1Z5UA

Crystal structure of s. typhimurium apha complexed with cyclic-amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
208
Chain Sequence
TLNPGTNVAKLAEQAPVHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTKVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRILRAANSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of class-B bacterial non-specific acid phosphatase: functional role of invariant Lys154
rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
molecule keywords AphA protein
total genus 73
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z5uA00
2YJ6A 4JDPA 1VJRA 1Z4NA 4L6AA 4O8CA 2I55A 3U19A 3WKBA 2MSNA 4NV0A 1FEZA 3FPSA 4YGYA 2WF8A 4I9FA 3NIWA 4BKMA 2C8LA 5FP0A 1U7OA 2GHQA 4MWOA 4BNDB 5AVWA 3W5DA 4RETA 3SF0A 3WGVA 4CF5A 2ZBGA 1RKQA 2D2VA 2FPXA 3ED5A 4GIBA 5ALTA 3WK5A 1ZJJA 2OA0A 1LTQA 5AIBA 4E88A 2P69A 4Y2VA 1TJ3A 2ZBFA 2X4DA 5AVVA 2AMYA 3L5KA 3I76A 3ET5A 3UM9A 3OCZA 4UW9A 1PW5A 4UU1A 4KNWA 3AR3A 2BDEA 3ZTYA 2NYVA 2HI0A 4Y2TA 5IT0A 3WKDA 3SHQA 4XOUA 1TJ4A 3F9RA 3E84A 4Y2UA 5AW1A 2C8KA 1J8DA 3QX7A 4UATA 3SKXA 2P27A 5AVXA 4EEKA 4XQ0A 3ET4A 2HEGA 2WFAA 2ZXEA 3DAOA 5ALUA 3QUCA 4OD0A 5T41A 1QH9A 3J7TA 5AI8A 1L8LA 1L6RA 5AICA 3WK7A 2JAUA 2HX1A 1RMQA 2FPWA 4AS2A 5AHXA 1YNSA 3QU4A 3QU2A 5ALOA 5AI0A 4FFDA 2IOHA 3QU9A 1Z4JA 1YJ5A 5ALIA 5ALXA 4ZEVA 3L8HA 1QQ6A 1S2OA 3W5CA 1MH9A 2MU1A 2QLTA 5AESA 5ALFA 4DW8A 4IG4A 1Z4IA 4HGOA 1JUDA 4Y2QA 3M9LA 1RLMA 2OYCA 3FVVA 2HF2A 3AR9A 3UMCA 5AKEA 3VAYA 3L1VA 4HGPA 3SLRA 4OCZA 5AW9A 5ALEA 1IWOA 2WF6A 5JJBA 2HSZA 2B8EA 2YY6A 2CFTA 4GXTA 3QU7A 4HGNA 5AW3A 2YBDA 4C4SA 1ZD2P 2YMLA 5AW7A 1T5TA 4BNDA 3B9RA 1RPZA 3U7FB 3U13A 3NRJA 5ALDA 4UM5A 3P96A 2YFYA 4HGRA 3OCYA 2Q5EA 2W4MA 5IT4A 3KZXA 2EARA 3K1ZA 4ZEWA 3MN1A 2R8EA 2PR7A 3FZQA 2PKEA 3ZVLA 2I34A 4EELA 2G1AA 2WF5A 5AKXA 2RAVA 4HYTA 3AR5A 1YS9A 3UMGA 1LVHA 1Z4PX 3E58A 5AKYA 1N8NA 1RDFA 3OPXA 4HAIA 5AI5A 4F71A 3WKCA 3QUBA 1ZD5A 3ZX4A 3QLEA 3CZ4A 4YCLA 1K1EA 4F72A 2G08A 3N07A 2I7DA 4YIKA 2B0CA 1Z4MA 3ZTWA 1CQZA 1RMYA 3R4CA 3QXGA 5AM5A 3DNPA 1YDFA 2HOQA 4C4RA 3QYPA 3BA6A 2EATA 5ALRA 2O9JA 4J2TA 2I54A 2I6XA 3OCWA 4CE6A 2R8ZA 1S8OA 5AI6A 5ALSA 3M1YA 4QQFA 3R09A 2FEAA 2Q4RA 2HO4A 4B6JA 4DWOA 3L0CA 1Z4OA 4NWIA 4UMVA 4Y3UA 2JAWA 3KD3A 4YIHA 3S6JA 2VKQA 5AW2A 4UAVA 1RKUA 2NO5A 5AW0A 4UM7A 4FE3A 3EWIA 5ALNA 5ALLA 3A3YA 2G07A 4Y2PA 1YV9A 1XVIA 3N28A 4KX5A 1QQ7A 3MMZA 1Q91A 2JARA 4CNQA 5ALKA 2EAUA 1Z5UA 2IA5A 4XPZA 3L1UA 3U7GA 4YCNA 4Y2SA 2WHEA 3N8GA 3FPBA 3GYGA 3PGVA 4BBJA 4YH1A 1ZD3A 5AI9A 1WVIA 1ZOLA 2IOFA 1VJ5A 5AM1A 3IJ5A 2YMPA 5ALQA 5ALPA 5AK5A 1Y8AA 4L57A 3QUTA 3AR2A 3PDWA 3RF6A 3AR6A 4UARA 2JGAA 3A1CA 1U2TA 1WPGA 1YMQA 2JAOA 2G80A 3ZVMA 3E81A 3ZU6A 1NNLA 1EK2A 5AK4A 1RQLA 2CFRA 2B30A 4PNHA 3QGMA 1L7OA 2B1QA 5ALVA 5AM0A 1QQ5A 3SKYA 5AVTA 2AUTA 2B82A 3OCUA 3NANA 1NF2A 5AKIA 5AKJA 2FUCA 2W43A 4ZEXA 1L7MA 4MUMA 2GFHA 3WK8A 3I28A 3ZI4A 5IS2A 3W5AA 4BEVA 4YCMA 1WR8A 5AVSA 2FPUA 2FI1A 1RQNA 5ALJA 1X42A 2RB5A 2IYEA 1ZD4A 2AH5A 3I6BA 4FYPA 4UAUA 3AR8A 3L8GA 3L7YA 3OTQA 4UU0A 3D6JA 3IB6A 3U26A 3PCTA 3QU5A 3RFUA 1U7PA 2PQ0A 5AK3A 3WKEA 4UMFA 1NRWA 2C9MA 3FM9A 3B9BA 4Y2JA 4H1WA 1RMTA 3IRUA 3DV9A 2WF7A 2YMMA 2WF9A 1N9KA 1ZRNA 3I1YA 4G9BA 3ZUPA 1RLTA 3U7HB 3ZX5A 3ESQA 3ZWDA 3HYCA 4KN8A 3ZWKA 1KYTA 5A3RA 5A3SA 2O2XA 1SU4A 5AKHA 4EZEA 3DDHA 3MC1A 2W11A 4CF3A 4G63A 5AKKA 2WM8A 3A1EA 2BDUA 2HCFA 5AVRA 5AW6A 3OCVA 2G06A 4UASA 2YJ5A 2FUEA 2B1RA 1J97A 5A3QA 4JB3A 4EX6A 3U7EB 3EPRA 1CR6A 3NASA 5AVUA 2FDRA 2RBKA 3WKAA 4NAVA 2G09A 1Q92A 1VFPA 2HHLA 4NFLA 1XPJA 2HF7A 5AVYA 2I33A 2ZBDA 3EF0A 3KBBA 5ALYA 3AR4A 1WZCA 3ZVNA 1ZRMA 3W5BA 5ALGA 2AGVA 5AW8A 2FPSA 4UMEA 3QNMA 3BWVA 3QUQA 2CN1A 3NUQA 3SD7A 2HDOA 5AK6A 3E8MA 3FGOA 3KOOA 2ODAA 4Y2RA 5AW4A 2RARA 4C4TA 3WK9A 1U02A 3NAMA 4I9GA 1EK1A 5ALWA 2IOFK 4J03A 4BEWA 4Y2XA 4RESA 3SMVA 3AR7A 2OM6A 1L7PA 4NABA 4KYTA 1XP5A 2OBBA 4BX3A 1RRCA 3L0YA 1ZS9A 4AS3A 2Q4TA 1O03A 3WGUA 4BYGA 2CFSA 2ZOSA 4KNVA 3KDPA 4IFTA 5ALZA 1SWWA 3EF1A 1O08A 1Z4KA 1U2SA 1L8OA 2R8XA 4OHFA 3ONNA 3WK4A 2P11A 5AI4A 1RLOA 2B8JA 4QJBA 2DQSA 3L0BA 3R9KA 2ZG6A 4Y2YA 4DFDA 1QYIA 2P9JA 3A1DA 5ALHA 3CNHA 4BX0A 3WK6A 1SWVA 5AM4A 4DCCA 4UMDA 1L7NA 5AM2A 5AKZA 3TLMA 1Z4LA 2YN4A 3L8EA 4OFZA 5AKGA 3B8EA 1TE2A 1Z5GA 2NO4A 2BY4A 2YJ4A 4AP9A 2GHTA 1F5SA 2R8YA 2G0AA 2ZBEA 1RC8A 1Z4QA 3ESRA 5AKLA 4XE5A 3PGLA 3MPOA 3N1UA 2GMWA 2QYHA 3HLTA 3KC2A 3L8FA 3N5KA 3NALA 3ZW7A 2YMQA 3UMBA 1T5SA 5AVQA 1TA0A 1AQ6A 2YJ3A 5AW5A 4HGQA 1RKVA 4KX3A 5AIAA 4L6CA 4BX2A 2C4NA 5AM3A 5E0OA 3OCXA 2GO7A 4EENA 4EX7A 1T9ZA 4CF4A 1TJ5A 5ALMA 1Z88A 5AVZA 2FPRA 2C88A
chains in the Genus database with same CATH superfamily
