1Z5UA

Crystal structure of s. typhimurium apha complexed with cyclic-amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
208
Chain Sequence
TLNPGTNVAKLAEQAPVHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTKVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRILRAANSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of class-B bacterial non-specific acid phosphatase: functional role of invariant Lys154
rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
molecule keywords AphA protein
total genus 73
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z5uA00
5AICA 3B9BA 2YJ3A 5ALJA 3CZ4A 4UARA 5AKIA 5T41A 2BDUA 4CF4A 1QH9A 1Q91A 3MC1A 5ALWA 2FPWA 5IT0A 2PQ0A 4Y2JA 1RPZA 1LTQA 2C88A 2Q4TA 3KD3A 1RKQA 2R8ZA 1Z4NA 4UW9A 3ZX4A 4HGOA 1RDFA 2I33A 2ZBGA 2ODAA 3ESRA 3AR8A 3ZVNA 2JAOA 3U7HB 2YFYA 2YMQA 3ZVLA 3M1YA 3PDWA 3EF1A 4UASA 3HYCA 4Y2PA 5AKEA 2YY6A 2I34A 3QUBA 4PNHA 4AS3A 5ALRA 2HHLA 4BEWA 3L8HA 4Y2QA 2I6XA 3E8MA 3SKXA 2YMPA 4FE3A 2CFRA 2EARA 2C8LA 4QQFA 3ET5A 2B0CA 4CF5A 5ALEA 3QGMA 2HX1A 4UATA 3WK8A 5JJBA 2FPRA 4XE5A 3ZWDA 2FUCA 5ALMA 5AW6A 2W11A 1Z4KA 3RF6A 5AW7A 3A1EA 2WF7A 5AW0A 4FYPA 5ALHA 3KDPA 4BBJA 2WF8A 4Y2TA 3NIWA 2YJ4A 3ZVMA 5AM0A 5A3RA 1N9KA 3A1CA 3MN1A 4UMFA 5AM4A 4YGYA 1QYIA 3M9LA 3BWVA 2HO4A 4L6CA 2Q4RA 3PCTA 2B8JA 2YN4A 5AK6A 4AP9A 3R9KA 3NASA 5AKJA 5AK5A 5AM5A 4F71A 2P69A 2W4MA 3A1DA 1L7OA 3OPXA 4GXTA 2HSZA 1Y8AA 2RB5A 1Z4JA 1RQLA 3U7EB 4Y2UA 3AR5A 1L7NA 2Q5EA 5A3SA 2AGVA 4FFDA 3WGUA 3AR9A 3MMZA 3NAMA 5ALTA 1O08A 3WK4A 2YJ5A 2GFHA 1CR6A 3U19A 5ALUA 3CNHA 1WZCA 1KYTA 2HF7A 2I55A 3A3YA 3U26A 5AW4A 5IT4A 1AQ6A 5ALYA 1XPJA 1L8LA 1ZD2P 3EF0A 4IFTA 3AR7A 5AW1A 3EPRA 3IRUA 3FGOA 3VAYA 3SD7A 5AVYA 1EK2A 1ZJJA 2FDRA 1RRCA 5AKLA 3NRJA 5ALSA 4KN8A 4UU1A 3W5DA 2OM6A 4ZEVA 1PW5A 4OD0A 1Z5GA 4BYGA 5ALGA 4DW8A 1U2TA 1TJ3A 2HF2A 1IWOA 3QX7A 1Z4IA 4F72A 2RBKA 1Q92A 3B8EA 4BX2A 2WFAA 4JDPA 2IA5A 5AI4A 2G07A 1QQ5A 3DNPA 1J97A 1RLMA 1TE2A 1NNLA 2VKQA 3P96A 2C9MA 4NAVA 5AVSA 3WK6A 3AR4A 3QLEA 3ED5A 4IG4A 2OBBA 5E0OA 3WKAA 2C4NA 4BEVA 4HGPA 3K1ZA 5AIAA 2FPXA 5AW8A 4YIKA 4H1WA 2W43A 1FEZA 3ZI4A 3KC2A 3ZTWA 2B8EA 2ZBFA 4KNVA 1ZRMA 1L6RA 5ALKA 3L8EA 3OCVA 1T5SA 5AKGA 2O2XA 3L0YA 3R09A 3SKYA 2G09A 3OCUA 2IOHA 3OCXA 5AK4A 5AKXA 1YDFA 4Y2SA 5ALNA 3AR6A 2D2VA 5AVRA 2ZOSA 2AH5A 2GMWA 4XOUA 2BY4A 1N8NA 1NRWA 4KNWA 5AI5A 2AUTA 2WF5A 3OCZA 4YCMA 3UM9A 5ALLA 2IYEA 2R8YA 4G63A 3NALA 3E58A 1U7OA 4HYTA 4UU0A 5AVWA 5IS2A 3PGLA 5AI9A 3DAOA 3N8GA 4GIBA 4G9BA 3QU2A 5ALFA 5AI8A 2IOFK 1XVIA 5AVVA 3I28A 4UM7A 3ZX5A 1ZS9A 5AKHA 5AVZA 3QUTA 3W5AA 4EZEA 1SWWA 3L1UA 4KX3A 3L8GA 1Z4QA 3L0CA 3ET4A 2FPSA 2O9JA 2NYVA 2FEAA 2R8EA 3QU9A 1CQZA 4UAUA 3WK9A 1TA0A 3E81A 1L7MA 3QUQA 2FUEA 4YH1A 3ESQA 2B1RA 4HAIA 3QU5A 1VJ5A 5AW5A 1WPGA 3WGVA 2GHQA 5AVUA 1YJ5A 4UMVA 1YMQA 2FPUA 3L1VA 2NO4A 2OA0A 3FVVA 3QU7A 3N28A 1Z4PX 5ALDA 1EK1A 2QLTA 1RC8A 3WKEA 1F5SA 1VFPA 1L8OA 2C8KA 3AR2A 5AVXA 3WK7A 1WR8A 1ZD5A 3N07A 5ALZA 4XQ0A 1RKUA 3KOOA 3RFUA 2P11A 2ZG6A 3FZQA 5AI6A 4CF3A 1RKVA 3SLRA 2EAUA 4MUMA 3OCWA 5ALQA 1ZRNA 4XPZA 3TLMA 3ZW7A 4Y2VA 3BA6A 2DQSA 4HGQA 3SMVA 3ZU6A 1RMYA 3I6BA 2HCFA 2WM8A 3NUQA 3FPBA 5AM2A 3J7TA 4UMDA 1Z4LA 4BNDB 3I76A 2B1QA 4I9FA 4RETA 5AKZA 3UMGA 5ALPA 1TJ5A 2CFSA 2G0AA 3UMCA 2B82A 1WVIA 3OCYA 3QU4A 3N1UA 1SU4A 2G80A 1L7PA 2CN1A 2OYCA 4DCCA 3W5CA 4AS2A 2HI0A 5FP0A 4J2TA 3S6JA 1ZD4A 4KYTA 4C4RA 4JB3A 2YBDA 4BNDA 2PKEA 3R4CA 3L7YA 2G06A 2WF6A 4UAVA 5AM3A 4L57A 2BDEA 1JUDA 1QQ6A 1NF2A 5AKYA 3NANA 2PR7A 2YMMA 4NV0A 4KX5A 2JARA 4EX6A 1ZOLA 3KZXA 1RMTA 3E84A 3L0BA 1RQNA 3GYGA 5AESA 2ZBEA 3FPSA 2WHEA 5AK3A 1ZD3A 4L6AA 3SF0A 4BX3A 4DFDA 4I9GA 3U7FB 3HLTA 5AHXA 3ONNA 1RLOA 2YJ6A 2EATA 4RESA 4YCNA 2YMLA 2I7DA 3PGVA 4CE6A 2HDOA 1Z88A 2RAVA 2JGAA 1U02A 1XP5A 4HGRA 2X4DA 4HGNA 4NFLA 1YV9A 3QNMA 4UM5A 1MH9A 3I1YA 1QQ7A 5AW2A 3U7GA 4Y3UA 5ALOA 1O03A 4ZEWA 1Z4MA 1J8DA 4YIHA 4C4SA 3ZWKA 3EWIA 1RMQA 5ALXA 4Y2XA 4O8CA 3B9RA 2JAUA 4EENA 2MU1A 2CFTA 2GHTA 2I54A 2HEGA 1S8OA 5AW3A 4YCLA 3QUCA 4MWOA 4B6JA 3IJ5A 2G08A 1RLTA 5AM1A 4NWIA 4OFZA 5AVTA 3ZUPA 2P27A 4EELA 3FM9A 4OCZA 4UMEA 3W5BA 3DDHA 1X42A 5AI0A 2WF9A 3WKDA 2RARA 2ZBDA 3WK5A 1SWVA 2QYHA 4Y2YA 5AW9A 2AMYA 3WKBA 2NO5A 3L5KA 4C4TA 1U2SA 2FI1A 1YS9A 2IOFA 2HOQA 5ALVA 4J03A 1T9ZA 1TJ4A 4BKMA 5AKKA 3WKCA 3UMBA 2GO7A 3AR3A 5ALIA 4CNQA 3F9RA 1K1EA 2G1AA 4E88A 2R8XA 3DV9A 1S2OA 1Z5UA 3N5KA 4ZEXA 4OHFA 3D6JA 1LVHA 3IB6A 4EEKA 1YNSA 3SHQA 1U7PA 4DWOA 3ZTYA 3U13A 3OTQA 4EX7A 3QXGA 2MSNA 3QYPA 2ZXEA 4BX0A 2P9JA 2B30A 4NABA 1VJRA 1T5TA 1Z4OA 4Y2RA 3MPOA 3L8FA 5AIBA 5AVQA 2JAWA 5A3QA 3KBBA 4QJBA
chains in the Genus database with same CATH superfamily
