1IXYA

Ternary complex of t4 phage bgt with udp and a 13 mer dna duplex
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*AP*TP*AP*CP*TP*3DRP*AP*GP*AP*TP*AP*G)-3'
publication title A Base-flipping Mechanism for the T4 Phage beta-Glucosyltransferase and Identification of a Transition-state Analog
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 127
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1ixyA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1ixyA02
2IEIA 3RSCA 2GEJA 3DD1A 2GJ4A 1E4OA 1PYGA 4MHSA 3VUEA 2GPAA 1L5WA 2IEGA 4EKYA 3G2LA 3CEJA 2C9ZA 4YUAA 3RSZA 1L7XA 3MRVA 4KQMA 3BCSA 2AW3A 2C1XA 5DU2A 3QKWA 1EXVA 1FU7A 2IV7A 1RZUA 1JG6A 3CUWA 3Q3IA 2ZB2A 2ATIA 4RENA 2VCHA 3DDSA 1BX3A 1GPAA 2XA1A 5D00A 3NCHA 2QN1A 1P29A 2QRPA 1UZUA 1NLMA 2F9FA 2XGMA 3BCRA 1V4VA 1SXQA 2PRIA 4GZ5A 3OKAA 3E3NA 1XV5A 3NP7A 2IW1A 1Z62A 4N9WA 3OT5A 4MI9A 4RELA 1F6DA 4EL5A 3C4QA 1PNVA 5HXAA 3TSAA 3UYLA 4F97A 2Q6VA 3CUYA 2XCIA 1VGVA 1J39A 1XL0A 2BISA 5LQDA 4FKZA 2X0DA 3L7BA 1A8IA 3S28A 2ACVA 6GPBA 1L5QA 4GZ6A 3IAAA 3OY7A 2QLMA 3CUTA 2QN8A 4EKEA 3T7DA 3VDNB 8GPBA 3G2NA 2PQ6A 3COPA 1C8LA 1HLFA 3T3EA 4RBNA 4MHOA 3IA7A 3RHZA 2YJNA 3PE4A 3D1JA 5D01A 2R4UA 4WACA 1NOIA 2O6LA 2XA2A 4WHMA 5IKOA 2WTXA 1NOKA 2F3QA 3AMVA 2IYAA 2SKEA 3T5TA 3PE3A 4W6QA 4BFCA 3WAGA 1M5RA 1XC7A 1GFZA 9GPBA 5ENZA 4AY5A 4REMA 2OFFA 4AN4A 3QHPA 3BD8A 4KQ2A 3L7AA 1RRVA 4X7RA 2QRGA 1P4GA 2H1FA 1P4JA 4G2TA 3BCUA 4X7MA 3DZCA 2R66A 1QKJA 1FU4A 1EM6A 4CTMA 3SYMA 2X6QA 1P4HA 4BQFA 1GZ5A 3ZCUA 1FS4A 2PRJA 3MT8A 4EL0A 1FU8A 3OKPA 3EBOA 5I45A 4RIHA 2X0EA 2BGTA 3OY2A 3MS2A 5GPBA 1L5RA 3S29A 1K06A 1GGNA 1JG7A 1L6IA 2QN2A 3DDWA 2ACWA 1FTQA 2VG8A 1YGPA 4BQIA 2F3SA 2VSYA 3HBMA 3D0QA 3WADA 4MI3A 1F0KA 3CUUA 3VDMA 1C3JA 4NC9A 1ABBA 4EJ2A 3T3IA 4CTNA 3ZCTA 4QLBA 1K08A 4YI3A 4NEQA 1WUYA 2XMPA 4YI5A 1Z8DA 1LWOA 2R4TA 3Q3HA 3NB0A 3CEHA 2JZCA 2ASVA 2G9UA 3OKCA 2QRQA 2F3PA 3C48A 1PSWA 3Q3EA 3GUHA 5TMDA 1YA6A 1WW2A 1NOJA 4N39A 4RIGA 3G2KA 4RIFA 3RT1A 3MRTA 1NVKA 4KQ1A 2VCEA 1XOIA 2FETA 5DLDA 1XL1A 3BD6A 3S2UA 3BEOA 3GPBA 3T3GA 3EBPA 4N3BA 1GPBA 2H1HA 3BDAA 4GYWA 1FC0A 2GPNA 4NESA 2JLBA 1GG8A 4BQEA 4GPBA 1Y6FA 5IKPA 4AY6A 2XA9A 3MTAA 1JIXA 2R60A 4AMGA 2QN3A 3ZCSA 1XKXA 2X0FA 1AXRA 1P2GA 1WV0A 1Y6GA 3HBFA 4RIEA 3UYKA 1GPYA 1Z6PA 4F96A 1SXPA 2PYDA 1C8KA 3MS4A 3H4TA 3MBOA 2X6RA 3MTDA 2QLLA 3G2IA 2P6PA 3MS7A 3G2HA 3T3HA 4M60A 5TMBA 4AMBA 1WUTA 5JTUA 5TMEA 4GYYA 2IYFA 3MT9A 1KTIA 1B4DA 3D0RA 2SKCA 3MTBA 1P2BA 1FTYA 3CUVA 2KS6A 3OTIA 1RZVA 2C4MA 3S27A 1C50A 3G2JA 4N3CA 3HBNA 5TVGA 2HY7A 2QLNA 2QRHA 1E1YA 3WC4A 4GZ3A 2AMVA 5C1DA 3H4IA 2BFWA 1IIRA 3FROA 2XGSA 3NC4A 1WV1A 1PN3A 3HBJA 4X7PA 2PYIA 2AV6A 3C4VA 4RIIA 1JIVA 2QZSA 5JTTA 1UQTA 7GPBA 4HWGA 1H5UA 4XIFA 2XCUA 1Y8ZA 2IUYA 3MQFA 2GEKA 2QN7A 2GT1A 3CX4A 4MICA 3BD7A 3S0JA 3OTHA 3L7DA 2G9VA 3L79A 3SYRA 1FTWA 2QN9A 1O6CA 5BNWA 4FZRA 1FA9A 3NPAA 3MRXA 4M83A 2G9RA 3MSCA 2XGOA 4F9FA 4WADA 1JEJA 1WW3A 2GPBA 1P2DA 3OTGA 4MI6A 3TAXA 5DXFA 4CTOA 2R68A 4HLNA 4CDRA 3CV3A 2IV3A 3E3LA 4X6LA 4PQGA 2QNBA 2JJMA 1AHPA 3ZCVA 1IXYA 2SKDA 2VSNA 3VUFA 3ZCRA 3NAZA 3NP9A 3ZCQA 1NZFA 1UQUA 4MRAA 1L5SA 3ZCPA 2GM9A 3T3DA 2QRMA 4LEIA 4M7PA 1QM5A 2G9QA 2ECPA 2FFRA 2AZDA 2C1ZA 4XI9A 1NZDA 1Z6QA 2BGUA 1LWNA 3L01A 3TOVA 2FF5A 3O3CA 4L22A 4LDPA 4Z5XA 3CEMA 3L7CA 1L5VA 4N3AA 3MT7A 3E3OA 1JIUA 2F3UA
chains in the Genus database with same CATH superfamily
1A8PA 4E33A 2C03A 4OB7A 1N36B 1N6HA 1NFRA 1Z2EA 1SVUA 2PL5A 4HMOA 4KXVA 3LPCA 1Z45A 1AMNA 2MINA 1YDFA 3F0TA 3TNJA 1I2CA 2OENG 1T3ZA 5IDQA 3VVCA 1YJ5A 2HU8A 3O7MA 1RXWA 3GROA 2FFHA 4F5ZA 2JK1A 5DXAA 3V7WA 3SY8A 2DT8A 4GWKA 3CEJA 1ZEJA 1XWIA 2G0AA 1MO3A 3G5UA 4OA8A 3VU0A 4HCJA 1KQPA 4FPXA 2WUWE 4BVKA 4EI2A 2UXBB 4OUDA 2BGRA 2IJGX 4L2IA 3K73O 5KJEA 1LH0A 1P1JA 2HJRA 1UJMA 3HYRA 1SVKA 3B9RA 1ILEA 2FEPA 4LSGA 5FADA 3C45A 2DHCA 5EJ8A 2P4QA 1UXOA 1WHTB 4P6VF 5IHXA 2QA5A 2GDZA 2XUPA 2YZMA 3RS2A 4BFUA 5IVIA 1SY7A 1AKVA 3TDNA 4KACA 2I4LA 1TUBB 1M8KA 1REQB 2WF5A 1GKIA 4B40A 2WZDA 4HQRA 1L5NA 1F5SA 4EP1A 1IXKA 1QWSA 3DV9A 3ND7A 3HNPA 3LDGA 2CFOA 5IARA 5LNK6 4DHEA 4YREA 1NLMA 1S2NA 4PSDA 3WLNA 1NJ8A 2PRIA 3KJHA 1TZCA 4ACBA 4BLSA 2FPGB 2WA1A 3HCNA 3HFRA 5KQRA 3IKLA 3U48A 1XQ6A 4D26A 2LGJA 2ZRPA 1T8TA 2OCBA 3KCNA 3C6MA 2MSLA 3VVLA 4LBZA 2YXDA 5HBGA 3WKAA 1E9CA 3PDWA 1BDBA 4J2OA 5JAQA 1EHYA 4MKHA 4CIXA 2ZPTX 4FDTA 3LL7A 3STHA 4MI9A 1Q0ZA 1LPNA 1LPOA 1XZJA 2JEYA 3PGKA 5C8XA 5FBRB 5CU7A 1FLAA 3B78A 5DN6A 2JJ1D 2DHEA 2FK8A 4FGZA 1N1DA 3MJSA 1UDBA 2GFQA 5AK5A 1DOAA 5JC8A 2GPYA 2QL7A 4ENTA 4B85A 4KR6A 1E79D 2XVMA 2CK3A 1OCEA 2IW3A 4OHWA 1FX0A 1USUA 4CXMA 5AXCA 1H0KA 4MVXA 1XDBA 1ZESA 4GC5A 1HGXA 1EE9A 4C7OB 1K8XB 3DLHA 1Q77A 1CY7A 1K5DA 5BR7A 2QW0X 3DMNA 4X62B 4A16A 1NMXA 4J4BA 1PJAA 2REOA 1YB7A 3BH0A 3R77A 3D1VA 1VJ0A 3BWDD 2R5FA 4MHOA 3O90A 3LECA 2CYBA 1KNQA 3BCHA 3NI2A 3BXHA 1GR1A 2ODQA 2DR2A 4JFRA 3JR3A 3P9QA 1LNSA 3ZHQA 1T6NA 5ANRB 2CUTA 4Z4EA 1E69A 4MW4A 1CRPA 1RVV1 2O6LA 3HR4A 3QPCA 2XA2A 4FMDF 5G2OA 3SQWA 3H2SA 3CF0A 4MLPA 4ZICA 1VHQA 