1Z5UA

Crystal structure of s. typhimurium apha complexed with cyclic-amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
208
Chain Sequence
TLNPGTNVAKLAEQAPVHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTKVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRILRAANSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AphA protein
publication title Structure and Function of class-B bacterial non-specific acid phosphatase: functional role of invariant Lys154
rcsb
source organism Salmonella typhimurium
total genus 73
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z5uA00
4IG4A 2OYCA 5IT4A 1FEZA 3KOOA 4DW8A 2Q4TA 2AH5A 1RKUA 1YDFA 2MU1A 1RPZA 1ZD5A 1JUDA 5AVSA 2GO7A 3WKBA 1SWVA 2FPWA 3ET5A 5ALWA 4YIHA 1EK2A 4Y2VA 1RMTA 5AW8A 2FPRA 2HI0A 3IJ5A 1LTQA 2PR7A 4BBJA 2O2XA 3E84A 3DAOA 2W43A 4C4RA 5AKGA 1QH9A 4AS3A 1L7NA 3QUTA 3W5CA 5ALSA 3W5AA 2EATA 2YMPA 3QU5A 3QYPA 2YY6A 2WF7A 3FPSA 2ZBFA 4Y2YA 3NALA 1L6RA 2C8KA 3SHQA 3ZW7A 1AQ6A 2ZBGA 3SKYA 5AKEA 2HF7A 4B6JA 3AR5A 1TE2A 1YMQA 2ZXEA 5AI6A 2CFSA 5AKKA 2I34A 1NF2A 2MSNA 3AR7A 2QLTA 2GFHA 1F5SA 3SD7A 1TJ4A 2JGAA 2NO5A 2WF8A 4NABA 3CNHA 3RF6A 2IYEA 3EWIA 2FEAA 1WVIA 1J97A 2WF9A 1QYIA 1CR6A 3ZX4A 3U7GA 3A1EA 2QYHA 1WZCA 3S6JA 1RDFA 3W5DA 2B0CA 3QUQA 3WKEA 1TA0A 3DV9A 3WKCA 4XOUA 2R8EA 1L7PA 3UMBA 5IS2A 3EF0A 3J7TA 5ALIA 4BX0A 1YS9A 5AKXA 4KX3A 4PNHA 2AMYA 3SMVA 2CFTA 3ZWDA 1Z4NA 2PKEA 5AVWA 3A3YA 3NANA 2IOHA 4BYGA 4MUMA 3M9LA 5AKLA 4NAVA 4EENA 4UATA 2YMLA 4FYPA 2B8EA 4JDPA 4L57A 4XE5A 3N5KA 4Y2QA 4C4SA 2JAUA 3U7FB 4NWIA 1ZRNA 5AVXA 2P27A 3L7YA 3NRJA 3MN1A 2YMMA 3QU2A 3AR6A 3W5BA 3IB6A 3P96A 2FI1A 5ALRA 2I6XA 3U19A 3QXGA 1X42A 3ZU6A 2OA0A 1QQ7A 3QX7A 3OTQA 5ALMA 2ZBEA 2HO4A 4EZEA 3PDWA 5AK4A 5ALNA 5AW4A 2FPXA 2RAVA 2YN4A 5AM3A 4KN8A 3ZWKA 4FFDA 4HGNA 5AW0A 1SU4A 1ZD3A 1T5SA 1ZD2P 2AGVA 5AIBA 4Y2RA 1RMQA 4DFDA 3FM9A 1SWWA 1Z4QA 3E81A 3L8EA 2GMWA 2HSZA 2JARA 3N1UA 4L6AA 3KC2A 4UMEA 4EX7A 4Y2PA 3OCZA 3AR2A 4F71A 3E58A 3OCYA 3DDHA 5AHXA 3U26A 4OCZA 3WK4A 5A3SA 1RKQA 5ALHA 2JAWA 4OD0A 4DCCA 3FVVA 3L8GA 3A1CA 4ZEVA 4BX3A 2RBKA 1Z4OA 5AVZA 2RB5A 1YNSA 3HYCA 1S8OA 1NNLA 2B1QA 3TLMA 4GIBA 5ALUA 4BNDB 4BEVA 2X4DA 3OPXA 5AK6A 5ALDA 5AICA 2BY4A 2FDRA 3B9RA 4DWOA 5IT0A 2HEGA 3KDPA 4FE3A 2FUCA 2CFRA 2YJ4A 4HGRA 4O8CA 2ZOSA 4KYTA 4EELA 4KX5A 3L5KA 2G06A 1ZOLA 1XP5A 4IFTA 1KYTA 5AI0A 5AW2A 2WHEA 2FUEA 3MPOA 3ET4A 4UASA 4UMVA 3ESRA 3WKDA 3A1DA 3RFUA 3AR4A 3UMCA 4YIKA 2P9JA 2GHTA 5JJBA 5ALLA 4L6CA 3PCTA 3KBBA 1O03A 5AESA 3EF1A 2Q5EA 3F9RA 2YMQA 5AIAA 3OCWA 3ZUPA 3ZI4A 4EX6A 2NO4A 4UMDA 2IA5A 1NRWA 2G09A 1L7OA 2C4NA 2ZBDA 5ALGA 3WK6A 4JB3A 4OHFA 5AKYA 4ZEXA 4CF3A 5AI8A 3PGLA 5AI5A 2B1RA 2WM8A 1YJ5A 1YV9A 5ALVA 4Y2XA 1N8NA 2R8YA 3FZQA 4CF4A 1Z5UA 3L8FA 2YJ6A 5AVQA 5AI4A 3QUBA 1VJRA 4UAUA 2HX1A 3U13A 5AKJA 2G0AA 5AVUA 5AW7A 3ZTYA 3WK9A 5AKIA 2YJ3A 5AM1A 2I33A 4BKMA 4UAVA 2WF6A 4YGYA 3KD3A 2BDUA 2B82A 1WR8A 2R8ZA 4GXTA 1RLTA 1Z5GA 3E8MA 4Y2SA 2ZG6A 4H1WA 4F72A 5AVVA 1VJ5A 2DQSA 5ALYA 3R4CA 2EARA 2C9MA 2IOFK 4AS2A 1RQNA 3U7HB 3SF0A 3L1VA 1Z4LA 3R9KA 2G08A 2VKQA 3IRUA 5AW9A 3N8GA 2C88A 2G07A 5ALZA 4NFLA 3D6JA 1WPGA 3ZX5A 1RQLA 4XQ0A 1VFPA 1ZJJA 5ALTA 3K1ZA 2W4MA 4UM7A 2P69A 3B9BA 1N9KA 3QUCA 5AKHA 2PQ0A 3QU4A 1K1EA 5AI9A 2P11A 2OBBA 3QGMA 4RETA 2W11A 5A3RA 3ZVNA 4CF5A 4RESA 2R8XA 2FPSA 1CQZA 5ALKA 3SKXA 2B8JA 3QU9A 1Z4IA 3AR9A 5AVYA 2O9JA 4I9FA 4UM5A 3ESQA 1Q92A 3ZTWA 1ZRMA 5T41A 1U2SA 5AVTA 3U7EB 4UMFA 1O08A 1RLOA 2NYVA 2HOQA 2BDEA 4HAIA 3FGOA 1T9ZA 4G9BA 3EPRA 1L8OA 1Q91A 3I6BA 3CZ4A 1J8DA 5ALJA 1L7MA 4YCLA 3QU7A 2YJ5A 3WGUA 4E88A 5AK3A 3WK5A 3NUQA 2YBDA 1TJ3A 3DNPA 2RARA 1RLMA 2Q4RA 3AR3A 1EK1A 1Z4MA 2EAUA 3UM9A 4G63A 4YCMA 1TJ5A 5ALFA 3B8EA 5AW5A 2G1AA 2AUTA 3AR8A 5AM2A 4BNDA 4QJBA 4ZEWA 2IOFA 3L0YA 5AKZA 4NV0A 5ALQA 1RRCA 3GYGA 3WK7A 5E0OA 2HCFA 4J2TA 3L8HA 3UMGA 5ALXA 4Y3UA 4Y2UA 3MMZA 4YH1A 1PW5A 1ZS9A 4Y2JA 1U7PA 3HLTA 4HGQA 1QQ5A 4AP9A 4UW9A 4C4TA 3N28A 3KZXA 3SLRA 2WF5A 5AK5A 3I76A 3ZVLA 3L0BA 3WGVA 5FP0A 4KNWA 3BWVA 4Y2TA 4UARA 3QNMA 2JAOA 1RKVA 2C8LA 2FPUA 4OFZA 3PGVA 3ZVMA 5ALOA 5A3QA 1U02A 5AM4A 1ZD4A 3WKAA 4EEKA 3ONNA 1XPJA 2GHQA 3VAYA 3BA6A 5ALEA 3M1YA 4HYTA 5AM0A 1RMYA 2HDOA 2I7DA 4I9GA 3L0CA 1Z4PX 4J03A 3MC1A 4CNQA 1T5TA 2I55A 3OCVA 3I1YA 4XPZA 2WFAA 5AM5A 4BEWA 4HGPA 3QLEA 3NIWA 3FPBA 4UU0A 1U2TA 2CN1A 2D2VA 2HHLA 1S2OA 4HGOA 2HF2A 4KNVA 1L8LA 3ED5A 4BX2A 1QQ6A 1Z4KA 3L1UA 2OM6A 3OCXA 4YCNA 2YFYA 3N07A 1Z88A 4UU1A 2G80A 3NASA 5AW1A 2I54A 5AVRA 3WK8A 1MH9A 2B30A 1Z4JA 1IWOA 3OCUA 1LVHA 1U7OA 5AW6A 2ODAA 3NAMA 3I28A 4CE6A 5AW3A 1Y8AA 4QQFA 5ALPA 3R09A 1XVIA 4MWOA 1RC8A
chains in the Genus database with same CATH superfamily
