3PGLA

Crystal structure of human small c-terminal domain phosphatase 1 (scp1) bound to rabeprazole
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Selective inactivation of a human neuronal silencing phosphatase by a small molecule inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3pglA00
2P27A 5JJBA 2JAUA 1F5SA 2FEAA 2W4MA 4L6AA 3SMVA 3AR4A 3ET5A 5IT4A 2P9JA 2ZG6A 4XPZA 2O2XA 1RDFA 3QGMA 3U13A 3QLEA 3I1YA 3N1UA 4O8CA 2EARA 3MN1A 1RMTA 1K1EA 3AR8A 1FEZA 3B8EA 1L8LA 1N9KA 2B8EA 2YBDA 4BYGA 2YJ5A 5AI4A 3SF0A 4CE6A 3U19A 3NUQA 5IT0A 5ALOA 2WF6A 1QQ6A 2FUEA 1RKUA 3U7HB 5ALHA 1VJ5A 3WKBA 3QXGA 2YMPA 3L0CA 1RLOA 3L0YA 1CQZA 2IA5A 3IRUA 5ALIA 4XOUA 3PCTA 4QQFA 3SLRA 3WK7A 3UMBA 4BKMA 2YJ4A 2FPSA 4BNDA 4KX5A 2ZBDA 3QU5A 3R4CA 3MMZA 4HGOA 3EF0A 1ZD3A 3OCZA 3NASA 3WK8A 2Q4RA 2RBKA 4YGYA 3S6JA 3BWVA 1T5TA 3KZXA 2HEGA 3L8FA 4DWOA 2HOQA 1O03A 4UMVA 3L1UA 3F9RA 3M9LA 4EZEA 1RKQA 1NNLA 3E81A 3AR2A 4UASA 2FPRA 2HF7A 2WF5A 3WKEA 3ZX4A 4NWIA 4EEKA 1L6RA 5AIAA 5AKJA 2HX1A 5ALNA 2MSNA 2HHLA 3L8EA 5AVTA 2R8XA 3E58A 5AW6A 4CNQA 3IJ5A 4KNWA 3DAOA 4CF5A 1L7OA 4KN8A 3D6JA 4ZEXA 2GHQA 2NO4A 4OCZA 2O9JA 4C4RA 1TJ5A 5AVUA 5AVQA 3U26A 3FPBA 1WPGA 3OTQA 4DFDA 2G08A 2I54A 3A1EA 2BDUA 3RFUA 4BX3A 3A1DA 3ET4A 3ZVLA 3IB6A 3QU9A 4Y2XA 4BBJA 5AM2A 4FE3A 5ALJA 4PNHA 4F71A 4Y3UA 5AKEA 1WVIA 2PQ0A 3KDPA 3UMGA 5AVWA 4Y2SA 3B9BA 4UMDA 1SWWA 2JGAA 3QUQA 4L6CA 3R9KA 4J03A 2CFRA 2YY6A 1Y8AA 1YMQA 1XPJA 3OCXA 1TJ4A 4CF3A 5IS2A 4UM7A 3SHQA 1JUDA 5AM4A 4YIKA 2G0AA 1MH9A 2B1QA 4AS3A 2GMWA 3A1CA 4Y2PA 2X4DA 1T9ZA 3FVVA 3AR9A 1XP5A 3WGUA 3NALA 5AI6A 2FPXA 2HSZA 3K1ZA 1IWOA 5AKXA 3ZX5A 1SU4A 2HCFA 3QU4A 4G9BA 4KX3A 2WF8A 1ZD4A 5AI0A 4JDPA 2CFSA 3I6BA 5AKIA 2PR7A 2C9MA 1Z4OA 2QYHA 2RARA 3WK6A 1Q92A 3ZVMA 4Y2YA 2WF9A 4BX2A 3N8GA 2G1AA 2YJ6A 2R8ZA 1PW5A 2B30A 2GFHA 1KYTA 5AM3A 2BDEA 2JAOA 3QUBA 5T41A 5ALXA 5AW9A 3OCUA 1Z5GA 2FUCA 1RQLA 4UATA 2YJ3A 4HYTA 3OCWA 5AW8A 3FZQA 2WM8A 5AVXA 2HO4A 2D2VA 3QUCA 2NO5A 4XE5A 3ZWDA 2IOFK 3PGLA 3AR3A 3ESQA 3ZVNA 4DW8A 3ZTYA 4EELA 2I6XA 2JAWA 2NYVA 3OCVA 4UU1A 5AW4A 5ALKA 2C88A 5ALFA 2R8EA 3P96A 3W5AA 2I55A 2HI0A 2FPWA 3KOOA 1Z4IA 3OCYA 4YCNA 4G63A 2FI1A 4ZEVA 4EENA 4Y2UA 5AI5A 3MC1A 3L8GA 3WKCA 3WGVA 4HAIA 2IOFA 1VJRA 1RQNA 5ALWA 2ZBGA 3UMCA 4BNDB 4CF4A 3A3YA 3MPOA 1ZRMA 5ALZA 2C8LA 1J97A 1L7MA 2B0CA 1S8OA 4YH1A 2GO7A 5AKKA 2WF7A 1Z4JA 2ODAA 2ZXEA 1Z4NA 4BEWA 2AH5A 1TE2A 3ZUPA 4UMFA 5AKGA 3E8MA 4XQ0A 4EX7A 3QYPA 2QLTA 4FYPA 5AI8A 5ALVA 4JB3A 2ZOSA 2CN1A 2I33A 2I34A 2IYEA 2P11A 4GIBA 4NAVA 3NRJA 3QU7A 5A3QA 1L8OA 3CNHA 3ESRA 5ALSA 4H1WA 2CFTA 5AW3A 2OA0A 4J2TA 1AQ6A 4OFZA 1U02A 4Y2VA 3U7FB 5AHXA 1ZS9A 3QU2A 5AM5A 5ALPA 1L7NA 4Y2QA 2JARA 2YMQA 3N5KA 1J8DA 2G07A 3N28A 3N07A 1RLTA 2EATA 3CZ4A 4AP9A 5AW7A 3EWIA 1U2SA 3VAYA 1RRCA 4HGNA 5ALTA 4GXTA 4Y2JA 1WZCA 2AUTA 4RESA 3QX7A 3KD3A 5ALUA 4Y2RA 1YS9A 1X42A 2HDOA 3ZU6A 1Q91A 5AK6A 5AW5A 5AKLA 4FFDA 1Z4QA 4B6JA 3ED5A 3U7EB 2OBBA 5AVYA 5AKZA 3M1YA 1WR8A 2MU1A 1QYIA 4BX0A 3L7YA 2W43A 3AR6A 3SD7A 3NAMA 2YFYA 2C8KA 2I7DA 5ALDA 2IOHA 1U2TA 1YDFA 3E84A 5ALEA 5ALGA 5A3RA 2EAUA 2Q4TA 3WK5A 1L7PA 1QH9A 2YMLA 3ZTWA 4F72A 5AW2A 5AK3A 4UAVA 2VKQA 3TLMA 1EK2A 2AMYA 3KC2A 2OM6A 3WKDA 2YMMA 2DQSA 2GHTA 3WK9A 3ZW7A 4E88A 1YNSA 4RETA 2B1RA 2FPUA 5AK4A 4DCCA 1YJ5A 3HLTA 3OPXA 4KYTA 3L0BA 5AVVA 1XVIA 1RMYA 1VFPA 1TJ3A 1Z4LA 2OYCA 2Q5EA 4OD0A 3SKXA 3I28A 2R8YA 1RPZA 2G06A 3GYGA 4NABA 3EF1A 3W5DA 4AS2A 3KBBA 1SWVA 5ALQA 4UM5A 3FM9A 3U7GA 1LTQA 4NV0A 3W5CA 2G09A 1LVHA 3AR7A 1ZD2P 1NRWA 3AR5A 2G80A 4UW9A 4MWOA 4BEVA 3QUTA 3ONNA 2RAVA 1CR6A 4IFTA 5AVRA 1Z88A 3PGVA 4UU0A 2P69A 4YCLA 1YV9A 4EX6A 5ALMA 4NFLA 5AVZA 2WFAA 5AK5A 1ZJJA 5AM1A 5AESA 1QQ5A 5AICA 4OHFA 4YCMA 3L5KA 3DV9A 3FPSA 1Z4MA 3UM9A 3WK4A 4YIHA 2C4NA 4UARA 4QJBA 4UAUA 1Z4PX 5AI9A 3EPRA 1RLMA 2HF2A 1ZOLA 3ZWKA 3DNPA 3SKYA 5ALYA 1U7OA 2PKEA 2B8JA 2ZBFA 3B9RA 1NF2A 1Z5UA 2ZBEA 3NANA 5A3SA 3L8HA 3R09A 1RMQA 3RF6A 3PDWA 1EK1A 3ZI4A 1ZRNA 3W5BA 1T5SA 1RKVA 5ALRA 1O08A 3J7TA 5AIBA 3WKAA 2BY4A 1ZD5A 3I76A 2YN4A 4UMEA 4KNVA 4L57A 1TA0A 2B82A 3L1VA 3QNMA 5AKYA 5AM0A 4ZEWA 1RC8A 3FGOA 2WHEA 5E0OA 5AKHA 5AW1A 4HGRA 3HYCA 1Z4KA 3NIWA 1S2OA 4MUMA 4I9GA 5FP0A 1QQ7A 2RB5A 4HGPA 2FDRA 4C4SA 4HGQA 5ALLA 4IG4A 5AW0A 1U7PA 3BA6A 4C4TA 5AVSA 4I9FA 3DDHA 1N8NA 4Y2TA 2W11A 2AGVA
chains in the Genus database with same CATH superfamily
