1W73A

Binary structure of human decr solved by semet sad.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
294
structure length
288
Chain Sequence
NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Human Mitochondrial 2,4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions in a Distinctive Short-Chain Reductase Active Site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 2,4-DIENOYL-COA REDUCTASE
total genus 99
structure length 288
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w73A00
1UAGA 4YEDA 1UXHA 4QFDA 5IN4A 5DNAA 4GKBA 3ITKA 1NHGA 1Z82A 5KVSA 2FR1A 4WPGA 3ZW8A 1P77A 3WIEA 2O23A 3OJFA 3PJEA 1LEHA 4BNYA 3PIIA 3L0DA 2DTXA 3QW2A 4ZRNA 5EQDA 3EC7A 4GH5A 1PJ4A 2Y0DA 3OJLA 1PGPA 3VPFA 2JCYA 1GYPA 1SBYA 4GLLA 4R54A 3U9LA 4L4XA 4XYEA 1ZK4A 3RSHA 5L7TA 1KEUA 1ZSYA 2VUSA 4EJ0A 1SPXA 3BHIA 1G0NA 1XU7A 2AEFA 3HDJA 4QQRA 3G17A 4I9UA 3ZNOA 2JD0A 4CMBA 2BFPA 2YJZA 2Q49A 4FJ1A 1XG5A 3PHHA 3ROQA 4MVJP 3DZHA 4F45A 4E21A 1YBAA 4WKGA 2P5UA 5A5EA 1D3AA 2PKQP 4BO9A 3JQ7B 4I9NA 1BG6A 1TA4A 1VI2A 3I83A 4B8WA 3CH6A 3RCBA 2RHCA 4B3IA 1PJ2A 1Z7EA 1PEDA 4PG5A 1N9GA 4Q3NA 1M75A 1LA2A 1LDYA 2OOSA 5LDHA 1MC5A 2CY0A 3FTPA 1QRRA 1JAYA 1BGVA 4FBGA 1SO8A 3RJ9A 3SXPA 4D3SA 4E2WA 2P9GA 2PKQO 3KSDO 1SNYA 1ZK0A 5JPIA 3V1YA 3DR3A 1HDYA 1JTVA 2EERA 3ONEA 4CM9D 4D43A 4E30A 4BO8A 3Q3CA 1EVIA 2D0IA 4XYBA 1X1TA 1H6BA 2A4KA 1C0PA 3ZNNA 5CDYA 1KEPA 1YKFA 4YT5A 5C7OO 3HN7A 3DTYA 3P5SA 2W90A 4N5NA 3TZHA 4K28A 1Q0HA 3VZPA 1OI7A 3I9KA 1T1RA 2ZTMA 1QMGA 1WDKA 3TFOA 1ZBQA 1KYQA 4NBWA 3TZKA 3ZGYA 3D7LA 3F46A 4ZGWA 3BYZA 4ZVVA 4DC1A 5DDIP 1YDWA 2B5VA 1NASA 1TT5B 3OJEA 1M6WA 3MTJA 2FR0A 1HDGO 3ANNA 4ZQFA 4XR9A 3WJAA 3R0IA 2FPGA 1WW8A 4WLNA 1FDVA 3PHJA 5CG2A 2Q1TA 2IXAA 4RJTA 1TB4A 3PIDA 4LVUA 4FJ2A 3ZWXA 2DM6A 2Y1DA 3KEOA 1J0XO 3IDSA 2EJVA 4Z3KA 4ALNA 1Z75A 3KBOA 2HJSA 2GZ2A 4XB1A 1VJ1A 4ZD6A 5JE8A 3X2FA 2HMTA 3A06A 2PGJA 3T7EA 1YJQA 3TDKA 1TI7A 1E5LA 3GZNA 4D0RA 1SEPA 4PLPA 5L9AA 3GDFA 4L4SA 5KJ1A 4E5PA 3SBOA 1GTMA 4LRTB 2J5KA 1TT5A 5LCXA 3U4DA 1S7CA 1LDGA 3UOGA 2DAPA 4Q3AA 4XJSA 4RVFA 1NR7A 3VH2A 2V65A 4E5KA 1ZK2A 4GWGA 5I9NA 4E2YA 4XX0A 3DBLA 5G2OA 4TROA 2Y1FA 4XGNA 4AJLA 3GEGA 3V1TC 3RFTA 3O9ZA 1L1FA 1E1LA 1KS9A 4WLOA 1DC6A 5JDCA 2CNBA 5MDHA 4NBTA 1HE3A 2YDXA 1EUDA 4ZQGA 1WVGA 3WGTA 4XRGA 4FC7A 4RF5A 3WICA 2Z95A 1ISMA 1E7QA 3H2ZA 3DMTC 1C14A 3R6DA 3UICA 1NFQA 1QORA 1F0YA 2NQTA 2IZZA 3HB5X 4I8XA 5L4LA 1VSVA 3L4BC 4YXFA 3LF2A 1Z6ZA 1MXFA 5TX7A 1OAAA 1PTJA 3B6ZA 5COAA 4CJXA 1RKXA 3WMXA 1O95A 2OBYA 2QZZA 1V9LA 1LTHR 2RCYA 3ANMA 3FTNA 3PEFA 1VKNA 5KIAA 4DWVA 4OXKA 3DZGA 2UUPA 3V8BA 4J1TA 3SJ7A 5JCJD 2GASA 3DC2A 3VPHA 5JAMA 1LLUA 3HN2A 4NFHA 2O7QA 2HUNA 5U1PA 1E6WA 5JY1A 5ADHA 3ONFA 4J4HA 2W2LA 2GN9A 3HNPA 3DONA 3TQHA 5TLSA 2O7SA 2PZKA 4LVCA 4BKUA 5A1TA 1KETA 2PZMA 1PZFA 2ZTLA 2HK8A 4NI5A 1LRLA 5L40A 4Y9DA 1ENPA 2PNFA 3KLMX 4R4JA 4BO3A 1I0ZA 4XQGA 4XKJA 1XIVA 2HDHA 2WSBA 3WBBA 4II3A 2GUGA 3OP4A 3C7CB 1UAYA 2B4TO 4OQZA 3Q11A 4CM7A 1ENOA 3WGGA 1H5QA 1XHLA 3I52A 2C07A 1GPDG 1UH5A 2EP5A 4NPCA 3H7AA 5TF4A 3UHAA 5FF9A 5KNLA 1OOEA 5CDGA 4FGSA 3KO8A 1MUUA 5G0UA 3K5PA 4E2XA 4IINA 1W0CA 1I3LA 1NYTA 1IE3A 3Q1LA 3RC2A 2NLOA 5DBFA 1UXKA 3C85A 3LLVA 5T8KC 9LDBA 1JA9A 2QW8A 2YQ4A 4HWKA 4OXNA 1RM5A 2B69A 2X1HA 1AHIA 1U5AA 3PQDA 3E9MA 1EUZA 4CLRB 1FJHA 1PJSA 3NKLA 1NWHA 4BKOA 5JCXA 3E9NA 2VYNA 2VHYA 3GR6A 2WTBA 4IPTA 1JW9B 2W2LD 3L07A 1SB8A 3DBVO 4PLVA 4RV9A 1ZNQO 4J7XA 3ANLA 5T67A 4BIIA 4F6LA 4YAKA 4Y8VA 3UXYA 3R3JA 1G6KA 1MLDA 3RBVA 4L8VA 2Q2WA 1I30A 4YCAA 4G5HA 1MG5A 1O89A 5GZ6A 3NTQA 4NU5A 3AY6A 2JFFA 5G4KB 1PX0A 4JJGA 4M87A 4OJNA 4DLLA 3FN4A 2NV6A 3INGA 2X22A 3O26A 1JQBA 1T2AA 2QQ5A 1ZJZA 1HXHA 1B8UA 1BXGB 1EBUA 2VWGA 4XB2A 5H82A 4CQLA 2A35A 1V6AA 2O3QA 4FJ0A 4MVJD 3PDJA 4YAEA 1F8GA 4BB6A 1ZKMA 4IJKA 4IXWA 5ILOA 1O94A 4CLOB 1K0UA 3WGYA 3ZNPA 4PLHA 4Z6KA 3FPLA 4HV4A 1B16A 2Q45A 2IEDA 3HHPA 4JGBA 3RUCA 2FSVA 3HG7A 3JQBC 1CETA 3NT4A 3UCFA 1H94A 4MP6A 2FPPA 3IKTA 3DBLB 4FD3A 1ZZEA 1OC2A 3VH1A 3DOJA 1GADO 3LT2A 2DQ4A 3G1UA 1P0CA 4RZIA 4A26A 5J23A 4YQYA 3WQSB 1E6UA 5I9LA 1GUFA 4PCVA 1ISGA 1P1RA 4N54A 4YBZA 3TF5A 1E77A 3ZU3A 1UR5A 4RLSA 2NTVA 3BA1A 3S2FA 2D2IA 1WDLA 4K6CA 5L7WA 2E6UX 3RFVA 4AJPA 1QP8A 3BTVA 1E3SA 3ETDA 4YR9A 5GY7A 4CM8A 4RZHA 3UFXA 2CDCA 1P45A 1G0OA 3PJFA 1LC3A 3VAZA 2ZATA 5HS6A 5MGBA 1GEGA 5JO0A 4UULA 4B7XA 1FXSA 3FNHA 2VCYA 4R5HA 2BMAA 2D8AA 2R2GA 4RQUA 3RASA 1IY8A 3ETGA 4Z0PA 5BQFA 2ZB3A 1PZHA 4F6CA 3H9UA 5EJ2A 1BVRA 3WSWA 5I7EA 2E82A 2X6TA 2XAAA 4B8ZA 1DRWA 1U2DA 2HK7A 1NXQA 1FDUA 3QVOA 4J7CA 3VKUA 1P74A 3K96A 4HADA 1JAXA 3LVFO 4UEKA 3TJRA 4IIUA 4MVJA 1IL0A 7ADHA 3K8ZA 4XGKA 2VRBA 2YV1A 3GFBA 4CQMA 1SOVA 4I5EA 4LRSB 4NH4A 2Y93A 1T4BA 2P4QA 4OHUA 1E3WA 2PH5A 4FCCA 1PGJA 2I66A 3DMTA 5L51A 2YFHA 2C2YA 1X7HA 1Y8QB 3A1NA 4Q39A 3WGQA 1EQUA 3RFXA 4CM6A 3JQAB 1LBEA 3E18A 3GZNB 4R1NA 5KTKA 3KTDA 7MDHA 4TVBA 5EPOA 1T4DA 3T7CA 3ZWOA 3DAFA 4Q9NA 2CDAA 2OUIA 4IDEA 2NVWA 1VSUA 1RYEA 1KERA 1B2LA 4NFYA 3NJ4A 5IXSA 3AK4A 1ARZA 1CDOA 2PV7A 4QX6A 4IGEA 1KVRA 4O0LA 