5AR1A 4MW0A 1Q7EA 1EA7A 1GTRA 5ANRB 1BWQA 4AT1A 5A5FA 1EK5A 3LTEA 1IXYA 4XVUA 4RMNA 1I10A 4EGJA 1A8QA 1AKNA 4Z4EA 4BB0A 3ZDYB 4DDVA 1X7ZA 4TS9A 5IT0A 3U7QA 2CHGA 3D8TA 3R3HA 5IT9A 1N2HA 1YDWA 1TFUA 2VYND 1TKAA 1E59A 1NNUA 2CKDA 2M6RA 1ZUD1 2XUJA 4UZSA 3O4RA 4BNNA 4JI2B 2ZBGA 5A7GA 1U80A 5CDSA 5CCBA 3ZVNA 4TYWA 2GCPA 2QUZA 1D6MA 2J31A 5K3SA 3LXRA 1SZCA 3KYCA 3U3ZA 4CBVA 1J0XO 1KFJB 4XKJA 3ZVLA 1N9GA 2GN4A 3UPTA 4IV5A 3IQHX 4E31A 2E89A 1I5EA 4LYHA 3ZV3A 1N92A 2C1XA 4PNHA 5HFJA 4AN1A 3N3AC 2P5TB 2DPGA 1AKYA 4B3MB 3V6MA 3UANA 2XMDA 3EAQA 3ILXA 4H2DA 4MLDA 4KSCA 3EGEA 3SKXA 3WNCA 5CH5A 1I1HA 1WEHA 2IHZA 1PJRA 4J94A 3VSEA 4JC0A 1Y0BA 1I4WA 2O05A 3G2MA 4LJRA 1ORRA 2QBYB 1OGYA 4C6TA 1Q1ZA 1FL9A 4BVEA 4NBTA 2HX1A 4I6JA 3SHVA 3PP8A 1MVOA 3ORHA 5FR2A 3RSLA 4YN3A 4F2PA 5J47A 5KJ1A 1C0KA 5HGJA 3UHOA 4CU2A 3T34A 4RS3A 2FR8A 4PWZA 3LDUA 4C7OB 2BZ0A 3EJ6A 5I47A 4NFYA 1SBNE 1HG1A 1L7VC 1SU7A 3HCWA 4BKQA 1VLZA 1ZEMA 2G36A 1X8JA 4AZVA 4BRSA 2Q4BA 5IKPA 5B53A 5GM1A 5J2TF 3WY9A 1UZLA 2EC5A 4ZT2A 5A0VA 1ETUA 4MOWA 5KTSA 1K4YA 2AFRA 3PICA 4NZOA 4MLZA 4N54A 1BXZA 5SZKB 3KPUA 4TRJA 3PXDA 3EFHA 1HTTA 1UJMA 3BFJA 3I01A 3LFTA 4I2VA 4YAEA 2B20A 3C24A 3EMKA 3A1CA 4LJYA 4PPYA 3R7NA 1L6IA 4D9GA 4A2CA 1SHUX 4JNKA 4OL0A 4CTJA 5D01A 1DX4A 3S81A 1E1DA 4G5GA 4ZOAA 5AK6A 1NW8A 4JBHA 2OLJA 5JOQA 2G1PA 4JQZA 1GZVA 3P9IA 1D2GA 1M1YB 4BLQA 4LPKA 1QYWA 4B87A 5GZ3A 1PWZA 1N25A 3UAYA 1O0SA 4DE5A 4P4LA 1UJ4A 4C03A 1NOJA 1FRZA 2W2LA 4AJPA 3BFPA 1X2BA 4A7PA 1FFCA 2PRJA 2BEJA 1LF5A 3R4VA 4DKXA 3G2NA 2JLZA 4Y2UA 4XLZA 2AGVA 4ZO9A 1FPMA 4Q4CA 1JECA 1GZ7A 5JO9A 1V0JA 4PG7A 3P0IA 1WZCA 4L15A 1QH8A 3UWOA 3BX1A 3U26A 3GDHA 5GMOA 3T9CA 2CXNA 3H8WA 4GI2A 2H1WA 3G0DA 1KZ7B 2QLJA 1AHHA 1YB2A 2ZWPA 4C1BA 2HLNA 1IJKA 1X94A 2W00A 3PUHA 4KQKA 2I1LA 3W79A 1CZNA 4QLBA 1OASA 4OPMA 1C41A 3KVRA 4RCVA 1ZUWA 1AIPA 1A5AB 4RQTA 5FBKA 1LW7A 2I0FA 1EWKA 4JIGA 3PD0A 4EYQA 1E4VA 1WD5A 3QXHA 4H3SA 3K1TA 2UVQA 1RRCA 4CMBA 3NBUA 2WJAA 4H18A 1MW8X 1C1DA 1LK5A 4DMFA 4EDHA 1QC5B 1CTQA 3B3AA 3TF5A 4NBVA 5KTTA 4D81A 4LDRA 3PL1A 4X00A 1N2GA 5JD5A 1P77A 1NOIA 1XAGA 2YCLA 1GKYA 1A50B 1W35A 2ZP1A 3KR2A 2XGOA 3E7DA 3A6EA 4H7HA 2I6UA 3SICE 2XGJA 5EUMA 2R84A 1MX5A 1XMSA 3V2HA 1KYZA 2WBLC 4KGZA 5I9SA 1E2LA 2ZBRA 2X4LA 1A2QA 4EGSA 5BMVA 1KIAA 5I9LA 1KJWA 2CLCX 1QO0D 3T1HB 1MOSA 2OB1A 2H17A 2Q6OA 3LP5A 4UBKA 3CJRA 2ASVA 5I6DA 1I6LA 1GAWA 4E5KA 3UJ8A 4M54A 5AI4A 2G07A 3T5PA 4EFMA 3RBXA 1MD9A 2SCUA 1PQ4A 2FLVA 1V5IA 3A04A 1D1TA 1P7YA 4C4YA 1SOAA 5FJIA 3VTZA 3UT0A 3L0IB 3AR4A 3JY6A 1G64A 2B61A 3A0RB 3QLJA 3QUSA 3WA6A 4BVAA 3EX7C 1HH4A 2OFWA 3T52A 2JVIA 1GHTA 1E1YA 2V3CC 1JEJA 1F8UA 3TOVA 5JSZA 1L7QA 3MG9A 4MI9A 1DLJA 4GOND 4UXHA 4YRLA 1V9LA 1E4EB 3PD1A 1YQUA 1M9NA 4P3KA 4ZQFA 1U0SY 2IYUA 2Y1FA 2H9YA 3O8OB 2B1JA 2H1SA 5FOTA 1D2EA 4MDEA 5DLPA 2P41A 3VNUA 3ROEA 2WFLA 3G0IA 4RE5A 4INZA 4BNHA 5HUJA 1SXJC 1KYWA 2FNAA 3NM6B 4F21A 3PQFA 5TPWA 1P81A 3KUCA 3QVSA 1J2UA 3EDRA 2OB2A 1O97C 2RCNA 2X3YA 4D8YA 1Q74A 3BB4A 4HNUA 2BE9A 4KXYA 1BE8A 2EZ9A 5T64A 3GQBB 5F2OA 2QGNA 4Q39A 2WJWA 4P3XA 2XWJI 4URWR 2BWJA 2FB9A 4WNCA 1W5FA 4PAQA 3BHJA 4XOUA 3ZZ1A 3RIXA 1X7ZB 1HORA 1M3SA 3PUJA 1E99A 1WMBA 5ALLA 3VDMA 1USKA 4O2AA 2BTQA 4R2KA 2BN4A 3PNBA 3SR3A 2UUAB 5JCOA 3K8YA 4E1BA 3U6KA 5DT9A 3WHPA 4V1CB 1Q83A 1EWYA 4LK2A 1YUBA 3V7YA 3VR6A 2QD2A 1JN0A 3GLFB 3VR4D 4LY0A 3IHKA 4CR6A 3B9QA 4IH1A 5ALFA 5C52B 2GPWA 3A7EA 3TZ6A 3C6ZA 1J9EA 2VYQA 3Q2IA 5AVVA 3H05A 5PNTA 3R5HA 2BKVA 2GI4A 1SIOA 2VPQA 4WNYA 5AKHA 1KI2A 3OFKA 1XLTC 3R9IA 1TT5B 4FZRA 2VJOA 4KR3A 3SEAA 4G0VA 2A94A 3OIUA 4CYMA 5C80A 2Q5IA 2P4SA 3S44A 3MF4A 4IMPA 2Q3LA 4HDSB 1MRZA 2FEAA 2AVDA 1ZH4A 5CYPA 1KYYA 4GRAA 4YYZA 4WZ6A 2YHSA 5EWJB 3TL3A 5GV7A 4LJ4A 3QEMA 3R5JA 4XB2A 3U4DA 3TRDA 3TUZC 2OVFA 3KT6A 3IHWA 1U5AA 3OOWA 2O2HA 4I4TB 1FU8A 3V7FA 3FVRA 4Z4FA 3RASA 1AKUA 4MTCA 1Z3CA 3NI2A 1YMQA 4HSGA 3DEAA 4TV9A 1FX0A 2DGDA 3GHYA 4NENA 5CVEA 4NATA 2QI9C 5D87A 4WKCA 2PTGA 2Q2OA 1NSYA 2VJNA 1EUDA 2UV8A 4Q66C 5C8YA 3ETHA 4ENQA 1SH7A 3EVDA 1AZLA 4LZNA 1EVKA 2QLTA 3A0UA 3IQEA 2J0VA 5HTOA 3I37X 4B3IA 3DCYA 4JLNA 3JWPA 4BAUA 5JFTA 4CPDA 1U2DA 2JK0A 1Y3CE 1Z06A 4C0QC 1QIFA 2CK3D 4QTZA 1QKJA 1ZN2A 2QX4A 3CZQA 4GXNA 1SY7A 4HCJA 2X13A 4RL6A 1JDNA 1Z47A 4BNLA 1E62A 2PJDA 3DE3X 4QUEA 5BN3A 2HA5A 4QU9A 1PJ2A 1VBMA 4B80A 1PJTA 2QT9A 4R31A 4HBGA 3ROQA 4UM9D 1RKVA 1XDUA 5EWLA 4ZARA 3OE4A 1D9ZA 2R751 2ADMA 2ZUSA 2EAUA 4UVDA 3RS8A 3FBTA 2VT7A 3ITKA 4EGCB 4EHHA 3MINA 5LQCA 1UBJS 1N1MA 2PZLA 3CW8X 4F4CA 3NHZA 1YJCA 3IMEA 1H6CA 5F7ZA 4BZZA 3VR5A 3V1LA 5KOHB 3O84A 5AM2A 5ED4A 1RXSA 2Y1EA 3Q0EA 4ZOQI 1FTGA 5TT0A 1M2HA 3JVVA 4WXYB 1CT9A 1GPAA 2YHIB 5H3HA 3MM4A 4IICA 2A9FA 1YB6A 2A5JA 1I51A 4ALIA 3NGXA 1Q3TA 1O6ZA 2DFKB 2FFQA 5CB4B 2A0FA 4IZHA 2QRVB 5T4BA 2WYVA 1J49A 4TLBA 1BAPA 5EMLA 4YUYA 1SUEA 3A6JA 3DLHA 1WVIA 1TVEA 1H5NA 4NPHA 3Q1KA 3B3JA 3D4NA 1TNDA 5LA6B 1SHTX 1UAGA 2CUKA 4HWRA 2ZYVX 4M6WA 2R1VB 3G0BA 1Z0FA 3WL8A 1LSJA 3BQNB 2CYBA 3K0FA 5SY9A 3ZHOA 2W6CX 1CZRA 3EQ8A 4FX5A 1HURA 4QG7A 2AZMA 4B4DA 4C4RA 5L4SA 5KYVA 1CQPA 3NV7A 4OUKX 3F8TA 3Q6NA 3QMMA 2QX9A 3ROZA 2E87A 4DXDA 5LMNB 3WQQA 4CF6A 4IOMA 5CRIA 1VG0B 1Y4SA 2HHCA 3Q9LA 4R2JA 3NATA 3I0MA 2PUGA 2ZBUA 1GL9B 5GJVC 1QQ6A 2X5XA 1QHSA 1XL0A 2BZGA 5DCWA 3AC0A 4CM4A 2AEMA 4I66A 4OHUA 3MAGA 4FQ7A 4G1BA 1H1LA 4YMGA 5TQVA 1O97D 3D8BA 4QTTB 2BMAA 2V55B 3IKVA 3PXAA 5FWXA 5G4LA 1R50A 2QDKA 3TS1A 4O2LA 1GSAA 4KQGA 5DW0A 3QOXA 5LJIA 2ERYA 3F1LA 5F3DA 4YP9A 5REQB 1N32B 