1DQZA 1Z22A 3ELDA 3OZRA 4TTVA 1UP4A 1KAOA 1VL6A 4B6GA 5DBEX 2FQXA 4OO3A 2FF7A 2IIVA 2A9VA 4JBWA 1Q1EA 2AVDA 4XAQA 5EQJB 2IQIA 1KZYC 1XI2A 1ZNZA 4JLDA 2GZSA 3NUZA 4K6KA 5DPMA 4A2QA 4FGLA 4Z9AA 1T8PA 2QKYA 1X3LA 5E9QA 4NBWA 3KEFA 2AJBA 2EX1A 2H2DA 2CMDA 2QTLA 3T12A 2QXUA 2H5IA 4XIJA 5TT1A 5LMCA 4OQYA 5ES3A 5KWIA 2YINC 1T6NA 3FOEC 2Z8ZA 2C9DA 3GARA 5HOQA 4R69A 3LY7A 1K68A 4OJYA 4ACBA 1W7AA 1ZCAA 2G17A 2QGNA 2C94A 1KI1A 2ZT8A 1CUBA 4HR7A 4MMYB 3CVOA 4QC2A 2VHCA 3QEMA 1KI9A 3N2NA 1A8SA 1WTCA 4H7KA 3C3WA 1T5DX 3MWFA 1DXQA 1JI3A 1ZMRA 2YMPA 1JA9A 2XX3A 3KKQA 4WNIA 1JDBB 4OHUA 4OYLA 5E0KB 1N25A 1H0RA 3EF3A 2O5CA 2QRVA 1ENZA 1SXJC 2XOXA 4OM8A 1AQ6A 1GCIA 3ESZA 3HJTA 1PWYE 5FQOA 3RAPR 1UFOA 4LC1A 1X9IA 5G53C 3ISJA 3UJ9A 3H4MA 1B2LA 3R6DA 2OFFA 2YCLA 4BIMA 3CSSA 3UWMA 4X93A 2UXBB 3I12A 3MRXA 1YKSA 2QLTA 1WP4A 4R71A 1TM5E 2FWMX 3N2GB 5DASA 4A8HA 3LIIA 1XRLA 4TWAA 1BCRA 1O89A 2VHUA 2IU3A 3RF6A 1Y6FA 4JYZA 2ISCA 2C2XA 3EWIA 1D4OA 3L46A 4OP1A 4R0NA 1OC4A 3T61A 4R9RA 1ZIDA 4Q12A 5IABA 1PS0A 2WF9A 4QOFA 2Y77A 3A1EA 4MW1A 4JR2A 2GESA 4UXIA 5LOVB 1GG8A 1NQ5A 3EXIB 5JS1A 3P45A 4RQTA 2I1VB 3QTLA 1W4LA 4AXBA 1FFXB 4RIFA 3CA8A 1IU9A 4N9WA 3VR6A 3LC2O 4F38A 3EJ6A 3H1AA 1UDCA 1Y8ZA 1B8PA 3PKZA 1R0YA 2E5WA 4LYHA 4B5KA 5JD6A 3TLCA 1M1XB 2HNAA 2HB6A 2IIPA 3E2PA 1TYBE 4EW3A 1PEKE 1C2TA 2XVXA 2CMHA 1W35A 3F7NA 1FPQA 1TT7A 4DDVA 2AMYA 4Z4FA 2CFTA 2QPAA 3N8DA 4RIGA 3ELUA 1DBWA 3KB1A 2HLDD 4DA4A 4UKDA 2IOHA 4NU5A 4UHEA 4HWKA 3RBVA 5FPYA 5JTTA 2DR2A 4BKUA 3AEKA 2BFAA 4XQEA 3PEVA 3BGSA 2NUBA 4YJ3F 4JH0A 2UU9B 5FPHA 1IVYA 1CD5A 3D0RA 4AY6A 2GN4A 4EGFA 5I7EA 4L2IA 1GLVA 1JBQA 3LUBA 1MOQA 2P27A 3BDVA 1Z39A 3CLSC 4WEQA 2HCBA 3RSHA 3HDJA 2NVWA 3IB6A 3GLHB 5CLHA 2BEVA 1WMDA 4PHFA 1GG9A 3BJRA 3MS4A 1GFIA 2DFNA 2XCIA 1NYRA 2UYQA 3NBFA 3K16A 1X8LA 2ZKIA 1QQ7A 4KH0A 1SUSA 4D79A 4DDUA 3DLPX 1E2FA 4R8LA 2A6PA 2H11A 1N7GA 1Q0PA 2I65A 2VJPA 4NCNA 1VKRA 4NI5A 1ISSA 2ZWIA 2CXRA 1MB4A 5IMSA 2CNWA 4ERNA 5KTYA 4CPDA 2P4QA 1PYGA 2ZJ3A 3CS3A 1AG9A 1O5TA 1XMSA 2A9PA 1H0HA 2QY6A 3QVOA 4ENSA 5AM3A 4W5QA 1EDOA 1MOSA 2V65A 4BU0A 4O2LA 3O8QB 4CKBA 1LK7A 2B35A 3KQWA 4YRRA 1CIVA 1JPVA 2B5OA 4TV8A 3CJTA 1QHXA 2ZREA 4ZV9A 4BCBA 1E1RD 3BCUA 1ZL2A 4I4LA 1IZZA 1H42A 1SWWA 1YHZA 3H83A 3W78A 1Z4QA 2FXIA 1TF2A 5CFRA 1E5LA 3W0LB 5B4TA 3EGXB 2WV9A 5BQXA 3KRTA 1PR5A 1ZH0A 3TMAA 4D3SA 4CEJB 1G2OA 1PL6A 1DI0A 1JR3E 3AIMA 2COKA 4BGDA 3BTOA 2YVLA 3HXKA 3JYHA 4NEQA 2V7QD 3LHSA 1H6CA 3MYRA 3E58A 1ISFA 1U98A 1IG0A 2ZUUA 3OCYA 3INGA 5HSGA 3ZE7A 1RM4A 4D0NA 1R0CA 4A4DA 4YJ2A 5ENVA 1YWGO 3WDLA 3N2KB 1XKLA 1TEVA 1UC5B 2HDHA 4OD0A 2A92A 4Q9JA 2WWFA 3STYA 1Y5MA 1PCXA 2REOA 2WVGA 3R3SA 1XDDA 2VTDA 1W0CA 2XADA 3KHTA 3HGTA 3IRVA 1UFRA 1R6TA 1P0PA 2EBHX 1RRMA 4KH1A 4CQJA 4WFJA 5FJIA 2G72A 1S8OA 4JOCA 3HCBA 4ENTA 5A4MS 2C7OA 4QDZA 2EHJA 4WXHA 4OGGA 3LMKA 1KI6B 4UXHA 4U7FA 1LLCA 1XJQA 4E5SA 1FU7A 1OFHA 2GRJA 2O05A 4Q3EA 1FQOA 1Y6ZA 5D3ZA 3T3DA 3L6UA 1CJKC 1UJ5A 4LDRA 5EMNA 3A6DA 4UM9B 1VE9A 1FFSA 4ZVVA 4CFYA 1J7JA 2AOUB 3ZDFA 5EJEA 1N78A 1HA3A 2HEGA 1NNSA 2O2GA 3H5TA 2Y9MB 3KLMX 3JZMA 2FUCA 4LXQA 2YX1A 4BZWA 5JAOA 3KWLA 1RWQA 1EAYA 1Y42X 2EG5A 2NADA 4MQFA 4V0MA 5IAEA 5GPBA 5IKOA 2ZOSA 3R3HA 1KJYA 1SEPA 3I1FA 5D3MB 3A27A 1ENYA 2NG1A 2J6BA 3EIHA 1E1RA 3OUUA 1TECE 3L07A 4I1UA 1JFTA 2HC9A 2V7PA 4ZZIA 5A0VA 2PSHA 1GTZA 4ZALA 4HNHA 5IZ4A 4D0SA 1T0JB 1Q57A 2QUBA 3OQ6A 4MV3A 3T4PA 5C8XA 4DR1B 2UXDB 4F4IA 2QQ5A 4HMQA 3TK1A 1MO5A 1E89A 4LOHA 3DKRA 3GNQA 5EYPA 1I1HA 1Z5NA 3PZRA 2V7QA 3MAAC 3NIFB 1BVYF 3MWDB 3WG9A 4RNCA 1B93A 3SE0A 3UMCA 4ZJZA 1I3CA 4I8XA 1ZK3A 2C4UA 1M6VB 3TZKA 3WJ1A 2IL1A 3T99A 1GSOA 1TJPB 4I66A 3FZNA 5IFLA 3EPLA 4ACAA 1ZCFA 3V3KA 3SX4A 4TS9A 3QFFA 5E6UB 1PUJA 2J33A 2XB9A 3U3JA 1NYTA 4Q9IA 1YL7A 4ZQEA 1QR6A 2G5TA 2PPVA 1P91A 2XYVA 1PEDA 1P19A 2OV3A 2A0YA 1C3LA 1OROA 3AF2A 1IPFA 3I92A 1RZ3A 1NN5A 1QIMA 1Q16A 3L7OA 3IA2A 3O8DA 4UBOA 5AKYA 3SKVA 2Y1XA 1UK6A 4RL6A 1FPMA 4AKEA 5IASA 2Z1MA 3JQ7A 3EJWA 2NO0A 2O2SA 4D9BA 4OXQA 4XGQA 1LK5A 2RG7A 3CQ9A 3MCVA 4COOA 1YCFA 3SHOA 3IPYA 2YJ6A 3UXHA 3SS8A 3WLRA 4HH4A 1R0XA 2B3DA 2W2XA 1W4RA 3QLUC 1YT5A 4Z1MA 4G84A 2VQEB 3H6HA 3B6KA 5KYUA 1YRWA 1K3UB 3FF4A 1MQSA 5AKIA 1OHHD 4YFVA 3MCZA 3Q7PA 3WRXA 4JBNA 1A4XA 2VCHA 4BZXA 3PQFA 4F9TA 1KO4A 3DDSA 2VDRB 2DE0X 4UPEA 1KMHA 1Z16A 4ZKEA 3FUTA 2V6MA 1QF6A 4Y0AA 1Y3BE 3RVLA 5JV5A 1HNZB 3O75A 2VJKA 2GZHA 2X4GA 5ECGC 4GG1A 3Q9LA 3U7RA 3RTCA 4FFBA 3VZSA 4L8LA 1E4EA 1HFJA 1TQ8A 4C9BA 2XCRB 3ZCQA 1PYDA 4R5MA 4X5OA 1JPJA 2VSOA 4YDSA 1A9XB 2I3BA 2PZGA 2WIBA 2OYSA 4CCSA 4DSUA 2ZYHA 3SF0A 1YZVA 2X6TA 1WTAA 3HHEA 1BX3A 2XZTA 4JT4A 1NI4B 4M86A 2FHPA 4BVBA 2G08A 1V7PC 2VZ0A 3SBXA 1HFKA 4S1OA 5JZSA 2HYIC 1FNBA 4FZ5A 4ZOCA 3U40A 4B71A 3D6JA 3KQQA 1EVQA 1GV0A 1MPTA 1N5MA 5JHHB 2TRSB 5DEOA 4ZD6A 4LF4B 1Z38A 4NBRA 1H1LB 1ESZA 4XYBA 3TOVA 3KPVA 1X74A 3SDZA 1EXDA 3GBSA 3ND5A 1G8MA 1N9KA 2F1IA 2X13A 3QWIA 4OHRA 3TTSA 4BMOB 5IWAB 3IFSA 1WPXA 2PT5A 1M7GA 2X9LA 3DTTA 3IBYA 2OBBA 1Z62A 3KLBA 4KRXA 3VU1A 1BS2A 3ZVNA 1F3OA 2QSJA 4UD6A 4RESA 3ZU2A 5IC5A 1B76A 2DCMA 4FI3C 4YUAA 4IICA 3TNYA 3HXQA 1HEYA 1NC3A 1EE1A 1Y9JA 3D0KA 4NG5A 3QU9A 5DYGA 1DX6A 4DL9A 2JHAA 4H0NA 2ATIA 3P2OA 1QCZA 3MIIA 4OJQA 1AK2A 1VMKA 3O1HB 4YAJA 1X1CA 3Q8XB 3NJRA 2JZOA 1KVTA 5GV7A 5LQKA 2J6CA 4YJKA 3EUAA 2Y4NA 3MCWA 2G8NA 4MR9B 1WHSB 2A67A 1FDRA 4ANFA 1GEEA 4NC9A 1QQBA 3OEED 4AMBA 3A7EA 3Q5GA 2RI0A 4D1YA 2A57A 3HU5A 2GUWA 4N18A 3SQDA 3PEFA 1OGYA 3LLSA 2YWXA 3AX6A 5TT0A 