1Z5UA

Crystal structure of s. typhimurium apha complexed with cyclic-amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
208
Chain Sequence
b'TLNPGTNVAKLAEQAPVHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTKVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRILRAANSTYKPLPQAGAFGEEVIVNSEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AphA protein
molecule tags Hydrolase
source organism Salmonella typhimurium
publication title Structure and Function of class-B bacterial non-specific acid phosphatase: functional role of invariant Lys154
rcsb
total genus 73
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z5uA00
3OCXA 3ZW7A 2ZBEA 3AR3A 1FEZA 2B1RA 1TA0A 2JAWA 2YBDA 4RESA 1QYIA 4I9GA 3L5KA 2AMYA 2RB5A 2P9JA 2WF6A 4UU0A 2NYVA 2ZBFA 4UMFA 2O2XA 2X4DA 1ZD2P 4UMVA 2G07A 1YS9A 4XPZA 1QQ5A 5AI6A 3DNPA 3ZUPA 5ALXA 3U19A 2HF2A 4C4TA 1L8LA 2WM8A 1RPZA 3QUCA 1IWOA 3GYGA 5ALRA 3NAMA 4ZEXA 4YCLA 3L0YA 3QLEA 5AKJA 4ZEWA 3SKYA 1ZJJA 1SWVA 5AKXA 1Z4QA 2I6XA 1ZD4A 2AGVA 5AVUA 5AW0A 3AR8A 1ZS9A 4KNVA 5AW5A 4Y2XA 3N28A 2YMLA 1TE2A 3I28A 4QQFA 3NANA 4XE5A 1T9ZA 2EATA 2FPWA 1Z4OA 4UATA 2PKEA 4AS3A 1Z5UA 5AM3A 2HO4A 4YGYA 2MU1A 2WF9A 5ALMA 3KOOA 3A1EA 1L7NA 2FPSA 3R4CA 4ZEVA 3FPSA 3ZI4A 3PGLA 5AW9A 3OCWA 4C4RA 1O08A 3W5CA 4UW9A 2C8KA 4Y2UA 5ALUA 3WK9A 3W5AA 2RARA 4OHFA 5AVXA 4YH1A 1RMQA 4BNDA 3UM9A 3AR2A 4O8CA 3OTQA 3NUQA 2ZOSA 5AVRA 2B1QA 2C8LA 2BDUA 1L6RA 2WF7A 3MC1A 3N1UA 4G9BA 5ALJA 1AQ6A 3PDWA 3I6BA 2G09A 3PGVA 3TLMA 1N9KA 3ZWKA 2IA5A 2RAVA 5AVWA 3EPRA 3QU2A 3RF6A 4BX2A 4UAVA 2MSNA 2D2VA 3FPBA 4L6CA 4Y2PA 3ONNA 1QQ6A 4BKMA 5AVQA 1VJ5A 4HAIA 5AM5A 4UM7A 5AKKA 3WK6A 3E84A 1N8NA 5ALOA 2AH5A 3WK7A 5ALEA 2ZBDA 1Q91A 1EK2A 4EENA 1CQZA 2HI0A 2Q5EA 5AI9A 4C4SA 5AW3A 2WF5A 3NRJA 3QU5A 5IT4A 2OA0A 3ET4A 4BYGA 5AKYA 4E88A 3L8FA 3CNHA 4FFDA 2ZBGA 1U2SA 2IOFA 5AW7A 2YMQA 3AR7A 3HLTA 4H1WA 2YJ5A 4EX6A 2FDRA 5AKLA 3BWVA 5AVYA 2VKQA 3L8EA 3ZTWA 4NV0A 4FYPA 1J8DA 3DAOA 1Y8AA 2GHTA 2GHQA 4Y2SA 3SKXA 4L57A 1L7MA 5ALZA 4KX5A 4EZEA 2BDEA 2JARA 3W5BA 4BX0A 2QYHA 3ESRA 3L7YA 4OCZA 5ALHA 5A3QA 4IFTA 5AKIA 3K1ZA 2FPXA 3AR9A 2HEGA 3P96A 2I54A 4AS2A 4KX3A 1F5SA 3MMZA 4B6JA 2PQ0A 5ALQA 2WFAA 3ED5A 3WKEA 1VFPA 3U13A 2FUEA 1Z4MA 1S8OA 2B8JA 5AI0A 2C88A 3KC2A 4CE6A 3SD7A 5JJBA 3VAYA 1Z4IA 2I7DA 5ALSA 1S2OA 2I34A 1XPJA 3DDHA 3L8GA 2CN1A 2B82A 1SWWA 2B30A 2GMWA 3RFUA 3ZX5A 1YV9A 2ZXEA 4GIBA 4CNQA 2HF7A 2R8YA 5AESA 3WKBA 1RMTA 3AR6A 4NAVA 3WK5A 5AVTA 3QUQA 1YMQA 3SMVA 1LVHA 4DFDA 5ALIA 3QNMA 1ZRMA 1Z4KA 4BX3A 3FZQA 5AW8A 1Q92A 2GFHA 5AVVA 2C9MA 4CF3A 2ODAA 1SU4A 5AW1A 5ALNA 3ZVNA 2WHEA 2GO7A 3M9LA 4JB3A 1RKVA 4OD0A 3U7EB 2IOHA 3IRUA 1QH9A 4UU1A 5T41A 2JGAA 2P11A 1TJ3A 5AI4A 4XOUA 3PCTA 4HGNA 1RKUA 3WKDA 3L0BA 3ZVMA 2PR7A 2HX1A 4F72A 3FM9A 4YIHA 2FEAA 1MH9A 1Z4NA 3QGMA 1X42A 5ALFA 3FVVA 5ALVA 1NRWA 1RQLA 5AVSA 5AIBA 5AW2A 3EF0A 1YJ5A 3ESQA 4Y2RA 3UMBA 1CR6A 3ZTYA 1KYTA 4BBJA 2FPUA 2JAUA 2RBKA 2YFYA 2R8EA 5ALDA 4YCMA 4NWIA 3A1CA 3B9RA 2O9JA 3HYCA 2CFSA 1J97A 3QU7A 5A3RA 3S6JA 2YJ4A 2Q4RA 2G08A 4JDPA 4EELA 3KD3A 2OYCA 3KZXA 4HGPA 3AR5A 3N07A 2I33A 2G80A 4BEWA 3N8GA 5ALKA 1YNSA 3QXGA 5AVZA 1RC8A 5ALLA 1K1EA 3A1DA 4NFLA 3B9BA 3QU9A 3U7HB 1L7OA 3WK8A 1U7PA 4J2TA 1L8OA 2G1AA 2ZG6A 4G63A 4DWOA 2C4NA 1RLMA 5AK5A 2AUTA 5ALPA 4PNHA 1RDFA 2YMMA 3E8MA 4J03A 1ZD3A 3WGUA 3MPOA 2HHLA 2IOFK 3BA6A 2FI1A 1YDFA 3F9RA 4UMDA 1ZOLA 4AP9A 1TJ5A 2HDOA 1T5TA 4FE3A 3OCZA 4GXTA 3UMCA 1EK1A 4UMEA 4YIKA 1L7PA 4IG4A 5ALWA 3I76A 2G06A 4KYTA 2BY4A 4F71A 2WF8A 3I1YA 5AW4A 4CF5A 2HSZA 1U02A 1RQNA 2G0AA 3B8EA 2YJ3A 5ALGA 4HGQA 3OCYA 3UMGA 5AKZA 3NASA 3WK4A 4EEKA 1PW5A 3E81A 1Z88A 3L0CA 5AW6A 3U7GA 4KNWA 3OCVA 3WKCA 1RLTA 4KN8A 2JAOA 4UASA 2NO5A 4BNDB 4OFZA 2EARA 4UAUA 2R8ZA 1WPGA 5AK3A 1ZRNA 2NO4A 5ALTA 3E58A 2YJ6A 3U26A 3IJ5A 3L8HA 4Y3UA 3M1YA 3QYPA 4DCCA 3SHQA 3ZX4A 3FGOA 3ZVLA 1RMYA 5IS2A 4RETA 4Y2YA 3NALA 3ZU6A 4CF4A 4QJBA 5AHXA 5AKGA 1XP5A 3MN1A 1RRCA 4UARA 3J7TA 3QX7A 1WR8A 3EF1A 4YCNA 4NABA 2YN4A 4XQ0A 5AK4A 5A3SA 3R9KA 2YMPA 3ZWDA 1NF2A 1Z4PX 3SF0A 5AM0A 4L6AA 2QLTA 1RKQA 2W43A 2CFTA 3AR4A 3DV9A 3EWIA 3R09A 3U7FB 2FPRA 2YY6A 1Z4JA 3SLRA 3A3YA 4HGOA 1JUDA 4Y2TA 3CZ4A 3KDPA 4MUMA 3KBBA 4HGRA 3OCUA 1VJRA 4MWOA 1Z5GA 4Y2JA 2EAUA 2Q4TA 5IT0A 1RLOA 3L1UA 4I9FA 2R8XA 4EX7A 1WVIA 5AK6A 1U2TA 5AKEA 3QU4A 2P27A 2DQSA 1U7OA 3N5KA 4DW8A 1NNLA 5AM4A 3WGVA 2IYEA 1QQ7A 1XVIA 3WKAA 3L1VA 2I55A 5ALYA 1T5SA 2W4MA 2P69A 4UM5A 5AICA 2OBBA 2FUCA 2OM6A 1Z4LA 2HOQA 3QUTA 1LTQA 2B0CA 3QUBA 3D6JA 1ZD5A 1WZCA 5AM1A 4BEVA 4Y2QA 2CFRA 3OPXA 4Y2VA 5AIAA 3ET5A 5AI5A 5E0OA 4HYTA 5AM2A 5FP0A 5AI8A 3IB6A 1TJ4A 3W5DA 3NIWA 5AKHA 2HCFA 2B8EA 2W11A 1O03A
chains in the Genus database with same CATH superfamily
