGBA 1GSIA 2RHMA 3CM0A 4XJXA 1DS6A 1E1QD 1E96A 3W34A 3U3KA 1E6CA 2GVDC 2ZUDA 1IBRA 3C14C 1N25A 3K0SA 2OCBA 4KJZA 1RIFA 4MRVA 4O2LA 1P9WA 5KYKA 1XMSA 2ATVA 4MH0R 1Q57A 3M0EA 3A37A 1H8EA 4TLEA 2BVNA 4NYIQ 4HATA 3U60B 3FDIA 3QG5A 1T5LA 2GJ8A 2QEQA 3A1WA 3ASZA 1BKDR 1YE8A 4DCVA 1UBCA 1OF1A 3VKGA 5DE3A 3K0CA 3V4FA 1F60A 2FPKA 5K8UA 4XD7D 5FOXA 1ZM4A 1E9AA 5F9FA 3C16C 3HU2A 3T61A 4CRWB 3OIYA 1E9CA 5FPSA 1OXUA 3OE7A 5CDFE 1HUQA 1G19A 3HDTA 1R5NA 3K1JA 4CEJB 4PO8A 2G0TA 2R44A 4TN1A 3A4MA 2OE2A 4LSGA 1ZINA 4PHHA 2E1RA 1KHTA 3DPUA 2JCSA 3LX8A 3Q8XB 1Z0AA 1OIWA 3L8ZA 1SVWA 2ORIA 1L4YA 3W8NA 1JR3D 4TZ6A 1OLOA 4DUGA 4CEJA 5DYGA 2UVQA 1UDXA 5JZVA 1ZYUA 3THYA 2UZIR 1TQ2A 3NEYA 2VL7A 3VQTA 3IBYA 2ZJ5A 4TMXA 1L8QA 1SVOA 3DVLA 1GILA 1S1MA 1ZIOA 3K8YA 1C9KA 3SC3A 4L16A 4EPXA 1EX6A 2GXAA 5JCPA 4LPSA 3IIJA 1GNPA 3NBYC 4BFXA 3HWSA 4LYJA 3U3RA 5HTKA 3TSZA 5C4MA 2FU5C 1VECA 1CKEA 2OFOA 121PA 2RGNA 4L15A 4ZCIA 1G16A 4DT1B 2MSEB 2Y8EA 2C2HA 3G5UA 3AVUA 3SQWA 1XMIA 3C5HA 3R9WA 3FHCB 1UAAA 3VKHA 4I1UA 2WMNB 3EZFA 5DH9A 4NBSA 3WMFA 4P31A 1L7VC 1W36D 2C9CA 4Q4LA 2ZJ8A 3SYLA 1AS2A 3QKTA 3VR2A 1OHHA 4M2LA 2PL3A 3L0IB 4QKQA 4DT1A 3QXCA 3VR4A 4DJTA 3RS3A 3L82B 2JLQA 4B6EA 4F4JA 4HUQA 3LX5A 1OYYA 1UFQA 5B2ZA 4V0KA 4LBWA 3EXAA 2BMEA 4HLCA 1OKKA 5LBIA 3EW9A 3C5CA 2V9PA 3WXMA 2GJ9A 2P0EA 4QGAA 5KNDA 2IYXA 2WHXA 4ILEA 1KI7A 4TLBA 4D81A 4JYCA 1WMSA 1OIXA 3OEED 4Q1FA 2NGRA 1P2VA 2QSZA 3ETLA 4ASUA 4NL4H 4OQNA 1W4CA 2OT3B 3U6BA 2CK3A 2W6JD 4A0RA 5GVSA 5JRZA 2IT1A 3AGPA 4B48A 3TNFA 1Y63A 1BS1A 4PXAA 4MRSA 1ODFA 2DFTA 4G5GA 3OFNA 5IDVA 1ZRHA 2FSHA 4EJSC 3CZPA 1E4VA 4FWTA 3MLEA 3UG7A 1YZTA 2AD5A 2ATXA 3EAQA 5LB4A 3FPAA 2YINC 2RGAA 2VEDA 3A4LA 2QQ0A 4FN5A 3RS2A 1IY1A 5F98A 1T6NA 4IVPA 4OI4A 4JVLA 5AUQA 2GK6A 1US8A 1T5IA 2OAP1 2ZSEA 2ZRDA 4KFTA 4US2R 3LAWA 4NE2A 2ZRKA 3GJ8A 1E2GA 2OFXA 3ZVNA 2OCAA 1F48A 2VSXA 2REBA 4D0LB 3WYGA 1KIMA 3HPQA 4JJZA 2BM1A 4DLUA 3QOFA 4C0HA 5GJWC 1G5TA 4E5UA 3IO5A 1S3GA 2ERYA 3B7GA 1Z0IA 2P6UA 3AVYA 2BHRA 2J5XA 3OAAD 4W5WA 1L4UA 1KSFX 1Z0DA 3AKYA 5SZIA 1VCOA 3UMFA 3RSOA 4Z1MD 4RKEA 5K8TA 2QM7A 2QZ4A 4L5BA 3PV0A 2EFCB 4YMUA 3Q85A 3PEWA 5EQTA 4KYIB 1VYTA 4G1UC 4MRRA 1E9DA 1QHYA 1NKTA 4Q66C 4II7A 4CVNA 4IXNA 4UKDA 1NY6A 2DWQA 3W5IA 3PFIA 1JNYA 4LHWA 4IDQA 5LD2B 1G64A 1JJVA 1FMLA 3NH9A 2C77A 621PA 2XEXA 2YOGA 4LHZA 2JIZA 3MWYW 3G0HA 2AKAB 5CJPA 4PHGA 1N6LA 2AWOA 2NG1A 1TF2A 4B44A 3LVRE 1MV5A 3T15A 4PO9A 4N0DA 2IA5A 5FPHA 4PC7A 4M1TA 1RYFA 2C9OA 3NH6A 4WXPA 1WF3A 4PZZA 2DHRA 1E1QA 4AYTA 3FMPB 3FMIA 4IDNA 1N0WA 2G1KA 4PPQA 1V43A 2PMDA 1FNNA 1E2MA 3VU9B 5L8VA 2IYLD 4P4TA 2BOVA 4C0BA 3I62A 3BFXA 2R65A 2IYQA 4QNMA 4IXMA 4LJAA 4GZMA 3EPHA 1R6BX 3U4QA 3CR7A 3R8FA 3U3JA 2CMKA 2FH5B 2BKUA 1EFUA 4WZAE 3SBEA 2ZS7A 2QT1A 5KOYA 4IDPA 2WJVA 3EZ2A 4C4PA 2HYDA 2QT0A 3VU9A 4R2HA 4E22A 5IK2D 3EIHA 1IN4A 4FI3C 1PLJA 2Z4RA 3U44B 4RZ2A 4AKGA 1DO0A 4DCNA 4C3ZA 4G5QA 5KSZA 3H0KA 4Q48A 1M74A 4W5HA 2YHSA 4JLOA 1NLYA 2F1RA 4NYIR 4WOPA 4AWXA 1CJKC 2AFIE 1HT1E 1S1CA 3CRRA 1Z2CA 2YYZA 3U44A 3ZZTA 5C1BA 4CF7A 1CP2A 2YWEA 5FBQB 3I61A 3RWOA 5AJXA 1NVUQ 2ZIAA 4JS0A 3GLFA 4C0KA 1LV7A 3B1WA 1VCIA 1NNEA 1MOZA 4PSAA 2QY9A 1JR3A 1E94E 2P65A 1KZ7B 2A30A 3NC1C 1KSJA 2VH5R 3ND8A 3OEHD 2HCJB 2ZRNA 2ZRJA 2ASEA 2Z6VA 4UNRA 1GM5A 1J8YF 3CX7A 4QXAA 3IO3A 2ZRCA 2J45A 1BH2A 2NO9A 3CF0A 2GF9A 2JLSA 3N70A 1KY2A 1T4GA 2Q9BA 1QF9A 4GI7A 4TT3D 2IXFA 4LBVA 1CU1A 3CO5A 1W44A 1W36B 4PSVA 1HA3A 1G7CA 1GITA 4BQSA 1DG3A 1LW7A 2G83A 4AC9A 3PIRA 5EE0A 2QTHA 4N1AA 4V0MA 1QHGA 2PZFA 4BZPA 2ANCA 3KJIA 3VR5A 4E09A 1NN3A 3SHFA 4ZIRA 3T5GA 1XPOA 4YXWA 1OFIA 4S2EA 2R6CA 2HF8A 2ZREA 3I8XA 2GEDA 4ACAA 1JQLB 3GFOA 2OAQ1 3VTKA 2PX3A 2BEJA 2VO1A 4YQFA 1QHHA 2DFKB 4DCUA 5AJWA 1SGWA 3W9YA 3X2SA 1IJEA 1N5JA 2HT6A 2NTYC 1AIPA 1E32A 1UBEA 2GRJA 2QENA 3LY5A 3MWLA 4M8NE 4QFMA 5EE9A 2AR7A 1VCNA 4MUBA 2B8TA 2VIIA 3KKNA 1JXOA 2J9RA 3KUDA 4HDQB 4DLZA 4FCWA 1X6VA 2GWHA 1BIFA 3EC2A 1JB1A 1E9SA 3AVWA 3EZ6A 3AVOA 4Q9IA 1VCMA 5FTKA 4BFUA 4Y0VA 3REFA 4PQFA 1G9XA 5B57C 1Z6XA 2DWPA 1VG0B 2NQ2C 2QPAA 2XOKA 1S3SA 1XTRA 2YWGA 4JSYA 4TYQA 4TYPA 1Z06A 4GRAA 5L3RA 4Q5IA 2IUSA 4DLVA 3PEUA 1NJFA 1B0UA 2BBTA 3NBFA 5E4FA 2P3SA 3F8TA 5DIFA 3QSYA 3BH6A 3GJ5A 1I4TD 4LYHA 1ZW6A 1E2NA 1QHSA 1IOZA 5KPDA 1Q1QA 2XZOA 1VG8A 4EFNA 3GLGA 3JZMA 3O8DA 2HDNB 2FFBA 1MR3F 3GJ6A 1AGRA 3MWJA 2F43B 5G3ZA 3RHFA 1F2TA 2OBMA 4CIDA 4GP6A 4D4LA 4NYMQ 1VYUA 3A6PC 3NDPA 3EA0A 1U0LA 3SYNA 1J90A 4BECA 1EFCA 3RYTC 2JGNA 1ZNZA 4KLZA 2V4ZA 3C8UA 1HYQA 4CGZA 1Z6TA 3W6PA 3FE2A 3KL4A 2GCOB 3U7GA 5JWRA 3A1VA 3NVAA 