1IXYA

Ternary complex of t4 phage bgt with udp and a 13 mer dna duplex
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*AP*TP*AP*CP*TP*3DRP*AP*GP*AP*TP*AP*G)-3'
publication title A Base-flipping Mechanism for the T4 Phage beta-Glucosyltransferase and Identification of a Transition-state Analog
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
total genus 127
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1ixyA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1ixyA02
2C1XA 2SKCA 5BNWA 1AHPA 2AZDA 1WW3A 5JTTA 3NB0A 3DD1A 1YA6A 3Q3IA 1F6DA 1FC0A 1RZVA 2GJ4A 1XL1A 4AY6A 2FF5A 2YJNA 1XOIA 5DLDA 3RT1A 2C9ZA 4N39A 2X0DA 3C48A 5TMEA 1FU7A 4WHMA 4XIFA 2XGOA 3S28A 4KQ2A 3G2JA 3TSAA 1Z6QA 2X6QA 7GPBA 3ZCUA 1GZ5A 1EXVA 2IEIA 3ZCRA 1LWNA 3TAXA 4BQEA 1L5SA 2BGUA 4RIIA 3WC4A 4KQMA 1AXRA 1UZUA 3FROA 2VG8A 2C4MA 3CEJA 3T3IA 4FKZA 4LEIA 4WACA 4BQIA 2G9RA 3UYLA 3ZCTA 3NPAA 1K08A 3MS2A 2X6RA 4WADA 4YI3A 2QN3A 4X7PA 1FU4A 3T3DA 3BD7A 2JLBA 3PE4A 1PSWA 3Q3HA 1QKJA 2ZB2A 1XV5A 5TMDA 3MT9A 4MI3A 3H4TA 4FZRA 1GGNA 2BFWA 1XL0A 3NC4A 2QRQA 3L7CA 3T3HA 1Y6FA 1C8KA 2IYFA 3S0JA 3CV3A 2IUYA 1E4OA 1XC7A 4MICA 3DDSA 3OKAA 3Q3EA 1ABBA 2IYAA 2IEGA 3RSZA 2AV6A 4RIEA 2QN2A 5D00A 1O6CA 2X0FA 2QN7A 2GEJA 1GPYA 2GEKA 2F3SA 1M5RA 3H4IA 4RENA 2HY7A 3TOVA 1NZDA 1FTWA 1NOIA 1FA9A 4MI9A 1GPAA 3OTHA 1SXPA 1P29A 3C4VA 3CX4A 3C4QA 4CDRA 4GZ6A 4GZ3A 1FTQA 3MT8A 4RIFA 3CUVA 4X7MA 2FFRA 3BDAA 2QRHA 3MTAA 4AY5A 4EL5A 1BX3A 3MBOA 3CUUA 1L5VA 8GPBA 1C8LA 4AN4A 2GT1A 5HXAA 1L5RA 2ASVA 9GPBA 4MHSA 2VCHA 2QLLA 3BCSA 3ZCSA 3HBFA 3EBPA 4REMA 4F97A 1Z62A 1UQUA 1C50A 3G2NA 1LWOA 4L22A 4N3AA 4MHOA 4EKYA 1WUYA 4MI6A 1L7XA 1P2BA 2XA2A 4BFCA 1P4HA 3VDMA 5DU2A 3GUHA 2IW1A 3UYKA 3OTGA 4G2TA 1NZFA 1XKXA 1P4JA 3MRXA 2VSYA 1PYGA 1PNVA 4RIHA 3MTBA 2F3PA 1JIXA 2QRPA 2O6LA 3ZCPA 4NESA 3O3CA 3CUYA 3RHZA 1HLFA 1L6IA 3T3EA 1J39A 2IV3A 3BEOA 4EL0A 1F0KA 2XA9A 2SKEA 2QN1A 4X6LA 4X7RA 3IAAA 2ATIA 3S29A 3MRVA 3HBMA 1VGVA 2JZCA 4M83A 3L7AA 1P4GA 3E3LA 3VUEA 1WV0A 3MS7A 4N3BA 2R4TA 5I45A 4EJ2A 1KTIA 6GPBA 2AW3A 1A8IA 3MT7A 4AMGA 1UQTA 2BGTA 3CUTA 1FTYA 1WV1A 4CTMA 1PN3A 4BQFA 2GPBA 4KQ1A 3G2LA 2PRIA 2R68A 3MSCA 3GPBA 2QNBA 2C1ZA 3L01A 3OY2A 3L7DA 4GYYA 1SXQA 4F96A 2G9VA 4N9WA 1JIVA 2SKDA 2QZSA 3COPA 3D1JA 3BD8A 4MRAA 1FS4A 1IIRA 4GYWA 3D0QA 3NP9A 2R60A 4CTNA 4HWGA 2PYIA 3MRTA 5C1DA 1E1YA 4M7PA 3QHPA 3T7DA 3OTIA 2GM9A 3MQFA 3L7BA 2XMPA 1V4VA 4NEQA 1WW2A 2QRGA 3HBJA 1L5QA 1NOKA 2FETA 2R4UA 1JG6A 3DZCA 3D0RA 4YI5A 4NC9A 2X0EA 1WUTA 2KS6A 2ACVA 3ZCQA 2QLNA 2F9FA 3WADA 2OFFA 3G2IA 4EKEA 3BCRA 3G2HA 2XCUA 2H1FA 3T3GA 2GPNA 2G9UA 2AMVA 1C3JA 1K06A 1GFZA 5JTUA 2Q6VA 1H5UA 2PYDA 1EM6A 3CEHA 1GG8A 2XA1A 3T5TA 1GPBA 3MTDA 4YUAA 4HLNA 1FU8A 1RRVA 3VDNB 3ZCVA 5IKPA 1JEJA 2H1HA 2P6PA 1RZUA 3NAZA 3MS4A 3CEMA 2XGSA 3OY7A 1JIUA 2F3UA 3G2KA 5DXFA 3OT5A 1JG7A 3S2UA 2QN8A 3QKWA 5ENZA 3SYMA 2PQ6A 3L79A 5TVGA 4F9FA 1IXYA 2QRMA 3DDWA 5LQDA 4CTOA 4Z5XA 4GZ5A 4N3CA 2VSNA 2BISA 2XGMA 2G9QA 1QM5A 3NCHA 3BD6A 4RIGA 3SYRA 3HBNA 2VCEA 5IKOA 3CUWA 2GPAA 3AMVA 3E3OA 2QN9A 1Z6PA 1P2GA 3WAGA 1NVKA 3OKCA 4LDPA 4AMBA 3S27A 2IV7A 1L5WA 2QLMA 4PQGA 2XCIA 2JJMA 5TMBA 4RBNA 4M60A 2ECPA 2R66A 4XI9A 2PRJA 1B4DA 3EBOA 5GPBA 1Z8DA 3NP7A 1Y8ZA 3BCUA 3E3NA 4RELA 5D01A 2ACWA 2F3QA 4QLBA 1NLMA 4W6QA 3PE3A 1Y6GA 3RSCA 1NOJA 1P2DA 3OKPA 4GPBA 1YGPA 2WTXA 3IA7A 3VUFA
chains in the Genus database with same CATH superfamily
5ALPA 5HCNA 5HKKA 4BB9A 1WKVA 1I3LA 2EGUA 1EQAA 2ZYSA 3IJPA 4LOLA 2EEPA 4C5BA 1QG0A 1W7AA 1DV1A 1U7TA 2AZDA 3EMDA 3F2IA 4V2IA 5T41A 7AT1A 3MEQA 1UP7A 3R75A 1RYEA 3GFVA 4LN1A 4TV9B 4CZ2A 2XHZA 3EZYA 2UYCA 3ZJUA 4IMJB 1KEVA 3MPUA 4HGNA 5INTA 1TCCA 1U0OC 4PCUA 2BVNA 2GTIA 3FZNA 3KCNA 3S1AA 1G8GA 2CGEA 3OC6A 5ENVA 4DCTA 1TDJA 1ZG3A 4UUBA 5FCDA 5CT5A 1Z5OA 3ZEIA 1CUZA 3WX0A 3PEWA 3U1VA 3ZY3A 3OC0A 5HK8A 2XYVA 3WSTA 4ERNA 4LGCA 1SZCA 1S7CA 2MOKA 3TR0A 1Z38A 1YJQA 2QLJA 3DE5X 3WRYC 1Y3BE 4BVGA 4GWGA 1U5CA 4CLDA 5BYAA 1N2GA 3L0IB 2P3QA 5AW2A 1AJEA 4QJ3A 2MIIA 1OGYA 3B2EA 1SN7A 3K9WA 1XZEA 2ZAIA 3SK0A 4FZJA 1ZVVA 2C88A 2P0AA 5FBHA 3GEPA 2CLCX 2AT1A 1F6WA 3TK1A 5GONF 2EFYA 1UBKS 3ZWXA 3KJXA 2JGNA 2QSUA 1T4BA 3DF7A 4Q3AA 2GN0A 1ISJA 2ORYA 2VJCA 3HMKA 4Q9AA 4UZFA 4XYMA 4UDOA 3PWTA 1PJSA 3NHKA 4C78A 3FUUA 1ENOA 1TGVA 2AX4A 2IY8A 2VN8A 2PLNA 2WU3A 4H0FA 4O4LB 2R11A 2BP7A 4PG6A 3C2QA 1P8JA 3F6BX 3AFIA 4E5DA 5FPQA 1AGYA 1OWNA 4K9OA 5ILOA 1PQ4A 3F3KA 3OU6A 1RRFA 1CNEA 1GNVA 1ZOSA 1ZUNB 2H1VA 2Q5CA 4GPAA 4Y98A 2PMCA 4ZT6A 1NYTA 5EQJB 2M1XA 2P77A 2QY6A 1E79A 1HV8A 1L3CA 2PZFA 1OT5A 1W5AA 4KBGA 2XBMA 2JIDA 4G9GA 1SEPA 4PCVA 4Q93A 4PIVA 1O96B 3TJMA 3THXA 1BA2A 4FX2A 4PYMA 1PNRA 1RCFA 2Y66A 1D5CA 2HLDA 3G3EA 3ZCTA 4R2HA 1SXHA 1ZXXA 2OV3A 2G0AA 3NOVA 3OPMA 1BZYA 1YCHA 3A1TA 3QLUA 4MW6A 1A7AA 4M87A 3WDMA 3NBAA 3K0SA 4Y6QA 3KUKA 3D4PA 1TQ4A 4JBLA 4WINA 1DXHA 3VI4B 3S2YA 4B3GA 3ABZA 2B94A 4XLLA 1CUWA 3T3DA 4DM3A 3Q3HA 2CEAA 2B25A 4M6WB 2ZB2A 3VAAA 3MT9A 3WYGA 3N58A 2PT6A 4K81B 3TNFA 3IEVA 4Q16A 3K6SB 1VKZA 5JNSA 3JWEA 4TRMA 2QRQA 4L7QA 