1Z5UA

Crystal structure of s. typhimurium apha complexed with cyclic-amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
208
Chain Sequence
TLNPGTNVAKLAEQAPVHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTKVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRILRAANSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AphA protein
publication title Structure and Function of class-B bacterial non-specific acid phosphatase: functional role of invariant Lys154
rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 73
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z5uA00
2WFAA 3QU9A 1RMTA 2DQSA 3AR6A 3L0BA 1ZOLA 2YJ3A 1VJ5A 3SF0A 3K1ZA 1NF2A 5AW4A 3U19A 3ZWDA 3NASA 4PNHA 2WHEA 4QQFA 3ZX5A 3DV9A 4OHFA 2CN1A 2I55A 3FPBA 3I1YA 4EELA 5AW2A 3L0CA 4GXTA 3ZVLA 1YNSA 5T41A 1RLOA 1VFPA 1SWWA 3A3YA 3VAYA 5AVVA 2YJ6A 3L1VA 4NWIA 2I33A 5ALIA 4HGNA 4L6AA 1O03A 4C4RA 5AVYA 2AMYA 2HHLA 4GIBA 2I7DA 4CF4A 2JAOA 4HAIA 3PGLA 2IA5A 5AVQA 2I54A 4AS2A 4YCMA 3N8GA 3E84A 1XVIA 2C8KA 4J2TA 5ALOA 3PDWA 3U7EB 5A3RA 2YJ5A 1O08A 2FI1A 2YN4A 1QQ6A 2HEGA 3IJ5A 3NIWA 4DWOA 3L8EA 3FGOA 3M9LA 1N9KA 3MN1A 5ALWA 1TJ5A 2W4MA 3WK6A 3BA6A 2P9JA 2FPRA 4EZEA 3OCXA 1RKUA 1RMQA 4OD0A 5AKYA 5ALGA 5AKJA 2W11A 5AKKA 4JB3A 1ZD2P 5AVXA 2NYVA 3TLMA 3NANA 5ALDA 1T9ZA 2R8YA 2PKEA 1TJ4A 3WKDA 2YMMA 3QUTA 1RRCA 2FDRA 1S2OA 3EF1A 3CNHA 1T5TA 4YCLA 4C4TA 5AVRA 1LVHA 4ZEVA 1KYTA 4UMVA 5AICA 5AM4A 1X42A 2B0CA 3NAMA 4HGPA 4YIHA 2O2XA 4BNDB 4Y2SA 1YS9A 2WM8A 2FPSA 3AR5A 4HGOA 3S6JA 2YBDA 3L8GA 1U7PA 5AW6A 3OCVA 4FYPA 1WPGA 3OPXA 2ODAA 4F72A 5AM2A 3AR8A 1SU4A 3SKYA 4Y2VA 5AW0A 5AK6A 3AR2A 4I9GA 2VKQA 3OCZA 5ALLA 2JAUA 2AGVA 2R8XA 2OM6A 3OCUA 3KDPA 3ZUPA 1WR8A 4B6JA 4Y2UA 2C8LA 3FPSA 5AKHA 2ZOSA 4J03A 2WF6A 4YCNA 5A3SA 2JGAA 3N1UA 3WK4A 1XPJA 3ZI4A 1RLTA 3U7FB 4CF3A 1Z4LA 2OYCA 5JJBA 1YMQA 4BEWA 5ALJA 1ZD5A 3I6BA 5IT0A 3ZVNA 3KBBA 2FPUA 3QX7A 3F9RA 2GMWA 1CQZA 3QUCA 2RAVA 4YH1A 2D2VA 1TJ3A 4G9BA 3MPOA 3QU5A 2P11A 2HSZA 4DW8A 5AKEA 1Z5UA 3KZXA 3W5BA 4Y2QA 2NO5A 3QYPA 2HO4A 3N5KA 1L8OA 5AIBA 1QQ7A 1Y8AA 3A1CA 1IWOA 2IOFK 5AI4A 1CR6A 2HF2A 4OCZA 2B8EA 4UMEA 4BX2A 5AM3A 3ET4A 5E0OA 2ZBEA 3ZWKA 3NRJA 2YFYA 3WK8A 3L8FA 4OFZA 3QU7A 4XE5A 5AVSA 3D6JA 3OCWA 5AK5A 3FM9A 1XP5A 4L6CA 4DCCA 5AKGA 3U26A 2ZXEA 4YIKA 2Q4TA 5ALQA 2IYEA 3DDHA 3QUQA 3ZTYA 4Y3UA 5ALMA 4JDPA 1RQLA 3N28A 5AKZA 3ZW7A 3R9KA 4QJBA 2G1AA 5AM0A 3IRUA 4ZEXA 4BKMA 3ZTWA 1Z4NA 3U7HB 2Q5EA 4UATA 2EAUA 2JARA 2YMQA 1ZD4A 3FVVA 2WF9A 4HGRA 2GHQA 2ZBDA 5A3QA 4L57A 2HOQA 5ALRA 2BDUA 2WF8A 5AESA 1L7OA 1ZD3A 2FPXA 5AHXA 4BX0A 5FP0A 5AVZA 5AK4A 4F71A 5AIAA 3E81A 3EWIA 5ALYA 3KD3A 4CF5A 2NO4A 3L1UA 5AW5A 5AW3A 3QGMA 2FEAA 1ZS9A 1WZCA 3AR7A 4KNVA 4HYTA 2AUTA 4UU1A 1FEZA 2GFHA 2QLTA 2BY4A 3HLTA 2G09A 3WKCA 5AKXA 4UARA 2OA0A 5AI9A 3OTQA 2O9JA 4BBJA 4MWOA 1ZRMA 3SLRA 3MC1A 3DNPA 5AKLA 3RFUA 4AP9A 1J97A 5AI5A 5ALFA 2CFTA 1LTQA 1Z5GA 4C4SA 1Z4KA 3UMGA 5IS2A 2PR7A 2WF7A 2G0AA 2GO7A 3UMCA 2B1RA 5AM1A 5AI6A 2PQ0A 1ZRNA 3KOOA 1Q91A 5ALEA 1Z88A 4RETA 4UM5A 2CFSA 3EPRA 5AVWA 1RPZA 3WGUA 3AR3A 4UAVA 4UMDA 5ALVA 2G06A 1L8LA 2HI0A 3QNMA 4CE6A 1Z4IA 4Y2JA 4E88A 1EK2A 2CFRA 2Q4RA 2C4NA 2I34A 3FZQA 4UASA 4EX7A 4IG4A 3QUBA 4ZEWA 3KC2A 3W5DA 3GYGA 1U02A 3SD7A 2JAWA 5AVTA 2MU1A 3W5CA 4Y2YA 3ZU6A 4BX3A 4XPZA 5AW9A 2R8EA 3AR9A 2FUCA 1VJRA 3WK9A 1YDFA 2EATA 3A1EA 2FPWA 3WKBA 2AH5A 3AR4A 4UU0A 4KX3A 4I9FA 2RBKA 2B30A 3OCYA 4AS3A 1Z4MA 3NUQA 3WKAA 2ZBFA 3I76A 4YGYA 2G08A 4UAUA 4CNQA 5AW1A 1K1EA 5AM5A 3ET5A 5ALPA 1Z4OA 5AI8A 1NRWA 3M1YA 1Z4PX 4Y2RA 1U2SA 5AW8A 2YMLA 5AW7A 1RC8A 2X4DA 4KYTA 3QU4A 3L0YA 2G80A 3DAOA 4UW9A 3ESQA 2I6XA 3SMVA 2BDEA 1L7MA 1ZJJA 3BWVA 4XQ0A 2B1QA 3ONNA 3CZ4A 5AI0A 3L5KA 1WVIA 3QU2A 4HGQA 3RF6A 3L8HA 3IB6A 1RQNA 4BNDA 2B8JA 1JUDA 1Z4QA 2ZBGA 3P96A 4KX5A 4O8CA 1AQ6A 3ZX4A 2OBBA 3L7YA 4EENA 1RLMA 2HCFA 4EEKA 1RDFA 3NALA 3QLEA 2W43A 4G63A 2HDOA 3WK7A 4EX6A 2R8ZA 3R4CA 3W5AA 3PCTA 1NNLA 3ESRA 4XOUA 1Q92A 2WF5A 3ED5A 1QYIA 4RESA 2YMPA 2P69A 2MSNA 5ALZA 5ALNA 4NABA 5ALHA 2G07A 2GHTA 3HYCA 3WGVA 5AKIA 5AK3A 2IOHA 3U13A 1MH9A 1L7NA 3WK5A 2B82A 4DFDA 1L6RA 3MMZA 3E58A 2C9MA 2YY6A 4NV0A 1L7PA 5AVUA 1SWVA 3B9RA 3A1DA 1F5SA 2EARA 3B8EA 4Y2PA 5ALTA 4Y2TA 2HX1A 1J8DA 3E8MA 2ZG6A 3EF0A 1U2TA 4NFLA 1PW5A 1RMYA 1N8NA 2HF7A 3QXGA 3R09A 5IT4A 2RARA 4BYGA 1Z4JA 2P27A 4Y2XA 3WKEA 1EK1A 3PGVA 2FUEA 5ALKA 5ALXA 4MUMA 4FE3A 5ALSA 1TE2A 1T5SA 1QQ5A 2IOFA 1S8OA 4FFDA 2QYHA 5ALUA 3J7TA 4UMFA 3UM9A 4KNWA 3N07A 4H1WA 3U7GA 3UMBA 3B9BA 4UM7A 2RB5A 4IFTA 1QH9A 2YJ4A 3SHQA 1YV9A 1RKQA 3SKXA 4BEVA 1RKVA 1U7OA 2C88A 3I28A 4KN8A 1TA0A 1YJ5A 3ZVMA 4NAVA
chains in the Genus database with same CATH superfamily
