3PGLA

Crystal structure of human small c-terminal domain phosphatase 1 (scp1) bound to rabeprazole
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Selective inactivation of a human neuronal silencing phosphatase by a small molecule inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3pglA00
2W43A 3EF0A 2P27A 3SD7A 4CE6A 5AVUA 2IA5A 3EWIA 3KOOA 4BEVA 2YJ5A 2ZXEA 3RFUA 4AS2A 3ZW7A 1Z4QA 4L6CA 3OCYA 2ODAA 2GFHA 1RQNA 1Z4IA 3NANA 4Y2PA 5AK6A 5IT0A 1EK1A 4RETA 1RC8A 5AKGA 5ALDA 1T5SA 3OCWA 1AQ6A 2W11A 5AKXA 5AW8A 4HGRA 3AR4A 4L57A 2ZBDA 5AKYA 2YBDA 3QGMA 4XOUA 3WKDA 1YDFA 2CFRA 3MN1A 3NIWA 4JB3A 3L0YA 2JAUA 3KD3A 5AW2A 1YV9A 3AR2A 1ZRMA 3WKBA 3RF6A 2AGVA 2OM6A 3MMZA 4DWOA 5AVTA 3DDHA 4UU1A 1U2TA 1JUDA 2HX1A 3R09A 1SWVA 2I55A 5ALVA 1LVHA 1NF2A 3I76A 3ESRA 4UAUA 2BDEA 3B8EA 3ZTYA 1MH9A 2R8YA 2EARA 2AUTA 3U19A 2C8KA 3L5KA 1Z4JA 3SKXA 4UMDA 4CF4A 4ZEVA 5AVRA 2HDOA 4NWIA 3IJ5A 2G0AA 2HO4A 3QU4A 2PKEA 2ZBGA 1SU4A 4XE5A 3ZTWA 4HGPA 3L8GA 5AM4A 1L8LA 4FE3A 2JAWA 2NO4A 3N8GA 2B0CA 4EENA 1RLMA 4YH1A 1Z4KA 3U7HB 3D6JA 5AKKA 3HYCA 5AVVA 3U7GA 3WK4A 5AVXA 2WF7A 4JDPA 4NAVA 3SMVA 3SKYA 3OTQA 1N8NA 3GYGA 5AK3A 3WKCA 5AM3A 3WKAA 4EX6A 5A3RA 2O2XA 4BNDB 2C88A 3QUBA 1RQLA 3I1YA 3S6JA 3FGOA 1Z5UA 2FUCA 4OHFA 4UAVA 5ALEA 4Y2JA 1K1EA 3E58A 3IB6A 1LTQA 1RMYA 2HI0A 2FPWA 2GMWA 1O08A 4G9BA 2RBKA 3FVVA 2I7DA 4Y2XA 4ZEXA 4OD0A 3F9RA 3R4CA 2MSNA 3P96A 2FPXA 1T9ZA 4BKMA 3OCUA 5ALLA 5AKLA 3WKEA 2R8EA 2YJ6A 2BDUA 2YMMA 4BEWA 2MU1A 3FM9A 2WF9A 1XPJA 2BY4A 1L8OA 3QUTA 4RESA 3I28A 3KZXA 3QUQA 5AVQA 5AW3A 4EX7A 5AI8A 3DAOA 1ZD2P 4OFZA 2WM8A 2C9MA 5AESA 1ZRNA 2G08A 5AKJA 1S2OA 3PDWA 4EZEA 4MWOA 2R8XA 1ZS9A 5AM0A 2HHLA 2QLTA 4DFDA 2Q4RA 2ZG6A 1ZJJA 1KYTA 3FPBA 4UMEA 3MC1A 2X4DA 2JARA 3L0CA 3E84A 3WK6A 1RKUA 1EK2A 2YMLA 1F5SA 3ZI4A 4DCCA 1TA0A 4C4RA 2I54A 2I33A 5AIBA 1J8DA 3QYPA 1YNSA 2Q5EA 1RMTA 2FEAA 1VFPA 4NFLA 5AW7A 3DNPA 2HF2A 3L1VA 1YS9A 2HEGA 4FYPA 4GIBA 2I6XA 3U13A 3ZX4A 3WGVA 4KX5A 3A1EA 2HCFA 4OCZA 1Z5GA 5ALSA 3ZWKA 5AW9A 2RARA 4QQFA 4BNDA 3QU2A 4NABA 3A3YA 4Y2RA 2EATA 3ZWDA 5AVYA 1RMQA 3WK9A 3BWVA 3KDPA 2QYHA 5IS2A 1Z88A 2YMPA 2YJ3A 5AI9A 4KYTA 1YJ5A 2WF8A 3PCTA 2P69A 4NV0A 2B1QA 4Y2SA 4UMFA 3EPRA 5ALJA 3UMBA 1T5TA 2EAUA 2IOFA 3W5CA 1VJ5A 4Y2TA 5ALTA 4Y3UA 3WK5A 2C8LA 2FPSA 3W5DA 3N5KA 5ALWA 3SHQA 2GO7A 3QU9A 3U26A 1FEZA 2WFAA 2JAOA 3ZVLA 4H1WA 3QUCA 3U7FB 2HF7A 4EELA 3BA6A 1IWOA 4BBJA 5AVSA 3FZQA 1SWWA 2FPRA 1CQZA 5AK5A 3M1YA 3L1UA 1CR6A 2FPUA 5ALMA 4I9FA 5AVZA 2FI1A 4Y2VA 1ZOLA 3EF1A 3A1DA 2IOHA 2NO5A 5AM5A 3R9KA 5AK4A 1Z4OA 1XP5A 2YY6A 5ALQA 4KX3A 4YIHA 2YJ4A 5ALYA 2RB5A 5AM1A 3SLRA 1NNLA 1QH9A 2WF5A 2W4MA 2B82A 4Y2YA 3WK7A 3AR3A 1RKQA 5AICA 3NRJA 4AS3A 1Y8AA 3AR6A 3ED5A 1VJRA 1QQ7A 1S8OA 4IFTA 1TJ4A 4C4SA 5AW4A 5T41A 2PR7A 2P9JA 1U7PA 4J2TA 5AI5A 3A1CA 1WR8A 3L8HA 4XPZA 4KN8A 4AP9A 4IG4A 5AI6A 4KNWA 3AR9A 3QU7A 4UARA 2DQSA 4UMVA 2Q4TA 5ALUA 5AM2A 1L7NA 4F71A 4ZEWA 4YCMA 4PNHA 4BX0A 5AKZA 4CF5A 3NUQA 1ZD5A 2OA0A 3SF0A 3ET5A 4HGQA 1RPZA 1RKVA 2YN4A 5ALRA 5JJBA 5FP0A 2HOQA 1ZD3A 2B1RA 4HGNA 5ALXA 2CFSA 4UW9A 4YCNA 3QXGA 1ZD4A 3UMCA 3ESQA 3WK8A 4YCLA 1L7OA 3L8FA 4E88A 1J97A 3W5BA 4UASA 2WF6A 4CNQA 5ALPA 2AMYA 5AW6A 1L7PA 3B9BA 3L0BA 2OBBA 5A3QA 3AR8A 5AW5A 2D2VA 5A3SA 1L7MA 1TJ3A 4MUMA 1X42A 3L7YA 2O9JA 3UMGA 4F72A 4QJBA 2G09A 2VKQA 4EEKA 3FPSA 2NYVA 1QQ6A 4C4TA 4KNVA 5AW0A 1Z4PX 3E8MA 4UU0A 1Z4LA 4I9GA 3KBBA 3NAMA 4HAIA 2B30A 3ZU6A 5AVWA 4BYGA 1U2SA 2CN1A 1L6RA 1QYIA 2PQ0A 3ONNA 2RAVA 1N9KA 2GHQA 4YGYA 5AI4A 4HGOA 3I6BA 1PW5A 1Z4NA 5AHXA 3N28A 3CNHA 4GXTA 4UATA 4CF3A 3HLTA 1Z4MA 5AKHA 3DV9A 3OCXA 3CZ4A 1WPGA 2JGAA 4UM7A 3W5AA 3AR7A 2YMQA 1YMQA 1WVIA 3U7EB 2IOFK 5AKIA 3B9RA 3NALA 3WGUA 4XQ0A 5ALFA 3UM9A 1RLTA 2HSZA 1U02A 2AH5A 1O03A 1RDFA 2GHTA 2P11A 2ZBEA 3MPOA 4L6AA 1WZCA 1NRWA 1Q92A 4FFDA 3E81A 2WHEA 5ALZA 5AW1A 2YFYA 2B8EA 5ALOA 2G07A 3ET4A 3ZUPA 5AIAA 3N1UA 5ALNA 3PGVA 1XVIA 2G80A 3ZVMA 4DW8A 4Y2UA 3N07A 3QNMA 5ALGA 3K1ZA 5IT4A 1Q91A 2ZBFA 3ZX5A 3OCZA 3OCVA 1RLOA 2B8JA 3QU5A 3ZVNA 5AI0A 5ALIA 3QLEA 4UM5A 4BX3A 5ALHA 3AR5A 3L8EA 4BX2A 4J03A 2ZOSA 3PGLA 3TLMA 4YIKA 1RRCA 5E0OA 2FDRA 2G1AA 2G06A 3NASA 4B6JA 4G63A 2C4NA 2IYEA 3IRUA 3J7TA 3OPXA 4O8CA 3KC2A 2OYCA 1U7OA 1QQ5A 2I34A 3M9LA 2FUEA 2CFTA 3QX7A 4HYTA 1TE2A 5AKEA 4Y2QA 3VAYA 5ALKA 2R8ZA 1TJ5A
chains in the Genus database with same CATH superfamily