3H42B 1I10A 3EIEA 3SIXA 2BMJA 1N6HA 2XW6A 3B1WA 4NBRA 3ILXA 2IYFA 3R7SA 2DJ5A 3LH5A 1CRZA 2MT9A 1MB0A 1W87A 5F78A 1BS2A 2FQ1A 3CUKA 4HV4A 1T3LA 3I9KA 5CFOA 6NULA 2DFKB 4LXXA 1NVDA 4KWTA 4DV5B 4N5HX 1NWCA 5AJZA 2QL7A 4D9BA 4Q18A 4RJTA 3H2GA 3A7EA 3PR3A 5D00A 1O1YA 5LOVF 3DL2A 2ZS9A 1JHZA 1GPYA 2PCJA 4UNIA 5BWLA 1YONA 4C7VA 3N6VA 1PI3A 4ID9A 1DBVO 2VP6A 3NM4A 2F00A 1XNGA 3O8LA 5AKGA 1V95A 2BMAA 1ENZA 4ZPJA 2RHDA 2BBWA 4WDRA 4EUEA 4LV6A 2EEZA 2ZULA 3W06A 3SM3A 3GDWA 4MLPA 1NVVQ 3JW8A 1NZDA 5TNXA 1IIBA 4JR2A 4IHAA 2GAFA 2GZHA 2QVBA 1V37A 3BHNA 4AKEA 5LQKA 4NCAA 1XMIA 3FVRA 4WNAA 1ST3A 3WNZA 2AR9A 3PQFA 3G6WA 3HJFA 4X44A 1AUQA 5IAKA 3EG5A 5G2OA 2R47A 3T7KA 4DSNA 3QFFA 3GA0A 3ZU3A 3HFRA 2ZCJA 4OXYA 3PZBA 2W7TA 4ZP1A 1RLTA 1APBA 3QJGA 3C0KA 3HSSA 5DP2A 4B85A 3T1HB 2WM8A 1N5DA 1JHRA 2QX7A 4ZKEA 1OH6A 3PNPA 1UWKA 4KOAA 3SKVA 2O8EA 1KPGA 3B53X 2XVYA 1Q16A 4FGWA 4PBRA 2VJOA 3W2EA 2Y68A 5FBZA 4F3YA 1CY2A 2J33A 4XOUA 3A3PA 4KXXA 1LDMA 4LY3A 3FKQA 4KLCA 1NW8A 1EFLA 2PZ8A 1ODKA 2YWDA 4XPZA 3KOXA 4TVOA 1S3SA 2OGWA 4R0NA 821PA 2AWNA 4DGQA 5MN4A 2YX1A 3DO6A 4ESVA 3Q5EA 4PYJA 9GPBA 2IH5A 5CMLA 1R0LA 2QLBA 4PSVA 4P3PA 5TF4A 1XCOA 1LQ2A 4EECA 1VG9B 3ZCSA 3V48A 4KAAA 2WIFA 4JZYA 5IJAA 2IY7A 2ZB7A 1YDWA 3I83A 4K87A 3CEPB 4CM1A 3V8BA 4YRAA 4DAEA 4X45A 4G0WA 4KGDA 4XYGA 5KOHA 2JAHA 2C9BA 3PJRA 1E1MA 1XD2B 2WJ4A 3IV9A 5LD2B 4JXZA 2CHFA 1W8DA 2QQEA 1YTUA 3CE6A 3P9ZA 1D2MA 4Y6PA 1L7XA 4IVPA 4B79A 2ZYVX 3E7FA 3QXSA 5IZCC 4CMIB 1Y3FE 1P4HA 3H9GA 4NZPA 4JCCA 1YZYA 1GUDA 5ALGA 3K15A 3TIFA 4DTIA 2I78A 1QYIA 2DCUA 3KR2A 4TVKA 1GXSB 4FBLA 1ECBA 2QTBA 5J59A 2BTQA 4HXEB 4BNGA 2WLTA 5A1JA 1JNYA 1A98A 1OYOA 3MFQA 1I3NA 2OV2A 3OMWA 4LTNA 3MRXA 3A9RA 1E98A 3O4VA 2DRIA 4B6PA 3ZH9B 1IOWA 1GILA 3OEWA 3V5NA 3N0TA 2ZR8A 1ZGAA 4HYYA 4J4BA 4R84A 4Y2QA 5BN4B 3ZU2A 3OFVA 3I4FA 4D9EA 2EL9A 2MSCB 5KHOC 2O6LA 3EX7C 1WPRA 4CM4A 4XR9A 2B92A 4IDPA 5F35A 1ZIDA 1E2HA 4MUIA 2G67A 2EBWA 2YVUA 2W6ID 3WGQA 4D4LA 3BK2A 3NFYA 3RHZA 4G8DA 5EJEA 4TS1A 2XRZA 1LLQA 1UM8A 3K9GA 3RBAA 2FVYA 2IYUA 1KZYC 3R3XA 4LC9A 5ES4B 4L8WB 4ZOLB 2CKDA 2X5NA 3FTNA 5ALSA 2WY2D 4DVGA 1A9XA 1FLVA 3AR8A 1G291 5FNVA 2JPDA 3LT2A 4WK6A 3HH8A 4BNWA 3ND5A 2FPIA 3JZDA 5ALWA 1U7WA 4TKUB 1LU9A 1T6XA 1QYCA 4OHVA 2GCEA 1QHXA 3U61B 1RLUA 3ORRA 4V38A 4BATA 1GGMA 5KNBH 4HYQA 3RARA 3X3HA 3GJ0A 3F4BA 2X1LA 3E3LA 1PWYE 5JZSA 3FMOB 2WA2A 2VPPA 2BUAA 4L3VA 1XQXA 4Y2JA 1PJ3A 2I54A 4I1PA 4O08A 5TT0A 3L7KA 2XAUA 4CBVA 1XMVA 4IJ5A 2GJSA 4MA4A 1RAAA 4AJPA 1D1PA 2WSBA 3U44A 1ZR4A 1FX1A 1U11A 3A2NA 2GZRA 4WCVA 5HDBB 4BX3A 3EZ9A 7ADHA 3GT4A 2PGLA 4G85A 1J5EB 1PJBA 1UFQA 2WOJA 1FQKA 4WFQA 3ZBTA 1VPWA 3EWIA 4N9QA 3ISTA 2JFXA 1UBCA 2QTFA 3BMNB 3CH4B 5CYGA 5D3QA 4Y2YA 1AN9A 4HH1A 1G20B 1JJFA 2TMDA 4L2IB 2R1ZA 4C87A 1VE9A 1P1RA 3GH1A 4OIMA 3F73A 1E20A 1RJEA 5HFJA 5E4FA 5GONA 7YASA 4UHEA 3E9QA 1DAGA 4UPDA 1KL7A 3Q0TA 3L0ZA 4RK6A 2IXEA 3MINB 1J0CA 3ZLUA 2ONJA 1GFWA 2Z56A 3OJOA 3QMMA 3VR4H 1NJGA 4IYJA 5C8YF 3GD7A 1VL0A 1H6AA 2RBGA 5KYWA 2WSSA 3QVUA 4NV0A 2VNHA 3EUWA 2OYRA 3VPCA 1OFVA 4ECAA 3PYLA 3RAJA 3AESB 2HCRA 2XYHA 4MB6A 2QQ5A 4Q47A 1A5SB 1WSBA 4FKMA 1RLMA 4IQ8A 4JWTA 5AKJA 3U1TA 4YHBA 1CY7A 4HVTA 1SIOA 1V9CA 3G13A 4QICA 3TL2A 4FC6A 1GZ3A 2HK7A 2Q28A 2R6CA 4ZQGA 4CE6A 1DKRA 3IESA 2ASEA 1DQSA 2WG1A 2GD0A 1RBQA 2BHNA 2IZ6A 5LLSA 4ZVOA 4OX9Y 5BPHA 2VQ3A 1E1YA 1X3SA 3JVDA 4BN5A 4Q9IA 4Y2GA 4UU0A 3QWBA 2A5JA 2UUBB 1XDGA 3T7DA 4MVJE 4B6JA 3LF2A 3W4KA 4ZZIA 3GNSA 1QPGA 2V6IA 4UAJA 1E7MA 2OLKA 2WHPB 2Z6QA 2DYKA 3L18A 1EWYA 3KHUA 4RZSA 2P8SA 3WMXA 4YRCA 3JYPA 3EJ6A 1WUHS 3IOYA 4YDSA 3BZUA 4YRJA 5MGBA 2GM5A 3WHLA 3DPUA 3DUFB 3MHTA 1UKZA 2VHCA 3KX2A 2BEJA 3QLJA 3NORA 3LYHA 4YJFB 2MDTA 3AQIA 1XE3A 3VRHA 4WJLA 2WYHA 1KEUA 1C1XA 2V97A 4YMSA 5DLQC 2RI0A 2YFHA 1O7JA 4Y1RB 4C4RA 1T1EA 2REXB 3F5FA 1A7JA 2VNIA 2DFNA 2X4GA 2DTDA 2FFHA 4TKLA 4JI0B 2PGDA 3RS4A 3Q98A 4BLWA 1KZGB 1FUIA 1PJAA 2GLTA 2WWIA 2Z4SA 3P19A 1FDSA 4O4HB 4PF1A 1CT9A 5IK2A 2WIKA 5F7XA 2CBXA 1TADA 1YL5A 2IDZA 2R1VB 2WMDA 4OHBA 2HCJB 3FNIA 1QP0A 1F5SA 4XGQA 3H1TA 3Q72A 2DHEA 2J9RA 5LOVA 1D0SA 3A27A 3K5IA 3FNFA 4M21A 3OPNA 4ND8B 5C5EA 2RHBA 1L4BA 2ZR9A 1EUCA 1CP3A 1D03A 1GQOA 1FYEA 2BE9A 4R8MA 1G2OA 5EFOA 3PYMA 4XXHA 1I51A 2QGNA 4M1OA 4Y9UA 4BC0A 1JHXA 2FEAA 2FLVA 4R68A 5FTNA 2DVMA 2A9QA 3BB1A 1Y6ZA 3LWDA 3IC5A 2ESRA 4L95C 4AMUA 4CM8A 5IHPA 3WZ2A 1KMIY 3GPDG 3HLYA 4B47A 4FZ5A 1LW7A 4DMRA 1VA5A 1T5LA 3DULA 3PG5A 4OJKA 4BRWA 5KDDA 3ERCA 1BSVA 5ALTA 4YTEA 3OQNA 3VNAA 4JI2B 1YRYE 5D7BA 1XGKA 3E8XA 4X84A 2G5PA 2XUFA 3IVAA 2R2AA 2EQ5A 1RRVA 2DT5A 2YICA 3MCWA 3DOEA 3ZHYA 1IRIA 1SCDA 5EWJA 3T7CA 2H1HA 1EGQA 2XMQA 4OGGA 4O8ZA 3OY7A 1JQLB 5JZBA 3MQ4A 3QW2A 3ACDA 3E0XA 1CF9A 3ZI7A 3OX2A 5GQSA 5M5BA 1WXEA 4B2YA 2NYUA 2EJWA 5C4IA 3BC1A 3CB2A 3LXMA 1TM4E 2IOFK 4RF2A 1D2EA 1FVOA 1ATIA 2XUPA 2JI8A 1XCGB 4NJMA 5FLEX 2UVDA 4H9GA 3GLQA 4QOGA 3GEMA 2A4MA 3ZU6A 2K2WA 3RC1A 4LJ4A 2GUGA 3PR2B 5GOTA 3R7DA 3VX3A 3K0HA 4FGUA 3NASA 4CQMA 3ORYA 1JEYB 1IXYA 1JKIA 3RJMA 2CYAA 1VSBA 4DSUA 3UAYA 1LEHA 5MFZA 4GWLA 3Q7TA 