3N2GB 3QYAA 5IBQA 4OKNA 5CGQB 2IXEA 3C8DA 3N86A 2FE4A 4IO0A 2OV2A 3SXUA 4HAWA 4LC0A 1MQ8B 3HGMA 5DP2A 4N76A 1XC7A 3KZVA 5JQWA 3DMDA 2OZEA 3GRVA 6REQB 2CN1A 1KS2A 2I29A 1UPUA 1BWSA 2VOEA 3EY4A 3R5SA 1DIGA 3L8ZA 5IABA 5JSHA 1HE1C 1PFUA 3WL5A 2PUJA 3E35A 2F55A 2PU7A 2WWFA 3MGAA 3H9JA 3IAM1 1ZGZA 3MUNA 3BCUA 5BWBA 4X7MA 5A4MS 3C3CA 2Y9MB 3FUCA 3DZCA 4CZ2A 2YTZA 5B5SA 2VRCD 4KN9S 1BOOA 1USIA 1JLRA 3NKLA 1WR8A 4BMDA 4R2MA 4M0EA 1UKBA 1AN9A 5FLYA 1RSZA 4DS3A 1GZ5A 4RZXA 1T3SA 5I7SA 4F04A 5CLIA 2GLTA 4AJNA 2HWUA 3HY3A 3K2QA 1EUDB 4WXHA 2W4MA 2M6RA 4XLLA 5HQ3A 1ULBA 1KEKA 4KXYA 1NW3A 3OKPA 3EBOA 3A4NA 2YOFA 3HRHA 4GRAA 4RE5A 2FI1A 4F3YA 2X8LA 2HZ7A 4RZQA 3VPXA 4BV8A 3KFXA 4X6XA 4N54A 4JZKA 1Q1NA 3WO0A 4R71A 2D2XA 1MPXA 2FR1A 3OBIA 4GVLA 4IDPA 4OV6B 5DHSA 4QG3A 2WQ6A 1SN7A 3C3WA 1Z6TA 3K4QA 4ZIRB 5KU1A 5ILQA 5DASA 4ENPA 1U9IC 2BEKA 3HE3A 3WLFA 3ZNQA 1YGPA 4LISA 4TN1A 2O5CA 3NAGA 5KYGA 1TKAA 2PX4A 2RONA 5ALEA 5JAIA 1YASA 1KSJA 4G07A 4LRWA 3TXXA 3K20A 3D0QA 3GGCA 4XGQA 3INTA 3VKVA 3IQEA 1YZUA 1L8XA 4LVCA 4DF3A 4DIFA 1QRUA 4KAJA 5AVYA 3FHLA 1GIAA 1NQUA 3CA8A 1H2RS 1X8JA 2XGJA 4I9GA 5F4BA 1P0QA 2Z5GA 2ZPAA 1EWVA 3DL4A 2X86A 4FFLA 4K28A 1YS2X 2FWIA 3G5LA 2WBLC 1AB6A 3QLEA 2OHGA 4PXYA 2B6NA 3L1VA 4B7ZA 5K03A 4N0QA 1T8WA 2XD4A 3F7TA 4OQ4A 4K6OA 2AHOA 5ADVA 3NOOA 4L5IA 4ZYLA 3D5EA 5GTDA 2XBMA 1JUDA 2NO1A 4ZHQB 3P2JA 1BU5A 1L7PA 1BHO1 3M5PA 1P5FA 1GSAA 2VHXA 2JH3A 4RHXA 4HNUA 4PNHA 5EHXA 4JYBA 3KLPX 1VSQA 4MLDA 1N5OX 3HZHA 1I3NA 3QF4A 4NCJA 2CB0A 1G98A 2IRWA 2HK8A 3CTPA 4GSLA 1A72A 1KGDA 1VJRA 4YJHA 3PKIA 5FCDA 4EJFA 4GBJA 1LSUA 4FZVA 1EVQA 3M1AA 2PCLA 3U1VA 3H5TA 5KTTA 1TZBA 2PUVA 5KOIA 2O2JA 4WJKB 5JNWA 5A4AA 1HX7A 2WJYA 1WW8A 3JQAB 4NS1A 4WUTA 4DE5A 4LFCB 4EA9A 1GDTA 4JEIA 3B6IA 3KTOA 1YZLA 3QEJA 3QG5A 1XE3A 3FHJA 1GL3A 5TJ9A 3UOGA 1K2VN 3OJCA 4DQLA 2JGMA 2OCGA 3FPFA 3HYSA 5ARBA 2PXAA 1P77A 2IK8A 3B6JA 2HPZA 2QZPA 2YVQA 1XTTA 2WF6A 4KMOA 4U2GA 3MK31 4RIFA 3V8NA 1G4HA 1U7DA 4TT8A 4C89A 1Z0ZA 4BNHA 4C1BA 4TRMA 2R8OA 5F7JA 2B1JA 1GL7A 1V48A 1VIDA 2CW5A 4KMRA 4LQDA 3L1IA 1DAIA 1PFWA 4UJ5A 4AURA 5JNVA 2XRZA 3RVLA 2JBAB 1ORTA 3WFZA 2I2XB 1NQXA 3JQAD 3SIRA 4ATNA 7MDHA 3ZHCA 4Q12A 3ICEA 2WABA 3FYHA 4YACA 2FEMA 2VYNA 1W1IA 1Z4OA 1FPMA 2C2GA 1AUXA 1SU8A 2ET6A 2X7HA 4ZQFA 1DC7A 3R20A 1MB9A 2GZSA 2PUTA 4PC2A 3ZXYA 1EAMA 1XRSB 2UV8A 3VNBA 1PLLA 4LOAA 3B1VA 4ZVUA 2QGNA 3RYHB 2GPNA 4QXRA 1JYSA 1HOTA 5FUMA 3J7AC 1X92A 5JDIA 3IT0A 1K0FA 1VLJA 4LXHA 3AGPA 4W5RA 2AX3A 3G3EA 5BN1A 1Y4SA 1KQFA 3INYA 4NHEA 4HZUA 4AMGA 2EF1A 2GA9A 4KIGA 5FIUA 4D56A 2XTZA 3KZCA 2PZKA 2WK1A 5A9TA 5F23A 4HP8A 1G5HA 1KMMA 1RWKA 2AG8A 2ZR9A 1K4KA 2IYYA 1NONA 3BWCA 2EYUA 4JUFA 3DMFA 1SXPA 4KO8A 3RKUA 5FO1A 3C8MA 1E5TA 2RJ3A 2HKIA 3H4TA 1WZ2A 4X1KA 2EFEB 3MBOA 4BC1A 1PT7A 2VK8A 4FD3A 4Y2SA 3C5VA 4KLNA 1RJWA 3RR2A 5CHEA 4C5CA 4EGQA 2A0FA 1HDZA 3LQFA 3HJAA 3CNLA 5FA6A 2O7QA 4B7UA 1O03A 1EJBA 5HRUA 1NN5A 1KY4A 4CKBB 3H3FA 2E21A 4ZK6A 4UUNA 3UWKA 1Z0DA 3SF0A 3T1HB 3ZH9B 2AT1A 2H18A 3H0KA 2YV2A 1J8VA 2B0JA 3E6AA 1AKMA 3M6IA 5DWQA 3KC2A 4LBWA 5TMEA 4S04A 3R40A 2KBEA 3TI7A 4PRKA 3Q9UA 5IXSA 1LU9A 1WO8A 4RHUA 1FF9A 2OBLA 2O5EA 2QKYA 3I42A 3PTZA 1G1MA 1U2EA 1Z5PA 2OVBA 2ZJ2A 3NBYC 3HWSA 4LY3A 5ULLA 1T9GS 3RC1A 3VMMA 2BKEA 4QFBA 2H5EA 4MV0A 3R74A 3DMHA 5DEIA 4XSHA 4F3RA 1VCHA 2EIHA 1DQRA 2OC9A 2WT4A 2JIZD 2AOTB 3T7AA 3O91A 4N3CA 2NACA 2W6NA 1YB5A 2WAXA 3BBPA 2HY7A 2QGFA 3C3XA 3HBNA 4K1LA 1Y5MA 1Y37A 4M8IA 3VPHA 4DLYA 1NU6A 2ENWA 4LZAA 4BIIA 5ABPA 3ZE1B 4DILA 4DG9A 1ECCA 5FOWA 4DC1A 1Y5NA 4WVFA 3QK7A 3IDOA 3NDBB 4PINA 1P19A 3HS3A 5FTJA 4RSHA 4DABA 3FRJA 4M1QA 3H1TA 1I1QB 1N2BA 4KWTA 3EIOA 1YBVA 1H23A 2D1RA 3MAAC 1SM4A 3T95A 2IYTA 3IAFA 3SWWA 3ULKA 1OV6A 1CZNA 4XASA 2ST1A 1PRYA 2P9ZA 3CQ9A 5HK8A 4IOMA 4GOXA 3RVDA 1NWHA 4TN5A 1MABA 4FONA 3DAFA 1NKTA 1ZCZA 3AKDA 4MQBA 4PYRA 4FMPA 5DYWA 4IXWA 4Q4HA 1Y81A 3D8HA 1HKHA 2ID7A 3AI3A 4IRXA 5H83A 4RTNA 1ZN9A 2NTNA 4KLZA 1Z8HA 4BTEA 1M34A 2IYWA 1XEXA 2VDRB 3HJBA 3G9TA 1Z2DA 5CIYA 4PY2A 3VPGA 5IPFA 2ZB4A 2PTGA 3BUSA 1U7PA 4QTUB 3L7IA 4YPVA 2YW2A 1DDIA 3MRSA 2AC7A 2M1ZA 2B2CA 2AW5A 2GT1A 1M2JA 2VBFA 3BVPA 3PRJA 3K2IA 3CX4A 4CM6A 4IGEA 2ZBFA 4OH1A 1RXYA 4P83A 1M2OB 3JVUA 3ZHXA 4AJJA 1IWBB 1H22A 3AKCA 5LMZA 1TCCA 4MKZA 1OUMA 2PBRA 3NW9A 3R0XA 2GF2A 1MN6A 1UFRA 4BVJA 3KE8A 1JT2A 1HO3A 3LXXA 2NVBA 4KI0A 2P6NA 4D98A 5BVGA 1IATA 2HK9A 5JQGF 1S2MA 4M1KA 2QHXA 4LYGA 1PJ4A 2VWHA 4YRRA 4J3FA 3BN3A 1PJRA 4JJKA 2ZSBA 3GAFA 2W8BA 3CNOA 1K8RA 3IAM6 4JR1A 3UMVA 2QQFA 3Q9SA 3U3KA 4AD8A 3EMDA 2CLMB 5G1NA 5FH9A 1L4FA 5HFAA 1Z6YA 2VBGA 1R7RA 3Q0TA 4FYKA 4WADA 3ONFA 1SQGA 4KV9A 4WFQA 5GJCA 1JEEA 4AWXA 1U9ZA 2YASA 1HL7A 3CXRA 4C7MA 2P5TB 4TTRA 2UUOA 3KQQA 1K7EB 2IBMA 1GPH1 4QC2A 1RKQA 2HZBA 5AKEA 2BEUB 4GI5A 2J9XB 3ZHBA 2DQKA 4BGDA 1XVTA 3THOA 1ZC4A 3A9TA 1H2HA 1CUWA 3LXRA 4XX1A 1CUHA 5GAJA 1ZNQO 4KE7A 5I01A 3JQ8B 1ZISA 1LBHA 3O4RA 4LZZA 3AC0A 3OPXA 4JLJA 3KOXA 4ZXFA 4EECA 4GP9A 1AB5A 1A3CA 1JEAA 1ENYA 1P61B 1FUKA 4PSUA 5FOVA 4EF4A 4ISCA 2VSNA 4I08A 2Q2OA 1N92A 2BDTA 