3D3WB 4NJMA 2NVBA 3AU9A 4EZBA 4P4NA 2D59A 4PVDA 1GAEO 4FC6A 2EW8A 4XGIA 4E32A 1B14A 4GLOA 3G1TA 5AXCA 1ZXLA 1DRVA 4KUEA 3KB6A 2NTJA 1IOLA 1LSOA 4KDFA 4OM8A 3HFSA 4FDAA 3ZHXA 5DBIA 4P38A 3TOXA 3VOSA 3INRA 2DPHA 4IMPA 4UVGA 3RKRA 3JQAA 3DAGA 4MOWA 1IUKA 3MZ0A 3FNGA 1LC0A 2G76A 3IUPA 3ZWMA 4MP8A 5F1OA 3C1AA 2GSDA 4FFRA 1HT0A 1UDBA 4BQRA 1ZCJA 4LCJA 3ZWCA 1F17A 2H63A 2PGLA 3IUSA 5AXDA 4NBRA 4XIYA 3L6OO 1YOVA 1NAIA 3WYBA 4NBUA 1PJLA 3SLGA 3WTCA 5BNFA 3LK7A 1LNQA 1BXGA 4H7PA 4PVCA 4S3MA 1ISFA 2NU8A 5HA5A 3UW3A 4D3FA 4TSKA 3BXXA 1H6CA 1KC3A 4HNHA 4QO7A 3PDUA 5COBA 2VWPA 5CEFA 3NTRA 2VYVA 1MV8A 1DIBA 5DULA 2NVUB 2NNLD 3I9MA 2Q46A 1P1KA 3GVIA 3ST7A 1HL3A 5JFOA 1YDEA 3NGXA 4HY3A 1DLJA 1MB4A 3VC7A 3OIFA 3ZU2A 3I4FA 3EZLA 2ZJ1A 4ND4A 1XA0A 1R0KA 3BMCA 4LK3A 2C29D 4IDFA 2X5JO 4IS3A 4MO2A 3E48A 4LMRA 8ADHA 5A3VA 3JQ9C 3OA0A 5EIOA 1E3JA 1K6IA 4CV2A 2NQ8A 1N5DA 3JYNA 4BKRA 3H8VA 3R1IA 4CM8B 3FF4A 3ORFA 4R9RA 4OAQA 5A3JA 3H65A 3RQSA 3CMMA 2NUAA 3KYBA 3NDIA 1A27A 2PD6A 2VHXA 3K6JA 3MOIA 1U3UA 1I01A 1LDEA 3QVXA 4TRRA 3PHLA 1ADFA 1CRWG 1ZK1A 1HDZA 4UVIA 4XEHA 5HM8A 3P19A 5BNTA 3WX0A 3DAPA 1MA0A 1Q7BA 4NG5A 1MG0A 2PLAA 3OFSA 5F3RA 4BUCA 1U5CA 2IEBA 4NQZA 1EVZA 4CMIB 4DGSA 1C1XA 3OIDA 1BW9B 3CPSA 3IJRA 3C1TA 2B4RO 2EKLA 3OQBA 5GZ1A 1ISHA 4Y6SA 4JQCA 3Q2IA 4WLVA 2O3JA 4GWKA 1B26A 4XJTA 3OMLA 3OIGA 1WXDA 3AUUA 1I24A 1ZEJA 4MJLA 5JMPA 4O6VA 5DN9A 3TSCA 4WLFA 3KYDB 5KVQA 1NQAO 2OZPA 1EMDA 3D3EA 4N5MA 5G4KA 1J49A 2C82A 2C54A 1R4NB 1NPYA 1NVGA 3FBTA 3I6QA 3VDQA 1NQTA 1NVTA 4EEZA 5CPFA 3MWDB 2JAHA 3LQFA 2ZTVA 3AU8A 3A4VA 1HSZA 2XOXA 2X5OA 2A92A 2VRCD 1EQ2A 1BWSA 3JD0A 3IKVA 2NU9A 3LC1O 3VPSA 4AJNA 1JVSA 2I76A 4R1UA 4KTTE 1O8CA 2EEZA 3PWSA 3QY9A 1QV7A 2DFDA 3GA0A 1XU9A 5KKAA 3TFQA 2AQHA 4ALMA 4DREA 1IZ0A 4FGWA 4JBIA 3DBRA 5B37A 2P2SA 4BO2A 5F5NA 4L75A 3JQDA 1E0DA 2UDPA 1LUAA 4I1IA 4QUKA 4XZ3A 1DHTA 4YJFA 3C8MA 4JX8A 5BSHA 5DP1A 2CF6A 1D1TA 2ZB7A 4GX1A 1R4MB 4YJFB 1LQUA 2NU7A 1EE9A 1UDCA 1YB4A 3M2PA 4CV0A 3PZRA 2E4AA 1RWBA 1FDSA 2HK9A 5EQFA 5GMOA 3DFUA 4R1SA 3KVOA 4UUMA 4DPLA 5JNLA 3B20A 1AE1A 3OBBA 3GMDA 2OMEA 2W4QA 3G79A 1IULA 1M6HA 1UXJA 4YA6A 4UAGA 3GY0A 3ZDFA 4A7PA 4CR6A 5JC8A 1ZEMA 3IMFA 4QO8A 2O3UA 4XYGA 5T6BA 1PZGA 4B3JA 5HS4A 2ILTA 1E7MA 4J4BA 5TQVA 4Y6RA 1S6YA 4ITUA 3ZU4A 3NTOA 3WTBA 1NP3A 2HKIA 4CL3A 1QXSA 4OKNA 4LN1A 3ZV4A 1VLLA 2EXXA 4R9SA 3A28A 3M6IA 4W7HA 4KOAA 4PGFA 1AGNA 3JQ6A 2EG9A 2EW2A 3LSYA 2ZIZA 2J5RA 4ALKA 4WLUA 3STHA 3V2UA 5JLAA 4DRYA 1IPFA 1LLCA 4NDNE 4AJJA 5F5LA 4B4WA 3HDHA 1CF2O 2DTEA 2BF7A 4DC0A 1VE9A 1ZK3A 1EBFA 3K31A 4RVDA 4BS9A 3H9JA 2G82A 1PZEA 2NM0A 1NFFA 1L7DA 5JDCC 1NX6A 1VRWA 3U4IA 1LI4A 4YRAA 5I8WA 1GCOA 1FF9A 3ZH2A 4BB5A 4M55A 3I23A 4BNVA 3WR5A 2X8LA 3PK0A 4U7WA 4ND2A 3U09A 4J0EA 4P4GA 3KHUA 4RQTA 2XXBA 3FCOA 4HFRA 3LDHA 4MINA 4EJ6A 5IXYA 1U7HA 2I3AA 1K6JA 2YHUA 2HLPA 3W4JA 1UUFA 2WE8A 3VZSA 3ABIA 5FFFA 1NNUA 1TXGA 2P9CA 3OJ0A 2EGGA 3CMCO 1HE2A 3I3OA 4TWRA 4D45A 2PWZA 5IDWA 3WMWA 4A73A 1QG6A 4BNHA 1V35A 4FFPA 1LDMA 1Z74A 3EK2A 1X7DA 1K2WA 1KEWA 4J91A 3AM4A 3D1LA 1PJTA 3FPCA 3HB4X 4DLAA 2EF1A 4R3NA 2ZB8A 2D1YA 1IYZA 3GOHA 5K6AC 3Q2KA 1B3BA 4HBGA 3ZV5A 3PTZA 1DRUA 3QVWA 4GX2A 1XSEA 1HKUA 3GQVA 1A71A 1N2SA 4P8RA 4N5LA 1GZ3A 1DSSG 4RVSA 1PJBA 2YQ5A 3GUYA 3GLQA 2Q50A 2BI7A 3QA9A 1KVSA 4W7IA 3T4EA 4FR5A 4CMEA 4D3DA 3OICA 5A4DA 1PIWA 3QWFA 5IZ4A 2YHIB 4RVGA 5EESA 1Y6JA 4WNCA 5B4TA 3CEAA 1PGQA 1E7RA 1YQDA 4UVHA 4WCFB 3H6KA 1SEVA 5F1KA 2QYTA 5G4LA 1PL6A 4URFA 1L7EA 3PGXA 1XR3A 1LLQA 1SAYA 4CQMB 5A9RA 1WNTA 2BKAA 3LYLA 1ID1A 1E3EA 4L73A 4RGBA 2EP7A 2Q1UA 5ITVA 1HSOA 1R16A 1ZJYA 2YHIA 2ZCUA 4OIMA 2A94A 3W1VA 3IL2A 1H9BA 3QQPA 2GLXA 2NWQA 1I2CA 3AUSA 2DBQA 2HSDA 1R37A 2GR9A 3GGGA 4R1TA 1E1MA 2VOJA 4AVYA 4OQYA 4CLHA 4BNKA 2LDBA 3JQ8A 5IFLA 1WMAA 2HQ1A 4FS3A 2HO5A 4ZA2A 4BNMA 3PP8A 4W9NC 3WXBA 3HSKA 4PZEA 4ZRMA 1GFSA 2FZEA 2HCTA 3EYWA 2VZ0A 3WLEA 4F3YA 3E8XA 3DEYX 4UREA 1V0JA 1KY5A 3L9WA 1GQQA 3VPXA 2EGHA 4CM4B 3F47A 1DIHA 4E5NA 3E1KA 1ZVMA 4IJUA 5CDSA 1U7TA 3GAFA 4IZHA 2OORA 2YZ7A 4GPD1 1TVEA 1OMOA 1O0SA 3C7AA 3NJ8A 4OSPA 1LSJA 4KZPA 4C7JA 5EN4A 1DFHA 2QHXA 2B0JA 2VN8A 1H93A 3K2BA 4O5OA 5ITWA 1Y8QA 5B4UA 2G5CA 2DBRA 3TZQA 4E0BA 3GFGA 3PQEA 5BT9A 3QWAA 4TMFA 5JDIC 1E3WB 3GN2A 4LMPA 2AQKA 4PLYA 3ZI0A 3DBHA 2I5PO 4YJGA 1UP7A 3H9QA 3JQAD 5IDXA 3DHNA 4A5OA 1HE4A 4HUJA 5IF3A 3BTSA 5JS6A 4O1MA 2DFVA 4WOKA 4CMJA 5IN5A 5TJHA 4W9NA 4ALIA 4U5QA 4FB5A 2YYYA 1AUPA 4J1NA 5HBRA 3QVSA 4I5FA 1F14A 2Q4BA 1JWBB 1JN0A 1DIAA 3E82A 5KJ6A 3INTA 3GNTA 3NAQA 3K92A 1IB6A 4ALLA 2X0IA 3CTMA 5ENDA 2X0NA 3TNLA 2FRDA 3CXRA 1W73A 4CLXA 3DMYA 5I7SA 4IBOA 1J6UA 4DPMA 1HYGA 3UAGA 1T1SA 4ZQBA 1LX6A 3DXFA 3LZ6A 4RL6A 3I4CA 4BV8A 1GYQA 4CODB 3EVTA 1C1DB 2AEMA 3ZWBA 1PSDA 2PD4A 3SEFA 3UKOA 1T2CA 2EIHA 2ZK7A 1JDJA 4A10A 4E5MA 3BMCB 4YT8A 4I9HA 4RPLA 3PJDA 4INAA 3H4VA 4YT4A 2FOIA 1O9BA 3EW7A 3GVXA 3ZCXA 4QFCA 2FR8A 4R68A 2C5AA 2J8ZA 4OOFA 4RPJA 2QZ9A 2ZJ0A 1EE2A 5A5FA 5IDQA 2J3KA 2XXJA 3IAHA 2Q1SA 3FI9A 5C5IA 4E12A 2JJYA 3DFZA 1X1EA 1YVEI 2EKQA 1VJ0A 1I10A 2W2KB 5K6AA 