3PGLA

Crystal structure of human small c-terminal domain phosphatase 1 (scp1) bound to rabeprazole
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Selective inactivation of a human neuronal silencing phosphatase by a small molecule inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3pglA00
3ET5A 1RMQA 5AKEA 5AKHA 3N8GA 5AVYA 3EPRA 5IT4A 5AVUA 4EZEA 5AM2A 3N07A 3NRJA 3ZX4A 3L1VA 3IRUA 2ZBGA 3SKXA 2FPXA 2R8EA 1O08A 1K1EA 3S6JA 2RARA 3DV9A 4F72A 4BNDB 3N5KA 2EAUA 2VKQA 2YMLA 4MWOA 3ZU6A 4FYPA 4CF5A 1Z4IA 4NAVA 1WR8A 3NUQA 3QU5A 3AR8A 4J2TA 2C8LA 2GFHA 4UARA 2EATA 3UMGA 4AP9A 1VJ5A 4UASA 5JJBA 1XP5A 3ZTWA 5AIAA 4Y2UA 1ZD4A 2C8KA 2ZXEA 2BDEA 2R8YA 2WF5A 3D6JA 1IWOA 2PR7A 1Z4NA 3MMZA 5AKYA 2FUEA 2WFAA 3OPXA 3RFUA 5A3RA 5ALVA 3OCXA 3FZQA 2FPRA 1TJ4A 2WHEA 3AR3A 3SD7A 3GYGA 5AW4A 3E58A 5AK4A 1TA0A 1XPJA 2NO4A 2YBDA 2YJ6A 3PCTA 4KYTA 4Y2XA 4YCMA 2YJ4A 4BX3A 3U13A 5AVXA 1LTQA 3P96A 1N8NA 1VFPA 2EARA 1SWWA 1ZRMA 1YS9A 3WKEA 3FGOA 3QNMA 4UMFA 5A3SA 1L8OA 5AI0A 1ZS9A 4EEKA 2P11A 3SKYA 5AW5A 4BX2A 3ED5A 5ALKA 3ZWKA 4BEVA 4B6JA 3QUCA 1U7OA 2FI1A 3QU7A 5ALUA 2OA0A 3W5AA 2YMQA 2D2VA 2I55A 2JAWA 2IA5A 3EF1A 1SWVA 2IOFA 3QUTA 2BY4A 4XOUA 2FUCA 2P27A 2ZBFA 5ALTA 3QU4A 3W5CA 5AVWA 5AM4A 2DQSA 5AM1A 1RKVA 2WM8A 3KD3A 4HGOA 4CNQA 3L8FA 4XE5A 4QJBA 4C4TA 3WKCA 1Z5UA 1L7MA 2WF7A 4J03A 1RLMA 5ALSA 1L7OA 4KX5A 5AI5A 5AI8A 1AQ6A 3UMCA 3L7YA 4XQ0A 5ALWA 4DCCA 1QQ5A 3WGUA 4EX7A 1FEZA 2G0AA 3NASA 3MC1A 4UATA 4UMEA 4ZEWA 3B9RA 1ZD5A 2NO5A 2FPWA 4Y2SA 2Q5EA 3WK9A 5AKIA 5AVRA 2R8ZA 3WKAA 4GIBA 3OCYA 4HGPA 3CZ4A 3HLTA 3NALA 3ZVNA 5IT0A 4JDPA 5ALJA 3OCZA 3QGMA 3EF0A 3BA6A 5ALIA 5AW8A 3AR4A 4OHFA 3E81A 3U26A 2FPSA 2ZBDA 3AR7A 5AVVA 2C9MA 5AKKA 3ZX5A 4Y2RA 4DW8A 3QYPA 5ALFA 1X42A 3NIWA 4AS3A 2P9JA 1QYIA 2B1RA 3I76A 3ZW7A 4PNHA 3DDHA 2ZG6A 1RMTA 5ALYA 3J7TA 4AS2A 3MPOA 4UAUA 1XVIA 3I1YA 1ZD3A 2HSZA 2NYVA 3QUQA 1Z4QA 4UM5A 2YY6A 4BNDA 3U7EB 2Q4RA 4YGYA 2CN1A 2B0CA 2HI0A 3U19A 2HEGA 4RETA 5AW1A 1ZRNA 1MH9A 5ALRA 4UW9A 1J97A 4YCNA 1RPZA 1YJ5A 2C4NA 3BWVA 2OBBA 4YCLA 3FPSA 2HHLA 3KBBA 3SLRA 3I6BA 1NRWA 3MN1A 3UMBA 3ZUPA 4DFDA 2G80A 5AIBA 4NV0A 2Q4TA 1NF2A 2I6XA 3KOOA 4UMDA 4ZEVA 3A3YA 4KX3A 5AICA 4BEWA 5AI4A 2AUTA 3N28A 5FP0A 3A1DA 4L6AA 3A1CA 2HCFA 4UU1A 5T41A 3CNHA 1RKQA 2X4DA 4F71A 2I54A 4YIKA 5ALDA 3WK8A 2IYEA 3TLMA 2FDRA 5AW6A 1TJ5A 3WKBA 4MUMA 5AVTA 2QLTA 1U2SA 3SHQA 2G06A 3IJ5A 5AKGA 2CFTA 3F9RA 3AR2A 3OCWA 3N1UA 4OCZA 4KN8A 5AM0A 3PDWA 3WK7A 1L8LA 2JAOA 1EK1A 3OCVA 3NANA 4NFLA 4ZEXA 3ZTYA 1Z4LA 2G09A 5ALGA 1Q91A 4HGRA 2PQ0A 5AKXA 3ZVLA 5AW9A 3OTQA 2OM6A 5A3QA 2RBKA 2JGAA 1TE2A 3WK4A 4C4RA 4E88A 4HAIA 4Y2TA 3W5BA 3FM9A 3NAMA 3E8MA 1Z5GA 3K1ZA 2P69A 3DNPA 1Z4PX 3ONNA 2C88A 2G1AA 2B1QA 1Z88A 5AKJA 3DAOA 2HDOA 2B30A 1QQ6A 2G07A 3R4CA 1RRCA 3AR6A 3KZXA 5AK5A 3EWIA 2HF2A 1F5SA 1RDFA 1WZCA 2FPUA 3QX7A 1WVIA 2YJ3A 2FEAA 2GMWA 3B8EA 2I34A 3UM9A 1S2OA 4Y2VA 1TJ3A 5ALHA 4O8CA 2IOFK 2W43A 3L8GA 3M9LA 2B8JA 4KNVA 5AI9A 1ZOLA 2I33A 3RF6A 5AVZA 4UMVA 1N9KA 2YN4A 5AVSA 5AM3A 2MSNA 3ESQA 3QU9A 1U2TA 3U7GA 5AHXA 3A1EA 4FFDA 1YNSA 2GO7A 2W4MA 5AK6A 3L5KA 3W5DA 3AR9A 2R8XA 3L0YA 5ALQA 4I9GA 3QUBA 1O03A 4Y2YA 1ZD2P 1Y8AA 3ZVMA 2O2XA 1U02A 2HO4A 5AW7A 3AR5A 2MU1A 4C4SA 4HGQA 3L0BA 3L1UA 1ZJJA 3HYCA 4CE6A 2ODAA 3WK5A 1RQNA 1WPGA 3PGLA 2ZOSA 4OD0A 2JARA 3WKDA 3VAYA 1RQLA 1Z4KA 1CR6A 5AI6A 2IOHA 1L7NA 1T5TA 3FVVA 5AM5A 2CFSA 4Y3UA 5AKLA 4Y2JA 1L6RA 3KC2A 5AW0A 4Y2PA 3QLEA 4YH1A 3E84A 1PW5A 1U7PA 2YMPA 2GHQA 2WF6A 1RC8A 4FE3A 3SF0A 5ALZA 1L7PA 5AVQA 5IS2A 4HGNA 4IFTA 1LVHA 5ALMA 1CQZA 4Y2QA 4RESA 3U7FB 4GXTA 5AESA 5AW2A 3WK6A 2G08A 4I9FA 2I7DA 2O9JA 1RKUA 1T5SA 4L6CA 3R9KA 2PKEA 2HF7A 1NNLA 2ZBEA 4EENA 4HYTA 3L0CA 3ZWDA 2B8EA 4YIHA 1YMQA 2YMMA 4JB3A 3L8HA 1SU4A 3R09A 4NABA 4UM7A 4EELA 2AH5A 4KNWA 4QQFA 4BKMA 1RMYA 2OYCA 3QXGA 2WF8A 4BBJA 3U7HB 1YDFA 4CF4A 1RLOA 3KDPA 1S8OA 5AKZA 2B82A 1VJRA 2BDUA 2AGVA 4OFZA 3IB6A 5ALNA 2HOQA 2HX1A 3OCUA 4G9BA 1Z4JA 4NWIA 2RAVA 3M1YA 3PGVA 5ALLA 2AMYA 5ALEA 5E0OA 1Z4MA 3ESRA 4BYGA 2GHTA 3ET4A 3WGVA 5ALOA 1T9ZA 1Z4OA 3QU2A 4XPZA 5AK3A 4EX6A 3L8EA 5ALPA 5AW3A 2YFYA 2YJ5A 1YV9A 5ALXA 4H1WA 2W11A 1QQ7A 4L57A 2CFRA 3B9BA 1J8DA 4BX0A 1JUDA 1KYTA 2RB5A 3FPBA 2WF9A 1Q92A 3SMVA 1QH9A 4UAVA 1RLTA 4UU0A 2JAUA 3I28A 4G63A 1EK2A 3ZI4A 4IG4A 2QYHA 4DWOA 4CF3A
chains in the Genus database with same CATH superfamily
