3BVPA

Crystal structure of the n-terminal catalytic domain of tp901-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
136
structure length
136
Chain Sequence
KKVAIYTRVSTTNQAEEGFSIDEQIDRLTKYAEAMGWQVSDTYTDAGFSGAKLERPAMQRLINDIENKAFDTVLVYKLDRLSRSVRDTLYLVKDVFTKNKIDFISLNESIDTSSAMGSLFLTILSAINEFERELEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords TP901-1 Integrase
publication title Tetrameric structure of a serine integrase catalytic domain.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
total genus 49
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bvpA00
1HX7A 5C35A 3GUVA 1GDTA 4BQQA 2GM4A 3BVPA 5C31A 1GHTA 1ZR4A 2MHCA 2GM5A 2R0QC 3PKZA 5C34B 5C32A 3G13A 3UJ3X 3ILXA 2RSLA 3LHFA 3LHKA 1ZR2A
chains in the Genus database with same CATH superfamily
1ABFA 4PAMA 4XQGA 2QV7A 1Y63A 1K68A 2PUVA 1UKYA 2OORC 2XODA 4HGPA 3CISA 4JBLA 4NCJA 2R65A 5ALIA 3SNHA 3W5UA 1Q6YA 3QEKA 4TV8F 4DT1B 4YMLA 1JH9A 4JWKA 2ZDQA 3H5OA 5IH3A 3R3XA 5KX5F 3A6DA 1R16A 2FR8A 1ADFA 2R1TA 3EQ8A 4HSEA 1TT7A 4J1QA 5DLQC 3TBFA 4F7WA 1OLSA 3G89A 1GGNA 1I3LA 2WWIA 5TQ2A 3BM5A 3MIZA 2EFDB 4OBWA 1DV2A 4FEYA 4N7RA 3H5RA 3ZZTA 3EWNA 2ZITA 4RE5A 2YYZA 1M2VB 5I9TA 1ZCFA 2HPAA 1EK6A 5U4XA 4EQ6B 3VI4B 4Q1FA 4AY2A 4MV3A 1Z13A 5IAJA 1XQXA 3T94A 5HKOA 5M34A 4WTOA 1ETHA 1NURA 2B99A 2FMKA 2R11A 3ON5A 2QRHA 2B7BA 1U2QA 4JNCA 3OOWA 1BGVA 2XDAA 4BAGA 1QC5B 4BMVA 1JVBA 3N7UA 1A95A 3DMRA 3KO8A 4BXOA 1MW9X 2NU7A 3KT8A 2ZI9A 4NBLA 2QAGC 2C99A 3EYAA 4LW8A 2FR0A 2QWXA 2PBRA 1JECA 1UOQA 4B2IA 3WK9A 1V96A 3GVCA 2XZPA 4INPA 4PTYA 1D0VA 1E2HA 4TV9A 4Y2GA 3UJ3X 3SFZA 3GRZA 1BQ4A 3R5TA 4HX9A 2PE5A 2B78A 3HGQA 5A5EA 2DP4E 1XDZA 2QMUA 4KAAA 5DGIA 4EJSB 2GZHA 3NBMA 5I5GA 3A14A 4G5FA 4AUMA 4H3VA 2BM1A 2PL9A 3M6XA 2YNMC 2A35A 4HX2A 2I4MA 3EASA 4AQYB 2XYPA 3F8WA 3GYGA 3MPOA 4B3SB 3U7QB 1X87A 4RVFA 5LUAA 5DNDA 2VYNA 7GPBA 2CD7A 1SHZA 4HMPA 1IJBA 5JCOA 1Q2XA 3F6BX 4HH4A 2GBLA 4KYVA 3TG8A 3U6KA 3UJDA 1POXA 3IEKA 1D3AA 1OBVA 4UNSA 4ND5A 2O7NA 2Y1EA 4NZZA 1RI2A 2CDNA 4XGQA 4HQ6A 3EVNA 2I7VA 3Q7TA 4GHWA 2AWNA 1I3OA 1IIRA 4KXVA 4RD4A 3TTSA 3HDQA 2QBYA 3CKKA 2P2LA 2GJKA 4E5MA 4YJHB 2ID9A 2AZTA 1U0SY 5H83A 3ROZA 2AZMA 2WWFA 4A91A 3VKUA 2UXCB 3RTEA 4PTZA 4D9HA 4QODA 5KYYA 3I9KA 1M8KA 3K1TA 9ATCA 1MAVA 3FPSA 4L9RA 1U9CA 2NAPA 5THXA 1RBQA 2ZRNA 4YO8A 2R79A 1XE3A 3HBFA 4RO0A 1FJGB 4ZRNA 2PJZA 3RO7A 1T5SA 1CDEA 1Y0BA 3OPNA 4E5VA 5CX1A 1W0KA 2R84A 4I5FA 3RT1A 2XZTA 3SEAA 4EUHA 1YB6A 3R76A 5DHSA 3D7SA 2VR1A 3PCTA 1J21A 4IDGA 4C06A 1GITA 2HWXA 4CHTA 4N41A 1DS6A 4WY8A 4YALA 3TQOA 1W0JD 3L4EA 1RJEA 1VDMA 1U1IA 1ODFA 3S99A 3CKLA 3UMVA 1QV9A 2P4QA 4NDAA 3O8CA 3AI2A 3RFUA 3ID6C 2FPSA 3ZNQA 2WI8A 4KJXA 1IQUA 1VCIA 2H8KA 1UXHA 1N5OX 1N4DA 4IO0A 4RKYA 1K27A 1XRSB 1GV0A 3H2JA 3NHZA 3QKTA 4X54A 1NUPA 5DHTA 1TJ5A 4XFJA 5AESA 4EUNA 2W2QA 1MH1A 2HSZA 5GM2A 1NVVQ 4RA6A 2P7IA 4IOJA 2H16A 3E9RA 2NPFA 2FOIA 2Z56A 2QUHA 4L4XA 5HR5A 1QRTA 3LZ6A 1W4BA 1BE0A 3RADC 3FVWA 4PZAA 4QDKA 4QOSA 3RVBA 3T0GA 5LB4A 1OH7A 2Z9CA 1GA6A 1VJRA 1XNGA 3JVEA 1G41A 4JITA 5BRNA 1XWIA 3STXA 3MG9A 1P2TA 4DREA 1DGQA 4Z3OA 4LZOA 5DNWA 3SM3A 3CONA 1PZHA 5DCUA 3SJ7A 4O4IF 1U0LA 2JW5A 1E63A 1H8EA 1JSRA 2R1VB 3O38A 1BU5A 3MJHA 1K2VN 2H31A 3PNMA 4RORA 1EUCA 1JR2A 2VDVE 3T7KA 5C52B 1GAXA 3K3PA 1XQ1A 2IF0A 3E9DA 4AZ0B 1YF3A 2FFJA 4OHUA 2JAHA 5LWQA 2Q0SA 3NT5A 3I2YX 1I80A 4YDRA 5FI5A 4HEJA 3RIGA 1PYOA 1W85A 3FNEA 3L7CA 4FGUA 4G3XA 7YASA 3LCRA 4C05A 4KLAA 4CKBB 3BK7A 5TF0A 2BM9A 4G25A 4Q7JB 4P82A 4M9XA 4HVLA 2PLFA 1ZSVA 3TSAA 3WB1A 4GOJA 4A6PA 3RQSA 2O1WA 2QXYA 2DWCA 1PDWA 4TN1A 1U5BA 3MRSA 3NHUA 3O8QB 2C7BA 4LTNA 4RMGA 1GYRA 3H6KA 4UU1A 3RWOA 4DWJA 1UBSB 1DQSA 1W29A 3P2EA 4RY8A 2GRJA 1N8SA 2VWPA 1KVSA 2H9IA 5E7IA 2Z3ZA 1VRWA 1RVDA 2WJHA 2Z5GA 1XZLA 5HMMA 2QYTA 3SC4A 2YXNA 2FSVC 3QEMB 3F46A 3AINA 4FZJA 1PL7A 3ASYA 4YJ2B 3OPYA 4BNDB 1TA4A 4RZQA 2QN8A 4CJXA 2UYGA 3KP1A 3USCS 2BI4A 3KFVA 3OD1A 4CCYB 2ZRQA 4O08A 5ABPA 5JS8A 1OTYA 1PW5A 2VTDA 5PNTA 5F5LA 4FW8A 4PFJA 4Q19A 3FDJA 5GV7A 3EVAA 2W8ZA 5AM5A 4BWGA 1WLSA 4PZLA 2VTBA 3NVMB 5CR9A 1TEZA 1X7YA 3D8BA 3K0BA 4YUYA 5FNVB 1UOOA 2I3ZA 3Q72A 4EJ2A 3R3SA 2WVGA 1WOYA 3M70A 4JVNA 3WGTA 1HNWB 2Q9UA 3IUYA 3S8YA 2V4ZA 1OI2A 4ZIRB 3ZDAA 3E1KA 4IVPA 3KJZA 3NC1C 2PFKA 3VTKA 3GJQA 1KZHA 5CB4A 1JQKA 2WT4A 3GIDA 3OJXA 2GZAA 1SXJD 1JAHA 4Y6SA 2C2XA 2Q3JA 1VP9A 4E4TA 2W58A 3H5WA 3KSDO 1JKXA 1SBQA 2IITA 5H81A 4KPUA 3FE2A 4WKNA 5HTOA 4MLZA 3EAGA 3LQ2A 5DW3A 1FS5A 3I6QA 2RIPA 3LC7O 4YFYA 2G7MC 5JH7B 2PXCA 4DMKA 2E89A 1XZIA 1AH2A 2ZIXB 3FMGA 3LW8A 4NMMA 1GPJA 1JSLA 2OR3A 4F5WA 1F48A 4OL9A 2I7TA 1OIXA 4QRHA 2R4QA 2PDAA 2XR1A 3ABQB 4N7BA 1SUEA 2G67A 4UHBA 2ZWIA 3HB5X 3TIIA 1U9IC 3Q3CA 1E1RD 2DUJA 3I9NA 4HS4A 4MKRA 4ZA2A 4YJFA 4G1FA 1EA5A 1IG0A 1MJFA 5TX7A 2ZM6B 5LMNB 2BSAA 2YIMA 4DCJA 2XBMA 1IY1A 4GDMA 5A4AA 3BPSA 1U2PA 3IQEA 4UE3S 2PR7A 2Q5FA 3KYCB 2JARA 2AA3A 1Z6TA 1BD4A 3PFBA 4YAJA 3T5DA 2E9SA 3BCHA 