1AM4D 2HJVA 3X1XA 5GADl 1BYIA 1W5SA 1JR3E 3L0OA 3ZGXA 1P9RA 5M04A 3WNCA 4Z1MA 4XTRA 1EK0A 3T12A 3IBGA 4A6PA 4W7SA 4A92A 3VNVA 2V8OA 1E2LA 2FWRA 1R5BA 4JVMA 3LXXA 4PAOA 5GJCA 4B76A 4TYNA 1XTQA 2GCOA 1SVLA 3KXIA 2FX3A 2WMOB 4WIAA 3E1SA 3OIVA 1P62B 3CLVA 3DZDA 2AKYA 4FCTA 1KI4A 2NIPA 1P73A 2FG5A 2REOA 2ONJA 1BMFD 1YZGA 4B75A 3LDAA 1ZVQA 4IOMA 1YZQA 5G53C 3WRXC 4Q01A 4RD4A 3DEFA 4C7OA 1H8ED 3T1VA 1XTJA 5FI0B 4XIGS 1ESNA 3W5JA 4V0ME 3V4RA 2QP9X 1F5NA 3RS5A 4QJ3A 5F9HA 5E3HA 4RD2A 4F4CA 2GESA 2QORA 3DMNA 3WP0A 1E0KA 5KPJA 5AWFC 1SXJA 1E0JA 3H84A 2ZAOA 4JVSB 3ASYA 2ZQ5A 3X1DA 1Q44A 2QMOA 4BLRA 4TYYA 3A1UA 3BIFA 3LH5A 1AS0A 4EJSA 1XXHA 1AGPA 3S1AB 5AUPB 4OK6A 3OE7D 2PEZA 3VHLB 2D2EA 2R62A 2FNAA 5E7JA 5KDLA 2C03A 4HZIA 3ADBA 2QMHA 3SEAA 1MH1A 3PEVA 1S9HA 2LWIA 1CJTC 5JECA 3CNLA 2F55A 1OJLA 5EZ6B 1N5KA 3Q7PA 1OFTA 3S1AA 3BJIC 2ZI5A 5E7MA 1VMAA 1XFAA 3K9GA 1SZPA 5DLQC 5DSZA 1E1RD 1FQKA 1G291 1P9NA 1R4AA 2CEAA 4BFVA 1D8TA 1TL7C 4G01B 4NTZA 4Q7LA 4Z54A 1U98A 2NO6A 5CB8A 4NCIA 1VDZA 3VX4A 3AKCA 2IYVA 2ZVQX 1G8HA 4A0HA 3P32A 4PAQA 1KSGA 2ZI7A 5LDDC 1W0KD 3LNCA 1J8MF 1Z83A 1A2KC 3GJ7A 2FE4A 4JT2A 4WZ6A 2GKSA 5EXXA 2IL1A 3GLGE 2F1IA 4IFBA 3EWSA 4Q4AB 4P4SB 5UKDA 5C18A 3OEHA 1XJ0A 3DKPA 3MD0A 5HCNA 4UNPA 5G41A 1XCMA 5DO9A 4GMDA 1HE8B 4N3NA 5KO2A 1A2BA 1U9IC 2WAYA 4Z8XA 5FOTA 3H1TA 4PC3A 1GG2A 3B78A 4TT3A 4G3XA 3UATA 4DSUA 1OHHD 5FOSA 4P4SA 3TVDA 2IHYA 1E99A 2AFHE 5EP3A 1FUKA 1KI6B 2C9YA 2JJ1D 4V0OA 3TW8B 1I2MA 2CE2X 2WKQA 5EXPA 5AK0A 2EFHB 5A5GA 2B8WA 4E07A 2JA1A 4JL5A 5DYIA 3KQHA 2XZLA 2QUZA 2MSCB 2Z5FA 1EWQA 1GRQA 4MKHA 4JJKA 2FEMA 4AURA 4ZKDA 3QF4B 2V54A 2ZYWX 4PC2A 2KB0A 1GKYA 3BB1A 1Z3IX 2FJUA 1E0AA 1OXTA 3H4MA 1ZU5A 5FFMA 3TBKA 4B32A 2QA5A 4IEIA 4M22A 2HF9A 1NIPA 3D7MA 2ZYUX 4KVGA 4R98A 1AK2A 1NMYA 3LQQA 1ZUIA 4HYYA 5AJVB 2OM2A 4MKFA 3WRYC 4RVCA 3TE6A 2P5SA 4OHXA 4BLTA 1RZ3A 2ZVPX 4PQRA 2D62A 1DAHA 5L3SB 1OXVA 1GRNA 4JLNA 3RRNA 1DAIA 3FVQA 2ZTSA 3KB2A 5IT5A 2C8VA 5FUVA 3P4YA 2R6GA 1SXJE 2N1BA 3K9NA 4L8GA 4BLPA 2DWOA 4JLDA 1DG1G 1OB2A 3BH7A 3UWKA 3WNBA 2AXNA 2F9LA 1HQCA 5L3SA 3D6TB 4DKXA 1TQ6A 5JI2E 4DLWA 2LKDA 5EXSA 1I4DD 4M9QA 1M8PA 3MJRA 3SJBA 4OHYA 3FHOA 4ERNA 3KUCA 2ZRHA 4B3GA 3ZIAA 5HZKA 1TU4A 2QM8A 3ZYCA 2VBCA 3GJXC 4IFEA 4CDGA 4RD0A 2GETA 2XB4A 3TR0A 2H18A 2FMXA 2DCUA 3B60A 3LLMA 4QGGA 2KE5A 4CEHB 4BFSA 1ZMXA 1PUIA 4XSGA 2PCLA 4MRPA 5J4VA 2PLFA 4DIEA 4YMVA 2CBZA 3CH5A 3Q5DA 1JPJA 2H7VA 4X8HA 1T3HA 3JVUA 2MMCA 4PZYA 3GP8A 4EPTA 1G7SA 2WZQA 2WJGA 4FXPA 3O47A 4RZXA 1TNDA 4CEHA 4NYMR 3NHBA 1U99A 1CXZA 3GLIA 3CIOA 1EFHA 1QHXA 2J0SA 4LGMA 1UKYA 1LF0A 1TPZA 3Q5EA 4FD2A 1Q1EA 1Q3TA 3TLXA 4MGIR 2CNWA 4TL6A 2A5YB 4HB4A 2FPLA 2BKEA 2BM0A 4URUR 3PJRA 4MGKR 3SJZA 4GP7A 2G9NA 1ETUA 5SZHB 5ANRB 4Q7KA 1ZCBA 3BFVA 2JLZA 4GL2A 1I4LD 3QUSA 1M2OB 1BMFA 1DBSA 1N6OA 1BO6A 1H8HA 4HAZA 2GBLC 1R0WA 3VMFA 5DN6D 2BJVA 3HYRA 4LZZA 3SYKA 2EVWX 2NO0A 1A5TA 3ECCA 1NSTA 4QBIA 1Q0UA 4KO8A 4NH0A 3IUYA 2QU8A 1M7BA 1EESA 1S96A 3MRSA 4HLDA 4NKRA 3KDSE 1IN6A 2LKCA 4GFDA 4KBGA 2OO7A 5AUNB 1W36C 4E03A 2QI9C 1Z08A 5DHFA 4DHEA 4JLAA 2GXUA 2AXPA 4A2PA 1MRSA 3T1TA 1N6RA 4Y0AA 3NBZC 1HEIA 1NLFA 1X3SA 4NP6A 1EFRD 2AL7A 1H65A 4DZZA 2WJIA 3THYB 3DM9B 2BCGY 1W1WA 1KNXA 1P2SA 1W48A 2FZLA 2J46A 2QAJA 3G82C 2YWHA 4L9WA 5BN3A 5JBQA 3CONA 3LLUA 4Q1EA 1LY1A 1YZUA 4L9SA 2ZRBA 2ZRGA 1UEIA 3LW8A 1II8A 2RGXA 2WWWA 4MDFA 2BC9A 5H70A 2PZGA 1M7HA 1E1RA 2QAGC 2A2ZA 2GEUA 1QVRA 3UIEA 5K8LA 2XGJA 3MUFA 2ORVA 4NCKA 3CR8A 4C0AC 1OYWA 1RYHA 4HLUC 4O25A 5TXGA 1N6KA 3LVQE 1NRJB 2IS1A 4GOJA 3RDPA 4M0LA 4OK3A 5FPKA 4J0QA 2ZS8A 3KQLA 1G18A 3MMPA 4LK2A 4JVNA 2EU8A 1KO1A 1T3LA 2I4IA 1XP8A 2I1QA 1W0KA 2OUKA 3I5YA 1PVOA 2O0HA 2VPPA 3ADCA 4U7DA 1LF5A 2OXRA 3T1OA 4A82A 4BFTA 4TL9A 1ZBDA 4OI0A 1Z47A 4TL8A 5G40A 3UPUA 1DELA 4CW7A 4FMCF 5HKKD 5FOVA 5J4HA 5L3QB 3I5XA 4HUQB 1P7CA 1UADA 4Q00A 4YXWD 3U6KA 3BOSA 1G3MA 1NVVQ 3M6AA 4UQOA 1Z2AA 1IXSB 2IF0A 4NDZA 4RFVA 4TTPA 4DEXA 2FSFA 1Q3HA 2Q9CA 1NG1A 3SU8A 2O8CB 4MGYR 4PR0A 3CBQA 4KLNA 2O8FB 4GNKA 1N6HA 2IYSA 1KJWA 1KSHA 4OYHA 5L3QA 2JJ1A 3VHXA 4DCSA 2WJYA 2ZPTX 2X1VA 1MT0A 1U94A 1MO6A 4OL0A 4PO1A 3RNLA 3O8CA 3CRW1 2QG6A 4LJ9A 4Q7MB 2GJKA 2IXGA 1C1YA 3GEEA 5GVRA 4BZQA 2XNDA 2AX4A 2O8CA 1R2QA 1QG2A 1SULA 5A0FA 5J4YA 4QL3A 2O8FA 5EE5B 1XRJA 1FFHA 3K70C 1JQJC 3F0TA 1A1VA 1ZP6A 1KK3A 1DOAA 2EYUA 4AYWA 2VP5A 2A5DA 5HR5A 4TZ0A 3N2IA 4OJKA 2CLSA 1JXMA 4O0MA 4URZR 4A1FA 2D06A 1N3BA 1RRPA 2XOKD 4LOAA 3HYTA 2CHGA 2GAAA 1US8B 4V02A 1OXSC 3K0FA 3OF5A 4PANA 1VKJA 3DM5A 1NLZA 1XD2B 4X8LA 5JRJA 1TX4B 1R0ZA 2ODBA 