2ZGVA 1JLMA 2DSNA 2Q2OA 2POQX 5HFAA 5AVUA 2R86A 2JJQA 2HHAA 3U3RA 1RR6A 2R7KA 1EA5A 2P4EA 3WJ1A 2XB4A 3L1VA 2R00C 2ZBGA 4GX0A 2FZGA 3OZRA 5KTSA 4PICA 4RWZA 1K1EA 1YS1X 3GYBA 1GO2A 1N34B 5KOYA 4O3FA 3KETA 3GFVA 4W5NA 2C5FA 1L1QA 3IMFA 3JRXA 1FUEA 4F21A 4N39A 1ZH6A 1L8QA 3I9KA 2F59A 4PZPA 1SKBA 3Q3JB 4NBTA 5FXMA 4N7JA 4EHIA 1K4MA 1K06A 1XPRA 3AVUA 1Z07A 3WMFA 1W581 5HXAA 3HUUA 1VIAA 2YXNA 3QPWA 4IJ5A 4DTCA 3ETLA 2XB9A 2V4UA 4INZA 2EATA 2QUAA 4I6GA 4LIPD 2IUUA 1DVRA 4PQFA 5HS6A 1L4YA 5I5EA 1L1FA 4Y9UA 3ZBQA 4JKIA 4WW0A 4OYLA 1YT5A 1HOXA 1TEVA 2DBRA 3G88A 4OJQA 3WHLA 3BTOA 3GJZA 4G5FA 1LPOA 4JDUA 4RCVA 1YDEA 3TNDA 5DSXA 1NSFA 1QKIA 4GT1A 4MVCA 2EQ5A 4A73A 5LN1A 2QG6A 1FTWA 4YJ3B 3TQTA 2F1HA 1YDGA 4N54A 2YV2A 1W5BA 3GNSA 2XRFA 1CEYA 1ZVQA 1ZQ9A 1E3LA 1GAWA 1BE6A 3RD5A 4LJKA 1N1DA 2HNKA 3WADA 2V1XA 3H2IA 4LPSA 5A1JA 1IZ7A 4FOTA 2PUCA 1RHMA 3M33A 4XD7D 3A70A 1TJ4A 3ACBA 3MRSA 1XDZA 4P0TA 5LU9A 2RKBA 3UAVA 3DLHA 4EI7A 1CULC 1E20A 1QF9A 2FWJA 2LTAA 1QP7A 4YJ3A 4Y98A 1Z8NA 3ANTA 2F9FA 5LZ8A 2ZVJA 4H7PA 4A2WA 4TL8A 3UAWA 1RVV1 2PVCA 3UY4A 1AB5A 2D0PB 4C01A 4C6SA 5KJEA 4G9EA 4R1TA 3ZDAA 2DFKB 2GM5A 3IRVA 1BE1A 3LYUA 1JJAA 3K5HA 1KP2A 3RVKA 2EU8A 4CPDA 2FZLA 3OJXA 2O8CB 1GGEA 1ZMXA 5DBHX 3UW3A 7AT1A 4YBZA 2OE2A 1QHHB 5K2MA 5CYGA 4H16A 4MPPA 4DV1B 1NJ5A 1ZW1A 3PGJA 2X23A 3KPWA 2G3YA 2MCFA 4QTUB 2UXCB 2YMQA 4MW4A 1SQ6A 3W5SA 1XTIA 2QXUA 3C8HA 4JUFA 3KZOA 4ML3A 5CIWA 3RVNA 4H9GA 2O8CA 5SZHB 1E9RA 2BKAA 3W7BA 1L4KA 2I6TA 2J4FA 3AEZA 5BSEA 4LNAA 3UCEA 2HMSA 1QHHA 1VG9B 4FKZA 3KOMA 5DNVA 2CLCX 3I04A 1A9TA 2PLWA 2F2TA 4JX9A 4DT1B 1P5HA 3U4CA 2P9QA 3O73A 4Q4JB 2O3UA 1WQ4A 2JJMA 2WJHA 3LX5A 1NOKA 4Y2HA 4AT1A 1RKVA 5LP6B 1RYBA 2QN9A 4NK4A 4JUIA 4BIIA 4IILA 3ZW8A 2YV1A 1CY4A 2NO6A 1CR4A 2SKCA 4U63A 4HWSA 1WMAA 4EL5A 4TN1A 3HDJA 3N7TA 3L0OA 4MROA 2IYZA 3OM8A 1U7XA 4O29A 3VNAA 1LX6A 1OWMA 4UQPA 4TXNA 4DT1A 1TT5B 4CMIB 1K8RA 3CLKA 4FMBB 3X43A 4JQOA 2MSLA 2AX4A 4WKBA 4OI1A 4Q4JA 5DTRA 5LP6A 3AWIA 1II8A 4S12A 4XRRA 1W76A 5BSKA 1CEQA 3PIDA 3K6SB 4JFRA 2IGBA 5CNMA 2CXNA 4GR9A 5TVKA 1D2MA 1K97A 1T0IA 1Z3IX 4MAFA 4CVNA 4YACA 2YIMA 3B9RA 3THSA 3P9NA 1TT5A 2HHCA 4CMIA 3IP6A 4PQYA 1OWPA 1ZWLA 2Q8PA 2WYWA 4ZT6A 1M34A 2XJ9A 4I1SA 4XX0B 3II6X 4RKEA 2B5OA 3BF8A 2HHHB 721PA 3K6SA 5GQSA 3U80A 3GFSA 2E4XA 1CD5A 1MAVA 1N6OA 3QVVA 4QREA 4AWBA 5TRTA 3DEJA 4GRDA 4BVKA 3DGEC 3ZVNA 4EQZA 4UEJA 5HIIA 1RRPA 4LJYA 1EGHA 1OC4A 2PYIA 3OCZA 5ALJA 2FPGA 3M49A 4FGSA 2YOFA 4MNTA 3T41A 5ALIA 2AOUB 3HV0A 1EVIA 2GCOA 2QMZA 1EXWA 4CN9A 3C6XA 3OTGA 2J5BA 5DBOA 4BNNA 3AR7A 1H8EA 4XX0A 1ISIA 3KAKA 1M33A 5ESWA 2VWGA 4JC0A 4A8TA 1NDQA 1P2UA 3GPBA 4EJ6A 4IDGA 3BGOS 5K9ZA 3B5JA 3K8ZA 4Q34A 2B35A 2FP4B 4CV0A 4YEDA 2NP6A 2DWPA 2IYPA 4PNHA 3UKDA 2GWHA 1NYQA 2AOUA 2H8KA 3K0EA 2O7NA 1YQXA 1FNBA 3I1YA 3FRHA 4RPGA 4GS5A 1JVNA 3DNFA 1Y3AA 2FDXA 1DBRA 2P1DA 2EJTA 4UM5A 3W8FA 9ATCA 2VJQA 1XZCA 2IHJA 1RWOA 2C61A 3AF2A 2CB9A 5SICE 1PFWA 4D9IA 3QLTA 4L8GA 2FP4A 3K92A 1P0PA 3HBLA 4UTXA 3WGKA 1Z8HA 1O8BA 1E5XA 2H1WA 1PDOA 1VQ1A 4DBVO 3FOWA 5AVOA 4AXXA 1QORA 3LQ2A 3MQ4A 4KYUA 4ZO4A 3F3SA 4DUGD 5FL3A 5G40A 1M66A 2PJUA 4XI9A 1LVUA 2R96A 3G7NA 3HDTA 4TM8A 2HPVA 1Z12A 3QTBA 2HU2A 3BWVA 3G8DA 2BFDB 3PYLA 3UQZA 1M0EA 4BVAA 3A32A 2JGRA 3Q8KA 5L4SA 2B2XA 5FV4A 3PR3A 4J2OA 2HF9A 4WBNF 2NO7A 1BKYA 3G1UA 5HGJA 4U5XA 2OHIA 2A5YB 2SKDA 2Q4TA 1XOIA 3H0CA 2C4WA 2X0DA 1BX1A 2QY6A 1K5GA 2FWNA 3GLVA 4UMDA 1IPHA 1UM8A 3MLAA 3VPAA 1HDOA 2Y8EA 4ZEVA 4GXQA 5F2OA 2BFDA 3AXSA 4TTSA 1B8PA 1AKMA 1VSBA 1SXIA 3DBRB 3USZA 5KYWB 3IBFA 4OI0A 3EZFA 3A6ZA 3KQYA 1BXKA 2ETVA 4RXTA 4HDSB 5ITWA 2I54A 2E0IA 1G7SA 4PGGA 2A9QA 1V35A 1L4MA 2JVKA 4N9WA 3BGSA 3IE1A 1M6EX 1TJ5A 1XWFA 2KSQA 3WQSB 3RU7A 1NONA 2OP0A 3WL3A 4Q15A 3WKBA 4MUMA 5E1OA 2AJ8A 1FVOA 4A10A 3SYMA 4YAGA 3DBRA 5KYWA 2RJNA 3S99A 4C08A 3HYNA 2CHVA 1FNDA 4N3BA 5M5BA 4TX1A 4HDSA 3HNOA 3BIOA 5AKGA 3FUCA 1FX0B 3GRRA 4IZOA 4B3DA 3L46A 4CMEC 3GFTA 4Z3KA 3UB2A 4QQRA 1DRWA 4CEJB 2B2CA 4C1NA 2AC2A 2YC2C 4BL5A 3KYCA 2DLCX 3TKLA 3VPXA 1IBRA 1D1PA 3WGMA 3DPUA 4N12A 4KQFA 1PWEA 5JBQA 3IIEA 5L6LB 1O57A 1R0LA 2BEKA 3G9ZA 1DJLA 2L42A 3L6RA 4GLLA 4FZVA 1HNNA 2HK7A 3C14C 3ZDXB 3NAQA 1RLUA 2D5IA 5UKDA 3GGCA 3P9XA 4UC0A 1LVGA 4BY9E 1FX0A 1I0IA 2DFDA 4LXYA 5LDDC 4WOCA 4CEJA 4ENWA 3PC3A 3EIQA 3RJMA 2GJ4A 2RBKA 4D46A 5KVAA 4BQSA 3F7OA 1XTPA 3PHJA 5BT8A 2ZBPA 3G7SA 3DEHA 3H42B 1UADA 3WLOA 5KNBD 5JBNA 4B34A 1XDGA 3IIIA 4L8LA 3RLIA 4CTJA 5I4BA 2AOWA 4WZAE 4QUDA 1LSJA 2QA5A 3FM9A 3TZCA 2IU3A 3KDAA 1P5ZB 3QE0A 3T3NA 4JR1A 1IFXA 4TLBA 4BP1A 4BTVA 5J1TB 3OE7A 2V7WA 3EVAA 2HSJA 2Q5OA 1N2JA 1QHIA 2B30A 2V9ZA 3DUFB 4K6GA 4XYMA 1I4LD 1X8LA 3U37A 4UUPA 4XIFA 3AV3A 2KI5A 2BGKA 5DEIA 3A4TA 1IWPB 5KX5B 1JHZA 1NFFA 3IJEB 1SUIA 3QX7A 1M8KA 1NVFA 4UXJA 4JXXA 4H17A 1V37A 8GPBA 4TT3D 3BWCA 3QNUA 4C3VA 4Y2VA 2ZRKA 5ALHA 4BDTA 2WPDA 4UEWA 4G1CA 2ZE6A 3WZLA 3DUFA 4BNYA 5FWNA 4KG7A 5ARCA 3BG5A 3OX3A 4UHDA 1RHQA 3M9LA 2X0FA 5KX5A 4ZP1A 2P5YA 1ZUWA 2IWHA 4OOFA 1XEXB 1NUUA 3ADPA 2VDRB 2D1YA 3QU9A 1QGED 4MCJA 4WERA 1DKNA 1M0WA 1NG1A 4D3ZA 1J0DA 1QFMA 4ZV7A 2O0KA 2NZ2A 2LZ0A 2OVBA 3VHXB 2R4QA 4IIDA 4YO7A 3OLXA 4PN3A 1ZIPA 1Y1TA 1OT3A 2GI4A 3GJ8A 2YXPX 1E1CB 3CH7A 2AQIA 1Z7YA 3NDRA 1SHKA 4EGCB 5I7HA 2QN6A 2OXCA 2J48A 1FCJA 1Y5RA 2ZWAA 4TSFA 1XUOA 2CJPA 4FNOA 1XEXA 4Y2YA 3D31A 4NZPA 2AR9A 5KWVA 2EBWA 1SVOA 1OYVA 4ND8B 1TA9A 3EDMA 4JSTA 4LC1A 2HW8A 1GAXA 2Q4EA 5L3QA 1BKSB 1JIQA 4WFJA 4JB2A 3KBOA 3VHXA 4GEKA 2B98A 5ENDA 2VNIA 3EIFA 4FUTA 3NYRA 2W98A 4K05A 1E1CA 4X20B 5IVPA 2KQUA 3PGLA 4MQLA 1SPXA 5K0BA 2WNSA 3ZLUA 4P4TA 3CYFA 4EF4A 2I2FA 4N5NA 2Q4BA 4EY7A 3QY9A 5BPHA 4Q7KA 4YRNA 2HADA 1RPJA 3OJLA 4V2IA 2R6HA 1XZIA 2RH9B 4IXNA 