1W73A

Binary structure of human decr solved by semet sad.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
294
structure length
288
Chain Sequence
NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Human Mitochondrial 2,4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions in a Distinctive Short-Chain Reductase Active Site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 2,4-DIENOYL-COA REDUCTASE
total genus 99
structure length 288
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w73A00
5KJ6A 2J8ZA 2OFPA 1ZH8A 1MX3A 4JCOA 2RH4A 4A27A 4UAGA 2W8ZA 1ZMTA 4JJFA 4BNWA 1DFIA 4J4BA 1VL0A 5TF4A 4I9NA 2PGLA 4ZICA 1SB8A 3DB2A 5A9SA 4YACA 1E1LA 4WASA 1LDBA 1VSUA 1C1XB 1PWXA 1R6DA 4Q3NA 1LNQA 4NI5A 4YJGA 3UCEA 2Y05A 1JWAB 2GN9A 5JW6A 1T2FA 4FB5A 3LT4A 4MPDA 3T4EA 3WR5A 5IFLA 4L73A 4YJFA 3FD8A 1YB1A 1VJ1A 1CYDA 3Q0EA 4RDIA 4UUMA 1Q0QA 3DBRB 5TQVA 3PHHA 2F00A 1XQ6A 5IDYA 4NG5A 2CZCA 1QYXA 2O2SA 1BXGA 2HKIA 1P0CA 4FJ2A 3WMWA 2PD6A 4ALJA 1QR6A 2TMGA 1RKXA 2B5WA 1NFFA 4E21A 1U8FO 1CDOA 3GMSA 1DXYA 2VUTA 5KJFA 2D3TA 1YOVB 4O1MA 1MV8A 4KZPA 1ADGA 1K3TA 3E5MA 4RLHA 1EVJA 1EEHA 1ZO8A 3LF2A 3CUKA 1U3WA 4XIJA 1XU9A 1E6EA 4M1QA 2DQ4A 4UREA 4J1QA 4KQXA 2W2LD 3ZWWA 3QE3A 4IGEA 3RD5A 3GK3A 2EHDA 1V6AA 1LU9A 1K2WA 4OSPA 3FI9A 3FBGA 4FGWA 3ASVA 3ZDFA 2HU2A 4E5YA 5L7WA 1GV1A 1NP3A 1BXZA 2I66A 4BNHA 2DUWA 3QA9A 1ISIA 4BNIA 3NDRA 2Q2VA 4GGPA 3JCZA 5A3JA 2IXAA 1A27A 4BNGA 1Y5RA 2C82A 3PZBA 5IXYA 4DTIA 4MP8A 2FPIA 2H6EA 4XJTA 4GX5A 1W8DA 4CMBA 1FDSA 3K92A 3A9WA 5U4QA 1UDAA 1V35A 4GSKA 4KP7A 4B4UA 3JQBA 3ZNQA 4DPMA 3UXYA 1A5ZA 1PZEA 4F46A 1EUDA 3FNHA 4P4LA 1JKJA 3K31A 3FNFA 1E7WA 5EPOA 4CMEA 3X2EA 3DTYA 3DZHA 3VVCA 4BS9A 4FW8A 1PJQA 3M2PA 4D0RA 1IZ9A 1XDWA 2NQ8A 2P4HX 3OEYA 4XGNA 4YDRA 1I2BA 2BMAA 4MIEA 2A92A 1R12A 2A9FA 3DFZA 4YAEA 1P74A 4YT5A 4Z0PA 3AI2A 2OHXA 2YV2A 3RFVA 2FZEA 2VHXA 4QSMA 1BVUA 4RV9A 3FRJA 1NQOA 4XGIA 1U3UA 1I2ZA 2FSVA 1BW9A 2H9IA 1J0XO 3ZWNA 5C7LO 3ZV3A 3OICA 1UZMA 3GGOA 1I5RA 3AOGA 4PG6A 2OBYA 3ZH2A 3PFWO 4E2WA 1ADCA 3EZLA 4IS3A 5ADHA 2NADA 4S3MA 4DXHA 3GFBA 1XIVA 1U28A 1IHYA 3GR6A 3H9EO 2CSUA 2OGUA 4U0JA 4CM8A 4IQGA 5ER9A 4F6CA 3PHIA 5K6AC 4PG7A 1PJCA 2HAEA 4B8WA 2O3UA 4FDAA 2B4QA 3ANLA 2VUSA 2PD4A 1V3VA 2QQ5A 1B8VA 3U4CA 3WQQA 4DLBA 4YEDA 3CXRA 3ZHZA 4CM5A 2DU8A 2RIRA 3OEWA 4R9SA 2YV3A 5JNLA 4BQRA 3IOYA 1UZNA 1ZEJA 3E82A 4AJ2A 1ADFA 3E48A 4HFNA 4OO3A 3HZZA 5TT0A 4ZQHA 1N9GB 4BGEA 4CUZA 3LSYA 3RJ5A 1ZK3A 2E82A 4FJ0A 1HEUA 3WGOA 4BO8A 5CDTA 4I9HA 1B7GO 4XR9A 4ZRNA 4NU5A 3UCXA 2YDXA 1VJ0A 1X0XA 3NRCA 4OIMA 1L1FA 2XOXA 1G0NA 5G4KB 4CV3A 3VH4A 3ZU3A 2O4CA 1LA2A 1H2HA 1P77A 4ND5A 4CM6A 3NAQA 3RBXA 4CUJA 4R9RA 2VZ9A 2DBVO 3I52A 4DQUA 2D1YA 1UZLA 3KVOA 3GLQA 5ILGA 2EJVA 3SJUA 1NHWA 1CQJA 2QRJA 3ZN2A 2NU8A 3PJEA 2IYPA 5GY7A 3FWNA 2J3IA 4D42A 3KB6A 2VN8A 4GVXA 3AUUA 1YH3A 2Q1TA 4RVDA 2PKQP 1A9YA 4YRBA 3WQRA 4IDFA 2YV1A 2BRUA 3C1AA 3CINA 4ILKA 3VPHA 3KYBA 4WLUA 5F1OA 5A06A 4XDYA 4E12A 1YS4A 3PI7A 1E3SA 1S7CA 4AICA 5L7TA 3GG9A 3NEPX 4WCFC 2WM3A 3ZU2A 4A10A 2X0RA 1M6WA 3TZQA 4JK3A 3PPIA 3KUXA 2X5OA 1P1JA 1IULA 3KYCA 1LDGA 1C0LA 5BNIA 4XZ3A 1BDMA 2VHVA 3F1KA 4M54A 4IINA 3H8VA 3INRA 4DMLA 4E0BA 4NFHA 4XB2A 5DT9A 1WPQA 4DLAA 1Q1NA 1DRUA 5THQA 5BSHA 1PIWA 1RWBA 4YJGB 4ESOA 4ZJUA 1ZK2A 4F6LA 3RQSA 4CMEC 3JD3A 3JD1A 4FOOA 4BNFA 2Y99A 3S2FA 4FJ1A 3AU9A 3JQBC 1VSVA 3A4VA 3EZYA 3GAZA 4FQ8A 4RQTA 3OH8A 4J43A 2NVWA 4RQUA 4MVJA 2GCGA 2J3KA 2P9GA 4E5MA 4I5EA 2ZTUA 1DIGA 1ISJA 1R4MA 4OKIA 3F1LA 3DBLA 4CLEA 2JCXA 1JKFA 1TT5B 4IMPA 1E7RA 2O4UX 4CUKA 2Q49A 4CLRA 3EHEA 1X7GA 5KJCA 3VPFA 1HDRA 4LK3A 4CM9A 2W2KB 5AYVA 4CM9D 1JU9A 3L9XA 2WE7A 3I9MA 4R1UA 5COQA 5JFOA 3TFQA 1JVBA 4ZQGA 3OSUA 3AUAA 3M1AA 4YQYA 2Y1GA 2YFQA 1E6WA 1H93A 3SBOA 3WJ7A 2G76A 3C85A 3QY9A 5BNTA 1SC6A 1TT7A 2VWPA 2NM0A 1G0OA 3OIDA 3VPSA 1G6KA 4A5OA 2QRKA 4B4VA 2OL4A 2Q3EA 4GVLA 3L6DA 2H5LA 3GVCA 2NWQA 1LXCA 3C7DB 4PG8A 4GMFA 2C5EA 5CEFA 3D4PA 4BMSA 3OQ1A 3AFMA 3K8ZA 5CPFA 2O50A 3UGKA 5K0ZA 3GN1A 4O59O 3UHAA 2UUOA 4O6VA 3EAGA 3DHNA 3H3JA 4L4SA 2B5VA 3SC4A 4CMCA 4BGUA 3U4DA 4RPLA 1U3TA 3BAZA 3RUDA 3WNVA 3VTZA 5JYDA 3P19A 4FCCA 1PQWA 1XCBA 2Z1MA 4NFYA 4AJLA 4TWRA 1ONPA 4EJ6A 4YVFA 4ALNA 4DYDA 5HA5A 3MJEA 1T4DA 2I5PO 3DZBA 1HDOA 1OOEA 3OFSA 1BRMA 2V65A 4U0KA 2GR9A 4AJOA 3NDJA 2POQX 3PTZA 1ZFNA 4BO2A 4CQLA 4O63O 4CV0A 3TL3A 1U2GA 2ZJ0A 5JBIA 1ZZEA 4TROA 3S2IA 5KVVA 2C2XA 2PR2A 1XA0A 3INTA 1K6IA 4FC7A 4RPGA 5TJHA 3CSDA 2BHLA 3LC1O 1NPDA 4WGGA 5B1YA 5TGDA 3L6OO 3UW3A 1UP7A 5G2OA 1H6CA 5KVQA 5HBRA 3C1TA 1QV6A 4QEDA 2RAFA 3WIDA 1HLDA 1Z74A 3VKVA 4UULA 4R1NA 4CJXA 4PG4A 4FFLA 3OQ6A 2YHUA 1ARZA 4QX6A 4LRTB 1Q2XA 4ND3A 3RASA 1T26A 1MC4A 3CZMA 3I9OA 2J3JA 3DONA 3Q1LA 3ETEA 1U7HA 3I4CA 5KKAA 1CIVA 2IODA 3GDFA 4BNVA 1YWGO 4NIMA 3FCOA 3ROKA 4CODB 1VRWA 3RU7A 3B1KA 3OA0A 1AHIA 3MTJA 1A4UA 4GWKA 2EKPA 3JYPA 5A3VA 2E6UX 2ZB7A 3D7LA 3UUWA 3DQPA 4CR7A 1D8AA 4XEHA 3DAGA 5KJ1A 1SO8A 2PGJA 3AWDA 4QFCA 2JJYA 3Q2KA 4HV4A 4FFPA 2PKRA 3WYBA 4GX0A 1Y7TA 3CMCO 3GA0A 1LSSA 4I5DA 3AM3A 1I33A 4UUNA 4WK6A 