1GRQA 4NESA 1LLCA 4OX9Y 3MTDA 1K4MA 1LQUA 5GM2A 3DGFC 2NZYA 1CUCA 1RLOA 2YIVX 4EW2A 4MW9A 3FPCA 4F0JA 1FP7A 1OWPA 1KE2A 2V6FA 4MV3A 1P2UA 2BL4A 1MO2A 4TN1A 3VOSA 2ZIXA 3DTVA 3BA1A 4A23A 1GCAA 3HZRA 2CVHA 3TLGB 4HGRA 4I5FA 4YC7A 1NVFA 1YV9A 1VLLA 3ETGA 3OOSA 1HYHA 1DU4A 1F4LA 1KMHB 1T0IA 3V8NA 1G8PA 3QWIA 2OENG 4M1TA 5JSUA 2CXSA 4JJFA 3T12A 1XVVA 4IX1A 3UT5B 2I2FA 2WUEA 1I6MA 4Q18A 3IE1A 2Z8YM 3TM4A 3VR0A 5CIQA 1B41A 2ORED 3EQ2A 3KUUA 4K9NA 3RS4A 3Q85A 3ZKWB 1U04A 2JF0A 3EQ6A 1W0KA 5D8DA 4C0XA 2QVCA 2PFKA 2A5FA 2ZIUB 3LDGA 4OHCA 4OHXA 3F73A 2HHAA 3EXG1 2GAIA 2C3UA 2P6MA 1G20B 1V1MA 4FR2A 4GW3A 4OU5A 4HTAA 4ZVLA 1G4HA 2CFTA 1E3MA 2IW3A 5DM70 4WK6A 2NXWA 4RJ2A 3ZE6A 1CJVC 3ONWA 4PQEA 4RJLA 3WNZA 5B3LA 2IH2A 1MC4A 4ND5A 3OQBA 3KS9A 3ZWNA 1UAAA 1P0QA 3KL4A 4K9PA 1VCHA 4YK7A 5TJHA 5AM1A 4CQLA 3EEIA 3SWWA 3LPCA 2Z1MA 2Q1XA 3KFVA 4RSRA 2P27A 1HC7A 3PUZA 4EELA 3BGWA 2VJMB 1SUBA 3BE5A 3W04A 1TC1A 3ZZTA 2WSLA 5DO9A 3ZV4A 1T4BA 1L9KA 3U7QB 1P8AA 1WP4A 2DWPA 2ORIA 2QF7A 3WXMA 3PDUA 3O1IC 4IGKA 4IDNA 2JIRA 3IS3A 3GA7A 5G2OA 1W5BA 1ZNZA 4M7OA 4LZZA 2OBMA 3HJTA 3I61A 1YS6A 1ZUHA 3QXSA 4K6FA 1QFJA 5BMVF 3PUIA 1G4UR 3GT4A 1PR3A 4ZJYA 3HY3A 4QICA 3IEXA 2Z3WA 3AB8A 3V32A 3G8YA 1II0A 3BIFA 1TI7A 1IMOA 5CFZA 4CTNA 3WO1A 1H4QA 4YBZA 1YB4A 1KI6B 4KAFA 1TM3E 3EFEA 5CA0B 3VJMA 4MKRA 2AC7A 3A6DA 4KQMA 2P5SA 1J0DA 1CR1A 1SOMA 1AHIA 3OMLA 5EZQA 4FI3F 2E7ZA 1BGWA 4I9HA 1EUYA 1K0FA 4Q1VA 1K1EA 3HXPA 3TN7A 2OP0A 2XRFA 2M6SA 1GD1O 2OXCA 3F9IA 2VUUA 2QLFA 1KI4A 1NNSA 4UFOA 3W05A 4EGAA 3OQNA 1C9EA 3UJ7A 1KKMA 1KDPA 3Q88A 4JSYA 2O1SA 1SXGA 1EXDA 2QIOA 2IDKA 3D6JA 2CMHA 4HNHA 4RQUA 4DBVO 3QE9Y 2ZJ6A 3RT9A 1EWRA 1YNSA 3I5UA 2QZ4A 2DFTA 1F0PA 1WTAA 2VWPA 1DAEA 3BSWA 1PVDA 3FMFA 1NJ2A 1IQRA 4H1HA 1I3OA 4X20B 3RFFA 4EX7A 1YVUA 2ZXEA 3GB9A 5JTTA 1VGQA 4NABA 2REQA 2EQBA 2H06A 3AKCA 1P1FA 1S4QA 4R3UC 4UTRA 1JTVA 4MS4A 1TCUA 3VPAA 2J3EA 2XYHA 3A2LA 5GONF 3L8FA 1WU8A 3NWEA 3V4VB 5AIBA 4YRJA 1K63A 2AOTA 2MMCA 1F5NA 1PS8A 2NUAA 4CTOA 4ND4A 1N7IA 2IEAA 2PFSA 1BKYA 1COWD 3MJTA 3M6IA 4WJKB 1I32A 4KITB 3FPHA 3M83A 1AN0A 5ALJA 4GR5A 2D4HA 1W49A 3SEQA 3CKKA 2JA1A 4JVLA 4HLUA 5CGQB 1GQ2A 2R6JA 3JALB 1RFLA 4FUTA 4NL4H 2PM8A 4U3JA 4XEHA 1U5BB 1MQSA 1Z12A 1W48A 1Y7LA 2DWUA 2PT7A 2Q0XA 2QUHA 3HCAA 3OT1A 4B2IA 5B2FA 5C4MA 4CEHA 2I4RA 1UXKA 3JYHA 3ZX4A 5J2UB 3HC7A 1P91A 3P26A 4M55A 4UE6A 2HBRA 1S2MA 2ZK7A 5JZMA 3KSZO 5TY0A 3A28A 2PO5A 1RQGA 3L07A 4MCIA 3MS7A 2JFPA 3HJFA 5FTMA 4YYEA 5B6PA 5K3EA 3F4LA 5AKEA 4Y2PA 5HZGA 5LDDC 3UWMA 4N9QA 2FZWA 5GONB 5LZ9A 2B5VA 4EFLA 4G1UC 2I34A 3ZGXA 4F86A 1P0MA 4XWYA 5EL0A 1AU9A 2HFJA 1KBOA 2QG6A 2WJIA 4UOEA 1X74A 3E48A 5G0VA 4IMJB 1WCXA 3DMDA 4GE0A 1ESCA 1KH2A 2BELA 2C3PA 1I24A 3HFJA 3JAKA 3AONB 1G42A 3RIEA 5JJCA 4E15A 4MWZA 2G7ZA 1J9ZA 1KWKA 4LJLA 3KTDA 2QN1A 3WKCA 4ZYVA 5LP6F 2FPIA 4Q3OA 1GGNA 3TG2A 1QHHA 3CN9A 1IHDA 4NOJA 2BI4A 4PO8A 3USZA 1QHEA 2JLCA 5BN1A 4P0PB 2EBWA 2ARKA 3K0KA 4MEJA 1L5WA 4YP7A 3TQTA 1BCRB 2ID8A 3PC7A 1MRNA 4XSGA 2HMYB 4D6XA 3L1JA 2PCJA 1JU3A 2IZ7A 1A9PA 4PYMA 1T3TA 4RX1A 4GR9A 2YV2A 4M0FA 5JD4A 1A8PA 3B8HA 2R0QC 3HXOA 4Q19A 3M4XA 3D64A 4IJVA 4B75A 2RJNA 4PR3A 1TUBA 3TMYA 5KOJB 1Y34E 3DUWA 5FPHA 2PH1A 3MUNA 3KQOA 1T2DA 3R0XA 4NYMR 1G9TA 3MUFA 1B15A 1RWNA 2LDBA 4Y2TA 5LMCA 5FB3A 2P3OA 5BP7A 2X2OA 3ZVMA 3LZDA 3MMSA 2EDAA 4C5BA 5A3RA 3IAFA 3R9WA 2CNWD 1DJOA 1Q7CA 2WE7A 4QULA 2X0JA 5JWHA 2GFIA 2D13A 3NBFA 4AP9A 3F5SA 1S7CA 3H19A 5ITWA 4Z86A 2PS3A 2WJ6A 5AKJA 3K09A 2BM0A 3B60A 3ZCUA 1WZ2A 4B71A 1SKQA 4AM8A 3FCAA 2Z6AA 5HS6A 1PKXA 5ICCA 3H7AA 5K45A 2G04A 5FL3A 1A8IA 2QLMA 3OPQA 1XN1A 3N0VA 1RZRD 1ZONA 1N7GA 3OHPA 4JQCA 2Z5LA 4RVUA 3QOWA 1BDMA 2K7FA 3E2MA 1QGED 3B12A 1A5SB 4LRTB 2DG2A 2Q5EA 4MPDA 4ZYWA 2KBFA 3MMZA 3DGEC 1XA0A 1O08A 3LQKA 1FTYA 1DDGA 1G63A 3L6CA 2D2EA 1S8FA 1THZA 2GPNA 2O7QA 4B31A 3ZLVA 2ECPA 2K4MA 4Q0MA 1PUIA 5DHUA 4ZYYA 2PY6A 3H1BA 2G17A 1FVFA 5DV9A 3ITDA 5AUOB 1CHNA 3GUZA 1TK9A 1N0IA 3DFMA 4KH1A 1N2OA 2BGUA 5LOVA 1MX9A 5IKXA 4AI6A 2HA2A 4S1TA 1E20A 2DFVA 2XCIA 1T43A 16PKA 2GAOA 3GXOA 2FKNA 3SXJA 5I3ZA 1DBRA 1UUFA 1CDEA 1FZQA 3HB0A 2VPZA 4EHLA 2GYWA 4ESEA 5AJZA 1DEXA 3Q40A 2ZB8A 1LLDA 2VZ8A 5L3SB 1N7JA 1NI3A 2QZZA 2UAGA 2GB4A 3RIGA 1GGJA 4DM3A 2ECOA 1N2CA 1XXHE 3TLGA 4Q7LA 2JJ1D 2OM6A 1ZOOA 5EUBA 2TRSB 5IHPA 2F17A 3HVHA 4G09A 2HHJA 1CULC 4KIUA 4Q9NA 1RP1A 2OG2A 1JDSA 3BM5A 3IIIA 4WEOA 3TGPA 4AMZA 4X6XA 4Q4HA 2GPYA 3VSCA 2QAGC 4EJSB 2UZIR 1YE3A 2VXOA 1Z4IA 3OC6A 1PWYE 3QTLA 3N7AA 4BVKA 1RADA 4K8RB 3JAMA 3ZHVA 3LLVA 1SOUA 2OZPA 4YXFA 4Q3DA 3NTOA 4GT1A 1GU1A 3P45A 2DHRA 4WMLA 4M8IA 5F1OA 3OUTA 3FOAA 1T9DA 2G67A 4UDXX 1TE2A 3MGGA 4XX0B 1PR0A 1VKRA 1FLDA 1WKCA 1C3VA 1BGVA 4F97A 5BW4A 1T8YA 1DTWA 3I04M 3X1YA 2P4EA 3QW2A 3RS3A 3BERA 3AWDA 1PJZA 3QITA 2P0YA 3R7WB 2JEYA 3T7EA 1QTQA 2X1HA 5CD1A 4KFSA 4K9OA 3N2ZB 1U2PA 2C4KA 1Z75A 3BILA 3X3HA 1RRGA 1FB5A 3HXLA 5A03A 1TK3A 3LVRE 4RF2A 4URHA 1IVYA 1K5GA 2QENA 2PBZA 2F1IA 2VCYA 3H5AA 4NONA 3HGMA 4OHVA 5F21A 3VTFA 2X22A 1J2JA 3UENA 1TC2A 4EHJA 5HQ3A 1OIWA 1XZ8A 4EIWA 2AN9A 2ZRMA 1VB5A 3KLBA 