2AWNA 1E2HA 2ONKA 2ZSDA 3K09C 4FMDF 4TWZA 3REGA 4DLRA 1G7RA 2ODWA 4DDWA 3AVTA 1XBTA 1I2DA 4MYHA 1F6BA 1KMQA 4TMKA 3B13B 3IPYA 1XD2A 3QPUA 3QXJA 4LJ5A 3PQCA 4YONB 1T8TA 4MA4A 4PQYA 5HE8A 3QJYA 3OZXA 4DLXA 1P60A 4HB0A 2QNRA 4AIIA 4KBFA 3C41J 4QOSA 4DVGA 4ESHA 5C46F 4MYTA 2FFHA 2Q0HA 2YKGA 5JS7A 2PBRA 3UKDA 1KO7A 1XZQA 3CNNA 3TUZC 1D2MA 2JLRA 5A4JA 4XWOA 4FW9A 4F91B 4IDHA 3QXHA 4QHSA 4FMBB 3R9IA 4DDTA 1GNRA 2IYRA 1CJMA 4OK5A 3VR3A 1YKSA 2BDTA 3CKLA 1N0UA 4BLOA 4A36A 1KK2A 4EPRA 3CUEF 1CR4A 5E7IA 2RKOA 1NN0A 4KXFB 1AKEA 521PA 4BUJA 2HYIC 5JJKA 1D9ZA 2ZJ2A 4OQMA 2OBLA 5FBVB 4P3YA 1G6HA 2NPIA 2B21A 3IDQA 4URWR 3ONWA 2QE7A 5FUYA 1N6PA 4EKDA 1PZNA 2JJ2A 3AF3A 4LUCA 4W5JA 1SVSA 3W8RA 4WVFA 4A8JB 1XEWY 2ZRIA 2RHDA 2OCPA 3I73A 4WA7A 5JEEA 1W47A 5EP1A 3P20A 4IDOA 2B6HA 1D5CA 2JJ8A 1JI0A 4LHYA 2KBFA 3U4QB 1K5GA 2G6BA 4Q9JA 1UPTA 4ARZA 4ACBA 1E2FA 3R20A 3U7HB 5CM8B 3DKVA 1SXJD 4NONA 3T1QA 4JKYA 1MO4A 3AP1A 3LBHA 4A8JA 2GCNA 4Q47A 1DAGA 3TQCA 3EWAA 3THXA 4ABYA 5DN6A 4LWZA 4TMTA 4KHZA 2PT5A 3AP3A 1OH7A 2W2VA 5IF9A 4PAMA 3A1SA 3WBKA 2IUTA 3ZD7A 2ZJYA 2GEVA 1GDDA 4TMWA 4B6FA 1HE1C 2IYTA 3NC0C 4JZKA 4WAUA 5DHAA 4FMCB 4K46A 1TUEA 3R8CA 1U8AA 4JYBA 3EPLA 2NOAA 2F6RA 4LY6A 4Q1CA 4XOIA 3B85A 1IN8A 2JEOA 2ZE8A 3LRPA 4A0FA 4DSTA 1T9HA 4OQXA 1CTQA 4IVRA 5CITA 2QRZA 1EWRA 2F7SA 3RS0A 4AG5A 4D6PA 3GLFB 2O0KA 1NMXA 3I3SR 1MO5A 3BK7A 2CL6X 3B1VA 2PJRA 4DB4A 1JBKA 1SKYB 1LFDB 1YZKA 1Z28A 3CRVA 5EUQB 1G5PA 2BJWA 3ZD6A 4Z8YA 5L3VA 4ZDIA 1EFRA 4TQAA 2Z4SA 2EQBA 3FKSD 1P4SA 4F4IA 2EFDB 3GFPA 5TY0A 3QF7A 4BEJA 5CLQA 1XEXB 3VNUA 1E9EA 5AJZA 3T35A 3TKLA 2HXYA 1R5OA 4HSEA 1SHKA 1TADA 5HCIA 3FGNA 1MABB 1QG4A 3HR8A 4C30A 3I4LA 1W2HA 2OXCA 5LPNA 1W49A 4HB3A 2OEPA 3HJNA 3UXMA 1D6JA 3CPHA 2O8DB 1CLUA 1YQTA 2REXB 1XEXA 3RRMA 1WBBA 4ZIRB 4P0TA 1NIJA 3GLHA 4NCJA 1MABA 4Q02A 3KB1A 2WSSA 2ZRPA 2H92A 3WY9A 4FMDB 4HB2A 1KI2A 2R2AA 3B1YA 4QJ5A 2IX3A 1P5ZB 4BRWA 1DAEA 1E2QA 4WZBE 2WKPA 5B30A 2YJTD 2GJSA 1QHHB 1AQUA 2O8DA 4C0JA 2WBLC 2Z43A 5HKKA 5KSOA 3W90A 4YMWA 5FL3A 4B2IA 3R7WA 2CLDX 2QRNA 1M6NA 5G3YA 5FR1A 1WQ1R 4LJ4A 5JJLA 4W9MC 1IY0A 1UKVY 1A7JA 3NG1A 1KTVA 2ECKA 2EWWA 3UMSA 4DSOA 4LPKA 4EFLA 3GPLA 1KDRA 3QKSA 1TMKA 4Q4JB 5J5CA 3EC1A 2VSOA 3A1TA 4URXR 1T0JB 3ADKA 1E9RA 3LXRA 4GBMA 3VAAA 2WOJA 3BGWA 1NVVR 5FR2A 1XDBA 4KFSA 2HLDA 4ZCMA 3AP2A 3W6NA 4V0NA 2FOLA 4R9UC 1YU9A 2IHBA 2SHKA 4Q4JA 1NI3A 3ICQB 4G0NA 5FI1B 5FPTA 1FNMA 3GLGB 3EG5A 3TH5A 1F2UA 1F2TB 3RRZA 3KFXA 3DL0A 2Z83A 3KFVA 3VKWA 3ZQJA 1JR6A 4F93B 3KX2A 3BB3A 1G4UR 2BEKA 5J4LA 3THWA 2CLCX 5JS8A 4P4UA 1GL9B 2QAGA 1JAIA 4RZUA 3ZIAD 2Q6TA 1II9A 2RAPA 2J7PA 2IEZA 4PTLA 2R6AA 3K0CC 3WYFA 4A6XA 1FUUA 4OKSA 1G8GA 3K0AB 4NU0A 4DLYA 1W4AA 2R9VA 4BLQA 1N0VC 3SE0A 2QBYA 4MGZR 3CX6A 4QNRA 2WPDD 4JSTA 4TLCA 3PENA 2ZROA 5C2JB 2N42A 4AD8A 3RC8A 3AKEA 1CJVC 3PXGA 3TMKA 2J0VA 4OI2A 4OHWA 1RFLA 1U0JA 2XTNA 3CPJB 1VIYA 3TVTA 1G20E 1GFIA 1U81A 1KDTA 2B92A 2OFWA 4H1UA 3GLFE 1G8YA 3K0AA 1AS3A 3PEYA 4BLSA 1SKYE 3LBIA 1YR7A 1OV4A 1SVKA 3DO6A 4FINA 4CYMA 4LV8B 3PUXA 3LFUA 5D3QA 1GTVA 2CNWD 3RABA 2ZANA 5FUWA 1ZCAA 4C7OB 2VHTA 5HPYB 2HUPA 4H1VA 2W83A 2ZR0A 1XTKA 1KGDA 3U2QA 1FP6A 2I1VB 4B2PA 4D82A 4PFSA 1W0JA 1CS4C 1UKZA 2GCPA 3V00A 4LV6A 1E4YA 5FBWB 3GLHE 5FBLB 2IS2A 1W46A 4QHYA 1PUJA 1SXJB 4AKEA 5C4GB 1H8HD 5EP4A 3D8BA 1AA9A 2H17A 3QXXA 4Q21A 4UXJA 3MGCA 2P5TB 4EDHA 3CB4A 5JMTA 2GNOA 2YNMA 2XTMA 2P6NA 1XXHB 4EJSB 1P3JA 3CZQA 3NTUA 1NVXQ 1ONBA 2RGNC 2UKDA 2FFAA 4JMPA 5ELXA 2V7QD 2WIBA 4JLKA 2ZS9A 2GZDA 2QPTA 2MMGA 2ZYVX 1ELOA 1PLKA 3WMEA 1CRPA 2X77A 2Z0MA 5JFGA 2D7DA 4BGDA 2O0JA 2PCJA 2WAXA 4JBWA 2ZE5A 3KXKA 5TARA 3HPRA 1YVDA 2ZI4A 1Z5ZA 2IF2A 3PITA 4TTQA 5KDOA 1TU3A 5KSPA 1N6NA 1WCV1 3SHWA 5IRCD 1DE0A 5B64A 1NKSA 1FP7A 1T0HB 2XNSA 4RZ3A 2BBOA 3QENA 3WP1B 1RRGA 4M4SA 2EW1A 3QQ5A 1XF9A 4RD3A 1KOFA 1NN5A 1P6XA 3FOZA 5D3MB 1LTQA 1E69A 721PA 5CK4A 2F9MA 1FTNA 1G21E 1COWD 3I1FA 1Z8FA 3FKSA 1NBMA 4RJLA 2OHFA 3T06B 3ZS8A 3M4YA 4IJMA 3CRQA 4P32A 1KAOA 1XX6A 2KJQA 2H57A 4H9GA 2PLRA 2WM9B 5BN4A 2PEYA 1HURA 3TUIC 221PA 3ZH9B 5BWMA 1TF5A 4KYUA 4JL8A 2WWHA 5D3MA 4I4LA 3UK6A 1GL7A 4CEIA 1R8SA 3FMFA 2IBMA 3AF2A 4GT1A 4LJ8A 2X8AA 2YWFA 4HAUA 3AF0A 3U5ZB 1E2PA 4EPVA 1GP2A 2J7KA 1GNQA 8OHMA 3EX7C 3P27A 4M1OA 1NMZA 3RWMB 4Q9HA 4AK9A 1YRAA 4EFMA 2J59A 4IRUB 2ZR7A 3DHWC 4IOLA 2HJGA 3LV8A 4KU4A 1XEFA 4RFSA 1U2RA 2WTUA 3U7FB 1ZUNB 2GK7A 4HZUB 3KTAA 3KXLA 2JATA 2XNDD 2ZRFA 3RS7A 3VX3A 3E5HA 4A15A 4A2QA 2O8EB 1T8UA 3CX8A 2DPXA 4RKFA 3BAFA 3L0SA 4RSGA 1NY5A 4LJYA 4PHFA 1U8YA 1VYVA 3AEZA 4MITA 2RGDA 