2RHCA 1L7EA 5JCJA 1T1RA 1FK8A 4YA6A 3CMMA 4PN3A 1AE1A 5HRUA 4BMVA 1X7HA 1Z82A 4GMGA 5A5EA 5DOZA 2DUUA 1HRDA 4PLPA 3SX2A 5GZ1A 3LC2O 2CD9A 4YJFB 4PLVA 1KY5A 3TOXA 1U1IA 3VKUA 1O5IA 4ZQBA 2G5CA 2X9VA 1P33A 3HDQA 3WX0A 3G0OA 2DAPA 3BMNA 2NU7A 1ULSA 5KIAA 1PJ2A 4R51A 3L07A 3RUAA 6ADHA 3F5QA 3UCFA 4FFMA 3WMXA 1P1HA 2HQ1A 3X2FA 4UVHA 5C7OO 4IGFA 1PJLA 3O8QB 1WDKA 2EJWA 3PEFA 1C3VA 2B69A 4J7UA 1X14A 2Z95A 3AOEC 5L95A 4MOWA 2P2SA 1EQ2A 4LN1A 3ROMA 1OBFO 3GEDA 2VWGA 4CQMB 4QT0A 4CMGA 1AXEA 1F14A 1K89A 5EQDA 4D44A 4CMIB 3WWYA 3JV7A 2QW8A 2OUIA 5EMHA 1UJMA 3Q9NA 2ZB3A 2QZZA 4BV9A 4AJHA 1N92A 1LDNA 3QVTA 4E6PA 4J91A 1PL6A 4LRSB 3VH3A 3PGXA 4CQMA 1S6YA 2Y68A 4BNJA 1SEPA 3W8FA 3TFOA 1TLTA 4D79A 1QSGA 2C29D 3CIFA 1MGOA 3PHLA 1ZBQA 1KC1A 1KEVA 3VPXA 1EK6A 4KUHA 3ANNA 3A06A 5CHEA 2GZ1A 1GR0A 3PFFA 4IZHA 3PJGA 3ZWAA 3S55A 5KNLA 4WCFA 3AM5A 4A26A 5K6AA 5DDIP 2JL1A 3FN4A 2WWRA 5DULA 3W4JA 4EUFA 9LDBA 2QG4A 4L76A 1J6UA 1DOHA 1GTMA 2BI8A 1GFSA 3V2GA 4DIFA 2J6IA 1LLQA 1KS9A 3GPIA 4IXTA 4OAQA 1F17A 3KHUA 3B1FA 3GUYA 4J49A 4PLGA 1VJTA 3TZHA 3UF0A 4BO1A 4D7AA 5ICSA 3RUFA 4W9NC 1LBEA 3L6EA 1HSZA 3RBVA 3DTTA 1E7SA 1EVIA 1OMOA 1RYEA 2XAAA 2DBRA 2D8AA 3BTSA 1BWSA 5L51A 4IZIA 1OC2A 3GNTA 3QJ5A 3JQEA 2UAGA 1I0ZA 4YPOA 2WTBA 2V6MA 2HJRA 4MIYA 2W90A 3MCVA 4QO7A 4J3FA 4WCDA 1ML3A 3EVNA 1E1NA 5AXCA 3M1LA 4YYZA 2E49A 3IP1A 2Y1DA 4PRKA 2OXIA 3ITDA 4NBRA 4Z3KA 3ZCXA 1XKQA 3PQFA 1P3DA 2EGHA 3RC9A 2IZ0A 3WSWA 2VRCD 4RCVA 3Q3CA 3TRIA 1PS9A 3ZWCA 2SCUA 4AJPA 4HFMA 3WLEA 3ULKA 3WXBA 2YHIB 3GGPA 4CLDA 2D2IA 3GHYA 1YBVA 2JFGA 3C3XA 2H63A 1LQUA 1NR1A 4YAGA 5FWNA 3HDJA 3IJPA 4MDHA 3DZIA 2I3GA 2BF7A 2HLPA 2YYYA 1XQ1A 4KOAA 1M6HA 1LC3A 4DIBA 1FDUA 2AHRA 3PHJA 1EUCA 3L4SO 1ZSVA 2PZKA 3GAFA 5COAA 4M55A 4EGFA 3K96A 1XR3A 3KSUA 2WYUA 4NU6A 4OGWA 4FR5A 1BTOA 3K2EA 1ZNQO 4PZDA 2Y0EA 1MB4A 4RZIA 3WNQA 5IJZA 3E9MA 1B15A 4RPKA 3AM4A 4G5HA 4DC1A 4YRDA 3NGLA 4MKRA 4W4TA 2VZ8A 4PZEA 4GL4A 3PP8A 3QVSA 3WS7A 2EV9A 1LLDA 1C0PA 4XR4A 4IJUA 1UH5A 5G0SA 3D4NA 4CL3A 4MJLA 2O2YA 1PL8A 1YQXA 1NQ5A 2GASA 3GC6A 5I7FA 3KZVA 1YXMA 1DBVO 2P4QA 4YT8A 2BFOA 2UYYA 2JCYA 4E33A 1HYEA 4F3YA 4RORA 3UVEA 1N7HA 1JWBB 1ZK1A 5AXDA 4QXMA 5LDGA 1H6AA 3WJAA 2DPHA 4WEQA 3OJLA 1H94A 4L8VA 1N8KA 4E30A 2FR8A 1KVRA 1BG6A 3TL2A 9LDTA 1NPYA 1WZIA 1KVQA 1LC0A 1IB6A 1KVTA 1WLYA 5T64A 1Z6ZA 4KUGA 4GQAA 1F8FA 4FFOA 4S1VA 2Q2WA 2ZQZA 5DF1A 4CR6A 4NBWA 1CQIA 2C54A 1CERA 4BNYA 4TVOA 3VTFA 1KC3A 2HRBA 4IDGA 3MJVA 4WCFB 1H9BA 4U6QA 5TS3A 1F12A 2ZYAA 1UXGA 1BSVA 1ADBA 2I65A 2Z5LA 2ILTA 4J0EA 2CFCA 3HB5X 2FPGA 4MVJI 5JO9A 3OETA 2C20A 3TDKA 3ZW8A 2V7PA 2V6GA 2AQHA 5COBA 3AY3A 3P7MA 4BKPA 1E7QA 5T8KC 4P38A 1E1KA 3R0IA 1WMBA 2C7VA 2Y1CA 3ABIA 3F5SA 1L7DA 2X7HA 4OHUA 3EGOA 4KWHA 4RPHA 1ZJYA 4RF5A 1QYWA 2YFHA 3D3WA 4L4RA 2Y67A 2X8LA 4B7XA 2CF6A 5BSFA 2QIOA 3KYCB 3GZNB 5C5IA 3BXXA 5A9TA 1GCOA 1GYPA 1QLHA 3RC2A 1QG6A 5K9ZA 3BTVA 5DN9A 2RHRA 1RPNA 6LDHA 3BMCA 2VHYA 3NTRA 4FFNA 4CQLB 1PJ3A 2DVMA 3GVXA 3TZ6A 3KO8A 3WGIA 4L9RA 2VHZA 4DPKA 4JXKA 4TKLA 2IE0A 2PTGA 2GDZA 3CE6A 4K6CA 3OP4A 4QQRA 5KVSA 4E5KA 3QHAA 2R00C 2JD1A 4G65A 5JDCC 2JHFA 4N18A 5BSEA 1HTBA 3HE3A 4EEZA 1VM6A 1N5DA 3U0BA 3WB9A 1DIHA 4E4YA 4PCVA 1WAMA 4PVCA 4WLEA 4YAJA 2H1SA 2BLLA 4I8XA 2EW8A 2VUUA 4D3FA 1R66A 1A7AA 3MJ4A 1ONOA 1VPDA 2NVUB 5LCXA 4H15A 1SB9A 1H9AA 4IDCA 1Y8QB 4INAA 1W73A 1NAHA 8ADHA 4ONEA 4YCAA 5EN4A 4LVCA 4YAKA 3ZHYA 5MDHA 4KDEA 2J5KA 5AXAA 5JCXA 1PS0A 1AGNA 1NHGA 2AA3A 3VZPA 4Z0TA 2HCTA 4RPJA 4J2HA 1FXSA 3D0OA 2CDBA 5I7VA 4DIOA 1E92A 1GY8A 3JYOA 1HXHA 1DJNA 4LCJA 3ON5A 3IC5A 1QP8A 2DKNA 1N7GA 2PY6A 1IHXA 3FWZA 3HWRA 4QTZA 1FDWA 4R5MA 4ZD6A 4XYLA 2VTEA 2ZIZA 3QVOA 3B70A 1OFGA 1WDMA 2B0JA 2PH5A 4RF4A 3AUSA 4IJKA 1HE2A 1PQPA 3JQ6A 1DFGA 1SMKA 4WKGA 2B37A 1GL3A 3QRWA 3TPCA 3HDYA 3P2YA 4PLYA 4JGBA 3WSVA 5I7SA 4WPGA 5TC4A 2AE1A 4ZA2A 3EDMA 3KRTA 1K6XA 3V1UA 3O26A 2FY8A 3WBBA 4XD2A 2W4QA 1C14A 4UUPA 1MXFA 2IEDA 1UAYA 3G79A 2IYOA 1NR7A 1IOLA 5ICMA 4R3WA 4LW8A 1LDYA 2YDYA 1LRLA 4BNKA 3U09A 5F5NA 2I76A 1YL6A 1ULUA 4RO0A 3F47A 3PLRA 2WD7B 3A28A 2Q1WA 5A9RA 4II2A 3ETGA 4CQMD 1DIRA 3H2SA 2CVZA 4NBUA 5HWSA 4LSWA 2LDXA 1I8TA 3FSRA 5TNXA 3C8MA 4J4TA 4KDFA 3DFUA 3ZWMA 3RFTA 2GF2A 1LRKA 5HM8A 4JJIA 4B3JA 3G17A 5H83A 1PQUA 2DBZA 3H9JA 4O0LA 3ZNNA 3G49A 2ZK7A 1P0FA 2DFVA 1MG0A 1KEPA 1U9JA 5A5FA 4YQZA 5CDSA 1GCUA 3QVXA 1E3WA 4M87A 3BMQA 2GERA 5THKA 4LISA 5FYDA 2DTXA 1BVRA 1D1SA 1NASA 1LDEA 1X15A 1LJ8A 4EDFA 5KCZA 2GN8A 2OMEA 1QRRA 3ZWXA 3FNEA 1Y1PA 1QMGA 2HRZA 2B83A 4JNKA 2FP4A 4E5NA 1GZ3A 2O3SA 3DO5A 4IUYA 2V6BA 1Y81A 1EUZA 4Q3EA 4ZU3A 5H81A 4MIOA 2ZCVA 4ND4A 4BNXA 2O7QA 3D3WB 4E31A 3GHHA 4CLOB 1O89A 2DLDA 5IN4A 1OI7A 3GVPA 3K2BA 4QECA 4XRRA 5CFZA 1C0IA 1I30A 1R0LA 2QZ9A 3IDSA 3FBTA 3CEAA 3EMKA 4BO6A 3FPCA 2CUKA 1DJQA 5IAAA 5JAQA 5JAIA 4EUEA 3S1LA 2XXBA 4TZKA 4F45A 4MVJD 2IZ1A 2YQ4A 3DOCA 4N7RA 4XCVA 3C7CB 1HLPA 5BSGA 3ROPA 2YQ5A 2GN4A 4Z9XA 4YWJA 4B7CA 1N9GA 3DZJA 1JKIA 4IDAA 4WUVA 3C7AA 1WVGA 2XXJA 3UOGA 2X9GA 4WLNA 4XQGA 2ZYDA 2CDCA 3DBRA 4PLTA 4CPDA 2VWQA 1D7OA 3WGHA 3WIEA 