1QYWA 4KU4A 1MKYA 1KFCB 3O8QA 3CJRA 3QFFA 1YHNA 1E58A 5C3MA 1R5OA 3DV0B 2KLHA 1TX4B 4ZICA 4MINA 1ZWKA 3U4MA 5HZMA 2GVZC 1QUEA 2YVAA 4HDKA 4RESA 3KFVA 5D1HA 1AGYA 1JQKA 4RH0A 3HYRA 4LZOA 5EIBC 1BKYA 2QKYA 3JQ6A 3SQOA 1WV1A 3TZBA 2H7CA 3W9SA 4CLXA 3PC4A 3IOMA 2FRVA 4YT2A 4UMVA 2G07A 4KE9A 4QE3A 3EN0A 5D7BA 2WAYA 4MPDA 1VA4A 2E4WA 3H2HA 2OSBA 3FWHA 1AB5A 4GZMA 4XPZA 1QQ5A 2I2DA 2QD2A 2HF2A 1A76A 1DBIA 1ZGBA 2ADFA 2VSXA 3PFCA 3WLJA 3H5TA 4FMDF 3SPXA 3TPZA 3WYNA 4X91A 3E3AA 3L0YA 4QBGB 3FE2A 3CEJA 3QLEA 1M10A 1K8QA 1RWMA 2GF9A 2ORYA 2VLIA 3VR3D 2A9QA 4AG6A 4IIGA 3IXQA 2REBA 4FFNA 4IXWA 4WZAA 2J0EA 3HO6A 2XT9A 3T4XA 1YQTA 5AKXA 5F77A 2AD5A 3DXXA 1S2LA 1B1AA 2AGVA 4N7RA 3Q9NA 1GPJA 4PX9A 4M53A 3AR8A 3A10A 4NATA 1T8SA 1S2DA 1ZS9A 1LWOA 5F2OA 5J5AA 3W78A 5DIZA 3IVRA 4CLOB 3N0XA 1ND6A 4ME6A 1HE8B 2CDRA 1EVQA 4EJSB 3WGIA 5IAKA 1QIIA 3OFVA 1TEVA 2AZ4A 1L5NA 2GN1A 4O2RA 4LS3A 4WY5A 4GKAA 2TMGA 4OP2A 1NR7A 4AWBA 4YCDA 1LDBA 1P1CA 4LZNA 3CB2A 3EWNA 1XN1A 2O23A 4MUXA 3L49A 4K81B 3UB4A 2EIHA 2V45A 4M4SA 3G2KA 5FOUA 1DIRA 4BVHA 1CJBA 1W0JA 4FMPA 3VPCA 4YUVA 3THXA 3HEBA 1L7RA 5AH0A 5MGNA 2NPFA 4RM2A 3UY4A 4ILKA 3MJRA 1IEVA 3VAAA 1DV1A 4LYEA 4E2ZA 2WNHA 3FWKA 3H6HA 2H4WA 3HXOA 3URMA 4UBNA 4NEQA 3TB6A 3PF8A 1C30A 2C2GA 4IKOA 4XB6B 2FG6C 5JH7B 1P9LA 4F3TA 2IOQA 1HSOA 1ID1A 1AXRA 2PWZA 1GDDA 4OSOA 4QYSA 1UPAA 1WX1A 3MMPA 3E7DA 1PYDA 3HJGA 1VJCA 3BHNA 2X2FA 1UKYA 521PA 3A36A 1Y1PA 2ZJFA 3P9IA 2QL6A 5CYFA 1F8GA 4ZO9A 4Z7QB 2FETA 4DV0B 2NLOA 3WHKA 2VK4A 2IPNA 4IIYA 4QO8A 2P9QA 3STTA 2QTNA 1GGVA 1KQFA 2ZJ8A 3CPEA 4L6CA 4LCJA 3G5UA 4OBEA 4K6CA 2GXQA 3JQ8B 1GPDG 4Y2PA 3UGQA 3X1DA 2PPVA 4BKMA 2WT9A 3VZDA 4UM7A 2F59A 4X97A 5KI6A 2A67A 2AYYA 1YT5A 2VJAA 2WAXA 1YRQA 3AF4A 3JQAD 5TC4A 3WK7A 5KSWB 3HB0A 1Q91A 3IEIA 1A69A 1CQZA 2W98A 2IZ0A 2PNFA 3BCHA 3NRJA 4AT1A 4HFMA 2C5HA 2QHXA 4CEIA 1FJXA 1XMJA 4WT7A 2A9KA 4YJ2B 2VP0A 4DC1A 3IAFA 5HZHA 3S55A 1IWPB 4M9ZA 4NHEA 4KREA 1XWIA 4YI5A 1H0KA 3O8DA 1BMQA 3K2QA 3GXOA 3PUVA 2P4EA 1CUVA 1U2SA 4MVXA 4XAQA 2FSVC 2GBPA 5EERA 5K2MA 3U56A 3N6VA 2CE2X 1B76A 2PD3A 2EJTA 5AXCA 3QJGA 3L7LA 4ZI5A 4MVJE 5BO5A 1G3QA 3ABOB 1U3UA 2OCAA 5H83A 5FTJA 5B58T 2VTVA 5AVYA 4PGAA 2LKDA 4NYJR 2R8RA 3OZIA 4QNRA 4I3FA 4RZHA 1GYPA 4IWXA 3I9V1 1FFGA 2AQ8A 3U44B 1L5YA 5I4BA 4XSGA 1TK2A 3MB5A 3EPHA 2NZ2A 2AF3C 1IK6A 3S2ZA 3PS9A 4B3JA 2XBMA 3OC0A 3FPHA 1PWZA 4EB6B 2REXB 5K6AC 1USKA 3NDBB 3D6NB 2FVYA 4FONA 4ZVNA 2K87A 2AFIA 2D1YA 2OGUA 2GN2A 2JJYA 2ROQA 2WPNA 2C04A 2EYUA 3CF0A 3KE9A 5EUMA 4ZVMA 4DYDA 4OGLA 4FYKA 5A4AA 4X65B 4BNUA 1LB1B 1O4VA 1KDRA 1A5ZA 2XPCA 4FYMA 3U13A 1EUQA 3R9WA 4ENPA 4UXHA 1F5SA 2PQ0A 2QLLA 3EIHA 3P4YA 1JDZA 3A27A 5TT0A 4ZO8A 1OIVA 1KGDA 1IZ7A 2QU7A 1H8EA 1W581 2JVIA 3VI4B 1UJBA 4M8IA 5CH3A 4CE6A 1AMUA 2AOUA 5EC8A 3RFXA 1W36B 3AFIA 4LNHA 4TZKA 2ET6A 3TVDA 1SCIA 1T36B 1P1KA 2BGWA 1ICIA 2IYQA 3SN6A 3H42B 1S2OA 4ER3A 4EKNB 4LGMA 4U7TB 2DWUA 4OHZA 3NBMA 1SK8A 2YY7A 3L7AA 2PFSA 1LRKA 5CFNA 2B82A 3TRHA 5THQA 4HTAA 4ML3A 1N0HA 4ZT2A 2PKXA 3IUBA 2GJSA 1EBBA 4LVCA 2IYTA 2Q6TA 4RY9A 1QFJA 2DH5A 2ZRLA 1X9IA 1I4WA 4ER0A 1NP6A 2ZUSA 3QPBA 3R5XA 3QUQA 4ZAYA 1VCHA 2RK6A 1GQ2A 3OP1A 1FSSA 2XHZA 1G7TA 2PEZA 5CIYA 4MI9A 4BX3A 3E9ZA 4FIDA 2PMFA 3FZQA 1Y98A 3LF2A 2NG1A 4CCYB 3GLGA 4KQKA 2NUTA 1FS6A 1JEJA 3RKUA 4D9KA 1KMHA 1O95C 1COZA 3D2AA 2GFHA 3EFHA 3V2UA 2EZTA 1FNBA 3SKVA 3TTVA 2ZSJA 2F2TA 4NP6A 1R0YA 1KIAA 1AE1A 3NAZA 4N5HX 2WT4A 2NWQA 4L78A 2JFUA 2WU3A 3H9EO 5A9SB 1HX7A 4TPKA 2ZT6A 2NYRA 3M9LA 4E15A 1UBRS 3D8HA 1ZJYA 2WBLC 3KQYA 1MIOB 2OZPA 4PPNA 1P7WA 1FRVA 1OFIA 2QF7A 3QHAA 5I9MA 3SX4A 1M2NA 1SG9A 1ZK4A 2W2NA 2ES4A 2PT6A 4ZVVA 4MUHA 4DDMA 3B1XA 4GOOD 1IPFA 1IHUA 4OH7A 3JZMA 4DV4B 3AESA 2OCYC 4XPIB 5BQOA 5SZJA 5CB4A 1R8YA 3QTLA 1AQLA 4H16A 5LLSA 4CEIB 1WCXA 4REQA 5FQOA 2J3EA 3K96A 3RH0A 3WRYA 1WZEA 5COQA 3RSCA 1JDBB 4GUAA 4KQ6A 3TIGA 2OKCA 1H1DA 5TJHA 4DIMA 2R7LA 1L1QA 4AZ0A 4DNFA 2WJWA 3H8SA 3JSXA 5CFLA 2JJ1A 2WHPA 3FVVA 1EZ4A 5ADVA 2IIVA 2RK3A 4CKZA 4OQZA 5JFTA 2PO7A 2P2NA 3IQIX 1FDTA 1AURA 4RA9A 4AK9A 1OB5A 2VHYA 4MYDA 1P2FA 4N3BA 3KK0A 2Z58A 4LSMA 2YFYA 3PYXA 1I6KA 2QMYA 4N9WA 4D8WA 4Q34A 4H9GA 4HRXA 4BZWA 3C6XA 2HL6A 3QVKA 1ZAKA 1HE3A 1NE7A 1U4NA 3QU7A 1C2TA 3UJ7A 4C21A 4HDOB 3K1JA 3UQZA 4TS4A 1GDHA 4DG8A 5IN5A 4C3ZA 2EKZA 1FDIA 5CB8A 1CJKC 3M70A 3S2FA 2F55A 1SELA 2JS7A 1E2FA 2G0NA 4WA8A 2W2TA 3ER6A 3LYHA 5CA0A 3TTWA 4U8GA 4Q1BA 4MI1A 3CF2A 1FDUA 1CR1A 3NDRA 1OF1A 1MIOA 3H9BA 4YLGA 3U80A 4XQCA 5AVZA 4KQHA 2QENA 3PYMA 3WGTA 4OKSA 2H4XA 1GITA 3FUCA 1N6LA 2C78A 3TPFA 1D7AA 2BVNA 1T1SA 4U2GA 2QUKA 2WSBA 3CX7A 4F5EA 1L7OA 1U3WA 2FEOA 2MTBA 3KQVA 3KCQA 4YPFA 1O6ZA 2QRQA 2X77A 4QXQA 4C3VA 3SHFA 3OJ0A 2VCYA 3BDAA 1LSUA 2H5EA 3ESYA 3QTBA 4EG4A 1A8HA 1TT7A 1TD9A 1RPNA 1ZM2A 4GNKA 2AUTA 2A57A 2FG7C 2JA2A 3R6GA 2FE1A 4CU5A 3TWOA 3NLLA 1YZQA 1CZHA 3GEBA 4FQ5A 1FYXA 1PFGA 2FW6A 4B3IA 5BVHB 4JITA 1CS4C 4FJ0A 2QVGA 4L3VA 3BA6A 1QFXA 2ZM5A 5ESWA 4PAQA 5DLQC 1CZOA 3KVNA 1E3SA 1PS0A 2VNJA 4MS3B 3JD4A 5DTMA 6NULA 2QIOA 3RK0A 1R5JA 4BL5A 3FI0A 3GFVA 5CA1A 2PIDA 1AHPA 2QD5A 4ITRC 4W6ZA 5HOEA 5AXAA 3C14C 3GF4A 4GOXA 2H2IA 4YIKA 5EXXA 4EHLA 1QHIA 2CL5A 4U7JA 2FEKA 4CF6A 3SIRA 3KAQA 4J2OA 4ARIA 3I37X 3RBAA 1YZGA 2DBRA 4RDCA 4FDAA 1T5LA 1TZMA 3DAFA 4F71A 4DUZB 2H4HA 1X92A 2R8OA 3MT7A 4L4RA 3B5IA 4URYR 2OBFA 3PK0A 4F2PA 2NV6A 4DSZA 1ITZA 4QOJA 3EGCA 4GMKA 3IOBA 3ZS9A 3B12A 3T61A 5KOIA 3T7CA 3U6BA 2Q99A 3OIVA 4E1AA 