3ZU5A 1TM4E 5H16A 4FZ3A 1IU9A 2APJA 4KU4A 1DCFA 3R9WA 1CRZA 4WV3A 1ORTA 2PZFA 5CFLA 4YRLA 4QFCA 3ASVA 2A57A 3ZK9A 2C7RA 3I53A 4GE3A 2EZ4A 2XDQB 3KOYA 4XPZA 5FTKA 3RKRA 1AZLA 2V9ZA 4MA5A 4YRTA 3TD2A 3W2TA 3PA8A 2JFQA 4IGKA 5EERA 2WU4A 5K3AA 7REQA 2QAGA 1RMTA 5ESXA 3GVHA 1G4UR 1K97A 3EH2A 4J2OA 1K7XB 1TM3E 4LTDA 6REQB 4U6QA 4WOPA 3BMOB 3K70C 1Y8RA 2W2KB 4OUKX 1EK6A 1Q19A 3AJDA 3ANXA 1EUDB 1NAIA 3NUQA 5BSMA 5L3QA 2UYOA 2VHUA 1G9TA 3KDAA 4AYTA 1E2DA 4BECA 1D0IA 1DC6A 3HUEA 1Y5LA 3V32A 1A98A 4ALIA 4JVSB 5FV4A 4EI7A 1J5PA 3ZN2A 1VIAA 2XSZD 4LK2A 2AW5A 4R9SA 3LQQA 1LTHR 2QU7A 4KQ6A 2OXEA 4Q1AA 1W9MA 4QXQA 4XOUA 4ZVMA 4D4KA 2NO1A 3IAAA 3W4IA 4E31A 5KYGA 4V2IA 3QXJA 4Y1GA 4KXFB 3DBHB 3P4UA 1Z2DA 3VUFA 5ETJA 4XAQA 4MUGA 1THTA 2FRDC 1U9IC 4HGOA 3B1XA 3I01M 1WSWA 4D46A 2HLNA 3IH5A 4EEXA 5K7SA 3VH3A 3HG7A 1X2EA 2Q4RA 1P80A 1YBFA 2V03A 3HFGA 5H81A 3UUGA 1RHKA 1TO6A 3WGQA 2JD1A 3CEHA 3L7JA 4B40A 1T5TA 4HAXA 4TN5A 4YB8A 3WP1B 4W1QA 5KYYB 3ZD7A 1VPVA 3QF7A 1HYGA 4MV4A 4AWBA 4MVJD 1A76A 4HDOB 2G04A 2VQDA 4TX1A 2MR6A 1GD1O 2AMJA 1AQIA 2VF5X 3EWNA 1P9RA 1MTOA 1NHGA 4YAEA 4KPUA 1FTYA 1U31A 3CF4G 4IDPA 5HS6A 5AFSA 1NT2A 4IUDS 3WYEA 2QUAA 4I14A 4EEKA 3KWLA 1T1GA 3I37X 1QGUA 3WFJA 5JROA 2DM6A 5KB3A 4P0QB 3B20A 1BHJA 3C3CA 3N39C 4MWSA 3R6TA 4OHXA 3PICA 4TKUB 5AVTA 4FFVA 3TJMA 1L5YA 3LLMA 1M83A 1OX4A 4AX4A 3ZCQA 3AJEA 1NBEA 1N92A 2G5CA 3G2QA 4RV5A 3RIXA 1BD4A 5TGZA 4G5RA 2XQKA 1E6WA 1Y33E 2HA2A 1X9HA 3LUGA 4BNJA 3HHEA 1Q84A 5IEJA 3GAMA 4DABA 2H57A 1C1XB 2X5JO 2QW0X 1KEUA 3LDGA 4D6XA 3KB1A 3PEYA 4LDJA 2VSFA 3SE7A 5HYVA 1H6DA 1NJ2A 1XMVA 1GSHA 2XUFA 3AONB 4LZZA 5EXSA 4C4RA 5KCZA 2W6ZA 5HZHA 4JC0A 5KWSA 5DN6D 2XCSB 2C7QA 2R11A 5I7RA 1V35A 3U26A 1KIAA 5FR2A 2QG6A 3NEPX 2G08A 3S2ZA 4IDOA 1TO1E 2AI1A 1V37A 2PGAA 2XAAA 3I6YA 1A04A 2G17A 5CFPA 2Y3IA 4U7DA 2IPOA 5ILQA 3MJRA 4U2GA 4DT1A 5DSZA 2WD7A 2AHOA 3F4BA 2RGAA 2EW2A 3IB6A 3GAFA 1TZ2A 4KBYA 1HTTA 2ZSDA 4N39A 4YRDA 4HAZA 5KSOA 4XIIA 4IMPA 4JD5A 4IDBA 5GONA 2ZIVB 3ABSB 4DWJA 4BN0A 4B3IA 3Q9LA 3UANA 1WVIA 5LQDA 2PY6A 2Q5HA 1L7VC 4DTIA 3FPAA 3I9OA 1E1QD 1FL9A 4TS1A 2H1RA 2WRZA 5CMLA 1BJRE 2BKEA 3GHHA 2HJRA 4MWDA 1ISHA 1R6DA 4PAMA 1L4LA 5BQPA 3W3AH 1XYGA 3G17A 4MVJG 1RWKA 2GCIA 3GLQA 3LC0A 3LT0A 4GG1A 1PJBA 1G5PA 2WJ3A 4GLOA 4ABYA 3W7VA 5HXAA 5LQJA 5EESA 5FOVA 2CDNA 3DCNA 1PNQA 1LI4A 4DLYA 1TPYA 1CS0A 4YAUA 1IB0A 1RYNA 1Z82A 4P81A 4UTOA 4PZEA 3ZBUA 4DZRA 1RJ9B 4AJNA 2PUEA 3GRAA 4D9CA 3GGOA 1YI0A 4NBUA 3CX8A 4OQDA 5DB4A 3UMJA 1KI2A 4MPRA 3EDRA 1ZD4A 2QK4A 4H1VA 4I46A 3VNQA 3LHIA 4GW3A 5KTSA 1B1CA 1LTKA 1SM4A 1TW3A 3I6BA 4R83A 5D8DA 1XNJA 3OPNA 3U1VA 4DAOA 3PRHA 4HXEB 1JR6A 2QA5A 4FW8A 3R3HA 1NMEA 1MAUA 3R3JA 2BHTA 2Q3LA 5E4YA 5EIAA 4BFXA 2C96A 4BP8A 2JNWA 4FNGA 4RQBA 5AXCA 3JVVA 1J8FA 4X20A 1G2OA 1KAQA 2E37A 1NF8A 4JLPA 1NFQA 2M6SA 4CKYA 4DEVA 5JAIA 5C8YF 1SVSA 4CCAA 3B70A 3WP0A 2ZYRA 1EESA 1X13A 4URWR 1AURA 2HA0A 1MNAA 2ZRGA 3K5IA 2DBRA 3KVYA 1D2GA 2M9MA 2QNRA 3K0SA 3ONVA 1EVJA 1E3LA 2B36A 3A10A 2Q4EA 3G2OA 1L7RA 1PTKA 3T06B 5ALXA 3VC1A 2IOQA 5IPFA 3FR7A 3DZCA 1MP0A 4LXYA 1D5CA 1L4NA 4FHGA 2ZRMA 4LVUA 4ALNA 1P9WA 2QDKA 2SECE 1V16A 1WP9A 2YVLA 1G7TA 3OKCA 1ADBA 4FJ0A 3OIUA 2GF2A 4DCVA 5JBQA 1AX9A 4U9IS 1UMBB 5L45A 1YB5A 1ZN2A 3IE0A 3IP5A 2D3TA 2JGKA 3MUNA 3IDSA 1JDBC 1U28A 4G2TA 4PLCA 3QPDA 5I7SA 2F62A 2FZEA 1USGA 3A1SA 3EGWA 4RZXA 3FGNA 4YALA 1QHFA 3V80A 4QPDA 4LF7B 4PBTA 4Q6WA 4G4GA 1DIOB 5EEHA 5FOXA 1K6MA 4BO7A 1KYZA 4KQHA 4RF4A 4ZVKA 2QPLA 2J7PA 2EF0A 3R5HA 2DH5A 2Y27A 1TQ2A 1DP4A 1W1WA 2WEKA 3ZI0A 4ENRA 2HADA 1YOVA 3IVRA 1LQTA 2GLTA 3N75A 3TK1A 1G8HA 1LPSA 3I1FA 3OTGA 2WTUA 5E9WA 2X77A 2HCTA 1I33A 5DMXA 3CH4B 1X1RA 3AEKB 3FCAA 3NIDB 5DO9A 1HGXA 4DLZA 3I2JA 4B6QA 3D2AA 4Y2GA 4TTAA 4Y2UA 1P0CA 2O2HA 3EQ2A 5TF0A 3WKCA 1EXWA 4J0CA 1PJSA 4Q66C 4UKDA 5EZYA 2QGFA 1YFLA 3AVXA 4JCOA 4RPHA 1A69A 4S1PA 2YIJA 2D7DA 3GT7A 1DO2A 3N53A 5CJJA 1JLMA 5ALZA 5JV5A 3IR5A 4OXYA 5E95A 4I4TB 5I9SA 1X7XB 3SM3A 1Z63A 2ACWA 5IJZA 4GZ5A 3FF4A 3HR7A 1E2MA 1SZDA 1F4LA 1A8QA 3FYHA 1PEDA 1UMKA 4JQOA 1I2CA 3W2HA 3W6OA 4DCPA 2YN2A 3M5PA 2ECOA 4P4UA 4MKZA 2O7SA 1E2EA 1TE2A 3T1VA 3W8FA 1ZKDA 4JENA 1ZK4A 5IN5A 4Z7OB 3ELWA 4G41A 2QLTA 4YLGA 3VR3D 5AI8A 4UXHA 1QK5A 2FMKA 1DTWA 4B4OA 4I55B 1AGYA 1T9KA 2IYEA 4NAVA 1AHHA 3QHQA 1GGEA 1RJEA 3ODPA 3PVSA 1B16A 4PSUA 4Z99A 1CRLA 2HGZA 3X2EA 3DAHA 2HU2A 4LJ7A 5DCYA 4OPMA 3OT4A 4WECA 2OA0A 1R9NA 4MLZA 1RYYA 4REMA 2PUHA 1Z6AA 1AE1A 4X41A 5AJTA 3VR5A 2D5IA 4WD3A 1R0SA 1HUQA 4AZTA 4IZ6A 2DLDA 3RFCA 1M0TA 1R4NA 3PITA 4E13A 2ZTSA 4IXWA 5A04A 2NVWA 3KSUA 2CNNA 3HWWA 4G0UA 1G1MA 5TC4A 3F1KA 1MDBA 1Y9AA 1ZGJA 1RLTA 2EATA 1LD3A 1V2HE 2WWRA 1E0SA 2NVOA 3DNFA 4PRZA 4YRRA 3PDHA 4TUYA 3TNYA 2ZS7A 1P3Y1 3ETJA 3KR2A 4LDZA 4UM8B 4TSFA 4U39A 3TSZA 3OPMA 2CEAA 3AFIA 1F2TA 2I3GA 5T4HA 4AWXA 5ALTA 3LQ4A 4N48A 4JNCA 4LXQA 4HSGA 1KFEB 3SNHA 1KTVA 1V5GA 2AUTA 2RIRA 3SIPA 4G6ZA 5EP3A 1UEXC 4UHKA 5JCOA 3QX7A 2VCEA 4WOJA 1VHQA 2JA2A 1M66A 2GOYA 1AKWA 3Q7EA 3VHXA 3DP9A 4AUKA 4B3FX 3U4QA 5CYOA 2D1FA 1F8XA 1Q91A 4HT3B 3X2FA 2VZ9A 4P32A 5C9ZA 3URKA 1KSJA 4UNNA 4B09A 4HWGA 1E9BA 1ODLA 5EUCA 2QD4A 2PKXA 3P0HA 1WWKA 1UFOA 4Y98A 1QCDA 2PO5A 3FTEA 2VPTA 2CJYA 3AMVA 3FGZA 5AOBA 1NR5A 2VJYA 3DBIA 3SBOA 4Q3KA 2GNOA 4LZOA 4Z4HA 3PR3A 5DV9A 3RSOA 2PO7A 2V3WA 3DZKA 3EHEA 4BNYA 2SKEA 5ALDA 5GM1A 1HOXA 2CVPA 2G71A 1Z9BA 3Q2OA 4OHZA 4OHRA 5B7GA 2AE2A 5JSQA 3E84A 4D8XA 1KRHA 3A14A 4RVCA 1G8KA 3IC5A 1D2CA 4PRLA 1DOZA 3JWGA 4M87A 4MA4A 1D5WA 5DPMA 3S2FA 3CVWA 4XB6B 3NOXA 3OCJA 2OCXA 4UULA 3MT0A 3ZGVA 3AI3A 4MWZA 2QTMA 3RJ9A 2H5JA 4FOPA 3QITA 4QD3A 2ALJA 3TX6A 1JXOA 3C6YA 3TOZA 5EMJA 3MTDA 2AG0A 2XOXA 4R2JA 3IL2A 1J22A 1SQ6A 1QRSA 4AKSA 