3JQRA 2FR1A 2FXIA 4IZHA 1L1RA 4FZ3A 3RNOA 4J2TA 3U09A 3U7FB 2WM9B 4OCZA 5EZQA 2E21A 5JECA 1WZCA 4RJJA 1G4UR 2WE7A 3GT7A 2CMFA 5CGZA 3HCRA 1E18A 3ZGNA 2VHJA 1PP4A 2J9YB 2C8JA 3D43A 4WFKA 3FAKA 2YRWA 3UGKA 5ELXA 4BB6A 3PUXA 2HSGA 4ZMBA 1S7GA 2XKBA 3AMVA 3O92A 2ZJYA 3RIMA 5AYVA 1Z6PA 3DMFA 4JUFA 4P36A 2W2QA 3KQSA 1P2GA 2B9VA 4HNSA 4HJXA 3T7RA 2ZJ2A 5EHZA 1R0YA 3K20A 3TTYA 2BFDB 4JYCA 3WNQA 2CNDA 3DBRA 4FI3F 3COYA 1Z2CA 3ILSA 2GYVA 3PRYA 4HFJA 4KPUA 4D8YA 2A5LA 1A4XA 1JGTA 5D6NA 3W1EA 1HPLA 1E89A 2FU5C 3S2ZA 1PZNA 4HWSA 1R27A 2WD7B 2IVZA 1SMKA 1WQ3A 2BC9A 2JJMA 2W2LA 3AVPA 3O3MB 3P27A 4IS3A 4B1FA 1OXTA 1UPCA 1H2EA 3D2LA 4UEOA 5EPOA 1BE1A 3KLMX 3EMBA 1T9HA 5TF0A 3AINA 1VLVA 3SAJA 4YUXA 2PPLA 5CBKA 5K09A 2R66A 1KDVA 3UJNA 4BVBA 2WAYA 1WMEA 2PTGA 1O03A 2GFQA 2Y3IA 3JSXA 2ZRKA 3QLTA 4ZAVA 3WK8A 2G88A 4CR7A 1ZH0A 1RQXA 2SNIE 4EARA 3B6JA 3IBYA 1GKYA 3I5AA 2HUNA 4YROA 3TOXA 3LGSA 3PPWA 2I6UA 2PGOA 4PYRA 5IKMA 2AXQA 1OKKA 1BA3A 1GSHA 2CE2X 2G08A 1JG1A 1Z5VA 2XE6A 3PE3A 4NEGA 4JLJA 4WZ6A 3UFBA 5I7FA 1OFHA 3NIGB 2ETVA 3MMNA 3TDKA 2EKDA 3BOSA 1RPZA 4IHJF 4HAXA 5DLPA 1PTJC 4CL0A 1N34B 3DWEX 4H7FA 2H6EA 4EPWA 2I29A 1VRVA 4C7OA 1TJYA 2VF7A 1QWSA 2BAGA 1H6CA 4M8KA 5T5QA 2AD1A 1I7DA 4MGEA 1NL3A 3U4QB 1Y1KE 1R8JA 4BNTA 2VDMB 5EKXA 2C8VA 2Q5IA 4C7BA 2X7JA 3WGYA 3KQNA 5J4YA 1YT5A 2C4UA 2BM1A 4UFPA 1HZJA 3UOGA 3PX7A 4L8FA 2GBLA 3PFNA 4O2AF 3C6KA 1F8YA 2BKUA 2WU4A 3HN7A 4J3FA 4ZVUA 3WGLA 1G3RA 2GN8A 4AYTA 1GAQA 2BBTA 4BKOA 2PN1A 3L06A 5DGIA 1FFBA 2ST1A 1OLXA 1JALA 1EEHA 4PQEA 4DR1B 2ATVA 1W94A 1QH1B 4HX5A 4PLZA 2PL1A 3A0UA 3JU3A 2YW2A 3I1IA 5AJYA 4URWR 3WB2A 4DWJA 4E6PA 1EP9A 3TG8A 3Q7PA 1X92A 1GYQA 2QT0A 3RAEC 2BEKA 2EXXA 3KEMA 1G5PA 2FSIA 2FEXA 4MWCA 1BIFA 4DJAA 1QR6A 3W4IA 2P1DA 1H66A 3BAZA 4YJDA 5IN4A 1R0SA 3F1KA 1VLQA 3VV3A 3UJHA 3OJCA 1DKUA 2GEFA 1JXAA 1Z0IA 4M0UA 1P8AA 3QU2A 5C8YA 1R8YA 2ZS7A 3QI2A 2SECE 2J48A 2RC5A 3FLBA 4F3CA 3R3SA 1VJDA 1SM4A 1EESA 2GM4A 1XD9A 4YAKA 1B0UA 3K1JA 3PYXA 1UBLS 2DWOA 3GGGA 2UUAB 2VSXA 3STVA 2W6JA 2QG6A 3A6LA 2NVUA 3CIOA 4Q4AA 4PTYA 3W79A 4X61A 2FDXA 1SKAA 5I7SA 5J4KA 4KQFA 5P21A 4BQEA 5BWOA 4FOSA 3RAPR 1GG9A 3G2QA 4IGIA 3AIKA 1Z34A 3VTFA 4JYPA 1AXRA 3DEFA 1C80A 1HGXA 1WXGA 3KPVA 1U2EA 4ZVPA 2R6R1 4P3NA 1WRBA 2HJVA 1X7WA 1C0EA 1X13A 2CNOA 4IP0A 3HKDA 3WISA 3GV0A 1Z4OA 2OAEA 1DC4A 5BRNA 2DH6A 4BWVA 1OMOA 1LPPA 4FDLA 4KSYA 2W6QA 3D5QA 4WZBE 4NCXA 3SIWA 5CEFA 1NY5A 2I3DA 2FW6A 2QD2A 3GP3A 3LNTA 1ORVA 1HDIA 1U8AA 2BSAA 1CRQA 2C03A 2QL5A 1DTSA 3L6DA 1GFIA 3QVOA 5TVKA 1U0RA 4RL4A 3L9XA 4B32A 5JV5A 4HGOA 3JD2A 1QKKA 2F1JA 1E8NA 2OBFA 3ZD6A 1VBMA 2BEVB 2CF5A 3LDHA 2IP2A 3QVJA 4J0EA 4W5QA 4ENRA 4EHBA 1ID8A 1HY3A 2OGUA 2H3HA 3KYCA 1GGHA 2KSQA 4HY3A 1AHIA 4RPCA 3KYJB 1ZC4A 2PMFA 1BHSA 2JGRA 5JU6A 2X8AA 1EPUA 1QS0B 4JOSA 1ETUA 2H11A 4EFMA 1GITA 1Q1BA 3O8RA 3BAFA 3KVYA 4U0JA 4UEQA 4FCWA 5ICSA 2BE7A 2A0FA 3MERA 3FNRA 3ICVA 1GU0A 1SUEA 2Q1SA 3H3XA 5LLTA 3JTEA 3IBSA 1E9CA 4HGPA 4ABTA 4K0KB 5JS2A 4P4LA 4Z0NA 2XGJA 1KRXA 3SIPA 1J90A 2QRVA 5M04A 3H1AA 2QI9F 2H0QA 3AKDA 4JGGA 2QVYX 3T0GA 1K5GA 1X1TA 4ZYLA 2OPHA 3GN2A 2B4TO 4XUEA 1YQUA 4WT7A 5DE3A 5LUBA 5KWJA 2X2PA 4RPGA 1XQWA 1QVVA 4XSVA 4ZYWA 3W3AA 2PKQP 2O2CA 2YRFA 5ALUA 3WLRA 1P75A 2HYIC 1YUNA 4EJ6A 2OBBA 4MWOA 2XZTA 3IQEA 4IXWA 3KB2A 4B7CA 2G5CA 3GXBA 3TM4A 1YOVA 2QROA 3DGEC 1U2PA 1FA9A 3BE4A 5DYGA 5FI5A 1BMFD 1GPAA 1DHRA 1GV0A 1DOHA 2HEGA 3NT2A 3PPYA 3TWOA 3OTHA 1OROA 3P52A 4ARBA 1SXPA 2FWNA 3G7UA 3I1FA 4MWZA 3P7MA 3FCXA 3A6FA 3U26A 4BNXA 1AZTA 4CDRA 4TRRA 3JV7A 5BORA 2VOEA 3BS4A 1RJ9B 3HCCA 1A8UA 1DAEA 2A58A 2W43A 4B83A 4ZDKA 1CB0A 3T4PA 2A9OA 4JL8A 2QRHA 1C2TA 3FHJA 3ZOKA 4BO5A 1C0KA 2YWBA 3O0TA 3KE9A 3QH4A 3U81A 2XCOA 4BKQA 4DCCA 4RH3A 3GLUA 2OWDA 4UM9B 2ISSD 4RESA 3IAXA 3W90A 3C16C 2F55A 4G97A 1XJ0A 2XQKA 4MVJM 4GDFA 5TGDA 4AN4A 2GT1A 2BHRA 4AZ0B 1NZJA 4BVJA 2WHQA 5HDQA 3N8IA 2JATA 3G02A 3BPSA 4G1BA 4IOJA 4YP9A 3VMFA 2PLWA 3DUWA 1KYWA 1HNZB 1H5NA 2ZRNA 3HBFA 4MRPA 4AF8A 4Z4GA 5JH7B 5KQLA 2G71A 1A9ZA 3IS3A 2PJUA 3JSAA 2BN4A 3DKPA 3SVZA 1EUZA 4MIOA 1FXWA 3HO8A 1C50A 1NF9A 1IK4A 2H63A 2PX5A 3OTWA 4P54A 3FYSA 3RC7A 1DCFA 3DQPA 4RYDA 5H82A 5CCEA 4DMFA 4YCAA 1W9MA 3BJRA 5LD2C 1VCMA 3LUJA 1L5KA 1CKEA 3PQ8A 4RORA 3GRRA 2HO4A 4L15A 1DJPA 5T4BA 1KOJA 1JFFB 1KXJA 3OJFA 3CG4A 5TMPA 4QDZA 2MR6A 3UFXB 4XB6B 3KSBC 3USZA 3U4GA 3DZBA 2WC1A 5I7AA 3WTBA 5K03A 3LO8A 1N0UA 2XGGA 3HYTA 4FHGA 1EQ2A 1Q0ZA 4FBMA 4Q6WA 5EVJA 5FWDA 5AVZA 3LLUA 3KVRA 2R79A 5CJPA 4F5EA 2VSFA 4GD3Q 4ZVRA 1IVSA 4G5OA 1NIPA 2BZ0A 2ORIA 3NTUA 1H93A 4OV6B 1XELA 1ORDA 4NQRA 4IJQA 5DN6D 1DCMA 3DP7A 4A2CA 1D2HA 1U0HC 2H54A 2G04A 3ETGA 3LQRA 4B46A 3AF1A 5DLEA 3ZZUA 3AW9A 2H1RA 1E3WB 4M4SA 4YECA 3RABA 5B64A 2KW5A 3JZFA 4CGYA 2WP0A 1K8YB 1XQVA 3MGCA 3PUYA 1LNSA 1W75A 4R81A 4IX1A 5H02A 1NKVA 4NENB 3RKSA 2AN3A 3BQMB 2H18A 4DMCA 4C05A 3GJ5A 1DUIA 2GX6A 2OY0A 5DHPA 1LXCA 5T67A 2NVWA 3EIFA 1YR8A 1OXXK 4XIYA 2V98A 1FFWA 4F4HA 3V4PB 1DOAA 1ZQ1A 3GJ7A 1D0IA 2A5GA 5HMLA 1IHDA 3QELA 4URXR 4MVJD 3F3SA 2QBYA 5LZ9A 2UAGA 2Z3ZA 2ISQA 