1QSGA 1E2LA 1GNQA 2EOAA 2KWIA 2UVPB 5AKZA 3NIBA 4GZ5A 1L4MA 4KAJA 2VO1A 2JVJA 1QFZA 2L0XA 3G49A 3T5BA 4EUHA 2NACA 3QIAA 4N9QA 4AJNA 4QDXA 3RRFA 2H17A 3PGJA 3KUKA 3KU4A 4K05A 4IDBA 4FR5A 1UXJA 2GD0A 2DFKB 3COPA 1D1SA 3KUXA 4I46A 4L5JA 3ABQB 5JW6A 2H0AA 1E79D 1QS0A 4XZ3A 3W4IA 2PX8A 5BN1A 3U26A 1XKQA 3PENA 5KDOA 4KQJA 4NS4A 4K9SA 1VYVA 3DPUA 1Q0SA 5D2CA 3B6EA 1GQSA 1HDGO 1VIYA 1MZPA 1XTSA 1EUZA 5CA1B 3HO1A 3UFBA 5E3HA 5FI0B 5C3UA 5DNYB 2WD7A 4N76A 3BJIC 3PNKA 2D1TA 3RC3A 4HL6A 4ENTA 1LCIA 2X5NA 4L0MA 4O2AA 1PQUA 4U7HA 4YMIA 1ZOOA 1MJGA 2TRSB 3A6LA 3SVZA 1YOVA 3U9TA 1SXPA 5IT5A 2AQHA 2CF5A 3EGOA 4X61A 2X58A 2MINB 2XGMA 3OA0A 3LBIA 4WZBA 4OB8A 5AQ1A 4IHAA 2ZYUX 4P9NA 5GJWC 3PKIA 2C7QA 1C7FA 5HFJA 2Y67A 1JE1A 2CBGA 3ENKA 5DEOA 4Z1MA 4L6AA 1EK5A 1ZGAA 2QLTA 1SU8A 5F21A 3VR6H 3AR4A 2VOEA 3D4PA 4MCJA 3U7FB 5JPDA 4ZIRA 1RKBA 4HEA6 4O4HF 4LMAA 2J5QA 4XD2A 3WLRA 3IP7A 3HLYA 2HU7A 3SLRA 1T1RA 2Y9MB 2G77B 1P9WA 2A5YB 2FFJA 4JL8A 2PYDA 2Y3IA 4JROA 4KLNA 1PGQA 3MIIA 3R1IA 1W46A 3MT9A 5FR2A 3PEYA 2FQXA 2ZRGA 1ES9A 1PT9A 2WJHA 2GK4A 1TAGA 3SEFA 4BMXA 3O4IA 1AQYA 4HDRB 4MK4A 4EHAA 2YNMD 2PH1A 5EYPA 2FDXA 3F8SA 1OX6A 1JSZA 4LHWA 5LWHA 3V7WA 3WLPA 2F8SA 4W5NA 1LNSA 2ZCUA 2AYZA 5F51A 1SXIA 2O4CA 1JEYB 1NYRA 3T3GA 4W5TA 2VPQA 3KALA 3RCBA 2XB4A 2AVNA 3M6VA 5IEJA 5HILA 3UBMA 2HUNA 1JEQA 4DMFA 2X7XA 3FW1A 3CH4B 1OFUX 2BKVA 3AL2A 4MAFA 4KL8S 3DJFA 4PY2A 3FHLA 1VPLA 2CV0A 2CLLB 3DVSX 2IYEA 3I32A 4QTTB 5CHEA 2WMOB 3I62A 1EGHA 1YSCA 1Q0QA 2Z9CA 3O1IC 4H7JA 4IIDA 4RHYA 5J2TA 4GD3Q 4D6PA 1ZZGA 1IZYA 1L5OA 2F64A 1BJKA 3L1VA 5KOJA 2PX4A 4BNYA 1HT0A 1W1IA 4DQKA 2H2FA 2P69A 2R6DA 5AICA 5K8VA 1NW9B 2ZVPX 2HOQA 3KO8A 4B3XA 4BP1A 1T25A 4ER5A 1JHQA 3W04A 3FYSA 3PL1A 2F9MA 2QSUA 3V8PA 4Y2QA 1FDSA 2Z6VA 2XF8A 4KZPA 3NNSA 4JLOA 1IPEA 4AUMA 1MDFA 4B6GA 1B26A 4EG8A 1ST2A 1HI9A 3WOHA 1X14A 3ERCA 5E0OA 3LY5A 4ARCA 1M6NA 2AXPA 1E9BA 1UIMA 2PK3A 4YUYA 2O7RA 5KHAA 4R1MA 5IU6A 1WUJS 1LDEA 4PCAA 1F38A 1WHSA 1YBHA 2F67A 2BKXA 5G0SA 3VNAA 5KNDH 1F7UA 1E7YA 2BBWA 1GTL1 3JQBA 2HX1A 4ZO6A 3UUWA 1VCIA 4D3ZA 2RGCA 1A72A 3B78A 3TGLA 4H7DA 4Q9NA 1GLVA 1HGXA 1ANKA 1N2BA 3OP4A 5TEWA 3TOXA 3ZE0B 3A1SA 5IXJA 5J3JA 2QBYB 4OLAA 1H4VB 1KFJB 1MUUA 4LOIA 3JS5A 2JASA 3EQZA 5D51S 3VKFA 2CD7A 4DY6A 4ZI2A 5JYDA 3H9GA 3JYOA 4FK8A 5K03A 2VWGA 3LUJA 4R2IA 4CM7A 4ENVA 3T8YA 5KPJA 2ZATA 3NTLA 4HFRA 3K9GA 4BVJA 1D4OA 7GPBA 1KJQA 4LZLA 3UGTA 2YL2A 3B1ZA 4O4HA 4AJJA 3MRTA 5CVVA 5BN4A 5K8UA 3I0MA 2ACVA 3QXSA 2WUWE 2IK8A 3PE6A 3F6SA 4DC0A 5LOVF 4JUIA 2CDAA 4UBIA 2X9NA 4UUQA 1SC9A 5DNDA 3DNPA 4WEQA 5ALXA 2REQA 3G2OA 3OOSA 3U3KA 4YRGA 4NJEA 3K09C 3E4DA 3T1HB 3B6ZA 3MELA 5ERYA 3GT0A 3NHBA 3IKJA 4QAJA 5LDGA 4E2FA 2H4ZA 3ZJVA 3QSGA 3VR2A 1VPTA 1BFKA 5CLHA 1FUYB 2D7JA 3FYTA 3NDPA 1ZU4A 1MQ9A 3AGPA 1Q0UA 1X1EA 3W5UA 1Z4QA 5C7YA 5J4KA 1N5LA 4KOEC 5DYIA 2QVCA 2XGJA 2IUSA 3GFRA 2Y71A 1VLLA 3PFFA 3VHXB 1IB0A 2R1TA 3FRJA 1E4EA 4XGQA 3PRYA 1HNWB 1SCBA 2WPDD 4Z9BA 1P1JA 4Q9DA 3R3JA 4IVRA 5HIMA 4II3A 4RFSA 1N5RA 1OBHA 3PDHA 4ZI3A 1D4ZA 5HG0A 5IPFA 4CLRA 1ULHA 3N6XA 3KOMA 1TLLA 3EXEA 3ZU3A 1U3GA 2Z2YA 1LDNA 2PKEA 4A3SA 2ZB8A 1DX4A 1WHTA 2X5JO 2WINI 4GYWA 4YGYA 3QSYA 2O8EA 4I8DA 2IHZA 2C99A 4CRWB 3W4JA 3JYPA 1T0PA 2YZ7A 2I2XB 1L5GB 3ZXSA 3CVVA 3AFHA 1D2RA 3CUWA 2AJCA 1QH8B 5K51A 4DR1B 4KQEA 3AM1A 1E98A 3LPAA 2DYKA 2QMUA 5FPKA 4BMZA 3NBUA 1E2MA 1XZFA 4GT1A 2BKUA 3WLOA 4D3FA 1XVUA 2WAMA 3A9WA 4EHJA 4X44A 3LT5A 4MV4A 5K0CA 5SZIA 4TYNA 2CLFB 4NZZA 1L7VC 2G5GX 1N6OA 2ZRAA 1MC5A 5TDHA 3RLIA 4ETWA 4ZK6A 1CUAA 5CA1F 2BDUA 3D3JA 1W93A 1FU7A 1UBFA 1WXXA 4IIJF 5E6UB 5A7GA 1NJ5A 1FSFA 1KFBB 2NZXA 3BGOS 3E22B 4LQDA 1PWYE 2NQ2C 3A4MA 2GB4A 3P45A 4OI1A 1RYDA 2FX2A 2G09A 1DKPA 3FDZA 4LTNA 1Y7TA 4O4LF 1R5BA 3H2YA 3IHKA 3SDSA 4B3DA 1A2OA 4GQIA 2JIZD 3N2ZB 5TXGA 5BOSA 5AJHA 2EBUA 1YR6A 1LBQA 1P7YA 1MG0A 2NUPB 1IATA 3IT0A 3ZNOA 4KXLA 5CTAA 1FNSA 1JAZA 1FW8A 5TS2A 1UBUS 1XA0A 1CUDA 1Z39A 4I1YA 4UHFA 2X0FA 4DMCA 1DELA 2BF7A 3B89A 2XYHA 1H8ED 3V7FA 4RD4A 5JSFA 1OFHA 4MV1A 5KQLA 2PBFA 4HQRA 1IMOA 1JG2A 1UFOA 1YJCA 2HI0A 2WA1A 4W8HA 5C35A 4OBBA 4RPHA 1UT6A 2IW3A 5FPPA 2G28A 4C4SA 4F96A 5A1TA 2GD6A 5IT4A 2HGZA 2Z2XA 4BYGA 4Z9YA 5HQ3A 2VEDA 1XBTA 4N3CA 4IILA 1ZSYA 4X6YA 3RV4A 3CNHA 1J0BA 1UMBA 2NU7B 4FFDA 4WFIA 2HCTA 1H0RA 1O9HA 2QRVA 3A37A 2Z1DA 3I0NA 4R3NA 4UNSA 4JOCA 2V7TA 5KTRA 1G8MA 2VJDA 2MYPA 5G0WA 1NP7A 2J3JA 5M5BA 5MN4A 5K0BA 5LUBA 2DCUA 4JEHA 1YR1A 2HSGA 5E9QA 3U40A 1AXEA 1A5SB 4EY5A 5ES4B 1SC1A 1R8JA 2VK2A 1NXVA 4ISCA 2EJCA 3KAJA 3BIJA 5ITVA 2R11A 3BKXA 2XUJA 4IIVA 4FYPA 4TVOA 1CLEA 3HXMA 1J5PA 5BN3B 4J0KA 2A9RA 3FFBA 2R751 1IAVA 2QDXA 3I2YX 4II7A 1SMKA 3SBEA 3SKXA 1T2FA 4QIHA 1L7MA 3T1OA 5HKKA 2BGJA 2YN2A 3F46A 3KHTA 4IDHA 2BDEA 3Q3GE 2NQ8A 4Y0AA 2BKAA 3RODA 4QTYA 5B1EA 7REQA 3N8KA 2R86A 4LGYA 3IP9A 5I7OA 5ALHA 4V0MA 1Z6PA 4UVGA 1P1HA 3IILA 3MJ4A 1DAPA 1FBNA 1M6YA 1RI5A 2HHCA 2NAPA 1BW9B 1NA5A 1X70A 3OQHA 3S5JA 4ABYA 4AS2A 4URUR 3QLUA 3HN7A 2WKPA 3K1AA 4HH1A 5EE5B 3EW9A 5FHRA 3UHJA 4YV2A 1JDUA 1GP2A 4RTPA 2AD1A 5IJWA 2B8JA 1S8OA 2B4RO 4JXJA 1RD4A 2I03A 