2EZTA 4OU5A 2DWQA 2TMDA 5BN3B 5E6UB 4QYIB 4ETNA 1FX1A 3ZV5A 3QUAA 4C3UA 4EQZA 2FWJA 3G59A 4B3SB 1PZXA 3QEJA 4CEHB 1W47A 1XU4A 3F5SA 2JGMA 5M29A 4RORA 1V5WA 1AKEA 4HP8A 4GPEA 1YK1A 3CRW1 4IDFA 1XVIA 3A9UA 5C8XA 1CUBA 2F90A 4REQA 3E8XA 2VSXA 1ZD9A 1IK6A 4JI6B 1N5RA 1EBBA 1V9CA 3I9V6 4OD0A 2Y0BA 3FSJX 1UM9A 1WBBA 3LTEA 5DASA 4G5QA 1RAHA 3ZWQA 1PT8A 4C4YA 2FX3A 4JUBA 4LN1A 5K8IA 3NRBA 4KR6A 3GT3A 3ELBA 4PZUA 4UBLA 1VLLA 1WHTA 4UAGA 1V41E 4DV7B 2O05A 2V96A 1NVDA 2YV2A 2I62A 3IVAA 5K8CA 1M2VA 2DUMA 3BH0A 3IX7A 3L07A 4ZN6A 2CKMA 5BN4B 5JJ5A 1RBZA 4O5OA 2OAGA 5LOVA 4EJSC 4CGYA 3R3SA 4XA8A 5FWYB 4ECAA 2B3DA 2JCSA 1XTRA 3PGVA 4DV3B 1QR2A 4JL8A 1W0KA 2IKSA 4Z1OA 4EX6A 1M2KA 1D1PA 1FFCA 3E3NA 3HFRA 4ZAFA 1K88A 3ZXYA 4ZV9A 1G291 3BILA 1HA3A 1O94A 2WB2A 1XKLA 4QTXA 4MUBA 3BGSA 1LGYA 4LOIA 4DQVA 3KKOA 3HJNA 3GEMA 5KYWB 3GG2A 1T3ZA 5CTJA 3TBFA 3UAOA 3H9JA 1Z8HA 4W99A 2C4NA 5KTTA 2ZULA 3HNPA 3I5AA 4UREA 2VK2A 4KP7A 8ABPA 4OX9Y 1FLNA 1XO1A 2G28A 3LXMA 3ICQB 4BPRA 2F1IA 3FNRA 2PK3A 3AUFA 4MICA 2JA1A 4Q4AA 3LIPA 4F91B 1WCIB 1B6RA 5EP4A 3RQIA 1AMNA 5CG2A 4OQPA 4BB0A 4LWPA 1Z6YA 4IIBA 4CQMA 4WL0A 2B0JA 3IP6A 4ZOCA 1Q44A 3BH7A 5LZ8A 4RTQA 3K0CA 4MR8B 3EA0A 3I9JA 4WQMA 3UT5A 2J9YB 1LA2A 5E9JA 2GK6A 1LBTA 1A4UA 1NI3A 1T6YA 2BWJA 4KYVA 2Q0HA 2XCIA 3K9GA 1C8LA 4X64B 3NATA 3AZOA 4UTXA 3H86A 4ALKA 1CIJA 2ANCA 2IBSA 1R3DA 2GH1A 3BXPA 4ACBA 2R6CA 2ZLBA 3B38A 2VP0A 1RJGA 3NIGB 3QKUA 1AU9A 2XWPA 3PQ3A 2VF8A 3QJYA 2NU9B 3UFXA 5AIBA 3I5YA 4V0RA 1CY4A 2G67A 1SVOA 3FMVA 3CLUC 3FCSB 1PJRA 4I1YA 5TPWA 1GDTA 2P6UA 1NUTA 2XEDA 4OQXA 4GR4A 2B82A 4KIWA 1KQGA 3ZHZA 1KJIA 1P5FA 1R5OA 2OL4A 4FWTA 4KWTA 2HW8A 3EB9A 1P4SA 1YHZA 2C4VA 2W8BB 1ONBA 2ZE5A 3FGOA 3HEAA 4I4LA 3ZDXB 5HR5A 4MUFA 3CUSA 4N7RA 2XDQA 3IIKA 1TCAA 1E3TA 1AZTA 3CN9A 1SVIA 4US1R 2HMAA 5DLEA 1PJ8A 3X2SA 4MRRA 1GGMA 1JBKA 4TXNA 4TWIA 6REQA 1BNCA 3HZOA 3KT3A 1XMIA 3BMOA 3WO0A 4AMYA 2OLKA 3JY6A 2Q0XA 2W2KA 1DXOA 1EUDA 3D2BA 1D6NA 1CQPA 5KNDD 3VISA 1QG4A 3I09A 3FG9A 1CZUA 5IM4F 2XODA 2Q2QA 4AO7A 3EUEA 1FRVA 1IQ0A 3AM5A 3PI7A 3N2EA 5HJEA 4L51A 3HPRA 4P36A 4QQRA 1G20A 4JBLA 3VHQA 1N8NA 3AU8A 1G41A 2CLDX 1NN5A 2R7AA 4YCBA 3NHJA 4JGBA 4Q7MB 2QL5A 4AROA 2GCOB 1CERA 2IYFA 2VYNA 4NCKA 2X22A 4P98A 4ZXFA 4ZCIA 3EGIA 1M6YA 2NU6B 3DBHA 4WSOA 3CVXA 3IHLA 4WBNB 4QXMA 2WQ7A 2F55A 1OI3A 2I3AA 1YS6A 5C7IO 1GUDA 3IAS6 5B37A 4M1TA 4R3UC 2PUFA 3H8VA 3RSZA 1E1CB 1IWPB 1USVA 2BFAA 2EWWA 3KKEA 4OHUA 3EPKA 4O33A 3FF1A 1KHTA 2FX5A 1SEVA 1T91A 1YIDA 5CLQA 2O5EA 1W19A 1XLVA 3H04A 1EFHA 3H9CA 4FFRA 5K0FA 4KKVA 1R5JA 5KYYA 1EJBA 3LQFA 4RZSA 3AETB 1XQYA 1ND5A 3MUFA 2BV3A 4AN1A 1YCFA 2VP4A 4J0JA 4JI5B 1CCWA 2ILTA 3B89A 3L0PA 5FBLB 4UVDA 3SIWA 3JQFA 3K4QA 1J7KA 1USIA 4FS3A 4CIYA 2Z95A 3TNJA 5DTMA 1QZ3A 1VGVA 4RA9B 3UJ3X 3RVKA 2FN8A 3PNVA 3VSCA 2YMPA 1RZRA 1IN5A 1RLOA 3UGTA 2YCBA 1J07A 3WQRA 4BO2A 1Z37A 1EFDN 4YJGB 1GG9A 4I9UA 1CJVC 4DM7A 5MHTA 4UD2A 2IEAA 2XWQA 3K9BA 4QYWA 3UO8B 2PGLA 2G72A 2QNIA 4J4TA 4UC0A 2O5RA 4XJVA 4GC5A 3S2YA 3KETA 1M8KA 1SUFA 1RAEA 2YFHA 4TXMA 3OCZA 3NASA 5EJ7A 1QDUA 3WNVA 1OZ0A 1C1XA 4EBFA 1VXRA 1Y6GA 4PGMA 4EY5A 3Q7PA 4X8HA 1RI5A 4QG7A 2HYDA 3G9ZA 6PFKA 1WSBA 4G1CA 4G0VA 2HUPA 2J33A 3IJRA 4OXXA 2Q29A 4BFUA 4UTNA 2JLVA 4RDCA 2C2OA 1G9XA 3KXLA 5E4TA 5JNVA 4IOJA 5FJJA 3VZSA 3Q9NA 2F1OA 2JZNA 1VBMA 3CONA 4TMWA 4L4YA 3G1UA 2UUPA 3C16C 5FBRB 5C31A 4KE6A 5AIAA 4DYVA 3I39X 3CLTC 4PXYA 4MTCA 1FJ2A 1JALA 2GDJA 4IIFA 1PG5A 4PPYA 4BKPA 1XHFA 1Q1QA 3JS5A 3IT0A 4F3YA 5FOQA 2I8AA 5HFAA 4HZGA 3AUJB 4N9WA 4TLDA 1M7BA 2ATXA 1FQKA 1TECE 2RGNA 4OATA 4LZJA 5KVAA 1GSOA 4KR7A 3VR0A 4A6EA 2COKA 2WPNA 1ZOOA 3H9GA 3H8SA 1EVKA 1MAAA 1O95D 4FU0A 2D1QA 2JKZA 2ZDQA 5U4QA 2BMDA 3O9ZA 6CHYA 2OC9A 3WAGA 3JWIA 4DHWA 4KN8A 3F7MA 3HRIA 3GDFA 4UCQA 3Q1LA 5F5NA 2HNAA 1QVWA 4FJ1A 1FRNA 1U0NA 3ABZA 4MYSA 3RG2A 5F21A 4A0SA 4V0NA 5FB3A 3NGLA 3PJDA 4YDQA 3KBOA 2CNKA 1R4ZA 1J0BA 3BMXA 4H15A 3T4XA 4UZSA 4KDRA 1G4AE 4PYMA 3IBTA 4QWWA 4B3JA 2OCBA 2YOFA 1CLUA 1RJ9A 4IZHA 3TQOA 4B4KA 1E5XA 3FTQA 4ZI3A 1NZJA 3NTUA 1FUIA 3GGPA 3RODA 5EI5A 5A4FS 1T10A 3TSYA 1TTHA 1EFRD 3H6KA 4M0UA 4DNPA 5LMUB 1TFRA 3HJUA 1WMAA 4FDTA 4MIEA 2V7VA 4R7ZA 3CBGA 1DBWA 2YX1A 1QVZA 1T6NA 2QE7D 3A1UA 2JJYA 3ODGA 2UZIR 4JROA 4JJ4A 2XQJA 4UVHA 1FBTA 1VE5A 2B21A 1DDGA 2ZJYA 3B3AA 3H1BA 2BF7A 3EIHA 4JLDA 1K86A 2LTAA 4K6MA 1JXMA 1SHLA 2DB3A 2CE7A 2RJ3A 2OLEA 4E3WA 1YBHA 4QBHA 1X7DA 2W8ZA 4QRIA 5BSGA 3LCRA 2HK7A 3HB4X 3JWEA 2BGRA 1QIIA 3T4UA 4AJIA 3EUFA 2JI4A 2WYHA 4AD8A 2ZBQA 2BZSA 2A7QA 3LWNA 4QVIA 4IQ0A 1MH9A 2B1QA 2CXHA 1A8HA 2WHPA 4J7XA 3O2QB 4WKCA 2X4DA 4HOYA 4ETMA 5KNDH 221PA 2IYZA 1HWYA 3OFND 4JWKA 1M8GA 2VP3A 3FLMA 4FZ5A 3SZLA 5BSEA 2RH4A 2UZ1A 2VNAA 3TR0A 4CUZA 1DCTA 3X1ZA 4IV0A 3INTA 2GAOA 2H51A 2LUOA 1G2IA 2AR9A 1WB5A 7MDHA 1IWOA 1UMBA 3WRWA 1KGDA 4D9EA 5K8VA 2XB8A 1T9HA 1KF0A 1DARA 4L8GA 5J4KA 4CM6A 1H1DA 1OH5A 5I6DA 3Q8XB 1VZ3A 2H8GA 3LHSA 4M53A 2YYAA 4ESEA 4W5HA 4NICA 4EG8A 4B7XA 5FTNA 3W5VA 4DR4B 1QKKA 1VTKA 2A9JA 2B98A 4RS3A 5DULA 4CM9A 2HTFA 4WA7A 