4UBMA 2ZQ5A 1ISIA 5B7GA 3MS7A 3B52X 3H2YA 4D4IA 2H51A 1WLSA 1Q11A 2SBTA 3PKIA 3T54A 2HHLA 3U7JA 3VZSA 1JFLA 3FZEA 3LAWA 3ZW8A 4FUQA 1JA0A 3HXTA 4BC1A 2ZYUX 5ANRB 2HF2A 2QVZX 1P7VA 5J2UF 1Z6ZA 2LDXA 1M9NA 4KVZA 4DV2B 2QZ9A 4ZU3A 1XRNA 3KB6A 4N6OA 3E1GA 3U1BA 1CY0A 1UDXA 4HR7A 1O95D 1T8UA 3SBEA 1VDMA 4R51A 3UXEA 2IPMA 4I1SA 3ZDRA 1XO1A 3DHWC 1QZZA 2C77A 1E5XA 1MFPA 1J9EA 4KZKA 4E11A 4L7VA 4HN2A 4XA8A 2VYNA 4RMGA 4ALLA 2P2CA 2BR3A 4QEKA 3TGWA 5DHFA 4WESB 3V33A 5KREA 1PW7A 3V8QA 2PMDA 1N5LA 4WY5A 3UZUA 2O7VA 2QXTA 3VO9A 1GARA 4DLAA 5G4KB 5A5GA 3WSWA 5CX1B 1CUXA 5I01A 3KTAB 2FMHA 4R01A 2AYZA 1M34A 5J2TB 4GEKA 4O02B 2R9VA 2WT8A 3C7TA 2ODQA 2VDKB 1EAMA 3B85A 4XDHA 2H92A 5I9MA 2P4SA 2D0IA 2VJLA 4QIHA 2VQDA 3DT6A 2R60A 4F4FA 2KQUA 1G6KA 1QHEA 1WSWA 3F74A 4HWGA 1NKSA 4M38A 4AZWA 1KYQA 4EQZA 3AFMA 3HJNA 4KR6A 4A6DA 1P3Y1 1EGMB 3KKPA 4GVXA 1RXCA 2GLUA 3BZBA 2OFPA 2FPSA 9ATCA 1C5KA 3AEXA 3KZOA 3OU2A 1YS4A 3MQFA 3QLVA 1W4AA 5KOYA 3PP8A 4HNAA 2P27A 1IOZA 2DBYA 5AVSA 5EWMB 3D3WA 1AA6A 2H16A 4EY5A 1MW9X 3O3OB 5BN1A 1ACLA 4CF6A 4HUQB 2E85A 5LYJF 5KO2A 3CJTA 1GLGA 3SQWA 4DEXA 2EG9A 1CWUA 3HYCA 1FFGA 4A36A 1Z5GA 2Q6OA 3IJEB 3B51X 2QMQA 3V6LA 3TEMA 4X95A 4QOJA 4BPBA 2DFTA 3OKFA 5TEWA 1D4AA 3WDSA 2ZTSA 4QBKA 2O8CA 4KQ9A 1VE3A 5JS8A 3EW9A 5CVTA 3OPVA 3NIFB 1Z56C 2NLOA 1P9OA 3EWNA 3P2YA 5D1HA 5DHQA 3W9YA 5SZIA 2NUTA 1HNWB 2RI1A 2ZWMA 1N8KA 3NHPA 5CW2A 1XA3A 2G36A 1TC2A 3MA0A 5C34B 4W6ZA 3ROKA 2XXAB 1WMAA 2NU6A 3CWZA 3OT1A 2O0HA 4E5YA 1L7OA 3AVTA 2EF1A 1YL7A 3D2BA 4MRRA 3AI7A 1C4OA 3DJFA 2AMVA 1I1OA 3MC1A 4O3MA 3ADOA 4CT4B 3AO0B 2P90A 4MCJA 5HS4A 5CTAA 1VJRA 2VDOB 2G9NA 3U3OA 1A72A 2B6NA 4IYRA 3HCEA 1XEXA 4LYAA 5D5QA 1GUFA 3ORQA 4BXOB 1ND6A 1EB9A 5D87A 1E3JA 2NYVA 4UEWA 4QPPA 3BQNB 3QWFA 2HRQA 4CIYA 4N18A 3LFHA 4ATNA 1TZCA 4C0SA 1X1QA 2GHTA 4WY8A 1WVGA 3D31A 3GHHA 1V11B 3TQFA 2XDWA 3QZUA 1XZKA 2CFRA 2OVBA 3HDHA 5CITA 1ORIA 3KR0A 2YH2A 4WERA 3LY5A 2EBHX 2BZGA 5T4HA 2ZZKA 1G8FA 4CI9A 3ADDA 4TYNA 5IZ4A 1E2IA 3IGFA 1VIAA 1ULSA 2AA3A 3FTDA 3PKJA 4MYTA 4E32A 3QEMA 5GMOA 1IVYA 3VU0A 4CJXA 4KPGA 5DRYA 3IMCA 4CLRA 5HK9A 1WXIA 1BEUB 1JEAA 1U1DA 1MJHA 2HSDA 1R6AA 2J4CA 3E18A 1SR8A 5GOZA 3RJTA 3UMYA 1K89A 2W2VA 3BHIA 3G85A 1SUBA 5EXXA 3HUUA 1P62B 4QBFA 1PEKE 3HHPA 4LKOA 4M37A 4AD8A 4FFSA 3NWPA 4X94A 3NJ8A 3UWMA 1RKVA 3IT0A 4RQTA 3RSQA 1XMXA 4KXMA 2EG5A 3QMWA 4ZV4A 1XUOA 2YS6A 5H81A 2AN5A 4PPGA 2ZEJA 3P8ZA 2JGLA 4MTCA 1RZ3A 4F3KA 3ZHSA 3EC7A 4GOXA 3W4JA 3K9NA 3GA7A 3EWSA 4JYMA 2RG7A 2D5AA 1ODTC 2CUTA 2WFMA 3Q8WA 4GMFA 4I99A 2H1SA 4W8GA 4K5QA 4KACA 1ISSA 4KGVA 3L1JA 3WLEA 3VR0A 2VUUA 1CUGA 4J6EA 2QTNA 4DOMA 1T26A 2VHWA 3CF6R 2YDXA 1BEZA 3CLSD 4X24A 4Y67A 4Y2PA 4HLCA 2DWQA 5EN4A 3DAFA 3JQEA 5DX1A 3S1SA 1H1DA 3ASZA 3ZWOA 2I4IA 1NC3A 3LC1O 1WNTA 1UZMA 1IEVA 2Z04A 4G65A 3HI4A 1R15A 4BMCA 3WWDA 1PGNA 1P18A 1V41E 2WV7A 3Q2KA 5SYAA 4L4ZA 4AMBA 4GP9A 4EHHA 1KDYA 1UM9B 4UCFA 3U37A 1HMPA 1SXJA 4BNMA 4ENPA 1A71A 4FILA 4LF8B 2GN2A 1CR6A 2AVNA 2WKQA 3AETA 1PUXA 1XNHA 3WZMA 3GK3A 3G0DA 2AFHB 1M67A 2ZB8A 2WG2A 3ZQ4A 4FFBA 3MB8A 3WI7A 4EEKA 3B60A 3GPCA 1DZ3A 3I37X 1T8PA 3LDUA 1VPTA 1QRTA 2J5BA 3KQQA 4MW0A 2J3JA 2FPMA 3L6OO 4YALA 4BFSA 1A50B 3SHOA 1SO8A 3KJEA 4P22A 5EHXA 5A0VA 1SCIA 1PG2A 3E9NA 3O93A 1GU1A 1Y34E 4RGBA 4XR4A 1ABEA 3GUCA 4GUAA 3ZNQA 1YS1X 3RTEA 5JHHB 5DM1A 4W6QA 4ZMRA 3RSCA 3B3GA 3HJAA 4CKWB 5DHAA 3N2IA 3QLEA 4IXMA 4X93A 4J94A 1W581 3UA4A 4BBZA 4QT4A 1QV7A 1Q0LA 2ORED 3OX1A 3Q87B 2Q0HA 5AJWA 5ALFA 3I1YA 3L0SA 4ZGGA 1XK7A 4PXYA 4PYQA 2P6RA 2ID7A 3DEJA 1S8OA 2F43A 1XBTA 2NQ8A 2W0MA 3L1HA 3LPLA 4M76B 3TXXA 4MOWA 1HFKA 4EI2A 4Q37A 1ITZA 1KSJA 2PBLA 2HNKA 3UW1A 2AFHE 2ZJ5A 4FE3A 1REQA 2KWIA 1CVLA 3OM1A 3O84A 5C18A 4DT1A 1R7RA 2DPGA 3TLMA 4AYWA 1GA4A 4ETMA 5J2UA 2B8WA 1XNJA 2NG1A 2I8LA 4YEDA 4ZVMA 4NJOA 3SF0A 3W5HA 4EW3A 4JLDA 5TPWB 3CW2A 1FUEA 2FSHA 2GLXA 2NADA 2HH9A 3MJDA 4ACBA 1OX4B 1R12A 2FSSA 5TGTA 3AHCA 5JARA 3BN3A 2A8YA 3DOIA 2Z6UA 1YVDA 2ZWVA 1NJ6A 1JHUA 1KBOA 2AD5A 3EE6A 3KE8A 2HK8A 5HHTA 1ISPA 2HRZA 1XTVA 1AGRA 5JJBA 1KO4A 1AU9A 3HP4A 5KINB 4OREX 2VYFA 3FRIA 2QTHA 1L8LA 3GRPA 5AP9A 4X7BA 3LCCA 3S28A 2VPXA 3U39A 2WQZA 4YK7A 1J97A 1HYBA 3LXUX 2I22A 5AKHA 4C0QC 1B8VA 3TSAA 1BNCA 3AP3A 1A82A 2PR7A 2ZR0A 2OHJA 4UXJA 2XT9A 2H07A 4JJKA 3JALB 5E9JA 2ECFA 1JH8A 4QX6A 2EJTA 2JNWA 2QUAA 4KO8A 2OL4A 1ZA2A 4Z4CA 4P3XA 4U7FA 1R88A 3C3KA 3ZV5A 1R4MB 1QQ5A 1Z6GA 1ZYUA 3F9IA 4JU9A 2BGUA 5G0WA 3T7EA 1TLLA 3TE6A 3V2GA 1WY7A 2KHZA 1TIPA 2BR5A 2GM3A 4EFKA 3A25A 3HACA 2V9PA 3K32A 3PDWA 3ZU4A 3H7IA 4B7UA 2FMUA 1P44A 1W2GA 4MW5A 4LEIA 4TYYA 2XB6A 3IIKA 2BCGY 2VEDA 4OQPA 2QSZA 2PVCA 1HOTA 1G8AA 2HA6A 2R8XA 1ILWA 4QDOA 2H48A 2A1IA 4EEZA 5ALZA 2IBTA 2VA9A 1QWOA 3A4TA 2LGJA 4IUBS 4YQYA 4Q3EA 3CX3A 4JBHA 5KJCA 4X66B 3S6JA 3SF8A 1PEYA 5LYJA 3RRZA 3HVJA 2FRDC 4ESHA 1WDTA 3WDKA 2V0NA 4JP8A 1GAEO 5ALLA 2GKSA 2B69A 4GUDA 3C45A 2PLRA 4JVNA 3BD7A 1PHRA 2AN4A 2JAPA 3QX9A 3TQIA 3RYCA 4E13A 1FX0A 2P2SA 4NYJQ 4AJEA 1YAJA 2GBIA 3BJIC 2AH5A 4HUJA 2PUWA 1AB6A 4KWHA 4ENWA 3ZWCA 1JU4A 1E1CA 3H4TA 