5TIIA 1EDZA 3JQ7B 1O9BA 3E9QA 4J9VA 1E0DA 1VLLA 1EZ4A 2BGLA 1DC3A 1ENPA 4DYVA 3UFXA 1YDWA 1VI2A 1PJBA 1YRLA 2QHXA 4HKTA 4Z9YA 3WGQA 3BHMA 3NGXA 3SLKA 4D3SA 4QFDA 4J7XA 2YJZA 4M49A 5G0TA 3U5TA 1B8UA 2A94A 1LRJA 4HWKA 4EI2A 4HFRA 3LK7A 3PDUA 4RZHA 3PYMA 5IDWA 4I9UA 3I5MA 3G3EA 4BO3A 4XA8A 3B1JA 1U8XX 3WFJA 4IDEA 3O9ZA 4GSLA 5A04A 4FN4A 3DBVO 5JE8A 3ZV4A 4E2YA 1EQUA 1RM0A 2PNFA 4GPD1 1A9ZA 2ZTMA 2C2YA 1BW9B 3AJRA 4W9NA 5GMOA 3I9LA 4J9UE 4ZVVA 3AK4A 3PZRA 5TSDA 1H6DA 3C1OA 1V9LA 2FWMX 3NV9A 1DIAA 1H2BA 2HMWA 1I2CA 3JD4A 3IIEA 1HYGA 3R3SA 3HN7A 2DC1A 3JYQA 2HUNA 5EJ2A 1WZEA 5JPIA 3A1NA 4NK4A 1SCUA 2ZQYA 2AQKA 1IPFA 1GQYA 3KLPX 3ZI0A 2AEMA 3L4BC 1NWHA 3T7EA 4XRGA 3LF1A 3L77A 3W8DA 4XQCA 2OOSA 2X23A 4JLWA 4W7HA 2C7GA 3VH2A 1R4NB 1QV7A 4PFJA 1NM5A 4JQCA 1QLJA 2YHIA 1VKOA 1D3AA 2O3JA 2Q1UA 3JSAA 4Q3CA 2HK9A 3UAGA 3VVBA 4CM1A 1PZGA 1ZXBA 3OF2A 3QLJA 1YDEA 3DOOA 1F8GA 5DZSA 5CEEA 5C37A 5IDQA 3C24A 5L9AA 2EKQA 3GH3A 4K6FA 4BNUA 4UVDA 4DLLA 3KBOA 1ZKMA 4XQEA 2BH9A 1ZMOA 3H2ZA 1C1DB 3RCBA 1Y9EA 1NBOA 1RJWA 1VL6A 4ZQFA 3GDGA 4RDHA 1GZ6A 1IL0A 1Z7BA 1MFZA 1HE3A 3IUSA 4RF3A 4NJMA 4Q9NA 1DSSG 1NFQA 4R54A 4URFA 3RUEA 5ER6A 4R01A 2IZZA 4W7IA 4HNGA 1HDXA 2PLAA 4N5NA 4P4NA 4J0FA 4GH5A 1UP4A 2RH8A 4CM3A 2E4AA 2JFHA 4E13A 1JDJA 3Q9UA 4U8GA 2GN6A 2BFAA 4J1TA 1A72A 4CV2A 3IL2A 4GX1A 4MO2A 3E18A 4ZGWA 5IF3A 3GN2A 4WLFA 3I9KA 1QORA 5BNFA 5TX7A 1E3WB 1X1EA 2FN7A 4HNHA 1NFRA 2TMDA 3JD2A 2HK8A 1E3LA 1KVUA 4JJGA 3MZ0A 1HZJA 1NVGA 3SC6A 2XPCA 3QWIA 3U4IA 3O4RA 1UAGA 3I4FA 2EP7A 1M66A 2DTDA 2UVDA 4NH4A 4OQZA 4Q39A 1YONA 2LDBA 3PQDA 5JMWA 5JS6A 3RBZA 1T2EA 1W6UA 4FSHA 1E7YA 1HL3A 5TLSA 3H5NA 4RLSA 1N1GA 1ZSYA 4GLOA 5BT9A 5B4VA 3NUGA 5JO0A 4XKJA 4Y6RA 1HYHA 3JQ8A 2Y66A 3JQ9C 2VYVA 5TT1A 3PWSA 5CG2A 1XEAA 3BA1A 1YB4A 4EJ0A 2EKLA 2BELA 2Y1OA 2X0JA 2VQ3A 2ZCUA 4IPTA 3DC2A 1B3BA 4RVSA 4JN6B 1UXIA 1YE3A 4DL9A 5C7IO 3GRKA 5IXSA 3QWAA 5EL0A 1PEDA 4B3HA 4G81A 4DGSA 1JVSA 2ZTLA 2O48X 4B79A 1GEGA 4B8ZA 2GRAA 2BKAA 1PGJA 4TVBA 3N58A 2C59A 5I9MA 4K28A 5F21A 5L4LA 3NYWA 3FR7A 1YOVA 3BHIA 3DMTC 3AU8A 2Q1SA 2Y0CA 1AXGA 1DIBA 4Z3DA 3K30A 2E48A 1V8BA 3JQDA 1I3NA 3ICPA 4OKNA 4OYRA 1XGKA 1UXHA 2PK3A 3HSKA 4YAIA 1Z73A 2EIHA 1DAPA 1O0SA 1T2AA 2VOEA 1W4ZA 2X4GA 3OA2A 4UVIA 3W4KA 5T67A 2RCYA 1LQTA 2FMUA 3HB4X 5CDGA 4CV1A 4EW6A 1PL7A 5JC1A 1E7MA 1A4IA 2CMDA 2OP1A 2VNSA 5G4LA 3OIGA 4JBGA 2HMUA 3LDHA 3V2HA 4HP8A 4BV8A 5EESA 1MFPA 3BMNB 3HNPA 4P22A 1B0AA 5IDXA 3W8EA 4PLZA 3STHA 4IM7A 3FTNA 4JP3A 1KETA 3JQFC 4ID9A 5JY1A 4RVUA 3JQAB 1LUAA 1DEHA 2G17A 2PV7A 4RGBA 4GGOA 1ZUD1 4M86A 1UXJA 2J3HA 4CLXA 1O94A 3GOHA 2Y1FA 2D59A 1XLTA 5FFFA 5JCJD 1T24A 3GFGA 1N1EA 2BFPA 1PTJA 4J1SA 4OSOA 3F4BA 2HDHA 5ENVA 3HADA 3N7UA 3GPDG 2X5JO 4CMIA 3BMOB 4DMMA 8LDHA 4WECA 5I9NA 5B4TA 5HS4A 1EE9A 2VYNA 1NVMB 2QX7A 3TOZA 4BOYA 2HO5A 1B2LA 4B3IA 4XJSA 2YUTA 1E6UA 3CH6A 3N74A 2X22A 5ENDA 3VC7A 3MOGA 4PZCA 1EFLA 5U1PA 2WJPA 3PK0A 1P45A 2DFDA 1UUFA 2CF5A 2QYTA 5DCYA 4A0SA 3S8MA 3ZWVA 1YVEI 4EUHA 1LEHA 3R6DA 1Z7EA 1ZK4A 5IZCA 3Q11A 4J6FA 1EDOA 5L4SA 4BMNA 5EERA 4KTTE 5LC1A 1H0KA 2FOIA 4MVJE 4R1SA 3E1KA 3RSHA 1M67A 4A03A 3DXFA 3WYCA 3LZ6A 5HS6A 1XSEA 2JD2A 1FF9A 2VT2A 1YBAA 3K5PA 4ZQEA 1B8PA 4LVUA 4P4GA 1KYQA 4OXKA 2IDZA 3IUPA 2B4RO 2HK7A 1I10A 4Q3DA 3SVTA 1NXQA 3TQHA 3LLVA 3GUCA 2A4KA 4WLVA 1NNUA 4XIYA 5GZ3A 3FR8A 4Y6SA 5KWEA 2CNBA 2G0TA 1MXHA 2P9EA 1U5AA 3GF4A 4R69A 1B26A 5L7YA 4BGIA 2AG8A 3W6ZA 5G4KA 1FDVA 4NR0A 3QW2A 1PGNA 1QYCA 1IZ0A 4GKBA 1HDYA 2O3RA 4Q3AA 2EG9A 4LMPA 4ZHSA 1B16A 2G82A 3BMQB 2D5AA 4K26A 1KVSA 3JQ9A 3QWBA 1QXSA 4IJWA 1YGYA 3ZGYA 1PX0A 5I9LA 4GX2A 5KTKA 1PJ4A 4FFRA 4TRJA 3E5RA 1QKIA 4RVHA 3IQDB 1T2CA 3DBLB 5A02A 3MEQA 5T8KA 3WGYA 1TXGA 3H9UA 3E03A 5JLAA 4PVDA 4X54A 3WGGA 1NVTA 1HE5A 4RJTA 3WGTA 1D1TA 3ST7A 3LYLA 4YJHB 1TT5A 1I3LA 2B35A 1WDLA 2FHSA 4J4HA 1Y6JA 1P1KA 1KEUA 3ZWOA 1Y8QA 5B37A 1ZVMA 4PRLA 4AFNA 1HE4A 1Y9AA 3BTUA 2I3AA 1BDBA 4E2ZA 1E5LA 1EFKA 3L4BA 1X13A 2NTNA 4Q3BA 5A03A 1GAEO 3S2GA 3ZHXA 4ALMA 4WNCA 5L40A 3RIHA 5G0VA 3GDOA 4TRRA 4H3VA 4TSKA 3EK2A 1UXKA 3GMDA 3H5AA 1GPDG 1JW9B 1KEWA 3PQEA 5F1KA 4BNNA 5HTOA 3ZW9A 4Z6KA 1M75A 1YKFA 2OZPA 3CTMA 4IIUA 2UV8A 2CVOA 4PLFA 3RKRA 4UEKA 2HJSA 4CMKA 3VH1A 4EYEA 5DBGA 1ISGA 4IXWA 1EK5A 3MJSA 1WNTA 3PJDA 4BKOA 4C4OA 2D0IA 1IYZA 2GSDA 4RL6A 4GBJA 3IMFA 4C7KA 4BNTA 5L4NA 1QYVA 5JC8A 1TVEA 3IKTA 4HFJA 2BFMA 3UICA 3LU1A 3HUDA 1R4MB 3MJCA 4GKVA 2WYVA 4WOKA 3IP3A 4ZRMA 1I24A 1SEVA 1SOWA 3H6KA 3ZNOA 2UDPA 3OJOA 4YT4A 2WEKA 4DC0A 3HQ4O 4AJIA 3ADOA 4Y9DA 2NU9A 1CWUA 3SLGA 4NNJA 1DO8A 3KEQA 1GQQA 5T6BA 2WD7A 4UUOA 1YBMA 4E5PA 3JQAA 3AI1A 1LTHR 5B12A 4OM8A 3U9LA 1XELA 3KTDA 3LVFO 3RI3A 5JYEA 2P68A 4HY3A 4DQXA 2VRCA 1ZCJA 1R37A 2I99A 1YJ8A 3WWZA 4IQ8A 3AW9A 1U7TA 3D5TA 3FHLA 3NJ8A 3DDNA 3I23A 4R1TA 2F1KA 3TF5A 2AEFA 3AI3A 1Q0LA 2X1HA 5BR7A 2GUGA 1RM5A 4AJ1A 3U62A 3DBHA 3GT0A 3QP9A 1HF3A 2X58A 3OJEA 1RYDA 3GY0A 3ORFA 1U5CA 3ONEA 1NX6A 4KMSA 4YB8A 1ZIDA 3D1LA 2BGMA 2DT5A 3PVZA 1P1IA 3LLSA 1NPTO 2NTJA 3I83A 2VNAA 3DBHB 4WLOA 3NTQA 5B4UA 3W4IA 4LCEA 1J49A 1LSOA 