1M1NB 4ZCRA 1PJ3A 3WMWA 1NASA 1LK7A 4D9BA 1EIZA 4NICA 3HJTA 5ALSA 2ZZKA 5F23A 4FZ5A 1TUEA 3L8GA 1S7GA 1H0SA 3HHEA 4G5FA 5BV2P 1WBBA 2B30A 5JQWA 1RAAA 4I1IA 2QAJA 5SYMA 4CZ2A 3UA3A 1YJAA 4JZYA 4CNQA 3PLAE 5EIHA 3RABA 4MW0A 5L4SA 2Q9BA 3T4PA 3P32A 5EHZA 1CETA 3PKZA 1Z0AA 3EIWA 1KZ6A 1Z6AA 2GTPA 3KZCA 4FHFA 5TARA 5GZ3A 2Q4DA 4PLZA 5EP2A 4FNOA 2NPIA 1SB8A 1LBSA 1PF7E 5E4TA 1QZZA 3LCVB 5I8PA 3UHFA 1T36A 5AW8A 2A8YA 1CQPA 4BAZA 3N0WA 3F73A 3BSWA 3FGPA 3CXUA 3AF3A 1ZCZA 2B2XA 2VNSA 4KOAA 4S35A 2SCUB 2HRDA 4MQ4A 5DH9A 2P2DA 1H85A 2V4UA 3PXDA 4Z8XA 1GPH1 1ODLA 2AOVA 3ZBTA 5AVVA 2J3QA 5JD5A 1ZVMA 2JC3A 4TV9F 3QBDA 3QYAA 3K9WA 5ALNA 1CE8B 2I29A 1JJ7A 2D5AA 1GEGA 4OI0A 1C5KA 1BGXT 2CDBA 1FUIA 1PU2A 5LQJA 1SQ5A 1HLGA 3D7NA 4WN3A 3IEVA 3OZ7A 4XVHA 4KBYA 2WUVA 3HJBA 2VQSA 4NX2A 4ZU3A 2IX9A 4ETMA 3I1IA 1RXEA 2IHUA 5ILOA 2QUJA 5LBIA 2ILVA 1X0XA 1ADCA 3I6YA 3PCTA 2XNJA 3A0RB 3K2BA 1N7JA 1Z0JA 1MQSA 2NO7A 3LIPA 1EU1A 2OFOA 3K4PA 3QE3A 4JMLA 4PC3A 4YT5A 2JFFA 4E2WA 2SKDA 2YHBA 5JNTA 2I9KA 1BD4A 5M29A 5IVPA 4O2BA 5DM2A 2VP2A 3OFND 5IUKC 3S8YA 5J9FA 4IPTA 5ALFA 5ALVA 5DLDA 1WA5A 3NHMA 2XSZA 3AEZA 4JOQA 4J76A 4Y2RA 2H85A 3T6KA 1KYTA 4JEIA 4CM1A 1VM6A 4Q4JB 3RK4A 2VHVA 3T1NA 1RABA 3GDGA 5I7VA 3OZEA 1UEJA 1HMYA 3LVBA 3QVWA 4QKQA 4QUBA 5EZYB 1Q77A 3IUYA 1W75A 5DHPA 1U7UA 1ICEA 4BBZA 1U90A 3C4QA 4R3UC 4UBOA 4V03A 2FCRA 2LCQA 4BMPB 3MMSA 3BORA 4JCCA 2K7ZA 4DQLA 2I6UA 4H7FA 3KZXA 5DCUA 5U4QA 3MHTA 2FJUA 1T5HX 1YB5A 1L4EA 1RXCA 2FTKE 2LV8A 1U0TA 2PDAA 4IOJA 1XI2A 2FW8A 4ZARA 1KJ8A 4RE5A 4Q18A 5FB3A 3QITA 2ODEA 3E27A 3UH1A 4PLYA 3F3YA 1H4TA 4MJLA 1BRMA 2QXUA 4LX0A 3ZV7A 1KU6A 2VH5R 3ESXA 4EYEA 2O3QA 3QU9A 3FZEA 1U1GA 4GP9A 1KDYA 3BE5A 3KWFA 1KP9A 5K0LA 3Q6NA 4PC1A 2EHJA 4GS5A 2RMKA 2BFBA 1KPGA 2ZR7A 1K89A 4JU8A 4PQRA 2Y93A 4X7RA 1YVEI 3K8YA 3RQSA 3S2UA 1XXLA 4X92A 2EP8A 3HDYA 4HQNA 5FFMA 3ZGZA 4MI6A 2GJ8A 1YCGA 3JASA 2GPJA 4BWVA 4B73A 5KTNA 4EB0A 1Z7EA 3V4PB 5JJLA 3QVGA 4TRJA 1BQ3A 4G23A 1Z56C 1AVTA 1FXSA 2CXSA 4ZDKA 3B9PA 1V5IA 2QG4A 3DLIA 3FB4A 3GWZA 1GO2A 4MVJG 3UMFA 3TF5A 3N6RA 1ZIPA 4UMDA 3F9RA 5FEMA 5CIWA 1JHVA 2JNWA 3VO8A 3VSAA 1LRJA 1Q1AA 5G41A 3AUFA 1TZBA 3B60A 4R9UC 1T15A 3MLBA 2GHRA 3DT8A 3PPYA 4HAXA 5J40A 4EABA 4D3YA 1J9ZA 3DHNA 3PD1A 2DPLA 2VHEA 1G6OA 3WJ7A 4B45A 3CLRD 4AROA 5LBUA 4KXVA 4HTFA 1X19A 4R7GA 4PONA 1PYGA 2PS9A 4RTLA 2KX7A 5BV0A 2B94A 4O2BF 2QSYA 1I7QB 1UFQA 3LSTA 8OHMA 2I2FA 1MEEA 3SS9X 1IVNA 4MYRA 3SQMA 1IL0A 4Q1DA 4HNSA 1JSXA 3NR2A 1D6SA 5C81A 4RMIA 1HQKA 1HG1A 1RXSA 4RXTA 4YXFA 3V2HA 2C5SA 5KOHB 4OFXA 1KYWA 1KARA 2X0NA 5DDIP 5DK6A 3IP5A 1G4HA 2PMBA 2WP0A 3TGPA 2ZANA 1DBQA 1PFUA 2RJ3A 1ZOPA 3FNEA 3K9LA 4OI2A 3DVAB 3LPCA 4EVIA 2XDYA 1HQDA 1E5VA 3D8SA 1T4DA 2I6SA 1HWYA 3CA8A 2H00A 1ZUNB 2ID7A 3WWZA 1ZVKA 3COVA 3ZV5A 4ZI7A 1UQUA 1VA5A 1ZGCA 3HCDA 4F7DA 4ASUD 3IJ5A 4MAAA 3SF8A 5C7IO 5L53A 1K88A 5B3LA 2J48A 1HF3A 3QE0A 2CMDA 1RBZA 2MSWA 3OBBA 1AKUA 3G1WA 4I50A 2FN9A 3TQIA 4ARAA 2DB3A 3SSAA 3EK2A 1UBLS 5FBWB 1AQJA 2GZRA 3GCWA 3AZQA 4UZEA 5EKTA 3RJ9A 1P75A 4FPXA 4BNXA 1QFSA 4CXMA 2HSEA 1QZ3A 3ZOKA 1QHSA 1UOQA 1T9HA 4Y1FA 3Q0EA 5FBRB 1PWHA 3R24A 3G1TA 1I3NA 4QHYA 3H16A 2RB4A 4D4JA 4B2YA 2WJJA 3LIIA 1N6RA 4RKEA 3FG9A 4A15A 3MLAA 2HR1A 3LQ1A 3NRBA 1CNFA 3AI1A 4IDPA 3BX1A 3QBJA 4TKVB 2FAXA 4P3XA 2OXCA 2JJ8A 3L8MA 1UKAA 2DMRA 2VPIA 3G8DA 1Y1QA 3L1JA 3ZJTA 3UMSA 4M6WA 4HV4A 2XR1A 1J6UA 2JFVA 3ZHUA 4BB6A 5L7YA 2OB1A 2RIRA 1NVKA 2GS9A 4US0R 5HNKA 4AJOA 2DKOA 3T35A 1XTPA 3C3PA 3VKVA 3IERA 1N0VC 5IWAB 4EYOA 5EXDA 1EP9A 1PJ8A 2WJAA 3GRUA 4XA8A 1V7ZA 2WKSA 4G67A 5KREA 3O84A 5DMHA 1K8RA 3FLAA 3D3KA 3CZ4A 2JFXA 1ZXLA 3UB3A 3IKLA 5I47A 2K5UA 1P3JA 1YI8A 4F3RA 2EFGA 3V1LA 2BUBA 3BDVA 4P5EA 1URPA 1NUTA 3KQNA 4LECA 3M4YA 2YNMA 1EWYA 2ZE7A 3M7IA 4HUJA 1NIPA 1XMOB 3MJCA 1TF5A 3UW3A 1MC1A 2IP4A 4EHHA 1G6KA 1QG2A 2EFHB 1Q95A 2ZJBA 2YCBA 3GPDG 4YTEA 1YVRA 4KHPB 3OF2A 2LZ0A 4A92A 5BWNA 4QTZA 3F1KA 3ZZNA 1V2HE 4FUTA 4BNNA 1QNLA 1D09A 3CF6R 5AM4A 2HEIA 1UMKA 1L4KA 5CT8A 4B3MB 2ZKLA 3VR2D 3HACA 2WJ3A 5JSZA 1KYIA 1RPTA 3BBLA 2Q5FA 3SYRA 4L95C 4TT3A 1UKCA 2BJVA 2WDZA 1QUFA 1WW3A 4XJTA 4AWAA 3QUBA 1DAIA 4X93A 3SYNA 4KQIA 1JIUA 3RHTA 5IK2D 2LNDA 2AZMA 1U0JA 1QM5A 4Q3OA 3JRNA 2BFAA 1I1HA 3ZV6A 3OURA 3ZDDA 4RANA 1E2JA 1NQOA 2HXGA 1SHJA 4N0MA 1SHZA 4NFSA 4FC6A 2BT4A 2KS6A 2X4GA 3CMMA 4J1TA 3TQRA 1MHTA 3S2GA 1HY3A 4G1MB 3OPYA 4MZXA 1EE1A 3PE4A 2INGX 5ITWA 2FP3A 2WYHA 5E7MA 1DCMA 1I8TA 1RM5A 2YXDA 2B9VA 5AT1A 3TLGB 1QANA 2P79A 1SHLA 2RBGA 1JKMA 3EVTA 1KZGB 4FMBB 1G9XA 3K05A 4IHKA 4KAXA 3WC4A 3ZW7A 3S70A 4KK4A 1Z0FA 4MKXA 2JAWA 2EBWA 4Q9KA 5EQDA 5IKOA 3RS0A 4EJ2A 2XEXA 4FCTA 4S1WA 3U3ZA 1Q0ZA 4C2TA 5IM4A 4UHEA 5JAQA 2A33A 2YBDA 4FYYA 2GRUA 3MGBA 1PKXA 1OT5A 4Y9SA 3G9ZA 4UU0A 4PZLA 4Y1RB 1E4VA 1M7GA 1PVDA 2PKQO 4KVZA 4L7VA 4TLDA 4D26A 3SR4A 4HP8A 1JECA 4XTRA 3B51X 2Q2WA 4OL9A 2GCOA 4QTUB 2X13A 4M7RA 2A14A 4FDMA 3UJNA 4YHHB 3I64A 5AI6A 4KIGA 1XQWA 1BHO1 3H1TA 4HWOA 4W4TA 5JNWA 3TRKA 4RJTA 3F5QA 5JXHA 5AR1A 3P2IA 4UZSA 1AM4D 2DSNA 4H6PA 3PNVA 1HQCA 3U3MA 2OD9A 1E8DA 2J09A 4EGFA 3HH8A 1NVVR 5IDVA 