1W73A

Binary structure of human decr solved by semet sad.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
294
structure length
288
Chain Sequence
NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2,4-DIENOYL-COA REDUCTASE
publication title Structure and Reactivity of Human Mitochondrial 2,4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions in a Distinctive Short-Chain Reductase Active Site
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 288
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w73A00
1GFSA 4GBJA 3MTJA 3AFNA 1DRVA 3QWAA 3WGQA 5ILOA 2DTXA 2GPTA 3K9QO 4HKTA 2Q1WA 1O6ZA 4B8ZA 5F5NA 2Q1TA 4CR8A 2F1KA 3UCFA 5HBRA 5CG1A 1XSEA 1LLUA 4PLWA 2C7VA 5EPOA 3LLVA 3EDMA 1Y7TA 3ZWPA 4YRAA 1PZFA 2Q99A 4MP3A 5HTOA 4XD2A 1MLDA 1OAAA 1B3BA 3KZVA 1U5CA 3AY3A 3PI7A 4NQZA 3V5NA 5JNLA 5BQFA 2NQTA 1Y5RA 3DFZA 4EW6A 2I99A 3QA9A 2HK8A 1P1IA 3V1TC 1HDGO 3GFBA 2E6UX 1EBUA 1EE9A 4U0JA 1K6IA 4KTVE 1B8UA 4EJ0A 1E3WA 1XKQA 3I9JA 2I67A 4NU6A 3UUWA 1XIVA 4AICA 2NTVA 1YRLA 2E48A 1HTBA 4Y6PA 1QYWA 3BMNA 4CV2A 3AI1A 2X86A 3KRTA 1A7AA 2I5PO 4BO4A 1PR9A 1DIRA 1U3WA 5I8WA 4S3MA 2JCVA 5TS3A 5I9NA 1OC2A 1P74A 2QYSA 3PHIA 1DC4A 4FGSA 4D41A 1JDJA 1PX0A 1QV7A 3GC6A 1OOEA 4GKVA 4J49A 1PQPA 1NR7A 1GEEA 5CP8A 5MDHA 1VL0A 1HYGA 1QYCA 4CUZA 1NPDA 2B69A 2ZTLA 4CMKA 4BGUA 1VLLA 4CM7A 3CUKA 4XQCA 2HRZA 4NK5A 1IPEA 1KC1A 4IUYA 1KVUA 4ZN6A 3ZCXA 5CAEA 3ADOA 1EFLA 1H6BA 4RPKA 1T2AA 4K28A 1UDBA 2VOEA 1I01A 3EVNA 1EQUA 5B37A 4Q3NA 3KXDA 1I5RA 1R37A 5EERA 5KVCA 2LDBA 3AUAA 1GR0A 1YOVB 5JYDA 4M55A 4J3FA 2EERA 1NFRA 4KP7A 4JROA 3E1KA 2Y0DA 3DEYX 4XDZA 3HDYA 4D0RA 3ST7A 4L8VA 1NAHA 2ZJ0A 4PLYA 2FP4A 3KYDB 4BQPA 1QMGA 4F45A 4E31A 2OBNA 4IGEA 2W98A 2BGKA 3FR8A 3LT0A 3M1AA 5IXYA 1H6DA 1DO8A 1P9LA 1QP8A 5C37A 1M75A 2G5CA 3ZHZA 4E32A 4YCAA 1ISHA 2R2GA 3WNQA 3KYCB 4O5OA 4RLSA 5DP1A 2YV1A 3IJPA 2NV6A 3WG9A 1SB8A 4R4JA 3ZDFA 2IXBA 4IJUA 4IMPA 5C7OO 3E6AA 4NHEA 4MKZA 3AU9A 1UAYA 5EESA 1WMBA 9LDTA 1WMAA 3HDHA 3MWDB 3INRA 3D1LA 4TKLA 4UUNA 4B7XA 5A02A 1K2WA 1ENZA 3NRCA 1U2DA 3C8MA 1ZK4A 1BDBA 5TRTA 3KO8A 3P19A 2BI8A 3TF5A 3OBBA 4H16A 1M67A 1P1RA 7ADHA 2O4CA 4QSMA 3VZPA 4MKRA 5TIIA 5F21A 4W9NC 1E1MA 4M8SA 2DBVO 2H1SA 3E82A 3IL2A 3TZQA 1RJWA 5L40A 3H9QA 2D3TA 3ORFA 1ZMTA 3RUEA 2A9FA 4MIOA 1YVEI 3CIFA 1HSOA 4R5MA 3RIHA 1F17A 2EGGA 4PRLA 5LC1A 4JX8A 4OGWA 3RUDA 4W6ZA 2VWQA 4DRYA 3IIEA 3DAGA 1V3VA 4D44A 3H5NA 2O3RA 1WP4A 4RF4A 4D0SA 3KEQA 4PG5A 1T2CA 2VRBA 3ZHYA 5EN4A 3SLKA 3ETDA 1ZK3A 5GZ1A 3FRJA 3KSUA 3NGXA 4NNJA 1QYDA 2ZB8A 2X8LA 3W8FA 3K31A 3JYNA 3MWEB 5KNLA 2X1HA 5IN5A 4E5NA 3CXRA 2PK3A 1IULA 3SXPA 4WCFC 2YFHA 3CZMA 4XWYA 1LX6A 3O4RA 3RUIA 5IDXA 1ZXLA 3DHNA 4BIIA 5L7YA 4ND2A 4ZQGA 2J5KA 3OEWA 4PG6A 1SZJG 2CVZA 4II2A 4W99A 1C0PA 6LDHA 1HE4A 1WZEA 1NPYA 4A27A 2C82A 1X7GA 3DZGA 2J3IA 1FK8A 4LSMA 4MDHA 2RIRA 2OL4A 3H9UA 1KVRA 2ZYAA 4E2XA 3H6KA 1A9YA 3FNGA 3LYLA 3GLQA 1PGQA 1PWZA 1HZZA 1UUFA 2GZ1A 2VWGA 3IAHA 4U8GA 4DYDA 1LRJA 3B1KA 3PRJA 4U0KA 4WUVA 3T7EA 2HRBA 2H5LA 4YDRA 4CQMB 3RBVA 1BVRA 3I1JA 4Q3EA 1W6UA 4AJKA 1C1DA 3N74A 1NAIA 4D7AA 3GQVA 4CL8A 3I9LA 2JAPA 4ID9A 4GX2A 5G4LA 3WBFA 4IGFA 4R54A 2FPIA 3FD8A 4DLAA 4H7PA 2Y1EA 2VUTA 2FRDA 4TWRA 4R9SA 4CQLA 1GAEO 1M66A 1OC4A 2V6FA 4NU5A 3I83A 5CPFA 2VYNA 4W82A 2C7GA 1X0VA 3GAZA 1N1EA 4ZQHA 1ZZEA 4UEOA 3ROKA 2VHZA 1QV6A 2UVDA 3OECA 4FFPA 1Q0LA 3JQ7A 3RFVA 5JXWA 1C0LA 2ZJ1A 1BXGB 1UP6A 3JQBA 2PLAA 3E03A 3WSWA 3NV9A 3L6EA 5DNAA 1I0ZA 3DAFA 1N9GB 1O89A 2ZATA 1CERA 4D43A 3VKUA 3EZLA 1E3SA 3VH4A 4CMIA 3GGPA 3PLNA 4BKQA 1CQJA 4IPTA 4YJHB 4YAGA 1A5ZA 4YWJA 1GZ4A 2VQ3A 3RC7A 2HMSA 1U28A 4J1TA 4DUPA 1YQGA 1YQDA 3Q9NA 7MDHA 2VTDA 1I10A 1BXKA 3EMKA 4RZHA 4UEKA 1PJTA 2DUUA 4I08A 1KEPA 1YBAA 4JN6B 4J9VA 3DWFA 3PYMA 3ZWAA 2CSUA 2DFDA 3R0IA 4NZ9A 1ADCA 1LA2A 2IYOA 1I24A 2OXIA 2HJSA 3WGYA 2DTDA 4GVXA 4UVIA 2PD6A 2PH5A 4R01A 2EXXA 2VCYA 4I5FA 4BNNA 4DREA 2E37A 3W4JA 3JQCA 4LW8A 4D42A 4EGFA 3H7AA 4XKJA 1MXFA 2PZJA 1VKOA 1QYXA 3BMOA 3FPCA 3PXXA 4W7HA 4CV0A 4HV4A 1DHTA 3PPIA 2X22A 3GH3A 1DAPA 3JD0A 1PZEA 2IE0A 4IDEA 4GX0A 5FEUA 2YDYA 3PVZA 1B26A 1IE3A 3U5TA 2Y0CA 3GHHA 3W8DA 3V2HA 4OJNA 2NVWA 3V2GA 2GSDA 5JE8A 2P5UA 2PV7A 1Z7EA 2EF1A 3GZNA 4RQTA 2DQ4A 3MJSA 1GY8A 2JFFA 2AQIA 3COSA 3QQPA 2C2YA 5JDIA 4NJOA 5I9MA 1H2BA 3NX4A 4NFHA 1GUZA 3U4HA 3ZNNA 4DC0A 1CF2O 3ZV3A 3BTUA 2R6JA 4RLHA 3VDQA 2DBQA 3AFMA 1GYPA 1Y8RA 1I33A 4R1NA 3ZGYA 4M49A 3OSUA 5EJ2A 4EBFA 3OJFA 3HUDA 4BO5A 4MO2A 4E21A 5G4KA 1CQIA 1GCOA 1DHRA 3ETGA 4CM5A 2OP1A 2DUWA 2RBEA 4ALIA 4JJIA 4MOWA 3VVBA 4DPKA 4GLOA 1JVSA 1I3KA 5G0WA 2HO5A 3CE6A 1EVIA 2GO1A 3N58A 3LF2A 4GVLA 2PGLA 4PLPA 1JW9B 6ADHA 1NP3A 3WDSA 4GX1A 5BSEA 4ROSA 1GPDG 1HF3A 2IEDA 4WOJA 4A73A 1XQ1A 2O23A 1VSVA 1P77A 1FDWA 3F4LA 1KETA 3ENKA 2WMDA 3OH8A 3WFIA 4BO1A 4WPGA 1JTVA 2JFGA 1ZH8A 3H5AA 3K92A 3RU7A 4FFLA 3OF2A 4QQRA 3FNEA 1YDWA 1DLJA 2A92A 1PGPA 1AHIA 3NUGA 4EUFA 1LEHA 5G0UA 4L4SA 1EDOA 4PLFA 3ICCA 5EMHA 5JDCC 2NVUA 1E7SA 2DPGA 2YY7A 1KVQA 3T4XA 1XGKA 2NADA 1F06A 3D64A 3JD2A 4C7KA 1J4AA 4WOKA 4J90A 4G81A 4KQWA 