5HKBA 2OUKA 2XXAA 4BNGA 1Z29A 2WTUA 2R4QA 2QTAA 3LI2A 3W8DA 1BGVA 1X8JA 4NK4A 3ZHRA 4JLDA 5ADUS 3QY0A 1PEAA 2G5PA 3NHPA 4LZAA 3A6HA 4TT8A 3V33A 1PZFA 1H9AA 2X0KA 2CZQA 2Q2QA 4L72A 1SNYA 3O3NB 5EWLA 4MVJP 1VCOA 2IZ1A 2ODBA 4IWXA 3RFXA 2QTTA 1CV2A 1OBHA 4M8IA 4EJFA 3TECE 3ECAA 1UK7A 2A0XA 4XGQA 3A6LA 3RYTC 4KPGA 4RETA 2DB3A 1PWYE 1SD1A 5CBPA 1J8YF 1DP4A 1M2HA 5GJVC 3EPPA 5A06A 2J0UB 4HDQB 3ZGXA 1PWEA 4HVLA 1U5BB 4D4MA 1NW4A 1M8FA 1G2IA 3KB6A 5IFLA 2F59A 3B1FA 4JLBA 2IPNA 3BEDA 4JIMA 5ICFA 3KJZA 3OKCA 4ALIA 1W25A 1PUXA 1N2CE 5EG5A 5EXXA 4OMUA 4DLNA 4YWHA 3R0XA 3WO0A 1ZI8A 2PCLA 3T5MA 4OM7A 1SZCA 4BU0A 4ZJYA 3ICQB 2JRCA 3CRW1 4HB0A 3Q7RA 2GM9A 4DANA 3A3PA 1M6NA 3L6DA 5EJ2A 4DDUA 5H8WA 4ZCQA 4KZPA 5YASA 1QPGA 1P1HA 4YFYA 1U28A 2PLFA 3SEZA 1R0KA 2Z5FA 121PA 1A27A 4PG6A 3KWLA 4B7UA 1E6CA 3PUXA 4FGWA 1NASA 1UOOA 3GVIA 3ZCVA 3HO8A 4JP5A 1J0CA 2IDZA 1QIJA 2QX6A 1NF2A 2ATXA 2BKLA 7ADHA 2BEWB 4B43A 1GN8A 3SQWA 1JZQA 3TMYA 4XDHA 3L5KA 2D7CA 4I46A 4ZKDA 2Q3LA 2SECE 4N49A 2QV7A 3I73A 4YEDA 3ELWA 2YOFA 3GDHA 1CUSA 1V2GA 2X0IA 4NWIA 1K6XA 1OBCA 3CLTC 3GAAA 5EMKA 4D97A 3TWOA 2HDNB 2GXAA 2QORA 3B8HA 3L8GA 1K6MA 4HGPA 1NQ5A 3TPZA 3LA6A 4U9UA 5GMOA 3NGMA 4CMEA 3S99A 4KMRA 5B37A 4V38A 1E4VA 2GCGA 2OYSA 3PE4A 2XA2A 4LQDA 3CC8A 2IXEA 4ZAWA 1XRJA 1SULA 2YWDA 3JW8A 4EENA 1MW8X 1RLUA 3D2LA 4QDJA 5FORA 3TDMA 4GQIA 3Q3EA 3L18A 3MTEA 4RD3A 3O3CA 4KAAA 1OVGA 4YPOA 1RP1A 1FLAA 2HFKA 5CVTA 5JR3A 2Z98A 7ABPA 3BMQB 1US8B 2YHUA 2OWDA 3A31A 3A9VA 5GQSA 2IXFA 3NHLA 1GWNA 3BGSA 2O2GA 4MW7A 5KCMA 1O0CA 1RKBA 2JAPA 4GVPA 1VCNA 2N47A 4L8LA 1HSZA 1N8NA 2DBZA 1P18A 2J5KA 2P4EA 4N01A 4QYIB 4DSAA 3NHAA 3UJPA 2JGRA 4KQGA 3QKSA 3RBVA 3ND6A 1QHGA 1BS9A 2YZ2A 2C88A 3JQPA 3K3PA 1NLUA 1QONA 1VHWA 2B2XA 1AKQA 3DGEC 3QUBA 4MOWA 4NG4A 1EWQA 4BTEA 2B61A 4OHFA 2YNMC 4Y8VA 3TW6A 2HR1A 5AQ1A 1Z8DA 3U4AA 4YV2A 1EFAA 1QTRA 4CKBB 1PYGA 1GN9A 3TW0A 3R3SA 2W37A 3KAJA 4LZNA 4M9SA 3OUTA 3BE8A 2QVYX 4UHFA 2RK6A 5JY6A 4BBZA 2VAXA 4XWGA 4PSDA 2A7QA 3EA0A 2HAEA 3IP6A 2O20A 2ZUVA 2E2WA 4ZEXA 3WOVA 3R4CA 1FPQA 3EJ6A 3LLUA 3H5RA 1J5PA 2QYTA 4RSMA 2AG8A 4FC7A 2GTPA 4MR9B 2PD6A 5FR2A 3ID6C 4JR0A 3K0KA 3ROTA 3W2EA 2QLJA 2W22A 1Y34E 3K15A 5FOVA 2O8VA 3UA3A 4LTNA 4MYTA 1KK0A 1MTOA 2MU1A 3STHA 2QWXA 3KPWA 1HT3A 3ITDA 1JWLA 1VG9B 2FGKA 2C5AA 2FJ0A 4XIFA 4HNHA 5K2MA 1H4VB 5A6SB 3WLAA 1XPJA 2DFPA 4R9UC 1EZZA 1ZMBA 4WKOA 3AKEA 1KTIA 3GVHA 4V3CA 2OZLA 4H7PA 1PLLA 3HDQA 2DLCX 4JJAA 3F96A 1DHRA 3OKPA 4ARBA 2ON6A 4NJOA 4FYKA 3DTYA 1OLXB 2WM8A 4FR0A 4I4TA 3ZXIA 3ISVA 1IHXA 2VTBA 1K75A 1IUOA 3GNLA 3QJ5A 4MA5A 4QOHA 3U5ZB 1P2GA 4ZOAA 4KPEC 3D2AA 1QHNA 1K88A 3RTDA 4M49A 1PWHA 3FX2A 2Y9PB 5AM0A 4QFCA 2ECFA 3GJ6A 2CSXA 1DXYA 1KYTA 1RI4A 2XW6A 5C80A 4G6ZA 1F0YA 3URKA 2IELA 3PFCA 4KN5A 2XTAA 3UICA 5GINE 1NXQA 4BVKA 3UKDA 5G0TA 2EC5A 3FI0A 5H70A 1JALA 2I33A 1UBCA 4K40A 5AIBA 4CHGA 2I2FA 2AN5A 5KAMA 3AVQA 1ULZA 3AF4A 1PVVA 1V39A 1E2MA 2XX3A 4FMCB 4DA9A 1SKYB 4O2LA 2XCSB 1ICIA 4E4RA 1WHSB 4Y6RA 5LZ8A 1WUJS 2P91A 4ETNA 4ER5A 3ANLA 4Y2HA 4EFNA 5INTA 4RMNA 4DQXA 3AF2A 3DDOA 2H0RA 3GFVA 3IH5A 4BFWA 2C1ZA 3HH8A 1DMSA 2P6OA 1UXGA 1Q6YA 3ENVA 3M4ZA 4QTZA 3U4HA 4EDFA 3ZWKA 1TTTA 1ZN8A 2XJ4A 4Q3EA 4DRZA 3LLMA 1NUUA 1PHRA 5DX1A 3Q9SA 3EOAI 4I5DA 2RC5A 2QTMA 3HYNA 2J41A 3KQWA 4R1OA 2NWQA 4TMYA 3VZDA 2E6KA 2VSNA 2ZYGA 5CD1A 1W4RA 3KZOA 4JU8A 3L79A 5K3FB 5T57A 1VIYA 4NPAA 4B2LA 1MXFA 2NU7B 4Y67A 1YFKA 2CLMB 2VJOA 3NHBA 3IPYA 3CR3C 4KUGA 4AJPA 2ETXA 4EHBA 4EHJA 2EAUA 1NU6A 1PX0A 1U2DC 5CJ2A 1JSRA 3KV3O 5IC5A 1GXSA 3ICCA 5G53C 5ALTA 2WG2A 4F3YA 4A36A 4JUCA 5HFNA 1VYVA 1EUYA 1HDCA 1YUBA 1IJFA 2GJ4A 2J3DA 3COVA 3D6UA 4AJJA 4P86A 1GEGA 1KQPA 2PX8A 4C7MA 1ATZA 5KWJA 2EBFX 4IEEA 1O54A 1NFRA 3RVKA 5HXAA 4WQMA 5IBPA 2Z6VA 2D5CA 3BRWD 4ZDKA 4CM3A 3GFOA 3B6EA 4RKYA 1B74A 2H17A 4BFUA 2YWEA 4G67A 4HWTA 5K2OA 5JDCA 2V3WA 3AEQA 1ZUHA 3OPQA 1W8DA 2JJ1A 4UU8A 4DS3A 3VNAA 3R0VA 4F1KA 2PA3A 1KOLA 1FRQA 1YR6A 1OPXA 3QMPA 4BWYA 3E1KA 4RZSA 3NMUF 3G6KA 1PR6A 1SBNE 1Y3DE 1Z7YA 1YB6A 2WT8A 5CDHA 3IQDB 4JLJA 4B4WA 4M0LA 1Y3IA 4XWYA 4AI6A 4NOMA 1D4OA 1Z33A 2WOJA 2YZGA 4J0EA 3VYTB 1D6MA 1R3UA 2O7VA 1L1QA 3KYBA 2SKEA 4C4OA 4YJ2B 1E3MA 1TVKB 2VAVA 4TMTA 1CR1A 4TSKA 3SJZA 4C0WA 1KDVA 3J7AC 1N33B 3ITKA 4FMPA 3MWYW 4G3XA 4M7PA 1BQ4A 1LPSA 3CLUC 5AJWA 5G1PA 4EB0A 1KKUA 3GN2A 3PRYA 2RI6A 1H3FA 3N86A 4I8XA 4H3KB 4UVGA 3RU7A 4LC1A 3ZK8A 4XVRA 2GYVA 5I5GA 5FBRB 4Y9TA 4B76A 4F4JA 1OFIA 4PS1A 1V95A 3KE9A 4I4TF 1S8OA 2VLIA 2QQFA 2J3HA 1TVMA 1XDDA 3DDNA 3EZYA 3Q40A 1MB2A 4GRAA 4LXUA 4LXYA 4WN9A 3WFZA 4E4TA 5AI5A 2O5CA 2AN1A 1YOVB 2P1ZA 2VLBA 4RTPA 3PJRA 1XLTC 1QG2A 1GT6A 1SUAA 3DE3X 3M82A 5LCXA 4QU5A 3DA8A 4F2WA 1T5IA 3BILA 1R27A 4JJFA 4F5YA 4LHWA 3IMKA 4ZAYA 4YC7A 4PLFA 1UODA 2WOOA 3LCJA 5AM2A 3KVOA 3U1BA 2NUPA 3ADPA 1DC8A 4HAZA 4CEIA 1T1JA 1U7XA 3ROQA 2PLWA 2AG0A 4P31A 5IJ9B 5FULA 1ILEA 1BIFA 1E5DA 2RC6A 1QH8B 2MIIA 2VRCA 3VHRA 3PPVA 5TS2A 5BNWA 1MA3A 1CEEA 1Q77A 4H4DA 3U3DA 3O7MA 1GVNB 4JAVC 4PX5A 1NMXA 1OGYA 2VJNA 2XYQA 3LHIA 3S8EA 4O02B 2FRDA 3D1VA 4X54A 2EWVA 1NW6A 1ZD3A 2V6FA 2K7FA 3NB0A 4RA9A 2PZEA 1KEEA 1WZ2A 5DGTA 3D8TA 3WTBA 5JXGA 1STOA 4C87A 4D5EA 2D00A 2O3QA 1SXGA 3M6WA 1B15A 2C04A 2BFDA 2PGIA 2CFCA 1NVVR 2GDJA 4HLDA 3BH7A 3MUEA 1GYPA 4N7MA 4C7BA 1CUZA 1KYQA 1ZBQA 1Z9BA 3PFNA 4PPQA 2WMNB 2DH5A 5HJ5A 2ZE6A 1M2OB 2I76A 4IDHA 2CV0A 4LECA 4YHBA 3HU3A 3R44A 2BH9A 3TLEA 1QPZA 4PNPA 4FKMA 2OBBA 4DNOA 4Q1AA 5GJCA 1JMKC 4WXEA 2JJ1D 3EMVA 2BBWA 3CVUA 2CDBA 1YR7A 1OB2A 4RTQA 5AP9A 1B23P 3LUAA 5EWMA 2G1KA 4F72A 2XVAA 4MGIR 1G7RA 3D0RA 3UO8B 4CF6A 2OV6A 3DOEA 1WCYA 1VECA 4RD1A 4WKPA 5FHRA 2O3SA 3KR1A 3OTHA 3GNQA 4HDAA 4UXHA 1BS2A 2BT4A 3IGFA 5E9WA 4B6FA 5JRZA 