3ORHA 3JYNA 4JIMA 4Y9TA 4K1LA 3O4RA 5AKJA 1KI1A 1F8YA 1DG9A 1D4AA 2B4YA 4GUDA 2WVAA 1GLGA 2BFOA 1VI5A 2JLAA 3EC2A 3ZXXA 4AJHA 1O1YA 2D1QA 3LZDA 4RACA 5J59A 4MQEB 3BERA 3M5CA 1WKBA 1WE2A 3R6WA 4GEGA 1O95A 3CONA 4S24A 1VSBA 4FCWA 5A1JA 1JFVA 1H94A 3WYBA 4UNNA 5DGTA 3KSMA 1QGZA 4GBGA 5BSRA 3S1AA 3SOZA 4ENSA 3WLMA 5BWLA 4TVSA 1FXWA 4WESA 3K3PA 3KJXA 2CJFA 2AKAB 3SJ7A 3VMMA 3BXEA 4BVKA 3FTEA 4BN4A 1DBRA 4YFYA 3SX0A 1J2UA 5IF9A 2H9YA 1RCTE 1MRNA 3MJVA 4GC9A 3TJRA 4B32A 2XIJA 1E1KA 4FR2A 5KYXA 1QMPA 1UBEA 2I4MA 5IJXA 1CB0A 1CPYA 2QUIA 1XD2B 1P0CA 2PT5A 3DONA 4HBGA 5BYBA 3VHXA 2J0UA 3C8ZA 3CG4A 1F2UB 2EX1A 1G8PA 3GFOA 3LCMA 1TMOA 3GDFA 1OLUA 4IS3A 2AJDA 2XAAA 4O2AF 3ROZA 4BUCA 3H04A 4JLUA 1NVMB 1XAGA 4O4JA 3HK2A 2O2SA 1OLXA 2XE4A 2X8BA 1G21B 3O7MA 1DADA 1I7SB 1W2HA 4BUZA 2NXWA 4EVQA 3OTQA 1HYHA 4Z3DA 2J3HA 4JY7A 4KAFA 1JPUA 2BSXA 3I53A 4GR4A 3A4IA 3VFDA 4PHCA 3ZI7A 2J67A 4EUEA 4UNIA 3D59A 3QG5A 4HLNA 3WBFA 3DO5A 3GLUA 2JF0A 4DBZA 3WGLA 1OR8A 3IURA 1ONBA 4HWSA 1XCLA 3BEDA 1CS0B 2JANA 5ED0A 5H3HA 5LB2A 3VU0A 3ANLA 4AZVA 1KK0A 4TWAA 4OHBA 1C7JA 3QU2A 3P5BA 4M0LA 4L8GA 1EJBA 3VVLA 4B6PA 1YFLA 3DHVA 5HYVA 1FB5A 4R1LA 1CY6A 1FFDA 3FPBA 3ONNA 2FWRA 4ZQGA 2C7RA 2XECA 5AVQA 3OZFA 1X1BA 2BM0A 3KX2A 1RYZA 1G3MA 1YGYA 2UU9B 5F5NA 2F43B 3W7VA 2X0KA 1N8NA 2KW5A 2WJYA 4JUFA 1UDRA 1YOVB 1Z9BA 2AH5A 5H4HA 3WWPA 5CLFA 1ST3A 3RADC 1SG6A 3H05A 3KQTA 4NBRA 3U9SA 1WUTA 1XLUA 3IDZA 1Z36A 1KERA 2GYVA 3ETCA 3IPRA 3O9MA 2VXOA 1OTXA 3DLCA 3VAZA 4HMPA 1K3UB 1BCSA 3W34A 1ODCA 4BCCA 1RLIA 4I4TF 4CMIA 5BNIA 2Q1WA 3VZCA 2BN4A 3NCHA 3L40A 1PR2A 4CQLB 3HJFA 4RHTA 3WNBA 3WYDA 4YV0A 2XNDA 1R50A 2AFHB 1YK1A 4RPIA 3JAWA 5EAIA 5A5FA 3RC9A 2PCLA 4G5HA 4J0CA 1MW8X 2H9IA 1DO0A 2CKDA 5HQJA 3Q2KA 3KYDA 4A91A 1NNUA 1CQJB 1PT6A 1YULA 3MWKA 2BR4A 2QR5A 4G89A 4L8VA 4MMXB 5DHSA 3R8CA 3L0ZA 3SNHA 3FCYA 2PGAA 2QNIA 3L41A 2BE9A 2ZAIA 4JBHA 4PYLA 4MVJI 1E8NA 1ZD9A 2GH1A 1X7YB 3TW0A 5A5VA 5FBZA 1V26A 3SQDA 1NC1A 2V3CC 4NECA 1OBVA 2PUBA 5CX1A 2YASA 5ECGC 3I5AA 3LKDA 3W5BA 5B1SA 5D01A 2HSWA 3EDYA 3FOFC 2C4UA 1DTEA 2JFNA 1NLMA 3FNIA 2J30A 2GZ1A 4CQJA 1F0PA 3W05A 5K3OA 4LV6A 1W19A 1LLDA 5E2AA 5GIOE 4J0EA 1TKAA 4BNKA 2ZAGA 4U6QA 4HN4B 1TPZA 4LIPD 4AY3A 4JWKA 1KI8A 4AZWA 1E7QA 4O5AA 5ELXA 2FK7A 2CCJA 2JH9A 1U9JA 2ZBQA 3O74A 1WP4A 4YJ3F 3GLQA 1OI7A 1TQ4A 1ZGJA 4OHVA 5BMVB 3O75A 4WDQA 2UZ1B 3HCWA 1BS1A 3VAYA 1JYSA 2WJ6A 1E99A 1JFTA 5DXAA 4LC0A 1B15A 1TAQA 3SXUA 1XPJA 1TKCA 3NATA 4O2LA 4OQLA 3U17A 1W47A 3O4JA 4MSUA 2CVQA 2O0JA 4G4GA 1VE5A 2XYVA 2JH8A 2Z4SA 1CHNA 3HWRA 3PE3A 1J24A 4K6FA 4WW0A 1UOOA 3NJRA 2R8YA 1H1TA 4JX9A 4U8HA 3HR8A 3JQ8A 3KUUA 3L9XA 4XJSA 3PGMA 4GMGA 4RD2A 3SY8A 2A92A 5AVTA 3GZ4A 2J9YB 2WKWA 4QOEA 5B1HA 4MITA 3GPCA 5ALIA 2E4YA 3NRCA 4PLWA 2V6JA 3ZHYA 4EF6A 4M0CA 3K6SB 3KM0A 3NTRA 9GPBA 2CVPA 3IOCA 3U0BA 4CU2A 2DQ4A 1PGNA 3UWPA 3Q2IA 1PLLA 2X8AA 4ZHSA 1XU4A 1ZX1A 4UJ3A 1S2GA 2FUG6 4NZNA 1L3CA 1ZN2A 1YVPA 3KPJA 1QHYA 1X7WB 2KSQA 2HJ9A 5LL6P 2WYWA 3ILVA 3FLMA 1P2GA 5BOSB 4O4HB 4CVNA 4TRRA 4YMVA 2DBQA 4CL2A 4BQPA 2VSYA 3VPFA 3HVUA 4BV8A 2G88A 2UXBB 4JLSA 1ONPA 3U7EB 4EJ6A 4C03A 1B8OA 1NY6A 4DBLC 1SQSA 5CDGA 3TBHA 1U8UA 3HR7A 4LXHA 1CNEA 1B16A 2MDTA 3HB1A 4JUAA 2ZB3A 1HRDA 1E3WA 3DSRA 1C7ZA 4G3XA 4N12A 2Q3CA 3HSYA 4K9PA 3ZV4A 4B81A 3ZEIA 2H2GA 1U99A 2QQFA 2FGJA 1DO2A 2O07A 3CLSC 1E20A 3VYTB 1Q19A 3WL8A 1R5NA 2X23A 3A4NA 5DGDA 4OM7A 3RANA 5IT9A 2ZBRA 4QRHA 1HDYA 3S68A 3WBBA 2MYUA 1X80B 1H93A 5E1MA 4NDZA 4R5MA 4F72A 2FN3A 2L69A 4YIHA 1PJBA 2J9FA 1NURA 1Z0IA 2OAEA 1UWVA 4FHGA 4ETNA 1T1GA 4PSDA 4TLCA 4WNIA 2CHUA 3GJZA 3DDZX 1P5ZB 2TECE 4DR7B 5ISMA 2VUTA 1MB9A 4Q6BA 1W34A 1ZDMA 3ANTA 4D8VA 3OX1A 3D7LA 3F2IA 3LUGA 2GNOA 4PVDA 3DCIA 3UH0A 4Z4IA 4X94A 1E2KA 1PYOA 3MJFA 5CAEB 4RTMA 4B7AA 1Q83A 2G70A 4RKRA 5LQUA 5F5XA 1AKWA 4MJXA 2B36A 4M7OA 2O1EA 2EFDB 1PR1A 1I7NA 2SKCA 3FA2A 4YMLA 1O87A 5FD8A 5TVKA 3IUNA 1TLFA 4I5IA 3DWGA 1V1MA 4YEDA 5M3BA 4AZ3A 2FWAA 2O8NA 1DC3A 1UJ2A 3A2MA 4FGSA 3GGCA 3S40A 1Z5OA 3BF8A 1LF5A 4MIEA 4DXAA 4CMJA 3I45A 4RD3A 5BUSA 2QT0A 4I1VA 2VK8A 4I0WB 3DBHB 3CLHA 4U5XA 3RPEA 4B2IA 4AF6A 1RBMA 1O57A 3HY3A 4AJ9A 3UHAA 1R0KA 4IWYA 4YAJA 3O26A 4DIUA 4RFLA 5B64A 2ONYA 3T3IA 3CNEA 3PKJA 4HRYA 2C2KA 3AUJB 3F8WA 4IQ4A 1OY1A 3ONWA 1N0IA 5BW6B 1M1UA 5D7NA 3CVJA 2ZITA 4ND4A 3W5SA 4JL5A 2J9FB 3PHBE 4AJ1A 2KB0A 1UQTA 1E3JA 3MFYA 4YPVA 4YY3B 5AVJA 1Q22A 1BMFA 1ZD3A 3CYFA 2GEKA 4IZ6A 5T3UA 1OA1A 3EGXB 5J23A 1G7SA 1KSFX 3PJEA 1ZINA 2CDCA 4YUWA 2YWGA 5EHNA 2BIFA 1Z2EA 3F71A 5F76A 5KWEA 1E4EB 1TJ5A 1T5TA 2HDOA 1T1EA 1ZMBA 3HWWA 1FRZA 2YX1A 2Q7XA 4RZUA 4Y98A 5EJFA 1C14A 2H6EA 3A04A 1RI4A 3NX4A 5HMLA 3NI2A 1NXQA 3OKAA 4JT4A 4RJ2A 5A4JA 4QOIA 5JCJD 3EBLA 4FWTA 1JXMA 4BXOB 1N3YA 3KLOA 3VV3A 1RC1A 4PS1A 4RPJA 2ZWAA 1EFVA 2HADA 3A3OA 2JA1A 3H7AA 3EH1A 3T95A 3D6TB 4S1VA 2HO5A 4MA5A 3LVQE 3U4HA 5EJ4A 3EEOA 1Y6QA 3RSSA 4UD6A 1U02A 1U8TA 1X7WA 3A6HA 1P91A 1PUJA 3MJDA 1XMQB 3EOZA 3NC1C 3TSAA 3V7YA 2G40A 3Q41A 4W5WA 4YAWA 2O48X 2XVAA 3OUUA 1E59A 4HQ0A 2QNBA 4ZRMA 3FTPA 1Z88A 1GV0A 2E7ZA 2A59A 4KN8A 2JAOA 3F90A 1JMYA 4UAUA 