1EFRA 1M2FA 1ZK2A 4Y0VA 4AD8A 1D8TA 3P9PA 4C08A 1W9MA 3SSOA 3GFPA 3A25A 1GTZA 2NU6A 3LXUX 4CQMA 5KDLA 1SVKA 4WFIA 2IYTA 1GAJA 3FROA 1HM5A 1NW6A 3LWDA 4II3A 4NOLA 1U28A 1XEWY 2R8YA 4MS3B 4HFNA 3KT3A 3RK0A 4M0LA 2WG1A 3HL0A 1SUSA 2JD1A 2OOSA 3E58A 2V5AA 4YONB 1Y9JA 3E3OA 1RI1A 2H1CA 2FWAA 1OKKD 3USCS 2QYSA 2VBFA 4G4SO 3TPCA 5BWBA 1G18A 2RGXA 4TQUS 5D3MA 13PKA 221PA 4G9BA 4ZCPA 1X15A 2C31A 5DISB 3O92A 3CGGA 2YWHA 3OIDA 1E8MA 4AF7A 5FFMA 1HE2A 2I6QA 1NMEA 3IUSA 3LWNA 4QHTA 5B1IA 1FSPA 2XUPA 1PVOA 4D97A 5JRJA 3KLMX 2OEPA 2P7HA 4LDAA 4D8TA 1RKXA 3VPXA 5L3VA 1NBMA 5C7IO 4EZEA 2YXBA 1SWWA 3D4BA 5L4NA 3LUCA 3OF3A 5GY7A 2OCKA 5L3QB 1JQDA 3L8GA 4HMQA 2P90A 4UJ3A 1XCPA 2W2QA 4R7GA 3TM5A 4CL2A 1LQ2A 3G9XA 4H9GA 4C43A 2IIPA 3ZDFA 1DDIA 2EKLA 3GBVA 4B6EA 2Y93A 4Z9XA 2CK3A 3I0ZA 1VL8A 2WNIA 3QFHA 4B85A 1U0OC 1ARZA 4EY6A 2PWPA 5K05A 2JK1A 9LDBA 4DLWA 1G60A 1UDCA 2WR8A 1MJGM 3ODGA 1BHJA 4MULA 3T15A 4C21A 4L51A 3SQNA 3OP4A 3A2MA 3KQVA 5CM9C 3FSGA 2CXHA 3LTNC 2B94A 1A7UA 2REQB 1I7DA 3RYCB 3RS9A 1FW6A 3G7UA 2LCIA 3W8RA 3V4RA 5LIPA 1E89A 1VMIA 4G9EA 1CJKC 1TM2A 3JQFC 1MLDA 4OLHA 3K4QA 3ZLTA 3ZQ4A 3P52A 1Q84A 3DOUA 2PL9A 5C0OE 3ZIUA 3IP3A 1RC8A 1KK3A 2BHSA 3LHFA 3N6RA 4PZ0A 1H0RA 1WE2A 3M1LA 4LV6A 1I2BA 1QNLA 4OQPA 3FYSA 1P73A 1A5TA 3KOWA 1YTLA 2PR2A 5GONA 1KRXA 3TX2A 1P3Y1 2VLIA 1W29A 4YJ2F 3LHIA 4EG4A 4OMUA 3EGDA 1XZJA 2K6GA 2F43A 2Y9MB 1JKJA 1GOTA 2ZG6A 2C2KA 4OSOA 5EC8A 3BZBA 3E9CA 2I80A 2F9FA 3LBNA 4S24A 4ZZ0A 3QBTA 4IXDA 3VXKA 3QE0A 2EZUA 4DLSA 4ETWA 4DDWA 3DMNA 4WWHA 4S04A 1YA6A 2XKAA 3KQYA 4R8SA 4ZK2A 3UYLA 1X0XA 4L8YA 5I5GA 3ORYA 3PC8A 2C78A 4XDHA 4J0QA 4QUHA 3QXCA 2YIMA 2ECKA 1ZI6A 1H2FA 1GPMA 4ZT7A 2GF0A 1A9ZA 4U2GA 5IPFA 4U6QA 4KQEA 3A1VA 3ISVA 1YFZA 5IEJA 1LRJA 1HNWB 1BXKA 1GU0A 4YRNA 4J3NA 1PI3A 4RFSB 5TQ0B 3OM8A 1AH2A 2Z2ZA 4LXGA 5F52A 1XBTA 1CUHA 3GEPA 3KYCB 3TZLA 3ZE1B 2IU0A 5KHOC 4EHFA 5DI3B 4DLZA 3I52A 1EVZA 4FXOA 1TM7E 9MHTA 4XFDA 3C7KA 3PFBA 4L5CA 4NJEA 2JFUA 3S2GA 4RFLA 1P4JA 3DP7A 4UHHA 2G8NA 3MWJA 2D74A 2FPGA 5KIAA 1FFBA 4CFYA 2WDPA 1CP2A 4ZYXA 3ICEA 3PNQA 4JROA 3EVCA 4MV6A 1AGXA 1P1RA 4P7BA 4TLLB 3V9PA 5BSHA 5TIIA 2BR4A 3DF9A 4IVPA 4YJGA 4IXTA 3WDLA 4UBNA 4E6PA 3L4JA 3AV0B 3MWFA 3I58A 1KIMA 4HWGA 1BO6A 1PG0A 4NV0A 3U4AA 5FNZA 1NAIA 1J1IA 1J42A 1O8CA 3EPLA 2ZJYA 1MB4A 2IPMA 3LCCA 4DCGA 4MIOA 2B37A 2VNIA 2P0EA 4KIJA 5KC9A 4YECA 5JXWA 1SIUA 1YCFA 4IWXA 4WXMA 5M29A 4DY6A 5DPMA 5JH7B 3DT9A 3INGA 3FKJA 3HDTA 5CTJA 5INTA 4ND2A 2JHPA 4KLRA 2FF7A 2JGNA 1XEWX 4JS0A 3NNSA 2QROA 1TZCA 5EEGA 3CG0A 1T9GS 2EOAA 1QJ4A 1QPGA 2EIXA 4BVBA 4MMZB 1NLFA 1ZC4A 2X40A 3DA8A 1E3DA 3PHIA 2ZYIA 1PEYA 4L22A 1PV2A 4PLVA 1NI4A 5L3SA 1DBWA 4C0BA 2RGEA 1PGNA 2O14A 2R65A 1SAYA 4L4ZA 1ZIOA 4TTSA 3EDYA 2O2ZA 5JS2A 2H8KA 4ZEWA 1ZKDA 3NRBA 4JOBA 4QUGA 5GTDA 1Y1KE 3CLSD 3HCEA 3P4XA 4KGVA 1VBFA 3O9MA 5DTRA 3KTFA 4KODA 3SYTA 4B48A 2AWOA 3U0VA 4GBJA 1ZXXA 2GNAA 3PWKA 2HN9A 1RJFA 4JL5A 3QKSA 4WKPA 1YZUA 1ZCBA 1VJGA 1KAQA 2EYUA 2PGLA 4JJ7A 3H5WA 4OBEA 4DBZA 2E9SA 4N01A 4RU1A 3MBIA 1QMPA 3S4YA 2LPMA 1EEXB 3NOQA 2JFXA 3OZBA 4G0NA 2OCGA 5BWCA 3QMVA 4TWIA 4BVFA 2XXAA 3SHTA 3IMFA 1W5EA 4OFZA 2WSBA 1K6JA 2VFAA 3P71T 2IXBA 4OGWA 4U39A 3DBRB 1SC1A 1KYVA 4QFCA 4DRXB 4F4DA 3UVEA 3ECSA 1DS6A 2XNDD 3V1TC 3A6ZA 2GZ1A 4W9MC 3L8ZA 3JD4A 2EW8A 2HRBA 5F4ZA 3WBJA 1BVHA 1DJMA 4Q7KA 2PUTA 1W6UA 2FMIA 2QQ0A 3CT6A 4ASUD 5F35A 3DC2A 1KEKA 1NRIA 2JAXA 1KPHA 3D4LA 4ZCSA 4F91B 3PQ7A 1I33A 2Q3EA 3G02A 4PCVA 3OUUA 4U00A 4ZOLA 5AW9A 4F38A 1JEDA 3D6HA 2NO5A 4J0GA 1NXSA 1T0HB 2HY7A 3C3KA 3DQPA 4BBZA 4E30A 1AD2A 3MUOA 4OM7A 4UAJA 2CL7X 4QDXA 1JTEA 4QXAA 4TSKA 5H70A 5EPUA 3TNJA 5K0ZA 1T9ZA 4ZAVA 1SQ5A 3L8YA 4NNOA 4R6WA 1V96A 1T1SA 2EP8A 3A4NA 2MR5A 4LECA 2W4QA 5AKKA 3T3MB 1LLFA 2BF7A 2VQSA 4O4JA 3ZIAA 3G2HA 1E5LA 1G3QA 4PXYA 2X2PA 3ZUGA 3TR0A 1Z7BA 2ZVPX 2VH2A 4EA6A 4WIAA 2ZB7A 4P9NA 5CCXA 1LI4A 3N5KA 3AY6A 4AJOA 1L7EA 1TXGA 1IQUA 1SHLA 4V0SA 2VP3A 2A58A 3F5DA 3IBSA 1HQYE 1TJYA 2VWHA 3N0XA 2HJRA 4BL5A 4AW9A 4EQZA 2E85A 1KTIA 4KACA 3ENKA 5YASA 4D42A 1QOQB 1OXTA 1BXRB 1ZCJA 3BWBA 4TMYA 1OIXA 4R71A 1OF1A 4JX8A 2R1TA 1JSLA 2VXYA 4CU5A 1US8A 3HDJA 2JJYA 2BMVA 1EFHA 4N5MA 1SA0B 2CL5A 2FMKA 4IUBS 3IBCA 1ONNA 1YAHA 4MRSA 4P4UA 1A9XB 4R8KA 3WMGA 4CMAA 1ZCZA 3T99A 4HC4A 3I4CA 5HF5A 2PRZA 4B7UA 4EECA 3MHPA 4FFWA 5EJ8A 2QN8A 1NV8A 4RLHA 1PIWA 4Z9AA 3GJ6A 3THOA 2YJ3A 3U9LA 2C5HA 1PR4A 1OH8A 1CX9B 1PQPA 2M98A 3D02A 1G0OA 2WUWE 4DHWA 3A9CA 3EBLA 3DMPA 2PU5A 3CEHA 2AQHA 5L3ZA 1HQCA 4UW9A 3W5VA 2VXBA 1JBEA 1JQEA 3ZEIA 2GR9A 1BU8A 1XMQB 1E2KA 3UK2A 2JBHA 1J07A 1O87A 1B8VA 3E4DA 1ZJYA 2PVSA 5BPFA 4BDTA 3ZH9B 4Q9AA 2R60A 3ILYA 3OF5A 1B2RA 4J8PA 4NLLA 1QFYA 5IWCA 2ZITA 2XCSB 3W5HA 4FOPA 3C70A 4EG6A 4JXZA 1P4AA 4BLOA 1RAAA 1ONPA 5AXCA 3SHOA 5KOIA 3GJRA 4R7ZA 1GITA 2Z8YA 3COZA 3KUKA 2JLYA 3NHLA 4H17A 3E23A 4ZI7F 5DNAA 1GNLA 3BMOA 3WQSB 4M0PA 3KYIB 3PNVA 4BDSA 4DF3A 2AOVA 2C2GA 5DNWA 3MMPA 3ZHBA 1IIBA 2OL4A 3LUBA 1QJCA 1UBMS 2IYWA 1XYGA 2OPBA 4ER0A 3RC3A 3OLVA 1YJXA 3N2GB 1YZLA 2VAMA 5HUQA 1DC4A 2AUMA 3HMQA 3JWGA 4JQYA 4EG7A 1VSUA 2CVQA 