3WYAA 3AESA 1W52X 3FSEA 4NCXA 3WNZA 3R23A 5DIFA 2QTGA 1E0JA 3TQTA 1CVRA 1N77A 1OXTA 2EJCA 2V54A 5F12A 4YRAA 1X7WA 4KVGA 4PS1A 1Z4MA 2P9ZA 3DNMA 1HY3A 2E4UA 2QZSA 5ELMA 5KHOC 3TW8B 3ND6A 3RVRA 2I2DA 1NRIA 3NV9A 1ACLA 1L5SA 4YRDA 5AFSA 3KEMA 3I5YA 1Z2NX 1SG0A 3NW9A 4KQIA 4PINA 1MRSA 2BUAA 4L5JA 1ORTA 2BHTA 3RNLA 4C6TB 1UBRS 2E48A 2YWGA 4B0PA 1RRVA 3FVWA 8ATCA 1TEZA 1QGED 4JBXA 1Z36A 1QRRA 2QSUA 4WA7A 4X8OA 1K6EA 2H2GA 2CHVA 5DNYB 1KEEA 3V34A 1AS3A 2OCBA 2CKDA 4HUQA 2CLEB 2EXXA 1BW9B 4L4YA 3A9SA 2EKQA 3VMMA 3HP4A 3ZBUA 1SKQA 2AR0A 1C7RA 2XTJA 5FHRA 2J6IA 4ZMRA 1OH8A 1EVLA 3RRXA 4IMPA 2FW9A 4UTRA 2X22A 3U44A 4PQGA 5AJHA 1AB6A 3ZDEA 1U6JA 5CURA 1F8GA 1PE0A 3F3MA 3K5PA 3ZWYA 4AZSA 1KI3A 4RDIA 4TM7A 4I6EA 2WF5A 1XU7A 3LZ6A 4JP5A 2C82A 4UEOA 5TQVA 4IJVA 1UJBA 2EIHA 2Z43A 4C03A 1OI4A 3ZVLA 4BNMA 2CEAA 3WGVA 1Z0AA 1J0DA 2FZCA 2Z9CA 5FP0A 3MG9A 5JDCC 5KQGA 3MMPA 4P4UA 4UARA 1S0UA 3RUDA 3M8KA 4P4LA 5FWXA 2UDPA 4TTPA 4ME6A 3UY4A 3ZDDA 3NHRA 5TLSA 5IDVA 4WLEA 4MI3A 5CYFA 2GNOA 3EGOA 3EUFA 2CVQA 4ZVSA 1L5WA 3BB4A 2Q3CA 1B00A 1XEWX 3DTVD 4TTAA 5C8YA 2REBA 1KO1A 2VNSA 2BFOA 1H1DA 1H05A 1AA6A 1X6VA 1BJRE 4TLDA 4BNZA 4YREA 3JPYA 1C8BA 4XARA 5FPKA 1XPJA 4FE7A 4HN2A 1GTL1 1UOEA 3BGWA 4R68A 4A7PA 3G0IA 3HCRA 1XQWA 3HZHA 4OHCA 3M6WA 2WJ6A 4KIGA 3DVQX 4YJGB 3U3ZA 3SPXA 4B9EA 4IFIA 5CA0B 3GO4A 3FUCA 4GS5A 5ICCA 5JTUA 1O58A 4G65A 2GWHA 2IYSA 3L0CA 2HU8A 4NFYA 5BNFA 4DTIA 4N76A 1RXVA 2QQGA 2DETA 1FUEA 3OM1A 2BOVA 2PH5A 3HVHA 5ITZB 2WB2A 2H2HA 4QU9A 1TO6A 3FX2A 1P2BA 2IBMA 1CFJA 2DBZA 5AM5A 4WY5A 2D5LA 1AC5A 2FN8A 4GKVA 4DLXA 2WSBA 2AE2A 1MC4A 1E94E 2LKDA 3BSWA 3C4QA 4PPYA 2PG3A 3HKEA 5LD2C 4BNFA 1JWLA 3A9WA 4LJ9A 1VOTA 2EHDA 2OB1A 3AEYA 3PFKA 5FV4A 4OAPA 2ZSIA 4QUHA 4BVKA 4CKEA 5TPWA 1M10A 1UADA 5DYTA 3NDPA 3SEZA 3O4FA 1E2MA 1VIMA 2BP7A 1Z4KA 4LHVA 1S2DA 4WD3A 3DEZA 4ZREA 4GMDA 3TJMA 2YFYA 1C3JA 1G6Q1 2PA0A 3AY0A 3HUEA 3ZHTA 5BR8B 1UPTA 1VIVA 2C2BA 1P2SA 1UZNA 2R1VB 3B3FA 3K5WA 2IIQA 1EVZA 2JAQA 3H1TA 4GI2A 3FVTA 2NWQA 2GETA 3MYYA 4ND1A 4OYHA 4ENUA 5BXQC 4IX9A 1N2OA 1Y8RA 2QG4A 4QJ5A 5L3QA 4H1HA 4KMMA 1AXRA 4S0XA 5KKAA 4DCUA 1U31A 3MUEA 4EG7A 2QLBA 3V8MA 1W36B 4JJ8A 3I6IA 5JSQA 2QD2A 3KOUA 3H3XA 2WM2A 1TZMA 4GXRA 4MUFA 4D3DA 1FFHA 1YB4A 1Z6ZA 3VKWA 4BJ3A 1SBZA 1KWKA 5CT4A 1VJDA 2JLQA 4TZTA 1RC8A 3T1QA 5KPJA 2D1TA 2ILVA 1LJLA 3F7OA 1SQSA 2PKQP 3K73O 4PZ9A 1IY8A 3PQDA 3NVDA 4K40A 4Z54A 5JJCA 5BYBA 2BR5A 4KAAA 5HJEA 1JILA 3OIFA 2AH5A 2NUTB 4A3SA 5IKMA 1M1YE 3SX0A 4B09A 4JFAA 5K8JB 2PX6A 3IAM1 1CF2O 1XZNA 3QITA 4JUIA 3VU9A 4EJSA 1LTHR 3GVIA 3UK0A 1UKCA 3SX2A 3SU8A 4EG3A 1IZYA 2R6HA 4JELA 5KSPA 5CFLA 3T1HB 2GPWA 1YR1A 5CUQA 3K6SB 1USWA 4PQEA 5A4JA 4PSVA 4DCPA 2VHTA 4OQFA 1MJGA 4CQMA 2H1VA 2O2ZA 4I3GA 4F06A 1N8SA 3BB1A 1F6BA 2GPSA 4EFLA 1L7VC 3AVPA 1AGYA 3DAOA 3JY6A 4YWJA 4JBGA 4DUPA 1IVSA 3FA2A 1BO6A 4XCVA 4B3MB 3BKWA 1CIJA 3K5IA 4G37A 3UHJA 1L7BA 4M8SA 2XUHA 4PZLA 1EXVA 1PI3A 4O25A 4BS9A 3UBMA 3FMIA 3OFVA 5K6AA 2FN9A 4J07A 3UJDA 3ZTTA 2W5UA 4GQIA 2GCOA 1RP1A 1OLXB 1Q74A 3P0FA 3PFNA 1TK2A 2DCUA 1T0BA 2AK3A 2ZXEA 1MG0A 2CKMA 2GERA 4ARSA 2GS9A 4F92B 3MJTA 3LECA 3EQ9A 2AC2A 1JDTA 2VDJA 2J3LA 3E7XA 4LDAA 3UHOA 3T9BA 2QN3A 5EE0A 2O2IA 2G4CA 2V74B 1LVUA 2GFHA 3FUXA 3EDOA 4LBVA 3AJ9A 4K9MA 2V03A 4LDPA 4CV0A 4DREA 5CAEA 5CTAA 3EZFA 3HUFA 4N6OA 5E38A 2X6RA 1DZIA 3T7KA 3TL2A 3U9TA 3V1MA 4D9IA 1GYRA 3QUAA 2F9LA 2QLMA 3WOVA 3R6WA 4TWBA 2FN3A 3DAFA 4GM4A 1RXSA 4TXHA 4F4JA 3FLBA 5JVDB 2RHMA 2WU3A 1QC5A 3QOFA 2ZCUA 3JSXA 1QAOA 3FHJA 3K8QA 1CQIB 3V9AA 3PE6A 5EESA 4BPBA 4FBLA 4CMCA 3N3BC 1AXGA 2IU6A 4TPKA 1NTOA 3ADOA 2K2QB 3BTUA 4CG2A 2NIPA 1TA0A 2DLDA 4FYMA 3H0KA 3HH8A 5JAHA 3UMBA 2R96A 1ZUWA 3A2NA 3IV6A 4YASA 1KPHA 5DCLA 4LHZA 1V39A 2QVXX 5L7YA 4BX0A 1GTVA 3UNXA 1I0LA 1QG2A 1MW9X 2HJHA 4AX8A 3DP9A 1G4UR 5EE3A 3PFCA 4RTMA 3IEPA 3T41A 2X14A 2ACEA 1JR3D 1NF9A 2H17A 4LXTA 3I72A 1O5IA 4RH1A 4YRBA 3RS9A 1CY7A 2B94A 4O1MA 1JHQA 4FX2A 4P83A 5FOXA 2AW5A 4B3JA 2A1TR 2XECA 2D8MA 2Q07A 1NDQA 4QECA 2Y0BA 1NASA 3QPAA 5JNSA 3DHEA 2J30A 4NBSA 1OAKA 3UMMA 4DWWA 1PVVA 5K8IA 2HAEA 4GNKA 4B32A 2W37A 1TD9A 1S6YA 1KFCB 3PC8A 4P38A 5FTJA 2J9ZB 3AR6A 2AK2A 2ECKA 3U9SA 2HT6A 1SMKA 5JMTA 3Q1KA 2GJKA 3C6KA 1LDNA 2FN7A 2JDIA 3GD5A 1ZVVA 5CBPA 4RAQA 3BFJA 2W98A 5ALMA 3VPXA 3S2SA 2VDWA 3Q3EA 2OUIA 4II3A 2PMDA 4M54A 5KWEA 1TPZA 2K87A 2FLVA 1KKUA 1KY4A 3OFKA 5ALNA 2YNMD 1I80A 2H1FA 3E3OA 3A3KA 4OA5A 4DYHA 1S5PA 4MVJP 5LR6A 2BGIA 3LA6A 3MFQA 2QNRA 1UEIA 4U7GA 2XGJA 2Z2ZA 1RYNA 3NPAA 2GKSA 2I4NA 2WP0A 3VVLA 4FYKA 4EHAA 2O7RA 7MDHA 4OAQA 1XHFA 3ZY6A 1NBMA 3S70A 2OENG 2EW1A 3PF8A 1ZA1A 3ZWCA 4QVGA 3GZNB 1L5OA 5CFMA 1B0PA 3L0ZA 3P9XA 4YAKA 3KKZA 4GZMA 2PKYX 3TXAA 1R27A 4N40A 3B5IA 4W5HA 1A8HA 3CY6A 3JWEA 1U6IA 1L9XA 2ZSHA 4FFPA 2C04A 4HN4B 4L0QA 4GYJA 4AM8A 2VJDA 4TN5A 4KWTA 1BXGA 5CGZA 3V2IA 5A06A 2BT4A 3FTQA 2WD9A 4IO1A 4NP6A 3M3HA 1DAEA 4YB8A 5C1DA 2SKEA 1Y4UA 2QD5A 3D8SA 4IINA 4NNOA 4IJUA 1X19A 2UKDA 1FU8A 1U8FO 2QB5A 5JAUA 1IE3A 1Q3HA 2I62A 3BC1A 3BUSA 1RZUA 3DE5X 3EVFA 2ANBA 4RD1A 2F8TA 5H16A 4ON9A 1G8KA 4RPKA 5ENDA 