4PG5A 2RIPA 3MWGA 4EF4A 3MF4A 4OBBA 5K3FA 4D4HA 4PXYA 3KV3O 1J25A 1QRDA 2D2XA 4IIHA 4R83A 4F6LA 5CA1F 4N12A 3ICEA 4WSOA 4CUJA 1AURA 4YUXA 4B5LA 3DHVA 1CDDA 4HS9A 2FPKA 1SQ5A 3JCZA 1ZNZA 1LDBA 3NIWA 3NXKA 4BFCA 4ZVTA 1RM4A 2TS1A 4UUMA 2HPHA 4DADA 1CZRA 2BJVA 3OZTA 4Y0NA 2GHQA 3UW3A 3H9BA 1N2CB 3FB1A 3I3OA 5SY4A 4EJ6A 3DZ8A 5BXQC 5KTSA 1GM5A 4TV9A 1DKUA 1ZGBA 3DEIA 4K05A 4F11A 1N36B 2FJUA 4RLQA 5JS1A 3RC2A 3NWJA 3I2FA 4WUTA 4ZO9A 3LBNA 1X7DA 3EIEA 5LDDC 10MHA 4KIJA 3ITNA 3QOWA 1CF9A 3O0TA 1L5MA 3REFA 2P7IA 4JI6B 3CCBA 3NNNA 2FEOA 2D00A 3MINB 4TWIA 2RHCA 3B8HA 3MTGA 2R97A 1ZXXA 3RS0A 3RF7A 4CQMA 4EG4A 2BGJA 3ZE7A 4BMOB 1XB2A 3EPPA 1QYXA 5FHRA 5MN4A 1BH6A 1ZD9A 1FYXA 4W8GA 4EHAA 3UJHA 2ORIA 3PXEA 2QPAA 5AVVA 4GNKA 3I76A 4UW9A 2F1IA 1F48A 1PKXA 1R0XA 4CFZA 3GLQA 1YGPA 2HI0A 2Q1SA 5DF1A 5FA8A 4BNVA 2AI2A 3K6SA 3A6GA 2BISA 3RIHA 4MUKA 3GFSA 1EP1B 4M9QA 1LU9A 1I7SB 3GIWA 4L08A 2H51A 3DZDA 1YA8A 3U3DA 3E84A 4O4HA 5KMGB 1G291 3IHTA 3OTIA 3WLOA 1SUAA 3O38A 3T7JA 1ZUNA 3BKXA 3T7EA 3E82A 2DETA 1FFYA 2FN4A 3GVIA 1I3MA 1BDMA 4OXNA 1E9FA 4QQRA 5CG1A 2GWHA 5CVUA 3HCRA 3WMXA 2OV6A 5G0WA 2P2YA 2XOKA 4ZKEA 3CF0A 2V9PA 4WN9B 4QA9A 3BIJA 1RRVA 1CNEA 4FGJA 2PJRA 1J21A 3PNKA 4WXEA 3HB9A 3K2IA 5BN4A 2BGRA 1DSSG 4QBTA 3KSUA 5AHXA 3ZG6A 3TW4A 2F3TA 4W1SA 1T5OA 3H18A 3IQDB 3NHZA 4B3BA 5IEJA 1N5IA 4H60A 4RZSA 4RHFA 5FF9A 1A4UA 3IVAA 4IDHA 3CCFA 4EG0A 3IYLW 3DQQA 4I19A 4PR3A 4XGRA 3V6LA 5LQJA 5LQSA 4JI0B 2MR6A 1BQ3A 1NVAA 1PTJC 3I2HA 2P9ZA 4QYIB 1PR6A 1ZC3A 2V4MA 3BFVA 3WQBA 4AG5A 1JQ5A 1CT9A 3NUGA 3I34X 4EEZA 5J2TA 2ZVDA 4C01A 5IKMA 4BFSA 3QXHA 1RJEA 3ENWA 3INNA 3H5OA 4AZ3B 1X13A 5DNDA 3MUOA 4QGGA 4HNVA 4ZZ3A 4Y2QA 1JDZA 5JARA 5JO9A 4JXZA 3AYZB 1G5QA 2FCRA 1YJCA 3OCCA 3KXIA 1XDDA 3PNYA 2EV9A 3TOVA 4D8VA 4UHFA 3KQLA 1FLNA 3ZDDA 2Y76A 1N0WA 1SUBA 2VNAA 4GZ5A 1TAHA 2IYFA 2QUJA 4RIHA 3HFGA 4P35A 4RK1A 2R48A 1CF4A 1Z83A 1GTL1 2R8PA 3INRA 2OFWA 1LPPA 1IN1A 2FEXA 4BLPA 2TSYB 2YCLA 1WD5A 1OXKB 4MKHA 4HAYA 4FDMA 3ZZTA 1E99A 3EEIA 3NS7A 2ZBRA 1MABB 3OA0A 4Q4HA 2KI5A 1JLHA 2R1UA 3QU7A 4I2NA 1JAZA 2BSAA 1U3CA 2FVYA 4MSUA 4PAWA 4BJ6A 5B6PA 5J2TB 1F6WA 1USWA 1XTVA 4C4SA 2JC3A 3PF8A 1QC5B 3H8WA 5B2FA 1MOSA 4RGBA 3T1NA 1TDJA 5ALDA 4BJHB 3LP6A 3PXBA 1T2VA 2YFYA 5BRNA 2AXNA 1YZLA 2NQTA 4G1VA 4EF6A 4IEEA 1HDRA 1OLXA 1R8YA 5I9BA 3G49A 1A8IA 3PR1A 2E1PA 3GIDA 2Q5OA 2FUNB 4U3JA 2IHZA 3W2TA 2XGSA 5DW0A 1QZ3A 1W8IA 3Q41A 4HDSA 4C07A 5EJ6A 2QTFA 1A72A 2PKQP 3I8OA 1GUDA 1ECPA 1M1ZA 4CR8A 3HYSA 4QTYA 1UK8A 4IDGA 3D54D 3W2GA 4B7UA 4MV0A 4LSWA 2IVFA 1CULC 3UEOA 5HK9A 2B6NA 3FMIA 3QEOA 3DZIA 2LCQA 3FF1A 4YDQA 4PG8A 3EEOA 5BUQA 1KHTA 2GEFA 2GK6A 1N1GA 3VJKA 4RPHA 4B3FX 4YO8A 2CLOB 3UGTA 4J0HA 4U2GA 1GTZA 1T8RA 4OEHA 4CM9D 4YPVA 1JILA 5DM1A 1HDCA 2VHEA 3L1HA 1DMRA 4IGKA 1V9LA 2QRMA 2GEDA 3GFPA 3R4CA 1ZC4A 3IJEB 3QXGA 3C3AA 4HTAA 1ZK1A 2F1HA 1W29A 3EOAI 3PP8A 4MRVA 4UBKA 4XCXA 1FJHA 1JXQA 3NORA 2C5AA 1JS1X 2Q2QA 3AKDA 1C4WA 3F7NA 1CUCA 3KUUA 4WKNA 2VT6A 3AP1A 3LI2A 3R3XA 3UAWA 1D0VA 5DHUA 4BLUA 1W19A 4F4IA 4ZIRB 1IHDA 4G81A 4TMXA 1QK5A 2PU5A 1Z15A 5FBKA 4CE6A 2GKSA 1Y34E 3IPLA 4ZPJA 4F5WA 4UBIA 4BWFB 5DBFA 3LT2A 1NOKA 5T4EA 3WLRA 2CVPA 3LOPA 1F1JA 4R81A 4Y3UA 5EERA 4QXAA 4U6NA 1V37A 3S6JA 3DS8A 2QYSA 4JODA 1XHEA 2XWJI 4R9NA 4WEOA 4AJNA 4EDFA 1W36C 2CLKB 5C51B 2NO5A 1C1DB 4WPGA 2Z0MA 2QAGC 4FE3A 3ZDCA 3U49A 3H6HA 3WZMA 2ZI5A 3GMIA 5AO9A 2H2HA 1GA1A 3Q7RA 4F84A 3IIKA 4NFHA 3E3MA 1LLFA 1E1MA 3OQ1A 2WYIA 2GNPA 3MMZA 2HRCA 1JWLA 1PZEA 1VL6A 1P2FA 2X3YA 3MYYA 4IXMA 1S3IA 3VZBA 1NQTA 2V7EA 5B58C 2O8VA 4EVRA 5FBQB 3RUDA 1B00A 2PCLA 5ABPA 5TMEA 1UKYA 3WP1B 2IJGX 1IPFA 1H93A 4J4TA 1MFZA 2PGLA 4I3FA 1YHNA 4HATA 1D6JA 2XE6A 4H3KB 3WRXA 5EHIA 2JGJA 2C03A 2RHWA 3R7AA 5KX5F 1C0PA 3GT0A 1E4VA 4AN1A 2GPWA 4Y7DA 3H97A 4E5YA 1H4QA 4J49A 1FSFA 1MX9A 2G82A 2J3KA 4V3BA 1CU1A 1TK9A 3A26A 3I01A 4W8HA 3O8OB 3RWBA 4W5JA 1GG9A 1LTKA 2WKSA 3CNEA 4WY2A 2H9AA 3UMJA 1RXYA 3V8QA 4AF7A 5L4NA 3W4JA 3V4PB 1YQXA 1A5BB 4KFUA 3NMUF 1JW9B 3C3PA 3DYIA 4O2AB 3T5BA 1TM4E 3SP1A 3EX7C 3RYIB 1N6PA 2RC6A 1B16A 1HLGA 1Y4SA 1BC5A 3K6KA 3M6AA 3OEED 1HQKA 3NH9A 2IP2A 4YHBA 1VGVA 2DFKB 5EE0A 5FADA 5FJJA 5FLXA 2AD1A 2WJAA 5A7HA 4GG1A 3H87A 4TLDA 4UCWA 5CDUA 1RRMA 1Z74A 2VJLA 1ENOA 3F7OA 1ULSA 3H1AA 4K2AA 1D07A 1KZGB 1G2PA 4MVYA 5EPUA 1JYSA 3SKYA 1Z0JA 2H8KA 3WYAA 1QB7A 2OM2A 1MGOA 3TVDA 4N1AA 3PV0A 1KJJA 2GT1A 5DTQA 3VR6A 3JQ6A 5JYEA 1W4RA 3EJWA 1IWPB 4ZQFA 2HU8A 3CA8A 1LS1A 4DEYA 4FGZA 2IZ1A 2ATEA 4G4IA 3KOMA 2V0GA 1FYDA 3E48A 7REQA 2QTMA 5AVKA 5IS2A 2ZXUA 4Q1BA 3K3PA 4DDKA 1MO4A 3N2KB 3R0QA 1FX0B 1NX6A 3H05A 4OAPA 4PQFA 4Y6OA 2O2GA 4KO3S 3HCCA 3HVKA 5FNVB 1S6YA 2WMYA 1YDEA 4IIGA 2O3TA 1G8SA 2DBRA 2HCTA 4Q02A 2P2CA 3FZGA 1R5BA 4QT0A 2AN1A 5D1NA 4CQMD 5KWSA 1GZHB 2VN8A 3ITEA 3TB6A 5BO5A 3GGJA 3Q72A 4OY3A 3SIXA 1XVUA 3LC0A 4RDCA 2VSQA 2JD1A 4ZVOA 5K3BA 1U3DA 5C5CA 4PTLA 1R15A 2JCGA 4XRRA 4GX2A 1NRWA 1RWWA 5F1KA 3T4XA 3OZXA 3BK1A 5KTKA 1E5LA 2ZB4A 4HDSB 1FLVA 4HAUA 4LF7B 4G0WA 4MHTA 1B6GA 1IULA 1SELA 1Y4UA 3CEMA 3A4VA 4RADA 3ZDFA 4BJ3A 4EA9A 4EIWA 4TRJA 1P0PA 2WF9A 4YACA 3R7WA 2PEZA 1P60A 2WHRA 3DMTC 2WINI 1XZPA 3FHLA 1V3QE 1ZGJA 1P1BA 4DQUA 5K20A 1OX6A 2J6IA 1E6WA 6NULA 1W9MA 4KWIA 1UJ4A 3GCDA 3KOZA 4X1YB 4CHGA 5HZMA 5JROA 1V7QA 4YJHB 2O2XA 2WIAA 5FKJA 1W1UA 2BLNA 1OFIA 2HBYA 2WZDA 1IEWA 3DDHA 4OLBA 4RK7A 2QMYA 4OQQA 1T2CA 4F2GA 2PLRA 4P93A 2A9OA 4CF3A 3DPIA 1VPDA 1TQDA 4FKMA 4E33A 3GY0A 2WTUA 2ZCUA 2X5XA 2BDUA 3E23A 4NZ9A 2QMEA 