3V3TA 3B7WA 3NWBA 1JAIA 1DOHA 5H3LA 4DYHA 3OTHA 3HCBA 4X6UA 1V6SA 5EAIA 4ES6A 4DV5B 2CLLB 1Z5PA 4CEIA 3ZY2A 1IUPA 5C18A 1QQ7A 2R48A 3FYDA 3RSSA 2JA2A 3RM3A 3ZLVA 3DE1X 1PUIA 3OX4A 4FE4A 3PXGA 3ICOA 1JL3A 1R5BA 2O20A 2AJTA 3EVZA 4WZ6A 4NZMA 2ANBA 4UKDA 5D3KA 3B51X 3CX7A 1C14A 5KINB 1U7OA 2EKLA 2EQ5A 4RL4A 3BMQB 1RXCA 1J42A 3V8NA 3PDJA 2Y1XA 4PYNA 1V8BA 1W30A 5L40A 4QYMA 2FDXA 1W34A 2WILA 2G17A 1RZ3A 1OZFA 1IRXA 2MOKA 2JFOA 1A77A 2ZPAA 3W3AA 3TM5A 4HDSA 3QY0A 1IMJA 3Q5GA 1SHUX 1ZUNB 1MAHA 1U28A 2XEXA 2ZR9A 4M76B 4N0EA 4QEDA 4YRBA 5HRUA 2VCYA 2NTEA 2YJ6A 1P3Y1 1QHEA 3D6JA 1WE2A 3R4VA 5KYUB 3LGSA 1NF8A 1C81A 4GGMX 4EKIA 1GQFA 2B1RA 4LPKA 3AFGA 3U56A 2XDQB 5ARBA 2BN4A 4B3DA 4L50A 1S6YA 3DL2A 1K3UB 1J90A 4M4SA 3RI3A 1GEGA 4BTEA 4MR8A 1DCMA 2WWWA 3W8FA 3N0XA 1PYDA 4JK3A 4ZO6A 5FT9A 4NG4A 1B0AA 2G72A 3NHMA 1BNCA 3NOVA 3ONNA 4BX3A 1RKUA 4B2PA 3IT3A 2YS6A 3SHFA 4GMHA 1OC4A 4U7TB 2RDMA 1FS4A 3INRA 4ETIA 4Q5IA 1VJ0A 5EHXA 5BWBA 4QUBA 4X63A 4PHTA 2B3DA 3CVOA 4JC4A 4I55A 1MCZA 2QGNA 3KC2A 2WIFA 4K81B 1XDDA 3FOBA 2FOLA 4UFNA 5JRZA 2Y0CA 3D7MA 3AFNA 4FBGA 5GAJA 5KREA 1ATIA 2J3EA 3TGPA 3R3ZA 2IWRA 4YRDA 2J4FA 4S04A 5DGXA 5EESA 4UHHA 1ZGGA 3IQHX 1Y9EA 2FV8A 3A0UA 4GRAA 3WYCA 1L5SA 1QDLB 1NBAA 2Y9PB 3DBOB 1ZN8A 3C24A 1QMGA 4BS9A 3BB1A 3K1AB 3ER6A 1I3MA 2LWIA 4BB5A 3DAYA 1IMOA 4HYQA 4EB0A 1W9HA 5G3YA 4BKUA 2Z8ZA 8GPBA 3L1JA 1V16B 4WOPA 1HLGA 1F3OA 1U7DA 1QE5A 1XC7A 2BFCB 2BFOA 2P2SA 5AVOA 2ZZNA 1J23A 5CLQA 5JSUA 4G67A 1ULTA 1PEAA 4W99A 1KNQA 4F1JA 4MULA 2BM0A 1G19A 1ZWLA 1PLKA 2V6FA 1QLWA 2XJ9A 3DR3A 4IDDA 3JQGB 4TQ9A 2IV7A 1RE1A 5C8DA 1UF9A 4WNYA 3FH0A 4O8ZA 2CJWA 2VF4X 2WHEA 2D59A 4G36A 4MVJG 4ZODA 4K8RB 2PNFA 5JJLA 4MKIA 3BEDA 5KCMA 3B5EA 2YINC 3AB7A 1PQYA 3OUZA 5BR8B 3TUIC 2Z2ZA 4U4AA 4EX7A 4IIVA 4CUZA 4JL6A 4OFWA 4OREX 3NJRA 3AUYA 1Y6GA 4MIEA 4GG1A 4ALLA 4H3KB 1Y3IA 3ERCA 2BVNA 1ZM4A 4G0WA 2BIFA 4I9NA 3LFUA 4HDKA 4LDPA 1QH8B 3S7TA 4F8JA 1JILA 1OAOA 2QNIA 3IIJA 2FW7A 3C3PA 1EFVB 3ULKA 2PYDA 2ZPTX 1E66A 4A82A 2BONA 4AJJA 4PC1A 3R20A 4L0DA 1L7NA 3JYNA 4EB6A 3KVVA 3RC8A 1LBHA 5TRTA 1QR6A 5MHTA 4QEZA 2VHWA 1C29B 3H3XA 1G5TA 3UUGA 3ZX4A 1HR0B 1CB0A 1JAZA 5K8CA 2IIQA 2GUWA 3BD6A 4GS5A 4Y1RA 3IURA 4OGLA 5EQFA 4BNGA 4RHFA 1JIKA 3LC0A 4HNHA 1WY5A 1QKKA 2G82A 2SKEA 3HGTA 4WUTA 1G3QA 5JD5A 2O8NA 2H5IA 3DB2A 1UPCA 5TMEA 1M7HA 2DUMA 3ZHUA 1Z4NA 4C0AC 3PWSA 3ZE9A 3WRYA 4RM3A 1QWOA 4Y6OA 3UB4A 4KZPA 4XR9A 2XKJE 5LR6A 3SQMA 2AK3A 3TCKA 5BORA 1PKEA 3S68A 3FPLA 3ENWA 1W0JA 3B6IA 1VE1A 3QMWA 4Z51A 1TI7A 5FFNA 5KYTA 4G5HA 1BWRA 3VKVA 1RLOA 4LSWA 4KWIA 2GK4A 3ED5A 16PKA 1EFRD 2IYPA 3IKMB 4MMYB 2PUGA 5AKLA 3MINB 4CNBA 1SUBA 1WF3A 1XTSA 3E1GA 3PGLA 3Q3GE 4HLUA 4IGIA 5AUOB 3QVOA 3O03A 1YVRA 2B8EA 2SHKA 5T67A 3SDSA 4JBIA 2VJMB 3WGGA 5J4HA 4EWLA 2ORWA 4BFYA 1NLUA 3IBYA 4YQYA 3TL3A 2P6RA 3IBFA 4QTTB 1PJSA 4UUBA 1HLFA 1IWPB 2Z2KA 3FPHA 1RQLA 4WFJA 2NUTA 1AUOA 2QD3A 1MTZA 3RS4A 3QWIA 2DWPA 4MRAA 4XB2A 4Q16A 2A9RA 2ZKIA 2DWUA 1WEKA 2SECE 3QM1A 2ZXFA 1RLTA 2HIMA 5BOSB 4Y7DA 2VATA 2XUDA 2CBGA 1QQ5A 4YAKA 2IDJA 1VMAA 3KSBC 2JLYA 1Z4QA 4POAA 3L8CA 1V5EA 3B3FA 1NUSA 1RS0A 3PWTA 5DIFA 3HV0A 4M7OA 4MHSA 4FFSA 1ORIA 1CCWA 4NHOA 4YWJA 4Q4LA 2X6QA 4CU5A 3UMCA 4C3UA 2FWNA 3SNKA 5A5VA 4QJIA 4RCZA 3KHKA 3NQ41 1V7ZA 4OU4A 5GP1A 3ICVA 4FYHA 1B0UA 5DWVA 1SHTX 2VBIA 1K8XB 3A11A 3DB1A 1E3DA 4GVPA 4OSOA 4R0MA 5JWOA 1C7IA 3R41A 2ZU6A 4M0EA 4H3SA 1P3DA 2VH2A 3WWOA 1QGED 1GZUA 3IH5A 4LOIA 1FCJA 3STHA 1E2DA 2TMKA 2QLLA 2YXPX 1XCMA 3IUSA 3E35A 1CSEE 4WN9A 2D06A 3FNIA 4NOMA 3RBVA 1L8QA 1SOWA 3I04M 3O7WA 2GZMA 3QOYA 1W4LA 4MUGA 3SR4A 3HCDA 1SVMA 3WQHA 3HP4A 1BROA 3O83A 4L07A 4L6IA 3JRXA 2WOJA 4UMFA 4W5HA 1JAYA 4A4DA 2HH9A 1HSZA 4RZIA 2PUAA 3LCVB 5EP4A 5AW5A 3AF3A 5EMNA 3BJEA 4ZVRA 1CDOA 3RK4A 1UEIA 3QLUC 2W2TA 3D6TB 4RKEA 3IA2A 3MYRA 4EHAA 1UT6A 2C4VA 2J07A 3I6ZA 4HX5A 3W9SA 1L3IA 5DYNA 2PRKA 3R9IA 1ZU5A 3Q15C 1NNLA 1JDUA 2DFPA 3R6DA 4AJIA 4FI3C 3D6NB 5C8XA 2IUTA 4X1YA 1U94A 3BUSA 3MS4A 5JC8A 3SQWA 2XH8A 5JUWA 4JUBA 1M67A 3ABSB 2YC4C 3D2AA 2OORA 3K9BA 3TLGB 3OCWA 2H7VA 4GC9A 4A5OA 4G5SA 5FD8A 3TLEA 5FX2A 4IV5A 1F7UA 2HTEA 1V5WA 2VOJA 1D2EA 3DPUA 3PFIA 3D3JA 4M83A 2FQYA 3TOZA 3VTAA 2C7RA 3FWZA 2YVAA 4AN0A 5JMPA 4I50F 4U9IS 4BB6A 4Z4HA 5JBNA 2WICA 4OA8A 5KJEA 3OZIA 3ZJVA 1YZTA 3SJCA 3WLMA 2FFRA 1N1DA 2YOFA 5TQ0A 4RLSA 3H75A 2PIAA 1N6KA 4GP9A 5FOVA 1G7SA 5K3DA 4XQCA 3KS9A 4YO7A 4JQOA 2PD4A 4URFA 4IKPA 4R5MA 2RHLA 4UDXX 1UM9B 3TMKA 1J2TA 4C22A 4HUQA 1M54A 3ZCVA 1EFLA 2ZJ7A 1HNZB 1ZJ5A 4MCHA 1E1RA 1SB9A 1OFTA 5DGCA 4LDRA 1H1LA 3DMDA 3U48A 5AUQA 1Z2NX 3IQGX 2IVFA 1XCJA 3B9RA 1JQAA 3ETCA 3BE8A 5LLSA 4OLJA 1YU6A 1W94A 4MW0A 4KUEA 5DT9A 4EF6A 3O4VA 4LBWA 1QIEA 1WW2A 1ISJA 2WJYA 3S6JA 2O5EA 2RAUA 2R86A 1R12A 5EMJA 5CFZA 1URPA 2BFWA 4XOIA 1EIWA 1YR9A 2IEGA 1KXZA 1A72A 2BGRA 4HRYA 1Z7GA 4O2AF 4URZR 1MJNA 1C0EA 2JFWA 3OQPA 3IT0A 2PMKA 1ULSA 1DWPA 3A1WA 2ZB3A 1F9EA 3OQ6A 3H8VA 4O1IA 1U8AA 