2YYZA 1KZ9A 4URFA 4ZEOA 4JI3B 3TLYA 3ZY2A 2EWWA 2ZUEA 3IBGA 2BW0A 3HU3A 3F5QA 1P2SA 3I1IA 1MNAA 4OB8A 5C5EA 1UXOA 3UYKA 4E33A 4HH0A 1PFGA 3RKRA 4F1KA 1RYYA 4QNMA 3J80A 3R0IA 4TVKA 2WJ3A 5U1PA 3CCBA 5F77A 4EO4A 5F3WB 4U5XA 2WPDD 5H59A 3H3FA 1WV1A 5JW6A 1H23A 3ZI7A 3LX5A 1HE1C 5LIRA 4JJGA 1E0SA 3Q0TA 1E2PA 4BKPA 1GVHA 5C8YB 2P2NA 1QANA 4X61A 1H3EA 1PDOA 4IPTA 4Y67A 4P5PA 4F8JA 1NZDA 1EWVA 1OA1A 4DMKA 4GOLD 1S3FA 3PCTA 2YN4A 2Q0HA 1RRPA 4YMIA 1G8YA 5KWJA 3I62A 4F2HA 4H7DA 4EY3A 3C14C 1WSBA 1C1XA 4J4HA 3C3AA 2RH9B 3RYIB 4OV6B 5B6JA 1UBEA 1ZOSA 1MKYA 2FGKA 4KE8A 5B6IA 4MIEA 3HRHA 2Z43A 3BCRA 1H2RS 2G71A 3HBNA 3WVNA 1RQLA 3LK6A 1F38A 5KWSA 1ODKA 3AR5A 5JS7A 4EB0A 1B8OA 3N3BC 1E2UA 3IP7A 2H0RA 1OZFA 2WTXA 2VQ3A 4H7EA 1E1NA 3CSSA 3G9UA 4HAWA 3IEUA 4KYUA 4WOPA 5JQWA 1XMIA 1BEUB 2WSIA 4Q3AA 3KELA 4WK4B 1DE0A 5A06A 1IHUA 2YX1A 3KPWA 3ZJVA 5ECWA 3INRA 1HL3A 1NVVQ 1JHVA 2VG8A 2X23A 3HDVA 1G21E 3AUSA 3PRKE 4IJKA 1E9RA 2GCOA 2IY7A 3PXEA 5HQ3B 2OC9A 4M38A 1M1NB 2VK2A 1IXZA 4QTXA 2ADOA 5JNVA 1UJ6A 1Q1NA 1R27A 2HA6A 1RVV1 1RYNA 4NCKA 4D82A 1G291 2AX4A 2NOAA 2C7PA 2O19A 3C0KA 3IXMA 4KFRA 4QYIB 1T91A 2ZYUX 1ZJJA 2GHRA 1FOEB 5EJFA 4X84A 3QVMA 3GZ4A 1XKQA 1QZUA 1TO2E 3WMEA 3HY6A 3ZHTA 1RWWA 4XD7D 3RSOA 3VBEA 2IE8A 4R51A 4TMZA 1Z6ZA 2CMGA 2I6GA 3FWYA 4H1TA 3UF0A 5FQNA 4BMCA 3DYVA 2QZ9A 3UV3A 1T6ZA 4QXMA 2VH5R 3I30X 2X8BA 3LC7O 3CH5A 1ISFA 2CUZA 4EY4A 1T5IA 5B64A 2O0JA 5JNWA 4KR0A 5JSKA 2XWSA 4PCUA 1EGAA 4XGRA 1NW9B 4WXHA 4YLGA 2WZDA 1ZGAA 3OEED 5A4FS 2WYOA 8MHTA 3F3SA 2VS1A 4JJ4A 4DGSA 2RIPA 2HZBA 3UUEA 1CS0A 3QVGA 2GJKA 3ANNA 4C3ZA 3SHFA 4BS9A 721PA 1ZZGA 2YC2C 1ADJA 3KJFA 1XTPA 2AC2A 4S35A 1NW4A 1WL8A 4HN4B 2DT8A 1CSEE 3ELBA 2CY0A 5EP1A 2PLWA 2H7XA 1FP4A 1XI2A 3GAMA 2JFBA 1J2YA 4A03A 5A62A 5HTKA 3SC4A 1P74A 3C1TA 1SUAA 1IFXA 1MX3A 2HSWA 2BFWA 1VLJA 2J4CA 3L43A 2YNMA 4OU4A 4ZYLA 5BWNA 2ZQYA 1AGNA 4DA4A 1RWQA 2AK3A 3COWA 2L0XA 4EKNB 1X80A 2WJYA 3EVNA 4OG2A 1UWVA 2JW5A 1I36A 1XDGA 2Q6KA 5EWLB 3MWKA 1R5NA 2GSDA 4YREA 4BKUA 2W8ZA 4JMPA 1U8CB 2CYAA 2BOVA 2W2VA 4UJ5A 3OE7A 3SKYA 4GWGA 1PNRA 1CYEA 1HNNA 1RWKA 4P7GA 5EJIA 4H27A 1NL3A 2OTCA 3G49A 3K9WA 3BGIA 2WU1A 3OCXA 1N6IA 5U4QA 4Z0PA 4Y2SA 4Z6KA 1PX0A 2ATXA 1E3WB 1KJQA 2D2VA 2OGSA 2IBTA 4DBLC 2Y92A 4I3HA 2YJZA 2GMWA 1J24A 2G70A 3K16A 1B3RA 1F48A 2B0JA 2QU7A 4JJIA 2O3UA 2WY2D 5HR5A 1DLIA 1L4NA 3L84A 1YRYE 4FBGA 3DE0X 3LAWA 1QO7A 1CQIA 5EIFA 2NADA 2XGMA 2DQYA 5A5EA 2O8CA 4BFVA 3N76A 3FTCA 1X19A 4NEQA 3UUFA 3QH4A 2BMDA 4ZJZA 1GL7A 3WMXA 2GAFA 3NB0A 4DIBA 1HXHA 3NOOA 1ISPA 5B58C 3C5EA 3HI6A 3IDSA 2Q5QA 2V7TA 4DABA 3BKXA 3CR8A 1JI0A 2MINB 5LP6C 4F96A 4D9BA 5IWAB 2RHJA 1E64A 4NHEA 1OKKA 2H1VA 1GUFA 3PU6A 3I28A 4OEHA 1MNQA 1XZDA 3CU5A 4UPDA 1HEIA 1YQGA 4RGQA 1ZS9A 2YUTA 3EXFA 1PJSA 1H1LB 2G9ZA 3GEIA 2I3BA 4KP7A 3KKKA 2WKSA 4FS8A 3ZLJA 2C92A 4DBLE 1HQDA 2O3JA 2CMDA 3R23A 4L85A 5EKXA 4QFMA 5TDHA 2QD1A 3L0CA 4RL4A 4YHHB 2EFYA 3BFXA 3ZE8A 3CT4A 1XZCA 2FSSA 1LBQA 1S2IA 3EBOA 4PLYA 4AMVA 1WSDA 3S2IA 3FLEA 1BA3A 3WWZA 1MTOA 3FDFA 1DGQA 4B6FA 4EHIA 2C5SA 1IN5A 2O8EA 2WB2A 3VZPA 4R2MA 3RVSA 2Q50A 1AUQA 1M34A 1UPFA 1WPGA 2B4AA 2VRCD 2WTAA 4B17A 4F5EA 3PUYA 5P21A 2QMEA 3G1UA 1A04A 1XRQA 4PPQA 2XADA 2I3DA 1YK1A 3T3IA 4FFVA 1E6EA 1K8XB 2JIDA 2P3LA 1SBCA 2KBEA 1KJ8A 3VNQA 1Z63A 3VC1A 2QL7A 3UPDA 3KPVA 2YXLA 4AYTA 3SXPA 4IJUA 1HZZA 2X7HA 4MUXA 4RKEA 4RHXA 5AVXA 2QVBA 3ICWA 2TMDA 2WP0A 3W5SA 1UPBA 4IQ8A 2J09A 4WFJA 2HMUA 3GAAA 4MS1A 3CLRD 3ZVRA 2Z9BA 3E9QA 5CURA 2PV0A 5ISMA 3B53X 4L50A 2VF5X 1O6FA 2IXDA 4FEYA 3MJFA 1X0VA 4M8SA 3HXMA 2I6SA 3BXXA 4KQ1A 5CB0A 4PS1A 4DMLA 1Q14A 1K7SN 1ZOPA 2VRCA 2WB4A 3F3YA 4RTQA 2R68A 4EG3A 3I9LA 3AH8A 3IYLW 4BNZA 5A5DA 4XVRA 3G89A 4O6VA 1GQYA 2JBAB 5K0CA 1C7ZA 1XZQA 3GLKA 2BBTA 3GWZA 4XPZA 5FTJA 1A69A 1SVSA 3GRUA 5D3ZA 1YMVA 1F8FA 5JU6A 3EFOA 3IQWA 5JPIA 5KKNB 4A9AA 4C7MA 1W2WB 2EG5A 5AK0A 4JC4A 4P4SB 4CN8A 3RKUA 2FW1A 2WFLB 1QP7A 4LRXA 5H4HA 3AJ8A 4ML3A 4UPVA 2WQ6A 1NW3A 5KNDD 1YC5A 4ZYTA 4HQKA 5FFNA 3I76A 4JUBA 3OT1B 3E9RA 1SHZA 4XWWA 2AQKA 3S2ZA 5BYKA 3I9NA 2G9RA 4J1TC 2RHHA 5A4DA 1VPDA 1JPNA 4ZCMA 3UMGA 2GCOB 1W19A 3ADDA 2HC9A 3CNEA 1TMOA 3UMCA 1W93A 2O3SA 1OU0A 2G6BA 3PPXA 2COEA 4FVTA 3IXQA 4LRYA 5C32A 1VM6A 3C85A 5HIJA 1P1HA 3E9MA 4WY8A 3ESXA 4MW5A 5LZ4A 3I2YX 4G0OA 4MITA 5F73A 4B7ZA 4O29A 1AC5A 2ZM5A 5K3OA 1XA3A 4ZVMA 3ZCXA 2HSJA 5JQGA 4PZZA 1MORA 1NPTO 3OMXA 2PZBA 2ZAIA 1TCVA 4FU0A 3P9QA 2ONYA 1DUVG 2GPJA 1V6SA 3C41J 4CI9A 3WGJA 1Y82A 1ZX1A 1ENYA 5TXGA 5DOZA 1O96A 8ABPA 1VIDA 3FZGA 1AE1A 1DWOA 4M1OA 3V4ZA 3LO8A 4PZLA 4J0FA 4TLMB 1QLJA 2HADA 2IHYA 2VSNA 2P9FA 3KKQA 3NANA 4IMIB 3VR6D 4RLSA 2GO1A 1EVIA 3QE4A 4Z2YA 1J21A 1HEUA 2AKAB 4TMTA 3ZU5A 3HBAA 3SYLA 3ADBA 2A1IA 2G7MC 1XNHA 2XUKA 3G0CA 4MUJA 5TF0A 1U2DC 3OA2A 3K5IA 5LQUA 3JCZA 1EFAA 2ZBEA 4TKLA 3T5MA 4S05A 5AK3A 1PGJA 2R6R1 4I9GA 3WLHA 5F1YA 1DKUA 3ADKA 1TUBB 1VL5A 3IPLA 4HWTA 1KOLA 3ZD9A 4PRLA 4WA7A 1D4AA 2CBXA 3B6JA 1LUAA 3NYQA 4OLJA 5KS2A 3OZEA 3H1TA 4RPKA 4CCYA 2WQZA 4KEAA 1Z88A 1AB5A 2J6IA 4B32A 4TTVA 2I22A 4N8SA 2HIAA 3SC2B 4E11A 4NMXB 