4HZUA 3Q7QA 4M9SA 3LO5A 421PA 5JHGB 1RVDA 3LBNA 4ZI3A 3K9HA 1VHTA 1C4OA 2O8EA 4AI6A 4UXIA 1KI8A 2QQEA 4UNNA 2W2TA 2BIFA 1OPXA 1KK1A 1AN0A 1U0HC 1DVRA 4IEEA 3KQKA 3FFBA 2JLYA 1IY2A 3A58B 4URVR 5LD2C 1IN7A 1DEKA 1CR2A 1KK0A 2CDNA 2YZ2A 3JZAA 1FL9A 2QMUA 3HR7A 2JAQA 1E79D 3NBXX 1PLLA 1Q22A 1XXHE 2W6ID 3E2IA 2WKRA 2KBEA 1ESMA 4JLVA 4LHXA 5FTMA 1CF4A 3BXZA 1S9DA 3IIKA 1U90A 4I99A 4PZLA 3VFDA 3ZZUA 1XEWX 3U3MA 4DEYA 2NPFA 3LW7A 4A9AA 1G3RA 1ZNYA 4L4UA 4ON9A 3DOFA 4WW0A 3QI2A 3A8TA 3C15C 4BWYA 2ZEJA 3W6OA 3J81k 3BERA 3AVVA 4DDUA 3IEVA 3KKQA 4G5SA 3THOA 5TMPA 1UBFA 3GLIB 4BRUA 5JLJA 1OH5A 2VP0A 2WPDA 2PZEA 4JLMA 2Q3FA 1WE2A 4QC2A 2FPMA 3L8YA 4B2LA 2G3YA 2A3RA 2IXEA 2QPOA 4CZ2A 1AKYA 2JDID 4LYAA 1NBME 2KSQA 1MKYA 3IPXA 1ZAKA 4YMTA 4KITB 2FV8A 3ZVRA 2QE7D 5J40A 2C78A 3ZLJA 1XMVA 2JJ2D 2V55B 4B33A 3BORA 4UJ3A 2J0UA 1GVNB 5BYKA 3M1IA 1UBGA 1QHIA 2YVUA 2IYWA 4PPFA 1GKIA 1S0UA 5DNYB 1DARA 2OV2A 2DY1A 4US1R 2A78A 4GZLA 5CIQA 4DWJA 5JI3E 1DTSA 1E2KA 3O8BA 2IS4A 3UMRA 4A4DA 1CR1A 3CNOA 2FN4A 5GJVC 2WV9A 4KV9A 1UF9A 1VIAA 3P1JA 2O8BA 4RD6A 5BW8A 1UJ2A 2XX3A 1M1YE 2C04A 3GJ4A 3QKRB 1ANKA 1KJZA 4JBYA 4V03A 1RPZA 3JVVA 4JLBA 4DLSA 4AKIA 5IHPA 3EIQA 4IOKA 1IN5A 5EJEA 2QROA 2D3WA 4ZKEA 1HT2E 1R0XA 2ZJAA 1HY3A 5DISB 2FSIA 1RE0A 2XTZA 1KI9A 4PSKA 2H16A 4I1VA 2V7QA 3QPVA 2QP3A 3QKRA 4ZCLA 3AB3A 2QTVB 1D2NA 2GHIA 1OXXK 1N6IA 3Q9LA 4TSFD 4C0SA 2VLIA 3EIEA 4KI0A 1II8B 2B7BA 4JLPA 3F5FA 5FTNA 4S35A 3TK1A 3BC1A 1OIVA 4IW3B 4ZDKA 3B9QA 1K6MA 1XPRA 1VTKA 1G8FA 2YC4C 3BS4A 1WB9A 3MJHA 4B73A 1KYIA 1G4AE 4NHOA 3SOPA 2JLWA 4D2IA 2IS6A 1F3OA 2W00A 3KJEA 2Q9AA 3EZ7A 4TTRA 2FSGA 3ZVMA 1GUAA 1E2IA 1XJQA 4BFZA 4DRZA 2BCJQ 3CF6R 1XB2A 2QGZA 3K9LA 1B23P 3CW2A 1TEVA 3KKOA 1W4RA 3OESA 1RW4A 1XWIA 4GDFA 5DI3B 5JEDA 2QSYA 1IQPA 1GWNA 4P33A 4RCZA 4BFWA 1T91A 2J1LA 3CPEA 5KDDA 4BPBA 1BYUA 2DR3A 3TJZA 2W0MA 1COWA 3GJ3A 3MAAC 1L2TA 1CEEA 2G77B 3ZZ0A 4RCYA 1X8JA 3IQXA 2RCNA 3K53A 1MO3A 2DBYA 4IVQA 4Q1AA 1P72A 5KSYA 1OH6A 3KQNA 4LCBA 3R9XA 2D7CA 1SVIA 5FOUA 1HQYE 4LJ7A 3WHLA 1G3QA 2CCJA 5FH9A 5CM9C 2D4HA 2WSSD 5DI3A 2O52A 4KVAA 3UWOA 4HAYA 2R8RA 1DPFA 4NYJQ 2VP4A 1NP6A 1RC8A 3NWJA 4A0GA 2EFGA 1S4QA 4F38A 2F1HA 2NZJA 2IWRA 3BRWD 4G5OA 4A2WA 1ZC4A 1NG9A 3AH8A 4DXAA 4DIDA 4XVUA 1RKBA 1TUIA 2FA9A 1SQ5A 5KUTA 3GQBA 4QM6A 5FL7A 4B74A 1UEJA 1PV4A 4TQUS 3FFAA 2WJHA 1E98A 4NPHA 1XCPA 3AVPA 3F3YA 5CYOA 1J99A 2OLJA 2W0SA 2RGGA 3NIBA 4IOJA 2ZM5A 3HU3A 3GLIE 1Z0KA 2IYYA 3B9PA 2NO7A 4RD1A 4XTCS 1R0YA 3A4NA 4QBGB 3TUJC 3VR1A 4F7WA 2NMVA 3DMDA 2ZI6A 3FKQA 4QJ4A 2UZ3A 4ZV4A 1GRRA 4OQFA 5CJ2A 2HLDD 4LV5B 3K0FB 4DLTA 1KKMA 2OSBA 2VHUA 3QVVA 1ZM7A 1R8QA 4LDJA 3ADDA 3CH4B 1FPMA 3GJ0A 1SHZA 2FF7A 2XITA 1CJUC 1OW3B 1ZM9A 2CVHA 2WWXA 1FTSA 4M9ZA 3NHAA 1UDWA 1OT3A 3ZJYA 3K70D 1KI1A 3QBTA 2AK3A 3FB4A 4B71A 5KU1A 2EWVA 5BN5A 4AKHA 3OHMA 3RAPR 4ITRC 4M1KA 1N5LA 2J87A 4KFRA 5BYJA 3BWDD 4JLJA 3LWNA 2J0QA 2Q3HA 3MG9A 1CR0A 4EAQA 4C2TA 1LVGA 2J7PD 2AK2A 3T34A 3VR6A 2C96A 5H8WA 1G7TA 4TMZA 1MRNA 1SXJC 1XCGB 3TAHA 1WA5A 4HAWA 1Z63A 1LNZA 1E79A 1W5TA 2W6IA 2DFNA 3QBVA 3WYAA 4X8OA 4KSBA 3GFTA 821PA 4IHQA 4EPWA 3HU1A 2OESA 1OFUX 1WBDA 2ANBA 1XD8A 3QIAA 1G3UA 4PHTA 1CULC 3NKVA 1WDTA 3BE4A 3TIFA 1KO4A 1ZNWA 5JHHB 1NN1A 1P61B 1U9IA 3I92A 2VP2A 3OIUA 4GSYA 3AV0B 4KODA 1R10A 3L2OB 1KI3A 2XAUA 4NZYA 1JJ7A 4TLDA 3ZQ6A 1A82A 2NO1A 1Z29A 1LB1B 2A5JA 2VA8A 4Q9LA 1CRQA 2JDIA 3FWYA 4OQLA 1W0JD 3W3AA 3IHWA 1HH4A 2P6RA 4ARZB 4B34A 4GOXA 1KO8A 2XXAB 4XWKA 4OHZA 2D2FA 3SI7A 2ZJZA 4QGFA 2RMKA 3L0PA 3SFVA 1E9BA 3MCAA 2WIAA 2CCGA 3THXB 5F2EA 1XPUA 3BFKA 2GVZC 2ODEA 1S2MA 2ZXUA 1D9XA 2BBWA 4YC7A 1TAGA 4MQBA 2RB4A 3AVXA 4M1YA 3TR5A 2X2FA 1JPNA 2K5UA 2XSZA 2V6IA 2C95A 2XXAA 1YR9A 1XU4A 2OLKA 4HLQB 2GDJA 4D25A 2X19A 4WBSA 4I1OA 1G3IA 4N0EA 1TQ4A 2QGNA 2ODNA 3P4XA 2ZRLA 3AKDA 3K0EA 1XTIA 3RLFA 4JL6A 4TQ9A 4EPYA 2LCFA 3SBDA 2FEOA 3B5JA 5DI9A 4B35A 3DDCA 2VP9A 3EA5A 2ZSAA 2A9KA 4IKEA 2ZRMA 1DO2A 4M53A 2ZU6A 4LX0A 5CLLA 2QL6A 5BQ5A 1M7GA 2IC5A 2ZAMA 3B6EA 1SKQA 5JCZA 4U00A 4YDHB 3U7EB 1EGAA 2JLUA 4RY2A 3ZDQA 2ZU0C 4TSFA 1IONA 2B7CA 3KJGA 1RRCA 3RSLA 5H1YA 1KZGB 1YHNA 1G1MA 4BEBA 3B8HA 2PH1A 3QG1A 2V3CC 1YRBA 2BMFA 1KDOA 3PUZA 1NBMD 2GTPA 3AF4A 2H5EA 3DOEA 2VHQA 2OZEA 5JWOA 3NDBB 1JAHA 1KNQA 1P2TA 4JBXA 1FZQA 1VG9B 2DYKA 4JT4A 1LS6A 4QBFA 4XD7A 5FTJA 4G5RA 4C0QC 1P2UA 4R2IA 3OIWA 2ZJOA 3GLHB 2GJAA 4UJ5A 3CF2A 3P26A 3PUWA 4MYUA 3TAUA 2G88A 3PVSA 1Z6YA 5FTLA 2CJWB 2GZAA 4UXHA 3LA6A 1ZC3A 4Q7JB 1AZSC 3FMOB 3T5DA 1IM2A 2P2LA 4JIMA 2J41A 1KAGA 1AJEA 2ZI9A 1IAQA 2FZ4A 1HV8A 2A7QA 2ORWA 4PPGA 3R7WB 4QGHA 1ZD9A 1OB5A 4K8OA 3I8SA 1M34E 2C5LA 3RC3A 4D0NA 2J3EA 2CJWA 4U02A 4GOKA 2HEIA 2RGCA 3AUYA 1KO5A 4M9XA 4QG7A 3TSOA 2ZJBA 4PX9A 4FCVA 4UNSA 2W58A 3QKSB 2VP6A 1UM8A 5KHOC 2VHJA 2WVJA 4MUAA 4TL7A 2RH5A 3X1WA 4F92B 2A5GA 4MDEA 2ZETA 2GBLA 3AVQA 5LB2A 4B47A 1DAMA 1IHUA 1E2DA 2F1JA 4O2RA 4ZPXA 1AZTA 1CBUA 4NYJR 1CIPA 4FWIB 1RJ9B 3QPWA 1W2GA 4DDVA 3RANA 1JECA 5TV2A 1N2CE 1P75A 2HT1A 3AQ4A 1QRAA 1EG7A 1OE0A 3SNHA 1YR8A 4MYCA 2ZE6A 4NCNA