2R2GA 4KMMA 4ZCTA 1L9XA 3HYRA 2EDCA 2XADA 3GFGA 1VPDA 1T2EA 4DJTA 1HETA 1EDDA 3ZWYA 3FGPA 3I73A 3O2QB 4HXYA 3VR3D 1R4AA 3UWSA 5LKAA 4KACA 4LE0A 4A10A 1JA0A 2AOUB 1W7AA 3Q2IA 2O5VA 1X8LA 1XMOB 1M6EX 2C29D 2EOAA 2RIRA 4KQ2A 3FCEA 2G4CA 2AFIE 1NN3A 4ZVKA 1I9GA 4Y9SA 3GEPA 3B5JA 4F8EA 1N2CA 1W73A 2XE7A 3KYJB 1CZUA 1BJKA 3JWHA 2E6KA 1NBMA 1O96B 5CDUA 2MSEB 4WA8A 1PL6A 3DWGA 3AEQA 3NEJA 3SLKA 3U4DA 3DCJA 1N2HA 3WLIA 2HMVA 4DQDA 1T15A 4FMCF 2HF7A 2LZ0A 4W5QA 3TTUA 3P9QA 5EMMA 5IC5A 2IYVA 1W9MA 2MWMA 2I22A 4NJOA 1KDZA 3VR5D 4NULA 1OPRA 4JJ8A 4BZQA 3M4ZA 4HB2A 1ZN7A 1LDYA 5C8YA 3TQCA 5HSGA 1ICIA 3MCZA 4URHA 3GH3A 1TQ6A 4JGIA 1TRKA 3AUSA 4M6WB 4R8RA 3SAJA 2G8NA 2OZEA 3MTJA 2PX6A 3N6RA 4OAOA 3QF4B 1XQWA 2C04A 2J45A 4LVCA 2D2XA 1F2UB 1RI4A 3P9NA 5FHRA 4UXIA 1UC4B 2A0WA 1Z68A 4UHKA 2GSDA 3MAGA 5ALLA 4PN7A 5AHKA 1JJIA 1JEYA 1RWQA 3GCDA 4PW0A 4RLQA 3PQ8A 2E0IA 4X45A 3X43A 2CE2X 4W6QA 1FMCA 1DSSG 4C87A 1MR3F 1X0VA 4MTCA 3I9V6 4CW7A 2IHJA 2QMEA 4FDVA 1GDTA 1GGVA 1WPXA 2V6IA 2X1LA 4HFMA 4LY9A 4TL8A 1BXRA 3QU4A 1MAAA 4ZI5A 4RIFA 5D2CA 5IUKC 2Z8YM 3AUJB 4ROTA 3V55A 3CUTA 3C3KA 1W4RA 4IZHA 2C2BA 5KHOC 1LV7A 3AR7A 3QQPA 4ZQCB 1QLJA 1FZQA 2GXUA 3U39A 3O4JA 3SYLA 4DILA 3AEKA 4X9XA 2EIHA 1YUMA 2DFTA 1Z83A 2HA3A 3P45A 2Y1KA 4LC1A 2R2AA 3MJRA 4UARA 2GLXA 2YY5A 3A4VA 3CRW1 5IAEA 1JHDA 5AJZA 3VHRA 5CLJA 1AUXA 1DLIA 1S8FA 2VK1A 3CO0S 3H1PA 4JJIA 4KR2A 4FBLA 1T6XA 2CYAA 3HPQA 9MHTA 1SIUA 2FWRA 2A1UB 2RK6A 3JCZA 3MWYW 5A0FA 5B7QA 1T2NA 3IPYA 2NSYA 4Y2UA 3IIIA 5JWRA 1AQYA 2VA9A 1SCUB 3C8UA 3LIIA 4I6GA 5EERA 1RCFA 3KTAA 4BVJA 5IWCA 1GLVA 3EE6A 1RZVA 1JDSA 3EPLA 1BKSB 1I36A 3MLAA 5ARCA 4DM3A 3PHCA 4FHFA 5J40A 2CNNA 3TK1A 2D74A 4WESB 1GZHB 4ZANA 5AVXA 4OK6A 2OFXA 2ONKA 2YXEA 3KD3A 4FHGA 5E9WA 4XB6B 3WWYA 1G66A 3DXXA 3I0ZA 1VHTA 4O4LF 2TYSB 3T7JA 1VJGA 1LQUA 2EWMA 2I78A 4G2NA 2BDTA 4P7BA 4Y98A 5FTLA 1R6BX 4I4CA 5SZJA 4BLSA 1FTSA 1M2OB 3W4IA 2ZSDA 3I83A 4KNWA 1P1RA 4CMEC 4BO2A 4P4GA 1A82A 5DTRA 3G6WA 5LN1A 2UU9B 2WVHA 3RK1A 3TEMA 4A26A 2XRMA 3G9UA 1V6CA 1PVDA 3GFVA 3B9BA 3D8HA 2WKPA 3WXMA 3F6YA 1M1NA 4TV8B 6NULA 3KIPA 5EVCA 5DM0A 4LI3X 5E6UB 3B82A 2QRZA 4CLOB 5KX5B 2CCKA 4QD3A 6Q21A 4WAUA 5KKCA 3PPIA 1N6RA 4DA4A 5D87A 3FVRA 5LZ2A 3AEZA 4CFYA 5E6SB 1QGUA 3I39X 1RPAA 3EIHA 1U6KA 1BVUA 1N5LA 2SNIE 3RAJA 3RSGA 3G82C 2ZT7A 2B5WA 4D9JA 4G5OA 1RC1A 1U9JA 3WBBA 5EJ8A 4C2AA 1U7WA 3PNBA 1EFRA 1ZOSA 4UBMA 3QUQA 3EEBA 4PX3A 4Y2TA 1JU9A 4QBIA 4JODA 1JLLA 4IVNA 1LBEA 1H4QA 4HXGA 3DFMA 5EKSA 4ZV7A 3TLJA 2AI2A 3DQQA 2EJWA 2CB0A 1Q0ZA 1RADA 1RAEA 4HH0A 4AZTA 5BSFA 4MH0R 1XNRB 3GEDA 2FP4B 2NNLD 5B2EA 1DKRA 3IS3A 3WP1B 2QRKA 1WU7A 2WV7A 2WU0A 1XTBA 5J58A 1B14A 5BOVA 3RUFA 1FYFA 4C7MA 4H1VA 5T5QA 4CCWA 5CH5A 2C2OA 5I9SA 1RRVA 5E9QA 5CDHA 4V3BA 1E1NA 2O2DA 5FHQA 5BR7A 4ERXA 4KFSA 1QCYA 2R8PA 2WJJA 2W37A 3IALA 1NSFA 3KKQA 2XXBA 3AHEA 3FCSB 3N8HA 4YA6A 1U9IA 1DIBA 4HDOB 3GZTB 1T10A 1RLUA 2QV0A 1IHYA 4JL8A 4ZVPA 1CJKC 3R7FA 1E0KA 3ZPXA 5BT8A 3UV3A 2VK8A 1FNMA 4DTIA 1M8JA 3IV6A 3HE3A 3TZBA 2EC5A 3CTMA 3D3WA 4U2GA 4HNGA 4B35A 2V4UA 3K09A 4FBMA 4GMFA 4AY5A 4WLEA 2II6A 3IE1A 4FC6A 2H2FA 4RH1A 4RK4A 3AETA 4U8GA 1GPKA 1UIRA 2ST1A 4BC0A 5JROA 1KMQA 3QU2A 3ADPA 4TS1A 4TZTA 4Z7OB 3AU9A 4EPTA 3HBAA 4B34A 1G59A 4LC0A 2YV3A 3M3PA 1DIGA 1CJCA 1T0IA 3LYHA 5FKJA 5B1SA 4BQNA 1Q1NA 3WQRA 5L7WA 3B70A 4IJ5A 4EPXA 2FVXA 2WJ3A 3AWDA 4NH4A 1WXDA 5L3RA 1YVDA 1ZC4A 2EG5A 2YYSA 1SQ5A 2X13A 5A2GA 1NW3A 1ZMTA 1PV1A 1UXGA 4CCSA 4GDFA 5HXAA 2ES4A 1EUDA 4EM6A 4UUNA 3P9CA 3SE7A 5KO2A 3PHJA 2CXUA 2J1LA 3HI6A 3KB6A 3I2KA 2IDKA 1OX6A 2FPIB 1G8MA 1I1QB 1SQ0A 3A25A 1AKNA 2Q07A 3LVBA 5BQOA 4D9IA 1NW4A 2F9FA 2HT1A 4F6RB 1CRWG 1ARZA 4KMRA 4O4JA 4BNNA 2CC2A 4LE1A 1PVVA 1I4LD 2AG5A 2CUTA 1XHFA 2XY4A 4MGYR 1QF7A 1Q1EA 1OI4A 4HDMB 3MAAC 3LGXA 2ZG6A 4GNKA 2B2CA 4BLOA 1E64A 4N8DA 4EA6A 4J07A 3FSGD 3SVZA 4LFBB 1FP1D 3DH0A 1NRJB 3Q9UA 1XLWA 4MV0A 3IUNA 1WCXA 5LQAA 2R25B 5I9NA 1Q22A 3PNSA 3ACBA 4QJ5A 2HHLA 4LX0A 4A73A 3I23A 2A9PA 1GG5A 2QT9A 2IY9A 3JYOA 5DEOA 2AD1A 2DR3A 2XI4A 2WP8J 3ZU2A 3K6JA 4DBZA 5DE3A 2IYWA 5AKYA 3D4IA 3RV3A 3ADBA 3T1YB 3EXIA 3W5CA 4AVYA 2IYEA 1IN4A 4HFRA 1XWFA 4ARBA 1RQRA 4QXOA 1E4VA 3VSBA 4N0QA 2QN9A 4C76A 1L8XA 1T5DX 4O4IB 2C4MA 1IVYA 3C1AA 5EOVA 4BYGA 1VPLA 1TFUA 1EP9A 1T5LA 3BIFA 4AJ4A 5FYQA 3PLAE 3NZEA 1ZBDA 2PYIA 3OIWA 4X3CA 1M6VA 5A62A 4AQDA 3EXEA 5F1PA 3SHQA 3UCFA 3UG7A 2X9NA 4JL5A 4MV6A 1Z5NA 5EZ6B 1N5RA 4N76A 3CF4G 2CHQA 2IGTA 5J2TA 2FZWA 2HGZA 2GXAA 2PGNA 1T8YA 3PKZA 3L0YA 3WLTA 5IVPA 1ND6A 3LU1A 3KG2A 4BN5A 1Q92A 4BUCA 4EX6A 1HDCA 3L6BA 1E2EA 4II2A 1CY8A 1FVXA 2FPKA 2ZJ4A 4UZFA 2BEUA 5T4EA 4BWFB 5L53A 1RACA 3EA5A 1W88B 4DRXA 2VQ6A 2IX9A 3FUXA 1BVYF 3KJFA 1P6UA 3L05A 2FEAA 3WWDA 3LO5A 4TQAA 4DRZA 4F1WA 2V6MA 5DCYA 4JOQA 3VC2A 1G3IA 5HJ2A 3ET5A 2PZ8A 4MQBA 3VR3A 1TYBE 1P72A 2GPBA 4YCAA 3R44A 4ETWA 2J0UB 5H70A 1TUGA 2X5OA 1CHDA 4G9BA 3UBMA 1U6IA 2R96A 1F12A 1LPNA 3EA0A 3HCWA 1EDOA 