4G5FA 4I46A 3I62A 4UVDA 5K8CA 5ALFA 2WAOA 4G8JA 2GBGA 3JQPA 3MHPA 4TKVA 3ZCRA 1C1XA 1UFVA 3R5TA 1B74A 2CEKA 3NAZA 4P3XA 3GYGA 3H5RA 4RH1A 5K20A 1UJ5A 3O73A 4QG7A 2XZOA 3CO0S 4Q1DA 3TZBA 3OSUA 3DDUA 3VR3D 2ODNA 3E7PA 2Q3HA 2EP7A 2ZJ1A 3MT0A 2XYVA 1XG5A 4F84A 1K5GA 1WXIA 4HN2A 3VO2A 2B78A 2H1SA 1CETA 2JIRA 1T4GA 2P6OA 4HH3C 3OF5A 4PEVA 2EP5A 2OE2A 4KPUA 4L0CA 4YJ2F 2FPUA 1E2NA 2G9QA 4EK9A 1L5OA 2C84A 1ETUA 1CS4C 1RTKA 3RJZA 5GJBA 5K0NA 4EZIA 1QF9A 4ETWA 2IL1A 4FBLA 2P4SA 4GR9A 4QJ5A 4R8VA 5IC5A 3LYHA 1N5KA 2VP9A 3VJLA 3RSSA 4D9EA 5KCMA 4RTJA 1QTQA 4XD7D 1NJ6A 3IVCA 5K3EA 1ZW1A 2Q1TA 2J0UB 3EEOA 3OQ6A 4KSYA 5JDIC 2YW9A 3G0OA 3IPXA 1H05A 3KDSE 2ZT8A 3V33A 2HU5A 4Y98A 4N3GA 3QKSA 2VO1A 5GONF 2YJ4A 1T5LA 5ESDA 3LCJA 1A7JA 5F1PA 1XTZA 3I76A 3LCMA 4OHOA 1V3QE 5I48A 4NENB 3BMOB 3MWJA 4KRYA 2PX6A 4M7RA 2I66A 1WJGA 4YT8A 2II6A 5B2EA 1DVRA 4ZVMA 4W5WA 1D2EA 4FILA 4GVPA 4TWJA 2G0TA 5E0KB 4E3ZA 3UWDA 4J3NA 2FN4A 1E4OA 5JYCA 2HCBA 4F8JA 2J32A 1EK1A 4BBAA 4F86A 4WSOA 1GTRA 3I0ZA 1KQOA 3EVEA 2WQ7A 1HK7A 3GJ4A 1K66A 3H05A 3FF1A 1I3MA 1OGIA 2VP4A 4I3HA 2VA9A 1Y89A 2W6OA 3VU8A 3WSWA 1QH9A 1FQJA 1FNMA 1QO0D 4HXEB 3FH0A 3LD9A 3W4IA 1F7UA 4CG3A 4JAVC 3T35A 5EP4A 2PX8A 4WK0B 5DU2A 3W5VA 4WQMA 1AHIA 3PSAA 1EHIA 1WU7A 3ZQUA 1NVUQ 3AR2A 3BB1A 3DO6A 3DWFA 3UGJA 2RGYA 2YJTD 3W06A 5DZSA 1FRNA 5HILA 4MEAA 1U1FA 3VZRA 3NV7A 3QBTA 3PNYA 1JU4A 5FOUA 1ABEA 1Q3KA 2IYRA 2QLBA 5CFMA 1JZSA 1SO8A 1OXBB 1Z33A 4MQMA 2XA1A 2QBYB 2H9AA 1Y7TA 3DZGA 5I7AA 2QRPA 4B35A 3GJ8A 4C08A 2VF5X 3TUJC 3UBTA 4V02A 1UZUA 1ZUNB 1XZFA 2B8JA 2JNWA 1T2CA 4FC7A 2RJNA 1ZN8A 4BJ6A 1S6YA 3ZY6A 3FZNA 4EG5A 1TIPA 2R5WA 3OSZA 1U02A 4RF5A 4A73A 1AKUA 1XTRA 4WNAB 1Z0IA 3ZJ5A 2DWUA 4IIJA 4KH0A 4KQWA 2WF8A 3UJNA 2WNIA 2J4CA 1T1JA 3OQBA 2FY8A 2WYUA 1QWOA 2IA5A 2PGAA 2V4MA 4I19A 4KO1S 2WKRA 3JQ7B 4HLUA 1LA2A 5CK4A 3DE3X 5H70A 4NFHA 4N9WA 4YLGA 1PGOA 4NABA 5SV2A 2XJ9A 2BR3A 1PK9A 1Y3CE 1ZXXA 4KG7A 4RTRA 2J3LA 1ORWA 2K4MA 2QV0A 1IHXA 1PQ4A 4B48A 4ZTUB 3VR2A 4J0FA 1JHAA 2AI2A 4BNDB 3L8GA 3LKZA 4YAFA 2GEVA 1V11A 4XOIA 4BMZA 5CDUA 1HTWA 3QYFA 2QTFA 1DO2A 2IPAB 3MWGA 4FXOA 4WXMA 2G7ZA 1WIWA 3D4BA 5TARA 3QMVA 5TPWB 3S28A 2C3UA 3GA5A 1O9GA 1GP2A 6GPBA 5FX2A 4ZCPA 4KB5A 2VUIB 1IH8A 3UCEA 5C8YB 4CMEA 1LV7A 4IQ0A 1M5TA 4IVRA 1N2CA 4PXAA 4J49A 4RCVA 2GPJA 4TSFA 4RM3A 4A23A 4JMPA 2XVAA 3GLQA 1WCIA 1HXHA 1M6EX 2LRHA 2QTLA 3GLFB 1CQJA 4UTOA 5E4FA 3T3EA 2Q8NA 3TE6A 5HW0A 4DN6A 4U2KA 3EVBA 2CE2X 1J2EA 1DAFA 1QGYA 2GILA 1UWLA 2CZCA 2Q7XA 2XRMA 1KSFX 3IV7A 4DMRA 5FNVA 2IF0A 3JWHA 5SZHB 1Y80A 2XOXA 1E0SA 1JSXA 3MQ2A 1U0FA 2VQ6A 3SSOA 1LK0A 2CT8A 1R12A 4MP3A 1YRAA 2ZVJA 4PSAA 1U2RA 1OAKA 5K2OA 1AHHA 4O2BF 3HU3A 4D74A 5BSEA 1GSOA 2ZXEA 2V6MA 4PZCA 5BSVA 3PE3A 1OWLA 2D62A 1E5XA 3GJ0A 3N70A 1JV2B 1SEPA 4RKFA 4PLPA 2QYSA 1VJDA 1J0AA 1KE1A 2W2MA 1L7OA 2F9LA 2NU6B 1CKEA 1SMKA 4BY9E 3Q9NA 1GJRA 3IVGA 2H8KA 3A9WA 3VVBA 1JE1A 2IP4A 3PR3A 4JC4A 5ERGB 3OCVA 5FPSA 4JXZA 2W2NA 1JDUA 4ZO8A 2GHTA 2BGJA 1X7ZA 1II8A 2FA9A 1H4QA 3AJ9A 5HHTA 4MV5A 4Q4JB 4WCFB 3LDAA 1HT3A 1TE2A 3RASA 4BE4A 1G7RA 3G9QA 2GBCA 2WWXA 1SQ6A 1X42A 2NPOA 3KAKA 4DREA 3L7KA 1U3FA 2I4OA 3QNUA 4YJFA 3LUFA 4IZHA 2W70A 4LHVA 5E1MA 3PXDA 4LPKA 1H2EA 4F11A 1N7JA 4IP0A 4HC4A 3TCNA 4R9NA 1A4XA 1YAJA 5DSXA 3AHIA 3JAWB 5CITA 2HAEA 3B1WA 3UAGA 2CLFB 2PKQP 5HRCA 2RHBA 4PSKA 2GXQA 3GQBB 1D4AA 1NF2A 2C9YA 2GUWA 3EUWA 4QU9A 4EGAA 4OPMA 2WMDA 1JEDA 3OZCA 3WDMA 4M1WA 2UZAA 4EL0A 2V1UA 3LC0A 4KR9A 3DXYA 5CVCA 4DNFA 4EPVA 4IJ6A 4M1ZA 1RRCA 2AMFA 5LBUA 2C9CA 2D3TA 1MG0A 5GJVC 2I33A 2F17A 2JIDA 3ORQA 4BO9A 3UMFA 1C30A 4BNYA 3R3UA 1Q50A 1X2BA 2WV9A 1L5RA 5A5EA 2L69A 4X1YB 2BMAA 2VUSA 2J9FB 4LJ7A 2IF2A 2B7BA 3AFOA 4JASB 4I99A 1Z68A 2QRVA 3RFCA 1OB5A 4Y6GB 4S1NA 4E5PA 4PPYA 2O14A 5B1IA 4D8TA 4Z4IA 2FSSA 1BW9A 2GZ2A 1Z7GA 3BIWA 5EMHA 4BX2A 2QU7A 2XXJA 3C70A 1CIJA 5L3VA 1AIPA 4FQ7A 3ERCA 1H8EA 2Z9DA 4QOHA 1ZH0A 2SBTA 3IEUA 3RRYA 1ABBA 2F1OA 2FSFA 1A4RA 2CHEA 2A4KA 2OGUA 4F4JA 1GCIA 3I34X 4I6EA 5JVDA 3ROTA 1KZ4A 3O74A 4LRTB 1RQLA 1KAEA 4HDKA 5T57A 3P4UA 1B2RA 1UKYA 1NW4A 3N8GA 1T25A 3TGLA 1TC1A 3BE6A 1ADCA 4DLXA 3M7IA 3FNFA 2JHFA 3QQPA 1MJGA 4O2AB 1O77A 4U6QA 4KYIB 3GDHA 1QZXA 2UZ4A 4E03A 3IC5A 4QYIB 2GRAA 4JSRA 4BPBA 4B45A 3HJGA 4MRSA 2WF7A 4X8LA 2X5NA 2X8JB 4K6FA 3FGPA 3PDIA 2POQX 2XMZA 3LIPA 2QG4A 2IXAA 4Y1RB 4QT4A 4HWSA 3CEHA 3TNLA 4JOSA 1EFVA 4CM5A 3CNEA 3WYBA 4EG0A 1F1BA 4CR8A 3R8FA 3FTEA 4FOSA 4TLBA 5FPTA 1N8NA 1O94D 3STVA 4C29A 1C9YA 1LPBB 1SUFA 1H2YA 3C7CB 3RIHA 3VTFA 4CF3A 5BNZA 3CX7A 4ZJPA 3OE7A 4BFZA 1NI4A 4ZMSA 4ITUA 3R7FA 3SOPA 3CPEA 5TE9A 4JJ6A 3ZEIA 4R2KA 4D4HA 2YFKA 3MFQA 5T64A 1KZHA 2QJFA 1N6NA 3VZBA 2N42A 2JLQA 1IRIA 4V3BA 5A7FA 2RGDA 2P3LA 4MW5A 1UEXC 4KQ1A 3VJKA 4ZI7F 1JTEA 4KSCA 4YUVA 3VYUB 5IMBA 3SEAA 1E6CA 1Q0QA 3IR5A 3P7MA 2BCJQ 1JKJB 1O9BA 2RB4A 2C7PA 5DLDA 2GKOA 4M9QA 5CURA 2AFVA 1DKNA 2ETVA 1QC5A 3BEOA 3FUWA 4W5NA 5I9NA 2CLIB 1SBIA 4NX2A 2I2WA 2GO1A 4UREA 4XYGA 4P93A 4U63A 5K0ZA 4B3GA 3QKRB 4B3IA 3BOSA 4FFNA 1FSPA 2ZRHA 2GF0A 3N5KA 1N0UA 4PG6A 4ZMBA 4WWHA 