5E6RB 2RDMA 1ISSA 3KQQA 4QU9A 3SU8A 2XBLA 3E05A 5EPEA 1VE6A 4A82A 4TV9F 4DNXA 5K8IA 1CRQA 1Y7LA 2J3EA 2FETA 1N57A 4TL7A 4Z4CA 4YWHA 2VSFA 1U0TA 1DEOA 3I72A 1RQGA 3MQ2A 1A9PA 4Z7JA 4RYLA 1LBIA 1IIBA 2JEOA 2C5EA 3PXUA 3R6GA 4N5NA 3WL7A 2D06A 2DXIA 3QSYA 1UWVA 5C3MA 5JZSA 2CJPA 1BN6A 3KK0A 4WXPA 3CZRA 1SVMA 4F93B 2GM3A 4OI4A 2XGOA 3NH6A 4QLOA 2PUCA 1YKSA 4W4TA 5TC4A 4LAFA 2V59A 2AFHA 1ISMA 4FZRA 3H19A 4B31A 1K5DA 2WAOA 2P5SA 4KMOA 3SOPA 2EQAA 1X70A 1JVBA 3S28A 4H31A 3V32A 1P2SA 3CZCA 3G1UA 4R1SA 5TS3A 1KYXA 1UINA 2FZWA 3OFVA 4AYXA 4H7FA 3QE0A 1AQUA 1QGUA 1OLSA 3AI3A 4GLOA 1F2UA 1JHOA 1GTG1 2KB0A 3ZLUA 4JLKA 4UBJA 3C3WA 1R0WA 5H3CA 4CIYA 1ISGA 4ZYXA 2ZYTX 2YIJA 1LRLA 3WY9A 3SR3A 3ASUA 3WS7A 3X2EA 4NPCA 4I1PA 2JGNA 2WIJA 3U4MA 4MV8A 3L7AA 5NLLA 1YDMA 2NO7A 2VZEA 3T3GA 4ROSA 4B4OA 5JVDF 2KS6A 4JZKA 4NCAA 1SG6A 1W34A 3C6MA 1M2KA 3TAXA 1Y37A 4X54A 4J1QA 3A14A 4CWAA 5B7QA 2XUQA 3E9DA 4MVJP 4RSHA 1VFNA 4US1R 5CA0A 4PCVA 2C42A 4EJ2A 1DQZA 1GZSA 2ORYA 3R6TA 2DWQA 2H4JA 3COYA 3QKWA 4JGBA 4AZWA 1Q7CA 1NDQA 4F1KA 3T1VA 4TVKA 3GLGB 4AI6A 3KLMX 3QLJA 2QRVB 1YT5A 1ADYA 3LX8A 3FOAA 1QHIA 2ZIVB 1LF0A 1E3SA 4AAYA 4I50F 2EL9A 2XNKA 4KNVA 3M3HA 2CSXA 4LF6B 4P7BA 3SLGA 4JIGA 3EDOA 4MVWA 4TMZA 3EF1A 3KM0A 4E03A 3G8CA 1Q0TA 1RLJA 1RBZA 4X20A 3PBKA 2PFKA 5EWMB 3SBXA 4MQFB 2EKDA 2L82A 3QLTA 1R0CA 1AHIA 2PY6A 4KVGA 1L0BA 1SHKA 2OYRA 2HA3A 4FD2A 3VI4B 4B9AA 4H08A 4FD3A 3BFKA 1GL3A 2VJYA 3B6ZA 4MWGA 3DE3X 4ZALA 4HUTA 4PYJA 1T8WA 4GPD1 5K8VA 3HPRA 4G4JA 1Z2CA 3ABOB 4II3A 5IJ0B 3OZWA 5AM4A 2I4IA 3AY6A 4MR7A 4ZQIA 2DFVA 2A14A 3AOEA 3VUFA 3VDRA 3BSYA 2BIFA 2G9VA 2UVQA 2WA1A 4R2JA 1XX6A 3H1EA 4RHEA 4DCGA 2IY7A 5JR3A 2IXGA 3I0ZA 1RRKA 2GLXA 4I9UA 2HA2A 4D5GA 3PXDA 1QE5A 4P54A 2PS3A 1H6DA 2NO4A 2IYLD 2TMGA 3V9PA 2BR4A 1TEVA 4GI2A 3U4AA 5H9WA 1Z9BA 4JFRA 2ZSJA 1RADA 3PJEA 2L69A 3V1YA 2FWAA 4XE5A 1P62B 3U3MA 1VDZA 2Q6VA 2IX3A 3C5VA 3RQIA 5HGXA 2FRDC 5LBUA 1CY4A 3IAS1 4I50B 2ZRKA 3V4RA 1VP9A 3ZDBA 1JQ3A 1L4HA 2GMWA 2JGFA 3IO5A 3OEYA 4QPPA 3LT5A 1DC5A 1FYFA 2P30A 3NOVA 1GPLA 3PC6A 4BVGA 5SZKB 4R1PA 1X74A 2DZDA 1G9TA 3ANNA 1AQ6A 4E6EA 4WK4B 3Q5GA 4BDTA 3E2MA 1WZNA 3NVMB 4D4LA 2XB2A 2OV2A 4JSTA 4OHVA 3ZLBA 4I81A 4A7PA 1LEHA 3H1FA 1KGSA 5L8VA 3GP3A 1V1MA 2QMHA 1PU2A 1A2KC 3JAKA 5G0SA 3TN7A 2Y1OA 2G9QA 4ABYA 4DQVA 3JZFA 3QWBA 5ED4A 3ZS8A 1XQXA 3AEZA 1LSJA 1O95C 4C88A 5M04A 2QN9A 5KYUB 1SBQA 2MSNA 2Z3ZA 3ZWYA 2XD9A 3VHXA 2C1XA 1GKUB 3U60B 2BGUA 3FPKA 4S2EA 1B93A 2QW0X 4XLLA 4HX5A 5D00A 4N5DA 5L51A 3COSA 4G0XA 4B4KA 1WCWA 2Y9PB 1E9BA 5EIWA 4AF8A 3E53A 5EJFA 4FOLA 3RVMA 5JCZA 2R7KA 2VOEA 2HEIA 2O2JA 3FPHA 5KSWB 1D9XA 4NBKA 2WUVA 1J42A 1PKEA 4AP6A 1EA7A 4JX8A 2HRBA 2AVNA 3DUWA 4MNTA 4CF5A 2ODPA 1OPXA 2H3EA 5E3JA 2Q29A 4BJ5A 1A77A 3W78A 1G20B 1EUZA 5DU2A 5AJTA 1UBCA 3FCYA 1AZWA 1D2RA 3ED5A 3ZY6A 3H2IA 1TK2A 1Z7GA 2R1VA 2PZAA 3GT3A 3PRKE 2BEUA 1U0LA 4XVQA 3FOZA 1BW9B 5K2OA 1N5JA 1PAUA 2C61A 4Q47A 3GEHA 4XD7D 2RG7A 1ZUHA 2PJDA 2VF7A 3WNDA 3VH2A 5AIBA 1T3GA 3OZIA 4JT4A 1BJTA 3W8NA 2O23A 3CT6A 1N8SA 1NMXA 3ZYZA 2GEUA 3ZHQA 2I2FA 3K0AB 4ZDIA 3WB9A 4DC9A 1EQAA 2NO1A 2V3VA 3AR3A 3D7SA 4FZ5A 4MH0R 3GUVA 5LOVB 1TF2A 1YVUA 2HZ7A 5DNVA 2I8AA 2ZB8A 4H3HB 4XOUA 4RJTA 3QVWA 2FA9A 3DMDA 2AZXA 5CJPA 3GT4A 1H3NA 2GN9A 4Y2UA 1UMBB 4ZCRA 2C2XA 4J7AA 2HHJA 1OH5A 3OIWA 1J6UA 2HNAA 3MT0A 4N0MA 4WKOA 3LKZA 1MUUA 1GCIA 1U8EA 5DM4A 1UMDB 5T6MA 3WFZA 4DA7A 4EHIA 4NNPA 3PPIA 3DAOA 1NM5C 1O95D 3N3BC 5HK8A 2GZMA 3TEMA 1TYBE 3QITA 5JFGA 5EMLA 2GB4A 3K16A 2B4KA 3UGJA 1ULTA 2ZSUA 4YP6A 2IU0A 4PFQA 4OJYA 1EFUA 2ZRMA 2B99A 3PL5A 3QE3A 3U80A 5AUOB 2W6MA 5JAOA 4LJ9A 3B89A 1AKNA 1OXMA 3E3LA 1Y3CE 3R23A 1FTSA 3HL0A 4ENQA 3G5LA 3HJUA 3NRCA 4BMDA 1T1EA 3ABZA 3QU9A 2FFAA 4FW8A 4HQFA 4WXRA 2CFOA 5JZMA 4FEAA 4PIVA 4QM6A 2CNLA 3PDIA 3L82B 3T54A 1NUPA 3UMYA 2BD0A 1O0CA 1I2ZA 5TB5A 4DV4B 3C2QA 1X7WB 3KU1A 1PK8A 3DE0X 3W5CA 1UJ2A 4LRWA 1TT7A 2GYWA 2A30A 1GGNA 3AF1A 4JKIA 4WA8A 1Q2UA 3NRBA 3P20A 3WFIA 3X1WA 2IEZA 4KQKA 5TT0A 1E0AA 1SC6A 1JE1A 4I55B 4M9CA 2QTCA 1FOEB 5HBRA 4UFPA 2WWWA 5A5GA 4HGOA 1OJLA 4X9XA 4G8CA 2ECKA 4PS0A 4P5EA 2QL7A 2VYFA 2QMQA 3AI1A 3IUQA 2XRYA 3MRSA 4NU8X 4V0NA 3SQMA 3ZBTA 1E7WA 4ZHQA 1JEYA 4BNIA 4KO1S 4HWGA 4KFCA 5F2KA 1KS9A 1YTUA 1MA0A 2Q8PA 4XTCS 5SY9A 4DY4A 4WZZA 4ZC1A 5KJ1A 5HDQA 1BMDA 1UOOA 2X7HA 1K7EB 1QE0A 3WSWA 3LE8A 2EFCB 3HA5A 4KMSA 5THQA 1NYTA 5F1PA 3WL8A 1NFQA 221PA 1C4KA 3RGGA 4BFVA 4DLUA 1Z8FA 1C1HA 1AU9A 3HY3A 1PK7A 5DWDA 4DVJA 4U7TB 2HPAA 3I23A 3LZCA 4M7RA 4J0JA 4KN6A 5BN3B 4DR3B 1W5BA 3K0CC 1T5TA 5IM5A 5A3VA 1Y1PA 1RPZA 3ICVA 2TYSB 5K3SA 3RVKA 4D44A 1CUZA 3SC2A 5E6SB 2FLVA 3W8DA 1XOIA 4AZVA 2QRQA 3PHGA 4RY0A 4ZA2A 2IX9A 3TUZC 2IUYA 3W5JA 3IKLA 4BN4A 4ED9A 5FI3A 1GUZA 1P9NA 3KJQA 3SHVA 1OVMA 2Y67A 4MX8A 4CMAA 5DPMA 1VBMA 1LDYA 1KEEB 4L4XA 3MSCA 1ND6A 2OLJA 4NCKA 3TECE 1G0NA 1XRJA 4PCAA 3PI6A 1CV2A 3MOIA 1SRQA 1SKBA 2QV7A 1I0LA 2VYND 2CHUA 1VKNA 1PO7A 4L5IA 1R8QA 1YACA 1H9BA 2PD4A 2WA2A 2Y4NA 3LA8A 1YZVA 1N8NA 1VC2A 1MO6A 2JCYA 5L40A 3DE5X 3BZWA 3TL6A 1OGJA 5JZBA 3WQRA 4GP7A 2OCYC 4ARCA 4DZZA 