3PGLA

Crystal structure of human small c-terminal domain phosphatase 1 (scp1) bound to rabeprazole
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
b'QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Selective inactivation of a human neuronal silencing phosphatase by a small molecule inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3pglA00
1S8OA 4OFZA 4MWOA 3J7TA 4KNWA 3QU2A 5AW2A 3SF0A 2EARA 3WKEA 4CNQA 4QQFA 1Z4OA 2NO4A 4YCLA 2OBBA 5AHXA 4MUMA 3E84A 2C8LA 4O8CA 5AI9A 2Q5EA 5T41A 4BBJA 3CNHA 3FVVA 4ZEXA 3OCVA 4UMFA 3EF1A 3QX7A 2R8YA 3RFUA 4UAVA 3S6JA 3IRUA 3SLRA 3OCZA 5AW7A 3WKBA 2FPXA 3L8EA 3ZVMA 5AKXA 3WKDA 2D2VA 1ZD2P 1VJ5A 2JGAA 3AR7A 3L8GA 2P27A 3I28A 1LVHA 1S2OA 2FPRA 3CZ4A 1Z88A 5ALOA 2AH5A 3NANA 3WGUA 4YIKA 2B82A 4YCNA 3HYCA 3N28A 4NV0A 3W5DA 1Z4KA 2R8EA 3EWIA 4E88A 5AVWA 1U7OA 3I6BA 3ONNA 1CR6A 1N9KA 1RLOA 2EATA 3KBBA 2HI0A 3QGMA 3N8GA 3RF6A 5ALDA 5AK4A 2BDEA 1J97A 3PGVA 4C4TA 2YMPA 2AMYA 2Q4RA 1X42A 5ALJA 3P96A 2FUCA 3MMZA 3QU5A 2WF5A 5AW3A 1RPZA 2WF6A 1Z4IA 2C4NA 3B8EA 2R8XA 2WF9A 3OCUA 1ZD5A 2CFRA 4UMEA 4L6AA 2ODAA 2IYEA 3QUTA 5ALSA 1RC8A 3L8FA 3AR2A 2B8JA 1Z4PX 2Q4TA 5AI4A 4YGYA 3OCXA 1ZOLA 4Y2XA 1Z4NA 2HCFA 2MSNA 1SU4A 3E58A 5ALKA 1XPJA 1RMQA 3L0CA 5AVZA 1RKUA 2OA0A 1AQ6A 1U2TA 4UAUA 5IS2A 4YIHA 2IOFA 1RLTA 4GXTA 1T9ZA 2ZG6A 1RDFA 4FYPA 3ZTWA 2GHTA 3ET5A 5AK5A 5AKKA 3QU4A 3D6JA 5AVYA 4EX7A 1F5SA 2HEGA 5ALVA 4HAIA 2AUTA 3ESQA 3KDPA 3WK4A 3ZI4A 5ALLA 5ALRA 5ALIA 2YMQA 2R8ZA 5AI6A 5AKEA 4UMVA 3U13A 2ZBEA 1U2SA 1MH9A 2I33A 4AS3A 2ZXEA 5AVSA 3ZWDA 5AVXA 2P9JA 1JUDA 2JAUA 2FDRA 4DFDA 2WHEA 2IA5A 1Z4MA 4XE5A 1RLMA 2ZOSA 2RBKA 4I9FA 2G0AA 4Y2UA 3AR8A 3SHQA 4FE3A 4PNHA 5A3RA 3MN1A 3U7GA 4Y2VA 2JARA 2ZBDA 2CFTA 2WF8A 1YV9A 3ZVLA 2O9JA 1QQ5A 5AVRA 3B9RA 4Y3UA 1L7OA 2HO4A 3L0BA 2P11A 4UW9A 4UM5A 3U26A 4IFTA 1EK1A 4J2TA 2WM8A 3AR5A 5AESA 1WR8A 3EF0A 2QYHA 4NAVA 4Y2PA 2C88A 5JJBA 4G63A 3L8HA 2HF7A 4Y2RA 1NF2A 1YS9A 1Z4QA 3NRJA 1ZD3A 3NASA 5AKZA 4G9BA 3NALA 2YJ4A 2YY6A 1YJ5A 2FI1A 3DAOA 2B30A 2G07A 2ZBGA 2C8KA 2HF2A 4L6CA 4C4SA 3F9RA 1J8DA 3PGLA 3OCWA 4ZEVA 3W5CA 1Z4JA 4KYTA 3SKXA 5AM5A 4BX2A 3WK7A 2PQ0A 3M1YA 4B6JA 2QLTA 4KX5A 5AKLA 1IWOA 1ZJJA 3UM9A 2VKQA 2YJ3A 2RARA 5ALGA 5AM0A 4UU1A 2I54A 4CE6A 2I6XA 2OYCA 1L8OA 4OCZA 2G06A 5ALEA 3GYGA 5ALMA 4UASA 4HGQA 1ZRMA 5ALFA 4JB3A 3ZX5A 2G1AA 3PDWA 3KOOA 5AKIA 1TE2A 4EX6A 1WPGA 3OTQA 4NWIA 5AW5A 5AVUA 3B9BA 3FPBA 2GHQA 1O08A 5AIAA 3QNMA 3OCYA 1NNLA 1K1EA 4RESA 4Y2JA 3UMGA 3ZX4A 4F72A 2NYVA 2FPUA 4UM7A 1PW5A 3A1DA 4OD0A 3IB6A 2G08A 4NFLA 3R09A 3A1EA 1ZD4A 1YMQA 2MU1A 4H1WA 3I76A 4UMDA 1ZRNA 1KYTA 5AVVA 3IJ5A 1RKVA 5ALYA 1WZCA 2GFHA 5AW8A 4UU0A 3SD7A 3EPRA 3DDHA 5AK3A 4Y2SA 3A3YA 5AIBA 3U7FB 3U7EB 1CQZA 1YNSA 1T5SA 1Q92A 5AW1A 5IT4A 1TJ3A 5AW4A 3DNPA 4DCCA 5AW9A 4BEWA 4AP9A 3SKYA 3E8MA 5AW0A 2IOFK 2CN1A 3FPSA 3M9LA 4Y2YA 5ALUA 5AKJA 3DV9A 1N8NA 3ZU6A 1Y8AA 3L5KA 1TJ5A 3MC1A 2HSZA 1RMYA 1QH9A 2AGVA 5ALTA 2B1RA 5ALHA 5AM1A 5AVQA 2PKEA 4BYGA 4YCMA 4HYTA 3L1UA 3R9KA 3WK8A 4EELA 2IOHA 2FEAA 4IG4A 1L7MA 3N5KA 4Y2QA 4RETA 3AR3A 1QQ7A 3BWVA 2YMMA 5AM3A 3KC2A 4L57A 2NO5A 3NIWA 2FPSA 3QUCA 2C9MA 2BY4A 4ZEWA 4YH1A 2PR7A 3AR9A 2YJ5A 3R4CA 2DQSA 2RAVA 2BDUA 3ZWKA 1SWWA 3QXGA 4AS2A 3QUBA 1O03A 1Z5UA 5ALQA 5AM4A 1L6RA 2YJ6A 1T5TA 4UARA 5FP0A 3E81A 1TA0A 3WGVA 2YFYA 2ZBFA 2HOQA 1VJRA 3SMVA 5ALNA 3WK5A 4EENA 2EAUA 3WK9A 1QQ6A 3FZQA 4BEVA 2YMLA 5AKGA 2G80A 2JAOA 3AR4A 5AICA 2RB5A 2B0CA 5ALPA 1XP5A 2G09A 3L0YA 5AI8A 3UMCA 2WF7A 3NAMA 1RRCA 4CF5A 3ZW7A 5A3QA 1WVIA 4EEKA 3KD3A 3PCTA 4KN8A 2FPWA 3NUQA 5AKYA 1Z4LA 1RQNA 3QUQA 2I7DA 1EK2A 4F71A 4Y2TA 1RMTA 3ZVNA 3W5BA 3N1UA 3KZXA 4DWOA 2B8EA 4BNDB 4NABA 4BX0A 4DW8A 5E0OA 5A3SA 2CFSA 3WKAA 4UATA 1TJ4A 4FFDA 4HGRA 1ZS9A 4I9GA 3BA6A 4BX3A 5AKHA 3WK6A 5AI5A 2B1QA 1QYIA 3AR6A 3FM9A 3TLMA 3WKCA 2W43A 4HGPA 3QU7A 5AK6A 3OPXA 3U7HB 4XOUA 1VFPA 5AW6A 4XPZA 3VAYA 3FGOA 5AM2A 3N07A 1Q91A 3QLEA 4BNDA 4CF3A 2HDOA 1U7PA 2O2XA 2OM6A 3MPOA 1SWVA 1L7NA 4GIBA 4C4RA 3L1VA 3ET4A 4KX3A 4HGNA 5AVTA 1RQLA 3L7YA 2WFAA 2HHLA 3ED5A 3I1YA 2HX1A 4JDPA 5AI0A 3HLTA 4EZEA 3UMBA 4HGOA 3ZUPA 1XVIA 4J03A 1RKQA 5ALXA 2YN4A 4KNVA 1NRWA 2JAWA 3A1CA 3ZTYA 1Z5GA 2W11A 1L8LA 1U02A 2I55A 4QJBA 5ALZA 4XQ0A 2GMWA 3ESRA 3U19A 1YDFA 4BKMA 2FUEA 4CF4A 1LTQA 3QYPA 2I34A 2YBDA 5ALWA 1FEZA 4OHFA 1L7PA 2GO7A 3QU9A 2W4MA 2X4DA 3K1ZA 3W5AA 5IT0A 2P69A
chains in the Genus database with same CATH superfamily