1R4MA 3DOCA 1NTOA 1BXKA 4OGWA 1DJQA 2HJRA 1Y5RA 5CAEA 3E03A 2WM3A 5JW6A 1YOVB 1DIGA 2BGMA 2FWMX 5T64A 3WFIA 1PJ3A 4W4TA 4NK4A 4DL9A 1R15A 2GO1A 5A02A 1IHYA 1FDWA 1EK5A 3WYEA 5A03A 4XQEA 1DB3A 1P3DA 3CIFA 4KQWA 4Z9XA 4IGFA 1A7AA 2X7HA 1ULUA 1OFGA 3T4XA 3W8DA 4BNXA 3F1LA 4GKVA 5IJZA 3WFJA 1N7HA 1ZUD1 2AQIA 4LCEA 2RHRA 4U6SA 4CM4A 3UGKA 4H3VA 4RPHA 1A7KA 1P33A 4J1QA 4MVJG 3JYQA 4GBJA 4AFNA 2PZLA 5A9TA 4CM5A 3KUXA 1D8AA 3GPDG 2R6JA 2UVDA 4EUEA 3U5TA 1GZ6A 3W6ZA 3NGLA 1GY8A 1B7GO 1CQIA 2EWMA 3TWOA 3U62A 4GAEA 4CUZA 1WZEA 3ASUA 4XIJA 1ZMTA 1X0XA 1NHWA 2GERA 2H5LA 1HDRA 2RIRA 4IQ0A 5A9SB 4RDIA 5AYVA 4OKIA 5IZCC 3NUGA 3A14A 4YJDA 4CUJA 3K2EA 1YO6A 4F46A 1R0SA 1YS4A 4B3HA 2VNAA 3WOHA 1W8DA 3BMNB 2GGSA 3OQ6A 1IHXA 2AXQA 2Y0EA 4O59O 1BMDA 4YQZA 2VUUA 3HUDA 1TEHA 4B7UA 2IE0A 1XYGA 2JD1A 1HYEA 3JD1A 4YACA 2V6FA 1I32A 3S8MA 1SCUA 3ITDA 4RVHA 4CMCA 4FFOA 4NMHA 2PKRA 3OH8A 3ZNQA 3QWHA 4ND3A 4R41A 5JC1A 4M1QA 3AUTA 3CKYA 2FP4A 1E7YA 5KOIA 1YQXA 1BDBA 2RH4A 4YDRA 1XCBA 1J5PA 3LF1A 1LXCA 3W6UA 1ADBA 3VVCA 4ID9A 1QYXA 1PJQA 4N18A 4ROSA 4IXTA 3AI2A 4GGPA 1R6DA 1PQWA 1F12A 5DOVA 1P0FA 3KM0A 5L95A 1WMBA 1DC4A 3G49A 1VC2A 1T25A 3VH3A 3VKVA 4MIOA 3AOEC 4IJWA 1WZIA 5KVCA 3G3EA 5HWSA 5KJEA 3GHYA 3WIDA 1GUZA 4BNWA 4J9VA 2IYOA 1QYDA 1JKJA 1EDOA 3WJ7A 3SJUA 3U49A 2IXBA 2CVZA 2QG4A 1BRMA 3L77A 1DHRA 4ND1A 5TNXA 1JKIA 2HMWA 3AFMA 3I6IA 3ZHYA 1LRKA 1CQJA 2JHGA 3W8FA 3B1KA 1UP4A 2I3GA 3P7MA 2NVUA 2VTEA 4PG4A 3AOEA 2PGDA 1XEAA 3BMOA 2GN6A 4DIBA 4WJZA 4TRJA 3TN7A 2VHVA 1ISJA 4WLEA 3U3XA 1Y7TA 3F1KA 4FIZA 4WNIA 5JCJA 1DC3A 4GMFA 4J43A 4K1LA 2FY8A 4BGIA 4E5YA 2AQ8A 1ENYA 5IZCA 1ZW1A 1A72A 1LSUA 1PQPA 2V7PA 4TRMA 3PVZA 2AA3A 4HNGA 1HF3A 6LDHA 3B1JA 4ONEA 3RVDA 4IDGA 4J9UE 2Y99A 1HWYA 4BVAA 1QSGA 4M8SA 3AUAA 1KY4A 2HAEA 1I33A 1QR6A 3QJ5A 1WAMA 1Q1NA 3EMKA 1ENZA 3S2EA 5L4SA 2IZ0A 2EJWA 5JAIA 3DQPA 4MVJI 4FN4A 1PS8A 2VZ8A 4R01A 1MC4A 3OHSX 1H2BA 1YB1A 1GEEA 1BVUA 1GDHA 3GK3A 2X9VA 4ZQHA 3KXDA 1DC5A 1KBZA 1X0VA 4MIEA 3PYLA 1YB5A 4WEQA 3KYCA 5EL0A 5JBIA 5JO9A 3W4KA 4WUVA 1XLTA 4NBVA 1P31A 2GYYA 3W4IA 1ZIDA 4FOOA 1DLIA 3SX2A 1P9LA 1U3TA 3MJTA 2PD3A 3KYCB 1YL7A 5L7YA 1V3UA 3RI3A 1ZMOA 1N1EA 4AJ2A 1N9GB 3WLFA 4CM3A 3ENKA 4J90A 3TZ6A 3S55A 1DXYA 2WD7A 5ES3A 4CM9A 3JQ7A 4DMLA 3F5QA 4EYEA 4U8GA 2EHDA 3IIEA 1WWKA 3JV7A 3KOUA 3DTTA 2AMFA 4XD2A 3AJRA 3JYOA 3KZVA 4R3WA 3PWZA 2Z1NA 3D4OA 3DZIA 3UVEA 3CUKA 3RBZA 1AN9A 3ZU5A 1VPDA 3GVPA 5JSFA 2Z5LA 5KVVA 2B4QA 2J5QA 1DAPA 5CDUA 1ZO8A 1DO8A 1NPTO 3OA2A 5DP2A 3WSVA 3GGPA 1ONOA 4MVJE 1CYDA 1I36A 2G17A 1K5HA 2O3SA 1WDMA 4LSMA 1QYCA 2ZQZA 3LT1A 2YV3A 2R00A 4E4YA 4LGVA 1Y8RA 2J3IA 1HE5A 1ZSNA 4RDHA 3BMOB 1U2GA 3DHYA 1EVYA 4WCFC 2HMUA 2IYPA 3GG9A 1DEHA 1XGKA 1U28A 3EGOA 1RM3A 2AHRA 2NADA 1EVJA 1PGOA 3HQ4O 4PFJA 1HDCA 4CUKA 4J7UA 1Q2XA 1X15A 2D5AA 2NU6A 1EZ4A 3HDQA 2DPGA 2PH3A 3I9LA 1N1GA 3JYLA 4QTZA 3ETEA 3FNEA 3WGZA 1LU9A 4BNUA 3Q9NA 4PN3A 2GN4A 2H1SA 2HMVA 3Q0EA 1EK6A 3ZWPA 3P2YA 3EDMA 1QV6A 4FFLA 4BNFA 1M67A 4QT0A 1BHSA 2QRKA 3V2GA 4CMEC 2OL4A 4NFSA 2B35A 3EHEA 1D4FA 3CZMA 4U6QA 2DUWA 1PS9A 4E33A 2GD1O 3AI3A 4FPXA 5KJFA 3WNQA 5ICMA 4MKXA 4PG7A 4J49A 2QIOA 4PLTA 2DBVO 4BHTA 1BXZA 1PS0A 5AVOA 3ROKA 1LDNA 2JKVA 5JAQA 2PA3A 5TJ9A 4CV3A 3KEQA 3OSUA 4JK3A 4DQVA 3Q6IA 2CF5A 2X5KO 4EDFA 3O4RA 3OM9A 4Q3BA 3JTMA 3NDRA 4DPKA 1D7OA 3NEPX 1YL6A 2E49A 3H3FA 3DZKA 2WE7A 3ZWWA 2W98A 5I9MA 2ZYAA 2WD8A 1O5IA 2LDXA 2Y68A 4BNZA 4N7RA 3QVTA 4O63O 4PIVA 3WG9A 1M76A 1TLTA 3BTOA 5TIIA 3GC6A 3E6AA 1PL8A 3GH3A 4FFNA 1U8FO 4OXYA 3WQRA 1ORRA 3GVCA 3SLKA 2DBZA 3F9IA 4XR4A 4NR0A 3GEMA 4K6FA 2WDZA 1HLPA 3LLSA 4KWHA 4MDHA 4YRBA 3PLNA 4PG6A 3WS7A 1Q0LA 1ADGA 3PYMA 2BELA 8LDHA 4HFMA 1FDTA 4BNGA 4TZKA 4LISA 3RU7A 4BNJA 1E6EA 4TVOA 4UUNA 3ZWNA 1HETA 4QECA 5H83A 1OZAA 1GU7A 1HEUA 3AFNA 1RYDA 1EFLA 3D4NA 2C20A 2CZCA 2VTDA 4U0JA 3ZZNA 5B1YA 2YW9A 5KJCA 1P1IA 4Y6PA 4DTIA 4ZN6A 5BSEA 2H9IA 4PLFA 5I8ZA 3BTUA 1U4SA 4RF3A 3V1UA 4BV9A 1PGNA 3PFWO 4M54A 3ADPA 4YAJA 2UUOA 5ILGA 4AJ4A 4AJIA 4A03A 5TGDA 4RF4A 3RC7A 4J2HA 1YXMA 2Q4EA 3HADA 4S1VA 2DKNA 4RF2A 3PXXA 2RAFA 3E5MA 3MCVA 4UVDA 5A05A 4AICA 4XDZA 2G1UA 5TT1A 4GQAA 4IQ8A 4Q3EA 2OFPA 5C7IO 4L0QA 4CMIA 3SVTA 4ILKA 1DDOA 2PR2A 2B5WA 4CM1A 3MEQA 3MWEB 4RORA 5A06A 4CQMD 4ND5A 2VT2A 5BSFA 2ZKLA 3VPGA 2VRCA 4EUHA 2JD2A 1AXEA 3BHJA 2P68A 1H2HA 3ENNA 2VHWA 3MJCA 2Q3EA 3I9OA 1F06A 4W82A 1LRJA 1ZFNA 2H6EA 4DMMA 4XYLA 1JLLA 2C7VA 3GEDA 3PZBA 4OSOA 3ONDA 4WOJA 3S2GA 3V5NA 3JD2A 4OYRA 5CEEA 1CERA 4J0FA 1CEQA 1P1HA 3IOYA 3JYPA 3PWKA 3JD3A 4IQGA 1GL3A 1VL0A 4M49A 1ZH8A 3OQ1A 5EERA 2BFAA 5FI3A 3ZWAA 2WYUA 4BO0A 4WECA 1DFGA 1FMCA 2D5CA 2O50A 3NT5A 2C59A 2C5EA 5BR7A 4WGGA 3N74A 4KUHA 4GSLA 1B3RA 4GX5A 5G0VA 2TMGA 4PLGA 2HU2A 1WP4A 5KWEA 4JJIA 3NDJA 5A04A 1Y1PA 5DZSA 1C0LA 1UZMA 3S2IA 5JAZA 2IRWA 5FI5A 1V3VA 3GDOA 5CFZA 1R66A 3F4BA 4CV1A 4I5GA 3F5SA 1HLDA 1UDAA 2E48A 1Y5MA 1NQOA 3ZHBA 4EI2A 1SZJG 4KDEA 1IZ9A 3F3SA 4BNLA 4RPKA 4BO5A 1T2EA 4AJ1A 4Z9FA 4AJKA 3DBHB 3WGIA 2DC1A 3L6DA 2Z1MA 4WCFA 5JMWA 4P4LA 1C0IA 5T8KA 4Z9YA 2P5YA 5DBGA 4ZQEA 3U0BA 