1ZM3A 2AF4C 5EFZA 2BHSA 3TW8B 2Q1UA 4GIBA 4ZD6A 2FG7C 2XYQA 3MTGA 4LSGA 2ZAYA 5CMLA 1V5IA 5D84A 2Q3BA 5KDLA 3MB8A 4RMJA 3O92A 4PYJA 4HLCA 1GQ2A 3OU6A 2D3WA 5IF9A 1CUIA 3OG9A 4FWTA 1U7ZA 1T9AA 1UBLS 2PK3A 1M2VA 4EATA 2Y93A 3TLAA 3VPBA 3HNRA 4EQ6A 1YA8A 1XZQA 1YQWA 5AJXA 4WXEA 3M3DA 3ZXIA 2FFHA 1SU4A 2AB0A 3HS3A 1ZGCA 3VR5A 3RUCA 3A6LA 3A7DA 4RL6A 3UKJA 2DR2A 1E5LA 1HDOA 1DMSA 4GI1A 4QOIA 5AQEA 3BS4A 3V7YA 1QC5A 2GHQA 1PD1A 3OWXA 4UDNA 3UAYA 1VYHA 4A8JC 2EQAA 4YS6A 1FSZA 4MUYA 2GUGA 2XVMA 1IBKB 3H5AA 4XPZA 1C3VA 4BX0A 3L7OA 3LRPA 2V9CA 5HRAA 3O94A 3QUAA 4M1KA 1UZNA 1G3MA 2JGMA 2QUKA 1VHLA 1SRQA 1NVWQ 1HEYA 1J97A 1UQTA 5DB4A 1AZSC 1VBNA 4EGQA 2XF2A 4WIAA 3E9YA 4AURA 4DMHA 1FFAA 1KI3A 2AMVA 2GJAA 2X8JA 1R6DA 2GT1A 3WOVA 1P7CA 1WNFA 2WM2A 2PLAA 1KZYC 1TU0A 1Y3HA 1Q6ZA 4ZCLA 2J6HA 3D3EA 4DVGA 4EJSA 3V8BA 3E8MA 2P79A 5L9AA 4ZZ2A 3D8UA 4IJ6A 2PMCA 3LX4A 3IOBA 3FHLA 5ED0A 3U7QA 3B5IA 3OQMA 1CS0A 3IPLA 2UAGA 4D8UA 1T8TA 4M9RA 5EKUA 2PKCA 3QNUA 4QT0A 2JLVA 4R2IA 4PYMA 2V5VA 4EP1A 3IODA 1QK5A 1XCGB 1YMQA 3W2HA 3AM1A 1SD2A 3CHYA 4Q02A 4RACA 4X3OA 4F71A 3PJRA 3AVWA 1BOFA 1LTQA 1SXIA 3CX4A 1Q1QA 4LXHA 3FNFA 3BQMB 4X1IA 4S2EA 2NVUB 2Z8YA 3SDZA 3ZY3A 1P1HA 1SUAA 3DZCA 1NSTA 5C1OA 3TWOA 1E5VA 1NQXA 1EE9A 1UK6A 3OPQA 1ES9A 1HMYA 2IPAB 3H5LA 1GIAA 4FHCA 4G24A 4PSVA 4C14A 2D2FA 3KKPA 4YJHA 1A0OA 1VPVA 2KLHA 2N46A 2PQMA 2HMYB 2YQZA 4CIAA 4TGLA 3HABA 1QYCA 1WXFA 2QEQA 3A2LA 3U13A 1XRPA 4UJ3A 3RCBA 4B6PA 2UV8A 3H7IA 3WMFA 3BDVA 3O8OA 4AWBA 4FNMA 2OXFA 4URXR 3BWYA 1DC3A 2PS9A 3H84A 4JMLA 1AGXA 4PPGA 4NNOA 4B2YA 5MN4A 1Y6ZA 3E2IA 5F9HA 5EIEA 2GI4A 2B0CA 4GX2A 1M5TA 4NMXB 1UP6A 3N58A 4QBTA 4C29A 2QNRA 4PICA 3CSDA 4YT5A 3KQNA 4FOSA 4YP7A 1DPFA 1EYZA 3H83A 2FHPA 4ZJYA 2YV1A 4KAJA 5FLYA 3X0DA 1UZAA 3CZRA 1T9BA 3G2HA 2ZBPA 1FYXA 3LVFO 4WNAB 2O3RA 1QQBA 1A7KA 2IEYA 3HU3A 4IHJF 5HZMA 4LTMA 3HXKA 1IU9A 1VP3A 1X1QA 4IGEA 3BGDA 4W1RA 5ALKA 8ADHA 4KDFA 2OGSA 4FQ5A 2AMJA 1RQGA 2NVWA 4LQDA 3CX6A 1VLMA 3U4QB 1BS9A 1T2CA 3QLUA 3OZXA 2YH2A 4TSRA 3B8EA 2Q1XA 5C37A 1I5OA 1CKEA 1HTTA 4ZQEA 3T34A 1NJ5A 1JXQA 5JHHB 2H2DA 2UZIR 4PANA 2QJWA 3W06A 4EQZA 4D5EA 3BORA 3EZLA 2AK2A 4MO2A 4RWZA 3U40A 4Z7JA 3EZYA 4ZYYA 1RWMA 2CGEA 4MKGA 3NV7A 1ID1A 1K7CA 3DAPA 3PUXA 2B8WA 3TFQA 3DDSA 4G2TA 2WLSA 1C9MA 3FMVA 3V4PB 1PK8A 2INGX 3PQ5A 3KALA 3WA6A 5F7OA 3OA0A 4V0LA 1EWRA 3F47A 4KVGA 1EVIA 3ZYZA 3UVEA 5IKEA 1AKQA 3AZQA 2R1VA 3QNMA 3WGQA 3PUKA 3EZ2A 3QENA 3BAFA 4XWGA 4F3YA 2GVDC 1WQ4A 2NNWB 1N32B 1NXQA 1G6HA 3CUUA 2XNJA 4WXYB 4AZ0A 2JFHA 3DFUA 3O5AA 1AKMA 4IIFA 4P98A 1IDN1 1EVJA 2HCRA 5CVUA 4DA8A 4ZJPA 3HH8A 1IE3A 1VM6A 1X7GA 2C8KA 4LI0A 4RDCA 2Y1OA 5D85A 4HEA1 5AI4A 2CBZA 4NXNB 2G7ZA 4OHXA 1L5ZA 2OMKA 3SBOA 5JNWA 2FMFA 3QP9A 4ABYA 3AK4A 1H66A 2CFIA 3LPDA 1OGJA 5BSTA 5LC1A 1JHUA 4R1SA 1SCNE 3VYVA 3O8QA 3W9BA 3ZCQA 5FBHA 2OOSA 5BT9A 4AIIA 5AVTA 2JEZA 2QB5A 4FR5A 3IPRA 3A6PC 1ZUHA 3PQ2A 1O2DA 3ZHCA 1C1XB 4OGWA 5JE8A 3E81A 3PS9A 3QEMA 3RFTA 3ZWWA 3ESDA 4BNDA 5DI9A 3LXUX 5C34B 2I6GA 2Z1MA 4EK9A 5F7XA 1TC2A 1C7QA 3GGGA 4MRPA 1R8SA 2MJLA 4DNFA 4EY6A 1J9EA 3U7RA 2WZQA 3HK2A 2W90A 3DPIA 5FA6A 1MGOA 1UMCA 1N5KA 2HM7A 1H93A 2PS3A 2ZR8A 3V80A 1GZ7A 1T9ZA 3CH7A 3WZ2A 3UW1A 1EWVA 3GL9A 2XT9A 1PGOA 1ZH0A 3GZJA 5FNVA 1KNXA 3IVXA 4AUNA 3M1AA 3IJRA 1VKJA 4PCUA 3DHYA 1YHNA 4D82A 4HG2A 2HXGA 3H42B 4EAQA 721PA 3LECA 4ZIRA 1JFLA 3MS7A 5J23A 4N7MA 1XEWX 5DF1A 4BVAA 4KPYA 2XZDA 1WU8A 1Z5OA 5E95A 3G9TA 5HW0A 3FSRA 2YXLA 2P3OA 5JAUA 2TMGA 4H77A 1YONA 5WRFA 3RUAA 3DLPX 1J0BA 3ZOZA 4DBVO 1L2TA 2JRCA 4FC7A 5L3QB 2DX7A 1O58A 5JH7A 1U80A 3B7PA 1VYTA 1KE1A 2QVCA 3S2UA 2ZIXA 4EITA 1JDNA 3AHGA 4P2GA 4YRFA 3HLTA 2JGJA 4ISBA 2ZJBA 1ODKA 2WAAA 2YUIA 1NJ8A 3RYFB 3TCXB 4AYXA 1AKVA 1GSIA 1GRQA 2HPZA 2YWFA 1NY5A 4LXGA 3EQZA 4FNGA 3PJFA 5DTQA 2YBEA 3FSGA 4NAVA 3DDUA 3T3OA 4A15A 3LUAA 1E9VA 1GPUA 1A97A 2RB5A 2ZSKA 3JWIA 3KKOA 4Q37A 3IIMA 3LFHA 4YP6A 4LOHA 3U3XA 1DEHA 1GNLA 2G88A 3KYCA 4WPGA 1DO8A 2P2DA 5FOXA 2HWYA 4S1VA 2RAFA 3MJVA 2WP0A 3PQ4A 2GASA 3AJRA 4YP1A 2HK6A 5B4TA 4A0FA 2LD4A 1DQRA 1SBZA 3ML1A 2EBWA 3JR7A 1ZKDA 3OZDA 3OIUA 2P6UA 3DDOA 4TMTA 4DA7A 3QWFA 1G8HA 5CA1F 4OXYA 3PQCA 5F73A 1AN0A 1ZZEA 2ZSHA 4YRPA 4F2GA 4BVFA 2ILTA 3WRXC 3PCRB 2ZRKA 4OBXA 4IHAA 3BMQA 1E2PA 3MMSA 3RJZA 4DLZA 2D0OB 2IL1A 3VU1A 4C6SA 2KBEA 2JS7A 4LJRA 4F45A 2C78A 5LP6F 2Q0XA 1QHXA 1T2UA 4REQB 4QECA 5AM3A 3GRRA 5EJGA 1WHSB 1ZUNA 4MSUA 4U9HS 3ABRB 2P9GA 4KV9A 2D62A 3DMNA 4LIPD 4NHEA 4QBHA 4WX2B 4NBKA 4X6LA 4D9CA 4Q7QA 4Q9LA 5KYUA 1WETA 2QP4A 3JQ7B 5B7NA 2DXIA 1DO2A 4EARA 5K8IA 1OB5A 4KK3A 2XDQA 2AFVA 3H9GA 1FXSA 4MNTA 3AFOA 1K3TA 5DMXA 2DCUA 3PG5A 4ZVNA 2AHRA 3JS5A 4CMHA 1WW3A 4MWOA 5EWLB 2VH1A 5ERXA 3VU0A 5JAIA 2HB6A 4TYWA 1AXEA 3OE5A 3GJRA 4BU0A 1P6QA 2UZ3A 2C8LA 4C7JA 3T3PB 3WIBA 5AHRA 2BKLA 4BWVA 3TVYA 3FY4A 3GMDA 4TOIA 3CVJA 3TTXA 1SZJG 2OHIA 4C43A 1ZNQO 4D74A 4PZEA 1FDOA 2WINI 4C21A 4AECA 5AUNB 2WVJA 3ONFA 5KB3A 2R7LA 