2YW2A 3C6MA 3PNKA 4H0CA 5CA0B 2IPNA 4ZCPA 4XDHA 1OWLA 1INLA 2EGGA 3OKAA 1OXKB 2BHSA 5BRNA 2XHEA 2R1ZA 3LCUA 3HI6A 1AKWA 3MSXA 4YWHA 3DOEA 3D02A 4ER7A 4YAIA 4NNPA 2G6BA 3MTEA 4L74A 1JILA 1WDMA 2FFRA 3SF0A 1XLWA 3WLJA 3OQNA 1C4XA 1SEPA 2VH2A 3R75A 2SKEA 2FMTA 4PO3X 1SVUA 4D7AA 3IV9A 5MGNA 1UDAA 3EQZA 3HJRA 2GLUA 1NDQA 2PGIA 5NULA 3OLWA 3W8EA 1TADA 3EFOB 1ZMXA 2EFYA 3HXPA 4PZDA 4QDTA 5FBVB 4YY3B 5IWAB 3HB5X 1JPUA 3E3NA 1P2BA 3LY7A 4NYJQ 4QECA 5C7YA 1VKHA 5K09A 4GLOA 1Z0FA 2Q7XA 4B80A 3T3NA 4FE4A 3V7UA 1R7RA 2PH5A 2QRKA 2YZ7A 3SMQA 2UXCB 4UAVA 1SC6A 1CUUA 5JSYA 4Y1RA 5BSRA 4DR7B 2QRGA 4HH0A 4Y9RA 3IEMA 3BE4A 3GVCA 3GFPA 5JMOA 3ZVMA 1WB9A 3UGKA 2VXYA 3LDAA 4EGFA 3TZLA 4KJZA 2FUG6 2Z9CA 1EK0A 2D8MA 3C3DA 3NOQA 3QVJA 4R8RA 3VZSA 4CDNA 5FAKA 1VYHA 1ADGA 1YRWA 4QJ5A 1DKNA 2FB9A 1PJBA 3L8YA 1HRDA 1IUOA 1G21A 4K87A 3R2JA 3LUAA 1I1NA 3FG9A 3T41A 1BS2A 3L93A 3N28A 5A3VA 1A95A 3HB7A 4HAWA 2AFIA 3UCFA 3QK7A 4UBNA 1M1NB 2AG6A 2JKVA 1D2AA 4QPDA 4BNKA 3LT2A 3AF6A 2MYPA 1UZMA 3Q0EA 2VAXA 4QYIA 2HL6A 1W1WA 3H2IA 4WN9B 3TOCA 4C3ZA 1CR6A 2FN7A 2RCYA 4DJTA 2JHGA 4U2CA 5CK4A 1GZ5A 4UXJA 3EIEA 1ZNYA 1GPH1 5HYVA 3FYSA 2Z8YM 2V7QD 3DZBA 3EE6A 1XZDA 3VJRA 1GCUA 1V2HE 2D4AA 4WIAA 4BNFA 2IUYA 4DBLC 3R76A 4FW8A 3R5FA 1KQPA 4JMLA 4KGDA 1EGAA 4QPCA 1KEWA 1HYBA 5ANRB 3WL5A 1AN9A 1QIEA 2GKSA 5LZ5A 2XTMA 4JKYA 5F5XA 1YR3A 1RBQA 2G9RA 2MDTA 3O74A 3M34A 3SFZA 5KINB 4AROA 4C0AC 5BW4A 3MAJA 1N2SA 4BP9A 3ZE6A 1USWA 2V7QA 1U2ZA 4YUWA 1YE5A 4NJEA 1E92A 1YRBA 1P61B 1NBAA 3AFMA 5EIWA 4GPD1 1QZZA 1W5SA 3MGGA 4GOJA 4CUZA 4UOEA 2QUAA 4YJ2B 4E09A 5JJLA 3FVTA 4U7PB 4Y18A 4CPDA 1T36A 4HDCA 1AUPA 4PLPA 4HDSB 5F64A 2PRKA 1H2HA 5J2UB 4P7GA 4IJ6A 4PU0A 1GYQA 5INTA 3ZC3A 3M0EA 2NYAA 5ALKA 3GOQA 3HEAA 5C8YA 3WTCA 2IZ6A 4EI2A 5FF9A 3I8OA 4IFEA 4P4GA 1WUIS 1DRVA 1PZMA 4OQPA 5AUOB 3PWSA 1HTBA 3F67A 1QJ4A 4FC6A 4RSRA 4HFNA 4H3SA 2ZB4A 5GMOA 2ZT5A 4JYZA 4IRXA 1Q0PA 4RD4A 4YIHA 1T9ZA 4LJRA 5TVGA 1WE2A 2GXUA 4FNAA 4CHGA 1IAVA 1G21E 2HJSA 4WHMA 4QBKA 3I6QA 4TM7A 4YS6A 5HQ3A 4FQ5A 4ZOEA 2I7TA 2FEOA 4KR2A 2YNMC 2RGGA 2DPHA 5K4HA 1KIFA 2I7XA 1CK4A 2AFIE 3T6KA 2NNLD 4CYMA 2R87A 4D9NA 4DR2B 3B1YA 3QU4A 1FLAA 1F2VA 3QWAA 2F2TA 5IC6A 3UWOA 4YPOA 1V37A 2ACWA 2Q27A 4EHKA 4QATA 2JFYA 3ZUGA 3IIEA 3K9HA 3L7NA 2DHDA 3RC7A 4EB0A 1UBSB 3GNQA 1ZM7A 4G0XA 4IGEA 3UENA 2NU6A 2TMYA 3QBJA 1OU0A 3G5TA 2ZBEA 4MV3A 2FV8A 3V3TA 2ZIZA 4NEQA 1C3EA 2I33A 2ZB8A 3T52A 3FMPB 3ZQ6A 1NL3A 2C99A 2VF2A 2WVJA 2JIRA 1CE8B 2X86A 1TEXA 3OMXA 4OK6A 5MF6A 4JITA 2XCTB 4GZMA 4LF8B 1YBFA 3HJNA 4PO8A 3E3LA 3PNPA 4LSZA 4RO0A 2GUWA 5E9AA 3V2GA 2IA5A 3DCJA 1I9CA 2V9PA 2BH9A 2YWCA 3UF0A 5A03A 3WAJA 1AXGA 5EWJA 2EG9A 3E9NA 3HUFA 3MCWA 3WZ2A 2Z1MA 3CRRA 2Q9AA 4RVHA 5LB2A 5K8VA 1VOTA 2EVWX 2ZBRA 1PX2A 4CM3A 4FR0A 1XXLA 2YRXA 1KNQA 1DO8A 1XTZA 2ZI3A 4HK4A 1G8GA 4X54A 3ZDQA 3O6VA 5BSFA 3SS8A 3JALB 2H18A 1PKEA 3T7CA 1PO7A 1SOMA 1MNQA 3I6MA 1ZD9A 2QN8A 3BVPA 1NVXQ 1GV1A 1QQ5A 1QHFA 1TA9A 1A5BB 3D5TA 2OBNA 3V80A 4BATA 1RAHA 4GT1A 1PUXA 3AP1A 3RW9A 3GELA 3ON5A 1VCNA 5IUJC 1I94B 2IDKA 1ACJA 3FYUC 3OJFA 4EJ2A 5DM60 2H2GA 3RKUA 4PO1A 4FLFA 3WICA 5IZCA 2PKWA 4XTRA 1MX1A 3EEYA 4PPQA 2PVPA 3ROTA 2WYUA 4HLUA 3S28A 3C3WA 5AESA 3CISA 2NO0A 1N5LA 2ZEJA 1Z0ZA 1H93A 4Q7JB 3ZN2A 3F73A 3ULKA 1M8JA 4ZZ2A 3ZCXA 4BX8A 5HW0A 3D7MA 1YS9A 4CEJA 4OAQA 4W5OA 1PT8A 1NN0A 1ZD3A 2CXOA 3NASA 4Y6PA 4K81B 1KO1A 3GRAA 4OYYA 5JWOA 4EGCB 5B58C 5CXQA 1TCBA 2A30A 1N2XA 2V58A 3KFXA 4P32A 1UJ2A 1AS0A 1V6CA 4WXPA 1LQUA 1FPQA 2R6FA 4Q24A 4MA5A 1TA4A 4QWWA 3AOEA 2ZTSA 4X9XA 4F92B 4A1FA 4TTAA 3LL7A 1OXXK 4DILA 4LOLA 2XUAA 4QBFA 2DG2A 2HK6A 3BH6A 3GRRA 4YCBA 3AHIA 5SY9A 5EMKA 3TR0A 3MWDA 5AM5A 3RK1A 1ESNA 1IHPA 1O9GA 4RF3A 2G3YA 2ZI4A 2PQ0A 4BMYA 1BDMA 2JB9A 1G8AA 2P1ZA 4RNDB 4UM9D 5HKBA 4BOYA 1O4WA 4G5GA 3Q3HA 4O4HA 4OY3A 4B4WA 2ZSBA 4M1QA 2RD2A 2EQAA 3BAZA 5ALEA 1I80A 1IEWA 4R51A 5ALMA 3QYFA 5CDFA 1X8JA 1O6ZA 4K9DA 2N75A 3L7AA 1VXRA 1ODJA 4K40A 3A26A 5TQJA 2X41A 1QWSA 2PXXA 1VL1A 5A7GA 3RVLA 3KOOA 3FMFA 3IKVA 4EUKA 2AK3A 4KVFA 4PQFA 1XTIA 3DCYA 4NWIA 4RX1A 5HIIA 3NHWA 3MTGA 3DD5A 4HDMA 3OVMA 3AY6A 2EWVA 4PBTA 3KJEA 1QS0B 1TW2A 1DG9A 2XJ4A 4C5BA 3F7OA 1IG3A 3IALA 1KJJA 5CD1A 2YJTD 3ZBQA 1K4KA 3H9EO 1OOEA 2HYDA 4W8GA 3RUPA 2V0CA 3BD8A 4IAOA 4C2AA 4LUCA 3WLLA 1MPTA 2I8CA 4MB6A 1OY1A 4OFBA 3ROXA 2PPLA 3H5WA 3VNRA 4D26A 2XHZA 1JN0A 4DR3B 2F3UA 5G0UA 2WB4A 1P7WA 3E4DA 4ENUA 1TAHA 3U3KA 4O2AA 1E77A 1YTLA 2C4TA 4PQYA 3VKHA 3SOPA 1Y9EA 1ND6A 3W34A 2QD1A 3WAGA 1RWOA 4CDMA 4C4YA 3EZ6A 2ZXFA 3FTFA 4OQDA 4RS3A 4UMDA 4ZIRB 3E2PA 2OCAA 3OP4A 1KYTA 2GYWA 1IXSB 2WU4A 4FN4A 4OQFA 2QI9F 4P83A 2C59A 4RE6A 1SVMA 1YVDA 2CLKB 2C3PA 3PNLA 3W04A 2OFPA 1LC3A 1AUOA 2C7GA 2I4LA 4WFIA 2DECA 1UJNA 3AI1A 4YDQA 4NCBA 1CQZA 3O31A 1SFRA 4GPBA 1QVWA 5CX4A 3VZPA 2BTEA 4K8RB 2I1QA 4US1R 4TS3A 4BNGA 1NBMD 1WHSB 3GT4A 1H2WA 2BZGA 2REXB 1G7CA 1G9TA 1U6KA 5F52A 4U7WA 4FB5A 1K4MA 3DVQX 4X91A 4AB1A 3RUEA 2GYUA 3N59A 3MS2A 1QYWA 2H1FA 2M6RA 3SFVA 1ABBA 4ZVVA 3E8MA 1Q19A 4L9AA 2HPVA 1WF3A 1XJ5A 1PLJA 3PFWO 3KYBA 1M8KA 3OOWA 4HGYA 5ADUS 4FYJA 2APJA 3AJ8A 3DV9A 4H7IA 4HQFA 4LWPA 3JPWA 4P82A 4DYHA 1TKCA 3Q8WA 4QGBA 1OXBB 1W0KD 2A0KA 3BIXA 4OMFG 1T5DX 2WG0A 1R6BX 2GTHA 4UQPA 5DTJA 5B4VA 5I7SA 5ITZA 2P4EA 4OYLA 1EBFA 1WQ1R 1YMUA 2AZTA 1NLMA 4PPGA 4HQOA 3B51X 2B1RA 3HNRA 3F1KA 1EUYA 2R2AA 3G02A 1EVYA 1DOZA 1FSPA 3DVAA 3OO1A 3R9KA 2FEAA 821PA 4OAPA 1J25A 3VDRA 3VAAA 1U0FA 2P9CA 3W9YA 4DADA 1SBZA 2LRHA 2YJNA 5E1DA 5I51A 4DV0B 1A4IA 2YMMA 3PD7A 4G5HA 1Y42X 4OKIA 4YV2A 5MDHA 2AW5A 1VIMA 4BVFA 2QT0A 4JNKA 2VJMA 4RU1A 5LOVA 4PS0A 1LK7A 1BCRB 3NNDA 1T2EA 3OJLA 3P2JA 4AN4A 1OB2A 3WDKA 