1CIJA 1LTKA 1UM8A 2PMEA 4R6XA 2HIMA 4OV6B 4ZV7A 2O20A 3ZLBA 4NMLA 4QUHA 1T8RA 1WLSA 1ZRNA 5E3IA 1OU4A 3C4VA 2UZ3A 1XJWA 1A9YA 1BEZA 2LWIA 2AZTA 2HWKA 3ER9A 1US8A 3TI7A 4B84A 4JGIA 1JQEA 1JFFB 4MIKA 1H2BA 3RSFA 2VYNA 3KZKA 1T2AA 3KKKA 2AC2A 4DT1A 3AVVA 2FFQA 1JAIA 1MORA 1RMYA 1ADFA 1QNFA 2ZIUB 3GLVA 2VQ6A 1KVUA 4Y2YA 1U3TA 3SYKA 3KVVA 4J90A 1BX1A 3A25A 1CUIA 2GESA 2VDWA 2WJVA 2XNCA 2C94A 1B6SA 3G8AA 4AKHA 4J4BA 1IZ0A 2Z1NA 4LTDA 3WGYA 4COKA 3HRKA 2FZGA 5BVGB 3UOWA 3C7AA 4U7PB 1KDVA 3RIYA 1ZOIA 1PSWA 1HDEA 2RGUA 2JL1A 2Z5GA 2ZDQA 3DG9A 1E2EA 2BLLA 4YJHB 5EMHA 1G291 1B3RA 5C1DA 2ISSD 1P4AA 1A9ZA 2VTEA 1ISIA 3IV9A 3WGKA 4YRMA 2ANBA 2DBYA 5IMBA 4DAOA 5JJCA 2RHJA 3A9TA 4FB5A 4M36A 4KLRA 4DPLA 1KWGA 5C5CA 5C1PA 4U0JA 4IYJA 1NW5A 5CJPA 1WTAA 1EMDA 1XQVA 2AMVA 3LT4A 4LDRA 2AZXA 1BGWA 4CCYA 4HNQA 4WI1A 2PQMA 3EGWA 2WM9B 1LDMA 2FX3A 2QVXX 5IUNC 5KU1A 1AMOA 4BP3A 2VQ3A 3I9OA 2BI7A 2P8SA 4U2KA 3MTIA 1X7XA 2F7SA 3S2YA 1CZNA 1NVDA 2WSSD 2RGNA 3PFBA 1JFFA 1OX5A 1TEHA 3IESA 5LUAA 5FAXA 1SPXA 2BCGY 1VYUA 3AEQA 1P9RA 4N7BA 3HYNA 4UEQA 1PJRA 1JYEA 4WCDA 1M75A 1JDBC 4Q3KA 3IE0A 2OXEA 3N5KA 4N5IX 1CZRA 1R4ZA 3KAPA 2GCGA 3KVRA 1N92A 4WD3A 2IV2X 4TN1A 3WLIA 2F62A 1YJBA 4G36A 3TZQA 2FF7A 3OMLA 4EHIA 5KDLA 1PJTA 2VHWA 1RM4A 5FWDA 4UEOA 3WKAA 4MVJP 1WXGA 2F4VB 1T4CB 3QH4A 1R15A 3IP3A 1CSEE 1G20E 2LXNA 1JSRA 2X6RA 3DNMA 4QUAA 2WKRA 3M81A 1V25A 2G4LA 4BDSA 4P3PA 3W2HA 2OHXA 2YJTD 3EQ6A 3GPIA 3VM6A 3PGXA 4Z86A 2I8CA 4BYMA 4UOZA 3I23A 5FL7D 4BU1A 1XEAA 3GLTA 2OXRA 1PNVA 3AHCA 3IVCA 4CFYA 4KIFA 2P6UA 4MW7A 4ZXPA 4LJ8A 2Y76A 3I04A 2GM3A 5L4LA 5BP7A 4WINA 3W5DA 3FFWA 2CE7A 1VPDA 2VKTA 2WAAA 4MPTA 3TQCA 2QRPA 5CD9A 2R7KA 5KU7A 3AO0B 1JBEA 1E9CA 2HCFA 2A4KA 3N2KA 1GCOA 1N3LA 1QR2A 3I2GA 2PL3A 5JS8A 1XB2A 3HNOA 4WK4B 5CA0B 4EO9A 4OHPA 3NXSA 4H3SA 4LRSB 2MINA 4ND5A 3LUHA 2BP7A 3H0KA 2A58A 1N2OA 4WLFA 2TMDA 4M1TA 5H81A 2DSTA 5JTTA 3EIFA 3G8BA 1N1GA 4DLUA 2QIPA 5E7IA 2P0YA 3UANA 2ZBFA 4CQMA 5FNZA 1ZXXA 3R3XA 3UWMA 4HPJB 5FPHA 4C2BA 1ONOA 3GGDA 2GRAA 4ZT6A 2V5VA 3BDIA 4F5ZA 3OFKA 4XXHA 2VYVA 4RLFA 2O8FB 3BE8A 4LYAA 4RTKA 2TS1A 1YQDA 2VZ8A 3WQSB 4MDYA 3KD2A 4FOOA 1DWUA 5LA6B 2GASA 3ZUPA 3U19A 4NBWA 2OAGA 4AN1A 3SZ3A 4O4LB 4IAOA 4E33A 1B6GA 1JNXX 2OOKA 5C7LO 2AYXA 1L4GA 2HMYB 1ADGA 3AFMA 4QGAA 1UDAA 1BKSB 2F9FA 1ZJJA 2Q5JA 2ZRQA 3BWXA 3CZAA 3LNTA 3PSAA 4YP6A 3VZRA 5JC1A 1O6CA 3GBSA 3SEAA 2ZS8A 5LNK1 3ONVA 2YIVX 4L85A 1KFEB 1LK0A 3BFKA 2B25A 5CDYA 3BILA 2IUYA 3FYDA 2FPIB 3F97A 4DKJA 2Y9PB 4G85A 3TBKA 4DL9A 1T13A 5IKPA 1XJCA 2J4FA 2YMLA 5JE8A 1FQKA 5SY6A 3CEPB 4Z4FA 2AHOA 1TEZA 4CMEC 5IBRA 3UK2A 1JT2A 2AMJA 4A2CA 4BLUA 5BW8A 1YACA 3OBIA 1IDN1 2NUAB 1W4ZA 4J1SA 8LDHA 3MD0A 3AIKA 3FHOA 4WLUA 5D5QA 1EWQA 1NQUA 2P75A 2N47A 4TMXA 3TTUA 5KB3A 4DLKA 1JQDA 4G81A 3H17A 3NWPA 4CM4B 2HREA 4L2IA 1JTVA 2C61A 1J0DA 4FOSA 1QC5B 5T8KA 4DS3A 2IZ5A 2TYSB 1G7CA 2XNDD 1SOAA 2DT5A 2MSLA 4GECA 4TQGA 1A5TA 4YP7A 5CH5A 5C4MA 3PGLA 4BBPA 2COKA 1N3IA 4MUFA 1UBSB 3HWX1 2QX7A 4LOAA 2B1IA 4NQZA 1N2SA 2HDNB 2H2HA 2F1RA 1KY2A 1RRKA 1SH7A 2DJ5A 2XCLA 3AR2A 1E6WA 3B1WA 4O8CA 2ORVA 1SVIA 4HQOA 1VE6A 1KMQA 3AC0A 1OZAA 1GCIA 3IEUA 3LLCA 4FFMA 5HWSA 3RU7A 2OG2A 2YINC 3B6KA 3H99A 1QV6A 2NTYC 2NZ8A 3G9XA 2JGIA 3R7SA 3OU6A 1ZUNA 1ZH2A 2MJLA 3GRCA 3IXMA 4AKSA 3LNCA 1JVBA 4ROTA 3TLYA 3W5JA 3B6JA 4BRWA 1KH1A 8ABPA 2LP4Y 4O4JF 5BQFA 3U7RA 4DWWA 3BHJA 1BWSA 2HK9A 4S1TA 3PUZA 3JQ7B 4GOMD 4ND1A 1C8LA 2VIIA 3PNMA 4OB6A 4AY5A 4CI0B 2C2XA 1CEQA 4M8LA 4Q3LA 4JUCA 3WB0A 5DSTA 4BNVA 5BPHA 4WAUA 2AFIE 2D2VA 3AV3A 3I12A 2EBHX 3OJFA 4XX0B 4DCTA 4RQBA 2IW1A 3UKJA 2GZMA 4O0LA 5ECDA 5JNLA 4J4TA 4RHCA 3RHFA 2N1MA 3ELWA 2NSDA 3OPMA 1CBUA 1XEWY 5C8YB 4AYWA 3QPAA 3LJKA 5AI9A 1VTKA 2IPXA 2WF5A 1M2OB 3HGMA 1DRVA 3QU5A 5BUCA 4QM7A 4D5GA 2AEFA 2XB8A 3JXEA 4ZZ1A 2BFPA 5EKUA 2VR1A 3RS2A 3L8FA 4M8KA 3L01A 3VYWA 2RH9B 2YYYA 4PG8A 2VQEB 4NNJA 3LY7A 4KKVA 4YMTA 4N0QA 5DFAA 4CT4B 2IOFA 4OLHA 2Q6KA 3NOQA 4N82A 5BN5B 3R7DA 4BMSA 3LP6A 3K72B 2JGMA 3WISA 2G5PA 2J31A 3ZGYA 3ZXIA 4I1UA 1KNQA 4BO8A 4EO7A 2EW1A 4G1VA 5LB4A 3H5OA 1I94B 1EQ2A 1XL1A 3R7WA 1U81A 1GRVA 2YJ5A 4FGKA 1TM7E 2GN0A 3JWHA 1U3VA 4DLAA 1FRQA 5B4UA 2Q0XA 3FF1A 2EZ4A 4YONB 1NM5A 4TMZA 5G0VA 4K9OA 1IZ9A 4Z53A 1TFRA 3DDOA 6GPBA 1XAJA 1Z37A 2Y27A 4G1BA 3HS3A 2DF8A 3PX3A 4P0PB 3ADDA 9LDBA 2O8EB 4QHTA 2RKBA 3HHPA 3UJ8A 4DC9A 4QDKA 4PLVA 3R3YA 1MX9A 1PQPA 3ZR4B 1X7ZA 3GD7A 1VHJA 2E87A 3O1LA 4QUJA 4D98A 3A58B 5CFOA 1T0HB 5KNBH 1KRXA 4KDRA 1WCYA 4FGJA 5KQSA 1TL7C 1ZNZA 2D0OB 4NCJA 1U8ZA 4LXTA 1R4NA 3TEJA 5CXUA 2BELA 1MVNA 5K3EA 3BGDA 1I7DA 2FXIA 3P2OA 4M1MA 9ATCA 3OTHA 3B70A 3W3AH 4AWXA 1OH5A 2OGWA 4H0CA 5FADA 2VJMB 2IEBA 3NTOA 4D56A 1L9XA 2Z6QA 4ZAXA 1LBHA 4X0EA 3KS9A 2I7DA 3WICA 2AXEA 4GSLA 3WHLA 3PWTA 5L7WA 3QX8A 4OJMX 1C3XA 3LP8A 1S3IA 3GDHA 2GMWA 3SJCA 2D5CA 3MYYA 3E3NA 2QPTA 4J4HA 4F12A 3DXZA 5T7BA 1D2NA 4CBVA 1DJPA 1KR5A 2GD1O 4KN5A 1NYLA 3AEYA 3UYKA 4MS3A 4CFSA 3E1GA 1H3NA 3K0HA 3WK5A 2X40A 3G2IA 3WMXA 4G8DA 1JKIA 2VZLA 3D7SA 5E95A 4NY1A 1MQAA 4DEYA 3S3TA 2Z5VA 1Y48E 5IAEA 2XY4A 4CR6A 1OXKB 4UTNA 1Y6RA 