2BFNA 2GEBA 5EXSA 2ZUTA 2OQVA 1KU0A 3GNSA 1DLJA 4C4ZA 4WASA 2XNDD 3OE1A 4HRXA 1U1DA 5FBRB 1BWSA 2CLDX 3X1ZA 4L15A 3PFKA 3EGOA 4RHYA 2PX3A 3DXYA 2VIIA 3MWGA 4IICA 2VP3A 5FPPA 4TYQA 5K0TA 3IA7A 3FGNA 4HAXA 1NUQA 4NNJA 4INAA 3K1AA 2PUBA 2IYQA 1A9OA 3DEFA 3HP7A 2TSYB 5AVQA 1E7WA 3C5HA 4DQXA 5B12A 5K0ZA 1KJYA 3I45A 5LZ8A 2BI8A 3B3AA 3RK0A 3G0CA 1DKMA 1TXGA 4EY3A 1V16A 3JYQA 2QTBA 4JB3A 4TT8A 4NYIQ 4I50B 3SZRA 2BF4A 2JCVA 1WHTB 2BFCA 3TMAA 3ZBQA 3ZGXA 4ZV4A 1SQ6A 1H94A 2JCGA 2JPDA 2J33A 2XYVA 5JSFA 4GW3A 1QP7A 3KHSA 5A3RA 3I72A 5L51A 4N5DA 4BWYA 4G4GA 1OTXA 4DJJA 4TWAA 2M9MA 4MOWA 4P93A 4PZ9A 3JQGA 4DS3A 5K0JA 4DSUA 1U2RA 1CVLA 4XQ0A 3CCFA 4JJ4A 4JHLA 1XDUA 1YE8A 3GVPA 1C7JA 2BR3A 3ESYA 4MEBA 4QUKA 2WDZA 3AKCA 3DM5A 5HZHA 1QM5A 2H1SA 2PYZA 2G07A 3CEMA 4Q82A 2GCNA 3F6RA 4QXRA 4XB1A 5HZGA 3Q8LA 2CMGA 3GCXA 4KQGA 1M9NA 2YKGA 3IAM6 2G1JA 4L5IA 3M34A 4K1LA 2QQEA 3P2IA 3M2TA 1C30B 1WCIB 3AW9A 3KT6A 3AXSA 3TOCA 1XZBA 3A1DA 4QUEA 5CYPA 3TW4A 5LQUA 1PWXA 3L4SO 4AJ2A 1Y4AE 3E15A 3QVVA 4O2AB 4XJXA 1DG9A 2HU7A 1EFVA 4Q05A 3WHPA 5BR1A 3LFTA 4D8XA 3SWWA 3EX7C 1Z0FA 1RIIA 2EP5A 4RKFA 4Z4IA 1LLFA 5CJPA 4EF5A 4UQPA 3UW3A 3AR4A 4EL0A 1NVGA 2GEDA 5U4QA 4GF5A 4KNYA 3AP2A 4B48A 4LVOA 2DY1A 5CIQA 2QGZA 4OSEA 2JKZA 2GSWA 3CS3A 3I01M 1VJ1A 3Q9NA 4BZPA 3OQJA 8AT1A 5I48A 1TMOA 3IL2A 3ZDFA 5F21A 3D7RA 3VKFA 2QLJA 1FXWA 3JQAB 2XB9A 2XUPA 3NASA 3MPUA 2IV2X 5JVDB 3QV1A 4XX1A 3AWIA 4REMA 1ILEA 3I64A 4FVTA 3GCWA 4K87A 3B38A 2LCFA 1DEXA 4MJ7A 2DF8A 3STWA 1MABB 2HGSA 1LDEA 1PJBA 2GAJA 4GICA 1EDEA 3CC8A 4X1KB 2Y1CA 3W6PA 4YT4A 3ZN2A 1UJ6A 3SJZA 4FMCB 5EI5A 4C88A 2BWJA 5AOAA 4HAOA 3ELUA 5JNTA 5CTJA 4B85A 1EUZA 3MINA 3TRFA 1M34E 3BT7A 3UANA 2GEVA 1VIVA 1NONA 4J0HA 4LHWA 3VH3A 9ABPA 2FPWA 2QTHA 1T3SA 2VJMA 3KEOA 1VCMA 2FWBA 2NZ2A 4LF7B 4FD3A 2OV8A 2OGTA 3L7AA 4UVGA 2WU3A 2FJ0A 1YZFA 4EMTA 2IHKA 3IBCA 4ZC1A 1NXVA 4K9KA 4AMVA 2ZZMA 3MHTA 1NVTA 4PIPA 1P5ZB 3G2JA 3JU3A 3DT8A 1Y1SA 2Y66A 2AG6A 3KKZA 3JRWA 1CY2A 1Q11A 5CAEB 2G09A 4EBFA 1Y82A 3C3BA 1QG4A 1IN6A 5BOSA 2PTGA 2EW8A 2ZFUA 4EHNA 3A31A 2Q4DA 1UC5B 2PJRA 5CFQA 2RH9B 3WDKA 6GPBA 1JF8A 1V8OA 2A94A 2XWQA 3K92A 4E2FA 1OA0A 5JNLA 3UJNA 1X3SA 2CSXA 3IKVA 4QYXA 2V0CA 2P62A 4LJKA 3VVCA 1XVLA 3NUQA 3IXLA 4S1OA 1UBGA 4MWCA 2XWSA 3I1YA 2I6XA 2O7SA 1SKYB 1HQKA 1QH9A 3BK2A 4PVCA 2VTEA 3GFBA 4B3CA 2A5DA 3QIVA 1XVIA 3A1NA 3P0HA 4XYEA 1NC1A 4FKZA 4KMSA 4AQ7A 3RS8A 3GLGB 1V25A 1R0XA 1Z35A 3OIVA 2XYGA 3ER8A 5AW6A 3MOSA 3ZWXA 4AMZA 4EFMA 1SEVA 1B3BA 3ABZA 1H6BA 3RRMA 2P41A 4ESVA 2Q6IA 2HK7A 4TPKA 2I33A 4B84A 3K6SB 4MXDA 4DCOA 4B3XA 1I7SB 1TC1A 3E03A 3OPMA 5CH3A 4LRXA 1DADA 2QA5A 4JJEA 3WK7A 1E6UA 1R0YA 1TYDE 3PUZA 3KNZA 3VKWA 2HBYA 4P4UA 1K6MA 1XAJA 2ORVA 2ZAIA 2QAJA 4RABA 4TTVA 1Q57A 4O4LB 1K6IA 4S1PA 3OHMA 1UAYA 4QUAA 4CL0A 1HOXA 4WV3A 1MOZA 1LI5A 3AEUB 3RIYA 4RTSA 3NG1A 1GYQA 3HLYA 3KL4A 1ISGA 4Y2RA 3TRJA 3TS1A 1E7SA 3PHGA 1F17A 3A9SA 2GF9A 4KN5A 5CRIA 5EJFA 3ZWKA 1CS4C 2X40A 5K0BA 3FFTA 1KZ4A 3H4IA 3TLGA 3OWHA 2WHQA 3LBAA 4Q3KA 5LOVF 2R8XA 4HAIA 3OZUA 2PV7A 5K8UA 2Q62A 1XQYA 2VRCD 4A27A 1CRLA 3TGLA 4KCGA 2OHFA 3NYWA 4UTXA 1BXGB 3KBBA 1MOSA 4DABA 1U7XA 1RXIA 2BC9A 2ZT5A 2B69A 1U02A 2IXGA 1HFJA 3BYZA 3VC3A 3SU8A 3VPGA 3DV9A 4NPCA 1VBMA 1T3LA 1R4NB 1CD5A 1I3CA 1UJ4A 4KLNA 2Q2NA 3IP7A 1TZJA 4DKJA 3ZWDA 1GU0A 2GPWA 1GAEO 5CHYA 2KX7A 2QNBA 5HDBB 2X2OA 4X85A 3AJDA 5C1IA 3V00A 1UM9A 4CQNA 2FCAA 4LWZA 5J63A 5JXJA 4EI7A 4NONA 3NO4A 5J3JA 2CMFA 4YRAA 1JHRA 1D0SA 1TZCA 2QMOA 4E88A 4QTXA 5KYNA 3H1BA 3KYDB 4UUAA 4ZTUB 3RARA 2ACKA 2PGXA 4EHDA 1CW2B 3O21A 3B1WA 5A03A 1DJLA 4UTPA 4YUZA 1RWKA 1Y81A 3REFA 5EQTA 2WFZA 4ENTA 4JXKA 4WEOA 4L75A 1FRNA 1GDHA 4Q9DA 4QATA 4X7MA 2IHVA 2NO9A 3WBJA 1I4TD 3MUOA 1OKKD 1TE2A 1JTFA 8ATCA 1ZR2A 2O19A 5I4BA 1HMPA 2EJTA 4R3UC 5A06A 3JYPA 3OJFA 5DJ5A 1XA3A 4QFBA 1K63A 1D2HA 1EX1A 1XHEA 1U90A 2AOUA 2P7HA 1OASA 1R74A 1WMAA 4GP7A 2OQ2A 2OG2A 1OB2A 4BVEA 4HVTA 3PEEA 4QUHA 4NS4A 3ROPA 5ICMA 3U44A 5A04A 4NEHB 5DYGA 3LBYA 1VI6A 4E7PA 3B6KA 2XNHA 3GRKA 1B73A 2VQSA 4QOHA 1GU1A 2XZOA 2PZLA 4NU6A 1O96A 3THYA 4C9BA 1YHYA 5CNIA 3O4GA 1AE1A 4YRTA 4HAVA 4BVKA 3GGSA 2B4AA 1GM5A 1DBRA 2TRSB 3DEKA 4AJ9A 4D3XA 2IBSA 3E61A 1A76A 5A6SB 3B6MA 4FR0A 1KS2A 2ZBDA 4KPEC 2AJDA 1XF1A 1UBCA 4QPCA 5ALTA 2IEDA 1UDCA 4A8PA 2BTEA 3SK0A 4RWEA 1QCCA 2X7XA 2FMXA 4FCCA 2I99A 2PA0A 4OU5A 3CPSA 4M6WA 4CTJA 1PR9A 1MVOA 2WG2A 2YZMA 2JVIA 3OFKA 1T35A 3ZV7A 3QF4A 1XLUA 3LS2A 1K5HA 3QA9A 4JELA 4KLRA 4M55A 1F2UA 1OZ0A 5CT4A 4BAUA 3QXHA 3PGA1 3OA2A 3VVLA 5K0SA 4P5PA 1BFUA 2XNDA 2JG3A 1B26A 3QE2A 3KXDA 5HA5A 4ENWA 4LJLA 3OMLA 1UFQA 4JSRA 4B3IA 1JPNA 3WHKA 1P4HA 3AKYA 3UMGA 5GZ3A 1Z8DA 1EE2A 2J5QA 3CTPA 2IE8A 1GG9A 3MNFA 3WLHA 4O0MA 2O5CA 3LE8A 1AMUA 3IAS6 3SOPA 3KUCA 2FSSA 4L5AA 2IU3A 2ONYA 2R6HA 2QW0X 4EHJA 1DUSA 4L2IB 1KO1A 3MGGA 2ZWPA 4Z2YA 1YOVB 4G65A 3WGNA 1SC4A 4MW6A 2P1ZA 4EKEA 2PWBA 2RGUA 4ZGBA 1NUUA 4Q03A 3NAGA 1RYMA 4C89A 1MF7A 4W5JA 