4MVJF 1E5QA 3HQ4O 5JAQA 3AJRA 4QO7A 2Y0EA 4IXWA 1PS9A 4CM9A 1YB4A 3S2FA 3L4BA 2JD1A 1NYTA 1WPQA 3U62A 1LSJA 3RFXA 2O50A 1U7HA 1NQTA 4FS3A 1AHHA 1D7OA 2DT5A 1PJ3A 3AWDA 4Q3CA 3ZV5A 3AY6A 3FWNA 1OFGA 4U6SA 4HUJA 4JQCA 1DBVO 4ND1A 1Y9EA 3O38A 2PH3A 4NBVA 4YACA 1PL6A 4A2CA 4IBOA 4RVHA 1U4SA 2V6GA 5HWSA 2OO5A 4XGNA 3QE3A 3GMSA 2EHDA 3JQAB 5FI5A 2GZ3A 4YBZA 3BTVA 1YL7A 1FF9A 5JCJA 2H9IA 2PKRA 5I7SA 3DMTA 2OUIA 3AUUA 5KVSA 3A28A 2VRCA 1SBYA 2Y1CA 4M89A 4WE3A 5DBGA 4Z9FA 4GMFA 5KTKA 1G0OA 4GMGA 1A4IA 3KSDO 4BHTA 4BMNA 2B35A 2FSSA 1BWSA 3BZUA 4R9RA 9LDBA 1UJMA 1AXEA 4CL3A 4EZBA 2W2LA 1GADO 4M1QA 1LDYA 1B0AA 1I3MA 1NBOA 3D4NA 5C3MA 3PDJA 1LU9A 5ES3A 4Q3AA 4R5HA 4OH1A 4BKRA 5HM8A 5IAAA 1U3TA 1KY5A 4HX5A 2ZIZA 3UW3A 4HNHA 3OFSA 4XIYA 3KB6A 1NM5A 2TMGA 3ON5A 5KJCA 5L45A 2GR9A 2YHUA 4DIOA 1L7EA 1PS8A 4R68A 1I32A 3K2EA 4FFMA 4OQZA 4CM8A 3C7CB 1R0KA 1V3UA 3SC6A 2X9NA 5CDGA 1U2GA 3GVXA 3TSCA 3JQFA 5CEFA 3HE3A 1MGOA 1B8PA 3UKOA 3PHGA 2NTNA 4YYZA 4WLFA 3TOXA 3OJEA 3P5SA 3KM0A 1P0CA 4PG8A 3LK7A 4CLHA 4DBVO 1SMKA 4FJ1A 2AQ8A 1GPJA 1UXJA 2OZPA 1LXCA 1EVYA 3U9LA 2GN4A 3ZWNA 4F46A 1LSSA 1GQQA 2HK9A 3K30A 3PWKA 5DOVA 4W7IA 2PWZA 3UXYA 3VH2A 5EQFA 1HDYA 3AM5A 3QVSA 5AXAA 1NQAO 1LC3A 4E5KA 3BHMA 3QVWA 1PGJA 4CMGA 4J7UA 4PZCA 3PWZA 3KV3O 2VTEA 3VZSA 2FHSA 2OGUA 1E3IA 1Q1NA 3GDGA 1A4UA 1PJQA 4E12A 5KJ1A 1ORRA 3Q2IA 2Y1DA 1T4DA 1AUPA 5EIOA 4L73A 2HMWA 5K6AC 3PP8A 2HU2A 1ZVMA 4EJ6A 3KEOA 3JQ9A 3KSZO 1DXYA 4CLOA 4L75A 3I9KA 5CFZA 4IJWA 2I66A 3S8MA 1ZKMA 1VSUA 2WDZA 2Y67A 1H94A 2GN9A 4CV1A 3PZRA 4Y6RA 3WGHA 3ZV4A 1BXZA 5JPIA 3JSAA 3F5QA 4EEZA 4QEDA 1YXMA 2P91A 3SEFA 4Y98A 4O63O 1DSSG 1UP4A 1E3WB 3ETEA 1D3AA 5DZSA 1DB3A 1NHGA 3DO5A 3MJEA 3SLGA 3CSDA 3RI3A 1U7TA 3BMNB 5T8KA 3GDFA 5L7WA 2NU7A 4NPCA 3EYWA 4ZD6A 2NSDA 3KVOA 4YRDA 2FPPA 5F1KA 1JN0A 3P2OA 2AEMA 1YB5A 3F3SA 1ZNQO 2W2KA 5H82A 5DF1A 3PYXA 4O59O 2J3JA 4CMJA 1P1JA 5B4VA 4C7JA 5B1YA 3K6JA 1ZEJA 1ISJA 2FN7A 1JU9A 3GOHA 4EUEA 2CY0A 4OHUA 1I2ZA 4QO8A 4LRTB 1EVZA 3W1VA 3KLMX 5K9ZA 4W4TA 3ONDA 3LC1O 3OIFA 3WGOA 3PJGA 5CEEA 2VT3A 3LZ6A 5IDWA 1VPDA 3PK0A 1K5HA 2JCYA 3OJOA 1ARZA 3QSGA 5GY7A 4IJKA 3RUFA 4XJSA 1L7DA 1AE1A 3C24A 2ZQYA 1IHYA 3FBGA 4MKXA 4BOYA 1IOLA 2B4QA 4WJZA 4BO9A 4KDFA 3HFSA 5ICSA 5MGBA 3WX0A 4OMUA 3ZWOA 1YBVA 5KVVA 4GSKA 4GPD1 3ITKA 3UOGA 3AOEC 1EZ4A 4PVDA 4TKMA 1HDOA 1ISIA 2NU6A 2NQ8A 4FFOA 1BVUA 2ZYGA 4RCVA 3AM4A 3HSKA 3LVFO 5IZCC 2NM0A 4H3VA 1VI2A 1V9LA 1E6EA 1Y6JA 1LLCA 3KUXA 1BSVA 2E82A 3S2IA 5I7VA 1MFPA 2IZ1A 1E3JA 3TRIA 4NBRA 4A5OA 3F47A 3FF4A 1O0SA 4I9UA 5ENDA 4RO0A 1GD1O 3G17A 3RSHA 1GV0A 3F6YA 4JCOA 1XLTA 5G0TA 5TLSA 4I5GA 2BFPA 3DBVO 2HMTA 1EUDA 1RYDA 1BGVA 1LQUA 4BNHA 4EEXA 3HDJA 1GCUA 5HA5A 4WNIA 2E4AA 1QG6A 3LQFA 1QR6A 1SAYA 2C5EA 4IM7A 3C7DB 4PZEA 3HADA 3RUAA 5ITWA 1V3TA 2HSDA 2VNSA 4XQEA 1W4ZA 3WYCA 2PKQP 1RM3A 1LI4A 1DEHA 4BO7A 1WNTA 4RL6A 2Y05A 3FR7A 3JQAD 3KTDA 1IB6A 1CETA 4RF2A 3IQDB 4DIBA 2DAPA 5A3VA 4XDYA 3L4SO 4D3SA 2B4RO 4PLCA 4BO2A 5KJFA 3NDIA 4OSOA 1PL8A 2GCGA 1X1TA 3G79A 2VT2A 1E7WA 4BGEA 3VTFA 2X0RA 3DBLA 3H9GA 2CF6A 3WSVA 3E5MA 5IXSA 5K0ZA 2BRUA 1ZSVA 1I2BA 1AXGA 2PZMA 1X15A 4BNJA 4IY1A 1YDEA 1HE5A 3QWBA 4OXKA 2EKPA 1NX6A 4WEQA 2VHYA 3HB5X 3ANLA 3H9EO 2JHFA 4MINA 3A9WA 3ADPA 4XJTA 4FOOA 1DIGA 1DJNA 3GVHA 3ZU4A 1HDXA 2AG5A 3K96A 4WLNA 2X0JA 1O9BA 3NDRA 4LCEA 1BRMA 3I9NA 4CR6A 5H83A 3SJUA 3U49A 4BNXA 4LSWA 4TRRA 2GASA 2BI7A 3DXFA 4I5DA 1XA0A 4ITUA 4N5MA 3GPIA 4WLVA 3ENNA 3VPHA 1X7DA 1YL6A 2X5KO 4II3A 5JS6A 3PIDA 1HYEA 1VRWA 2V6MA 4N18A 5BNIA 2EKLA 1E7YA 1ZO8A 1OI7A 2DC1A 2H6EA 2W8ZA 1ZXBA 1GQYA 2AHRA 1B7GO 1HWYA 1Q2XA 1YBMA 4CMEC 1T2FA 1I3NA 2NU8A 4JXKA 4MIEA 4J43A 3I6QA 4XA8A 2Z5LA 3HFGA 3DMTC 1C1DB 3CMMA 4INAA 1XYGA 1VJ0A 2R00A 4AJ2A 3D5TA 2ZTUA 3BTOA 4NMHA 3ASUA 4WECA 2EV9A 1ENPA 1GYQA 1QYVA 4BNVA 4DQVA 4XZ3A 1LSUA 4Y8VA 5IDQA 2RHRA 4CQLB 2NNLD 3WMXA 3A1NA 1Y5MA 4BS9A 4AJLA 3D5QA 5JYEA 3BMCA 1ONNA 3LT4A 2QRKA 3HN7A 3OP4A 4IIVA 4KQXA 4PGFA 3L9XA 3PQEA 4IZIA 2WEKA 4FGWA 1NTOA 1JWBB 1Z75A 3C1OA 5DBIA 3DAPA 4RVDA 3JQ7B 3G1TA 4MP8A 4B3HA 3CINA 5EINA 3DTYA 2Q2VA 5COAA 2YV3A 3GK3A 1MUUA 3OHSX 2V65A 3IP3A 3TL3A 1ENYA 3QVOA 4CMIB 3I9MA 3JD4A 3I3OA 4BNGA 1V0JA 2DM6A 4UUOA 1DDOA 3AI2A 4ND3A 1ADGA 1E7QA 1N1GA 4MPDA 3OA0A 3SX2A 4FFNA 5AXCA 1JLLA 1EEHA 2DTEA 3SJ7A 2W90A 1PR3A 3F5SA 4U7WA 2BMAA 3SVTA 2ZCUA 5KKCA 2QW8A 5JC8A 2XF8A 1E7RA 3ZHXA 2JD0A 1UXHA 4XRRA 4E5PA 1OBFO 3BMOB 3JD3A 2WD7A 3FTNA 4PVCA 4G2NA 4Y67A 1J0XO 4NR0A 3G49A 4LVUA 4DLLA 3B20A 4OXYA 3ROQA 3PJEA 3VTZA 5U9CA 3RASA 4YAKA 1O95A 2Q50A 5BSFA 2XAAA 3AW9A 4BO8A 3ULKA 3AUTA 5KWEA 3FNHA 4OOEA 3PHJA 4CMBA 5KKAA 2VHVA 3GZNB 4XIJA 1DFGA 4DYVA 4UEJA 4ZA2A 5KVQA 3VKVA 2FPGA 2I9PA 3WYEA 2HKIA 4JLWA 3PGJA 4QECA 1SC6A 4NBUA 1YL5A 3NGLA 3SBOA 1C1XB 4E30A 2FY8A 3ABIA 5DOZA 2B83A 3W6UA 4CMCA 4MVJD 1Y8RB 4J7XA 1WDLA 4CLEA 1X0XA 4CLXA 4IQGA 4U6QA 4CM3A 1Y8QA 2V6BA 3TJRA 5JO0A 1T24A 1A7KA 3Q9UA 1EE2A 5G4KB 1VM6A 1J5PA 4J2OA 4P22A 4RPHA 3ZWYA 2YHIA 3VDRA 4CJXA 2JL1A 5A9SA 3H2SA 2D8AA 4YJGA 3ZHBA 2IRWA 5T67A 4JP3A 4IDGA 3QV1A 3U4DA 4ZQBA 