1KQ3A 1CUVA 1IBCA 1YA8A 5EPOA 3THRA 3DMGA 3NHZA 1SVLA 1GTRA 3GPIA 4OB8A 1Z4OA 2MYNA 2RH4A 4XVUA 1DXHA 4XLLA 4KN5A 1ZWLA 3COPA 4IR7A 2ECFA 4A6XA 3PHCA 2EEPA 3QJYA 1IQRA 1DOHA 3FI9A 1WB9A 1GUYA 3SQWA 1QNLA 1BFUA 4K05A 1DWQA 3VZQA 5JRDS 3SSAA 3G2LA 4JHLA 4IIJA 5CTJA 4DDHA 4EYOA 1MAWA 5EIOA 2X4DA 3CE6A 5IFKA 5IJ9B 1N6IA 2HH9A 3HUDA 5JARA 2ASEA 5G41A 2EFHB 3IT3A 2XOKA 3GIWA 4DWOA 5B7PA 3IQEA 1BZYA 3KDPA 3N76A 3G5AA 4GWGA 4IEFB 2V8BA 4KREA 1VDMA 3PDJA 4Z2YA 3WLFA 3RC9A 4MGEA 3SF8A 2C2HA 4DM4A 4QJ3A 3OMXA 4UQOA 1NT2A 1YQDA 2I3DA 4A5OA 4A82A 1V9CA 1JYEA 2OK8A 4YPVA 1X7ZA 3L5KA 4ENQA 3WIUA 4Q3NA 3WRVA 1VYUA 4LNUB 4M1SA 1GZSA 3K0CA 1V6CA 3ER8A 1WBDA 4EABA 5CA1F 3TGWA 2DBQA 3CLKA 3HB0A 5EMJA 2F8SA 4Y6PA 4I5DA 5DSXA 4UDXX 3ROQA 1GN8A 4M99A 2WVHA 4QREA 3AUKA 2D1RA 1SKAA 1QYCA 3IESA 4MITA 2B0JA 4EJMA 4EVSA 3W9YA 4QOHA 1E7SA 1XROA 1LDEA 4EB3A 4CGZA 4EPTA 2H6EA 1WB4A 2NZWA 3GLQA 1JLHA 1XMJA 1EH5A 4YIKA 1RZRD 5E9JA 1C7IA 4G5YA 1E2LA 1RLUA 4W8GA 3MQ2A 4AECA 1NATA 4DLLA 1I2ZA 1UT8A 4NULA 2EGHA 4QPCA 4D74A 1EK0A 4BQEA 1WRBA 4NH0A 5AIAA 3GJYA 3M6VA 1XRSB 3VVMA 5LYJB 4S05A 1T5BA 3L4BC 3NEJA 4DRXB 3IKTA 1PNOA 2OY0A 4HY3A 2IA5A 2CD9A 4Q9NA 1PWEA 2G09A 2J48A 4C7BA 2YOFA 2C4NA 4GXNA 4ND3A 5EWLA 2H0AA 5A0FA 3VI4B 1E2KA 1QYRA 4BP1A 2ZU6A 5H3LA 1UBOS 5BUQA 2QHXA 2VRCD 1IPHA 2BBTA 1V1MB 2IXAA 2BI7A 4OMCA 5JDIA 1O6CA 4QU8A 5LSAA 4YV7A 3K9HA 1NOIA 2B1RA 4J16C 2Y76A 3TIXB 1IM8A 2BSQA 4D92A 4R7ZA 5H81A 3U09A 3IAFA 1ONSA 2N1MA 1K8ZB 1FX1A 3KJGA 3OQIA 1YBAA 4ECAA 1ZBDA 2IX3A 2XKKA 4AUKA 2OMKA 3Q1LA 4OHWA 2FX2A 1Y81A 2WHYA 3IJPA 3IE1A 2FZLA 2P35A 5E8RA 3C3KA 3JS5A 1XVUA 1GADO 3H65A 3C6QA 3JALA 5AVUA 2Z3ZA 4EHHA 1PRYA 1XCLA 1GZ5A 4BKMA 3LPDA 4ZMSA 1H6AA 4CZ2A 3U3DA 4B4VA 5AUPB 1BE8A 2C7VA 4RJIA 2BDUA 1DFHA 3RJ9A 4E15A 1YFZA 3C8UA 1Z5GA 3PDIA 2BD0A 2M6SA 2QX7A 3MGBA 1E1MA 4CIVA 1QUEA 4O2AA 3GRAA 3HJCA 2HJRA 1MX5A 2B36A 3LOPA 4MKZA 3DOUA 2FG5A 5KPDA 2C9MA 1YF3A 4IUDS 4KJZA 1XQ9A 2IOFK 4O2BF 4D4JA 1Z37A 2CXQA 1XRNA 2P0AA 1B26A 2I0FA 5E6RA 2CHFA 3LDFA 4DA8A 4ER5A 5KNBH 1CNFA 4V1CA 1EXWA 3DLHA 3EDYA 2ZTMA 1YDEA 2ZUTA 1QRTA 1G42A 1YC2A 4TMVA 5H3CA 3S44A 4AZVA 2JGMA 3O4HA 3IEVA 4INPA 3K6JA 1E9SA 4KXNA 1NJ5A 2GZ2A 5JSZB 2WQ7A 5LP6A 2D6FA 4ZN6A 4OUKX 4LGMA 3NTXA 2J0VA 4GI3A 4X61A 1H9BA 3RVJA 1E9BA 5IVDA 2GLTA 3COZA 1E7YA 1JR4A 3GLSA 1OXXK 1SXJB 2C8VA 2ID4A 4OBEA 2IUTA 3Q5EA 5I4BA 1YZLA 3KDSE 2Q6LA 2PFKA 1A96A 3DL0A 2Q7OE 4PG6A 5D85A 5IMBA 2P2NA 2XUGA 1F38A 1GVHA 1HQCA 1K6IA 3FE2A 2BH9A 3IQWA 3OZVA 4H3SA 4WZBB 5AYVA 3X0DA 3CUKA 3W8DA 1HDCA 5FL7A 5TMDA 5JXGA 2WYIA 4FU0A 4K9RA 3G9ZA 5IC4A 4XIFA 4M76B 1HETA 1V5WA 3F4LA 1Z5WA 3IDQA 4KI7A 4C14A 4UHDA 3KEGA 3OU2A 1CLUA 4C6RA 2RJ3A 1FP1D 1MAAA 3NJ4A 3KS9A 3ZGVA 1Y63A 3FHCB 1JHVA 3ZBQA 2WWTA 3TLJA 4CYMA 2B8NA 1TQ2A 3HKDB 4YXWA 1I0IA 3FTDA 4P5PA 2NYVA 1Y4DE 5EZSA 4HXGA 4JT8A 3UQYS 3WHIA 1QHNA 3OQNA 4I4TB 3THWB 4PO3X 5B7GA 3GN1A 3CUSA 3PL5A 4HAIA 2WZDA 1IUKA 1UKVY 4AJOA 1IYZA 1LW6E 1MQ8B 1O6ZA 3K09C 2IUUA 4BC1A 2KW5A 1NVTA 3RSZA 1M2EA 5HIMA 3SZGA 3X1DA 3I64A 1CR0A 3DAGA 4R8SA 3WGUA 3P2IA 2GR9A 5AK3A 4ZC1A 4ZAZA 4IP0A 1I24A 4G09A 4YECA 4BOYA 1R8YA 3EC7A 4L4UA 2WFLA 5GQSA 3LQ2A 3KSDO 4K6OA 1V9LA 4F6LA 3LC7O 5AW5A 4P4SA 2AUTA 2PAAA 5T57A 1TRKA 4WH0A 4KWIA 2RCNA 3REFA 1U7ZA 2O8DA 4FVTA 1A9TA 3DOIA 3QWBA 5E2IA 4KV9A 1MFPA 1MO4A 1UP7A 2PKCA 4C20A 1N3YA 2QA5A 4B46A 4C5AA 3OX2A 1RZVA 3TQIA 3ZCVA 4EG8A 3DDWA 3O2NA 4EUFA 1EIZA 4YRKA 1IM5A 1AX9A 1LDBA 2FMKA 4G0YA 1JSZA 3UMGA 2I99A 4RFSA 3IBFA 3BK2A 1TCVA 3KCQA 4ITRC 1GUFA 4C0HA 5A1JA 3RYIA 3D64A 2I4MA 2Q4EA 6ADHA 5H8WA 3QVUA 1W581 2EW2A 4MVJA 4EPWA 2ZJ2A 2BJWA 3U3XA 3UVEA 4C4TA 2MSCB 1P1IA 1SUCA 3C5EA 2DPYA 1LVGA 3GI1A 4UBJA 2H8KA 4F6RB 2PAFA 5H1YA 1L7RA 1KU6A 1KI7A 3CG0A 4Y1RA 5AK5A 5CVCA 2IV3A 3GEDA 1SC4A 4WACA 3RC1A 2ZTLA 4NE9A 2PKXA 3AI7A 4QTTB 4W5WA 4V0RA 1LPPA 2ZKLA 5HFNA 3W5VA 1NXQA 5G0UA 2ZR7A 3T9EA 4TLMB 1L5GB 3MJSA 3G7UA 1ODIA 4A15A 3MGGA 5AK0A 1T5LA 1N5DA 2PZJA 1JFSA 3X1XA 2NXCA 4GR4A 2GNPA 2JCGA 3FF1A 4A9AA 3IPCA 3EMBA 4CTNA 3I01M 2PMCA 3H8JA 3PCXA 1LLFA 4A5SA 3EYWA 1A69A 1ULTA 1VXRA 1XZJA 1FRQA 5HMLA 3ZHYA 5AD1A 1SXQA 3B6ZA 4XYGA 2AMLA 4TSFD 3ZH9B 3P9RA 5A62A 2P4SA 1HYBA 1ENPA 5CVUA 5DO9A 621PA 2F17A 1VZ2A 2R85A 4TUYA 4CIYA 1A7KA 1KBOA 4XIGS 1DRKA 3T52A 1G63A 3MELA 5M7EA 3KJIA 1V11A 1Z15A 1I10A 4CM9A 3DV0B 4TKVA 4ASUD 3ZHQA 3KYIB 3UMFA 1NF3A 1OGIA 1HMPA 1WMBA 4WTOA 4JBHA 3ZXSA 3B1XA 2WU1A 4NH4A 2IH4A 3BIWA 5DGHA 5NULA 5ARBA 4CKCB 2J9XB 3H75A 1D2NA 1DKRA 2XZPA 2I7CA 1G5PA 2W4QA 2HF2A 3C1OA 2OV4A 3EGDB 4LVUA 2OQVA 5H4GA 4CF7A 1DIOB 1TMKA 5KKNB 4OX9Y 2JGEA 3FVRA 1ZHHA 3MGKA 3MQ4A 3NLLA 4ETIA 3I2GA 1W93A 3A58B 3JXEA 2WE7A 2XUDA 4PYQA 4H7HA 5HDBB 4DLZA 5DK4A 2FRDA 2PGIA 4HQLA 2QE7D 4J7CA 4RWZA 3OD1A 2CBGA 4F2HA 4QOIA 1SB9A 3R3UA 3TI7A 3PUWA 1YVDA 4KWEA 1SUIA 2ZJ4A 3UT6A 5IAOA 2BFEB 2P2GA 2VOJA 3RGGA 1KWGA 4AWAA 3BXPA 4EFDA 1YB1A 1P5FA 2VYVA 3L7CA 3I09A 5HJ7A 1TADA 2ZTHA 1JP7A 3EA4A 3ZGYA 3SLGA 2P6RA 4MLPA 3HEMA 2H0RA 4JUCA 2ZUFA 1G4AE 1C4XA 1UBGA 2FEPA 5DBHX 4ZXFA 1M2JA 1DTSA 1ZOOA 3QA3E 4IOMA 3ZZ1A 