4KLZA 1R15A 2YJ5A 1PJQA 2YRFA 3K5IA 4QA9A 2RGCA 3DNFA 2F1HA 2Z56A 4P3XA 1CU1A 3GMTA 3Q6MA 2Y1FA 2VPPA 1T4CB 3KQMA 4PRKA 4WBNF 4N48A 5IN4A 2X7JA 1QYDA 3ZXUB 4ESVA 2XNDD 1M74A 3DEKA 4F46A 4JHLA 2O2GA 2CGEA 2OKGA 1J07A 1NTRA 2HA0A 3ETDA 4PZUA 3BSWA 3PDHA 3ZY4A 1TA0A 3RREA 5DTRA 2VSQA 3ICWA 3ENWA 1P33A 4MROA 2FNAA 1YB4A 4WX2B 3EZ7A 1G17A 3B20A 3D8HA 2PUBA 2Q6OA 2XCOA 3INRA 3PXXA 3Q7RA 1GTVA 3ASYA 4S3MA 1NE2A 1E3IA 1LB1B 5DF1A 4EB6B 1QH1B 3VPCA 3MF4A 1VE1A 3Q40A 2XNDA 1JA0A 5IMBA 3U7QB 2OGZA 4E5MA 3AR4A 2YYYA 3W9UA 4IF4A 5A4KA 2ZBQA 3H87A 1I6WA 1RYYA 3L0YA 4WZAA 3LL4A 1H5UA 1KI9A 1KJNA 2PMKA 3AZPA 1PKXA 2H8GA 5C9ZA 1JT9A 2YVQA 1NV9A 4BRWA 5BYBA 1XDDA 1OXVA 2X42A 1MC5A 1U7UA 3OQBA 5D00A 1KE1A 1ULAA 1Y82A 4CU5A 1U3CA 2IPXA 1NM5A 4ZVPA 4MDFA 2HM7A 1MF7A 1II9A 3KG2A 4JY7A 3VNBA 1XDSA 5JNUA 3UB4A 3AUAA 2DFDA 1EAMA 1DO0A 1GUFA 4M8SA 5IF9A 2ZRKA 4DB4A 5REQB 4LQ4A 4JUIA 3GT3A 3MRSA 1X1CA 3UPTA 1IY0A 4Q9IA 2ZDGA 3ZWNA 3IO5A 1WABA 1EQ2A 3SIXA 5LDGA 4GRIA 5TJ9A 2NMVA 4KQEA 1LF5A 1E2FA 4F4DA 3EH1A 1OJLA 4YUAA 3JASA 1LRKA 4Z4CA 3THWA 1RHKA 2LP4Y 3Q1KA 1XMOB 1G20B 4Q9HA 5AHRA 4BC1A 4LKRA 2GD0A 3D64A 4PFQA 4YV0A 3COJA 3EW9A 3GVIA 3TLBA 3O2QB 4YMSA 2XMPA 4KB5A 4U0JA 4ZPJA 2A1UB 4LE2A 2VDMB 4JUDX 5JZBA 1TIPA 3JW8A 3FZEA 1K7YA 3GUCA 1TCVA 3KJQA 4FFPA 4B74A 5ICGA 1QYXA 1UBOS 2IXBA 2WKQA 3AJ9A 4H1UA 4LY3A 4O1HA 2VG8A 2ZI9A 1GZDA 5FXMA 3L1JA 3N2GB 3WTBA 4AUNA 4UDOA 4GIBA 4NOLA 2SKCA 4DLSA 4IXMA 1QQAA 4CT0A 5I7VA 3ZK8A 5I47A 4FYKA 1TZ2A 1Q0HA 4KX3A 4P31A 2QUZA 4QT0A 3LWDA 3SJ7A 1SO8A 4XWAA 1PGJA 1BS1A 4FS8A 3TTUA 2BBOA 2ADOA 1WAMA 1W87A 2QU7A 3CXRA 2EGHA 3C4QA 3QF7A 4ZOLB 4DRXB 1BH6A 4WZAE 1QE0A 1YS2X 3T1HB 9LDBA 1TM5E 5H83A 4UBOA 2YN4A 3I72A 1VDZA 4S1TA 2BFEB 4L4XA 5BORA 2D06A 1JDUA 1K92A 1JP7A 3NWBA 2X6TA 1JXMA 3KFVA 4DVGA 3GRZA 4BKMA 2CE7A 3R6WA 4WLVA 1JFTA 1MVOA 4IQFA 4JSRA 4B4UA 3GRVA 1AUVA 2NXEA 4AO8A 2PJDA 1ZI9A 3LYLA 4JAVC 2P30A 1DTSA 1FTSA 4PG4A 1N0HA 2Z8YA 3LXMA 3MJSA 5J1SB 2AE1A 2HH9A 4JI6B 4CG0A 3LRTA 4HGQA 1N2HA 3HCWA 1EWQA 1UXOA 5AOCA 4QIHA 5JI2E 2VBIA 1VSVA 1ZW1A 2ZRIA 4MQLA 7MDHA 3IA2A 1QV7A 4X1YA 5KTPA 3RBAA 3EULA 3WLRA 5KTSA 1XEWX 3AHJA 1S01A 3H65A 4UEOA 2NO4A 2IEDA 4WCFC 1OYWA 4EW2A 5BSEA 3WLFA 1L1RA 4WNYA 4L5JA 2X8AA 3CUKA 3UWPA 3DSRA 5G4KA 2ZUFA 4QARA 1F6WA 2J0UA 1EPUA 1V1MA 5D51S 1YVPA 1FY2A 1PJ2A 1XP8A 3D7RA 1HDOA 5F1OA 5JS6A 1MB0A 2FVYA 1N7JA 5I4BA 3OQIA 1KMCA 5T41A 4C2BA 2JEOA 2QSZA 1V5FA 3FVWA 5T4BA 4B7ZA 2GAFA 5DPMA 1H2RS 4M8IA 4PYRA 3EOAI 2ZR0A 3RVQA 3EF1A 3PENA 2XF8A 3N2KA 3WI7A 1FP6A 4OJNA 2P4HX 2P7IA 2YJZA 3R3SA 1D2GA 4DWWA 2UVQA 5AW7A 3WGNA 4EHDA 1BHQ1 3QKRB 3PWZA 1UMCB 2Y1WA 3LY8A 2D2VA 1RBZA 3BQNB 1JQDA 4A23A 4ZN6A 4IOJA 2WSSD 5FLXA 3V1NA 1RWPA 4G65A 1UDCA 4BJ1A 5BNZA 3OEYA 3O3CA 4F9GA 4JCCA 4Q4JB 1W35A 2CEKA 2VEOA 2X9NA 3A9SA 1Z62A 3B2EA 3FSGA 1H65A 3QLUA 2YIDA 4FMCB 4YRFA 2NACA 1RI5A 2O3TA 3RTGA 3ZGNA 1OVMA 4K88A 1ZLYA 1BEUB 1C3VA 1JWAB 2P91A 3ONDA 1Z39A 4GVXA 4EY7A 2N42A 2VP5A 1PFVA 2A0FA 2D74A 5EL0A 5AVWA 2WSSA 3P2EA 2ZPUA 5AYVA 2O8BB 1R6DA 5TVKA 2JLQA 3VNAA 4QU9A 4R7ZA 4NIMA 1C50A 1WUKS 3RU2A 2N47A 3SQWA 1WV1A 3BMOB 3LNCA 3RH0A 2QMEA 4EBFA 4LVNA 4LVOA 2FW1A 1RBYA 3KCQA 1X42A 3QF4B 5H68A 3VU0A 3T4XA 2A57A 3Q7TA 2JAPA 3ZHQA 3OX2A 5CA1A 5L3QA 1L1EA 2NZJA 1CEQA 1SB8A 2JD2A 2LNDA 1GRCA 3QKTA 1ATZA 4TXNA 2A1TS 2QGFA 1LSOA 3B2NA 3LXRA 2Y66A 2YCLA 1F17A 1PQWA 2WG1A 3ENKA 5E7IA 4AYTA 2ONYA 4R1NA 1BDIA 4KLCA 2VJLA 4NU8X 3W0LB 1OWOA 5K3AA 2DHQA 3QUTA 5HS6A 3KYIB 2RAPA 4IDCA 5T8KA 1Y34E 4V0LA 5DCUA 3TVYA 1PS8A 1GPNA 5K3SA 5FI1B 5CBKA 2H7VA 4D92A 4QGFA 3G7SA 2ATVA 1APBA 4TL6A 1RHUA 3M5CA 2B37A 1R18A 2IYRA 1V8OA 3BXZA 3QFFA 4I5EA 1JQAA 3TSOA 3UHOA 4DTIA 2D7DA 3OIYA 10MHA 1AQ6A 2HQSA 1GNRA 4A5SA 4BO1A 1MG5A 2X5KO 4DLXA 3ZLVA 4DLBA 4GQIA 3EBPA 3I0ZA 3LXXA 1MTOA 2A94A 3GT7A 1XGKA 4JSTA 4K9SA 1L5NA 1FVHA 3WOVA 1ZUNA 4B43A 2CCJA 1KJWA 2BTOA 3RHSA 5BSHA 2BUAA 2R00C 5IH7A 4URWR 3ABRB 1Y8RB 1ZP6A 3GZJA 1YZYA 2NXNA 2CLFB 1WUTA 1NZFA 2GJSA 3P94A 1BRTA 4IFBA 4ILKA 4QUJA 4XCQA 3WWCA 1DRKA 2PV7A 5IRCD 5GJWC 2CNKA 5GONF 4Z4EA 4GQAA 4K3VA 3HGQA 3MWEB 1CUFA 4QICA 1JG4A 3JARA 3AUYA 2W8BB 1KYXA 3MSCA 4MR7A 4V24A 4PY2A 2IYYA 5F77A 3CH5A 4LOJA 4PLFA 1T9GS 1Y1TA 2ICAA 2RFLA 3BULA 3F3MA 1N8KA 5JCJD 1IULA 3DKIA 5B64A 2PWBA 4EJ0A 3ZWWA 7YASA 4X1KA 4N47A 1EA7A 1D4OA 4G5SA 4MQMA 2FMFA 2VQFB 1IN5A 2ZYDA 4K6GA 3GL9A 3DL4A 5HTKA 1MH9A 1FS6A 4TQ9A 4F5YA 3UOAB 1HETA 5EFZA 4PN7A 3VR5H 4GM0A 5JZOA 3GNTA 1H66A 3CE6A 1WCWA 4DHEA 1GGEA 4D6PA 2ERXA 5TR9A 3JQ6A 1AVTA 2PSFA 2WHEA 1VE7A 1DTWB 2FSGA 4P38A 3A7DA 4S1PA 1T0UA 2ORED 3TM5A 1F7UA 3OX3A 3WSWA 1PR4A 2X0FA 4QTTB 1ZUHA 1FSZA 2X0JA 3B3QA 3FWNA 4FE3A 3ZGOA 3KPJA 1SCUB 1K3UB 1MA0A 1L5QA 4W8OA 1SCNE 4H2DA 2JJ1D 2NUTB 2BFFB 3E9CA 4QXMA 4BO8A 3ETJA 1XLVA 3NXSA 4KAJA 4ZZIA 1XF9A 4C1NA 2HWWA 5GIPE 2YHAA 2CLHB 4IJKA 4JFAA 4P0QB 3KWLA 3KAPA 3OZBA 1WKBA 4I19A 3HB9A 4EG6A 3TGLA 3B6EA 4B2IA 4JLPA 4Y30A 1TM3E 4MW2A 5FNZA 4UW9A 2AC4A 1LBTA 3EQ6A 2DUMA 3P5SA 4FDUA 4E6PA 4UJ5A 2PEYA 2JJ1A 3STYA 5E4YA 4JVMA 