2Y1FA 4TVBA 3P7MA 2DVMA 3T7CA 1BDMA 5L53A 4JJGA 5DCWA 2ZTVA 1UZNA 3ZU2A 5BSHA 3PYLA 3NEPX 1B15A 1DRWA 1R0LA 2C20A 4LVCA 2O3SA 2HJRA 1QLJA 4KWHA 1UAGA 4A7PA 4XX0A 2YZ7A 1PJSA 3WMWA 5JAZA 4JBHA 1R4MA 1LUAA 4RPGA 1GTMA 1DPGA 3EC7A 2P2SA 1ADFA 4E5MA 5ER9A 3WBBA 3DB2A 3EUWA 2PZLA 2NVUB 1SNYA 2O3UA 4J1QA 5FF9A 4JK3A 4YAEA 3E5RA 2CVOA 3PIIA 2RH4A 3AU8A 3U4CA 3JYLA 2I76A 4DWVA 1TB4A 5THQA 3X2EA 1EVJA 4B7UA 1ML3A 2WE8A 1KVTA 3C7AA 1KS9A 3Q11A 1FMCA 1FJHA 1U5AA 4DMLA 1DAOA 1GU7A 1GEGA 4IJVA 2UDPA 1H0KA 2FSVA 5TNXA 3GGOA 1T2DA 1PQUA 2FR0A 4CM4A 4ESOA 5KJEA 4D3DA 2GLXA 1E6WA 4J0FA 1IYZA 4FFRA 1MFZA 1ZCJA 4YJFA 4HWKA 2VZ0A 4XGIA 4FOSA 1BG6A 2EKQA 1N8KA 3OQBA 4MVJP 1FXSA 2AXQA 2VZ9A 5A5FA 4UREA 4J7CA 2HUNA 2EP5A 3G1UA 3ZNOA 2GZ2A 2CF5A 1FDTA 4R51A 2ZTMA 3RJ9A 4G65A 1T25A 3N7UA 2PGDA 4BMVA 2FOIA 4CUJA 4QFCA 3TZ6A 5FFFA 2JJYA 1P44A 1D4FA 2Q4EA 4WK6A 3X2FA 1H9BA 4RORA 5DDIP 1XDWA 4XR9A 4AJ1A 1YWGO 1WXDA 2HK7A 3AI3A 1EUZA 2AMFA 4IDAA 4LN1A 1C1XA 4E2ZA 3V2UA 2G1UA 3A4VA 4WKGA 1UDAA 3U4IA 3JQ8A 3RKRA 5EQDA 4BB6A 4BNWA 1E1NA 1S6YA 1PJCA 2JHGA 2PY6A 2XXBA 3WLEA 3RC9A 1EFKA 1DJQA 3CH6A 5FI3A 1GV1A 3MJCA 3WXBA 4A03A 2WTBA 3TOZA 2JAHA 2UAGA 5JW6A 1VJ1A 1MX3A 1LJ8A 2LDXA 2D59A 5U1PA 4CM8B 2E49A 2Q1UA 2C54A 1BTOA 2GRAA 1ISMA 1I36A 4DLBA 1HRDA 3D4OA 2UV8A 2AE1A 3OJLA 1V6AA 2ET6A 2GF2A 4PLVA 4Q39A 4R16A 2C2XA 3E9MA 2YQ5A 2OP0A 2JCXA 4O0LA 2CNBA 5DN9A 3QWFA 3E48A 1R4NA 3NTRA 3DONA 1DFIA 1LTHR 4R3NA 3WQRA 5LDHA 4H15A 2J6IA 3I9OA 1NXQA 5T64A 3KLPX 1LLQA 2YV2A 3HN2A 4BVAA 3I23A 2O3TA 4PG7A 3JQEA 8LDHA 1B2LA 5BR7A 1A9ZA 4CLRA 1U1IA 1V8BA 3GA0A 3BIOA 3GPDG 5KCZA 3JD1A 4OAQA 5COBA 2PNFA 1LDMA 1O5IA 4AJNA 1RM5A 3QWHA 3GVIA 4TMFA 5HS6A 3UICA 3BA1A 2RHCA 4CLOB 3ITDA 1W73A 2A94A 1P1KA 4RDHA 1NWHA 2O7SA 2FZEA 1B16A 2BHLA 2I6TA 2DBRA 3ZZNA 1LBEA 1ZIDA 4RGBA 1U8FO 2BFOA 2R00C 5GZ6A 4U5QA 3K2BA 4F6CA 2YW9A 4TRNA 2PGJA 3UCEA 1UP7A 3BMQA 2JD2A 4YQZA 1PZHA 1P1HA 3GNQA 3KETA 3L6OO 4I5EA 2VYVD 2WWRA 1WWKA 2P9GA 3WIDA 5A9RA 3PHHA 3QY9A 4UAGA 4Y9DA 3V1YA 3UHAA 4CV3A 4ALJA 1N7HA 3GNTA 3GUCA 1VE9A 3EGOA 4KZPA 4PLGA 2AA3A 3DL2A 1GYRA 4BKOA 4YRBA 4B3JA 2JKVA 3R6DA 3ZWVA 4L0QA 2FR8A 3F1KA 4KWIA 4A10A 4K26A 1U8XX 5KOIA 3MZ0A 2B5WA 3DBHA 3NT4A 3M2TA 5LDGA 3VVCA 5IZ4A 2W2KB 1A72A 3UH1A 3KBOA 1JKIA 1XCBA 4CQMD 4O1MA 2OOSA 1E7MA 4S1VA 5GZ3A 4E4YA 3RROA 2Q49A 2DFVA 1XG5A 3B6ZA 4M86A 1WLYA 1H6CA 2C07A 2WJPA 1NFQA 1ULUA 2BFMA 3DZFA 3O8QA 2WE7A 3TL2A 4Z0PA 3GEMA 4Q3DA 3DZJA 4RJTA 4ZU3A 4KOAA 3PJDA 1GQ2A 1HEUA 5ER6A 4E6PA 1D1SA 2AW5A 5JY1A 2Y99A 1ZJZA 4R1SA 3O26A 3L77A 3OA2A 4P4LA 3ZW8A 1YKFA 1U9JA 1O94A 4MVJM 2YDXA 1AGNA 1B14A 1P31A 4M54A 1EBFA 4XQ9A 1LC0A 3TDKA 1NQOA 3D7LA 1PGOA 2B36A 3GGGA 3HZZA 1WZIA 4NBTA 3ZN2A 2P4HX 4D79A 4KDEA 1L1FA 2NLOA 3S2GA 3GEDA 4W9NA 3CKYA 4J0EA 3FI9A 4LK3A 1P45A 3DZBA 3CPSA 5G0SA 5FYDA 5COQA 3W4KA 3DQPA 4K6CA 3DOJA 2PKQO 3U09A 1IL0A 4OQYA 4URFA 3NAQA 3C3XA 4K9DA 4IMRA 4XQGA 4FQ8A 1QXSA 3WJAA 4E3ZA 1F0YA 4YT2A 2P5YA 5GMOA 4XB1A 3D3EA 2VUSA 3GZ4A 3PQDA 4R41A 3BHJA 1U3VA 4CM9D 4EUHA 2WM3A 3LU1A 1WW8A 5CEJA 4YAIA 3H3FA 1EDZA 2GERA 2Y68A 4IXTA 4PZDA 4ZHSA 1BW9A 1UH5A 1DLIA 1HKUA 2BGMA 2PA3A 4FR5A 4AJJA 5C5IA 2QYTA 3L07A 3ZU3A 4NFYA 3FN4A 4YB8A 3UF0A 3WNVA 4BNTA 3OEYA 4WCFA 3ROPA 3PGXA 1NNUA 3GG9A 4YJDA 4AJEA 3JYPA 3O9ZA 4RDIA 1E77A 3DR3A 2RCYA 3RQSA 1LQTA 3B70A 2P68A 3FSRA 1CDOA 1DIHA 3PTZA 1TI7A 1G1AA 2FR1A 5CDUA 1HE3A 4I9NA 4RPLA 3ZWXA 3WTCA 4BKUA 8ADHA 4D45A 4WLUA 1NVTA 5ICMA 3L9WA 1YONA 1PTJA 4JGBA 3DBLB 4NIMA 4AFNA 4GWGA 2NACA 4ALKA 2W2LD 4UVDA 1RKXA 4Z3DA 3JQBC 1NR1A 3EZYA 4P4GA 2HLPA 3DHEA 1E1LA 3TNLA 4BB5A 3S2EA 4OKNA 2I3AA 2UUOA 4HBGA 4BMSA 3OQ1A 4O6VA 2BELA 3EK2A 4PCVA 1WAMA 2EG9A 2POQX 3V1UA 3I4FA 3GG2A 1N2SA 4D3FA 1UXGA 2WYVA 4PG4A 2O3JA 1E1KA 4ND4A 4B4VA 1CEQA 1G0NA 1GDHA 1PJ2A 1I2CA 3MJ4A 4PRKA 4RVGA 5JFOA 1DFHA 3WTBA 4DBZA 3RKUA 4CMHA 4Q9NA 5F1OA 1J6UA 1Y81A 2EIHA 1VJTA 1DIBA 1T2EA 3MCVA 4BUCA 1C0IA 3IMFA 3RU9A 1JA9A 2J8ZA 3DOOA 3VPSA 3GF4A 4BV8A 3D3WA 5I7EA 5IN4A 2X58A 2B5VA 2DLDA 4N5NA 2Y93A 5L51A 1LDNA 4J1NA 1HT0A 1TXGA 2X4GA 3UGKA 4AJIA 4BQRA 1K89A 5A05A 2BKAA 4JIGA 5THKA 4XYGA 5C7LO 4ALLA 1K0UA 4FBGA 2HAEA 4L76A 4LRSB 4OO3A 4EI2A 1E3EA 4A0SA 4BO3A 2IZ0A 3RD5A 1X1EA 3RCBA 4YA6A 5TT0A 5CG2A 1EUCA 4LISA 3VZRA 1NPTO 5TSDA 4FJ2A 1ID1A 4L4RA 5CDYA 5A04A 5JDIC 3ANNA 4CODB 5KIAA 3WFJA 1CWUA 1IHXA 3AOGA 3BYZA 3H2ZA 5DULA 5B4UA 3UN1A 3NTOA 5HS4A 3E9QA 2FZWA 1LSOA 3BMCB 4IQ8A 2V7PA 2GN6A 3WGTA 3QLJA 2C0CA 3HB4X 2PR2A 3OETA 2CDCA 1H2HA 2XXJA 4QXMA 1XEAA 2F00A 1B3RA 1PEDA 2CMDA 2WYUA 2Z1NA 3CTMA 4MIYA 3GR6A 4R1UA 2J3KA 4JP2A 3GAFA 2ILTA 3E8XA 4WCDA 4AL4A 1C3VA 1SB9A 3G0OA 3H5RA 2X23A 4I1IA 3GEGA 2NWQA 4ONEA 1PJBA 2VUUA 3AM3A 3CMCO 4R69A 2P9EA 4IQ0A 3F4BA 1NQ5A 1UZLA 2H63A 4BL5A 3W8EA 1VL6A 4BGIA 1D8AA 1RPNA 1XR3A 4EJMA 2EWMA 4TZTA 5A4DA 3IDSA 5F5LA 4J16A 3GUYA 1PU2A 2VN8A 2Q2QA 4WLEA 4KMSA 1X13A 3UFXA 2CZCA 1GL3A 3NJ4A 4NJMA 3ZWBA 4E5YA 3TZKA 4ZICA 2QRJA 1KERA 2EJWA 4IIUA 4PLTA 5B12A 5BSGA 1NASA 5HRUA 5BT9A 2OHXA 1DC3A 1HETA 3R3JA 3D0OA 2WD7B 3ONFA 2QIOA 