2B20A 2ZULA 3VR4H 2HPAA 4OHYA 2NNWB 5LQAA 5DTQA 3E3AA 1CIJA 2QS9A 4GX2A 1XZIA 2WWGA 3L7MA 4R2HA 1D5WA 2IITA 4JYCA 5CT6A 5F4ZA 3ZU6A 5DLEA 1HQYE 3BUSA 3FYDA 3O95A 4DHWA 6ADHA 3KWMA 4FOLA 5IC6A 2GASA 2HHCA 1LQ2A 1NVGA 1TUGA 3FSRA 3M5CA 3WRYC 2IEBA 1FP2A 1UJ5A 4C76A 4D4IA 2XBLA 3VR6A 1MRZA 1Y8ZA 1DCTA 4KXXA 5TC4A 1F7UA 1BKYA 3FWPA 3H5OA 2WUEA 1PGJA 1GRVA 1YJ8A 4ETIA 4RWZA 4EVIA 3B3FA 4URUR 4M88A 4HAYA 5KYGA 1KMMA 4GMDA 1R8JA 1T0HB 4UATA 3D3WB 2PMEA 4Q3CA 4YT2A 2JD0A 3H16A 1FS4A 4JLOA 1R0WA 1Y6JA 3U39A 1U1CA 1EFUA 5AD1A 5BUQA 2IY8A 1C3OB 4OSPA 4AJ4A 2RGDA 2WYVA 1A71A 2XMBA 3EEYA 4XW2A 5E7JA 3SDZA 1OI4A 1IVNA 1KETA 4LPKA 3NYIA 2J4DA 3CLRD 3HU1A 3KOUA 1PFVA 3TS1A 4FCCA 1A4IA 2VRCD 3WIUA 2F1IA 5DI3A 3AHIA 4KWCA 3G5UA 3L01A 5KSWB 4NJMA 4P2GA 4LMBA 7GPBA 3G9UA 1ZNZA 5KX5A 3T3MB 4HTAA 3DBHA 5J47A 2WIGA 2HWUA 2BGMA 1DVRA 2ST1A 5EIEA 3WGQA 3SGLA 2CBZA 3I1FA 1SCNE 1TJYA 3CUKA 4JGBA 2A86A 4TYNA 3QEMA 3CMMA 5AIAA 5LP6A 2JGJA 1DAIA 1M6YA 3PGVA 4QQ8A 4BQFA 3S2IA 3IT1A 1CFJA 4Q0MA 5LDGA 3HVHA 2VJPA 3DW1X 4JBNA 3WV5A 2ECKA 5EWJB 5DNUA 1ZN2A 2VJMA 4L4YA 3SVLA 4C5BA 2RCYA 3I64A 3P4XA 4BDSA 1DQNA 2GZAA 4PYLA 1O6BA 4Q4CA 1JAYA 3FYUA 4DPMA 2CJWB 1YUMA 4WGFA 3HZHA 5DN9A 2CLCX 5ALHA 3W9UA 4XM0A 3WO1A 3ZNNA 1ZSNA 5EMHA 3C1AA 4DZZA 5BSKA 5ENVA 3CFYA 1LLDA 1EEXB 3GJ8A 3PGLA 5GP1A 4BIIA 4C5CA 4TN5A 3GVPA 2ODPA 2Z08A 4CV1A 1KH2A 1DEKA 2AG5A 1IZYA 1L4YA 1O94C 2X14A 2EW8A 3HKDA 3K4QA 5IK2A 3VVCA 1HE8B 2BR5A 3QYJA 2C4NA 4P2BA 4BO0A 3S8YA 4Y1RB 1PVOA 2DWQA 2HKIA 1E8NA 3AHHA 1WP9A 2Y8EA 4TS3A 2FV8A 3TQCA 3PQ8A 1PHPA 3QX9A 4HDNB 4BIMA 2FJPA 3PG5A 1I7PA 2BMVA 3N8NA 3OIYA 4BTVA 3HCDA 3AYZB 3DULA 4FBMA 4HVCA 4F56A 3KFVA 3L7NA 4QEDA 4G0ZA 2W58A 2EG5A 2VWQA 4J43A 4LDJA 5I8PA 2ZZNA 3VHLB 4A0GA 3IHKA 4MCJA 1O97D 2XIJA 4GLOA 3DOOA 3DDWA 3FJ1A 4MIKA 1QHFA 4RE5A 1SOAA 2EW2A 1BH2A 1UMKA 1J0BA 4WFKA 3VPGA 1YF3A 2Z9CA 3R6WA 2W0MA 1MRNA 4BP1A 1PZEA 1K7FB 3M7IA 1AZTA 3LUHA 1ONPA 1CNMA 2CVZA 4B9EA 1NXXA 3VDXA 2QN2A 3NWJA 5BR4A 1ZHHA 4PG7A 4AROA 1XZMA 4HYYA 3HGTA 3SZRA 1V1MA 2OBNA 2QMYA 2XUDA 2EZ8A 3V4PB 3MILA 2XBMA 3HB7A 5HRUA 1WPQA 4Q3AA 3ZVKA 5AK6A 1IFXA 3CF2A 4WIAA 5AM3A 1S01A 4CGZA 2LBPA 1QH1B 3FTDA 1MAHA 1ZU4A 3B60A 1L7DA 3INGA 2CYCA 2NZXA 4YALA 4C1NA 3MD9A 3ZLUA 1RJGA 2P78A 3FNEA 1XMOB 3TJMA 1N8TA 1W47A 3AR4A 4HGRA 3O8RA 3I12A 3IXMA 2WU4A 5DLDA 2J48A 3GT4A 4C08A 5K0FA 5GZ3A 3EDQA 4KLNA 1YDFA 1MAWA 3MRSA 4TLAA 1T2VA 1J5EB 2JGDB 3TNFA 3ICVA 4Y6SA 3V8MA 2CE2X 1JZTA 2Q6LA 4KQ2A 4I36A 4RDIA 3I0MA 3L0YA 2HV9A 3P9XA 3QXCA 5HZMA 1RCFA 1EPUA 1Z2DA 1UUFA 2ZU6A 4DT1A 5BW4A 4IRUB 2I2XB 1YA4A 3FJYA 1XYGA 3ROFA 3W4IA 4ID9A 1H6CA 2J31A 3HA7A 3KCNA 4ZMRA 4PIMA 3A6GA 3F5FA 4DM4A 5IWAB 2VS1A 1J2JA 2B4AA 5B7PA 3DDHA 4R7ZA 3GUZA 4BB5A 3ACDA 1U2TA 3S7TA 5CDFA 5KC8A 3CLSC 3HP4A 5CITA 3L46A 5JI3E 1FNSA 1C1XA 2NZUG 2KM1A 4CM8B 4ZFNA 1IY2A 2Z1DA 2XVMA 3BBLA 3U19A 2B1IA 2IU0A 5C5EA 3P32A 3E2MA 4MVJI 3WAJA 2X0FA 3RNLA 5KX5F 5I4IA 4ABTA 3C7DB 1MJGA 3VSAA 2BJWA 1SKMA 4DA8A 1U3UA 4GLBA 4UHEA 3UWSA 2JI4A 4YDHB 1XPOA 4QDXA 1EUCB 2JEYA 2G4VA 1ODLA 5MN4A 3HFJA 4F38A 1HYGA 2YIMA 4HO1X 2ONYA 2JI8A 5K8UA 2NNLD 3ISTA 5K3SA 3UJCA 1YJCA 3EULA 3RGGA 1ORHA 1WX1A 1IATA 5JQGA 2DGDA 4IUCS 4IIVA 1C2TA 1JU9A 2B0CA 3W2IA 2R44A 4E2WA 4GR5A 4DIKA 4D82A 5B3LA 3WSTA 1H9CA 4KE9A 1RLMA 3BWEA 4RHFA 4QRIA 1V8FA 3KOYA 4HFJA 4HC4A 1MVOA 2COEA 4H2DA 4KGDA 1GPDG 1DKLA 1NBOA 1Q3TA 2A9RA 3E2PA 2CCGA 2NUAB 8ATCA 4G0QA 2ZJ4A 4GSKA 3A4NA 4JCOA 2Z6QA 2OMKA 2JFHA 2PWAA 2H4HA 3WLSA 4Z4FA 4DCSA 2PZGA 1C1DB 1UIMA 4IL5A 4RACA 3ZTTA 3RRJA 4EDHA 4YASA 1W5EA 1FK8A 2ZIAA 3A2NA 2G9ZA 4WZAB 5ERGB 3WXMA 5C37A 1J20A 3BD8A 1VCIA 3KEQA 1E1KA 3PC3A 1RQLA 3S5UA 3KU4A 3A6EA 1XD9A 1KMQA 1Z5UA 3GZJA 5EXSA 3SXUB 4UAVA 3T3IA 3ASZA 4ZGGA 3WIDA 4NLLA 5IM4A 1TCBA 5K5EA 4M7WA 3DPIA 1O9BA 1XXHE 4MS3A 3SF8A 4AW9A 3LC0A 1P4AA 1RPNA 2Q0QA 1HKUA 3IIJA 3O8NA 3GJZA 3AM4A 3I8XA 4PSAA 4F92B 1GQOA 5H1YA 1TKAA 3OEWA 3ZY3A 4DQLA 5LWHA 5IJWA 2CXRA 2LV8A 5BRAA 2ZR7A 3NNDA 3DT9A 5T4HA 1QE5A 4ANFA 2FOIA 3GLVA 1E2DA 4FLFA 4IZIA 1BFKA 3AESB 3ZWQA 1J56A 4FJ0A 1YONA 4TZ6A 3ZN2A 2DQYA 4QUAA 2A9QA 3DZHA 3O4RA 3P96A 4JZKA 4ZT6A 3VHXB 4BKMA 4NCBA 1XZBA 5JATA 1ZUNB 1GFSA 3K0AA 5FBZA 4UE3S 5E6SA 3CBQA 4Z0PA 4M7OA 3S0JA 2EJTA 3R9WA 2YMMA 4ND4A 1LUAA 3WGIA 3OP1A 2X23A 2I7CA 4AU1A 1R4MB 4EKGA 4BGDA 2Q46A 4ZREA 3HYSA 1UZAA 3KK0A 2B37A 4PWZA 4URWR 3RYHA 1J1ZA 1ZI9A 1GY8A 1IHDA 2G83A 3KPJA 3EA4A 1JLSA 3Q2IA 1A9OA 4G24A 4NZNA 2D62A 5ELXA 1G5QA 1QGUB 1QTQA 4BBPA 3SQOA 2YDXA 2IV7A 4CTJA 5FPYA 5JAPA 3ZS8A 5SZJA 4HVAA 1OWPA 4B82A 1FE8A 4KJZA 1RZRA 3DS8A 5EKUA 3PDWA 4IIJB 5F98A 3ZI0A 1SIBE 1SU7A 1CP3A 3GH3A 2FSGA 4B34A 2DR0A 5KINB 1L7BA 2WR8A 4RV4A 3IUSA 4XYMA 2XMSA 4RSGA 1QGOA 1FUUA 3ZOZA 4O59O 2YW2A 2Y1LA 3N76A 1H2RS 3SYRA 5KYKA 5LA6B 4E6EA 1KZ4A 2GRUA 4GI5A 4KLAA 2FDCA 4HN4B 1KJQA 5FPHA 5BVHA 5IYZA 2I54A 3JQ8A 4MKFA 3S4YA 1BA3A 2HK8A 2MYUA 5EIFA 2NO6A 4RXMA 2EYQA 1UKVY 4UHKA 1E89A 2UUPA 1UDCA 3ORYA 4R9SA 1K8RA 1FUKA 2I29A 2CXOA 4UTOA 5IN5A 4FWTA 2EGHA 2ZFUA 1E1MA 