3HXOA 3HBLA 1TO1E 1GPUA 4F1WA 3AEQB 3BDAA 2X13A 1D2AA 2A67A 5HIJA 1F8YA 3KB8A 5CPBA 3ZZMA 1XNHA 2DPMA 1PJ2A 1G60A 5IH7A 3L02A 4CMEC 3QLVA 4GR4A 1PWEA 2ZJ7A 2R47A 2FQYA 3DEAA 4BB9A 1QH1B 4EUEA 2VOJA 1DMSA 4TXMA 2A0KA 3MELA 3WLEA 1XK7A 3TB4A 1Y1TA 3GUYA 2HHLA 3PNPA 2HCJB 4MV8A 4E94A 2O2HA 1VBFA 3S55A 3UGQA 4I4CA 3F78A 1RQGA 1N2JA 5CDSA 1E2EA 3WDSA 5BN5A 3DOOA 4EELA 2X0FA 1AXRA 3LP8A 3ZE2B 1P2GA 5HZKA 1W5SA 4Q01A 2JASA 3Q6IA 2EBWA 4IUBS 1DBQA 1LC3A 1QQ6A 5JCJA 2Q46A 1E1QA 4CKCA 3GT3A 1HDEA 2NSJA 2IWRA 3PD1A 4ZCIA 3INRA 2CWWA 3D6FA 4KAXA 4YTEA 3U61B 1RAIA 3GARA 5EZYB 3VSDA 4UUOA 4RK4A 1MBZA 2O19A 1SHJA 3HM2A 3PTAA 1RLMA 5KQMA 3DDHA 2FOIA 1OU4A 4GSYA 4XIYA 1M9NA 1Q7BA 4KSBA 2ZWMA 5E7JA 1TU0A 4MWBA 4PQYA 1BRMA 2V98A 4MKIA 1DPGA 2CNNA 4URYR 3H1EA 3MIZA 5HF9A 1NQTA 1XCMA 2JA2A 3LUPA 2JAXA 4A15A 3WIOA 3GWGA 4JJ8A 1FUIA 3K5PA 3L43A 1S02A 4L5BA 4P3PA 1KTIA 1B4DA 4C6TB 3OPMA 2GM4A 4IJQA 2ZWOA 4KYTA 2V7BA 4RLFA 4FEYA 4ID3A 3ZZUA 5IAGA 4GPEA 2ZYRA 4DLKA 4FMCF 2GXUA 2ZYVX 4UDOA 2RSLA 4JQYA 3VC7A 2EXXA 3R3WA 1WWKA 2VEOA 2ZJ4A 3O3NB 5DOZA 2WC1A 2QLNA 4ZCTA 2JGLA 2QRHA 2J3IA 2UAGA 3EN0A 3DMRA 3KT6A 3KKZA 1UDAA 2P7IA 2O2DA 5A4IS 3NTRA 4X90A 1SXJE 5AW7A 4GG1A 5T7BA 2AKYA 3MINA 1SVSA 5F77A 5C1DA 3RUPA 5JADA 3EWIA 3AM4A 1N32B 2R6AA 2BM8A 3QE2A 1XZEA 3HJTA 1MG5A 1S8NA 2COEA 1XSEA 1Y1LA 2A5YB 4M21A 4PGFA 2UYYA 1WRBA 1I30A 4D8VA 5FLKA 2OV1A 3NNSA 3E9YA 2I2DA 2GCOB 4ENSA 3TK1A 3MCTA 1HR0B 4A27A 1RKBA 1JU3A 4CL2A 2YFHA 3R9WA 4JNKA 4JP8A 3ZR4B 4D79A 3HVRA 1VG9B 2EP8A 2PR2A 4G0MA 4NZNA 4C04A 4UTVA 2CV1A 2IQ5A 3E3AA 3M33A 3B20A 5ALPA 2OHIA 3F90A 4OFXA 3TQIA 1UPCA 2HBRA 1JE0A 2P0YA 1OFTA 2WJHA 3MJFA 4MQ4A 1X7YA 3NH9A 5DM4A 3CZAA 3OLQA 4MUEA 4YP7A 3SSNA 4AG6A 4H6PA 1G66A 2Q4OA 1WKBA 4I1OA 2P2GA 1JPNA 1VE9A 5BSRA 4NAUA 5EIBC 1NYRA 3P45A 3ZU4A 2GO7A 4PGAA 2ILTA 2PWZA 3PCXA 2D4HA 1QGAA 1ORIA 2GZ3A 1E7QA 3HGTA 3IHTA 3H8VA 4TMWA 4L4XA 3VTKA 4B75A 1E8NA 3VOTA 4DBLE 3D6TB 4HQ6A 3UHPA 4B33A 4YV0A 3SXJA 3FKQA 3T5GA 4RYLA 2IZZA 5MN6A 4J16C 4XE5A 5DM70 3MM4A 1XJCA 4FOPA 3VKFA 5KQGA 2DLNA 2ZQYA 1F4PA 4LDRA 1JECA 4EUKA 5CUQA 1CP2A 3OFND 1YI1A 5AHOA 5IKEA 1Z5UA 4HDQB 1NW6A 3LFTA 4CFZA 4L02A 1GQ2A 3ILVA 1GVNB 1VDZA 2E37A 2AEMA 2IPOA 2CEAA 3MTJA 3RFVA 1YSCA 2VLIA 4LJLA 3LUDA 5FBHA 5C7LO 1E20A 1R8JA 2K2QB 3P71T 5BSWA 3HU2A 4KWEA 4W5OA 3CPJB 4ZOCA 5F3DA 1KA9H 3IUMA 1SXGA 4AP5A 1OXSC 1IXYA 2AOXA 4CF5A 1UBMS 1U99A 1N3LA 3A37A 1HTTA 3QXXA 3TQCA 4DSAA 5H4GA 4YJGB 4II7A 4Y2PA 4DV2B 1BN6A 1UXJA 2Y1KA 4MI1A 3K1AB 4MR7B 1CEXA 5E9QA 2JFYA 2ODEA 1E62A 1VJ1A 2BD0A 2Q5LA 3PUIA 1C0EA 3GLIB 1LDBA 2P4EA 3PNMA 5MN5A 1QGUA 3BRSA 3LA6A 1HDRA 3OPYB 3GMSA 3ACCA 2EGHA 2ZDHA 3QTLA 3B36A 2JGDB 5KAPA 5KTKA 1OWPA 3KTAA 4L1KA 4YRPA 4A6XA 1CY6A 2QX9A 4KWCA 2O7RA 5CDGA 3EVCA 3O1IC 5JRDS 5IF9A 4FGWA 4XI9A 2NXJA 2ZT5A 521PA 5KNBH 1P7CA 4R1OA 1IEWA 1UBOS 4GXTA 4AG3A 1ZK3A 4DIEA 9ABPA 2HV8A 2QSZA 2ZTMA 3K30A 3G79A 4RA9A 5DNAA 4DM4A 4ZHQA 4KIJA 3EG9B 1QE5A 1XWWA 4AZ0B 1E3TA 2QZ9A 5ESWA 3Q40A 3K1YA 4W9MC 4F4FA 3GP5A 3K6SA 3LSTA 1GG9A 3CEMA 4LSZA 5REQB 2JFUA 1R4MA 4JP2A 3GT7A 4NE2A 1LTHR 1QG2A 3NVKI 3GAZA 1ETHA 1QJCA 2LBPA 4M8NE 4R1TA 1S2LA 1Y3AA 2GJSA 2YS6A 4BBJA 2WNHA 3I61A 1R0ZA 3EA5A 5IX8A 4MROA 2IEIA 2ZJBA 2K5UA 2NNWB 1CJKC 2ZAMA 3L4KA 3E53A 3ND8A 1UDRA 3RYCA 3RSFA 1GPLA 5CA0A 3VSAA 5ALQA 3AUAA 3GFOA 3QX7A 3MUEA 2MINB 4A8HA 5KYXA 3FUUA 5LLSA 4R01A 1NJ1A 1ZJ4A 1C80A 3TFQA 5KYUB 2GM5A 5J40A 4CWAA 3D7RA 4KTTE 3FBWA 1CJSA 4HJRA 4LTMA 5FBQB 2C9ZA 5BQ5A 4TTIA 4ZD6A 1UMCA 3ZTTA 3HDHA 3MYYA 1E59A 1XXLA 3HB5X 5JXGA 5KINB 2A88A 3TPCA 1BWRA 4YVFA 1QRAA 1K8YB 4OUDB 4DMLA 3K53A 4J0DA 4L2IB 2C1XA 3MGKA 3TZEA 2Q21A 2AUNA 1AKYA 1ODFA 3DAPA 3EF0A 4I9FA 2H08A 4KH1A 4MUKA 4AS3A 4P3KA 5B64A 4HADA 2BVNA 3HL0A 2A9RA 1LDNA 4DMGA 3IQWA 1K7FB 2R65A 3D3QA 1BQ4A 3OZVA 5T8KA 4UQOA 3USES 4E7PA 1NG9A 3WAJA 3AEYA 1HSOA 3DG9A 2A5GA 2IHTA 1DT3A 3H04A 4H7PA 4AUNA 4C4PA 3HJFA 1H2BA 1UT6A 3NQ41 3Q87B 5HF6A 1MA0A 1GQFA 1TNDA 1BA3A 5A0FA 2FGJA 3I2FA 3JR7A 4JBIA 3L2OB 5EPUA 4ZT7A 1J06A 1ZH6A 4JBHA 1K4YA 4KP7A 1BFDA 4LNAA 1R6VA 2R6FA 3TLKA 2QQEA 5K8IA 2RI1A 4IEEA 4JQOA 1WPRA 4D9GA 1AXEA 4NNPA 2PZGA 4F0JA 1N6IA 1NNI1 4OHRA 2R2GA 3S4YA 6CHYA 1IN1A 4M9XA 4X8MA 5K2MA 1DBRA 4KDFA 4XOUA 1PBNA 2CL7X 3L6RA 4YRJA 1XV5A 4EKIA 2O0HA 3WYCA 2AR0A 2A84A 2GSDA 1YI8A 3T7CA 1CQXA 1MH9A 1RI5A 1Z4LA 2VP6A 4G41A 2QWXA 3FYUA 4U7PB 1KQ3A 1D1TA 3CLSC 4JUAA 3SJBA 3L0PA 3QU2A 4TUYF 3LK7A 4X63A 2GVDC 4UBKA 4C4RA 5CXXA 2JFHA 2P69A 1C81A 2X8BA 4PYIA 5EG5A 3I1YA 2JI8A 2BISA 4BEBA 4KN5A 5LQDA 2CL0X 2DJIA 4NWIA 1TF2A 4P3OA 4RY8A 4TZKA 1V43A 1WPQA 3TDMA 1A8IA 1GOTA 1FX0B 3GNTA 5C0OE 4YCMA 4V1CI 1I3KA 4B0PA 4O4JA 3RWOA 3A1CA 4FT4A 5EHZA 1FVFA 4K0RA 3LYAA 4E22A 4U7DA 1L9XA 1YDWA 2QLMA 5DW3A 2QN8A 4ZFNA 3C8HA 3O3MB 5BMVA 4FDLA 4MB6A 3HKEA 1KEVA 1NKVA 3L1JA 3P9SA 4X97A 3M6FA 4MWSA 3QWBA 4XTCS 1JFLA 1Z4KA 4UM8B 1U7OA 1VL1A 4N01A 2B7LA 3C0KA 2XMRA 5DN6D 3FYSA 1RXSA 1VHDA 3HV0A 3LLUA 1SVMA 3MF4A 1IQ0A 1OFUA 2C0PA 4QU5A 3SBDA 5B55A 3RVNA 3FE2A 4QQRA 4J1TA 3I58A 1BEUB 1QIDA 