3BVPA

Crystal structure of the n-terminal catalytic domain of tp901-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
136
structure length
136
Chain Sequence
KKVAIYTRVSTTNQAEEGFSIDEQIDRLTKYAEAMGWQVSDTYTDAGFSGAKLERPAMQRLINDIENKAFDTVLVYKLDRLSRSVRDTLYLVKDVFTKNKIDFISLNESIDTSSAMGSLFLTILSAINEFERELEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrameric structure of a serine integrase catalytic domain.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Recombination
molecule keywords TP901-1 Integrase
total genus 49
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bvpA00
4BQQA 1GHTA 2GM4A 3LHFA 3GUVA 5C35A 3G13A 3PKZA 5C34B 2GM5A 3ILXA 2RSLA 1HX7A 1ZR2A 5C32A 3BVPA 5C31A 2MHCA 3LHKA 1ZR4A 1GDTA 2R0QC 3UJ3X
chains in the Genus database with same CATH superfamily
2A4MA 4MHSA 4YLYA 3K1TA 2ZB2A 3LBNA 1FLNA 1QG0A 1NTRA 4IKPA 4MRAA 1CW2B 2OP0A 5FXMA 1SAYA 4AS2A 3ADOA 4WCFC 4CM8B 1MRSA 2YVLA 4HRAA 4ZVRA 2HMSA 3ZI4A 2ACWA 3ONEA 4MP6A 2FFHA 3ESBA 3GT3A 1DDGA 1YRQA 4ND7A 3ROZA 1Y8QB 4LXHA 1IXZA 1QFMA 3Q0TA 3ZWXA 4QT4A 2B21A 4L74A 3DTVD 3HJNA 3M3HA 5KYXB 3R9XA 1HX7A 1WU7A 4JYBA 3TOXA 3MWLA 4J7CA 3KAJA 1M5UA 1FPQA 4PXYA 1GYPA 4H31A 3UBMA 2J4FA 1OFUA 1QIEA 3I9MA 1MENA 3NNSA 1BJRE 3OVMA 1ZNZA 2V7EA 3PHBE 2O3TA 4L7VA 4LCEA 1ADGA 3ESQA 3TM5A 3T4PA 4I99A 1T1EA 5HX7A 3GYGA 3P32A 4FYWA 1HDYA 3W6NA 5J59A 1XAHA 3ZHBA 2BGGA 4MB0A 4XR9A 4YDRA 3V8VA 3C3YA 2DLCX 4YP7A 3UAWA 2GBFA 2P9TA 2QRQA 1GT6A 3BT7A 1TD1A 3ONWA 4KGXA 3S28A 1J99A 5LPNA 5LMUB 2ZT7A 1BJKA 4QU9A 2P9FA 5BSVA 1EFPB 5IWCA 3HB1A 2EBFX 2NV0A 2O3QA 4TWBA 1QF6A 3FVRA 4HDRB 2E9SA 1AUXA 4J9UE 1TAHA 4IEEA 4PCLA 5FLKA 3UYLA 4LPKA 3O90A 3Q10A 4KWIA 1JILA 2EKBA 5L6LB 3H97A 2RHTA 5C3UA 3UQZA 4CI0B 5I4CA 4BTLA 2ODPA 1G4HA 4IX1A 1GSAA 3NBAA 3VR6D 3FUVA 1P9OA 3ZK8A 3K1ZA 3NDIA 1AK1A 1R6BX 3AX6A 5TS2A 1Y81A 2JG3A 8LDHA 2ZG6A 2XMGA 3P9RA 4MRMB 2Y27A 2FP4A 2JL1A 3SIPA 2E82A 3ONDA 3LC1O 3QELB 3AR7A 3KJFA 2COKA 2EZUA 3JD0A 1OWLA 4D6YA 4C7JA 4OH7A 3RYCA 3VH3A 2JIDA 3GUVA 2GJ9A 3GCWA 3WL7A 2RJNA 4YXWA 1M1UA 4MITA 4XWWA 1HNWB 2QOEA 5C34B 5HQJA 4RF3A 1NSTA 2IELA 5EAIA 3L7KA 4NMMA 4URHA 3G0CA 4FSDA 1F2UA 4JUFA 2GRUA 3W79A 3QEMB 1WMBA 3GLFB 4ZV4A 5J9FA 3AFOA 4Z5XA 5TQ2B 2F3TA 2B4AA 2C7GA 2G4LA 1DADA 1QUEA 2D7CA 3AR9A 3E7XA 2P3LA 2VDUE 2IC5A 3QBVA 4DLTA 2BGJA 5DIFA 5E1DA 1F2TB 1M8KA 1ZP6A 1YR1A 1Y7LA 1YDFA 2CXXA 2WZQA 5CDFA 4PYJA 4IDGA 1TK2A 3ZV6A 3CVXA 2JB9A 2OD2A 2Q4OA 4LQ4A 1NSFA 2VF5X 1ZU4A 3FLMA 1E6UA 1H0HA 1R5JA 1XKXA 4Q18A 4MWZA 4WKOA 3GYBA 3O2JA 3C4JA 3SYRA 4B35A 4D41A 4D98A 3HY6A 3KLMX 1E1CA 1OLSA 3DQQA 4DMFA 1YQWA 1VIMA 2CNWD 1BSVA 3HP4A 2ZWPA 3FG9A 1QYVA 4MKRA 1DC7A 1CUCA 2AE1A 3U4HA 3CE9A 3I2FA 1MN6A 3WMRA 3PUIA 5AW0A 2EEPA 1B6SA 4IFBA 5LP6B 1KOGA 1LW6E 1RTKA 2CYAA 4LHWA 2YMPA 3PENA 4KX3A 3RS9A 1DG1G 1Q0HA 4UU0A 3ND9A 3A27A 3OIUA 3BTOA 1J5EB 2AIRA 1VRCA 3KJZA 1EFLA 2GYYA 2HQRA 2XUHA 3DTYA 1G20B 4FD2A 2V7TA 2JIMA 3GA5A 3GCXA 4TLBA 1AMUA 3HJRA 4XRRA 1ZGHA 2Y0DA 2FKAA 4OQMA 3I9JA 4K9KA 3BWYA 4D9FA 4B6OA 1FRNA 2OO5A 2QLJA 2ZROA 4FGUA 2ZU0C 3VTFA 1Q44A 2R44A 1EFCA 4Z99A 4RGYA 4BTEA 4N47A 4AJKA 3BH0A 4JLSA 3ZGOA 3JWPA 5M2QA 1YR7A 2HMWA 2RHMA 3B51X 1Z8DA 1M2HA 1XNGA 3ONNA 2HPVA 4RHCA 1C1XB 1XRRA 2YZGA 2BJVA 1LJLA 1W1UA 3QG1A 4IWNA 4PZDA 1ZGJA 3HPQA 3L8MA 3O26A 4KWTA 1EVZA 4MRPA 3NFRA 5DHAA 5I3ZA 1VIYA 3PE3A 5BVGB 1DJLA 5JAMA 1OASA 1C8BA 2NAFA 3HRHA 3JQ9A 4QG7A 4BMYA 4H27A 4JI3B 1PVOA 3HY3A 3UQYS 1GAJA 3QKTA 5FUBA 4EY5A 4YPOA 1ZK0A 1X7YB 3O9MA 4HWSA 3ESDA 3FH0A 2BGNA 4RA9B 1RXUA 4FI3F 4FOPA 4NBUA 4GAEA 5DO9A 3UF0A 5L53A 1W73A 3L8HA 1TUEA 1SXJC 10MHA 5DN6A 3N0TA 3F3MA 4LXQA 4P34A 2PEYA 1JFSA 2R7MA 4CCWA 3ZGZA 2ZT5A 2C7BA 1GTL1 2JZNA 3JSXA 2ERYA 4JFRA 3AJ9A 4L4XA 3V4FA 4E5SA 3AF1A 4EY3A 2CDBA 5LJIA 4K26A 4RA6A 4QDZA 4S0ZA 5AR1A 5DM0A 1U8CB 3IQGX 2DCUA 2QZ9A 1RLTA 3ZXIA 4P3XA 3SYLA 3BVPA 2UZIR 4N9WA 3BREA 3HYLA 3LECA 3VQTA 3RRYA 4GKBA 4B5KA 3P9NA 2P27A 5C4GB 3ADCA 1K7EB 2AYZA 2II6A 2FE4A 4TQ9A 3EXHC 4EITA 5LA6A 2BAGA 3DMTA 4PLVA 2WTAA 4QQFA 5DGDA 3JASB 5IPFA 4R40A 3W3ZB 2GERA 3NJ4A 1H94A 4F2WA 3ZHVA 4Z7JA 2I87A 1KQ3A 4KN8A 2OV2A 1R3DA 3TQOA 2AOWA 4IUDS 4LRWA 1TW2A 1X0VA 1H1LA 1QDEA 3LGSA 4JBLA 3OKAA 5LMZA 2GR9A 1D1QA 2XCOA 2OCDA 1E9DA 4PLGA 3NJRA 2XBLA 2XITA 3NIBA 4NCJA 5HFNA 3R7DA 2F1HA 3RW9A 1V35A 2NNWB 2WP0A 3MINA 3A4NA 4R6WA 1QGUA 4AMGA 2VSQA 3EXHB 2TMKA 4WZAB 2B30A 3CLHA 4WGGA 3KL2A 1J24A 4TTAA 2WWHA 2HC9A 4E6PA 5CXSA 3DW3X 3INNA 5KJ1A 5AW4A 1GQRA 3TSZA 2WM2A 4H08A 4OY3A 1E9FA 4E2YA 3OIYA 1PS9A 4FYIA 1CR0A 1HL7A 1AY0A 4K1LA 3TWOA 3MWEA 4OUDB 1JSZA 2PMKA 1MJGA 3JR7A 1QP4A 3R44A 1VBKA 1PR0A 3G6KA 5J2UA 3H2HA 5EPEA 4BX2A 3A3KA 1GR0A 1X7ZA 1QC5B 2CVZA 2CKDA 2ZYHA 3H6KA 4H1WA 3NTQA 1CFJA 2FZLA 3SJCA 1G42A 2VF7A 1RFGE 2R6GA 3GJ5A 3EGDB 3WKBA 1YH3A 4YCCA 3ZKWA 1I7NA 4A0FA 5BUZA 1ND6A 2AR0A 1TAQA 1T2VA 2BISA 3NHJA 4IXDA 1RAFA 3PIIA 4IQGA 2GN0A 2AVDA 1KWKA 1NQUA 1NYLA 1AH2A 1YCHA 3OX2A 3EC2A 4P80A 4RH3A 3R0QA 4A7PA 2FR0A 4KU4A 4TYQA 2OZLA 2GZSA 4JBHA 5DLEA 4WKBA 3UUEA 2RC5A 3EGWA 1IWOA 2EFYA 1L5LA 3PICA 1EA7A 2OQ2A 2P65A 