1GGNA 4R1UA 2O9JA 1SUDA 1EDZA 3AIIA 1NJ2A 2VTVA 3SNHA 3NHZA 2ONYA 4ZAXA 3WLFA 4ID3A 4OP2A 5TS3A 2LRHA 4F8YA 2QDKA 3CT4A 1RYFA 3ZH2A 3BE6A 1M1YA 1LBQA 2PX0A 3G17A 3EGDB 3O8OB 4AKGA 4P84A 4TT8A 1T8RA 1G6OA 2JLCA 1X19A 3WGMA 1BCRA 1MB9A 4F6LA 1ZVJA 5ECWA 3TTUA 1TF5A 2OORC 3IPCA 1M74A 4IQ0A 5EKTA 2ZRBA 3DB1A 3KZNA 4Z4HA 2K4MA 5BV7A 1ZRNA 3FHLA 3LWNA 3QF4B 4DPLA 5CG2A 4D9CA 5KNLA 1W52X 3PLNA 4W5TA 3X2FA 3BMXA 3Q7RA 3PUVA 1I3CA 4MJXA 5H8WA 1XZLA 4P8RA 1L4YA 1XCJA 1BH2A 1DMSA 1IQ0A 1OBVA 5DT9A 3TZ6A 2IXAA 5A2GA 3K1TA 2QPTA 1PLJA 2HF7A 2X1VA 3NI2A 5AVXA 1IZ7A 3BFJA 4M9CA 5CIWA 5A05A 4JI3B 1GKIA 2MINB 4S1WA 3GLHB 4BGEA 5BY2A 2IA5A 2CB0A 2Q3HA 2QYTA 3EEYA 4KFRA 3JAWB 4HFRA 4Z9BA 2N9UA 1A9SA 1SQSA 4BP1A 3DT8A 3WK9A 2CEKA 3E4CA 5HCIA 2JIBA 1PZFA 2WRZA 2AF3C 2AZMA 2X3UA 1SELA 5CIQA 2LXNA 5G3YA 3GP8A 3CUVA 4FUTA 3RFTA 3CX6A 1EVQA 3BDAA 4CNQA 2N1MA 2VAPA 4EAQA 1SBNE 2CHEA 3KLPX 4O4JA 4JQZA 1SQ5A 4JP2A 1S2GA 4RCVA 3SBXA 4ZJUA 5KIAA 1I3KA 4HAUA 3WLTA 4J49A 3TIVA 4II7A 1ODJA 4URUR 2IHZA 2PAFA 1DKOA 3NHMA 3JWHA 4KIJA 3R5XA 1E2KA 3EVTA 5PNTA 1ISFA 1ZD1A 3GQBA 1KFKB 2GARA 5F7JA 1O8BA 3LYLA 1BROA 3DNPA 4EQ6A 5ITVA 2ODBA 5LMNB 1V7QA 2R96A 2IODA 3ABIA 3BXGA 2CWDA 3ZD9A 4UMFA 5CT9A 4AJ9A 3CF0A 3CKMA 2ZE7A 5CG1A 3IQDB 2C0PA 2ODEA 1CTQA 2W48A 4GLOA 3C5HA 4KQGA 1XLVA 4ROSA 3VJLA 1YDMA 3IIIA 3OLZA 4RK0A 5EZ5A 4RQUA 1PAUA 4BFCA 2R97A 2XCQA 4XJXA 3HZHA 3D7MA 4EUSA 1RXUA 4X1KB 2C7GA 3GUUA 2JIOA 5I7OA 2X3YA 3ESDA 4NY1A 2WJYA 1AGNA 1L0BA 4G2TA 1E77A 3K71B 3Q8MA 1NN3A 3I6QA 4GOKA 3FCOA 3PPIA 1T1JA 1XU9A 3HNPA 3HCBA 4QU8A 2D2EA 4MYUA 1JLRA 2X76A 1YU6A 3I32A 3WOHA 1KFBB 1XA0A 2QAGB 4DR5B 3WIUA 1SK8A 2BI8A 1Z5WA 1MAVA 3HC7A 3T4EA 4I6EA 3QVGB 5LMZA 4KRGA 1DMRA 2Q0SA 1NXPA 2CVOA 3GZNA 2WJAA 3GGOA 1ONPA 2BDEA 3EPHA 1Z4JA 3VHXA 2VBIA 3GLGE 1HNNA 1L6IA 2HF9A 3EFBA 3GZTB 2OAP1 1Q57A 3LX6A 4FQ8A 4JFAA 4L1KA 4RF4A 3IMFA 2Q7OE 4OK6A 3VAZA 3BEOA 4NPHA 4KHZA 1QK4A 1ULAA 1Y6RA 5CA0B 1KVTA 1L7VC 2SKEA 2JCXA 3HWX1 3L6BA 5FPYA 1Z63A 5B3JA 3LDAA 4B40A 3E5RA 1W59A 3SS7X 3SDBA 2J31A 3GC6A 2FI1A 3DC2A 1V9SA 5LMUB 4BV8A 2EP5A 1HYGA 5K3DA 3WWPA 1TMKA 1U8TA 1WZEA 2O7NA 2W00A 4GX5A 5GY7A 5I7WA 1P17A 1P4GA 3L7AA 3NGLA 4BE9A 4UTVA 2O2YA 4RVOA 1JDBB 4Q3LA 4II3A 2VQFB 3J7TA 3P26A 3EVNA 5KNCD 2INGX 4WUVA 4B8ZA 1E62A 1H3NA 3HV2A 4AJ4A 4B4VA 3SI7A 3C8UA 3A11A 4Q4LA 1XVVA 4B31A 3TRIA 5CM8B 3OBBA 1JQDA 2RHRA 5LR6A 2YMQA 4NS4A 2FXVA 4F6CA 1TUBB 2C5FA 3PA6A 1UFRA 3PX3A 1ORHA 4QVGA 2GXUA 3CUTA 1FTYA 4NBNA 3OX4A 3IXMA 3P9XA 4BMZA 2XKKA 2BRUA 3VA7A 1T3SA 4XX1A 1HE1C 3BGOS 4V1CA 3K5WA 5BWCA 2JFOA 3PS9A 2BFMA 3GPBA 2BM9A 2DZDA 2HA5A 4GI1A 4A8JA 4Q7KA 1L3IA 4JLSA 1MENA 1BH6A 4KN6A 2OZVA 2ZRPA 5JPIA 4ZYUA 5KVVA 4CEHA 3E8MA 3G0GA 1J2RA 4YJ2F 1CIJA 3GOHA 1WULS 1TRKA 2OO5C 2JK1A 2OXRA 4FD2A 4J1SA 2YWXA 5JYCA 1DBRA 1E63A 2JRCA 2HQBA 2VJQA 1L6RA 3LA6A 4H6VA 4YO7A 3O2SB 5ISMA 2G1JA 5EE1A 2Q3EA 4ER0A 1E5QA 5I8ZA 3HLTA 2CCGA 4P7FA 1JZSA 2GEDA 3VOTA 4MXDA 3W3AH 2HJSA 1Z0ZA 2QT1A 1ZHHA 1C7JA 3DFUA 3NKFA 4ZOBA 3ZKWA 1IMJA 2OLJA 1E2JA 4KWCA 4FYKA 4LVNA 4AP9A 4L4RA 1AVTA 4AN0A 2BPOA 4Z51A 2VHEA 3K09A 2AEFA 2EARA 3M4XA 1SHJA 2O3UA 2XITA 1RWOA 1GAJA 1NASA 3DAHA 4CN8A 1HDYA 1GRRA 1O6FA 3OZUA 1NMZA 4PLHA 2J3HA 3ND6A 2ODAA 4WZAE 1L5LA 3VVCA 4YLYA 1BQEA 2E3JA 3MWKA 1WU8A 4UMEA 1J5XA 4C0JA 1ADYA 3AR9A 1A77A 4I4NA 2GM9A 1RDFA 5BSEA 4UM8B 2R85A 4TMYA 4J9UE 4GL4A 4ZCSA 3WHKA 1ZMXA 1ZL0A 3U80A 1I2ZA 3IALA 2JANA 4PAQA 2XVAA 2O3QA 2ZI7A 1MO3A 1RE0A 1O4VA 4TVBA 4TWRA 5FUBA 5CA1B 2V65A 1EWKA 3T0IA 1R6VA 3A31A 3M4YA 3IDQA 2CLLB 4AG5A 4EVIA 1XN1A 3HBJA 1Z3IX 1G8PA 2VRCD 1QORA 4U2DA 4ZEOA 4NOMA 1VHDA 5C46F 1YVPA 1I13A 1NHGA 1NBAA 1NDUA 2IP4A 3AHDA 4MI1A 1YS2X 4XM2A 3RC8A 4S1NA 4MAFA 2PGJA 3D6TB 1FNNA 7REQA 1ONNA 3LUKA 5CLGA 4X65B 4I3HA 2C54A 1K5HA 3EVCA 4MR7B 2KS6A 1YDEA 4QYIB 3KL2A 3RREA 2FJ0A 5J58A 4IH9A 2C04A 2J0SA 5ALOA 4QVIA 1M2FA 2FX2A 4Q66C 2K7ZA 4IDEA 1O9GA 4JVLA 1LPMA 4FMCF 4P33A 4Z8XA 4BCBA 1RI5A 1E6MA 2OE2A 2RGNC 1N4AA 2GPNA 1ZM7A 4R1MA 1P1IA 5I7UA 1CD5A 4LC1A 4R1TA 1XXLA 1UFVA 1E3DA 2O0JA 1VLLA 1EZ1A 2YQ4A 3FVVA 3KT6A 3LP5A 3OZIA 4NFYA 3OCXA 3EFOB 4AZSA 1F51E 2WUEA 1DAIA 4WL0A 5T6BA 4NK4A 4INOA 4W9NC 1HE2A 3QRWA 1JLMA 4CT0A 5D2CA 2ID8A 2RFLA 3AUAA 4HBZA 3NVAA 2A59A 1NYRA 3NXKA 3HVIA 3V3KA 1I0IA 4YCNA 4HXYA 1GN9A 2XVZA 3SY8A 1NMSA 5C8DA 1V3QE 3IV7A 3SLRA 4HLNA 2ZLBA 4KODA 2WP8J 3E53A 2WJ3A 1WVIA 1X1SA 4OQNA 1E1QD 3NAZA 2HLPA 3OE4A 3U6KA 1E1LA 1M54A 4G1FA 3DVLA 5TIIA 4MQ4A 3WV4A 3ZK7A 2A0XA 1X39A 4FT4A 1ZGHA 3M6LA 1ZD4A 4AAYA 4D74A 5C1BA 3RAGA 2P5SA 2WNSA 3BERA 4BKRA 3GXOA 5FTWA 2HADA 3OT5A 2HIGA 3QW4B 1LS1A 4WGFA 3S2UA 3TBKA 4JWKA 1K75A 3WQSB 2H9AA 1KOFA 2VQEB 1A9PA 1MJNA 3Q40A 4ENQA 4PC3A 2IIVA 3BICA 1DADA 2GK4A 3H2SA 5EKSA 1KY4A 1CB7A 3WKAA 1EVKA 1MT0A 3OWXA 1G17A 4F38A 1LBEA 4WBNF 3TZBA 4E5MA 2ZYWX 3I58A 5A5DA 4GR4A 4KQWA 4GXRA 4B2IA 4FYIA 3EGVA 4AT1A 5I5GA 2YWRA 3MWFA 4RDXA 1GNTA 3TI9A 2N47A 5JG7A 3VSBA 1M8PA 4OD0A 1U3TA 3OCYA 3O4FA 4PRZA 2G9QA 3DKVA 1V16A 3D4IA 3VPSA 1H65A 2HAEA 4KFTA 4CM9D 1ONSA 3IEXA 6Q21A 