2NSJA 4JC8A 3ZU4A 4PGGA 2VRNA 4RV9A 5KJCA 2HRDA 1DX9A 2CNWD 4G4GA 3ZTWA 4EA6A 3AKEA 1EJ2A 3O1HB 1YSCA 3VZQA 2XECA 3W05A 1TZ2A 4PGHA 4OL0A 2O7VA 3RHSA 2WTBA 3CJQA 4JZYA 4XWTA 3VO2A 5DNAA 1G38A 1TECE 5CVCA 3HDGA 3JAMA 3UHOA 2R1VB 3VKUA 2ZS8A 2D4HA 5BWBA 3SJAA 2PBLA 2O3JA 1KXJA 2ZRPA 4OVKA 2OFOA 3THWB 2E55A 5ALRA 4N5MA 1PVOA 1HTBA 2NXNA 4WESB 1MB0A 1ZIOA 4YRRA 1AS2A 1II9A 5DT2A 4NE2A 2EEZA 3KV1A 1JDSA 1QTQA 2IODA 3PQDA 4ZN6A 1GRCA 2R8ZA 3KFLA 3M1YA 3TIVA 4PAGA 3O8BA 2CUTA 2F1RA 1YK0A 3JD2A 1D1PA 4GOLD 2KMLA 4GPZA 4UAGA 3RIMA 5BSGA 3ZKAA 3FTDA 3FNRA 3K1YA 2EFGA 2VKQA 3R5TA 2YJZA 4ADSG 1JT9A 2GK4A 4EI8A 2OVFA 4YQYA 4NS1A 4UM7A 5EUBA 2ZTHA 4BLTA 3NBXX 4JUBA 4LRYA 1O5TA 1AA9A 4DEVA 3A9RA 4IY1A 3AGQA 2I2AA 3EQ8A 1QH8A 1C80A 1JYEA 2FW8A 2AQIA 1YS6A 5LU9A 3G2PA 4C21A 5J40A 1LNSA 3PX2A 4F0JA 5EJ5A 1QG6A 4L7QA 3C7CB 5F3RA 2AV6A 3ETGA 3EAFA 3O9VA 1KE2A 3I1IA 4M8NE 3RUEA 3KEFA 4DXHA 3U6KA 1EG2A 3LF1A 4E12A 2QMUA 4B81A 3KYJB 2NT4A 1KDZA 4F1WA 4H6WA 1EK5A 3MJEA 4Z6KA 3O3NB 4X6UA 1UFQA 2LW7A 4B7CA 5F2NA 5AM1A 2BGWA 4XJVA 1ZVQA 4CMCA 1AVTA 1FRFS 2BONA 2QX8A 1EEHA 3F4LA 3CPEA 4BZQA 4M89A 4PAMA 2CFCA 1T4CA 2EKQA 2VPIA 3CN9A 3PUHA 5EKXA 3RTDA 3I39X 3LY8A 2PX4A 5K0NA 1NN1A 2J67A 4LOKA 3KYCA 1HYGA 2QXUA 4ON9A 2D59A 1E1DA 1WPGA 5DOVA 1MAWA 1XHFA 4BV2A 4CQNA 1LDEA 1WKCA 4O1IA 4CL2A 1K6JA 1FJXA 1JFFB 3JQ9C 1FUYB 3HKEB 3HNPA 1M2OB 4IYJA 4Y6GB 2AE1A 4UUQA 5IFLA 4YAUA 4LZZA 2JFZA 3GJQA 3RRMA 4ABTA 1NTRA 1KDRA 4PZLA 4JELA 4BNFA 1EDDA 3TNDA 1HEYA 4OSEA 2B1QA 5C8YB 4QRDA 1MQSA 2EGGA 5JAUA 2ASEA 5JBNA 1N34B 3IEVA 1NQXA 1Y9AA 2NV0A 2I66A 3A4TA 1UDCA 1DKOA 4IIJF 1JR3A 1Y3FE 2BKEA 2IZ0A 2XE4A 1W5EA 2FPPA 1HQYE 4QLAA 2X8BA 1CUBA 1LVGA 5IC5A 5IJZA 2OQRA 2QGZA 4QOEA 2N46A 2F3PA 2PTHA 3L8YA 1GUBA 3KJGA 4F9FA 3ZN2A 2DLDA 3NGMA 1NAIA 3GJSA 4LK2A 4X66B 2XWQA 4ZAYA 4BNMA 4YCCA 2GAFA 3CO0S 2C77A 4RELA 3UHPA 5IVPA 4JVOA 4RPGA 1HX7A 4RK6A 1MW8X 1G4HA 3X1KA 1VLVA 3EW7A 1GPNA 4TS9A 3R3SA 4TSRA 3R7NA 1G66A 4M76B 5CNIA 2RGDA 2HIAA 1KKLA 3AJ8A 2C9ZA 1RTTA 4DC0A 4ZT5A 5JQGA 3ZY3A 5G1PA 2ZPTX 3SAJA 4DNFA 2C7GA 1VGQA 4URYR 5JMWA 1ESMA 4ND8B 2X1LA 3BYZA 4QDXA 2JJ1A 4UMFA 3CM0A 5IT5A 1F12A 3E9RA 3PPVA 2JI6A 2XVYA 3L6UA 1IN7A 3OTOB 2JH8A 4FX2A 2HF9A 1QHYA 3S29A 3QKSA 2YMMA 4HWSA 2W6QA 3TSYA 1AGPA 1AF4A 3M4ZA 5KTTA 3VNUA 1YUMA 2IXEA 2C4UA 3F6BX 3LXUX 4UUNA 4V3CA 3SLKA 3Q85A 3DHNA 4NR0A 3A6KA 2PH3A 3ZWKA 1VB3A 4DV0B 1XN4A 2E89A 5I7RA 3I9LA 2I91A 2EP5A 2H9YA 1O9BA 1WXEA 3D8TA 4HAWA 2DFPA 2P3SA 2PAFA 1WPQA 1S3GA 1WMFA 1BVUA 4NK5A 4Y0VA 4XB2A 3NTUA 1AJEA 1G2QA 3WOHA 3TZLA 5EG5A 4Q1VA 4GP9A 3RYCA 1J0DA 1G42A 1RHRA 4CCYA 2QXTA 2BUAA 1DJQA 3BTUA 2EJCA 3OKFA 5C5DA 1TPYA 5L4LA 4NZZA 1A4RA 2CL0X 3CNOA 4OAOA 2QL9A 4J1SA 1Y81A 3RTGA 2PWBA 3B82A 1IXSB 3LHDA 4MRAA 3WLHA 2IOQA 1KWGA 1QLHA 5KU7A 3U7EB 4ANFA 4Z53A 3CZQA 3N87A 3EPRA 5EZQA 2J5QA 5FT9A 3UHJA 3NASA 2XA2A 3KU4A 3L7CA 2X8JB 3EZ9A 1D9ZA 1MIOA 4A8HA 1LJ8A 2B4QA 2JAXA 4Z4QA 4JB0A 3PXAA 1E89A 1PJCA 3E4DA 4L4UA 4LJ5A 3N6VA 2I80A 3NZEA 4LWZA 4MA0A 4NJOA 4EI2A 1ST3A 1YJXA 2ZSAA 1GKYA 1FVFA 2X9GA 1IZ0A 1IXKA 2P9TA 3GDFA 1DC8A 3KD2A 3ZQUA 2PX3A 1YZNA 2W7TA 4OMUA 1KEWA 3S70A 721PA 1X92A 2YOFA 3CRQA 3KBBA 3GBPA 3THXA 4KLCA 3I61A 4FMDF 1E3MA 1ZG3A 1ODSA 3EGXB 1VOTA 2ZRAA 3Q0EA 4LA4A 4NMXB 5AHKA 3OM0A 4RSMA 1GQQA 3A36A 1KKUA 5BURA 1A3CA 4UHJA 4LXQA 1QS0B 3D6MA 5BPHA 4KAAA 2AJLI 4C7BA 1ZJ5A 2LCFA 5EZYB 2XKBA 3I3SR 3U31A 2P9GA 4EPXA 3G2OA 3VO9A 1CC1S 1SPBS 2VHCA 2D5LA 1M6VB 3AIMA 3F4BA 1KAQA 2FFHA 3VVBA 3GRYA 4WKBA 1GQYA 1Y0BA 2QVGA 5DW3A 2J48A 1FU7A 1TMOA 3HU2A 1ZM7A 2V5VA 3KHSA 4L5YA 5TQ2A 5DP2A 2HBZA 1H42A 1OFUA 1JLSA 3ZVKA 1ZCFA 2HXGA 1NNEA 2J08A 4B80A 2CMKA 1IDN1 3CLTD 3V3TA 3IA7A 4G9GA 2IUTA 4MPDA 1IN8A 1AHHA 4RFVA 4BEWA 1H3EA 2SHKA 1XJ0A 4X1IA 4JI5B 1Z12A 4JBHA 1N33B 2XGMA 2BEWB 1OBVA 5C4MA 4FILA 5CK4A 2XJ9A 4BPRA 2XOXA 3LC2O 3MSXA 3BD9A 4QDJA 3ZE1B 4M83A 4S05A 1B0ZA 4IQ4A 4TMVA 3WGUA 4BYGA 1KK3A 3ONWA 4JL5A 4HXYA 2GXSA 4UTPA 1JDUA 3QX3A 4XYBA 3JXEA 4LW8A 3L7LA 1S8FA 5GV8A 2BGGA 1I4LD 2R68A 2ZCVA 4PZEA 3SXPA 1QONA 4JSRA 1DADA 1L4BA 2ENWA 1L8OA 2QWXA 1NW4A 4HEA6 4HR7A 8OHMA 3WK4A 2V5AA 4A0RA 1CQWA 2DQSA 2O19A 1P75A 1PQWA 1R5NA 1RXVA 5KCZA 3RS7A 1V11A 1IM5A 4ARVA 3NNDA 1JA0A 1JIIA 1SK8A 5AVOA 4LF8B 4EFDA 2XWPA 4OHUA 3HN6A 3R7WB 4WD3A 1TU4A 2Q3HA 2CXSA 4YJDA 2HCBA 1KBOA 1A71A 4MV1A 3UG6A 5A02A 2QN3A 4DCCA 1O5OA 4X00A 2ZUUA 5F77A 2ECFA 2AZ4A 4A8TA 1WMBA 2QR5A 3HKCB 2P35A 3SYRA 2CEKA 1FSZA 1K68A 5AKGA 4EDHA 3GLGE 2PUAA 4K2HA 1Q1ZA 5HMMA 1WW8A 2XOKD 1XCJA 4H7HA 1XNHA 4RK0A 4B2IA 1DQRA 1BU8A 2NV2B 3WHKA 3A37A 1NW9B 1F0YA 3OX3A 2WRZA 3L0OA 3ZXYA 1E9CA 3WYCA 1C4OA 3JAWA 2OFPA 3NLLA 1S9DA 1ODCA 1WSBA 1X6VA 3KFXA 3PDIB 3PFBA 3KKPA 4NZYA 1P18A 2H7YA 3TS1A 1V1RB 2EKZA 3AM1A 4PZUA 4AJ4A 3UMBA 4UAJA 5AW5A 4CJXA 3B3FA 1C3XA 4FWTA 4UNSA 1Q5PA 3KUDA 1CYDA 4HMQA 4MDFA 4R8LA 4F4DA 4EF5A 2CD7A 5CD9A 2AG1A 3M6FA 1AHNA 1TM1E 1STOA 4Y9SA 4HNTA 1JQAA 5KVVA 4B3GA 3UOGA 4CM3A 4L72A 5KVAA 1GTRA 1ISPA 2O7QA 3IUSA 4J8PA 1BS2A 2YC4C 1YO6A 4QSHA 4AJPA 2QOEA 4O4JB 3WKBA 1XLVA 3O1LA 3PQ8A 4X7RA 