4RDIA 1L5KA 3VVLA 1QHGA 5DHPA 3FJOA 4KPEC 3H2GA 2HCRA 1MX5A 1P73A 4D4LA 4IVPA 2C88A 3HDHA 1LJUA 1P0MA 2TMDA 4Y9TA 3GJ3A 3L8HA 4YRDA 4M0FA 3IQIX 1W8DA 1Z4QA 4X3OA 2WTXA 1MX3A 3EY9A 1IHDA 3KYDA 5DCYA 4MVXA 4RD6A 1LNSA 1YCDA 2Z8ZA 3KVRA 3T15A 4RMJA 1J0BA 5DIZA 3I3SR 2FX2A 1P80A 1HFEL 1UBFA 1G9XA 2BVNA 4QOGA 4QZVA 5IDXA 3BBLA 4I4IA 5JMWA 3G13A 1IRIA 3CLVA 2JFGA 3ZLJA 4NS4A 2JEYA 3HXQA 4EI9A 1PQPA 1ACLA 3KLPX 3N0VA 3USCS 2XMBA 3OOJA 3QFSA 5JH7A 1N2GA 3UOGA 1RXSA 2V6BA 3V4PB 3WB0A 2VHVA 3HS3A 3QZUA 3BSYA 3O84A 4BLOA 4N4AA 2I3BA 1DFIA 4O4LB 3TQQA 2XA1A 3WRWA 1YA6A 4MW9A 4LXYA 4M1ZA 1D3AA 2ZETA 1W59A 1DC8A 4AO6A 3D6MA 2OYCA 4W7IA 1LQTA 2G06A 3CLTD 1C41A 3JQGB 4MO9A 1XVAA 4FHCA 2Z2ZA 4GM1A 3T7JA 1B93A 4WZBB 4F6CA 1G6OA 1PR2A 3M6XA 5ALFA 4CNBA 2DFNA 4H7KA 5KZMB 1LQ2A 3L46A 4X7RA 3VISA 2LPMA 4WE3A 1JIQA 2EX0A 2G5TA 5LP6C 2O2DA 1GL3A 3QHAA 5IKEA 2FSPA 5AJYA 1TO1E 1FF9A 4M0EA 2J6HA 1QF7A 2P2CA 1CR0A 4JVLA 1N9ZA 4ENTA 2JAQA 4O2RA 3ROQA 3A6GA 3LG2A 1V47A 4M1MA 2C4WA 2AZ4A 2BM8A 4IM7A 4KIGA 2P67A 3G68A 4YP0A 1B0ZA 1CUDA 2X5OA 1N5OX 2GHIA 4BWVA 4NPCA 2ES4A 3Q1LA 4CR7A 5EUBA 4F72A 3UWMA 1Y5LA 3KQNA 2IHUA 1CTQA 1VYTA 2Q62A 3QMVA 5EXPA 1UJBA 1P0PA 2P4SA 4EG1A 1Z17A 1YS6A 2GM9A 2VHTA 5JC1A 2JFHA 2BM0A 4JC0A 4PXYA 1ZNXA 4WKNA 5FUVA 2Q50A 3JATB 1EEHA 4GNRA 4IV8A 3ZHVA 3GQBB 5EE3A 3K2BA 4OB7A 2NZXA 3VTAA 1PJ3A 4JI8B 4RLSA 1ELOA 2YJGA 1OLXA 4L3OA 4YGXB 3A25A 1UWCA 4Z86A 4HFJA 4G8CA 4TLAA 2J45A 3MGKA 4X6XA 4MRNA 5U1PA 2YUIA 3STWA 1BTOA 1XF1A 1YJQA 2VRNA 1GRVA 4U2KA 1FVXA 1IK4A 1MOSA 4OXRA 1KYVA 2GZHA 1N2CA 3L79A 1EX9A 3NGMA 1Z12A 3NCHA 2HK9A 4YJFA 1RAEA 5H3HA 1HE8B 2BGGA 1URPA 3BMCA 4GO1A 3HNPA 4GR4A 1QVRA 2CN1A 1QRAA 3M6FA 4KL8S 4ZOLF 2AHOA 2ZCVA 5JYCA 4TYNA 2XQIA 4KH0A 1DI0A 1I4WA 4NY1A 3TEFA 1N8NA 3I9V1 1OBCA 1M75A 4P34A 5HJ7A 1XCJA 5AD1A 1JW9B 1KYIA 2G0TA 4DF3A 4WCVA 2H1WA 5KDOA 2JJMA 3DHEA 3Q8LA 2JANA 1C7IA 4PZ9A 3D31A 3U80A 2Y0BA 3A1TA 3DV2A 4H18A 3CPHA 2A9VA 2FU5C 5ALTA 1T26A 3AUJB 1T1SA 3TNLA 3LK7A 5C8VA 4DZZA 2IL1A 3FJYA 5FR2A 1JZTA 1Q0QA 4IVQA 1WMDA 3SNHA 4L2IB 3OT5A 1JG1A 4GBMA 4IKPA 1NQUA 1AMOA 1YRLA 5KTRA 3EN0A 3RJTA 1XRMA 3WO1A 3IAM6 2GJAA 4IDAA 5J59A 3FTNA 1G6HA 3DUFB 4K9PA 4CGZA 1LXCA 4DV7B 1WU7A 4AYWA 2HU5A 5FTMA 2NO5A 5LQCA 4D80A 3QJGA 2DHRA 3RBVA 3VA7A 1R3DA 4D98A 1XNGA 4X8OA 4YH1A 2RGUA 4FNGA 1M8PA 4KXQA 3VSDA 3OIWA 3M82A 2F1KA 5UKDA 4UFPA 3GHHA 3NHRA 3K70B 2VYFA 1A69A 2RGDA 1E1QD 1HSZA 1TUIA 3Q0TA 4M7RA 2QLFA 5CFZA 4DV3B 1JXQA 1ZLXA 3FUVA 2VTBA 5K0TA 3IQXA 1FFAA 3AV3A 3BE8A 1YJBA 5ICCA 4LKOA 2Y0CA 3GPLA 1PGQA 4BJ6A 4C4AA 1QK3A 2D13A 3OETA 5E8JA 1YF3A 4DAOA 1TMKA 3NBUA 4PYIA 1EK5A 4LF4B 1QDEA 4DQUA 1HDRA 1JEAA 1FYFA 2ZRAA 4WXEA 4YRMA 2VWHA 3JAWA 1YS4A 1FRNA 1WWKA 5JXGA 4OSEA 2OAEA 1RTKA 4DV5B 3H2JA 3EZLA 1E1QA 1FQKA 1XBTA 5DRTA 3TLXA 5LLTA 4HZUA 1TEHA 4RF5A 4ZKEA 5LD2B 2OY0A 1N2CE 1XZAA 2ZCJA 2WKPA 3VR4D 2FEMA 4KQMA 3EA4A 2JAOA 5K4AA 1KMHB 1GTMA 1VSBA 2K5UA 2O3QA 3T7RA 3DW3X 3M6UA 3OY7A 8OHMA 3ITNA 1UK6A 4NR0A 4Y0VA 1LPSA 3ZWCA 1GPLA 1RZVA 2O20A 1T15A 4NZPA 4CF5A 3FZYA 1G3RA 2NYUA 3KD3A 2O8CA 2VPTA 3R9XB 1NQOA 2HTEA 4DG8A 1HG1A 2PBRA 2QROA 2ZBPA 2QW8A 3A9CA 1XRNA 1C4OA 2ANCA 2G04A 2YCBA 3DZ8A 3F5FA 5DM4A 4W5TA 2D5CA 4QFBA 4AVYA 3QUQA 1VHTA 4UREA 1EM6A 1E5VA 2V7GA 4IUBS 2HT6A 2PX6A 1U7ZA 2GA8A 4LHYA 4S12A 5BSVA 4YBRA 2FMUA 5E6RA 1A5AB 3DHNA 3MWLA 4NK4A 1S3FA 4IZ6A 4KUGA 1GSIA 4Q3OA 4F5WA 3FVQA 2ZU0C 1PX0A 1KAOA 5LA6F 3BILA 4A0HA 3ZZMA 3WIVA 3LY5A 4HT3B 4ZYLA 1PFQA 3N1UA 3VR1A 4RPJA 5A5FA 3LT1A 4HTFB 4KMMA 5ITSA 2X1HA 3X1JA 4O2BA 2G7MC 1JFVA 4RK5A 5ULLA 4BNDB 3TJRA 4JCOA 2WWGA 3CURA 3KRTA 4V2IA 1JF8A 2LGJA 1DFGA 1OPXA 3AG6A 5CM8B 3LBFA 1Z7WA 2C4VA 5DCLA 1YAHA 3OIVA 2C4MA 4BZQA 2PUDA 1OASA 2W5UA 3LF1A 2W43A 3MJCA 4HGPA 4KDCA 5DSTA 3R7DA 4MMZB 2V0GA 3AVTA 1QTNA 4D9HA 1MT0A 3CF6R 2XE4A 5EQDA 5I3CA 4OF4A 3LI2A 4AJLA 3SLKA 4IXNA 4FOPA 4NBWA 4L78A 1RIFA 5BVGA 2R1VB 4CKEB 5CB8A 3NGLA 3NTUA 1I0IA 2P6OA 2Y1EA 5HF6A 6ABPA 5GM1A 3ZD9A 4M1WA 2AF3C 2C29D 5E7MA 1HF3A 4E5PA 5I7FA 3OM9A 5TC4A 3IBCA 4HDKA 1NJGA 3D0RA 4N3CA 5I9NA 5K2OA 3KQHA 2WFAA 2FPKA 1GPMA 2XVAA 4KACA 1JFLA 3VJKA 2BYTA 3R7LA 2CVPA 3D8TA 4RANA 3VC2A 5JROA 2JGDA 4ID9A 2WJIA 1TIKA 5M34A 1N2OA 4N8EA 1T0BA 4W6ZA 4IS2A 4MUHA 3UWSA 4ENQA 4YRCA 3AKEA 1XEFA 1Z06A 4EUSA 5JXHA 4YRJA 2W2KA 3MWGA 4N0EA 1EXMA 2EYUA 3WWYA 2VJAA 3PTAA 3TBFA 5KOHA 2I55A 1NIJA 5AWFC 4ZRDA 2PA0A 1TF7A 1NNSA 4ZODA 1JVSA 1VFNA 4J7XA 2GMWA 1ISGA 1Q5PA 2X3FA 1DBSA 1BFDA 2IYQA 2G4VA 2R4UA 3HP1A 3QBEA 4XDZA 3T99A 3FI0A 1L7DA 2I4NA 2QSUA 3AB8A 2W2NA 3WLKX 1SMKA 3WMRA 1GN9A 3RU7A 4EG8A 4F38A 2R6GA 3OE1A 2UYHA 3NMUF 1O94D 4MICA 3UA3A 3A27A 1XZEA 1KFEB 4RSGA 5FIUA 2XE6A 3E1GA 2B1GA 5C35A 2YWRA 4PHCA 2PSJA 2HFJA 1JH8A 3BCUA 4IF6A 4A82A 5KTYA 4KNWA 3EZXA 5K0BA 2NM0A 4TTIA 3OECA 4BEBA 5LN1A 1F1JA 4ZU3A 4H6PA 3IQWA 4FYVA 2BMEA 4KK3A 5KSOA 5JD4A 2YV1A 5LLDA 1Q1QA 2DAPA 3K9GA 3KQWA 4KTTE 5KUTA 1Y8QA 4NS1A 2Q5EA 4AY2A 4REOA 1FRZA 5TARA 1NX6A 1U4NA 1UOPA 2WJHA 4AMVA 3RYFB 4CLOB 1TGVA 2RGAA 4UHHA 4FXPA 2V7PA 