3FKQA 5KPDA 3IP9A 4ME6A 1K5PA 2NZXA 4H77A 3TXAA 2O8VA 3ERCA 2GCGA 3ANSA 3EUWA 4J43A 4OQXA 2Z6UA 2VUIB 3UFXA 3O8RA 3EULA 1ZM7A 4NC9A 5FD8A 5ALOA 3V1NA 1O03A 4C0SA 2ZUWA 4ZJUA 5KTPA 4PPGA 4S3MA 1IM8A 2QN9A 2QMQA 1LSOA 4H4CA 4RZ2A 4BIIA 1JPVA 4F60A 2Y1OA 5JH7F 1KQFA 1RMQA 3NIFB 2QRHA 1JAZA 3NP9A 5CK4A 3CLUD 1VJ0A 1WB9A 4I4CA 1UM9A 1PBTA 2IT1A 4ODIA 5AW3A 1MAAA 4MRNA 1OXXK 3QIVA 4ZPXA 4WFKA 5J2UA 5CGZA 4I1YA 1SELA 2QL6A 4EBBA 1ISHA 3EOAI 4V0OA 5BNTA 1B00A 1FNBA 2OPHA 3M5DA 2FZ5A 1R3DA 5EQJB 1C8KA 5EIOA 1HETA 1YOVA 4HEJA 3SR0A 4OB7A 3H5RA 3K9LA 4G89A 4DS3A 1TM5E 1MZVA 4E3ZA 1SHKA 4EO9A 3HLKA 1UFOA 2VHZA 4CDRA 4XUGB 1PR9A 2QRKA 3KYDB 4FR0A 3UMFA 3UA3A 1M1UA 5HKAA 2CNOA 4GP9A 2PZMA 1SURA 1Q44A 5DJ5A 1DQNA 5JHHB 3W5UA 3V2IA 1CEEA 3GA0A 1JLLB 2IPXA 2J6HA 5C1BA 2QPTA 4R1QA 4O5OA 3MWYW 3FSGD 2I03A 3SCZA 3WLOA 2ZIEA 1ZK3A 3E5MA 4RA6B 7ABPA 1YS9A 1LY1A 4OXIA 3IIEA 3ZQ6A 5B3JC 2OP1A 4KQJA 4WBNA 1NJSA 1LC0A 3DBHA 5ENZA 1TO6A 1RHMA 2MSEB 2HBYA 2LCFA 4XJTA 2QUIA 5I48A 1C1YA 1L5VA 3OJ0A 2Z08A 1U9ZA 4XQCA 3HUEA 1D4OA 1DXQA 1JIQA 2B4YA 4GR4A 2FWRA 4OJQA 3H0EA 2PJZA 3GW8A 5GZ6A 3FHOA 2I9PA 4PLWA 4V0RA 3R8XA 4Z0NA 3TE6A 2BPOA 4KHZA 4XCXA 4F4IA 4GSYA 3FZNA 1Y7IA 2FK7A 5A1JA 3VU1A 4F46A 1CQXA 5J1TB 2QBYA 4NULA 1F8XA 4TV8B 4MLPA 3OEWA 2FP4B 2CXQA 4V38A 3S8MA 3U7JA 5DNUA 2XE8A 2ABWA 3OT5A 4HB4A 5DHAA 2WIBA 2BFBB 2PGXA 2M9MA 4G2NA 4UU7A 3DVAA 5AXBA 3RBZA 4EGFA 3L8CA 4BVJA 6GPBA 2Y66A 2VRNA 1O95C 4DSOA 1R4ZA 2RHTA 5ER6A 1XK7A 1UXIA 4JYBA 5H81A 3L7KA 3QA9A 1BWSA 3GRKA 1JLMA 3K32A 4JJEA 3HTXA 2E4UA 2ZI9A 3CF4G 4PC2A 4WI1A 4II2A 4YRMA 1E5TA 1H2BA 5HRUA 2BE7A 2HKIA 3C3CA 1K86A 1VKJA 4RABA 3TFOA 4CF4A 5E38A 4ENTA 4ITRC 2ERXA 5F5NA 4FZVA 3IB3A 3LIIA 5KNCA 3I45A 4QE3A 3GU3A 1Y9AA 1ILWA 2IWHA 2PJRA 3W0LB 5JPCA 1MG5A 3NT4A 4QYTA 2JJ2D 2GAJA 1OC4A 3V48A 4CQMB 3T9DA 1CUXA 2QE7D 1D2NA 1EUCB 1ZJ4A 3UMYA 4G67A 4HEA6 4LCEA 3TQRA 3ESRA 3TNDA 3PVZA 4ID9A 4L02A 2VCHA 1DWUA 5FPTA 3Q3VA 4G36A 1KFEB 2NP7A 6CHYA 1Y1QA 4AAYA 4R0NA 3SBEA 1BCRA 3RVKA 1PZXA 3U56A 2XD4A 4JVNA 5ITVA 3JD0A 3EYWA 1THGA 3G2OA 4LRWA 1X1EA 4N12A 4N3BA 4M9CA 3SXUB 3VC3A 3ZGYA 3QVXA 1GKUB 2V3VA 4MQFA 3LQ4A 5B58T 2JGDA 3SJ7A 1ENPA 1JAHA 1XJQA 4UOQA 2BHLA 3LX4A 3DZHA 3G6KA 3KKZA 3D9QX 1I7NA 3W5CA 3THXA 1FW8A 4RK5A 1AKVA 3GCXA 4GQAA 3I39X 2DHCA 2ENUA 1E2BA 1EFTA 4P6VF 4QU8A 1NPYA 3JV7A 4ARAA 5TMEA 1HT0A 8AT1A 3UK1A 3GMDA 1CUUA 4HT3B 5EMMA 3AVQA 2D2IA 4GMXA 1PG2A 5JWRA 4CKBB 3QHAA 2RDMA 4Z5XA 1UBGA 2RONA 4QGGA 3KU1A 4MS1B 4HPJB 2O8DB 3VKGA 2WJGA 5AW6A 2ZBQA 2DAPA 5BN5B 4FYYA 3A6GA 1J7KA 1Y5NA 2WVAA 3L3BA 4EUNA 4CM5A 1WA5A 1MC1A 3COYA 1MAUA 2OZLA 4NICA 4EO7A 2CDCA 2WD7B 4C4XA 1W47A 3BL6A 4H7PA 3HPRA 2ZJZA 1D5WA 1HDGO 1I30A 3NBXX 5FTKA 2YJ4A 3HVUA 1UC9A 4LXTA 3RNLA 4ASUA 2HK8A 1ULSA 4DTIA 4NCJA 4JBWA 3SSNA 4KSBA 3T7CA 4GG1A 1TA9A 5IZCC 1Y6FA 2X1LA 1H2XA 3D8UA 2F9MA 4B09A 2I1WA 5E1DA 5J2TA 4MO2A 1HRKA 1Z8FA 1SC9A 1GO2A 1EFVB 4OXNA 2WYHA 4E14A 3TRKA 4HZGA 3OPXA 2ID7A 3E18A 2AOUB 5FEMA 4BO1A 4EARA 4CUJA 4PFSA 1NBME 4MIKA 4WCDA 1E3EA 1FYEA 1OXUA 2VNHA 3DE6X 4HNSA 4R3NA 3W1WA 2QLNA 3KQMA 1HYQA 1MPXA 4JXXA 4FFDA 1AGRA 4G24A 4KAJA 4NPCA 4GO1A 4O2BB 3N05A 4C5AA 1SUIA 1S9DA 1Z39A 2GFHA 2YJ5A 3KJZA 4EG5A 2XT9A 2CHVA 1EMDA 4GF5A 3Q98A 2C4MA 4O33A 4HTFA 3G8CA 2QL9A 2VPPA 2CLIB 3OTWA 3JYPA 4JL8A 1C7QA 5KAPA 4D57A 2WSYB 3DFKA 4LC9A 3OE5A 3U3OA 1ZD2P 2ZWAA 4NXMB 5FA8A 3NPMA 2C83A 4IFTA 1BZYA 3IODA 3FHTA 3PDJA 3AR7A 4YV0A 2JRLA 1JWLA 3AI3A 4HQLA 4DY4A 3EXEB 1V8PA 2RHOA 3QVLA 3WQBA 1G20E 4NFSA 5H82A 1VRVA 4RD4A 2BFEB 4P3NA 4ZT4A 2F3SA 2DRIA 2IZZA 2R66A 2VP6A 2E2WA 1I3NA 1M6WA 5DBOA 2OQRA 2P9HA 2WK1A 4PTLA 1ZCFA 3DBIA 1IWBB 4NJMA 3T7JA 4N6OA 5K03A 5IXSA 3M6FA 3C3BA 2AG6A 3SSAA 3PL5A 3RREA 1PV1A 2W0SA 1U3WA 3DEYX 3IMCA 4AJIA 4A0SA 1LTKA 4AKTA 5CCDA 5GGXA 2JD2A 4HRXA 5CNJA 4ER7A 5CA1B 1E2EA 4J1TA 5FV4A 2OAQ1 3MIZA 2ZI5A 3MELA 4TSRA 4XGNA 1RZ3A 4MGEA 4M8LA 2JHFA 3ZI0A 3OQIA 4K5QA 4I99A 4HAYA 4RHCA 4BTLA 1NBWB 4C6RA 3D7KA 2OY0A 2YQ4A 2VJLA 2B1IA 2CVOA 3NCHA 1FQJA 2VKQA 2XI4A 4Q1FA 4XGKA 4EMBA 2DPXA 3KAQA 3VTAA 2DLNA 3UTDA 3DCNA 3N87A 4M87A 1KOGA 3D3NA 4JJ6A 2OO5A 4B3TB 1U2ZA 2CB0A 3I6ZA 3QELA 3D8RA 3UXYA 1I2AA 4RZHA 5FBVB 1P6QA 3FVTA 4A2QA 4ZQHA 1J00A 1Y1LA 4H1WA 1P2VA 1FEZA 3NG1A 1KTVA 3ZU2A 5KJ6A 3T61A 4IVQA 3FOWA 1AV7A 3KZ1E 3PNMA 4DADA 1ZRMA 2WTBA 1HZZC 5F1KA 4OK3A 1HYBA 3Q15C 1MXFA 1Z6AA 2EV9A 5AKGA 5HZMA 5KNLA 3RDPA 1Q0ZA 1KDTA 1VG1A 2IOHA 1B73A 4OJTA 3GJ8A 2AE2A 5DGIA 4NJOA 3REFA 2XIJA 4U7GA 1YD7A 3FBGA 3L06A 1JYFA 2EGGA 3BL8A 1Z0JA 3KVVA 4MGHA 2VSQA 3E1SA 4KNWA 2Q3DA 4O2RA 4G5XA 4REQB 4BO3A 1EHYA 2BEVA 3KT8A 4YCMA 1PT6A 1QRAA 2A0WA 2PV7A 1T9GR 1V25A 1QB7A 2RCYA 3CLRC 2V7QA 3LL4A 3PENA 3K5PA 5AO9A 5T67A 4BO4A 4DN6A 2J7PA 4N0DA 1J0BA 1GTL1 1U9YA 1WW2A 3A3KA 2QRLA 2YL2A 3B7GA 3DE4X 3Q6MA 4J7UA 2PKQO 2WWIA 2YXDA 2N3ZA 5FULA 3WYFA 4EI8A 5A9SB 1RHUA 2J07A 4FONA 4KQ9A 2IOFK 3CRMA 1M8FA 3X2EA 3WB2A 1HE4A 5K4HA 4CJXA 1CB7A 4CZ2A 4HYQA 5JYCA 1WBJB 3THYA 1ORTA 1P2BA 5J4KA 2Q07A 1ECJA 1PUXA 3CUVA 3U6BA 1N2ZA 1N2SA 2C4HA 5HF6A 5DBIA 1C7RA 1UQUA 4N9WA 