1R6UA 3PFIA 4BE7B 4PY2A 4W82A 2ANCA 1ISRA 2G1UA 5BNWA 3E9RA 1E2DA 1TAHA 3RO7A 3IJRA 1GRQA 3FCXA 3PQ7A 2NV2B 1NVDA 3OLVA 3CNQS 5G4LA 3V4SA 1ZVKA 3ZLBA 2MSDB 3LCRA 2F67A 3CEHA 3EEIA 4EFNA 5CJJA 2BM0A 3CIFA 4B34A 2QE6A 1E9CA 1JUDA 2UYCA 3HKCA 3Q6MA 1U3UA 4YIHA 1M54A 3R2JA 5A4DA 1L5VA 3DJFA 4QXQA 1YTUA 4FFWA 1G3UA 3O3MB 4BB6A 3G7SA 4GR9A 3ZCRA 3Q3IA 4B31A 3F47A 1ETHA 1N9GA 1WF3A 1OV6A 2JGLA 4BAUA 1FFBA 1YHNA 3TX6A 2O1XA 2O0MA 1N0VC 3VC1A 3D0OA 4DXDA 3OQ1A 3TBKA 2FSVA 2AFIB 4GMGA 1KHHA 1SHUX 2X2EA 1RPAA 2GEBA 4ZGWA 1YMUA 3KXLA 1KZ1A 4Y1FA 1E6EA 1N2CA 3KKOA 4IKOA 4RF4A 3I9MA 1QGDA 3PXDA 2Z3WA 3OJFA 3D6UA 4Q37A 1MRZA 4L76A 4U63A 3AERA 5F5NA 2RK3A 2V5AA 5IN5A 1Z8NA 1U11A 5EHNA 5FOWA 3OEHA 4F85A 2J46A 4NCJA 1ZLYA 2ZS8A 4ZI3A 4ZU6X 1J2YA 2XVMA 5FI0B 4Y9UA 1ABFA 5LUAA 2WG2A 2AHRA 4M1YA 2PGNA 4WVFA 1YBFA 2X5XA 4YJFA 3UWDA 4QKQA 5L6MB 1NW7A 1ZJ6A 2BFCA 1KC3A 1DO2A 5L3ZA 3SYMA 1SQ6A 1QXSA 2X3YA 1KZ4A 4BE4A 2A7QA 2PT9A 1DUVG 2FEAA 3GFBA 4KXQA 4TYQA 4HTFA 4JI6B 4MYCA 1H69A 5MN5A 3WHPA 4DCSA 2DFPA 1RWVA 2VFAA 2GN6A 4F9GA 1W5TA 2WTAA 1M8GA 4NOKA 4DADA 3PS9A 1JG7A 2ZI6A 1FRVA 3ECAA 3X44A 4BNJA 3K70C 3H2YA 5A6SB 3V3TA 1SVOA 3GD7A 4I81A 4K81B 5KJCA 1AK1A 4C78A 1R5BA 2ZUWA 1R8SA 3CTMA 2I91A 1SK9A 2MMGA 2CSXA 3GPBA 3ILHA 2QP9X 4P7GA 3ZWWA 2AXEA 5F3RA 1OH6A 4HF7A 4FIZA 4W5NA 4Q4DA 5KTOA 2VL7A 4EI9A 3NHAA 3GNLA 1UEJA 2W6ID 3C87A 1Z4NA 2W8BB 3ETLA 4I3FA 1V6AA 5K0JA 2PWPA 3M9XA 2O2JA 1VYTA 4R8VA 4BO6A 4BYGA 3TNDA 5HF9A 4PCAA 5A3JA 1KTIA 3LYLA 4CN8A 4QFBA 2O0HA 1ZG3A 4GL4A 5BNZA 2EGUA 4JDPA 1O8CA 1Q95A 2NN3C 3MS7A 4Q3AA 2VT2A 4HDQB 1ZOIA 2ZQYA 1K92A 3LVQE 5JD4A 2OPHA 1C0KA 1NQXA 2H3EA 4FNMA 4GX5A 5F35A 1TM2A 2K6GA 1V7QA 4IJMA 1U81A 2OQIA 4ZV4A 2QBYB 1RI3A 4K28A 3SICE 4BMVA 4MKFA 3USZA 4MVJI 3FR7A 1FK8A 2BFBA 3TQRA 1M0EA 1O96B 2GILA 3HRIA 3NOXA 4HQ6A 4ONEA 4LJ8A 3TZLA 4CI9A 1KKMA 1YTLA 1PFGA 2H1SA 3QIAA 4XD2A 3B8HA 4MS4A 2KBFA 2GH1A 1MRNA 4N39A 3ZPXA 5HUQA 4ZT2A 2ZVPX 1J70A 3M81A 1BC5A 2WICA 3KUXA 4FZJA 1T91A 3JQ8B 3J81k 3VTAA 2OYRA 1RRGA 1ZGGA 5FUMA 1NG1A 4DJAA 4U6QA 1ADJA 1V3UA 2WJ3A 4M0DA 4PBTA 1J06A 4EI8A 1DIRA 4JENA 4CEIB 4MAMA 2E4WA 1YZFA 4TTIA 3IP9A 1H2XA 2Y0CA 4BNNA 5KUTA 3HJNA 1P1JA 1ZD2P 1NMQA 1JPNA 1QYXA 1B8VA 2W8ZA 4LWOA 4NF2A 5EXXA 5AIBA 2JKVA 3NTLA 3FOAA 4Y2RA 1L8QA 4D3YA 1Y4ZA 5B5SA 4D6YA 3CX4A 4ZIRB 3I1JA 3N7TA 2OAGA 3TR0A 3N1UA 4RXUA 4LOIA 1T1JA 1YRAA 3GV0A 3QELB 3WRXC 3ZOKA 2NZJA 1Y89A 1H2BA 1N33B 1M2KA 2ZETA 4X6YA 4BLQA 1NX9A 2VNAA 4YJFB 3W2FA 3N7AA 1J9ZA 1AF4A 2QW0X 3EGCA 3OAAA 2CLMB 2G9NA 5AO9A 3V6MA 2O59A 3B1WA 3DWEX 4BNWA 1XLUA 4QTYA 2GK4A 3HFJA 1SUWA 1R4MB 1E60A 1US8A 3NH9A 3UKJA 3TFQA 3BMXA 5SYAA 3W5UA 4MUIA 3DXFA 5JC1A 5EI5A 1J0BA 1O87A 4DJJA 1QTIA 2NW6A 3ELBA 1ZUIA 2IEGA 1VL2A 2ZYGA 3L0IB 3LK6A 4K3VA 1A7JA 5EKUA 1P3DA 3HACA 1CY8A 4PC2A 4WJZA 2AOVA 4FFRA 4F56A 1A8PA 1WCWA 2XB4A 1MX3A 3HYCA 3KZCA 1ISPA 3O73A 3HYNA 1XFAA 5K45A 1KBQA 1OX4A 4MYDA 3GLIB 3R9WA 4DC9A 3CTPA 3KWMA 1XJWA 2EKBA 1E7MA 3MWLA 5DW0A 3VJLA 7MHTA 2WJYA 4MX8A 2D00A 2PY6A 4TYMA 1JKIA 4L85A 1KGDA 5A7GA 5AICA 5DT2A 2W2LA 4MGYR 1TL7C 3QG5A 3SZOA 1UBCA 4MQEA 4DHWA 2AN3A 4H1TA 1TTTA 4QM6A 2K5UA 5GOZA 1OAOA 5GAJA 1T35A 4RD4A 4U1RA 1WOYA 3EG9A 4LOJA 2PSEA 5B4UA 1DAHA 1YVRA 1Z6TA 1WS6A 3HYTA 1X70A 2H1IA 4NENB 5G40A 5KMGA 3E4CA 1S02A 1A5ZA 4EUHA 1NFFA 3IX7A 1FSZA 4UTVA 4AAYA 4Y0VA 3H5IA 1HYEA 2JLXA 1XP5A 3NC0C 1GUBA 3BBLA 5KSZA 1IEWA 4GU5A 3C6MA 1NFRA 5KC9A 1O9GA 3OSZA 5J1TB 4TZ0A 2FE1A 1XMQB 5JSKA 2YHIA 5DIZA 2NTJA 3U3KA 1AGRA 3OJWA 2PIAA 1U2PA 2G9VA 2IPOA 4D3ZA 2DUWA 1GXSB 2P78A 3S1AA 1OOEA 2LGJA 3LS2A 4M36A 3S1SA 4BLPA 1AN9A 3AGQA 4H7FA 1NN3A 4XIYA 1TGYA 1Q2XA 2WIKA 5DWQA 5F4ZA 1YOBA 5LD2B 2R4QA 3CR8A 4KXMA 1ADFA 1VG8A 1X8JA 1LX6A 2NYUA 2JJ1D 4AULA 4CF6A 2IS2A 2OT3B 4FGSA 3PNLA 1L7DA 1NKTA 3BFVA 3TRDA 4YMHA 3HCAA 1YQQA 2GZMA 4KXXA 1BGVA 3ORHA 4UDOA 3SVTA 2NO7A 4ZDWA 5ALGA 1NV9A 2FMXA 1ICEA 4QUEA 2X8JA 1JDJA 1DAMA 1N6OA 2P7IA 3ADCA 2GF9A 3EX7C 3IIEA 3THXB 1C7JA 2V7VA 4D96A 1AN0A 2OE2A 3DKKA 4KPUA 4JB3A 4FC6A 1O94A 5JWHA 3SYKA 1E69A 5FFFA 3GR6A 1NN0A 2B78A 1X3SA 2PX8A 2XWBF 4B3TB 4WBNB 4M49A 5EPUA 3TB4A 3DMYA 4M9CA 2NQ2C 3JVVA 2W2KB 4YP6A 1CS0A 4UJ3A 4WKPA 1I5OA 2TS1A 5HX7A 1LFDB 3H05A 3G2MA 2C84A 4MCIA 3ESYA 1H1TA 4JCCA 3BF7A 1DO0A 1UDXA 1QTNA 1ZN9A 4LHWA 3SCZA 2ACVA 2Y2UA 4N8EA 1JVBA 2RFLA 1L0BA 2XQGA 4L3VA 1XYVA 4FB5A 2XSZD 1YQEA 3EVNA 5KTSA 4K3UA 5AJYA 1KEUA 1U4NA 4LWQA 1AKYA 3ABQB 3C3YA 2XJ4A 3QFSA 5EY5B 2CLOB 2F3TA 3HWSA 5C32A 5IYZB 5JYBA 3LT1A 1QHFA 1EUDB 3FJYA 4CCWA 3QE3A 1P7CA 3LVRE 2FMHA 2OKCA 3E3AA 1DU4A 4HMOA 4F9FA 2BR3A 1VJ5A 2Z2YA 2Y0PA 3M83A 3FG9A 4WOCA 5AVVA 1KMNA 1U8ZA 4MAFA 4R8RA 5FBZA 4QGGA 3M4XA 5JD5A 5EIWA 3GUHA 4V24A 1HYGA 1P1KA 1JTEA 5FBKA 3JVUA 4ZO7A 4HI0E 1QUFA 2I8AA 1LC0A 1HOTA 4FEGA 4DTCA 3P71T 1O9BA 4LZNA 1UXGA 3R3JA 4GO1A 1PR3A 2QRQA 4A2CA 2W4IA 4OMUA 3ZV6A 3SXUA 3SQOA 2RGNC 3M1IA 2AI2A 3N8HA 3P2JA 4OP3A 3OOHA 1FJGB 4MR8B 3H97A 3WMFA 4JGIA 1P9NA 1PUXA 2XUPA 3QZUA 2PRZA 1H85A 4N3AA 1A9SA 2WLSA 2J5RA 4PYMA 3QPVA 1N9ZA 3CRNA 3GGSA 3ONWA 5TXGA 4ZYXA 3G6KA 