1MA0A 1TEHA 3D4OA 3LT0A 1X0VA 3H65A 1BGVA 1EVZA 1SZJG 5A1TA 2C07A 3PWKA 3QSGA 1ISHA 4BB6A 1OC4A 4JROA 4EEXA 3LC7O 4MKXA 1B14A 1SNYA 2PZMA 2Q50A 3GZNA 1T2DA 3INGA 4R41A 1E3JA 4YTEA 5KJEA 3WICA 3BMOA 2NSDA 5IG2A 5JDIC 4HADA 4NBTA 2NVUA 1HZZA 3GEGA 3NT5A 1ENOA 4E2XA 4PLHA 4CR8A 3O03A 3VPGA 3AFNA 1PZFA 3IS3A 3F46A 1ID1A 2EF1A 5F5LA 4FD3A 3WGZA 4NFSA 4FC6A 2VTDA 3U4HA 5TRTA 2UUPA 2VOJA 5DBIA 2W2LA 5T5QA 3HFSA 4TQGA 3DZFA 4QUKA 3D64A 2AG5A 3Q2IA 4LMRA 3ZU5A 1I3KA 2CVQA 3KYDB 3OM9A 4BGVA 3KV3O 3QWFA 1JN0A 2AQ8A 3ZV5A 1GUYA 2PA3A 5DP1A 3OMLA 2GYYA 2C0CA 3H7AA 3JQGA 4YJDA 3DWFA 1J5PA 2YW9A 3JD0A 3RUHA 4M89A 3WLFA 2DM6A 3FNGA 2CY0A 1RM4A 1Z45A 2W98A 4G2NA 4P8RA 3KM0A 3EC7A 4BKQA 4BL5A 2AW5A 5DCWA 5AQ1A 2JCVA 2O23A 5ITVA 2NTVA 4ITUA 1K5HA 4EITA 4EZBA 1YQDA 4DQVA 4A2CA 4OMUA 4RVGA 5EIOA 2AMFA 3I9JA 4R16A 2BGKA 1GV0A 1LLUA 2IXBA 4W82A 4OXNA 5I8ZA 4NMHA 3ICCA 4TRMA 2NACA 4UVGA 3ZV6A 5CG1A 1V3TA 2IEBA 4MVJG 4WJZA 3L0DA 2WMDA 1WWKA 3OJ0A 4NJOA 3TZCA 3I9NA 4NZ9A 4BO4A 4WOJA 1W0CA 3L9WA 3NTOA 1MC5A 1P31A 4O5OA 4BQPA 3QVWA 2HMSA 3ZNPA 2HMVA 2GLXA 4OJNA 2PFGA 4BKRA 2Y1EA 3K9QO 3ZWPA 5CP8A 4J1NA 1GEEA 2HMTA 4CM4B 4XGKA 4WNIA 4FS3A 3K73O 2X86A 1LI4A 3GRPA 1GZ4A 2Q45A 4H7PA 1PGQA 5U9CA 4J16A 4ALKA 2Q4EA 3GZ4A 1PU2A 4FOSA 1ISMA 4W99A 4GWGA 1HKUA 4FBGA 2PKQO 4AJEA 2OBNA 2VRBA 5AOVA 3RWBA 1PZHA 3WFIA 3R1IA 3S2EA 3PRJA 2E37A 5A05A 4E32A 1NQAO 2WSBA 1M2WA 3ADPA 5DOVA 3A14A 2VYND 4KTVE 4ALIA 1JLLA 4OXYA 1GYQA 5L3ZA 1E3IA 2GZ2A 3M2TA 4I5FA 4TMFA 2FRDA 1NWCA 5F1PA 4XYEA 2GD1O 3JQ8B 3ONFA 3TN7A 5IZCC 1FMCA 5CDYA 5JDCA 3HG7A 4JBIA 5DCUA 1AHHA 2EEZA 4MP3A 5IZ4A 1PGOA 5ITWA 1YO6A 2OO5A 5CEJA 1NTOA 2AE2A 3KETA 1KIFA 3PJFA 3G1TA 1JA9A 3HN2A 3B6ZA 5A9SB 4MVJP 3IAHA 5FF9A 1DC6A 2ZKLA 1TI7A 4YBZA 1PJTA 3SJ7A 3ANMA 2P5YA 1UDBA 1KERA 1DC5A 4NK5A 2JFFA 4NDNE 2Q46A 2R6JA 3JQ7A 4CMAA 3F6YA 1NQTA 2JAPA 4B4OA 4QO8A 4NHEA 2Q4BA 4FPXA 4Z9FA 4MVJM 1KOLA 4CL8A 2DPGA 4KUEA 1YL5A 2WD8A 3D3EA 1G1AA 4ROSA 4LGVA 3EYWA 3LT2A 3V8BA 3CPSA 4I1IA 2GPTA 4K9DA 1H5QA 4Y6PA 5I8WA 3F4LA 4XYMA 2ZATA 4KQWA 3V5NA 2ZB8A 4ND2A 4J2OA 1CJCA 1R16A 2P9CA 1VKNA 3FTPA 3JQGB 1R0SA 3QV1A 1EMDA 4XDZA 2R00A 3P2OA 4AG3A 1M76A 1DDOA 2Q99A 1BXKA 3EW7A 2J5RA 2C5AA 1DLJA 2NQTA 3EY4A 1NAIA 2EERA 2I6TA 3IJRA 3CKYA 4RVFA 4BHTA 5T57A 3TNLA 5EINA 3JYLA 5G0WA 3H3FA 4DA9A 3AY7A 1IY8A 4AJ4A 4U6SA 4PGFA 3RJ9A 4ALLA 5JAZA 1IPEA 2GNAA 1LX6A 4BO5A 1LLCA 4N5MA 2P5UA 2JHGA 5CDUA 1SPXA 2V6FA 4D0SA 1R4NA 1T25A 3OBBA 1HWYA 3DMTA 3V1TC 1HDCA 1E1MA 3GNQA 4BO7A 1DRVA 2OORA 2EXXA 2X0NA 3DZKA 3U49A 4DVJA 2DBQA 1RM3A 1KBZA 1Q7BA 3MTGA 3NDIA 3T4XA 3R3JA 2GO1A 4Y8VA 1GU7A 3VZQA 4IY1A 2VZ0A 4PLCA 2I9PA 2X5KO 3KSDO 3MWDB 4AJJA 1P44A 1PS8A 4D45A 5AVOA 4PG5A 3M6IA 2PWZA 3NKLA 2NVBA 2X9NA 3RC7A 1EE2A 1XHLA 4R68A 4WEOA 3BMCB 1Q7CA 1DLIA 5G0UA 4XWYA 1DHTA 1GYRA 1LSUA 5C3MA 4XYBA 3PXXA 3GG2A 1PGPA 3OIFA 4J7CA 3ZU4A 1U2DA 5KVCA 2ZYGA 1R0KA 1VL8A 2PD3A 1DHRA 3H4VA 3KYDA 3NT2A 3OQBA 1ZEMA 3O8QA 3ZZNA 1UDCA 3LT1A 2VHWA 2ZJ1A 5MGBA 4BVAA 1C1DA 1DRWA 3ASUA 4I08A 4HXYA 3B20A 4CLHA 7MDHA 2Z1NA 4WE3A 1V0JA 1J4AA 4RF2A 5TJ9A 1HT0A 2P91A 4L74A 3BIOA 4MVJF 3WDSA 4AJNA 4D41A 1PWZA 5DNAA 1YL7A 3NX4A 4IMRA 4DREA 1OZAA 3MWEB 4KWIA 2AXQA 1XU7A 3H9QA 1PR3A 1AN9A 2D5CA 4FGSA 3H5RA 1SAYA 5ES3A 4E3ZA 2ZTVA 3PIIA 2WE8A 3KEOA 3BTOA 3ONDA 1P9LA 4IS2A 2EWMA 4YJHA 1V3UA 3PWZA 3H9GA 1ISFA 1PSDA 2NU6A 1F0YA 3E6AA 2FR0A 3PHGA 5FI3A 1X7DA 1MP0A 4NBVA 3ENNA 5BQFA 5JDIA 3SXPA 2FPPA 2YY7A 1U4SA 4MKZA 3AUTA 2WYWA 4OOFA 4GLLA 1N2SA 2VT3A 2XF8A 3DL2A 4L4XA 4CLRB 2AEJA 2EW2A 4B7UA 4BB5A 1ENZA 1C0KA 4N54A 4XB1A 4AVYA 1DPGA 1XG5A 4OQYA 2O7SA 1ONNA 2VCYA 2X6TA 3G1UA 4J90A 2WDZA 4CMHA 4YT2A 1JAXA 2AQIA 3FF4A 1SOVA 5GZ6A 4ZN6A 3ENKA 3I6QA 3RROA 3ITKA 3WYEA 3GQVA 5H82A 3RUIA 1F06A 3VAZA 1KY4A 4AJKA 3OECA 5L45A 3WTBA 4OH1A 1CRWG 3HDHA 3RKUA 4BO9A 1A7KA 1AUPA 1Y5MA 1ZSNA 2PGDA 2B4TO 4BUCA 4M8SA 3GEMA 3MOIA 4D43A 4I5GA 3F9IA 2BD0A 4IIVA 1Y8RA 5F3RA 1MLDA 1OAAA 1I32A 5FEUA 3UH1A 4IDBA 3V1YA 3EUWA 2Y93A 5DBFA 2IRWA 2EP5A 4MINA 2FR1A 4XX0A 2B36A 3DZGA 2QYSA 4FIZA 5AXBA 3KLMX 4EJMA 2OP0A 3DMYA 4CM8B 1WP4A 2ZB4A 1WXDA 3PYXA 4YRAA 2Y0DA 3WOHA 3VHRA 4L75A 3IKVA 1K0UA 4DWVA 1GQ2A 3VZSA 3VOSA 3DHYA 5CAEA 4DBZA 4XQ9A 5L53A 2FZWA 1TB4A 4K1LA 1ZJZA 1IUKA 3P5SA 4PIVA 1BHSA 2PZJA 3W1VA 3F3SA 1GUFA 3PLNA 3D5QA 3SEFA 1MUUA 1ZW1A 1EBFA 1E3EA 2EGGA 7ADHA 1UP6A 3I6IA 4JIGA 4CLOA 1TA4A 3I1JA 4HBGA 3ETDA 1T4BA 5EQFA 1EVYA 3KSZO 5ILOA 4UEOA 4A7PA 2VWHA 2JKVA 1GADO 1T1SA 3ZHBA 3GNSA 1Q0HA 3VDRA 1CETA 4YR9A 1YQGA 1H6BA 1VE9A 4Y67A 3OJFA 2YZ7A 1K6JA 1WW8A 2Q2QA 1CF2O 1HDZA 1P1FA 2D4AA 2W2KA 2NUAA 3FPLA 2I67A 1FJHA 3RFXA 1Q7GA 4DUPA 3GVHA 4DRYA 3MJTA 4IDDA 5DP2A 1GD1O 4MP6A 4R5HA 1PJSA 1LDMA 2GGSA 4BKUA 5JMPA 1B3RA 3PGJA 4BIIA 3EVTA 1U3VA 4B4WA 3NJ4A 1DB3A 2PZLA 1GUZA 1ZK0A 5IN5A 4CMJA 2GZ3A 4LSMA 1Z75A 4YXFA 5I7EA 1O8CA 1VC2A 3OHSX 1D4FA 1CEQA 1GDHA 2FSSA 2R2GA 3O38A 3AOEA 3U3XA 3VZRA 3JQCA 4W6ZA 4R3NA 4Z0HO 1JAYA 1XYGA 1BMDA 3WBFA 2NV6A 2J5QA 2NLOA 4Y98A 3TSCA 3RUCA 1O95A 5FI5A 1E77A 2PH3A 4IQ0A 1UR5A 3JTMA 