2XDYA 2RKOA 2J6IA 3NIGB 3P0FA 2R8ZA 4CCSA 2P2DA 2EJCA 1VBFA 4I4CA 2E5FA 4UZFA 3GOHA 3W2TA 4HPJB 3AU8A 1RRVA 4ZYXA 5ALTA 2GVDC 3GNLA 2YCBA 3TLGB 4EKGA 5D2CA 3SWWA 4M60A 1UJ4A 4IQ0A 5K3SA 4C7KA 1ZRSA 4ENTA 1F7VA 4B7CA 1PGQA 1N78A 3OKCA 1UM9A 2C8VA 1UOEA 5C37A 3L7BA 2ZIZA 3GCGA 4UUOA 4ZARA 5G3YA 2Q29A 2R6ZA 3T1OA 121PA 3RVOA 2OP1A 5C2JB 2W5UA 4Q1AA 3TQIA 1US8B 1MB0A 1Y7IA 3CO5A 1JIIA 2PJUA 3NT5A 2IDKA 3GJ8A 3FTQA 3LWZA 4LMAA 2AX3A 1Z0IA 1BRTA 1JFFA 5H1YA 1SD2A 2CVPA 4S1WA 5LLSA 1KVUA 4ZJZA 2LNDA 3ZJYA 5CTJA 2ECPA 3HSSA 1REQA 2IV3A 4FILA 1HH4A 1T4DA 5ALOA 1YKGA 1OREA 4RJTA 1CIJA 4AUEA 4JUDX 3GFVA 3F98A 2OFPA 1LBHA 3V4SA 3A1FA 1ZEJA 2R8BA 1TYEB 2GSWA 4FM9A 4KE9A 1X9HA 1HI9A 5ICEA 3DNMA 5HFJA 4B6EA 3GJZA 5ES4B 1CB7A 2FMUA 3O2NA 5BR1A 5D7BA 2CLLB 4LZAA 1II8A 5FWDA 3VSDA 4J16C 3T5AA 4MQBA 1Z62A 3DDNA 4KH1A 4KI0A 3NMUF 1YZUA 1QZ3A 4KJZA 3BXFA 1M6EX 1KVQA 4UTRA 1OKKD 1RRFA 3Q7TA 4H9GA 2X22A 4DMHA 1VL0A 4ZCIA 2O59A 4BMOB 3PYMA 1GLVA 3A9VA 1L4GA 1J0DA 1IY8A 1L6RA 2HL6A 1AO0A 4ESVA 1BEZA 2CK3A 3L6CA 3WDSA 1CKEA 4IDOA 4LXGA 3NIWA 4QPPA 1OH5A 4PC3A 2AFHE 2COEA 1F0PA 4MHOA 2AMFA 2A33A 4D82A 5HKBA 1EESA 3K9LA 5IXYA 4TQUS 4F8YA 5HYVA 2VBGA 3PC2A 1KSGA 4GBED 4Q3LA 1OXBB 1NE2A 3SFZA 1NXQA 4PLFA 3SU8A 4B4WA 3BGWA 1Q7EA 2GMWA 3WHIA 3AF3A 5U1PA 3BF7A 3IIJA 1N6KA 2WIJA 3QMPA 3P0RA 5KREA 1JG7A 1T36B 4N6GA 5DI3B 4K5QA 1EWQA 2GX6A 3ASZA 4ZOBA 2JAPA 3DOHA 5ALQA 3G2IA 1F2UB 4R05A 5BQXA 1YAJA 3F7NA 1K27A 4MGKR 2Q2QA 3DUWA 4JOBA 1EXMA 2JGEA 2WAAA 4LRSB 3VHQA 1DVRA 2YWBA 4B40A 1ENZA 2FSIA 4OGWA 5DTJA 4ALIA 1PZHA 5IT9A 3A4TA 1XQYA 1LS1A 4PBRA 1AGXA 4OJYA 2WIFA 4U7PB 4PLWA 2GM4A 1ZIXA 4NF2A 4P0PB 4JJGA 2KW5A 4D6PA 5I7OA 4JBYA 2CMKA 3MK31 3HN6A 2QVBA 1FC0A 1XXHE 3UKJA 2VHJA 3ZS9A 1BYUA 3CRMA 3KHUA 2Q3EA 1E92A 4EW3A 5KJFA 5KO2A 2OK8A 4DMMA 2CMGA 2QRZA 1HYEA 2VLBA 4JI4B 4RY0A 3ENQA 3WK8A 4TV8F 4KUGA 1UMKA 4DT1A 5NLLA 4RDIA 3W5HA 2C61A 4MR7A 3RVJA 2ZYGA 3CH5A 1KJ8A 4LN1A 4D0GA 5FWNA 3NAQA 2BMJA 2WB4A 2Q5JA 4G0OA 4NWIA 4JLVA 1GJRA 1TYCA 1DTWA 3N75A 4RPKA 4EP1A 1P1BA 5E6SA 1PGNA 1T4CA 2QI9F 3R7WB 4UBKA 1WZEA 3FRIA 4JJZA 3GJ3A 3Q9NA 3NOVA 4HK4A 1B15A 5K0ZA 1WZIA 5D85A 4EENA 4ZCRA 3ROFA 2QD5A 1A77A 3AMVA 1ZA1A 4TKMA 3G13A 1P77A 3ACBA 3F3SA 4FU0A 1ZJ4A 2HUPA 2QMOA 3TGPA 3DOOA 1QH9A 1FRVA 5T67A 2ZIVB 3LNTA 4BZZA 1GAWA 2WJJA 4NBWA 3J80A 3BCUA 4IIYA 2WD7A 2X1LA 2JIPA 2OGTA 1Y42X 1VXOA 3SSAA 3BD9A 4KIFA 1NW3A 4NPHA 5FV7A 2GPTA 1CZOA 1Q0UA 3AHFA 3KZ1E 3LLUA 3JVEA 4AT1A 1NVDA 1RLUA 2FSGA 3QKRA 4PR0A 5BSEA 1U0OC 4LV6A 2V6FA 3PJDA 1QS0B 4L85A 4U6SA 3RVLA 1E7QA 4KHZA 4UAUA 1A69A 4IQFA 1XWWA 3Q3VA 3D6MA 5LZ5A 1WABA 4PYKA 2QN8A 3E9RA 3OPYB 2XNDD 5FL3A 4C6TA 4JIMA 3PRHA 2GO1A 4JXJA 5JDIA 1NHWA 3NUGA 3PFHA 3QOXA 4Z2YA 5GOZA 4ZAYA 4QU5A 1MIHA 3CGGA 1PP4A 2QLFA 3KU4A 3PJEA 2QBYB 1P1IA 1QDUA 4AVYA 1DV2A 1KYQA 2PVCA 2BTEA 3FDIA 5JRJA 1IBRA 2E85A 3ZBTA 1G98A 1E18A 4HGZA 2F8LA 1BDJA 1UFOA 1UL1X 2H7VA 4ZOLA 1XVUA 2P9CA 3LNCA 2C7QA 4DV6B 2DMRA 4NZ9A 4CTNA 4MOWA 4EGQA 4B3MB 1DDOA 2C3YA 4GZ3A 4P7GA 5D8DA 5E6RA 1JT2A 4MDHA 3GQBA 4E51A 5K5EA 1NP3A 3HNRA 2QBYA 3ZWMA 3RKSA 1QGZA 1U2PA 3AEZA 5CPBA 3GHHA 2GOYA 1QK5A 1CIVA 5KI6A 4QZVA 4DR1B 1NW7A 1ODJA 4KXUA 1B7GO 1AXEA 1VHWA 1PKEA 4UHJA 1G8JA 4BQOA 4C5AA 4CM6A 1Z7GA 4B32A 4NZZA 3KKPA 3E5NA 2HF9A 4QODA 5J4YA 4A0QA 2C42A 4Q0MA 3S2EA 1I1NA 4ZC1A 3QJGA 4KB5A 2ETXA 3ET5A 4O4IA 3USCS 3VSAA 3RJ9A 1YRLA 1CY0A 3GV0A 5EZ5A 3UMVA 1X1TA 3JV7A 4XWGA 1P7WA 13PKA 1T3ZA 2HQOA 2RAUA 3A7DA 5FOWA 3STTA 1U9IC 4NJOA 4KIUA 1H6AA 1XT6A 1WQ3A 1S2NA 3J7TA 1Z3IX 2GDJA 4U4AA 2W2QA 3CX8A 4QOFA 5AH0A 4YQZA 4A2CA 4YHBA 5EXDA 2PKCA 1IC6A 3K30A 3VISA 3JS5A 2IPOA 2GHIA 4LQLA 3SFTA 5GIPE 2G1JA 2ZM6B 4UPDA 2YHIB 5CNIA 2CHEA 5LUBA 3C7DB 3EFEA 3LF1A 4GPZA 5HZHA 4IICA 3BWDD 3IL2A 4QXPA 5ICFA 3TG2A 1YS4A 5A71A 1EK6A 1RMYA 2VPQA 3DXFA 2R8EA 3COWA 2R00C 3OWHA 5BORA 1TCCA 3CN7A 1Z2PX 2V0CA 4RD1A 3VPCA 3BTUA 1Q5PA 3Q12A 2G17A 2XDWA 3PD7A 1UDCA 2I5PO 3AF5A 4HVAA 4JYZA 2XEDA 3IMCA 5LZ7A 8MHTA 3GDHA 1H23A 2BFEB 3PWKA 4G24A 4DSNA 1SUIA 3G8CA 2OPHA 2FW6A 3FMVA 2OBYA 1E3SA 4LJ6A 4OHRA 2C4KA 3RODA 4QJIA 1ZOSA 1AKQA 3T7AA 2B99A 3GLIE 2PL5A 2ZRMA 4GX1A 3LQFA 4HWTA 5HKOA 2UYYA 1U0BB 1NXXA 3DEHA 8ADHA 1Y1PA 1Z17A 1KP9A 1D2AA 2ZUVA 5FX2A 1CYDA 2VWGA 3KKNA 3H0EA 3SOPA 4OK6A 4KMMA 5KNBH 2G8NA 3EB9A 3EVBA 3G17A 2JD1A 4KUEA 5FBQB 4ZJPA 3CF4G 4M98A 2X6TA 2F7SA 4C08A 4JI2B 4EHFA 4RK5A 4CMGA 1RBMA 4BKMA 2ZRGA 3B3FA 4A9AA 3K4HA 3SVTA 1FUIA 4JT9A 4RTNA 1EX6A 3E5RA 2CUNA 3EGOA 3R0JA 3H5NA 1HE1C 1UM9B 3VJRA 3SMVA 1XPJA 1CEQA 2WHRA 3GQVA 1G2QA 1PYGA 2XTMA 3QXGA 4K7JA 2VXBA 3U7HB 1TAGA 1EEHA 1E3LA 3GA7A 3E23A 2VZLA 3KQUA 3QV1A 1QYCA 4ZQBA 4BVKA 1TE2A 2DE0X 4CMEA 2IXFA 3GJ6A 4HRYA 5ESDA 1REQB 1U6IA 2R4QA 2YIVX 2ZIFA 4AZTA 1QE3A 3NXKA 3PGVA 3S1LA 3WZLA 1CUJA 1E7SA 4HDNB 3USES 3VYVA 3MBOA 4YT2A 3BD8A 4RLQA 4XX1A 4BMSA 2ID9A 4CMKA 5EUCA 1SC6A 3KHKA 2FWNA 3QI2A 2B8JA 1KNQA 1A9QA 4R2KA 3FLEA 3SDZA 1V8BA 3KLBA 3W8NA 4OXYA 2P9YA 3GPLA 1C8LA 5HZKA 4CBVA 2FSPA 4B46A 2Z9CA 4GQIA 1H2XA 4R3WA 1QG2A 1BDBA 1NG1A 3W3AA 2VXCA 1DV1A 2WINI 