1KVTA 4W99A 3VH4A 1AXGA 3AM3A 4BGEA 3HE3A 4B4UA 4HXYA 3BMNA 4CMKA 2OP1A 4KUGA 2PY6A 3QWBA 3OETA 1XQ6A 4JN6B 3B1FA 3RU9A 2QX7A 1GUYA 4BGUA 3HDYA 4R5MA 5A9SA 3RUHA 5AXBA 3GAZA 4NZ9A 4YAIA 4QXMA 1YGYA 1RPNA 5L3ZA 1B8PA 2SCUA 3FNFA 3RC9A 1JKFA 3PLRA 3IC5A 4DQUA 5JDIA 1R12A 1WLYA 4YWJA 3GZ4A 5K0ZA 1XELA 3DZFA 3TL2A 1T2FA 3RWBA 3BHMA 4MVJH 2BGKA 4CL8A 1QYVA 3JQFC 2YY7A 1HTBA 1D1SA 4IDDA 5T57A 3R3SA 4MKZA 2W8ZA 2Y66A 3H5NA 1SC6A 3D5QA 1LLDA 1DBVO 4K26A 3WNVA 2CDBA 4BNIA 1GQ2A 3KV3O 3IJPA 4XDYA 2Q2VA 4J3FA 4RPGA 3GPIA 5THKA 4DVJA 3FRJA 1KEVA 2O4UX 2P91A 4RLHA 4QEDA 4PRLA 5ICSA 4IS2A 2CMDA 5EINA 4DXHA 2POQX 3LT4A 4G81A 4YVFA 5CEJA 2Y05A 4LSWA 3FWZA 2Y1OA 1BDMA 4A2CA 3ZWVA 2JFHA 4Y67A 2X86A 4YT2A 1ONPA 1PWZA 2GN8A 3KSZO 4ALJA 1TT7A 3PYXA 1KC1A 3GUCA 5L45A 1SB9A 1HYHA 4XA8A 4NNJA 4Z0HO 2VZ9A 1Q7GA 5CPBA 2AG8A 1C0KA 4D44A 5JYDA 2R00C 4JROA 4YYZA 1GV1A 2DLDA 4IIVA 4L9RA 4MKRA 5C37A 2YV2A 2BD0A 3GRKA 1CJCA 2Q99A 2F00A 2O2YA 4JNKA 1VL8A 2VWQA 3EUWA 3GVHA 1T2DA 2NACA 4A27A 2AW5A 3BMQB 3HFGA 1ZSVA 1NQ5A 4XRRA 3TPCA 4BGVA 5FEUA 3SC4A 3RUEA 1JWAB 4KP7A 4UEOA 1UP6A 5KKCA 2QYSA 2Y1CA 4IDAA 3FSRA 5COQA 4CLEA 2B83A 4HX5A 3COSA 3LU1A 1MP0A 2DVMA 3S1LA 3WWYA 3ZV3A 4RCVA 2PK3A 1LSSA 4R16A 2Q2QA 2RH8A 2GRAA 3QRWA 3PFFA 3VHRA 3CSDA 4J6FA 4XWYA 4BO1A 1QKIA 2BRUA 5CP8A 3RUFA 3GNSA 4D42A 2P4HX 3PHIA 1YBMA 3JSAA 4M89A 4OL9A 2FPIA 4L4RA 5F1PA 9LDTA 4IUYA 1PJCA 2P9EA 4GI2A 3LC2O 4BL5A 2B37A 1DOHA 4CMGA 5FYDA 2GDZA 1A9YA 2C0CA 4JIGA 3K73O 5TC4A 3U4CA 1XDWA 4B79A 1YWGO 1K89A 4NIMA 1W4ZA 4DBVO 2ET6A 1BTOA 4H15A 1XQ1A 2VHZA 2V6GA 5EMHA 4DIOA 1MX3A 2PFGA 3ULKA 5ER9A 5DF1A 4CMAA 1YH3A 3QWIA 1VL6A 5AOVA 2D3TA 4D79A 5DCUA 3K9QO 1C1DA 3JQCA 5DCYA 5L4NA 4Z3DA 4IDCA 4II2A 3PRJA 3DDNA 2ZTUA 3NRCA 4EGFA 4JCOA 5JY6A 1K6XA 2EV9A 2ZB4A 3HWRA 5DT9A 2ZCVA 1U9JA 3DB2A 3DZBA 2X9NA 3ICPA 3C24A 3IS3A 4KMSA 2Y0CA 5U4QA 4BNTA 2J3JA 2YUTA 3JQ8B 1AHHA 3IP1A 1VJTA 2F1KA 4FOSA 4NU6A 1A4UA 4CLRA 1Y8RB 4GX0A 3DWFA 2PTGA 3FBGA 3RIHA 4TQGA 3D64A 3SC6A 4OOEA 4E3ZA 5I7FA 1H9AA 2X4GA 3PGJA 2Q1WA 3WDSA 5AXAA 2PZJA 3CZRA 2CFCA 3GGOA 4PZDA 3OEYA 1GPJA 4D7AA 3EY4A 4UEJA 4BOYA 4DIFA 3ZWYA 2AG5A 1Z45A 2VYVD 1MGOA 1U4OA 1QYWA 4YJGB 1BW9A 2BFMA 3LC7O 4DLBA 5TSDA 3NX4A 3ICCA 1M2WA 4TKLA 2YDYA 4GGOA 3P2OA 4BO6A 3I1JA 3TL3A 5CG1A 2VUTA 3WBFA 3K30A 3GMSA 4AJOA 1RM4A 4B7CA 3E9QA 3H5RA 3GT0A 3OECA 4FQ8A 3RKUA 1E3IA 3HJAA 2WD7B 3G0OA 1E7SA 4JXKA 4YJHB 1OC4A 3ON5A 1PL7A 1DJNA 1F8FA 1A4IA 2X23A 4DQXA 4BMSA 4E6PA 5H81A 3PQFA 1MFPA 1ONNA 4FFMA 4D41A 1NM5A 3C1OA 1MFZA 3Q9UA 2WJPA 1CWUA 1LQTA 2HMSA 3ADOA 5JYEA 1P1JA 2GPTA 4IY1A 3KRTA 1H6DA 2DTDA 4Z0TA 4MPDA 2BI8A 5THQA 1N8KA 1PQUA 1RJWA 2WWRA 3BAZA 1DFIA 1T24A 3ROMA 2BLLA 3I5MA 5BNIA 2UV8A 5G0WA 4YAGA 1U8XX 2IODA 1FK8A 4ZHSA 1Y81A 3JCZA 3PHGA 3DL2A 1KVUA 1ULSA 1NAHA 2I67A 2RBEA 2XPCA 3VVBA 4E2ZA 3QSGA 4KTVE 1X13A 3H5AA 4Q3CA 1GCUA 4G65A 3RD5A 4HFJA 1KOLA 1UXGA 4RVUA 4UUOA 4XQ9A 3RROA 3ZW9A 3QP9A 1UJMA 5AQ1A 3DHEA 1I3MA 3QIVA 4J16A 2HRZA 3UCEA 3NT2A 1ISIA 4GMGA 3PJGA 4L74A 2GCGA 2BHLA 2C2XA 3E5RA 3RUIA 1E5QA 2I65A 1YQGA 3HZZA 4MP3A 3NV9A 4DYVA 2VWHA 1EUCA 2JAPA 1WPQA 4EITA 5IAAA 1U3VA 3V2HA 4HP8A 1N92A 1UXIA 4D0SA 3M1AA 3VZQA 2VOEA 1V8BA 3ZN2A 4GSKA 3JQFA 5GZ3A 3TOZA 1GR0A 1N7GA 2CVQA 3QHAA 2J3HA 2OGUA 2C7GA 2FSSA 3LT0A 5ER6A 1HDOA 2NTNA 3FWNA 2XF8A 3JQ9A 3BMQA 4DUPA 3MJ4A 3W8EA 4AG3A 3CINA 2BH9A 2DUUA 4PLCA 3EZYA 3QLJA 3JQGA 1Z7BA 3MJSA 3JQBA 5ENVA 4A0SA 1EFKA 2JCXA 3B70A 3WB9A 1YE3A 1SMKA 3H3JA 5IDYA 4C4OA 2V6BA 3C7DB 4DBZA 2OHXA 5L53A 1A9ZA 1IPEA 2VNSA 1KIFA 4TKMA 1YBVA 3FHLA 1GQYA 4FW8A 1GV0A 1E92A 2BFOA 1KVQA 3ROPA 1P1FA 3FD8A 4JJFA 2AEJA 2FZWA 2HRBA 3O38A 3QV1A 1XWFA 4J1SA 5FWNA 3GHHA 5K9ZA 4PZCA 2X9GA 3L4SO 1ADCA 1X7GA 4YTEA 4WCDA 3MOGA 4U0KA 4BMNA 4LW8A 1E1NA 1T26A 3QE3A 4ESOA 1E7WA 1DIRA 3RC1A 4BO7A 4CPDA 4CR7A 3KETA 1I2ZA 5DOZA 4PG8A 2BGLA 3MTGA 1X14A 3UCXA 1EEHA 2ZYGA 1Y9AA 4HKTA 3GNQA 1JU9A 3OJOA 3D0OA 4X54A 3UH1A 3AW9A 4I08A 3PI7A 4CLOA 3MJVA 2EKPA 1E1KA 3DBRB 4E31A 3AY3A 2AE1A 3AOGA 1GZ4A 4WEOA 4BNNA 3DO5A 1PR3A 3BIOA 3WGOA 3AY7A 1LJ8A 4XYMA 3RAJA 2G0TA 1NR1A 3GG2A 6ADHA 3H2SA 4PRKA 1VM6A 2Y67A 2O4CA 1I8TA 2TMDA 1OBFO 5T5QA 3JQGB 4KWIA 3WYCA 1LDBA 4GVLA 2CVOA 4NJMB 1H6AA 3UF0A 3UN1A 2OXIA 3DOOA 5C7LO 1DAOA 3WQQA 5U9CA 3EVNA 5HRUA 5CDTA 1QLHA 4YB8A 1R4NA 4PLWA 4PLZA 5G0SA 1M66A 1UZNA 3ZV6A 2CSUA 4NHEA 5TT0A 1H0KA 3AM5A 4YJHA 1R0LA 2OBNA 4DA9A 3O8QA 4FSHA 4AJHA 4BQPA 3U4HA 4J4TA 2A9FA 3RJ5A 4TRNA 2Y1EA 5BSGA 4EEXA 2JHFA 1I3NA 1HZZA 1BSVA 3RUAA 4EW6A 3I9NA 3FR8A 4OO3A 4UUPA 3TZCA 2CUKA 1K3TA 4G2NA 4JP2A 5G0TA 4ZJUA 1U3WA 4YPOA 3ASVA 2YFQA 2WYVA 3GF4A 1DPGA 2FMUA 2WYWA 2W2KA 2FHSA 3AI1A 1NPDA 1NVMB 3I9JA 3RBXA 3WGHA 4GVXA 3D4PA 2UAGA 4ZU3A 5LDGA 2JFGA 2O3RA 1NBOA 4R51A 2OO5A 4JP3A 3L9XA 3IQDB 4IM7A 1ML3A 4E13A 3L4BA 2B36A 1O6ZA 1CIVA 5B12A 2GNAA 1UZLA 2WEKA 1U1IA 2I6TA 4CQLB 4RO0A 3D5TA 3FR7A 3NYWA 4IDBA 1ZXBA 4B4VA 3WWZA 1PWXA 2VYND 4WASA 5JXWA 5HTOA 3M1LA 1SOWA 2Y1GA 1QLJA 4MVJM 2O48X 1YRLA 1G1AA 4Q3DA 4L76A 1YJ8A 3O03A 4QSMA 3CE6A 4JBHA 4JLWA 1I5RA 