4O2AB 4TV9B 2EXXA 3TQHA 1KK2A 2YX1A 3ZW9A 1B0UA 3V2GA 1LX6A 5ES3A 3HVJA 3LYUA 1D2NA 2BFMA 4DCUA 2EFJA 2N9UA 2I2BA 2Y92A 1ISHA 4E15A 2PWPA 1U9YA 3LQQA 5DLQC 1JYFA 1QR2A 3R7FA 3RJ9A 4DC1A 5I7RA 3MB8A 1GZHB 3TOSA 1TAHA 3IE2A 2VBGA 3I62A 1KPGA 4MNTA 1Q16A 2DPXA 2F3SA 3BQMB 5F35A 3U7IA 5JQGF 4QM7A 5FAXA 3ORHA 1KRHA 3W1WA 4RPCA 4Y2RA 1Q1NA 2VHQA 2CZCA 4COKA 1KAQA 1DOAA 1SCUB 4R2XA 5EQFA 3O4GA 3EDYA 3KQMA 3CRQA 4W5HA 4FJ2A 1RQGA 2Y1FA 1B73A 2YJ3A 3LC1O 5B3KA 2VH5R 1NWHA 2J3LA 5CM2Z 4WJZA 2V58A 1CU1A 1P2VA 4JD5A 3Q0EA 1S7CA 2JIMA 4C6RA 2OR3A 5LQRA 4IZHA 1QHHB 1RRPA 1WHTA 4ZOCA 2ZTSA 1N8KA 2LIVA 1FMCA 3GVXA 1G8KA 2H48A 5C5DA 5C8YB 4MQ4A 2Q5QA 1EWYA 1JEQB 1DUIA 3DWFA 1JIKA 4KL8S 2C8LA 3GDGA 5F7JA 3N5KA 5IM4F 2QSYA 1G9SA 4S0ZA 2G63A 5FBWB 3GRCA 4K9PA 4RTOA 1G9XA 4DMKA 2HXGA 5JXIA 4KDRA 1T3LA 4JASB 4EVRA 4MCHA 3N53A 4MUEA 3IAUA 4RJJA 5IBRA 3WI7A 1U0EA 3OLCX 4M21A 1Y48E 2IVFA 2J67A 4ZU1X 3TRFA 2X6TA 4WY8A 5AVSA 1ZM7A 3CGGA 3TZEA 4A4DA 1FIUA 2XZLA 3K4HA 3N0VA 2Z2XA 4C3UA 4C21A 1ICEA 3BL6A 5AK5A 5ALMA 1DTWB 2GZ2A 4UUQA 3C2QA 4CUKA 4F84A 3QW2A 3OJEA 3A25A 3U80A 3L93A 3KQKA 2GLTA 4ZVNA 4D8UA 1EDOA 1F9AA 4FCWA 1QK5A 3VR1A 1YQEA 2ZB7A 1F0PA 3DBRB 2O8EA 4BKPA 4F9EA 1SHUX 4I2VA 2PUVA 1IZ0A 1XP5A 1A76A 3NBUA 1S4MA 2CT8A 3QEBZ 1IN1A 1L4NA 3RYCA 2Z2IA 3MWGA 1X87A 2JFQA 3O5AA 5E38A 3UJBA 1K7CA 3ZH2A 4JT2A 4UFPA 1TYAE 1OLOA 3IJRA 2OCDA 2H29A 4KPUB 2C9YA 1GV0A 4AS3A 2VPXA 1RXSA 1VLQA 1SXPA 2KHZA 3ME5A 4WEQA 3KG2A 1S02A 3GRRA 2ARKA 1X8XA 3QE0A 1RAGA 2A0FA 5T41A 2NPFA 1G4HA 3GHHA 5HF6A 4YAKA 3MW8A 1ETHA 2HDHA 3UN1A 3A2KA 4DABA 1KHTA 3B52X 4DNQA 1XD2A 1EGVB 2WU3A 5NLLA 2BKUA 3G2MA 4PIVA 4WD3A 5E2IA 3QE9Y 1GL9B 3QQPA 1Q15A 4O4JB 3ZLVA 2DQSA 4NZOA 4ASUA 5IYZF 3BM5A 4I7EA 1JEYA 5EIBC 4D8WA 4DNXA 3A2MA 4YN3A 3S44A 3D5TA 2WJHA 4NYJR 3G02A 5AKZA 1CJVC 2FCAA 2PO5A 2ZRBA 1U8XX 2R1TB 3LWNA 1ODKA 3DMTC 2AT1A 4H0CA 4O2BA 4XLTA 4HGQA 1SY7A 3JQ7A 1PG0A 4AK9A 1Y5IA 3DUFA 1Q5PA 3GEHA 3JY6A 2A5LA 1BMTA 1JDBB 1IE3A 1KJJA 4BFXA 3UUFA 2OQ2A 3FGNA 2M1ZA 4DV3B 3VU1A 521PA 3GAFA 1J8VA 3F4KA 4N8EA 5TS3A 4S35A 1GG5A 2B1RA 4PN7A 1E3DA 1NDHA 1M67A 13PKA 1HT1E 1ADFA 1UBNA 4OHRA 5T67A 1QF9A 4PC2A 3KJFA 4S1TA 5GPBA 1FBTA 4HDOB 4CLXA 3ND9A 5HIIA 3AOGA 4G86A 4WLUA 1G7SA 3GLHB 1L7OA 5HX7A 4G8DA 4KXVA 2WVGA 1N1GA 1HL7A 1O87A 3WLKX 4K2HA 4CMIA 1A9PA 2RHTA 3DE2X 4OAOA 5JARA 1M0TA 3N2IA 3IUQA 3BTOA 5K1ZA 3H8SA 4YNBA 3FFBA 4JBHA 4WINA 4NXMB 3ZJVA 4FHGA 1X2EA 3WWCA 4DLAA 1QX4A 5FJJA 3UMGA 2VTDA 3P19A 3GDFA 3WL4A 4KCGA 1UK9A 2IHBA 2VPIA 4MGKR 1L5SA 4Y30A 5DBEX 5CLQA 4WOKA 1SCDA 2B36A 5BPFA 3S2ZA 2HJWA 2EJBA 2V6JA 3EYAA 4WA7A 1Z82A 5C7YA 1NVXQ 3OWOA 3W5JA 4D9KA 5DGCA 4QEZA 3E1SA 1FOEB 2XT9A 2WQZA 3FLMA 3KBBA 5BSVA 2BM9A 1RCTE 1CW2B 2I99A 1SCBA 1UC5B 2GN6A 3LXXA 4GVXA 5EUQB 2EVWX 1KTVA 3CKLA 2B30A 2XXJA 4TL6A 3D0KA 1J70A 2B4RO 3FPFA 5HTKA 4ACAA 1GTMA 1D5CA 2F1OA 4IZ6A 1E5VA 4GGOA 3TKAA 3ZCTA 5IULC 3C8UA 3ISJA 2W2QA 3NT5A 5K3DA 4Q9DA 3RC1A 2PT9A 1NLZA 2BJVA 1RM0A 3KTFA 3BZUA 1TM3E 1YB1A 1DO0A 4HGOA 3B1KA 1TT5B 4B4KA 3N28A 3ZE1B 3BXOA 4IHKA 3AC0A 3K72B 1GGJA 1L4UA 4R1TA 1H3EA 3C4JA 4EQZA 4ZCLA 5U1PA 2AYXA 3I53A 2RKWA 2O8NA 3HLTA 1JLKA 2QE7A 3JRXA 1DIRA 2AMVA 3GD7A 1G8MA 4DUGA 3EEBA 1LF5A 2JB9A 2VSQA 2Z43A 3LUKA 4CN8A 2OORC 4KTVE 4R2JA 4IMRA 2OXTA 2NP7A 1QDEA 4L8VA 1IOWA 3LO5A 5CFRA 4BFCA 1YMQA 4RKQA 3DE6X 3G0OA 4L50A 1TEVA 4C6TA 4FMBB 1EP9A 2LKDA 4QIHA 2IV3A 5DBGA 3WLEA 4Q4HA 4K6FA 3UMRA 3WGUA 1TO1E 2ZJ0A 5ICGA 1BVRA 3P4UA 1YWGO 1GT91 4R3UC 3OZGA 3LVFO 1E1QD 2NO9A 3D6NB 3OHPA 1M7HA 2GJ8A 1IEWA 4BUCA 2CV1A 3F8TA 3PE3A 1H8EA 2IYPA 4W7IA 3UH0A 2WVJA 3O38A 4AY2A 2EX1A 2C9ZA 4MRVA 3X2SA 1A5SB 1XN1A 1UC9A 1P8JA 4FSDA 1E9RA 4B85A 4KQCA 1JMYA 1X9GA 5TMPA 3M6LA 4J76A 4LZJA 4X71A 5CX1B 5KNLA 2BWJA 1Z5OA 2NUTB 2NTJA 5A0FA 3K0CA 2AZTA 2WTAA 2XUIA 3O92A 4H4EA 1G5IA 2WJ4A 1MB4A 4LHSA 2PD3A 2Y77A 3NRBA 1Z07A 4JGIA 1TGYA 1XKLA 4UCFA 3T94A 4O2BF 3PPWA 5EEHA 1FQKA 5K8LA 2J5XA 3KSBC 4OBEA 4H3VA 3ZGZA 3EB9A 2XRMA 2HPVA 4TN1A 4DSOA 4LHEA 1YVEI 4HV4A 1TEHA 2CVOA 1QLJA 2V65A 4OTZA 5EZYB 1MDBA 3WLPA 4X6YA 4B3HA 2V4UA 4NHOA 2MMGA 3KKMA 1CP2A 2F3UA 1KRWA 4I3FA 4L9AA 4TRRA 3TTWA 4WLOA 1QIDA 4V0NA 3U61B 1AUVA 4S2EA 2FE4A 1Y9AA 1P2FA 4EY4A 3CVVA 2EBWA 4DSTA 1JIJA 3KELA 1OT5A 4U9IS 5BT9A 1MW9X 1XVTA 1DOZA 4KLCA 5BYKA 1XFAA 4KKVA 3TD9A 1QP4A 2VF7A 3C6KA 4RL6A 1P5RA 1TJ5A 2NZVG 1L5KA 2TYSB 1Y6QA 3VYSB 2O7RA 4DC0A 1WD7A 3TD6A 1PLKA 3ND8A 4O2RA 2ZYSA 4HS4A 1QIIA 3K94A 1GILA 2Q5LA 4ECEA 3KOOA 4PO3X 2A5JA 2K2WA 1EJ6A 1BDHA 4KO8A 4ZYXA 2H9IA 5H68A 2ZIWB 2H52A 2PBFA 4RK5A 2JFOA 1XX6A 2NXNA 3UCEA 3MT8A 4O4IF 3GEPA 4P7KA 1X7XA 5DT2A 4ME6A 3A3NA 1D6SA 2QTFA 4ZC8A 4QUKA 3CEHA 3TEJA 2OFPA 4B31A 2CXQA 4RO0A 1QOPB 1YKGA 1ZITA 3AINA 3BVPA 3IBCA 3JVUA 3LWBA 4RHXA 4PZDA 3WB0A 4DUGD 5ER9A 5KVCA 3WQSB 1CR2A 1LNQA 3HZOA 4AKEA 4GKAA 1BCSB 1KEKA 4IRXA 5IXYA 1I5RA 2Z2JA 4PFQA 3SJUA 1NJ8A 1CG6A 1U7DA 2WI8A 4TXLA 3X1ZA 3R6DA 1RHUA 3P2YA 3UC9A 2X9VA 3JQBC 3EZNA 4HRVA 4Y2GA 4DQ0A 4MS1B 2QMQA 4HNAB 2QXYA 1TIBA 2VP6A 3WL3A 5G3YA 