2H3HA 2WTXA 2CK3D 3G2QA 4CM8A 5F64A 2F3QA 5A1JA 2C7QA 4QJBA 1B2LA 4JUBA 1IYZA 1PAUA 2CZQA 3D8NA 4ZZIA 1Q0PA 1N6KA 1R15A 1W0JD 1XHLA 3DZKA 3FLAA 3SXUB 3U3DA 2P67A 4A4DA 4BCDA 5I7HA 2FW9A 3WAGA 1L5HA 1FRZA 3LT5A 2EYQA 4C2UA 2JAQA 4MTCA 3JWIA 1V8DA 5JS6A 2O2GA 2JFBA 4WKCA 4NXNB 4P36A 1YCDA 1M1ZA 4YMWA 1WS6A 5C53B 1KKUA 1M73E 4DSZA 4RANA 1GKYA 3V1MA 5FPKA 1JHMA 1X77A 3QHPA 2O5RA 4KQ2A 2C3OA 4LJ8A 4NH0A 4X1IA 4GNRA 3ZVKA 4TTPA 1L2TA 3E15A 2DG2A 3OG9A 1CDEA 1W5AA 4URHA 5JSYA 4IDNA 3AUXA 4L7QA 1G18A 4LXXA 1WL8A 2L0XA 3CG4A 1XZNA 3A6EA 4RNDB 3O84A 3HCFA 1TI7A 4WL0A 3AV3A 3TUIC 2ZW9A 2HR1A 1I32A 4JGGA 3MD0A 3SYMA 4DDKA 3OICA 4BQFA 1AK2A 4NCHA 1WDKA 3HR7A 3ITKA 4RY0A 5LDHA 3W2HA 1VYHA 1F48A 4WERA 4AZVA 2ANCA 4BX0A 3JAKA 5KYVA 3UG7A 2ISCA 1E3WA 1QUFA 1TQHA 3MPOA 4NE7A 1Y3BE 2PEYA 1VI2A 1T5HX 5WRFA 3FSRA 5KQSA 5JJIA 5EZQA 4UFOA 1BVUA 4WY5A 5HQ3B 1N34B 3GJSA 1P9LA 3CR7A 3WO1A 4DLRA 3EX7C 1I7DA 1EFUA 2DQYA 4IIYA 5HM8A 3E0QA 2YHSA 3TIGA 2EX4A 3EBLA 3IIMA 3SF8A 4AJHA 4IRMA 4X24A 5TS3A 2QV7A 2DSNA 3HYNA 5BV7A 3PGVA 4DA9A 5G0WA 1VL5A 1ISGA 4KMMA 1DTSA 2CGEA 3KZOA 3RARA 1KZ7B 1A2QA 4IGFA 4F3KA 1ONNA 1KH3A 3NKVA 4FBGA 4JV5B 4QJIA 4LFBB 1HE5A 2PJDA 2CDBA 4C0KA 3PFKA 2P9GA 1PR4A 3AXSA 3EGWA 5MHTA 3K8YA 4Z6KA 1VP9A 1SZCA 3OUUA 1IHYA 4IGIA 4UE2A 3TQOA 1F0KA 2BY4A 5ED4A 5AQEA 2WOOA 4MCAA 4RK1A 1T5OA 4ND6A 3K0HA 4AZ3A 2XQJA 1ZK0A 3SMVA 4G5XA 4EHBA 2AYXA 3DDZX 4ZYUA 5JBNA 1EDDA 4X94A 1UMDA 4D44A 3HKDA 4HWOA 4CUJA 3WBBA 4Y2QA 2AUTA 1FYEA 2ECOA 3GIDA 2AR7A 4M8KA 4BO6A 1DZIA 4AKHA 1OIXA 4QKQA 2HCFA 3PQ6A 3DNMA 1VLVA 4DLPA 1NMSA 1P17A 4U0JA 2P62A 1GV0A 1ZVMA 3AR7A 1PVVA 3R7LA 3GRZA 4W9NA 3QF4B 2DWQA 3PD7A 4F2PA 1E7MA 3ETEA 1RQRA 4V24A 4YJHB 3SYKA 5F9FA 1JDJA 4YJ3F 1HNWB 5E6UA 2V9CA 2G9UA 2VYFA 3BJRA 3VNUA 2JJ8A 1PSWA 3AEXA 3RO7A 3VTZA 1X3LA 1SHZA 5CJ2A 5BV8A 3H1BA 4X44A 4JJAA 3SZLA 1BKSB 2A4MA 4DWVA 4P82A 2ZSFA 4I6JA 1IOZA 3NHLA 2BM1A 3W77A 4CNBA 2QOEA 3QU4A 1RWMA 3VI4B 1UPTA 2H6EA 3PDHA 5EIXA 1SBZA 5BV2P 4YT5A 2E6KA 2YHAA 1W75A 3T9DA 5L40A 1Y3FE 4BEWA 4D45A 5TC4A 1V8OA 2HGZA 4A2WA 2P2LA 3ICWA 1GZ7A 4W9RA 3OI7A 3FYUC 3LLVA 2IX3A 1B0PA 3GT4A 5LB2A 2G1PA 1I0IA 4AMZA 1OT5A 4ZVLA 3JZIA 4A3SA 2I4RA 3EBPA 3CIOA 2ZRGA 3NJ8A 1GZ3A 4N3BA 3VO9A 4YMVA 5BR8B 1R6TA 1PT6A 4LOJA 2D54A 3UMCA 4DLSA 1J0BA 4EAQA 4BFTA 3QVXA 1U2ZA 1B6TA 3G8DA 4RTQA 1IDN1 3ZVNA 2XQFA 4ALMA 1WG8A 1MNAA 2P5UA 3O9VA 1X1EA 1IB6A 1N2IA 1J7KA 4DGQA 4BQEA 1A98A 3MQ4A 3ZN2A 2XY4A 5C7OO 5D51S 3SFZA 4PCUA 3DOCA 2XE4A 3ABSB 4TXHA 2L42A 4PAMA 3STTA 5DCYA 4J7CA 3HMQA 2GYUA 4R8MA 3ZDEA 5JH7F 3IEXA 4AY6A 2OB2A 1JKIA 3NS7A 1Q0SA 2JH8A 4JJGA 4HZUB 1IEVA 1QFXA 2JFGA 1HQYE 1CVRA 4C7JA 3PFFA 5BRAA 3FOCA 4BNNA 3LQ4A 5HVNA 3M4NA 3Q85A 3ZZNA 2OV3A 2FZKA 4MMXB 3IKMB 4JX8A 2OC4A 3HBFA 4CEJA 5BQOA 1CJBA 3ZWNA 2UKDA 2WM8A 3JARA 4J1TC 4TYYA 1ZONA 2VYND 4P4LA 4EPTA 3PJEA 2PYDA 4BE9A 1BDJA 1DV1A 3G2OA 1SUCA 4V38A 4ZV9A 3PX2A 3K71B 4JC8A 1PTJA 3ZQJA 4L16A 5BSMA 4X1KB 2H4ZA 2QLLA 5AKIA 5G4LA 1KJ9A 5F2NA 3LUCA 4PYKA 1OIVA 4F9TA 4Y8VA 3DVAA 1J00A 3E9ZA 2G0NA 4RFSA 3MJVA 1Z4QA 3T7RA 4GWGA 2ZP1A 4MUAA 1MJGM 1JQKA 2VH2A 4LJSA 3SC4A 5CNMA 2X9QA 1WF6A 1GRRA 1K6MA 1EBBA 4MW1A 5CB4A 1GV1A 1E9VA 4ZC8A 5IC4A 3I9OA 2BI4A 3Q11A 1XQXA 4IVNA 1DELA 3P96A 2JLWA 1GLVA 2DOKA 1WKCA 3D0RA 4ARBA 1B3BA 4S1VA 1CD5A 2WI8A 1KJ8A 4NSNA 1KQNA 3TMAA 4YMIA 2LNDA 1L7RA 4OMUA 2QX7A 1KDPA 4ICIA 3KZXA 1A76A 4Y6RA 4IDQA 3S27A 1NA5A 1JLSA 5TR9A 1TU4A 2E2WA 3DFMA 3P2IA 3D6HA 3MMSA 2WT9A 4M0MA 2GASA 4PW0A 3KQWA 1XLTC 4K6GA 1SZDA 4YMGA 3M5WA 1R8SA 3WC4A 4CR6A 5K6TA 1GTL1 2GK6A 4N6GA 3B48A 4OBXA 3LVFO 5FF9A 1OTXA 3SLKA 4A92A 1O8CA 3L4SO 4B44A 5P8WA 2ATEA 1QKIA 4YN3A 3EGEA 4L8LA 3DNFA 1P7PA 2X42A 3FNEA 3ITEA 1ZA1A 1T8PA 5CX4A 2P11A 5EKDA 1NXSA 1CY0A 2FYTA 1TIKA 1RNLA 1G5TA 2V96A 1Z4JA 1W19A 1PK8A 1JIVA 2QZSA 3RJ5A 2ZITA 1U28A 1ODLA 1MABB 3Q2KA 4MVYA 1ZXBA 7GPBA 4WXEA 1BEEA 2FZCA 4N5HX 2XMBA 5D3KA 3IUBA 2YWCA 3U4HA 5F12A 1BXRA 1P4AA 4Q4HB 4ZQCB 1TAUA 2VSFA 3D3EA 4HPXB 4M7OA 1PGQA 1M34B 4B34A 1XEXB 3HXLA 5DM0A 4MYDA 4UQPA 4CF4A 1MOQA 4YAUA 4MQUA 2QT1A 2M32A 5FBWB 2FWPA 4YMUA 3OCCA 2QRUA 1NQWA 2ODPA 4WA7A 2DECA 1SK8A 2D5LA 2NVUA 4R1UA 5LQCA 4LECA 3V4RA 1NXPA 2O8BA 1UPFA 3OTHA 2HPAA 2BIFA 4ZVNA 3T52A 5DCWA 3I4CA 4YUWA 3HB7A 1LI5A 3GELA 3O0TA 5CA1F 3E4CA 5GIPE 3U37A 2ZYWX 4XYBA 5BVGB 1RP7A 3GJ7A 2A86A 4EENA 1RM5A 1P45A 2AS0A 5AVZA 3MRXA 2XYRA 5KNBA 2W8BB 2VYVA 4HEQA 4I1VA 1GITA 4EHHA 2SHKA 2J3KA 1KF0A 1BE0A 4NF2A 1WP9A 2OFWA 4OFZA 1TX4B 1N57A 4Y9UA 3T1QA 4KBGA 1F14A 1ZM3A 1R8QA 5BXYA 1OVGA 3PNBA 1J0CA 1Q83A 3SKXA 2COUA 1YFKA 4C06A 3GFQA 3HFGA 2JBHA 3NYIA 3D31A 3WAKA 1DG1G 1U2SA 1XKTA 4ER3A 3OT4A 4DWOA 1XZKA 2Y77A 3PEFA 4MUGA 4PAQA 5D6NA 4JLOA 1O57A 2JVIA 3NIGB 4HQ0A 3W8RA 5ICEA 5JS7A 5TT0A 1RIFA 3U7RA 3UATA 5IN4A 2Q27A 3QA3E 5FWNA 4UJ3A 3Q2OA 1ODCA 4GMXA 3VH4A 2FWRA 4H1TA 4TKVB 1C1XB 1P7ZA 3AB7A 4NYIQ 3RHFA 1USWA 3QIVA 3QI7A 3CRW1 3ZIUA 3PWKA 1UQUA 4UTZA 5FFFA 3T4UA 3VPAA 4CI9A 1YXMA 3P9KA 1QV7A 1SC1A 2IUEA 1RYYA 2O7NA 4I8DA 3T5BA 5IFLA 3D2LA 4G37A 2FPXA 3N0RA 