2ZQYA 2FN7A 3UUWA 2J6IA 3KSUA 4JBGA 3GDGA 1J4AA 2GZ3A 3VTFA 1YL5A 4H16A 3F6YA 4C7KA 4EBFA 3MJEA 2CD9A 3N7UA 4AL4A 4D46A 5LC1A 3IP3A 4YRDA 1GD1O 5KCZA 2JCVA 3M2TA 5F21A 4R69A 4KQXA 3A9WA 5TRTA 3BZUA 1GYRA 2O3TA 4XCVA 1C3VA 4HFNA 2VT3A 5I7VA 1C1XB 4K9DA 1Q0QA 1I2BA 2NSDA 2E37A 4TZTA 2IZ1A 3JQEA 4DYDA 3F4LA 4W6ZA 4IJVA 1YONA 4IMRA 1PU2A 1P44A 2OP0A 3PPIA 2X58A 4CR8A 4MVJF 4XQCA 4EUFA 4CMHA 2GF2A 4Y98A 3RUDA 3EAGA 3JD4A 4NK5A 3ZHZA 4BMVA 3X2EA 4BKQA 4BKPA 3O8QB 2QRJA 2AE2A 4GL4A 3GN1A 2DT5A 3H9EO 2IDZA 4UVEA 5C3MA 5B4VA 1E3LA 4WE3A 3OF2A 5IG2A 1PR9A 3VTZA 1I3KA 1NWCA 4OH1A 2D4AA 1RM0A 4IZIA 2WMDA 3DZJA 1XKQA 1EDZA 4M86A 2I99A 3VDRA 3C3XA 4P22A 1Q7CA 4ZICA 4CLDA 2GZ1A 4NJOA 1HDXA 4MIYA 2DU8A 1MXHA 1A5ZA 3D3WA 2X0JA 3AWDA 2I9PA 1Y9EA 2V6MA 5CHEA 2UYYA 2X0RA 3KYDA 5TS3A 1HZJA 3VZRA 3KLPX 3N58A 1W6UA 3TRIA 2QRLA 3OEWA 4B4OA 3L6EA 1B0AA 4EJMA 4I5DA 2VQ3A 2JL1A 1V3TA 2O2SA 4WK6A 1VKOA 1B15A 1NFRA 1JVBA 3GRPA 4OMUA 1HRDA 4AJEA 4BO4A 5DCWA 4J2OA 1B8VA 1Z73A 2ZYDA 3H9GA
chains in the Genus database with same CATH superfamily
1UAGA 3SI7A 1KO5A 5IN4A 2E2WA 2H5IA 1V96A 3RF6A 3LPAA 3ITKA 1Z82A 4WACA 1PNTA 5FWYB 3F5MA 2WW8A 2QUJA 3MCAA 1S8FA 2AV6A 4I8DA 2YXLA 4MA5A 4WPGA 1P77A 1JIUA 5EA2A 4V0MA 5F33A 3TR6A 1FW8A 2NGRA 9GPBA 4EQ6B 3R7SA 4D0LB 4DV0B 5IUKC 3OIWA 2F67A 2HBRA 1J24A 3LUFA 1KDVA 4YHHB 2JGIA 2OV8A 4BCBA 2QLLA 3IEMA 1YR8A 1XRQA 2BHRA 1XMJA 1PGPA 4C04A 2Z2XA 4GLLA 2UYHA 5SZHB 1XRPA 2QXYA 3C5VA 1ORDA 4JI0B 2CNLA 3V4PB 5L7TA 2VUSA 1LS1A 1SUPA 4FEGA 1SOUA 4H3SA 2G1PA 2AEFA 3ZNOA 4QQRA 3BXZA 2JD0A 3I53A 1VE7A 1SUBA 3OU7A 3ROQA 4MVJP 2PWAA 3DZHA 3C45A 3JRNA 1G20E 3QFCA 4LJYA 4BLVA 3JAWB 4E21A 1U3DA 3CVWA 4FQ7A 4PX2A 2HBYA 3RIEA 4FB4A 4ZHQB 3U4QA 4M1TA 2XGSA 2XOEA 4L07A 3BBLA 3VC2A 4CKCB 8ABPA 2X7JA 3KJGA 5JD6A 2QMQA 2RHCA 3O4FA 1S2GA 1Z7EA 1YUMA 3H5OA 4LY0A 5DM0A 4Q3NA 5A7HA 5KQLA 3RLFA 3LWBA 5H3CA 2AFVA 4QBHA 4GU5A 3N7TA 3A3OA 2GILA 2OOSA 2PN1A 3QNUA 1CD5A 2OILA 5B53A 5KNDH 2YXDA 1Y1TA 3RIGA 1VLQA 3GQBB 3LK6A 3MCWA 1QGOA 2J4DA 1Q7TA 2WKRA 3CW2A 3MUFA 3BIJA 1QDEA 4BZQA 4X9XA 1BNCA 5D5HA 3V7FA 5AIBA 1ZK0A 3FF1A 6REQB 2AC2A 3M6WA 5AWFC 2D0PB 4CTMA 2SNIE 2J31A 2EERA 3ONEA 3JWGA 3GJ6A 5EEGA 3TI9A 2FPUA 4E30A 4R05A 2B6HA 1EVIA 3KPVA 4ARUA 2D0IA 4FP9A 4XYBA 4KMRA 2CXOA 3TW4A 1EDBA 3E2PA 3MJRA 3IOCA 1EG2A 4AUEA 4RY2A 5AW0A 3LO5A 1E94E 2HF2A 1U2RA 3DKVA 3SLRA 2QGZA 4QU9A 5C7OO 4QHTA 3HLYA 1XQXA 2FZGA 3DTYA 4O2AF 2WJHA 2XUIA 1L7RA 1YS1X 3W04A 4QM7A 4K28A 1W4RA 5IH3A 4YMTA 3O8NA 1DJLA 5KNBA 3IQGX 3BF7A 3VZPA 1LVHA 2V6JA 1T1RA 3TVDA 2ZTMA 1WDKA 2XGGA 1VGVA 1JMKC 1Z12A 4WX2B 1A98A 1A50B 2Q62A 3MYYA 3ZW7A 4B71A 4LEIA 1Z4LA 2G9UA 3CPHA 2JFOA 3O7MA 5DDIP 2ZITA 1SXJD 3BJEA 3LHDA 1TT5B 4MUNA 5KCMA 1M6WA 5KYUB 4BPBA 1SUCA 2FR0A 4FCWA 9ABPA 1VMIA 1K97A 2JGNA 1E9SA 4J2TA 3WJAA 3R0IA 4LJ6A 2FPWA 4D3XA 4A82A 3PHJA 4MUHA 3ZJYA 2OGZA 1ZAKA 2QLJA 3GLHE 4F96A 1LH0A 3KELA 4JV5B 4JJAA 4RJTA 1F5SA 2IE8A 4Y2TA 3NHBA 4LVUA 3ZWXA 3AEQA 2DM6A 1J2EA 2JFQA 3MA0A 5T3YA 3MUNA 2AC4A 2R8BA 4Z3KA 2CL5A 2HJSA 2V59A 3MIZA 1TGYA 4KO4S 1T3LA 4F91B 3GJYA 1C8BA 4PBSA 5J2UB 4Q03A 2D2VA 2W7TA 2CNWD 5AKKA 4ETWA 3H4MA 5KVAA 1QGAA 1SHKA 1SFRA 3PFHA 3C1UA 4R8MA 3T7EA 4HH1A 1LI7A 2CEKA 1YHZA 2PRZA 3QW4B 4QNRA 3T1VA 3WIUA 5L9AA 3WO0A 3GDFA 4L4SA 2EZ8A 3DFMA 3BFKA 4E5PA 4YXWD 2WUDA 3QG5A 1S7CA 2IOFK 3UOGA 5G40A 2DAPA 3BGOS 3NWOA 4Q3AA 3BJMA 4GWGA 1PSWA 1Q95A 5K8UA 5KREA 5I9NA 4GM4A 4E2YA 3TUZC 1IIRA 1VA4A 1Z4MA 2Y1FA 3PXAA 4DJDC 4OQNA 1AS2A 5BV1A 4BQQA 1ABBA 1BKSB 2K7ZA 2JI7A 4CEHA 1U8UA 5FNVF 4DM3A 4KPUA 1TD1A 4M98A 1IMJA 1YT5A 3FWPA 1AXRA 1DC6A 1FTSA 1U1EA 3QMVA 5JDCA 1JEAA 3X1JA 1J5EB 1E8MA 1GQOA 2CNBA 4EQ6A 4LJ8A 3PQ6A 1WVGA 2P0AA 4WAUA 1HNXB 1SKAA 2W6ZA 3T54A 4RF5A 4QL3A 1NOKA 1RWXA 4K03A 4LVOA 3WICA 2G9VA 1Y89A 3ZOKA 5K0TA 5ALKA 4E09A 2P77A 5B7GA 3GRRA 3NBMA 3GJ7A 5EY5B 3WGLA 2Y6UA 3H2ZA 2HRCA 3DMTC 4OHMA 1TQHA 2WILA 5BQ5A 5AKHA 2C0QA 1NMEA 4U7TB 1F0YA 3CF4G 2RGDA 3U80A 3HB5X 1K08A 4MI9A 3QNWA 3TLJA 2X19A 3N07A 5AW9A 1Z6ZA 1ZIXA 2IF0A 5TX7A 2VF4X 4ZKDA 1A4RA 2PYDA 2IEYA 3BWXA 3IXLA 4MWCA 3EXIA 1D9XA 3H0CA 1U2SA 3WMXA 2RJ3A 1FFXA 1E5VA 1V9LA 2EFCB 2OBYA 3E15A 3F73A 4F0JA 3DZGA 2UUPA 4KV7A 3B3JA 2HZBA 1N3LA 3SJ7A 3V8BA 1S96A 3ZXUB 3A70A 3CNNA 3E23A 3ZCSA 5JCJD 5BQOA 1GVHA 3RABA 4MRMA 1MPXA 4NFHA 1SUEA 3LYUA 3H11A 4J3JA 3OI7A 4XVCA 2RH5A 4CKXA 1GXSA 2D1QA 2REXB 3CNHA 4NCXA 5EMLA 2W70A 5LNK1 3UWOA 4JQOA 1U1DA 1YQTA 4ARSA 5TLSA 2EG5A 4LVCA 1O3YA 1Y48E 1Z18A 1DWPA 4ICIA 5AUQA 5A1TA 5IKMA 1KETA 1VCHA 1G2OA 2HHJA 1P5ZB 3A25A 4L15A 2ZTLA 2AJLI 3OOHA 1P2SA 4MPJA 4Y9DA 5G41A 2PNFA 3KLMX 4R4JA 2R1VB 4EOGA 3Q6MA 4MXDA 3B3QA 3H2GA 5A2GA 4AN1A 3IQZA 3WBBA 1ZAYA 4DZTA 4IQFA 4RFSB 3GIDA 2UZAA 3BH6A 2IKSA 4ECAA 1GNLA 2PUHA 4G5GA 4IFIA 3SKYA 3T5CA 4CM7A 5KYKA 2XMSA 2F6RA 2GBLA 1JIIA 1UJ5A 5T6MA 4EBBA 1YVPA 1H5QA 1JLSA 2Y9PB 3AL3A 3I52A 3T06B 1RZ3A 5C81A 2NU7B 4MJ3A 3VHQA 1GPDG 2JGFA 3LSTA 4NPCA 1SCUB 2DP4E 4UTRA 5J9FA 1KMNA 5AESA 5FF9A 1DG1G 4QC2A 4R1PA 2QORA 1ABEA 1K3UB 2V7UA 4FGSA 5LVAA 3KO8A 3QOWA 1NW9B 