1OILA 2J41A 5DEOA 4CCAA 1JU9A 3DYIA 1GZHB 4H3VA 3F8WA 2E3JA 3EVDA 3N58A 2GKOA 5K9ZA 3K1ZA 2AWNA 1NF2A 4JK3A 4PHCA 4KAJA 1I4LD 3DE5X 1VL6A 4P32A 4AO7A 2GCIA 4TMWA 3F74A 2DHQA 2PLAA 3B78A 4FEGA 2CVZA 3F3YA 1JTFA 2H1HA 4JI1B 4BIMA 2CVPA 1FC0A 5JCPA 2IELA 2IQIA 4PFJA 1TCUA 4FYVA 5EJ6A 3UMMA 2Z1MA 5J1TB 1Y9AA 4PC1A 1JAIA 3NYRA 4KC0A 4RA9B 4IIEA 2WWHA 4WMLA 4FKZA 2V1XA 2CFOA 4EG0A 2W00A 1CULC 2NZUG 3D5QA 3G5AA 3WGYA 3BT7A 3KQSA 4AUEA 4V0RA 2C99A 3Q7PA 5BOSA 3KJNA 2Z4SA 3GFGA 1M54A 2ATEA 2VTEA 4FYJA 3E22B 4KWTA 4RXUA 5EY5B 4A82A 1J0AA 2OHGA 1E1DA 1QJ4A 3A6EA 1A1SA 5FNVA 5EHNA 3D4PA 2WIFA 2X40A 4IW3B 4COOA 1CQWA 1CC1S 2IEZA 1L8XA 1ZH6A 3QLTA 4R51A 1K4KA 3SHFA 1XVIA 2TYSB 4J76A 1CR2A 1PNOA 3SNKA 1UBRS 4B2IA 4BATA 4P6VF 4C5AA 5FFFA 1RIIA 4HAUA 4BBZA 1J8VA 4O02B 1EQ2A 1MOPA 3YASA 3QVLA 1N8TA 4YYZA 1ENYA 1VHLA 4RKRA 1O4VA 1ZLXA 2JW5A 2BI7A 2D06A 5KI6A 1N0WA 1I13A 1YCHA 2VXCA 4V0KA 4JJZA 4RKYA 4RHTA 3C6BA 1DS6A 4HBGA 2WHRA 1IK6A 1W73A 2QRGA 3SBEA 3HCOA 4R71A 5DOZA 1VYUA 2PGXA 3LYHA 1EX1A 5BURA 2C7OA 2FB9A 3D6FA 3ZQ4A 1ODKA 2SCUB 3KSBC 2Y99A 4PPYA 2BGUA 4X1IB 4MJLA 3LY8A 1E2IA 4KQKA 2Y8EA 2D5CA 3QKSA 2PA3A 2ZT8A 5BSVA 2J5QA 2HRQA 3FCAA 4LXXA 4BP8A 3TTXA 4B71A 5KSZA 4I08A 3WIDA 4R8RA 5BV7A 1EDBA 2C04A 3O75A 1GZDA 2B0CA 1T5IA 2K2WA 2VF5X 1CDZA 3KJFA 3NAMA 1EGQA 2ACEA 3T41A 3VPCA 2O2IA 1P4SA 1Y1RA 1M83A 2D00A 1KH1A 3VMMA 9LDBA 2WM8A 4ECEA 2DWOA 5FLXA 1Y6GA 1REQA 1YR7A 5JRDS 4M37A 1YQWA 5TEWA 1TQHA 4O5OA 1C4OA 3V2UA 3SI7A 1DEHA 3BB1A 4HADA 5B64A 1SIBE 2A1TS 2DTEA 5CG2A 3R74A 1EWTA 1XQ6A 1AKUA 2A9FA 2YUIA 3QOYA 3DVQX 3IELA 3OPXA 1GG2A 2ZIUB 2JLSA 3PB3A 1PJSA 4X63A 1WMBA 5FLEX 1EFRD 2PQ2A 3LJKA 4GDMA 5FKJA 1PCXA 3IS3A 1DC3A 2XNCA 1BE6A 1QIHA 3OA2A 4G5RA 2VRBA 5DHAA 4EG5A 4QOGA 2HPHA 1UAAA 3G9TA 1T15A 3OCZA 5J63A 3D8BA 3TDMA 2AKYA 2W71A 3MOSA 1XD2B 4JC5A 3WGMA 3DVSX 3GA7A 3O4GA 2XE4A 2J48A 4MYCA 2ADOA 3OF5A 4QUEA 2ZOSA 5JCJA 2QS9A 3MRTA 2LNDA 5ELLA 5L7WA 4HWOA 2WB2A 2BGMA 3OZTA 4RTQA 2WMYA 4Y6SA 4FN4A 5JJBA 2MTBA 1W5BA 1ZD5A 3T5DA 5HQ3A 1KQGA 1AK9A 3QX7A 4PPQA 2V6JA 4MAMA 1ZC4A 1FP6A 2D2VA 1R4MB 4F7DA 1DUIA 1I3MA 1U5AA 5C18A 1EAYA 2AK3A 4TT8A 2JIZA 1N2JA 2Q50A 3K8YA 1ESMA 4RH0A 3NP9A 4U63A 5AXCA 4ACAA 3A4VA 1P77A 1UF9A 3BBLA 3JQ9C 3KKOA 4KFRA 2AC7A 1XVLA 3PD0A 3TBHA 2J33A 4D9EA 3SJ7A 3DGEC 4CV1A 4B3GA 4F5YA 1MJHA 1CUBA 1CUGA 2IOFK 4U7DA 4L0MA 1E9RA 2X4LA 2FPPA 2IBTA 2N1BA 1SXJB 2CXTA 4UKDA 3CQ9A 2P2SA 2BGJA 5FPTA 3DBHA 1KO1A 2CHVA 5EIAA 2PV0A 3OJCA 4EA6A 3QP9A 1CNMA 2CW5A 4G8JA 1PE0A 3H2GA 3L8FA 4OFZA 4EQZA 3I05A 3OQHA 4C0WA 2WABA 3B6IA 1ANKA 1RKXA 4DS3A 3U4QB 4EITA 3E35A 3SYTA 4GVLA 4Y6GB 3Q2OA 2WHPA 3KL2A 5EP3A 3V4FA 4YHBA 3CLRD 2O2ZA 4G8DA 1JDJA 3F78A 4QPZA 1CQJA 2ZXEA 3LCUA 3PF8A 4UE2A 5EIWA 3SSMA 4A1FA 1E2BA 4I5IA 1CJVC 4G81A 5BNTA 3PHLA 1NVBA 4YRMA 1EE9A 4LQ4A 1OGYA 4M53A 1SJ9A 4RNDB 4EPTA 1E1NA 2G1AA 4A03A 4PR3A 4Y6LA 5E8RA 2XMDA 3JQAB 4NS1A 4EHIA 2RG7A 1TT7A 1XG5A 2FUG1 4HOYA 4JY7A 1T91A 4L5AA 2JJQA 4NV1A 1IOZA 4NYMQ 5IVPA 3HA3A 1AV6A 4CKCA 5FL7A 1EMDA 3W78A 3FOAA 4QBFA 1KY2A 3PC8C 4NENA 1BXGA 4MUHA 4ZCLA 2BFWA 3FAZA 1FTGA 4UBJA 4TYNA 5IARA 2WF8A 1BDBA 4LHZA 2CJYA 2MIIA 2OKGA 1KRHA 5AK4A 5AIAA 1WUIS 1E69A 1C3LA 3GAFA 1RR6A 3F6RA 3K9FC 5CT8A 1DAIA 3A32A 4WESB 2OP0A 4XQGA 1K9SA 3KD3A 2IU0A 1G5QA 1M2HA 1GA6A 2FN4A 3FWHA 1IHYA 3JWHA 1X70A 5DRTA 2B4AA 1M2VA 4R1OA 3J81k 2RHDA 3A6ZA 4PAMA 3FVTA 2PM8A 3WMXA 5CPBA 4NCJA 4ZOCA 1HI9A 3KPVA 2NQ2C 4I6JA 4R1MA 2P4QA 2C29D 5H1YA 5HKKD 4JLMA 2QU7A 3N8NA 3P8ZA 1SCDA 1I1OA 4A4DA 1QS0A 4TQUS 5AJUA 2CB9A 3ZXUB 1N0UA 2O9JA 4D41A 1KY3A 1CQIA 2I2WA 3GJ8A 1KJ9A 3OO1A 4DL9A 1D07A 3PXCX 2QRZA 1E32A 1DIBA 1UOOA 3SLRA 4BMXA 2XMBA 2BI8A 4KE7A 4MV9A 1I0LA 2HCBA 4ZCQA 4B32A 4DVGA 1JJFA 2O7RA 3OLXA 1FU8A 2D3TA 2XKAA 5F5NA 5HFJA 2Q7OE 3RFUA 1UAGA 1L4FA 3EH2A 1YA8A 3D8RA 1PS9A 3WGKA 3P0FA 4R6XA 4WLNA 1YI1A 4NYJR 4XUGB 5CEFA 2D7DA 3IPAA 1F8UA 4EHKA 3USZA 1QPGA 1GPAA 1XTPA 3AOGA 2LVBA 1G2OA 3C3AA 3FTPA 1NVUQ 4O2LA 4OO3A 4YLEA 3SJUA 1L4MA 3U7IA 3ZGVA 2PZBA 2DFKB 2N75A 3N0TA 4HRYA 3M82A 5DMHA 4OHYA 3BD6A 3WMFA 1SCKA 1FRZA 3PIRA 1N5MA 2GPBA 5C1OA 2Q4EA 3RG2A 3WYNA 2B1RA 4F4CA 1VTKA 4NHOA 1DG3A 5AI6A 2NPFA 1Y9EA 2Q9CA 4GZ6A 1K6MA 2VJBA 3C97A 5F7XA 2PS9A 3RASA 2JZCA 1KEPA 1Q91A 3UFBA 1E0JA 3DA8A 3PIIA 3N2IA 1W5SA 5ALEA 1ZCFA 4C2BA 3PFKA 3GHYA 4EY3A 4P3NA 2QM3A 1NUTA 2HNKA 3H9BA 4JJAA 2RJNA 4MVJM 3VNVA 3IKJA 1XMPA 2WC1A 3LCJA 3ORSA 2GFQA 4P93A 1P80A 1W2GA 2Y67A 3FNFA 1PNRA 1DBQA 1THZA 4MZXA 1A4IA 4FGZA 4F5EA 3M1LA 2GLUA 1VBMA 2I34A 4COKA 3TI9A 4L76A 4YFVA 1X7WA 2OHIA 4BFWA 3PE3A 3OURA 4RXMA 4II2A 3QUBA 1ZMXA 1X8KA 3G1UA 1PJRA 1RXIA 5KU1A 4DR2B 1JLLB 1P6QA 2C5GA 1NJ2A 4C08A 1LH0A 1FXWA 3RSOA 1M10A 3OX4A 4B2LA 1G8JA 3OJWA 2E1PA 3ZZUA 1PZMA 4WZAB 5C46F 5E6SB 1H8HA 2GRUA 3WLKX 1GQYA 5FWDA 1ACMA 5IKOA 1QZUA 5BN3A 3LT4A 4J4TA 5REQA 4FD3A 4LXQA 4CQJA 1OFUA 2P65A 1RWKA 3BL6A 1H9AA 1R4NB 4BP9A 1JWBB 4RBNA 2WLTA 3DEYX 5KC9A 2KPOA 1SK9A 3G2IA 2NXEA 3NWOA 1QFYA 3GPDG 4IFIA 5JZVA 1OFIA 4G0VA 1GRNA 1JHUA 2B92A 3T38A 4QATA 2F1HA 3AF4A 1IL0A 3SBDA 1I5EA 2I2DA 3FLMA 1KQOA 4HAWA 3DUFB 1RWWA 1MO5A 1UBSB 3J7AC 3CF4A 1LDGA 3BULA 4PINA 4MRMA 5FEMA 3ET5A 4P9NA 1HR0B 2GCEA 1SVNA 4L9SA 1GLVA 4L50A 4LJSA 4MIKA 4NCXA 1HDCA 3NM5A 1RP7A 1SULA 2JGNA 3VH2A 3EW7A 4NF2A 4W82A 1MHPA 3IODA 4XDHA 4ZQFA 1LK5A 4ZDWA 4B4OA 4ZDJA 3MWFA 5KVCA 1GZSA 4DIKA 3C7CB 1L7DA 4R1TA 4HK4A 1YFKA 3W8NA 4QHTA 1J9ZA 3HKEA 5KNLA 5MN6A 1AUPA 3LW7A 2ZE6A 5IXSA 1A88A 