1U90A 1UADA 2Y0BA 1E1NA 1N6LA 3K0EA 2R00C 2MSDB 4ZKDA 3ZIUA 2YQ5A 2H4WA 2ATVA 3MGGA 4ZCQA 1WHSB 4V0RA 3T35A 3P9XA 4LV5B 1X1QA 4LRXA 2W6JD 2I8LA 2BFWA 3D7RA 5F5LA 3WJ1A 2ZTSA 1DXYA 5JFOA 5LJLA 5AVWA 3I04A 5LN1A 1N78A 4RETA 4PBRA 1CJCA 1RAIA 2N0SA 5L3ZA 3TZKA 1BGVA 1QMGA 2JFPA 4D3FA 5JFTA 1YVRA 4O5OA 4AKGA 5KOHA 3TLZA 1XQVA 4URVR 1VLLA 1L5KA 1A4IA 4KSCA 2W4QA 3VPXA 1JF8A 1DPFA 4WOCA 4BE4A 5A2GA 3QPAA 1SRRA 3EPKA 4YCBA 3SQDA 2Q9AA 1DBSA 4IX9A 3B53X 3BWMA 1KC1A 3WK5A 4U2KA 2EZ4A 3HYTA 1R00A 2FTKE 3DDNA 5EKDA 3NC1C 1PNRA 2Q4OA 4OFBA 2GM9A 4RZQA 2QL5A 1J39A 3JX9A 5CH3A 4OQ4A 5IW8A 2N1BA 1OBCA 4FBLA 1RWVA 2ONCA 1HDZA 3V7FA 5LP6A 5BR7A 4GD3Q 1K7XB 5K0CA 2VPPA 3ETHA 2Z83A 3I53A 1DEKA 2LTAA 3PLNA 1G20A 1F1BA 1XDBA 4Y2TA 3LGXA 4OU5A 5IKOA 5LQMA 2HB6A 3CIFA 3OJEA 3P8ZA 4AJKA 1NMYA 4FTWA 3UB4A 3MHTA 2SNIE 3NYQA 4HRXA 3JALA 2WJ4A 3NWEA 4MUGA 3N8KA 1JPVA 4H3SA 2K4MA 3IE1A 1ZO8A 1Q15A 3GAAA 1WCIB 3IAUA 1T0IA 4N3NA 5FOQA 4L73A 1T6BY 2CBZA 1J23A 2YVQA 2TMYA 3COWA 5BQXA 3ZHXA 1TMYA 1FYWA 2BFDA 1Z0KA 3GVHA 5E4TA 3QY0A 2VJBA 2RHHA 4DV2B 1N4AA 1N0UA 3MHPA 3ABSB 3FOFC 1QH9A 2X0FA 3FFXA 5DHQA 4AZSA 1RYEA 2JAUA 3PHJA 4UPVA 1JWBB 2HX1A 3PWSA 3K15A 3LT0A 3CKMA 4OOFA 1D8AA 4YJ3B 5LZ8A 1YNSA 4UNIA 3KQKA 1OH8A 2MYNA 2VA8A 2VUUA 4P7JA 1U1GA 1M5UA 1PUXA 4PRZA 1FYVA 5FWXB 1A9RA 1FUUA 2FE4A 5DNEA 4B3IA 2H4ZA 1TL7C 1O77A 2JDIA 4LJ6A 3RVPA 3UXMA 1QIGA 3RC7A 4EJSC 3TX6A 1UAYA 5EKSA 3VISA 5KYXB 1I3CA 2E49A 2QN2A 4KLRA 4OP2A 3SZGA 5JXGA 4YJFA 3T0IA 1Y6GA 1Z68A 2QUAA 3VKHA 3ABRB 1OD6A 4FFPA 4L8GA 1Q11A 4BU1A 5CB0A 5FPYA 1JUDA 3T7AA 1GUFA 2VTBA 4BNZA 3TX2A 4TWZA 3U9LA 5T6BA 2ZTMA 2OAEA 3ICCA 3UMVA 2EDCA 3SX4A 2QD1A 2WFMA 4G2NA 3RVBA 1YJQA 2PMCA 3WA7A 1RRPA 2J85A 2OGUA 3FR8A 3KOYA 1N1MA 3OLYA 3LCCA 2JFYA 1RTKA 1XIVA 3AI7A 1Z08A 1DARA 3DH0A 2NYRA 4M86A 2B8EA 2NU7A 3HB5X 3QSGA 5KYUA 3CVOA 2DERA 4FKZA 3DMGA 1UJCA 2QJOA 2O7NA 2P8JA 3QWIA 3NBFA 4RKQA 3JATB 3X1MA 3QPBA 2OY0A 1N2CA 1RWXA 4P92A 1I2BA 4MUFA 1JQLB 1NMSA 1T1SA 2ZAMA 4LY0A 3ZE0B 3OT5A 1U5AA 3BH0A 4FS3A 4WN9A 4EW3A 4ZCIA 1M83A 5IT4A 5G2OA 4O3FA 3GLIB 1B15A 1OYYA 2H31A 2O0KA 4NU6A 4YO7A 1CTQA 1WEKA 1L5NA 4DSAA 1CR1A 3UJNA 4RNDB 5B7PA 2BKUA 2V9ZA 4TSFD 2CHFA 3ELDA 1ZL2A 2QE7A 2Z1NA 2OTCA 3M34A 4XWWA 1N25A 4CT0A 1JJ7A 3BHJA 4YRFA 4RW0A 4CMJA 3T5AA 2A1IA 4M0EA 2NSLA 3GLSA 1IC6A 3PGXA 5D7BA 3UMGA 2X5OA 1H8HD 1CYEA 3E58A 4PPNA 4IDPA 2KE5A 3DMFA 4HLUA 4F71A 1YR6A 1R4ZA 4HVTA 4DUGD 4KQGA 3VR6D 1JLLB 3N8DA 1BEEA 3H9JA 1KI6B 4LPSA 1AKTA 1VL1A 2EIXA 3EFOB 3HABA 1ECFA 2AF3C 3UCFA 4MPRA 3T4PA 2EBHX 4RLHA 3N2GB 4H18A 4TSFA 5CXSA 2OORA 2P0EA 2CNOA 2J4DA 3K9WA 3JQFC 4GUDA 2OHOA 4QNMA 3RYTC 1IAVA 3LUKA 1U1EA 4PZCA 4L8WB 5AM5A 4BRWA 4B09A 2VK2A 4RACA 1I13A 5MFPA 4D9EA 3PITA 4UVEA 4IO0A 4YLYA 5LMNB 3Q7IA 2E9SA 5CGQB 1U6KA 3HS3A 3I1FA 2HF8A 4IL5A 3H6KA 4R1TA 4KIGA 2YIDA 3ZI7A 2H0QA 2XR1A 2YWDA 1M2JA 3W90A 1TU0A 5JD5A 4PC1A 1RWBA 1UWLA 1H2FA 1VRVA 2B78A 2X4GA 3LO8A 5LM3A 1IBLB 4HTFB 2EFJA 3O4FA 5FOSA 3DBHA 3IE0A 1CETA 4D8UA 1UBTS 4WCFA 3F3MA 1M10A 3D4LA 4H4EA 3KKMA 3L0CA 3BRCA 1XA3A 3JZMA 3MAGA 4AJIA 1O54A 1C7JA 1ONSA 3PUZA 1YS1X 4LY6A 3U5TA 2WTEA 4B46A 4YRLA 4XH9B 4M7OA 2W00A 4GR5A 3TTTA 2WMNB 1FB5A 1RI5A 5F3DA 1T9CA 2ZFUA 1LI4A 4CKXA 3O8RA 1V25A 2HIMA 2XQGA 3T7TA 4EFNA 1JQKA 3RK1A 4A6DA 4PGAA 4GPIB 1IM8A 2IUUA 5ALKA 4DVGA 5K6AA 2EAUA 4I6GA 1Z5ZA 4MUYA 2IPAB 2VPQA 3DBHB 5CEEA 1SIUA 3OHPA 2VK4A 4WCFB 3CMCO 4UTRA 2ECOA 4XGIA 1DC3A 1MA3A 3Q3HA 3TAHA 4BB9A 1GFZA 3PU6A 2PZ8A 4KE9A 3G2KA 2AXQA 5EZSA 2V7PA 4CT4B 2ZUEA 3JVUA 5IDXA 2EHJA 1YZQA 3JRXA 5D5QA 1ZHHA 3O0DA 4FGKA 3UJ6A 4F12A 4K86A 4WACA 5KTMA 1A9OA 4IXWA 1TEZA 1IVNA 4DPMA 3EGOA 2FMKA 2NXJA 1RKBA 2GBLC 2RAFA 3GFVA 3PQ5A 2DJ5A 2G80A 2IHTA 2B37A 2VRWA 1DZ3A 5AJZA 3STTA 5EE1A 1PT9A 2REQA 2VP2A 1AMUA 1QYRA 1XQ6A 1P91A 2OP1A 4GGPA 3ZS9A 1MJFA 1B8OA 4X8MA 3X1ZA 1PZMA 1FW8A 2QE7D 3AUFA 5AFSA 3QGMA 1XFAA 3T0FA 5F7XA 5JH7A 4JI4B 4WQMA 3R3ZA 1AT1A 2IVZA 3FPJA 3WWPA 1KO7A 3H2ZA 3I2JA 3P2IA 2FW9A 4ISCA 1MHPA 4RVOA 1VSTA 1LZLA 2AR9A 2B82A 3MVEA 4YMSA 1AXRA 1RQPA 4IINA 3CUYA 1VYVA 3NM4A 2VQSA 3KSMA 4QO7A 3JQPA 4D41A 4TS1A 4NHOA 1B23P 3GCZA 5TXGA 1LCIA 2F3SA 3HKEA 5TGZA 2UUAB 2PXAA 3DEYX 3K0FA 2RHBA 1XVLA 3ZPXA 6ABPA 2VSYA 4JXXA 1AKMA 1Z0DA 3W5AA 1P19A 4IIJB 4C2UA 3QTLA 1SQ6A 1Y3BE 2OK8A 3P0FA 4J43A 4PBTA 1Z2PX 5CVEA 3QRWA 3EPJA 1PJ3A 4OBWA 1G9XA 3KYDA 1JDPA 4TSKA 1NU8A 4BOYA 3L7YA 5C4IA 3SXJA 1KAHA 3KQUA 2KW5A 2OBMA 4KRXA 3ID6C 4B4UA 2QVLA 3PL1A 2WG1A 4MJXA 4HG2A 1GAXA 2PQ0A 1NNUA 1TYZA 3CONA 5A2QA 1ENZA 1JALA 3B9BA 1VE1A 3HJGA 3JSXA 4FWIB 5F35A 3RUIA 1ND5A 5DM60 3P0JA 4EMTA 3CVJA 4EK9A 3HXTA 1TJNA 3MJRA 4JKOA 1KETA 4PX9A 1CHNA 1Y63A 2FW6A 4WEQA 1RLIA 5FTLA 3H2YA 3K0FB 4WZBB 4QD3A 2SKCA 2X6QA 1PWZA 3OH8A 5LZ2A 3IQIX 5IVDA 3LY9A 1SA0B 2B7LA 5EE9A 1ZVKA 4IWNA 3MB5A 3T9BA 3ZNPA 4QPJC 5CCBA 2R79A 1NUUA 2W11A 2XNJA 4PCLA 2NQ2C 1U9YA 2HCJB 4PRLA 3OZDA 3GPDG 3KJHA 4QFMA 2F1OA 4BO4A 2IPLA 1HDGO 3W77A 4ZI7F 1KOJA 2I71A 2HMAA 3FDZA 4FBGA 5DWVA 2OCIA 1T8YA 1Y1KE 1GYQA 1JEOA 5EJ2A 1HWYA 5K0TA 4GGOA 3S0JA 1PV1A 4A73A 