2FK8A 1O58A 2GA9A 5BURA 3H1GA 2FPSA 4EX6A 1KGDA 2ZBVA 3ZNOA 3E5NA 5I4CA 3D5QA 3A4MA 4HDSA 3I5YA 4HDNA 4ACAA 4EYOA 5HIAA 3BXFA 4H35A 2OHXA 4DM7A 1EIWA 4GAEA 2F8LA 3AVPA 2ZE7A 4OLFA 1NFQA 4B0PA 2Q29A 3CVJA 4JUIA 1IZ9A 1PK9A 4Q9JA 4H3HB 4QBKA 3P2MA 4Q05A 3V3TA 1I13A 3HA5A 1VDMA 2ZAGA 3PC2A 4BWFB 4RDCA 4LRUA 3CCCA 1GZ3A 1ZUNB 2I2CA 3FVVA 3N0WA 3QU7A 4M83A 5I45A 5ALDA 3ESCA 5BSUA 2YCBA 4AO7A 4QNRA 2AMFA 1EEHA 3NHJA 1EUDB 4BNFA 4BMXA 1XNGA 4WCFA 4XOIA 1QUFA 1G2PA 4KI0A 4ZMSA 2H4JA 1JF8A 2YWRA 4FDVA 2G40A 1WR8A 4N48A 1AX9A 3HP1A 3KQQA 3E7PA 1W34A 1OXVA 1Y3AA 2YYSA 1F6WA 1JB1A 3VI4B 1HUQA 2FOIA 5BQOA 4JB0A 4FFMA 4FEGA 4RJKA 1JFSA 1YS7A 3LY5A 3MTAA 1E1QD 2ATEA 1Y4ZA 3HP7A 3TE7A 3R0JA 4GLOA 3FFXA 1Z29A 4JT4A 4N18A 4HNVA 3GDWA 2GBIA 1U28C 4DILA 3ZWMA 2PMBA 1ECGA 4QAJA 3DHEA 1XPOA 3ZBPA 5FXMA 3BA6A 3NRCA 1W8DA 5SYAA 4HHEA 3O95A 1R8QA 3Q4GA 3K2BA 3T8YA 4BAGA 3O5AA 3LBYA 1QK5A 3U4QA 1H4VB 3BFVA 3QK7A 2QX8A 2GN2A 3E5HA 9ATCA 1DV1A 2N42A 4UHDA 4XM1A 3DR3A 1FCJA 3D4PA 1SBYA 2RFLA 5HCUA 4V2UA 5AJHA 2Z6VA 5AKZA 1WBDA 1GPUA 4XIGS 5KWVA 1IBSA 1QF9A 1NG9A 2HLHA 4QPCA 1POWA 3OFNA 2R62A 1JFFB 1TFRA 3TW0A 2F3UA 1JZQA 3FWPA 5J43A 1CKEA 1P5FA 3DS8A 4QHSA 3M2TA 4FYJA 4WKBA 2OYCA 2NU9B 4ZO7A 4R7TA 5LQSA 3VRHA 1SD5A 1QNFA 3NKVA 1EP1B 4W82A 3HJHA 4C0KA 4MV5A 4Z7NB 4E6EA 5BUSA 4OO3A 1NN3A 2QHXA 1BMQA 1Q1EA 1U0FA 3A06A 2Q9BA 4KE7A 3VBCA 4BEBA 1LBEA 1BOFA 1I8TA 1VPLA 2ON6A 4RVGA 1QF7A 4YGXB 1CP3A 2JCBA 1RKBA 4NENB 2RAFA 1GTVA 1MXHA 1UXHA 2QV7A 1Q6YA 2QVGA 3ZR4B 4CQLB 5LYJF 2DPHA 3KWMA 3KZNA 3KYJB 3EXIB 3AETA 4BFYA 2JATA 4OHWA 1LPMA 5E9QA 5G3ZA 4S2EA 2PE5A 2OLEA 4NARA 3I34X 4F5YA 4IUDS 2JEOA 2OGUA 1QGUA 2AG1A 3EMDA 3R5SA 3AB7A 3RUIA 1SQGA 4DMCA 4L3WA 1D1SA 3PFCA 2WHRA 3HKDB 4MR7B 4FZ3A 1CXZA 1DNPA 3LA6A 3ILSA 4QODA 5EIHA 1NQ5A 4A3SA 5DLYA 1H0SA 2I2AA 3M2PA 4JBLA 2XTJA 2BMJA 3Q7RA 5LDGA 2ZYHA 1I2CA 3CYFA 3PGVA 5DYNA 4UE2A 5BXQC 3DDOA 1G7TA 1KU6A 1H9AA 3FJYA 2JZOA 3S2UA 1K3UB 2BJHA 3UOAB 1C30A 1RRVA 3QVOA 3RVPA 3VVLA 4FS3A 2BGGA 1CDDA 3UAXA 1GFIA 1R9NA 1YONA 2DQKA 4GZLA 2BFEA 4TTAA 2FE4A 1O0CA 2TSYB 1QQ7A 3RUEA 5D3KA 1Z6GA 1LD3A 1JG6A 1NJ1A 1WDKA 8GPBA 5EJ7A 3JZIA 4PPNA 3M4NA 4RSHA 3UHPA 4YIHA 3Q8KA 5K0BA 3ZLUA 1H1DA 2J7KA 1OFGA 2DR3A 1K97A 2WABA 3PLAE 4JP1A 4J0IA 1YDGA 1JQLB 3MQ2A 4U2EA 5ICFA 1T0PA 1M7HA 1POXA 3T3PB 1GXSB 4LOJA 2R96A 4RVFA 3DXYA 4X20A 2AN1A 4KXNA 2FWNA 3WV4A 1PR6A 3KJNA 1TIKA 3DDUA 1QHFA 4WASA 5TVGA 5JAHA 4WSOA 4EF6A 1OBFO 3K0FB 1Q15A 3THWA 5KUTA 4LF9B 4FGZA 1C0IA 4TKZA 2GSWA 2VHYA 2D8MA 4K9QA 4PRKA 4TKMA 5FHQA 4HAUA 5JZBA 1RLTA 1CUZA 1KZ4A 4JI0B 4A82A 4JNCA 4Y6OA 4PNZA 4C89A 2XUIA 4EA7A 3UWPA 3O94A 1GCIA 5HZHA 1QPZA 1ZU5A 3P27A 4NAUA 1XKTA 2IUSA 1EAMA 4BU1A 2I87A 4E1VA 4AS1A 2WWFA 3HM2A 4OCZA 4TTIA 3MK31 3TD2A 1XLVA 2DVMA 3P2EA 1E1RD 5AI0A 4WL0A 4J0KA 1YCHA 5IKEA 3PNLA 2IDZA 4JI1B 3ZKAA 1TYBE 2X4GA 2NZWA 3WK5A 2J5BA 3ER9A 1CU1A 1F2UB 3KEGA 5FLKA 1F17A 1VE1A 2CCGA 1RWPA 4Z9FA 2NVOA 3HE3A 3IEPA 1JILA 1NLYA 5T3YA 5C18A 1OFUX 3HRKA 2V65A 3MBKA 3QKIA 2ZPAA 2C2YA 3FRIA 4MQFB 4MHOA 2QXTA 4ZREA 4A26A 1ORIA 4BKMA 3HFRA 2NO6A 2EKPA 2F1RA 1SVLA 3TXYA 4D1YA 1DZ3A 1I0IA 3GJ5A 1WUJS 1MU0A 3TNLA 4TRRA 5JC8A 3O47A 4W5OA 1R9GA 1RPTA 1Z5NA 1QX4A 1VMAA 3FOEC 3FCSB 5KI6A 4ZP1A 5JDCA 3SF8A 1JLKA 4ZVNA 5H3LA 2C99A 3WLPA 4HN2A 3T1NA 1JHZA 3I5XA 2JNWA 4Y9SA 1D2HA 2CCKA 5TVKA 4LDZA 4P36A 1BWPA 2GZ2A 2L19A 2L82A 1FQKA 2F90A 4J9VA 3ZTYA 1W44A 2WAYA 4LX8A 5EKUA 1ZW6A 2I6TA 2ZTMA 2MSNA 3QYPA 3UTCA 5DMHA 1DTEA 1JLRA 3UK6A 1BFUA 2JI6A 4U7WA 3EIEA 3C2QA 3S1AB 1FDOA 1QGAA 4B8ZA 4ZHQF 3MD9A 3A10A 1SUDA 3ITEA 2R2GA 1X1CA 1D7OA 4FT2A 1U8AA 1C7FA 2GBPA 2EG9A 1PNQA 1SCIA 3DKVA 4H6XA 3UBTA 1JSZA 1NY5A 4HNQA 1B7GO 2I3GA 3E9NA 5HHTA 1MFZA 2NYAA 4L6IA 4K0RA 3ZDXB 3LKVA 4ZA2A 5K8JB 4YT8A 3KZCA 1NJ6A 4X64B 4QRDA 1UEIA 1T8WA 4AULA 4GVLA 3A3OA 3P0EA 3SM9A 4V1CI 4IYRA 4E7OA 3FSJX 4K6GA 4PYOA 4MGZR 1CF9A 1GUZA 1XD9A 1Z4NA 4LBWA 2WAXA 5PGMA 1RIFA 4PN3A 1LI5A 3TDMA 3QX8A 1CNMA 3EEYA 5IXYA 1A4IA 1SKAA 4BXOA 1L2TA 2YY7A 3PEWA 1DBIA 3LUFA 2YZGA 3FUWA 3KKNA 4Q7MB 1B23P 2V7XA 1VRCA 3ANYB 4EW1A 4F2GA 4Q21A 4GPZA 4DR1B 4J0HA 1GG8A 4Q12A 5GINE 2E3JA 2NXEA 3OEHD 2ZJ3A 4BNYA 4DSZA 1N6PA 2WFMA 1R18A 4HXFB 1L5RA 2ES4A 3AJRA 5FUWA 3BMQB 3LT0A 3HBJA 3FTPA 5J40A 5TT1A 1RPNA 1XTQA 3R7LA 3SKVA 2BD0A 2YMPA 5A4IS 2QTCA 4CM8B 1YWGO 1ZICA 3GMSA 1Y5RA 3W2HA 2QDXA 3AU8A 3N8DA 1J39A 1S89A 4X3PA 4WX2B 1N7HA 1WRBA 3PHGA 3U3MA 1ZM2A 2UXDB 4ZU6X 2M6LA 1OBVA 3DVSX 5LBUA 2JGMA 5ADHA 5LQDA 1N9GB 4WZZA 3L49A 5JS8A 3ORQA 2LP4Y 4PGAA 1P0FA 4P93A 1G8GA 2BI7A 1UBHS 3ELDA 5FDFA 1BN6A 4JLJA 1WCV1 4HP8A 4NH4A 4NNJA 3QIAA 2ETXA 2NUTB 3PB3A 4BP9A 5FX2A 3Q5EA 1S01A 1X80B 4I8IA 3CY6A 3WNVA 1KY4A 1Y5MA 3B1KA 3DDSA 4CDMA 2R6AA 4Q4DA 3FTEA 1Y1RA 1FP6A 1F9EA 1PJCA 3FMPB 5G1NA 1Z2AA 4L0CA 4MR7A 1GLGA 1R8JA 4FW8A 4QJ3A 4YAUA 4WZBE 4FMPA 2WWWA 3THSA 3DE2X 3M0EA 2FN4A 5U4XA 4GHWA 3CM0A 2Q0QA 1L0BA 5JNRA 1G5FA 2CNBA 1CUDA 5JMOA 1DMRA 4DC9A 4DSUA 1LA2A 3UGKA 3VOTA 3WISA 2P35A 1A4XA 5HZKA 1VTKA 1E9EA 2OAGA 3MLAA 3FLAA 5CJJA 4EG1A 2W6JA 2IHTA 5JJIA 1KRWA 