2NUPA 2ZE8A 5FH9A 3QX7A 4RYLA 2R8YA 3S6JA 2E49A 3KTAA 4Z51A 4CL2A 1YTUA 3BPSA 4RCZA 2H0QA 3FMOB 3ZW8A 3FCXA 2J4FA 3OCZA 2XAAA 3AF5A 5IZCC 1HDXA 4L15A 1X38A 2FPXA 3E9QA 4JXKA 3REOA 1H4VB 1K7EB 1YBVA 3L8CA 3EAFA 1Z2CA 1SA0A 2JA1A 4MP8A 4HLUC 2LKDA 1OH6A 4ZD6A 3QNUA 4QGGA 4A27A 2P8JA 2CXQA 1QHHB 4KGVA 2JPDA 1I7PA 4JYMA 2HHHB 1W4CA 3MJEA 4S24A 5HFAA 3V2UA 3TQSA 4Q3CA 3I9V6 2C3OA 2HC9A 3W5HA 4E08A 2PSSA 1L5HB 4QDOA 1VMAA 4Z7OB 4L22A 3LC0A 4NRDA 2XTNA 5M3BA 4M21A 4EL5A 4GWKA 4DQVA 1JPVA 3PGJA 1ODFA 3ONVA 5BYAA 1KF0A 3TEJA 3UG7A 3PIDA 1ZCBA 4CM8A 4FJ0A 3UKOA 3IMEA 3R3VA 4EYSA 1EH5A 2PUTA 1FU7A 4EEXA 5K4GA 3NQ41 4J75A 5JNLA 4PAGA 4OXYA 1A3CA 3BE6A 1KVRA 3CSSA 3HZZA 3RF6A 3STUA 4ARZB 4HV4A 4C4TA 3I04A 2DBRA 1EM8A 3F7NA 3FETA 3OWOA 1UK9A 2ECFA 3LPNA 2HV8A 2G9VA 2XNHA 3AEZA 3C98A 4IMPA 1QFXA 1W5EA 4MWSA 4C3OB 4KE7A 2WF9A 1CJVC 1RWWA 3ILYA 1CRLA 2CFRA 3U3OA 3Q87B 4INPA 1O57A 5EYPA 3TBKA 4OXIA 4L6AA 4AKTA 4CKZA 2RB4A 2SKDA 3ZY3A 3GARA 3T54A 3S99A 3G2QA 1GAQA 4OJMX 4GM4A 1OLSA 1DVRA 1T24A 2FN4A 5JADA 1RPJA 1V8DA 4LSMA 4RZQA 5AI4A 4D44A 1T6BY 1T9DA 4D8TA 5DIFA 1Z2DA 1E5QA 1TM1E 1Z4NA 4Q4HA 4RJLA 4W1SA 4Y2XA 3R5XA 5D86A 5C2JB 4C7OA 3SZUA 2NTEA 1HY3A 3Q0IA 3K35A 3KVOA 3KPYA 1XPJA 4XQCA 1E3MA 3DPSA 3NW9A 2ZE5A 4N49A 3L0CA 4ZDKA 4Z4IA 3H11A 3NDIA 3YASA 4C20A 1U8CB 3HHEA 3MJTA 4NMMA 2ZP1A 3TVDA 1Y1KE 1YVEI 1R50A 1VM6A 1U2TA 4R5HA 3UHJA 3NTOA 1I01A 1S7GA 2WD7B 1E8DA 3I9OA 1RR6A 4FGUA 4R9VA 3C6XA 1NWHA 2XDWA 4XM1A 3IEKA 1XWFA 2ORYA 3K09A 4FYPA 1RWVA 3M4XA 3EOBI 3X1YA 1UPFA 5LXTB 4G86A 3U4QA 4UEJA 3U7JA 1U2DA 1OFTA 2VDKB 2J3JA 2ZAOA 2ZS8A 4ZO6A 1JZSA 5EXSA 3WQQA 1EVZA 1V16A 1RXWA 3S55A 3HJFA 1LSJA 3N3AC 1FFHA 2ZRCA 3EIUA 3G2LA 1DAKA 3I6IA 4WERA 2VF4X 2HLDD 1BMTA 1OFIA 2HEGA 1N1EA 4F5ZA 2I8LA 1GG8A 3C6ZA 2YBEA 3GA0A 4MS4B 1GQRA 1JIJA 3AHFA 2B2CA 3WNQA 5CW1A 1M1ZA 1TCUA 2UVPB 4LAFA 4X24A 2J3KA 2FR8A 3TE6A 1UP4A 4HN9A 4U1RA 3ASUA 1W4BA 4ER0A 4PCVA 5J4LA 3EPKA 4ND1A 1AKVA 5CFNA 1V41E 3WAKA 4EFDA 2A7QA 2CHQA 2C8JA 1U7HA 1PD0A 1W19A 2HLDA 4F7DA 2E5WA 2R96A 3FTPA 1FFSA 1OGIA 4RKYA 3DULA 5C8DA 5FB3A 4DFDA 1Y7IA 4FVTA 2JGNA 3A58B 2D2XA 3FJ1A 1YB1A 3AY3A 3KSDO 2RBKA 3DE4X 2OFOA 4RKFA 4Y2UA 3CPSA 4JWKA 1OSNA 3ZZUA 3GZ4A 3OBIA 1YBHA 3TD2A 1J24A 2VJOA 2UKDA 4G1CA 3RUIA 4C7JA 4IDPA 4L9WA 4C0QC 4CL8A 1SBHA 1F0NA 1B00A 1GKIA 3P2IA 3E82A 2DF8A 2Y2VA 1M2OB 1GXSB 6REQB 3B13B 3ZD6A 5HIAA 3LKDA 2UYYA 5FEMA 3T3IA 4YI3A 3UJNA 4ZREA 2WF8A 1E2IA 3I2JA 4KBGA 1Z0SA 1XQXA 4HVAA 5AXCA 4BNNA 4P35A 4YONB 5J43A 3C1AA 2O1EA 2HJRA 1IZYA 5G1NA 5KQPA 3ZE7A 3H1TA 2P11A 4PC6A 3T12A 3A6ZA 4WBNA 5TS3A 3ZLUA 1Z0KA 4J49A 3BICA 3DAPA 4HLNA 1RM5A 2N3ZA 3NJ8A 1GDTA 1B42A 5CCEA 3EFOA 1SG0A 2QD5A 1A2KC 1WR8A 4OHKA 4RZHA 5EHZA 2AB0A 2JD1A 4NVRA 7REQB 4P1ZA 4YP7A 3TR5A 4RKWA 1ZKDA 2XX3A 3ZY5A 5FUBA 3IURA 4E2XA 5IAOA 1X70A 4D46A 1CQJB 2YY6A 3EGDB 3W77A 1TMYA 1OWPA 1C2TA 2X0EA 3CG0A 1PK8A 4CHTA 2CJXA 1SC9A 2FW7A 2X0IA 5CGZA 2F4VB 3KT6A 4LEIA 1QG4A 1NFFA 1GGVA 1R0KA 1S0UA 4I1RA 1M2VB 2CHGA 1ZOPA 3UJ3X 3GU3A 3ISVA 2HDWA 2QTMA 2G9ZA 3KB6A 4HN4B 2JFXA 4JJ6A 5K0JA 2AX4A 2PU5A 4LECA 4DLPA 2XQGA 3PA8A 3NB0A 2SHKA 1T91A 4WOJA 2V1XA 3KCNA 3ND9A 1SZJG 4MXDA 4XD2A 2GYVA 3HEMA 4RV5A 3UJ9A 3BMQB 3D3EA 1RW4A 2O5RA 3PF8A 2XIQA 1JSCA 3OTHA 4PNPA 2JCVA 4CE6A 5BWLA 3CFYA 1R8JA 3O8CA 4PICA 3K9CA 1GVNB 2XV1A 5D5PA 4TWBA 4AUKA 1DWUA 2QN3A 4A0GA 1WPQA 2UZ1B 5AVKA 1KC3A 2GERA 4M1OA 1ST3A 4K9RA 2QX8A 4MKGA 2JK1A 2LE0A 3KOWA 4TQGA 1YIAA 3QKUA 4Y6SA 5PNTA 2LCQA 3UK0A 3V8EA 5AJXA 4OXNA 1BDBA 3FTDA 3S29A 4LC1A 1PWEA 1QYRA 3EXHB 2VH1A 4U7GA 1P9OA 2AJCA 4QU8A 5IG2A 2P4QA 2E0IA 3R7WB 2XB2A 4TRRA 3TNJA 2NSHA 1EK6A 1Y3CE 4GPEA 4MWGA 5KJ6A 3FTQA 2ISCA 2IK8A 1K86A 3EUFA 3G2NA 1SB9A 2NUAA 3I9MA 3LQ2A 1RJ9B 4OGLA 1Z5OA 1VL5A 4ZCTA 4JHXA 3N2YA 4OD0A 5DNDA 2VJNA 4L28A 4QVKA 3UTCA 1GQOA 1E9CA 4GLBA 1O89A 3LVBA 1F9EA 3UAZA 1HDIA 1GZ6A 2A0YA 4JA0A 5E9WA 1CX9B 2ESRA 3WJ1A 3KLMX 1IWPB 1E6UA 1ZIDA 3GZNB 2Q9UA 1KQGA 4KMSA 4JLVA 1AIPA 3NUQA 1YS7A 1JR3A 1V95A 1FLNA 2EU8A 5F7ZA 5TQ0A 1FZQA 1HOXA 2BMWA 4AN1A 3A3KA 4KZKA 3M33A 1ZVQA 4K9LA 4AK9A 2EQBA 1KEZA 3NM4A 2PCLA 1E1RA 1GUZA 1U5CA 2WNSA 3C74A 3IVCA 4GU5A 1Y4UA 4XVHA 5G53C 3O26A 1TJ3A 3AERB 3OZWA 1W30A 2XOKD 1A9TA 1R0BA 3ZU3A 2CSUA 4O3FA 4DCCA 1UWKA 2H5JA 2R2GA 3L4BA 2JCXA 1RCFA 2Z2IA 4WOKA 4EVIA 5JRZA 4OHBA 1N9GA 2IOFK 2Q3BA 3H1GA 3SOZA 3D5EA 3PEWA 3G8YA 4LWOA 4JVSB 4Q3NA 4ZT2A 1BCSA 2XEXA 2RKWA 1Z6TA 4OA8A 3I8SA 3IP3A 4FYHA 5H16A 3VVCA 4ABYA 4N3GA 3AETB 3U81A 2FP4B 2AEJA 2XOKA 1K27A 4OGKA 1V26A 2BEVB 2O8VA 3DVSX 4MVJG 5I8WA 5JJ5A 4R2LA 5G02A 2GM4A 3AESB 4BYGA 1FJ2A 1QIJA 2A1IA 4FFWA 3INYA 4N7BA 2IOHA 2CYCA 1L7MA 4R68A 3NVMB 4D4GA 3BAFA 4MVJI 1FC0A 4HATA 1HA3A 4B8WA 1H2XA 5AM3A 1W93A 3C4JA 2WTNA 3G5UA 1NSYA 3A6EA 3QPBA 3DAYA 3VM6A 5L4NA 4HQ0A 2O14A 1IEQA 3BORA 4TSFD 5DP1A 5ERXA 2CMKA 4EG4A 3QBVA 3E61A 1SBIA 1X7ZB 4WUTA 5HP4A 1SXPA 1VDMA 4BTLA 3OU6A 1YZHA 4EHBA 3KQTA 5A5GA 1GZUA 1XVTA 4NMWA 4A8PA 3QX8A 1NN1A 1RM3A 4HD8A 1RXUA 2PN1A 1OE0A 2QRHA 5LQUA 2ZI7A 5F51A 2ZB3A 1JR3E 