5EMKA 5KKAA 1YZYA 4MPPA 3RCBA 3I72A 3DZFA 3L07A 1YS2X 2WJ4A 2XRYA 2ZB3A 1R0YA 4CTNA 1J8FA 1YIDA 1RXWA 3IB3A 5BR7A 1N4DA 2PA0A 1UXGA 1JDBB 4S24A 4Y0NA 1M1UA 3VXKA 4ZZIA 5L3QA 1ZVMA 2FY8A 1U9CA 2JS7A 3N6RA 3IQXA 5TGTA 4H77A 5FTLA 4M0EA 1JP7A 5I8WA 2ABWA 4YRZA 5JATA 1QQBA 4G8BA 1WKVA 1Q3KA 3OOHA 4IMRA 3SYMA 5IDQA 3I8SA 3BH7A 5CU7A 3BXOA 3HFSA 4G5XA 4KV7A 1T0JB 2W43A 1OI4A 3IUNA 4EABA 2BFEB 4D6YA 5EZYA 3LWDA 5HCNA 3UPUA 1A9TA 4EAAA 1P4RA 1MB3A 3B82A 1EX7A 2COUA 2VP0A 5IN4A 2QPAA 3CLTD 4QE3A 5EE5B 5L6MB 4ZVUA 1I33A 4Q3LA 1LRLA 5COQA 1QIIA 3DCNA 1H4VB 5CT5A 3B6EA 3W8FA 2ZI9A 2IS6A 1DRUA 5EWMA 4K86A 3V6LA 1FYVA 1M1XB 2IPLA 2VDKB 3EFHA 3IP8A 1LBHA 2GJ8A 2Y3IA 5DASA 3T0FA 1PVOA 3D3JA 2NSJA 3ENQA 5ICFA 3H9JA 5KAMA 4A3SA 2I4RA 5IZ4A 1YE8A 4FGUA 4YWJA 2WM3A 3OZVA 1JAHA 1KH3A 2ZRKA 4V38A 3UWOA 2QTNA 4WZBB 1PR5A 1KKLA 1T4DA 3CW2A 4D9KA 2DY1A 5AVUA 5FWNA 4RMIA 4LIPD 3A1DA 2Q3DA 2JI7A 4PZZA 3BHMA 4TOIA 1A04A 4D9GA 4WGGA 1ND5A 4JEIA 4D92A 4PWZA 4EF4A 1SQGA 3ANSA 4B3FX 2O0JA 2L19A 3JR7A 1H1LB 3QWFA 1DJLA 2PR2A 2XH8A 3WMEA 2Z5LA 1JFRA 1QSGA 4HEHA 1LK0A 1E5QA 4D8YA 3PNMA 4DIDA 3NX4A 1BQ3A 3MT7A 1GT6A 2ZEJA 1Z6TA 2ZR7A 3OLWA 2RARA 3G2HA 1NBHA 2PZFA 3HACA 4AP6A 2KI5A 4QO8A 5BNFA 2PMDA 2ZWMA 4E70A 5E0KB 1EK1A 1NYRA 1IJBA 5KMGA 1E3WA 4LXIA 2FOLA 4M54A 5DP1A 3WWPA 1IATA 5EIOA 4B4VA 3I6MA 4TKLA 1LGYA 1RWPA 1S9DA 2ZP1A 5BYBA 1XNQB 1GPWB 1K3FA 5IABA 4NP6A 3EH1A 1YQUA 2DLNA 5F51A 4KKVA 3HXQA 2E0IA 1THGA 2VDQB 4B3BA 5KJ1A 4BUCA 3A6GA 4QDOA 3UJPA 1XHEA 4XB1A 4CI9A 2C96A 4LNHA 5U1PA 1ULSA 5H7XA 4ER6A 4M3NA 1EFRA 3AESA 5TPWA 4G23A 2UV8A 4PY2A 3LK6A 3HJBA 2XWBF 5ENZA 2TMDA 3UT0A 4CT5A 1EBFA 4F4IA 1J7KA 3O4JA 1CP3A 3AXSA 3H9CA 4LZJA 2ZROA 3H1BA 1NYTA 2NU9A 2YWGA 3AH8A 4OLHA 2XT9A 1Y3DE 3SHQA 2OHHA 2WZQA 2GK6A 2AN3A 4L8WB 2QV7A 5CFOA 3SKXA 4PLCA 1TUBB 2IEDA 4BNWA 1UPTA 4LSGA 1JHDA 1CUSA 4PZ9A 1Q1NA 4F9EA 2QBYA 3A3NA 3PA8A 2FEPA 4EQ6B 2C88A 4P4LA 2FZ5A 2JZOA 3CE6A 2ZAIA 3UJDA 3AF0A 4XLZA 1F12A 4RHEA 5KHLB 2ZRNA 4QQFA 1XDZA 4QJIA 3ZX5A 2WFAA 5A4IS 5HUQA 2DQSA 4K6FA 4EHJA 3P9PA 4JOCA 1ENPA 4PZYA 5C34B 1VJ5A 2MSWA 1CJBA 4EEZA 3TTTA 5JNRA 1FVOA 1XNGA 5CXSA 1QANA 1XMIA 4J3JA 1DWOA 3NHUA 5JSKA 4FMDB 4AW9A 3MD9A 2QD2A 3KXKA 4OHXA 5J4HA 1X87A 2DFDA 4DY6A 1PL8A 3SHOA 1NC1A 3BXFA 3GLHE 4JGGA 1Z62A 1U0FA 4HEA6 2HHAA 2O1EA 4RA6B 2GNOA 5NULA 5THXA 4YJKA 4BNGA 2F90A 4RF2A 1QZZA 4MJXA 1II0A 1AKVA 1MUUA 1S8AA 1UJ4A 4YRTA 2B4RO 3RTGA 1PJBA 4MLPA 3UJ3X 1XF9A 4RJLA 4YQEA 4B0PA 3TQSA 1EUDA 2H1IA 2VSOA 3DPUA 3C4JA 2HHLA 1CY1A 3BOSA 3CNBA 4PLFA 3HKDA 2A58A 5SICE 4RAQA 5CVEA 3QEMA 5JSQA 2R1VA 5CT4A 2XOKA 3SN6A 3P7MA 3USES 1GDHA 3W8DA 4ZGGA 2X3UA 1JSRA 1RSZA 4OVKA 2A7QA 4MYRA 1Z8DA 3SMQA 5FTKA 3UOAB 4GL4A 1YU9A 2RIRA 1XMSA 1QU2A 2A4MA 3GDFA 1OFGA 1VKRA 4NZNA 4LGYA 4B35A 5LMUB 2LXNA 1T3GA 5CX1B 3AM1A 4B84A 2O3QA 3MN1A 1U0JA 1OMOA 1UDWA 3L6BA 3S2SA 5BWMA 2IX3A 4TQ9A 4QTYA 2DWPA 2CCGA 5BORA 3MOIA 4XFKA 4DG5A 1G6OA 4RLSA 4JQSA 1NYLA 3ANNA 4KLZA 2C2KA 1SKYE 4KVZA 2Q1UA 4TRNA 4BIIA 1UJ5A 4I1UA 2V5AA 1GLNA 5HQJA 4Z99A 5B37A 2GVNA 1KH2A 2OO5C 3LDUA 3Q4GA 1BHSA 1U11A 2NSDA 3PBKA 4G41A 2QP4A 1NUPA 2ZT6A 3JVVA 4KB5A 1XZEA 1WUJS 1C1XA 4NYMR 3EHEA 5TJHA 2C9ZA 3I09A 1SFRA 3E7DA 5FNVB 3DM5A 3WKDA 1RAGA 1R00A 1Z37A 4EEXA 1WBBA 2OP1A 2VHVA 3ADBA 2QZZA 1TECE 2VDLB 3EQ2A 5HILA 3HSKA 3SKVA 1XC7A 4HH0A 3HEMA 2DFNA 4IS2A 4YIHA 2EQAA 4GC5A 10MHA 1INLA 3QPWA 3F46A 3C14C 1ODFA 4I8DA 4F2PA 3OZXA 1CB0A 4KGZA 1X38A 4YRLA 5EVCA 5J2UF 1G2PA 2C9YA 4JSTA 3ZJYA 2D2EA 1TLFA 1ZYUA 1WL8A 1KI6A 3RK0A 2UYHA 1MW9X 2OECA 1EXMA 1BVRA 4K8RB 3MWEA 4ZGBA 4ZDKA 1M76A 1NOJA 3H4MA 4LWOA 3HADA 3N3AC 2GWRA 1XO1A 2PSFA 4BMCA 1AQUA 4G0MA 5FWXB 2WVAA 4JC8A 3A37A 2ODAA 2VTVA 3AB7A 4TX1A 2GQ0A 3P2MA 5IW8A 2POCA 3H1GA 2YZGA 2Y4NA 2JKVA 1G55A 4B7XA 2COKA 3D7RA 1U0HC 2CEKA 2UYGA 4OHVA 2C9BA 1L8QA 3UKOA 4GX5A 3BXPA 3QKSB 1PWHA 3OE5A 2VJDA 1SRRA 3W0LB 3K6SB 3QI2A 1U4SA 1AE1A 1P2DA 1ULZA 3IEIA 4JMLA 4OX9Y 4UUMA 2XD9A 3MFYA 2BEWA 4DVJA 4WKOA 4ER7A 1BDHA 3CV3A 2WA1A 1N2OA 1G17A 1F9EA 4AN1A 1GTZA 1D7AA 1KSFX 1WXGA 1REQB 4GFDA 4DC9A 1TOAA 2JGAA 4RK4A 3SXUA 4BHTA 4FMDF 2DBRA 1QV7A 3FMGA 2GEUA 3I34X 3OZUA 4ND8B 1BMDA 4O4HB 1EM6A 1XOIA 2A9PA 2P35A 3E05A 1PLKA 1JIIA 1M2JA 3PUIA 5A9SA 5JH7B 4Q7MB 1D5WA 3E5NA 3SFVA 4WBNF 3RM3A 1YZ3A 4F46A 2ZUCA 3OKCA 2ZTLA 5IMSA 1EQUA 2QSYA 3HTXA 4JZKA 3B1JA 3NJ4A 1DV1A 2OILA 3DC7A 4B9AA 4DW8A 1Z5UA 1RI5A 4FHEA 2CCKA 1H9CA 3P9CA 1W25A 3EIXA 2ZYWX 1Q5PA 4DMMA 3EZ6A 3WLFA 2JNWA 2HV8A 4AF6A 4DUYB 1X77A 5A0FA 4RTPA 3MCUA 1EVQA 1KNQA 4IQFA 3V7WA 1TAHA 5HOQA 2RH9B 4N18A 4NZYA 1R0SA 3HCCA 4WADA 4X7BA 3ILSA 3LBNA 4PONA 3F9IA 3UAVA 4S1NA 1RAEA 3TZLA 3JQRA 4JHXA 3HB7A 4LHXA 1J2TA 4GI1A 2G9UA 2LRHA 5J58A 3ZQUA 2C7QA 4FGJA 3VGPA 4QGGA 4X1KA 5HQ3B 4JP3A 2GM4A 3LC7O 3H05A 3ZDBA 4XGIA 2CGEA 3PFBA 1GZ5A 3ICOA 4FILA 2XWSA 4Q0MA 5J40A 3W2EA 2VJAA 3TZQA 2AN1A 4CF6A 5H70A 3TWOA 4YMSA 3U9TA 3DEAA 7REQB 1GDTA 4MKFA 2HBQA 2J3KA 5ALQA 4DPKA 2HJGA 4RV9A 3GFPA 5DX1A 4YXFA 3P9SA 5F9HA 5D3QA 1T8RA 4OPMA 1O54A 3T94A 3VU8A 3N28A 4QU9A 5F1KA 3ICEA 2YW9A 2Q5LA 4EWLA 