4X91A 4G1CA 4B4WA 1CBUA 2QRMA 2D3WA 2VJPA 2Q1YA 4RK7A 4WOCA 5D84A 2I80A 1P8AA 4JOQA 4XSGA 4KPUB 5KYWA 1ESEA 3W9YA 1WBJB 4MQFB 4C4TA 2AZDA 1JQLB 2QMQA 2X0JA 2R0QC 2FMTA 1P73A 1IVNA 3AUSA 3TZ6A 1YKSA 4RX1A 3ZKWA 3W7AA 1T43A 3L8MA 3BREA 5AKZA 4B6RA 1S2IA 2PMKA 3ZDZB 5CW1A 2OCYC 4C87A 3KR2A 1PBTA 5BURA 2H52A 1HQDA 3O3CA 3CVOA 3DM5A 3FCUB 1KI2A 4LDPA 4Z5XA 5BNWA 4N7BA 1EFAA 2ZBQA 4Y9TA 5HOQA 1XDSA 3O8OA 1TEHA 5HCNA 4PPNA 1JDPA 1GZ6A 4N3AA 4TMTA 3QKSB 3WLAA 3ZDDA 1OTHA 5AXAA 3T99A 4F2GA 3EDCA 1SCQA 3OAAA 3L4BA 3P94A 2I8CA 1E1KA 5LCXA 3JXEA 2EDAA 5DHAA 2KLBA 1XZHA 2R3SA 4E2XA 1WCV1 4F4HA 1YE3A 1X13A 3L07A 4G0YA 1X9IA 4XDZA 3A6ZA 3LNTA 4OHXA 3STWA 3I83A 5DCLA 1CPYA 1J9ZA 2RK3A 3CS3A 5CIQA 3E7WA 1YQ9A 4NDAA 2GDJA 4ND1A 1F4VA 4OOFA 3NWPA 2BGLA 1WPXA 1XYYA 1PTJC 1I4EB 1L7EA 2O6HA 2PTHA 4MZDA 1Z5WA 4IOKA 1G9XA 1I8TA 1B43A 1B6SA 1J49A 1PKEA 4NV1A 3QU5A 4MA4A 4YFVA 3ZK9A 1DHRA 1J1UA 2RHCA 5I3CA 1AURA 4M1EA 2NZVG 2P27A 2R79A 5F35A 1ACLA 1ECBA 3CLUD 4JY7A 2GRUA 2W58A 4JN6B 2I6FA 4PG5A 1T0HB 1Z5ZA 2BJWA 2ZTVA 3KUXA 4IS2A 5J3JA 3C1AA 5HR5A 2O8CA 3IV9A 3ZWDA 1V1RA 2JJYA 3GD5A 4UBMA 5C31A 3UK6A 4H7HA 3EXFA 4IGAA 1FU7A 4OP2A 3W8EA 3BL6A 1TQDA 5HUJA 2AQ8A 5BT8A 2ARKA 4WDRA 4A03A 3ZXXA 3HCRA 2W5UA 1JG6A 3BGVA 5AM1A 3ZW9A 2XUHA 2EKBA 2VCHA 3IUQA 1XZ8A 4IIUA 4JELA 4ZKEA 4RSMA 2X22A 3CC8A 3OZGA 1PUXA 3ZHTA 5T5QA 3NANA 3I1FA 1Y6JA 4O1MA 5BNFA 1DPFA 2HDHA 4JLWA 1ZVJA 3A7EA 3JVDA 3K31A 2XQIA 4DADA 4EAAA 2G4VA 2ON6A 5GZ6A 4EB8A 5CFQA 4GOKA 4R5MA 5BR4A 3A6LA 3MA0A 1XD8A 4R6XA 4R8KA 1T36A 3UUWA 2PUCA 1KK2A 4IIJB 1FXUA 2ZZMA 1ZR4A 4LJ9A 2WM3A 4XJTA 3GA7A 1DSSG 1JLLA 1KYYA 1LPPA 3D3NA 3FY4A 3UIEA 4DPLA 4IICA 4QUBA 2X4DA 4DMCA 3K3PA 2XPCA 1AKNA 1YH3A 1L3CA 4PVCA 1NWCA 1PZXA 1R4NA 1ZZEA 2GK7A 4LGMA 4RA6B 1E4EA 2GPSA 2XHEA 4XAQA 3H8WA 3TSAA 2GZDA 3ZX4A 1HDIA 4BMXA 3TRIA 5J2TB 5D85A 5C1PA 3TLXA 1R6BX 3ZHUA 1V11B 4FDVA 3MC1A 2YQ5A 3DYBA 3LPAA 3K0AA 1U65A 1M2FA 3NBMA 1S3IA 4LRSB 2IU6A 2X0DA 2VJBA 3OZBA 1TTHA 4MEBA 1XQWA 2ZIUB 3BGDA 3IUPA 5FLEX 3RC7A 1XZGA 5JJBA 2JLVA 1KO1A 3NBFA 3ROKA 1BVHA 1DAMA 1JZQA 2AR9A 3L8CA 1FQWA 1I13A 1KPGA 3FZEA 1N2CB 3OKFA 2C2BA 4OIMA 4F4CA 3G23A 1Z83A 4TVOA 2JIQA 2JHAA 3ZVMA 4Z2AA 2AMLA 1OH5A 4BWFB 4JUIA 4L6IA 5JJLA 3KVRA 5LUAA 1WCIB 4E2FA 2H1VA 1CQJB 2R25B 5COBA 2LVBA 1DAKA 2ZRDA 4EG8A 4XWTA 3VR2D 3ELUA 3IRVA 3DE5X 4EKNB 3FTNA 3RVQA 2DPHA 4RTOA 3F4LA 1VFNA 4QOEA 4K87A 3BF8A 1D9XA 1YD7A 2R6R1 5FNVB 1SOAA 1NN1A 1K3UB 1ML4A 1WVGA 2Q45A 4YCAA 4L5CA 1ZKDA 1IL0A 1OXUA 3IIKA 3IKVA 3G59A 3UPDA 1XTJA 1JPUA 1L4LA 2EARA 4XD2A 4BAUA 1I6WA 5ITVA 2HW8A 1ZJJA 1JP7A 4DLBA 1LRLA 2V59A 4WOKA 2GXSA 1J0XO 1SZJG 4INOA 4TSFD 4YRLA 4TVSA 1NPYA 1ICEA 4N48A 1CZHA 3BWYA 1XROA 4HR7A 2AVDA 4FSXA 1ULZA 3D7SA 3L77A 4F7DA 1G2QA 1ZGCA 4I2VA 3G88A 4LC9A 3IR7A 2PH1A 4FFVA 2AK3A 4H7EA 1X7ZB 4HLQB 2D74A 1II8B 1MX1A 2GLXA 1P4JA 3JTMA 4OKIA 3GCZA 1SBQA 4PC3A 4W82A 1XMQB 1LBTA 5C3MA 3FDZA 5ARDA 2DU8A 2Q7DA 3VQTA 3IDAA 4HNQA 2HRZA 2J3EA 4TKZA 5KYTA 1JF8A 3RTGA 4YJFB 3WVNA 4RTMA 1QE3A 2E0IA 4I5GA 3AUYA 1SXJA 2W00A 3V42A 1LDEA 2H0QA 2PX2A 1O4WA 4LDZA 5I4IA 1GGKA 1Q20A 2X5OA 3FAZA 2VAWA 3A1EA 2CCKA 3V8MA 3W78A 3BZWA 1I7QB 2HNBA 1XHFA 2IY9A 1UJBA 4JR0A 3KB1A 1C14A 3LFHA 5EKXA 2Z5VA 3EXHA 2UYOA 4EPWA 4K03A 5DDIP 3D4LA 4ZT4A 1E7WA 3H13A 5J5VA 4XCQA 4HNRA 4Z3DA 5PGMA 5KQPA 2ZIGA 3CUSA 4R0VA 3HHPA 5H3CA 1NW5A 1OBFO 2B3TA 4X3CA 2G9ZA 3FOFC 2B36A 3JVEA 3WB2A 3WWZA 1WXQA 3QVGB 4XIJA 3F6CA 3SS8A 4CKYA 1TYDE 1C30B 3KEOA 2EFJA 5AI8A 3ZHVA 3M4XA 4G65A 1GPKA 4O25A 4UEKA 4BLPA 4WASA 1YUNA 3CWCA 3L4BC 5ECYA 1U63A 1ZD4A 2YV3A 2DRIA 1P31A 1I51A 1X7WA 2G40A 3EFOA 2QRVB 3GW8A 3MW8A 4FHCA 2FSIA 4FKBA 2FN3A 4DCUA 1ZPDA 4H31A 1WP4A 2HO5A 2CBZA 4S1TA 1WE2A 1HNZB 1BW9B 2VSYA 3ICVA 3IVXA 3KUCA 5GADl 4E3WA 4V0NA 2OLEA 3EDRA 3EHEA 2ZBDA 2PL1A 1CQPA 5BSTA 3RH0A 3TRJA 3VDMA 4KMSA 1Q19A 1RP1A 2IKQA 3QEAZ 4LHXA 5CFLA 3MJDA 2W6MA 4PF1A 5JVDB 2JRCA 4HDKB 1UOQA 4IJKA 1Q0HA 5C9ZA 4X65B 2X2PA 5H02A 3ZBQA 4QOIA 4NEQA 5GQSA 2KWIA 5CT8A 4M1MA 1TQ2A 4HXFB 3RJ9A 1ZJYA 3ST7A 3W5UA 1FFEA 3A9CA 5ICFA 4ETNA 1W47A 3H2IA 1F12A 3FMGA 4ED9A 3D8SA 2XMPA 1WZIA 4YI5A 1N0HA 4TRNA 1H42A 5K0BA 3HYCA 5FLXA 3U3OA 3PDIB 2FP4A 3UANA 3DDNA 2VBCA 1R74A 1RLOA 4DCTA 1UPXA 5EIFA 2JZCA 1Q15A 1P72A 4J75A 3F2IA 4R54A 4YONB 1EFVB 4JQZA 4B6SA 2RHMA 3RVPA 4ERNA 4MVJF 1NMYA 3TMKA 4H27A 1KFCB 4FU0A 4L07A 1GPMA 3KXPA 4G86A 4UPVA 3C98A 1GVHA 4R7TA 4U8HA 5EIBD 1EUYA 3HY6A 3OFJA 3PGMA 1IVSA 4K81B 4I50A 2NM0A 5BN3A 3DFZA 1NOJA 1NI4B 1YR3A 4FNGA 3VHQA 2B4YA 3X1KA 5BWLA 4ND4A 1I9GA 3EIFA 5FUBA 1E3SA 5DK6A 4WNIA 1J90A 5C8VA 1UEJA 2A5JA 3G2KA 1UJNA 3PZBA 5DHRA 1L4MA 2BBSA 1RRPA 5CH5A 2Y71A 2NU7B 3TLYA 4QSHA 4FX2A 3U7JA 2OK7A 1V3TA 3D4NA 1NX6A 1K8QA 4G97A 2J8ZA 3K9QO 5F21A 3WB0A 4DR6B 4HDRA 2RI0A 5DX0A 5IEBA 2LV8A 2XWBF 3GNSA 3HCCA 5LBTA 1D4ZA 4MWZA 4NRDA 4Y9SA 1QC5B 4CLHA 4NLLA 5AJYA 1L7MA 1E2GA 1N2OA 3I3SR 3IE0A 3PI7A 5AVWA 1DRKA 3W1VA 2UZ1A 2ZATA 1PO7A 2PS1A 1M0SA 1ZP6A 3A6DA 1G3QA 2MIIA 3IMCA 3OE7D 3PDJA 1IAQA 4K7JA 4NYMR 4UHEA 3ENQA 5BUCA 