1GR1A 3IEMA 2H18A 2VBCA 2BMWA 1OF1A 1NL3A 3WJ1A 3HYLA 4HMQA 2AVNA 1DOZA 1L8LA 1XTUA 1YZLA 1IOLA 2VPZA 4KQ6A 3RS0A 5C4IA 3HJAA 2QU8A 2WFAA 4U2DA 1NJ6A 3ZDRA 2FN9A 4L74A 5SYMA 1ST2A 2HFJA 2C1XA 3B85A 5K3FB 1QJ4A 3TTWA 4ZTBA 1QP8A 2X8LA 1KZ6A 3T5AA 1Y7LA 4XZ3A 1D6JA 1FUEA 1II9A 2A1UA 4QVGA 1UINA 4Y9DA 5FBQB 4UVIA 2P90A 4HADA 4JKYA 4K0KB 2OVBA 4HYTA 2VYVD 1TTQB 4KQJA 5DWDA 2QX9A 4O2RA 1OILA 1KK3A 2ZRPA 3N2IA 4KYIB 4Q1CA 1H22A 4WESA 1CP3A 2GBGA 3HXPA 3NP7A 1U65A 1DEAA 3O47A 1S2IA 2Y0EA 4WLFA 5KNCD 2BMJA 2I87A 1C9KA 1HUQA 5BUQA 4BFVA 2XIQA 4BQRA 3HMKA 5KTRA 4MV5A 1TGVA 2CHVA 1FQKA 4ER3A 3OZFA 3I9JA 4TTTS 5ADUS 1KQOA 1LK0A 1P4RA 1QRSA 2BRUA 2VI5A 2X4LA 2ZBVA 4J0KA 1CLUA 3FTNA 5DNVA 3TECE 1U5AA 1IY2A 1AF4A 1Z07A 1BA2A 4TXHA 4R9RA 3UHOA 3UAVA 1VZ2A 1NW8A 3ZVMA 5AI5A 1A9XB 2Q5LA 4PTLA 1U0OC 3HVKA 4TV8A 4XQEA 2AI1A 4IRXA 2RC5A 3I8SA 4YN3A 3I0MA 1HEIA 3K96A 5KX5A 1K4MA 3OM0A 4I3FA 1NBOA 2C1ZA 5HUHA 2ZB8A 1YA6A 2WZCA 3I01A 4GLFA 5GONF 2PZKA 3DMYA 5E6SA 3CKYA 1S2NA 1R18A 5EWJA 4MPJA 1XJWA 1QU3A 2B6HA 2H4FA 3FJOA 3RRBA 3ZDQA 3G0DA 2XQJA 5EY5B 5FOWA 4OI1A 1RAGA 2BHNA 3RWMB 4CMCA 3MS2A 1JHXA 1UZLA 4MDYA 5F51A 3PT5A 2F59A 4DCUA 4LRQA 4BECA 2C2WA 4LF8B 5BO5A 1BO6A 2KPOA 3C7KA 3E4CA 4H7FA 5ELMA 2OK7A 4HNSA 3BSFA 1E99A 2PZBA 3NHLA 1UAGA 3MILA 4EGCB 3A70A 1JKIA 2UKDA 3OEYA 2EJUA 2J3HA 3H2GA 5B64A 4BJ1A 1KMMA 1BVRA 3BWDD 4M9ZA 3HEMA 2O2XA 1B1AA 3QXSA 1DJQA 2F9MA 4D3ZA 1Q0UA 1FVFA 2ADMA 1X7DA 4W9NA 2I4OA 3KX2A 2BGNA 3GJ4A 2RK4A 4IXTA 5KKAA 5CFLA 4LS3A 4GPIB 3C4VA 1SUPA 1KE2A 3BTOA 1NQVA 2O07A 2RAPA 3E3MA 4OQLA 1WVMA 3GUYA 3UMFA 3KXIA 4D02A 4DE5A 2I7CA 3OBBA 1BDBA 3E53A 4LF6B 4IGKA 3Q2OA 1YZGA 1LPMA 1H4VB 3D3QA 2O2CA 3N2EA 4ECEA 4QM7A 1KDRA 4LRWA 3I61A 4AKGA 2CNKA 2I4RA 2JGIA 4Q1EA 4BN0A 1IPHA 5EP2A 2JHPA 2I54A 1ADCA 4K1XA 3BWVA 4HZGA 1FRZA 1X80A 2YCBA 1DFGA 1QHFA 3KJXA 3Q3JB 1IZ7A 1QPZA 2LE0A 2IJGX 4MP8A 5EHQA 5KJ1A 3E7FA 2ZT6A 1JN0A 2AKYA 5JANA 4B6RA 2F3UA 3M4YA 3WRXA 3C3AA 2NZVG 4X20B 1PX2A 3DG9A 1T0HB 3QTTA 1J8DA 2XXAB 4NH0A 3DBIA 4E14A 4M9UA 3QXJA 4IM7A 2YW9A 1KYVA 1CNEA 1VKZA 2B1QA 2PWYA 2QGFA 3B3GA 1O6BA 3DLIA 2RK3A 2IIVA 3DAGA 2RI0A 2C9DA 3LPNA 1F8XA 3L8HA 2CDAA 3FFXA 5L3ZA 1T5HX 3KB8A 4N82A 5I9MA 4C6TB 3CSUA 2EV9A 3N2NA 3DP7A 1WM1A 4GVLA 1G5IA 2FPIA 5BUSA 3K71B 3OIGA 4TVSA 3EQ2A 4JROA 2QRPA 2CLSA 5IHPA 2JAQA 4XJVA 5BUCA 4J8PA 3TI7A 2BHRA 5E6RA 2EF0A 2WSLA 4ZYWA 5HF8A 1DRWA 2VPPA 2WU4A 3K8QA 1X1CA 4IHJB 2DJ5A 4ZC8A 1A50B 2VYFA 4TRMA 1IXSB 4HDMA 4LJSA 3ZTWA 4IIUA 2PX2A 1XTIA 2WQZA 3AR9A 2DPHA 3LPLA 3OQ1A 5E7QA 4QJ3A 1QLHA 1ZI6A 3L0CA 3TLYA 5CX4A 4BE4A 2ADFA 2BUAA 3RTGA 2VRCA 4RY2A 4DSZA 5HWSA 1E92A 2BJVA 1MRSA 4XASA 5AXAA 2RHWA 3DKVA 1ZY2A 1A27A 3F4BA 4DC9A 4EZBA 2VHUA 4WHMA 4JVMA 3ZY4A 2G4LA 2J59A 2WA2A 2PAAA 2ZQ5A 1YR1A 4XDHA 1VG1A 3QVXA 3E0XA 3VO1A 4A0HA 1JALA 4WZAB 2G6BA 4PPYA 2IYTA 5KHAA 2CFOA 1TEXA 1CR2A 3IELA 4KQIA 3NTXA 1EQ2A 4KITB 3DLAA 2BEVB 4LBZA 1LNQA 4R8SA 4RZSA 4MYDA 3SYTA 4B8ZA 1WBBA 5LUBA 1KI2A 4O4IA 1H2ZA 3UWDA 1ZGZA 2JDID 4I3GA 5I45A 5IT5A 5P21A 4NK4A 4BO6A 1WV1A 2Z95A 4C78A 2V45A 3ELBA 3I8OA 2Z5LA 4OQZA 4V24A 1CZNA 2OWEA 4TL9A 1KQNA 4DLKA 1V9LA 3DWIA 2NW6A 2FEKA 3D1VA 2FETA 4YP5A 2DQSA 4M37A 4MKFA 1YB2A 2OV6A 5C51B 2NVOA 2VVTA 4FFOA 4OXQA 4UTZA 3I62A 1KJQA 1Z6XA 2CFCA 3SX4A 4F3TA 2IYYA 2JJ2D 1VE9A 3PA8A 4DV6B 3JPYA 1DI0A 5DHRA 4ZCIA 2RGNA 1I3NA 3A4MA 1WS6A 3PZBA 3QZUA 4ZO4A 3LDUA 3VR0A 1W88A 3OFND 3VV3A 1OKKA 4L8GA 1FFBA 2I03A 3MWDB 5CIYA 1W48A 4XYLA 4W7IA 3DMTC 3DUWA 3F9RA 3LQYA 4M60A 1K8YB 4Y1GA 2HJHA 4CMBA 1N33B 1I32A 3EA4A 3NNDA 4Q9HA 3T99A 3WKBA 4EHKA 1BW9B 3LUJA 2FF5A 3H65A 4XXHA 3DWFA 4MUNA 7REQB 2J0UA 2J9GA 1VRCA 5KOYA 2YY7A 4ARCA 2B36A 4WZBE 2H54A 1S2GA 3DHVA 4PO9A 4ROSA 2YHIB 3TW8A 1ZWKA 2QUJA 2C2KA 4KWTA 2Z8XA 3VOTA 1EFKA 2GHRA 2WWVD 1CUCA 1KL7A 1MC1A 1D0IA 5A02A 3LY7A 4Y30A 1IOWA 2XBUA 4Y18A 2PGOA 4MRSA 3VYSB 4RTQA 1DXHA 1QBGA 5BSMA 2IV3A 3UPUA 3MLEA 2IZ7A 5ICFA 4O5AA 3NHSA 3X2EA 4O8CA 1C3LA 1IBSA 1CERA 2E1PA 2EZ4A 4YAUA 1IDOA 2ACEA 2AJBA 2RHTA 1JR4A 3NORA 4QOGA 4EGSA 3ZYCA 4Z5XA 1ULHA 2BHLA 2UVQA 3CQ9A 4Q7MB 5DN6D 5IRCD 3QK7A 5E3JA 4HDRB 1ZD1A 4TN5A 3ZDBA 3Q3EA 1Q17A 1EVLA 1HKHA 2QPOA 3G8AA 2I2DA 3JD0A 4RZXA 1QG0A 2ZBFA 2DECA 1NLYA 4AJOA 3TJZA 4RNDB 3NW9A 2HO4A 1I0IA 3EXG2 4ZYVA 3TPZA 1R1DA 2RH4A 3W7VA 1A5ZA 4DMMA 3S2SA 1LDGA 1F14A 1RMTA 5JCJA 1EX7A 4NEGA 4CKCB 2WSBA 3H2YA 3KQHA 4MCJA 3U81A 1HT3A 1MEEA 2FF7A 2XCIA 1SKAA 3L84A 4EDHA 4REQA 3K53A 3SHVA 2RE8A 3AV0B 2W5UA 3CF4A 5KWIA 2HZBA 1XJQA 1ZLYA 2A9QA 2ILVA 2H29A 2QVYX 1M1UA 3UGJA 1ML4A 1E61A 1XNHA 3D02A 3EGCA 4UHEA 1FFCA 2H9YA 2J7PD 3MMNA 1NW7A 1EB9A 4MW5A 3WQQA 4I9GA 4BKQA 2JIBA 4R7ZA 2NU6B 5GIOE 2GM9A 4PQYA 1RI3A 4QHTA 1FTYA 2PXXA 3WTBA 1FTWA 3EBOA 4BEVA 3DV0B 2NV0A 2NVUA 3KQTA 3OQIB 3QF7A 1OSNA 1NHWA 1LH0A 4OM7A 4EEXA 5CA1B 1XCPA 3CUYA 2I7XA 3KLPX 4LCEA 3IBTA 1MB9A 1N3IA 4UC0A 5GQSA 2HLPA 4YV2A 1CUFA 4JJAA 3CR8A 5KTMA 1GUYA 4A3SA 1SGWA 