3W6OA 1M33A 4TTAA 2GCPA 1QGUB 1U0SY 2IQIA 5AWFC 2JLXA 2W6NA 3ACDA 5KNDD 4TZ6A 2R65A 4XWKA 5K01A 1SCKA 1WABA 2UZ0A 4AYTA 2JBHA 4R1SA 2VSFA 2ZKIA 4WNAB 3LXUX 2V1XA 3AI2A 3VR5H 2OO7A 3RREA 1BWPA 4US2R 2BJWA 2OTCA 5JYBA 4UUAA 3IDAA 3H9JA 2Q4EA 3DCNA 4DABA 3D3WA 4JB3A 3NHAA 4KB5A 5AW1A 2OZEA 1NF9A 1SBCA 3ENWA 3GWGA 2X76A 5JS2A 1NQAO 4NXNB 3CH6A 3AJRA 3IGFA 1I4TD 4C4XA 4DLPA 4E3WA 1WQ4A 2XWQA 3ST7A 2YQZA 4MUKA 2D74A 1CKEA 1TU4A 3RYIA 2RGYA 1KEUA 2R6GA 3TLJA 4KEAA 1MJHA 1EXNA 2F1HA 2A5LA 3G17A 5HK8A 3DOUA 4X8OA 4ERNA 1A98A 4RS4A 3RS5A 2YC2C 3O8QB 1W5EA 1L4YA 2GM5A 4PX2A 1H6AA 2QRUA 2G8LA 4HWKA 2I4OA 4IJMA 2B34A 5A4MS 3KR2A 2F3UA 3H8WA 2LUOA 3SHWA 3RVMA 3KQPA 3BMCB 1MH9A 3QGMA 1QX4A 5EKSA 1GZUA 2ETXA 4ZKEA 1I2AA 3OEHA 4PZEA 3TX6A 3ZH9B 2RGXA 3ZZ0A 3LBAA 1C41A 1ZOSA 2NU8B 5AVSA 1ZIOA 2WFMA 5E6RA 3ZTYA 3BL6A 3ZHRA 5CBPB 5C8XA 3G82C 1DPGA 4U39A 1VYTA 4NCBA 3PCRB 2PG3A 3D4NA 1CEXA 2BR5A 4P81A 3EISA 4IH4A 4XWGA 1NDUA 2Z2IA 4JYPA 1EX9A 3V00A 1KS2A 1NDQA 1F5NA 2FFBA 5B3KA 3AFOA 2AOTA 3FWYA 2YUTA 3NOOA 3DB2A 4GSKA 5EJIA 3ZH2A 3WO0A 2EVWX 1XMVA 3I9LA 4DRZA 4EPTA 3JARA 4B7ZA 4AXBA 3ZGXA 2V0GA 3LK6A 2N46A 6REQB 4MW1A 1XYGA 4RTSA 4IVNA 3T15A 2E4AA 1ATIA 3SYLA 3LT1A 1I30A 1ACJA 2LVBA 3VVMA 3FOWA 3HFRA 4CG0A 1GTZA 5HF8A 4NU0A 3FCEA 3KZMA 1MX5A 3O1JC 3LLVA 3S29A 1XTZA 2W42A 3H3XA 2IZ1A 4MQFB 2FZWA 4N47A 4L5IA 4LF7B 3IMEA 3O38A 1I3LA 4GXQA 1XE3A 1OX4B 2HIGA 3UNXA 4CG2A 4DV6B 3LVRE 3A6JA 4E07A 2CL6X 3FDZB 3L6OO 2IBSA 1YZ3A 1NC3A 1AG9A 3KT6A 3LT0A 3E9RA 4C0BA 4M1SA 1HE2A 2ZI3A 2W6JD 3WZ2A 4MUGA 1E69A 4L1KA 5AXBA 1YQUA 2VFAA 4P93A 3BHMA 3HXQA 4R01A 4KNYA 2BHLA 3GIWA 3BMXA 4NZ9A 1E5LA 2HPZA 5DI3B 5BSEA 5JRZA 4Y9RA 1D2AA 4XGKA 3KEGA 1YDFA 3U3RA 2NP6A 4HX2A 3SLGA 2OCXA 5IN4A 2GSDA 3HJCA 4IZHA 1SKMA 4ACAA 1MXFA 3IV6A 4PWYA 3K0BA 3UMCA 3VO9A 2IOYA 2V9ZA 3N53A 2QR3A 4PXYA 5I4KA 4YRPA 1GTG1 1WMDA 1L5MA 3LU1A 2IE0A 2JKVA 1EFTA 1HNXB 4NAHA 3LOPA 3THSA 4O25A 1VL0A 2PAAA 4Q4AB 3VVCA 2ZBPA 4DIEA 4PIVA 4DMKA 2LIPA 2VJLA 4EHBA 4P3KA 4R83A 3IFSA 1SC6A 3PNYA 2WKQA 1DE0A 4G5QA 3RNOA 4XM0A 3M82A 1PJ4A 4RVDA 1P5RA 3EULA 3B8EA 4GM4A 4I9HA 3U9LA 3PFWO 5BRJA 4TQAA 4EW3A 4PN3A 1D04A 1X1AA 1MU0A 1ND5A 3VU9A 5KVAA 4R1PA 4A8JB 2PZBA 4II2A 4W1RA 5EIEA 3PD7A 4DIFA 3PICA 4MUYA 2YYSA 1QFYA 2DLCX 1RLTA 3V46A 3DZGA 3D4IA 2GA8A 2WSSA 4OFZA 1C0KA 2I62A 4H18A 1H8HD 4BFWA 4ND7A 2HPHA 2SBTA 3HCBA 2V0CA 1IONA 2PH3A 2QLMA 1CQIA 3LUAA 1N33B 2CLIB 3IUEA 4LK3A 4E4RA 5LP6B 1FE8A 1P0PA 5DTRA 4TMTA 3FTQA 4JOSA 4K6OA 2FPOA 2D2IA 3KVYA 3HCFA 1OUMA 4YACA 1I13A 3KKMA 4M83A 4WVLA 2VAMA 4GR5A 4LKOA 1SUAA 2H2DA 3LDGA 3WIOA 1GWNA 2VYND 3I2KA 3LX4A 3OLQA 4B31A 2FRDC 5F7XA 3NALA 3M6IA 3M83A 4N5NA 4PZYA 3O2SB 1Y1TA 4CF4A 2OZLB 5A3JA 1I7PA 3MN1A 2DUMA 3N87A 4MKFA 4N8SA 3C43A 3CW8X 4O4IB 4BHTA 2HLNA 4YCNA 2DWPA 2JJ2D 3CO0S 3GJSA 3P9PA 1NF2A 2D0PB 3OE5A 4PRZA 4TM8A 3PJDA 4BQIA 1IY1A 4R41A 4COOA 2QTMA 4BLQA 3HB4X 4UUPA 4YJGA 1ACMA 2WV9A 3GNQA 2EJUA 4U6NA 3CUUA 2X0IA 3D5QA 1P9NA 4TV9B 2QN2A 1A7AA 1P74A 1J07A 4UDYX 5C37A 1QLWA 3MWJA 3L6EA 1EWVA 1VIVA 1G16A 4JEMA 4MIYA 1X8KA 5D6NA 1P3Y1 1IQRA 1O5TA 3WNQA 1G6HA 2QK4A 1JUDA 4IGAA 1WP9A 5JD4A 2E5WA 3PHCA 1E9RA 1SKAA 3KBBA 3TB4A 3NGLA 4R9RA 2IPAB 1UXKA 4YCBA 4KXYA 1TQ6A 4KO3S 4DWJA 3EZLA 5EUCA 3HZHA 4HAZA 4Z9XA 1NR1A 5K9ZA 3NETA 5IXYA 4BXOA 2NO6A 5TQ0A 3GJ6A 4CLDA 2JIQA 3C1TA 1QH8A 5JNRA 3U5ZB 1XTTA 1MH1A 3AL3A 5AK6A 5HJ2A 1WXFA 2PUEA 1NMEA 3HA3A 3PDCA 2YZGA 4IDGA 3ZHBA 1Y3DE 4PRYA 3WRWA 4MR9A 4TLLB 4DQVA 3BQ9A 4DW8A 1YK0A 3V8MA 1CUHA 1Y34E 1ZVQA 2WB2A 1P4HA 1E2UA 3UW1A 4LJ4A 2PFKA 5FBVB 4QELA 1WW8A 1KJNA 4UE2A 1NZJA 4C30A 2OWDA 5KS2A 4RWEA 1DQRA 3QE2A 5LYYA 5DGIA 3H6GA 3BHIA 4UTZA 4ITVA 4ZVKA 2RSLA 4EHFA 4UREA 2G0TA 4ZZ0A 5JIBA 3I39X 3T1VA 4B83A 2GD2A 3LDAA 5AUNB 2FUCA 3CVXA 3WVNA 2B0CA 3UGKA 2AE1A 3D6JA 4EENA 1RJEA 4QUGA 4NBNA 2XIQA 1WOMA 1QG6A 3PZRA 3CNQS 3AKDA 4KGXA 2ECKA 1SKBA 4Z4HA 3Q8MA 4PFKA 3SF8B 2R4QA 1X7GA 2ID4A 5FWXB 1SA0A 2F9LA 1SKUA 5EIAA 3DMYA 4EJSA 1ILEA 1EFHA 1NN0A 4F9EA 4L0QA 4YRJA 4OQEA 1LQTA 3W2FA 4ECEA 4R5HA 2O52A 3EXIA 5F7ZA 1N2GA 5FO0A 4BGEA 2M2IA 3AEUA 4Y2HA 1JHAA 5ICGA 3F47A 1GPNA 2BC9A 4E13A 3HJNA 3L1HA 3KV3O 2CXTA 2P35A 3ZDXB 3AUKA 1J42A 1WMEA 3EEIA 4X6XA 3ABRB 1JS1X 1KSGA 3T7TA 4YAKA 5HQ3B 3H3JA 2B3DA 3HI6A 3KZOA 1YFJA 2Q9AA 4TMYA 1QYIA 2UUOA 2P3LA 4FYXA 4OGKA 4DIBA 1V35A 1O9BA 1AT1A 2QXYA 2LDBA 1QGED 1M1YE 3ROMA 4C7OB 1YZTA 2NYVA 2HMTA 2P9HA 1Q14A 2ZYGA 1F51E 3S1LA 2GZSA 4UUNA 1T4GA 5TGDA 2VTBB 1MDBA 4FBLA 1R3UA 3QXXA 1NVUQ 4DYHA 1JR2A 3T0GA 4MWGA 3BG5A 1NJ2A 3K15A 1T43A 5DHUA 2O5VA 2QTZA 1NVVQ 1R8QA 1WDLA 3JWJA 3S5UA 4LHSA 4S1PA 1MJNA 2LIVA 2BRUA 4JVSB 1H2XA 1RBYA 1UP7A 1I1QB 2UYGA 4OU5A 3T9DA 2W7TA 1LFDB 2B35A 3RBXA 4DPKA 3KHUA 3U4IA 4LUCA 4N18A 2R8BA 1R0CA 3VZPA 1WMBA 3DEHA 5EJ2A 2C7PA 1KYQA 4HWTA 3CH5A 1G5IA 1VE3A 3TXXA 1G3IA 4KYUA 8GPBA 2XTZA 4HT3B 1KKUA 5PGMA 4FMCF 3KJNA 3OHPA 4PWZA 4BMDA 3NJ4A 1HDCA 1WXDA 3PTZA 4EUSA 2UVPA 1BMFD 4FEAA 4UNPA 5KWJA 4DB2A 3CRZA 2ZCJA 2QJWA 1IY9A 2JW5A 1TE2A 4KC0A 5JZSA 2WVGA 4LF8B 2PQ2A 4JDUA 3KOUA 3PQ2A 4N8EA 4W1SA 