2WKWA 2WHPB 3QLVA 4HD8A 4LMPA 1QIJA 3O26A 4J76A 4QULA 3N2ZB 3HDQA 3UAGA 4LTNA 5IBRA 1K4KA 3VKVA 3ZJTA 2UXBB 4DGQA 1OB5A 1ADJA 2DTXA 4JUAA 3E3OA 3B2QA 1K08A 4FDLA 1UKCA 2D0OB 5CP8A 1XMQB 1YU6A 4CDRA 3T3HA 2JGLA 2QTVA 2JFWA 4U7DA 1J1UA 5D87A 5HOEA 3V2GA 4B5KA 5CPFA 1DBQA 1XPJA 1YQQA 4D8WA 3P4XA 1L5HA 4Q01A 3IDZA 1AKYA 2CMGA 5CX1A 5L4SA 1V1JA 5EXXA 1S96A 3KXLA 3ZV5A 4PHTA 3D6TB 1VI6A 2YV1A 3ZVNA 3ETJA 1QQAA 4PLFA 2JIQA 1SHTX 1P9LA 1C2YA 4GXQA 4FB5A 4NECA 4NH4A 2ZJ4A 4XGKA 3KHUA 4JKYA 4ZU1X 2VJNA 1Q7GA 2XMQA 3ZY4A 6LDHA 4Q34A 1HT1E 1GDDA 2H29A 1TA4A 3EJ6A 1J2UA 2FPSA 2PZJA 3I5UA 4NBRA 1T9GR 3R20A 4HRAA 2WMDA 3MTBA 2FVXA 4MO9A 5BMVF 2GZRA 3BOSA 2AQHA 4DM3A 4JBGA 4AMUA 5SZIA 2VQDA 2MR5A 1CNFA 3OESA 5B3KA 2XY4A 4MUHA 4UE2A 4AJEA 1CY0A 2PRKA 3NWOA 5DM70 1Z2OX 3F7TA 5K9ZA 2I29A 4J03A 1EZZA 2W2LD 3UTDA 3C48A 4EZBA 4WJZA 5G1NA 1RI1A 1JIQA 2RGEA 1L3BA 4G23A 3ON5A 4S1PA 1HG1A 5H81A 3T9AA 2RH5A 2ZIWB 4IR7A 5JAMA 5E6UB 2NQ8A 5EMNA 1GARA 5J5CA 4OTZA 5ICEA 2PT9A 5K3DA 3UK7A 3HB7A 1SUDA 3FBWA 1G8YA 5JC1A 2IS4A 3HB1A 2WWGA 1J8YF 1O03A 1CUHA 1II0A 1WLSA 1ZBQA 1Y48E 1DQSA 4PU0A 3RSGA 2ZJ2A 1M72A 5HZHA 2GZAA 2WDPA 4I5IA 4URFA 1EXWA 1U2ZA 4K6GA 3DMYA 3U44A 4FN4A 2VWHA 5BW4A 1ZSVA 1U3GA 1BXZA 3FTPA 4DCNA 1MJGM 1SY7A 2DT5A 3LK6A 3AM4A 5LVAA 1Z26A 3BORA 3KQNA 4JR0A 2P9JA 1U7WA 4F4CA 5BMVB 1PSDA 2RHMA 3AF3A 3ETCA 5IN5A 1X1TA 4ZGBA 5JAIA 2ZP1A 5DN9A 5TF4A 3L92A 1E7QA 1CQJB 3B7WA 1WPRA 2O1XA 1L7NA 3IESA 1XMXA 4RE5A 3BKWA 3FPEA 4UMDA 4YI5A 5AKZA 5EMKA 2QAIA 5GGYA 3O03A 4BNGA 1YZFA 4UPDA 2BMFA 4AP5A 2QB5A 3JQ8B 4WHMA 5ICCA 2JLSA 1C7EA 1Y89A 3GMTA 5BYAA 1IATA 1DTEA 2YJ4A 2CB9A 2VL7A 2XCQA 4E1VA 1VPWA 1GLVA 4CF7A 5F1OA 4H6PA 1S3SA 3S5JA 1A97A 5CB8A 1K8QA 2R5WA 3NHFA 1OWMA 1PR0A 1KZ7B 2ZR8A 1I01A 3P2JA 4H17A 1XO1A 3DV2A 5A03A 2IU3A 1IL0A 4RA6A 4QQKA 4N54A 3N5KA 1UZMA 3VPAA 2ONZA 3IDQA 1NG9A 5AVQA 1DDOA 3AW9A 2ZRHA 3VDNB 1LFAA 3ZWOA 2Q6OA 1U2GA 1TAQA 1RKVA 5DGIA 4DV1B 3KCQA 3X3HA 4R3UC 1E3QA 2VH5R 5TJ9A 1L1FA 3OCXA 2C0QA 1RJFA 2QA5A 3HDTA 1TKCA 3C3YA 4LDJA 4P80A 3ZK7A 3SQWA 3MWDB 3KVOA 1J56A 1JXMA 1KEZA 2FPRA 4CR7A 1HEUA 2PBZA 4G0NA 3PLAE 2ESRA 3DHEA 1PNOA 1IUKA 2WWHA 3SR4A 3TRKA 1W36D 2VPWA 2WVAA 3RI3A 3PE3A 2IZOA 1XMSA 1W93A 3OJWA 3Q12A 5H1YA 4TMWA 2QTBA 2WSLA 2XSZA 4BVJA 3OHSX 1LH0A 4JQCA 4OGGA 4GXRA 4XB1A 5AD1A 3BTVA 1QCZA 1U9JA 1WW3A 4G5OA 5FP0A 2XDYA 3JWHA 1WSDA 1ZMBA 1U81A 3ZZ1A 2XUKA 2R6R1 5EZYA 2WQ7A 1NWCA 3HACA 4ITUA 2A1TS 2HA7A 5HPYB 2ZSHA 3QEKA 4CEHA 3ZGZA 2X5NA 5THXA 1ZCZA 4N01A 3D6AA 1BX3A 4NFSA 1RKQA 2DHRA 2QPOA 3PQ3A 1QDLB 3A1NA 4OPMA 3UCEA 3VVMA 2B4RO 2F4VB 1GD1O 2DYKA 2GCEA 4Q4JA 3VPDA 1SVOA 3A27A 3CJRA 4LQDA 3VX4A 1X1DA 2VBFA 3HV2A 4I1YA 4FK8A 1Y1LA 1UM8A 3K4HA 3QHPA 4Q3NA 1CUGA 1EUCA 1K6IA 2HJVA 3TYXA 2QT0A 5TLSA 4XUCA 1G21B 2VK1A 5HIIA 2RGWA 5B1HA 1WTAA 4B6SA 3U0VA 1R6XA 3Q2OA 4E2YA 4UTVA 2V7UA 2XDAA 2ID9A 2V45A 4MGYR 3VC3A 2C5SA 5FOXA 3WIUA 4E5VA 1T29A 1ZQ1A 1H65A 1NSYA 2AWNA 2JBHA 4CDMA 3DXFA 5BYKA 1XKLA 3VSCA 3TSCA 2OG2A 1GN9A 3BIFA 3GNTA 5HA5A 1USVA 1OU0A 3DCNA 1XTIA 4MQFA 3S8YA 2GCOA 4A0HA 1X9GA 2CNWA 4P82A 4TMFA 5CXQA 1NNI1 1SZCA 5AW1A 2E5WA 1NW3A 4JIMA 5IX8A 3MPUA 1QHEA 1IK4A 2ALJA 3CB4A 1H1LB 3IERA 4MW6A 4PO3X 1Y3DE 2GZHA 2ZXEA 4G6ZA 2CW5A 1KI1A 4GOOD 4OYYA 1B7GO 3RQSA 1WIWA 2WUGA 1XQYA 4EB8A 4NDZA 5TGDA 2R8RA 3LV8A 1AHPA 1CCWA 5I9SA 3GAFA 4DV3B 1MX3A 1NBWB 4ARAA 2X3FA 3RPEA 3GLUA 4G5YA 3H42B 1HE3A 4BMVA 1FL9A 2I4LA 3JYHA 3MT9A 1C8VB 1Q1NA 1O95A 2LDBA 4Y0AA 1FP1D 2PJZA 1XK7A 2OZLB 3WBFA 5JE8A 3Q9NA 2HPZA 1K86A 5LA6B 1M5RA 3N7TA 5JU6A 3LUHA 1PNQA 3KBOA 2IU6A 2PKWA 3UJAA 2Y93A 4GLFA 3CGGA 3HGQA 4GVLA 3W9SA 4BV3A 2R7MA 1TQ4A 4RTQA 3P32A 3ROQA 3TLEA 3HSYA 2VJMA 3IVMA 1CDOA 4MI3A 4U1RA 1O89A 2V7WA 5DYIA 5BYJA 3ZKWA 5JVDA 4E31A 2DCMA 4GHWA 1L5GB 1Y5MA 2LWIA 4G9EA 3WLQA 3P2EA 4C1NA 1EGMB 2RSLA 2O8DB 4IXTA 4MDYA 1M1XB 3OA2A 1SBCA 1IZYA 2JIZA 3E3NA 4HGPA 1OZFA 4KPUB 4LZAA 2B36A 1IBMB 2Y2VA 2GN2A 5F9HA 1KRXA 2OHHA 2WMOB 4G01B 3RJ5A 1IQPA 2JJYA 4IH1A 4JJFA 2HDHA 2ZE8A 5GY7A 4YPOA 3IVRA 1X80A 4HDNB 5FFFA 4LHEA 3UAOA 5JNTA 3N2EA 4G41A 1JAXA 5EE3A 3FKSD 3LUAA 4MULA 5KDOA 4UJ5A 2Q27A 2RGAA 5FRDA 5E2IA 4AUKA 5BNWA 1M8FA 4LPKA 5B3JC 4DMRA 4YAWA 3ZGNA 3CEHA 1LRKA 4X5OA 4ERXA 1NJ1A 2L18A 3TJRA 1N32B 1CJKC 1I5EA 1ZVMA 5KU1A 3WX0A 5J4YA 3U4QB 4PX3A 4AROA 4YN3A 2DSNA 1Q57A 5AKXA 3KYIB 1E8NA 4TROA 1GR0A 5K3FB 4MCAA 2FR1A 3V7YA 1UAGA 1CG6A 3DMPA 4LE2A 5DCUA 1ZOOA 2Q41A 3U9TA 1X0XA 3H4VA 1MC5A 3L4SO 3IPAA 5A71A 1ESDA 5ILOA 3V8RA 4EHJA 4LJYA 3OQJA 4K3VA 3BZBA 4NICA 2FUKA 2YBEA 4LOAA 4E7PA 3B78A 5LL6P 4F72A 2P4SA 4B3JA 2YWXA 2I7DA 2FX5A 2NPOA 1Z4MA 5KX5B 3GJRA 4D97A 1BEUB 1SAYA 3GD7A 1MTZA 4WZ6A 1JAYA 3WYEA 1R0RE 4E1AA 2VI5A 3CRMA 1JSXA 2BM9A 4YAFA 1NVFA 2XODA 1R37A 1SEPA 1TKBA 3A25A 1ELOA 3M1IA 1VIAA 1KO1A 3VZPA 4A3SA 1UMDA 4D92A 3RT9A 2ZJFA 3GJ4A 4MCIA 4NKRA 3F47A 5GVSA 2GF9A 5DHSA 4F56A 3ZE2B 3VAAA 2X5JO 3QUSA 4KI7A 4Y8VA 4G0YA 1Q0ZA 5TJHA 4C9BA 1F2UB 3N0RA 4ID9A 3ORSA 3RAGA 1W2WB 4R31A 4RMIA 4Y1RA 3SFVA 1WXWA 4GOXA 2BGKA 4CMGA 4MKXA 1QP4A 2E2WA 3Q1LA 2Q4RA 3I9V6 3VSBA 