1UDBA 4J0DA 1L4UA 2GETA 2PH3A 4OP2A 3FOCA 3PU6A 4YRQA 5C46F 3E9EA 1CP2A 2Q4RA 2PZEA 3IO5A 4A1OA 2UXDB 4EPXA 4LK2A 2BZ1A 1K7FB 1G2OA 2JGRA 4XE5A 3UJNA 3NIFB 2GK6A 1BE8A 3RR2A 4ESOA 4I3FA 2PDAA 4KL8S 4MHTA 2ZYAA 1B00A 1GPDG 1QGYA 3SF0A 1DWQA 1E7WA 3A3OA 4DE5A 3DE4X 4K9SA 1PZNA 3U2QA 4LX0A 4M1ZA 2WRZA 4IRXA 3C7TA 2HCTA 4POAA 1EH5A 1SBNE 2V4UA 4UUPA 5B4UA 4BC0A 3ABZA 2R8XA 4JL5A 2HJSA 4F45A 4IBOA 1W52X 4AB1A 5ECGC 1AMNA 3B6MA 4ZYWA 3PEVA 1I6KA 1GCAA 4GL2A 5ALEA 1NBAA 3MQ2A 1JSXA 4WFKA 1T6YA 1LLQA 5ABPA 3MAAC 5EJ4A 5HRAA 2AXNA 1QGAA 3MWDB 2XCRB 5DYTA 3D6AA 1IXSB 1T2NA 3DNFA 5AHOA 1SKUA 4LRTB 1E3EA 2IYAA 3ZCSA 1W5FA 1G3MA 3AKDA 4RETA 1QTIA 1USUA 1N0WA 1QOQB 4P93A 2SICE 2VPTA 3TPZA 4ECEA 4HLQB 3II6X 4M76B 2XAAA 4V0KA 4MV9A 2G1AA 1HFWA 1SBQA 2V5VA 3TRJA 4BNKA 3QMVA 1TMYA 1ISIA 1JR3E 3A2KA 1E3MA 3M9WA 4AKEA 4YBZA 3N2KA 1ZLXA 5LNK6 1W44A 4IJWA 2WWVD 1KFKB 1B6GA 2EFDB 2Q5LA 3AUXA 3U44B 1BXRB 1EDOA 1I36A 4XQ9A 4HCJA 4EI2A 2VHVA 1YBMA 1ESCA 3FMOB 4WA8A 4UM8B 2PZJA 2CXUA 3AHEA 1MZPA 1U2DC 1BD4A 1OI7A 4Y9UA 1Z0UA 1PK7A 3ANXA 3BMXA 3JQEA 4A92A 4W5HA 1IB0A 3PKZA 2QU8A 1JXAA 2VPYA 1OLXA 5AI5A 3L7AA 3ZWQA 2B6NA 1UR5A 2QLBA 3CVOA 1EUQA 1C1HA 1DG9A 2O2GA 1C4OA 1UWVA 2WVAA 2P9ZA 3HY4A 2FUNB 3IBYA 3NHRA 3WZ2A 4DIFA 1C7QA 1OCEA 1Z8FA 2CEAA 2FCAA 2NVBA 4L51A 1GTZA 3SMQA 1LH0A 1BFDA 3BL6A 5K8JB 1SWWA 3HKDB 3C8DA 4M0UA 4CZ2A 3K53A 4UEWA 1JHDA 1LPAB 3O4GA 2WNHA 2RE8A 3ZX4A 1BCSB 5FOTA 4DAEA 4L5AA 5K6RA 3QSYA 1L8AA 1NOJA 1ZUNB 2J9XB 3BK7A 1P5HA 2RKBA 4QUKA 2NUTA 3SAJA 3T99A 4IOLA 3ZOKA 2XYVA 2JGDB 3EE6A 2JHCA 3RROA 4BO8A 2WJ6A 3GBPA 4RK7A 5KWJA 1IG3A 1USGA 1X7GA 2A9QA 2QD2A 3KEQA 4QJ5A 2G04A 4LFBB 1FFXA 2P7IA 4RMIA 3LPMA 4C05A 5K8LA 1UPXA 1JIQA 2IW3A 1GZDA 4PBSA 4HWOA 4Q9DA 3EK2A 4YDQA 4P4SB 5AHXA 2QRVB 3DWEX 3FYUC 3SC6A 3D4NA 1Y0BA 3MUOA 2H5LA 4P1ZA 2F2TA 4WECA 3W5VA 2QZJA 2IHKA 3SQWA 1JR2A 1ZIOA 4N4AA 1GARA 1MCZA 3OIGA 5L3QA 4JR1A 2CMHA 1CG6A 1XKQA 4FFVA 3DE2X 1XWFA 4LWZA 3KDPA 1OC2A 4HUQB 2B5WA 4DLZA 4GGOA 2X4DA 3CSDA 5DIZA 5KTKA 2R6FA 3ZY4A 1BHJA 3EFBA 3GGGA 4PFQA 4YASA 2OE2A 1Q20A 2E89A 1JBQA 4EMUA 2EERA 3WI7A 1Z5OA 5DMHA 2I2WA 4QL3A 3CUTA 2JZOA 3EWIA 3ISTA 1SVKA 3VU8A 1AN0A 3BWMA 3O82A 4US1R 2PKQP 3B5IA 1LNSA 3GK3A 1XDSA 2XB4A 4RH0A 5D5QA 1I2ZA 5JBQA 4PNPA 2XKKA 5B1IA 1I6MA 1PL0A 2UZ3A 5BN5A 1LUAA 1BS1A 1OE0A 2FCRA 3ED1A 4HVTA 5E9JA 3U0BA 1IQRA 4RF4A 2FZEA 4B33A 4R5HA 1Z2NX 2GVNA 3NVKI 2ZANA 3BZWA 3H2SA 2R47A 2XTJA 3B9BA 2R7KA 2FUG6 5BWOA 1EIZA 4BNZA 3TKYA 3TTTA 1S8NA 3G1WA 2Y3IA 1E1LA 1IEVA 1NF9A 3LHDA 2WAOA 1FOEB 3HYRA 3RIHA 4PIVA 3S4YA 1K8YB 4I14A 3ZGYA 5IKEA 4BV9A 5JZVA 4OQPA 1TZJA 3WRXA 3OJCA 4AG3A 1L3CA 4A15A 4YJFA 2M32A 1DHTA 2GPAA 1RM0A 3ABRB 3VOTA 1E3WA 1J5PA 1C0KA 1YS9A 3G85A 3WV4A 2Q46A 3WA7A 3STUA 4B9AA 1Z83A 3HACA 4RS3A 4UNRA 3RS7A 5A4AA 2IBMA 1ESEA 3LOUA 1H8ED 2NVOA 2IIBA 4LVUA 3JWEA 1LB1B 3H4IA 1R0ZA 4P3NA 2A1UB 3RLIA 1P5ZB 2PT6A 2BRUC 4M1KA 1YR6A 4EARA 4S05A 4TS4A 2CDAA 3EY9A 1ST2A 1RBZA 4QYXA 5GONF 4FCVA 5JSYA 1MHPA 3ZD9A 4DPKA 1X7ZB 1LY1A 4JXZA 2BY4A 3AR3A 3I6MA 3PQCA 1DPGA 4WACA 2CLDX 4X84A 4OSOA 5F77A 4DCCA 3H4VA 5DGHA 2XCSB 5JSUA 3MCWA 4XVRA 3JAMA 4H1VA 3PBKA 1NR1A 3VO8A 5E9WA 2FSVA 1RPTA 4QGGA 3SE0A 2N0SA 1M1YA 1YZQA 2VDQB 1ZCAA 2DWQA 4ZZ2A 3V7WA 4A8PA 5C7YA 1B23P 5FOVA 1ZOPA 4WK0B 2WICA 4I3HA 1IM2A 4OYRA 3N7TA 3OOEA 4JOSA 4KOAA 4LYJA 4UVHA 3RREA 3TMAA 4I1PA 2R3SA 5EIBD 2XIQA 2CVHA 1S3IA 2QGNA 2VPXA 2W83A 2KI5A 1SUPA 3H11A 1JQAA 5CEFA 4B3GA 3S2ZA 4DCNA 4E5YA 2V59A 3LCCA 4HAYA 2B25A 4TYWA 2HMVA 2HSZA 4O2AF 2JLZA 1KJWA 2XB2A 1A5TA 2VYFA 3REQB 3S8EA 1K9SA 5K0NA 1ZOIA 2QTMA 2HN9A 4LBWA 1ULSA 4L2IB 4CCYB 4IV0A 5DHFA 5AUOB 2C8KA 2J3HA 2HK8A 4ERNA 2R25B 4UOQA 4URWR 1IHPA 2GTIA 2YFKA 3OG9A 2ZJ0A 4V3BA 1JLLA 3QBJA 5KHLB 3C6QA 4UU1A 3NIDB 4JBWA 1BOFA 3CIOA 3I92A 4YRJA 1T5IA 1UBEA 5AK3A 5HRCA 3NANA 3DHNA 4K8OA 5TVKA 3SJBA 5KC9A 2JLRA 2WFMA 1H9CA 1RXVA 3A6FA 5G1NA 3T06B 2XMSA 1V4VA 4C1NA 3T7DA 5AJZA 1HA3A 4JLBA 1COZA 1BA3A 1T1SA 1R6TA 3EEFA 2FY8A 4UM7A 3HJCA 5A4JA 1CWUA 4JXKA 2R5NA 2IRWA 4YJ2A 2J3IA 3B38A 4DARA 2BEWB 1V1RA 1KNXA 3M2TA 3EMBA 2DU8A 3MXTA 4OV6B 4TL7A 4C14A 3AHCA 2X8JB 2B0JA 2PFGA 3PHCA 3L8YA 4TS3A 3P0IA 4H18A 2FEAA 1SVMA 5FFNA 4LX8A 4W4TA 5KHAA 3VJLA 5K0FA 4KPUB 2ZPAA 1RCUA 1P61B 4DCUA 1L7OA 1OFHA 2Y92A 4C78A 3MLEA 4BNXA 1RXSA 1ZA2A 2Q9CA 2HADA 3R0VA 2C3MA 3QXSA 4ZWNA 2RHBA 4BLSA 3K94A 2ZUBA 5CB8A 1I14A 3AV3A 3ORSA 4IUCS 3WOVA 4F8EA 4K2AA 4C22A 5GINE 5EHNA 2PRSA 2JDID 3ZX5A 1XMOB 4PLPA 3WJ7A 4ZCQA 1O97D 3TEJA 1M1NB 4WLEA 1NXTA 3K5IA 5IAKA 2BEKA 4N5HX 3WLJA 4B0PA 4FZRA 3B1FA 3S1AB 4FDAA 5YASA 1O96B 4O3MA 4GZ6A 4TT3D 4HPWA 1PJSA 1E32A 5HEKA 4WZZA 5DXFA 5AWFC 3KV1A 5C0OE 4N03A 2O2XA 4FT4A 3FMPB 4CG2A 3DYBA 4EGCB 2BR5A 1YACA 2WKWA 4LI3X 4B6FA 3K0BA 2FPPA 2JH3A 3DR5A 1KZYC 4XI9A 1QQ6A 3PD1A 3DE0X 3VR5A 3ZE8A 2W6MA 2BWJA 1AQIA 1TUIA 3AZPA 1RNLA 2I34A 2D3TA 1U0JA 2NW6A 2YBEA 4Y0VA 4BCDA 4DLVA 5BV8A 5J58A 1OBVA 1M72A 3AG6A 1N8SA 3QPUA 4J90A 4BGDA 2IS6A 2BTQB 3A2MA 1DQZA 4C7BA 1MX5A 3D0OA 4WOPA 2G9VA 5FBWB 3SEFA 3L82B 3NHUA 2ZRPA 5E7MA 1PFWA 4PGAA 