3X2SA 2YC4C 2WMYA 1R66A 4H7EA 2A0KA 4HYEA 4IQ0A 4EYGA 2F3TA 1SHTX 1ZRSA 2ZQYA 2N1BA 3GN2A 2HMUA 3R7AA 2ZEJA 4EQZA 4LHEA 1QS0B 5DT2A 2JD2A 2YYAA 3PQ7A 3K16A 4P8RA 3G0HA 3QA3E 5FLXA 1MTZA 3LSYA 1N9ZA 1YCHA 1CCWA 1N5MA 3AXSA 4IMIB 4NJOA 5HQTA 4DNPA 4KR3A 3O21A 3IL2A 4GP7A 3ROEA 3WR5A 1GSAA 1YCFA 5BWCA 1H5QA 3BFXA 3QELA 4KN6A 4PSCA 3GJ3A 2OM2A 3QKIA 1EI9A 3C3KA 1QE0A 1L4LA 1X1TA 1XZNA 3IT3A 3JQRA 4P0QB 1C80A 1T5OA 4I5FA 5BV8A 1VXOA 3DMGA 4G5GA 2H1OA 1NN5A 2CXQA 2RARA 1A9SA 5LYJA 2B7CA 2QL9A 4XB2A 1GKIA 5JCPA 4HGYA 2EFCB 3DVRX 4AJ2A 1UJCA 5F64A 5IYZA 1OA0A 1TMGE 2C8LA 4XQEA 5THXA 1VBNA 5KYUB 4EITA 1YQWA 2JIOA 4KDCA 3NVDA 3T3OA 1ZR4A 1F6WA 1PBNA 3IAM6 4I4CA 4P7KA 3UMYA 2CLSA 5DMXA 1U0LA 4A7PA 3IBTA 3NTUA 1JLLA 3TLMA 5LD2C 1IBLB 1Y9JA 4PHFA 3HJHA 5BMOA 5AVWA 2O7NA 2HDWA 2VHUA 5ADUS 3VBEA 3VNVA 4HVAA 3TMYA 3VKHA 2C00A 4HNVA 4HCJA 3W3AD 1V7QA 1FVXA 1K8ZB 2O50A 2IDJA 1STOA 3E9MA 3MUFA 4N3GA 5G53C 2P4HX 3KSDO 3VTZA 3H9UA 5CCXA 5LZ2A 2VJBA 5TGZA 1PD1A 2P6MA 4E7PA 2RGNC 5BWOA 5KDDA 2GPBA 5HRAA 5JS1A 2XUAA 4WK2B 3ZY6A 1QZUA 1U2GC 1R0LA 4E4TA 3TVTA 4QSMA 5JYEA 3JCZA 4WLVA 1FY2A 2QD3A 4YR7A 1WZ2A 1QPBA 4FLEA 2VZEA 3A3NA 2BFFB 5JS7A 2G5CA 5M7EA 4E09A 2XZTA 5D5PA 1NF8A 1IBMB 3HKEA 2A4MA 1FP4A 2FKNA 4PV7A 2Z8ZA 1M2VB 3AR7A 3GD5A 5J2UB 4UBLA 1XXHB 2IYPA 2B4TO 3CLUC 3IVMA 4HLUA 4HGZA 2CY0A 4J7UA 4X3PA 3IEPA 3W4KA 4GGPA 3A4LA 2H9AA 3B1FA 3IO3A 4AQDA 1F2DA 2VKQA 1TO1E 4JENA 1I1OA 4K0RA 2IP1A 1Y5IA 4O33A 4BZXA 1OTHA 2CZGA 1TU0A 5FUWA 1JXOA 4RS3A 1MGPA 3H6KA 2EX4A 1PJLA 1Z0SA 2GARA 5TQJA 4BWGA 3EVEA 1KYVA 2PUHA 3DW3X 3RG8A 1RZVA 3TTTA 2YV2A 3DZHA 4M8SA 4GOJA 2OCDA 1EBFA 3KETA 3IKTA 3CINA 4ICIA 1EXDA 4H6XA 1YUNA 4KXFB 4UE6A 3WNDA 3IIEA 1MJGM 2ENWA 3ZCSA 1NBWB 1EB9A 5A9SA 5BR4A 2BEWA 3TLAA 1QIJA 4I55F 4B6JA 5EIBD 1JIVA 1ZN8A 4IGEA 2XH8A 2WFAA 1K7FB 3WG9A 2AS0A 1NPTO 2Z2ZA 3VU3A 1G9SA 1Z4MA 2G63A 3JRXA 4GC5A 2VNIA 5LLTA 1C8KA 4GI1A 2R2GA 5CDSA 1QRDA 1E2DA 2J32A 2B3TA 5D3KA 3RS9A 5A4FS 4MRAA 5CB4B 2D5BA 5AJTA 2OEPA 2HSDA 4B34A 4CETA 4QOHA 2NXNA 4E5UA 1H22A 2YOGA 4L5BA 4REQB 1KVRA 3RARA 2F90A 4GE0A 4HZUB 4V1CA 2OORC 2AN5A 4C9BA 3D5TA 5EJ5A 2PUVA 3AR6A 3UCXA 3NM6B 1ILWA 4TWJA 2J6HA 3QV1A 3T7IA 1IUOA 2UZ1A 4JHLA 4MVJD 2I7XA 2PJUA 5A6VA 2ZDHA 4F45A 4GW3A 2C7GA 1NNI1 1D2CA 4TV8F 2B4QA 3MF4A 3VHRA 1Y9DA 1A2KC 4DA9A 1MZVA 4CKCB 2EDCA 1L5ZA 1YR3A 2PRSA 2R4TA 3USZA 4MRSA 4BIMA 3DBVO 3P9SA 5JSHA 1GG2A 1SULA 1J9EA 2XVMA 1F2TA 4LDPA 3RLFA 4CMIB 5JISA 2E9SA 2Q28A 1XCMA 3B2NA 3F0TA 2ODAA 1YRYE 4Z0NA 1A27A 1TB4A 4BGUA 1WO8A 1L3IA 1JGTA 2H0QA 1EDOA 2IITA 1CFJA 4JQOA 4EZIA 4QM6A 1U5BB 3I6IA 5K99A 1IIBA 4X6LA 3Q3CA 2I3ZA 1IMJA 4Q47A 2PJRA 4HAOA 3HFJA 5C8YA 1IE3A 2B98A 4P6VF 5GVSA 2C5AA 2R7AA 2JFWA 2ZT8A 3KOXA 3FKSD 4YRDA 5EESA 2YW2A 3OU2A 2NIPA 4QDUA 4FNAA 3KZVA 3THOA 1NMZA 1PEDA 3OM8A 3C16C 4JI5B 2DM6A 4NK4A 1BE1A 3WRXA 3C8HA 3ETLA 4P3YA 2VPYA 5ENDA 1T2VA 1YS1X 3W9UA 3EXFA 1ULBA 3UC5A 3VOAA 2OMKA 1C3EA 4QDOA 4YO7A 3UC9A 1JQAA 1NX6A 1PDVA 4NPAA 5G3ZA 4JJZA 5IG2A 3C48A 4F3CA 1O9GA 3L0DA 4N03A 1WOYA 3DOIA 3EYAA 3HKDA 3KLNA 5BNTA 1HNZB 2F17A 5AQEA 2PZLA 3FDXA 2R8EA 4O3FA 4RSGA 5KMGB 1ZI8A 3A1CA 4QFCA 4U7DA 2Y6VA 1CUGA 3GGGA 1F4VA 3LGSA 1BVUA 3VR4D 3PIRA 2HQSA 2IJGX 4MPJA 4U2CA 4PAGA 1GZ5A 2YJ4A 2Q4RA 3GJ5A 4MRPA 2O2JA 2QAGC 3OT5A 1UMCA 4IO1A 2HA2A 4PTLA 4RZIA 4TKVA 3I9NA 1SCNE 1QV9A 2VJMA 5C4IA 2HV9A 3I73A 2PZMA 1TIPA 4BEWA 3PNPA 5ALKA 1G21A 5FQNA 1U1FA 3PNBA 1FP1D 1U5BA 4LJYA 5EIXA 1JPNA 4PW0A 4DWVA 3KVOA 2PZKA 4RWZA 4RZ2A 3NYWA 4YXWD 3LZ6A 3I2HA 2ZQZA 4OJTA 1K1EA 2ZUUA 5ALLA 4YALA 2E5LB 2P8JA 3VC7A 1DIBA 3OVMA 2GJAA 1U1DA 3BA1A 1FFCA 3ZDYB 4EMBA 3E18A 1M2HA 2FEWB 2YH2A 1V8ZA 5KCMA 5A5DA 1BXGA 4BX9A 3MTAA 3EQ7A 3TO5A 3SI7A 4B85A 2GK3A 3H5NA 5LFAA 5EVJA 1F12A 2P4UA 3N39C 2PCJA 1PG2A 1RCUA 1LH0A 2IUTA 3FXAA 6REQA 2YMMA 2O54A 2AV6A 2RK4A 1DB3A 1G4AE 4A8JC 4MYTA 3UICA 1WQ1R 2NXCA 1GV1A 1YQEA 3ZE2B 5M04A 3OZCA 1P7ZA 5JCZA 3FOCA 3GHYA 3N05A 3A32A 3UXHA 2C98A 1YE8A 4OQFA 1PW7A 3QKWA 2DTXA 4FINA 4C88A 2CYCA 4K0KB 2XUDA 2G9QA 3ZE6A 3KB2A 3R7FA 1DKNA 4D43A 4B3TB 3T5AA 4KR2A 2I67A 1CY7A 3PIDA 1P6QA 1XQ6A 3VTFA 3EHEA 3VC1A 2XZOA 3I76A 1RWKA 2V65A 3C70A 1JAXA 1T2UA 2OFFA 2PT7A 2YOFA 1OYVA 3UCEA 1NLFA 3FH0A 1REQA 5CVTA 1PS9A 1ETUA 4XGIA 4CKCA 3OQJA 4JLMA 1Z2OX 5AW4A 5JAMA 3GG9A 1G5TA 1JHOA 1WPQA 2OP0A 3GPBA 3GUVA 4WCFB 3WGOA 1JVSA 1TAHA 4MYCA 1D5WA 1PX0A 4AG3A 5FEUA 4ZU1X 1V43A 4DY4A 4MMZB 1NQ5A 2P5UA 1L7DA 1L6IA 1G2QA 3S1SA 3KQQA 5HFNA 5A62A 3M0EA 2EFJA 3QG1A 3MEQA 3AKYA 4J07A 5EJ8A 1DFHA 3DJYA 1RM0A 3AP1A 3HBJA 1WPGA 5DP2A 1WUKS 1OYWA 1PCXA 1EWRA 1M2EA 1Z83A 3K20A 2C5LA 3NTXA 1BHQ1 4TS9A 4CL3A 5KQMA 3ZOZA 1C0PA 3D0KA 3DKIA 3PCXA 1M74A 2YJ6A 1NYTA 2W2LA 4FQ8A 5JWRA 3X1MA 4ZT5A 2BZ0A 2GYUA 3T1YB 5LNK6 2ZE5A 4KDEA 3F7TA 3QYPA 4RADA 2YZNA 4G26A 3VPBA 3SHQA 1KKMA 1Z15A 1DV2A 5CNJA 5JCOA 4D02A 1NOJA 3FGOA 1THTA 2YJNA 4FBMA 1OFTA 3PNOA 4NHOA 3QEOA 4OQ4A 2IEDA 3B1KA 2X5OA 4QO7A 3A7DA 1OHHA 2Z5LA 4QJBA 1IUKA 3BF7A 1KAOA 2FOXA 1QCZA 5AKGA 2R6ZA 5HDQA 2VP9A 1NSTA 3JAKB 2RH8A 3REQB 2VL7A 4OK5A 3UJPA 2YWFA 1VKHA 3QX7A</