3T7CA 3E9NA 3WQSB 1Y8RB 3GVIA 3ZWYA 4C7JA 3PIDA 4NQZA 5KKCA 1PR9A 4IBOA 4L0QA 4JP2A 4BNMA 4BNLA 5A4DA 1LSJA 1ENYA 4R4JA 3JYNA 1R15A 1BXGB 3TJRA 1E5QA 1HDGO 4II3A 5J23A 2HSDA 3CZRA 3DR3A 3KOUA 2BI7A 1HETA 1ZXLA 3HFGA 4HX5A 1EBUA 4N5LA 3W6UA 1I01A 4U7WA 3DAPA 1WMAA 4MVJH 4H16A 4UEJA 5JY6A 4TKMA 1MG5A 3RU9A 2O3TA 1X1TA 3DEYX 3TWOA 1C1XA 3WTCA 2ET6A 3LQFA 4ND1A 3DOJA 3K6JA 4A73A 3Q6IA 3VDQA 2RBEA 1ORRA 4JX8A 1DC4A 1SBYA 3BYZA 5LDHA 2QRLA 3V2UA 3E8XA 4JBHA 4NJMB 3RAJA 3GGGA 3DHEA 4HUJA 2VYVD 4NPCA 4GI2A 4EBFA 2X0IA 4D46A 4U5QA 1QYDA 5JAMA 5KOIA 3WG9A 1XWFA 1I3MA 4OOEA 1U4OA 2O3QA 2A35A 5CPBA 3UKOA 4UVEA 3ROQA 1P1RA 3I3OA 3DAFA 3HJAA 1O6ZA 2NNLD 1NYTA 3RVDA 3JQAD 3PYLA 3QWHA 4IJVA 1YJQA 2JAHA 3QIVA 3QQPA 4TZTA 3JQFA 1DFHA 1FDTA 4PLWA 1IE3A 4D3DA 2G1UA 1JTVA 4OL9A 4BNZA 1I36A 4AL4A 2CDAA 3BZUA 1HSOA 3AY6A 4BO0A 4TRNA 1DAOA 2DTEA 4DPLA 3NT4A 3RC1A 1JQBA 3KXDA 3PDJA 4GAEA 4DBVO 4CM4A 5JSFA 3TZKA 1A71A 1GPJA 3HHPA 3BHJA 4XYGA 3UN1A 4CM7A 1YB5A 5JXWA 3COSA 2JD0A 3ZWBA
chains in the Genus database with same CATH superfamily
3PEVA 2CBGA 4B73A 5KJ6A 4MGZR 4DR5B 3T3OA 1U8AA 1ZH8A 3RK4A 4PICA 1MX3A 3QFHA 4FMPA 3SIXA 3UMFA 3UAVA 5DFAA 2QPAA 5BURA 5HRAA 2OEPA 1ZWKA 2C4HA 4I9NA 5TF4A 5EQTA 2OLEA 3EXHC 1WXHA 1QGYA 3OD5A 3QF4B 4EHBA 5IAKA 4L6AA 1CZLA 2QU7A 1PWXA 2O2HA 4LOLA 1YFKA 1ODJA 4YJGA 3UCEA 1Z2OX 4IO1A 2Y05A 4RFSA 5KTYA 5JW6A 3P9QA 5AHRA 5IFLA 1PX2A 4HWRA 4F2WA 4TUYA 1TW3A 3NDBB 3GAAA 4J07A 2NOAA 5B58C 6REQA 1PG2A 3EHDA 1YB1A 2EL9A 1J56A 1VJ1A 4J16C 5D85A 4A0HA 4F2GA 5K0SA 2B1GA 5AM5A 3TSWA 3T12A 1DAGA 5AK0A 4KIUA 5TQVA 3RB8A 2XZLA 2V5AA 4G8DA 1LBHA 2CZCA 5KSPA 1QYXA 1EFPA 1BXGA 1KK3A 2HKIA 5F76A 3H8WA 1QR6A 5F35A 2ZDQA 1E1CA 4E21A 5CT8A 4Q4AB 1CDOA 3A6HA 1DXYA 3GMSA 4G1CA 3ZX5A 1G59A 2PMFA 5LP6B 2W83A 2D3TA 1YOVB 4JT9A 5F7JA 3BFPA 4JUBA 2F3UA 4Q19A 1EVJA 4RLHA 2COEA 3LP5A 5D1NA 4UNRA 3BD7A 1NNEA 3EE6A 1YS7A 2YBDA 3QSYA 5BWCA 1IXSB 1SG0A 4QPNA 2I2XB 1Q6YA 3G7NA 4BJ5A 1E6EA 5JS8A 2JJ1A 3PUKA 4UREA 1NJ6A 3K0BA 2E4WA 3BE5A 4X1KB 3HR7A 1MKYA 3ZWWA 2HLDD 5GADl 1V6AA 3CEJA 4WI1A 2ZT8A 4OSPA 2RIPA 3FI9A 4FGWA 3JZMA 3FTQA 4W9RA 3TG2A 1OLSB 2I66A 4BNHA 3EVBA 3ZVRA 3QPUA 3Q2OA 2J0UA 3FIJA 3IJEB 5LQNA 1PFUA 3NDRA 2Q2VA 4S1TA 1ILEA 3JCZA 2R47A 3U48A 3O4FA 4Y0VA 3SZGA 5A3JA 1T6ZA 1SZCA 2WFLB 3DL4A 5CB6A 4BNGA 4U9UA 2NT4A 3PZBA 4UEQA 3P2KA 3KHKA 3DD5A 3TDNA 2WP8J 2FPIA 3FY4A 3H83A 4B5LA 1NIPA 1W8DA 1E98A 2CCGA 1JKMA 5DTIA 4AJ9A 4XWOA 2Q0HA 3K92A 1J8YF 1BEEA 2ACVA 2BFEA 2H92A 4OU5A 4GSKA 4B4UA 1RHMA 3JQBA 4LHZA 3ZNQA 1WB9A 4RELA 1W5AA 2AWOA 5EXXA 2IBSA 1S4QA 3K2QA 1RQLA 2FZLA 1E7WA 3F4KA 4KDCA 4DA7A 2Q7OE 3F8WA 1K7EB 2XOKD 3I01M 2CMKA 4D6YA 2Z3ZA 1FX1A 4BS9A 2HLHA 5EIBC 4D0RA 3JZDA 3MSXA 3GEIA 3T9AA 2NQ8A 3TIIA 5IT9A 1MO6A 1ZRMA 1R9NA 4HGRA 3TOVA 1G20A 3OEYA 4XGNA 2BMAA 1NM5C 1U7UA 1V39A 1X8LA 1UBSB 2C4KA 2PWPA 3KU1A 4F5ZA 2FPMA 1KQPA 3CYFA 4HAZA 1JR2A 2NPIA 3NTUA 5F2KA 1E3TA 1KNXA 3MAGA 1UIRA 2OVFA 3CB2A 3QKTA 5CXQA 4F4CA 2A5LA 4F9FA 3C6BA 1I2ZA 2JZOA 3JATB 2FSVA 2H9IA 4LJ5A 3ZWNA 2HBRA 5SICE 3R9KA 3II6X 4ATNA 2EFYA 4R0MA 2E4VA 1UZMA 3A9UA 3JWIA 4ZDKA 3RHSA 1I5RA 1P0PA 3AOGA 3SQNA 3ZH2A 1DOZA 2JHAA 1GRRA 3WK9A 3VZCA 2BT4A 2QE6A 3EZLA 1JFTA 3MYYA 2LV8A 3DW1X 3LUDA 4JBXA 4OM7A 2WM2A 3T9BA 5AJTA 3W1EA 1IHYA 1P0MA 2WU3A 4G0WA 5D01A 5KOJA 2CSUA 2OYSA 3E1GA 2OGUA 4A0RA 3ZQUA 4UXHA 4U0JA 1RCTE 2BDEA 1KY3A 1BXRA 4RTJA 2ZE6A 5ER9A 5FXMA 5K6AC 2IUYA 1PJCA 5BQOA 2O8CB 3ND7A 4UKDA 2O3UA 4LJ7A 2VUSA 2BEUB 1V3VA 3B36A 3GEHA 5DWDA 1A5AB 2CUZA 3QXCA 2ZSIA 2QAGA 4YEDA 2DU8A 5A3SA 2RIRA 3ZHZA 5FR1A 3G59A 2XNKA 4BQRA 3IOYA 3VR4A 2PXCA 3E82A 4HNSA 2JASA 3LUBA 1ADFA 3DTVB 1DQNA 3MD9A 3GJ3A 4NS1A 4OMDA 3VO8A 1I4TD 4E46A 1FVHA 2PKYX 1V43A 1K9VF 2WAXA 1XBTA 3GP5A 1E0JA 3K5IA 5TT0A 2JJ2D 1C7ZA 2H9AA 2IUSA 3MJRA 3GI1A 1OZFA 4P81A 3HZHA 5AKIA 4CUZA 2JBWA 3LSYA 4UPEA 1TJ3A 2GK7A 3TM4A 2JI9A 1A9RA 2H2HA 1M6YA 3E27A 4LPSA 4PQYA 3IKTA 1S89A 1ZGZA 4HJXA 1BCSA 4XR9A 4D9JA 4QAQA 2CBZA 3EMVA 4LJ4A 4ZRNA 1XPRA 2GJ9A 2JLAA 1E0AA 1Q0ZA 4GC9A 1L1FA 3RPEA 5LQUA 1XKLA 3DE0X 1JPUA 2X13A 1CY1A 1LA2A 4OLHA 1H2HA 1K4YA 5C8XA 4KLZA 1USIA 2VZ9A 3K70B 1G63A 3RS2A 3SEQA 3IA7A 3WMEA 3G2QA 1RVV1 3HS3A 2GA9A 3KVOA 3P0HA 3QXXA 4Y9SA 3FDXA 5C1DA 1Z33A 3RTAA 3SJUA 1NHWA 1CQJA 3ZN2A 4HMPA 4HNTA 1AK2A 4ZCMA 1J1UA 4JP5A 2RGCA 2YMQA 1D2MA 1MO4A 2WM9B 3I6MA 1CU1A 1P0IA 3E81A 4U7FA 4LS3A 4HH4A 5K0NA 3T52A 3TNJA 3UOAB 2X1LA 2PKQP 2JLXA 2QX8A 1GXSB 1A9YA 1F8YA 4TQ9A 13PKA 4FYKA 3QOXA 4G4SO 4UTOA 4GOOD 1W85A 1LPBB 2BGTA 2CLSA 3DDOA 3KYBA 4LTNA 5F1OA 4KPFC 4XDYA 2R0QC 1YS4A 4ZKDA 3QK7A 5F3WB 1IRXA 3K16A 4RA9A 1Q0SA 4JQSA 1Y33E 3QIAA 4V0QA 4OQEA 1EFPB 5SY6A 1G2OA 1A2OA 4QELA 3HY6A 5CX4A 5BSRA 3TZQA 4GLBA 1V16A 5B3KA 1N25A 1PO7A 2DGDA 2X5OA 1CVIA 1VMEA 3KT0A 3KYCA 1D0IA 4JT8A 1C0LA 1D07A 2WG2A 4HTFB 2ZYWX 4DMCA 3F1KA 3CVXA 2W4MA 1F1JA 4IINA 3W1WA 4BE4A 3EPJA 3KAQA 4NFHA 4DLAA 1JSXA 1Q1NA 3ZHCA 1KYWA 2O2JA 1DRUA 3NHUA 5AI8A 5BSHA 5HDQA 4YASA 4LGMA 4BLOA 3JAMA 5F5XA 3RQSA 4CMEC 3BE4A 1ANKA 1MJGM 4OU4A 3UK1A 4FOOA 1R0ZA 