2PS0A 2AXNA 4Y3UA 3EDOA 2XZOA 2IBTA 3VNVA 1JQDA 4X20A 2FUNB 2JFOA 2WBLC 3FI0A 1TCCA 4CKCB 1K6JA 4WXPA 2G1KA 3UKOA 4MQ5A 3QLEA 4Y2PA 5DNDA 3D6FA 2LD4A 4NLLA 1XQXA 5HKKA 3O4HA 3L04A 1MQAA 3NIGB 4FYJA 5T64A 3LPMA 3PL1A 4Q47A 4R1LA 3E82A 5KVCA 2GN9A 4KQIA 1PFQA 3MA0A 4RSHA 3PA8A 5TQ2B 4E1BA 1WXHA 5LKAA 3FFTA 4A4DA 3TE7A 5K8UA 4FW9A 4CKCA 2OORC 1HETA 4FINA 2VHYA 4FT4A 1JFFA 4NYMR 3DCYA 4JI7B 4LRWA 4A15A 3IAS1 2WRZA 4RA9B 4EM6A 4E21A 2VNJA 4I9FA 2E6UX 5KKCA 3CFYA 1Y89A 3IURA 4BRSA 1RKUA 4KFCA 2V0CA 2I1VB 1OX4B 2HF7A 3W1VA 4B3FX 4I1UA 1Z75A 2QSJA 2WUDA 5CW2A 2VC2B 1WW2A 2HMWA 1VHDA 1PEYA 5DTQA 5IUKC 1YE5A 1GCOA 1ZOIA 5DMXA 1T9CA 4IDQA 3ENVA 3BEDA 3NM6B 4RA9A 3H8SA 3KUUA 1NBWB 2AR7A 2G88A 3CNQS 1PK7A 4UM7A 4V3CA 3TB4A 4G8BA 3V8NA 4DF3A 3RK0A 5IDVA 3VSEA 1JU9A 3E0XA 4HEJA 2RGNC 2VJMB 2OYCA 3O8BA 5CPFA 4OMFG 4YXWA 3K9FC 1NAIA 2HTEA 3DDOA 4B4VA 3R9IA 1VHLA 1OBVA 1YI1A 4X9XA 2ZAMA 3SSAA 5A4AA 5BSWA 3VR2A 1E58A 5LOVF 3G9TA 1NW5A 4IDDA 3TRHA 5KWSA 2H07A 1MW9X 1EX1A 2RAVA 2VJMA 1O87A 4X6UA 3FY4A 3GA7A 4MICA 4LKRA 4N49A 1YRBA 3V9PA 2AMYA 2ZUTA 4BFTA 1PL7A 2PUAA 4NOJA 1OB5A 1NNI1 3G9UA 1WRBA 3LQYA 1DV1A 3I9NA 1YE3A 1H1LB 2ICAA 3C7KA 3BILA 3QI2A 4GKAA 4BYGA 5CG1A 3MS4A 3D4NA 3VR5A 2BBOA 1MT0A 1CSEE 1GNPA 2Y93A 2G7ZA 3IPXA 1SCKA 1LLCA 4QDZA 1H65A 5B1EA 1COWD 4I8DA 3DT6A 1J22A 2CDAA 1E18A 4RIHA 3AO0B 5KOJA 5J4LA 1C7JA 3K30A 4AW9A 4E7PA 5LBIA 1MRZA 1GY8A 1QH9A 1U8CB 1H1LA 3PXBA 5AOAA 1MJGM 5KSZA 3K4PA 2OV3A 1DC5A 4WCFB 3VDNB 5EPUA 1O4VA 4OQQA 2GS9A 3C74A 3ET5A 4L15A 1XTTA 1DAPA 2JKVA 3CZRA 1SXGA 3O1IC 5DHQA 2YV4A 1NJ1A 1O95D 3K9QO 3OPNA 3MJSA 2P75A 4OGGA 1N75A 2IYXA 1RBQA 1XYGA 1ZGHA 4ZOCA 2R84A 5HF5A 1JSCA 2CLHB 3TQCA 3V6MA 5C35A 4MDHA 2LCIA 2P6RA 4MRPA 2UYOA 5HF6A 2YKGA 4YRSA 1CUEA 2DQYA 4CL0A 4W1RA 3SHFA 3E4CA 4JC5A 3PB3A 4WCFA 3SR3A 4GMXA 2VSNA 2XMGA 2O2CA 5TIIA 4K03A 4H6VA 1NMSA 3DEAA 3KOYA 1TUGA 1CNFA 3A4IA 4NONA 1UPAA 1BMQA 2CNNA 4NBWA 3NTQA 5KQRA 4LJLA 2JCGA 4DV5B 4MWOA 4D5EA 4G8JA 1QHEA 1YDMA 1DJQA 2HMUA 1CE8B 1V8FA 4OIMA 4UBMA 1XZPA 3LYAA 3T7JA 3QU5A 3QLVC 3L0PA 1F6BA 2C3PA 3I3OA 4OUKX 5TJHA 3E2PA 2O8FB 3JD3A 5L51A 2H4FA 1G60A 2WKPA 4I7EA 1XI2A 3G5MA 1LUAA 2B20A 4EPVA 1XBTA 1DLJA 4WOJA 4R2MA 3JQDA 1XTBA 4JB8A 5GZ6A 4YRIA 4HK4A 4C89A 3ZGVA 3DFFA 1Z6ZA 2M98A 1UUFA 2QRKA 3OEHA 4GQBA 3IT2A 3I4CA 5CA1F 5AXDA 2GEFA 3KSAC 3X3HA 1O0BA 3URKA 3CLUD 4ZREA 2DETA 5C46F 2WFAA 4LCJA 4LYHA 3EEIA 2GFIA 4POOA 4IH9A 1GGFA 3GJ6A 3TG2A 3JS5A 1SGWA 2F1RA 2PZLA 3NVAA 5ADUS 1XD8A 1N9ZA 2W48A 2O2SA 4R01A 1DAIA 2I4MA 2VAXA 1ORVA 2WMDA 421PA 1L8XA 4EIWA 4B9AA 3NHLA 1DUIA 2QT0A 2ZWOA 1BDBA 4UHJA 1WUKS 1K5DA 3NTRA 3GUCA 5I7AA 5K6RA 4KDCA 1VFPA 4TLEA 4W1QA 4XLLA 1Y6FA 1YS9A 2ZDGA 3M2PA 1GSOA 3GLHB 3IAM1 4TKMA 3C7AA 2AZXA 3CF4A 3D4BA 3GLFE 1EQ2A 2OPBA 1ZHHA 1IJBA 4LSMA 4AP6A 2QB5A 3Q7TA 3L7IA 1DQPA 2A5FA 3AOGA 2EIXA 3IEPA 1GQOA 3AF5A 2Y4NA 4P7GA 3GEPA 4E2WA 1NXSA 3SWWA 4E30A 2V8BA 3IAHA 3LT1A 3LUHA 3Q8MA 1S89A 3B85A 3WIOA 5IAAA 3OLWA 4M0FA 1HY3A 4OM8A 2OCPA 1IJFA 2B7BA 1FUYB 2GN8A 3GLHA 1NJSA 2QR2A 3JWHA 4A16A 3QV1A 2I55A 4TMYA 4QG3A 2JLXA 1WCV1 3HA7A 4HLUA 5B2EA 3OCCA 1MOQA 4MVYA 2FZKA 5KQPA 4EEXA 3Q6IA 2P9BA 1Z6GA 4ZMRA 5HMLA 1GCAA 1HSOA 2K6GA 2JIQA 5ALTA 1MX1A 1PWYE 2O0LA 2O7RA 2YFKA 5BUQA 1LJUA 1ETUA 4CIXA 5I9NA 2WOOA 3TZ6A 3UKJA 3FHLA 5IM4F 2VSXA 3KQWA 2VCHA 2B94A 3L8FA 3D8BA 1CZKA 2PSEA 3D4IA 3PPIA 2VT2A 2I9KA 1BVHA 6ADHA 1G0NA 2Q9AA 1Q2UA 2HMTA 3L7BA 2C9BA 4GKVA 1Z5UA 3QJGA 1YIDA 1P4AA 4M8LA 4QYTA 4R84A 1GA1A 2A33A 4WDQA 5BSVA 3ABZA 4EFKA 3QXSA 1N7HA 1ZL2A 5KYVA 5IH7A 3AOEA 3FWHA 2Z09A 2FU5C 1U9ZA 4LN1A 3L7YA 1DQZA 2FW8A 2E4YA 2HJVA 1Y7PA 3BM5A 3ILSA 3LWNA 4JODA 1OREA 3ZIUA 1US8B 2XMDA 3L02A 3O4VA 3P45A 2ZR8A 4XX1A 3W0LB 4G0YA 1OGYA 3PF8A 1PZXA 1K66A 3SQXA 4EAAA 2ZPAA 3T9FA 1NAHA 1DU4A 3P9CA 1N4AA 1M2NA 3C70A 4BX8A 3FVWA 4ZOQI 2X6RA 1BU8A 1NV8A 1QGUB 1IULA 1SN7A 5BN4B 3BMOB 1PCXA 1DEKA 4LTNA 1JE0A 1KRHA 1X1BA 3L4SO 3N76A 3NIFB 1CRPA 1JQLB 4OEHA 1QLHA 3F6BX 3DTNA 2GCEA 4IIBA 1WLSA 1US8A 4ZZ1A 1RAIA 4B45A 2XAUA 5DRYA 3SMQA 2APJA 1X3SA 1E79D 1Z0DA 3DBIA 3IVAA 1XTVA 1KJJA 3JZAA 3KAJA 4KQJA 1E5LA 3U1VA 2VT6A 2GK7A 3NT5A 1SHZA 1QGUA 1GZ5A 3E9NA 521PA 3I01M 4JGIA 5BN4A 4KJXA 4MIYA 2H7CA 4LHEA 1I6WA 4MWBA 1OI2A 2UYGA 4LF9B 1FUUA 3FJOA 4REQB 1IE3A 5KCZA 1LC0A 3BRWA 3VPBA 3R3HA 3WA6A 4JUDX 3H5LA 1EAMA 2B1RA 3TW8A 1K7XB 4LXIA 1G7CA 1BOOA 1QDUA 2OGWA 2PGDA 1EZZA 1JSLA 1QV6A 5JYCA 1C0IA 1ULHA 4RU1A 3ZHQA 1VGVA 1IVYA 2NYVA 2HBRA 4IPTA 4RHXA 1H1DA 4B3IA 4LXQA 1GTL1 1LW6E 1WZIA 2AOVA 3M89A 4REQA 2CLSA 4DQVA 2D5LA 2Q4RA 5HW0A 3ZGNA 3ST7A 3KTAB 4RETA 4MV3A 3V1LA 3HB5X 3PWTA 1DINA 2ISSD 3C87A 3QX9A 1Z6QA 3W3AA 5C1DA 5D00A 1K7FB 1Y4UA 3AY7A 3S3TA 4OI4A 3F0TA 3RVMA 4CFYA 3G9XA 4N8EA 4PIPA 3VPSA 2ZRJA 4FHDA 3SJAA 5KQLA 1JNXX 4LDNA 4L5BA 4EUSA 3RBZA 3A2NA 2B6NA 4YAFA 3EUFA 3KTAA 2VXOA 4L0CA 4YBRA 2XYQA 4NFSA 3B8HA 3MB5A 4EOGA 3FETA 1SD1A 2G80A 2XQJA 3IDQA 2QVZX 2BFWA 1CKEA 3LIPA 4KDRA 4UVHA 4ZT3A 3ROXA 3COJA 4MWZA 1KJNA 4OHZA 1V0JA 1WMEA 3TGWA 3WDKA 