4XYBA 1X7YA 3T1TA 3H4VA 3ANNA 5DEOA 2PPLA 3GYBA 3LFHA 5EJEA 5F2KA 4XUEA 1E5XA 3DOCA 3GZ4A 3KD3A 5D3MB 1U9ZA 3DEYX 3JARB 3TVDA 1L5OA 2ZTLA 3VOBA 1P1FA 1E5TA 2IUTA 3Q3VA 4BMVA 3GP5A 3IP8A 4UDXX 1VPEA 4E5DA 4HUQA 2W42A 1KKLA 1T8SA 2BM8A 4ABYA 3T4UA 3ABOB 2KW5A 2ZRMA 5TQ2B 1ZIXA 3PB3A 3SJCA 3PC6A 3E23A 3R09A 3DT8A 1DGQA 1ZJYA 5JXWA 4MGHA 2NP6A 1YAJA 4LYGA 3QVVA 4EECA 1MDFA 2WP8J 4K6CA 4J0GA 2FXVA 1R6TA 4HTFB 1L4HA 4XB6B 3DTNA 5B3JA 1YDEA 1N2IA 5EKTA 1VIMA 5DGDA 3GLIA 2FUG1 1KYYA 3FR8A 4GKBA 3SKXA 4FFWA 3SQXA 1CZUA 4EZIA 3MOGA 2Y0BA 1T5HX 3SY8A 3EXFB 4DADA 2AFIB 3NDRA 4DIMA 3U81A 1WBDA 3HWRA 2HK9A 5KKAA 4R0MA 5LQMA 3D8BA 3QPVA 2GHRA 1V9LA 4O4HA 5JSYA 1QWOA 4Y6QA 2DWOA 5P21A 3LYAA 3VO9A 3NBQA 3LQYA 4RTKA 3L7AA 3NXSA 4XWTA 1JQ5A 2E82A 1CJCA 5CDGA 3I9JA 2BFEB 4IILA 4C4PA 1OH5A 3NOOA 3WLRA 4LF8B 1E1CB 2WIFA 2BMWA 3MJTA 2BRUA 5CXSA 4YH1A 5DBFA 2BBTA 4BOYA 1EFRA 1NRIA 3UCFA 1U0HC 5J2TA 1SXHA 4C4XA 5AKKA 3DEIA 1UJ2A 2R8BA 3B3GA 3FUVA 3I42A 2NXWA 1EGHA 3NORA 4J7UA 3RJMA 3L8CA 4D43A 3DWEX 1O4VA 4BO4A 4Y6LA 4OX9Y 3WP0A 1NKSA 4RK0A 3SMVA 4MDEA 2JFZA 3PUVA 3L8DA 3Q1LA 4RY0A 2OO3A 3CPHA 3SKYA 3K0SA 2RGUA 1Z6GA 3DW3X 1NGSA 4JT4A 3RYIA 4BO2A 4QATA 2X4LA 1IHPA 1EFDN 2QRKA 5L7TA 5BWNA 3TR0A 1YIOA 3QTTA 1V3QE 4B73A 2EL7A 2UVQA 3RW9A 1JDSA 3NHUA 4ZP1A 1GHTA 3D4IA 4C7JA 3IPCA 4C22A 1V8DA 1HEYA 1PGOA 2FPGB 2RHGB 1WCXA 1C0EA 3QY9A 4D6YA 1M2WA 1GSIA 3HV0A 4QASA 5IT5A 2C58A 1H0KA 2FFBA 2FX3A 4F1WA 3EEOA 1N6LA 1KAHA 3AZOA 3ETNA 1E1RA 2X6RA 3FVVA 4OGWA 5DSXA 3VDMA 5A7HA 3B38A 2PKYX 2QW0X 1YRAA 3DOFA 1JTEA 3UOGA 1RWKA 3I1JA 4GOOD 3JALB 1IVSA 1O77A 4NXNB 2LW7A 2O3UA 1E6WA 2P40A 5EHGA 4RM2A 2A4KA 1QKIA 2FMXA 2ECOA 4BDTA 4EKDA 4MUFA 1PFGA 3K4PA 3UMSA 2X4IA 2QJWA 2W6PA 4RVGA 1X1RA 1MU0A 1Y7HA 4R05A 2QD1A 3E9YA 4O6VA 1OPRA 4CMEC 1AQUA 1O5IA 4ZOBA 4DMMA 2PMKA 1B76A 1LGYA 4QVKA 1ZVMA 3CWZA 3ONEA 3GMTA 3B3AA 3TQIA 3ZW8A 4B48A 3J81A 2QU8A 4IQGA 3OG9A 3RSCA 4ZI2A 4F4CA 1OXTA 1EZ1A 3A9TA 3T5AA 3A4TA 4CIXA 1OUMA 2HNAA 1GZSA 4KPFC 4FPXA 3Q85A 1W46A 2FPKA 2FLWA 2ZQYA 4X1KA 4AJOA 4FTWA 3RLIA 4EX7A 1O95A 2OV8A 1ZBDA 1FDOA 1Q50A 2ZTMA 4B84A 4DV1B 4MV7A 2J6BA 5GGXA 4KV9A 1TMOA 2LCIA 1XQXA 1HFJA 3GUUA 3KWJA 1NQXA 2CFOA 3A9RA 5BQFA 1AX9A 2ZG6A 4KGXA 2I3AA 4RPHA 3UGKA 2CD9A 1J2RA 2ZATA 2B1JA 3P9KA 5HF8A 4F4DA 2G7ZA 1TA0A 1UDRA 3ZQKA 1RI5A 5E2AA 4I0WB 1S89A 2C0CA 4EVSA 4KXLA 3WHPA 2GLUA 1EFRD 4YAEA 1B41A 1JEJA 1V6AA 3ONFA 1K0UA 4Q7LA 5K3EA 4OQLA 3QPDA 4XGIA 2JLSA 5B57C 1Q0SA 5FD8A 1A0OA 3G7UA 3ZHBA 1PJ2A 1N2BA 1B26A 4GRDA 3GLGA 2VAPA 1ORTA 1A8SA 1W44A 3H9QA 3DNPA 3L6UA 3PQFA 5JCOA 2HCJB 5IJAA 1AGNA 1N25A 2EJUA 2P2LA 3LA8A 4QLBA 4BVHA 2DM6A 4FDVA 4PGAA 2O19A 5JJIA 3AF6A 4HJXA 1Q1BA 2ATEA 3UQZA 3WS7A 1RFGE 2ILTA 3LWDA 4ZQBA 4CQLB 5M5BA 1JG4A 3CW9A 3ZWDA 1NAIA 4XUCA 2GEVA 4BQOA 3BWVA 4DBLC 2ZXUA 4LZZA 5ELMA 4IGFA 3ZZMA 3NTVA 4YMVA 1KS2A 1RZ3A 4MB2A 5F4BA 2REQA 3ZWNA 5J2TF 1YB4A 5HIAA 3N2ZB 5L3VA 2O8BA 1MEEA 4Q9LA 4UQPA 3KE8A 2A9FA 2DVMA 2WILA 3G0BA 1M34B 2A9OA 4LSMA 4OXYA 4RIFA 4YO8A 1AF7A 1ND5A 3FW1A 3LUPA 5CNJA 1T15A 2X9GA 1EFLA 3QFSA 1SVMA 2VRBA 2VP4A 2PRIA 4BB9A 2IHUA 2BLNA 1J6UA 1JYEA 2AR0A 5HGXA 2I4OA 3IPXA 3OIGA 4ND6A 4NQZA 4QNMA 2GBGA 5JALA 4ZYVA 1EWVA 2NO7A 1E69A 3HKEA 2MMCA 4RVUA 1GUDA 3MTIA 2AN3A 4NDAA 4BCCA 2FUG6 1Y6GA 3AZQA 2GTHA 2FPSA 2EFCB 1JT9A 3QBVA 4OK5A 5A4AA 5ALWA 4K9NA 3U3RA 4HX2A 5ITWA 2YFKA 4FFOA 4XLZA 4M98A 2OOSA 5JISA 5IABA 2VQ6A 1L5GB 4RHEA 3AP1A 1QYXA 3QUCA 4PW0A 4BB0A 1MCZA 2WTBA 3CSUA 3DNMA 2HJGA 4QBKA 5K0LA 1NM5C 2WWIA 1KIFA 2QUBA 1QYRA 1JAXA 1OMOA 4YV7A 3IEKA 1QGDA 3VR5D 5EJ6A 5KNDH 4IIYA 5FB3A 4LCJA 3THWA 3AYXB 4KHPB 1TZKA 1VMEA 3S2FA 2OCIA 4X8MA 1IZZA 2N1MA 3I30X 5ESRA 1NX9A 1O95D 1R50A 1XAJA 2FPUA 3BFPA 3A6KA 5EJFA 1T3SA 3FUXA 3AEKB 1PR9A 4F1JA 1Y98A 1CUDA 2ID9A 4RLSA 3RAPR 3BKXA 1IJKA 3L0IB 3SS8A 3SAJA 4H7DA 2A5YB 4BAUA 4F6RB 2C5GA 4YWJA 3ADCA 4WHMA 1PJQA 1V11A 2FMHA 3TX2A 4CMHA 1MMFB 1ZINA 1QUEA 5DYIA 1PJ4A 2XCRB 1GCGA 1AKVA 2QRNA 3I2GA 4CQMB 2Q8NA 4QJ5A 1T6NA 2AN4A 2XUGA 3KUXA 3V4SA 2AOTA 2PPVA 1J5XA 1JR6A 4W5TA 3HCBA 4UCXA 4QGBA 4TPKA 1OXXK 5DV9A 2XNJA 4TL9A 1CF4A 4N6GA 3LECA 3DPUA 3TINA 3AVXA 3EVBA 4YJHB 2P2CA 3OMXA 4KWEA 4EKEA 5A5GA 1WG8A 4UDNA 4I9NA 2H4ZA 3DJFA 4Q4LA 3VNBA 3MWEA 4A2WA 3D4OA 4PYNA 1UFVA 2EQ5A 4QUHA 3CV3A 3GN1A 3GLFA 4N41A 3RT9A 1U7PA 3MJCA 4PY2A 1UPFA 4KOAA 1H9BA 5EOVA 4HZIA 1Y1QA 1FY2A 2F6RA 2VHWA 3RVOA 4C7OA 3NEPX 1JX6A 4KH1A 3UFXA 1T1GA 5BP7A 1KBOA 2IHJA 1YZNA 2BC9A 5BWLA 2QN6A 1JHOA 3QU7A 2O1XA 1SU6A 1W0CA 1KI6A 2P2ZA 2WTNA 2YIJA 3VV2A 3VAZA 1WY7A 4MGYR 5D51S 2QRVB 3WBKA 2LGJA 5IEJA 1PGNA 3GRUA 1GKYA 1RRGA 4CF5A 2AF4C 2XODA 3VA7A 1IQRA 2C2GA 1OHHD 5DE3A 5LQSA 3CG0A 3EZXA 2R5NA 2C5FA 5JDCC 2C97A 2ZRHA 5JJBA 1TQ8A 3NOQA 2WK1A 4YMWA 4ZVRA 1UPXA 2F62A 3UMJA 3D8NA 3FLEA 3K9BA 2BUBA 1BX3A 1C41A 4Y0VA 1VI6A 3EZGA 3AL0C 2A0UA 1IYZA 2GVZC 3H1EA 4HGNA 3MERA 4YCNA 3OTOB 3QXGA 2JFWA 2WAOA 5FADA 1I30A 1KDTA 2PO7A 3W6PA 1G55A 2WJWA 3QJYA 5AR1A 1JTFA 4AX8A 4RH3A 2EFGA 3E18A 1P8AA 3IP5A 2A30A 1HYEA 3AUXA 3MUFA 