4RUKA 2HGZA 3WRYA 3QMPA 1TVCA 4BMVA 3ANLA 1O0BA 1VBNA 1PTJA 3SQMA 4ABTA 3V8QA 3WGOA 3OT4A 3C3KA 3D3NA 1R4NA 3QXCA 1VJRA 2Z09A 1EDBA 4MRPA 1N6KA 3DMGA 5JFOA 2FPPB 3NM5A 1QKIA 3QYJA 3C2QA 1FSFA 1SNYA 1WZUA 4QX6A 3VO8A 4Z1MD 5FWYA 3KTDA 4YJ3A 3R41A 4Z9FA 3CRQA 3IHLA 4GX5A 3QLUC 3FWPA 1X7YB 3TSYA 3FHLA 4B75A 2P0EA 1VLLA 1ZIOA 4NZOA 2GO1A 1VIVA 3NHZA 4CTMA 4D82A 3K73O 5A02A 2J9YB 5HFNA 4BMOB 3C6YA 2XDQA 4QDZA 4G85A 1ES9A 1P4GA 1ZK1A 2AW3A 1UBEA 4BNIA 4BXOA 2X8BA 3GWZA 3HH8A 4F11A 2H7CA 3ZDYB 4EGQA 1ESMA 5A3JA 1S3GA 3D2AA 2ZIAA 3JQ9C 3W79A 3GGOA 4AIIA 2FAXA 4DCPA 1A4RA 1TRKA 4E94A 1QBGA 4WKGA 1XOIA 3RVKA 1BG6A 2ZZMA 1Q95A 4DC0A 3V4VB 5B6JA 1R0ZA 1H3FA 1MJGM 1G59A 4KO8A 4CV1A 4D0RA 1TZMA 3D59A 1H69A 4OB6A 3K1YA 3MNFA 4KQXA 2ZAIA 3CNBA 2IWHA 4MITA 2B8EA 1KRXA 2ZWPA 5JNRA 2NSDA 5EIFA 3TW4A 4JI2B 2EOAA 2P6NA 3KU4A 1GGFA 1KDZA 3UK6A 3KQQA 3OAAA 3O1HB 1I3MA 3N0TA 4BX3A 2AKYA 3MS4A 2V7VA 2GF9A 2B1QA 3Q3IA 3TFWA 3B82A 4FGSA 2P2LA 4NH4A 5T8KC 3DQZA 5HFJA 3F49S 4HB0A 5KQRA 3P0IA 1CV2A 1OA1A 1PT6A 4PGAA 4UZFA 3ZJTA 1XCBA 4KXMA 3ITEA 1TQ8A 4IOLA 3IYLW 4U7DA 2BFOA 3QELB 5GVRA 5T4FA 1PZEA 2AN1A 3VOAA 4ZYYA 3ND5A 1T4BA 3LCJA 4US2R 3HP7A 1M73E 1SAYA 1IONA 3NIGB 5DLPA 4DLRA 3LCCA 2QL5A 2LXNA 2DERA 1CY0A 4LGMA 1PR6A 3BB1A 3GEDA 5GONA 2J59A 2ZIFA 5EY5B 4B3FX 1XHEA 4UCFA 3LV8A 2Y9PB 3EDOA 3U1TA 1AG9A 4QUDA 3VKVA 4XYMA 2OZPA 2GNOA 4LYGA 3AEQB 2ZLBA 4JEUA 2XRMA 5HKKD 4YHBA 3ICEA 4F4UA 2LBPA 1JAIA 2AHRA 3C41J 3T4PA 4MI9A 4KNVA 1GGJA 4MINA 1L4EA 1N7HA 4TLCA 2HSDA 1H8ED 2ONKA 2IWRA 1XZMA 1T5IA 2HCBA 4MV6A 1GDDA 3D8UA 1GSHA 4L3VA 4ZJZA 5KNBD 4FX2A 3U19A 4C3UA 3CMCO 5L3SA 1KPHA 2QUKA 4UTNA 2QDKA 3MBKA 4FNMA 4IXTA 3IIJA 4CWAA 2RK3A 2UDPA 3T0IA 3A6KA 3SGLA 4C4ZA 5HKKA 5IT5A 1N32B 1K8RA 2R5WA 3EUAA 3CZCA 3L0SA 2EQ5A 4QREA 2P69A 3OEHD 5JSZB 5THKA 3RCBA 3IT1A 3O2NA 4PX2A 1H8EA 2CBXA 3FSRA 1BW9A 5BP7A 4LBVA 3WSTA 2BGIA 3WHLA 2GX6A 1LPMA 5KNBA 3AHDA 1EHIA 5D84A 5K51A 3MINA 3QU2A 2ISQA 5DCWA 5TDHA 5C18A 3DO8A 5LMCA 2UU9B 1C7RA 4CNQA 3STVA 3ICOA 1L9XA 1CZRA 1L5OA 2R4TA 1T10A 4OGFA 3T1OA 3TNFA 1U11A 4BMNA 4S05A 3AFIA 3H7IA 2ZYAA 5HZKA 4OH1A 1SKBA 3WXBA 2YQ4A 2B6NA 3OEHA 1RC0A 3KEMA 4BP3A 1THTA 1JDJA 1KHTA 2Z6AA 3TG2A 2VNKA 3QEJA 2EX1A 4GGMX 3MTJA 5PGMA 4DS3A 3SM9A 5JAOA 1FFXB 3BJMA 3WL7A 1RZ3A 3SSAA 1XMPA 2O8EA 3ESYA 3EZYA 1ZUD1 3OCJA 2ZB7A 3IOYA 3RFUA 1F1BA 4V1CA 4HQ6A 1ODLA 4FKMA 1BXGA 4ITUA 5BWBA 2WYVA 4DZRA 3FFTA 1U90A 4PHTA 1P29A 4B81A 1TUEA 5IUKC 2ATEA 5M29A 1UT5A 1F51E 5DN6A 3WLAA 2EBUA 1NQVA 1CF2O 1DSSG 1GWNA 1DIGA 5E4FA 2AXPA 1U8XX 1DB3A 1T2UA 4I2NA 4NFYA 4H6XA 4PCAA 2P0AA 1DV2A 1IM8A 1QXSA 2HAEA 3ZLTA 1BYIA 4DSOA 2SCUB 3Q8XB 1NR5A 4KLNA 3F6SA 5AXAA 4YCNA 2OHHA 3W5DA 3DMHA 2GUGA 2WINI 5ADHA 3HWWA 4B0PA 4JI7B 3KHSA 1GAJA 3NDJA 4EYQA 1TK2A 1NATA 4B73A 4C5AA 1XYVA 2WIAA 5EJ4A 3OJEA 4D25A 1OT5A 5T6MA 1WZ2A 4GP6A 4LNHA 2K2QB 2Q5QA 1DAMA 3HFGA 2HHAA 1QFYA 2C42A 3CWQA 4URHA 2WTUA 1PI3A 2MSLA 4Y6QA 1UAYA 3U7QA 3UPDA 3MW8A 5B3KA 1BH2A 1EG2A 1U7DA 1U8YA 3LC2O 3WGHA 3VAZA 2RE8A 3Q9NA 4RZ3A 1Y6QA 4W8HA 4Y6LA 5F78A 4C21A 3NIBA 5MN4A 1FTYA 5EHQA 1QLWA 2WABA 3R0VA 5FWNA 1XTTA 3V1UA 3Q8KA 1JHYA 4KIWA 4KODA 1Z8DA 4AXXA 4LDNA 3CQ9A 4MGEA 4MQ6A 3AHGA 4PCUA 5EGNA 4GRAA 4YRAA 2X0KA 3BIJA 4I14A 3NG1A 4TL9A 3F5QA 3IAS6 1MABA 3OCUA 2UUOA 1HKUA 4MMYB 4PBRA 9ATCA 1I7QB 4DV4B 3NBKA 3TPZA 3JQRA 1R1DA 2V7UA 2ODAA 3HV2A 4HI0E 3BDIA 4X6UA 4CMBA 3EEBA 5L3ZA 2VA9A 4PEVA 13PKA 1KJQA 3FNBA 4N0DA 5KOJB 5G3YA 2D1QA 4FKZA 4MJXA 3PTLA 5IJWA 1VA5A 1SKYB 3PUKA 4B40A 3KUXA 4HPXB 4YGYA 1XPOA 3OBBA 4GZLA 1ZOLA 3OZTA 2PBLA 4BQSA 4UBIA 5JR3A 3JTMA 3VZDA 1G2PA 3CLRD 2HSJA 3CLTC 3SFTA 3S2YA 3WYCA 2AA3A 4L7VA 1VIDA 5DBGA 1Z3CA 1GOTA 4KR9A 5KYYA 2OO3A 1ZWLA 2PZMA 3A8TA 1XR3A 3F6EX 2VUSA 3VR4H 4AWAA 3UMJA 4YMWA 3HJCA 4FFOA 1A96A 1RI3A 2DH5A 2QLBA 4MWBA 3D3WA 4ZVKA 3OFSA 2JI8A 4NPHA 3VOBA 4A73A 3K0FB 3RIYA 1C30B 2OB2A 3C7DB 4MPDA 2H17A 2JVIA 4DZTA 3KKNA 3OFND 3B78A 1KKLA 5DW0A 3QPVA 3FCSB 5B1EA 2W93A 3JWEA 3GVPA 2YYAA 4I36A 4U7JA 2NT4A 2L18A 2PWAA 4G9GA 2C57A 4Y8VA 2IRWA 3T1QA 4KITB 5JBNA 3HBMA 2F8TA 2R5NA 3FKSD 2C98A 4I6GA 4D3DA 1YQXA 2WEKA 3BD9A 5FUYA 1EFUA 2HJWA 2PAAA 2NV6A 2VF5X 3DE5X 3HQ4O 2AUTA 4HAIA 3GLIB 1OHHD 1ZX1A 2C82A 1PLKA 3HXKA 4U2DA 2V6MA 2HQRA 2ZJ5A 2Z5VA 4OMCA 3V8BA 4RIEA 4KSYA 4BNVA 3RD5A 5DK4A 3PICA 2Q6VA 4P22A 3RUFA 4RY9A 4BVAA 1Z29A 2JBAA 4LG1A 3TGWA 4F06A 1YRYE 4CIYA 5FDFA 3ROKA 2H2HA 4RA9B 5F12A 1Q57A 1R6TA 2BONA 4NESA 2AJDA 2FSFA 2GZRA 4PAQA 2CV1A 5K0LA 2GOYA 1EZ4A 1KI6B 5AHWA 4YB8A 4EEZA 3JD1A 3WB9A 1OHHA 5CFOA 1DX6A 2ZOSA 3ZWYA 3ZJUA 5IX8A 1Q1GA 3QFCA 1F38A 1A7KA 3URKA 1W85B 4MJLA 4PIMA 1CUGA 5I9MA 3C3EA 3GIDA 3C5VA 4LK2A 5FV7A 4ZALA 3ZNNA 4MPTA 1PJLA 4WPGA 3FGPA 5B2EA 1RYHA 1FTNA 1NKVA 1SXJD 2PUWA 4OOFA 3I23A 3LRXA 1ZRSA 3K6RA 3MTBA 1XHFA 5B5SA 1WMBA 2JHPA 3IP1A 4LYAA 1UXJA 1VL2A 3EEFA 3VFDA 3AKYA 3FLAA 2ZITA 4DLTA 3T1VA 1G20E 3O21A 2C20A 4EYEA 4W1PA 2BMJA 1P4HA 2J3QA 5T57A 5IBPA 3R8XA 2F3RA 4X5OA 3UT5A 5FV4A 3ZDDA 3DFZA 4U9IS 1CT9A 3K0BA 1GV0A 2FETA 2ZVDA 1SXJA 