3GJXC 4Q7LA 3BD6A 5DNEA 2WKQA 2CNLA 3LQRA 4CNBA 3FKJA 4Q05A 3DL7A 4B6OA 2OQ2A 2GBPA 4MWZA 4CIBA 3S7TA 4BQFA 3CKYA 3G6WA 3HKBB 2QAGA 2QP3A 3GX1A 1KQNA 3TD6A 2FPSA 2QDKA 2A30A 3KT3A 2HBQA 4MP6A 4QU0A 1XTJA 4LJ7A 3TS1A 4DCTA 2YIMA 3F8WA 2XTZA 4CTOA 1VLJA 2VAMA 4E51A 2P8SA 3HVIA 1N7IA 2MSLA 4LXUA 4HH3C 4RMHA 1LXCA 2E4YA 2YHBA 4YP5A 3GUUA 2XZOA 3LD9A 1GU0A 3ABIA 4F3KA 1OREA 3CUVA 1QGYA 1CUEA 5IEJA 3FPCA 2H9AA 3MJVA 5FO1A 2W48A 1K6XA 1K7XB 3O1IC 3KYBA 1AKWA 1IXSB 4R1SA 5AVJA 4FD3A 3AEXA 5KOHA 4JNKA 4EMBA 3KOMA 1FXWA 1TF7A 1WAMA 3FGOA 5FXMA 2IWRA 3INRA 1EJ6A 3QVKA 4G9BA 2XMRA 3KZVA 4EYGA 2Z8YA 1YB5A 4YCLA 2JRLA 1EBFA 2FZVA 5EMMA 2DPMA 1GPNA 5KVAA 1S3IA 2ZYIA 4JNCA 3A28A 3ME5A 3UJNA 1RLMA 1P6QA 3GVPA 5B3JC 1PJ2A 5C34B 1BJKA 2G5PA 3PXXA 2OBFA 2ZIVB 3K30A 3G2IA 5HKAA 1FNSA 1VRVA 3EPPA 4LV6A 1RYEA 4NTZA 5D01A 4FB4A 4ARCA 3ZBTA 1XZHA 1QCCA 5CB4B 3IE2A 4IOKA 2HWKA 5T8KA 4MGZR 4B4DA 3RSOA 3V2UA 3CX7A 3U7JA 1KJNA 2X19A 3N75A 1ESEA 4KI0A 5F9FA 2O1EA 3UENA 1JVSA 4BJ1A 4AKHA 2EFJA 1GGFA 3LNTA 2VZ8A 3FFXA 1J25A 2ZT6A 2E0IA 1J1ZA 2WI8A 3LHKA 4N3BA 3PR1A 5TPZD 3QFCA 3T8YA 4AJKA 5C80A 5IM4A 1EFAA 1L4YA 2G8LA 3JQAA 3PXUA 4NEGA 4XUDA 5GJVC 3RK4A 3TUIC 4F3YA 4C30A 3C16C 4CT5A 3MLBA 1BFKA 4K9OA 2EWWA 3AF3A 3RSCA 4N7MA 4NR0A 4YRNA 5KWSA 4CV2A 5AVKA 4R5HA 5CLIA 3D8NA 4IDFA 3FNHA 1UFVA 3BGOS 5KYYB 1PQPA 5J43A 5JALA 4XYLA 1JG6A 1BDIA 3HJFA 1XMVA 5KJ6A 4PWZA 3F74A 1QNFA 5G0VA 5BORA 5BSUA 4LX0A 2HMSA 4GUAA 3OMWA 3TD2A 4ZYVA 1BYUA 1PFVA 2SICE 4JU8A 4MB6A 2ERYA 5BOSA 4V39A 3WE7A 1OI3A 3HXPA 2JAOA 1SNYA 3GG2A 2HL6A 5D86A 4UUAA 2QDXA 2O3JA 1VLLA 1ZCZA 1M83A 3G2OA 4LSMA 3RFXA 5JAIA 3CWQA 4DUYB 3ST7A 4BLRA 1ZVMA 1X87A 5EC8A 3JAMA 2V9PA 2HPZA 2R00A 4QDOA 2FWBA 3TZCA 2AOTA 2D74A 1ZL0A 4GH5A 2B5WA 2O07A 1U5BB 5K4AA 1TGVA 2C95A 2QS9A 3CRQA 3GFQA 3GGCA 5BYKA 4KNYA 2BPOA 3E9CA 1A95A 1RM0A 2EEZA 4HNAA 4KE7A 5CFQA 1G20B 2CHEA 2WD8A 2WSIA 1N5RA 1ZJYA 2Q28A 4KDFA 4I50F 3LC1O 5FR1A 2R66A 1SBTA 3A6JA 4JGBA 1U1GA 1GA6A 1C30B 5LDGA 1XYGA 1JF8A 3BH6A 5EZYF 4HVCA 4XB1A 5EP3A 3WGHA 2GTHA 5L3SA 3OICA 4AWXA 1IHOA 1ILWA 1O8BA 2CXOA 2HV9A 4OG2A 1YB7A 2IHYA 2VA8A 3GUCA 3Q2KA 2J3QA 3I58A 5L51A 3T1VA 1D5WA 2NT3A 1U1DA 3FPBA 2CMFA 2ES4A 3TWOA 1XXHA 4L5IA 4LHYA 5BN5A 4XWWA 3RM3A 2TECE 2H2AA 4E2YA 4D9HA 3MK31 1PG2A 2B4AA 2PU7A 3T4EA 4NCAA 1PTJC 1H4SA 2PUJA 2GTIA 3GY0A 2O0JA 1Q7BA 5HK8A 4H4EA 1QQ6A 4XFJA 2EGGA 2GYYA 3NKLA 2RIPA 1P7ZA 5HRUA 1XX6A 3KXKA 2J07A 1CVIA 3OPMA 4QSMA 4DC1A 4EMSA 1RE0A 2J7KA 1LPOA 2DWCA 3BB3A 4KRGA 1V5IA 1Z29A 2P9TA 2CHGA 3REQA 1QRUA 3W2TA 4U5XA 3CKLA 2ECOA 4HX2A 1S96A 1Q19A 2CJPA 1TJYA 3DUFB 1G8GA 1XOIA 2CMKA 3R0XA 4PLPA 3BE6A 4KAFA 5J23A 1WY5A 2DPHA 4PANA 1YJAA 1NVGA 1Y8AA 4TWRA 3FPHA 3W3AA 2H4FA 3NCTA 3IULA 2D7CA 1QH1A 3F6BX 1UMBB 3I45A 4RLFA 2JPDA 4YQZA 4DQVA 1MHPA 2ICAA 2QXTA 4IG4A 1VHWA 1C1XA 4YRFA 3I9KA 1CQXA 2CUNA 3MB8A 1GNTA 3VYWA 3WLSA 4ZT6A 3NQ41 1FYXA 1UPUA 2AG1A 4XRRA 4JS0A 3S2YA 1DQPA 1DG3A 3L43A 3UCXA 4M55A 2JIZD 4UCWA 5KQPA 4B8WA 2FX3A 2GD1O 3QEOA 3R5FA 3WQRA 1SWVA 5I9NA 1XVAA 1W85B 4B5LA 3LK7A 1BMQA 2FPRA 3PGJA 3ZBPA 4E3ZA 3EQ8A 3KR2A 3AOEC 3ZY5A 4WL0A 5TF0A 4NMWA 2AYYA 4QYIA 3R9IA 1X7YB 3GG9A 1YOVA 3C6YA 1SD1A 5EUBA 1RAHA 5C0OE 1TU4A 2XIJA 3GLFA 1J5PA 1GZ6A 5LXTF 3O3NB 3PJRA 1E4VA 2YV5A 3AO0B 5JASA 4KYUA 2G6TA 2W7TA 3EZGA 1AZWA 2DHEA 4JOSA 3WLMA 2JLUA 3QYPA 3HNPA 4B9AA 2NV0A 2YY6A 2E4VA 3NZEA 2B4RO 4CUZA 2FMUA 5DSZA 4RV5A 1YB6A 1AMNA 1N1MA 1LEHA 3E1GA 4MWGA 3RS8A 4B6JA 3HBMA 4DGQA 2Q4BA 5IPFA 4B7XA 3ZR4B 3KDAA 4W7SA 3O74A 4HG2A 5COAA 3UHFA 4AVYA 4JP2A 1GR0A 3ISTA 3P9YA 2A94A 3W1EA 2DBYA 1GQFA 4MRAA 4OA8A 3EXAA 3FR8A 4HEJA 4N7JA 1C50A 1X80A 4Y8VA 4BRWA 4NQRA 4NABA 1N5KA 4X7BA 3F78A 1A2QA 1L9KA 2JJYA 3CVXA 3CLHA 1FSSA 3LT0A 2GEVA 4KQGA 3TW4A 2FN4A 2Q5OA 2BH2A 1JHOA 4LJ6A 4W7IA 2H7CA 5M04A 5FBRB 4IH9A 1EJ2A 3TZQA 3UJHA 4FOTA 3EXHA 2XH8A 1L2TA 2ZPTX 3V1LA 4HNTA 4DV0B 1DINA 1JAHA 3A3PA 2ADMA 2XQKA 3GMSA 4FWBA 4M0EA 4NQZA 4CGYA 4PG7A 3JD2A 1D2RA 1I2DA 3GLUA 2R6DA 4ND8B 3WL6A 1JHAA 3PPXA 1QG6A 1SXHA 4J90A 4RM3A 3A0UA 1KTVA 2DMRA 4LDJA 1E79A 2AX4A 4XOUA 5EFOA 3WKCA 1FMCA 4J0QA 1NUQA 1JHRA 2DWOA 2RAUA 1NLUA 4G23A 1E1QD 4BRSA 3EODA 3VXKA 2WV7A 3FTEA 1DNPA 5AKXA 4HLCA 2ZE5A 1EP3B 2VUUA 1OBFO 1Q83A 1UBTS 3HZZA 4H7EA 4NMXB 4OHMA 3CM0A 4U2CA 1KVRA 4OYRA 3VZRA 3DHYA 2VAXA 3NANA 2QZJA 2ONJA 1VFNA 3Q88A 1CJUC 1YO6A 2PYDA 4RLQA 2FDCA 5DYYA 3S1LA 2FFAA 2MYPA 3F3SA 3VR5A 1JE1A 3AVWA 3HC7A 2X15A 3UN1A 2ACKA 721PA 3EQ7A 2ZU0C 1TO1E 1KNQA 3ZK7A 2RHBA 1RTKA 4U7PB 3EOAI 1JKJA 1NDHA 3OM8A 2QUKA 1BOFA 1WZIA 3KBOA 4PLGA 2OLEA 3KZKA 4R9NA 2KI5A 3JYOA 5E6SB 4X8LA 3T94A 4BP3A 2X9VA 5JS7A 4QDTA 1QRDA 2B37A 1E63A 2Q7XA 3U19A 4ZYYA 3P19A 3CCBA 1WB5A 4KPGA 5KQRA 5CCBA 3KVNA 2O48X 3DOEA 3VNRA 1C9MA 5M2QA 4GLOA 1CS4C 1OXVA 2B4KA 2RI1A 2VPYA 3H2JA 3O92A 1ZIYA 3KLOA 3QVGB 1Q17A 2QTBA 3DPSA 2HO4A 3G2QA 1Y5IA 3R6GA 4MJ7A 5SY6A 1JSCA 5D3KA 3UXYA 1DZ3A 4C4ZA 5AK4A 1XRPA 2WJGA 3QX8A 4KQWA 421PA 4OTZA 2XT9A 4MWDA 1R2QA 2ATCA 4YMTA 1QF9A 1XZPA 3GH1A 1Q84A 4ZI2A 4WY8A 5HVNA 3TGLA 2XKAA 1MNAA 3O4IA 1FYDA 2X2FA 