1LW7A 2FOXA 2P8SA 3VBCA 4BKMA 4EKNB 1Z39A 2A0FA 2WAXA 4JU8A 1EZZA 3BWYA 2CHGA 1UXIA 3KZ1E 4TMVA 2A0UA 2BTQA 5FNVF 4A2PA 4KFCA 3LWBA 2VF7A 4H27A 4IIGA 4RC9A 4ZEMA 2GOYA 5KSWB 4DADA 2FPPB 2HK9A 2HQRA 2WU0A 2NAPA 3ZQJA 4DUGD 3RRNA 3KJEA 3OQBA 1X1CA 3DBHB 1ZWLA 2ZRFA 1J70A 2JKZA 4F4HA 5CXUA 5BRNA 1ZD3A 2FK7A 2BH2A 2X4IA 2ZIEA 4TSKA 5AVZA 2GUWA 5CFMA 2D7JA 1G2IA 2P77A 3E81A 3VSCA 1SBTA 4HNQA 4ENSA 4H7FA 1Z18A 3R1IA 5D3KA 1WBDA 2WHPB 1ULTA 4B87A 3O4HA 3WL3A 3DAFA 4BLPA 3ECCA 2W2TA 3AR7A 1B8OA 2N47A 4KNVA 3WGNA 3Q15C 5IH7A 2ZREA 4LCBA 3WL4A 3KKPA 3T9FA 3OOEA 5EIBC 3HLTA 4E07A 2X6RA 4G5SA 4JT9A 5HVNA 2P9HA 2BFDA 2R60A 4OKNA 1V6AA 2Q6VA 1YAHA 1HRKA 1NKTA 4UE6A 1AXEA 3KXIA 4Z1OA 4CKCB 4A10A 1TC2A 1TFUA 1ZCBA 3UXMA 1KOFA 3MC1A 3DNPA 4S05A 4X6UA 2BHSA 3GLIE 4NENB 3PQDA 4M49A 1BXGB 2XYQA 5CM9C 1LTKA 1FVXA 1IQRA 2JD2A 1XV5A 1WXWA 1MEEA 1PHPA 3OMXA 3UGJA 4WXYB 1VMKA 4C7VA 5EG5A 2I3DA 1XTIA 4YDQA 4QT0A 3IULA 4A8JC 2R1TA 1Z4KA 1J06A 4O4HF 4N8EA 5K99A 3K0SA 1LPNA 1Z2NX 1KIAA 2AB0A 1QG6A 2GO7A 2V74B 1JVBA 3GNSA 4EJMA 5JH7F 3E1GA 3T7TA 1ESDA 2B20A 3ROGA 2EYQA 3ACCA 1MP0A 3EPJA 1JIJA 4Y30A 4ASUA 2MWMA 3BK1A 3WZMA 1DAOA 5LYJA 2VPZA 1YA6A 2CXPA 3EQ6A 4EJSA 3W9UA 1JPJA 4GQBA 1CQIB 1VG8A 2VPYA 2JAQA 3TL2A 2QE7D 1DWPA 4RTSA 4W7HA 1XU7A 4C6RA 3R3UA 3GELA 3SS9X 1Q7TA 4KOEC 2QN8A 3OPYA 1BROA 4EB6A 2WWYA 4FONA 3HU5A 3ZZNA 2R00A 5GJCA 1ESZA 1GQRA 1PS8A 2HH9A 3D3EA 2JD1A 4W8OA 4OFWA 2W2LA 1AQNA 3HFRA 3IVXA 4GOJA 4EX7A 2XHEA 4A6DA 3NV9A 2D0DA 2AG5A 1LWNA 3DCJA 3KC2A 4IXTA 5CLLA 4YCSA 1S2MA 4Q4HA 2FG6C 2UVQA 4N3CA 2C4MA 3NHJA 2J30A 3QOXA 3DO8A 1VM6A 2W0SA 2XB4A 3A4IA 3ZU6A 2H06A 2PMEA 4D80A 4HAYA 1I2AA 2IS2A 3K70D 5DSTA 4MR8B 3RUHA 3DYBA 4MQ6A 1TA4A 2UUOA 3O1IC 3X3HA 4RDIA 4WIAA 1N2CE 1ZDMA 4XEUA 4XVQA 5JWHA 5LP6C 1T5OA 1WDKA 3FETA 4FS3A 3JW8A 2ECKA 3VJMA 2W2OA 4OGFA 5MDHA 2PWPA 1N2IA 2G71A 4KYIB 4AS3A 4BJHB 5JWOA 2C2YA 3WB1A 3E9YA 3F3SA 9ABPA 1NVMB 1NXTA 3P9XA 4XFDA 1EH5A 5IDVA 2P4EA 4TVBA 2JA1A 5CYOA 1NG1A 3HCBA 3HJCA 1GKUB 1X7WB 4R7TA 5JS8A 1E2DA 2VBCA 3K1YA 3MMSA 1GQOA 3KOXA 2E89A 4A0RA 1K7SN 4F5ZA 1E5DA 1X1RA 1UP7A 2C92A 1UOPA 1WIWA 3LY5A 1J5XA 5I9LA 2VT3A 1B6GA 3VPFA 1HDXA 2PRYA 1IXZA 2ZBUA 4DA9A 4Z6KA 2XUPA 4IGAA 2OFFA 1I7SB 1RC8A 1LI4A 3FE2A 3JRWA 4EUHA 2JHGA 4YWHA 1AGPA 5BN3B 4V0NA 1JR3E 3CIFA 5REQB 4N48A 2G80A 1R9GA 5ARDA 3UENA 5ER6A 1SBQA 2JGLA 2H92A 4JC0A 1ESNA 4ARSA 4O3MA 1YR3A 4ETMA 2IIPA 1XRPA 2RMKA 3BG5A 2ZRQA 3AF1A 1SPBS 4OK3A 3IUJA 5FRDA 2JRLA 4FW9A 1ECPA 1KY5A 3QU2A 4N39A 2G04A 4G0PA 4UULA 4UVGA 3HABA 1U28A 2E6UX 2PGAA 2SNIE 4L8FA 1TQ8A 3F97A 4NJEA 2ZRAA 2P4HX 2R11A 3IAM1 2W8BA 4Q6WA 4BKRA 3PD1A 4RQAA 1L6IA 3K5WA 2IHZA 4MRMB 3W6ZA 3ONWA 3HC7A 4LV5B 1TK3A 3K0EA 2QTZA 3A2LA 4FKBA 1I24A 5JU6A 3HWSA 1H69A 1M67A 1VJTA 2NZVG 4RTJA 2HDOA 3KT8A 3SQMA 4ZOAA 5LJLA 1HDGO 1HDOA 1G8KA 1B6TA 1QX3A 3H2KA 4RU1A 4B81A 5DSXA 2HYDA 2UXCB 1NASA 2O05A 5GOTA 1UKEA 1RBQA 2GAJA 2Q3FA 2WMNB 3AVWA 5J2TA 2QTHA 3AHFA 4NMMA 4QLOA 4W5NA 3C3EA 1WZUA 2AOVA 3RTAA 3ZU2A 4CG1A 1QRTA 5A6SA 4D43A 4AZVA 5KREA 3GLGE 3ZI0A 2FRVA 2ZWAA 2I71A 3CO0S 4R1NA 4RWEA 4LI0A 4OBWA 3X1JA 4GZLA 2YVUA 1H2HA 1M33A 5BWBA 4P81A 3B9RA 1TGYA 2QF7A 1N6RA 1CJKC 1DO0A 3NHKA 4V02A 4Y2PA 1IXKA 4HC4A 5DDIP 4MINA 4LQDA 1ST3A 1BEUB 1RE0A 3KZMA 4EVIA 3EA0A 3I1IA 1N5IA 1MAWA 3EF0A 4R83A 1YMUA 4TV8B 4WINA 1URPA 5FBQB 2V54A 1XFAA 4D26A 1WZNA 2QSJA 5EZYB 4KXNA 1B8VA 4MWBA 1IZYA 1QK5A 1T5LA 1NP3A 2HSJA 3DKKA 1QO7A 2DRIA 3SJAA 1LPSA 1YC5A 2WV9A 3EVTA 4W5JA 4DSTA 5JEDA 3MVEA 5JAZA 2YZ7A 1P9RA 4GECA 4KH0A 2WY2D 5M34A 4GS5A 3MS7A 3I58A 3PC3A 3GD7A 5JD3A 2JLZA 2OEPA 1AKMA 3S27A 2ZJFA 5EWMB 2DH5A 3IL2A 4DV5B 3OT5A 2V96A 2WRZA 3AUTA 1VSTA 2XGGA 5K3CA 3T9DA 1BCSB 5HM6A 5K8CA 3ES9A 4DKJA 3ROMA 1MTZA 3CZAA 2PX6A 3HCNA 4FI3C 3OT4A 4MVJE 4O4LA 2Q49A 3D8NA 2WJVA 4JKYA 5AUQA 4BFYA 2DWUA 2GN4A 2WSLA 3IDOA 3QSGA 4QNRA 1ZAYA 1XYYA 1W4RA 3UJHA 5DBOA 4GOLD 1V47A 1XQXA 3EXAA 3IALA 3JZFA 3OTIA 4NHEA 5KYWA 3B9BA 3PJFA 4NXMB 5LZ4A 3D1LA 2J87A 3OZRA 2YOGA 2P1DA 4ND2A 4Q24A 2GPJA 1BOFA 4FXPA 2I76A 2RK4A 1RKQA 2HREA 1E0KA 4UREA 4MQFA 3T9EA 3HRIA 1QQAA 1UKCA 3IDFA 5K8TA 3B3GA 1DWUA 1ODLA 3HP1A 3ILVA 4L22A 3I28A 4PR0A 1TA0A 3HR8A 5KMGB 1ZR4A 1FXWF 1E3WB 1A82A 1XK7A 2IEYA 2ORIA 3QU9A 1W6UA 1ZG3A 5L51A 1J8MF 3LW8A 1X7DA 1C0EA 2WWRA 4JLAA 1MIHA 1N2HA 2X0NA 3VC3A 1QC5A 2XJ4A 4P5PA 1NBMA 4C2AA 2PZGA 2QG9A 2X5KO 2WVGA 4ZZ1A 5CFNA 3TPZA 5JDIC 2HJWA 3NONA 5FHQA 2Q6OA 3U48A 2CLSA 4RGQA 5C8ZA 3FPBA 1RADA 2I91A 3OM1A 5TPWB 2Q3HA 1B8NA 4KAFA 3VO2A 3EBOA 1AA9A 2E7ZA 2BZ1A 3IOYA 5BUQA 4HX9A 5EJEA 5EVJA 3AZPA 3N8DA 3RW9A 1B16A 3MQ2A 2GF2A 4OJQA 1CY8A 2EC5A 1GRVA 3TMAA 2YFHA 4ZAYA 4OSPA 2NU9B 2GEDA 2CLDX 2RKBA 2PLWA 4NWIA 2JANA 5IXJA 3GN1A 2HJVA 2Z2JA 4TN1A 1PT6A 2D8AA 1SZCA 1T2VA 1VE9A 2GLXA 3BXEA 1YH3A 1G60A 3D7SA 1M34E 2AOUB 2CNBA 4KXMA 3REQA 4CF4A 2QBYB 1IZ8A 2DT8A 4KFUA 2UYYA 1GQQA 2J0VA 4UD6A 4NMHA 2VA8A 4CLDA 2XMQA 1AMUA 5JQGA 3E84A 1EZ1A 1L3BA 4QFCA 4U6SA 4ERXA 4OXYA 1RM4A 3U7EB 4PVDA 3L0OA 2IBSA 5KQPA 3KSMA 4CT0A 1MENA 5EGNA 4IHJA 2Z1NA 4L4YA 3RHTA 1RJGA 4C6TA 