3KZ1E 4OUDB 4JLSA 3AXTA 3QJYA 5EHIA 2WM8A 5ESRA 3U62A 5KX5F 3MA0A 5A1TA 3WNZA 1IXYA 4LJAA 4HYQA 3EIHA 5A6VA 3M3HA 5COQA 4EMSA 3DWGA 3WLPA 4BVEA 3DWEX 3NRJA 5ES3A 1OBHA 2YN0A 3I73A 3BQ9A 5HIJA 4GNKA 2ANBA 1LD3A 3NALA 2WYOA 3PV0A 2IHVA 1QV9A 3LWBA 4JXJA 4CTNA 3NV9A 5COBA 2DR2A 4MHSA 4YRIA 4E03A 2PTHA 2AZXA 4FHFA 2XAUA 5H5JA 3GCWA 2V8OA 2ZANA 3DE6X 1Q7RA 1U04A 3E0QA 2VR1A 4I8DA 2RG7A 4UDYX 4DDWA 4UFOA 3SAJA 4IQ4A 4CMGA 3IV7A 3ADBA 5F7JA 1K08A 3H5LA 6AT1A 2WJJA 4CCAA 4F4IA 3U4AA 4EO9A 4FZVA 3RABA 1KAMA 4XLZA 4I4TB 1Z0DA 2QL6A 3RV4A 4RVFA 5ICMA 1M83A 4TYMA 4Q0MA 5KWSA 2XUJA 4B6JA 2L42A 4BV8A 1FP4B 2V7XA 4WECA 1ZO8A 3FN4A 4YRSA 5IDYA 2RARA 5JQGB 1T9CA 3D8NA 4LNUB 2Q3FA 4I3HA 3FB4A 4L95C 4PLHA 4RTLA 4W5QA 1WXGA 1S5PA 3PC6A 4HNRA 5LA6A 4B3GA 4UASA 1J56A 4M1SA 3WMFA 1IZ0A 5KJFA 3ZX5A 5DOVA 3RUCA 3EASA 3K4QA 3LYHA 4TZKA 1L5GB 2WQ6A 2H4YA 4NENB 4EX6A 4F85A 2XQVA 3KSUA 1PD1A 5E2IA 1KYQA 2MTBA 3CR8A 5DOZA 1GT91 2WJ3A 4P6VF 5KSZA 1C2YA 4ES6A 2JATA 1KSJA 5EINA 5JCXA 5T4EA 1P0FA 5BNTA 3OA0A 5GGXA 4IRMA 1RJDA 3P4YA 3CVWA 2DB3A 3IILA 1SXJE 1HYGA 3QHPA 2Q3HA 2R1TB 1PYOA 3NATA 1NNLA 1JEQA 1K1EA 2BZ1A 3LDHA 1QO0A 3O7MA 4NBKA 4OQQA 3FPHA 4J1QA 3UQYS 2H6EA 3HCDA 3KJNA 3DTVA 3T38A 1WSBA 4ZCSA 2ZXUA 2QBYB 1F2TB 1RQPA 2HMYB 4W5JA 3A7EA 1QX3A 2VYVD 3QRWA 2V6FA 3HXOA 3EXAA 1FYDA 3LQQA 3O4HA 1RWXA 1I3KA 4M8LA 1U3TA 1C8VB 3VHXB 1ABFA 1Y33E 2O05A 3BIFA 2IELA 5AICA 3NH9A 3RARA 1PNOA 4NLLA 4U8GA 4C6TA 5I48A 2YHUA 4AJPA 1ZJZA 1EXVA 1RQ2A 3GLHB 3II6X 1GZ4A 4P2GA 3ZNPA 4XUGB 2ZQZA 4W63A 4XUCA 4U9UA 1WOMA 2ZT6A 3R7NA 4I1OA 2IHZA 4E5UA 3WFIA 5CJPA 4YQFA 4XVCA 1FX0B 1SXGA 1G6KA 2O06A 2AG8A 2WWFA 3DHVA 4EPXA 4GLFA 3TOVA 1G3QA 2I6SA 1U8ZA 2FRDA 1M34A 5K45A 2VL7A 5AR1A 2ZYHA 3BHIA 3GG2A 4Q48A 2VEDA 4G4GA 4ETWA 4MV7A 1GLGA 4YUZA 2QTNA 3TCNA 4BO4A 4TV8A 1BWQA 2EX4A 8ADHA 4A8HA 2XB6A 5EJAA 1QNLA 4M0DA 4QXPA 3D6NB 5AQ1A 3FWKA 3LS2A 4TTQA 2GB4A 1QH8B 5AKJA 1CP2A 2C0CA 3CZ5A 1REQA 3H5NA 3KZKA 4TUYF 5D3MA 1Y8AA 1RPNA 1B8PA 3TQFA 1JVBA 4FBLA 2N46A 2VHCA 3RG8A 1EE2A 4B7AA 1ZJWA 4EKIA 1I2BA 3JQQA 4V0NA 3L7MA 5KWVA 1BE8A 4V0MA 5DNEA 1MJGA 1V1RA 3UKJA 3K0AA 2QRLA 3A1NA 4A6PA 2CV2A 1ZMRA 1OXTA 1SUEA 5CNIA 3WK8A 4QL3A 5LZ8A 1FBTA 4YMLA 1K97A 3MILA 4M2LA 2K87A 4R41A 2HFKA 2NOAA 2G1UA 2ADMA 1UZLA 1C4WA 3VV3A 4BNXA 1B43A 5CB6A 2HU8A 4RMIA 1KI7A 2BEWB 4BLUA 3OE7A 1PR9A 3OI7A 1O94C 3DGFC 1CEXA 4BQNA 1TYEB 1CJTC 2BFBA 1V3VA 1TKRA 2Q1SA 3TSWA 3OUZA 5FOSA 1GDHA 1P81A 4BFWA 1NNUA 4YP5A 4MYRA 3GJXC 4ZMSA 5CDYA 1IUPA 4H1TA 4TMXA 2XXAB 1O03A 4OVKA 3QVMA 2RH8A 1NVTA 3W8FA 1ZM4A 3IDFA 2P65A 1G2IA 4MUGA 3ZGYA 4H4CA 1L5VA 3KKPA 4KRFA 3OC0A 3IP5A 4DJFC 1M6YA 3DP7A 1Z22A 3TZCA 5HE8A 2JFQA 3RJ9A 3U1VA 2HR1A 3CRVA 4HWOA 4MQFA 4ARVA 2HRDA 3ABQB 3KELA 4X45A 2C5SA 2O8CB 1XCOA 2PTGA 4FYMA 1IOVA 2HEIA 1U9ZA 1XEXB 2OZLB 2PQ6A 3A4TA 1M34E 3ESAA 1PSZA 4OATA 2IUEA 1F4VA 2AWNA 1NBHA 1HLGA 2CW5A 3SYKA 2B94A 3HSYA 4BN4A 3WQRA 5DTMA 1BROA 3ITDA 3UB3A 3IIMA 5K0SA 1P19A 2EHJA 2GSDA 1LX6A 3NAMA 3B1JA 3EZGA 1RRCA 1EJ0A 4MI3A 3JZDA 3B7WA 4NFSA 4EQ6B 3O4IA 2QTZA 2P5SA 1PYDA 2ENWA 1T29A 2Y4NA 4L50A 4BMXA 2YL2A 3ZDBA 1JHDA 2PZJA 2ZAYA 1KK0A 3ZHYA 4HMQA 3COVA 2Y3IA 1XKTA 2P4UA 2XD4A 4TZ0A 4LJ5A 4AMGA 2WP8J 1XTJA 1XCPA 3ETEA 4PSAA 2CV0A 2XCLA 1R0XA 5GZ1A 2PQMA 1W2GA 4PM4A 1TAQA 4WXMA 3FOWA 1ZC4A 4EA9A 1W73A 2P9YA 3EG5A 2P9GA 2JLYA 1HE5A 3K5HA 4NF2A 1YRAA 1OZFA 4LRXA 1FMFA 2QXTA 3PJFA 5DO9A 5HX7A 1DRWA 1JLHA 4LJ9A 5LB4A 3ZWBA 4B3IA 1YFJA 1N1MA 4AIRA 1ODIA 1QGUB 4QG3A 5ARBA 2PAFA 3ACCA 1VIYA 4C6RA 5CTAA 3P8ZA 2J9XB 5ECWA 3KBOA 3MJHA 3OZ7A 1OH5A 3RJMA 4LHWA 1QYIA 5KNCA 1UEIA 3MWKA 4HY3A 2E4WA 4EG0A 4B8ZA 4CEHA 3IP6A 2ZRQA 3H84A 4N1AA 1M6HA 2F6RA 2I4TA 2Q5JA 3CEJA 3E35A 4R31A 5H4HA 1XUOA 3JYLA 4Q39A 3SIWA 3WLNA 5KQSA 2AWOA 4CF3A 1PIWA 1EVEA 1JIVA 2PUVA 4PVCA 3PNOA 4AX4A 3GJYA 4H3HB 2IHBA 3IB3A 1SN7A 2ZSKA 3GFRA 4C5CA 5K6TA 2ST1A 3HVHA 4LXXA 3P9CA 1Y5MA 4MIEA 1DWQA 1QZ3A 1BA3A 2PO5A 4IY1A 1KP2A 5A2QA 5FADA 3LX4A 4E15A 1DKQA 1H1LB 1T4GA 1UIRA 1LK5A 1WQ3A 4MTCA 4P0TA 3SVTA 4A3SA 1VKZA 1ZI8A 2ECKA 3PRJA 1N0UA 4H7HA 4Z4FA 2QI9C 5EJMA 4Q1FA 3K09C 3D54D 4R2XA 1U0RA 4PV7A 1KOFA 1DQYA 3GDHA 1RRPA 5GQSA 2LTAA 4ZQCB 2BEUB 1M6VA 3FSJX 4K28A 2J33A 3JATA 3ZUPA 1Z82A 5ALXA 4AQYB 5CB4F 1UMDB 3R7FA 1H2YA 4QTYA 3NDBB 3BWBA 2IBSA 4RXUA 1Z6XA 1Z6QA 3B48A 3TX2A 1X1DA 4Q9AA 2X0RA 2CK3A 3ESRA 1JDVA 2WLTA 3JU3A 1J6UA 1X0XA 2QTLA 4CF4A 3ZI0A 3HR4A 2WT4A 1W96A 3BIOA 3MB8A 3U3DA 1Z16A 2E87A 4CI0B 4NOJA 4CQJA 1DQZA 1L7PA 5G41A 1CUVA 4QXOA 5G0WA 2PNJA 5FUMA 3ZPXA 1PRYA 3GUHA 3HKCB 4KV7A 5BVHB 2EDAA 4CF7A 4Y6GB 5IT0A 3DZDA 1CLUA 1WXFA 4KXWA 4P4NA 5ENVA 1H05A 2BRUC 2AV6A 1XCGB 1HQYE 2X77A 4RWEA 3WLMA 4QKQA 3JX9A 4HRXA 1AQYA 1PL7A 3MQ4A 4H6VA 4TKUB 3VPBA 1J1UA 1ICEA 5K3FB 4XJSA 5B37A 1GNPA 1IZ7A 3E2IA 4YCLA 3IMKA 5IFKA 1KI4A 2IF0A 4OYRA 1L4UA 4EGSA 4PE5B 1OLUA 1MPXA 5JMPA 4D9MA 1EUQA 2NSLA 3HDYA 1RQ7A 3WLHA 4XVUA 4FSDA 1IQPA 2C5HA 3PQ6A 1YA4A 3I64A 4NU6A 2HHJA 4GS5A 4YCCA 4DT1B 2GEFA 1SVWA 3O1LA 1X2EA 3KQLA 1T6XA 5ARDA 2P2GA 3TRIA 3K70D 