3BT7A 3NUQA 2ZVJA 2Q41A 4F2DA 1NNI1 4EGAA 2H5JA 3GLKA 2XRYA 5EMHA 1TEVA 4OBEA 2VF2A 5DRTA 5ETJA 1E64A 1Q2XA 4RQBA 4OHKA 5AXAA 2W5UA 1EK2A 3F9CA 1OR8A 1MGPA 1QG6A 2HK6A 4R69A 5LZ7A 3RGWS 3TB4A 4JYBA 4LMAA 1G21A 2OCXA 1GZHB 5DM60 1LRKA 3RLIA 3CWCA 5JDIA 3KUDA 3R3WA 5BVGA 1RQGA 2RARA 3GVXA 121PA 3H13A 5FYQA 1N6RA 3GD5A 1IM2A 2F3TA 2P5YA 3MT0A 4Q9HA 5AK6A 3U7RA 1H2WA 1C9MA 1ML3A 1ZK3A 5TMBA 3NYWA 4Z1MA 3H04A 2HU8A 1WVMA 1M3SA 2PVSA 3GJ6A 4P2BA 3ZE9A 1Y5LA 2EDCA 1XRJA 1L5HA 4PGFA 4R5HA 3D81A 1T0IA 4BRZA 5CDGA 2R65A 3OJLA 4MH0R 2GD6A 1VFPA 2C3UA 3LQFA 4PLVA 4XPIA 2V5UA 1ELOA 3QJYA 4KO2S 5DBGA 3EEFA 3FJ1A 5DNWA 5DP1A 4B6RA 2CNLA 3NV9A 5LSAA 4FWTA 2GCPA 4I6GA 1CEYA 3M5CA 5ERGB 2HHHB 1X6VA 1VE5A 2P79A 3N39C 1UAGA 3Q10A 1CZNA 1OV4A 3OA0A 1RAIA 2QJWA 4QECA 4IHQA 2QYOA 4A8PA 4DIDA 1SQ6A 3KV3O 3IT3A 3QUTA 4RYLA 3R8CA 1HQCA 2WDZA 4EF5A 5C35A 3MUNA 4QFBA 3D59A 3BE5A 3NATA 5IG2A 1XTSA 2AYXA 1B8OA 4PVCA 1WETA 4LJAA 3F8WA 3OI7A 1CUUA 2R44A 2BL4A 4EFDA 5KTOA 3BGVA 2A35A 1DAPA 4WXRA 3QPCA 5BSFA 2FG5A 3RS0A 1X3LA 1KZ4A 3NNDA 4MMXB 4CM4B 2RGCA 1F0NA 3OZAA 4EH1A 2EHJA 2QZJA 3H5LA 2P1ZA 3CVWA 3ESBA 1YMUA 1JH9A 3NVMB 1RC1A 4N76A 4FOLA 4DZTA 2RB5A 3FNEA 4JA0A 1Y80A 1XL1A 1C3EA 3AEZA 5EKDA 4CIXA 5FI1B 5JZVA 1G66A 5F1KA 2FPIB 1VRCA 2I6FA 1Z83A 3BSFA 3D6NB 3HS3A 4S1TA 4IXDA 4NV1A 1XMPA 1FP7A 1USGA 2J7PA 3WLQA 3Q5GA 4YJ2A 1TAUA 2WKSA 3A4LA 5EJAA 3ZDBA 2OMEA 4X41A 5LP6F 1U8XX 4P7JA 2CNWA 2HSZA 2OXTA 3E7DA 1D7AA 2B6HA 1YA8A 2VLIA 2WPDD 3FX2A 4FHZA 4G37A 3YASA 4ZI5A 4F5DA 5L3RA 3QFSA 4K1LA 4BX0A 3BH6A 1HTTA 1S8FA 5CVCA 5TE9A 1IHXA 1L7AA 1RKXA 4JA2A 4HPXB 3TPZA 2CL7X 1D3AA 3T9FA 3F4KA 1H69A 4KKVA 4KQMA 2X3FA 4BE4A 1CEXA 4YV7A 4OQZA 4H4EA 4JP3A 2NTVA 1G4AE 1UMBB 1EM8A 1NW9B 2VXOA 3QV2A 1JHYA 4RE5A 1RBMA 5HF9A 2CFCA 1X7XB 2Q5FA 2QVXX 4QQ8A 5BYKA 2AQIA 3PXAA 3D8NA 4LDQA 4DABA 4DV4B 4P32A 4AB1A 1ZK1A 2DPXA 4IKPA 5B1SA 1N9KA 3CRMA 4C4OA 5GONB 4MPRA 1G60A 4HDRB 2HPVA 4BQOA 5B2FA 1P60A 3UYLA 4C7XA 1GTL1 3RYFA 2XB9A 2ZAMA 2DPYA 3HN2A 4NCBA 1XDZA 3S8EA 2ERCA 3ZZTA 2IYLD 1X2EA 3A6HA 4QYTA 3T12A 5JW6A 4ZCPA 1EXNA 3A32A 3WFZA 2WAAA 4GPD1 5JXHA 4A6XA 3NVKI 4N54A 1VL8A 5SY4A 3B5IA 1G7SA 1PS8A 2PUHA 4OMUA 3U49A 6REQA 1N2BA 1SC4A 3ZHCA 3ZV7A 3VTAA 2Z09A 3AY3A 5F1YA 4RK4A 3TX6A 3U56A 1GPKA 2PIAA 4OEHA 5CHYA 1XV5A 5LMCA 4MI3A 4FSDA 2VS1A 3EQ8A 3S8YA 3JPWA 3DCNA 1X8KA 1CW2B 2I3ZA 1W36D 4DJEC 5H80A 3NX4A 3GRKA 4OYYA 5JNUA 2AZXA 1XG5A 2PVPA 1QBKC 1ODLA 3M8KA 4DV7B 1ZD2P 2VJYA 4EY4A 3PIDA 2PA3A 4JX9A 5ALJA 2FR8A 5AR1A 4QNNA 3ZQ6A 5IAOA 2QR3A 2AG1A 2A9KA 3DFZA 3I2GA 3ITDA 4FJ1A 2QAJA 1RADA 3FPBA 3K9CA 4I0WB 4ZYYA 3MB5A 3SYNA 3OOEA 4TMXA 3IJRA 1A5AB 2Q3LA 2QUIA 1MTZA 2RGAA 1N57A 1MRZA 3NGMA 1P2VA 5FWXB 2AFIA 1PQYA 1YFLA 1CDZA 4BVKA 4BYMA 2EQBA 4L02A 1E9EA 2C2YA 3R3YA 4D8VA 3C70A 2PWBA 4KREA 1K2WA 3EGXB 4RK5A 1JVNA 2GN1A 4R31A 1RWWA 2W11A 3LT0A 2JA1A 3PWSA 4MKRA 2X8JB 1E4YA 3JASB 1K6JA 1DRVA 2Q3CA 5JATA 1LK7A 4KPFC 3MUOA 1ZITA 4LYFA 3TJZA 3N8KA 1VL5A 4M8NE 1FTWA 2PRKA 3OP1A 1ZOPA 5K6AC 4EUNA 4KK3A 1O57A 1NW5A 4I1OA 4JQCA 2GCGA 4ISBA 3WYDA 4D0RA 2F1KA 4YXFA 3MD0A 5JPCA 2I5PO 3V34A 2AJLI 2PTHA 3H5VA 4JNCA 2RH4A 3VYRB 1IMOA 1JKJA 2GEBA 5KTSA 4J0JA 5BSGA 1WB9A 3UOAB 3C4VA 5JYEA 2ZJ1A 2J0UB 1CC1S 3ZY5A 1JN0A 1XRQA 4JJ8A 5TARA 3UM9A 3DOOA 2BFCA 4K6CA 4TL6A 5HM8A 5KSWB 2Q2QA 1NMXA 3MT8A 1CYDA 3P32A 4DCNA 3KBBA 1DWOA 4ND7A 3N86A 4OGFA 4Q3KA 1F7VA 3OOHA 1RPNA 4LJSA 5HX7A 1DX4A 3QUAA 4FCVA 3AVYA 1JKXA 1ZFNA 2DQ4A 2JHAA 2KLBA 2Q4RA 2WBLC 4RWEA 2GESA 4I7EA 4UXIA 4CM8B 1D5WA 4TLEA 3AY0A 3RS3A 3DHVA 3HNRA 4TRNA 1VKRA 2B83A 4Y2VA 2Q8PA 3GEBA 3RT9A 4YP5A 3THRA 4EA7A 1TU3A 5KYUB 2WFZA 1G5HA 4U7HA 1RHJA 4XFKA 5K8CA 4JLKA 3EQ7A 5FDFA 1YA4A 2G8NA 4FSHA 3C6BA 4TS3A 5SV2A 2GK7A 2YXLA 2DCMA 4C2TA 3EBPA 5HBRA 5EWJB 4O1IA 4JUIA 5BWBA 4G41A 1EX9A 1SA0A 2ZYTX 4FMDF 2ZSDA 4A3SA 3TZHA 1Z5UA 2B82A 4QATA 1QF9A 3C24A 4X1IA 3KZXA 2CSUA 4ZGWA 5HSGA 5EE0A 3JQQA 4MI6A 3MCZA 5TQJA 2FV8A 1V96A 3UHOA 4OYHA 3Q7IA 3WRXA 1P2FA 2FSVC 4NJMB 4Z3KA 1LPNA 4YGYA 2CHUA 3BX1A 1JIIA 4G0XA 5JAZA 4D4KA 3EDCA 3STUA 4CQMB 1GTG1 1PE0A 4KQHA 1T2DA 2NU7A 3WKBA 1YI0A 1TIKA 3OZBA 5AW6A 2QTZA 4PLWA 4RL6A 1DBWA 4CQJA 1C41A 3FMPB 1IHUA 4MV4A 3G79A 4ND6A 4CIVA 3KJGA 4DDKA 2QE7A 1JBKA 2QAGC 1P9LA 1JIXA 4ROTA 2QRPA 4RVNA 4NPAA 4J1TA 3O3CA 3B70A 3GG9A 2GAAA 2GVDC 5GIPE 4LZAA 5JSZA 2IV3A 2H2GA 3DE2X 4AMZA 5FNZA 4E22A 5IAJA 1XF9A 3DDHA 2PD4A 3ZWWA 3A9UA 3JZAA 3PGXA 1MFZA 2BKXA 4IGKA 1M8KA 1GTSA 4GRDA 3LPMA 1ZMBA 5AK4A 4OP3A 4KXFB 4JP5A 2PZBA 5BR7A 1YVRA 4JI7B 2BMVA 5FL7A 4QODA 3QXHA 2CXRA 1DTWA 4GM1A 4R8RA 5FOVA 4QBGB 4R98A 2O0KA 3FY4A 2PH5A 1JDBC 4KXLA 3S99A 4P5PA 1D2AA 4X9XA 4UNQA 3PFBA 2Y1DA 3MJFA 3QPAA 2JFBA 4IAOA 2ZJBA 2AW3A 3IP8A 4FONA 1ENPA 1L7EA 1IZZA 1SVLA 2D1FA 3NWBA 4Z0PA 3W6OA 4V0QA 5BQ5A 1JP7A 5K8JB 5JVDF 3PFHA 5GZ3A 3BWCA 4YCBA 4UUAA 2W8BA 1QQ6A 1R10A 1W0JD 3K0AB 1DPGA 3DCYA 4V03A 1G2PA 1DFGA 2ARKA 1R0BA 3BRSA 4LA4A 1E9DA 2GKOA 2HBZA 4ZT7A 3QVWA 3U4CA 1KY5A 5CAEA 1L7NA 2HXYA 2PRIA 5HZHA 4A0FA 1Z08A 1YC2A 1KYZA 3HDJA 3MUFA 4GKAA 