3N0TA 4UEQA 3PPIA 4CKWA 3BX1A 4GQBA 5DB4A 2OAEA 1IPEA 3NHUA 1T5SA 3VYSB 4CCYA 1COWD 4BMXA 2QQEA 1ZW6A 3TF5A 4O4JA 4DFDA 1EQ2A 4OQNA 3P2MA 2CXTA 1GQRA 3HGQA 3NONA 4KR9A 1OVGA 4MYUA 1RRPA 3WZLA 4LGYA 5TF4A 5IU6A 2XF2A 4JU9A 5F2NA 4ZO4A 2OECA 2ZB3A 3OOJA 3UWSA 4DNPA 3QPWA 5AOVA 3ESBA 4DC0A 1V0JA 1QORA 4C87A 1JW9B 3CUUA 4KIUA 1ESCA 2I7TA 3NBXX 2C78A 3CEPB 1FSFA 1P0MA 3TIGA 1G7TA 4IH1A 5AJUA 4X64B 3RAEC 3HDTA 2ZWMA 4FOPA 3VU0A 3ZHUA 5SZKB 3JATA 3TG2A 2HKIA 3HR7A 3MGCA 4LKRA 1QHHA 5H59A 4AX4A 3ICVA 2R86A 5K3AA 2MR5A 2WNSA 4TMZA 4X97A 1PJCA 4B2IA 4E1VA 4EY8A 3P2EA 5FPSA 4M6WA 4FNGA 4FCVA 3K9LA 4LN1A 4ZEVA 5C5CA 3QBDA 4GMXA 4B4WA 3CONA 4GUDA 4BUZA 2WSMA 3FI0A 1C0LA 1VPDA 3EHEA 1JIQA 4TN1A 1F1BA 1RPJA 5K1ZA 3WGMA 5KU1A 4I55B 1Z5PA 2VK1A 5LA6A 4QT4A 3EVAA 1ZGAA 3AW9A 1Z5ZA 5ITVA 2V6IA 2B25A 1EM6A 1MJ5A 2QRVB 3CLRC 3D7LA 4G0PA 5AK6A 5H5JA 1JQKA 2BY4A 4BLVA 3BJMA 5JY1A 2FG7C 2OFXA 2JFVA 4EKNB 3AB8A 4LZAA 5JIBA 1H6BA 1KVUA 1QJ4A 1TEHA 3ZDXB 3CRRA 3GDWA 4F7WA 2WWGA 3O2SB 1Q1QA 2FA9A 1UM8A 3TR6A 1CFZA 2I4TA 5JMPA 3FCCA 4LJAA 3FIJA 4EDHA 4C88A 3LA8A 3LJKA 5C52B 4BWYA 4AZ0A 1UIRA 5IK2A 4HFRA 3RLFA 1W8DA 1LC3A 3HGMA 3MWYW 3MPOA 4FZVA 4HXFB 1PGNA 3PDHA 4JI1B 3UK7A 3M6MD 5IAKA 4UMVA 4IVRA 1KE1A 1TUGA 4C05A 3JASA 3N2GA 3K1JA 4G86A 4CL8A 1WCYA 2IP2A 3FW1A 4DLSA 1QP0A 2P1RA 2WHRA 2FU5C 3C24A 2J0EA 4CMAA 5K8TA 3P9CA 4MZXA 1B6GA 3EF1A 2I67A 3A9CA 3AFHA 4YMIA 4V0OA 1XD9A 3FAZA 3C41J 3GH3A 3FKSA 4JLWA 3I62A 1EFPA 1X8KA 4G1BA 4DAOA 2YWCA 3FGPA 4HMPA 5DN6D 3GZ4A 3H4TA 3OT1B 1XUOA 4IUBS 5ILOA 5LOVA 1D8AA 2A0FA 5JFTA 1NY6A 4PC3A 2XBLA 5DF1A 3MJEA 2HJVA 1FFXA 1Z28A 2X0IA 1SIOA 4NLLA 2AN5A 2ZYTX 5ABPA 2EX0A 4G85A 4MV5A 4BFYA 5B3LA 2VTEA 3JQRA 5FYDA 2HCTA 4NS4A 2OHVA 3AEKB 4DXAA 2D2EA 4NZYA 2D7DA 4ZI5A 1CG6A 1VLHA 3ZDQA 2VK4A 5DTRA 4Q7QA 1XDUA 2OBMA 3QE0A 2H57A 5JNWA 2FEWB 1U0LA 4UEJA 1X0XA 2VN8A 2XRFA 2H5LA 3KEOA 1YRHA 2JGIA 4MKXA 4DV3B 5CB0A 1JKXA 1YJCA 3LLCA 8AT1A 1PSDA 2UXCB 2BZGA 1MT3A 1XWIA 4LYYA 1XN4A 1O97D 2E4ZA 3EHDA 3BGDA 5DHFA 5AM1A 2BEVB 3AUAA 4RF5A 5FT9A 3ZJ4A 3B6IA 1Z07A 2QTTA 2J1LA 2OAP1 4P92A 4F5DA 1CR4A 1ZZEA 1FS5A 1T2DA 4U2BA 1T2CA 1T9GR 1D09A 1GSIA 1RWBA 4HAVA 1K8XB 2WJ4A 3FB1A 3GHHA 3MPUA 1CUAA 1X38A 5KYWA 4R84A 3QPBA 2WMNB 4KE6A 1CJMA 2A1TS 2QUAA 3FOZA 4HD8A 4TMXA 1XCOA 3KPWA 4J0IA 4DMFA 2ZTUA 1WW8A 1KDYA 1VI2A 4AC9A 5CFOA 3GLHA 4MXDA 3R24A 4GBJA 3U7HB 2ZJOA 1IK6A 1R6XA 5CBKA 1SUEA 1RYYA 3TDNA 3FWKA 2JFGA 5JQGF 1C3VA 4CKBB 3NS7A 1AUPA 2AOXA 1J07A 3BE4A 1XQYA 3IRUA 1V2HE 1G8AA 2QVGA 3N8GA 4K6FA 5DE3A 2NU9A 2C88A 5BUZA 1C8VB 1DWUA 1OCEA 2Q2VA 2R7AA 4BBZA 2PT7A 4TWJA 1R8JA 4RCZA 4UM9D 1H22A 3RKUA 1Q3TA 4PG4A 4KR3A 1L7AA 3QMMA 4ESVA 3PENA 1KDOA 2C9CA 3K1ZA 2YS6A 3CH7A 1IN8A 2XYQA 3ZLUA 2Q5FA 3O8QA 4ZEOA 4RJKA 3DOHA 4LMPA 1U1IA 3QOXA 4JI2B 5CXSA 1BSVA 3FNQA 3HBNA 1RRFA 1HXHA 2I2XB 1GLNA 1V26A 1I6LA 3AJ8A 1KGSA 3S2UA 1NJ1A 3PEUA 1VIYA 1XCPA 4YJ2B 2G40A 4Y2GA 4U9UA 2VQFB 3EGXA 2HF8A 3NM4A 4LZOA 4CEJA 2OFWA 1VSUA 5LQCA 5AVYA 3ZN2A 1ODJA 3K2BA 1FFDA 4G4JA 4J1TA 3JQGB 3TAUA 3Q11A 4RELA 3RASA 2WU4A 1PD1A 2O06A 3SHWA 3K70B 1FMFA 1U65A 1DV2A 4XH9B 2RBEA 2IHJA 4W5RA 3T5PA 1BFDA 3EPRA 3CZ4A 2RGCA 1TQDA 3Q8KA 1L4FA 1M33A 3MXOA 1QV9A 2CV2A 1R0LA 1XPUA 3WZ2A 4PTYA 3LCMA 4UNNA 4Y9DA 3EZ2A 4M7PA 3VBEA 3VNAA 1BHO1 1I14A 4MQFB 1LBIA 5AR1A 3QPUA 1T4CB 2GX6A 3M2PA 2I6TA 3F71A 1AO3A 2I9PA 2C4HA 4XSHA 4EG6A 4F3NA 2WRZA 1MEEA 1UF9A 1AT1A 3LY5A 4NYMQ 4P54A 2A0UA 4KQ9A 3I2YX 3JQ9C 4NV0A 1KQGA 1WUIS 4GDFA 2AOUA 2RGUA 3TLXA 2XD9A 4OSEA 5EMLA 5C5DA 1JTVA 2Q5IA 5F3WB 2YVQA 1N1DA 3C5WP 3FYUC 1HE3A 1IZ8A 5EYPB 1RWWA 2PD6A 3LPLA 1UMKA 1YQ9A 1K27A 4KQMA 3IYLW 2X0RA 3RE1A 1J8FA 1DV1A 5LMUB 3I4FA 2AD5A 5I7UA 3NTQA 1VL1A 1DEKA 4B48A 2Y9PB 1XT6A 2HJGA 1WA5A 1BG6A 2G9QA 3HYLA 3ERCA 1DLIA 3ABSB 4XDYA 1DG9A 3RRZA 3UMVA 4BEBA 2P9CA 2A33A 2DFLA 4PYJA 2VJCA 1KXJA 4OXRA 3WJ7A 5B57C 1DHRA 5CXQA 3H16A 3H7AA 4DJTA 4PLTA 4R81A 4KNWA 1NI5A 4IY1A 4Q18A 4XLZA 4ZA2A 1WUKS 1E3MA 4G67A 3HMQA 1NURA 2D0PB 2XCUA 1GPYA 5BXYA 2FPUA 2AE1A 1M6VA 5LLTA 3UGQA 2F00A 2ZITA 2A78A 4ZYTA 4RVUA 4UULA 1NBHA 4DIEA 4G8CA 3FPGA 1NE7A 2CXHA 1DAOA 3D6NB 5E6UA 1JLRA 4IHKA 3VR2A 3DF7A 1OU4A 2GM5A 2WYWA 3WB2A 1VGRA 3T5AA 1NAIA 2WZCA 3DE1X 4IMJB 4NU8X 1Q7RA 2DPXA 5F78A 1O54A 1V25A 1VZ3A 4C7KA 1GD1O 2D0DA 2JFFA 5KYUB 1Q1NA 1JJBA 3BL5A 3QNUA 3AMVA 3QJ5A 4H4CA 4J03A 3BJZA 1HG0A 4LRTB 4P22A 3RC8A 1XU4A 2JA2A 1L1FA 4OUDA 2I55A 2XYGA 3NHWA 1KMHB 4YBZA 1XA4A 5L8VA 2GFQA 3AFNA 4OBWA 3A6HA 3WAJA 3QLEA 1X94A 3STXA 4FFBB 4K9LA 4FUTA 3ETCA 4EKEA 2MINA 1TMGE 4JCOA 4CN9A 4KO8A 3CNNA 3TAHA 1K9VF 2FOXA 4YAEA 4AF8A 5IJZA 1EBUA 4MIOA 4LSGA 4K6GA 1WQ1R 3LU1A 4HWSA 4RY8A 2HM7A 1WIWA 3ZU5A 3GROA 1ZI8A 3ZHSA 2G6BA 1EEHA 3S29A 1II0A 5CA1B 3ZWAA 2R1UA 2ZRGA 4ZAXA 4Z7JA 5HXAA 3AUFA 4YCNA 3HLKA 1WHTA 4AF7A 1SOAA 4WNAA 5C3MA 1JNYA 4TXLA 3KNZA 5IDWA 1C9EA 3OX3A 2G80A 2P9FA 2PZKA 1A9XA 1JALA 2FJ0A 4YRSA 3CV3A 2DJIA 4LOLA 1JDPA 2FY8A 3FYCA 1FNDA 4M2LA 1YR7A 5I48A 1HUQA 1NI4A 3F3KA 1GQ2A 1MJFA 1OD6A 3WWOA 4RWEA 2GCPA 2KS6A 4RFVA 1MA0A 1U8AA 2RH9B 1NGSA 2ZRAA 4YJHA 