3NYWA 4ZVVA 1Z45A 4WLOA 5JCXA 2YQ4A 2J5QA 2EW2A 2Y1OA 2P9CA 3L4BC 3OIDA 3VZQA 2PTGA 1W8DA 3DHYA 4NH4A 4ZGWA 3EAGA 2DU8A 2OBYA 4ND5A 3ASVA 2J5RA 4DC1A 1SCUA 2B37A 3L0DA 5TF4A 2CFCA 4GL4A 4MVJH 3VH1A 5IJZA 4J91A 3RAJA 1X14A 3KYBA 3AUSA 4BGVA 3NT2A 4KUHA 1MP0A 1Q0HA 4GWKA 2P4QA 4XYMA 2GGSA 3DBRA 2WSBA 4RF5A 1SEPA 1S7CA 2BLLA 3JQGA 2NTJA 1V35A 3QJ5A 1I3LA 4NFSA 4YEDA 2G76A 4B8WA 3WJ7A 5JDCA 3RWBA 1LDEA 2Q3EA 2DBZA 2EJVA 1Y8QB 4PLHA 1PZGA 4K6FA 4R3WA 5TC4A 2O48X 4FPXA 4L9RA 1Z6ZA 5DP2A 1QRRA 2YJZA 2YHIB 2X0NA 3GRPA 2UYYA 5I8ZA 4CLDA 2X7HA 3HDQA 3UAGA 5A9SB 4YJGB 2X0IA 3TZCA 4DIFA 4M87A 4MJLA 3DOCA 1KEUA 4MVJE 5AVOA 3R3SA 1Y1PA 2GD1O 5T6BA 1A71A 1UDCA 2QQ5A 1ENOA 4ZRMA 4NK4A 1ISGA 1EMDA 4GSLA 3PFFA 4MVJA 3LF1A 4NBWA 4BNMA 4OYRA 1JAYA 2I3GA 1IZ0A 4BNIA 1GZ3A 3GMDA 3INTA 3VPXA 3ZWCA 5L4SA 3EY4A 5KJ6A 5ILGA 1R12A 3I52A 3PFWO 1ZFNA 5EL0A 1TT5B 3EHEA 1R4MB 3FWZA 1ZSNA 2QZZA 5A3JA 5DBFA 1LRKA 1ZUD1 2AQHA 3JQFC 3LT2A 2Z95A 3VHRA 1R66A 2VWPA 3JTMA 3M6IA 4BNKA 3VOSA 3IJRA 2HQ1A 4BO6A 5AQ1A 3RBXA 2BH9A 1XELA 3HNPA 3K73O 4OSPA 3JYOA 5L9AA 1Q7BA 1T26A 1MXHA 4FSHA 5AXBA 1VC2A 4KTTE 3F1LA 2CVQA 3TFOA 1MC4A 2O3QA 1KBZA 2GNAA 3FCOA 3GHYA 4NDNE 1Z7BA 3NKLA 4E13A 1DC5A 1HLPA 2D2IA 3IKVA 2BD0A 3MJTA 2UUPA 1WVGA 3QVTA 4DL9A 3IC5A 3DZIA 3Q6IA 1MG0A 3NJ8A 3ZWMA 4CM4B 4MVJI 1LNQA 1ZMOA 3ANMA 1ZJYA 1ZK0A 4YJFB 4MVJG 1XWFA 2HMUA 3GY0A 3VPFA 3TFQA 1PWXA 4J9UE 1RWBA 1M6HA 1M76A 1Z82A 5A06A 3IP1A 1FDSA 1E3LA 3JQ9C 3Q1LA 3STHA 4BKPA 2AE2A 1XU7A 4YAJA 4FCCA 3C1AA 1O8CA 4ALNA 4DGSA 1P3DA 4RPJA 3GDOA 3KHUA 4BNUA 1YO6A 1RYEA 4TROA 5C7IO 1BMDA 2AEJA 5JMPA 1R6DA 3H9JA 3TZHA 3LT1A 1CYDA 1K3TA 3PQFA 1FDVA 3JQ8B 4GI2A 4OM8A 3M1LA 3PEFA 4X54A 5T8KC 3K5PA 3GN1A 1I8TA 3VC7A 1E5LA 1YOVA 4Z9YA 3RUCA 1TVEA 3WIEA 1HYHA 4DTIA 3DDNA 3P2YA 1F8FA 5JC1A 1KY4A 1HZJA 3WGGA 3NTQA 5K6AA 1HDZA 4JJFA 3KYDA 3WGIA 2VZ8A 3OIGA 1R16A 4P8RA 4XRGA 5JAIA 3E18A 3KOUA 3WWYA 3Q0EA 1U4OA 4RVFA 5DT9A 5L95A 2IYPA 3KYCA 1A27A 1LDGA 1VKNA 2CDAA 3ZW9A 3H65A 2Y1GA 1R4NB 3DC2A 1QORA 3WR5A 1TT5A 4LCJA 3BXXA 3OJ0A 5L4NA 1XHLA 4A26A 4YR9A 4OIMA 3WS7A 4QFDA 1JQBA 3F9IA 3C1TA 1EK5A 2OORA 2D4AA 4CLRB 2CD9A 3JQ6A 3BAZA 1PJ4A 1KVSA 5JMWA 1HLDA 3K8ZA 5TJ9A 4E33A 5JBIA 1DIAA 4WEOA 5L4LA 4ILKA 4UULA 1TA4A 1R15A 1X7HA 4P4NA 2W4QA 4IINA 1UZMA 4TSKA 4DMMA 1HL3A 2NUAA 3PZBA 4CM1A 2AG8A 1H9AA 1U3UA 4AJHA 3NDJA 5ITVA 5IFLA 3BMQB 2YYYA 4IS3A 1Y9AA 5ENVA 2DPHA 1T1RA 3INGA 4DPLA 4IDCA 3GVPA 1HDRA 1XQ6A 4G5HA 1G6KA 1SOVA 1YGYA 4TRMA 3ZNQA 3I6IA 4E2WA 2IDZA 2RAFA 2BF7A 4KUEA 1ADBA 2I65A 3WQQA 3LC7O 2ZB3A 5IF3A 3RC2A 4JNKA 1PIWA 3ZV6A 4CMAA 3GRKA 1H6AA 4AJPA 1OZAA 3QRWA 4PLZA 4EITA 2EEZA 4HADA 2BFAA 5CDTA 1IZ9A 3JQDA 2EW8A 3AOEA 5T5QA 3DBHB 4RF3A 4J4TA 3DZKA 2FMUA 1DC6A 3IOYA 4HFMA 3UCXA 5IZCA 4CR7A 3BHIA 3UVEA 2VYVA 4RVUA 1YQXA 5BNFA 1JVBA 1Z73A 1MA0A 4J2HA 4XYBA 2AEFA 2QX7A 4I9HA 4B79A 4GX5A 4RV9A 4L4XA 2PFGA 4UVHA 2GYYA 4IDDA 3O8QB 4OL9A 3ONEA 1UXKA 2JFHA 2O7QA 4FC6A 4MP6A 1ZBQA 5F3RA 3A06A 3ZI0A 5J23A 1PJLA 2IEBA 3LDHA 5T57A 3MTGA 4HNGA 4IS2A 4LMPA 4ALMA 5I7FA 2QG4A 3FNFA 2WD8A 1AN9A 1DRUA 2QZ9A 3JCZA 4Q3BA 4BNLA 1ONPA 4CQMA 1K6JA 1JAXA 2O2SA 1JWAB 2VYND 4UVEA 4DVJA 5FWNA 4B3IA 3ROMA 1KYQA 3RJ5A 1FDUA 3LSYA 1MB4A 1Z74A 3HWRA 3WWZA 2OFPA 4DXHA 1NWCA 3PHLA 3ZNPA 4NG5A 1E92A 1W0CA 4AVYA 2X5JO 1GZ6A 5U4QA 5A1TA 1SPXA 3ICPA 4GKBA 4CPDA 2ZB7A 4BNYA 3WICA 1C0KA 3GN2A 4AG3A 3HJAA 3C85A 1N7GA 4XGKA 1H93A 5A03A 2VOJA 4B4OA 3IUPA 2IZZA 2ZCVA 4RQUA 3WYBA 2BGLA 2VNAA 5IG2A 3QWIA 1SOWA 1HDCA 3CEAA 5A9TA 4PIVA 1JKFA 4EDFA 2D5CA 1TLTA 1TT7A 4J4BA 1F14A 2FWMX 4J4HA 3PDUA 1BXGA 4YXFA 1KC3A 1NFFA 1BW9B 3PWSA 3JV7A 3DMYA 4N5LA 3QVXA 1N9GA 4CUKA 1SEVA 1RM4A 2A35A 2HMVA 4RVSA 2YUTA 2VHWA 4K1LA 4YJHA 1YJ8A 4C4OA 1B8VA 4WCFB 5F1PA 1K6XA 2GUGA 3HHPA 3OM9A 4TZKA 5G2OA 4P38A 2QHXA 3FPLA 5IDYA 1SO8A 1M2WA 3MOGA 2ZB4A 3LC2O 1DOHA 4XB2A 4ZJUA 2NVBA 4QX6A 3LLSA 4B4WA 1TEHA 2Y66A 5TT1A 3TPCA 3O03A 5JAMA 3WQSB 1LRLA 4TQGA 2Q4BA 4IDFA 4XEHA 4GQAA 1KEVA 3QIVA 4FDAA 4FJ0A 4Z6KA 5A5EA 1QKIA 1Q7GA 1I30A 2XOXA 3OICA 3H4VA 1PL7A 4TRJA 1KEWA 3BTSA 2XPCA 5CPBA 4CMEA 4PFJA 4F6LA 1KIFA 4FD3A 2WYWA 4DA9A 2X5OA 4HY3A 2QRLA 5TJHA 2YFQA 3DZHA 4YT4A 4GGOA 5JLAA 2HDHA 3L6DA 4ZQFA 2B4TO 1H5QA 2CDBA 1IUKA 3I5MA 3ZH2A 5AXDA 2Q1SA 4GH5A 1MC5A 4J1SA 1NHWA 2IODA 4WNCA 2B0JA 5TGDA 4F3YA 5BNTA 2Z1MA 2ZYDA 3AK4A 4FC7A 4HFNA 2GN8A 3A14A 3QW2A 4ZRNA 4FW8A 3T4EA 3Q2KA 2D0IA 4QUKA 1KOLA 5CDSA 3VH3A 3D3WB 1VL8A 4FN4A 2VHXA 4HP8A 4DQUA 2G17A 4B7CA 1IY8A 3GFGA 3WOHA 1RM0A 2C5AA 4HFRA 4Z0TA 3QHAA 3SC4A 4YTEA 5JO9A 2ZK7A 1P33A 4LMRA 1HXHA 4GGPA 3H8VA 3FBTA 4TVOA 2ZQZA 2DKNA 4Z0HO 4AJOA 2OMEA 4LGVA 2Q46A 4GLLA 1QSGA 2PD3A 4JBIA 3U0BA 2C29D 4N7RA 4YQYA 3EVTA 3WB9A 5ADHA 3FTPA 4QT0A 1ZW1A 3F46A 3D4PA 2X9VA 1MV8A 1F12A 4RZIA 1ZK2A 3G3EA 5JSFA 1ZK1A 5TX7A 3VPGA 1QLHA 3ZU5A 3MEQA 4XYLA 3V8BA 3TN7A 4YPOA 3CZRA 4IDBA 4DPMA 1E6UA 4I8XA 2CUKA 2Q2WA 3M2PA 1ONOA 1MG5A 4BO0A 5DCYA 2G0TA 1D1TA 1P1FA 1HE2A 2RH8A 4OOFA 5JCJD 4J6FA 2O2YA 3MOIA 4OKIA 2O4UX 4BNFA 2VRCD 4XR4A 4FB5A 3VAZA 2AQKA 1ULSA 2TMDA 