2O1XA 3C41J 2XHEA 3DONA 5THXA 4PTYA 4QLBA 2O19A 2D0OB 4HBZA 2FW8A 5IDQA 1J2JA 4EYOA 2AVNA 1U7TA 1IM5A 1BH6A 1VLVA 4OK5A 4R8RA 3ZHOA 1JUDA 2P2CA 4R16A 1U1IA 1WEKA 4TV9B 3OIFA 5I8ZA 1QMPA 2H85A 2VHWA 1U5BA 3BFKA 3FYHA 3WL3A 4I4TA 1Y8RB 4BRZA 2DQ4A 3W0LB 2NSLA 2FMKA 2FEMA 1GZHB 3PGXA 2WA2A 3KALA 5IARA 3T3PB 2R87A 1NLZA 2YJGA 3PT5A 4OHPA 4PZEA 3RK1A 2P9HA 1V3TA 3UW1A 5KPDA 2IHYA 2VT3A 3DLIA 1E6MA 2G25A 2E4UA 2LGJA 4F3RA 1DO2A 3WIVA 1LBSA 4FJ0A 2WQ7A 2ZRHA 1HDOA 3PV0A 5CVEA 2AEMA 3UW3A 4QLAA 4H3VA 3B9RA 3DA8A 4GR4A 3V1UA 3IHTA 3VC3A 3DAPA 3GZTB 3GCZA 5HBRA 3A4VA 2A9FA 5GWXA 2Q8NA 4M0PA 4DREA 3IAM1 4D3ZA 1G21E 3OTIA 3OUUA 2ZCJA 4FQ7A 1NDHA 1AKYA 1ECCA 1Z39A 4ZEOA 2CD9A 4X41A 4N6NA 1KR2A 4DLRA 3L84A 3FZEA 2VEOA 4UU7A 1UCFA 3E8XA 3CF0A 4FBLA 4U7TB 5ALZA 2VK4A 5BXQC 5DYGA 2JGIA 3ZIUA 4B3TB 1YHNA 2AXEA 1DRWA 3CA8A 4JB2A 3I61A 3JWHA 1DTEA 3VYUB 4I9NA 3OJFA 1IVSA 2PANA 5TY0A 3U3DA 1SU7A 3TVYA 4E5PA 5G41A 1ZD2P 2I7XA 2MSDB 3U1VA 3C16C 4Y9DA 3I37X 3JYQA 2PYIA 4QWMA 5EFZA 3R6WA 1YGPA 5AK6A 2AJDA 2CFRA 4JT2A 3VR5D 4YC7A 3I2KA 3I5MA 1H6CA 3MWJA 3PNQA 3IJRA 4A26A 4BQQA 3AERB 1I10A 3GFQA 5JCOC 3CN9A 3ICVA 2A7XA 5KOYA 3ETNA 1IVYA 4YCMA 5F2EA 1MC8A 1Z29A 1JFVA 2Q7XA 3RS8A 1EDEA 4REQA 1GIAA 3ZWNA 1KQPA 5BP7A 1V11B 1NZDA 4B48A 2Q1UA 3WX0A 1KI8A 4IZHA 5BSHA 3NALA 5EPUA 1VIVA 2H9IA 3H9GA 1GA1A 4ZAZA 1X94A 3AILA 4R01A 4QUAA 3OPNA 2AG8A 1OT3A 1RIIA 3HA5A 4JCOA 4B47A 5CPFA 3U4IA 4PANA 3GLFE 3ZBUA 3AHJA 4D79A 4OATA 1RHQA 5DLQC 4CM1A 4ZCTA 4CEJA 4H1TA 1TGYA 1LSSA 2PV0A 2D5LA 1KSHA 1E5LA 4NPAA 1YZTA 2ZTSA 2BFFA 5K6TA 1BVYF 2O0KA 3OQHA 2JW5A 3FYCA 3VZQA 2OHOA 1ZSYA 1FFGA 1KH1A 1UK7A 5JNLA 3DZJA 3H5AA 3MCVA 2FN8A 1VZ2A 1L7PA 1SQSA 3QEOA 1LXCA 1EBBA 3C7AA 3EVFA 4KODA 2FSUA 2GEUA 2UDPA 2IDZA 3N58A 3RRXA 3QM1A 4FFNA 2O1EA 4PXAA 2ZBGA 3ZHUA 1B16A 2DAPA 1VIAA 4P7FA 3KQSA 2ID8A 3EC1A 3SN6A 4RPGA 4XB2A 4ZT2A 1ML3A 1P19A 4AW9A 2C5GA 1MNAA 5TPZA 2NU8A 3GPDG 3WHPA 3HUUA 1MG0A 4L0DA 4DWVA 1G8GA 2CDNA 1WRBA 2DQYA 4E31A 9GPBA 3A37A 4A1FA 3MRSA 4YIKA 1NPDA 3DDHA 3VM6A 2K4MA 1ZUD1 3D2CA 5EEGA 1HPLA 2WWFA 3HU3A 4S1TA 2IKSA 3EBLA 3W77A 5IAOA 1DEXA 1GQYA 1Z2OX 1HYQA 3MXOA 4BP3A 2P90A 2QV7A 2PUDA 4AWBA 1M1YB 1NV9A 2BLLA 4GSYA 3BGOS 3LVBA 4YMWA 1E69A 6REQA 5A9SB 1TQDA 4XPIB 3JY6A 1RZVA 4HQRA 2AQHA 5JAZA 1NN5A 1RC8A 2IUSA 2I4TA 1XMPA 1EP1B 2C7VA 3AR5A 4CN8A 1UDXA 4Y2VA 3FHTA 4ZFNA 3R3HA 2HSWA 1IJEA 2BM0A 1VI2A 4Q82A 2VKQA 1O77A 4OP3A 4EF5A 2UYGA 4M8KA 4DIEA 1ULTA 1KYVA 5I8PA 1C7IA 3OZTA 1CDOA 4XGNA 5A9SA 4OI0A 2W43A 1X1SA 1OAOA 1VTKA 2FWBA 1P6XA 4XGRA 3HVIA 3EPHA 3G2PA 2OCPA 2PPVA 4DDKA 2QM3A 1SU8A 2JKZA 3IELA 1OTXA 4JX8A 3JQAB 4EHDA 2PTHA 1JYEA 3A2LA 4IIJB 3KKOA 2C04A 1WKCA 3CF4A 4HZIA 5IC6A 5JAOA 1L5ZA 2P78A 2R8RA 4FDTA 2B7CA 2OD7A 2YFHA 3CZQA 4MGIR 4ZVPA 1QFZA 2HLNA 5ESWA 3S7TA 4GXTA 1FNDA 1D0SA 5K8IA 2CW5A 4HVLA 1QVRA 1DFGA 1TEXA 5P8WA 4RNDB 2A5FA 4GG1A 4MZXA 5A6SA 3K71B 2BP7A 3CKKA 3EUAA 2VK2A 3K0FB 4QUEA 3UMBA 2ORIA 2EJWA 2PRJA 3K2IA 3ZV7A 2P67A 2ZRNA 4G1CA 3NS7A 5JYCA 1HE5A 2B4YA 2PSSA 4BMVA 4C88A 2IY9A 3Q2IA 3SBOA 1J2UA 4JAVC 1MABB 2REBA 3KKMA 3N28A 3I5AA 2RB5A 2ZWMA 3DKVA 1BJTA 2FMHA 2OQVA 2C2KA 2PUAA 1T1IA 1IJKA 2V6MA 1OV4A 1W76A 2BFDB 2OEPA 3BYZA 4YQYA 3RKRA 2C4WA 1Y8RA 1GV1A 1XTJA 4OU4A 4RJ2A 4PR3A 3TVDA 2ZKIA 4RHUA 2R6CA 1GRVA 4MVJM 2I1WA 4R8MA 4BNHA 1GYRA 5TJHA 2RHOA 3PA6A 3T94A 1L4MA 1T2DA 5I7RA 5IU6A 2HEIA 5AKJA 5T6BA 1MFPA 5BR7A 1IQ0A 1I2BA 3PC7A 5AHKA 3N6VA 1U7ZA 3NGXA 2WE7A 4PRLA 3TH5A 5BVHA 2WSLA 4CIWA 1OXKB 1EA5A 1EVIA 1L8LA 1SCQA 4AY5A 2IZ5A 1ZVKA 4DNXA 1KYXA 1T3LA 1F06A 2PU5A 2ZB3A 3PNLA 4YRNA 3IQHX 2GYWA 3S1AA 4Q93A 4G01B 5CHYA 4KVGA 4PG7A 4I1YA 3I5YA 5A02A 4FSXA 3Q7IA 1CIPA 1CHNA 5GOTA 5EJ5A 2XAUA 2D1SA 1MEJA 3BHJA 4QEKA 1KDRA 2RHLA 3DMNA 3D64A 1YB1A 1G9XA 1PEYA 1BDHA 1BGWA 1X8JA 2I8CA 2GPBA 4KR2A 1P2DA 1SBCA 1MW9X 1XEWX 2JFXA 2NAPA 1NBOA 2SKCA 3DVRX 4PGHA 4UHCA 1I5RA 4M22A 5T7BA 1NW4A 4I8DA 4Y6GB 2PA3A 4RVHA 1PQPA 3D2LA 4EYSA 4KO1S 1T0IA 1V4NA 5AUPB 1V8ZA 2C3OA 1BFUA 2C5AA 3ZD8A 1Z7EA 4BO9A 4Q3EA 4EK9A 5IBQA 1DIGA 3DCJA 4YCBA 2PKWA 2X86A 4BV8A 1G18A 5FNVA 1CUDA 3UWKA 1NF8A 4DBVO 4HT3B 2NP7A 1I2AA 2OAP1 4RHEA 4X92A 4TX1A 3UY4A 4FFBA 1YBAA 4LDJA 1W5AA 4D8XA 2J5KA 1N2BA 3WTBA 1W0JA 1VLLA 2E4VA 2WAMA 3ESXA 2DBVO 3N2KB 4LJ9A 3IAHA 3SSOA 3HVJA 3DE5X 4Q4AA 3UJ3X 3QFRA 1U1FA 4LRQA 5SV2A 1UFRA 3HMQA 1V7QA 2SKEA 5JNVA 3EJWA 4US2R 3BIJA 1JDVA 3DVAB 3G79A 2Q41A 1Z5ZA 4TV9A 4DCOA 5HOEA 3OFNA 3RIEA 3V48A 2OENG 3HU1A 5TQ2A 5FWXA 3A4LA 3WQBA 1Z73A 3AL0C 4YFVA 5E6UA 1IEWA 1P7YA 1Y1SA 1TM1E 1WPRA 3D7NA 4TLDA 3DV0B 4DMLA 4UOZA 4TLAA 3Q72A 4JYPA 3VO9A 5HCIA 1ZJZA 2GPSA 4GP6A 2HQSA 2POCA 2ZB7A 1FDRA 4RQAA 3DVAA 5T4BA 3B1ZA 5D3ZA 4ENRA 3LXRA 5AOCA 1A82A 1ZGCA 5EOVA 3WNDA 4GWLA 2FEOA 1E0SA 1OJ7A 1M2VA 1RPNA 1XRLA 1K9VF 2V1XA 4NMHA 4LF5B 2PUGA 5F98A 4RJJA 3EQ8A 4NYJQ 3JQBA 3PC4A 4KQCA 2HZBA 4G5SA 3ZU4A 1ELOA 2H29A 4UPVA 1WEHA 1XD2A 3BG5A 4NAUA 4YQEA 5IKMA 3QA9A 4ZXFA 1YC5A 1KO8A 1T9CA 2REQA 5D3QA 3GL9A 1LVGA 3RTEA 3LQ2A 1L4NA 3OQOA 1PHPA 3HI6A 4TQGA 4YCDA 3FCYA 3G1TA 2BELA 3SR0A 2EZ8A 