2Q50A 4DIOA 2C0PA 1G6HA 3KD3A 2CZQA 4RDIA 3ROPA 3VR5D 4JYPA 4D4JA 4E14A 2OCGA 5FWXA 3GDHA 4C6TB 5ADHA 2C4KA 4XPIA 1MAHA 2ISSD 4JLOA 1XXLA 1LBQA 1IN4A 1PEKE 1X1CA 2OGSA 2Q5FA 2YR0A 4NZPA 4PPQA 2OGZA 4S12A 1L4LA 1WUYA 4C3ZA 3N28A 4EHLA 1E5TA 1W30A 4B9EA 5JS8A 1P4JA 1WA5A 1EHIA 2B94A 3FLAA 5CMLA 2V65A 1TXGA 1LPAB 4ZT3A 3DFFA 1TUBA 5THKA 3WLLA 5MN5A 2G5GX 3FUCA 3AOGA 4G5GA 1J1IA 1AGNA 2ZI3A 2XUGA 4RTOA 4PYIA 3Q8WA 4BO1A 5KNBH 3GLHB 3PHLA 3V7UA 1NVKA 5ESXA 2WG2A 2F7SA 2CNKA 1NR7A 1ACLA 1OFTA 4HJRA 5DLDA 3KWJA 4BP8A 5KTPA 4WFKA 2Y1GA 5EIAA 4BFZA 5ICFA 2ZULA 2HHHB 2PBFA 3BDVA 3BK7A 5BORA 2IYVA 3UWMA 4TZTA 4L57A 4P36A 4M2LA 3CE9A 4JU9A 2CVFA 1ISHA 1XMPA 4LWQA 5CGZA 1R6AA 5TMBA 1SJ9A 3EAGA 3WTCA 3ELBA 2WTNA 4EQ6B 2VRCA 5SICE 4AJ9A 2WR8A 1VJ0A 2VHVA 3HRKA 3K2BA 2XCLA 3NQ41 2F1JA 2HTFA 2Q0XA 3BFJA 3T1TA 4Q7EA 1QQBA 2IIQA 3CKKA 2OLKA 3U2QA 1JDNA 1VPVA 3CY6A 4IV5A 1CUWA 1BX1A 2VJQA 421PA 4B1FA 1ANKA 3WDSA 2Z2JA 5KAPA 2VFAA 4MEJA 5EPOA 5DX0A 1ADCA 4B6PA 5MGBA 4QRHA 4Z9AA 1SOUA 2D0IA 5HQTA 2G36A 2ZYIA 4Z7NB 4ESVA 4K9PA 4UZEA 4YMGA 3S2EA 5DX1A 3U3XA 3IUMA 3BCSA 5TE9A 3S8MA 2ZT6A 1U8YA 3SHTA 3MGKA 4OYHA 4P58A 1SBIA 3PXCX 1WG8A 3M6XA 4HH3C 4ZI2A 4X7BA 2AB0A 2BFBA 1DNPA 1P1FA 1T9BA 3MCAA 4BTEA 3AJDA 1V2GA 3LFTA 5KIAA 4GC5A 4KDCA 1DRKA 2FPUA 3A28A 3ZDRA 1ULBA 3PFNA 3PFKA 3LDGA 2JPDA 1NPTO 1LKZA 1JI0A 3FVTA 3V3KA 3ZE6A 1Y4ZA 2QTTA 3NNSA 1IUNA 2JHGA 4XCQA 4R69A 2RGBA 4QQNA 3ZCTA 1W44A 1E1CB 3L02A 5LD2C 4TKZA 4UCQA 1OI7A 1P7CA 2QU8A 4K7JA 4Q3LA 4WY8A 4JP8A 3H5NA 4DILA 3AV3A 4YR7A 1PFVA 3FM9A 2OMKA 1AUPA 3HDJA 4X3OA 2DLNA 4Y2JA 1CDZA 3VU8A 5LYYA 3HRIA 3H5AA 1L4GA 2NTVA 1AKUA 2V96A 4WZAA 3MOGA 2Q28A 5AOAA 4IICA 3RLFA 1N9KA 4MV9A 4KLNA 1GTVA 4K8OA 4EB6A 3AUSA 2Q5CA 3KKOA 4HQ0A 4HFNA 4M49A 3A6FA 3DFUA 3HCDA 1TM5E 3EGIA 4KAJA 4ZFNA 4XEHA 4FCVA 4GKJB 1KPIA 1E9DA 2H85A 4ZAVA 1F4PA 1XZIA 1ZDMA 2AK3A 1OWLA 1ZEJA 3NHBA 2A94A 2I6TA 4IMPA 4L0CA 5F64A 3RBVA 2ON6A 4DMCA 1IZ8A 4MS4B 3DFZA 3BK2A 4RXTA 2FG5A 2QM8A 3W3AH 5AKKA 4BMNA 3THRA 4IGEA 5TQVA 3WMFA 1JHZA 2FZGA 1EI9A 4DA8A 1M66A 2DM6A 2GNOA 5KQGA 3C1OA 3IBTA 3QPUA 1H2RS 4MI9A 5A1JA 2QVZX 3GZNB 2Q07A 3OU6A 3T3DA 4WW0A 3U5ZB 4BTVA 5FUYA 3HXLA 3ME5A 2I9PA 4EI7A 1RM0A 3EVCA 5DBIA 3GUYA 3TL2A 3ZE9A 4D02A 1B8UA 3QE9Y 4M1YA 2NVWA 3D7NA 1DJLA 1T43A 2VDOB 4PYRA 4YA6A 1FNDA 1NBIA 3NGXA 2VDRB 3HCNA 4IOKA 3CNQS 4FM9A 1FQOA 1T1GA 1YRWA 4QUHA 1FFSA 2Y05A 3AESA 4M8SA 3BC1A 4ALLA 1BQEA 1GG2A 4WAUA 4E7OA 4U00A 5AVYA 1SIWA 3I5YA 1OUMA 3WWYA 3T4EA 3WB0A 3DUFB 4FDTA 2G0TA 3A70A 1K9SA 1CB7A 2C2WA 4HH0A 3ZDYB 3AIKA 1BVRA 1E2JA 2A0FA 3JPWA 1FMTA 2OL4A 1XTQA 3CUKA 3FOBA 1JDJA 1OJ7A 4UCFA 1NBME 3UJCA 1DGQA 3D8SA 1GZ5A 1QH0A 2Q2NA 2JFGA 3NTOA 5BSEA 2C3UA 1KY3A 1P2GA 4OIMA 3ZKWB 2WD7B 4GBED 2JJMA 5JOQA 2CLCX 2ET6A 4D9CA 3AHJA 4DUGA 1Z36A 2JKZA 3JD0A 1DWUA 1NUTA 4F91B 1YZYA 4BFTA 1E1QA 4ER6A 4FR2A 3DL7A 2IWHA 121PA 5FO0A 1XPRA 4LHYA 1WKBA 4KPUA 2BBSA 4D9HA 2HMTA 1ZWLA 4ENWA 4JYAB 1UBFA 1XT6A 5ALWA 4MRPA 2Z8YM 1OFGA 3EIUA 1N6OA 1WDMA 1OF1A 2VAPA 2VEOA 3ZU5A 1H3FA 1UK6A 2YQZA 3ZGYA 4BECA 2AUNA 4NQRA 2IYOA 3LTEA 1RRCA 1E63A 2H2IA 3SSAA 4NONA 4M21A 3TLGA 3DF7A 4JB8A 3W6PA 4E46A 4BY9E 2BGMA 2WJ6A 4RM3A 1UODA 1MIOB 1SIBE 3H7AA 4GLJA 2BP7B 3RC1A 1U7UA 5IARA 3KDSE 3KLNA 4U3JB 3UGKA 4KH0A 5TV2A 2AYYA 2PQ6A 5C8VA 4GM1A 5EXSA 1GV0A 1O8CA 4E21A 4F7DA 3Q8XB 4INAA 5F78A 2PX0A 4NBSA 4YMIA 3E22B 4CGYA 2D1QA 4R8KA 1S1CA 5KHAA 1LPBB 2DT8A 4ZOAA 1XKXA 4CM7A 1ZMOA 1CVRA 5FNVF 2JGRA 1ZH0A 4P4LA 4KP7A 3AF5A 4GMDA 4NC9A 2VPTA 1S2IA 2ZRGA 4LG1A 1Z5VA 3NOXA 3TM5A 5JZ9A 2IYQA 3K9NA 4HB2A 1EFDN 2KJQA 4J4HA 3MCTA 4U63A 4F5DA 4QX6A 2CJXA 2BY4A 1UT5A 4QLBA 3LXMA 3S81A 3P9CA 1JXAA 3QHAA 3TCNA 2QBYA 2KBEA 1XNQB 1NLFA 2F43A 3BHIA 3IVXA 5LP6F 1VCOA 1U0RA 2HUNA 3F96A 4QJIA 3V8MA 4AN4A 1S7CA 4GL4A 2BC9A 4DL9A 4DR6B 2XYGA 3DEJA 5CJJA 3ZJUA 3A9WA 4UE6A 1WSAA 1PF7E 4B48A 1KIAA 3FB4A 2FWPA 3GFFA 3HLTA 1FUKA 4PZPA 3LVFO 5LA6F 2RGNC 4ENTA 2YMQA 4HEA1 4CM6A 2G67A 3BM5A 4P32A 2XUDA 1OYOA 1X8KA 5HW0A 3D2AA 1PGQA 3L0ZA 5GZ3A 4L75A 4URHA 2MCFA 4HWPA 5ERXA 4CF4A 1VHLA 1DWOA 3WOVA 2J9GA 2XTJA 4DJ5X 1GPYA 5D6NA 1M1YE 3COVA 1HZZA 2C88A 1QAQA 1KAOA 3DM9B 1FS4A 2TMKA 2XF2A 2XZOA 3ND6A 2VQ3A 3UMRA 2J7PA 2O52A 1TZKA 1V8PA 2VDPB 1CJMA 3FH0A 2WJZB 3FVQA 5ECWA 5IJWA 3P2YA 4CIDA 3T5PA 1Q0LA 5EWLB 3NIFB 2C7BA 3DXZA 3IIEA 5BOSB 4KWTA 4M8KA 3T41A 3G9ZA 3RYFA 1Z18A 3KETA 1XQWA 4BP1A 1QCDA 1JHDA 1QFSA 5EUMA 5HX7A 1V11B 2CY0A 2F9MA 3OTGA 3PIRA 4CKWB 5EY5B 1A5SB 1GWNA 4P53A 4EY8A 4TYQA 4OFWA 3LF2A 3ISJA 1PYGA 1SCDA 1EGAA 4BNDB 3HE3A 3IMGA 2VQFB 2UXCB 3JQDA 2LUOA 3A05A 1VHTA 3PPYA 4GX1A 2C97A 5EZ6B 3WLMA 1DAFA 1U65A 1XWWA 2FE1A 1W2HA 4RZXA 3WBKA 4YXFA 4QHTA 1E2MA 1GNQA 2QN6A 3FYTA 1EVKA 2B4TO 2B8NA 4WBNA 3AU8A 4M1ZA 4D4MA 2PL9A 4ZAFA 2ZJ5A 2C5FA 3I6ZA 3IH5A 4HBZA 1N7JA 2ERYA 2Y0DA 3BF8A 2R60A 3GRUA 1LTQA 1T2NA 2PVCA 4HADA 2PWPA 4IPTA 4TWBA 5L3SB 4E88A 1ZKMA 2P69A 4G25A 1J2TA 1QFZA 1WXQA 4JC0A 4AJHA 4W82A 4HDCA 3IEUA 4A2PA 4ZOQI 1DU4A 1I14A 1YE5A 4KODA 4DQ0A 2IV3A 3OCZA 1PL8A 4JITA 3VSEA 4E08A 4F3CA 4YUAA 1AUVA 