4E2FA 3IUBA 1P2GA 3OZWA 3WLIA 5LJIA 4N12A 4MUFA 4NJMA 4EAQA 4V0MA 4FFWA 4C0QC 2W4MA 4N01A 2ZS7A 4UHDA 1XTVA 1NE2A 3WK6A 2XEXA 3GCZA 3K2BA 4EZEA 2R7AA 3M5CA 2IYFA 4D8VA 1SIWA 2VNHA 5B6JA 3JAWA 1EUDB 1RKUA 1PL0A 1XEAA 1SVSA 1CUIA 2VSYA 4IGEA 5LQUA 4KTTE 5SZKB 2JVIA 3T4UA 1SC9A 3HKDB 4JB3A 3FMIA 3QEMB 2BCJQ 3GPIA 1JQDA 2R1VB 4JB2A 3NANA 4TV8F 4DUGA 3DNFA 2A9RA 1T9ZA 2P75A 4FHZA 2ZRDA 2EJTA 5EZYF 2QL7A 5J3JA 1V4BA 1AT1A 3HJHA 1FFBA 2GR9A 1OIWA 2YN2A 3A6LA 4LVNA 1NG9A 3B3JA 3QE3A 4EL0A 5AM4A 3MA0A 5KWIA 1XTRA 1YZNA 1WUHS 2XEDA 4LN1A 3ZHUA 1PSWA 1TM4E 1Q7EA 4QGFA 5HYVA 3IIKA 1WCIB 4G5GA 5BW6B 1BJKA 1VLMA 3EGWA 2QZPA 4DQLA 3TIGA 1FLNA 3E53A 4R8SA 2SHKA 2Y0PA 3A3OA 2JFPA 4LXHA 1LCIA 1X1TA 4FNOA 4UEWA 2XLCA 3TSYA 2W7TA 3QG5A 4BJ1A 2PJDA 5KYTA 5I9TA 4UZSA 2FMUA 3FTFA 2ZU0C 4AZWA 2C9CA 4QECA 8GPBA 2F17A 1F2VA 2H8GA 3SS8A 4CQMB 4D0GA 1V96A 1R6AA 1QO0D 1TQ4A 4C7XA 1MB4A 1C1XB 1DMRA 3IH5A 5KC8A 1S2NA 3LFUA 2J0QA 2VAXA 3RLFA 2F9MA 3RHSA 1J0CA 2JLXA 4BRUA 1IOVA 2VKQA 1ID1A 4EMTA 4QGBA 1SVMA 2P9QA 1GYRA 3R0XA 4NCKA 4OH7A 4D3XA 4GE0A 3IBCA 5DM0A 5CEEA 3JZAA 2JFHA 3I01A 2JIMA 4QDTA 3H6GA 4FFMA 1AS0A 2HNBA 3IV9A 4KPEC 4BFCA 2Q41A 5H5JA 5K0JA 3ER9A 2GESA 4ADSG 3RFFA 1Z4LA 3L04A 2NU8A 3MCTA 1KI6B 4F93B 2O8FA 1J2UA 2Z8YA 3EDQA 3J81A 3A2MA 4X8OA 3U62A 1G8HA 4RZQA 1CJSA 5D51S 1G3IA 2MDTA 4EUKA 4GLJA 3RROA 4F4UA 3AXTA 2QE7A 2ECPA 1TJYA 3BTVA 2AXQA 3R6LA 3DDWA 4EHFA 4EW6A 4D6PA 5B2FA 3GDOA 5C4MA 4BLOA 3Q5GA 1L0BA 2EHJA 3TRFA 1OIVA 1XN1A 2O48X 3A6FA 3JXEA 4NCIA 3UOWA 1DIRA 1HV8A 2J46A 3COWA 4FPXA 4PSDA 3N0WA 3HYNA 4J16C 3P2KA 5L3ZA 2VJNA 5F73A 1V3QE 3R0ZA 4GPBA 3STXA 5M04A 2VJMA 2BEWB 3KOWA 4DQ0A 1ICIA 4XSVA 1VHDA 2IYWA 2X3FA 3CWQA 3GFVA 2P9ZA 2QX7A 3BWEA 3NWPA 4WACA 3ZZTA 2WPDA 2HF2A 5H80A 3H18A 2FHPA 1FB5A 2DHEA 5BT9A 2IHKA 1Q84A 5J9FA 1JT2A 1DB3A 1F0NA 2EGHA 3WQSB 3CVJA 2PH5A 3HBMA 3ISVA 3WK8A 4B44A 1A5TA 2R6FA 1TI7A 5K0FA 5A9SB 1O0BA 4J7XA 2P2ZA 4WCFC 4L5YA 4DE5A 1PWEA 1XP5A 3BKXA 4LYAA 3ABQB 2X7XA 3COZA 1JEJA 4P3PA 3KYCA 5DK6A 5LZ7A 2J3HA 3L4BC 4LKOA 4A15A 3EMDA 3PQ3A 3DD5A 3MCAA 4YCJA 2G5PA 3GEPA 1GFZA 2NACA 3HV0A 4HMPA 1S2IA 3AKEA 2G9QA 4L72A 2G25A 1FJXA 1G3UA 4OX9B 4MRSA 2O50A 2E37A 3GF4A 3DV0A 3HJNA 2ZRCA 1A9YA 3R3XA 4LWZA 1P7PA 4QJBA 4TKVB 1CVLA 3SXJA 5JADA 2CJPA 2XXAA 4XYGA 2ZCUA 4TWRA 1FSSA 3DZJA 1G8PA 1W0JD 4JQZA 1JFVA 3TNYA 2QVCA 4BB6A 2DHCA 4EJ0A 4XGQA 4DEXA 1KZYC 1WETA 4QVKA 2JB9A 1DHTA 5A3QA 4Q7QA 2D1YA 4E94A 1KSGA 1FS5A 4FLEA 4DHWA 5J4YA 3R7FA 3SEAA 2B4YA 2WKQA 1S1CA 4X1KB 3SK0A 5BSEA 4Y1RA 5FP0A 2WWTA 2IYPA 3W2GA 3K71B 1R6DA 1GUAA 1RHQA 3AF5A 2Y0BA 1A9PA 4FNMA 3PEVA 2H2AA 3DWIA 3KQMA 2QNIA 1D7OA 3ICWA 4JJ8A 5CP8A 9LDTA 1RJFA 4UDXX 2CL5A 2HA7A 5AW5A 5KTOA 1HX7A 5BR4A 4I6EA 5LMCA 2CSXA 1E4OA 1WLYA 5DI9A 1UFVA 1E3SA 1P6UA 4IGIA 2F64A 3NDJA 1E3DA 1FEZA 4Q19A 4JL6A 4YAUA 1R10A 2B4KA 3I1FA 1X1QA 2VCHA 4V1CI 4YECA 2CHFA 3TXXA 4YT2A 4EW3A 3KWMA 1NJ8A 4JZYA 3GUCA 2BTQB 4L85A 1H2XA 4BNNA 1FP1D 1WB4A 5I7SA 1LSUA 2HWXA 4YUZA 2H0QA 4OMCA 2ZDQA 3VDMA 1BS9A 1QH1A 1S02A 1U2ZA 1XLWA 2I4TA 3R3VA 4W9RA 2G72A 3W9BA 2PY6A 5I3CA 3O9VA 2GN9A 2VBFA 4HDMA 4DM4A 1IBMB 5PGMA 5GGYA 2PBZA 4OB8A 3FD8A 3ZY4A 4N82A 4Q3OA 5DWQA 2H2DA 2HDNB 3ZW9A 4F8EA 5DTEA 2YYYA 4PLHA 3OZAA 5IAJA 3QELA 3OX2A 2WF7A 4NBWA 4AJJA 4AIIA 4ZHSA 4Z7NB 3C3CA 3VFDA 3HU1A 3IKLA 3NCTA 1LSJA 1MJGA 4R9RA 1RXEA 3FSEA 1QK4A 1RZVA 1X1AA 1ZI9A 3C15C 1L9KA 1UH5A 4PPFA 3ZLBA 2YHSA 3OJLA 3LL7A 1QRUA 3PUJA 1HYHA 1VKOA 3PR2B 4F0JA 2BFDB 2VZ8A 3EMBA 3TJRA 5E4JA 3DEJA 1SQFA 4B8YA 5BWLA 2QLMA 4OQYA 1Z35A 1NVXQ 1XMXA 4XCVA 2XD4A 5BSTA 2VSFA 2J6HA 2C7VA 3NT4A 2CFIA 3O8QA 1KARA 5B4UA 3TDKA 3N86A 1GEEA 5K5EA 1U3GA 3P2EA 1G7TA 2P9YA 1L2TA 4Y2JA 4E88A 4CEJA 1UBEA 1C2TA 3CPSA 5E3HA 3KLMX 4G4IA 3GQBB 2ZAYA 1GUYA 2Y1GA 1P5ZB 4KQHA 4N3BA 4RF5A 4AG3A 3PITA 3GRVA 3QVKA 2QE6A 1AKTA 3DOUA 1FDUA 1EP3B 5JFOA 2ZYAA 3BB3A 2IP2A 3BGDA 3D8TA 3KLOA 5EPUA 421PA 1A5SB 4B3RB 5A3VA 4MWZA 3SZUA 3H1EA 3ORQA 2GZRA 4DLXA 5CK4A 3U3RA 5LYJB 1Z0SA 1RYYA 2HLDD 4O1HA 4OGWA 5DYYA 1VJRA 1Q14A 4EJSB 4K3UA 1ZMBA 2DPMA 4GUAA 8OHMA 1UC9A 3O38A 5LWHA 1MW8X 2AG1A 2AUNA 2R6R1 4FCCA 2B5OA 2F9FA 3TJZA 3UKJA 3K0CA 3H16A 5K8IA 3A6DA 1PR9A 3Q9UA 4RVGA 4XD2A 3OPYB 2PZJA 3D0RA 4HS4A 4RIFA 5TMDA 1J24A 2WJGA 3WKAA 1KZ7B 2QLLA 3BQ9A 4RFSA 1RIFA 2RGNA 2QUJA 1NXSA 1PZXA 2NU6A 4N5MA 4G65A 4PQRA 3O3MB 5EP4A 4RHUA 3ZEAA 3OJEA 3W6NA 3QXXA 4B4WA 4G4JA 3Q10A 2PN1A 3ZV3A 2ZJ7A 3OIDA 1UMCA 3I32A 1D09A 3ILYA 2C2HA 1QFJA 2X4GA 4R8LA 1JJVA 2GCOA 1E9SA 4N7JA 3FTNA 1BS1A 3WQRA 5CB6A 3PHGA 1U0NA 2ZQ5A 1KKUA 2X9NA 5F2OA 4YRFA 3A1UA 3PFIA 5DT2A 3RYFA 5EP2A 1A5ZA 2IE8A 2ZBPA 4LOHA 4OF4A 4YASA 3UAWA 5LWQA 2DECA 2H1VA 2C5LA 3HXOA 5LQSA 4CR8A 2WG1A 1X1EA 3FTCA 1ZNWA 1YS4A 3NV7A 4DCSA 4UNRA 7ADHA 1XVUA 2QQGA 4FDTA 4FB5A 3PLNA 4KPUB 5BOSB 1GITA 2CK3A 2LKCA 4IHKA 1QAOA 2E4ZA 2W6JA 2ONZA 4GOOD 4G0ZA 2Q7DA 4KO8A 4OMDA 4IHAA 5IC5A 2I7XA 1UXOA 1XRRA 1NDUA 3ZX4A 2FFQA 2WQ7A 3CU5A 2CF5A 3LCRA 3BMOA 1MEJA 1JJ7A 1ZGHA 3UBMA 2PL1A 4J7CA 4DR6B 4GRAA 4RMJA 3C5HA 2PKRA 3C85A 3QLUA 2Y2UA 3EEQA 4LGCA 1QYDA 2MCFA 