1M5UA 1IL0A 3IEUA 3ETGA 5FP0A 4C6TB 4D0GA 2NNLD 4P9NA 3ZWBA 2YHIB 3NP7A 3K2BA 4MCAA 4LJSA 2XCRB 2QSZA 2UVDA 16PKA 3AUXA 5PGMA 5GTDA 2FMXA 5LZ9A 2IYVA 1C30B 1N2BA 1X39A 3CUEF 1JSRA 2ENWA 4K1XA 4AJOA 2QRVA 4O0LA 1T2VA 1WXXA 1OV4A 1P8AA 2OV6A 1HM5A 2J67A 1F8GA 4A8JB 1S3FA 2ABWA 2XRMA 1MAUA 3ZWVA 2QDXA 4UVEA 2P5UA 1KDZA 4BNMA 4C6TA 4K9MA 3W1WA 4Q0MA 5JDIC 3SXPA 1KL7A 2X0KA 2YHIA 1U2SA 3WLEA 1JR6A 4O08A 1E89A 2ASVA 1E3QA 4FXOA 3IJ5A 4LV6A 4BE4A 1IXYA 2BP7A 2RHDA 1GUFA 2GZ1A 2XDAA 4HDNB 3AP1A 2BMFA 4PLGA 2GAOA 2VFAA 2FR8A 4WCDA 3NJ8A 3N1UA 1ZI9A 3VNUA 1ORTA 4FWIB 4A8JA 5JJLA 5EXXA 3AH8A 3SVZA 3G6WA 3HEAA 3R5TA 4WIAA 3D5TA 2OSVA 4WHMA 1P45A 2EWVA 4K0KB 4P7KA 5EPOA 3GLUA 4HGRA 3EZNA 4HDNA 5CCBA 3A6LA 5B37A 2ZUEA 1E0JA 3A1SA 2KW5A 4FE7A 5FPTA 1VTKA 3UXHA 1DWUA 5JVDB 4EATA 3RTGA 1Q17A 4WY5A 3ESYA 1OFUX 2VT7A 1NVMB 3VFDA 2HREA 2QLJA 5IP5A 1IC6A 1PTJC 5E3JA 4WZAB 3NAMA 3E8MA 1OI7A 2J5RA 4LDQA 1RCFA 4YJGB 1GPMA 3M6LA 3CNBA 1NW9B 1FYDA 3W7VA 4TWZA 4YX9A 3V8VA 2D7DA 2FYTA 4MYCA 4Q03A 5JVDA 4WV3A 2AA3A 4ZVSA 3G2NA 3DAOA 1HKUA 3QMWA 2RI6A 3JVDA 2IH5A 1ODCA 3A2LA 3ZV7A 3UQYS 3CR8A 1G2PA 4H27A 3QWFA 4AMYA 3K9LA 4KW7A 3DR3A 4KEAA 5ERYA 4YJGA 1AN0A 1XU7A 1WM1A 2PYDA 3UBTA 4CM3A 2X8BA 2H7VA 2AG0A 4RKQA 4KITB 3AIOA 3NWOA 4G2NA 3BXFA 5C52B 5EIOA 3TQRA 2VJLA 1TYBE 2VF5X 2Q1TA 1I5EA 1MDBA 3GAMA 4HEQA 3QVLA 1HX7A 1K6MA 1I5RA 4RTSA 2MSEB 5HWSA 3ASYA 5AI9A 3E0QA 3FDIA 1O6ZA 1BHJA 2G6TA 2NLOA 2K5UA 1JDZA 2ZYAA 1EE2A 2YWXA 3PFCA 3NJ4A 4G07A 4N0PA 2QENA 4DUPA 2FJPA 1QE0A 1Y3FE 1DAFA 2XCOA 4YRCA 2BSXA 1JR3E 3A1EA 1WP4A 4ED9A 1BTOA 3S5JA 3GAFA 4F0JA 4G0NA 3TR0A 2HIGA 4G0QA 3DMFA 3MGCA 3DAYA 4F3TA 4GM0A 4EYKA 4I9GA 4PCAA 3UJ7A 3VKUA 2XQVA 3RCBA 1ZD2P 3FNGA 4BLRA 3W2TA 4DBZA 3ZVMA 3HMQA 1IEXA 2NMVA 3AVXA 3ELWA 4DCUA 3O84A 5AW7A 1G2QA 5JLAA 4TTAA 2CXRA 5D5HA 2HIHA 4JEHA 1U8TA 2DFVA 1PKEA 2QP9X 2G83A 4G09A 5JI2E 5A0TA 3IP7A 3RVQA 1U5AA 3KNZA 1Y5MA 4L27A 4E5NA 4AKSA 1Y9EA 2P9HA 4K26A 3UICA 1A95A 3V4PB 3TGLA 1Z5OA 2X1MA 4ENSA 2QQFA 3K3PA 1IZZA 3ZEAA 4N3GA 2HWWA 2JFUA 2BTQB 5JS8A 1XZLA 1ICEA 4AYWA 1SBCA 4LWZA 1TFRA 1XDDA 3FVVA 5AM5A 5B30A 2MOKA 4W1PA 2MHCA 3FE2A 3P71T 4ASUA 4W8OA 2Q5FA 4M6WB 4C2AA 2TECE 1JAZA 4E6EA 4OBBA 4KAXA 3V33A 1FRFS 1HSZA 2MSDB 2ZAOA 4MRNA 3STYA 1D4FA 1XDWA 2XWBF 3NVKI 2FWIA 2PRZA 4LXUA 2W90A 2YMPA 4RV4A 2WLTA 5DGIA 1KFBB 2BTQA 4X64B 5FPHA 4M0UA 1MJFA 2YYAA 3ICPA 1HBJA 4FQ7A 4NZZA 5CJ2A 3D1LA 5ENVA 5B64A 2X5KO 4M6WA 2IEYA 3F6EX 5E1MA 3CW9A 3KUCA 1FU7A 2ZROA 2JGLA 3HKCA 3KT6A 1GG9A 4IVQA 1YH3A 1THTA 3H3JA 5EWJA 4N8SA 4BNUA 1R0WA 2NXJA 4F3KA 2IKSA 1NZFA 3A1FA 3QHAA 4GXTA 3HNPA 4IHKA 1D0SA 5ILGA 4EI8A 3O7MA 5AESA 4DC0A 5JBIA 3WV5A 2F3UA 2O1WA 4Z9FA 3AJDA 3AQIA 5D51S 3DQPA 5HE8A 1MC8A 5LQKA 3TJMA 3LPDA 2YZ7A 4LHYA 3Q4GA 4BMNA 1UWCA 4CG3A 1NQWA 3O8OB 2EKQA 2CV1A 2ZI3A 1WPXA 5DZSA 1WVMA 3N8NA 1F2VA 3FDZA 4LYDA 1NDUA 1V5GA 2GPJA 3R09A 2P7HA 1JP7A 5GVSA 5J1SB 1KXJA 3L7AA 1RU3A 4B79A 1DCKA 3ICQB 4DNOA 4N7RA 4AQDA 1LPBB 4AK9A 5BR8B 3QXGA 3PPXA 1PZHA 4MW6A 3MCWA 2P6NA 4OQPA 4P32A 4UFNA 3DG9A 3E5NA 3O8OA 4XSGA 1S8OA 2Y1XA 4K6MA 2XUIA 2HH9A 3UHAA 4TLDA 5I51A 3TD6A 2BZGA 5FUQA 3KSZO 3DVQX 5K0LA 1P80A 1PGOA 1YC2A 3HEBA 4XJSA 3IUJA 1SIOA 1Z5ZA 2WSSD 3PXGA 5H80A 1N6HA 1GL3A 4KIJA 3U3JA 3ZLJA 3OHMA 4UBKA 3HFRA 3WL7A 3S1SA 2BONA 2ZEJA 3MTAA 3OURA 4BEBA 4PW0A 2J41A 2GD6A 4GMHA 3CZAA 3CUTA 4M1OA 1H6CA 1H5UA 1L5WA 2VDOB 1I3MA 4PRLA 3Q87B 3ZE0B 5ALOA 3ZS8A 4C87A 4KU4A 5AK3A 3IHWA 4TXJA 3ZWQA 1G17A 4UKDA 1YL5A 3RC8A 2W11A 1FL9A 4CL2A 4MPTA 1H42A 2WIJA 2QM0A 3K94A 1UZAA 5DSTA 2H08A 1AB6A 2WU3A 3VO1A 4QYXA 4RZUA 1ILEA 4HB0A 2COUA 3PEUA 4YAKA 1ORRA 2AC7A 2RHCA 4YALA 2X0IA 1JH9A 1IHPA 2C1XA 2OECA 2O0HA 2XHZA 4PSDA 2D1QA 4G4JA 3E22B 2IV3A 1DKRA 1KYYA 2GEJA 4LGVA 3THRA 1MF7A 3QA3E 1NDHA 3PLNA 2CZCA 5IT4A 4XAQA 1F2DA 5K4AA 3WLRA 3HL4A 3OF3A 1JZSA 2WUGA 5LXTA 1GRQA 3N07A 4JU8A 3Q1KA 4FX5A 4TYMA 1W30A 5KNCD 1GTMA 4MRRA 3WYBA 2IS1A 4OYHA 2VPIA 5JAOA 3DTTA 2IBSA 3D8NA 3F3YA 6PFKA 1GTVA 1NWHA 4U6SA 1IHDA 1QVWA 4PYLA 5JT1A 3E22A 3X2EA 4FHEA 2VSQA 4F8YA 1BYIA 1BEEA 1MUUA 1GVNB 1N2XA 2G6BA 3O3MB 5IAOA 1IIBA 5DWVA 1Y63A 1NQXA 3E9YA 1R64A 1OXXK 5COQA 4QNMA 2QTMA 6Q21A 2GN4A 3L9XA 3CLTC 2CUNA 1M8JA 1J90A 3HFGA 1VM6A 2VHUA 3FUTA 2VLBA 4JJZA 5CVUA 5BN1A 1DG3A 1W85A 3CSDA 4IIXA 4XTRA 1SXPA 4JVMA 1PP4A 4QECA 1NUSA 2QRGA 3ZTWA 1CP2A 5J43A 3L6DA 1K08A 4MS1A 2H0QA 4F8JA 1IWOA 2PR7A 2H17A 4NDZA 2K7FA 1C7QA 1HORA 1RAGA 3KKPA 4OFWA 2Q45A 1NUAA 1I2CA 1YBMA 3FZQA 4KWEA 4KQCA 3A05A 2XQKA 4LBZA 3E48A 4AL4A 4B81A 4Z7QB 1M2EA 5K05A 3U16A 4KXUA 2EKBA 3C5EA 4EB0A 1KBQA 3GFBA 3UYKA 3CZMA 1FQOA 1TQ6A 2P4HX 4P4GA 5T8KA 1F51E 1ZHOA 4OLBA 2Z04A 1N3YA 3U13A 4MV5A 3IR6A 1V5WA 2ZUFA 3O8QA 3OQ6A 1MU0A 3D7KA 4X3OA 1Y8CA 4R7GA 5H16A 5HQTA 1WETA 3CMCO 3O9VA 3DDSA 3IVGA 3KV3O 4FGKA 2ECKA 3PC4A 2PCJA 1YB2A 3H17A 1DGQA 3GLFB 5IPFA 4INJA 4QDTA 4EEKA 1C3OB 3BJZA 3EA5A 2I6FA 1P5JA 1TLFA 2GF0A 3BK1A 3HUTA 5ALKA 2QD5A 4RDXA 1CNEA 4HH3C 1HEUA 1MW8X 4HX5A 4Q9NA 4YO8A 4J76A 3U7QA 3QUCA 1MQSA 2YXLA 