4E2YA 2X9GA 5TQVA 1YE3A 1ZSYA 3GVCA 2ZKLA 3EW7A 3ZWWA 4CM6A 1PS0A 4D46A 1CRWG 1WDKA 5I9LA 3IKTA 3B1FA 4E0BA 1YS4A 1GUFA 4YT8A 4DQXA 1XU9A 4UUMA 4WASA 4YVFA 1PQWA 2X6TA 1CIVA 4XYEA 1N92A 3JQAA 5L7TA 3B1JA 3PJFA 4NJMB 1R0SA 4YT5A 5B4TA 4BV9A 3QP9A 4IZHA 4Z9XA 5AYVA 2Q45A 2GDZA 1N5DA 5G0VA 4B4UA 3I4CA 3HG7A 3TQHA 3GNSA 1YJQA 3RUHA 1J49A 2D1YA 3TWOA 5AOVA 1CJCA 4HXYA 3RC1A 2SCUA 3OQ6A 2A4KA 1P0FA 2PZKA 4JBGA 1Q0QA 4NI5A 5DCUA 1F8GA 3AY7A 3DTTA 5LCXA 2EP7A 1C14A 5H81A 2NU9A 3RBZA 4GAEA 1WDMA 4Z3KA 3NT5A 2EGHA 4HFJA 1UR5A 1HSZA 1NVGA 1T1SA 3IS3A 2PD4A 5JY6A 4BNZA 3DFUA 2C59A 3R1IA 4N54A 3S1LA 3U3XA 4R1TA 1T4BA 3DBRB 3MJVA 3FHLA 1LLDA 1E0DA 4UUPA 4EYEA 1ZEMA 3WLFA 1LDBA 3JQGB 4FIZA 4KUGA 3JYQA 1IPFA 3RVDA 2VWHA 1PSDA 1UXIA 3IUSA 4OXNA 3RFTA 4UVGA 2HCTA 5L3ZA 4AJ4A 4QTZA 4Y6SA 1YH3A 1JKJA 3E9NA 1NVMB 4WGGA 3W6ZA 5CHEA 4ZQEA 3WGZA 3OMLA 1EQ2A 1Q7CA 1PGNA 1YB1A 1ISFA 4L74A 3S55A 1EK6A 4PN3A 3Q3CA 1OMOA 2G82A 3W4IA 1GUYA 3H3JA 1BHSA 2IXAA 3PLRA 3GT0A 4XCVA 2D5AA 2J3HA 1M6WA
chains in the Genus database with same CATH superfamily
3KWFA 1D0VA 1FUIA 1EZZA 2CWWA 3AFNA 2QGNA 2Z57A 3U3ZA 3USZA 5E6RB 2RI0A 2J3EA 5JD3A 3WGQA 2CNOA 3P2KA 3BN3A 4IJMA 4JYBA 1THZA 1RHKA 3FWHA 3HL0A 2F8TA 3K9QO 2W42A 1MJ5A 2CCGA 1CRLA 4OEHA 5JZOA 1HDIA 1O6ZA 1Z33A 4B8ZA 2R11A 1RLMA 2F1KA 5LMNB 2EBHX 1XHFA 1RWMA 1LLUA 1QRTA 4L9WA 3RSSA 1NOKA 3U4MA 5EPOA 2B30A 1NBMD 4RIGA 3K9GA 4UBOA 1QGED 1COZA 1CR2A 3LFUA 4QU9A 3T35A 5HTOA 3PI7A 1B3BA 2XDAA 1O58A 1U5CA 3CX4A 4NQZA 4DT1B 2NQTA 1DAGA 2PWBA 3RJZA 4LGCA 5L3VA 2CXNA 5DEOA 1GKIA 3GLGE 2IV3A 1JE0A 4W5RA 2BJHA 2HK8A 4WT7A 3VSBA 4BPBA 2CVPA 2OCIA 1ZYUA 1M54A 3LPCA 1L5QA 1L4KA 1OWNA 1HO3A 1B41A 4TL9A 2W71A 4FR0A 5LYJA 1YASA 3NKFA 1CK4A 1J70A 2GKGA 1J33A 2NTVA 2IKSA 2ZZKA 4M8LA 2XAUA 4PR3A 4Q82A 1Q6YA 4TXJA 1YOBA 3SQLA 4GW3A 4AY4A 4F72A 5CCXA 2R48A 2P7IA 3G85A 1VCIA 4YI5A 4CV2A 1IC6A 1T2VA 4Q19A 5BW5A 4EA6A 1HFKA 3BH7A 3KRTA 2I5PO 2GZMA 3NHYA 1PR9A 4NYIQ 4QWWA 2VJBA 4TTAA 4BQFA 1FNMA 2ZVDA 3IIMA 4OATA 4PPFA 5AM1A 2X4IA 5IAGA 4X44A 1KKLA 2ZAIA 1U8UA 1KIMA 2H1HA 2C0PA 1FNBA 4GKVA 4J49A 4C7OA 2OD7A 3K5HA 4TV9A 1TF5A 2I34A 3RYTC 2IUUA 1VLLA 2VHEA 4IIDA 3RABA 2J32A 4F2PA 4KEAA 2FQWA 4XQCA 2XTZA 3I1YA 1Z56C 2O1EA 1T5OA 3IP5A 4OGKA 1IPEA 4TVKA 5IJWA 2ZYSA 1SXIA 1EEXB 1E2DA 1E1RA 4IUYA 5BWMA 1WCWA 2NP7A 3FNIA 1FFGA 1Z4LA 3IXMA 3MT9A 4G1UC 4IV0A 3ADOA 4L5IA 4QUGA 5DNYB 2I71A 4JEUA 1AF4A 3AEYA 3OZUA 2IPXA 3SNHA 4FLMA 3LRTA 2KJQA 1E2LA 3CZCA 2FSHA 2H0RA 2VOEA 3TUJC 2F3RA 4Y18A 4F5WA 3RRMA 4Q3NA 4QOFA 1I5RA 1OPXA 5C1IA 3REFA 5FOWA 1OHHD 1DEXA 4F3CA 4TYYA 1TUGA 3GCDA 5JYDA 1Z63A 1OFUA 2QLNA 4ZC1A 1E9DA 3PNKA 4RKRA 4ARBA 2ZYIA 4JB0A 4J3FA 2A1UA 1T5BA 3AEKB 4XDZA 1GRRA 4AKGA 1MEEA 4BN5A 4AY2A 4L8VA 4A2QA 1RXYA 2ZJ0A 2AXEA 4M0MA 2YWCA 2FP4A 4BQPA 1GKLA 1QMGA 4L4YA 3UXMA 4F45A 4P58A 4RSHA 1M72A 1DMSA 3WMEA 2C4VA 3FR8A 4O4JB 3LT0A 1T9KA 2ADOA 3VR2D 5MFPA 2RGCA 2K7FA 1JMKC 2G08A 1EWVA 4BAZA 4E32A 1RQXA 4F4HA 3VGJA 4YCAA 1ISHA 4WESB 4D8UA 4XDGA 4URXR 2IEZA 2LIVA 5D7NA 3MUNA 1HQYE 2NV6A 4V2IA 3EIFA 3ZDFA 4IJUA 1C7JA 4BQEA 1RU3A 3B3JA 1ZD3A 2PGAA 3L18A 3TNJA 5B3JC 3MELA 3KOMA 4LGMA 3HDHA 2PZAA 3B3QA 3E81A 3HCFA 4JBXA 9LDTA 2JEYA 3Q9LA 4ZMRA 1F3LA 1K2WA 2I7DA 3A1TA 1D2GA 2Q27A 1ORWA 1XTSA 4KK4A 1X38A 4UM8B 1BDBA 1QFSA 4KO4S 2VL7A 3P19A 5TRTA 4PR0A 1C8BA 3HWWA 3OCUA 2WJVA 4CI0B 3C5CA 1T5DX 2HIGA 4I7EA 1J24A 4HYQA 4MKRA 1M5TA 2BSQA 1KE2A 1G17A 1N78A 2CV0A 3JZAA 4M9RA 4W9NC 2G9RA 1FY2A 4C4PA 4DV7B 3HDVA 1P6UA 4KR7A 3IL2A 4X41A 4M76B 4FGZA 3ORFA 1MJGA 5GINE 1ANKA 4I6EA 3V4ZA 3ECSA 4K6MA 4LTDA 8MHTA 3O2JA 4PRLA 5LC1A 4JX8A 4BFVA 4KXFB 4MLDA 3BL8A 5E2AA 3EC1A 2VWQA 2DLNA 3IIEA 1DAFA 1W93A 2GESA 3A4MA 1CSEE 3GEEA 3GMTA 2OBBA 3BE5A 3H5NA 5A6VA 4RF4A 1IY2A 2CXRA 4AN4A 2RGNC 1USGA 4D0SA 3KEQA 3CCFA 2R6R1 1ZGJA 3CBGA 2RKWA 3GU3A 3K0FB 2WG1A 3W8RA 3ZHYA 2FWIA 5K3CA 3NDBB 4A8JA 4YS6A 1YC5A 1ZK3A 3AH8A 4P53A 1NW3A 5EWJB 1EQAA 3NGXA 1TTHA 4NNJA 1YZNA 2WWYA 1SC3A 2VVTA 3R2JA 4L95C 3UIEA 3JYNA 1H2AS 4JLDA 3KE9A 2X1HA 1HK7A 4C01A 3QE2A 4XD7A 4Z7NB 2FK8A 4MRMB 4ZOEA 1SUBA 4BTLA 2QORA 2EJTA 1F8XA 2YFHA 1Z6YA 2Q3BA 5FLKA 5IM5A 3YASA 4LV6A 1AKUA 3BCRA 4XWYA 3O4RA 2CXTA 3BILA 1JHDA 1JU4A 3DHNA 1E20A 5BNWA 1T36A 5L7YA 5DLPA 1TKBA 5FX2A 1EH5A 3M5CA 3OEWA 4PG6A 1SKAA 4FEAA 5EE0A 3DFKA 3WFZA 1TW3A 1C0PA 1G20A 2OGSA 1HE4A 3JWGA 1ST2A 1LGYA 4B9AA 1NPYA 1KTIA 3EG9B 3CVVA 1H2FA 2HYIC 2ZBRA 4MKGA 1F2VA 2DFNA 1UPAA 4HWTA 2J3IA 1FK8A 4MDHA 2DULA 2FN3A 3ZTTA 4H3KB 1YU6A 2NZYA 2OL4A 2CVFA 2I91A 2DHDA 3RAGA 5JATA 1P7WA 3O8CA 4Q1DA 1QIIA 5FI0B 1NG9A 3WIOA 1NQUA 2VHTA 3UYKA 2ID7A 2EDAA 3OOSA 3ZIDA 1W5BA 1MPXA 1TAQA 1EUYA 1R00A 3GLQA 4KQCA 3Q6NA 1HYBA 2IYWA 1HZZA 1SUIA 1UUFA 4UBIA 4IUBS 5HMLA 2Q1YA 2XOEA 2OO3A 1LRJA 2P35A 3KVVA 5HILA 4DYDA 2IX3A 3T7EA 4OLBA 3A6HA 1OBVA 4BB0A 3GOQA 3PSAA 3SG0A 4CQMB 4JZKA 3EIQA 4H31A 5B1DA 3WRVA 3N74A 1NAIA 2PYZA 3B5EA 1JIQA 1PBTA 3I9LA 1DX4A 1LS1A 4FYKA 2VJCA 1QDEA 4JV5B 3DMDA 1L7RA 3RSQA 3PEWA 5G4LA 1I1OA 1NSYA 1P2BA 4R54A 2FPIA 2OFFA 1V2HE 1CR0A 4DF3A 