6REQA 4EX6A 3WK7A 3FWKA 3J80A 1CHNA 3IUYA 1O1YA 2R8ZA 1ODJA 3R4CA 1CSEE 4D79A 1LDBA 1Q92A 5DX8A 1W47A 2G6TA 2J0SA 1JSXA 1SBHA 4OU5A 1P33A 4GR4A 5JOQA 2CBZA 2E1RA 1F8XA 2ISCA 2KYRA 3G89A 4G6ZA 3U40A 821PA 5JTTA 4JT2A 1QWSA 5C53B 1LF5A 4YREA 1X8XA 3E3AA 4L9AA 1ZPDA 1F17A 5D5HA 4WY8A 1MH9A 1I3OA 2B82A 1TT5A 4MARA 1SXPA 3LOPA 4CKEA 3T9CA 3CIOA 3MMZA 3VNUA 3QVOA 1POWA 3JVUA 1BW9A 3RK4A 1ENZA 1T6NA 1TYDE 2OZPA 3PQ4A 3Q8WA 4LXTA 4NV0A 4OYYA 4RHXA 3HK2A 3L93A 1NVAA 4TYYA 3RRYA 4NJEB 3B8EA 3EC1A 3OCCA 5FAKA 2ISSD 1JT9A 2GF0A 4ENUA 1MPXA 1M74A 2O2EA 1LUAA 2CF6A 1PGQA 1E3MA 1AO3A 1Y9ZA 3C5CA 1FQJA 2E21A 3K16A 4G85A 4I55B 4RJIA 1OPXA 1QYWA 2AEFA 3ETGA 4M9SA 4PLTA 2RGCA 1KMHA 3CSUA 3ENZA 1UM8A 2HF7A 2WJ6A 1K7EB 4P3YA 4R2KA 4BNDB 3U39A 2JVKA 4RACA 3G3EA 3JYNA 4GH5A 5H81A 4LOKA 2I66A 5IT5A 2QW1A 3U7QA 3PQ8A 3QG1A 5CIQA 5IVDA 4EG8A 3U3MA 5J2TB 4J0HA 2ILVA 1BVHA 1RQ2A 2D2XA 4R0MA 2BP7A 5ESWA 5A6SB 4QXRA 4XOIA 5LYJF 2X58A 4IIHA 5EPOA 4F3CA 1RP1A 3IO5A 3A28A 3IC5A 4KH1A 1IULA 1ZICA 4UOQA 4CLHA 3R0QA 1QO0A 2EP5A 3AHJA 1UK7A 3H83A 1I6MA 1RT9A 4HRAA 1JZQA 1KZHA 1VDMA 5TT1A 4PGMA 1UXKA 3HRKA 4LS3A 5KVAA 1SXJC 2WKRA 1UFOA 5E6RA 1VE7A 4I7EA 4HX5A 3UCFA 5HBGA 4D4JA 4KVAA 1KJQA 3AUKA 3O9MA 4YCDA 4DOMA 1BQEA 1QF7A 1RKVA 4FDAA 4YAWA 5F7OA 4PIVA 4ZMBA 3JQBA 3M3HA 1NY6A 1BXZA 1B76A 2Q1WA 1OFHA 2QU8A 3ZWXA 1XCPA 4N54A 1ZH2A 1KDYA 1SN7A 3WP0A 2DPHA 3AR6A 3BXHA 3CISA 3K0BA 1H2AS 3MWDA 4Q9HA 2IH4A 2VUTA 4Y18A 5JT1A 4I50A 4L07A 1IM2A 4I4CA 2H1OA 2HA3A 3FZGA 2CKMA 3HYLA 5HE9A 5A71A 3V4VB 2IF0A 1WCXA 4FQ5A 3I0NA 3NASA 4BWYA 3JAKA 4DMKA 4DCUA 1OZAA 3LHDA 5KEIA 2CL0X 3FF4A 5LBIA 2FQ1A 5HM8A 1K7XB 1E3EA 1QWOA 1RLOA 3LLCA 2JAXA 1G8GA 1XLUA 4P22A 4JASB 5DM1A 5KYWB 1SWWA 4GEKA 4B6RA 1V3UA 5BQPA 1JEDA 4NDNE 4XFJA 1QG2A 4X3PA 2GK7A 4RVCA 2OXCA 3PNQA 4AJKA 1L4EA 3EQ9A 2XUZA 2FEMA 4GIBA 3B60A 1JWLA 3IX7A 3O8NA 2I7DA 1E66A 3K6SA 2REXB 1T2CA 2A1TR 4ITUA 4ND3A 4ZO7A 4YPOA 3OLCX 2NXJA 1AIPA 2QLBA 3DE2X 3KL4A 3BCHA 1W29A 3CSSA 1RI3A 1X86B 3GEEA 1V1MB 4O1MA 1DRJA 2Q0SA 4YP7A 4CL0A 2E6KA 4CM9A 4H3HB 4BNUA 3SFTA 3MGAA 5C37A 4HR7A 4XUEA 1N78A 1QC5B 3EVZA 5F52A 4ER0A 4JXXA 1OH5A 4LRYA 4N03A 1IJKA 4JVMA 4GKKB 1P3JA 2VCYA 4ZI2A 2GZHA 5NLLA 4Q39A 2WILA 2OXFA 2PUDA 5EE3A 3R5FA 3NTQA 3D4LA 3PKIA 1FXUA 1ZNZA 4HUJA 1UZUA 2PCJA 1IVNA 3RABA 2D0OB 2AD5A 3PNSA 4LC1A 4EPRA 1JYFA 1YQEA 3BZUA 4EHBA 1Z73A 4RTRA 3KUXA 3A1FA 4KOAA 1EFKA 2Q1XA 1LBQA 3QLVA 2Z2KA 3T3HA 3F5QA 3WRVA 4AMYA 4YJ3B 3AZQA 1ADCA 4PBSA 4DIMA 1U6KA 1UXJA 1Z0AA 3MG9A 2PS1A 1I80A 4NZOA 1W0JA 3L18A 4QBGB 4QQRA 4E1BA 3N2YA 2ZVDA 5F5XA 3E9CA 5F9MA 5IHPA 1QB7A 3SSAA 4U00A 1KP3A 2XMGA 2K4MA 4O08A 5G4KA 4C5BA 3RNLA 3VGJA 1NSFA 3CNHA 3RVPA 5AJZA 5JQGB 4LWQA 2OHXA 5AVRA 4TL9A 3DLPX 3OE1A 5EE9A 5KINB 3QFRA 1C9DB 3DE0X 4QAQA 1XXHE 3IHKA 5ECDA 1BNCA 2DPYA 5J2TF 3FMOB 3GCWA 3IPXA 1C9NA 1TYAE 5YASA 2RGRA 1LJLA 2BFBA 2XDYA 3I2JA 3BJIC 4KZKA 4DDWA 5JS7A 4ZOLA 5EHZA 4UCXA 1XXLA 4NJMB 1P5HA 2HA2A 5EKUA 3UWSA 1RWNA 1KEEA 4XWWA 2OPHA 1B43A 1E2PA 3PEWA 3HYRA 3ISTA 1GP2A 1NUSA 5DGXA 3T5AA 1BA3A 2C3PA 3F73A 1WG8A 1KGDA 3OOSA 4CKZA 4W5WA 1LC3A 1K89A 2WIBA 2YJZA 4D9MA 5EP1A 4F97A 2IHNA 3V8MA 4RTMA 1R8JA 3KOMA 4WNIA 1YCGA 3UWDA 2AXPA 2IP1A 2VLBA 3QFCA 2YHUA 4P54A 1RRKA 3IUSA 3DKIA 4RK5A 4C4OA 1NQXA 1QM5A 1N5JA 5B3LA 4PLWA 3KKKA 2AFHB 1W85B 1PSDA 3I53A 3A58B 1U1FA 2N9UA 3DMNA 4MGEA 1CUHA 1WX1A 1XRSB 3OIGA 4E2ZA 2HIMA 1HDIA 2GTHA 4ZO8A 5FUVA 1KQNA 1JEAA 4BKPA 3O8BA 4AKIA 1DKPA 2GAAA 2O2JA 3GFBA 3D6TB 3HPQA 5ES3A 1J5PA 1EB8A 2O8DA 1Y37A 4Q12A 4BFXA 1KIFA 3UJ9A 1XTSA 2IDJA 1ZIYA 1GNVA 2P1ZA 2Y6VA 4FGSA 1ULAA 3NKVA 2B8NA 3T5CA 5JXWA 4LRQA 4DQUA 1NBOA 2FQXA 3COJA 3SBXA 4KFSA 4AO8A 2EG9A 1PKXA 2J85A 3QY0A 2J7KA 1JX6A 1NNI1 1V2HE 2FQWA 3JYPA 4Q3BA 4BGDA 1AGRA 3F6YA 1QBGA 2NADA 3NHWA 4OQEA 2HHHB 4FZ5A 3KBBA 2WM9B 1N9GA 1BCRA 3WBFA 2PGIA 3GJ0A 3OQPA 3C3JA 1JR3D 3PE6A 3WHIA 2W2MA 3RGGA 4S2EA 3TXYA 4E13A 1IYZA 3DEHA 3VR5D 3T35A 1QG4A 4PQYA 5C35A 1M2OA 1O96B 1NZJA 3EZ2A 4K88A 4N3NA 1Q0TA 2EEPA 3F8SA 1R64A 2JK0A 3PA6A 1L5GB 1VBFA 1Y6FA 2FVYA 2HO4A 2W4IA 5BN4B 1UIMA 4R7ZA 1WD5A 4G1CA 2I6UA 5L4LA 4FJ0A 1DCKA 1QQ7A 4XX1A 3MTQA 2AYZA 1BXRA 5J4LA 4YCAA 4FXOA 1UODA 1CCWA 4O3FA 3X1XA 1O3YA 3VRHA 1YZVA 1ACLA 2B8EA 4MITA 2MINA 1QYVA 1J2EA 3OP4A 3VPSA 1V8PA 5DM60 5AUNB 1G16A 2BR4A 1XZIA 4FW8A 5LIRA 3F9CA 2E87A 3WWEA 2NU8B 3QKUA 4CU5A 1A96A 1O6BA 3V8EA 3IQWA 2EF0A 4BCCA 2O8FB 4CM5A 1TMKA 2HJHA 4YRIA 5CCBA 4HWPA 4XE5A 3KSDO 1T0IA 1OLSA 3PHJA 3TOVA 3WS7A 3RVSA 2VJCA 1DP4A 4EL5A 3AO0B 1UANA 1S8FA 1HH4A 4P2GA 4YB8A 3V55A 1JDBC 3HJUA 5C1PA 1CYDA 2WIKA 3UZUA 1DBRA 4HAXA 4NBKA 4YJ3F 4C43A 6GPBA 3ITDA 3R0IA 2LR0A 3VU0A 1RVDA 3ZTYA 3E5HA 4Y3UA 1GAQA 3LX6A 2O7QA 2XDQB 4JGIA 1RABA 5AKZA 3VYWA 1HFKA 3HB0A 1VMAA 4ZEXA 5ELXA 4Z4GA 1NF9A 1O2DA 4JBHA 4OM8A 1PWZA 4ZVSA 3W5SA 1ZH4A 1QF6A 5LU9A 4YP6A 2OGWA 2VJMB 4KBFA 4CETA 1CUUA 5KHAA 4PV7A 5IKEA 5LL6P 2G8NA 1L7XA 3UVEA 5JQGF 2NUTA 2B25A 4XD7A 4JJ6A 1ZSYA 1GZVA 1YJBA 2WF9A 4PBTA 3ABZA 2YVKA 1KOJA 2YVQA 2WUGA 3FWPA 1DIAA 4I3HA 2VJPA 5JI3E 2JJ1D 5ALRA 3T1HB 