3DZHA 3GGJA 1CF2O 2GBLA 4RV9A 2JIMA 4TGLA 5G0VA 4D8UA 1ITZA 4N5MA 1DQRA 3ZDBA 1I9CA 5L3QB 4OXQA 1XD2B 1QBGA 4G86A 3HN7A 3DZGA 4WZZA 5FWYB 3AKZA 3GLFA 4NZOA 3EX7C 1GQRA 1C3OA 2FX3A 2PL9A 4GBJA 2WJGA 2I0FA 2JD0A 2XDYA 3EOBI 4IHJB 3O2QB 3DJFA 2HR1A 2XQFA 4RF3A 2ZANA 3M5PA 1T5BA 1E7QA 2R6R1 4DLUA 1ZXXA 2ZSUA 4TRMA 1TD1A 1D2HA 1RJGA 1XD2A 4N3NA 1BFDA 1RZ3A 2CLOB 2GAJA 2HGSA 1RKBA 3KD3A 3Q40A 1ISRA 5E3IA 5B3JC 5FWYA 2ORYA 3R2JA 3WL8A 4N48A 1V7QA 4UVGA 2X5NA 4G0UA 2VBGA 4K0RA 4K87A 4Y18A 3WRVA 1RCTE 4OYRA 1I7DA 3CPHA 3D4PA 4CRWB 4IHJA 4OHOA 4D9NA 1SHJA 4D8TA 1A69A 2WQZA 3UPUA 4XM2A 5C8YF 1BD3A 1OU0A 4I5EA 4HXFB 3A06A 2BELA 2Z83A 3B89A 3ZGOA 1N5JA 4JI0B 4K9LA 4URZR 3WWCA 2I8AA 1C4XA 3CH4B 4ZMSA 4HLQB 5MN6A 2K4MA 1K6IA 2NXWA 3UJPA 1CY1A 1G8PA 3I2KA 3P4UA 1U4OA 4QBGB 4B3RB 1QIHA 4DWVA 5IKEA 3P9QA 3VH3A 2OILA 4ZEWA 1R4NB 1ZD5A 4MVJD 3NHKA 3WHKA 2CCKA 2IEZA 2DUUA 3A28A 2A9OA 4UE6A 3WWPA 2ZAYA 2NSHA 4XUEA 4ZYVA 4W5TA 2JLAA 1I2DA 1DOAA 2P77A 3H11B 4IIHA 3U39A 2V54A 2UV8A 1Z9BA 4QUKA 3X1ZA 1LGYA 1YR3A 3SVLA 1B6TA 1RFGE 3EVCA 3MBKA 1KO8A 3QFFA 2E87A 4RY0A 4BHTA 3AX6A 3P2MA 3QE3A 3QBDA 4MUIA 3ZCRA 4EW6A 1P2DA 1R4NA 3MT9A 3RKRA 3OFNA 1A8UA 1GRRA 2ZSIA 4D56A 2JH3A 3LWZA 1CT9A 2BI7A 3ZXUB 5HKAA 4Y6GB 3TSCA 1ZR4A 5DIZA 4LVOA 5CYPA 3E81A 3Q5DA 1U11A 3Q3HA 3KFLA 3H6KA 5AVVA 2WR8A 1CTQA 4INOA 3ZX5A 3B1WA 3D5QA 4BQRA 1NIPA 1L1EA 1PVDA 1WEKA 1N2EA 1GUDA 1K7EB 3P9YA 1ECLA 1M7HA 1NUHA 1RKXA 2FR0A 2ZT6A 3DVLA 3GX1A 4BNGA 3NGXA 4Y2GA 1R4MB 2JGKA 3BBLA 1PGQA 1SUDA 1E7WA 2BGTA 3MPOA 1NBAA 3H1GA 2ZIZA 2YS7A 4OXIA 5AT1A 2H2HA 2WSYB 2E49A 5KAMA 3PYXA 2RAUA 2ZSEA 4AZWA 1JALA 4W8GA 2FOXA 1BWPA 3DZFA 5ARDA 1CC1S 3ABOB 5CA0A 1SCBA 2ZW9A 1BRTA 1M1XB 5IZCC 4HEA1 2EV9A 4ADSG 1MH9A 3T99A 1R4MA 1T2UA 4RIGA 5J47A 3ZWWA 1XNQB 1J97A 2PQ6A 5HDBB 5EQJB 4I1OA 1L5NA 1YJ5A 5L3RA 3UJ8A 5ER6A 1N1EA 2PJZA 3O47A 4YUZA 3IO5A 3OKFA 2I2CA 2HHLA 1ZCAA 3BXXA 1MD9A 3OETA 4P4SB 2P8JA 4CMBA 3HY4A 4IH1A 4GHWA 1OAKA 3OM1A 4DXDA 3OQPA 1T5IA 3E9ZA 3VDXA 2CBXA 5FBLB 5J40A 5AJVB 3T8YA 1U2PA 4EH1A 4ZKEA 4BASA 1MFZA 1JXQA 2I6XA 2JI8A 4FDTA 4MITA 2PK3A 1E7YA 2UYQA 4MVWA 1TAHA 2JJ1A 1JLLB 1B7GO 4M53A 3WIDA 2R0QC 3IV9A 1EXNA 1JHYA 2ECPA 2PS9A 4LE0A 3SS9X 1KS2A 1DIGA 3TX6A 1ACMA 4EJSB 5LJIA 3MRTA 4P4SA 2F1OA 1MA0A 1MEEA 1T3LA 2HQOA 3KPYA 2JATA 3M6VA 4H08A 1OFUA 4KJZA 4FZ5A 4PAMA 1XLTA 5CB6A 3P52A 4OI2A 4R1MA 2GPTA 5ALDA 4XCXA 3W34A 5IN4A 1X86B 3TM5A 4M87A 4M8IA 4RS4A 1SBQA 1JLLA 1VFNA 3W79A 5JH7B 4EJSA 2H4YA 3AETA 1JLSA 5AHWA 5E9WA 4RULA 2P9TA 3U81A 4NCAA 1P3Y1 3RREA 3S1LA 1A8HA 3GCGA 4KXMA 2YVLA 4WPGA 5IAEA 1N7GA 1W8DA 1MVNA 2PT5A 3ELDA 4PCLA 1E96A 3SS7X 2XZDA 1EDDA 4WRRA 2QI9F 1B3BA 4LVUA 1XEWX 2PTHA 3EA0A 3JTEA 4G36A 4L8YA 4QUIA 2IW3A 1Z7GA 1CZOA 2YICA 5JH7A 4ITRC 2VCYA 2QTVB 3ZCPA 4ZQFA 3TS1A 3HCOA 1RQ7A 2Q28A 3L43A 2EZ9A 4A7PA 1P4JA 3DS8A 3EEYA 3M3PA 5HGXA 2VUSA 1DKMA 3ZTYA 3CSUA 2IEIA 1F48A 1GXSB 1NBME 4AROA 5JWRA 3AL0C 2WY2D 2PAAA 1FXWA 3EGDB 1M72A 3OD1A 5I4KA 3VPDA 1F1BA 5MN5A 2O8FA 4DIOA 3DFKA 5FA5A 1EWYA 1ADFA 4JASB 4Z4EA 1UMKA 3ZD6A 4C4RA 3U3XA 2DJ5A 5EWMB 4NV1A 4P31A 2ZRBA 4Z7NB 1A9RA 3FCSB 3ER9A 1EJ0A 2PSDA 4XUGB 2PWZA 1X0VA 1Z6TA 4AZ0A 3KU1A 5NULA 4UQLA 5E6SB 3ZOZA 1OU4A 2PRJA 1SZCA 4B82A 4P5DA 4NYIQ 3OA0A 3AFMA 4R2JA 2ZJ2A 1B4DA 4S0ZA 4KIFA 2M6KA 1PFKA 2PYZA 2R1ZA 3WAGA 1BDIA 4WA8A 2FPIB 6AT1A 2FH5B 5EWMA 2ZIVB 1AGYA 1KI4A 2N75A 2LDBA 3FPLA 1F5SA 1MA3A 2R5FA 3C3PA 2EZTA 4GP9A 4KVGA 4J9VA 5U4XA 2FG5A 3CEHA 3HVHA 4DLBA 5E6SA 3K16A 1A9PA 1T5OA 4HAYA 4QGFA 3TOVA 3K15A 5DGXA 5KPDA 1Q7RA 1PEKE 2PZJA 1JPVA 3LHKA 4I5FA 5DYGA 4HDRB 3A4MA 4G85A 1HO3A 3CB4A 3OU7A 4O8CA 5B1YA 5K3EA 3F2IA 4LHXA 3OTOB 1D1SA 1R0YA 1N0VC 1USWA 2CBZA 2FN9A 3I2GA 4UCFA 3IBYA 2BM1A 2V8OA 2FPIA 2QRLA 2X14A 3PWZA 5I9TA 4KNVA 3AV0B 3RC9A 1SNYA 2FUKA 2H6EA 2I33A 2R00A 3C1AA 3I4FA 4GPD1 4NBLA 4Q00A 5KYNA 3DLIA 1CQWA 3VTZA 1AQYA 1O94C 1P0MA 5AM3A 4WKNA 3RS8A 2VZEA 2WD7B 1LCIA 3C1OA 3PXUA 4NOMA 3LU1A 1KR5A 2DWUA 2HNAA 5BUSA 3T3PB 4HDRA 3A4NA 1FJHA 2IE0A 4M2LA 3AK4A 1Z8FA 2QNIA 4UHHA 3FZGA 1GG5A 4MW5A 4Q9KA 1J5XA 4PAQA 5A1TA 4R2WA 2QVLA 3ZYZA 1XIVA 3RRYA 1K3FA 3S2GA 5L3ZA 3H6GA 3BEOA 3HUDA 1USVA 1KKMA 1O03A 4PLPA 3V55A 5DM70 4OGFA 3KUDA 2O4CA 4U9UA 3N39C 2ZJ4A 4E5UA 1QFJA 2WD7A 3O4JA 4FDAA 3OFKA 4RFSB 2Z9CA 3V7YA 4B32A 3O26A 5ITZA 4RZHA 5TEVA 4KXQA 3ZH9B 3SC4A 3WWEA 1J2TA 5DIFA 1FPMA 5FI0B 3EZ2A 4QBIA 4OHKA 2QE7A 1I3KA 3KB6A 3LOUA 1CUGA 2W2LD 3ZWXA 2G04A 3K4HA 3FA2A 1XB2A 3DLCA 3VZRA 4TLAA 5BOSB 4B6PA 4YB8A 1GV1A 2IOHA 3NFRA 1VJ1A 3RROA 3P4XA 1TO1E 4G1VA 4RFSA 5YASA 4ME6A 4OX9B 2JLWA 3A6PC 2J59A 4CIDA 2FX2A 1HQCA 4EGSA 1FFSA 2BC9A 2O50A 2Y67A 1W5SA 1YUMA 1GN8A 1Q44A 5LB2A 2IU4A 4XIYA 1L5LA 1SOAA 4YNBA 1CCWA 5FF9A 2VBIA 2DF8A 5BOSA 5K3CA 4PLHA 1PEDA 1U7PA 3M70A 2BEWB 3WQQA 5JWHA 1Z7EA 2ODPA 1DRVA 3ENZA 1U2EA 1Q0RA 4MMYB 3G0BA 1UBCA 5FOXA 4RPCA 1S3SA 3BL6A 4MR8B 4O2RA 1AGRA 1M8GA 1LVHA 3TMAA 2Q5JA 1H1TA 3A14A 1E2DA 1RTKA 4FYWA 3M34A 1E2JA 5CMLA 4K9DA 1LWNA 4ARVA 3CG4A 2ESRA 4YDQA 1N2IA 5AW2A 4WA7A 1ZG3A 