1YBVA 1ADBA 3I28A 3I0MA 1SA0B 3WQSB 4DQKA 1KYWA 3M70A 4PBRA 3C39A 3NAGA 3TB6A 4DLWA 1OJLA 3RCBA 4UCFA 3DW1X 1SXJE 3TJZA 1UWKA 1XZFA 2CCKA 1GCOA 1FUUA 2P62A 3BERA 2O2YA 4PEVA 3F6EX 3A6KA 3QTTA 4QULA 4DW8A 4EKGA 5E4TA 1BE6A 4REOA 4PNEA 2C7RA 5CT5A 1FZTA 2QM0A 5ICMA 4WZBE 4P32A 1OWNA 1E4OA 3O38A 2JFWA 2GPNA 2OO7A 2ZSAA 3PIIA 4ESOA 2RHGB 3LDAA 4PGGA 1JVNA 2OVBA 1RBYA 1GR1A 3UW3A 4H3KB 2C3OA 4ZO8A 4R2XA 3GRYA 4F96A 2QN2A 4ENRA 2NZUG 4ETMA 4CETA 2TSYB 1POXA 2Q41A 3AESB 2IEBA 4BTLA 1F06A 2A1IA 3E84A 4YMSA 2QL6A 3CZ9A 3P9NA 1VPWA 5AKGA 2Y1GA 2YC2C 1QH9A 2XITA 4MQ5A 1Y34E 1X7WB 1SOWA 1KQOA 3EIQA 3ENKA 1WHSA 5TB5A 3HCWA 4IHJA 1XCGB 5HCIA 4YR9A 2H92A 4Y7CA 1ZO8A 2WF7A 3K8ZA 1KZ9A 3IOMA 4N5DA 4Y2YA 5K0EA 3H5NA 1SCIA 5KTRA 1BXZA 3SHQA 1FUKA 5DLYA 3DCYA 4TMYA 2IV7A 4KR7A 1TLFA 4MV9A 4IKPA 4KZPA 1WWKA 3LRPA 4A27A 4KPEC 1GRNA 4O2BB 2P2YA 2WQ6A 3LPMA 3WX0A 3UV6A 2IS4A 4S12A 2MSNA 2JGDB 5EVJA 3AR7A 5EHIA 1HDZA 1KEEB 4MQMA 3DDZX 2DFDA 3TW8A 3O90A 2E87A 1F5SA 4HUQB 1KMCA 1QO0D 3SD7A 3WBKA 5JROA 2X0EA 3WC4A 4PQYA 3TSYA 5HUJA 4B35A 4WCDA 3EVGA 221PA 4XD7A 1EZ4A 3FCSB 4LRQA 4C6TA 2VBGA 4B6SA 2XB8A 3ONVA 3LPNA 1ZGZA 2ODEA 3CZPA 3EW9A 3V2GA 3AVVA 1JHMA 4F9EA 4D98A 3FZEA 1U4OA 2QYOA 4B84A 2XYPA 1GT91 1PHPA 3OZSA 3ZE2B 3GJTA 1GKLA 1XBTA 3AL2A 3BL8A 1EFRD 1TK3A 2NQTA 4JYBA 4RVHA 4OHOA 4PF1A 2DH6A 2WTMA 1ODCA 1RJGA 1GGVA 3HP1A 5FWXB 3B82A 1DAPA 3DG9A 3I8SA 4AJEA 3O3OB 3IEMA 3VSAA 5IS2A 3ODGA 2YXEA 4TYYA 4Q4LA 3R76A 2PL5A 1P7WA 2NSJA 2DM6A 3DE3X 5IBPA 4EIWA 2Y3IA 2J0UB 5JBNA 4PC1A 3N8IA 3EA0A 4IDCA 4JKIA 3KLPX 5C8YB 4V38A 1NVAA 3PPYA 5CM9C 2ZVQX 4M9QA 3GVHA 5K6RA 1XHLA 2NP7A 2CYBA 4OH1A 1HTTA 4I36A 2YVKA 1U3TA 2PBRA 4MHTA 3ZWOA 2ORIA 4MICA 4MUMA 4UTNA 4NU0A 4J0DA 3I42A 2FQYA 3TXYA 3BCRA 3GZTB 1T13A 4H6WA 1W36D 1RNLA 1CUIA 3TEJA 4B4UA 4G0WA 5KEIA 3N5KA 4BNIA 2YW2A 3WGNA 2ZBVA 2RG1A 1DB3A 5E7IA 1J39A 3SVZA 4YJGA 3R7FA 4QFDA 5HUHA 4ZVUA 2JA1A 1BN7A 1E92A 2UUOA 5CA0A 3EZ6A 1EK6A 1ULSA 3HKEB 4X0EA 1CUZA 5F98A 3RDPA 2FOIA 4DNXA 4TSRA 4DKXA 4EO7A 2OHGA 3HABA 4B6RA 1WABA 3TTVA 2O3UA 2XI4A 1TU0A 4BMNA 4WLUA 5TPWB 5ITZA 3LCJA 1NSTA 3LBHA 5J40A 1HR0B 5K3EA 1Z2EA 4A0FA 1R5OA 5KTMA 1ADGA 3DAYA 1E61A 4CM8A 4EFMA 3ZE6A 4KHZA 2Y68A 4XR9A 4BFSA 3GFSA 2C4WA 2O3RA 4L74A 1V2GA 3RTDA 5JEEA 3MD0A 3L02A 3FROA 3BDAA 2A84A 3WGYA 1G2QA 4HWOA 5I7FA 1P39A 1XSEA 4FZ3A 4LY3A 5EP2A 2PO5A 2PX2A 2TMKA 4M9UA 1Y8RB 4ISCA 2GUGA 3A4MA 1IEVA 2FXVA 4M1KA 4RZUA 4AQDA 5L3QB 2E2WA 2QTWB 4Q7KA 1PL8A 1U2GA 4H1UA 4HGZA 2FRXA 2R8PA 3B1YA 1HV8A 2N9UA 1ML3A 2XUZA 3HL0A 3SFZA 5CDHA 1YVPA 4I8IA 1UZLA 3KL2A 2N47A 4E33A 1IQUA 2HSZA 4O4HF 3RS2A 3DE7X 2DB3A 1S8AA 1G21B 1MN6A 4ML3A 5EIBC 4RHUA 4AROA 5KVQA 1OASA 3AR2A 4TRNA 5MGNA 2VBCA 3BRWD 1ZUHA 3RYCA 1PFQA 3E7WA 3OKFA 1GA4A 4C6SA 2F90A 3KX2A 4LFBB 3TDMA 1ONBA 2XGGA 5DX0A 2PLWA 3ZZ0A 3ZCPA 1YAHA 2WJJA 4MLDA 1TKBA 4C0KA 2P6OA 4BNLA 1G7CA 4DCCA 1P1HA 2WC1A 4QG3A 3KJNA 1GZDA 3OLCX 4Q4CA 1KK0A 4CQMB 2WNIA 1OFUX 1Z0ZA 1FYEA 1SRQA 3ROKA 4JIGA 1N8KA 3C1UA 2GXUA 2D62A 2VH2A 4E3WA 2FWPA 1NNLA 3C8ZA 2VXBA 3DQQA 3TW6A 3K6SA 1AKNA 4X8MA 2OOKA 4QXRA 2BMVA 4EGSA 4MS1A 3CVJA 4N4AA 1R4AA 4TS3A 2GCOB 1GKKA 3ACBA 2LIPA 3G02A 1RWNA 5C4MA 1VJ0A 5BV1A 4RACA 1WUYA 5IT0A 4GPZA 1Z63A 1PNRA 4HDKB 1GARA 3WO1A 4LDZA 3PX3A 2RGXA 1TCAA 2PZLA 1ABBA 3R3WA 4JX9A 1N4DA 3CZCA 2CVPA 4KBYA 2GCNA 2QAGC 3ZS8A 4XVCA 5K8UA 5EEGA 1FVXA 1VLQA 3QKTA 2G06A 5CAEB 3ZQKA 3PTZA 3U16A 1KY5A 1LDMA 1U0OC 1Z82A 2G28A 4RLSA 4J9UE 4BXOB 2DWUA 2RIRA 3Q10A 3P9IA 3TL3A 2PQ2A 1WD5A 4P8RA 1ZGBA 4Q1EA 4ZOLB 3L1IA 2HHAA 2YHUA 3E3LA 1OB2A 1TT5B 5JXHA 5FTKA 1G17A 1W6RA 4WXPA 3HTXA 3QY0A 1HF3A 5I4CA 3KQTA 2DR3A 4HQRA 1H3FA 1JSRA 3UT5A 4MK4A 3LDGA 3AB3A 3MVEA 2GM4A 5HBRA 4G1MB 4CR8A 4U9HS 4EHDA 2W6JA 2NVUB 1JAIA 1F0PA 3DTYA 1B14A 3RS5A 4DCJA 1AKTA 1CEQA 3LWBA 3EC1A 2QGZA 1JQLB 2WABA 3FCEA 5ERXA 1RI1A 3WISA 3ZI4A 1JECA 1F60A 3K4PA 4R2HA 4QXPA 1CQIA 5CRIA 4KQJA 4JI7B 2OZLA 3IXLA 4RVDA 1WZ2A 2HIGA 2FMIA 5GONF 1FA9A 2GHRA 4G0XA 1GSAA 2HQSA 3FDFA 3MWEB 1MXFA 5T8KC 5AQ1A 2IYFA 2PKWA 3Q3HA 4L4ZA 3EXG2 4YVFA 3VR4D 3UGJA 3A14A 1YK0A 5HRCA 2LR0A 4KSCA 4NOJA 3H2ZA 3L8FA 5FBVB 5AI4A 1Y7IA 2OV2A 3DT9A 3IOCA 1TVEA 3MHPA 3QENA 3VDQA 4IDQA 3OHSX 4IDEA 2YL2A 2J45A 3NYRA 2NO1A 5FO0A 1KOFA 4PE5B 3QE9Y 4KDEA 1XD8A 2VDQB 1GPMA 4IM7A 4MW5A 4P34A 1R1DA 1ZESA 3LY9A 2HRBA 3UC9A 4UFPA 3AM5A 1O6FA 1W0KD 2ZJZA 5CBPB 2Y1EA 1VKOA 2V1UA 3VAAA 1E1CB 3GNSA 2P5UA 5EP4A 1GPAA 1O3YA 5IAAA 4KRFA 4XDGA 1QV6A 2HW8A 4FOLA 3RRJA 5T4EA 5KBYA 3VOTA 4CMBA 3T9FA 5IAGA 4EOGA 5KOIA 4KR0A 3L7BA 1CDDA 2QD4A 2HXSA 1Z4LA 4PSKA 2N75A 2GBIA 3AINA 5BSTA 5BN3A 3OQBA 1CKEA 2BMDA 3A2LA 2JH3A 3CW9A 3KJEA 1I6KA 3OH8A 4NK4A 4PX5A 3T5DA 1FNNA 1HOXA 2IYXA 5HZGA 1LGYA 1WPGA 3AZPA 1JDZA 2AN4A 2XY4A 2UUAB 4BQSA 2EP8A 5T4BA 1VFPA 3X1WA 2FQ1A 3D2CA 2CVFA 2MYUA 6YASA 5KSOA 4KR2A 3G0GA 1GOTA 4EL5A 3ZDCA 1CXZA 2QTCA 2X76A 3KYDA 1KBZA 3NGMA 4DMGA 4V2IA 1ID8A 3Q3GE 1II8B 5TY0A 1JFLA 4LOAA 4O6VA 4EHFA 2Q29A 1GL6A 5EQFA 3UAWA 2OGUA 4G0NA 1VIAA 1I94B 5G1PA 1X7HA 3LX8A 3LX6A 1W76A 3AYXB 4OATA 5C8ZA 4KAJA 2ZI3