3B89A 4BQRA 4DMLA 4UHHA 3WBJA 3U6KA 1D9XA 3C6QA 4JBNA 4O2BA 3F7TA 4F71A 3AEKA 2W2NA 4YJHB 3LC0A 4HUTA 5AOBA 1QIGA 4B4DA 3A6KA 2B5WA 3TQTA 2I4IA 4ML3A 1I6WA 1V26A 3GLTA 3PWTA 3QNWA 5DJ5A 2C57A 4BAUA 4YMHA 3SC6A 4Z8XA 3MUEA 1GGFA 4FD2A 5IHXA 2AW5A 3EOAI 5JUWA 3RE1A 3T7SA 1OFUX 2AX4A 3DV0B 3TEFA 4MP6A 4WCDA 2WK1A 2NTYC 2RCNA 4YV1A 4MVJD 1C9EA 4XI9A 2XXAB 5JHHB 2RHCA 4QU0A 4FYMA 3HLKA 4R8VA 2YN0A 4DWWA 1DHRA 1MVNA 3EPKA 1YVPA 1GPDG 3B9PA 2BF4A 1SVLA 3RVBA 4V0OA 5JJ5A 2WD7A 2NTVA 4RCYA 4C3VA 4DKXA 2ZZMA 4O5AA 4N9QA 4DGSA 3BCUA 1NJ6A 3LUAA 3TL3A 2XUGA 2GXUA 2H0RA 5E9AA 4EY8A 3UAZA 1QOQB 4M1KA 3WSVA 4TTAA 4UBKA 4ZVOA 1YUNA 4C0JA 5TARA 5LKAA 2W90A 4U8HA 1DKNA 1JQBA 1ZLYA 2ATCA 2G0AA 4KJZA 4DBLC 1QRAA 2RC6A 5BPHA 1JLMA 3R0JA 5AM1A 1T35A 3KQWA 4MDEA 3VYTB 2IUTA 1SXHA 4LF8B 1IBRA 3KXLA 5DHPA 1R0CA 2WNIA 1ISMA 3FUWA 1QPBA 1LTHR 4BNHA 1AXGA 2XF2A 1S1MA 2DTXA 2ROQA 5AJYA 4DSNA 1B14A 3RUIA 1PO7A 3V6MA 4M88A 5M3BA 4JOSA 3BMCA 4R3UC 2ZIZA 3H3FA 3N74A 2M1XA 2XNKA 3AKCA 4YBRA 4ZANA 1PKEA 1KMIY 1QH1B 3AJAA 1WY7A 4KV9A 3WV5A 4JC4A 5TV2A 4NK4A 3N7AA 3W79A 5E95A 6Q21A 1ADYA 1YKFA 3NTOA 4HDMB 4OREX 3KAQA 2CE7A 2Y66A 4UU7A 1PL7A 1MDBA 1Z4IA 1C3JA 1DWQA 2LWIA 2R68A 3OM9A 3R24A 5KJ6A 2GTPA 3O47A 2PUHA 5HCIA 1N0HA 2B8TA 4BP3A 1Z6QA 1P1RA 2D54A 4MYUA 1L5QA 1E77A 1XGKA 2DUUA 3TLGB 3U31A 4NH4A 4H7DA 1XK6A 1G4AE 4WKCA 4MMXB 4LCJA 5IAGA 4NOKA 2I1LA 3CXUA 4ZEWA 4HDKA 3I12A 3T7AA 1IRIA 2QGFA 4BB9A 2XQVA 4JI7B 2AZTA 4P0QB 1UC4B 1OWPA 2DQZA 1WHSA 2MU1A 4G4SP 1EHCA 4GBJA 3AK4A 1F8FA 4NBVA 3A8TA 4PX9A 2Z9BA 5HWSA 2H2HA 1USKA 3N8KA 3ESXA 3E9DA 3RKRA 4K46A 1PGJA 2RHOA 3KTOA 3HL0A 4EDFA 2B1IA 1M66A 3MJCA 3B2QA 3HLYA 3U1TA 1YDFA 2JI9A 2OAP1 1LNSA 4MTLA 1IY1A 3WKBA 1CY6A 1D0IA 4BO2A 2I65A 1HNNA 2WZBA 3JZIA 1TL7C 2HQOA 1LDMA 2PEYA 2PFGA 2ZAGA 1SXJE 3NOQA 1QAQA 2QUHA 3O8QB 3QBJA 4GPAA 4I9FA 1C0KA 4LUCA 4R2LA 3DMHA 4US0R 3LLVA 5AVKA 3OTWA 4HH3C 5SY9A 3RVJA 521PA 1W19A 4CEJB 4NICA 3WLSA 5I7OA 1JEEA 1MO3A 3PGKA 2BM0A 3VR6D 3LI2A 4W99A 3T7EA 1ISHA 1GSOA 3HCEA 5B7QA 1J33A 1TLLA 2QM8A 3GN2A 5AW1A 2LIPA 3DOCA 2JGMA 2G77B 3JVDA 3R6GA 1YB1A 4LISA 5KOHA 4ROSA 2Q3JA 2Z08A 3Q87B 5KNDA 3SIRA 1K06A 1XDWA 5IPFA 4N7RA 3W1EA 1ZUHA 1Q1ZA 3BEOA 3I5AA 3N2KA 4IOLA 3ZE8A 3ZJVA 2IYTA 5CVJA 4TTTS 1OAAA 1ORWA 5EGSA 3BIJA 1D04A 1VLJA 3ROQA 1U0BB 2H5IA 1N5KA 4P5DA 1E1YA 1DQRA 4JB0A 3CUSA 3THYA 1D6JA 3H8JA 1JNYA 1YQXA 1E9FA 4K81B 1NOKA 2CVQA 2GNAA 2B83A 3E5MA 4LZPA 4P4NA 4R8MA 4V0LA 1MTOA 3D1VA 2XA9A 4BN5A 3BORA 4A92A 1FMTA 2IX9A 4BTVA 3CZ4A 4EF6A 4YT8A 4RPJA 3IFSA 4QASA 4RFSB 2FEOA 4E0BA 5ES4B 4B2YA 4J90A 1Z4QA 2PUTA 3V8RA 4GPD1 5J47A 1NRXA 2VATA 4DRXB 2EFJA 3RNOA 2JKYA 3F7OA 3MCWA 5C8DA 1RLMA 2PUJA 1JYSA 4IZOA 4DSZA 4J3FA 3TQRA 1FFAA 3HU3A 1V9SA 2ESRA 3QLEA 2GCOB 1WUTA 3C48A 5C8VA 1A4XA 4EB8A 2OMKA 4LYEA 4C06A 4Q7KA 2HN9A 4HQNA 3RS0A 3A27A 5JFTA 5JYCA 4AY2A 4J94A 3D7MA 4G3XA 4AZTA 5B1YA 5BSKA 2NW6A 1KDPA 3RYFB 1ZFNA 4X44A 1U3VA 2M32A 4I1OA 3JQFA 4DJEC 4Q5IA 1GKYA 3G5TA 1MRZA 4L95C 1T9CA 1DEAA 4HDOB 4LA4A 1W581 1NDQA 2GHTA 2HXSA 3EISA 3EY4A 3M9XA 3S7TA 5JJCA 1YCDA 2VI5A 3DBIA 3E3MA 4PZAA 4Y7DA 3ORRA 5DYIA 1PFVA 5F2EA 1T5HX 3U1VA 4B9EA 1FTSA 1L6RA 3IESA 2C0CA 3GARA 1G66A 2IJGX 3NXKA 1U9JA 2DSNA 2XOEA 4QXAA 2AZDA 4AQDA 3HY6A 3R8CA 3P4XA 2OG1A 3BMOB 5T64A 3U4AA 3DQQA 2JAPA 4AY3A 1BE0A 2B61A 3C6YA 4KRGA 2YVAA 1G8MA 1VIYA 3SZMA 3U7RA 3VPAA 4IH4A 4LF6B 4QHSA 2XNDD 5BMOA 1D03A 1JLSA 1DINA 3QKWA 3VU9A 1XHLA 4EKEA 5BN5B 1YJQA 2IYXA 1RMYA 2WNSA 3B38A 2A9KA 4GMFA 1WAMA 3PGA1 2PRKA 3KX2A 1VJCA 3VH3A 3UAXA 2J6CA 4DARA 1AUXA 2R25B 3H17A 3II6X 4REMA 2Z5FA 3CMCO 5JISA 1XU9A 2JGKA 5BT8A 1DNPA 1FTNA 1BN7A 1QH0A 4QYWA 3U3JA 3LKBA 1RBZA 4Q05A 3H87A 4FFOA 1JGTA 1BVUA 1XZKA 1FFGA 3EIEA 4B5KA 1TT5B 4RZ3A 2WMDA 4CKEB 2ZXUA 2OBLA 5E4YA 5GV8A 1WB6A 1A76A 1Z2AA 5H16A 2FZCA 1BW9B 1E3JA 2RH5A 2YFQA 3FDIA 5IBCA 1YXMA 1GPLA 1HE5A 1ZRHA 2V7EA 4MV8A 2I6QA 2JLYA 4YMUA 3B53X 4FJ1A 3JALA 3IAAA 3RVOA 1LQUA 1V8OA 1JAYA 1Z6GA 1KK0A 1EGVB 2HWWA 3I9KA 3IQHX 5C3UA 5G02A 3QJ5A 3Q7IA 4HVAA 1YV9A 3G7UA 5HE8A 3PXEA 1OZ0A 5CITA 5EE1A 2Q0QA 4TWBA 1WULS 1U9IA 2Y1LA 4EB6B 3TR5A 2XUJA 3R4VA 3PD7A 1P1HA 3LKVA 1PJ3A 3M4XA 4YRBA 2F3PA 1LLFA 3FNIA 3ABOB 3QA9A 2C78A 4R54A 5FBHA 3U7QB 3VI3B 4EVSA 2R1UA 1RAAA 3OU7A 5I5GA 1FXSA 4YV7A 1CR1A 5JNWA 2J4CA 2HTFA 2QAJA 1A2KC 2RJ3A 2YWBA 1ATZA 1LJUA 2BP7B 5C8YA 4YRSA 5A1TA 4JYAB 4MXDA 1UXHA 3A4MA 5KNBD 1TEVA 4FZJA 4U02A 5DW3A 5HZHA 4JP5A 3TZHA 5IRCD 2F8TA 1JR3A 3DV9A 2OYSA 3IHTA 3R3JA 4QXOA 1E20A 1XQ1A 4KHPB 1X9GA 2CD9A 3VR5A 4CTMA 1JG7A 1L5HA 3T4PA 1K6EA 5FUWA 2GBGA 3U9LA 3D4OA 4BMOB 3AHEA 4PTLA 1H65A 1Y80A 4CMKA 5JYBA 3OCJA 4EJ6A 3CHYA 5E6RB 2Q1SA 4XYLA 2I99A 4C4RA 3CONA 3LTEA 1G0OA 3RYCA 1DE0A 2HR1A 1UKAA 1SCNE 4Q9KA 2I6FA 1S3IA 2WAAA 3NATA 5JZOA 4UHFA 3OEWA 3T7KA 3NEYA 1UBJS 1MMFB 2QWXA 2YIMA 2OFPA 3JS5A 4RKWA 3HR4A 3L6RA 2VDUE 4OSEA 2Y71A 5C1IA 3PTAA 4KXVA 2VSQA 1YE5A 1O08A 2PDAA 1LBIA 2AN4A 2QTAA 3TLBA 3EODA 1UT8A 3KTAA 4AT1A 1ZK0A 3HCRA 3JAKB 3RB8A 2B5VA 5TVKA 2JLWA 2Q4OA 2H1WA 5DYWA 1XAIA 3I42A 5EXXA 4AG6A 5FR1A 3GLGA 