3NVDA 4NJEA 5EKUA 2C1ZA 1XZHA 4RWZA 5D1NA 4CFYA 2FZKA 1GVHA 4C7OB 2I2DA 1C1YA 1GRNA 3FPLA 3L4EA 1T2EA 2X8BA 2X7XA 4Z8YA 3T9EA 3T9CA 3L41A 3S4YA 5LKRA 3V2HA 3EFEA 1I0ZA 3V8RA 3TSYA 4JI5B 2ATEA 3IQIX 2KX7A 1ND5A 1VIDA 2HV8A 4F4DA 5BV1A 4LTDA 2NP7A 5IABA 4WBSA 3EQ9A 2WU1A 3K4QA 5GJVC 1SKUA 5IDQA 2OK7A 2K2QB 3ZQJA 1BMDA 2O2ZA 3O7WA 1RI2A 7MHTA 3W9UA 2FE1A 3P97A 4MKGA 4QUDA 4ZEXA 3TVTA 2X1HA 2ZREA 3PHIA 1LFDB 1QCCA 3CVYA 4AUNA 2IELA 4DLKA 2XLCA 4OXRA 3BUSA 5L6MB 1HQKA 3MYRA 3ZTWA 1MDBA 4N0MA 5EJ5A 3QKIA 5BP7A 1TM3E 2C20A 1EFRA 3ICWA 2ZRGA 2GSWA 1PZEA 1R16A 3TZLA 4ITRC 3CLTD 1N8TA 1U0GA 3LGXA 3ON5A 4KDCA 5C8YB 4DKXA 5E38A 2XV1A 2QYHA 1LPBB 2H85A 3H1EA 4LQCA 5CB6A 1NE2A 3E70C 4G2NA 5C8ZA 1SWVA 4BO9A 3AG6A 1Y98A 2IE8A 4DA0A 3ROQA 2IU0A 5B7NA 2V9CA 2Y4OA 4JN6B 1SKYB 3ANTA 2BJHA 2WWFA 1JAHA 1BGXT 3ODPA 4CMCA 3CH5A 3ZGVA 4AY3A 4HH4A 5CDHA 4I4TF 5G0SA 3F0TA 4GM4A 3PRHA 1QFMA 2HPAA 4M8SA 2R4UA 4K88A 3WLPA 1MNAA 5KTMA 5DM4A 2G5TA 1ILEA 5DWVA 3JZIA 4C6HA 2VPTA 1FP6A 3MAGA 2GCIA 4E0BA 5F52A 3IAM6 4UQLA 1X7WB 1OB2A 1US8B 4DCSA 2B8NA 2RKBA 1PGOA 3G9ZA 3Q2IA 4YRGA 4QUKA 5KPDA 1E2FA 1X1AA 3K16A 4N5DA 5A4KA 5E2IA 2P4UA 2HNAA 3ZWPA 4ZC8A 1X7YA 4BNIA 1VGQA 1XDDA 2VO1A 3SM9A 4EHFA 1WAMA 2YMPA 2H06A 3RUFA 4CDMA 4ICIA 3E27A 4H0NA 4UHFA 1AK2A 3AM4A 2Q6VA 4BWGA 1MD9A 4DNOA 1N0IA 3N2GB 3IQFA 1ZCZA 2FWBA 4WRRA 4PNEA 3RUAA 1E2DA 4YHHB 1EIZA 1EU1A 2JFFA 4R05A 4JI4B 3I72A 5JO0A 2NGRA 5IH3A 1L5FA 1SKYE 2HDOA 4J0HA 4JBNA 3DYVA 4U7DA 1JMYA 3R40A 3KYCB 4BMSA 3N76A 3L43A 3QBDA 3HCNA 5AI5A 4AC9A 1JF8A 3K1YA 4AS2A 3A6EA 3DBHA 3FB1A 1LA2A 1EA5A 4Z86A 3KZCA 4L85A 5CK4A 5AVKA 4C08A 1Y6JA 1EVJA 2ISCA 3LMKA 5IXJA 3BE8A 2J8ZA 5A7HA 3K0CC 3PNKA 3ZE8A 2IKSA 4JB0A 2XUQA 4PHCA 3L04A 3SX0A 4TM7A 4MW1A 2BHLA 1E3TA 3EGWA 4R0VA 4XJSA 2UYQA 4MUNA 2Z58A 4QUJA 4PPYA 1NJFA 2PA0A 4MZDA 4KE7A 1VPLA 2Q2NA 2X13A 2X8WA 1NVGA 3ZV3A 5A03A 1FZQA 3ESCA 4G0OA 1KI8A 2BGNA 2P4HX 5AJXA 3DWGA 3KQWA 1XZNA 5FH9A 3E03A 5LQJA 2XZLA 4PFQA 2QRVB 4QO8A 1Q0PA 3M6IA 4JI6B 1QAQA 2C5GA 1FMJA 2HHAA 2ZQZA 1KSFX 2OXFA 2XCLA 3PC6A 4ILKA 3HUTA 4GI5A 3WK5A 1TYAE 5KCZA 4N03A 3UY4A 4AF7A 4FYJA 4ND4A 4R3NA 1JSZA 1P6XA 2V54A 3L79A 3TD6A 3RPEA 4XVQA 1EUQA 4FVTA 2YYAA 4R7TA 1CJKC 1J8MF 3OHSX 5LQDA 3MZ0A 4PNHA 3ZUGA 4GE0A 3LNCA 2Q4TA 2FQXA 2XNCA 3JQ9A 5EIBD 2IHBA 1YHYA 3BMOB 1IUOA 3OEYA 2VRWA 1QR2A 4IKOA 1YC5A 3DC7A 2PGAA 2GVZC 3CEAA 4UZEA 1KNXA 3L49A 3ZWAA 1K6XA 2QMUA 2NZUG 1FDIA 4PGGA 4L9AA 5FV7A 1XMOB 1Z47A 5JANA 1CE8A 1UEJA 1PFVA 3B89A 3DS8A 3EQ6A 4NARA 2QN9A 5H83A 4LCEA 1U1IA 2YV1A 4QJIA 3SSOA 4G8CA 1EP1B 1I24A 3R7NA 1OPXA 5AUOB 1J49A 1KI4A 2Z8XA 5ALRA 3COJA 1K8QA 1X87A 4B2LA 1DVRA 3SJBA 4RE6A 3Q6MA 4RKYA 4D6XA 4KW7A 1UBGA 1G3IA 4P0TA 3FZYA 3SVTA 5EIBC 3AF4A 1ONOA 1H94A 1NTOA 2ZYHA 3NC0C 2BHSA 3P2JA 2CKMA 2CV0A 4NXMB 2FPGA 2QLMA 4MCAA 3RJZA 4JFRA 4E1AA 4E2WA 4NOJA 3M1YA 4QPDA 2CDCA 3TRFA 1Z73A 2WOOA 4KMSA 3QWAA 1PDWA 3EG9A 3GCZA 4YJ3F 2XWJI 1RPJA 1DRWA 2P75A 2YL2A 3EFHA 4HWRA 4M60A 5EGSA 3SR0A 1B4DA 1HUQA 3JATB 4BZXA 1R0ZA 3KAPA 2JJ2D 2ORWA 3LDGA 2WMNB 2BUBA 1N1EA 4O25A 9ABPA 3LRXA 1UT8A 4R1PA 4RELA 4IOKA 2CNWD 4WVFA 1VE6A 4RU1A 5I9LA 1ISGA 2J59A 3BORA 3U9SA 2Y4NA 1K9VF 3UKDA 4MKXA 1Z4MA 3U19A 1V26A 4XGIA 5BQPA 4MW9A 1ID1A 3NZEA 1E2UA 1U63A 5AIAA 2HX1A 4GX0A 2WTXA 3HU1A 1SNYA 1NR7A 2BGKA 3CZ9A 4JLUA 5CBPB 4Z54A 1EH5A 4XCXA 4TVSA 3U5ZB 4AKHA 1PG5A 3PFFA 4AY2A 2BI7A 4GX2A 4XB1A 1DGQA 2OFOA 4Y6GB 3RFXA 4GOLD 5ABPA 3AU8A 3I61A 2ZYAA 4MQEB 1MOZA 5KKNB 2CXSA 1YE5A 1FRZA 1OBCA 4O59O 5JVDA 1G0NA 1NATA 2WWWA 3IL2A 5CLFA 3B1VA 2GUWA 4GBGA 4Y0NA 1FFDA 1G8HA 3LC2O 3QFRA 4ZQIA 3VU9A 4MPDA 1PQUA 1OYVA 5ALDA 4DLXA 1SWWA 1FC0A 3L0PA 3HY6A 3ANLA 1G3QA 3VR5A 3WYCA 2D4HA 2QJOA 1UBFA 1MG5A 3IULA 4AJ1A 4IHJB 4I5EA 4NI5A 1JG2A 2ZBRA 1M1ZA 2FY8A 3EXIB 3W1VA 4DEVA 5IJ0A 3II6X 4LZPA 4EJMA 2C9MA 3K8QA 3HDYA 1I1QB 2YJ6A 1U0SY 4M0DA 4PZEA 1Q12A 3QENA 5KU1A 4PZLA 3TAUA 3WO0A 5H4GA 4OQFA 4FFDA 1W5EA 2ZIFA 3O1IC 4MKIA 5BYJA 5BUQA 3HB4X 3KXIA 1MX5A 3EVFA 3QELB 3RDPA 4ZCRA 1S1MA 4IGFA 2QBYB 4Z3DA 4DCMA 5AW8A 2XQVA 3QNUA 4O2AB 4ETNA 4UZSA 1D8TA 2OC9A 1EVIA 4X20A 3V8VA 3IAFA 1HG1A 4E1BA 1E2PA 2Y1WA 5BQOA 1IBMB 2FOXA 4M0EA 4CMJA 3LIIA 1VIYA 3PENA 1XYGA 3U6BA 2ZGVA 5DHSA 1TZKA 2GA8A 4BTEA 1FPMA 1V7CA 5BN5A 3LOQA 1N6IA 1H2HA 4U7GA 3MMZA 3TLCA 3UWOA 2RD2A 3T4UA 1W73A 2AUTA 2AUNA 4YXWA 4RM2A 5LQMA 3FROA 3O73A 3K6JA 1J00A 1JQKA 1BW9B 3CRVA 3PQ5A 4G0MA 4XDYA 3ZX5A 1MJGA 4LQ4A 3SWWA 1H2FA 3R24A 2ADFA 4HNRA 1HORA 1N7GA 3ZZNA 4BGIA 1ZUHA 3GHYA 4LDNA 4E7PA 2I62A 3ILHA 1XI2A 1N1DA 2D5IA 5EMLA 2PSHA 4LJKA 2RH9B 2IDKA 1DELA 3R0ZA 3W5SA 1WB6A 1JUDA 4YI3A 1S6YA 4G1EB 1IG3A 3WIVA 1LVGA 2JCGA 2XTJA 1MVLA 5GGYA 3TIGA 3KXKA 3KDAA 1GDDA 2ENWA 1XVAA 3OETA 2PWYA 1SCBA 3RC3A 4IR7A 1V1JA 4S1VA 3TQTA 4E3WA 5A3RA 4C5CA 3BCHA 3LOPA 5JXWA 4ZQCB 3IR5A 3N0RA 1UMDB 2EKLA 4D9JA 4QRDA 2BFWA 4Q0MA 1XL0A 1Q3TA 1G1MA 1XDUA 1JA9A 1LPSA 3L7CA 4FINA 4E7OA 4YIHA 2FOIA 1QQAA 1VIVA 2FK8A 3RS5A 1IQRA 5JZ9A 2FZLA 1T4CA 2CLIB 1CF2O 2J3LA 3DOHA 4D6YA 3EARA 2YHSA 4YPOA 4J76A 4TXJA 1H2AS 