4F71A 2ODTX 2FWBA 1ZNWA 1D09A 3DZ8A 1KY3A 3GJ0A 1IJBA 1PL6A 1NUPA 2ORYA 1UBTS 2RB5A 4CKCA 1R88A 4RJIA 1O6GA 3E7WA 4LE2A 1LPOA 4FYMA 2QRJA 4CN9A 3JATB 1IN8A 3B38A 4AY3A 5BSGA 1JEYA 1MHPA 1X77A 2ZCJA 4AY5A 2X1MA 3C4VA 3NNDA 4YRCA 5GZ1A 3GLHA 3CNHA 1EK0A 1ZQ1A 3IO3A 4GLJA 5JADA 3FDXA 1CRZA 2PUVA 3A3YA 4MCAA 5B57C 1B0ZA 4F6RB 4Y2HA 1T5LA 1PU2A 1OAAA 1QP4A 2DUUA 2PGOA 2QUAA 1JIVA 2IRWA 3PHHA 4Q24A 4XVHA 3CNBA 3W4KA 1ISGA 2R3SA 4DLXA 1XPJA 3OOEA 4PX5A 2PUCA 3Q2OA 1CY7A 4RK7A 4GUDA 1HOTA 2HH9A 3ZGVA 2YYYA 1DC7A 1N0UA 1WQ4A 3A3PA 3AP2A 3EPRA 3F6BX 1PGQA 4IIGA 4EY7A 3CO5A 2F1OA 3K1JA 1KO5A 3HXQA 3PGXA 3MWEB 4XRGA 1JXAA 4P0TA 2UU9B 2EKQA 1JAIA 3BD6A 1RAIA 4N7JA 1LTHR 4DLVA 3IAM6 4JP5A 1YVEI 2HDHA 4ZJPA 5T7BA 3OU2A 2R6CA 1JNXX 3LUKA 5LOVF 3C3JA 3KUDA 1GWNA 4BWVA 1P8JA 1XZFA 4MA4A 3A9SA 2WJZB 3DD1A 5G40A 2Y1XA 1THMA 3HH8A 2JCSA 4M1SA 4DW8A 1KDVA 1U2TA 1BIFA 3EGXB 3IVMA 3VKHA 3L4BC 1S3SA 1U0EA 3EJWA 2GM5A 3OX1A 4F9FA 1BVRA 3Q1LA 1U0JA 2VF4X 4R2IA 2JFYA 2PGAA 2A84A 2OKCA 5LWQA 2VTDA 2ODBA 4ZTUB 4FFSA 2X3UA 1V11A 5EZYA 2ZUVA 3RVJA 5J58A 5BRAA 2IBMA 3RAEC 1ZVVA 1S2DA 2QX7A 4IDCA 4TYPA 5EG5A 3RAGA 3ZY6A 1U8UA 5FBRB 3SFTA 2VP4A 2XA1A 3UIEA 2Q1WA 4QGAA 2CWDA 1PJ4A 3KU4A 5EGSA 2I8AA 1JFFA 3AY3A 3NDRA 3C43A 2JFNA 1YZFA 3STXA 2QTMA 5ELMA 1J1UA 3PUVA 4FZJA 1CFJA 2IVZA 1WX1A 1ISIA 2OWEA 1DZIA 4HGPA 3I83A 5CUQA 4YAIA 1ZSVA 4QX6A 3RARA 3NVKI 3E8SA 4AG6A 4AIIA 2J45A 2O23A 4V02A 4HS4A 2A1TR 3B1WA 1SVWA 2OK7A 2QSZA 2WTMA 3T1YB 2R2AA 3GP3A 3KC2A 3A9UA 3LD9A 4QDJA 5DHPA 3EDMA 2UXBB 1NM5C 1J7JA 1P1CA 1A4RA 5E6RB 1T15A 4FMCF 4XJSA 1VXOA 5F9MA 3TW6A 1A71A 4L8LA 1HLFA 4DDUA 4I55F 3TW4A 1D8AA 3ZXXA 4QDKA 4BO7A 4LJ9A 1OLSA 3F8SA 4CKYA 4G0YA 2X0RA 3MSXA 3ASVA 3PUKA 4MJ7A 4R1PA 1GRVA 4KK4A 2NZJA 1B6SA 2W83A 3JQBC 1JMKC 3PFWO 2PZ8A 1KJZA 1U7WA 3HJBA 5FI5A 5JDIA 3N2LA 4WN9B 1ZVMA 1MIOA 4CKXA 1N8NA 4GI7A 5AI5A 5TMPA 2OUKA 4RK1A 1FVOA 4TQ9A 1QGUB 3NUZA 3OCZA 4BLVA 4NEHB 1U7UA 4UUBA 2ZSEA 5LNK1 2X8JA 3NT5A 3QJGA 2Y1WA 3WA7A 4HYTA 1GPKA 4YJ3B 4BC0A 1DINA 1G8KA 5AI9A 4LC0A 3R8CA 1TQDA 3TCXB 4DL9A 5EE3A 1MV8A 3TBKA 5JSZB 5TPWB 1AN9A 4B44A 1GQSA 1X7WA 2CYCA 4NU0A 3X2SA 5CLLA 2UDPA 3P1JA 1MTZA 2RGUA 3UATA 3TXXA 4BP1A 2A4KA 2MJLA 3W9UA 1IC6A 1QO9A 1D4ZA 1ZJ6A 1YR3A 1JR6A 3S3TA 2XCQA 4FUQA 1YJ8A 4BGDA 2V6JA 5EVCA 2NLOA 1AMOA 1L4LA 3EE6A 3DL4A 1ESNA 5FPQA 1GGHA 3G5LA 4I1VA 2H2WA 3II6X 4M0DA 4P22A 3R20A 2O9JA 1GPWB 1E9CA 4FCCA 3WIVA 2P6NA 2P30A 4ARIA 1J0AA 1XC7A 2PLNA 1Z08A 3ECAA 4A1OA 1NFRA 4B2LA 4DQ0A 2QGFA 2PX4A 5BV0A 4GQBA 3U16A 1WHTB 3C97A 3K8ZA 3KXLA 3D5TA 3CMMA 4BJ5A 1JQKA 3GUUA 1WV0A 2OGWA 3DLAA 3A70A 1UDRA 1RYBA 3O2NA 4UUAA 5CEFA 5CXSA 3OTOB 4DLLA 5CB4F 1YJ5A 3U0BA 4DLKA 3W6NA 1RD4A 2IUEA 2JZNA 1NQAO 3B36A 3GN1A 1JHQA 2BLNA 4HDOB 2OA0A 3WJ7A 2GD6A 4OHRA 1SEVA 1ZW1A 1Z6QA 3OJXA 5LQMA 1JB9A 4QBGB 4YV1A 4M7WA 3K0CC 2NSDA 4GI1A 1DKOA 2G6TA 3PPIA 4I14A 5DSTA 1FUKA 2IP1A 5G0SA 2J6CA 3I6YA 1FYFA 5ESWA 3QPCA 4XR9A 1RYHA 1E0KA 2X41A 5JS1A 3NM4A 4MI1A 4V2IA 5AJTA 3QKRB 7GPBA 1XAJA 1ZD5A 4I8XA 3SYKA 2G88A 1ZM9A 2NPIA 2QQEA 4NVRA 2SKDA 4L28A 4U1RA 3RUPA 1ZESA 4LF4B 1REQB 4CG2A 1ZD9A 5LNK6 1X8LA 3AZQA 4XYLA 2H4YA 4E07A 1VJDA 4PSAA 1KEEB 3PC4A 3L7NA 1P75A 1V5FA 2AFIB 4FMDB 4WD3A 3RB8A 3ORRA 3GV0A 3PBKA 4DMRA 3KJGA 4ZTZB 3TEMA 4BB9A 4EKIA 4MIYA 1F3OA 2Z9DA 2GETA 3PNKA 4QLAA 3NHWA 4S0XA 3W5IA 4GX2A 4V0NA 3G1WA 1UFVA 4QSMA 1ZR4A 1MOQA 2EJCA 2H85A 3H17A 1TVKB 3OH8A 3LDAA 3P0FA 3PITA 4Y2VA 3CTMA 3WIOA 2HCFA 3BQ9A 2Z4TA 3F6YA 1CEYA 1WUIS 3FPBA 5KTMA 5DEOA 3D2BA 3ENWA 1MQ8B 3G9ZA 1SCJA 3MUEA 5CLJA 3ESYA 3O0DA 3D0RA 2GNPA 3WGTA 1A9QA 3H04A 1D03A 1JPUA 1P0CA 4L9AA 4TV9B 4I0WB 3NTXA 4Z1OA 2PX0A 1ZISA 3BMNA 1BD4A 3JASB 4O08A 4Z8XA 1DWPA 5H68A 5A05A 4WESA 3R0QA 3GEDA 2D0DA 3AHDA 2G82A 3EH2A 2EZTA 2OD7A 4FBMA 2POCA 2BM9A 3DKRA 4QRIA 5EZSA 5KB3A 1OXKB 4HWOA 4WN3A 5H3CA 3EC7A 3U44B 4G5RA 3PNSA 1IVSA 3AGQA 1IL0A 1YBAA 1AY0A 4HDQB 4DA6A 3JQCA 4V03A 1D3AA 3I0NA 3QW4B 2WIAA 4OQEA 1SN7A 3F3MA 4J2TA 2ZSJA 3HKBA 4X66B 1ZD4A 4L2IA 1Q3KA 2IX3A 1WABA 2P2DA 3C8MA 3R4CA 4KQXA 4RUKA 1QIDA 1ZA2A 3WOHA 1GKLA 1MJ5A 3EZGA 3GQVA 1X9IA 3K2QA 4W5QA 1AQLA 2HA4A 4PYNA 3LBHA 2RK4A 2PG3A 2R8RA 1OZHA 3GD7A 5FPSA 4IV8A 5FLYA 4FKZA 3BF8A 2IPOA 2NT3A 3BHIA 5CCEA 1SVIA 2Q1YA 2W2OA 3H2SA 1RWOA 3TUJC 3A7DA 3UFXB 3MCWA 3UCEA 2CSXA 4G5SA 5B4TA 2C5AA 2HRCA 3GYGA 4NE2A 2ZKLA 2GRUA 3EWAA 2JI8A 1XAIA 5SZHB 3K70B 4Q4AA 2RGDA 3HLTA 5EMJA 2P9YA 1LS1A 2Q4OA 2FCAA 2Q5FA 3K8OE 5ARCA 1JT2A 4YCNA 4HVLA 3VMFA 3QA3E 4HO1X 2HNAA 3GJXC 1K8QA 5EIBC 1ZHFA 4JWKA 5BVGA 10MHA 1SVNA 1Y9DA 1RCUA 2I62A 2XUQA 2ZULA 2YINC 3NIDB 1P80A 1GP2A 4FLFA 3ESDA 5A9TA 3AVYA 4ZQIA 1N6HA 2V0NA 3QNMA 3OMWA 2PGDA 3CZ5A 4UVGA 1PZFA 2A33A 1Y6GA 2MSKA 3PYMA 1Q2UA 5CM2Z 3DWIA 3RAJA 5DW3A 2P91A 3RW9A 1XMOB 3VO1A 2V54A 5ADUS 4ROSA 5BOSB 1D2CA 5LBTA 4UBJA 4YVFA 1N77A 4IDDA 5CBPA 1KYQA 4IY1A 4QXQA 3NHAA 2J30A 4JEUA 3GVPA 5ESDA 4KPYA 4JYPA 3QLUC 2V9ZA 3ER6A 3WAGA 1EX1A 1GNRA 4CQMD 2G9NA 1I1NA 1EJ2A 1ZXBA 3H8JA 3TLAA 4CVNA 4HDRB 2JGDB 3PV0A 4MP3A 2PSHA 3X44A 4YUXA 3KHUA 3W78A 3JTMA 2P62A 2Q28A