2DWPA 3H5LA 2HRRA 4YRDA 1KDTA 1DEKA 1FC0A 1R2QA 2VAPA 3B5IA 3TQRA 1BD3A 1O87A 1OXMA 3NLLA 5EXSA 2CDRA 3GGSA 1Y1KE 4X85A 3H2YA 1E3IA 4Q24A 2VXBA 5CXSA 5AKXA 3JYOA 2YY5A 3K35A 2HUPA 5I5GA 1YOVA 1IZ8A 1QH0A 1KEPA 2D5CA 9LDTA 1N33B 5BN5B 5FWYA 5EE9A 1WV0A 3UJ7A 3WV4A 4RTKA 1PJLA 2OORC 1GHTA 3UK7A 3VHXA 2LUOA 3GGOA 1QHYA 3UHOA 1T9BA 4CKCB 5LP6A 3H9CA 3DZHA 1CUUA 5AQ1A 1J8DA 4OM8A 1LI7A 4D41A 3SQXA 2VH5R 1OX4A 1L1RA 1TW2A 1WLSA 2JFXA 3RPEA 1CHDA 1MIOA 1I1NA 1UIMA 4MWOA 3ZKAA 2LTAA 4FR0A 3WSTA 3ZHYA 4Z7OB 1U9YA 3E27A 4X6YA 3BDVA 3U49A 4EBFA 1OOEA 1T9CA 2ODTX 2ONYA 5BMVB 4Z3OA 3ASYA 2MJLA 3BK1A 4NFSA 4ZVSA 2H57A 1QHXA 1KDOA 1WY5A 1FTSA 2D5IA 2G25A 4GYYA 3KKLA 1UM8A 1PFKA 4ZQEA 3WHIA 4EJ6A 2WSBA 3I05A 3ADBA 3BKXA 3L7OA 5I7VA 3LVQE 4FFOA 3NWOA 5B1YA 1FTYA 5JCJD 2ZUCA 3KEQA 2F64A 1RI3A 2XI4A 1MFPA 1RZVA 3VJRA 3BORA 1P1BA 4K2HA 4M9CA 3DYVA 4NOKA 4DCOA 1PV4A 1OLXA 2ZBRA 4EUHA 1IXSB 1T5BA 3H19A 4OUKX 4UVHA 3GBPA 1EWYA 1GA1A 3PLRA 3L8HA 4JT9A 1DWUA 2R6ZA 4ZDJA 1BOFA 2C8LA 1QDEA 4MYHA 3E8MA 4B4VA 3P9YA 1X7GA 5DI3A 3RVBA 4EG3A 3WIDA 3K9NA 3TL2A 2R00C 3H4IA 3NT2A 4H4DA 3D8UA 5DJ5A 3MINB 3O47A 1HNNA 3L7YA 1T6BY 1IIRA 2VHVA 3DCIA 4IG4A 4BKMA 2W6PA 1MMFB 2PJUA 2XQGA 1KEWA 3S8YA 1YQDA 3WL3A 1O97C 4LXUA 2EF0A 3VH3A 4AJ9A 5CMLA 2J45A 1VKHA 4KO3S 5DISB 1EGMB 4PYQA 2WAMA 3PHCA 3GRFA 3P52A 1MO4A 2QD4A 1MO6A 5CLQA 4KXNA 1U8ZA 2OG1A 2FE1A 3IAS1 4DR5B 2HU7A 3BH6A 2ZKLA 1QPZA 4MCIA 4N8SA 3DXFA 3VXKA 3WNQA 1SU7A 5K3BA 2A92A 3LUBA 2VK4A 1A9RA 1N6RA 1M2KA 2NXNA 3SVZA 3QH4A 3D5TA 1NUSA 1XF9A 3SX4A 4YRKA 2X5KO 8LDHA 3OMWA 2GEKA 3OZXA 3VYSB 1JAZA 1ADFA 2CFIA 3WK8A 1HEIA 2YMPA 1LS1A 2CMHA 2BGKA 2ZI4A 2QD5A 1X7YB 5AM0A 3OU6A 4RACA 3SDZA 3DE4X 3TD6A 3ZWCA 5KC8A 1VDMA 1DAGA 1M8FA 3IBSA 1FTWA 5K0TA 3NEAA 1AD2A 5TF0A 2C2OA 3RAEC 2O3SA 1SQFA 2WU8A 4D3ZA 3FFWA 1V5IA 5LR6A 4CQNA 1FJXA 1UUFA 1MJNA 3U7QA 2GAJA 3CLSD 3THWB 2WPNA 1SCUA 4OHPA 4QQFA 1C0PA 1WDLA 1KZYC 2OXCA 2Q2QA 2E4YA 4FUTA 4U7HA 1CZOA 5DH9A 2FMUA 1V1MA 2VXYA 4Q6WA 3SZGA 4AJ2A 3W5BA 1I36A 2GPBA 3QVJA 1UC4B 2OXRA 3ONVA 4B7XA 5BOVA 4BHTA 1CR4A 5DXFA 5ALYA 4ZCMA 3QUSA 1F5NA 3E9QA 2YWRA 5M3BA 4RDIA 2XOKA 2ZIZA 1QQ5A 3UF0A 1AO0A 3E7DA 2ZIVB 4ZJZA 1J25A 1HZZC 3HG7A 5JAUA 1AHPA 3SQMA 1QRSA 3A70A 1I10A 3AFIA 2HBQA 2JB9A 4GIBA 3PUZA 4I3GA 4X8HA 2WZQA 2G63A 1KP2A 1KERA 5EJIA 4B4OA 2PZLA 2HSDA 3A6HA 4JJFA 2H4FA 3W5JA 1JQ3A 1N4DA 2CMDA 1R0KA 3AEUA 1CW2B 3ZXIA 4JLBA 3HB9A 4ZT2A 4DM7A 4UBNA 1ABFA 4HRAA 4WFJA 3LU1A 3EF1A 2A0WA 3HRIA 3MN1A 4EHFA 3F6BX 4WNCA 5DNYB 4EHLA 1PLJA 3JVVA 2AMJA 3X1DA 3ZDFA 1U2DA 1M76A 4QL3A 1S3SA 3PUKA 4RZ2A 3SEFA 5KQLA 1QGUB 2GM9A 3JY6A 2V6BA 1D03A 1ODKA 1IMOA 2AFIA 2GCEA 2GFIA 3ZVRA 3SR3A 1AMOA 2VJNA 2FN9A 4IRUB 5CT5A 1BC5A 3ZLUA 4TT3D 3KTAB 2XF8A 1GQSA 1D1QA 1JALA 1YONA 4MGEA 5DX8A 2TRSB 4N7RA 3N5CA 2C1ZA 3K70B 1F60A 1YQEA 2I6XA 3WK9A 3HWX1 1FYFA 1U11A 3KBOA 3PXAA 3N0VA 5AICA 4M1YA 4O4LB 4KR3A 4KXUA 5ERXA 4RA9B 3K2BA 2GF9A 2WKPA 1IONA 1JL3A 3L0SA 3L6BA 4MRNA 5FTKA 4AX8A 4B5KA 3CGWA 5LYJF 2WHPA 2IZ5A 1F8FA 1IM8A 2DQSA 2NZYA 3K6SB 5HE9A 3M0EA 5ALNA 4MWGA 2G1JA 3S2FA 1Z56C 5ISMA 2C7BA 1R4MB 3AUFA 5JQGA 1IUOA 1T13A 4P7BA 4DR1B 4Q9NA 3H9UA 4K9KA 2WR8A 3T3PB 2O4UX 4QICA 4DG5A 4DLNA 3REOA 5KREA 1KR2A 4FGLA 4TXLA 4ZO4A 1N5MA 1J24A 3ORRA 4K46A 3A4VA 4UCFA 2PZAA 1M54A 3K70D 1AJEA 5EP3A 2P9HA 3RYCB 1V96A 4I1UA 3ITNA 5L3ZA 3SBXA 5LP6C 2FFJA 2ZIFA 5CA0B 1UBKS 1I3LA 3I39X 3VUEA 8ABPA 4NBLA 5KYXB 2VDMB 4PYNA 5G40A 4L8YA 3GFSA 3QVSA 4EKYA 1EGVB 5BQ3A 4QAJA 4CMCA 3AJDA 3F1KA 5K99A 2XNDA 2YRFA 2JFVA 2CD7A 4OBEA 4MIYA 2QI9F 1UMCB 2XUAA 2CV0A 3IIJA 1KVTA 4GXQA 3GMDA 1WEKA 3KHSA 2OBNA 1NURA 1RFLA 3SLRA 2ZK7A 4K0KB 1T2UA 2Z58A 4EIWA 1A8SA 5C1OA 4IX9A 3H4VA 3L6DA 2OP1A 1VXOA 1A5ZA 1UWVA 3I64A 2UXDB 1C5KA 3M1IA 5TPZA 1DEAA 3E4DA 1JJFA 5GJWC 4RD2A 5CJJA 3SS9X 3RGGA 3ZDQA 3Q3IA 4PCAA 4BP3A 4JI5B 2YX1A 1UK8A 3EXAA 1DLJA 4Y3UA 4OLHA 2BN4A 3LNCA 5DRTA 5HCIA 4BOYA 2F8TA 3PHHA 3EMKA 1ZOLA 1L5GB 4AJ1A 1KY5A 1X7DA 1XKQA 3IALA 3O1HB 4YJ2A 3U4QA 3G0IA 1V2HE 1I6MA 2C5FA 3CX8A 3U5ZB 2D2FA 2OXEA 1XRQA 4OHCA 1JDSA 4ZVQA 2GYWA 3Q7QA 5EFOA 3U56A 4GH5A 4CW7A 3OCXA 4L0DA 2BGWA 2QUZA 3QRWA 1V6CA 1BU8A 2W2PA 3BXOA 1AZSC 3E3NA 2J1LA 3DR5A 1U2PA 3NTOA 2V6IA 2UZ0A 2ZR7A 1KJWA 4KWHA 4QHYA 1XTUA 4D3SA 1XCOA 2X3FA 3B1FA 1UJ6A 3F5FA 1ISMA 5FPYA 4DNPA 2QQ5A 1JHRA 4Y9DA 3NHKA 3CLVA 1DO0A 4R68A 2DWCA 2SNIE 2Z1MA 3FYUB 1GA6A 3PKJA 4WZAE 2C3PA 4I4TF 4RDXA 5IG2A 2RAFA 3OH8A 4ROSA 4FKMA 2PSEA 3FF4A 2GTPA 4EZBA 2HJ9A 4MV6A 3D2BA 4R51A 2V65A 2ZAYA 3V6MA 3BJEA 5B3KA 1FVHA 2AUMA 3LT2A 3DNPA 1Z7BA 3EEFA 3EVAA 5IUKC 3QU7A 3RWMB 4DLVA 4JI0B 4P35A 4Y2TA 4ENVA 2UDPA 1ATIA 4MYCA 3WRVA 4O4JB 1DL5A 1R0BA 4LQ4A 2PH7A 4OGGA 2B69A 3WZLA 1IPEA 4R16A 3OZ7A 2P4HX 3N74A 4AW9A 2XKBA 1K5PA 3DFFA 3QEMA 2H7YA 1BFKA 1RJEA 1S2DA 1CUIA 3FPKA 3LHKA 4GEGA 4NONA 1C8LA 3HKEB 3ZQKA 2QM7A 2W2KA 1W36B 4IILA 3EAFA 3L0ZA 5EWLA 4URFA 1H3FA 1N2GA 1O0SA 4E4YA 3OA0A 3T7KA 4Y2GA 4QE3A 4CMJA 1HE2A 3TIIA 3D1JA 4JGBA 3EXIA 1FTNA 1I2AA 2O0JA 1JI0A 3B7WA 3CKMA 4WHMA 2E4AA 5IKOA 3VNAA 1ZA2A 