1J0EA 1M2EA 3OQMA 5EXEA 3MWEB 1R2QA 2AQKA 1E7MA 2I2BA 2PL1A 1W94A 1BX0A 1RQXA 1XZAA 3DB1A 1O94C 3WV4A 4EUNA 5JALA 5K8JB 4JV5B 1TJ4A 3AQ4A 2PUWA 4PF1A 3FZNA 3CZ9A 4I46A 1TA9A 4ZQCB 1NVDA 1FDOA 3BHNA 4WK6A 4B74A 4ES6A 1RPAA 2YN0A 4WLNA 3FXAA 1CDEA 1Y98A 3UMFA 1IXZA 3VH3A 5C5IA 4CEIB 2BGNA 5FI5A 3BIXA 2LXNA 5A5VA 1KU0A 1OXUA 3MD9A 1RP1A 2GBLA 2IYPA 5ETJA 5IWAB 4ENVA 3VH1A 4CCSA 1SURA 5DP1A 2C2GA 1XQ9A 3RAJA 5K0FA 3HKCA 4Q9DA 4P22A 3KKZA 4KDFA 1E61A 4F2WA 1ZPDA 4DLWA 1T9HA 5F12A 2VT2A 2A7QA 2VJCA 1AUQA 3C8DA 3TJMA 2EEPA 1E64A 3ROFA 1PE0A 3WP0A 1A9YA 1SOAA 2HWWA 2QHXA 2VHUA 3PCXA 4FFDA 5FUMA 2H2GA 2JLBA 2X77A 1BVHA 5K6AC 1JECA 1OA0A 2ZJ0A 1A04A 1UBNA 5CNKA 3X44A 1DKMA 1QO0D 1T25A 1CLUA 1HOTA 1NUHA 1T34A 2GN1A 2JFFA 2Q3EA 4IV8A 4Z49A 1QQ6A 3ENNA 4ECEA 1MX1A 4QUEA 3ES9A 1K88A 2XQJA 2MU1A 4JWKA 4XQGA 4NG5A 1VIDA 2PJUA 4QUGA 3H1GA 4MWBA 1YD7A 4DW8A 3UPTA 2A5GA 2FOXA 2NWQA 3CQ9A 1CIPA 5HF8A 2WB2A 2O20A 1OMOA 4YJHA 4B71A 1QP7A 4XX0A 3MIIA 2PUFA 3K9BA 2Y1DA 4FHDA 1LXCA 1YFLA 3OIYA 5FORA 1A1SA 2L2QA 3O73A 3QZUA 4YMTA 3ILSA 2OYCA 4F6RB 1GZ6A 2VKTA 3E5NA 1NFFA 4R9RA 1KYVA 4NL4H 1GVHA 4S1WA 3I0MA 4XM1A 4ZVNA 4EL5A 5DHRA 1P6XA 4WESA 1WO8A 4MPTA 2ACVA 2YINC 1W8DA 1BXGB 4XZ3A 3GDGA 4M22A 3X1XA 1JR6A 4LDNA 1RXCA 2O6LA 2NUPB 2P6UA 5KI6A 4B3HA 2GBFA 2REQB 4YECA 4X8OA 2PPLA 2G9UA 1V3UA 3NHSA 4LJRA 3SBDA 1E8DA 2AOWA 1YS4A 4ARIA 4KEAA 5JD3A 1M8GA 2WKQA 1P31A 3OQPA 1XMOB 3MIZA 4RTKA 4JQOA 2ZUWA 2I4TA 3N9IA 5DHFA 1JG2A 3K5PA 4ETNA 2J45A 3WRYA 4QOHA 3I6QA 4HQKA 1SH7A 2X86A 4JAVC 2NSDA 1WHTA 2JIPA 1WTCA 3IT2A 2JI7A 4R7TA 5H3LA 1XAGA 2VSXA 5IBCA 3WGKA 1JMVA 5CIYA 3AERB 3RVQA 5BSHA 1Z0ZA 1QM5A 2QX4A 4J3JA 2G04A 3ICPA 1LQTA 1Z56C 2I6SA 2H1CA 2ZWOA 2C4TA 3QLEA 4L8LA 3FCSB 1E1QD 4I8IA 4YCLA 3GG9A 4JBIA 4O1MA 4FHZA 3L77A 1XNRB 4H2DA 4RIGA 1YR1A 3DV0A 5EKUA 4UTNA 1PT5A 3DOFA 1QOZA 1L4EA 4KGXA 1OVGA 1GQSA 2QDKA 3SQOA 1RMYA 2YZ7A 2CLMB 4IUYA 1G8MA 1WSWA 3HB4X 1IHXA 1XTSA 4P8RA 1GOTA 4DT1B 5LFAA 1TW3A 4GH5A 2DHCA 4DCOA 4J16C 2PXHA 4CU5A 3ROGA 3UPDA 4ND2A 2A9KA 5E9QA 1R66A 4TL6A 3EB9A 5DTRA 3NHKA 5DT9A 5CA1A 1G16A 3VOTA 3A0UA 4JNCA 1T0JB 1R6UA 2V7VA 1EVYA 4PLVA 1YK1A 2XNDA 2QTLA 4EGQA 1JDBB 4MRMB 1A7KA 5M7EA 1UDXA 2QI9F 3DZBA 3JWPA 3LRPA 4GOMD 3GDWA 3LPLA 2DAPA 3B1ZA 4FYKA 4KFRA 1NJ6A 4LVCA 5C8YA 1YFJA 4HAZA 4DR4B 2ZYDA 3B1YA 2O57A 1ZGHA 3OOEA 5AW2A 3BMOA 3EH1A 5GM1A 3RFVA 1NZDA 3PT5A 3GRRA 2ZB3A 3A06A 1U0FA 3WL5A 2BGTA 4Y2PA 1EP9A 3G2LA 4A2CA 2GBCA 3ORYA 4ZAZA 4CQLA 5EI5A 4MYSA 4EZIA 2OZLA 3O2SB 1PR9A 1THGA 4RPKA 5DV9A 5JDIA 3K53A 1RQRA 4XWGA 1OW3B 4MS1B 4NCHA 1XC7A 3R4VA 2GS9A 2FFJA 2JEYA 4LSMA 2DX7A 1E62A 3H3JA 4KSYA 4YCNA 1E0KA 1VPTA 1WY7A 5P8WA 1XL0A 1C0KA 2EJBA 1T3LA 3FPBA 3DOHA 4QUBA 4HNAA 2C0CA 2FOIA 3B2EA 4CVNA 4DNQA 1OLOA 1XNGA 1SCIA 4HWTA 5DHTA 4YP9A 2IHNA 4EI9A 3H17A 4BQIA 4LXTA 2JS7A 2YMPA 1V9CA 4ZI5A 3QIVA 3OZCA 1JHVA 4MLPA 3T3IA 1C3OA 4OUDA 5HS6A 2WU3A 4P4UA 5CCEA 3Q4GA 1OH7A 3Q3GE 2G1PA 1VG0B 4IJVA 5JANA 4FB4A 1P7YA 2BPOA 1ILWA 5LC1A 4EMBA 4BNNA 1OI3A 5I8WA 3STHA 2Q7XA 3PGA1 1YJ8A 1Q0UA 3CLKA 1JFLA 4L4RA 2ID7A 1ZNYA 5K4AA 4RS4A 1KDPA 4D43A 4PPYA 2R00A 1JYFA 3RVLA 1ZMRA 3T06B 5LIRA 4RMNA 3D4IA 1G3RA 2JKYA 5AK4A 4PN7A 3Q7PA 1J22A 4WASA 1PTJA 2PA0A 1GPKA 3CXUA 4GYKA 1PX0A 3ZJ4A 4B3MB 4IQ8A 1MOPA 3ZCXA 1PFGA 2C9OA 3G89A 3EPHA 3DVRX 1ISIA 3W4IA 2C2OA 2AUTA 5EJ7A 3AT1A 2ZI7A 3UB2A 3LUFA 4YCSA 3T5GA 3PXXA 1AV6A 2FP4A 1C9DB 1PGPA 2GD1O 4HVCA 4QFCA 4DCSA 3JZIA 1UEXC 3B5IA 3L9WA 3RO7A 4D42A 1EIWA 2OXTA 5CYFA 2FY8A 1JIJA 4CODB 5JSQA 1M33A 2AR0A 4MHSA 3QELA 4G56A 2WU8A 4MI1A 4I1OA 4XVHA 1RAAA 1ZA2A 2O2ZA 1T24A 2ZR7A 4CLRA 3RAFC 3NIDB 1A1VA 2ZSDA 621PA 1X42A 2RB5A 7GPBA 2BBTA 3E27A 4MLZA 4X93A 2X0IA 3DT9A 2N75A 2NZ8A 4WK0B 5A6VA 3Q7SA 4JASB 2CJWA 2F64A 2VNJA 1RIIA 3L9XA 4II7A 3K9QO 3KQOA 2QS9A 2GH1A 4NDAA 4WOBA 3MCZA 2BSXA 4QBFA 1J7KA 5CH5A 1VCMA 4ISBA 5TNXA 2LVBA 4QOGA 3SM3A 1KPHA 2LCIA 1Z6YA 3VOBA 1A5ZA 2QZPA 4IEFB 3DLCA 2C9MA 4MJLA 4A1FA 5IF9A 2OFFA 3KPUA 3NONA 3P0EA 1UDBA 1S4QA 4CM8B 2E87A 3ADPA 4WXHA 4FVTA 5CCDA 1AGRA 2IH2A 3AIIA 1IG3A 1CJTC 2DUJA 5HG0A 3U17A 2X9QA 1WF6A 3D6UA 3GOQA 4I0WB 4Y1RB 1ICEA 5FL7D 3RRBA 1JLMA 2B2NA 2P1ZA 2AA3A 1GHTA 1ECBA 2FUG1 4HXEB 4LE1A 1E3IA 5DI9A 1NF9A 5KCMA 5BSVA 2ZJZA 2GDJA 2VXCA 3H0CA 3VSDA 4OYLA 3DBRB 2VDMB 3PGKA 4OXXA 3VH4A 4DOMA 2HNKA 4EMSA 3CRRA 4TLMB 1K9VF 4MRNA 5FOUA 5T3YA 4B3CA 1QV7A 4TN5A 1TUIA 3CRZA 3K71B 2BFFB 3ADDA 2H1IA 3FE2A 5DBOA 1EG7A 2Y27A 2ZSIA 4AG3A 3H86A 1JHQA 1BOFA 2FHSA 3WMGA 3UICA 1AQIA 3A3NA 4M7PA 4PTZA 4WA7A 4D0SA 3G82C 3B5EA 4JB3A 4YAGA 4LRQA 3LGSA 1ZLYA 1N6HA 2YVLA 3WYDA 3EFOA 5DYWA 4EECA 3TW8B 3HJAA 2PYDA 3TW0A 4P6VF 5AVUA 2IYWA 3PF9A 2HREA 3FGNA 4NYMQ 2DPLA 3T1QA 2GAJA 5IUJC 1XU7A 4MS4A 3FRJA 3MCWA 3LMKA 2P9EA 1UPAA 4J0IA 4M1EA 1JDTA 2HPVA 4N3BA 3H0KA 4X8HA 4YV0A 3RUFA 5KZMB 2OYSA 2YWFA 3GLRA 1CB0A 4AULA 3OT1B 4DCVA 2ZW9A 3LW7A 5ALYA 5CDFA 1E6CA 4MB2A 2PR2A 1HR0B 4HUQB 3N2YA 2ODWA 3MMNA 4Z7OB 2J5XA 4MZXA 2I78A 5DX8A 1JU9A 3RYFB 3IIMA 1SCUB 4TXMA 1E2EA 3VQTA 2YV2A 1H2BA 3LY7A 3WJ7A 4C43A 3ER8A 1DKPA 2VHTA 1OBHA