4Q4CA 2C88A 4EVQA 1J49A 1FMLA 4DZTA 6AT1A 4QO7A 4L4RA 1VPLA 1I4WA 3RRMA 3LUPA 2NG1A 3DP9A 1XLVA 3KUXA 4TV9F 1WP9A 4HB3A 1EXVA 5HF8A 1NVGA 1VHQA 1C2YA 2I67A 1P3Y1 3Q3CA 1JHVA 3AJDA 3IEMA 1C81A 3BMQB 1W87A 2GRJA 3OMXA 1NQVA 3SYNA 5I7FA 2XWPA 4FLEA 1BDMA 1JR6A 4RAOA 1UAAA 2ODAA 1G3IA 4IKOA 2GK3A 2N46A 3CLTD 3WMXA 4TKZA 4D8UA 3OCWA 5T5QA 3ZDXB 4QAJA 4IIJF 3MS2A 3TLBA 4E5KA 3OPMA 4IQ8A 5DBIA 3LCRA 1VOTA 3JRNA 4E11A 1T9AA 5AW8A 3E18A 1E96A 4RE5A 3WWOA 4Z9BA 5CAEA 4TRMA 4MKHA 1VL8A 2L82A 4A03A 2PYZA 4WLFA 1T1RA 4NY1A 1GPMA 1E6WA 4KSCA 2JLXA 4FMBB 4XSHA 1U02A 4L9SA 3AGPA 2RIPA 2XNCA 3GROA 1COWD 2ZJ3A 3HGMA 3LM8A 1S8FA 1XJ0A 2B9VA 3QW4B 3FPBA 2WUFA 1C0LA 1O6ZA 2CJFA 3TTUA 2W2LA 3TPFA 3G0DA 2GJSA 4JLAA 4H15A 2G0TA 3FNQA 5LYJB 1ZL2A 5FA8A 4AZWA 4DA8A 4KAAA 5JISA 2XVYA 3QKSB 1XZQA 2WSYB 3TMKA 1YQGA 2CNNA 3ZTYA 4EPVA 4L8FA 4UAGA 4Q7MB 3PTZA 5IJ9A 4BO3A 2FFQA 4BCCA 4ZTUB 5CCEA 3ITKA 4HLCA 5C80A 3I2YX 3HCEA 3IXLA 3KLPX 5KU7A 5A4DA 3DZCA 4G36A 1U2DA 2IYYA 5JQGB 1JR4A 3ICQB 1WKBA 3KQVA 4RTJA 3UUGA 2GN8A 3KT6A 5LA6B 3UCFA 3TSAA 5FULA 3TJMA 2I80A 3KLNA 3HV0A 4Q66C 2GEVA 1Z4OA 5F1PA 3DG9A 4MQEB 2ZRJA 1T25A 1ISFA 1T9ZA 2AHOA 1OYOA 1PL8A 3DFKA 4S1NA 3UKDA 2YMLA 4TZKA 5CLIA 1CJVC 3U60B 4C5BA 1PJ2A 3LQ4A 1MQAA 5JS2A 5IJXA 3UWSA 4ZICA 4EO7A 1VGQA 1BIFA 3B6IA 3DMHA 4X1KB 3CY6A 5LFAA 2ZRFA 4R69A 4UTXA 3HJTA 3SC4A 1W85B 3HCBA 3BAZA 4FEGA 4DA6A 3KR2A 1L9KA 1E7MA 3DB1A 1T3SA 4MX8A 3CRVA 5JJIA 1KRXA 4HNGA 5CLJA 2GWHA 2ZR8A 2JGMA 4JL6A 4PG5A 5DKFA 3PKJA 3C85A 4MPJA 4U9IS 2VPWA 4XPIA 5FBLB 1KH2A 1E3DA 3ZIDA 3NHYA 4RTLA 3HBNA 2WWGA 1LDNA 1Q0RA 3IP1A 3EPRA 4TT8A 1P1HA 4ZXPA 4B73A 5I9TA 1P4AA 2ZIXB 2FYTA 2IY8A 5I7WA 1U8ZA 3VC2A 3W9YA 1N9GA 3HN7A 1IHDA 5FNZA 3R3ZA 1UP7A 5LBTA 4O4HB 4QOIA 4WXHA 2FMFA 4DIBA 1S2MA 4JP2A 1XXLA 1R9NA 1Y4SA 2OVBA 4J0KA 4V38A 2XH8A 3RHFA 2SCUA 3CLUC 1ZINA 1SCUA 1I3MA 2XWSA 3DBHB 7REQB 2HREA 1CU1A 1I4EB 2Y4OA 4KTVE 4Z0PA 4L8YA 3DEYX 3UGTA 1GUBA 3K9CA 1HL3A 1OXXK 1T3GA 2HWYA 2Q9UA 5B7PA 3BKWA 4YR7A 1BAPA 5A1TA 1E2JA 1B8OA 1VXRA 1NQ5A 1ZUHA 2X5OA 4LJ7A 3F3YA 3PT9A 4JGGA 3S2UA 4CM4B 1AZLA 2WTBA 1VMKA 4FE7A 2AOVA 3MELA 3PGLA 4BEWA 2W4MA 4KQXA 1U80A 3URMA 4FYXA 1AS0A 1ZVQA 3KQMA 1D2EA 1LZLA 1Y6GA 4JLKA 3PDUA 3WO1A 1PNQA 3SQMA 2IOFK 4JQOA 3FTPA 3PEYA 3BM5A 3Q7RA 4BO2A 4ZVQA 5CITA 2Z2XA 4P98A 5EWJA 5BMOA 3VYTB 2ZVJA 1ZAYA 1HOXA 2OC9A 2P2LA 4AO7A 4UXJA 1YT5A 2QV0A 1K97A 2DSTA 1YS7A 1UC8A 4YA6A 4D43A 1FW6A 3AG5A 4R8KA 3LQQA 3LKBA 1WXIA 3UMSA 2C2ZA 2XQJA 1M7GA 1F3LA 2Q1YA 2XNSA 1QQBA 2QVYX 4W7HA 3S3TA 1VPDA 4AJJA 4G0QA 3A32A 4AYTA 1G0NA 2CLMB 4JQCA 5FRDA 3IUYA 2H08A 1MT3A 1I7DA 3NHWA 2HHJA 1N2ZA 2QRPA 3BFPA 3D6VA 4G1FA 1BFKA 1RD4A 2VBFA 4IG9A 1QIFA 3BIWA 2NZYA 1IHUA 1MGOA 4RM2A 2SBTA 3N86A 4BJ1A 1E2KA 1DXYA 4CMCA 4KR7A 4F0JA 1GEEA 1QRAA 3LX8A 4CJXA 3THYA 4GDFA 2VPZA 3FHJA 3LC0A 4MJXA 3CNOA 5LZ4A 2HSGA 3MJFA 4DEXA 5HBGA 3V42A 3ZIAA 5KYGA 4GPTA 1XZEA 3U0VA 4MV5A 4ZC8A 3VR3A 3CPEA 1I80A 4NOKA 3TQQA 5JLJA 2C2BA 4JOQA 1DSSG 3QP9A 1PSDA 2XRFA 4QM6A 3BJIC 4UTNA 3M1IA 2ORVA 1ZZEA 4NVRA 2Q3BA 1E60A 4KI7A 1D6SA 1T9BA 2R2GA 3HHPA 2FEXA 2YW2A 1GDDA 2XE4A 3HVRA 4CL2A 4NH0A 1ZGGA 5A62A 2QP4A 2ZR9A 3T35A 4FIDA 1OA0A 2WM9B 1WXFA 4MS1B 1N6OA 2G1PA 3FYUB 2PUTA 4BLPA 1RYDA 1EFPA 2XWJI 2X77A 4DM7A 2UV8A 3HFRA 5GVSA 5FLEX 1BXZA 3DCNA 1NIJA 2PRZA 3RTDA 5IH7A 3WA6A 2FPPB 2G3YA 4M8LA 2V6IA 4S1OA 1H4VB 5JNTA 1THMA 1YJBA 2GDZA 1N2CE 4KYTA 4U63A 4CMHA 4DS3A 1CR4A 4IIGA 1UMBA 2WMDA 4OA8A 1WUHS 5CX4A 3FFTA 3O7WA 4EA9A 1TKCA 5LMCA 3WL4A 2MR6A 3KR1A 1O08A 5AOBA 2WWRA 2WILA 3UO8B 1XGKA 1P73A 4RQBA 4C0HA 3AY3A 2YJ4A 1MJNA 4KITB 3I3SR 1OILA 5H7XA 3CPHA 3SHTA 3PSAA 2HHAA 2RAVA 2BUAA 5I6DA 1UZLA 1M0TA 2GHQA 3QJ5A 4PXSA 4NICA 5EEHA 1QR6A 4FHFA 5JNSA 2H4FA 2BHLA 3FOAA 3ZWOA 1A9SA 2Y1FA 3FYDA 4LKRA 4MUNA 4ZCLA 4LF9B 2KLBA 2WMOB 3ZDDA 1PZFA 4K9QA 4PX9A 4DA7A 5I7HA 1G7RA 2RGXA 2PGAA 3VNBA 4QJ3A 4BQNA 4D9BA 4CQMA 2BPOA 3BORA 2JLAA 1VYTA 1U0TA 3DDSA 4RIFA 1KDYA 4XZ3A 4KQIA 1IZYA 2VT7A 4GIBA 3CFYA 2PWZA 3PDHA 4AY4A 3O1LA 1MU0A 3O7MA 4JFAA 4Q5IA 4IHAA 1UPUA 3SHVA 1SXJE 2FOXA 4U39A 1H6BA 3B2NA 4JYCA 5IP5A 3ACDA 4MJ7A 1X0XA 5KVCA 5FT9A 2DR2A 4H7PA 5T3UA 4ZI7A 4GI7A 4MS4B 4KXLA 1VG9B 4RV4A 4RIGA 2Z2IA 1KSJA 2KS6A 4U2CA 3B1WA 3CCBA 5CGQB 3FWZA 3T5MA 2FSFA 8ATCA 1TVCA 4M83A 3EVZA 5EWMB 1PTJA 4LXXA 2YL2A 5LC1A 3U62A 4I4TF 1SHLA 3HKCB 1XTZA 2Y05A 5TVGA 3OP4A 4OO3A 5FORA 5HK9A 1LQUA 3U56A 4DLUA 4KAXA 1U11A 1WD7A 4OYLA 4DLBA 3U4MA 1R74A 1AKUA 1R10A 4MMYB 4AKSA 3MBIA 5B12A 4Q1VA 2HJRA 4OIFA 2L42A 4KQJA 3CVYA 2FZCA 2E55A 3HP7A 5A9TA 3RJ5A 1FP4B 3VR6H 5EWMA 2PZGA 1RKUA 2Z3ZA 4JR0A 2PMFA 3NTOA 4Y2PA 4G65A 2QN2A 3PA8A 4J8PA 1IPFA 1N3YA 2BFMA 2BH9A 3L0OA 2AN4A 3KZOA 4RF5A 3TLZA 3TLMA 2HPAA 3TK1A 4LOIA 4DNPA 4GMXA 4FS3A 1TZKA 1WBJB 1YB6A 2H07A 2Y1CA 3DULA 1RSZA 2WDPA 4YCJA 5B7NA 1MAVA 2R6HA 1ZCJA 2HLDD 4WAUA 5IEJA 5IZCA 3OEWA 5DMXA 2WWXA 1I6LA 3THRA 1QRRA 2R6AA 2A5DA 7REQA 4TMKA 3UFBA 2B9EA 2O3SA 4Q9AA 4QSMA 3OOYA 1N4AA 3L6OO 2AFIB 2GEJA 2UU9B 1PLJA 1JXMA 4ND3A 1KZ9A 3LJKA 4WUTA 4B2LA 1RZRD 3GJYA 4CUZA 2HPZA 3GT7A 4BJ6A 