2ODTX 2ISQA 5DKFA 3EJ6A 4EB6B 4C14A 4D0NA 3DYIA 2O2DA 4PC7A 2DPXA 2WV7A 3CG4A 4YP5A 2V6FA 2MSCB 1D0IA 3H42B 5CPFA 3UMRA 5C32A 1ZRMA 1NW9B 4YPFA 3D0RA 4QG7A 1UKYA 2DPLA 5AKIA 2Q4TA 4W82A 1X0VA 3HLTA 3TEJA 1S3GA 5DISB 4Z0NA 3GAZA 1SVOA 2J4FA 4MPJA 4DHEA 3ZD7A 1U7PA 1ND5A 4UEOA 3TZEA 2VLBA 1KR5A 4Q4CA 4HZIA 4P2BA 1Q0LA 2QN3A 2Z6VA 3OQNA 1C0LA 1JG7A 3C3JA 3L6EA 2XCQA 3V8MA 4F8JA 2CBXA 4D56A 4DSTA 3DAFA 5IKOA 1F20A 3LTEA 4B6EA 2F7SA 2GI4A 3VKUA 5T4BA 3EZLA 3E35A 2QRVB 4MB0A 3GGPA 1SU4A 4CMIA 3OY7A 2ZSFA 4YAGA 5AKJA 3OHMA 1I7SB 2FUCA 4YWJA 1YRYE 2DPYA 5ALXA 1D1PA 3RS0A 2C9CA 2DQYA 2DJIA 3QPBA 4UBNA 1YQGA 1CYEA 3C4VA 2QM7A 3RFFA 1IY9A 1G21A 2VK8A 4X3OA 1I10A 4ZPXA 1BXKA 2H4JA 3R3HA 3VR4H 2DUUA 2I6QA 5FAXA 1C9MA 3ZWAA 4KQ9A 3EWNA 4NZ9A 1ADCA 1LA2A 2V7QA 3OF3A 1QB8A 2A6PA 3Q5GA 5KNDD 1YR6A 4Y0AA 2OXIA 3LPNA 1T8UA 4K0KB 3B78A 4PC6A 3PG5A 2VXYA 1ZOIA 4R01A 4BNNA 2GM3A 1G4HA 1E3TA 1XEFA 2ZBEA 1JHPA 4B3TB 3G23A 4WHMA 5DTJA 3ZVNA 1MXFA 3FPCA 3FPSA 3B7PA 3PQ6A 3ZHTA 4HV4A 1DHTA 2CB9A 2I6FA 3RR2A 1N9KA 2PQ0A 3JD0A 2M6SA 1V48A 2RONA 3I92A 2ZVJA 4OHPA 4K9MA 3HO8A 1Z4QA 5K20A 3U31A 5AW7A 3ZY4A 2DYKA 4IIJF 5IANA 4OQQA 3MGAA 2Q3JA 5ALWA 5JE8A 5KOHB 3EEOA 4XWOA 1Z7EA 4AXXA 1L4BA 2H1LA 2DQ4A 3VR4A 1GY8A 1XZPA 1UEIA 4ARZA 1AV7A 2FWRA 1Y1RA 3COSA 2C2YA 1L5HB 5T3YA 4IDPA 5EE5B 4H1WA 1BCSA 3U4HA 3BF7A 4WXMA 3WL4A 5AK4A 3FAKA 3BWMA 3ESBA 3IMKA 4L4ZA 3ZV3A 2QP4A 2R6JA 4RLHA 3VDQA 2DBQA 3AFMA 1GYPA 3H5IA 1MNAA 1IEXA 4AIIA 3TX2A 3A05A 3ZGYA 2KQUA 4FOPA 1XZGA 3FNQA 4K9RA 5BQ5A 3TOVA 1M2GA 1ST3A 4EBFA 1H2WA 3S28A 4EY7A 5KTRA 1JFSA 4I99A 2WIKA 4JSTA 5G4KA 4CM5A 2OP1A 1V5FA 4LZPA 2RBEA 4G1MB 1BWPA 1YR9A 4OSEA 4D9NA 4MOWA 2RI6A 4YDQA 1CQXA 4P0TA 3OLXA 5JD6A 1XDSA 4KYIB 1LD3A 5D87A 3HH8A 3MG9A 3VO1A 3GP8A 3SHQA 1EFVB 2A5FA 2ODWA 4GVLA 1FBNA 3W5DA 1JW9B 2KMLA 3WDSA 2IUFA 2QUAA 3JAMA 3R44A 4AZ0B 2I4MA 3ZJUA 5BSEA 5BOSA 3UY4A 4JOQA 2V74B 2IEDA 4W8OA 1Z4KA 1V1RA 4ED9A 3PQ8A 4M0EA 5FPSA 2K6GA 2PEYA 2ZPUA 1GVHA 3IQHX 3PUZA 3OH8A 4A92A 4IMJB 4WPGA 2HLDD 3BEDA 5IX8A 3C45A 2ZRJA 4NL4H 5FYQA 1ZRSA 3ICWA 3K92A 1PUXA 4V0KA 3BF8A 1Q19A 4JZYA 1XNRB 1FA9A 4FX5A 4NPAA 1PGPA 2G06A 1U31A 3NUGA 4L7QA 4QRHA 1V5GA 2R65A 2XQGA 4L4SA 3KKQA 5FUVA 4QG3A 3NKVA 3UJPA 4G8JA 5EMHA 1L4MA 1PL0A 2YY7A 1NN5A 3QH4A 4IJ6A 2ZWOA 1XGKA 2NADA 1SGWA 2WF9A 3D64A 3JD2A 4EFKA 2Y9MB 1EGVB 3FHTA 2WF8A 1R0CA 2EATA 3HQ4O 3QPVA 3TLCA 1JDVA 2KE5A 3TLKA 2Y0EA 4CEHB 3L8EA 1WXWA 3M4JA 3KZKA 2F3PA 1YB4A 2EFYA 4CM9A 1GR1A 5GV7A 5CLJA 1KAHA 3L4BA 5EXSA 1NYTA 2R60A 3SEAA 3RFXA 3M81A 1J09A 4MB6A 1D7OA 1PJ3A 1BE1A 1VBFA 1ESNA 2KS6A 3OE7A 3HGTA 1NJ1A 3AY6A 5JD4A 1DBVO 2NP6A 1Y5LA 2B3TA 3ZR4B 1UMCA 3DE3X 3H5LA 3LK6A 1SD2A 1C5KA 3DVAA 1PVDA 2O1WA 4KDRA 4WAUA 4A2CA 4AYXA 1THGA 2G04A 2P78A 2PQMA 4PYQA 4FM9A 5C8YA 1I4WA 3QE3A 3IEKA 1W46A 3BGVA 4K9LA 2JGMA 3TNYA 5LD2C 3PXDA 2E4VA 1RRPA 2H9IA 5I7SA 1NJSA 3HKEA 2OUIA 4P3PA 2EJCA 4DCVA 1EHYA 1I2MA 3NFYA 4M89A 4WE3A 4OV6B 1SXPA 1JSXA 3T9FA 3T99A 1KAGA 1W85B 2F3TA 2P4UA 2VKTA 3ZQ6A 4JB3A 1RMYA 5JAPA 4NOJA 3OT4A 2WK1A 2WWXA 1PYDA 1FUEA 3LP6A 5F4ZA 1QU2A 2PUVA 2IZ5A 2W4IA 4WINA 4BMNA 1PW5A 1BWSA 2HHLA 2V5AA 3B9BA 5JHHB 1E4VA 9LDBA 5LUBA 4KXWA 1JFVA 2CJWA 1AKQA 3RRZA 4F93B 3KR0A 1OLXB 1NKTA 4EZBA 2QTWB 4YH1A 4PYIA 3T9DA 3ZYZA 2ZUFA 3V8QA 2LBPA 4Y6LA 2JH8A 4G84A 4EHJA 1GA6A 1GFZA 5IC5A 4OH1A 1BAPA 1OASA 1PTKA 1U3TA 4H9GA 1ZGHA 4PIPA 2P6RA 4NCXA 3Q3EA 2IXGA 4B80A 1I4LD 3RV4A 2WRZA 2ZROA 4JVNA 4KFCA 2TMGA 1PS8A 3AVYA 2BN4A 1T6BY 3K2EA 4OQZA 1R0KA 3DQQA 3TW6A 5CDGA 5LJIA 4DQKA 1RHUA 4UUQA 3JQFA 4UUMA 3MJHA 3HE3A 4ZYWA 5B1HA 1EWYA 1B8PA 1NF2A 1T1JA 4EM6A 4MA4A 1ZN7A 3C7TA 4B32A 4RTLA 4CIWA 5I45A 2O8BB 3PHGA 2C00A 4HEQA 4YYZA 3TUIC 1CJKC 4HQRA 4QYIB 2HQBA 3OJEA 1N25A 2G7MC 3P5SA 2ESRA 4QGAA 5BWBA 1FJGB 4JEHA 4PBRA 4KQIA 2PMKA 4D2IA 1JKJB 1T29A 4AMUA 4BX3A 4QJ4A 5BT8A 1P8AA 3W5VA 1EVYA 4Q9JA 5CJJA 2Q3DA 2QUJA 4PNPA 1GQQA 3VH2A 2AFRA 3PWKA 5DHUA 1JDNA 3VKWA 5KMGA 3I2KA 4C89A 5EQFA 2PCJA 1HDYA 3DLBA 1CP2A 4XB6B 5A7GA 3JR7A 3PUHA 5JYBA 4FZ3A 2OZLA 3DNMA 3LNCA 3QVWA 1PGJA 2Q7DA 4EK9A 4TT3A 3S40A 2BFEB 2DH5A 3SMVA 3E2PA 2Z9BA 4OB7A 2NYUA 5E9WA 3TEMA 5IT4A 5JLJA 4B2PA 2FEXA 4EYQA 3VDMA 1E3IA 5B6IA 4TTQA 4URUR 3WZLA 3A1WA 2N1MA 2W6IA 3DUFA 2V9PA 3Q2IA 5EIOA 5ICFA 4ZPJA 3ESCA 5ADVA 3KB2A 3KEOA 1RPAA 3FZYA 3I9KA 5E6SB 4C4YA 4ENWA 3S8MA 3HYLA 2OB1A 1TYDE 1KKUA 3IO3A 3AHCA 5D6OA 5KU1A 2REQB 1G291 2AS0A 2J45A 2VATA 2ZIGA 2Y67A 3A31A 2C2ZA 1Z0AA 3EA4A 1MT3A 1H94A 4V38A 1BMFD 2D7CA 4FMCF 4EJSA 3MBIA 1VKJA 1J0AA 4RY9A 3WGHA 5JPIA 1SXJC 3ZV4A 4C29A 2B1QA 4HDMB 2RB4A 3OQVA 1STOA 1BEZA 3WLHA 1F4PA 1UP4A 3SFZA 1IN4A 1LBTA 1D3AA 3ETEA 2XMQA 1ULBA 3BVPA 4ER3A 2WJIA 3MJEA 3G13A 1R1DA 2ECOA 4EHKA 3CSDA 1PV1A 4PFKA 3R3UA 3R5XA 4IOMA 5TV2A 4A8PA 4ACBA 1RQ2A 4L2IA 2BT4A 2I3BA 3PI6A 3NCHA 4RZQA 4CCAA 2BYTA 4YRDA 2IYQA 3FVWA 1RLIA 3FVRA 4WFKA 2PU5A 3TK1A 4HO1X 5ADUS 1MX5A 5DGTA 2W2KA 5LZ5A 3CNEA 1OYWA 1XLWA 3PYXA 3L4KA 4O59O 2J3JA 4CMJA 3A1UA 4C7JA 4MV1A 3D8TA 4C4SA 3V42A 3K6JA 1YC2A 2LNDA 4UASA 5J47A 3FB4A 3ROZA 