1UQUA 4NI5A 3GVCA 1Z9BA 2C94A 4WUTA 4BNTA 3OT1A 4E08A 4GGPA 5A4MS 5LZ2A 1ODCA 3Q3CA 1F7VA 2O57A 5DNDA 2GDZA 3OCXA 2FZGA 2NM0A 2OO5A 4JKIA 4OD0A 2CNNA 2GZMA 3DDSA 3BMQA 5JI2E 4XWYA 2Y1WA 2W2XA 3KB1A 2GS9A 2XGJA 4Q82A 3NB0A 1JA1A 1RWOA 3V9PA 4NE2A 2CXRA 2X0RA 2X8JA 2PWYA 3ETJA 3HYSA 5IKPA 1HQKA 2JJ1A 2OCKA 3OPQA 2L18A 1C3OA 3QKTA 3GJ4A 1LVHA 1XKTA 4O29A 4S35A 1KYTA 4TZTA 1NMEA 1A9QA 2OSVA 3AIIA 1WZIA 5IBPA 4NMXB 3RBAA 3GIDA 3MJVA 1JQ5A 3LF1A 4HGPA 3INRA 3RRXA 4DV0B 2GJSA 1CDOA 1HYQA 1KMNA 1XT6A 1YGYA 1IC6A 2I4OA 4Y1EA 4WZBE 3WRWA 1V9LA 3KO8A 1W88A 2N42A 2PJUA 2ZU6A 3KT0A 5EA2A 1U2EA 3STVA 3WLQA 3UUGA 1SHUX 4B31A 4D5EA 3AVOA 1QR2A 1V7ZA 2JCSA 4I5GA 4M9QA 4ED9A 4RJJA 1G59A 2JI4A 3QX9A 1FP4A 2HT1A 3L7MA 1VGVA 4PLYA 4LFCB 3W5UA 1YRLA 5IDXA 4TMXA 3QVXA 1OW3B 2R7LA 4M8LA 3K2EA 2UZ3A 3DO5A 3B20A 4WLFA 2VYND 2FPGA 3L8ZA 4UXIA 1C4WA 2FSFA 3IR6A 3GK3A 4Y0AA 2DHRA 1SU4A 3KZOA 3V1LA 4DG9A 3X2FA 5G4KB 1KFJB 1ECCA 2WVHA 4LJ9A 4DA0A 3K9CA 3AR2A 3AVXA 4I9GA 4E7PA 2B7LA 3P1JA 3JAMA 3CURA 3DFMA 1NLMA 1XI2A 3H42B 1SBCA 4PANA 1CJTC 2JAUA 5CM8B 4RXTA 1J39A 2FCAA 3BCRA 5B1SA 1DBSA 3G0HA 3MM4A 2MJLA 1OBCA 3O92A 1LJ8A 1UBFA 4I99A 4J03A 621PA 1DC7A 1P9NA 2BFBB 3OIYA 6PFKA 1XZMA 4ZOLB 4DBLE 2FW7A 4PZEA 4IDAA 5CXQA 2XITA 4CIWA 1KEEB 1BO6A 3TSWA 4E1AA 2FX3A 5G2OA 3WZ2A 4I9NA 5JD4A 2YX1A 4LJ4A 3FFTA 3QRWA 1VIMA 1V5EA 3RU9A 4ZDIA 1Q7GA 2ODEA 4NBTA 3D3KA 3BWXA 5JECA 3QUCA 3UTDA 2RAVA 2VP6A 4UOZA 3O90A 4LECA 5DULA 5A02A 4FOSA 4Q6BA 5B1EA 5FADA 2A92A 3K20A 4QFMA 1YGPA 1YNOA 3MPOA 4REQA 4H6PA 4O2AA 4QHYA 1IG0A 3PLAE 3IV7A 5E38A 3IAEA 2HIGA 3WDKA 3NHPA 1Q6ZA 3ESBA 3QHQA 2WKPA 3F5FA 2AOTB 2GCPA 2UAGA 3HB1A 3SOZA 2ZRMA 3AF3A 3U81A 4AMZA 4PYKA 4EHNA 5EKSA 2JEYA 2QVYX 4TYQA 1XROA 2V4ZA 5E1BA 4HDCA 2O8DB 4Q01A 3BKWA 4PAWA 3IEMA 2DF8A 1JW9B 5B5SA 3JWGA 1DUSA 3B9QA 3AL0C 5JR3A 1B23P 4QOFA 2FFBA 3ZHBA 1D6NA 1DO8A 2JAHA 1E7MA 5AM3A 4FR2A 5CRIA 1MXFA 4D4GA 2PVCA 3WYEA 5BSHA 1P4AA 3GCXA 3R3YA 3W2HA 2I6SA 5FX2A 2QXYA 1U0RA 3RV4A 2F1RA 3IPRA 5FA5A 3WSTA 1HO3A 3B51X 4IPTA 1N9GB 1BCRB 2Y6UA 2OZVA 4QUDA 1CXZA 2DJIA 4PC3A 3WJ7A 3MBKA 1W34A 4B74A 3CRRA 1XX6A 1IPEA 2YV4A 5DN9A 4HPJB 1L5NA 4EMBA 5JNTA 3JY6A 3W9YA 3H5WA 5LQAA 1I4WA 1M2OB 5BQOA 3OZ7A 1OYVA 3OIUA 1IDN1 3WIVA 3KUCA 4OTZA 3ZW7A 4P7FA 1LX7A 2AOXA 2O1SA 2JGFA 2RCYA 3CGGA 3HDGA 1XQ9A 4G8CA 4MVJG 4N6NA 4UTXA 1J2YA 3WGOA 5HFNA 2XYVA 5CTAA 4Q37A 2Y27A 2N1MA 1BXRB 1W2WB 3DD1A 3W6OA 5D85A 2WZCA 1D4FA 1XLTA 3DB1A 1YULA 3N7UA 5K51A 1EXVA 5TRTA 1AC5A 3IXLA 1VMEA 2IXDA 2MINB 4YQYA 5AJXA 3MCVA 1VZ3A 3DOHA 4EUFA 4DV7B 4TMYA 1OB5A 1B93A 2G83A 2H2GA 3FPJA 3F6BX 1RFLA 4ISCA 2Q9AA 4BX0A 2BGKA 1BVYF 4QBHA 1CRWG 1OLSB 2BI4A 2XMRA 5JROA 3UYKA 2GYYA 4WNCA 2A84A 1ZJ5A 1HNWB 4NH0A 1UPXA 4AJ1A 1P2FA 1KPIA 1PW7A 5JCOA 1CFJA 2Y77A 4JIMA 5KKCA 3O31A 3LBIA 5FJJA 1GDDA 3DOJA 1CRPA 3TCKA 1MOSA 2KB0A 1F6BA 4XCXA 2BY4A 2IKQA 3GLKA 1KEVA 4JNCA 1BTOA 1X9IA 4DPMA 4JBIA 3ZGZA 4LRXA 4BBJA 4PLVA 1NQTA 2GX6A 2IUUA 4KRYA 2QP3A 2D5AA 2J9FA 4MIOA 4FCWA 2WJ3A 2NUTB 3IOBA 3QMWA 5HKBA 1JVNA 2I2CA 1N2GA 2PU7A 3PSHA 3E2MA 4MKGA 4XJTA 1TA9A 2O2DA 2RKOA 3ADCA 5CA1A 3GZTB 2PQMA 1NR5A 5BQFA 2D5LA 3SE0A 1MV5A 3ZHTA 3P2JA 1K5GA 1FK8A 1Z2OX 2HSGA 3GWZA 1JQEA 2Z95A 4J4BA 3AEKB 4G09A 2FG7C 3GJXC 4O2BB 3S8MA 4C4SA 1KL7A 3QXJA 4DV4B 4YQZA 3OHSX 3C5WP 1NXVA 1Q3TA 1UEJA 2J5BA 3I8OA 3VO1A 4KQ2A 2C83A 4JLVA 3JR3A 4LBZA 4NNPA 2YC2C 3KSZO 1L5KA 5ITVA 5GY7A 4PX3A 3KOYA 3OF2A 3G8DA 3PCXA 1YHNA 5E4FA 1L3IA 1SU8A 4URUR 4DT1A 7GPBA 4GYKA 2J1LA 1OTHA 1R9MA 3HMKA 2GT1A 3PX2A 4I4IA 1X3LA 2XB9A 5FTWA 4BN0A 3I6IA 3HWX1 3KQVA 4W9NC 4OMFG 5E3JA 3SFZA 3BGVA 3HO1A 3ZCSA 1K4YA 2HDHA 3D2CA 2W2KA 3WGUA 1Y8QA 3G0BA 5EXPA 2WD7B 3PG5A 1EK5A 3OZDA 2BJHA 3EARA 2VG8A 5TGDA 2G06A 2IHVA 3CCFA 1AMNA 3L6CA 3H86A 3KZKA 4QTTB 3UXYA 1BAPA 1ZGBA 1A9ZA 2D8MA 2GFIA 2QJRA 2YV3A 5GZ6A 2ZYSA 4E46A 4HNUA 2BR5A 4B48A 4KO4S 4L15A 4YAJA 2WINI 5IEJA 5I3ZA 4MKZA 4OGLA 2P6RA 4J1SA 3GDHA 2B36A 3I6QA 1D4OA 1E9CA 1JR4A 1Z82A 1WXEA 2Q2WA 3H5TA 3V9AA 3OTOB 3K6KA 1KE1A 4KEAA 5AVTA 3NTVA 4Y2YA 1KVQA 1QE0A 3GZNA 3OWHA 2P2NA 3ZUGA 2FFRA 1JG3A 2CLOB 5LMZA 2VWHA 1T3LA 1THMA 1R3UA 3M6XA 3N9IA 3CZMA 3JVIA 4ZO9A 3TF5A 4GX2A 4MVYA 4Q02A 1FNCA 3BMCB 3CH4B 3UO8B 1YTUA 2LDBA 2AWOA 2NV6A 4NONA 5LP6A 1Z5NA 4YJ2A 3K1TA 1KJJA 3A1EA 2L2QA 3K31A 4K87A 3ROFA 1OX4A 2O0HA 3K0HA 1Y7TA 4A5SA 5DIZA 2V3VA 4N8DA 3TX6A 1XQVA 4ZN6A 2IKSA 2OCYC 3IQDB 4G1UC 5BV8A 4PO3X 3WXBA 2VH1A 4CDNA 2V6GA 3MXOA 2P4SA 2ZRJA 3AGPA 4UHCA 1ISIA 1ZBQA 1Z4MA 1ZIXA 2KMLA 1R12A 1JEOA 2WB4A 1IWBB 4K9MA 2ZBFA 4AN0A 3LLSA 1CZUA 4BE7B 3NDPA 3A26A 3V1NA 1T1GA 1AQIA 5BVGA 4BB0A 2ZYHA 3D6MA 1GAXA 1XVTA 4FDUA 3KJGA 5B1DA 1W44A 3IAS1 4N6GA 4HDKB 3QBEA 3ACBA 4LOIA 3UMSA 2NIPA 3MSCA 3M1YA 1W1UA 4OBXA 3RS8A 5K3OA 5FUBA 1IXYA 1WHSB 3EJ6A 3FHJA 3FR8A 3LQYA 3Q7RA 5HJ2A 3ABRB 2QHXA 4MI6A 4QGAA 3T1TA 4IGFA 3UV3A 3JX9A 3QLJA 4W1RA 1NU6A 1POXA 2CJFA 1S2GA 3RTBA 4DSUA 3BRWA 5F7JA 3AT1A 5B12A 1XZDA 3WQQA 1CKEA 2BZSA 2KJQA 4HS9A 3W1VA 2EFGA 3VO9A 1UM9A 2M6SA 4ARZA 2DAPA 2H0AA 3SMVA 4CL2A 4PNPA 4LF7B 1GUDA 2XQGA 3PIDA