3CZMA 2VAWA 4Q05A 2O5EA 1E2QA 3IRVA 3JALB 3LPNA 1WY7A 3DBVO 1FS4A 4FYVA 4IMIB 3T52A 3CWQA 3A10A 4M3NA 1ULZA 1SPBS 2GF9A 4KXVA 5IF9A 3PLAE 3IE0A 1HNXB 1JDJA 1U3DA 4M7PA 3IHKA 2QI9C 2YC4C 5K4GA 1T8PA 2FPMA 3VDRA 3AQIA 5D3KA 1MOQA 4KP7A 1QHSA 2Y6UA 3TBHA 1BTOA 5IC4A 3LY9A 1P44A 5JXGA 2H63A 1TX4B 3FJYA 2DXIA 4FKZA 4KKVA 3Q8MA 2LKCA 5CDHA 1ZW6A 4GE3A 5EIXA 2J31A 2WHPB 3JWJA 4ZO4A 1HT1E 3S7ZA 1S3SA 3ZCRA 2ZI4A 5ALRA 1QAQA 4IOMA 3GN2A 1Q11A 1V9CA 2Y1WA 2X5NA 4W5JA 4D3YA 3QITA 2Z2KA 3K5HA 4EIWA 1K92A 3UMJA 3PFNA 4QOGA 1HK7A 5L40A 4ONEA 2JVIA 2YWXA 2VAPA 1Z35A 2Z4RA 5ENZA 5FFMA 2JFQA 3WNCA 4HL6A 2ZJ5A 4FWIB 3LVQE 1LTQA 4G8CA 1JZSA 2J33A 2YVKA 1U7WA 1NUHA 2J09A 2NYRA 2FRVA 1LVHA 4O1MA 3ZLTA 1N5JA 1N6PA 4NZPA 9LDTA 1F1BA 1PD1A 1TYDE 3F5MA 1QYWA 3LYAA 1CRZA 1NL3A 4KN5A 4Q9HA 5C5DA 4KFSA 2C4VA 3OU7A 4INPA 4WCVA 1RXCA 2QT9A 5C1PA 3EPLA 2XE6A 2FTKE 4LHXA 3TXYA 1E4VA 5F4BA 4J4TA 3OLXA 4NJEB 3OE7A 1UKVY 2PYDA 2ZBEA 4PO9A 1XWIA 1UBTS 3QU4A 3WYNA 2BSQA 3T7SA 4TL9A 1IG0A 1NI3A 3OOSA 4A6DA 5ARBA 1N34B 3R6LA 5LWHA 2XLCA 1P3DA 4QXRA 3ZBQA 3PRYA 4F1KA 1VRWA 3DC2A 5K3AA 3IC5A 1QO9A 3WGZA 5CMLA 2PZBA 1M0SA 2I6TA 1RHMA 1WB9A 5CEEA 5IMSA 2AQKA 2PN1A 4GMKA 4B6GA 4FYKA 4QVKA 3QELA 5IT4A 1C7RA 1CCWA 1XZCA 3D31A 1HUQA 1SOWA 3ZCVA 2RHGB 4BFSA 3EW9A 4LC1A 4P7KA 2ONKA 3DUFA 1B14A 2CZQA 3W06A 4DG8A 1GG9A 3HM2A 1OR8A 3PQ3A 4C3ZA 3WWEA 4O4LA 2ZIUB 2BBSA 4LIPD 2ECKA 5FTWA 4OG2A 1K4KA 2PO5A 3FPCA 2FUCA 3QX9A 3JWIA 4D3FA 2WWYA 3W8DA 1Z0KA 4E2XA 4BRWA 3HWX1 3IJEB 2IIPA 2VUIB 2FW9A 3K9WA 4MGYR 2OY0A 1Q0LA 1XEXA 3EZYA 5H5JA 4PBTA 5LSAA 1QU2A 3KSZO 3RF7A 1JZQA 5F1OA 3THSA 1FEZA 5JPCA 1NSYA 4KQ6A 2FGJA 3AWIA 1UBNA 3C3BA 1HORA 4M54A 3EEBA 4RXMA 4JJ6A 2ZYSA 4DSTA 3IKTA 1XNHA 3H3XA 1H8EA 2OM2A 4DVJA 4EJFA 3U40A 2WHPA 2V96A 2WPNA 2GCEA 3LDUA 2Z3WA 2FW7A 4DIKA 1LBIA 3VYWA 5FBVB 1GKYA 3LQKA 1KK3A 2QK4A 3CB4A 3ONFA 5TJ9A 1I32A 1U7OA 3MJCA 4Q3CA 1J0CA 2RGWA 3PE6A 4JQYA 3EYAA 1NVBA 1Z0SA 1FDWA 2AQ8A 3BICA 3RU3A 5AVUA 3MJVA 2C5EA 4HMQA 1YMVA 4ZAVA 1QP0A 2VFAA 3WGKA 1FJGB 4FFWA 3UHFA 1QO7A 4X54A 5JNUA 4QNNA 3IUEA 4N5MA 4L0CA 4FBGA 3FWKA 4IZIA 4LW8A 4RESA 4ZQCB 4CQLB 2VR1A 1KEUA 2VF4X 4TS9A 1FRFS 4KZPA 3VNQA 1WCV1 4C6HA 1AD2A 4GKAA 4ZVLA 2O52A 4LE2A 4Y7CA 5CH5A 2X0EA 3NH9A 2XCTB 1Z28A 2PD3A 2GPWA 2NLOA 3UMCA 4FT2A 4EY6A 1Z25A 1FX1A 3J7AC 3ZK9A 1I1HA 1DI0A 3ECCA 5DNUA 5B3AA 1NI5A 5HNKA 4WJZA 4IF4A 1OKKA 4WVFA 2Z5FA 4X91A 5BYBA 4A6XA 4UQPA 5MN5A 3DOUA 4LECA 1U5CA 3SK0A 1G8KA 4MVCA 3FVTA 3V4OA 3FTEA 3CX3A 3U7GA 4OI2A 3ELYA 3VI3B 9ABPA 3GEBA 4RXUA 1WXQA 3IV9A 3G5UA 1HG1A 3EISA 1NW8A 5A6VA 1FMTA 1Y1RA 1Z47A 3HB7A 3R3VA 3SI7A 4AYWA 1T6NA 5DH9A 5I7AA 1B3RA 4FFSA 2WIKA 3MJHA 2R1VA 1GTJ1 3PF9A 4XUCA 3UENA 4GVXA 1KDPA 4X45A 4D9JA 3VU1A 4RTKA 4MIOA 1ZD1A 4ENSA 3OO0A 1P72A 3QIAA 4JJ4A 5C7OO 3O1IC 3T5TA 2HF8A 1VM6A 2REOA 2H4WA 1JNYA 3LC2O 4DUZB 2C9CA 5F9FA 5K3BA 3O6VA 1U0GA 1WL8A 4ER3A 3BWEA 1MO5A 4QEDA 2ZE8A 1Z7BA 1U2SA 4PTLA 3EIFA 5HIIA 4DYDA 5KNCA 1W4AA 4PN3A 2CXOA 4NU5A 4HX5A 5F5XA 1U81A 2XF8A 4AU1A 3TAUA 1NFQA 2IODA 2QQFA 4BZWA 3S81A 3RFUA 3A2NA 2B1JA 1A97A 2C58A 3H7AA 5L7WA 1AUOA 1WZ2A 1U99A 5HA5A 5FO1A 3UHPA 3W2IA 1RZ3A 2PX2A 3D7KA 3M3PA 2DT8A 2BFOA 3C5WP 4WT7A 1NHGA 1M74A 3DMDA 3H18A 3AESA 3T9FA 3N7AA 1E5VA 1FFBA 1G9SA 3PXCX 2IWRA 2BMEA 1SD5A 5EMJA 2FSHA 1T8YA 3DL0A 5E4FA 5LYYA 1KMIY 1XIVA 4FD3A 3HB4X 3SYTA 4ESEA 1H1LB 1H9BA 1SB9A 2C2GA 2R7AA 5JCPA 3OZWA 3PSHA 3QHQA 3QKWA 4FFRA 4IIVA 4NBLA 4AJ1A 1U9YA 1M8FA 4TVBA 4AWXA 1UXHA 3UT5A 2MMCA 4RJLA 3KE8A 4QT0A 4N9QA 2XE8A 3IX7A 3IXMA 4HLUC 3BPSA 3RVMA 2J7KA 3WYDA 3Q8KA 1C1XA 1U0FA 2CZGA 4F4UA 2AN9A 5ED0A 1TTPB 2BKAA 2J0EA 4QPZA 4YRKA 4F3KA 4A0SA 4WZAA 2ZE7A 4OLBA 2QL7A 3QF7A 1L7NA 1MIOB 1XZIA 2H48A 3VVBA 4E2ZA 2XGJA 3E5MA 1VL1A 2R86A 3OZCA 1PZGA 2XT0A 1DCKA 4XGIA 2P4SA 3BD6A 4KC0A 4M1SA 1P9WA 1XAJA 4EH1A 4R7TA 2R8PA 3Q6MA 4X62B 2VNHA 3G5LA 1HXHA 1P5FA 4MUAA 1OXVA 2K2QB 3CNEA 4N12A 3SC2A 1GL9B 1PDWA 1Y3CE 4ZYUA 1KIFA 1Q74A 2GJAA 2EYUA 3DDUA 4RENA 3AO0B 2JZCA 4BE7B 1XDZA 4FPXA 2DX7A 4RSHA 5HDQA 4MLZA 3QRWA 4B76A 4MUHA 4EW6A 4X6LA 1FUUA 1J33A 2EHDA 1BXGB 2V0NA 2W8BB 1Z82A 1A8QA 4MW5A 3ND5A 5IM4A 5FYDA 2B5VA 2OXRA 1N9KA 4NYMQ 2OCAA 4WFQA 3TPCA 3SZUA 3FLAA 4FYHA 1TM7E 2P0EA 4U2BA 2WKPA 5CXQA 2G82A 3CW9A 4IDBA 5LLDA 3GLHB 3FBWA 3WGQA 3IIEA 1I3CA 2ZSFA 3HSKA 4TPKA 4GR9A 5BOSA 2Y8EA 4GYKA 2GBLC 1UXKA 2POQX 4F5EA 4KO4S 2B8EA 5CW2A 4FB4A 1Y8QA 4U7HA 1L2TA 3H4TA 1OBOA 4UREA 3IR5A 3NM5A 4PCAA 3PXGA 2QRKA 2W58A 2ZKLA 1P1RA 2ZJZA 3BXEA 4PRYA 1RE0A 3WJ1A 1UWKA 1FDIA 2R751 2DFKB 3WLIA 4EEZA 1X1BA 1KERA 4HGNA 5H80A 4NDNE 2PZFA 1QMGA 3N8DA 4N8SA 1YZ3A 2GQ0A 1J2RA 1UBFA 2QT0A 3DS8A 3NM6B 1F14A 3HL0A 2PH7A 3OPXA 4HDNA 3SHWA 4HLUA 3ESRA 5DLYA 4PLYA 3WDMA 4LISA 1YWGO 1BZYA 2QP3A 1CQJA 1P4GA 4KFCA 4DG9A 2NADA 2QL6A 2VLIA 3MF4A 4KO8A 4YEDA 1DWPA 2OXCA 2LIPA 1E2HA 1FBNA 3OMWA 1KYYA 1VGRA 2A0YA 3FFBA 3DWFA 3AC0A 1VHDA 4QREA 4BYGA 5JYDA 2EGUA 3DMPA 3DXXA 1D3AA 1JLRA 1P45A 1XRNA 1Z0JA 2CHFA 4TSFD 4QYTA 4Y3UA 1Q1BA 1R8YA 1GQOA 3FGZA 3WNQA 4NMWA 3QQPA 1TT5B 2XB6A 5GGYA 4C4SA 4CL3A 1JECA 