1WKVA 4ZEVA 2ZRBA 4TTSA 1IC6A 1W0CA 1Q14A 4OF4A 3ZK9A 1EP3B 4E2XA 1PEKE 3RC2A 1TUGA 2DG2A 2K6GA 2RGAA 3ZU6A 3L7JA 4J0JA 2CXQA 5T8KC 2C4KA 2YQ4A 3BD6A 4HQKA 4C30A 1Y9DA 2XNKA 9LDBA 1RYFA 2X1HA 3UWDA 1MABA 2VQEB 2O2XA 3E9MA 3QUSA 1EUZA 1FJHA 3BC1A 4TKUA 2CLCX 3GXBA 4BZXA 4BP3A 3B2QA 3E9NA 2QL5A 2VYNA 3EY9A 3EC2A 4WZBE 3PC8A 5ESRA 2GM9A 2COUA 1N77A 4D57A 1X74A 4Q4JA 4UZFA 1Q2UA 1ZNQO 3EYAA 5DRYA 1FL9A 5T67A 4F6LA 2H7YA 3RBVA 1MLDA 5JISA 3SYKA 4Y6GB 4AZWA 2VAPA 3AR6A 5DHUA 5ECWA 4LF8B 4G5HA 1MG5A 1O89A 4RM3A 4UDXX 3H87A 4NU5A 2VTVA 2YJTD 3JWPA 1PX0A 4JJGA 4CW7A 2O2EA 4KIUA 3INGA 4QOHA 1A2BA 1H4VB 2JH9A 3S7TA 1T2AA 2I33A 1KRHA 1UJ6A 4JOQA 3VR4D 4CCAA 1XTZA 1B8UA 1OWMA 2G9ZA 5KX5A 1AF7A 3JY6A 2O3QA 2QLMA 3DAOA 3NTUA 4KHPB 5ALPA 2II6A 1N2ZA 4UU7A 3C87A 3IV6A 2QUBA 3PVCA 3T34A 2Q45A 2Q27A 2ZRMA 4GLJA 2ZXFA 3NT4A 4EW2A 1KL7A 4AWAA 4MHOA 4E94A 4MJ7A 4ZJZA 4PQRA 3L6CA 4RJLA 4FD3A 2XMDA 5I6DA 5AVZA 2QRVA 3ZCPA 1P0CA 4OLBA 3DD1A 3L1HA 3A6GA 4PRYA 3DC7A 1S2LA 1CJKC 3VMFA 3WQSB 4DLZA 5BN3B 1GUFA 5I9LA 3FCEA 1P1RA 4C6TA 4YBZA 2HC9A 1JJIA 4LDQA 4N49A 4Y2UA 3EDQA 3TF5A 3ILVA 2C98A 3H8SA 1UR5A 1G60A 2NTVA 2SKEA 2J1LA 1XBTA 3BA1A 1QTIA 1BMFD 1G5RA 4WK0B 3S2FA 4BASA 4BBZA 1V25A 4GEKA 3SC2A 3AHJA 3ETJA 4KO2S 5GONF 4AJPA 3JALB 4ER3A 4LF4B 4RZ3A 3HU1A 2VQSA 5ALZA 4EA6A 4XGQA 3GLKA 1KKUA 1DTEA 5GY7A 1GOTA 1USVA 4RZHA 2EX1A 1JHXA 1KMIY 4GXQA 1E5TA 1LLFA 2CDCA 2VP2A 1G0OA 3PJFA 1M2VB 2PZAA 1LC3A 2R5WA 4PS0A 5LB2A 2D5IA 3VVMA 1L4UA 1K63A 1TM3E 1T9DA 3OM8A 3W5DA 4NCAA 4B7XA 3ANSA 4I1RA 2PBFA 5B7PA 5IK2D 2CZGA 3FNHA 1VA5A 4C5AA 4R5HA 2BMAA 5F78A 1J0BA 2Q4RA 2IHUA 3GUVA 4EHLA 5CM9C 2HXYA 4TOIA 4UBMA 5AP9A 1YQ9A 3U13A 1AKUA 2BFCA 1Q1GA 2GVNA 5BYKA 1W76A 2ZB3A 2Q1XA 5CVVA 3KDSE 3JSXA 4F6CA 4XM2A 5BOSB 5JZOA 3H9UA 5EJ2A 5HKKA 1R6BX 1RCFA 2XAAA 1JALA 2I91A 4PZAA 1DRWA 2YJ4A 5BW8A 1INLA 5ALEA 4EZIA 4J7CA 3PE6A 4KWTA 1DOZA 1ZCFA 1TYAE 1DKOA 2NSLA 3LVFO 4UEKA 2V3VA 3DJYA 4IIUA 2X2FA 1IL0A 3WOVA 2A9VA 1YDMA 4XGKA 1Z39A 1SUDA 2VRBA 3Q8XB 4LDPA 3USCS 1QG0A 3ENQA 4EGJA 1SVOA 4Q0MA 4I5EA 3VR6H 2Y93A 1T4BA 4QUDA 4OHUA 1KF0A 3IUJA 1KQNA 4GYJA 3V8VA 2D5LA 2PH5A 5EE1A 5SY6A 1SHJA 3D4LA 5J58A 4U9HS 1B42A 1DRKA 3TOVA 3UO8B 2QU7A 1HOTA 2BEVA 3DLAA 5DHTA 1NBEA 4BE7B 5K09A 1PT7A 4QOEA 4EJSB 5MN4A 1P2TA 5JH7B 1EVQA 5CNJA 2GJKA 2CXSA 2VF7A 3RFXA 3L8EA 2OT3B 1ZH4A 3GZNB 1NN5A 4R1NA 5K45A 1N32B 1D6JA 5A0FA 2RAPA 2Z8ZA 4JVOA 1FRQA 3X1MA 3VX4A 1CY2A 3UWMA 4ER5A 1T4DA 3ACDA 2A5FA 2NZWA 4US0R 4BQIA 4IJ5A 1ZR4A 2EJCA 2ZI4A 2OUIA 2X42A 3P97A 2NVWA 5HE8A 4JASB 5L3QA 4LWOA 5EXDA 4AROA 2FGKA 5H4GA 1KVRA 1OX6A 4KYUA 3OZFA 4O0LA 3MQFA 4ZVQA 2O54A 2VF5X 3IUYA 5AVXA 4DJEC 1ZD9A 1KQ3A 3AESA 3FDZB 4MYHA 1ACLA 4IDHA 4P4NA 4PVDA 2SCUB 4FC6A 3A6FA 2EW8A 3CX3A 4E32A 1TDJA 4N1AA 4GLOA 4NBKA 1DDGA 2EKZA 1GN8A 3RS3A 1NNLA 1DRVA 1YQWA 2ODNA 4FXPA 3Q8KA 4PNZA 5DM4A 1N57A 2Z83A 3QU5A 1EESA 2ZS8A 3HFJA 4KDFA 1RLIA 4OM8A 1V11B 1GUDA 1BH6A 2XEXA 3CUEF 2RHBA 5JJCA 4FDAA 1XZJA 2RARA 1P62B 2HA2A 3I64A 5B5SA 4FE4A 1H66A 1FRZA 4IMPA 4UVGA 4X6XA 2ZI6A 3ZHOA 5J5VA 3DAGA 4AF6A 3NOXA 4MV1A 3IUPA 3T7SA 2VNKA 2HA3A 1KJ8A 4EJSA 1RWMA 2ZW9A 4TS1A 4OUKX 1HT0A 2VK2A 2L69A 2RHHA 1E66A 1ZCJA 2ZIXB 2P8SA 3LT5A 5CITA 3HCWA 5ED4A 4CEIB 2PGLA 5B3KA 4TN1A 1QF7A 4NBRA 5EJFA 1M1YB 3L6OO 2OE2A 3S68A 5B30A 1EYZA 4NBUA 3WTCA 1PK7A 3LECA 4ZEMA 1II8B 2OB1A 3KUKA 4H7PA 4D3FA 2NU8A 5HA5A 4GW3A 4TSKA 3H5VA 4HNHA 4OBXA 4O2BB 3PDUA 4ASUA 4LXUA 1SUSA 2VSFA 4YFYA 3DVLA 5JEDA 4HGRA 3V7YA 2VYVA 4N8SA 4XB6B 4ZT5A 1LK5A 2H4FA 3HGQA 2NVUB 2Q0SA 3V8MA 3SSMA 4KFTA 2Q46A 3AJ8A 3SIWA 3CC8A 3ST7A 1XU4A 2UXBB 3NGXA 5AW8A 4P6VF 4B47A 3ZU2A 3EZLA 3EB9A 1L5WA 1VCMA 5E1DA 5BOVA 4ID3A 2JLCA 3VJMA 1NNI1 5DMHA 4FHZA 3PCRB 3EF1A 1BX0A 1CW2B 4BFCA 3Q3HA 2YH2A 2WLTA 5A3VA 4KE8A 1ULHA 1OLXB 4RY0A 4IXMA 2ZTSA 3VGPA 5DWQA 1WUKS 5E3HA 3ABSB 3R1IA 1CPYA 4X60A 4ZVOA 4F3NA 2OBBA 5E9AA 4JCCA 1EA5A 1RAGA 1ZDMA 1FBTA 5A3JA 1DAMA 2QGNA 1Q1QA 3H65A 1BQEA 4FYPA 4YUYA 5DBOA 3W2TA 2NUAA 2R6FA 3KG2A 2VPIA 1IM2A 5EFOA 1I4TD 3GNLA 4Y2QA 1C7ZA 4I3HA 3VPDA 5CX1B 1QRAA 1I01A 2W11A 1T9KA 1E4VA 3B82A 2XXAB 2NP6A 1ETUA 1J70A 3M5DA 4DTCA 2JAUA 4LV5B 1HDZA 3TO5A 1DAHA 2D1TA 5EP2A 2ZRCA 4ZMSA 3P19A 2DB3A 3ES9A 4LQ4A 4XSGA 3I2HA 2Q41A 5EE9A 1CP2A 1Q83A 2VHUA 1Q7BA 3C8UA 2FLWA 1E2FA 2NW6A 3EULA 2ISQA 4AUNA 3IH5A 4ENPA 2PLAA 3J81k 1HNWB 1K8RA 2WQ6A 3MNFA 4CMIB 1R88A 3OIDA 1EP9A 4OXIA 3H99A 3D2CA 1JAHA 1ZCZA 4PHFA 2B4RO 1KMHB 5C7YA 4PYKA 3SXJA 4K9PA 3X1DA 4G8CA 4JKOA 5HVNA 3IERA 3L6RA 4N3BA 4ZAWA 1ATZA 1T3HA 2HBZA 1L5QA 4M9UA 4WLVA 3AW8A 1V1RA 2PUFA 1B26A 1L0BA 1Z6GA 1IDOA 3OMLA 4L0CA 3N6XA 4D8XA 5FP0A 2X2OA 1G8JA 3GLVA 3EXHB 2XOKA 1N75A 4FUTA 4JL6A 3TSCA 4WLFA 3KYDB 2FFJA 4TM7A 1SQ0A 1G55A 1W48A 2OZKA 3I0ZA 2C82A 2WJWA 4QUIA 3UZUA 2Y8EA 1QGDA 1X19A 2WINI 3DXXA 5HK8A 4FTWA 2YJGA 3A9TA 1US8A 2XCRB 1LNSA 2CJYA 3BSWA 3EEOA 1LD3A 1NVTA 1W29A 2XZPA 2H7CA 2GNPA 3F2IA 3RGWS 1JBQA 2ZRFA 3EUFA 4K3VA 1VRVA 2JAHA 5CPFA 4RETA 4YRPA 5NULA 2C4NA 3A4VA 5TY0A 3USES 4YPVA 3I61A 3LXMA 1N5OX 4GEGA 3LG2A 1SD1A 