2VJCA 3DMPA 1TIBA 1Z47A 1I8TA 2BCJQ 2DTDA 3DZBA 4EO7A 2TMDA 3CLRD 4XOIA 2JLYA 1SMKA 4IVRA 5DOVA 5EJ4A 5ECYA 4JBXA 4NJMB 1ZD8A 2PKEA 4HMPA 1JPUA 3EZ9A 1M2OB 1FS4A 2CE7A 1E2KA 2WIBA 4OMUA 3N0RA 4MR8A 2EOAA 4TWIA 3IV7A 5HPYB 3S44A 2AUMA 1D1TA 3DCNA 3IPYA 3LVFO 3ZKAA 4KZKA 1QNLA 1P2FA 2BM8A 1QCZA 2ZJFA 1M2VB 4MS3B 3RGGA 5DK4A 1JTVA 4L74A 5H68A 4K6OA 4E5PA 1NNSA 5EGSA 2ZATA 1TNDA 2J09A 1E9CA 1EP1B 2Q62A 3I53A 3KJXA 2OLKA 4GOMD 1IAVA 2WF8A 4KO1S 3NBZC 4NJMA 5BQFA 3HZOA 1QZZA 2SICE 3BSYA 5FUXA 1OD6A 4TRNA 3S7TA 4EP1A 1VIYA 3IOEA 2C5SA 2GYVA 4OHBA 3GFFA 1E1QD 3LA8A 3M7IA 3QRWA 4AIIA 2JLRA 4DNFA 3TAXA 3SQNA 3ZUGA 5KYKA 1ZCFA 1ZUNA 2IEBA 3G23A 4P3KA 4NXMB 3DZCA 4MS3A 1M2VA 3GJ7A 1DBIA 5EHXA 1YGYA 2GDZA 2I3BA 2OV2A 4QJ4A 2VYND 2QJWA 1SVSA 2QTHA 3B20A 2JLCA 5JD4A 3PTAA 2H5IA 3RARA 4BPBA 3T06B 3N58A 4IF4A 2CDCA 3TVTA 3B7GA 1A9OA 1Q11A 3C6QA 2XOKA 4DDUA 1PV2A 1QHFA 3O90A 3E1KA 3AM4A 1KE1A 1COWA 4EHLA 2PFGA 4QKQA 3BE8A 3K9GA 4JP3A 4LXTA 5FUMA 1BD4A 4OJNA 4OK6A 4EB3A 4UM9D 1I3CA 2YY5A 3CHYA 2CFRA 3HWX1 1YQTA 4FQ5A 3MQFA 3GU3A 4CHGA 3IAEA 3TLCA 1YHYA 2PX6A 1GKUB 3L3BA 4M8NE 4X1YB 2FEOA 1GZ6A 5IARA 4LZNA 3SX4A 1H0RA 3OH8A 1X94A 1YKSA 3N2KA 3I28A 4ZT5A 5JS1A 1P9LA 3UATA 3S5UA 4RAQA 2EP5A 1Q19A 4S1NA 2OFFA 4WL0A 5B4VA 3N8HA 3V2IA 1N32B 3C15C 3G79A 3IQIX 2YX1A 2FW9A 3GOQA 1TXGA 2V7PA 3CRVA 1SXQA 3D6TB 3TW0A 1CUSA 4I6EA 3LBHA 4X1YA 3OWXA 1Z22A 3ANXA 1MTZA 1Z83A 2OB1A 1B26A 2AFHA 1O08A 2IIVA 5IKPA 3M6MD 2VNAA 1NVWQ 4IMPA 4G5OA 1QCYA 2VZLA 1JRLA 2VYFA 3QE4A 5EJMA 1T6ZA 1GDTA 3EBPA 2YMLA 3O21A 5JUWA 3H5OA 4D3XA 4RD1A 3DEFA 3JD2A 4HKTA 5JE8A 4IKPA 2XKKA 3LQRA 2X6TA 2AI3A 1UJCA 4J29A 3PDHA 4G89A 3ZY3A 3U48A 3Q88A 3J81k 3OMWA 3B3FA 2EFYA 1KEPA 4FP9A 4HXEB 4CEHB 3CIFA 2OBYA 3MOGA 1OXUA 4OK5A 4EQ6B 3PV0A 2ZAIA 5AWFC 3RJ5A 1C4KA 2EJBA 3HVUA 3T38A 3KP1A 3QPDA 3E03A 3T5CA 1XRNA 5EUBA 4OHCA 2EX1A 1PR6A 1KC3A 2HCTA 3CINA 3KQPA 3ZDQA 4DQUA 3T3OA 2JGEA 1EWKA 3R7WB 3VR6D 1WPRA 2OZPA 3SYKA 2O5EA 4CEHA 1ZVMA 5DLDA 3C3MA 4IRMA 3TECE 1QE5A 4ZK2A 2WW8A 5LUAA 3S8MA 4RD3A 3DA8A 3LX6A 2FPRA 3PFFA 1HT0A 3AR3A 1SVIA 3K8OE 3ER6A 2HPHA 3FKQA 5K51A 3RHZA 2BE7A 4P34A 1TA0A 5IEJA 1S2GA 4MHSA 1EHIA 3BMCB 5AO9A 2ZUSA 1DELA 4Z8YA 3DCJA 3ZOKA 1N8NA 1OV6A 1XFDA 3BDVA 3R7WA 4XIIA 4YR9A 3UGJA 4GBED 4RYLA 5AUOB 3EGEA 1SVKA 4H0CA 2M2IA 2A9PA 1SB8A 2DAPA 2BL4A 3NM5A 4YUWA 4AMGA 2ONYA 1BWQA 4BUCA 2GZMA 1VE6A 2LGJA 4FGWA 3H1BA 1T0UA 4DJTA 4YV7A 1MDFA 1JKXA 3S27A 2OFPA 5SZIA 5H9WA 4KLCA 4BEVA 2O7VA 2N42A 1RJ9B 1QK4A 3VHRA 4B31A 2XJ4A 4Q3OA 1BS2A 1P4HA 2PUBA 3M1IA 5CD9A 4P80A 1IIRA 4W63A 4FMDB 1L4GA 5DP1A 1E3MA 1OXVA 3G2MA 2JAWA 2B1IA 2QRUA 3HHPA 2PY6A 2JLUA 2IHZA 2QM7A 3TW8B 3DE0X 5A4MS 2L69A 4TVOA 2ZBFA 3WGLA 3TVYA 1JSXA 4KVZA 4MQMA 2J0QA 3SX2A 1QGDA 1RJ9A 4CLXA 1Q7CA 4FMCB 5FEMA 3LV8A 1ENOA 2OHXA 2BFPA 2Z0MA 3D3KA 1W4CA 3HYTA 1ZKDA 3D7NA 1WUIS 3JASB 3M82A 3MG9A 1GPH1 2JCSA 3R20A 4QPDA 4WADA 2BLNA 5FTNA 1DFIA 4J7AA 2CJXA 3T1HB 4G25A 2I71A 1CZNA 3V7WA 2XTMA 4GWLA 4DXAA 1FFXB 4AX4A 4ZAXA 4BXOB 2D8AA 2BGUA 1RLMA 3G89A 4G56A 3WC4A 3HLYA 2UUAB 1M2HA 3IUBA 2GSWA 1XXHE 2FRXA 3HBFA 3M5WA 4FCTA 3ZY4A 1R0ZA 2PH1A 3JASA 3SEFA 3GHYA 1HRDA 2QTWB 1U94A 3N3AC 5CTJA 3PNYA 4DIFA 2PXHA 3PRYA 4XQ0A 4P92A 1OVGA 4EYQA 5HUJA 1Q74A 4FFLA 2G0AA 2R1UA 3LRTA 4W5WA 2GPSA 1N5RA 3MC1A 1FFXA 4RGYA 5D2CA 3FTEA 1F2TB 4BXOA 3WNBA 1WHSB 2QTBA 4HS9A 4PX2A 2QVBA 1PR2A 3FMIA 5EP2A 3W6UA 3AJEA 1GAQA 4AJIA 1GYRA 3H5WA 4JJAA 4YAOA 2IYUA 2CGEA 2GYUA 4NP6A 3P2IA 5AVZA 3HLKA 2B0JA 4IMRA 3KT0A 4B4UA 2H57A 3HDHA 4D9BA 2NTNA 3BIXA 5K09A 2IY8A 4R2XA 1CUCA 2JIDA 1CVIA 1GR1A 1RXIA 2E7ZA 3KEQA 5BUZA 4ZYYA 4CL3A 1DL5A 2QAJA 1FP6A 2DWCA 2XGJA 3H86A 4F5YA 5LSAA 2ZS7A 1F2TA 1QUFA 3IPRA 3WY9A 3M81A 1WHSA 3CR7A 2QG9A 1PSZA 1OKKD 2CXPA 3DLPX 3I64A 3P2EA 4GSKA 4RGQA 4XDHA 1A9SA 2QTFA 3P0FA 4D1YA 1KI9A 2DWOA 3G2OA 3H0KA 3MJDA 1PEAA 2AN3A 2LIPA 1V3VA 3LMKA 4AJHA 1V96A 3IP9A 4M9RA 2DQ4A 4XB2A 1A9XB 5LYJF 3GPLA 3ZCSA 4O4LB 2OWEA 3PHGA 1TB4A 3PTZA 1JR3D 4RMIA 5JPIA 5BSTA 4CTKA 4DDHA 1HNXB 2FK7A 1J8QA 3T1OA 1KZ4A 1YB1A 3F1KA 2DCUA 3EIEA 4JJFA 3N2LA 2PD3A 4EJ0A 2C7QA 1QF6A 3B7PA 4H7JA 2V6IA 3LGSA 4DR3B 4OLAA 3J7TA 3ND6A 4P93A 5ITSA 4EHJA 3FCEA 3KZVA 3FYDA 4UAUA 5CLJA 2GM3A 4XFJA 3QUQA 3MJTA 4YV0A 3IX7A 1A9XA 4GBMA 3AT1A 1B8VA 3R0VA 4DLVA 4O4LA 4YGYA 1FFAA 1KVSA 5SYNA 3RIHA 3TH5A 1BE0A 4TMVA 2HEGA 1P6UA 2NIPA 2CJYA 5AW1A 1LV7A 2OEPA 4BAZA 4X7MA 4LVCA 4R9UC 3K9WA 2X58A 3NC4A 1RWPA 1ZMOA 2PH3A 3JY6A 3KX2A 2C5GA 3BXHA 4H7FA 4R0VA 5FI5A 5A4FS 2QMUA 3KU4A 4DDWA 3V4ZA 2Q5HA 3LGAA 1TAGA 3GBPA 1E5VA 3LK6A 4ZZ0A 1RPZA 2Y1WA 1RM0A 1AD2A 1TI7A 5L3SA 3FWNA 2O07A 2WMOB 3HBAA 3KBBA 3RSQA 4Z51A 3P9KA 3A6EA 1CF9A 4CL8A 3X1KA 2M9MA 4YK7A 3MD9A 4E2FA 2FQQA 4J75A 3ZUPA 1UKVY 3PZBA 4JU9A 2JFXA 3DHNA 1JU3A 1OCEA 1PR4A 2QD3A 2RJ3A 1XMIA 2V5UA 4LHSA 3ZY2A 3KJQA 1C81A 4R68A 4BGUA 4HV4A 1KI1A 1W94A 4C0HA 1NQTA 4IFBA 2IIBA 5EZYB 2OORA 4DMKA 4S05A 4ZRNA 1W47A 5CW1A 1B3RA 1LI7A 3LCMA 1LRKA 5EJEA 4ZOLB 3SN6A 3DDZX 2AMFA 3H5TA 4YP7A 3FCUB 2WM2A 3TE6A 