3EX7C 1O6FA 1SG6A 1THTA 1EE9A 1UBHS 1J25A 3GPIA 4XWYA 1QKJA 2AKYA 1AZTA 1FFWA 3NX4A 3V4ZA 5HQ3A 4HOYA 4I5IA 1EP9A 3RU7A 3N6RA 3CTPA 1YZYA 3N2GB 5DX0A 2AEJA 4YV0A 1ZQ1A 3NPAA 1B6TA 3K6KA 1ITZA 1YV9A 5AW5A 3L7OA 1N2XA 2FFBA 5DTMA 2VRWA 5E3HA 3OEEA 4YRBA 1VRVA 1SHUX 1NYQA 3LSTA 1XJQA 2IY7A 1YZGA 3E5HA 3IILA 4DJAA 2B3DA 2R1TA 5E9QA 4DIMA 5BWMA 3A26A 4GPD1 4NV1A 3HEBA 3MCAA 2NV2B 4H0CA 3M49A 1PLKA 4BV3A 1GUFA 1WVIA 3KFLA 4MUYA 1TJYA 2DQSA 1V2HE 1BN7A 1LK0A 5I47A 4M7RA 1R7RA 2WJHA 3UWPA 1QIGA 1D1PA 3EZ6A 3F47A 1N1DA 4NAVA 2LR0A 2D59A 3HCFA 2ZR0A 3R5HA 4N3GA 4D9NA 1NP6A 1U2GC 1OWPA 3F78A 4BNTA 2HKIA 3MRTA 2OTCA 4AYXA 4JYAB 3BK1A 4TSFA 1XLWA 5L3SA 4XSVA 2FP4B 1P60A 2VJYA 5IAGA 4CKWB 1D9XA 1QFSA 5AIAA 4AJIA 3G5MA 4XKJA 3UBTA 3B6KA 5LP6A 2KYRA 1PBTA 2JI7A 1O94D 2QAGC 3HQ4O 4N7BA 5D6NA 5K0LA 5LXTF 1BDIA 3C48A 5FPKA 1BO6A 2O0JA 5EJFA 5FLYA 4A27A 3HTXA 5LD2C 4GT1A 3PPXA 4BNMA 3DMGA 1IE3A 1YL7A 2Q62A 4N0PA 4TMWA 1D2RA 3CBGA 2JC3A 3G7SA 1FYEA 1U65A 4ARAA 2J6HA 3CSSA 1UEXC 3QLEA 2FG6C 4RYLA 1YQDA 4PG8A 1G9TA 3LGAA 4KR0A 4UUMA 4GWGA 1E9EA 3TE6A 4LVNA 1QFJA 3O4RA 4DV2B 2WOJA 1DC5A 1P7VA 2K6GA 3FGNA 5ITZA 3R9XB 2H1IA 4E7PA 2HAEA 3NAGA 4K9LA 4OD0A 1CNFA 5DSXA 5HUHA 2CLSA 3FSGA 3H1EA 5ALKA 4YAWA 3RUFA 3KZKA 4BGEA 4YMHA 2IU4A 1N32B 3GLUA 1USIA 4J1SA 2J3JA 3UYKA 2F1RA 3AVPA 3OZIA 3WR5A 4DXDA 2XTAA 4ITVA 2YJ6A 1VKOA 3ILVA 3QOYA 1PN3A 4L5YA 4MVJG 4Q00A 3ZE1B 3FLBA 1FFDA 3WQQA 1FBTA 1H8HD 3NC4A 1F9EA 3R8CA 3NYIA 5J2TB 4WKPA 2R1ZA 1OZ0A 4XVHA 1UBCA 4K46A 2EX4A 2PQ6A 1W2GA 4M1OA 2OCBA 4OXXA 2IYNA 3FPEA 4B7ZA 2IXBA 4X63A 1PNVA 2C2YA 1JDBB 3O38A 4A5OA 4B4VA 2Y68A 4Z53A 2QX6A 1C2TA 2FX5A 3IPAA 1PLLA 4O1IA 2QVLA 4RPIA 4FZ3A 1ESZA 2HA2A 4AKIA 5DM2A 2G0AA 5EINA 2XT9A 4M7WA 3AEUB 4FCCA 4I1VA 3SKXA 2YKGA 2FDCA 3KQNA 4CL8A 1KQGA 1Y4ZA 3X0DA 1DC3A 2OZLB 1ZHFA 2QJTA 2G07A 2Q3CA 1CUGA 2GKOA 4AS3A 2BEUB 2OWDA 3NNNA 3KEGA 4I9UA 3U7RA 2IH4A 3UK6A 3CO0S 3E1SA 1R0RE 3ANSA 1V37A 2OCLA 1J7KA 2C94A 4JJAA 1KA9H 4LJAA 4OCZA 5I8WA 3HEAA 3DB2A 4U7GA 1P62B 4I9FA 3SZMA 3T7KA 3ZU3A 5HE9A 1PT7A 3F1LA 5A3SA 1QLWA 3NRBA 3QYPA 4DEVA 4MWCA 3OX4A 1XHEA 4MPRA 4TM8A 1Y8ZA 1AHPA 1X7DA 3STVA 1SVIA 3GDWA 3NDRA 2JLYA 5BT8A 1KS9A 1LV8A 2DP4E 4UFOA 4LF6B 4V3CA 1T8TA 4XEHA 1DTWB 1XKTA 3H5TA 3UMRA 2I3AA 4U1RA 3FMFA 3HGQA 1DBQA 1THGA 3CVJA 4AQDA 1ZOLA 1QVAA 4JASB 2VG8A 2W0MA 3ICCA 1OIXA 5KTPA 4B3RB 1K1EA 4CYMA 3BXOA 3FXAA 1FSFA 2AMLA 5A5GA 5JECA 4QECA 5AMXA 3U44A 2O8VA 2WDZA 1Y37A 3GJQA 3LA8A 4I8IA 1A7AA 4MP3A 4PZPA 5D1HA 4AZVA 5LJLA 3JZDA 5SY9A 1N8KA 2IEAA 3ILHA 5BPFA 1QE5A 1L8XA 4K86A 4W8OA 3C3JA 5F21A 4NCNA 4A6PA 3E3NA 1WOYA 1CE8B 4H6PA 1NVVR 4IUYA 2XUDA 5LLTA 3O74A 1G2PA 1KH3A 4RSRA 2ZT6A 2VHUA 3OX1A 4NECA 5KYXA 3ELBA 4G9GA 3DPIA 5AW1A 1H42A 2TMGA 2VJKA 1IN1A 4TLCA 1GCIA 1QX4A 1U8FO 4IIFA 1O0BA 5DWDA 4W5WA 4J6FA 3RC9A 4KQKA 1VLJA 3H8SA 1TXGA 1X1QA 3CSUA 3GIWA 1MTOA 3ORQA 2IYQA 1NWHA 3S2FA 1PSWA 3BFVA 3HI4A 5GJVC 4TRRA 2EL9A 4LSGA 3IKVA 5AVTA 3BBLA 3IYLW 4ZVTA 1RQ7A 2A4KA 3H86A 3L4JA 4QBIA 1O5TA 3VXKA 4DV4B 1M34A 2IYPA 5B2EA 1H65A 2XQGA 3DEAA 4E32A 2XGMA 2ZPUA 1KDTA 1KEKA 1SKMA 3K1AB 2DY1A 1VFPA 3FCOA 1PJQA 4EFDA 4CIVA 3ESAA 3D4IA 5FJIA 4K0KB 1DAKA 1ZK2A 2WT9A 1PWXA 4CDMA 1F6BA 1BW9B 4X8MA 3UGKA 1B0PA 2V54A 1EDDA 1PJ4A 2KE5A 2QD3A 2ZE5A 3IVAA 3V9PA 5G4KA 3X3HA 3TOVA 2WAXA 3ZHCA 1OH8A 3WSTA 1H2YA 1TF7A 3HJBA 3OSZA 4TGLA 1ZESA 1FNSA 1ND5A 3NGMA 1WA5A 1NNI1 1M34B 4W5QA 2R1TB 5FUWA 3DZDA 5LQMA 4GLFA 2LUOA 1H85A 4UD2A 3WL6A 4YV1A 3SBEA 2HCFA 1JHPA 4LXUA 5HIJA 4FINA 2NV6A 3EZFA 1QTNA 1ULHA 3IEUA 2PT5A 4P5DA 1XYVA 3OTQA 4ON9A 1U2TA 1U3WA 5EZ6B 3VHLB 4JLNA 2XVMA 4DNFA 3RYCB 1D5WA 3OE4A 2HFKA 5ALWA 5LR6A 1VP9A 3KXIA 3D7LA 1YKSA 3H5IA 4X6UA 1NXPA 2XWQA 2C78A 1ZD9A 3BL8A 4CV0A 5LD2B 1PX0A 2BGMA 3QEMA 3LLMA 2W2KB 4JJEA 4IILA 4CM8A 1U5AA 1JMVA 1QRSA 2J0QA 4ZOEA 1JSCA 1N7JA 1J8FA 1NONA 4DA9A 4EPYA 4CKWA 4LY3A 4NNOA 3V46A 2CLOB 2F1OA 3IOCA 2B7BA 1BHO1 1DBRA 4FSHA 1O9BA 1JI3A 4I46A 4M9UA 4GUAA 2QMZA 4YLGA 4B8YA 2VK1A 2BCJQ 1PEDA 4LYHA 4NFLA 3JQ7B 4TSKA 3HABA 4IWYA 4PQFA 3QEKA 1MKYA 2F3PA 2CUTA 3H7IA 4FKMA 3FI9A 4I2VA 1UM8A 4W9NA 4D4MA 3CKLA 1E6CA 1I1QB 3V4RA 3KTAB 2E1PA 3JZIA 1MP0A 2W2KA 3ESCA 2UXBB 3CKMA 3MOSA 1HEYA 1VL2A 4TVKA 3DZBA 4TYYA 1GCUA 2DTEA 1ZPDA 4MW9A 1VJGA 1MB3A 1YR2A 4DC1A 3N1UA 4WY5A 1NVVQ 1DCTA 1E1QD 5HXAA 3HVHA 2I29A 1PD0A 1SC9A 1AQJA 2GAFA 5ITZB 1OFUX 2OLEA 3EEIA 1PQWA 4MINA 4OF4A 4DOMA 1JKJB 3C5EA 2F48A 3FUXA 3AVUA 3LV8A 2CSXA 3UOWA 2I9KA 1CV2A 2Q49A 2HXGA 4HNAB 2IYTA 5E1OA 2V03A 2VDPB 4E4YA 3CUWA 5FAKA 4PCUA 4PFSA 3ELDA 4HADA 2FR8A 3N2GA 4F86A 1HRKA 1SULA 2VQDA 1VZ3A 3Q9SA 1P1JA 4PZLA 1X7WB 3DBOB 2M6LA 5TMPA 3T3NA 3MHTA 1ICIA 5E7IA 5AVSA 2IX9A 3SX4A 4CF7A 1BE1A 1QC5A 2LE0A 1QZZA 4IF6A 4OREX 1QF7A 1LNZA 3R8XA 4JENA 1NBWB 1EWTA 2BGLA 1NNSA 4WLNA 4LJRA 4CKZA 4BMZA 1XFAA 1EVLA 2GFQA 1OFGA 2A5GA 2VDJA 3L9XA 4WTOA 3R09A 2XNKA 1F6DA 4R81A 5JI3E 3RF6A 3V2UA 2R96A 2BHRA 3NKFA 4ND6A 3OF2A 4LZNA 1NASA 2BGIA 2BM9A 1UDWA 2OHXA 3I6BA 1BVHA 3IQIX 1WLSA 3BERA 3UFXA 4M36A 5AK0A 1IOWA 3D02A 5ALIA 5JAIA 3NVMB 2ZRAA 