3AEYA 2O7NA 4INZA 4L8WB 1K4MA 4IVNA 2OBYA 4TL8A 4D9HA 1WQ4A 2CWDA 2FFQA 3ZVMA 1G0NA 1K2VN 2LPMA 1H85A 2II6A 4GNKA 4P8RA 3LVQE 5P8WA 4EPWA 1EGAA 3BFVA 2C5EA 2YJ6A 10MHA 4P0PB 1QOPB 2F8MA 4K9DA 1BKDR 1YD7A 2ZPUA 3AEKA 4DTCA 4BJ1A 2J87A 2VWPA 3H17A 3N58A 4JOBA 3HP4A 3SQDA 4BNVA 4Z9FA 4MP8A 2AYZA 3MFQA 4V38A 4B4DA 3LOPA 3B51X 1ZA1A 2C82A 4YJ2F 2VBFA 1Q1NA 3OKPA 4L3VA 4L78A 4HR7A 2I67A 1IJKA 1E6CA 3N0WA 5FD8A 2Z8ZA 1E77A 1QMPA 2IZ6A 5AVXA 4BIMA 4XE5A 4IIXA 1X7XA 2YIDA 3AF0A 3LBAA 1M2HA 2BGNA 3BE4A 2ZUDA 4R98A 2PLRA 4A0RA 4RD0A 2ABWA 2E6KA 5ENDA 4RJ2A 4Q3DA 3ERCA 2JLQA 3FHOA 4MI6A 5MF6A 2WFLB 5KU1A 4CF6A 1C41A 4FDMA 1CUDA 3O84A 2FMIA 2QEQA 3O91A 4LY0A 2ZIAA 5AW4A 1WQ3A 1PGQA 4LTMA 4QUGA 2Y4NA 4KQFA 3T3NA 4V39A 4I55A 4PFKA 1CP3A 2XB9A 4EG7A 1N8SA 4YCSA 1NBMA 3ZG6A 3EYAA 5HPYB 1HNXB 5FHQA 5CDTA 5LMCA 3OFSA 1GAJA 1YC5A 4NAHA 1KZ1A 3S5UA 5CDSA 1P1RA 4IEFB 1FFGA 1IEQA 2PX3A 1OHHD 4R31A 3MTEA 2AG1A 3FJYA 1XTUA 2DUJA 4X84A 1GZ7A 1M7GA 2VLBA 2VYVA 4QNRA 1Z18A 1X39A 3I9FA 3STTA 1E7MA 1DADA 1C1DB 4N5HX 3LCMA 4CT5A 1WM1A 4HUQB 3UWSA 3I3SR 4B3HA 4ZCMA 4I1UA 4X71A 5JTTA 3T3MB 3D5TA 1XZNA 1YI8A 3Q98A 1O0CA 5BR8B 3C7CB 1L7MA 1TQ8A 2UUAB 2I4TA 3HGQA 1T8RA 2DFKB 2GR9A 5TY0A 3RGWS 1TC2A 2CUNA 4JP2A 2B7LA 4US0R 1JQDA 2LGJA 3EDCA 4YNBA 3ZY5A 2YRWA 1VC2A 3A04A 2XRYA 4D45A 5FIUA 3B2EA 5EXTA 1O6CA 3V48A 1JKFA 1JHXA 2WYIA 2Z2JA 1MMFB 3D6HA 4L76A 4LBZA 1N2CB 3L04A 3OAAD 3NP7A 2IXTA 1XKQA 2PGJA 1ULHA 3DEHA 3LZCA 4EDFA 1RQRA 3GLFB 1YQ9A 4GIBA 2OCIA 4OXNA 5A3QA 3NWOA 3IAM1 1W29A 2R6HA 1SUDA 1RPTA 1KIFA 3L9WA 4RF5A 5FAXA 1CJBA 4G0PA 5JAQA 1IJFA 4HMOA 1UXJA 2C2HA 5E6SB 2M6RA 2CLKB 4LV5B 1WZEA 1RPAA 4FQ8A 4TVBA 1J70A 1EP2B 4A16A 1RBMA 5KQLA 16PKA 4L9WA 2C4UA 2VKTA 1C2YA 3CWZA 2V4ZA 4KKXB 4ZQEA 3GL9A 5IWCA 4M60A 5KQMA 2BYTA 3BB3A 4JYMA 1M1ZA 2GZMA 2XE8A 3CM0A 3N28A 3VM6A 5ITVA 4NZZA 1L5VA 5J1SB 1CJMA 4YHBA 1J20A 1RI4A 4XFJA 3SCZA 3U7QB 2IITA 2MT9A 1V3UA 4NH0A 3W8EA 1Z0AA 3HXTA 3EMDA 4N1AA 4BQNA 4U7HA 4CM8B 2MHCA 3DOEA 2XDYA 3L1KA 4ZI2A 3BRCA 5FWNA 1SUSA 3HTXA 1FYFA 2QT9A 4QLBA 5HJ5A 2TRSB 3OQ1A 1IBRA 3MTGA 3PUVA 2GBFA 1K98A 3VO8A 1QTIA 1AUQA 4PICA 3SJ7A 4AZWA 5BN3A 1S01A 2IDMA 2PEZA 4RH0A 5E6UA 1LBQA 1GUFA 2FPLA 1J0CA 1KORA 4PU0A 1PU2A 4KBFA 3AT1A 4IHKA 5EQFA 5FQNA 2FWPA 4U00A 4EB6B 2QM3A 3SYKA 4BFTA 4PC6A 4MP6A 4BDTA 3AR6A 3KZCA 3R5XA 1E5LA 2AEMA 1Z17A 3HLKA 2AN5A 4TWZA 5ERXA 3ZDAA 1K7FB 3CJQA 4QOIA 1ZH0A 2C2ZA 1ORWA 2WWGA 2XJ9A 1GO2A 4YEDA 4YI3A 1TEXA 5A05A 1E7SA 4S2UA 4MW9A 1DXYA 5ALGA 4NDAA 3WY9A 2GPSA 1XAGA 4PG4A 3HU2A 4OIFA 5E6RB 4QOHA 3BKWA 2GS9A 1RFGE 1YT5A 2VWGA 3C7AA 4U0KA 5G02A 4F72A 1XL0A 1QXSA 4EOGA 4P22A 4X1OA 4F3RA 5EIEA 3IOYA 4IH4A 3F5MA 2AMVA 1V8PA 4BMYA 1YQXA 1IMOA 5JU6A 2P62A 1NG1A 1Q20A 2VDOB 3P32A 1X19A 4BBAA 2FZLA 5LQMA 4LF6B 2NX2A 1Q1ZA 3RBAA 4JZKA 5FWYA 3C1AA 4ZRNA 3RD5A 4J91A 4J29A 1WG8A 3P9NA 2P9BA 3A28A 2NGRA 3HXQA 1WXEA 2XKAA 1WUJS 1KA9H 2JLWA 3PD0A 2FOLA 3ZWCA 4DLWA 5H0IA 3GA0A 1RRFA 3EVEA 1K2WA 2O1EA 2PRKA 3EDMA 1ULUA 4HX5A 5C5DA 2H1VA 4K86A 3TLEA 5KYWA 4KRFA 3SKXA 2QTCA 2FK8A 4IRMA 2EYUA 4QTUB 1WDTA 3EF1A 2A3RA 2X4IA 3PK0A 3V2GA 2J5KA 4CQLB 1BVHA 2JGJA 1ZO8A 3UQYS 1WCIA 5DNCA 4G5GA 1OSNA 1IDOA 5BOSB 1LPAB 3N8IA 5CFZA 1TYAE 1XMJA 1FF9A 1YR8A 3R5SA 4FGUA 2N75A 4GECA 1IOZA 3PE4A 4MR8A 3HXPA 4TTTS 3DC7A 3W7BA 4YRJA 4JEUA 3UJ9A 1CRPA 1JDSA 5TPZA 2W22A 1Z88A 2XMCA 3P9XA 5IVDA 2QTWB 2BLNA 1W75A 2E82A 2B92A 4HPXB 4KVFA 3HACA 1YV9A 2EWMA 2UDPA 2Q45A 2NXEA 3MTAA 3ZE8A 1L7DA 2ZB3A 4DR7B 1R6TA 2PA3A 3C45A 1KQOA 5AM1A 1GL6A 2XA1A 3B7WA 1FK8A 2X1HA 4KE9A 4BAUA 1U3CA 3PIDA 2R47A 1KDTA 1PWHA 4KEAA 5I01A 1HPLA 4R54A 4X63A 5DVZA 3HJAA 1ILWA 3HKCB 1OMOA 2YDXA 1XNHA 2W8BA 1TQ4A 3DB2A 3JQAB 5AI9A 3W8NA 4EA9A 5CDHA 4YO7A 1D1QA 4PZ9A 5DGHA 1XTIA 2EFHB 3IMKA 2JDIA 5BWMA 1JNXX 3TVYA 2WZBA 2LRHA 4YJKA 2DPGA 2ORWA 4UVEA 5EN4A 3SSAA 1OBOA 1HTBA 5M3BA 4KXUA 4COKA 4FD3A 7MHTA 4EWLA 3I2GA 3LAWA 1ZIDA 3OKAA 3EXEB 1C81A 5H3LA 2YRFA 1E2BA 4IKPA 3RF6A 3RREA 3SBDA 4FOTA 5F73A 3SLGA 2BZGA 1KPGA 5LIRA 3MGCA 4WGGA 4JMLA 4FM9A 3MNFA 3IOCA 3L1JA 3ROTA 4I36A 2GLUA 1KI4A 1XQXA 1VDMA 4E30A 4EGQA 3EMBA 3SZMA 4HWPA 4FI3C 3C8ZA 2GXUA 2OZLB 4U6SA 4N6OA 4P93A 4YN3A 3AXTA 2GCOA 3RAPR 3DLBA 2OC4A 2QTVB 2NU6A 1T2EA 1T4DA 1SN7A 3HVHA 1E63A 1ST3A 4WBNA 1RC8A 3JCZA 1X2BA 4K6GA 1XD2B 2FG7C 3UJDA 2GN4A 4LFCB 3B6JA 4XI9A 1VJTA 2BM9A 3AOGA 3SICE 4K3VA 3UWKA 4A2CA 4AIIA 1JVSA 1AVTA 1E1CA 1SHKA 2WUDA 1GZ5A 1V7QA 2B1GA 1AKNA 2OKGA 4ZDKA 1N2EA 1U1DA 3C3YA 5JCZA 1OY1A 5G3YA 4MQ4A 3F9CA 2OCDA 2GJ9A 3AETA 4B33A 1EVYA 3ESCA 1GG2A 1K63A 1JHYA 1DWPA 5FP0A 1G20E 2ZUEA 3TQFA 1W5EA 3D3KA 1FBNA 1O5IA 4U1RA 1ATIA 4IZOA 3KQUA 2YKGA 3N59A 1YQTA 4RA9A 5KYTA 2B83A 3FTNA 4CEJA 1U9JA 3D64A 2QM7A 3IDOA 3UC9A 4R8VA 4CMJA 3MS4A 4LSMA 5TX7A 5LNK6 2PD6A 3ONFA 3PNQA 2PFSA 4YJGA 1IY1A 2JBWA 3N2ZB 2A67A 2B2NA 2O20A 3O95A 4PRKA 2X1MA 5FL7A 1B8PA 4G4IA 5EINA 3IT2A 4AY6A 4H4CA 3SXPA 4YQYA 1WTCA 1COWD 1TI7A 2RIPA 4II7A 5IT4A 3O9MA 3IEKA 2DSNA 3C6QA 4MVJF 2ODNA 1XCJA 3ORYA 3NWJA 1KYQA 4P82A 3U13A 