chains in the Genus database with same CATH superfamily
2F17A 3SEQA 1ULBA 1U80A 4P53A 1E9FA 4BQQA 2WKSA 3RJ9A 1L4EA 1Z0JA 1J2JA 4ARBA 1XTSA 4B85A 4BIIA 3C8ZA 1P4HA 2FGJA 4A5SA 1EX7A 1F9EA 1MGOA 1U2EA 3D3QA 1X74A 3NHMA 4UM9D 1WP9A 1GQ2A 2I80A 4MWTA 4NCHA 3Q7IA 3VSCA 5ICCA 4FU0A 2ZYRA 4POAA 2YHIB 3FPEA 3JQGA 1YZ3A 1WHTA 3I6YA 1J0XO 3IE2A 1P7WA 4NY1A 1X8LA 3U1VA 2RGYA 4QXQA 2J4CA 2B5WA 4CF5A 1AV7A 4EHBA 1IEVA 5CA1B 4J29A 3BIWA 2ZYHA 1MEOA 4PGGA 4M3NA 3FBGA 3VDXA 3WGMA 4CMKA 2Q3MA 5AW9A 1K5DA 1VE5A 4MWOA 2OXFA 4PVCA 3QEJA 1X8KA 3T3GA 3OZEA 1YAHA 5F3WB 2YHIA 1VPLA 3I2YX 3VKUA 4BX8A 4GEGA 1A1SA 5K01A 3OEEA 2O23A 2BMJA 4QRHA 2XMSA 2BM8A 5GONB 3UJAA 4CM9A 3RRFA 5GM2A 1OTXA 2MYPA 1PT8A 5CA1A 1H4QA 1KZ6A 2CLFB 2VJCA 5DHQA 3RSQA 1VG1A 5HBGA 5A6VA 4LXQA 2TMDA 3IS3A 1GPJA 2JBHA 3KT3A 3OECA 5FX2A 2H9AA 4HDSB 1D5WA 2GYVA 4RS4A 5GY7A 4QOHA 3TFOA 1G59A 4C88A 1ZIPA 4PRKA 2W42A 1NL3A 4AP6A 4GU5A 3KOXA 4B6JA 1X86B 3EXEB 3KZVA 5GONA 3C7KA 4C20A 4ZOEA 3N7AA 1BMTA 3QU2A 3USCS 2Z9CA 4J91A 3RC9A 5CDSA 5F2KA 4Z1OA 5HJEA 5A7HA 1Q77A 2BE7A 1FFGA 3MS2A 1UPUA 4QTZA 3FBWA 4HDSA 4OY3A 4ZVOA 4BCCA 4KDEA 3S4YA 5KQGA 1SMKA 3M9XA 2QL7A 1K8QA 1VRWA 4G1BA 5D5HA 3CRMA 3S5JA 3UUEA 3L40A 1E3TA 3CW9A 3N2EA 4HQ0A 3EZ9A 4F8JA 5BUQA 4IJ5A 3G0HA 3HP1A 2UZ0A 3RRYA 2C99A 2AW3A 4YRRA 3R7LA 3OLWA 3DOJA 1X8XA 5BWBA 1K8RA 2F43A 4LJ6A 2E4XA 3GGCA 7REQB 3DR3A 1P0QA 2H54A 4K88A 4WOBA 3USZA 3NWOA 4Q18A 1XNRB 3LPDA 2C07A 2Q21A 2QVXX 2XVYA 3SC4A 1U7WA 2PYIA 1VLLA 3SFZA 3ZCRA 4G0ZA 2YFHA 1VC2A 1HFKA 3QEOA 4R84A 3MPUA 1J7KA 4GPTA 4YLEA 5FBRB 3ZY4A 1QE5A 2C3YA 2W22A 3B82A 3Q72A 5P21A 2MCFA 4ZANA 4ZVPA 3IVRA 4CLRB 1GV0A 4Y6LA 4NICA 4TLAA 1GZSA 3OTIA 4HDOB 4FYVA 1I5EA 3TVYA 4JGGA 3EBLA 1WXQA 2AOWA 4FC7A 2NZUG 1R0BA 2O3UA 3B5IA 3K4QA 3IVGA 4IZIA 5AVWA 2RK4A 3IGFA 2B25A 1JDZA 3GGOA 3R6WA 2GA8A 1RYBA 3PKIA 4PZPA 5JQGA 3KKPA 1ZH8A 3AHHA 4CLRA 4G9GA 3L7DA 2CL7X 3O4FA 4WCFA 1GTJ1 2Q9UA 2B61A 3K09A 3QTBA 5J4KA 4YV2A 5K8JB 2OECA 1NT4A 3B6KA 1JX6A 3R0JA 3WWYA 4BV9A 3E7PA 5HE9A 4DB2A 3F4KA 2DLDA 1KY3A 3H9GA 2H2GA 2O7SA 4K9LA 5CYPA 2IK8A 3CRZA 1OAOC 4EYKA 4NVRA 1ISHA 4PNHA 5H68A 3C6KA 2XWQA 1NR5A 1VHLA 1Q5PA 2NWQA 1IVYA 4KXNA 2FFRA 3K1YA 4OAOA 5EKSA 4ZVSA 5BN4B 1OILA 3UOGA 3IP7A 3KJQA 4KZPA 2WLSA 3WGQA 2ZCJA 3L1JA 1QZXA 2HCBA 3KB6A 4FOSA 4YCSA 1PYOA 1NVKA 3PLNA 2HD4A 4E4YA 1NURA 1RRFA 1WJGA 5IAKA 3O8QA 2EIXA 1B26A 2C3OA 2II6A 3MSXA 3OP4A 5TB5A 1A04A 2J6CA 2RGUA 5SZKB 2NAFA 3N5CA 1Z5WA 1GEGA 4ZODA 3LYUA 5I47A 3G0OA 2FFQA 3QP9A 4P4NA 5DHUA 5TQJA 3X1YA 4LRWA 4BTLA 4V38A 2RONA 3KQWA 1WPXA 5REQB 4DL9A 4JR0A 2JD2A 2JLVA 3LS2A 2BWJA 5DBHX 4KSCA 4D4JA 1TEHA 1WB5A 2E5WA 4U5XA 3UWPA 2ZYTX 4MJ3A 4MGHA 4MW5A 1XCLA 3OTWA 4GX2A 3ZWNA 1BX0A 3RNOA 1UOQA 4OATA 4D8VA 1SQ0A 4FKBA 3R23A 4GMXA 1T2CA 2WU8A 1ZGBA 4JOBA 2OOSA 4PINA 1C9YA 2OO5C 3MFYA 5FL7D 4N0PA 1QTQA 1YA6A 3E5MA 5I7AA 4B3FX 3SAJA 3E8SA 1QORA 2HV8A 4LYGA 1AVTA 3DDUA 4UZEA 1UZUA 1QCDA 1T4BA 3GDGA 1T3SA 5LZ7A 2VG8A 1Q1ZA 2WNSA 5ERXA 2UYGA 1V26A 2H1LA 4D9HA 3VTAA 4M8LA 2IYUA 1YVPA 1BCRB 3CLUD 3QNUA 4RA6A 3RU9A 2Y0CA 3LQRA 5JSZB 4BDTA 1MVNA 5TJ9A 1V6AA 2JARA 2O50A 2YIVX 5A2GA 5DGXA 4Z4FA 3M6MD 3R44A 4OYRA 2CHQA 4WMLA 1LDEA 4XDHA 4GUAA 4AU1A 2Y1FA 4RF2A 1QQ7A 3OF2A 1UXKA 2D0DA 2BAGA 1GN9A 1PW7A 2ECOA 3MWFA 4RV9A 1C3LA 3HHPA 2YZKA 4C5BA 1ETHA 5JSZA 4LDRA 1IH8A 4KAXA 4NE7A 2VJMA 7ABPA 1TQDA 4RKQA 3BGOS 1TQHA 5J2TF 4FKZA 1PWXA 2OZLB 3KTFA 2FZ5A 2NVBA 2Q7XA 3PT5A 2BFBB 3VPHA 4D1YA 4TYWA 2FK8A 1IWOA 1IPEA 1CDZA 1Z6ZA 3ETHA 4WLVA 3IDOA 1M6YA 1ZJ6A 1G17A 1FYVA 2HRQA 3NEJA 1GPNA 4HEHA 4LF5B 4TMVA 4D9GA 1I30A 3B1XA 1IWPB 1GKUB 1XMJA 2WYIA 4YJ3F 4A8JC 5KB3A 2FG6C 3K1AB 1YZLA 2BFPA 5EWMB 1MH9A 2FQQA 3BEDA 3HJCA 1SOAA 2C4TA 3D6JA 4HI0E 2KW5A 1O3YA 3A04A 1WDLA 1H6BA 4DYVA 4MKGA 1KWKA 2FWIA 1YR6A 2P67A 5CVEA 4IG9A 1DCFA 3MPOA 3D8RA 4ETMA 5A4AA 1O5OA 4AY2A 4FR5A 4CKZA 1Z22A 2DP4E 3Q0IA 4S2UA 3S6JA 3GYGA 4EA6A 3LP6A 3A36A 1GCUA 4R81A 2Y67A 2W6ZA 5EWMA 1U4OA 1RTTA 1FRVA 5IVDA 1HKHA 5CAEA 4HFRA 1XQVA 3DZFA 2FQ1A 1ZUWA 4GW3A 4FLEA 3KOUA 2PHZA 3GT4A 4JXXA 2C5HA 