3ANLA 1UJBA 2XUFA 4MA4A 5HUQA 5ALNA 4PSCA 2VYVA 2HDWA 4P4NA 1FYWA 2BFBB 2J3MA 5LP6B 4ISCA 2G28A 2K4MA 1HK7A 3JQAD 5DBEX 1LTKA 3FVQA 3SIXA 3VH2A 3ICEA 4DV0B 5JS1A 3HB9A 1L5QA 1X19A 2DTXA 5KNCA 2HRQA 5DNCA 3UMRA 2C2MA 3MTBA 2HDNB 2V6BA 4IPTA 1PWZA 1ZN2A 2IW3A 4JFRA 1ST3A 3VHQA 5M29A 3ZVNA 4J0JA 4LDJA 1ELOA 1PWEA 2F48A 1K5GA 3KR1A 3M2PA 4IJQA 3DEHA 2XAAA 4WNAA 3N8GA 1WXIA 1WZNA 2GDZA 3UMBA 2NUAB 1QYIA 1XD2B 1YJAA 4OPMA 1NYRA 1WDTA 3MT9A 4YRZA 4OLAA 1JWBB 2HT6A 1MDFA 1U8UA 1IM8A 3V32A 2H11A 3CBQA 3EH1A 1P5FA 4L08A 3U17A 4Q1VA 1Y3CE 2RHHA 3M6AA 4CIWA 2JAUA 1V5GA 2GK6A 4AMUA 2OHHA 1HC7A 2PGDA 4WWHA 2GPJA 2GVNA 1XTVA 2UXBB 3U3MA 1BVHA 3IVGA 3TLXA 3WLAA 2QTAA 2HXYA 3HR4A 2J46A 1H0RA 2A3NA 2UVDA 3EZXA 4AT1A 5FI0B 1Q3TA 3FTEA 4OB6A 1JT2A 5EPOA 3TAXA 1IVNA 2EF1A 1ACLA 1NR5A 4WN3A 2GS9A 3GX1A 4D0LB 3RH0A 5BV8A 3U5ZB 2XUQA 2FSHA 3HA3A 4QGFA 2JJQA 1M5RA 3OQVA 1NJSA 4CUKA 1EX9A 4NL4H 4Y1EA 4WVLA 1N5MA 3FPJA 5TQJA 2O8BB 5AXBA 3L5OA 4JY7A 3V8EA 1AT1A 4Z6KA 2B5OA 1KIAA 2XVXA 1GNQA 3KE9A 1XAGA 4NE7A 1NAHA 4RPGA 4PLCA 4DQUA 5AK5A 3FNBA 4F4CA 1DFHA 4OI0A 3E9NA 2WSYB 1NQTA 1O6GA 2OA0A 3HVHA 4RK1A 4X7PA 3ASUA 4MWSA 3UPDA 4CKYA 4W4TA 4H6XA 1V71A 4M1EA 3ZDEA 4TWZA 3QBDA 4EFNA 5GIPE 3KQUA 1AHIA 5H9WA 1JKMA 4NMHA 1GPWB 3PUYA 4NV3A 2IH5A 1G17A 1UK9A 1YR3A 2YUTA 3IR6A 1U4OA 2VLBA 3GNQA 1TPYA 2JBHA 4GZMA 1B8VA 1OZHA 3GLFE 4DXAA 3P19A 2NAFA 1U2DC 1KSHA 2XHZA 1G4UR 5DX1A 3ZXXA 4DPKA 1FSSA 4CGZA 1CRPA 3HRIA 1HNNA 1KZ9A 4HAZA 1YDWA 4WERA 4D2IA 3A6FA 4CM3A 1E9SA 3DBRB 1FQOA 3I30X 3ILHA 4YRKA 8ABPA 3DSRA 3HUEA 4X61A 1SNYA 3G8DA 5HK8A 3I5AA 1H2FA 2BTQB 2FUNB 4LZNA 2Z57A 4HSGA 4Y6LA 2PKQO 3RFFA 2ZXEA 4JLOA 3DAFA 2CLEB 3RGWS 1IPFA 4GR9A 5JR3A 1Z2PX 1FTGA 4FFNA 2JGNA 4ZAWA 1UR5A 3INGA 1KBOA 5C7YA 3B52X 1ESMA 4GXNA 2UZ4A 3ZD6A 1JQEA 4OGKA 1USUA 3KK0A 5JADA 4EL5A 1MBZA 2XMDA 1P0PA 2AN3A 3PRYA 3EGWA 3TTVA 4RK6A 1S2DA 2IUSA 1LDMA 4Y2PA 3UCXA 1Z56C 3IRVA 1FFEA 4IFEA 1VIDA 3NEYA 5IJAA 4BQIA 1XNQB 3EN0A 4N9QA 5L3QA 1QG2A 4TZ0A 3VJRA 2QQFA 4PC2A 1RHJA 1DEOA 2OO5C 2XCTB 1EI9A 3HBLA 2WY2D 2O4CA 1GUZA 1P5HA 2PT9A 3GP3A 1PS0A 1QB7A 1K86A 3QHQA 2YYYA 4PSUA 4ALIA 2O3JA 3FNRA 3DHWC 1REQA 3MRTA 1QPBA 2VJCA 3RYFA 3EPJA 2QD5A 1ACJA 3HL0A 1Z47A 3WI7A 2EWWA 4ZVMA 1E2NA 2QZSA 1SOAA 2AW3A 1Z06A 2VAVA 2FZVA 1H23A 2ZRMA 1PGPA 3LXMA 1M74A 3QEJA 1YQTA 2HCJB 3FMOB 3T5TA 1A96A 4IIEA 3R9KA 2GWHA 2PO7A 3CG0A 3BFPA 1IWBB 2G06A 1G5HA 2RJOA 4OUDB 4RJLA 1OXMA 2A5GA 2YX1A 1OYYA 4IEFB 1JRLA 5AW3A 1XV5A 1FFHA 1ENZA 3ZGYA 4AG5A 1MH9A 4D4MA 3ZDXB 4A92A 1FDWA 3QSGA 1V1RB 1D04A 1I4OA 1ZOPA 4IEEA 5EJ4A 5KWJA 5AW0A 3VKHA 1AZWA 1YQ9A 1FJ2A 1Z22A 3HKDB 4L4RA 4BV3A 4UFOA 1L4EA 1WXWA 5AWFC 3T54A 5JY6A 1JFFA 2JDIA 2ZI5A 3OHSX 4HB4A 4NNPA 3RJTA 5HJ5A 1J0CA 1N6PA 1DAIA 2RGCA 2HMSA 5IEBA 4QSHA 4AROA 5HUJA 2I8AA 5AVRA 3LSTA 4E5PA 3P0JA 4OFZA 4XVRA 1U0BB 4NBSA 1G7CA 1FLAA 3DBLA 4RADA 1KP9A 3EVGA 4RQUA 4N0DA 1EGMB 1SCJA 1J2EA 1ZOIA 2AC4A 4MV4A 2JJ2A 5LQKA 2HHHB 1WHSA 2XUHA 1X39A 2G5GX 4MIKA 1GGKA 1EGAA 4Y9RA 3JZMA 3OP1A 2H06A 3GLHB 4G5YA 1LPOA 4QNMA 4ED9A 5CCXA 5HRCA 4OHZA 1N8KA 3SIWA 5BSEA 3JQ7A 3OFNA 4D0GA 5KS2A 3KOZA 4ZFNA 1WCWA 3RC3A 2DBZA 3B1XA 1SIWA 1UEJA 3ZD8A 3CRNA 2FMHA 1T1EA 1A8HA 3DZFA 3K0SA 2IODA 1ISIA 5LDGA 3F96A 3X2SA 2FU5C 2R8EA 1T3HA 5EWLA 4OHVA 1QP4A 2GRUA 5LL6P 1RQNA 1US8A 4Q3NA 1IL0A 4B40A 5JXGA 1RYDA 2QUAA 4OHKA 1FBTA 5EUBA 5E4JA 2H52A 2X8AA 4K9RA 1EESA 3OTOB 1KF0A 1RXWA 4MW1A 4S0XA 4XCVA 4XLLA 3EXG1 3SHWA 2XUGA 2GEUA 3S2IA 2JJYA 1XLTC 3WB9A 3LY8A 3IOEA 2EFCB 2YRWA 4FGKA 4MQFB 3H2BA 3OX2A 5D00A 1P19A 4YT8A 2QLTA 3LHFA 2I6TA 5JMTA 3LZDA 3I5MA 3NVDA 2P5TB 2W6PA 2WAOA 3LKDA 2FXVA 5GADl 2WKQA 3H1EA 4E15A 1UAAA 2HEGA 1EEHA 2O3TA 3OZ7A 3ZCRA 1RTTA 5B3LA 5LOVB 1YDFA 5DN6A 2PFGA 3SQNA 4AIRA 1NXSA 2HJ9A 3L6OO 1BKDR 3PQDA 5FPSA 3NUZA 4IDBA 4UREA 5G41A 5J9FA 1N7GA 1YBHA 2O2JA 1XRMA 1WUYA 4I50A 2G0NA 2PZJA 3W8DA 3X3HA 4BBAA 3VOSA 1ABEA 2YWEA 3G7UA 3OF3A 4K9PA 4N4AA 4EG0A 4U9UA 1YFLA 2Q2OA 4HJRA 1GT91 3UEOA 2JLZA 5I8ZA 1D2RA 1YL7A 4RQTA 2OWDA 2PY6A 1PF7E 2DFKB 2YHSA 3N6XA 1WSDA 5DM70 3EUWA 3V2UA 1A7UA 1WW8A 1J8MF 4X95A 1M6HA 1Z6YA 4FJ1A 5K0LA 3IDZA 4JBGA 1GCOA 4R81A 4B7CA 4TQUS 2Q7XA 2F64A 3QSYA 1XEAA 1ZXXA 4Q34A 1YR6A 2Q99A 3U4IA 4AZWA 1E1KA 1VIYA 4EG5A 1Z45A 2AIRA 3JAMA 4KN8A 4P4LA 2MSNA 1WPQA 3C16C 5EIFA 3RVDA 1NBHA 3S4YA 4BNIA 1CRQA 2GCGA 2J7PA 3GJ3A 4JYBA 4ZQGA 4F9TA 4EJ6A 3RROA 3DCNA 3ZWBA 2QYOA 4ABTA 1PQ4A 3OIYA 2NG1A 4O2AA 2I3GA 2VNSA 1UADA 4PQGA 2TECE 4JYZA 1O87A 1XZJA 1GQOA 4S12A 5REQB 3HYNA 2OZPA 4D4KA 4UVDA 2VDQB 3DO5A 5JAHA 2DEUA 5H0IA 4N3BA 5ISMA 4N0MA 1I6KA 3L3BA 2G80A 3FDZB 2IZZA 1DAEA 5IYZF 5BYJA 1MV8A 4DLLA 5A7GA 3VZDA 1TKAA 4C0SA 1S4QA 3GGOA 5B1HA 2QJOA 4DCTA 2GM5A 3O4IA 3JQAA 5BNIA 2QOEA 4RKWA 1DELA 3VDMA 3JRNA 4DLTA 5IM4F 2OXCA 5C4MA 1RRKA 2XWJI 3LQQA 5IKXA 4XIYA 4G5GA 4QAJA 3W5VA 3IT2A 4DFDA 4FEEA 2WAXA 1Y9JA 1S9DA 4X1KA 3UAWA 3HXTA 1HPLA 1FVOA 1I6MA 1GTL1 4MHOA 