4OJNA 3LC7O 1U5AA 1P9OA 4YA6A 5JLJA 2I2BA 2X2EA 4CM8B 3KETA 5HKKD 1FCJA 2IH4A 1QU3A 2QPOA 5CYPA 4BTVA 5KOHA 3DT6A 3QE9Y 1J09A 2VHCA 1F17A 2ESRA 2E49A 1L5HB 3G2MA 5C35A 5JNLA 1VA4A 4G8CA 4R2HA 4ZARA 3T06B 1SCJA 2ZJ3A 1NUAA 3EWSA 3DC7A 1YHYA 4AN4A 1P2SA 1WMBA 4ZI5A 5DNUA 4M0PA 1KORA 3KKEA 1Y7IA 3VO1A 2PQ2A 4GOMD 5L3QA 4NHOA 2ORWA 4X1IB 3GEDA 4JZYA 1NFFA 1IPHA 4LV5B 3EZ9A 2RCYA 3TSCA 1U2DC 4R05A 3AKZA 4I66A 2I4MA 5G3ZA 1XF1A 3AQ4A 3IO5A 1M8PA 1VC2A 5COAA 4A8JC 4H59A 4A8TA 2WVJA 4HV4A 2F59A 2DFKB 2ISSD 1ZMOA 3MJCA 2HCRA 3PIDA 4EB6A 3ROQA 4LNUA 1XU7A 5DTIA 2H0RA 1NDUA 3WA6A 4BO4A 3W5AA 4PV7A 3PQCA 4AJIA 5GINE 1K75A 4NZPA 4ZC1A 2W2XA 3IAHA 3E84A 5ALKA 3JAKB 2WSMA 3DDOA 4WRRA 1E3WB 3LBYA 4YP9A 5ESRA 3U6KA 5J9FA 2YFQA 2ENUA 1BGWA 2ZKIA 1FU8A 2Q4EA 1S3GA 3AR8A 4C4OA 2WT8A 4YIKA 1ISPA 1DXYA 1FUYB 4YT2A 1F6BA 3O2NA 4TL8A 4ZQBA 1HSZA 4B0OA 1EIWA 3MTIA 1SB9A 5GPBA 3MMNA 2IPXA 3PT9A 2CXXA 1M0TA 2RK6A 3S7TA 4NYJQ 3S29A 1J0EA 4UMFA 3SF8B 3ZWBA 3GRPA 2QTCA 2C2YA 3X0DA 2BCGY 2HA6A 2RBEA 3I5YA 1EVKA 2VG8A 4L51A 1YI0A 4FR5A 3ZY5A 3REFA 4YRAA 2VHJA 4G24A 1XDGA 5KUTA 3KALA 1TGVA 4MUBA 5DHUA 3QBVA 2F4NA 5HCUA 1DJLA 3L0YA 4JU9A 4L76A 3TZKA 1GTZA 2PA0A 3WADA 1KARA 3WDLA 1C3JA 4JBXA 2HSZA 1W9MA 1XNGA 5GIOE 2Z6UA 3PA8A 2PU5A 4MUIA 3ZBTA 3F8SA 4CHGA 1PGPA 4YP0A 3AILA 4U9HS 4AZ3B 2VF2A 3C74A 3OX4A 1TVEA 1UMDB 1Z06A 3HKDB 4MWEA 4D6YA 4KNVA 5BORA 2HLDA 1KS9A 1T9ZA 4M0UA 1HFWA 5FTWA 3RSLA 3RS0A 3GLVA 1X1RA 3KKOA 3C3MA 3QFRA 5DTEA 3NBZC 3GN1A 4GVXA 1J8QA 1XA3A 4Q03A 2NGRA 5LOVA 1ZM7A 3RBXA 3V7YA 4DQKA 2JEZA 4MX8A 3W04A 1JN0A 2IWHA 2NSYA 1ESMA 5AW0A 2OMKA 4UCWA 5IVDA 4IDDA 4UM5A 1H9AA 5E6UB 3TRDA 2UVPA 1QF7A 1A9OA 1PJ3A 2BMFA 1GNSA 2ZRAA 3Q3EA 4LG1A 2WMOB 3MG9A 1ARZA 9LDBA 5L7WA 3C85A 4RUKA 2BV3A 4FCVA 4AKGA 2V7WA 3THRA 3NAMA 3IVAA 1DC6A 4OAQA 4ND8A 2HNKA 1GAXA 1JIJA 1THMA 1EG7A 2CXQA 3GLTA 2J4FA 5DX1A 1HMYA 3B9QA 4Q7LA 4Z0PA 4RORA 2FW1A 1WZCA 1KDZA 2HA5A 3HN2A 3W3AA 4LCEA 4DCPA 1EVYA 1POXA 1K7CA 1N5DA 1QK4A 4OHYA 4BJ1A 5AK4A 3ESQA 3OZAA 1NXXA 1FRVA 3I0MA 3NTVA 3OUZA 3K4PA 4HBZA 4NBRA 3ENZA 2KYRA 2MSKA 4B4UA 2EEPA 3RTAA 1FFHA 3A3KA 2ZM6B 4JB8A 1AUPA 2FPOA 2NTVA 2DPYA 4UAJA 1ZRMA 3TJMA 2HREA 5LZ8A 4IDFA 1NNUA 5JMWA 1AKWA 1IY8A 4NU8X 4BATA 1ENOA 3A1TA 5AW1A 1USKA 2HNAA 4M0CA 4DIUA 3JASA 2PQ0A 1GSHA 1E1RA 3UH1A 4L85A 5NLLA 4Y7DA 1KXZA 2YV4A 4Q9LA 2VATA 1IZZA 1CJCA 3AOEC 4UZSA 1PG5A 3PUVA 3UT6A 3VM6A 2NP6A 3CE6A 3A2KA 2QM8A 1CUFA 1XYGA 2W6JA 3KL2A 3P0JA 4IH9A 4DXAA 4EG4A 4N41A 2PSFA 1I0ZA 4Z1OA 1AGNA 3N58A 3UJDA 1ZNYA 1ODSA 1JAYA 1Y8CA 1F3LA 2ZG6A 2V9ZA 3JARB 3GL9A 3RFUA 1A2KC 4XQ0A 1DC8A 3MHTA 1DKQA 5LDGA 3HZZA 5JPDA 2HA2A 4INJA 2O52A 4C4AA 1E6EA 4OI4A 1FS6A 5ALLA 3IRUA 2WWGA 5GOTA 3WISA 4XXHA 1Z3CA 5E7QA 3RYFA 3CXUA 1Z8NA 1WCWA 2WSSA 2VZ8A 4PX3A 1KXJA 1T29A 3DVAB 3DL7A 3I8SA 3G2HA 3F6YA 3JPYA 1ZOIA 1M6YA 1QHNA 4Q3NA 4RFSB 3AHFA 4TL7A 4X61A 1PU2A 2GCGA 5C4GB 4EQ6A 2Q28A 5TMBA 5F9HA 2IBTA 3P1JA 3BK2A 3HTXA 4NOMA 4LF5B 3FVQA 1QK3A 2ZB8A 1V7CA 5SY6A 1LV8A 3UXHA 4QLAA 4MUMA 1VGQA 2NZWA 1FS5A 3AVXA 3ASVA 2G67A 2QW8A 5DM1A 2B30A 1PW7A 4EYGA 2JCGA 5FV4A 2HSWA 4ZI7A 1J33A 3PEEA 3AWIA 4Q18A 2A3NA 3TOZA 1SCBA 3QZUA 3I92A 4LXIA 5FUYA 3TPZA 3A9UA 3QUAA 4H7KA 3RTEA 3M4YA 1FBNA 3OQJA 3JQCA 5CHYA 3LT4A 2JHGA 3WIUA 3NM4A 2NVWA 3THXA 3DSRA 3K9HA 3NXSA 1ZVKA 2YXLA 3M34A 1RZRA 2ZUEA 2G28A 5L6MB 1Q11A 3OEEA 4DQXA 3N2YA 2C59A 4HWRA 2AMVA 4BEJA 1TF5A 3ED5A 5TXGA 3ZC3A 3ON5A 1RQPA 2GBLA 4G9GA 1QYCA 3NC4A 4MO2A 4GT1A 2J5XA 3HBJA 3M6XA 3FNBA 3LGSA 1R16A 1CY1A 2JGEA 1KBOA 1YVDA 1EFHA 2H9IA 2FTKE 2WFLA 5C51B 2NZ8A 1BO6A 4GF5A 1ZMTA 5BRNA 2VT6A 1E4VA 3WMWA 2V5UA 2VPQA 5CB8A 3DHNA 3KQNA 3NXKA 2HIGA 2R62A 3F98A 3JU3A 3PPIA 4P08A 3O4HA 3ZYZA 3U60B 1Z63A 3H2HA 4WESA 3D7KA 3HUTA 3OCWA 1BXRB 3EGVA 4KX3A 3WG9A 2V8BA 3DF7A 3GJQA 4IQ8A 4Z4FA 3WYNA 4NBSA 3WOVA 5EGSA 5ITSA 4L8VA 1N6OA 1TVMA 2IHZA 4B17A 2QN7A 4BN4A 4E1BA 1GU0A 5IS2A 3CH4B 1QYRA 3UJHA 1IAVA 1RLJA 3ETCA 2I91A 3U3RA 2NVUB 4BUCA 3M82A 4H7JA 3L7DA 3M1YA 5AIBA 2O8BB 3K0BA 3QHAA 5HKOA 2QB5A 4WINA 4CFSA 2ZVDA 1YQQA 3P97A 4WT7A 3DULA 5JWOA 2H7CA 2DPLA 2YWDA 2V45A 3HCDA 3F4KA 4UAGA 4JBNA 2J46A 4D3YA 1TLFA 1VG1A 3DKPA 2ZRCA 3R3SA 5ILGA 4J9VA 3H6HA 3SI7A 1R6XA 3D0KA 1NY5A 1V16A 2C5AA 1E1CA 4E70A 5U9CA 3F9IA 3AW8A 4OP3A 3DW3X 3HYTA 1QH8A 1WW3A 5DSZA 4EGSA 4AKIA 3M2PA 4OO3A 4GDFA 3IXQA 4OX9Y 3LIIA 1WTCA 2JAOA 5JO9A 2W6IA 1DC3A 2I2AA 3ENKA 4N4AA 1Q0TA 1NASA 1WUHS 3BXGA 3PLAE 2P30A 1OFVA 4ZOAA 2A33A 1SH7A 4QBHA 4D4LA 3HEBA 4ETMA 4MDFA 1HE4A 1SU4A 2RHWA 1MOPA 4FFMA 3T1NA 3J81k 4W8OA 2P6RA 3ZCVA 2CJWA 2B8EA 4YV1A 3AJRA 2GYYA 4ARSA 1T6YA 2C97A 2Q50A 4XYLA 2C2HA 2H1OA 4NOLA 1FNDA 3DUWA 1J8FA 2BKVA 3B1JA 4ZYXA 5KNBD 4XPIA 2VYVD 3WYFA 1NPTO 3NP9A 1SBNE 1W4CA 2IHVA 4N5NA 2XD9A 5DKFA 1QDLB 1SK9A 2C4HA 2PSJA 4G1VA 1IVYA 3AYZB 1PT8A 1T26A 1U0HC 4WW0A 1L5SA 3N53A 4FZ3A 2XHZA 2BLNA 4G9BA 4A7PA 4BKRA 1AGXA 4A91A 3CUEF 2NZ2A 4PZLA 4C22A 4CQMA 5KCZA 2FN7A 3BMCA 4YK7A 3QXSA 2GOYA 1YR6A 4P4GA 4Z4HA 2IPNA 4JCCA 1G4UR 2VIIA 4RMJA 4G25A 3VJMA 5KYWB 1XNRB 1ZI8A