1Q1BA 2VI5A 3M33A 5IVKA 1DKOA 3S8YA 3QMPA 3RUDA 4ESVA 1G41A 3PLAE 1E64A 3M4JA 3PL1A 2IWHA 5KWIA 2ZUEA 1S8NA 3IQIX 3QVOA 3SP1A 3KHKA 3OU7A 1A96A 1KMHB 4LXUA 5JNSA 3R41A 1L5LA 2E9SA 1UBUS 4U7JA 3JCZA 4BE7B 2DF8A 1A8UA 3DCYA 1EDDA 4HEJA 5KTYA 3WGLA 1UKEA 3ND9A 3QLEA 1QHFA 4OFWA 3M2TA 3RYIB 5IYZB 2PVPA 3ZNOA 3B1ZA 1WKVA 1P1RA 3OCYA 4GPEA 2HMYB 4DMMA 1JEDA 3STHA 1RT9A 2J4DA 2IEYA 4G37A 5HKLA 3AEKB 5G2OA 4ZXPA 1HZJA 1KMHA 2P4QA 2XSZD 3IKJA 4U9IS 1LKZA 4LYFA 4NAUA 3C3AA 3CEHA 2YN4A 3RS4A 1N34B 3PQ3A 1R0CA 2OP0A 3LT0A 1K9VF 4KIWA 5F7JA 4B3XA 4E32A 4TM7A 3D3KA 2BR3A 4B3DA 5JS2A 1ESEA 5FUXA 4AMZA 2A5FA 4ZVMA 1L7DA 3K7EA 3LBAA 4NECA 1DADA 3V7FA 3IKTA 3IBFA 3PQEA 3EPKA 1JDUA 1C4XA 4LBZA 1IEQA 5EZQA 4YN3A 1KXZA 1JG3A 3AEKA 1Y4UA 5BXQC 4MI6A 4ZOLF 2XWJI 3B6IA 4L5CA 4OLHA 4AP5A 4M87A 1CUSA 2YZNA 2RGBA 4MS1B 4UQLA 3CM0A 4KDCA 2AR0A 1DS6A 3RTGA 1E1QD 1E96A 1Q1AA 4PNPA 3ELBA 5L53A 3UHJA 3RJTA 4UVGA 1N5DA 4OL9A 1N25A 2QUJA 3NTVA 4FE3A 3PF8A 1ST2A 2MDTA 1SUCA 1OU0A 4NFLA 5KYKA 1P9WA 3ZVKA 3D0QA 3SIPA 2FCAA 5ICFA 3U9LA 3W79A 2FW7A 1FMCA 4MI9A 2ATVA 4ND6A 5LOVF 3A37A 4UVHA 1MZVA 2E4YA 2VLBA 4MZXA 5EUCA 4D3DA 4DREA 4TLEA 2G09A 5JZ9A 3WYBA 2Z1MA 4HATA 5SY9A 5HILA 3OUZA 3AY7A 2BTOA 2DUUA 2PX5A 3QG5A 2D5CA 3G02A 3OA2A 3ASZA 1YE8A 2XE4A 1OF1A 3OLQA 2B1QA 3PNQA 4BNGA 5DE3A 5HS6A 4BBPA 3V4FA 3N58A 2FPKA 3IH5A 3VR4H 4N5IX 3LT2A 1UM9A 4IHJF 4XD7D 5FOXA 3VU1A 4BGVA 1E9AA 4AY5A 1P77A 1NPYA 1RKUA 5FBZA 1KZ4A 4D3FA 2P2CA 5LSAA 4NG5A 1OXUA 3HSKA 3WDMA 1LJUA 2HZ7A 5CDFE 4JLUA 4EATA 1GR0A 1HUQA 3UYLA 3N2LA 1GGMA 4JBGA 1U0TA 2R85A 4TLMB 2VTEA 4FB4A 5TPWB 1MC8A 4KUHA 4BVEA 4CM8B 3NRCA 1BQ4A 2IRWA 2FAXA 3HCEA 1DMSA 3HCNA 1KHTA 4K3UA 5E8JA 5ADWA 4GXQA 1Z0AA 3E03A 1SVWA 2ORIA 1L4YA 2D8AA 4OHRA 3EGEA 3IMFA 1U2QA 2C57A 1Y4ZA 1K5HA 4XM0A 1T2NA 5HEKA 1XP5A 2PD3A 4X7RA 1FDRA 1JR3D 4ZCTA 3F4BA 5DYGA 2UVQA 3TLKA 5TPWA 4KWTA 1EJ2A 4ALMA 3HL0A 4QODA 4XJVA 1Z2DA 3THYA 2UZIR 1TQ2A 3LIIA 1ZGAA 2KM1A 2Z8XA 5JASA 3VQTA 1PJTA 2ZJ5A 3QXGA 3LUAA 3U16A 4YPOA 5I5GA 3W5SA 1ZIOA 4J0EA 3QE3A 1E2BA 3UT0A 4EPXA 1EX6A 4BJ1A 4CIVA 3NBYC 1YNSA 3NOQA 3HWSA 4LYJA 1LDMA 4I3HA 3RS9A 4G0PA 1ZPDA 3ETEA 1EUYA 1TLTA 3ZKAA 4OAQA 4CKBA 3HO8A 1N7HA 4KEAA 2DHCA 1XMIA 3R9WA 3HLKA 2EL7A 3VKHA 2O2CA 4P31A 5GAJA 1W0CA 3L84A 4G5FA 1KQNA 4B80A 1CYDA 1L7VC 3IT2A 3ILXA 4NAVA 2NU6A 3D5EA 2ZJ8A 4RIGA 2OQ2A 1YE3A 1HDIA 3QKTA 3PFKA 3VR2A 4EH1A 4RCVA 1YFLA 4M2LA 2OAEA 3L0IB 2A92A 3A25A 2OP1A 4P3KA 1X77A 3VR4A 2JLQA 3QBDA 4B3HA 4F4JA 1NUAA 1QTIA 3Q6MA 3ZD8A 1G0NA 1N0IA 2BGUA 1EFVA 3KKEA 2JIPA 3AR5A 4HLCA 3UT6A 4AUKA 2AFIB 3E5NA 4C6SA 1OKKA 3RM3A 3AL3A 4P86A 3S55A 4KHPB 2C97A 4S0XA 5LU9A 3BMCA 2GAFA 3L1IA 3VI4B 3BQ9A 3P7MA 2GJ9A 2P0EA 3V9AA 5KNDA 5AI6A 2IYXA 3PDIB 4HVCA 5JZOA 4Z4QA 2Y1GA 4TLBA 1OX6A 1X1TA 3RYFB 4DA7A 4O2BA 3ETLA 1P2VA 2HU7A 1YMQA 2IHKA 3KLMX 4PBTA 4R1LA 1JQDA 1YB4A 1XA0A 4JP3A 2AFIA 4ASUA 1GZHB 3F6RA 2CK3A 4IH9A 4FM9A 5CHEA 3AGPA 1Z4MA 4D8TA 1Y63A 5TMDA 3QYPA 2J3KA 4PXAA 2DFTA 4FS8A 2W2KA 4GC5A 3OFNA 4Z3KA 4JOQA 4X62B 3CLHA 4EJSC 3ESCA 2DEUA 4E4TA 4W5QA 2VNJA 3KT6A 3MLEA 4UUAA 3NV7A 3UG7A 2WLTA 3EAQA 4MWCA 4FWTA 5T64A 2Q7OE 3FPAA 1OA1A 2QI9F 1IRXA 3IAAA 3O93A 3PE3A 3QLJA 4FQ8A 2GMWA 1B15A 2RGAA 5BQOA 2B20A 3ZXIA 1F8UA 1MTOA 2YCBA 5FEMA 3RI3A 4KLRA 4JVLA 3CNEA 4OI4A 2VQEB 2OWDA 2ZRDA 4ZCPA 4ZXFA 4AO7A 3L8HA 3HYCA 4H3KB 5JAHA 1JG6A 3TBFA 3IEMA 1M73E 3GUZA 4BU0A 3ZVNA 2OCAA 1GUYA 1K7CA 2HN9A 3CSSA 2QUBA 4KX5A 1W2WB 2VUHB 1J2UA 1KETA 4R9NA 3WYGA 1KIMA 3VVBA 4JJZA 1D4AA 3PGKA 4D0LB 4J6EA 1V5FA 2QUKA 1G5TA 1JXAA 3OKFA 1U04A 1J97A 2ZJ1A 4BQOA 4CNBA 4ZAWA 5CLJA 1SH7A 2QSUA 1QIGA 3E84A 2YJGA 1OI3A 3B9RA 3CINA 3HI6A 3HP7A 4H15A 1JIKA 1L4UA 3TNLA 1OFGA 1ULAA 3AB7A 3AKYA 1QPGA 4IMPA 4WXYB 4P7BA 2ZM6B 1P8JA 3Q85A 1UXHA 4CKCA 4RGBA 3TIVA 3QEKA 5AESA 1XZJA 2H63A 1E9DA 1U3GA 1V11B 2XQIA 1DG9A 4I9UA 4JUAA 4MRRA 4F1JA 4GQIA 4JQCA 3COPA 1PN3A 5H59A 5KNDH 4UAGA 2WT9A 2YS7A 2Y1OA 2G1AA 4A03A 4AUEA 1O5TA 1XDZA 1FUIA 3PFIA 1U6JA 2GPJA 5DJ5A 5E4TA 2Z4TA 3NH9A 1JVNA 5BW6B 4E2XA 5HZGA 2H1VA 3CCBA 1MJ5A 1O6BA 2HLNA 1GFSA 1PJ8A 4PHGA 5K0ZA 3FG9A 2VDUE 1V11A 3OZTA 1DC6A 3NUZA 1MV5A 1ZY2A 1YVUA 3UFBA 4MVCA 1NOKA 3WLHA 4ZAGA 3NH6A 2JFYA 4WXPA 1SQGA 1WF3A 1KQOA 3SX2A 3QKWA 4UE2A 3ROMA 3WLPA 1JEOA 2GPNA 3M9LA 1GPWB 4R6WA 5E6SB 3VPXA 1V48A 2FF5A 3IC5A 4LSZA 3V3TA 1E2MA 3IB3A 5L8VA 4BO1A 1BWQA 4FYPA 2PVSA 4IXMA 4LJAA 4YJ2A 1ZHHA 3E3MA 4PCAA 1C7EA 5IBQA 5CEEA 2G80A 4PZDA 2MWMA 4WZAE 5E9AA 3UMCA 2FWAA 4NDNE 2BZSA 2WTXA 4DV6B 3INRA 4U2EA 5E6SA 4AY6A 5KOYA 1NW4A 3TZBA 