4DV4B 1DV1A 1XTSA 1G7CA 4FJ1A 2B34A 1VSVA 3A4VA 4RQTA 3QBDA 2HPAA 3CISA 2TYSB 5FOWA 2NVWA 1P1CA 4RQUA 3PQ8A 2GCGA 3H0CA 1Z4LA 4KYTA 1IJEA 5LVAA 5BYKA 3WSTA 4X65B 3C3AA 1VCOA 1HO3A 5HMMA 3TW0A 3ZU6A 2CE2X 2I6GA 1R4MA 4L3VA 4KE9A 1VPLA 2HFKA 2VVTA 2PBLA 1EM8B 3DBLA 4LCBA 4YCDA 1JKFA 3HU3A 3TR6A 1TT5B 5ALNA 3PXAA 1JEYA 4KFUA 5HKBA 2IHUA 4HF7A 4P7JA 2O4UX 2XA1A 1ZJ5A 4CUKA 2F48A 2JHPA 4AAYA 1QH9A 3EFHA 2XZOA 1OB5A 1X7GA 2OWDA 3EWNA 1M5TA 4CEIA 1T8PA 2B8TA 3ZBPA 4D8YA 1J8VA 1HDRA 3B7GA 1DADA 1C3XA 4IIJB 1E2FA 1JU9A 5J63A 5ARDA 4FZRA 4KHPB 1LNSA 2VATA 2SKEA 4R1UA 4ES6A 5JFOA 3OI7A 3TFQA 4O2BA 1UXOA 3M1AA 5F33A 4PBSA 3WB2A 2HDWA 1M34B 3NIWA 5CBPA 2QW0X 1Y6ZA 1UT5A 1FZTA 1XZ8A 1O6FA 4G1BA 3C85A 5IKEA 5BNTA 2VYQA 5CB0A 4ZVTA 1UPXA 2GSWA 4XVQA 4GOND 1G6KA 2IYVA 2QRKA 5ALYA 1BDIA 1NJ2A 4TMKA 2PIAA 4W9MC 4PU0A 2PSFA 5BQPA 1R3DA 1Q3TA 4PSDA 2X8JA 4V0KA 4JIMA 5E7MA 1LXCA 1P73A 3WY9A 1FQWA 4GMFA 3BCRA 2W22A 3AEZA 1H22A 4HUTA 5CPFA 1SHJA 3QXSA 2O50A 3DG9A 2RG7A 3A4NA 2YVUA 2ZYTX 3DH0A 3UGKA 1KQNA 3WP1B 5K0ZA 2ZWOA 1G8KA 1WUJS 3H3JA 3G2NA 3O95A 4L4SA 2B5VA 3RC3A 2GPSA 4D56A 3O2JA 1M1NB 1KFCB 2QV0A 1C41A 3O7MA 1SXJE 3RUDA 2EWVA 2O7VA 4FCCA 3P9SA 2VDRB 4N0MA 5C0OE 4TWRA 1GTVA 2VSNA 2GOYA 2PZAA 5HA5A 4H1HA 3MJEA 1T4DA 4YMIA 2FMIA 1FDOA 2FETA 2OPBA 3DZBA 1GFZA 2XWSA 3QGMA 4U0KA 4MZDA 3C48A 3NDJA 1F3OA 5BN3A 2JJ1D 4O63O 2AFHA 3CC8A 4EY7A 2ZJ0A 3F6PA 4TROA 5KVVA 2PT7A 3O2QB 4PGAA 2C2XA 3INTA 5JRJA 5HF5A 1R8YA 1H2XA 1RRPA 4FC7A 1E6LA 5EAIA 4OQPA 3CSDA 4INOA 3E3OA 3QUQA 4KR2A 5HKKD 3KUDA 3D5EA 1UP7A 5KVQA 4MXDA 2PN1A 3DEFA 3C1TA 1BN7A 4QEDA 2D1TA 1H8HA 1TAGA 2IYZA 3MGGA 2GDJA 1EWKA 4R1NA 5J2TB 1YVDA 3FSGD 2EEPA 4N6NA 1PLLA 1QAOA 1ZHHA 3ANSA 3ZGLA 2NZVG 2QT9A 3VRHA 3TSZA 1LPPA 1T26A 1FUEA 2ODPA 4U7GA 1KZ9A 5B57C 1Y8AA 4ISBA 3L6BA 3CRZA 3Q3VA 4X62B 1E5XA 1WSAA 4AP9A 2IDJA 4WK2B 3BWCA 4FGLA 3TTUA 2V7VA 2P1RA 3IUJA 4LXYA 5KKAA 5LPNA 1ZVJA 3B1ZA 4PAMA 1CRZA 2VKTA 4RCYA 3IUEA 5FHQA 4DCTA 3WAKA 1YQTA 3CB4A 3OQIA 4NIMA 3RYIA 4CODB 4BFVA 1XV5A 2A5FA 4FU0A 4H4DA 4NY1A 5CX1B 1NXXA 3B1KA 4RXMA 3FMGA 3RU7A 4DZTA 3FMIA 5KHAA 1AHIA 1YHNA 4XIIA 3SNKA 1A4UA 4GWKA 1X1QA 5A3VA 5DWVA 2ZB7A 3D7LA 1MQAA 4HWOA 2FPSA 4XEHA 2HM7A 5DRTA 1PYGA 4FFPA 2O1WA 3OZRA 1Y6RA 1XRRA 4LQCA 1US8A 4NARA 3K9HA 2I2AA 4ND7A 4NV3A 3WYBA 3QFCA 4NC9A 3SSNA 4BFUA 1Y7TA 4J0QA 3CMCO 1XK6A 1LSSA 4MV3A 3AM3A 1J70A 1KARA 2A57A 1Z0SA 1I33A 2H16A 1QBGA 1DKLA 5LU9A 5MN5A 4PHTA 5CH3A 5AVUA 2RHCA 3FUXA 1QCCA 5JCJA 4M0EA 3H4IA 2VO1A 1BGWA 1HDEA 2EFCB 5HRUA 1H65A 2ECOA 2OAQ1 1WSBA 4P6VF 5A4AA 2C9DA 1O8BA 2DUUA 4PLPA 5EMLA 4FMDB 1N34B 2HEGA 2O8EA 3V4VB 1GZVA 3L7AA 2YWFA 4GI1A 4JMLA 4YJFB 3UW1A 4EGQA 4KHZA 3BS4A 4NCBA 4W1PA 2XDAA 1ICEA 4ZQBA 3CZ5A 2CJPA 1I0IA 2WMYA 3DR5A 3CF0A 4AG6A 3Q3GE 2GM5A 2XD9A 1A5TA 2NU7A 3GZTB 1MPTA 1UBTS 1WB4A 2RDMA 1WETA 1M2NA 1PDVA 1PJ2A 2Q9CA 2XY4A 4INZA 4AC9A 3RUAA 3UCFA 5IKOA 2O5EA 1P1HA 2Q6VA 3COZA 5E0KB 3DM9B 4UVHA 1AIPA 1Y34E 2ZAOA 3IELA 1C81A 2EJWA 2B69A 4AN1A 3HO6A 3GJ8A 2BW0A 4FCWA 4BV3A 3BC1A 4AXBA 1F0KA 2BIFA 1XHFA 2Z95A 2IYRA 3IVRA 4BMYA 1L1QA 4P2BA 3KOZA 3WBKA 5L95A 2QBYB 1KZ7B 3DDCA 3SQXA 2P2SA 1EQ2A 4LN1A 2VLBA 3N6RA 1OBFO 4FXPA 3F78A 4QT0A 1Y4AE 4G63A 1GLNA 2QW8A 1INLA 2GJKA 3V7YA 4DJDC 4R2XA 3QY0A 4JBWA 1LDNA 2J6BA 3QVTA 4RTQA 1KJQA 1XPOA 1S6YA 2P3QA 1EWVA 2X3UA 3TLJA 4JLPA 4BNJA 2FJ0A 1DE0A 3CRRA 3W8FA 3VU0A 3TFOA 5K3DA 2AC4A 4DRXA 1HBJA 3ACCA 5AVYA 5B64A 1JHVA 3QU7A 1CYEA 4KUHA 5JFGA 1T9HA 2V7QD 3A06A 3DSRA 5CM8B 1PK9A 1TJYA 1CFZA 1KH1A 4IZHA 4F3KA 1IPHA 2LKCA 5KNLA 4A26A 5K6AA 1IQ0A 1W76A 2FU5C 2YCBA 3W4JA 1J22A 2OE2A 4EUFA 4FDUA 4XLTA 2D4HA 2QQEA 1QHGA 2QVYX 1B93A 3QJYA 3VU9A 1J6UA 4LWOA 1EK1A 3DKKA 4RLQA 4YCLA 2X4IA 3P20A 1FDRA 2DX7A 4IDQA 4K6OA 4OBBA 4OYLA 3D8SA 1LLQA 2WNSA 5BO5A 1Z2DA 1U98A 4UNPA 2QMEA 2QVBA 4N5HX 4MMZB 4A23A 5REQA 5E6RA 3VR5D 2W00A 5ICSA 2Y9PB 3G8YA 4D7AA 3TLGA 1G21A 5DGHA 1LBEA 4PWYA 1SXJC 2XMCA 4ZV9A 1E7SA 4ETMA 1EVIA 5EE9A 1AKRA 1MB0A 2DY0A 3D3JA 1H4VB 1Z3CA 1NULA 3QF7A 1PG0A 4IZIA 1BS1A 4DMGA 4TS3A 5KVAA 2CJWA 2NZ2A 4KQHA 4RKQA 1DQYA 4BMDA 3QJ5A 3QQ5A 1K8RA 1VCNA 2WVJA 5A4KA 5HUQA 3GLFA 3H16A 5JJ5A 2Q1XA 1BGXT 4UTNA 3NP7A 4QLBA 3MCVA 1ESNA 4WCDA 3RYHB 1XMIA 5CCDA 1HZZC 2CLFB 5F9FA 3EVNA 1E1NA 3CTPA 2FPWA 2C96A 2I54A 2VNKA 2ZJZA 1VJCA 4YYZA 3QPWA 4ARCA 2HN9A 1UWLA 3W7AA 3O8NA 3RS4A 2B2NA 2ODQA 3KT3A 4HZUA 3ITDA 2EQBA 3HRKA 3A3OA 1VDZA 5H7XA 4YIHA 3WRXA 2WMNB 3ZCXA 4KQIA 4WFKA 1SXJA 4BNDA 5FBQB 2EGHA 3KVNA 3G9TA 2FNAA 3VYRB 4QTUB 2ZIXA 5AT1A 1EJ2A 3D6TB 2SCUA 4X44A 4AJPA 4HFMA 3EGDA 5LLDA 3C15C 2ID4A 3MK31 3RG2A 3BD8A 3GIDA 2RAPA 2HF7A 3GHYA 2YYZA 3K70D 2CEKA 1YBVA 4MUNA 3T3PB 3ZE8A 1LQUA 4YAGA 2V7GA 2C0QA 5FWNA 1U6IA 1CR6A 4TTIA 1BCRA 2BF7A 3OCCA 5C8YB 1MAAA 2JVJA 5EUBA 1TQDA 1PV1A 3IBYA 3NH9A 3HXLA 5FB3A 2MSDB 1FDUA 2AHRA 3PHJA 1ST2A 2H2AA 2DPYA 1NXPA 2BHSA 3A1UA 3L4SO 1TVMA 3NANA 4PNHA 4QDUA 1IVYA 3TEJA 1WJGA 1DWPA 4DEVA 3ZCTA 3NAZA 4M55A 2AF3C 3RAFC 2VF4X 3VJLA 3AKEA 3AFGA 4MS3B 1L3CA 5B3AA 4G0ZA 1I3OA 2QL9A 4HAXA 4PXAA 1ABFA 1U3FA 