3VNUA 3WXBA 1SKBA 1GQRA 4FFRA 2HJHA 1IB0A 2HCBA 3Q3EA 4HNAB 4WFJA 5EYPA 1ZGGA 4NE2A 2QN2A 4RIEA 4YB8A 3VTZA 2WSLA 1QFZA 2QA5A 5IDVA 3GCGA 1FP4B 1NXWA 4GLBA 2JIQA 5HFNA 1DNPA 2Q3FA 3LX8A 2FUG6 3ICOA 4HVAA 4Y2SA 4JJAA 3V55A 3RW9A 2FMTA 5J47A 3U3XA 1LFAA 2GQ0A 2WTMA 3IOCA 3VHRA 2V7XA 4ACAA 1YI8A 1O9HA 3HJRA 5J40A 4HXGA 3F5SA 4P86A 2PT7A 3C3JA 2QZ4A 3P2OA 4X0EA 4MO9A 4UTNA 1OT3A 1NOIA 4BFVA 1KJNA 2HO5A 5CH5A 3VC1A 2NSJA 3A3NA 1PR5A 4M1WA 4H77A 1ZHFA 1T9GS 4GX1A 2A9RA 5BVHA 1P29A 4NBVA 1T8TA 3MTEA 1WEHA 1Y5IA 3CX4A 1EHIA 2NU6B 2DQYA 5FUVA 3V4OA 2EWWA 4V0KA 5DSZA 4R5MA 2Z8YM 3RJ5A 2ZXEA 4RIFA 3LSYA 1QO0A 4LS3A 4KOEC 4FW9A 4QUAA 2C5LA 5EY5B 4CETA 4X7MA 5JI2E 1CZUA 1ZNYA 3FGPA 4MUKA 3AG5A 1XTZA 3AR6A 2XKJE 4FR2A 1Q19A 3FWKA 4LV5B 4CODB 1XEXB 1BHJA 2RKOA 3MBOA 3N75A 3S2FA 1GCAA 2GZMA 5FUQA 3O2JA 4Y0VA 1JV2B 3UPDA 1JFRA 2ID4A 5L3VA 4HN4B 1GPNA 5G0UA 1Z12A 1F6BA 4INAA 2FN3A 2P2GA 3HWSA 1R0XA 2JGIA 1LI4A 3AB8A 3EF1A 3GLRA 2P62A 3Q3GE 2XQJA 4WI1A 3EODA 4TYQA 5DKFA 3BCSA 3I05A 2GF9A 1IBKB 2P9YA 2GPJA 3H5OA 3HXLA 4U2GA 2WZQA 3GMSA 3I28A 1GT6A 3KOYA 4QXMA 2AHRA 4W8OA 1ICIA 4ODIA 3REGA 4CKXA 1LCIA 4N3AA 5AICA 3QEMB 3SSNA 5BSHA 2FMKA 4JEUA 1QYDA 4JLAA 1V1MB 2IYZA 2PXHA 2RHOA 2NNLD 1HG0A 2WUGA 3WWCA 4A8HA 1MCZA 1Q0HA 3Q7QA 4QRHA 5E3IA 2CDNA 1F3LA 3VDMA 3FPCA 3T0FA 3UMRA 2DE0X 3E9YA 3HUFA 4G9BA 2QUHA 1TYBE 4DQLA 5IU6A 4GYJA 5F77A 3UYKA 1ZUIA 2IU6A 3EXAA 5AHXA 3IUQA 3UN1A 2DBRA 2PX6A 4GLLA 3GROA 4JUCA 2FWRA 2VSYA 1B8NA 1Q84A 4C5AA 1X1CA 1VIMA 4YQEA 4U00A 4XD7D 4FHDA 3MTBA 4HLUA 1U02A 2X0JA 3GUYA 4HYEA 4TWZA 4Y9DA 3ZDCA 5HBGA 2LCFA 4ARZA 2F8TA 2ZI3A 2R751 3A58B 1PO7A 1W2WB 521PA 1LV7A 4BVHA 3EZ6A 4GRAA 1NXOA 1G8MA 1HLFA 1NR5A 3FYHA 2J5KA 4QBTA 2B4YA 3Q6IA 1MNQA 2D0PB 1UZLA 3RWOA 3TSOA 3DMTA 1R0RE 3DVAB 1HDGO 3GJSA 2YFYA 4Y6LA 2EW1A 4JJ7A 4Q48A 4X7RA 4RFLA 3SC4A 4ARUA 1PZMA 2WILA 4HRAA 4JC4A 4MUFA 1UDRA 4XRRA 1DAFA 1U8EA 1QNLA 1QG2A 2CHGA 3AETB 4RULA 1VLZA 2OUKA 3KSMA 1MAUA 1WD5A 3KHKA 3QBEA 3T7TA 4BAZA 1K7EB 3SE7A 4MPTA 4B3MB 4FFBB 1WEKA 2AVDA 2J9GA 3PUWA 4AJOA 3CLKA 1E96A 4RA6A 3OQIB 2ZJFA 1WIWA 3CF4G 4NSNA 4MZXA 4V0LA 1F1JA 2W6PA 4H6WA 2R3SA 5LUAA 3ZDZB 1IB6A 2OPBA 3TRHA 4B5LA 3L7NA 2QSJA 4S1OA 4XQGA 1ZJZA 3O4RA 3ZXUB 4ABYA 2E89A 4WOCA 2DLNA 2FKAA 2HMUA 3A9CA 4DJTA 4DV6B 5F76A 1WO8A 2BGTA 2DSNA 1AZWA 4JOBA 4R83A 5CNJA 4YH1A 1SUPA 1MRSA 4LJ8A 4MP8A 1H5QA 3R6DA 1P1BA 3N7AA 4MVJG 4P7KA 3WLNA 2Z2YA 5IT9A 3IT2A 1PRYA 3FLAA 3GA5A 3HCDA 1OBHA 3W6ZA 3QKRB 1R3DA 4BIMA 3OPYA 1U9IC 1W0KA 4MR9A 2LIPA 4B09A 3CZMA 3AJRA 3FFBA 5D7NA 1AHNA 1KR2A 1GDHA 3D1LA 3OY2A 4TT3A 1KXZA 3EEQA 1E1DA 3GBVA 2JVIA 5DW0A 5HKLA 3RR2A 4QGSA 5MGNA 4S24A 1RQPA 5JWOA 1DC7A 2F43B 2QB5A 3NJ4A 1UJ4A 1M75A 4QGBA 2C97A 4DUYB 4HYTA 3UCEA 4EJSA 4WSOA 1EFHA 1YZGA 2G9VA 1REQB 4AKSA 5C1PA 2OHGA 4DT1B 3TR6A 2Q62A 1ATZA 1SU7A 4HTFA 4TGLA 3JQ8B 5J2UB 2M6SA 3VC2A 3T7AA 4GYWA 3K70B 4G4GA 4Z0HO 5KYYA 3KTDA 1CRWG 2XXBA 4BY9E 1RWMA 4RADA 4MPJA 4IS2A 4MYRA 4FJ0A 4EZIA 2ZM5A 2VP2A 1H2XA 3AEQA 3EF0A 4M7OA 3OP4A 5GZ1A 1D4ZA 1WHSA 3DTVB 1DJOA 1T34A 3MRTA 4U3JA 3SKXA 4Q03A 1TUIA 1SKQA 1U3UA 3BDIA 3CNEA 3GPIA 4UEJA 1H8HA 3SN6A 1BFKA 4C21A 1DJMA 1Z0JA 2UZAA 1AN0A 2HR1A 1QGDA 1FP2A 1KYTA 4BZWA 3PDCA 1ZC3A 3JQFA 5TSDA 5KYNA 1PBTA 3G8DA 3ESQA 3RQIA 1LSOA 3GT0A 3JWGA 1JEDA 1MOQA 3EGCA 1P33A 4IX9A 4B2PA 1Z15A 2NUBA 3WJ1A 1KDOA 4ZHQF 4CKCB 2I1WA 1BTOA 1C1DB 1WW2A 2AOTB 3D3NA 4IW3B 1QGUB 4V0OA 5EP3A 5TQ2A 5EIHA 2OV4A 3UTDA 3QSYA 2FWPA 1F5NA 5TS2A 5DYYA 1QHFA 1FB5A 4GE3A 4BYGA 4DVJA 3P5SA 2WJWA 2Y8EA 1TT5B 1SBCA 5CCDA 3SBOA 2NAPA 3N0WA 4KYTA 1JHAA 1U2ZA 1QFYA 1AH2A 1U2DA 3PGJA 4U5XA 3DLAA 3MK31 3HA3A 3P4UA 1G18A 5DTQA 4ESOA 4AQ7A 3CTPA 5A7GA 2UUOA 4KMOA 4R8KA 4LY6A 3IFSA 3M3PA 3AP1A 2H29A 5K8UA 1Z17A 2FSGA 2PD3A 3QE2A 1B0PA 1U3DA 1EI9A 2B7BA 3KYIB 4M0LA 2C99A 4P5EA 4RETA 5CPBA 3K0KA 1PX0A 5A3VA 4AX4A 5LYJB 4RAOA 5EWLA 4Q7JB 3VYSB 3ZIAA 4ZO6A 3HWWA 1Y3DE 2ZB3A 2QTLA 3CT6A 2V5VA 2IEAA 3ZYZA 4KSCA 1WKBA 5K4GA 1H5UA 4DADA 4HVLA 2XTNA 3R5KA 4AN1A 1IE3A 3HKEB 3RYCB 1JR4A 2NWQA 2YY6A 2PO5A 3ZVNA 3H9QA 5I8WA 5J23A 1E1CB 1GG8A 2WNIA 2AEMA 2X0IA 2XA1A 4LK3A 1Y81A 1TLTA 4LZJA 4QPCA 4E15A 2W2XA 3NBMA 1Z2DA 2H08A 4J0QA 1NJ8A 1Y48E 3T34A 1QYVA 2WTBA 3ZHUA 2J3EA 2LIVA 2VJKA 2BD0A 2XNDA 2YV4A 1UK7A 1JMVA 3W5CA 1BDJA 2HYDA 3AZPA 1EINA 2A1UB 2E5WA 3NCTA 4JGIA 1BCRB 4XEHA 1I3MA 3I01A 4XIIA 3N74A 4YA6A 4O5OA 1T8WA 2BCEA 1X70A 1OLSB 5EP1A 3I4CA 1EQUA 2MHCA 1UOPA 1JHPA 2OUIA 3KSZO 5A6SA 3ENWA 1ULTA 1EGAA 2P9CA 4AG3A 1A27A 1NLYA 3C87A 1Z68A 4FHFA 4GQIA 3ABSB 3G49A 3P94A 2ZQYA 1QIFA 4CL8A 3G5AA 2FZCA 2J87A 3FD8A 4GP7A 4M9ZA 4QE3A 3WR5A 2M1ZA 2HV9A 1NVEA 2WJ6A 4PCAA 1EXWA 3GMIA 1T3GA 3I3OA 3OA2A 3NUZA 4I9FA 3BMQB 4RDCA 3UK7A 3N2NA 4Z5XA 3AYZB 3H9UA 4C2UA 4IRMA 4L8LA 4FNOA 4AROA 1I30A 3V9PA 1R5OA 1JAXA 5IFKA 1G2QA 3OUUA 1VYUA 3QX7A 1GKUB 4K6KA 2EFEB 3P71T 3CGWA 1QM5A 4QM7A 4RMHA 1P9NA 3GLIB 3O26A 1ABFA 3Q5DA 1OWMA 3MWEA 3CUWA 3DV0A 2IW3A 3DE7X 4LSGA 1Y5NA 4PYOA 4CT5A 4OAOA 4GXQA 4GSLA 4DM7A 1PLKA 1CQJA 1R18A 4GSYA 3P0HA 4FM9A 1VSTA