4V0MA 1H0KA 4HI0E 5T8KC 3U4GA 4FXPA 2MYUA 5A4MS 4Y0VA 1QG6A 3IR7A 3C3DA 3H2YA 4H6XA 4KI0A 5AI4A 5HQ3B 3U6KA 3NBFA 2WVHA 4R7GA 5DK4A 2C42A 1EZ4A 4UBIA 1F2UB 1BE0A 2JCGA 3KAKA 4M7WA 1VJ0A 3KCQA 3W6PA 3VNVA 3ELYA 1Z7YA 1L3CA 3HZZA 3WKBA 1HYBA 3MWGA 1U1FA 2WHRA 2Z9BA 3H3FA 3IULA 3JAKB 3L5OA 4YQZA 5CFRA 3RVMA 1JLKA 3AIOA 2FR1A 1THMA 1LQUA 1N1DA 4PGGA 3TQQA 1XN1A 1OAAA 3HJBA 1BOFA 2IYWA 3UA4A 1DKLA 2A5GA 2OHXA 3C39A 1JIIA 1EP1B 4KYIB 2BW0A 5D6NA 5I9TA 1DQPA 1Z6TA 4KX5A 4RL6A 2Y1EA 1I3MA 3KCNA 4DJJA 2GWHA 4TMXA 5CA0F 4RDIA 4J43A 1VCIA 1JSZA 3TXYA 4MB0A 2CVFA 1H4TA 4PV7A 4YGXB 5ICMA 3WK8A 1SD5A 3M70A 5KDLA 1Y89A 1QO9A 1Z7WA 2VZ0A 4P3XA 5DHAA 3UPUA 4PQGA 3ZDYB 3FYUB 1U8XX 2YFKA 4QXPA 1QIGA 4LMBA 5C52B 2JLRA 3KHUA 1P5JA 3GDGA 5B55A 2VF7A 3JWJA 5CXUA 2BFCB 1DG9A 1R66A 4FDUA 4K9RA 2Q9BA 2WZDA 4NV3A 1J90A 5ILOA 2XGJA 1XNGA 2UXDB 4K03A 1E9RA 1D3AA 2Z57A 2GAIA 4ER5A 3LLUA 4F9FA 1ZIOA 2C1ZA 4G09A 2YJZA 2FEOA 3EXG1 5EXXA 5K20A 2N42A 2ECPA 2KPOA 2RHLA 3NNSA 3UBMA 6Q21A 4NWIA 2HWXA 3K92A 4RSGA 5EWLB 5C32A 3D6VA 3PTZA 5IBQA 5KPJA 4J2HA 2EW1A 3R1IA 2CBZA 1H2HA 2PZJA 3HSYA 4AIRA 2R66A 2HHLA 1M7HA 1FJXA 1UJ4A 5A7HA 1O7JA 2RB4A 3H83A 3OTIA 4DMRA 5FQOA 4K28A 5SZIA 2R65A 2J9GA 4ISBA 3G23A 3DFZA 3NGXA 1RI2A 2SCUA 2VR1A 4CKEB 4E5UA 2G7MC 2PANA 1CUYA 3GRCA 4DMLA 4M49A 2GK4A 1TU4A 3ZR4B 4BAGA 5EIBC 2ZJ0A 1HFWA 1WXDA 2AT1A 4QXAA 3DHNA 3K30A 5CNIA 4YR7A 1V1RA 3Q6NA 2PIDA 4JI0B 3H5RA 1QAOA 3FB1A 1YS4A 3H8JA 3W04A 4GKJB 2Z4TA 4DWVA 5TQ2B 1L7AA 2XQFA 5KYUA 2O4UX 5JCJD 2DPYA 3Q8WA 5AVUA 1CR1A 1B7GO 3G8BA 1ZWKA 1MU0A 2ERYA 3TX2A 3SYRA 1PLJA 4P5DA 3OTQA 5LCXA 3ANNA 4GRIA 1HQCA 2Q2WA 2AK2A 9MHTA 2V1XA 5EEGA 1K8YB 1SNYA 1SPBS 3GFQA 3KT6A 3WLNA 3CIFA 3ICVA 1ENZA 1F14A 5C0OE 3D3JA 3N8NA 4HLQB 5JYDA 3G5LA 2QMYA 3EVZA 2PRYA 4F5EA 1K0FA 3GHYA 3MQFA 1TQ6A 4Y18A 2D5AA 2JJ2D 1UEIA 3MBOA 4M7OA 3UMGA 4PPNA 4G85A 4WZAE 4OLFA 3C41J 1SEPA 4TSRA 5T67A 4MB2A 2NXJA 4M46A 4R2MA 1VZ2A 5A9SB 3LI2A 3RU3A 3C7DB 5IS2A 3DQZA 1V4NA 1G6HA 5HCIA 3DMYA 3AEXA 3T3HA 2VDUE 3DFFA 3WBBA 2JVKA 2PUTA 3ELDA 4G4SO 2WAMA 1ZSNA 1RYDA 2EGGA 4ARVA 4BMOB 1B3RA 3COSA 1MO3A 4IEIA 3S1AB 4DRZA 1ISGA 5BSHA 2PE5A 1SHTX 2H2HA 4P5EA 2DHQA 2X9QA 1Q7BA 1IH8A 1DLIA 1C9DB 3ITEA 3WYCA 1EH5A 2JFGA 3WV5A 2ZYGA 3VZPA 3ZVKA 1OYVA 3B48A 1XK7A 4QHTA 5AKXA 3SU8A 3ZX5A 2H2DA 2ADOA 4IP0A 4ZO4A 5DHPA 4C7VA 4R41A 5CIYA 2WF8A 3IIMA 2I7VA 2ZATA 1ZFNA 3U4DA 2GUWA 3GJ7A 3QY9A 2N9UA 2WFLA 4E46A 3OMLA 5FTLA 5LM3A 5SZJA 2ZU0C 1L8XA 2X3FA 4EHJA 1K3FA 2GM9A 3S2SA 3CZ9A 3LP8A 5M5BA 2YZMA 3TQIA 1L4UA 5DEOA 1CQIB 2DZDA 3EZLA 2QLMA 3WIDA 2WSIA 3ZZ0A 5EJ5A 5I7FA 4BMZA 2O14A 1BJTA 1U1EA 4C0JA 1IUOA 3V4RA 2V58A 3ITKA 4YP9A 4NI5A 5A5DA 1GCAA 1XTSA 3K0HA 4TYMA 5E7JA 4ZT4A 3K9QO 4PANA 4N7BA 2Q1UA 2VBCA 3BZBA 4RQAA 4A8JC 4OLBA 3TQSA 1C1DA 1I6LA 3DTTA 5G3ZA 1KI7A 4HUQA 4HFJA 5KSPA 3II6X 1YZQA 4XVCA 3RYFB 1HNWB 3VKFA 4YAFA 2QP3A 3EIWA 1EUQA 4LJRA 1L1EA 1ZUWA 3CVOA 2CUTA 3E35A 4N8SA 4ZZIA 2EKQA 2NO5A 2Y77A 3IELA 5B3AA 1UADA 4UU7A 4C05A 4EMSA 4DUGD 3TTUA 3GMIA 3PGLA 1N6PA 4QUIA 4XWGA 4F4UA 1K3TA 2ZRBA 4H9GA 3HJTA 4RLHA 1YGYA 2PPLA 4J94A 3P20A 5HIKA 1T8TA 2NV2B 2VDWB 2CXSA 2WWIA 4GPTA 4E1AA 4HADA 2ZE6A 1WHSB 1RPNA 4FX2A 3VGJA 3ZJ5A 3QLVA 1N2CA 5ALKA 3BZUA 3GLFA 2PIAA 2HI0A 3LK7A 1CZKA 1XU7A 5KYVA 3GV0A 1B6GA 3OF5A 3AV0B 3BCUA 4P80A 4AQDA 4YCNA 3GLIE 1MVOA 3EG9A 3LYUA 4GRDA 1UFRA 2QAGC 4LYHA 1RCUA 4BO6A 1B73A 3O92A 3ONWA 1ZU5A 4QDTA 5E6SA 1VJDA 1RQXA 4NU8X 2PQ2A 4UUAA 3GDHA 2BFMA 4RD1A 2BFFA 2GQ0A 3K9WA 2D1SA 2UXBB 1TLTA 2IGTA 3DWIA 3L41A 3AUYA 3UJHA 1TU3A 2QX8A 2PL1A 1PEKE 4BMXA 2LIVA 1AMOA 1NI5A 3NC1C 2Y4OA 1RYHA 3GP8A 1T2CA 3CLSD 2V5VA 3COZA 3ZU3A 2X0EA 2WOJA 3DVSX 4L0DA 4J4BA 4JL6A 2DLCX 1WNTA 1T25A 4MW6A 5EAIA 3GT4A 3ABRB 3ZC3A 1AT1A 3GAAA 4JQZA 2ZM5A 2YINC 5DBIA 4NBTA 5F4ZA 3TNLA 4CM8A 1K89A 4BEWA 4P34A 2YQ4A 2AE1A 1NMYA 3LRPA 3NBUA 4C5CA 1A1SA 4N3AA 4UMFA 2AB0A 1DX9A 4RLQA 1ODCA 4FYPA 3LPAA 3K0AB 4LCEA 1JFRA 3VNRA 1DQYA 5EZ6B 3GJTA 1C9KA 4D8TA 3I30X 4MQBA 1IPEA 4CTJA 5JRDS 4LPKA 3TCKA 1EWVA 3QX9A 1RWQA 5EJGA 3WLAA 4OHVA 1SC9A 2YWGA 3U3KA 3MZ0A 1VBNA 2FFJA 4LOLA 3T1TA 1E7YA 4EHNA 3JZMA 2QVYX 4EAQA 4EB6A 1T0PA 3IKVA 3IMEA 4OFZA 2E4VA 3FPGA 3V9AA 2XNKA 1L7NA 5SZKB 5HWSA 1KPHA 2CV2A 3HO1A 1SXJA 3OEEA 1J8DA 4L8LA 3BXZA 4LMRA 4G8BA 2VH5R 4FFSA 2NYAA 3VQTA 4ETWA 3SEAA 1KQPA 3T95A 3VOBA 3B5EA 4EB8A 1IXRC 1PHPA 4MVXA 4AF7A 1HG0A 1SIWA 1RWNA 1KDVA 5E6RA 2SNIE 3LUDA 4XM1A 4V0KA 2VF2A 4UUPA 5LZ9A 3CCFA 3DXYA 4MK4A 4EL0A 4LRSB 1U2QA 5B3JA 1WZCA 1OLUB 4AECA 2O2ZA 1ODFA 3PFWO 4ROSA 4Y6SA 1PLLA 4JFAA 5K51A 1T6ZA 3DFIA 1CY8A 1T8PA 1IBKB 1DWUA 1L5LA 4B3MB 1SCJA 1YS1X 3GOHA 1DJNA 5FV7A 1L4GA 1OYWA 3GBVA 4R4JA 5DYYA 3W5UA 3STYA 1P0FA 3ED5A 5CGZA 1D07A 3ABQB 4ZT5A 1JGTA 4LF5B 2ICAA 4L22A 2RE8A 4NE2A 1KP3A 2V0NA 4IFBA 1XVUA 1ECBA 3R7DA 4FYMA 2JRCA 3R20A 2OORA 2PUGA 1HEIA 3L4EA 5CLLA 1I2AA 3PC6A 4TTJA 4M83A 4JJ8A 3S0JA 2WVAA 1QS0A 3UY4A 1JSCA 5EWMB 2IEBA 5C1PA 1QTNA 3WRVA 2P35A 4ZMSA 1O89A 3LHDA 4Q3EA 4IMJB 4KW7A 5GGXA 4CQLA 4DCJA 5LA6A 4U2DA 