2A1IA 2QM8A 4D57A 1JU9A 1NGSA 4HGRA 1J2RA 4IL5A 4RU1A 4UCFA 4Y2UA 2J07A 5K9ZA 4W4TA 3ONDA 3LC1O 3SNKA 3T5DA 4MW6A 1V96A 3P94A 3PJGA 4E70A 1X7YB 3T1TA 5IMSA 5CEEA 1O0CA 1AKWA 2DY1A 2VT3A 4KNYA 2MOKA 3GJ5A 2IXEA 4PXSA 5IDWA 1VPDA 1BVYF 3LSTA 4G23A 1C9YA 4BFWA 1KMCA 2P4SA 4IJKA 1CZKA 1CUCA 4RULA 4RHYA 5LBIA 1UODA 1GGJA 4ZT7A 1TK3A 3BORA 1Z4MA 4ND7A 3ZY6A 2B4QA 1VZ2A 4NYJR 4WJZA 4CKYA 1I5EA 3EMBA 3WX0A 2R1UA 4RNCA 3PNSA 4MR7B 3WV5A 5CDFE 5DHTA 4GPD1 2QP9X 3HI6A 3UOGA 4AULA 3LTNC 2Q6OA 1BD4A 1BVUA 2GPSA 2WM9B 1V8DA 1FP7A 2CD7A 4EP1A 3KHSA 2XCRB 3PVSA 3AVXA 1SOAA 3C5HA 2NM0A 3M3HA 2P2ZA 1VI2A 1OJ7A 2PX2A 1V9LA 4KQHA 3CYFA 4WI1A 3NTVA 2VA9A 1Y6JA 3PRKE 4BWGA 1P9WA 4LQDA 4Q0MA 4RZSA 1OD6A 2CCKA 2F43B 2RBGA 1GCGA 4HQ0A 1IBLB 4N01A 1WMDA 3FF4A 2LD4A 5HQ3A 5KQMA 4RO0A 1N8TA 3D5EA 2PPVA 5A5DA 1XALA 1KA9H 3ROGA 3OPVA 1XLTA 3RIMA 5EA2A 4I5GA 1Q7EA 3HEMA 5CVDA 3A9CA 4AP6A 3KTFA 2UXCB 4C0WA 2W9XA 2RD2A 3TIVA 5JXHA 3HDJA 1GCUA 5DMXA 5HA5A 2PWPA 2X76A 3PQ7A 2OAP1 1QG6A 5KINB 2F9FA 3UK2A 4IXNA 2H3EA 5JVDA 2AH5A 4PZEA 1NSTA 3H75A 4B40A 1EWRA 1CIPA 1MB2A 1FTGA 1JMYA 2VNSA 3K4PA 2ZWPA 4ZVOA 3FJOA 5EZQA 4UFOA 4IMIB 1M6YA 2GILA 4GOXA 4ODIA 1R6BX 4BO7A 4PQFA 3MCTA 3ZKWB 5IJ9B 1WNTA 2IELA 3IDOA 1EKXA 2Y05A 2IZ6A 4RL6A 4CG1A 4DN6A 1BVHA 1WJGA 1Z2PX 1EP9A 3QFFA 1XFAA 5LQRA 2RHDA 1JPUA 4Q18A 2J7PA 4LYJA 4K86A 4RF2A 2MYUA 3U7RA 4DXDA 2OCDA 2P0YA 2VSYA 4XDYA 5JOQA 4D3SA 4YLEA 4QPJC 2BTQB 3SR3A 3NHBA 1PL8A 4M1EA 1DV2A 2HCBA 3F9CA 1Y1KE 1LQ2A 3ZG6A 2JI7A 2NYRA 4DSZA 4BGEA 1G3IA 2Y2UA 4EA9A 2X0RA 3H9GA 4ISBA 3IE0A 2P7HA 4RV4A 3T34A 3RLIA 1RTKA 1X6VA 2JFXA 4GSYA 4HH3C 4ZZIA 3PR1A 5EMNA 4JI3B 3AHHA 3ZGZA 2IHBA 4GPEA 3O83A 5DXJA 2YBDA 3QEMB 4PINA 1X92A 2FZ4A 2GAJA 2HGSA 5D3MA 5BYBA 3QWBA 1HE5A 4B3SB 5F73A 1T9CA 2EKPA 2HD4A 1G16A 2VHYA 1WY7A 3HCBA 3TIGA 4EG4A 1W48A 1X74A 1QIHA 4ZOLB 5BN1A 3A1EA 3H9EO 4LS3A 3OC0A 4WUTA 1KEEB 4MINA 3A9WA 4H0CA 4IYRA 1VLMA 4QTYA 4AG5A 3GVHA 4S24A 1OBHA 1HDXA 5K0EA 1WCYA 4WLNA 4HNUA 1JXMA 1S2OA 1XA3A 2CXXA 1BRMA 3R74A 4N82A 1FTWA 2FN9A 3I9NA 3TQCA 3LHKA 4CR6A 4D4IA 3G9XA 4OMDA 1M83A 3DXFA 3SHFA 3ACBA 2VAMA 4DSNA 2PANA 1M7BA 1E6CA 2FXIA 3BH0A 1CY2A 2HV9A 1N6KA 2YCBA 4WLVA 3LC0A 1WMEA 3VPHA 1YL6A 1BIFA 1N1DA 3I39X 3GJ0A 2V6MA 4L5YA 4P34A 3RIXA 3TCXB 5B7QA 2EKLA 2G70A 1ZO8A 1OI7A 5CBPA 2IE8A 4ZU1X 2Q3CA 2AHRA 2XRZA 3GJYA 5CVVA 1HWYA 1CUEA 1Q2XA 4HQ6A 4Z8YA 5AJTA 1EHIA 1YBMA 1ZC4A 4OI4A 1KTVA 1NU6A 4JXKA 4JC0A 3I6QA 2LTAA 5CCDA 5CVUA 2Z5LA 4PX2A 3DMTC 2ATXA 1MVOA 1DAMA 2Z08A 1VJ0A 5LM3A 3D5TA 2ZTUA 1HQKA 2E1PA 1Q7RA 2X5XA 4RIIA 1KI6A 5K8CA 3DXYA 4J29A 1T0PA 4NHOA 5ELMA 1JSLA 4QM6A 1SXJB 2X7XA 1C41A 3AIMA 1QYVA 1GYQA 3B5JA 3GLSA 3L7BA 3OPYA 3EC2A 1M8KA 4FINA 4GS5A 1OA1A 4XZ3A 1ZIXA 3WYGA 4MV7A 3CU5A 1KF0A 4BMPB 1TF7A 2HC9A 3E70C 2BR4A 3KT8A 1Y5MA 3KT6A 3EXEA 4BS9A 2COEA 4J07A 4FILA 2C2WA 2E9SA 3IAS1 4TMWA 1DJLA 1JA1A 3LT4A 1BXRB 3PXAA 3WDKA 2QRKA 3OP4A 5DBOA 4R2IA 3A36A 3ZVKA 1R50A 2ODPA 2WAYA 3LY5A 2BUCA 1E8MA 1PLLA 3L9XA 3BCSA 4FGWA 3UTDA 3AWIA 1MRSA 1NTOA 1BN7A 3T95A 3W06A 1FQOA 2C42A 4MS3A 5HCNA 3FGOA 2PMWB 3ND9A 1U0EA 5CA0F 3J7AC 1JJFA 4RTQA 3JQ7B 3G1TA 3L1IA 3LLMA 3EFBA 2F3QA 2Q2VA 2YV3A 4CETA 3B89A 5JWOA 2Y77A 1YMQA 4FCWA 3HO6A 4C0AC 2O52A 2XNDD 4Q1FA 1MV5A 4DUGD 1YDFA 3D3QA 3HGQA 4G36A 4K2AA 4N9QA 3G9TA 3JD4A 1CQJB 3H9CA 3ZTWA 1KOGA 4C08A 2OZVA 3ZC3A 4NMWA 3OX2A 5CYOA 2WU8A 2XTMA 2UVPB 1DDOA 4ND3A 5C1OA 1XL0A 4FKMA 2IYLD 3CRRA 2YJNA 1S2GA 1E7QA 4JDUA 1F2UA 4OGFA 4BP3A 4DADA 3AVWA 2PKXA 4BFZA 1XZBA 4MPDA 3SPXA 8ABPA 4KPYA 1GL6A 1C29B 1RHQA 2CUNA 3F6SA 4JUBA 3ILHA 3BIWA 3OFNA 5LYYA 5CJPA 3ZCPA 2DMRA 1J56A 2I22A 3UWOA 4P1ZA 1QS0A 3G82C 1B8NA 3LI2A 4I50F 1AQJA 3V8RA 4P7BA 5KKCA 2QW8A 2D0DA 2OAQ1 4EX7A 3ZHXA 3TG8A 2JD0A 2QQEA 1OI2A 1UXHA 4JY7A 2AG6A 3BMOB 3EULA 2FF5A 1TCBA 2R62A 2WD7A 3RG8A 4Q93A 1QFZA 3A27A 4TTVA 1E6LA 1XCLA 2BKEA 2WKSA 1UT8A 3QUBA 1JT2A 1DXOA 3G49A 1HMYA 4X85A 3JVDA 3T1QA 4C78A 4QBFA 4DLLA 4OXYA 1MZVA 3ROQA 4XCQA 3A2NA 3FFTA 3PJEA 1L1QA 5J9FA 3V33A 3WK9A 3T3MB 3ADBA 1O95A 1XZAA 3QNMA 2XAAA 1E79D 1Y3IA 1G7SA 3FBWA 5BSVA 1MQ9A 2ZBPA 4JB2A 1P61B 1T4GA 1UT6A 1CY1A 1VA4A 1YHNA 4CMBA 3K0SA 3GZNB 2ODBA 4XIJA 3FVTA 2RHHA 5ABPA 4DYVA 4TKVA 2A0FA 5HVNA 1GVNB 2AOTA 2IVZA 1UJ2A 5KNBH 5KSPA 2XYPA 1ISRA 3K09A 3QA3E 2HKIA 4IO0A 2GYUA 4CU2A 5BMVA 5JR3A 1FJ2A 4AS1A 4QECA 3DCJA 1T8WA 1QHNA 3P9CA 4DDKA 1P62B 3LE8A 5DOZA 2DERA 1IEWA 2ZIAA 5J58A 2D1RA 1UAAA 3MMNA 3TB4A 4CLEA 1TTPB 3L8FA 1HNZB 1WA5A 4CM3A 4FWTA 1Y8QA 5JO0A 4YCJA 5EYPA 5HQJA 4LJYA 3TJRA 3V2IA 6ABPA 3VU9B 1QTIA 1VCNA 2ZAGA 4OHYA 2OXEA 4MEJA 4IX9A 1A7KA 2H1WA 2UYQA 1M0TA 5KWSA 1IOVA 1VM6A 1J5PA 1XZKA 1IAQA 2LP4Y 3QYAA 4J2OA 1DCTA 2FWNA 1Z22A 2YHIA 4QQ8A 3QY0A 3OI7A 1NZDA 5GTDA 3H2SA 4YJGA 2EG5A 3ZHBA 4IG9A 5EIEA 4HC4A 1Y8CA 4JP3A 1HEIA 2BDTA 5A3RA 1K5GA 3U2QA 1X1AA 3G0GA 3K9BA 3LUJA 3P7MA 3PD1A 4HEA6 4M4SA 4PE5B 3S2ZA 3BB1A 2XZLA 1BDMA 3E5NA 4INPA 4R1QA 2G09A 5DCWA 1UZNA 1K0FA 1T4MA 3CX3A 5CHYA 1YB7A 5F12A 5KNBA 1UBOS 4N6NA 2C8VA 3GX1A 2EKDA 4HH0A 4D74A 2PRKA 1OR8A 1W4AA 2O3SA 