2ODPA 2WNIA 4G84A 1ST2A 1EQ2A 4ATNA 4NAVA 4BFWA 3PUYA 1USIA 1JVSA 3LP8A 3H05A 4RAOA 1ACJA 1DKRA 4EDHA 3T61A 4QLAA 1WHSA 2DFDA 2AJTA 2ETVA 1SUIA 3RYHA 1XU9A 5KKAA 1DADA 2V03A 2W58A 3TFQA 3UMGA 5ESXA 4ALMA 4QWWA 4ZC1A 2J7PD 4DREA 4BGDA 4AW9A 3BREA 4RTMA 5JADA 4KITB 1VRCA 1KJYA 2NYVA 2H8GA 3DM5A 3V4LA 5F5NA 3JQDA 3K0HA 2HF7A 2A30A 5JJIA 1L4LA 4IGIA 4QUKA 2HIAA 3QLTA 4LV8B 4HNTA 2GZSA 5CH5A 1NLZA 2XJ9A 3L2OB 4JX8A 3KUUA 1SVNA 4MWDA 2PS1A 4MARA 4Q9IA 4YAUA 1AKNA 1R4MB 4G2TA 3KB2A 2NU7A 1A8SA 1H2FA 1UDCA 1WCWA 2IEGA 4MA4A 5CB4F 3AHHA 2E4AA 4JC0A 4Z4EA 1FEZA 3A4LA 2HK9A 5H9WA 2CNDA 1ZOSA 3PIRA 2Q2NA 3CISA 3GDHA 4GP7A 4UUMA 2JARA 4EARA 1OH5A 2XB2A 2D7JA 5EQTA 2O0JA 4H17A 3OBBA 2Q9AA 4PNHA 2PRSA 4EMUA 2D62A 2W4QA 3GMDA 3OZSA 5FL7D 2BKXA 3GT3A 5F52A 1M6HA 4UAGA 4D3ZA 4G1VA 4WA7A 4CR6A 5KNBH 2QE7A 3UHOA 2FUNB 3KQTA 1AQIA 2XDQB 2AXNA 4M83A 4QRIA 4X24A 5KMGB 4HYQA 4J4BA 1E7MA 1L1EA 2C9DA 1OKKD 1TMKA 3R24A 3VR5A 1S6YA 3ZU4A 5FEMA 5H02A 1JNYA 1JXQA 2PFSA 3NTOA 1OFTA 1EQAA 3VHXB 1R8SA 3AR4A 5GVSA 1EFHA 3OPYB 2ZROA 4LN1A 4M9RA 1VLLA 4XPZA 3AP3A 3CVXA 1A8QA 4GMKA 4R9SA 2Q5FA 4HS9A 2R25B 4KOAA 4IIHA 1KARA 3JQ6A 5EKUA 5KSOA 3J80A 2CFIA 2EW2A 4FK8A 4AN0A 3RQIA 3V2UA 3EXIB 3GLGA 1QTRA 3S27A 4WVLA 1BCRA 1ZOIA 1NKVA 4G5QA 4B4WA 4V0SA 5C34B 4GR9A 2BF7A 4D8YA 2JFPA 4Y2JA 5EIBC 2DRIA 1EGAA 1CS0A 4V02A 4WNAA 1VE9A 3TW8B 3K6SA 1RXVA 4G5FA 1KI6A 2ODBA 5EIAA 4BS9A 5EZ5A 2G82A 1A3CA 2FWJA 1MNQA 1NFFA 4ZOEA 3N0RA 4HWPA 1E1QA 2CB0A 1MKYA 1RMTA 3Q7RA 5TEVA 1M7GA 3GLTA 4YMUA 2HA5A 3U4IA 2GK3A 4F4JA 1LI4A 1Y80A 2VJMA 5GVRA 2W6JA 1QIEA 1FF9A 3BF8A 3QVJA 5CLJA 5JJLA 2PX6A 4YMHA 3L1JA 5EHZA 1KSJA 3NALA 4YCBA 4BDTA 3UK2A 3WR5A 4YAFA 2IGTA 4PPQA 4EPWA 4RZUA 4Z2AA 3U09A 2B1QA 2JATA 2VP9A 3OCJA 4P33A 1CZUA 2XXBA 3UOWA 1SVMA 3FCOA 1QANA 3UJHA 5AM4A 1WUJS 5LWQA 1FMTA 1BDIA 1XVTA 4F5WA 4F72A 2CHVA 3A2NA 1K6JA 2YHUA 4JYCA 2HLPA 5CA1B 3VZSA 4BRZA 1D2MA 3A4IA 2ZIFA 4CZ2A 2EARA 4UOZA 1ZUNA 2EGGA 2ZR9A 3CMCO 5EKXA 1MOZA 4A6EA 3ESBA 3WMRA 3CX8A 2CYAA 2YYZA 2PWZA 3FLBA 4Q3LA 4KVGA 4URHA 5BVHB 5KO2A 1P73A 1RNLA 1JR3D 1LDMA 1OWNA 3CLUC 1Z74A 1WSAA 2VDPB 1E2UA 1PR5A 2FJ0A 1K2WA 3DT8A 3HLKA 4Q4HB 3RTCA 4DADA 4DJJA 5BUQA 1QIKA 3D1LA 3R3XA 3HGTA 1IQRA 3CCCA 1PSZA 3OPVA 3R40A 5EZYB 3UFXB 1U6IA 2W2NA 1Z0KA 3EMDA 1OGIA 4B5LA 1Q5PA 2ZB8A 4URXR 2D1YA 1IYZA 2QQFA 3DXZA 4BVBA 1AMOA 1O0CA 1SK8A 3RT1A 3V4SA 4YX9A 1G18A 4S2UA 2PVCA 4IX9A 3QKWA 2C61A 3R3WA 4HYYA 3A04A 4GX2A 4TV9A 3R7FA 1HKUA 4N0DA 5CX4A 1N2SA 3OQHA 1AN0A 2MSDB 4N5LA 4P32A 2GEDA 4EELA 5B6PA 1GZ3A 4CE6A 3IUQA 4NYIR 1P5HA 1GDDA 1URPA 1RYMA 3QA9A 4P5EA 4W7IA 3T4EA 2RAUA 4EECA 2WTXA 1E1YA 1UMKA 4UHCA 3N8HA 1YDHA 4JSRA 1ECBA 1I7QB 3GZTB 1TIBA 5ELLA 3G8AA 5KYUA 1PGQA 1E7RA 1FMLA 2J9FB 2VCHA 2PIDA 2ZU6A 4DAOA 1ORHA 3ESDA 4G4IA 4L2IA 3KT6A 4FWIB 1TVMA 4X91A 2JJ1A 3EXFB 2WJIA 4URFA 2F90A 1CKEA 3FDJA 1MHTA 4KR7A 3KJFA 5EMKA 3PUZA 2QNIA 3ZBTA 1ID1A 1FFGA 2QTTA 2DWOA 5E8JA 5JATA 4RGBA 1JEYB 3PBKA 5ITVA 2D6FA 2OC4A 3S70A 2QOEA 1R16A 2ORWA 2ZCUA 4OIMA 3VBEA 2VUHB 3LKBA 1I6WA 1EXWA 4MJXA 2A59A 1FLNA 2GLXA 2JFXA 3PNBA 2IX3A 1CK4A 1YUNA 5JD3A 1P81A 4CTKA 4XH9B 1QONA 2VOJA 3CRQA 4MYTA 2ECKA 1VJCA 3IPLA 3RYHB 3OCCA 1G9SA 3RVQA 4CLHA 4EJ2A 5HILA 4AIRA 3OZBA 5FV4A 4Z8XA 3EQ2A 3JQ8A 5E1BA 3FI0A 5CGQB 4A2WA 4REQA 4QICA 4YLEA 1CRLA 1I4EB 2HO5A 3BXOA 4FS3A 3T3HA 3ZE2B 2B8JA 3PP8A 1MR3F 2IHZA 2P90A 4FYXA 3CRZA 3E58A 1OBVA 2ZIVB 4PX3A 3TECE 2P2YA 4F3YA 4B85A 1DAKA 3E8XA 3VSDA 2AUNA 1V0JA 2XZOA 2EGHA 3FPGA 3K4HA 3QENA 3R3HA 4N6GA 3E1KA 4DA4A 3IQFA 2XWSA 1JFFA 3GJ8A 3V4RA 3V4ZA 4H1VA 4F4FA 4ZDJA 5IJWA 1TEVA 2YZ7A 2APJA 1QH8A 2ENWA 1FDRA 4A9AA 4CKCA 2Z4RA 2ZJ5A 3C7AA 4ZVUA 1DFHA 2QHXA 5UKDA 5U4XA 4Q9HA 1V6CA 2NYRA 1NJSA 2HU5A 3JAWA 5TVGA 3Q8LA 2DBRA 3TZQA 4D74A 2YIMA 8ATCA 4MCAA 5BW5A 5JFTA 2HJ9A 3ZDBA 3QWAA 5CFOA 1XPOA 2EU8A 1PYGA 1E3WB 2PLWA 4LMPA 4YCDA 2MMGA 2ZR7A 5AVQA 4JBNA 2QDXA 3ZI0A 3RFFA 2A1UA 2I5PO 2P3OA 3R9WA 3FMIA 5AKYA 5IDXA 1KQOA 4PAGA 2QD1A 2ZU0C 1HT1E 1HE4A 3FPEA 3L7DA 4PR0A 2ANBA 3GJZA 2OM2A 4QYIB 4N5HX 5AVVA 5JS6A 4RTPA 2RD2A 3CV3A 2DFVA 2VT6A 4WOKA 5IN5A 5MFZA 1J1ZA 5TJHA 3AHIA 2XCSB 1AUPA 1SVUA 4J1NA 1L8QA 3QVSA 3K72B 2DXIA 5EI5A 4DIDA 2ZUWA 4IO1A 3HUFA 1RLTA 1HG0A 2R6CA 2XKAA 3EHDA 3GNTA 3INTA 3OT1B 3PRKE 5TEWA 2VJQA 2D13A 3CTMA 4FZJA 4ALLA 3TLKA 2X0NA 4UBNA 4U3JB 4XFJA 1H85A 2M6KA 5IT9A 4EYSA 5DFAA 5IWAB 5I7UA 2R5FA 1EFUA 2ONKA 5ALOA 5IT0A 2IPNA 1FOEB 3A4YA 2C8JA 4OHZA 1MC8A 1ULBA 5JS1A 4ZQBA 4WZZA 5REQA 3F6SA 1A9XB 2HHCA 2PCJA 2QN8A 1JEOA 2ZS7A 3TGPA 1M83A 3Q2OA 4FHEA 2E89A 1H0SA 3LUHA 4CODB 2H4WA 4PQYA 5ICGA 3QVVA 1PDOA 3NHUA 2G71A 2V4UA 5IEBA 1Q3TA 3EIOA 3UKOA 1T2CA 2A0UA 4PYLA 1MGPA 1ZH0A 2AMVA 4YT8A 2CKMA 2P40A 3P4XA 1DQYA 4I9HA 5HGXA 2V9CA 2AN1A 4RPLA 1N33B 3GRAA 3PJDA 4INAA 1ND5A 2QSYA 3TR0A 2ZJAA 4UBOA 2FR8A 2VXBA 5JOQA 4RPJA 3IYLW 2ZJ0A 3I1FA 4N65A 2JIOA 1BDHA 1WSWA 2WG0A 3BH0A 2QEQA 3BFVA 1KR2A 3T9AA 3DW1X 1T9AA 2FEPA 4OTZA 2PE5A 5B64A 2QVZX 3T3NA 3SX0A 2GYUA 2GHTA 3ZDDA 4EG4A 2CGEA 1GRQA 1Y5RA 3C70A 5D3ZA 3E03A 2UUAB 4KFCA 