2M6SA 4MR9B 3UT5B 3WOHA 2VOJA 4B48A 1DT3A 4DTIA 1XEFA 3P5BA 4GOXA 3DE4X 3KCQA 5AHRA 1XNHA 3TXYA 3W3ZB 2GCPA 1I4TD 5CH8A 2OZKA 3TIIA 1XRRA 2GEKA 3M6XA 4KNYA 4NX2A 5EZYA 3AY3A 4Z99A 4X90A 4GFDA 3KR0A 3SIPA 2I99A 2VA9A 2JGIA 121PA 1T0BA 1ZNWA 4ZOLA 2BRUC 2JVIA 2W6JA 3QIAA 4GQAA 5BWBA 3UXYA 4MR9A 3UT5A 2CFTA 2ZVDA 1DEOA 1GUAA 1HLFA 1UFKA 1ZK4A 2RAPA 3HJGA 4KBFA 4CLDA 4EY8A 1O3YA 4NF2A 2HIAA 2RGNA 5M3BA 3AKDA 2XCUA 3R76A 2V45A 1YUNA 2ZJAA 2A1UB 1C9MA 4MUEA 3SM9A 1L1RA 4ND1A 3QLUC 4YN3A 3EG9B 3PLAE 1L8LA 2BBTA 2XT6A 3LXRA 4NFLA 3OCVA 1VZ3A 4IW3B 1PD0A 3V4VB 1X19A 5ED0A 2WD9A 3HJFA 2NU9B 4D9GA 4V0LA 5K0NA 1U1DA 3JQPA 4ND2A 1JHAA 4QUEA 5I7WA 4YHBA 4HWTA 4ROSA 2ZTMA 3LHDA 3NWEA 4RJJA 4WY2A 5A62A 2A1UA 3AP3A 3O9ZA 3PENA 4HAIA 2W6ID 5HFNA 1Q3KA 1E7MA 2P78A 3EG9A 4BP3A 4D4LA 4X45A 3HCDA 3FUVA 2D4AA 3MWDB 1A7UA 1E0AA 1NBMA 2ZKIA 4R9VA 2NU9A 3DNPA 4X41A 5JD6A 2XMCA 5F3WB 2V0NA 2PUEA 3NVMB 4HNAA 4O2AB 4AUEA 2PIDA 3CN7A 3DKIA 1KE2A 1FU4A 2UDPA 4ARCA 4HI0E 5FX2A 1QRTA 3MCUA 3QVGB 1BJTA 4DCVA 3U1TA 1PS9A 3Q98A 3GT4A 2OTCA 2JCYA 1MO2A 4OB6A 1IAQA 3LF1A 3MWDA 3TXAA 3VOBA 2ZPTX 4JXZA 2OCKA 2GMWA 2IXGA 2VEDA 1ZVJA 2AYZA 1LW7A 2E82A 3GVPA 5DNCA 4DNPA 3Q7QA 4MYRA 2C82A 2PT7A 1XHLA 1GNRA 2VBFA 2ZRLA 4OXNA 1GU1A 2XD9A 4W8HA 4YFYA 4F97A 4FJ0A 2W43A 3KIPA 3UF0A 3QVGA 1ZLYA 2AKYA 1CFZA 1WLYA 1E6EA 1SG0A 1C8BA 4YRLA 2X2OA 2ONCA 3TDMA 2AQKA 3TUJC 3Q0IA 1PR1A 3K0HA 2Y1CA 4BFUA 3GRCA 5T4EA 1U2TA 5KDOA 1CIPA 1EUCB 1E1YA 4ZHSA 2QVYX 2PR2A 2OXEA 2JBAA 2CT8A 1BO6A 3RSLA 1HYQA 2WJ4A 1PZMA 3DMHA 1E2BA 3V8BA 2W4QA 3GVHA 5ALQA 5H70A 1VP9A 3N6RA 3QLVA 4DHEA 3RS7A 1B73A 1ZITA 2QX6A 1ECPA 2CXSA 3EC1A 4BMCA 4CCWA 4H6XA 4AYXA 3T4XA 4HWRA 1U02A 3U4DA 5EGNA 3ZCTA 4KQ6A 7GPBA 3KELA 3F7MA 1EUCA 1KEEB 2O06A 1P17A 1JQ5A 5JRDS 3GZNB 2I2XB 3G02A 3VDRA 1IG3A 1MJGA 2VDWA 1UWVA 4QU5A 5I8ZA 2OGUA 4CQMB 5HIAA 3FHTA 3EXEB 3JZMA 1DSSG 5J5VA 1C5KA 4RNCA 4IOLA 1RYYA 1AU9A 4HAOA 5CTAA 3GLIE 2WNHA 1JLRA 5FFMA 1RM3A 1T4DA 1HYEA 3ROTA 2Z8ZA 3BVPA 4EMSA 2WKWA 3T34A 4HB2A 2VXCA 3FRIA 2FEWB 2IYWA 4EKGA 5LBTA 1KEEA 1EHCA 3ZLVA 2JKYA 4IJWA 5FBWB 3IOMA 1AXGA 4ZYWA 1U04A 3GZNA 5BN5B 3R7SA 4CQMA 4GPIB 2XNDD 4LYYA 2JA1A 3N87A 2EQBA 1U2RA 3AUSA 3EXEA 4HAVA 3ZI7A 3ENNA 3FD8A 1CVLA 1U80A 2IRWA 4ZXFA 5CM2Z 1V8BA 2J5QA 2C9OA 2B9VA 3DE1X 2V7TA 5EVCA 3D3NA 4BO9A 4X97A 5I5GA 3N2GA 2GHQA 2JC3A 3NTUA 5DWQA 5JSZB 2GZ2A 2JLZA 2R7AA 5CB0A 4UJ3A 2C1EA 4A92A 2P4QA 4YRZA 3DAFA 2Q9UA 4FE3A 2R1TB 4JB0A 5BN5A 4HQOA 1VLZA 1DAGA 2O6LA 3D6AA 3ZXSA 4L07A 2OHGA 2GNPA 3TNLA 1XVVA 3MWYW 1HLPA 1XJWA 4F5WA 1JI3A 4JYZA 2QIOA 1XJ5A 2Y9MB 2HV8A 2JCXA 4GYWA 4LX0A 5HIMA 3QVTA 4FS3A 5I3CA 3U7FB 4KR3A 3C3DA 1CR1A 2ERCA 3TTXA 5JSZA 3LBAA 2O9JA 3B1XA 4X1IB 1KTIA 1ONOA 2NQTA 3R8XA 1P8JA 4PF1A 3DHWC 3A9RA 4PIVA 1GPYA 1T9GR 1XCPA 3HJHA 2ZB7A 4XDYA 5CM9C 3OZSA 4ZAZA 3UA4A 1QRAA 3ZWDA 2IY9A 5G1OA 1CUVA 5EJ8A 2QAIA 4DN6A 2YMMA 4N6NA 2XNSA 4JI5B 1B16A 3EMBA 1W36D 1VKJA 2JK0A 4ZOAA 1TMOA 4KSBA 4OQFA 4RTKA 2IKQA 3L01A 3W8NA 1OSNA 5JAQA 3GXBA 2RI1A 4X1IA 4KI7A 3B1KA 2NSYA 2EL9A 5F1KA 5FHQA 2JRCA 4BNIA 2GK3A 4KXVA 4M8KA 4KMRA 1YDFA 1O5OA 2PZMA 3QEOA 3QBVA 4R51A 1N33B 1EFTA 5GIOE 4MVJF 1JTFA 2I80A 2E1PA 1D04A 1KZ9A 3A1VA 1U5CA 4MGEA 3WYFA 5BNWA 1D9XA 1NLFA 3CT6A 1ZJ6A 2WMYA 5G0SA 3SZRA 3OAAA 2EGHA 5ALNA 1AMOA 4N65A 5ELLA 4DLWA 2Y1LA 3DB2A 2O8BB 1G5IA 1GPKA 4M22A 5A9TA 4ABYA 5IK2D 1MQ8B 4AUNA 4XQ9A 2QD1A 4NWIA 3CRRA 1YULA 3UUEA 5LZ5A 5BQXA 4YP1A 4DDMA 1UC5B 5KCMA 4FBGA 1YACA 1A8QA 1T3GA 3KQLA 3RWBA 3OO0A 4MINA 1OIXA 4JVOA 3E2MA 4UNNA 4D7AA 1XRLA 5C7LO 1S02A 2ZR9A 2ORED 1C1HA 1DFGA 2GHTA 3ET4A 3BRCA 2XEXA 4IJKA 4LZWA 4Z7JA 3AMVA 3DXFA 1SKQA 2I91A 2WT8A 2O8BA 4MRVA 2NM0A 3FCOA 5DI3B 1KAMA 3WWOA 1K6XA 4J7CA 4H1WA 2XV1A 2JHGA 2W83A 3NS7A 1G16A 4RACA 1RWBA 4LRXA 4QBKA 1JUDA 2WYHA 2DERA 3SEZA 1NRXA 3FIJA 4C2BA 3PKZA 3RK1A 3TQIA 3AEXA 3PQDA 3FNFA 4CDRA 5JPCA 5MN4A 2SNIE 3ZXXA 1UPBA 2YDXA 4GDFA 1TO6A 3D3JA 1TW2A 3F3KA 2I7CA 2XNHA 4Z1OA 3Q15C 1YCFA 3VPGA 3KHUA 5DI3A 3W8RA 4KXFB 3FYHA 3PPYA 3OU6A 5H3LA 4BAGA 5A5FA 5AVYA 4DLSA 4EZEA 1N9GB 4RHFA 5AM2A 3SYLA 3RTBA 2ZTSA 3KSMA 4KXLA 4ENRA 3HZHA 3B2QA 3KOWA 4H60A 1TU3A 2QZJA 3NHUA 1OYOA 2O14A 2YXBA 3FCAA 1H69A 1P0CA 1T1EA 3RFTA 5LR6A 1N2OA 1E8MA 3MGKA 1ENZA 4EMTA 4PCUA 3ZCXA 3X0DA 1AMUA 1FPQA 1SFRA 4EG8A 1CQJB 1Z4IA 1DKOA 1VL0A 2YN2A 1NKVA 3AUKA 4I46A 4WCVA 5FBRB 5K3DA 3DLBA 2FLVA 2XCLA 4LOIA 4D57A 1ECFA 4J2TA 5FTLA 2VP2A 2OUKA 1L4NA 2GFHA 2QXTA 4EJMA 3B9QA 3WXBA 2ZYWX 1T2NA 2EXXA 1MV5A 3ROMA 1KS9A 1NMQA 1XAIA 3LF2A 4KAJA 4MGKR 4RO0A 3R3JA 1QG4A 1L5YA 2LP4Y 3W9BA 3IT0A 4F46A 5FYDA 1L5RA 1CQJA 1ZD4A 1JU4A 2BM9A 4L0MA 4ZO6A 3SQDA 4AZVA 4B71A 1TO2E 4EBFA 1HDEA 2ILTA 4I9NA 3V1NA 3I01A 4QA9A 4P3PA 4QJIA 3TQQA 3ZK7A 1ISSA 4X1KB 3QEAZ 2GT1A 4H1TA 2P0AA 5AKYA 4H1UA 3OPXA 3GT3A 1K8ZB 3PEEA 4I5IA 4XKJA 3ZQUA 2K2QB 3ICOA 4H2DA 2X7HA 2AR0A 4L78A 2XDQB 1X7GA 5KNDA 1PFUA 1YAHA 4LBWA 1F20A 2CD7A 2WG0A 2JRLA 3Q7SA 1P2VA 1J5PA 5AW4A 3GNQA 1Q1AA 2JCBA 5BYAA 3ETEA 2IZZA 4Q37A 3G6KA 1FP4B 4KPYA 1G20B 2FG7C 