3SXUA 1R6VA 4Y6GB 3NUGA 4G8CA 1BD3A 5EKSA 5FFFA 1L7PA 5BOSA 2JB9A 2QX7A 3CQ9A 2Q5LA 2JAHA 2YS6A 3ZE0B 2HTEA 4QIHA 3GEBA 3MRSA 1CB7A 1XDDA 2AX4A 3LW8A 4F3CA 4HNHA 4UE3S 4CFYA 1T3LA 3PZRA 3GLGA 3T7JA 3UATA 5CA0B 2ZKLA 1BH6A 1HQYE 2CF5A 2JI8A 3HDVA 4LYJA 4R9UC 2C59A 3EQ6A 4WCFB 4JR1A 2NNLD 4FR2A 5K0LA 4ZVSA 1OTXA 1QGOA 4RACA 2C98A 3ZQUA 1JJFA 4QO7A 1VFPA 1XRSB 3T7IA 3ANTA 3PDJA 1CUWA 1EK0A 1TVMA 3F71A 4UUOA 3V4OA 2OHOA 3TI7A 3UG6A 3OJFA 3RADC 3E53A 4EI2A 3GYGA 3HKCA 4B1FA 3EGXB 1CFJA 2PFGA 2ZSKA 4FFPA 2WIBA 2FSHA 2QQGA 4EW1A 1Z2EA 2YVAA 5HIMA 2HIAA 4MQEB 4TL6A 5J9FA 4EJMA 4MRMB 3G85A 1U1IA 2QTRA 1UJNA 3PX2A 2Y1XA 4O5AA 4BLTA 3NTXA 3RJZA 3O8RA 1MX9A 3QPVA 2D54A 1VM6A 3EXEA 4WDRA 3GC6A 3U16A 4DAEA 4S1NA 1QO0D 5JSZB 3V8RA 2CKDA 1EM8B 5LU9A 3JZDA 4IQFA 4CHGA 3FAZA 1OIWA 3GFVA 3LUHA 4I5FA 3A06A 5CCXA 1FRFS 1ZI6A 2JFWA 2C5HA 2ZWAA 3VDXA 4GKKB 4LSGA 4V24A 2YNMC 3RCBA 4F97A 2VFAA 1NW9B 4BC0A 4BP3A 2ONYA 3I2KA 1YCDA 3L05A 1T4CB 3N6VA 3NV7A 4KQKA 1NE7A 5HRCA 5JAUA 2XBMA 2QTVA 1Q0UA 3OZWA 1NW4A 1S8NA 1XF9A 3GEDA 2J59A 4QJBA 4EM6A 1LX7A 4WLNA 1Z08A 1A5BB 3RTDA 3SLKA 5CDYA 1U28C 1MTZA 4DB4A 3P2EA 3HKEA 1B23P 3DDSA 3EAQA 2QI9C 1P2FA 3J80A 2ACVA 1R8SA 2B8JA 4ZCPA 4WIAA 2BLLA 2DG2A 3E15A 2CLHB 3KKNA 4BVGA 1DX4A 3LCCA 3UCXA 4YRNA 5BVHB 2EERA 3ECCA 4EEZA 1HORA 1H5UA 2QT0A 3S99A 5BRJA 1Y5RA 1E9VA 1EGHA 3CRMA 3TQHA 1ZHHA 2B8WA 1DDOA 5IDWA 2AG5A 1T5SA 2FLWA 4UBOA 5IN4A 4X54A 1P31A 2VJBA 1T5BA 4JP5A 4B46A 3HM9A 2QS9A 2R4QA 2WUGA 1PSWA 2OB1A 3IUEA 4MGHA 1LF0A 3JYQA 4Y7DA 4O1HA 2AEEA 1F06A 1N6NA 1KP2A 2GM5A 2P78A 4NK4A 1ZW6A 4PG6A 4Q7JB 4CF7A 4L8FA 3IHTA 1E1RA 3AKEA 3HQ4O 1Z6ZA 2W2VA 1MO6A 4X8MA 1HI9A 1ZM3A 2OSBA 1SZPA 3QNMA 1ECFA 8OHMA 2VJCA 1Z73A 3TTTA 4X90A 3ZU2A 3K6SB 2OP1A 3LC1O 1G8YA 5LN1A 2IV3A 1O58A 3QLUA 2V74B 3HCNA 3ZNNA 1V4BA 2I2WA 2ZB2A 3D0QA 3OIDA 3UMVA 1E3MA 5KNCD 1C7IA 5K05A 1ZR2A 4Q1EA 3F3KA 1CVIA 1E1LA 4O2BF 2ZPAA 5DZSA 3L4KA 5J3JA 1A7UA 1X94A 2QJFA 2RB5A 3LGXA 4BUCA 2C0QA 1WW8A 1SXQA 1L5WA 1EIWA 3ZE9A 2ONKA 1JSLA 3KUUA 3WYBA 2R4UA 1A1VA 1U7PA 1DU4A 3KLBA 1F2UA 2E5FA 3MRTA 1CUXA 2C78A 2UYGA 4NPHA 1ZXLA 2E5LB 3AVYA 1X8XA 1GV1A 3FOFC 3HJCA 3DG9A 4NBVA 1NNSA 1YMUA 4YT2A 1K8ZB 1PR0A 1Z28A 3HDYA 3FWHA 4PZCA 4HWOA 1L7QA 5JLJA 3IJPA 3F7OA 3QUSA 2ACEA 1B6TA 4W8GA 3SX0A 2WAOA 1XZKA 5K0NA 4MV1A 3RIEA 1B43A 1NBIA 1OXSC 1TM2A 4NMXB 2BVNA 2WY2D 4JBHA 1R9GA 1DQRA 2PUVA 3VC3A 3UMFA 3LLSA 2FEAA 2W4MA 2E89A 2I66A 3EDYA 4LXHA 3KS9A 2IBMA 2Q27A 3FXAA 1VIYA 2WG1A 5F7JA 3WQBA 1P7VA 1VBFA 5AOAA 2YFQA 1CY0A 1NN3A 4CM4B 5DM1A 2LD4A 1VPDA 1UDXA 3WZLA 2OV2A 2AQHA 3BXOA 3FYUA 5JCOC 1PJ4A 5SYNA 3V4VB 1CTQA 4IVRA 3JRNA 2BFCA 3E05A 2YBDA 3A9TA 1FUEA 4O63O 2JLAA 3DBOB 3PHBE 3PQ6A 2AFHB 3P27A 1ADJA 1JMVA 3NP9A 4MGEA 4P7GA 3RC3A 4HVLA 1UT6A 2X8WA 1QH8B 1RWVA 5K0ZA 3HKBB 3E9YA 4RK5A 3OA0A 4CWAA 2JGFA 1NVUQ 2J6CA 1YFJA 1HDIA 2Y67A 3NKLA 5JI3E 4WJZA 2ZRFA 4X24A 2QR5A 5DN9A 4FYXA 4BWVA 3TLAA 5JRZA 3I5XA 5LIPA 3K72B 4C6TB 4ZHQF 4ZOAA 4EABA 1FNNA 3Q5GA 2IV7A 3SLRA 5MFPA 1HSZA 4P4GA 4E33A 1SPXA 1QK3A 3LHKA 4FMBB 4QU9A 4IQGA 4UCXA 4V1CB 5CD9A 3NBXX 1EFTA 3MMZA 2I7CA 2BGGA 1HKUA 1FP7A 4AJEA 5LDGA 4Q4HB 4BL5A 4C7KA 4PSKA 5I5GA 4AMUA 1UK8A 4A8TA 4CEIA 4CCSA 4TWRA 1SKUA 3IURA 3G82C 5K4AA 3GJ3A 2HPVA 2C8JA 1V6AA 5TQ2A 4KXVA 2XVXA 3F5DA 2I5PO 4ITUA 5D51S 1R5NA 3UCEA 2OXRA 4UASA 1L5MA 3WIUA 4M8IA 4UHFA 1X8KA 1BGVA 1LDGA 2Q5FA 2FLKA 3TOSA 2HF7A 3HO6A 4N41A 1KDOA 1BCRB 2IHTA 1OAKA 3O03A 1I30A 2ZI7A 3BMNB 4XOIA 2KJQA 2CC2A 1ID1A 2YUTA 3UNXA 1ZMOA 2B35A 2GWRA 2IXBA 4DA8A 3NBZC 2XT0A 1TZKA 1U80A 1HM5A 3LFHA 3R6GA 3RBXA 1UBMS 2IE0A 3L8EA 4LY9A 2NVBA 5D5HA 3HZRA 1OT3A 2YQ5A 2YXPX 1HLFA 2G63A 3PBKA 1X86B 4EPYA 4Q82A 4KNWA 3A0UA 3FFBA 4ICIA 4X1YB 1XNRB 1QIEA 2YOGA 1H4QA 3DZBA 1RBQA 5A9SA 4YCLA 3WG9A 2FUKA 3VR6A 2IT1A 1KAMA 4IM7A 4A2WA 1J23A 2GN2A 2W4QA 4YJFB 3VYRB 4ER3A 2BJWA 5IXSA 1MJNA 1T9GR 2BEUA 2XV1A 3P9RA 1M1YA 3P7MA 5AXAA 5BV2P 3IEVA 5HZKA 4JYCA 5I8PA 4AKTA 2ERCA 3IESA 3OZDA 3TTVA 3S1AA 1ECCA 1HV8A 3UUWA 5AVQA 1PUJA 3CPHA 4NCIA 1SQ0A 2O2YA 4QLAA 2ZXFA 5IAJA 3UJ6A 4I5IA 3GD5A 3OZ7A 3QE3A 4ZVTA 4A1OA 2J45A 3EHDA 2DFNA 2QXUA 2XNSA 4EQ6B 1V5FA 1YZVA 4B80A 1JHUA 3U7IA 1UANA 2W7TA 5BRAA 2KE5A 2WM2A 3IBGA 3HDJA 1I2DA 1WU8A 1BFUA 3GPDG 2QRNA 2B6HA 3L92A 4G0XA 4WKOA 1W52X 1O94C 3UN1A 2HSDA 3VU0A 3ZVLA 4BHTA 3VMMA 5I3CA 1U4OA 2WJ4A 5ALJA 1NDQA 2GF9A 3CY6A 1IY2A 3WDMA 3A9SA 3R44A 4X45A 3DR3A 4ZPXA 1KFKB 2YWHA 3FSGD 4IG9A 1MBZA 2WAXA 1U9YA 2QG4A 2VBGA 1UQRA 4RD4A 4ZOQI 2I3DA 3QUQA 3WAKA 4A4DA 4IHJB 5KNCH 2JAXA 2FMFA 1CQIA 1B42A 1R74A 4AJPA 2QD2A 3X1WA 4X6YA 1EIZA 4N82A 1JUDA 4DYHA 4JLMA 2C92A 5KOJB 2CT8A 1H2WA 1LB1B 1XMPA 5CW2A 5C2JB 1SELA 4J16A 4B9EA 2JFZA 5JADA 1M34E 1A5TA 1BWRA 1ZOIA 4R1OA 1ZUNB 4YAIA 4OQ4A 4Y6OA 3RYFA 4FEYA 3E7DA 4ZDWA 1KK0A 2P2CA 4Q7EA 4Y9RA 1C50A 1GPJA 2O3SA 4K0KB 4WXYB 4AF6A 3ZGNA 4RWZA 4RE5A 4FGSA 4WKBA 4HN4B 3OVMA 2XZOA 3GLHA 5ADUS 3PNMA 2ODWA 4L5YA 2IZOA 2ZDHA 4AXXA 1C80A 4L07A 2O2EA 2O0KA 4LE0A 1P29A 1KJNA 4KZKA 4EO9A 5FXMA 4KE8A 3PEUA 