1BTOA 2LTAA 3D7RA 1P9NA 5FULA 1IJFA 3S2YA 5D3MB 2JEOA 821PA 3TCKA 3WNQA 3KYJB 1WLSA 3FPHA 3R41A 4K9QA 1NUAA 4YRDA 3VAAA 5AKKA 4TKVB 5H3HA 4MKRA 3RF6A 4IGIA 3E2PA 1L5YA 1RXIA 2OT3B 3CLTC 1YZNA 1SXJB 3AIKA 3EWSA 2GARA 3QVSA 4O2AB 3LGSA 4Q18A 5KWVA 3RS8A 3H0KA 4OQQA 3A3PA 4X6XA 2PQMA 3F90A 4R1PA 4V1CI 1FNNA 2QJOA 2ZI9A 4S1OA 5G0SA 4DF3A 2O2YA 2GKOA 1PL8A 3AEXA 1C80A 1NQ5A 4R8VA 1EVEA 2QMZA 4WN9B 4F6CA 1PR1A 2FN3A 2BFOA 4D4JA 1L5FA 1ZP6A 4NF2A 3H99A 4JYAB 2G36A 3K9LA 1SULA 2JLBA 1OJLA 3C98A 3IH5A 4IUBS 3DVQX 2PRIA 4JOSA 5LDGA 4NMXB 4X3OA 3WADA 4CT0A 4URUR 4Y0NA 3OJLA 5IUJC 2O2IA 4WWHA 1VBNA 5EE1A 5DBHX 2G0NA 1B8NA 1H94A 4L8VA 4US2R 4BLWA 3I6YA 1N8KA 1IAVA 5DM0A 2B8WA 3BM5A 1FX0A 3CQ9A 2FR8A 1KVRA 3WIOA 1A04A 4KPGA 5HFJA 3SQLA 1Y82A 4G86A 1ISRA 1WZIA 4BFXA 4H1WA 1NNLA 4B84A 1RAFA 1ZA2A 4NONA 1KVQA 1T4GA 3SM9A 1IB6A 5L6LB 2ATCA 4Q3KA 3BOSA 4CEIB 4Q02A 1BD3A 2VT6A 5MHTA 5EXDA 1CQIA 1KAGA 4URHA 3ZWQA 4BMOB 1CERA 4L2IB 5DPMA 1W49A 2A9QA 3CZ4A 3RSSA 4PQRA 3VTFA 4PO3X 1SUWA 3SBXA 3K9BA 1G291 3VC1A 4F8JA 3MJVA 1TUEA 3V34A 2ZYAA 1WTAA 2ORIA 1QNFA 2ILTA 3L01A 1OWOA 4KRXA 5J5VA 1TAQA 2G06A 4BPBA 2EHJA 1I4OA 2QZJA 3OETA 3R3HA 2ZSKA 3ZW8A 1R9GA 1DCTA 3I53A 4LZJA 5DVZA 2E4ZA 1E96A 3T4UA 4BZQA 5JXIA 5T8KC 5TEVA 2FGKA 5I4BA 1O96A 1GKUB 2IEZA 3ABIA 3F5SA 3KZNA 3KFXA 3RVJA 4OFXA 3T41A 5KYYB 1VKZA 3KJFA 4BQOA 2OORC 3D3WA 5H9WA 2VPTA 1JFFA 3JYHA 4AYWA 4XUEA 2WHPA 1OV6A 2AOUB 2XWPA 3WKAA 3ZXYA 4C7VA 5HUJA 3GZNB 3DV2A 5EVCA 3KOYA 5C5IA 3ENZA 2Q9BA 1GCOA 3DVAB 3E2MA 3GLSA 2IOYA 2P90A 2QTMA 2RHRA 4FFNA 3B1WA 4ZREA 1P5RA 1IWBB 3AO0B 4F5YA 1W88A 2QGFA 2Z4SA 2A3RA 2JC3A 2VQ6A 2IE0A 4QD3A 2N1BA 1W48A 2PTGA 4IOLA 1L4GA 2A14A 2HUPA 3MCWA 1M9NA 1UKCA 4QJ3A 2MYPA 4CCYA 2AR9A 3OEHA 2Q07A 3EAQA 4EI7A 2MSKA 4RJKA 5JDCC 3SPXA 5AUNB 2JHFA 2K4MA 2I91A 2EX1A 1BJTA 3LO8A 3RT9A 4E4YA 1KQFA 1PDOA 5ALTA 1MO3A 1SN7A 2BLLA 2VXBA 2VUUA 4B3CA 3OZIA 4D3FA 1VIMA 2REQB 2H29A 1CUZA 1A7AA 3AMVA 2X3FA 3MJ4A 4H9GA 1U2PA 1VPDA 2QMUA 1X9HA 3FDIA 1RWOA 2Y92A 4XXHA 5C4MA 2Q5EA 3B2EA 3OLVA 1W4RA 4C2BA 1LK0A 4DLYA 4YAKA 4A8PA 1T0PA 4UHDA 3ZHYA 2J30A 2PMKA 4GMXA 4HPJB 3M81A 5MDHA 4Y1GA 3PRYA 4KIWA 2J5KA 4UHBA 3AG5A 2AA3A 2C99A 4LK2A 3VZPA 2GXQA 2ZT7A 1GRVA 2JAWA 3WMGA 4J2HA 5JH7A 3R9WA 2CDBA 2AN5A 1PF7E 3GELA 4DIDA 3DUFA 4QRIA 1TPYA 5ALUA 3VQTA 1ZD9A 2ST1A 4C7XA 5FKJA 4DNOA 2JEZA 1GY8A 5CHYA 3R8CA 4FS8A 4LCJA 4HWPA 2PWAA 3HCEA 4L9SA 4X8HA 1H0SA 1N7GA 4BN0A 1FDWA 3SHVA 1G8YA 2FCRA 4ZVKA 1I6MA 4EPRA 3Q3EA 2ZBDA 3WL6A 3K6RA 2B0JA 4Z3OA 4RF4A 4B87A 5KTTA 1PQPA 1SMKA 2VYFA 3IMCA 4CKCA 4LZAA 5DW0A 4PLYA 3P2YA 4Q15A 1XYVA 3A1WA 3KTOA 4TZ0A 2JFWA 3EDMA 2IHNA 2Z3WA 3TL6A 2DR3A 4ZZIA 4LWZA 1Z8HA 4H6PA 1M2FA 1BE1A 3M6AA 2W4QA 1GKIA 1MXFA 3QPCA 4C29A 2IEDA 5ECYA 3G79A 3MS2A 2X41A 2R48A 1EM8A 2I4RA 2GPBA 2H31A 2NO7A 4LW8A 1T8SA 4R3WA 1RLOA 3MMNA 2PL1A 5E95A 3I34X 3SR0A 4BNKA 1HT2E 1ZNYA 3DDWA 4DLZA 2I76A 3U09A 5FTWA 1MDBA 1YL6A 1QB7A 5BVGA 3ICEA 1ULUA 2XUFA 1SBZA 1MT3A 5CVUA 2WD7B 3MQ4A 5A9RA 1L4MA 4II2A 4O08A 3ETGA 4P32A 3UYKA 2XRMA 3H2SA 5HGXA 1A8HA 2CVZA 4NBUA 1IXYA 1KKMA 4LSWA 2LDXA 2PWBA 1JWLA 2VQSA 2FP3A 4C6TA 2QYOA 5FQNA 3Q41A 3SC3A 1O95D 1Z6PA 5HCUA 2IOHA 2H7YA 3OMWA 4L78A 1L4EA 2HJGA 2C5SA 1EHIA 2PKEA 3EQZA 4JJIA 2QMOA 2IITA 3RRZA 3WYFA 4A8JC 5H83A 5JJKA 1F60A 1PQUA 3S0JA 3MM4A 3H9JA 3M6VA 2OSVA 3LXUX 3G49A 1P0FA 2V3CC 5EYPA 3OLCX 5EXSA 5M7EA 4GOXA 3KQNA 3ZCVA 3KKNA 3DMPA 3MS7A 1GCUA 3F6BX 1JQ5A 3L7KA 1VA4A 2GERA 5E1MA 5DYYA 3WZMA 1I94B 4JKOA 3PT9A 2ZANA 5FYDA 2HTEA 1TL7C 1NASA 1YE8A 1VMDA 1LDEA 2JLUA 4FT2A 1HFWA 3MILA 4XX1A 1CQXA 2HJ9A 4GBMA 1LJ8A 1YR6A 3TJZA 3M70A 3EF0A 5EEGA 1V5FA 3E3LA 3MC1A 4MV0A 4JNKA 4YPVA 4BU0A 1JZQA 2PX2A 2IXFA 1GZ3A 3DO5A 5BW5A 1EUDB 1Y81A 1G4UR 2E55A 3QKSB 4Z7JA 2ZCVA 3FUVA 1KP9A 3AYZB 4GRAA 4RWZA 4DWJA 1CVRA 1S2LA 4GU5A 3SS9X 4MR8A 1FC0A 3PR3A 4PINA 4HRAA 4HPXB 4TV9B 1ZD2P 1C0IA 4D1YA 2QZ9A 5BSMA 3IDSA 2R86A 3DZDA 3RNOA 3AHDA 5IT0A 3B3GA 4PY2A 4CVNA 2IYLD 4IKEA 5HIIA 4ZK6A 1KE2A 2RAVA 1L5VA 3B48A 2GBGA 4RE5A 4X71A 5DX0A 5IC5A 4F9GA 5IAAA 2Y1LA 4IX9A 1C50A 2ZBRA 2OYCA 1VCHA 1GITA 3CKMA 3IBTA 3QKWA 3H86A 4UMVA 5E4JA 1LPAB 2QN8A 4J0IA 4MV9A 4EUEA 4YX9A 5C3UA 1VIYA 4JR1A 1I9GA 1IDN1 4RABA 2IZ1A 2FW6A 5SV2A 5KBYA 2Z2IA 3DPSA 1LPMA 1BS2A 1QR2A 2QS9A 1PZMA 2R6CA 3I5XA 5JXJA 4O2AA 2GJ4A 4MS3A 4RTLA 2YVQA 1D9XA 4N0EA 3B12A 4W1QA 1NF2A 1RTKA 7YASA 4GD3Q 2G72A 1V16B 2FAXA 3TAXA 1GA1A 4B7CA 1DAHA 2XCLA 2Z0MA 4MKIA 3DZJA 1ZIYA 3DVAA 1H2RS 5DI3A 3NHJA 1EXDA 2H06A 4WLNA 3UFXB 3K2IA 4XQGA 2ZYDA 1L7QA 4HZIA 2F9MA 2Z9CA 1G1MA 5KYWA 1TVKA 3K6KA 3L7YA 3FFXA 1WZNA 1NY6A 1XEXA 4COOA 1BJRE 1UJ6A 4ZTZB 1XJQA 2D0DA 4QUGA 1JDUA 1L7MA 3M3PA 3JQ7B 4QTXA 3E9QA 2ZROA 3HDVA 4DIKA 5KKNB 1EZ4A 1GT6A 4OVKA 4CTMA 1EGMB 4HKTA 2QHXA 3HA3A 2B3TA 4XB6B 4Z9YA 4P7KA 4Y2SA 3Q12A 1PEAA 5FUXA 3UJ7A 3LDAA 3S81A 4RENA 3I6ZA 2YJZA 2BCEA 5G0TA 1VB5A 4WESA 1RRGA 3R24A 3VV3A 1LRJA 4KQEA 4R8LA 2XADA 2PGAA 3LK7A 3PDUA 2J0UB 1CJVC 4KSBA 4TV9F 1WOYA 2OXTA 4YDQA 4MZXA 2CNNA 1XJCA 3I5MA 5IDWA 3EZGA 2A1TR 5JAHA 1T9GS 