2ZIWB 1ZI6A 1A5BB 1AC5A 1CZUA 2OO7A 3K73O 4NOLA 1NT2A 1RCUA 2Y1FA 4XFKA 1ZM4A 5KSPA 4EA7A 3I04M 2V1UA 4O63O 2GTHA 1Y5LA 4EHAA 2XDQA 4AN0A 2R4UA 3D6VA 2NACA 5KHAA 3SKYA 3TI7A 2WWFA 4U2EA 5JDIA 1G20A 1WDWB 1WZUA 2Q21A 3ED5A 2OBMA 1WZNA 2FZ4A 3N2ZB 3I5XA 4EHHA 1YTLA 4FSXA 1TZMA 4KLAA 3C1TA 4N5IX 1YI0A 3PLRA 1SK8A 2IF0A 3HBMA 1C9EA 4G4SO 3MB8A 3DKRA 4M83A 3PXXA 3GFGA 2Q6IA 5K8TA 3EF1A 3L49A 3R3ZA 3P94A 1XZGA 3DC2A 1SC9A 1DARA 1R10A 3T7TA 2DBYA 1RPAA 3CURA 3ECAA 5FQNA 1Y4AE 3C5VA 2FJ0A 2NVBA 1E1RA 2IIQA 4EDFA 1EGMB 3ICVA 4MLZA 4BYMA 1ORIA 2JL1A 1IY8A 4RVHA 3DPIA 4Y7CA 4HRXA 4MV0A 4MUJA 5TSDA 3U3DA 1KQGA 2NYUA 1KQNA 2R9VA 1JKMA 1PTJA 4LWPA 5FUYA 1UP4A 1ESNA 3VM6A 1NUPA 2D2XA 5J59A 1RHKA 4R0MA 4FCVA 3ASZA 4DMFA 1A9ZA 3WB9A 2VJDA 4J03A 5AXCA 3V7NA 4MB2A 4PEVA 5FCDA 2BKLA 3CEPB 3OLQA 1LA2A 1XXHB 1RTTA 4ZU3A 3JQGB 4BO4A 1E8NA 1EI9A 1O54A 4TUYF 2IHBA 3GW8A 2XECA 1LDEA 3F8SA 3OD5A 1AK9A 1JFRA 4JP1A 4PFJA 1QLJA 5TXGA 3ZGLA 1MO3A 2CLDX 4ALMA 5DNYB 2A9FA 4RVOA 3QQPA 4HO1X 1GKYA 3U62A 4UATA 3PUYA 1M6YA 1TKRA 2NU6A 4DUYB 5B7GA 2YXEA 3TWOA 1J1UA 2AD1A 2GWRA 2G0TA 2CUTA 4A6PA 4KQEA 3OJWA 4K2HA 1XXHA 5FKJA 3JQGA 2BFFB 3UPDA 3G2JA 3NBKA 2G71A 1IOVA 1JV2B 1SQ5A 1UBOS 2R8ZA 4TV9B 2BSAA 3RUCA 3WBJA 2PSJA 3LLSA 3U9SA 2MMGA 3HSSA 4YRGA 4Q9JA 3ODGA 1AURA 3I58A 5FPYA 1W87A 4GKBA 4CM9D 2XMQA 1QTIA 3PHIA 1NQVA 2VYVA 3ZKWB 3W6ZA 5HZGA 1BRMA 3A04A 4HH0A 5CU7A 5IU6A 1GEGA 1FTGA 1WXEA 5JFOA 1IK6A 2BFFA 1IXSB 1DDIA 2HA0A 2TMKA 3ZYCA 1Y6GA 4MJ3A 2X76A 2P3QA 1EFKA 5JY6A 4TV9A 4CGYA 1GRNA 4U7DA 4Z4HA 4M8SA 4EKIA 3DTVA 2I62A 4QUHA 5JD5A 2I2DA 4AS3A 1VMIA 3HB7A 1SRRA 1YJCA 3ZKWA 2QLMA 2ORWA 1YRAA 1PYGA 1HTTA 2JAXA 4FK8A 3PDIB 4QTXA 1BU5A 3TIVA 1RRVA 3PHCA 5ALYA 2RHBA 3FHOA 5DX0A 1TCBA 2CE2X 1LJ8A 5E4JA 5FUWA 4F1KA 2J3HA 3NKLA 3NP9A 2R8BA 3NBMA 3OZVA 3RS4A 3CM0A 2I8LA 2YYYA 3KZMA 2WFMA 2WZBA 3QVXA 4H18A 3FBWA 4MCHA 5U9CA 2GRJA 4NDNE 4E5YA 2H06A 5DYTA 4R3UC 3EQ6A 4J94A 5IEBA 4BUZA 4DNXA 3V1YA 5C5EA 2PM8A 3BICA 1G6Q1 2HV9A 3PDIA 4ZV9A 3PXCX 2Q3FA 3T1VA 3H5IA 5BP7A 5G41A 5IJXA 1XPUA 4KREA 1VMAA 3R5XA 2AG1A 2QIPA 4YRRA 3VPFA 3NIDB 3REFA 4AO7A 5JAPA 5H4HA 5HNKA 3TG8A 3HE3A 5C4IA 3E9DA 4EUKA 3IA2A 4ND7A 3OHSX 3P19A 4GOOD 1JAYA 4E2ZA 5MF6A 4KQHA 3C5HA 1M9NA 1WKVA 1NRWA 1PV4A 1GZDA 4OGLA 2XDWA 3OZFA 4K6HA 3VBCA 5LQMA 1EX9A 4PYKA 4OBEA 1NF2A 1VL6A 3QX8A 2D54A 3ZHYA 1SC4A 2KM1A 1J9GA 4BX9A 1PZEA 3QXJA 4Q6BA 1I7NA 3D02A 2GBIA 2ZTUA 1PSWA 3OUUA 4YMSA 3ROKA 1BHO1 1AOXA 2H65A 4QUJA 3ZNOA 2ZYDA 5T41A 3GEDA 3RQSA 1ZX1A 3M9XA 4CCAA 1G6HA 1XWIA 5ADWA 2YUTA 5K7SA 2HMAA 2L17A 5JSFA 2QX4A 4U2FA 4LRQA 2FFAA 3MJVA 2NV2B 5CH5A 4ZARA 4B09A 2XMSA 3LW8A 3R5KA 3KV1A 2EJWA 2C2XA 2P79A 2F3PA 4J8PA 4X6XA 2PRKA 4FGZA 3DOIA 3QSGA 4XDZA 4ETNA 3U6KA 4FB4A 3GRZA 2ZU0C 1EHYA 2HJWA 1GFIA 5DXAA 4DV2B 4YCBA 1HUQA 2GERA 4PC3A 3B53X 4DADA 1AXRA 4RHCA 5FORA 4E46A 2B8WA 2KWIA 3ND9A 3TBHA 2H9AA 2HWYA 3L1HA 4FYHA 2WFLB 4CIVA 2ZQYA 3KYJB 3H65A 4N0EA 4ARIA 1P62B 1ZA1A 4I8IA 4YECA 2EG9A 1Q1BA 3NO4A 3L8ZA 1V3TA 3FMGA 4TWRA 3TINA 1JA9A 1SXJE 4QU8A 1NUTA 3A36A 3PDWA 1EK0A 3AINA 4WKCA 3NANA 5B1DA 2CHUA 1Z4LA 2ST1A 2ERYA 1LU9A 3GJQA 2C9CA 3LPAA 4KV7A 4WLEA 5CDFA 3RYIA 4B75A 1EEHA 1RZVA 4BKQA 1Z2DA 1W49A 3LXUX 1TZBA 1K63A 3SR0A 3RADC 4F2DA 2SBTA 5KTMA 4LYJA 5LNK6 13PKA 1WZEA 5F2EA 5DN6D 4TYNA 1ZK1A 1Y34E 3WK4A 5T5QA 4N6GA 3H05A 3LA6A 3MWJA 3RIMA 1XKQA 3VC2A 4GZMA 4RTRA 1SU7A 2DR0A 4RSGA 5K4GA 4ESVA 1HLGA 1T24A 3D0OA 4DLTA 4I4IA 3ZJ5A 1U2DC 5B57C 1XZMA 1PFVA 1ULZA 2H59A 2EFEB 4MUYA 2CLIB 1Z4PX 3AVVA 3D0RA 3CX4A 1ZESA 3GVIA 4LDPA 1NVTA 3CG0A 5JTUA 2G07A 1B42A 3IJPA 4DYDA 1WMSA 2Y4OA 3AHFA 4YMWA 3U40A 5JZ9A 2GASA 3EWIA 4QPPA 3C45A 1JH8A 1GSAA 2NYRA 4O0MA 4HVCA 5A5VA 1XKLA 2GYYA 1NXQA 1XA0A 4GG1A 1TQ8A 4HB4A 1ADJA 2I8CA 4U7HA 5J63A 4ZOBA 5C5CA 2FZCA 2QTNA 3ELYA 4YCJA 3UZUA 3MAJA 2ZM5A 1TJ3A 4IRUB 4LJ5A 1KEKA 3AIMA 3PL5A 4Q48A 4E7OA 1YJQA 2FWBA 3JALB 3VR3D 4F93B 4MQUA 4AJ4A 4L08A 3AIIA 4G4GA 2QKYA 1VXRA 1XRQA 3NU1A 1D4AA 2GYWA 3TBKA 1JA0A 2MYUA 2ID7A 3C3BA 3OLZA 1M7GA 3PNLA 4MS1B 3WNCA 3H3FA 3ZHXA 3P0HA 4EFNA 2P30A 2MSNA 3OJCA 3IQHX 3PHBE 1R5NA 4G37A 4Q3KA 5AHXA 1FJXA 1J7KA 1YIOA 2IUSA 2BOVA 5FFNA 2GO7A 4GQIA 5ENZA 5TS2A 3EVTA 1RHRA 3JALA 3W5DA 2FPOA 1TZKA 1VGRA 3GN1A 1SKAA 4QQKA 3ZCVA 2PVSA 1OFIA 4M38A 3N8IA 2CK3D 3SXUB 1GZ3A 4BO3A 3C1UA 1Y8AA 4DILA 4EO9A 4EDHA 2Z08A 1MC4A 3RSCA 1QO0D 2C2BA 1EX6A 3GCDA 4Y8VA 2I5PO 1R27A 1ADGA 2FCAA 3OE4A 4LSZA 4YYEA 2VPZA 1SVMA 1NC1A 3PQ2A 1C8VB 4MP6A 3N8KA 3SKVA 1FFCA 1WPGA 2NZWA 1S3IA 3KKOA 4L3WA 5BQ5A 3SXUA 3ZV6A 2XQIA 3IUEA 3TSZA 3GLIB 2Z6QA 2YWBA 1LBIA 3D6NB 5DT9A 4OV6B 3AC0A 1D5WA 4D9KA 3FR7A 3QFTA 1APBA 4AVYA 4LGYA 2YV5A 2IS2A 1P7ZA 1NLYA 4BQIA 3X1XA 4MUBA 1P18A 2JANA 2XIJA 4URVR 3NOXA 3RKSA 4UU8A 1MTOA 1RBMA 4N3AA 3KVRA 1L6RA 3GNLA 1N7IA 3FSGD 1GFSA 1IONA 5K03A 2YR0A 4HD8A 2XYVA 3FPFA 4D8WA 5K99A 1XP8A 5DXJA 3RSFA 3EN0A 2ZJZA 5F12A 3UV7A 3V8MA 5IHPA 3CXRA 3TN7A 3VH4A 4AM8A 4ESHA 1QU3A 1MPTA 1NVVQ 1SOUA 2FFRA 2UZ3A 1RI4A 1PLKA 1UBKS 2GCIA 3DF7A 5CNIA 1KBZA