4KH0A 4LSZA 721PA 1YVPA 4I1SA 1KJIA 5H9VA 2QL5A 2WJIA 1E58A 3FVWA 5BRJA 3RUHA 3BRQA 3OPVA 3AB3A 4LW8A 5AW5A 5LMUB 5A3SA 4D3SA 1OXBB 1RI2A 1P4RA 1XCBA 1ZI6A 3F7OA 4PFSA 4PGFA 4JI6B 2CJFA 1EM6A 1U0FA 1XQ9A 5A4MS 4D9EA 3KZCA 3FH0A 3PNBA 1ESDA 4I3GA 5I4CA 3N70A 3AJ8A 1Q74A 2AIRA 2WHPB 3GELA 2YY7A 3IUPA 3SDSA 4TQAA 3T5TA 3F5MA 1CUWA 1OILA 1RWNA 4EQ6B 4R2WA 3DDZX 2HIGA 4TWBA 2OCAA 1MOZA 2EF0A 3I05A 1ISJA 2VK2A 3Q2KA 4C0XA 1ZVQA 2IXDA 1GNTA 2ISCA 3LT4A 1UFQA 1V2HE 1C4XA 2AW3A 4RMJA 3LBNA 1HTBA 1RI3A 1QYIA 1W0JA 1VXOA 2FKAA 3EIQA 1Y81A 3CLRC 3KO8A 3TZCA 2DEUA 1JNYA 4Z49A 3C7CB 3GHYA 3BGWA 1ORRA 1GZ7A 1N5IA 1ZIYA 2H18A 3D2BA 4A1FA 2CUNA 2GHQA 2H8GA 1YRBA 1EP1B 3DCYA 3HM2A 4QU9A 2F8LA 3IP1A 1PW5A 3RK4A 3ZJYA 4FNMA 1YFLA 4QTYA 4F3TA 4ND2A 1EFKA 4TTRA 3UV3A 1VE6A 1PNOA 3EZ7A 3QZUA 1UBUS 3A8TA 3NONA 1V37A 2CNOA 1YS6A 4HWSA 5JH7A 2QTGA 3N0XA 3PQDA 4PZPA 1AM4D 3HP1A 5H02A 3V3KA 4DR3B 5JCZA 1NJ6A 1QZTA 1XNHA 4LY3A 2GA9A 3B5IA 3Q6IA 4XB2A 3BHMA 4I3HA 1JG6A 3OA2A 5FLKA 4GBGA 5JJLA 4G5FA 4UZEA 3LHSA 3U7EB 3KQTA 4IKOA 4M0KA 4MV1A 1OSNA 1D2AA 3IBTA 2WFZA 3FDXA 4IH1A 1KYWA 1XHFA 1CD5A 1OU4A 2ZYAA 1QPBA 3IR7A 4L75A 4R98A 3ZZ1A 3ZHUA 2FMTA 5E8RA 3TXYA 2GHTA 3Q8MA 1FJHA 3WLIA 1K0FA 1PR5A 2YHSA 4CG1A 3FWZA 5REQB 3TIIA 4IEIA 3KB1A 4NV1A 3NBKA 2NV2B 2F1KA 2XYHA 4UBLA 1II9A 1EAMA 5AH0A 4YUVA 4KMOA 1Z0DA 2O2EA 4D45A 2XTNA 1T4CB 2W6CX 2VAMA 1KYIA 2VHUA 1PJZA 1GP2A 3GLTA 1A1SA 4G8BA 1YCFA 3G2NA 3HJFA 1JEEA 3C3DA 3UT0A 2O07A 1Z0FA 1XRPA 3BZWA 3IVMA 2WE8A 3QNMA 4RV5A 4O29A 4BRUA 5IT4A 4HX9A 3DTVB 1JQDA 3TL6A 5CG2A 1F2UB 5DGIA 3OEEA 3E05A 1LPMA 1RM5A 4Q05A 4IDOA 3RPEA 3SCZA 3STUA 2J0UA 4LXTA 4XIYA 4WNYA 2E85A 4J03A 1V7CA 1NZFA 2FDRA 3ROKA 1VI5A 1XZQA 1Z63A 2NTVA 4HR7A 2KMLA 2DLNA 2VDVE 3NASA 4P4NA 2WZBA 4EF4A 2J87A 4DJEC 1KDOA 3J7TA 3OBIA 4WCVA 4FGKA 1N3LA 5CB4B 4AG3A 4JXJA 1T8RA 4KZKA 4HSGA 3EG9B 3MMXA 2COUA 4DA4A 2HMVA 1P1KA 4BLSA 2C0QA 4XIIA 2XT6A 1WU8A 2XVYA 4FW8A 1G0NA 1V71A 2C2YA 2H1LA 4RM3A 3O83A 3LNTA 1HZZA 4ICIA 4UJ5A 4OHWA 1HPLA 4LF6B 3F0TA 2PJDA 3I4FA 1W0JD 5ITVA 3FOCA 2BFFB 5CHYA 2FW6A 4F93B 3PWTA 1CHDA 1G4UR 4QHSA 3LV8A 4DA6A 4YCJA 4L6CA 3M6AA 5L6LB 1TUBB 3PPXA 4P3YA 3ACBA 3GEGA 1NL3A 3H9GA 3MMNA 3OWHA 4Q34A 1RQNA 1AS2A 2FG5A 2PX3A 2SHKA 2XB8A 3DFIA 4WOJA 4B5LA 4ZI7F 1E77A 4N48A 5WRFA 4CI0B 2HWXA 2GT1A 4FM9A 4RULA 2BCJQ 4PNZA 2DR2A 1NR1A 4G5OA 4XDGA 1O5OA 4MR7A 1NV9A 5LM3A 1NYLA 1ZA1A 2G9RA 1AQ6A 1G7CA 1NXOA 4FYWA 3PI6A 1KEPA 2UZ3A 4NR0A 4BKOA 5J2UA 1C7ZA 3S2YA 4L57A 4BLPA 1OFUX 3PK0A 3TI7A 1ZAYA 5H5JA 3FYUC 1I2DA 2HSGA 3WADA 1P7YA 2J3IA 1VXRA 1K8XB 2L69A 5FH9A 5KTOA 4LTDA 4MUHA 4OHZA 3SM9A 2G67A 5FWNA 3OZBA 5BV1A 1SZJG 1WU7A 2QMHA 2ZBPA 4KKXB 1S3GA 3VZQA 4GHWA 4GKJB 2NW6A 3N3AC 3WTCA 3KXDA 4RTSA 4MLDA 4PO8A 3L8MA 5JH7F 2R7MA 4DMCA 1US8A 4FHEA 2ZRIA 3MWDA 2JAQA 4IINA 1JR4A 5G0UA 3R7WB 4DWOA 1GKUB 1DV1A 1WB4A 2MR6A 3IERA 4TTVA 1HXHA 2WM2A 3CNLA 1WB5A 1YVRA 1L8XA 2O0MA 3OZFA 4DMFA 1TAUA 2BMAA 2PEZA 4DCVA 1LVHA 4FNOA 2RIRA 4PFJA 3OEED 4EPXA 1J00A 1ZGZA 4P34A 1AUPA 1DZIA 4XZ3A 2ZRQA 2G76A 4B81A 2BZSA 1SB9A 1W73A 3A7EA 2FX5A 1D2RA 4JQYA 4FILA 1XZDA 1FSSA 2ANBA 3TBKA 4CKBA 2W8ZA 2ASVA 4MVJA 4DSZA 1BHO1 5AESA 5AVRA 1K4YA 3K6SB 2I3BA 3IJ5A 5F7ZA 4U2BA 5KSYA 1R0SA 1IAQA 5LB2A 2Y0CA 1R0RE 1QFMA 2YN2A 1BCRB 1QCZA 4G0WA 4ZQEA 2V7EA 1CY0A 5EFZA 2C9OA 5FKJA 1C9MA 1GZDA 3PEVA 3TDKA 1CZHA 3G7NA 4MR9A 3HMQA 2AXQA 1DEXA 4TWJA 4PQEA 1HDRA 3H04A 3WDLA 4CM9D 5KC9A 1NXPA 4KIWA 1YMUA 2FUNB 4QHYA 3HGMA 1DTEA 5E0KB 1FPMA 1KJ9A 4GMXA 5J1SB 5IFKA 1SAYA 2B5OA 4ID3A 4NAVA 3NKVA 5H0IA 5I9SA 4KQMA 2YWCA 1T9GS 2IXBA 1E63A 3VTZA 5A6SA 5K0BA 4BZQA 1E9SA 3E0XA 3LCRA 1QGYA 3U1TA 1P2UA 4GD3Q 5A3RA 4I1IA 3K92A 2B9EA 3ZYCA 3VZCA 2Z2YA 4TQUS 3GJQA 3FGOA 4CZ2A 4HY3A 1P0QA 5ALEA 4PLCA 1RW4A 1GGKA 5E3IA 2WW8A 3U4CA 2B6HA 1MN6A 5B36A 1KDYA 2YWFA 1U99A 2DKNA 1RWQA 3IALA 4YCBA 3W77A 3DOIA 2GMWA 4U63A 4IW3B 2OAGA 3KLOA 2JATA 1SR8A 3K1YA 1PD0A 3KKNA 1XCLA 5BYAA 4H0FA 2J85A 2NOAA 2I0FA 2AC7A 4Z2YA 4E7PA 2FVYA 3BGOS 4X97A 1THTA 4X3OA 4CR7A 2C92A 3CRNA 3F9RA 4WZBE 1T35A 3GEEA 1PS0A 3D81A 3EC2A 3E9ZA 2MSNA 3Q8LA 3UV6A 1M33A 1QTNA 3LYHA 4RTJA 3GFSA 4BX8A 4PFKA 3HDJA 1WAMA 3EBLA 1G5PA 1ZW1A 5BN1A 4REQA 2RAFA 4FBGA 4LJYA 4QPJC 2CF5A 4HDMB 3HJNA 2CNBA 3DKRA 4GBJA 3GROA 1WHSA 4PC6A 5SY9A 2QK4A 1SHTX 5GJWC 4G01B 1A9TA 1NVTA 2QBYB 1QO7A 2LXNA 2OTCA 3DB2A 3SMQA 3BK7A 2D1TA 3IB3A 4ZOEA 3RF7A 2ZLBA 1WNTA 3FI9A 4JENA 4YAFA 1R15A 2CDAA 4GMFA 3ETJA 4N5IX 1A97A 3VOSA 2PX2A 4NCXA 1C1YA 2PM8A 3E4DA 4MVJD 1LV8A 2FW7A 4FGLA 3HFGA 5A1JA 1JIXA 3GUVA 2ONZA 3ZLJA 2QM8A 1S2OA 5K3FA 1Y5LA 5JECA 4HJRA 3DLCA 4ITRC 4EO4A 4L95C 2NU7A 2QLTA 4LRQA 4QX6A 4TM7A 4JC4A 2CXXA 1XXLA 3EF3A 3L6OO 3LQFA 5FWYB 2OHJA 3L0CA 1ESEA 1ZH4A 4DREA 1UH5A 3EQ8A 1CB0A 2QUHA 4DCCA 4TMWA 4K28A 5A4DA 2P1DA 1AUXA 1R6DA 2JF0A 2RMKA 1QNFA 2HK7A 2Y1WA 2I6SA 5JMPA 2P67A 1FRFS 4YUXA 2IHTA 3HB0A 3AHGA 5L4NA 2PRZA 3Q0IA 3F4LA 1W87A 4P9NA 1ODJA 2A94A 1P74A 1PAUA 3IDOA 1RMTA 4MVJF 2WV9A 1TU3A 1XZFA 3FNIA 4Z9XA 1QZ3A 3SR4A 5JAMA 