2HJRA 4DTCA 3N2IA 1QLJA 2WKWA 4HRXA 1X9HA 1GNSA 3WB1A 2FE1A 4A7PA 5C52B 2CL6X 3CURA 4U3JA 1WETA 2QLMA 1H22A 3WMWA 4E7OA 1RWQA 4BLRA 1ITZA 3HSSA 3Q1KA 1VGQA 3AUFA 4RPGA 1GTMA 2XMZA 3C4QA 3AV0B 3QVGB 1WF3A 2P2SA 4P83A 1VJGA 3TH5A 2QU8A 3OCYA 5ER9A 4NJEB 5HKLA 3WBBA 2Z6AA 2BFFB 5FCDA 3EUWA 4FE7A 2NVUB 2CNKA 2HA0A 1I14A 2WOJA 3EEQA 3N8GA 4J1QA 5J2TA 3E5RA 2O2EA 2F3SA 3EIXA 4RXUA 2ECFA 2OYRA 2RH4A 3AHIA 1DBIA 4KXXA 2QF7A 1GPLA 3WB0A 1XPOA 4YONB 5H16A 3TIIA 2HWYA 1A5SB 2G5TA 1M34E 3GLFA 1R4ZA 1SOMA 2RK4A 1K9VF 2H8KA 5A3SA 3H05A 2OV4A 2JLYA 4FT2A 1ECPA 5HYVA 3CUEF 1CEEA 4EGJA 1EVJA 5JNVA 3R4VA 4BRWA 2WE8A 2AOVA 4C0QC 4QFMA 4R40A 1J9EA 5BW4A 1Q1QA 4CHGA 1U5AA 2ZAMA 1GU7A 3HKBA 2AVDA 4P3KA 4ERNA 2XF2A 3IBYA 4GM1A 5EXDA 1NUHA 3ETCA 3GGOA 4F3KA 4M1OA 4X20B 1B43A 1COWD 2JJ2D 5KJEA 1J0CA 3DLIA 3MPUA 1IYZA 1MQSA 4HWKA 1P9OA 2VZ0A 1UBGA 4OJMX 3P32A 4ND8B 5D6NA 4DG5A 1F9EA 3QTBA 4DLWA 3WB2A 2AXQA 1XVTA 2VZ9A 1L0BA 2GPBA 3CS3A 3G1UA 3VX4A 1IOWA 1NJFA 2RSLA 3L84A 3EVGA 1FDTA 3LIPA 4P4TA 1SG6A 3KCQA 3N39C 4R51A 5IAKA 4G65A 2DF8A 2FOIA 4BMVA 1HG0A 4IIFA 2PUBA 3BQNB 2P3OA 3M6AA 4WK6A 2YXLA 2RH9B 4XR9A 5BSUA 1W4RA 4YRMA 3QI7A 2WG2A 1Z0IA 3O3CA 1EUZA 2XMBA 4IDAA 5FWAA 4QATA 3H1PA 4UU7A 3IYLW 3V2UA 2EYUA 2G1UA 2WF6A 4I55F 1UDAA 5KVAA 1Z4IA 3JQ8A 1EK1A 4Q4JB 4BNWA 1N2OA 4RTPA 1PJCA 3HRHA 3QUQA 4M0KA 2PY6A 5BR1A 3WKDA 2W6JD 4YX9A 2XXBA 3WLEA 3V4LA 1PX2A 1XX6A 1F3OA 2I6XA 1SXJD 4ARSA 1I4TD 1XE3A 1ORDA 3E8MA 3EF3A 3E3LA 3OPXA 5F2OA 3MJCA 3U37A 5IUNC 1SR8A 5JW6A 2JAHA 3M4ZA 3P52A 3JWHA 5WRFA 5H59A 4BLTA 1GPBA 3AFOA 4IV8A 1V6SA 2Q1UA 2C54A 4RACA 2P0AA 4GE3A 2GA8A 3GT7A 1XMVA 1BKDR 3HA3A 1W5FA 1BH2A 1ZCBA 1ISMA 2GRAA 2BMWA 4FBMA 5A4FS 3MLAA 4LYGA 4BU0A 1G59A 2GWHA 1V6AA 2ET6A 2B4KA 4GZ6A 4Q39A 2E89A 4KQ1A 2AZTA 3U3RA 3ZKAA 3K2QA 4CF5A 3L02A 5DI9A 2YQ5A 2W43A 4F3RA 4OD0A 1ID8A 1OU4A 3N2GB 5AKKA 1E4OA 2HT1A 3D7NA 1DFIA 2VPWA 2RHMA 1WXGA 2J6IA 1GUDA 5GWXA 3H4MA 3KLPX 2EARA 2XIJA 3DGFC 2TMKA 1LLQA 3M4NA 2AXPA 3I23A 1N7IA 2A84A 4PX3A 3FXAA 2OFXA 2Z83A 3D6HA 2TSYB 3PDIA 4XSGA 1B2LA 1YRQA 1A9ZA 2AYZA 2FDXA 4EUNA 3MINA 2JAWA 4HGZA 1NN1A 4RX1A 1NVVR 3BIOA 4TQUS 3TPZA 4ZDIA 4LTMA 4QREA 3LLCA 1O03A 5DTMA 5COBA 4E6EA 1XNGA 4YECA 3JAKB 3QWHA 4TMFA 4BDTA 2BZSA 4GP7A 4DEVA 3BA1A 1UBEA 3I6BA 5GQSA 4A36A 2QUZA 4NTZA 4RDHA 4ZJPA 1NWHA 2O7SA 3EQZA 2FZEA 3V1KA 1U7DA 2XDWA 1C3OB 1LBEA 1YB6A 4R8KA 2PH1A 1V9CA 4A3SA 2RIPA 2NZJA 1I4DD 3D6AA 2YW9A 1HC7A 2OEPA 1U2QA 3GZJA 1N2XA 3LHDA 3R5SA 4MV0A 4D25A 4YQZA 2W93A 5HZKA 3RWMB 1XAJA 5FBHA 1QIMA 4EB0A 3PA8A 3KETA 3KSBC 2VYVD 1NI4A 2WWRA 2EJBA 5A9RA 1JKMA 3PHHA 4KQEA 4UAGA 4ZQCB 4OQDA 4Y9DA 3V1YA 4F9FA 5JQWA 4MGEA 4OL0A 2HREA 3GNTA 4AKTA 1VE9A 1H1LA 2DR3A 2VPXA 3EGOA 2AA3A 2FLVA 3DL2A 3HYNA 3H1AA 3OJCA 1G3UA 1AO3A 1GYRA 2IZOA 2G1AA 4ZYXA 4B3JA 1VDMA 4EFNA 5DVZA 1MBZA 2MYPA 4HAVA 4YRFA 1YCFA 4A10A 3CVUA 1AZWA 2FPPB 1R4AA 4JWKA 1TDJA 4EKIA 3AIOA 3IVXA 3NT4A 4ILEA 3M2TA 4PCUA 4R0VA 5IZ4A 5JNWA 4Z54A 5KNCD 1EHCA 1LF0A 2IPLA 1NYQA 1F2DA 3CPHA 3KBOA 1YIAA 3NXSA 2WJWA 1D6MA 1XCBA 1YJXA 3GRYA 4HB0A 5CXUA 4JYZA 1N77A 1HMPA 4KAXA 3VSAA 2B8NA 1Z0UA 1E7MA 2ZDQA 3A1DA 1FXWF 1R8XA 1CS0A 2QSZA 3SIRA 1M8GA 3L7AA 4RC9A 1KZ7B 4YIKA 2O06A 5JTTA 2DFVA 1GGVA 4REQA 4M86A 2D4HA 3TTUA 5C8VA 1ULUA 2ODEA 3DZFA 1M0SA 5CTJA 5E2BA 1PV2A 1Y4AE 3P8ZA 1Z28A 3VR3D 1GLNA 2C4WA 2CL5A 2Q4RA 1ECCA 2BEVA 2Q62A 3DZJA 4Q3DA 2XZDA 1RWVA 4JI5B 1ORVA 1EJBA 2XYHA 3RBAA 2O2ZA 2JGRA 2QU7A 3CIOA 1O96A 3UJDA 2RMKA 1C7RA 2FWAA 2YWHA 3BX1A 4Q4AA 4A8JC 1WZUA 1ZJZA 3PS9A 1NVAA 1FFEA 1Q0PA 1O94A 4MVJM 1N8SA 2ZUVA 3CSSA 4M54A 4XQ9A 5DE3A 3RSCA 3IAM1 1LC0A 5DX1A 4B0OA 2O8CA 4JUCA 5EE9A 1YV9A 1WZIA 3GMIA 4CG3A 2CXOA 2QOEA 2P6PA 3LV8A 2NLOA 3S2GA 4MSUA 3SYKA 1LY1A 4ZZ3A 5JCPA 1G60A 3BC1A 4PAMA 5AVQA 4DR1B 5JFGA 4J0EA 4TTRA 3FI9A 1NXPA 1EU1A 1U0NA 2PUAA 2CHFA 2MTBA 3L7JA 2AUMA 2W4MA 4M9UA 1P45A 2ENWA 1W5TA 3H3XA 4F4FA 3U40A 2AB0A 2I4OA 2IY8A 3GFSA 3M6VA 5AKYA 3W4KA 1E6MA 3CW8X 3DQPA 3JWJA 4KVFA 3OUTA 4MVXA 1NULA 1P72A 1J21A 4HPWA 2G07A 1G9TA 3CCCA 3JASB 4OQYA 2Z4SA 3AFHA 1WCV1 1RQGA 4URFA 4FQ8A 3WJAA 1CDEA 1NR5A 2GETA 5FPKA 2OD9A 3A3PA 1W6RA 1I4OA 1W35A 1UPFA 3PQDA 1MJGM 1I2DA 2A3RA 1OBOA 2XUOA 3L8CA 4IEFB 4WRRA 3UC5A 2WM3A 4Q03A 2QGFA 1BQ3A 2PXCA 2KB0A 3WC4A 2B9VA 4TMXA 3OWOA 3NU1A 5LB2A 4Q9AA 5CEJA 4GMDA 4EKYA 1G66A 2ZI7A 4IXTA 4JQZA 2LKCA 2WP8J 1A5AB 3QXXA 1S8OA 2BGMA 1G4UR 2JIMA 2QWXA 3BUSA 3EGCA 4XWTA 4AJJA 3OZDA 3ZU3A 2Q3HA 3H17A 1Y7LA 2GZRA 3GPBA 3FN4A 4CEIB 4YB8A 3SR0A 3UF0A 4HMOA 3WNVA 3X2SA 3CLTC 1XV5A 5KYXB 5K0BA 2XWBF 2OLKA 1NXTA 5EJMA 3FHOA 2VK1A 3FLEA 3ZTYA 1GTSA 1SUDA 4YJDA 3GG9A 3IE1A 2AKEA 3UB3A 2H1OA 2PMDA 5A2GA 2JA2A 1E77A 1T10A 4LEIA 4NOKA 2RCYA 1PD0A 2YW2A 1GSIA 4JYPA 1DIHA 1SKQA 5FTJA 2G83A 1TI7A 1R6UA 5DO9A 1CY8A 4YMHA 1OFVA 1AGYA 2J9FA 2WWWA 4Q7EA 3ZWXA 5AJWA 1GO2A 3R7AA 5G3ZA 1N2HA 5LMUB 3X1JA 2AC7A 2XYRA 1JLRA 4WLUA 1RAEA 1QLWA 2X8JB 2XKBA 3PICA 1JR2A 3L9WA 4OQEA 5K8JB 3DBLB 4I14A 4MIKA 1MIOB 3NO4A 3CISA 2EF0A 2G7ZA 4AFNA 5I4IA 5IHPA 3VMFA 2QAIA 2NO1A 5AI8A 3R6WA