4EB6A 2HYDA 2QT0A 4NJEB 1XGKA 2KS6A 1JIXA 3C4QA 1PLJA 3EIHA 3IYLW 4X5OA 3HB0A 4FSDA 3PJGA 4G5QA 3ZV4A 4ZOCA 4BO8A 4XUDA 3N2GB 3HA7A 4Q48A 4G0YA 4GMFA 1IZ0A 4JLOA 4WA8A 4ZZ2A 1JHUA 4NYIR 2VPZA 2GD6A 3K15A 2Q3DA 4L28A 3TB4A 4ND5A 4NJEA 5GTDA 2Y1DA 1IBLB 3MC1A 1ZRNA 1KS2A 1QB7A 4IIGA 4EG0A 5C1BA 1GKKA 2CYCA 4UFPA 3N2GA 2HMWA 5G0UA 5FWXB 1VCIA 1AA6A 4MV9A 3K9QO 4YAIA 2J3DA 4J7CA 4HEA6 1WD7A 5I9TA 4IV8A 1EPUA 5F7OA 2A30A 3NYRA 3KZKA 2GHTA 4HP8A 4HWPA 3OEHD 3C3XA 5KOHB 5LYYA 1JLLB 2ZRJA 2Z6VA 1QLWA 5AKJA 2AF4C 4LMAA 1A77A 2I54A 4U2DA 4RZSA 3L05A 1M3SA 3F78A 4OJYA 3GEPA 1C7ZA 1XLWA 3CF0A 2P9FA 4NF2A 1KY2A 3GF4A 2SECE 4IIEA 1PTJC 3CKMA 3FWPA 4TT3D 5B53A 5D01A 1CU1A 1W44A 3QX8A 3CXRA 5KOHA 1V7QA 1DG3A 2G83A 3ZGZA 4AC9A 3DCNA 2CXOA 4R8RA 2YJ5A 1DX4A 1D7OA 4K9PA 3KTDA 2AMJA 1A5AB 5FULA 2D00A 4BZPA 2ANCA 3KJIA 4O2AF 5F7XA 1VKZA 3FPLA 3VR5A 3SHFA 5K45A 5LZ9A 4LG1A 3HDQA 3OCVA 2COEA 3HKDB 4QAJA 4YXWA 1AMOA 1OFIA 1ONNA 2FDXA 1LNQA 3MB5A 4I9HA 4QOEA 2VF2A 1OWLA 4O0LA 3T9FA 3I8XA 4AG3A 3KWFA 1GGFA 1A9OA 4L2IB 4YQFA 3WA7A 3R77A 5I4KA 2HPZA 3X1KA 5I4CA 1GG9A 3ZKWB 1XA4A 2MSKA 5AJWA 1FU8A 1SGWA 5CVDA 3NCHA 3EXHC 4S1WA 1IJEA 3HKDA 2HT6A 3DW3X 1J8VA 1N2HA 1E32A 2BKVA 3LY5A 3OUUA 3RS8A 3RYHA 3DQZA 3OETA 1EG2A 2J5RA 3JASA 4URFA 5CVJA 2VIIA 1G5IA 1F51E 3SHOA 3PC8A 3F8WA 4HDQB 2OA0A 4BNHA 4L2IA 1J06A 3EVZA 1J07A 1D0IA 1K7YA 1RQNA 1X6VA 1BIFA 3TZCA 4H17A 3EC2A 3U62A 3T7CA 3I9FA 4R1NA 2PLWA 4C4YA 4DJFC 4CM6A 3K4HA 4FGZA 3AVWA 4QLAA 3A14A 1PJQA 1U2TA 2VK8A 2VXCA 3AVOA 4Q9IA 3WK6A 5FTKA 3SVTA 1H2FA 2IYEA 2XH8A 1GPMA 2F67A 5B57C 1ENYA 4JSYA 1VG0B 2RAUA 5L3RA 1S3SA 1XTRA 3EGXB 5ADUS 1XRSB 5EQDA 1KOGA 4UULA 5FKJA 1KVSA 2IUSA 3TCXB 3BHNA 5E4FA 1B0UA 1PJ3A 3HV2A 5BUSA 3BH6A 1HR0B 5G1NA 4LYHA 2W8BA 5CT6A 4JQSA 4LDPA 1QHSA 4PCLA 1M76A 3WL3A 5KPDA 1Q1QA 1PT9A 4PRYA 4N48A 1C0PA 3L92A 2AEEA 2VPIA 3O8DA 3FTCA 4RGQA 2HDNB 2OV6A 3IDZA 2AFHB 2EATA 1AGRA 3EGXA 3HXKA 3F3MA 4D4LA 4GP6A 4HKTA 2V6BA 3L01A 2OGSA 3A6PC 3NDPA 5LA6B 1NXSA 2BH2A 3QVGB 3VR5H 4F5EA 3D4IA 4BECA 2GZ3A 1EFCA 3MYYA 3NBAA 2B2CA 2JGNA 1ZKMA 4KLZA 3RYTC 1MXFA 3SX0A 4I55B 2V4ZA 4AJHA 1OGIA 1Z37A 4RY0A 4CGZA 2AFHA 1Z6TA 4IKPA 4XDYA 4XM2A 4DBZA 3Q3HA 1K4MA 1RD4A 4PLCA 2HRRA 3VHRA 3NT2A 4Z7NB 3A1VA 5LA6A 4LW8A 3QVGA 4R0MA 1I3MA 2H5JA 4TRMA 5GADl 1BYIA 3L0OA 5H4HA 1XU7A 2HFKA 3QUCA 4KXQA 4P7GA 3ZGXA 3RF6A 4XTRA 4A7PA 1YFJA 4JJ7A 2HHHB 2IYNA 3DKKA 3FVWA 3NKFA 1TO2E 3QFHA 4K87A 2G7MC 3VNVA 3BL6A 3A6GA 4C7XA 1R5BA 2J09A 4TKVB 1LSSA 1GT6A 3EG9A 3GPDG 3WA6A 1SVLA 4YCLA 1A9RA 3GLVA 2BF4A 3IX7A 1J2TA 1YQGA 4WIAA 5E6UB 5H0IA 1BCSB 2GUWA 4P82A 3CLVA 1JDVA 4MR9B 1RJDA 2IPAB 1P73A 4MICA 1FNSA 1UODA 3QWIA 1R8XA 4OU5A 1F1BA 1L1RA 4TOIA 2HFJA 1NXTA 3ZLBA 2JZOA 1FS6A 3PPIA 3T1VA 2MSWA 4TKVA 3BK1A 5CVTA 2R751 2AN3A 1MX9A 5E6UA 1D2CA 2GFIA 1OVGA 4QGBA 4QPDA 4E30A 3JZFA 3KDAA 2VJLA 3TSCA 3L7LA 1VP9A 3MD9A 1E0KA 4WFJA 1E0JA 2RG7A 2Q1XA 2AGVA 3ZQUA 2L19A 1I4WA 5C51B 5B1SA 5IKEA 3KSDO 3M1AA 3PGLA 3BIFA 4CG2A 4RX1A 1KVRA 1AS0A 4BBZA 2VWQA 1AGPA 1ZW1A 4S1VA 4A5OA 2OK7A 2PEZA 3ML1A 3OE7D 5LQSA 4BRSA 2X14A 5DNWA 1BJTA 4Y9RA 4S05A 1AKUA 2I4RA 3L18A 2CHUA 3Q2KA 2JAXA 3AHIA 4RK0A 3T7EA 1EZ4A 1JHAA 4HZIA 1FMTA 4HCJA 1ISMA 2A84A 1MH1A 3E05A 3PEVA 1XCJA 2Z95A 3SEAA 3KU1A 2HPHA 1NBIA 4WJLA 5AKEA 2BISA 1CSEE 1OJLA 5EZ6B 1U7ZA 1NE2A 5E7MA 2H59A 2PYDA 2F3PA 1GZDA 1SZPA 3K9GA 2E48A 5ALFA 5HW0A 1OZGA 5DSZA 2PSDA 1E1RD 4N7RA 4F1WA 1R4AA 4J0GA 3I2JA 4PXYA 2UVDA 1O8BA 3KJXA 3UHAA 4G0UA 5FRDA 1PQPA 3LJKA 2JVIA 2NO6A 1VDZA 4E2WA 5HF9A 2OCGA 1QXSA 5HQTA 3WV5A 4X94A 3V2HA 3V34A 5K4GA 1XZMA 3CZ4A 4GLJA 3JR3A 1MW9X 1B3RA 2OD7A 4FZRA 2WK1A 1KSGA 2ZI7A 2CKDA 3LNCA 3KG2A 1F20A 1XJ5A 4YNBA 4GPD1 1KKUA 1I3OA 2PMEA 4NV1A 2GKSA 1T10A 4ONEA 4R31A 2IL1A 3PDJA 5EHZA 3ITEA 4P83A 5C7LO 3RSCA 1SY7A 1O4WA 4BNNA 5D85A 4P4SB 3I04A 4N7BA 3NETA 1HRKA 2M32A 4V39A 5BR8B 2D59A 3DKPA 2YTZA 5G41A 4TZKA 5F3RA 5DO9A 4KAFA 5EIWA 4CU2A 4Y9SA 3ZBTA 4QGSA 4F72A 4N3NA 4KPEC 3EK2A 1U9IC 4AF8A 1IEXA 1VIMA 1UFRA 4C5CA 3FCXA 3EUAA 5IBPA 1GG2A 1G8MA 1IOVA 2VHZA 4MA0A 5FOSA 1BN7A 4P4SA 1P1HA 1E99A 3QELB 2VVTA 4QQRA 4Z9XA 3FR8A 1L4FA 5BN1A 1FUKA 1B2RA 4X90A 1KMMA 2C9YA 1YCDA 2M2IA 2WJWA 2JJ1D 1EAMA 5LBUA 4RY8A 2H29A 3PGMA 5EXPA 5HJ5A 1XU9A 1ARZA 4HFJA 1SEPA 1OWMA 5BR1A 3FCYA 4KFCA 1C8KA 2WP8J 3C1AA 5MHTA 1NW9B 4RHEA 4CL8A 3QELA 1ZGZA 2JKYA 3QF4B 1ADBA 1C9EA 2QAIA 3N8HA 1GKYA 2HK8A 5I9BA 4M49A 4YRFA 2Y68A 1Z74A 4KNWA 5FFMA 3HCRA 4MYRA 4UHJA 4B32A 5U1PA 3H3JA 3I0NA 1P7PA 4M22A 4X71A 3TQIA 4D4GA 2B6NA 1KIFA 1S2DA 3N75A 5DP1A 