4ZI5A 4OJTA 1G8HA 2FDXA 1VPTA 2IUUA 3ZHSA 3B85A 4B7ZA 5F9MA 1M2GA 3RIYA 5CXXA 2AFRA 1WZUA 4TRMA 5KDOA 1GPWB 4R2LA 4LDQA 1RABA 2GPWA 4G5GA 4BMZA 1CE8B 1EBFA 2GJAA 3IKMB 5LD2C 2PT5A 1CUXA 1VG0B 3M4JA 1QO0A 1UBGA 4KMMA 3RREA 1U3TA 5CDUA 4ITUA 3H5WA 3LT2A 1IL0A 4JVMA 4MMYB 1AXRA 4BCDA 2QYHA 2QSJA 1TTPB 1F6WA 2QRUA 5DRYA 3REFA 1WMFA 1N5MA 1ONNA 1Z17A 2QLFA 1ZM3A 3IPAA 2PH1A 3PKZA 4II7A 5D8DA 5EXEA 2Z3ZA 2ZS8A 4NZ9A 1JNXX 5J2UB 4JU9A 1TVKA 2QJOA 4UMFA 3RQIA 5KNBD 4EM6A 3KWFA 3H05A 1UWVA 4G1BA 5TF4A 4YRMA 2WKQA 3GIWA 2QX4A 5G40A 4N5NA 4HQKA 2JH3A 3A70A 3WGOA 4B3DA 2FZEA 4IGAA 2L18A 3DVQX 3G6WA 4MWGA 4Y3UA 3TXXA 3KSAC 3EXHC 5GIOE 3RFCA 3WK5A 4U00A 2LKCA 1O6ZA 1YDMA 3BE4A 3H86A 5C7IO 1E99A 1RYEA 4YROA 4P0QB 2CMHA 1YQQA 3IA2A 1IUPA 1X1AA 3BSSA 4KODA 2VQ3A 3COSA 3ZHYA 4V39A 2P8SA 5H82A 2XDYA 4FDMA 4HD8A 2E18A 1IXZA 2G70A 4NZPA 4FNAA 1DKNA 5DIFA 4G1VA 4BQRA 2I87A 3EQ7A 2HPHA 4MWSA 2AEJA 4BBJA 4CM4A 5HTOA 5KAPA 5EQTA 1XNQB 2QTZA 4HH1A 4L5IA 4D8XA 5KIAA 5L7WA 3CX6A 3GRZA 3B2NA 1CQZA 3HA3A 2VQFB 1KRXA 3SK0A 1NIJA 4PBRA 2ZRGA 4DLYA 2N0SA 1BXRB 5JPIA 4FIDA 4AMGA 3AJDA 4D79A 2R6AA 4XDZA 2JVJA 1QB8A 2VXBA 1B42A 1WMBA 4YJDA 5AM5A 5FCDA 1DU4A 4QQNA 1DUSA 1U8UA 5IJ9A 4J2OA 4RS4A 3FTCA 1OBOA 1E9BA 1SKAA 1QH8A 3H75A 3M6VA 4FMCF 2CNDA 3T38A 2IGTA 4HRXA 3PICA 1YQWA 2J07A 1XXHB 2RDMA 2JBAB 4R5MA 3NHJA 3I5XA 3FE2A 1KMCA 4W9NA 3ZHCA 3LKBA 1HLFA 5EPEA 4YUAA 4D98A 2NVUA 5LU9A 2HUNA 4IIXA 3TFWA 4LXQA 2G1JA 2QQEA 4ZIRA 2GJSA 3M81A 5C1DA 4Z1MD 2BM1A 4OAQA 5DF1A 3C16C 2H54A 4EG8A 4HLNA 4DLWA 3FTQA 1JPVA 1VIVA 3PXBA 4DVJA 1R4ZA 3OQNA 1CUBA 4B47A 1C9EA 3C8MA 1MABB 2PR7A 4LE0A 3LDUA 4YJKA 3G1TA 3UEOA 4ED9A 1M2OA 3OLQA 3RWMB 2OMEA 1E0JA 1DRVA 1O3YA 4PV7A 3BIFA 4KN8A 1M1YA 4X92A 3AJEA 3R5HA 1NUSA 4WX2B 1O5TA 1XCOA 1PQYA 4UARA 1OZHA 4IH9A 2PGJA 1DJNA 3L7OA 3LUGA 4V2IA 4Z9FA 4B7AA 1OCEA 2O6HA 2ZIUB 4JJ6A 3T7SA 1PYDA 2PSFA 4KR0A 4X8OA 3RS4A 3G9TA 1PSWA 2HSEA 3ACCA 4PZUA 4YCMA 1UCFA 5F12A 3ETLA 1D4FA 2HTEA 3FROA 3H83A 2E37A 1JHRA 5CFLA 1Y1RA 3NT4A 3AK4A 3SHOA 3KBOA 4KWTA 1P39A 4CUJA 1PLJA 4CCAA 3THYB 3OETA 1F6BA 5JSZB 2V7PA 4ROTA 1S7GA 2VJQA 3DL2A 4PE5B 4ZOLB 4I1PA 3Q7PA 1E4EB 5LUBA 2W4IA 4D3DA 1MC8A 4IQFA 1R4NB 1FNDA 3LZ6A 4ZZ3A 1ES9A 4S3MA 2ACVA 2XMCA 4BO3A 1G8FA 2NVBA 4B17A 4ZARA 5BUCA 7REQB 4DRYA 4UTNA 5IASA 3GT0A 3PFWO 4U9HS 3KXPA 3NH9A 1JQJC 4AY4A 3DOJA 3KKLA 2H1WA 2J59A 3PFIA 3C6MA 4YJ2F 8MHTA 2PLNA 3L0BA 4FP9A 1FF9A 2W98A 5EESA 4EFDA 4YMGA 5KU1A 1WP4A 2J9YB 4LISA 3AR8A 4ZO8A 1P2SA 4QO7A 3VR6H 4WNIA 3OOSA 1SPXA 1JIVA 3DLTA 4HEQA 1MQ9A 3UJ3X 1AQJA 2IU4A 3W3ZB 4DSNA 4MJLA 4ADSG 2WU8A 2SBTA 1EE2A 3GT3A 1JIUA 5CDTA 4Q1BA 1EVLA 5ADVA 1P4SA 3UHOA 2IIBA 1WUTA 2YUTA 1E61A 2I1LA 3DT6A 4I9GA 3NAMA 2XXAB 3PX3A 1XZKA 5DHQA 1I7NA 1GPKA 1L2TA 3NHWA 3K5IA 5LPNA 1DAKA 5JCJD 3Q9NA 4H15A 1DBVO 2O52A 3G2JA 3UT6A 4ER6A 3HBJA 4PRKA 3PSAA 5CK4A 4BRZA 5K4HA 2AMJA 4GDFA 1II8B 2JHGA 4KRYA 1M7BA 4HNUA 5EWLB 3WGZA 3ONNA 4WZ6A 1WO8A 1UR5A 5LP6F 2H92A 5IVPA 4DYVA 3C0KA 2CYBA 3EG5A 4NECA 4UUOA 1Z4NA 3IVGA 2ID7A 1MF7A 4R2MA 5LBIA 3TSZA 5CPFA 1LK0A 1M0WA 2CJWA 3T4EA 3CNHA 1JVNA 3LVRE 3NIGB 3UQYS 2PRSA 2WABA 3R0QA 4ND7A 3V8VA 4BV3A 4X85A 4ZOQI 3ETCA 2Z3WA 3AUYA 3LW7A 1EX6A 1NYTA 4DA7A 1K7SN 1S3SA 1L3BA 3V4LA 4X6UA 3L7KA 4JR1A 4OQPA 3GP3A 4LUCA 3ZHVA 2IX9A 3BB3A 2X76A 4Y1RA 2R6DA 3R6GA 4R3WA 1JQEA 3DD1A 3GLSA 5F33A 1H0RA 3A4IA 4D41A 3AVVA 1DBRA 3ZCQA 1R1DA 5D5PA 1G3IA 5B64A 3TUZC 1E1YA 2J7PA 1EK5A 2ZAOA 3NM5A 3ER8A 2DU8A 4H7IA 2P11A 4S1VA 4YRKA 3WJ1A 3RLFA 3L84A 2O1SA 4MUAA 4JI4B 1EP2B 1SOMA 1RHRA 4G41A 1DELA 1WXHA 2ZZMA 5CLLA 3TTXA 5AQEA 1LDMA 4JC8A 2OYRA 3KUKA 1Y4ZA 2XCQA 3NNNA 1U0OC 2CEAA 3RABA 3NTUA 1FW6A 1K6JA 4NCHA 4LBVA 1MT0A 3SC4A 1I0ZA 1AKRA 2AOUB 2ILVA 2YV1A 1S8NA 1G66A 2R5WA 1KC1A 4L8WB 3TL2A 5LIPA 1CUVA 2B8JA 5CB8A 5LQCA 4W63A 2H59A 4OUDB 4AQDA 3OY2A 2AQKA 3GPBA 5GGYA 5DLYA 3W9BA 5B4VA 1XKXA 2YDYA 1KGDA 2AK2A 3QELB 1UKZA 2GEDA 4FYMA 4RYDA 4KXYA 4BE4A 1VDZA 4CW7A 2I7XA 4OP3A 2QGFA 3TLGA 1OH6A 5A0TA 2F8MA 4QUBA 3W8EA 3M1LA 4ARCA 5IDVA 1AUOA 1RXYA 1FFYA 4R68A 4ZYWA 3W1VA 4EHIA 1HTWA 1C30A 1U1IA 3HGQA 1PNVA 2FPLA 3F6PA 3DO6A 2Q9UA 4AN0A 5HRCA 1J1IA 2ZSDA 4YECA 2JJ8A 2IE8A 3BWBA 4DKJA 1G42A 5GY7A 3ZWVA 2HYDA 421PA 4B6QA 3KQLA 2P6PA 1EP3B 4MUGA 2WKSA 5FLEX 3ZY4A 3JR3A 3PXCX 2IA5A 3R7BA 4E5KA 1GGEA 5I7AA 1N77A 3ZW7A 1JYSA 3C3CA 2PMDA 2JEOA 3IT3A 1EXMA 5FOSA 1P4GA 2C9CA 1R74A 2D1SA 4BUJA 4CM8A 2XWPA 1Z3IX 4JP1A 4JVNA 5AXCA 2BONA 2A3RA 2OBMA 3NJRA 3BCUA 4DBZA 1X7ZA 1RRVA 3ZD7A 3EGEA 3FJOA 4I5EA 4KQ1A 2H5LA 2W6JA 3AIKA 4TROA 3K0CC 1JB9A 1VLZA 1EUCA 4FLMA 2WWWA 4BVJA 1QIKA 2Q5OA 5EA2A 2A59A 2NYRA 2ZBDA 2QDXA 2BBOA 3QGMA 5DNVA 2IU6A 2DBRA 4HEHA 4CIDA 4FS8A 5G4KB 1U7ZA 8ABPA 2VHYA 5T8KA 2HRBA 5AOBA 2P0EA 3L9XA 3C3WA 4M99A 1BSVA 1H0SA 3M9WA 5EFOA 2B7CA 3DCNA 1GPBA 3AUKA 5L7YA 1K7EB 1I3CA 3KB8A 3BTUA 2QM3A 3DZKA 1GDTA 5KYTA 2WY2D 4W4TA 3HY6A 3QEAZ 3ROZA 2NUAA 1DQZA 4II2A 1I1OA 2M6SA 3FZEA 4CEJB 2JA2A 3F4BA 4L0DA 1L4FA 4F5DA 3MLEA 1EWTA 4YCCA 5F73A 4ZN6A 2ZWIA 1C1DA 5CD9A 