3KCNA 4NRDA 2O8FB 1YHYA 3GA7A 3UGQA 3L7NA 1R15A 1S2DA 3RVSA 2YC4C 2AN9A 5DN6A 3U7GA 4GT1A 1OU0A 4D0NA 1M2OB 5HCIA 2ZBFA 1T34A 1DB3A 1KI4A 4ZZ3A 4Z9XA 1T36A 2X7HA 4WH0A 3JQPA 1J8QA 1N6IA 2WNSA 5J63A 3FYHA 1VPEA 5IVIA 4RA9A 4YUZA 3BK7A 3U7QB 4Q1AA 4UTZA 3R20A 4LCEA 4C0HA 2RHRA 4U6SA 3SHWA 4CN8A 2GRUA 4FXOA 4CM4A 1V37A 1A7KA 2FEXA 4UOQA 4Q6WA 4DE5A 1RSZA 1W5TA 2P6UA 1JDNA 4GBGA 3JYQA 4MO9A 3UC5A 5A9TA 4BWVA 4UW9A 5DIZA 3DTNA 3EMBA 3KTFA 3UKDA 2XOKD 3U5TA 1W1WA 4C3ZA 5IJ0A 3VV2A 4FFSA 4HAWA 1HEIA 3RS7A 1GY8A 1B7GO 2EWMA 2IW3A 1XDUA 4MZDA 3TWOA 5CB0A 4N6NA 1EX1A 3NIBA 1XLTC 3Q5DA 4HDNA 1OH8A 3K1YA 1ZD5A 4C01A 2R86A 2RIRA 4RDIA 3PITA 1TAQA 4XE5A 4OKIA 5AYVA 3NUGA 4HNUA 2LR0A 3MCTA 4CUJA 1YO6A 4NABA 4Q7EA 2A9OA 1S02A 4B3HA 3MBIA 3WOHA 1W8DA 3BMNB 4W1SA 2GGSA 1O95D 2WZBA 3HUUA 3W5BA 3OQ6A 2FN4A 2AXQA 3MK31 4O59O 1BMDA 4J8PA 2VUUA 4TL7A 4B7UA 2GAAA 2JD1A 3CX7A 4IHQA 1IXZA 4OUDA 4RYDA 4XGRA 1B00A 3B7WA 2PA0A 3EIXA 2P4UA 2PKXA 2G09A 3ITDA 4G1BA 5D86A 3V80A 3P32A 2OGWA 3ZE1B 1GRRA 1XJWA 4Y3UA 1KH2A 3OH8A 3ZNQA 2Y1LA 3SVZA 3QWHA 1P9WA 3BB3A 2AS0A 3CKYA 1OLSB 5KOIA 2B7BA 3FTCA 5HFAA 2O14A 2QN7A 3K1AA 3K1TA 1X1QA 3LF1A 1LXCA 1RIFA 2OCLA 3EIEA 5JMOA 1U0HC 2MSKA 2QA5A 4H7KA 2GEFA 1ZINA 3HRKA 3ZE7A 4O4JA 4XI9A 5JNUA 1PQWA 5FBVB 2RHDA 5L95A 2OXTA 2WIDA 2WOOA 3BH7A 5E6UA 2QAGA 5EMMA 4KI7A 1ZH6A 5BOSA 1VC2A 2DKOA 1RI3A 4LI3X 4QHYA 1G1MA 2P62A 4IJWA 1WZIA 4P0TA 1ZJWA 4LE1A 3G3EA 3OKFA 5KJEA 3REGA 2PUEA 1IUPA 3QOFA 3C4QA 1GUZA 1Z22A 2N46A 3L0BA 4J9VA 3WIDA 4BNWA 1QYDA 4X84A 4X3CA 2FZVA 1KSHA 3HCBA 4I4TA 1M2VA 2CK3D 2GEJA 5A71A 4EENA 4C3VA 2H1CA 2YWEA 3HCRA 2FCRA 1BRMA 3L77A 2C77A 2I29A 4RU1A 1DHRA 3R75A 3AETA 3KAPA 3ROTA 4DB2A 3OU2A 4EFKA 3BGWA 4LQDA 3B3GA 2RHGB 3RG8A 3P2JA 2AK2A 2OZVA 2XWBF 4I4TB 4WKBA 4G9BA 4XX1A 1I6LA 1TCBA 3F9RA 1JEEA 3IFSA 4ZEOA 3IQHX 3P7MA 5KC8A 2VTEA 2EIXA 4OHRA 5M29A 3B9RA 3IURA 3MBOA 2JIDA 1E6MA 2JGJA 4TL6A 4RADA 3MT7A 4DIBA 2O8CB 3OEEA 3SNHA 5ALMA 2QAGB 5EVCA 3TN7A 3NVDA 1ISJA 3GUHA 4KPGA 1WNFA 2QI9F 3F1KA 4FIZA 2NO0A 3U9SA 4OMDA 4J43A 1M5UA 1IWPB 2BN4A 2FY8A 2PEZA 2AQ8A 2NG1A 3HKBB 4HMQA 4B81A 5FJJA 5IZCA 4E5VA 2O8BB 4MR9B 5BN4A 3VISA 1PQPA 3HYNA 3E4CA 5FT9A 3MXOA 2ASEA 1TF7A 1JLRA 3AFOA 3N2GA 4FX2A 6LDHA 1Q22A 2F48A 1EFRD 1Z4QA 2VPTA 3MSCA 3NIGB 3C3BA 1Z47A 2CE2X 2PXCA 2WUFA 4IP0A 5FD8A 5E2AA 4BVAA 4ERXA 1MQ8B 2VG8A 1KY4A 4QOSA 1WAMA 4JBXA 4M4SA 4ZOLF 4BBPA 2B3TA 2ZJ4A 1O94D 2AUTA 2JLRA 3DEHA 5C31A 1RPAA 2BV3A 2FOLA 2MJLA 3CT6A 1XF1A 3P20A 1PJAA 1TM5E 2AF4C 2I7DA 1ORTA 1PS8A 2GEUA 2FUG6 2H0QA 1MC4A 3OHSX 4UE3S 2YC2C 3UB4A 4DDHA 4DKXA 4RULA 3EZXA 3I30X 1GEEA 3FBWA 4PN7A 1SA0A 4ZQHA 4JJ4A 3GW8A 4O4HF 3KE9A 5DGXA 2YICA 2P0EA 1YB5A 3R76A 1CR1A 1V3QE 4EG6A 1XZLA 3KYCA 5EL0A 1QO0D 5JBIA 4WUVA 3OZUA 5LIRA 4V0KA 5LZ7A 1TECE 3KVRA 4EO4A 1VMKA 4ARZB 2XBUA 1P9LA 3NIWA 1K7EB 4TKZA 3MJTA 4KR3A 3KYCB 1YL7A 4FMBB 2V5VA 2XYQA 2BBTA 1QQ5A 2EGUA 1N9GB 2P8JA 2BFEA 1PFYA 1XZAA 2E7ZA 1KK2A 3GLUA 2HT1A 5DNDA 4C14A 4XM1A 4QU0A 3IXMA 4JB8A 5LXTF 4F1WA 3GJ0A 2XQKA 4U8GA 5IW8A 4I4LA 1WWKA 3MTIA 4I3GA 1E5XA 421PA 3NUQA 2WSSA 4LGCA 3A0RB 2AMFA 3EDRA 4O2BF 5EWMB 4HLCA 5HIJA 3SM9A 3KZVA 2HQSA 4K87A 4KODA 1Y37A 4ZT4A 4M60A 3FX2A 4Y0AA 3KWMA 1JL3A 2BL4A 3CUKA 3L7AA 4QJBA 4KH0A 1NJ1A 4DLTA 4P81A 3I01M 1MC1A 2ATCA 4F3RA 2B4QA 1DAPA 3MWYW 5DU2A 4JLKA 5DLEA 1FC0A 1X1AA 3RIYA 4YV0A 1O9GA 3PQ8A 3OA2A 4UFNA 4LHEA 2DWPA 2FKAA 2FLVA 2ZAOA 3GWGA 1I36A 1L8XA 2G17A 4I50A 5AVYA 4DCMA 4DDKA 1K5HA 5FDFA 2ZBVA 2C3OA 4BBAA 1O97C 1Y8RA 5CK4A 1NL3A 2PUJA 2J9GA 4LX0A 5EJAA 1HE5A 2D7DA 1C2YA 3WP1B 3A32A 3DH0A 1YMQA 3DHYA 4K9RA 1Z8FA 1EVYA 5KKNB 4CKYA 3IR5A 1TTQB 4KXQA 3GJRA 4AUMA 3U3MA 5AW6A 1GFZA 3KAQA 4J7UA 4KX3A 3PV0A 5ALDA 5F2OA 4AY3A 1O7JA 4JQYA 3HDQA 2WU8A 4KG7A 4PHCA 2PH3A 3QKSA 2QD5A 2AI2A 3TOCA 1N1GA 5BR8B 3OZCA 4QUAA 1GQFA 1RI2A 4WY2A 1OE0A 4JU9A 1DZ3A 3EEYA 2V7QD 3EN0A 3Q9NA 2CWWA 2H1SA 1T5TA 2G70A 5JFGA 5HGJA 1NX9A 1XL0A 3LDGA 2LPMA 3R2JA 4PPNA 2O6HA 3H18A 3QHPA 1IG3A 4YASA 1TYEB 4BNFA 4Q4AB 5HKBA 4DR6B 1M67A 2YMLA 2BBSA 1VYVA 2OL4A 3HC7A 2B35A 3CZMA 1TLLA 2DUWA 1ADYA 2C99A 1EBBA 3AG5A 3MUEA 4U6QA 3V3KA 1VG8A 1JGTA 1N6KA 1RFGE 2WU1A 4JYBA 3WNQA 3L8GA 4MW4A 3D81A 3WKBA 4MKXA 4D9BA 1AQYA 2QRGA 3U3OA 4PLTA 2R47A 3RYIB 2DBVO 4FINA 5ICCA 3G88A 1FFWA 1PS0A 1PTKA 1XZEA 2LUOA 2VDLB 3DFKA 3HEBA 4FE3A 4G5RA 5TJ9A 3MW8A 5AR1A 4V1CB 3LNCA 4JGGA 5JSYA 2UVPA 4ESHA 2Q0XA 2VAMA 1OLSA 2CE7A 2CYCA 3Q6IA 5E4FA 3U9TA 4DQVA 2A1TS 2JIPA 1IUNA 3DJFA 3KUCA 2WVGA 1NXSA 3F97A 1O1YA 4DPKA 2AHOA 1KH3A 4JZKA 3NEPX 2D3WA 2PZGA 1Y7IA 2Z9DA 3RV3A 4AURA 1M73E 1UWCA 1CUEA 1LBTA 4DT1B 3QKTA 3ONVA 4L72A 4R9UC 4F3KA 1QH9A 4BAZA 3HP1A 3VR4H 3RVPA 1VE5A 4BX2A 1MVOA 2LDXA 3EEIA 1N2JA 4LECA 4O63O 3WG9A 2P3QA 2FMIA 4Q15A 1R0YA 3THWB 4IG4A 1QZXA 1PL8A 2V7EA 3CX6A 2HGZA 3JVDA 3GH3A 1PKXA 3QFHA 1Z08A 3QIAA 4KLCA 4ND8B 4UTXA 4ZYYA 3H4TA 2VDRB 1IRIA 3GVCA 2W93A 4CG0A 4KVFA 1MJNA 2FQ1A 3IUNA 4FKMA 3RAEC 1QIHA 3GEMA 2WDZA 4KQFA 3FGPA 2GARA 1CNEA 3ABZA 1VKHA 1J25A 2JBAB 3GEBA 1YCHA 2PUGA 2G6TA 1OVMA 1ADGA