2VDWA 5IABA 2B7CA 2WC1A 4EF6A 3IKMB 3KHKA 1WHSA 2EHDA 4BVKA 3SZ3A 1O6GA 3AW9A 3D7SA 4IS3A 5CBKA 3C97A 1LUAA 5C7LO 3EVGA 3I4LA 5HF6A 5J2TF 3ZCPA 1GUAA 2G1AA 4B31A 4CMEC 3H4TA 2QJTA 4FYYA 5JZ9A 4FS8A 2BT4A 4GLLA 3DLAA 2W71A 5JDCA 2AZMA 1GAQA 1MOQA 5EVJA 3JQ9A 3M34A 4PQEA 1QYWA 1Z6GA 2XWSA 5D01A 1CVRA 1ZY2A 4K5QA 4A7PA 4QPZA 1W46A 3HVJA 2FSIA 3TZHA 8ATCA 1ZJ4A 1PI3A 3DHVA 3RUPA 3PLAE 4LGCA 4EFLA 4E03A 2WTMA 3H9EO 2BFBB 3GJ8A 4HUJA 2RAUA 3CW2A 3SF8A 4MVJP 4E22A 2MINB 4U9HS 1U0FA 3C5HA 3H11B 5GMOA 2BR5A 5C46F 3AR3A 3C2QA 3CF4A 3L49A 5DM70 1H2BA 4XXHA 1S7GA 5C51B 2FSSA 3RE1A 2Z4SA 2W93A 2FPKA 3B6ZA 2IQIA 5FBKA 2R8BA 5E1DA 3CEMA 1J6UA 2JS7A 2XUIA 3K0AA 1AXRA 3OQIB 3REOA 3ROQA 5KTNA 1NF3A 3EJ6A 1NTRA 5CDUA 1G59A 2W6ID 2HY7A 5AXBA 2G5PA 2P0EA 4A0HA 2XH8A 3P9ZA 4TRMA 4D0GA 2WFMA 1YRAA 4PE5B 3TLYA 3QPCA 1YR2A 1TYDE 3TF5A 3SGLA 1P75A 3M9XA 4WZZA 3H3XA 3QKSB 3R0JA 5AJVB 3ZK7A 2XZLA 3OH8A 1Q6ZA 4BFVA 3CMCO 4JP1A 9LDBA 2AI3A 1Y5NA 4L73A 1GYRA 3C3AA 4CZ2A 2H6EA 4D9MA 4HDMB 5JYCA 3LECA 4GL4A 3UOGA 2D5LA 4Q3AA 4JOSA 3WWOA 1RE1A 3JQFC 4QJIA 5BYJA 4O3FA 4Z3OA 1H69A 4BNDB 1KMQA 3UGJA 5JCXA 4RZIA 3V7YA 2RK6A 4ZYVA 1W93A 1XMSA 3OOWA 1D09A 2Y92A 1UBCA 1ESDA 1MJFA 4ZU6X 1Q3TA 1M72A 1S3FA 2PD3A 1WOYA 3SP1A 3HKDB 1KAOA 3GLVA 3TPCA 2QUZA 3S44A 2IFTA 4EX7A 1OLUA 3HB0A 4MZXA 3TQTA 2XGSA 1U7HA 3UPTA 1Y1SA 4XDHA 1Z5WA 1Y1TA 3BORA 2F9FA 1G3RA 1JFLA 4QJ4A 1I4OA 4WKPA 5FA8A 1LNQA 5GADl 4MRAA 4ZEOA 2Q21A 3KWMA 1A77A 4LCBA 5IJXA 4D5GA 1E6EA 3RHFA 4C2TA 4M1QA 4YBRA 1JIUA 4JNKA 5EHGA 1RWPA 2LWIA 1BW9B 4S0ZA 2CXRA 1AQ6A 5EMMA 2EEZA 4U2FA 1SXJE 1V26A 4K6OA 1GV0A 4CV1A 1V3TA 3GBPA 5C5EA 5IUJC 4H2DA 2NP6A 4MVJA 2D8MA 4BVEA 5J43A 1PTJA 2XT6A 3SM9A 1AQUA 3KB2A 1P73A 4KWCA 4P9NA 4TVOA 3KAQA 2C9ZA 5EWMA 2PWYA 1ZX1A 1OD6A 2YMQA 5E38A 4O2BB 3TPZA 5DOVA 2QY9A 3EWSA 1B0PA 3PENA 4LRYA 1U8YA 2DKOA 3EXFA 1Y8ZA 1WCYA 4C7OB 2OAQ1 2FWMX 3HCDA 4NYMR 3S40A 1RRCA 3WJ7A 2QSZA 3EIFA 4FWBA 2RGNC 2YHSA 4LG1A 4UNRA 1GY8A 1P6XA 3MTJA 4D74A 3RI3A 1QHNA 2NVUB 3VVCA 4F04A 3COJA 1IXSB 1N25A 1QVRA 5EYPB 3MFYA 5I9BA 4EMUA 4NARA 2HJVA 1VLZA 4X1KB 2P68A 3FYCA 3LBFA 4F0JA 1R00A 5BWBA 4QTZA 5CA0A 2HBRA 5K1ZA 4P5PA 4WCFA 4X62B 5AVYA 4TLCA 4XCXA 3M1YA 2J7KA 3EMVA 1WD5A 3IGFA 5I4IA 5DEIA 3TB6A 2ZT8A 3BGIA 4JVNA 3WWCA 2QHXA 4AULA 5COQA 1S9DA 3FRIA 3I4CA 4YMLA 5EE1A 3CUEF 3D59A 3OZRA 5CT5A 5JSFA 4AY3A 4ZOEA 3PF9A 4DMUB 3EGXA 4UXJA 2CL6X 3UIEA 4CDNA 3A3NA 1CR4A 2D5BA 3NKVA 1T5IA 4MQEA 1TX4B 4MZDA 1BHO1 3LT1A 4HEHA 1APBA 5KSYA 3K0BA 4MRMA 1IEXA 3SJZA 2FEMA 2JIDA 2ZVJA 3I3OA 3BD9A 4LGMA 3GLGE 1TEVA 2PS1A 1MEEA 5FWXB 1TA9A 1RCFA 1Z56C 3W5JA 2P4QA 5TE9A 4ZHQB 3I04M 3QVTA 5JSZA 2DQSA 2G4VA 1EM8A 3NVDA 3CW9A 4KAXA 2G40A 2GHTA 1GFZA 3WQQA 1JECA 1Z7EA 4FEAA 1BXKA 3WRXC 5LP6F 2XA9A 3RIGA 4KLAA 4Y30A 4P4LA 5CURA 1CDEA 2J0UB 3HLTA 5GIPE 1XRQA 3N2GB 3OURA 4YV0A 2WINI 2P2ZA 3CB4A 4IILA 2ZJAA 3A2LA 4MRSA 3ZI7A 7ABPA 4E2ZA 3BYZA 3GELA 1EFAA 1T4CA 1JR2A 5FNZA 1P2UA 4NZMA 1CE8B 3TTYA 4B45A 4EF4A 1XYVA 1T13A 4TV9F 4ZWNA 2F3SA 3IUPA 3Q6IA 2N3ZA 3URMA 1K4YA 2ZIGA 3KBBA 1GFSA 1K06A 1XAHA 2JIQA 2WNIA 3FM9A 3DB1A 1B4DA 1BEUB 2BFPA 3PPYA 1ZD2P 2RHGB 3OOEA 1JAXA 1JZTA 2ZBUA 2PLWA 3N0VA 2NO0A 4NULA 3QV1A 4ZQFA 4C88A 4RF3A 1N2BA 4E1BA 4EI9A 1VPLA 2RAVA 2VT7A 2EL9A 4HQ0A 1V0JA 4QREA 1QU3A 2X7HA 2A9FA 3BTUA 4NCNA 1RCTE 3QTLA 4DR1B 3O8DA 2Z08A 4GFDA 3USZA 3WNZA 2XMQA 5PNTA 3CVUA 2XCOA 3DPUA 1P72A 3KUKA 3WISA 5JXGA 2IYNA 1XR3A 4NFLA 1GKKA 1KR5A 1DIGA 1KAGA 4EBBA 1R0YA 2PV7A 2PXAA 4TTVA 4GICA 5E1MA 2HK6A 3BE8A 4Y1FA 5F2OA 4F85A 1ZICA 4XQCA 1FJHA 1JAHA 1UBKS 2ZPTX 4AUNA 1AK1A 3IAM6 4FHFA 4HNUA 3DUWA 2HIMA 4YJ3F 2OILA 2XE6A 1ZMBA 2ZQZA 3HN2A 3MRVA 3PS9A 3W79A 3K6SA 3AVOA 1UPAA 5T4FA 4AKGA 4KQIA 5G4KB 1UAYA 3UCFA 3JAWA 5IC5A 1E9AA 1QNLA 5B1HA 3WGYA 1G8GA 2P77A 3D3EA 1KH2A 4GAEA 1ZZGA 2P0AA 1KEWA 3RK1A 5FULA 4F4HA 3CZQA 2DBYA 1Z5UA 2ZWOA 2EU8A 3FOAA 3MGKA 1AB6A 3OIWA 3PXBA 1UZLA 3L8HA 5KYNA 4DV0B 1PV2A 1A9ZA 3PUIA 2C29D 4LSWA 5J2UF 4E7OA 5C80A 2IP2A 2GN0A 2FW8A 4NCXA 2IPXA 5BSUA 1RLIA 3DMTA 4PXSA 1BQ3A 1DFHA 4HYEA 1UP4A 3DTVB 3VSEA 2P2YA 3AVWA 2YXNA 3CFYA 2GEVA 4E32A 2FW9A 2C5AA 5TF4A 2NAFA 1ZD5A 4JMPA 4ND2A 2DHDA 1GPDG 3C6ZA 4BVLA 3VPHA 2B4TO 3Q2KA 4G26A 4IWXA 3EN0A 1SK8A 2I7TA 2R97A 3JQBA 4I8DA 2VN8A 3RT9A 3PGXA 3K1TA 2OV6A 2RAFA 4HLUA 1KJWA 4I5DA 5JFOA 2Z6QA 2OZPA 3AF6A 4KSBA 1FMFA 5BP7A 4WDQA 2CSXA 4BVAA 2A5LA 2C2YA 1XWWA 1BVUA 1L7EA 3NT5A 4TTSA 5E2IA 3WL5A 1JR3D 1WY5A 3IP1A 1CX9B 2UV8A 4CM4A 4J76A 2DOKA 4DIBA 2Y6UA 5HJ7A 4D0LB 2I2FA 2YCLA 5KQPA 1RLUA 3LL7A 4HNVA 4X7PA 3MA0A 1SIOA 1AO3A 2Z04A 1L4EA 1Y3DE 1A0OA 4I9GA 1NP3A 2O6HA 3TAUA 5EQJB 2AFHA 1GPLA 2V7QA 4FYVA 2ZIEA 4GYKA 4MV6A 1QH8A 4GS5A 1KMNA 4INPA 4L16A 5GVRA 3HP7A 3VR4D 1WB9A 2W2OA 1OFVA 3QXHA 1BIFA 2V5UA 1J99A 3BL8A 4G97A 3B52X 2FQQA 3F8SA 3W5IA 2KHZA 2AJLI 5J2TB 5D3QA 2HRDA 4ZJUA 5EHIA 1U9CA 3RSGA 3ZDFA 5KKNB 1CQJB 1UOQA 1EUYA 4NFSA 3U3JA 4B7CA 2O07A 3K2QA 4M8SA 2X0FA 1C7RA 2M1XA 1STOA 2XTAA 4R84A 5JNWA 5H8WA 1Z0JA 2Z8YM 3H3JA 4TTQA 5KNLA 1R6AA 2K7FA 