2WJWA 1JEDA 2ZTHA 3FVVA 1Z7EA 3H1PA 5TSDA 3WGZA 3PFBA 1ZZGA 1SC1A 4BLPA 5JAMA 1A27A 3DB2A 3G8AA 2GXQA 2GKOA 1YZVA 4FK8A 3H8VA 1NFQA 3EPHA 1S8AA 1XROA 4P8RA 4C04A 1L5ZA 4A0SA 1N2EA 2EBHX 1WV0A 2Q4DA 3BDAA 1N0IA 4BFCA 4ZEMA 1DAOA 3RVBA 1UKAA 3RYHA 3AL2A 3KYCB 4TS4A 5DNAA 5K0GA 2BP7B 3HLKA 4I46A 3GLUA 4JUBA 3RVRA 2GJ8A 4OHZA 1XZNA 1Z88A 2X23A 3F6CA 3NAQA 1QAQA 2WSLA 2H1VA 221PA 4MKRA 2PS1A 2XVMA 4NQZA 5CVEA 2G8NA 2IXTA 5EQTA 5IDVA 1GTSA 1X8XA 4FGWA 4F93B 3SJCA 3PDIA 1C7FA 3LPMA 1QFJA 4YI5A 2PFKA 1TU3A 2ZJZA 4Q7MB 3HB1A 5P8WA 2V65A 4OMUA 3NORA 3VZBA 3L9WA 3ONNA 3DXYA 3PK0A 3VGJA 1FMJA 4FCWA 1U3VA 2YOGA 1X1SA 1MJFA 1NX9A 4ENVA 3ZCPA 1ODCA 2GCNA 4XX0B 1TDJA 2NPIA 1Z68A 1LVGA 1V7ZA 4IIJB 3DFIA 3M2PA 4MEJA 2I2CA 1T3HA 1WXHA 4G81A 1UM9A 5EN4A 1OWMA 3GGDA 3LC7O 4TWAA 1C9MA 1DKRA 4QWMA 1VMDA 1GUAA 1JEJA 2OC9A 1HEUA 2NU7B 3C4VA 4JK3A 1PDOA 4RA6B 5CYFA 5EP1A 2EJWA 5TX7A 1OYVA 4C1BA 3CBQA 5SYNA 5DWVA 2JH9A 2R68A 3FE2A 3TLAA 4ERNA 1ZD5A 4MWEA 5KNDD 1KWKA 4N5DA 1R2QA 3DOUA 4PFKA 1H85A 4O4IB 3KKEA 5JQGF 4HLDA 1UBNA 3WIOA 1IY8A 2I22A 3H13A 3L8FA 1VHQA 3H4VA 5HDQA 3AJRA 4HXEB 2Q4TA 2AFHB 4L0MA 2ZAGA 2J3EA 1G5IA 3DOIA 3PGXA 4EF4A 3DZCA 3PUHA 4ZT4A 2WHPB 5J4VA 3I0NA 4HTFA 4QUHA 5DNWA 3E58A 3NFRA 3O8OB 4Q7KA 1XA4A 1ZHHA 3RUHA 2ZS9A 1MJHA 5AVZA 1C1XA 1RKUA 4CFSA 5A0TA 2PZ8A 4XB2A 2SICE 1KSHA 2WWRA 2FCAA 2YHSA 3T3OA 5EPEA 1FMTA 1CLEA 5E1BA 1TYCA 4ND8B 1FYXA 1KZ9A 3W06A 1XCMA 3KOMA 1H0HA 5FFFA 4PGMA 1XZBA 1L5YA 1P1FA 1X13A 3HACA 4KQJA 3TTSA 1JBQA 4DHWA 2WAMA 4WA7A 1NC1A 3O8DA 4IX9A 4QGHA 3G9ZA 4E5YA 2XDYA 2AI3A 2FMKA 4H7PA 3UZUA 2BI4A 1NVEA 1T1GA 4MWCA 4ZI5A 3WS7A 1SHUX 3BTSA 1FNBA 3AVXA 4RM2A 3DF9A 3WLIA 3FOBA 2Z1DA 4EX7A 5BNWA 2VPQA 2I3ZA 3JQBA 3K8QA 1CFZA 1WKVA 2H48A 4CM9D 2V03A 1SCDA 3K1AB 5CLQA 3OT1A 3ESQA 3ZI4A 5JO9A 1CZLA 1CUIA 1ULSA 5ALLA 1KA9H 1UMKA 3GIWA 1VE9A 4W9NA 1G98A 3MHTA 4OQYA 3H3XA 2QGZA 3C6QA 4W6QA 1X1EA 1XN4A 1F2UB 4X41A 4OIMA 1B74A 1N6LA 2HXGA 3IQEA 3L4BC 5BYJA 2X1VA 2PKCA 2FZVA 1J09A 5AVXA 1P8AA 3SC6A 3BRWD 4MPPA 1UFRA 4G1FA 2XUKA 2ZREA 4H15A 5LMNB 4PX3A 1ECBA 1MNAA 1OT3A 1V3TA 3LZDA 3QG1A 1ISJA 4EITA 3OCCA 1WMFA 1X2BA 3R0XA 1CVLA 4ETNA 4EJSC 1JKMA 3BS4A 4F2WA 4D9GA 4CF6A 1BD3A 1JG2A 1P9WA 1QIGA 2WZDA 3IIKA 4UAJA 2CBZA 4G01B 3QVGB 3DT9A 2PWPA 5KIAA 4NTZA 4KFSA 2BBSA 2HJVA 5I45A 2ZSIA 4DGSA 4OK5A 4OI0A 3BRWA 4BDSA 1I1HA 1NJ6A 5HMLA 2C61A 3E18A 1ATIA 5JY1A 2L0XA 3AF4A 5CURA 2NWQA 1TTHA 3P9ZA 5CBPA 1CY7A 4X6YA 1L4KA 3IPRA 5DE3A 2BZSA 3WV4A 2X13A 4ZO7A 3SS9X 3ML1A 5E1MA 2FZ5A 1QQTA 3V1YA 1UT6A 2D0PB 3FRJA 5LUAA 3D8RA 1W5FA 2BGTA 3ES9A 1WL8A 1U3FA 1U6JA 1U0TA 2C7BA 1SQSA 4ZU6X 4YVFA 4NXMB 5GADl 3A2MA 3PLRA 4RMNA 1KERA 2BGMA 3MJFA 4H4DA 4NOKA 3AKZA 2QYHA 4TMFA 3L40A 4CTOA 3ROEA 4NAVA 4Y2PA 5ILQA 4D43A 2TRSB 1OC4A 4EYOA 2D0OB 5FBLB 5KS2A 2H4HA 1N3YA 1Q7EA 421PA 3ZKWA 1ZA1A 3WRYC 1XELA 3V00A 1DDOA 1E5TA 5AKZA 3CX7A 5KNBH 2IF2A 3CZPA 1YZLA 3EVZA 4AW9A 1MFPA 3KD2A 1JVNA 1P2VA 1P2FA 2AMJA 1PZNA 3WIBA 1QBKC 4NECA 3JZAA 1PR1A 4NI5A 4ND2A 3DLBA 4FHGA 2GPSA 3EVTA 3X43A 1MVLA 2HRRA 3WNBA 1F14A 1KDVA 1KOGA 4V0RA 1GNSA 2VP2A 2WE7A 4O3MA 3W3AD 4JS0A 3V2HA 5CNJA 5L95A 3AEKB 2JDID 3RYCA 3ZDRA 3M1YA 3AUKA 1FDOA 2PZGA 2B4TO 3ZHZA 5EWMA 5DDIP 4NMLA 2C9CA 2MYNA 2RCNA 3DZIA 4GW3A 1FVOA 1W4ZA 2FOIA 2GDJA 2I6XA 4EJ6A 3OLXA 2NO7A 4PZEA 4AG5A 3O3OB 1U99A 3ORYA 1FVFA 2PVSA 3R7BA 3UYKA 2RK4A 3ZYCA 1MJNA 3QE2A 3N6XA 4JLNA 2LV8A 1SXQA 4MQ4A 3G6KA 2C2YA 2O52A 2QVYX 3KZCA 3RRMA 1DZIA 4LDPA 1XKXA 4DIFA 4DCOA 1SHZA 3Q5EA 5CUQA 5IUNC 1BWRA 2O50A 2QP4A 1NVWQ 1A72A 4TRMA 3T5MA 3IDQA 2ZJ1A 2F4NA 1HLDA 1YJXA 4XX1A 5HKLA 2PY6A 5FYDA 2DLNA 5B1SA 1UAGA 4DCGA 5EG5A 4M38A 4MQBA 1QC5B 1E3WA 1CY6A 1T6YA 2EW8A 2FJ0A 1OI4A 3G2OA 1RCTE 2FEWB 4PYNA 2VIIA 3CNLA 3VVBA 3X1ZA 1WPXA 2GN1A 2PH7A 3U0VA 5EQFA 1T2AA 1SCBA 1XC7A 3CZAA 3HFRA 3PEUA 3R1IA 5DB4A 5AUPB 5IZ4A 1IIRA 1SUDA 4XWYA 3AVWA 1V11B 2WMNB 2VK1A 4O33A 5CH5A 3I2HA 3CNQS 4IDEA 2MU1A 4CQLA 4RD0A 1P39A 4MW0A 4RQUA 4R83A 3SXJA 3IVXA 4AF6A 1NGSA 3FSEA 1AGXA 2F59A 3R20A 1RKVA 3HL0A 1JEYB 2GZDA 1XLTC 1O5OA 2REQB 3NHLA 2O7QA 2Q5FA 2PVCA 4O2LA 3RAJA 4MH0R 5AK3A 3SD7A 4X6LA 4WMLA 4RHYA 3R3YA 4AYXA 3ZQKA 5LU9A 2Q5IA 1MB3A 1E69A 1XZGA 2PMDA 1PK9A 2DY1A 2FFJA 1X39A 1FP2A 3QXSA 4LA4A 3FYTA 1L4LA 1G8JA 1Q2UA 1HEIA 1YULA 2BE9A 2VJQA 3NDRA 1GKKA 4KOAA 1SELA 1Q14A 3LUFA 1I32A 1TMGE 1UT8A 1NYTA 2E7ZA 4MUYA 3LZCA 2WU0A 3L6BA 1C3OB 4GQBA 2BFCA 1DHRA 1ZD8A 3K6KA 2JGRA 2V7BA 4U6QA 3TQHA 3G2PA 3QXJA 4EB8A 5JFTA 4BMDA 1MR3F 3DT6A 4B34A 1DKMA 1Z73A 5JNVA 3HNOA 4UNNA 1TGYA 3M9LA 4ZPXA 2QIOA 3OQJA 3W6UA 2XWQA 4KG7A 2OPHA 3T9CA 1FJXA 1L5SA 4I5IA 1XDGA 4INJA 3N8HA 2RHCA 4MR8A 3RFFA 2VI5A 2QIPA 9GPBA 3MJRA 3VPSA 1NPDA 3KAQA 4BTEA 1UL1X 4KEAA 1BVYF 1GD1O 3DLIA 2R8BA 2NU9A 3FY4A 4ZHQB 1Y4AE 1J06A 1TVKA 3AEUB 4HYTA 3ZGLA 1BD4A 1R5JA 5EJ7A 3EGXA 3VGPA 3A4LA 3DEYX 4W5HA 4OP2A 1EUCB 1ZXXA 2PRIA 1IXZA 2I4IA 1OYOA 1DGQA 1M0EA 1MBZA 3PVZA 1CR4A 4PF1A 5G40A 4NYIR 3KR1A 3D4OA 1G5RA 3AFOA 1PSWA 2C9MA 1SJ9A 4N6GA 4ZEWA 4PC1A 2WWIA 4IDGA 2WFLB 3DDSA