1P9RA 2HX1A 3B1VA 4AO6A 1WA5A 3RUAA 2YCLA 4UREA 4MYRA 2FR1A 2AUTA 4NMLA 1E2IA 4I4TB 4DNFA 2GESA 4E70A 4BLWA 2JEZA 2VTBB 3R2JA 1NVFA 4JUFA 1J09A 4ZVSA 3QHQA 3H4IA 4IJQA 4M36A 4MK4A 1JDUA 5KMGA 3HKCA 1YJAA 2XPCA 3F47A 4DBVO 2V4ZA 3RJ5A 3DV2A 4JLUA 4R8SA 3ZTWA 1RRFA 3SC2B 5AM4A 4Y0AA 4OIMA 4C0AC 2CZGA 4R2KA 2VCYA 1X92A 4MGEA 1WF3A 3OAAD 2QP9X 4L9RA 1U8TA 4BJ3A 4KP7A 4C07A 3AESA 2NO4A 2XVXA 3N8GA 4YV0A 3EISA 5A62A 4DLRA 2Z8ZA 2H1SA 1JQBA 1S5PA 1ZUNA 2GF2A 1U2EA 2GGSA 2PKXA 2W6NA 4LX8A 4MGZR 2PS3A 5JNRA 2H2WA 3BJEA 1G41A 5K0EA 1QLWA 10MHA 2J5RA 3NFYA 5JMOA 3O8DA 4JK3A 2V96A 2V6MA 3CJRA 2CXSA 1TB4A 4MSUA 2PH5A 1NJFA 2OZKA 1T6BY 5HF5A 1YNOA 3ZD6A 4OATA 1Z28A 2AJLI 3BERA 5FI1B 3EDCA 1E3JA 2OFWA 1MAAA 2B4QA 1QGUA 4D81A 4YPFA 1APBA 4ARVA 3V42A 4X00A 2W6JD 1NTOA 1E6EA 1VB3A 2P9CA 3ZQ6A 2ZAGA 4MWBA 4NNJA 4X7RA 4ESOA 4IIJA 1CJMA 2HI0A 3D4PA 4UE6A 3RFVA 5JRJA 1J0XO 4FT2A 4B4OA 5JWRA 2QM7A 5B3JC 2RBKA 3WWYA 1GNPA 4TYWA 3VSEA 2I7DA 3PKIA 4PYJA 4UBJA 3OJOA 3CH7A 3D4NA 3GGCA 5LA6A 1CEXA 2HA6A 2J30A 5BYBA 4QBFA 1FVHA 1E7YA 4FDLA 1AS3A 2AN9A 3QX8A 3R74A 2CYAA 2VA8A 1FLNA 2IBTA 1A2OA 4F06A 3CINA 3OZUA 4Y98A 5AKLA 5AOCA 5LKAA 2CXPA 5I9NA 5B1SA 2Q28A 4Q1DA 4ZU6X 2H2DA 1MB9A 1HEUA 2VJLA 2VF2A 1ZC4A 3HR8A 2P3SA 1N5OX 4RHYA 3JQDA 1HLDA 3JYLA 3I92A 1N5RA 2GK7A 3KTOA 1IDN1 3HB9A 1PKXA 2EWMA 2HA3A 2AG1A 1A5TA 1TDJA 2BRUC 3BD6A 3G8YA 2XWBF 4RJLA 5BRNA 4RTLA 3KZXA 2G9UA 3GCGA 2VHEA 5K3BA 3FPAA 1URPA 2R97A 1XU9A 3IOCA 1X19A 4CG0A 1SCUA 1KC3A 2ZVJA 3CH6A 3R76A 4XX1A 4KFSA 2DT8A 1KZYC 3FCAA 2IDKA 4M1YA 4XKJA 3IVCA 3VTFA 3ZGOA 1SFRA 5ECGC 3KR9A 4Q4JB 2UKDA 2Y1DA 4M3NA 1CF9A 4MH0R 1ZS9A 3GNTA 5FL3A 4N0PA 4FOTA 4MIEA 1QHHA 1R6XA 2OVBA 2HZ7A 2GK4A 5BYJA 1KYVA 2GI4A 2FEOA 5ABPA 4AY5A 1U1FA 4XQGA 3KV1A 5C8YA 4EY5A 2H1OA 3T9BA 2QLNA 1W4LA 1OIVA 2XCUA 3PXUA 4UUMA 3LPCA 3DMGA 1LLFA 2DFNA 4KV7A 4CCYA 1JEQA 1DKOA 1TJNA 3QFTA 4O3FA 3PD1A 4PHFA 5F2EA 3FFTA 1A82A 1HG0A 2JIRA 2QNRA 4WN9B 2CWWA 1ZK4A 2ATIA 1XSEA 5F7XA 1VKJA 4DBLE 1VFPA 2ONKA 4INPA 3RROA 4NFLA 1OJLA 2Q8PA 1UT8A 2P1RA 2ZRFA 3FVQA 3JQGA 3OT4A 1UMCB 2ZUTA 5IH3A 1N6KA 5EMJA 3FPLA 2ERCA 2O6LA 2DY0A 1WZIA 4FX2A 1XMQB 4NE2A 1DTWA 2Q1XA 3CT6A 5KZMB 3EWNA 4URYR 1E4OA 1MHPA 2IIPA 1VKOA 3ILSA 3R5SA 3DMYA 1JDJA 1LPAB 3GRKA 3MUNA 4GYWA 4L8YA 3HRIA 4Y1EA 2WTXA 4OH7A 1FBNA 1R16A 4WK2B 3DBRA 1N78A 3QV1A 2Y4NA 5BNZA 5J9FA 3GZNA 3LTNC 4MRPA 1HDYA 2SKCA 4KXNA 2VJBA 1EXVA 1NYRA 2ZYWX 5CNIA 4J9UE 1GV1A 2D0DA 4BMXA 1HZJA 4QRHA 4WDRA 3CF4A 1O95C 4TTQA 4DQVA 2VZEA 4IHJB 3EVGA 1JHAA 1GRRA 3G82C 4CM5A 2BFBB 2Q2VA 4KPUA 3A3OA 4PC3A 3ZDZB 4PYOA 2YYAA 3AU9A 2R7NA 5ECYA 5LDHA 4AQ7A 2WLTA 2BFDB 3OFND 3I61A 4JY7A 3BEOA 4DIFA 3ZOKA 3FOEC 1R5NA 2FWIA 2Q5FA 3QVUA 4PIPA 3FFXA 1HNZB 1FEZA 2PQMA 2DE0X 5EJ5A 4G1FA 1WEHA 5EUCA 2KI5A 4IIJF 4YFVA 4B09A 5BQOA 2P5UA 2EKQA 4R1UA 1I1HA 2JIZA 3FMIA 3K96A 3DMDA 3EMKA 4I2NA 4FB5A 2VNAA 5KOJA 3RI3A 2C29D 4BO7A 2FPRA 4WK0B 3GPCA 3B1YA 1Y0BA 4ZC1A 5LA6F 1ZRHA 1IIBA 2H85A 3UWPA 3M1YA 4UULA 2BP7B 3BIJA 4OQZA 1OT3A 4DDVA 3AIIA 2G5CA 4GC5A 1OAKA 4H59A 1XDSA 3ZCRA 5JJ5A 2V9PA 4F5WA 1AHNA 2WYWA 4HB4A 4TV9F 5JCOC 1W48A 2IIQA 2DPLA 4TKVA 1XCGB 1ZD1A 2APJA 3P52A 5IAKA 2YJ4A 3PC2A 3RUPA 1HC7A 3AIOA 3LCUA 5K6AA 1B3BA 1RAFA 4PVCA 1UDBA 1QH9A 4YT4A 3CE9A 5BSWA 4JEMA 1GUZA 3B6IA 1VL8A 2GJKA 3R0ZA 2GCIA 2Z9DA 5AICA 4AICA 4RYLA 3JQAB 1ZKDA 4DCTA 1YI8A 2CHQA 4RBNA 3UPTA 2PG3A 1AK2A 2ZROA 3K09A 4QREA 5T4FA 2J3EA 3SG0A 1RXVA 4Q12A 3HDTA 3FZYA 1KK3A 4NIMA 3FNQA 2WAXA 3CNNA 3GLHA 4J2TA 1MNAA 4ARUA 5CT5A 5I7SA 1AJEA 4IDPA 4XRGA 2A67A 1WR8A 1SUSA 4JP8A 4OPMA 1B8PA 1UBSB 2BFCB 2VXOA 4LMRA 3ROEA 3TUJC 3FOBA 4PR3A 5FTMA 5BW5A 3QG5A 4LK2A 5C8YF 4O5AA 4M46A 1JXAA 2HJ9A 3H84A 4AJEA 5GJBA 2PSJA 4X64B 1PZNA 4LVUA 4RVOA 1H66A 2X1VA 4WUTA 3SX2A 4DCNA 2VOEA 1J42A 5DKFA 2WJAA 3ZJ4A 1K3FA 5BPHA 4PNHA 1JDTA 1V8PA 3THOA 1USIA 3KJNA 4HN2A 3LVBA 5JLAA 1HYHA 5JLJA 1SXQA 4JLMA 5KX5B 4GI7A 4US1R 4HNSA 5DM70 2ATVA 1QCCA 3DBHB 1QRDA 2FSUA 3LL4A 3CZAA 3R0JA 3CXRA 4OXKA 4DG9A 4P4SA 5IJ0A 5LP1A 1XTBA 2E49A 1UBHS 3QBDA 1JEDA 4HWGA 2WDZA 1VGQA 2D8MA 2GKOA 3L8ZA 4OMFG 4TMVA 3M6IA 5TQJA 1K5PA 3EXG2 3WIEA 4DCOA 4MW1A 4Q93A 3AW9A 5BR7A 5G1NA 1DO8A 1E2KA 5JNVA 1SOWA 2I65A 2GF9A 2OV3A 1U2PA 2FYTA 2VJMB 5L3SB 2L82A 1GEEA 1ZA2A 2CJPA 2G9QA 4G85A 4NK5A 4CMBA 5C7LO 1HNWB 5C18A 1J2EA 4OYRA 5ADHA 3EVTA 4CNQA 4EZBA 4PAOA 5DVZA 2ZU0C 2QT0A 1BE6A 2ZIXA 1N2GA 3MWJA 4DR7B 1UZMA 2QLLA 1DCFA 1B6SA 1HV8A 2JCGA 2WHRA 4N8DA 3NTOA 1LJ8A 2P5SA 3VR4D 1AUQA 3OPNA 4ARIA 4GOLD 1U8YA 1C3VA 1FP7A 4YAIA 2HTFA 4QXPA 4AIRA 1FDIA 3ZV6A 1E32A 1WXXA 4PYKA 4ZO7A 1JG3A 3UVEA 1QF7A 1LXCA 2ET6A 4TLDA 3PDUA 2PUGA 2GXQA 4KNYA 2CLIB 1GSAA 1V5EA 4MW5A 1J9EA 621PA 1N0UA 4Q00A 3RFTA 3R77A 1D0IA 4C4TA 3IEPA 1Z2AA 1ZCZA 1NVUQ 4KXFB 5CH5A 1X0VA 2I3GA 3JPWA 5ILOA 4J1TA 1NOIA 4LGCA 4KQ6A 5BQ3A 3CSDA 3N3BC 4GP7A 2OC4A 2OP0A 3TXAA 3ZLTA 5JS8A 4A6EA 3EW9A 1EHCA 4MQ6A 1JKJA 1RHMA 3DM9B 4AMBA 1OJ7A 5JCXA 3EWAA 1KIMA 1LZKA 2H2FA 4HS9A 1NXSA 3G9XA 5CX1A 4ZA2A 1XJQA 1U3WA 2C2MA 4QSMA 4Z9AA