4BZPA 2QN7A 1MO5A 2TS1A 2XNDD 4ARSA 2WKPA 5BXYA 1NJGA 3OIYA 2O19A 3KUCA 2VF4X 2R62A 2YWRA 3M6IA 4XUGB 2CL7X 4O4IF 2QVBA 4FHCA 3A05A 2NIPA 3JX9A 3FCXA 4U8GA 3HLYA 2JJ1D 1OXBB 2YRXA 1QBKC 4OB7A 2Q5IA 1XPOA 1O9BA 1AA9A 3Q0IA 1L8LA 4Y9SA 1YQDA 1FSSA 3LQ1A 5KMGB 1G18A 3D02A 2BISA 3EEQA 1E58A 5K8LA 1PJQA 2JIZA 5DGCA 3UAWA 3OU6A 2JH3A 3BHJA 4MMXB 4RYDA 3TW0A 4E12A 3T5DA 1BCRA 2XB4A 2GESA 4AC9A 5GP1A 2BGJA 2HPHA 4YRAA 1E62A 2FPGA 1C0EA 1K8RA 2QD1A 5DYTA 3CLKA 3VC7A 3V7WA 1NVVR 5FA6A 1SQFA 3FVRA 4JLUA 1T15A 3GVXA 3UMBA 4FMCF 4Q3BA 4I8IA 4LV6A 1CR2A 2FPSA 1JL3A 4R40A 3O82A 1R0LA 4PHCA 3NTRA 3L4JA 4X1YA 3BIFA 2XMGA 4GT1A 4P2GA 4QUDA 1S5PA 4C4XA 3LWZA 4AS1A 1TMGE 5EJFA 2I6TA 3MHPA 3OEWA 1GZUA 2AC7A 3BWVA 1NW8A 4YJFA 1DAEA 3L4SO 2X9GA 1GZ6A 1YUMA 5FORA 4RJJA 3BPSA 1B41A 4ZT7A 3ETHA 3M33A 1OBCA 4G8DA 1J39A 4YREA 1KU6A 4OQFA 4Y1EA 2P75A 2GZ2A 1KQNA 2KB0A 4OQLA 2HA3A 4IH9A 1WPQA 3DO8A 4EY8A 4LXXA 1VE6A 1MRSA 2IS1A 4HGZA 2HLPA 2IIBA 4EQ6A 2CLFB 1XROA 1N8TA 2IXAA 1L5KA 4C6HA 1QCZA 4GBGA 2D2EA 2H5LA 3PHLA 3RT1A 3HK2A 5IM5A 2YC4C 3X1DA 3SDBA 2HX1A 4K46A 3MELA 2CLSA 3Q11A 1FQJA 2G5TA 2GPBA 3KQSA 5CNJA 2V54A 5FI3A 1U99A 4W5TA 1KARA 4KI7A 2WR8A 3QSYA 4BE7B 2GDZA 1VI6A 1II9A 2ZWMA 4G4JA 1M1YE 1JYEA 3QNWA 4GYJA 4RSHA 3ZCVA 4BQOA 2WP8J 2R7NA 3G5MA 2GZ3A 1XKXA 4IHJA 2Q1XA 1EVEA 3O4RA 4PIMA 4URUR 1DO8A 2AFIE 4YMHA 1IK4A 2GILA 4ZEXA 4OSEA 4B6RA 5IT9A 3F7NA 2VHJA 5KOJA 4UHCA 1C30B 3HBAA 3OBBA 1L8AA 1ZZEA 2EYQA 4Q7LA 4RXTA 5B6PA 5FPKA 3IV9A 1HEUA 5B53A 3JYNA 1ZUNA 1FP1D 1EP9A 3BIXA 2B4AA 3C0KA 3ROFA 3PQ7A 3VPFA 3HN7A 1R16A 1WS6A 3QOYA 3OM9A 5JTUA 4LHZA 2XMBA 4ZO8A 1JKIA 1RYBA 2R8PA 3DC2A 3ET4A 3T7CA 3AUTA 3NEYA 4RIIA 3P9CA 1YZGA 4FB5A 3IPLA 3U09A 3JD2A 5B1DA 3ISTA 5AVOA 3K9CA 4QBIA 4Y6QA 4FHDA 2NYRA 4XYMA 3S8MA 4BLQA 2NTVA 4Y3UA 3ROPA 2PT5A 1XP8A 1UK9A 3NHLA 3ITNA 2TECE 4M0LA 1JU3A 3HUTA 4UUMA 3HC7A 4MDHA 3ENQA 2R9VA 4BQPA 1UWKA 1H2XA 4OHBA 4OI2A 1P8AA 4LJ8A 3TSOA 3OE4A 2IKQA 1DC5A 1K27A 4INOA 1Y8AA 1YMQA 3TXXA 3VPAA 2J6HA 1M0EA 2CY0A 1ABFA 5THQA 1AB5A 4C0LA 1C0IA 2AZDA 2FUNB 3AY7A 3C1OA 1GZ4A 3GFPA 3CNNA 3TWOA 1Q2UA 2EP5A 5ANRB 1Z8FA 3NC0C 1UBNA 2GMWA 4P4SB 4Y2PA 5CB4F 1JH9A 3OTWA 1Y63A 3VR4H 1JJBA 3KPYA 4JU9A 2YW2A 1EMDA 4PLWA 3ZHUA 3GLHE 1Q2XA 3AVPA 5L3RA 5BR4A 1J1IA 1ZXBA 4H3SA 4OV6B 2GPJA 3S70A 1P1CA 3ZCRA 1I36A 4M9ZA 2BFBA 1NXPA 1Q21A 1SU4A 2B9EA 2O3QA 1XZMA 2XBLA 1KZYC 2CHEA 3WMEA 3DXZA 1MVNA 2MINA 1OI4A 1VMEA 3PFBA 2RI6A 2C4WA 3H11A 3PIRA 1SU6A 3R0IA 3IDAA 3PF8A 3PWZA 3SJUA 5LP6B 2BGWA 4X00A 4IVPA 4P53A 1Z4OA 1XJQA 2GERA 4IF6A 4JLVA 2XIJA 8AT1A 5K0SA 5L8VA 3UOWA 4EFDA 4ZCTA 4OOEA 3COYA 1Q92A 3OQIA 3UB4A 3BWBA 3ZHTA 3L02A 1WUYA 4BN5A 2ROQA 3CLUD 4CLEA 2VTBA 2D0DA 2HB6A 4C2UA 1FYEA 4TV9B 5CLGA 4XW2A 2ZJ7A 1P0MA 1CR0A 1U0SY 4P3NA 4WMLA 4EGFA 1UBJS 1DQSA 1UPFA 1A3CA 3VPXA 5AM3A 3QKSA 3GCGA 2XUHA 1B0AA 2ZSHA 2OKCA 4AG5A 1M0SA 2IC5A 3OCUA 1WCWA 3UAXA 2I03A 1Z5GA 3ZYCA 4HDMA 1GNQA 2RHBA 2Y2VA 3E0XA 4A9AA 4NIMA 2DETA 2CSUA 4M3NA 5G0TA 3WB0A 4RVOA 4XVUA 4Y0AA 5F5LA 2H1LA 2VHCA 4FZJA 4RKQA 2CDRA 1E5VA 1UJCA 1VRCA 1MXFA 3SR0A 4IIYA 2GLXA 5JS7A 5HTOA 2PXCA 2Z6VA 3WA6A 3CBQA 4DCOA 1AUPA 2PXXA 3PFGA 1Y81A 4U2CA 2GVDC 4YV2A 4O2LA 5KUTA 3K20A 2C9YA 4H0CA 2GBGA 3EW7A 2K5UA 2KLBA 1MX3A 4PZDA 4QUKA 1MJGA 4L7VA 2X5KO 4XVRA 5FEMA 5GTDA 4S1OA 3KVRA 2Q62A 2VXCA 3K73O 1TB4A 1B00A 2REOA 4YJ3B 3DZGA 5IRCD 4ZVUA 3KQMA 4DOMA 4CKWB 4M37A 4HB0A 5IMBA 3ZIAA 1SZCA 1BW9A 3WLEA 3NHFA 2AJCA 5DI3B 1A7JA 2IDZA 2D62A 4EJ6A 2RHRA 2GZAA 5KOHB 1K0UA 2H08A 1MEJA 2H2IA 2N1MA 1KI3A 3N6RA 2IOFA 3W5HA 1DINA 4DNXA 4JLJA 4WOBA 3MT7A 5FLEX 1T34A 3D1LA 2AX3A 3UMRA 4O2BA 3A3YA 1Q0QA 1U7ZA 1E1DA 2OY0A 4LY3A 4RF2A 1DWOA 3DFMA 3R41A 4B74A 5J2UB 4D3FA 3PU6A 1CZNA 1NRJB 4ITVA 2HSJA 1ZK0A 4TKMA 3QW2A 1N2OA 1MEOA 3KX2A 3MOIA 4A10A 5LQKA 1VLHA 3NBKA 2EZ8A 1P0QA 1SKYE 2QMHA 4JV5B 1E3SA 2HNBA 2ZUVA 3ZWYA 2J9XB 4L75A 3CNBA 4F86A 2BF4A 1L5QA 3VU3A 2AC4A 2NVUA 2IYUA 1P1IA 3BMCB 1KEVA 3NJRA 5EYPA 3RHZA 3T38A 3GPLA 4ZK6A 5CEFA 2HXYA 4X1KA 4ALLA 2EKDA 3IQZA 1BKSB 4X7MA 3C87A 1JZSA 4M8KA 3ESRA 1JA1A 2WA2A 1T2UA 3MJVA 4N54A 4RZ2A 3HV0A 4J2TA 4GSKA 3GDOA 5EPEA 3FETA 1USUA 2G7ZA 4V2UA 1WE2A 3DAFA 1DCMA 4JJ6A 4UE6A 5KU7A 1VIVA 4C0KA 2J0QA 2VDKB 4DLTA 3HP1A 3WQSB 1BE8A 4GEKA 3GFOA 1N5LA 3QPAA 1NQTA 2WJZB 2FVYA 5AW7A 1NMQA 3EWIA 4DNFA 1FIUA 3JR3A 2HMTA 3DKKA 3B5IA 4ZOBA 2ZS8A 4I6GA 3D8BA 1GTRA 3EFBA 4FIZA 4ZTUB 3AOEC 3VU9B 3LQYA 5LXTF 1R0KA 5FWXA 4PVDA 2BKAA 2HRRA 3KZVA 1T2DA 3CLTD 2EKZA 2P2GA 4YUXA 1X42A 2G76A 5DWDA 4ZHQA 2G6TA 4IRUB 4G9GA 4TKVB 2KI5A 1JQJC 5BR1A 1QQTA 2VXBA 3WXMA 4HX2A 3SAJA 2GYYA 3GIWA 1YZ3A 1IM8A 2P5TB 1Z4QA 3CEPB 5FNVF 3WLLA 2J0UA 2QRVB 1VL5A 4G0MA 1H23A 1WZUA 1X80B 1VCNA 3N2GA 3NXKA 3H6HA 4JR2A 1ECGA 5AKZA 3UICA 3ZV7A 4XWTA 1SQGA 4QM7A 2DKNA 3I6QA 5A03A 2VWQA 4O4IB 1H93A 4MKGA 3JARB 3KOWA 4U5XA 5CDFA 1EXVA 1CE8A 2AR7A 1FDVA 1FSZA 4NYJQ 1KEZA 1RRGA 1QHHB 3EZFA 1QX4A 4IJUA 4KTVE 3GRYA 2TSYB 2JPDA 5EXDA 5FCDA 3NCTA 4L4UA 2H2AA 4ND7A 2RCYA 3AI7A 5K3SA 5LFAA 4J6FA 1IYZA 4OVKA