2O0HA 3L2OB 1R5NA 3L8YA 3O9ZA 3B6MA 4N48A 1EG7A 4UM8B 4FN4A 1QAMA 3DBVO 1AMOA 3CGWA 4B2IA 1EQUA 3CV3A 2D2VA 4JHLA 4US1R 3ZVMA 4ARIA 1NXTA 3N6XA 4X54A 4GPD1 1A9ZA 4I36A 2IC5A 2C2YA 2R1TB 3AJRA 4W9NA 3I9LA 1WVMA 4EZEA 2JJ2A 5FYQA 1LNZA 3PG5A 3MWLA 3CSUA 2WJ4A 5TSDA 3ZDDA 3D4LA 3OX3A 3E7PA 3QOWA 4NE9A 1ZM9A 4HGZA 4DANA 4ZAWA 4UFPA 2FWMX 3IQFA 2FWBA 1I2CA 2HMWA 1F0PA 2AXPA 2Z6QA 1A76A 1NV8A 4GUDA 1VIDA 2XTNA 2G88A 1XJ0A 1E1DA 2UZ4A 1TU0A 4NOMA 3BFKA 4RWEA 1KGSA 3RC8A 5HKLA 1RQXA 1B23P 4E14A 1JQDA 3AGQA 3D81A 4J76A 1SD5A 4LDNA 2HA7A 3AH8A 3G0CA 1NWHA 3QLUC 3EFOB 4QAJA 4B40A 4BBZA 1VHJA 3H8SA 4XRGA 3LF1A 3L77A 2W6JD 4GZMA 4XQCA 1TE2A 2X23A 5HCNA 4BWVA 2WFAA 3MTEA 4FFDA 4G0NA 4FNMA 2GYUA 4JQCA 3ANXA 1QLJA 3AILA 3TBHA 2YHIA 1IFXA 4I4LA 1VKOA 5IP5A 3UAGA 5ITZA 2N9UA 3OF2A 4GICA 4Q1DA 3DOOA 3H2KA 1F8GA 4FR2A 2HCJB 1TZBA 1GGVA 2W6MA 1PDWA 1WMDA 3PQ2A 5L9AA 2QVCA 3QLTA 4NSNA 3KBOA 1ZKMA 1CR1A 4PO1A 3RM3A 2BH9A 3BWYA 3KELA 1ZMOA 1JDTA 2A4MA 3FFBA 3I45A 2NW6A 3PXEA 4Q82A 3T34A 2ZRGA 3TZBA 1UMBA 1C1DB 3H2ZA 3K0HA 2JRLA 1TD9A 1WABA 3V7WA 3NDPA 1QCYA 1RJWA 1SXIA 2OV4A 3HCRA 4WBXC 5BOSA 1P17A 1GZ6A 1PT8A 1FFDA 1GTZA 5C8VA 3ZJ4A 1NFQA 4R54A 2EGUA 3B7PA 5FORA 5ESDA 4R01A 4C1NA 3Q3IA 3GLIE 4RUKA 4WMLA 2R9VA 4W7IA 3SD7A 1G5PA 1Q91A 1AQIA 3MS4A 2BHNA 2NSJA 3SE7A 4NBLA 3LA6A 3WSVA 3PITA 1KYYA 3BE6A 4O4LB 2WC1A 3L8FA 4GH5A 1GNTA 3RBAA 4KFCA 1Y1QA 4PSAA 2PKWA 3ZS8A 4D4MA 4E13A 3Q9UA 3IAFA 1A72A 3PA8A 5AKZA 1C9DB 3IL2A 4TZ6A 1MTZA 1Z63A 4ZVPA 3GN2A 4P82A 3I9KA 1QORA 3QVVA 1C3OB 1JHYA 1KI1A 3FPJA 3FYUA 1X1EA 3Q85A 4WY8A 3N8HA 4LOAA 2QU8A 1G5FA 4IIDA 3W2IA 4AS3A 2BGUA 4GXQA 1XTBA 3FW1A 2XBLA 1H2AS 2HIMA 3CFYA 3PEUA 4JJGA 4O0MA 5I7FA 2HPZA 4GEKA 2NP6A 3VDMA 3WO0A 1GP2A 2GYWA 2RHDA 3IIIA 3RYIB 1GDTA 4HH3C 1AT1A 4Q39A 4YP0A 1Z07A 1L1EA 2LDBA 2EATA 2V9CA 2ZWPA 5H0IA 5JMWA 4DG8A 4Z5XA 3SLRA 3URMA 3UV3A 4JYZA 3RBZA 1ZMXA 2VDOB 4FSHA 3WGUA 3OZ7A 4UPVA 4HXFB 3NUGA 4EJFA 4O4JA 4CN9A 2JFPA 3IEMA 1QO0A 2G3YA 2MSEB 3HMQA 4MW9A 1JLKA 4BJ3A 4BLTA 5JH7B 1U1CA 3LH5A 3PWSA 2OV1A 1VP9A 4ZO8A 4RXUA 2FEMA 9MHTA 1YB4A 3PU6A 1RD4A 3NTVA 1L8XA 2VQ3A 1OF1A 3A6JA 4JN6B 5IXSA 3WGNA 2PMCA 4P0QB 1T8UA 3QWAA 5EZ5A 2VCHA 5EL0A 4MAMA 4LYAA 2ZIGA 4DGSA 3UT6A 4D92A 1JVSA 1TO6A 2H11A 2O48X 2C8LA 1RYHA 4RSGA 1H8HD 4FDMA 2YHBA 4O4IF 1YIDA 2CHGA 4B8YA 4AQYB 4DA8A 4I4TF 1NUHA 1C9MA 2R60A 2VJDA 1GQSA 4K28A 4NHOA 3OLZA 4KPUB 4NAHA 4MYDA 3TSOA 4P4TA 1BD4A 3DMTC 4UM7A 5INTA 1TUGA 1OUMA 4ZVOA 2Q1SA 1AXGA 1U94A 1O94C 1UEJA 2CMHA 4FHEA 3ANYB 4JR2A 4MWBA 2HZBA 4NTZA 4YBRA 1V8BA 3EPKA 2RHMA 1XGKA 1UXHA 4HMOA 3IOEA 3CLHA 5F77A 4RY2A 3ZR4B 2ZR7A 2CHVA 4UVIA 1H8ED 3HB4X 4C6SA 4B9EA 1TGYA 4CV1A 4OXIA 3JQRA 2NT3A 4BECA 4EW6A 1BKYA 1E7MA 3C97A 5KAMA 3AEUA 2G70A 3OIGA 4JBGA 1DTEA 3NOVA 3LFUA 2VH5R 4QREA 4HWSA 1VKJA 4JC8A 4WK0B 2E2WA 3WK4A 1GU0A 1S4MA 1VYUA 3HNPA 4EL0A 1W87A 3IURA 5ARBA 4ZEMA 2EOAA 3QVLA 1PZNA 3P9ZA 4ON9A 4MQBA 3E7XA 2DR0A 5D7NA 5IDXA 3H2JA 1KETA 4HR7A 3JQFC 5A0FA 3JRNA 2QE7A 2CVPA 1ECFA 1ZU4A 3M5PA 4TVKA 1NG9A 1JFFB 4LBWA 2PV7A 1G8SA 2QUAA 4RIHA 3C5EA 1UXJA 1WD5A 2J3HA 2ZJ7A 3I32A 1NN0A 1ODLA 1XLTA 1P4GA 1GNRA 4F38A 3HXMA 2Z3VA 2YY5A 1QP4A 1C3LA 2RB4A 4RY9A 2YIJA 5MN6A 3M7IA 4OFBA 2HDHA 3RJMA 1VXOA 4TMVA 3O8OB 4UBLA 4P3PA 2RE8A 1D6JA 4I4TB 8LDHA 5I9NA 2V9ZA 2VYNA 1Q44A 2WYHA 3BFXA 3LOQA 2IHYA 3NASA 3Q7PA 3VU1A 1VIAA 4BOYA 1OXMA 3PIRA 2HYIC 4KU4A 1ZAKA 2XZPA 1W5EA 3S7TA 1FFAA 3VC7A 2X5NA 5KTRA 1QOZA 1XZJA 3LW7A 4MQ6A 5HJ5A 4WOCA 1M33A 2B4AA 3NBKA 2CF5A 4KBGA 2FQQA 3WZ2A 2XQVA 3ZE2B 3A6PC 2A1UB 4PAWA 5DCYA 5SZIA 2D1RA 1ZUIA 4EA7A 2AOXA 4NV1A 5AFSA 1OX4B 4EUHA 3O90A 1Z7EA 3HWX1 4MQ4A 5ALEA 4PIMA 1I0LA 5HF8A 3UJ6A 5IZCA 3Q11A 2HA6A 3NUZA 4MYUA 5L4SA 4BMNA 5EERA 5LC1A 2FOIA 4R1SA 2NO5A 4IVPA 5J4LA 1TC1A 3C5WP 4YI3A 4EG1A 2CCJA 5AI0A 5AKLA 1RQRA 4KRYA 1PW5A 4CEJB 2P7HA 2A2ZA 4B33A 4AKIA 4PTZA 3OWHA 1V2HE 2VT2A 3T7IA 2O14A 1AQ6A 3EVDA 4OXKA 2JI4A 1D09A 1H4TA 4J0GA 1XTPA 3OE5A 3OESA 3SVTA 3V55A 1NXQA 2I1QA 3LLVA 1X1CA 4AO8A 5A1JA 2D3WA 3HXOA 1SPBS 4XOUA 3T9FA 5GZ3A 1M34A 1KJJA 2B1RA 2GEKA 2ECFA 4Y6SA 2LGJA 5G3YA 1ZXXA 1MXHA 2P9EA 3DQZA 1C9JA 1B26A 3DBOB 1THMA 1GPWB 2G0AA 3U17A 4BVJA 1U5BA 5FOQA 1CRQA 2JIZA 1VSBA 4NVRA 5E6SB 2FW0A 2FCAA 1A50B 3H75A 4Q3AA 1MVLA 3IIMA 3BILA 1B16A 1TU4A 2G82A 2D5AA 1KVSA 2ZYRA 3QWBA 2V7EA 2M6RA 5I9LA 3ELWA 1Z4MA 4FFRA 5EKDA 2QTTA 2OLJA 3V8PA 1JIUA 3HKBB 2FTKE 1QKIA 4KITB 4XVCA 4RVHA 2CKDA 5AJHA 1S2IA 3EQ9A 4Q21A 1MO2A 2MMCA 4QG7A 4Q4HB 4XTRA 2V0GA 4OX9B 3O4JA 5T8KA 2GILA 3WGYA 1FSPA 3H9UA 1JNYA 4QQ8A 4Y1EA 3CG0A 1GZSA 3UAZA 1KGDA 4RJTA 2NN3C 3FOWA 1Z4QA 1D1TA 4M36A 4IHKA 5FWYB 1CUIA 1KU0A 1ZMRA 2KWIA 1MX9A 2TMYA 1DKRA 3DT6A 3FPFA 1TUBA 4IDPA 3FPAA 4JL5A 4UE6A 3MXOA 2B35A 1WDLA 2H8GA 5CT5A 3V8VA 1SVIA 4MI1A 3U16A 1TA0A 3ICWA 5AIBA 5EIXA 1ZVMA 1YCGA 2I3AA 2YR0A 4LC1A 2OKCA 4ODIA 1FS6A 1PEYA 1Y9JA 5EJ6A 1IWPB 1AA9A 1EFKA 4C0QC 2I4LA 4XJVA 2YZKA 4L72A 3LQQA 4TMYA 1GAEO 1N0IA 2DULA 3ZHXA 5L40A 1Y80A 1QDEA 3OY2A 5K8UA 3FKSA 3KTAB 3OIUA 1PVVA 4IXNA 4TSKA 3ETNA 1P18A 4XIFA