4AF8A 1KJNA 4BY9E 4UZSA 2G77B 4BQPA 5BQ3A 3BMCB 4X94A 1JAYA 1V1MA 2I6FA 1A7UA 1FUYB 3L06A 2D2IA 4KQFA 3FKQA 1J70A 1UQUA 5EQFA 5L3RA 3SQLA 4PSCA 3TB6A 2VUTA 1ZUIA 1YKFA 1ATIA 4HN9A 3I4LA 2QTGA 4QD3A 4IFEA 1T9HA 2DWOA 3UUFA 4DBLC 1QUFA 4B2PA 4BO1A 3PFFA 4PF1A 5LU8A 4HY3A 3AH8A 3BN3A 1N92A 4KNWA 4H3HB 3IB6A 4GPAA 1XA0A 5ADHA 1NJ6A 2W6IA 2YN2A 1JAIA 1R9GA 1W94A 5ALJA 4MW6A 1DO0A 2VNJA 4HAUA 3LBIA 1OFVA 1KU6A 4RDHA 1EGMB 4MKXA 4Q3OA 5K0TA 1W4ZA 1UANA 3AFMA 1CJUC 5A06A 2YIDA 3M4NA 1RBQA 3REQA 2JLUA 2HI0A 4B44A 2ZR7A 1QTRA 4N41A 1DJMA 4R2MA 1QZTA 4P0TA 4K9MA 5HJ7A 1TPZA 3IMFA 1N25A 2W4IA 2PV7A 2F4VB 3D6UA 1XU7A 4IUBS 4Q6WA 3TEMA 2Z1NA 1J6UA 3EXG2 5F3DA 2NPFA 4YX9A 2PJZA 4JC5A 3CHYA 4RPJA 5ARDA 2IPMA 3D1VA 1JEQB 4PRZA 4D0SA 2HA6A 4UNIA 4I55F 2NX2A 1MIOA 1JA1A 4OL9A 3MLBA 3UJ8A 2WQ6A 2PE5A 4KW7A 5J2TF 3E48A 3NBKA 3K70B 5C1BA 4Q7LA 2VDLB 2JLCA 3N5KA 4C29A 2Y93A 3QX3A 4QARA 2Y2UA 3DR3A 3R77A 3KB2A 3KC2A 5IF3A 1GDHA 1QPBA 5DM60 1Q1NA 1PV1A 4EG7A 2WIGA 5CT8A 2I1QA 1EE2A 1F4LA 2NXJA 5JD3A 2Q6LA 3CUEF 1BNCA 4BLWA 5KPJA 1Z0DA 2DEUA 3LYUA 3OAAA 2D54A 3FPGA 2QN3A 1K8RA 2GPJA 3UWDA 3A11A 2YQ5A 4GI3A 3T5GA 3UXHA 2A1TS 2VYQA 3E27A 3AVVA 1B2RA 4JJ7A 3DW1X 2XMRA 2DULA 3BJRA 3E22B 5B37A 3V8BA 4MR9A 3FZNA 2IFTA 3B1JA 3TKLA 3MTAA 4YJHB 3KU1A 4E0BA 3VUEA 5K0CA 4R9SA 2DPGA 4GQAA 3X43A 1T36A 1YXMA 5AXCA 2C2MA 5KWVA 1FMJA 3IQZA 1M6VA 1E1RD 4HQOA 2QR3A 3PTLA 5AO9A 5DTRA 1XAGA 2YY5A 3FR8A 5FJJA 2IUYA 1MX1A 4L15A 4C0BA 4URYR 3I9LA 4GBMA 2WT8A 4MYCA 2AQIA 1E8DA 1NVAA 2OZEA 2RGEA 4R2JA 4C07A 2WWIA 3TIIA 3H4MA 2VAMA 1DG3A 4PPFA 2Y1XA 3VU0A 2EX0A 2H1LA 3OTHA 4C7OB 4UNNA 5DT9A 2BFBB 1NUSA 3DHEA 2XQVA 5AKGA 2IH2A 1F4VA 4UEOA 1C4WA 5KSWB 1CTQA 4W5OA 4DN6A 5CBKA 1ONOA 1VHJA 5F7JA 4R51A 1EQAA 3FNRA 2PS1A 2AF4C 4KQEA 3S55A 5IASA 3QX8A 1JHMA 3AHDA 5LP6C 4QDXA 2HPHA 2JIBA 3MAJA 4M87A 4G23A 3HC7A 3OOHA 1NR7A 1W6RA 4PCVA 3RCBA 1U3GA 4AK9A 4XJSA 1CUZA 2CXTA 2VSNA 3JSAA 4Z3KA 1HZZC 2IHBA 5DN6D 4AY6A 2Z6QA 2Z30A 2RI1A 5EIHA 3RS3A 4L0QA 2V7GA 5ALNA 3UC9A 5FOQA 2CVFA 1T3HA 2CJWA 2GHRA 3AF0A 4QPCA 1VYVA 4YJGA 3SJ7A 2UVDA 2VQEB 3PJGA 1KE2A 3W5SA 2VQFB 2VHEA 4MUJA 4QAQA 1I3NA 1K7CA 2IA5A 2X0IA 2G9RA 3RUEA 1CUFA 5ARCA 4EB8A 1RAAA 3ZDCA 2X0NA 1GNPA 2H5EA 1B0UA 4MW0A 1JHUA 1N0IA 3EARA 4KBGA 4X6YA 5FL7A 3KFVA 4D5EA 2CNOA 4IFTA 5B3JA 3FVWA 5B1EA 1G6HA 4ZVKA 3EDQA 3GGOA 1UPBA 3UTCA 5F52A 4DWWA 4XWOA 2IHNA 1FW8A 2FPOA 4JU9A 4DTIA 2PSFA 5HQTA 2XKJE 3CMMA 3LW8A 5ECDA 5JDIC 1DAIA 2BM8A 2VS1A 3MOIA 4KVAA 5CVVA 5DASA 2H31A 4NJEA 2YHSA 1NW9B 4X8OA 2SHKA 5A7GA 3I6QA 2I3ZA 3DC7A 4BFWA 4GU5A 1W4CA 2SKDA 3WLHA 4MICA 4HG2A 5ESRA 2QVXX 3RSZA 5KHOC 3RD5A 4MMZB 3ZU5A 3DHVA 5IULC 2BM1A 3OH8A 3B9QA 4L6AA 3WOHA 2Q6KA 4C9BA 1F8GA 2HK6A 1ZMOA 4ZIRA 2J67A 2XQIA 3WNZA 3WKCA 1EWYA 3GCDA 3DDWA 2B4RO 3W4JA 1GR1A 4X7MA 5BO5A 2DERA 3JZMA 3H5VA 3ZWYA 3WGTA 2EWVA 5FAXA 2ZJ8A 4G0ZA 1LI7A 3Q1KA 3UCEA 3KXLA 3USZA 3OLWA 4QYMA 3NDBB 4LY9A 3WISA 5J43A 3IOEA 2P68A 4JB8A 4P5PA 3RC1A 5F3WB 2VHCA 1CERA 1FUEA 4PFKA 4J6EA 1X8XA 2XSZD 1PJTA 1ZL0A 4GM0A 1X80B 3ZQJA 1II0A 3C70A 1SA0B 4KG7A 3RK0A 5L95A 1Z5VA 1Z18A 2HT1A 3WS7A 2RKWA 2GAAA 5LQAA 4QG3A 5KSZA 2I03A 4UW9A 3IA7A 1EUDA 3TS1A 1R2QA 3R3JA 2EWMA 2XVAA 4J91A 2QY9A 4E12A 3IUSA 3N2EA 4TKLA 2DHQA 4W6QA 3TZKA 2ERCA 2GK7A 4FHGA 2D62A 2DB3A 4YMTA 1HC7A 1S2DA 1QYRA 4J0GA 5KCMA 4F5DA 2P6PA 3TAHA 1HE8B 4U2GA 1E9CA 4UDXX 4UNPA 3VOSA 1OLXB 3OLVA 2ZCUA 3ZN2A 4OX9B 3F90A 3RNOA 1TYAE 3WK7A 1MJHA 4C43A 2CMFA 2EARA 4DF3A 4BNGA 3O0TA 2X41A 1A9PA 3LZCA 2NXCA 3VU3A 4H6WA 3EF3A 1EAMA 3OFSA 4H7DA 5C32A 1THZA 2VSFA 5ERXA 4NENB 1LW7A 3F6CA 3NJ8A 1H69A 5L6MB 2XRZA 1GN9A 2VKTA 3AJAA 1T0JB 2O6LA 3GBVA 5C5CA 2NO5A 1SK8A 1NW5A 2A84A 3AUTA 5GV7A 2K7FA 4TTQA 1WNFA 1KMHA 2XSZA 4I6GA 5EERA 3EVDA 1JKIA 2P3OA 2PAFA 3WGIA 2NIPA 3HYTA 3RBZA 4JLUA 1GNLA 2G9ZA 3PZRA 1QV6A 1RU3A 3EZNA 2AWOA 4OQNA 3AVOA 1Z5GA 1O6CA 4B17A 5B30A 3RSFA 4LSWA 5T4HA 2XXAA 2H4HA 1DAHA 1PQ4A 2VJAA 4XIJA 2JBAA 4REOA 3FPJA 2HA5A 4BO5A 3K0SA 2BGRA 3GEIA 5KTYA 3HLTA 1P0CA 3P2OA 4MJLA 3GY0A 3L5OA 4AG5A 1QRTA 3DMFA 4BNDB 1IONA 3C4VA 1UPCA 4KV7A 5KMGB 2ZJ7A 1DJPA 4EI8A 5JJLA 2YN4A 4C7MA 1S96A 1IAVA 1M1NA 1ZO8A 3F49S 1Q0SA 3F4LA 1AUPA 2A0FA 5CYOA 4D97A 1ECLA 3QBEA 3ETLA 4IFIA 5G53C 3TIXB 2DF8A 4G63A 1MDBA 1GSHA 4RSMA 3FZQA 1VFNA 1W59A 5D00A 2VDVE 4F06A 3E1GA 2JFHA 2PEZA 3K35A 4C0KA 2N1MA 2NO0A 2ZULA 4ETWA 2O48X 2UVQA 4EFMA 1O95A 1RJFA 3QVUA 1E99A 3SNKA 3MTBA 3VKVA 4OJTA 4WZBA 1XN4A 1RVDA 2YR0A 4DCPA 3LC7O 5JR3A 3RB8A 4B4UA 5JHHB 1M76A 1T91A 4C1BA 2ZETA 4HGRA 3MZ0A 1TQ6A 4EG8A 3G3EA 5ADVA 4E5DA 5GADl 3BFJA 4MVWA 3KQPA 5G40A 1Y1QA 1BWQA 4I1OA 4LRYA 4ZDIA 4DR4B 1KP2A 1P5JA 3IULA 4LOLA 3EUEA 1F48A 3ETGA 4YPFA 4XD7D 5CDTA 5CCXA 2FF5A 1D07A 3QPWA 1U90A 4UBNA 4YAGA 1UBSB 1HMPA 3ODPA 1D0VA 3P9ZA 2GASA 3JXEA 3CYFA 3EA0A 3R2JA 3BDAA 4R0VA 1ZICA 2F43B 4WCFA 3LZDA 4O4LF 4KR3A 3H2JA 1D9ZA 3I3OA 5MN6A 1W4LA 2ORYA 4E88A 2NUPB 1TMOA 3GGPA 3V1TC 4RUKA 4YP5A 5T57A 3QUAA 5TMEA 3V1NA 3H8WA 4E70A 4TN5A 2WU3A 4Z2AA 3IEVA 3EG9B 3H1BA 3KVYA 3MCTA 1Y98A 3QPDA 4XB6B 5DISB 3TD2A 4NCIA