1Q11A 4HNGA 3PDHA 2ZYUX 4LJKA 4ZAVA 1AK2A 4BMPB 2ST1A 4HYYA 3C8MA 2WQ7A 2WM2A 3CISA 2FPGA 3TE6A 3HCFA 5SICE 2UYOA 2W2PA 3CRNA 1VSTA 2RAVA 5JADA 2OPHA 5K0BA 1GRNA 2VXYA 1R9GA 3RC1A 1V95A 3DA8A 4FEEA 2C8VA 3ZCXA 4A26A 2I55A 3BGDA 1Z7YA 5DMXA 2FR1A 2OR3A 1SXJE 2R6GA 5IDWA 2AZDA 3D4NA 2DWOA 1GADO 5ARDA 3T5MA 4POOA 5ITVA 1DG1G 5HYVA 3WNBA 1V4VA 1SUPA 2AXNA 2A9QA 3H5IA 2Z2XA 5KMGB 1HQCA 5FPPA 4EW2A 1J1IA 3AOEA 3L4BC 1UDRA 2ICAA 4DLWA 2R79A 5EXSA 2EAUA 1GZ7A 3VPCA 3Q11A 5I5EA 5H80A 4OHYA 1BD3A 3L8FA 4KQGA 4Y6OA 3SJBA 1YJ8A 4P7JA 1AKRA 4TRRA 3WSWA 5BNIA 3I5AA 3BTOA 3ZIAA 2OCXA 3EWIA 3FVVA 2A1UB 1VE6A 1ZMTA 2QM8A 2IZ5A 4BNZA 4ETNA 3GJXC 1A76A 3WICA 5TGTA 1T3ZA 3TR0A 4B7UA 1RWBA 2WAMA 3QV1A 3GUUA 3QLUC 4EJMA 3KALA 2KE5A 4FZVA 2E6UX 2PCLA 2CNNA 3QLVA 4MRPA 5COBA 1J20A 4ERXA 4YMVA 3UANA 3TTXA 4J1SA 1QKJA 5IU6A 1NI4B 2A1UA 1E5TA 4KK4A 3H8VA 1DFIA 1T26A 1O89A 2MMCA 2ALJA 4PZYA 3UK1A 1G7SA 5CHYA 3S29A 2R66A 1GPAA 2WE8A 5FORA 1YUNA 5GWXA 1EFAA 3O47A 4KVZA 4FYHA 3N28A 3R3VA 3WDKA 4E4RA 1L7RA 4J90A 1U99A 4PLTA 3PXBA 1QNLA 2XQGA 3C3BA 4MWSA 4IWXA 4LGMA 4HL6A 2WHYA 1AXRA 1GAQA 3L1HA 4N3GA 4QE3A 1NI4A 3DAFA 3IEIA 4TN5A 4UBKA 4YAWA 5G0VA 3ZW7A 3ZHQA 3NB0A 4PG8A 2A5YB 2DKNA 1CUWA 2BKEA 1U2PA 1H22A 1K63A 1LVHA 3E15A 1IDOA 3E3OA 2KYRA 3AYZB 5EMNA 4E7PA 3WDLA 1L5GB 2QY6A 3NW9A 1BDBA 3Q3VA 4QG3A 4N01A 2VF5X 4HJXA 1PR3A 5ANRB 1M0SA 1ZCBA 3HABA 3NR2A 4UW9A 1HSOA 5LZ8A 1S8OA 2I67A 5B1IA 1I4LD 3NIGB 5IZCC 3QUSA 1Z8NA 2L82A 3OPMA 3N76A 4B5LA 1DBSA 1N6OA 3HU5A 4FILA 3HWRA 4HAZA 1TCVA 1SD2A 2B98A 4Q82A 5FWYB 5DN6D 4BXOB 2HMUA 2PGDA 4LZZA 3SYKA 3MJFA 3M9WA 3A4IA 5DRTA 2E4WA 3VZCA 2MT9A 5F35A 2O1EA 2EVWX 4NNPA 3ZWBA 4ZT5A 3W1WA 5AM3A 2PQ0A 3BE5A 1X94A 1BW9B 5EJIA 3LUFA 4W82A 4OH1A 1XZKA 2R1ZA 1NATA 4AO6A 1EESA 3MRSA 5K3OA 2VQ6A 1RADA 3KDSE 5FWYA 1FYEA 2YRXA 4GFDA 4BXOA 3I05A 4P8RA 3F6EX 3KVVA 1WD5A 3Q8WA 3VPFA 4MYDA 4F56A 5AUNB 1JIVA 4E03A 5KWJA 2DX7A 3PIDA 3BF8A 4JLAA 2P9HA 2GXUA 4ZAXA 2AXPA 3PQ5A 3ZY6A 4CIYA 4CV1A 5JJBA 3R3HA 5F1KA 5JCOC 3HKEB 2I8AA 2W2QA 4ND2A 1N6RA 4KMRA 3NBZC 4O5AA 1EFRD 1F2DA 1SUFA 3DAPA 3UUFA 5A6SA 1QFSA 2WJIA 4H4CA 1UBNA 3PJRA 2BCGY 1TGVA 1W1WA 2J46A 3DEAA 1MPXA 2FZLA 3CNQS 2FEKA 4HRYA 4L9WA 1ZD3A 4Q1EA 2XKBA 4QT4A 2ZRGA 1UEIA 4CCSA 2A88A 1QANA 2RGXA 3NHFA 5LJLA 4MVJG 1EVJA 1PYDA 2BC9A 3LUCA 3T9CA 4ENTA 5LNK1 2BI7A 1XMQB 5T4BA 2IPXA 4IS3A 2ZB4A 2XGJA 1G63A 4LSWA 3WNZA 1GTRA 4L4SA 3DV9A 5EXDA 1ZOIA 1EVLA 1OYWA 1RYHA 4B45A 4EF5A 4M54A 3VYWA 2IS1A 1DQZA 3DMPA 3DTVD 3R4CA 3RDPA 2J8ZA 2O8NA 3MGAA 2A1TS 4MV3A 4B0PA 2O59A 1G18A 3MMPA 4I50F 1B43A 1QKIA 1N5MA 2EU8A 2I4IA 2HIHA 2I1QA 3O3CA 4XAQA 5THKA 4PQGA 4GLLA 5K0JA 2WILA 3ELDA 3JARB 4QU5A 3ETJA 1LF5A 1SIOA 2VBIA 1PS9A 3FD8A 4KQJA 4Y30A 5E3IA 4A82A 5MF6A 4JYAB 3PK0A 4CIAA 1NP3A 1VOTA 5I4IA 1EX1A 1W5FA 4FFLA 3BXXA 1Z47A 2HPVA 1KEPA 5G40A 1P5RA 3UPUA 5L3QB 2JF0A 5FOVA 3I5XA 4Q9DA 3AX6A 1Z13A 4HUQB 3JYHA 4S12A 3QWAA 1I2AA 3C45A 3ZLVA 1UIRA 1XN1A 1G3MA 1NVVQ 2NXEA 3JARA 3KOYA 3M6AA 2W4IA 3TXAA 3VOAA 4KREA 1RWQA 1VMIA 3O1HB 4RFVA 2FSFA 5JAOA 1YDWA 3SU8A 1KFCB 4PR0A 1UWCA 3CBQA 4RW0A 4KLAA 2IYSA 4HGPA 5L3QA 3OP1A 1ZK3A 3SZUA 4EX6A 4F3RA 2GPAA 2QWXA 1SU4A 4PO1A 4Y2JA 4HFNA 2OXTA 3UUWA 4ZVKA 3CRW1 4NZZA 3ABZA 4LJ9A 4Q7MB 3BXFA 4Z9YA 5DLDA 1PVVA 2WJ4A 1CW2B 1RRVA 3M4XA 2R8PA 4Q3BA 4QYTA 3PC6A 4QL3A 2AYZA 4G5XA 4H7DA 1Y3CE 3LUPA 4FE4A 3IERA 3V32A 3WLSA 3NM5A 4AYWA 5JDIA 2A5DA 1FY2A 1C2YA 5HR5A 3HG7A 3N2IA 3FYTA 4TZ0A 1JXMA 4O0MA 2FLVA 1MC5A 4URZR 4MB0A 3H5RA 3DJFA 3GZJA 4MUGA 3S3TA 3V8QA 3I6MA 4MVWA 1DT5A 3RU3A 1WMBA 3E7FA 1QONA 4PANA 1KQ3A 2J3QA 3J80A 3KAQA 5JRJA 2I2DA 1QO0A 3G9ZA 3I9V6 3F73A 4HTFB 1PD1A 1OI4A 1R0ZA 5AKXA 4WCFC 2ONKA 4IGEA 3K09C 3BTSA 1NR1A 3G2IA 4M8KA 2XEDA 3CVXA 3OD5A 4YRGA 2FEXA 1I2DA 3DKRA 3OQPA 4X44A 2BFDA 1FFYA 1HBJA 2R60A 3QXJA 3PQCA 1O97D 1N1GA 4WZBB 4CG3A 1QSGA 1I6KA 2C5AA 2GASA 5EHXA 1Q6ZA 3D2AA 4DLXA 1UFKA 3ZWQA 1JDTA 4BVBA 1VSBA 1MD9A 2FRDA 4N40A 4U8GA 5TNXA 4EJ0A 2PQ6A 1HRDA 1ZJ5A 5JSYA 3GXBA 1Z7EA 2FFHA 4MYTA 4OSOA 3ZK8A 5JS7A 5B1EA 4IKOA 3CNNA 4FJ2A 3OY7A 5A4JA 1SC3A 3BMQB 4WZBA 2D0PB 1A7UA 1V45E 4XWOA 1RCTE 1YRWA 4FMBB 1H4VB 2D1SA 1MEJA 4RF4A 3R9IA 3MRVA 2QHXA 2C5SA 2CLOB 4MVJI 3U1TA 1DEOA 3CZ9A 4CMCA 4HT3B 2QZSA 2VQFB 4BB0A 3NVKI 1EFKA 2VDMB 3FAKA 5KYXB 1NW5A 1TK2A 4K6KA 1QVWA 4OFBA 3INNA 3LCJA 1M75A 3EN0A 1AKEA 1IMOA 1NRXA 2XUGA 3JWEA 1D9ZA 2ZJ2A 3K8QA 3TCNA 4BUJA 2CZGA 3V4VB 5IAOA 1LWOA 3BMQA 3T5CA 3TW0A 3IPCA 2ZB3A 3AZOA 4G0XA 2I78A 1FNBA 4AJJA 4C06A 5FUYA 5HIIA 4L4RA 4DLBA 3LHKA 2VDPB 3JD2A 1RM5A