1PJAA 3D6FA 5F4BA 1HNXB 2W6JD 4DHEA 1J8YF 3VYRB 4LX8A 2AZ4A 1RAAA 1M1YE 1VSUA 1R0LA 2GK7A 4PIMA 4GM1A 3IDSA 3AUFA 5HJ7A 3L8FA 1TD9A 3CLRD 1SR8A 1DKQA 2Q4OA 2XEDA 3WIDA 2YMLA 1T13A 2FFBA 4UD2A 5E4YA 1FDUA 4R41A 2EW2A 1LDBA 1RC0A 1G38A 2PKQP 3GLVA 2FSGA 1MW8X 2PZMA 4F9EA 1F9AA 5J5AA 3OCCA 4WOKA 1YJQA 1CZOA 3UF0A 5LZ9A 5EXEA 2DAPA 4HFNA 3JW8A 2VAWA 3R0XA 5CAEA 3QPCA 4YMTA 1WB4A 3ZI7A 5DNEA 4XUGB 2AUNA 2ZJ2A 2CLFB 4B4UA 1C4WA 2EGHA 2KHZA 3M6WA 2WT9A 1XA4A 3EDRA 3PVSA 3TIFA 4DDKA 2OKGA 1UXIA 3I2IA 1EBFA 2P69A 4PG8A 4ZK6A 4LJ8A 5EJIA 4Y2JA 3UJCA 4Q3BA 3P9IA 2VF5X 3IB3A 1ZX1A 3PITA 2YW2A 4JNKA 5FA5A 4ZOBA 5MN6A 2H1FA 4CMIA 1AA6A 1FFSA 1TOAA 1H6CA 3P4YA 2DUNA 4AU1A 4CKWB 5LP6C 4YRGA 1W87A 2D5BA 3V1LA 4BNXA 2VQDA 4MI6A 4NIMA 2FZ4A 2HMWA 3VTFA 1GTSA 4OI2A 4LGMA 5CLHA 3WGZA 1U9ZA 2ICAA 3GLRA 4Q1BA 2G36A 2R1UA 5T4FA 3GOHA 4W5RA 3GLGA 1IUNA 3KQVA 2CK3D 2Q45A 2NACA 3NMUF 1FVHA 1ECGA 2F6RA 3VXKA 3LG2A 3MWEB 2NYVA 1IJEA 2NIPA 5D6NA 3USES 1RLJA 3MD0A 4MICA 3K6SA 3B89A 5CU7A 4ND3A 5FJIA 3WHIA 4DR5B 3D2BA 3F98A 1M0EA 4KGDA 2X0EA 3FOFC 4BLVA 3NTOA 3GMSA 1EEXB 3T0IA 2WG0A 1ISMA 1D8TA 3LBIA 2JI8A 4S24A 5JBIA 4HNAB 4Q1AA 1MO2A 4H4CA 4O4LA 2K87A 3I53A 2QLBA 3QELB 4JJFA 4OJYA 2H9AA 3UXMA 3SF8B 4HNUA 2Q5HA 3DMTA 4EVSA 2Z08A 4PYLA 2EERA 3I32A 3AEUA 2DBYA 4DMRA 3OHPA 2QR3A 4E6EA 1J1UA 1DX6A 5EN4A 4KE6A 2R8RA 2P2NA 4PO8A 1THMA 1QGDA 2NXNA 3AH8A 3N0WA 3HB0A 3QBVA 4Q7LA 1CVRA 5GJCA 3SR3A 4NATA 3PXCX 4HUJA 1RI5A 4TKLA 1KFKB 5CVCA 3LIPA 2I7DA 2VH5R 3KZMA 4MWDA 4DMGA 2GR9A 2H85A 3NM6B 1GTG1 2HTFA 4IDQA 1BXGA 3WSTA 5GONB 2W6OA 2PUHA 2PSJA 1WR8A 5B1EA 1R4NA 3OU7A 4ZT2A 1UC8A 3GEGA 3EMBA 1I9CA 3R1IA 5EQDA 1MX3A 1PR0A 2GJ9A 4MVCA 1H5UA 1PAUA 2J0EA 3DO8A 4JXZA 5BXQC 2VEOA 3NFYA 3TZQA 3VFDA 2YQ5A 4RF2A 5CTAA 2IYSA 1LW7A 2Y9MB 1PEYA 2CN1A 2ATXA 2QVLA 1DV1A 3X2FA 1GL6A 3FBTA 4LOKA 1C9EA 5F35A 1Z2OX 3KEFA 3RTBA 3U4HA 4ZI3A 1EVQA 2B4RO 4ZVQA 1OR8A 1HE3A 2J9ZB 2C4NA 5BN3B 1BMQA 2ZYGA 1KPIA 1XT6A 3UK6A 1MX9A 3NEPX 4HN4B 3QX9A 4QELA 3C7AA 2X41A 3FIJA 3PD7A 1UMDB 2EWVA 2OLEA 2WG1A 1OVMA 3H1GA 2P8JA 3EEOA 1KAQA 2VTKA 4EI2A 1W1WA 4Q4CA 3EGDB 1RYEA 1IM2A 3HYSA 1CY0A 2X4DA 2XMZA 3NANA 2VK2A 5KWVA 4LHYA 2W4IA 4FPXA 1DHTA 1RNLA 2GCOB 2PQ0A 5SV2A 1GXSB 1AN9A 1UXOA 3D1JA 1RRCA 1GP2A 3TZHA 3FMIA 1L5LA 2C07A 3DT9A 2J3IA 3N3AC 4Q4JB 4E5KA 4GLJA 5DX8A 5E38A 5TY0A 1RHQA 1UPBA 2VLIA 2JIRA 2BDEA 3CV3A 3DMHA 4G86A 3V4LA 4FCWA 2VA8A 3Q98A 2D3TA 2P78A 2JLQA 4OV6B 1P4GA 1XMXA 1PUJA 3GBPA 3ZGZA 2H1OA 4W5NA 4K9DA 2H0RA 4N5HX 4NQRA 5KJFA 3K4QA 1CE8B 2QXUA 1JFRA 3K5IA 3LZCA 4F5ZA 3FF1A 1LJLA 2P11A 2KMLA 2PLRA 2R47A 3OZTA 4M1QA 4NEQA 4UPVA 4DLPA 4US2R 1PNOA 1K08A 1P2FA 4BBZA 3L6EA 3T95A 4L57A 4L85A 1YRYE 1QH1B 4U8HA 3MGCA 5GY7A 4ZXPA 4G8DA 4CM9D 4CYMA 2GAIA 1K8QA 2NZYA 3BZBA 4V0NA 4KI7A 3ZH2A 3U2QA 4YXWD 3VR4H 2VUIB 5A6SA 4MMXB 1PD0A 1Z4LA 4Z8YA 2I76A 2L2QA 3AILA 1MFPA 2GN1A 4RF4A 3V5NA 1NF9A 4DV7B 2CL0X 2ENUA 1ORDA 3HJBA 2C2ZA 3H99A 4L9SA 5TQ2B 1DXOA 5LU9A 1I8TA 1I2MA 3GCZA 4RD0A 3TQSA 2A92A 2R68A 4HTAA 3T7SA 3PI6A 3WV4A 2OP1A 3BILA 4WFQA 3PC2A 2XCOA 1BJRE 4YRJA 1U2SA 3H13A 3S8EA 3K0HA 4C20A 4YRMA 1YFJA 1Z0JA 2G25A 2HIHA 1R0CA 1DPGA 2E4XA 3IYLW 1ZINA 3ZNPA 2FB9A 1W46A 4OTZA 3DFIA 3GG2A 4NCHA 4BXOB 1L6IA 1L1QA 2BBWA 4RE6A 5FNZA 4TLLB 1IZZA 1C9JA 1U9YA 2JAXA 3K9HA 3IV7A 4FONA 1N5IA 4DA0A 1ODTC 4YROA 4L2IA 5J4YA 2IOHA 4X97A 1YOVA 3OLQA 3H1TA 1HGXA 3AM3A 3FFWA 1A8QA 1J8FA 5KYXB 1XZDA 5JAQA 3RKRA 1B6RA 3VQTA 4DBLC 4DUPA 3KLBA 5HM8A 5AVWA 1ZRMA 3I9V1 2H2GA 3ACDA 5FPYA 2CVPA 4G0XA 3SM9A 3ZCXA 3ED1A 4BGDA 1NVMB 3FHCB 3Q8KA 5T6MA 1WDMA 2WUWE 5K3FA 4NFYA 3TLKA 4MUMA 4PX2A 1NVDA 3AUXA 1J8QA 3EEFA 3H8SA 5IH7A 3BJIC 3FZQA 1SJ9A 3NAQA 3PDCA 2PXAA 1CNFA 1R0BA 2HJRA 2ATVA 2AMFA 2HAEA 2DSNA 1VKRA 3AUTA 1GKKA 3EOAI 4F2WA 1SUSA 2XUIA 1EXDA 3D4OA 2CZQA 2DPYA 1VYUA 2C2HA 3F8SA 2IX3A 4KGZA 1Z2EA 3LX8A 4BASA 2QPAA 1AQJA 3MTQA 2UUOA 3WK6A 4D9KA 4GO1A 3PFNA 5IULC 2XBLA 1OCEA 3KE8A 4LOJA 2WUFA 1IOVA 4D3DA 4EEKA 2GBPA 3G1WA 2R3SA 1A88A 1Z6AA 4AF6A 3VO2A 3VSAA 3W90A 3IJPA 4DLYA 1T6ZA 2WF5A 1FU8A 2CUZA 4F97A 3FB4A 5FCDA 5BYAA 2BGJA 3ZR4B 1AZTA 3SZOA 4GOND 3EF1A 3ZTTA 1BC5A 4PGGA 2FQQA 1KI8A 2AEJA 5KQSA 1MZPA 5CX1B 4MJXA 4ZKDA 1A9XA 5IUNC 1YBVA 3G0GA 3QLEA 4FMPA 1U3WA 5AJWA 3NC4A 3H19A 4GPTA 1XXHE 3QLVC 2JEOA 2Q6VA 3G13A 4BOYA 1FIUA 4Z53A 1YQUA 3O3NB 1QS0B 2ZUWA 3EW9A 3L92A 2GLUA 1W75A 3PHIA 3HTXA 4B81A 2Q9BA 2EATA 3KVRA 2V7QA 4FGLA 4EI8A 1AK9A 3L0OA 2IP4A 1H1DA 4I66A 2QS9A 3KL2A 4P36A 2ZAMA 2JKYA 2NTJA 3OZAA 1F1BA 1XNJA 4IHQA 5ELLA 4CWAA 4F86A 2W6JA 1MP0A 3ETJA 1E0JA 4JBWA 3N5CA 5DASA 5AKXA 3GNLA 4F72A 1ANKA 3MGAA 4X93A 1C7EA 1MFZA 2V8OA 4NFSA 1SFRA 4UAGA 4XSVA 3VX4A 3LY9A 4WNCA 1QGAA 3FUTA 4C0LA 1ZNWA 1T2DA 3UTCA 3DLHA 1VZ3A 2IUEA 2C7GA 2BMVA 1ZRNA 4LYEA 4EY8A 3E6AA 1RT9A 1XL1A 3CW2A 4GWKA 3P26A 4HWPA 1J5EB 4CM4B 1GR0A 3VBCA 1EE1A 1K2WA 3RVJA 4EHLA 5C32A 4XYGA 1JEEA 2RGXA 1YRBA 4G26A 2N75A 1KMCA 2LGJA 3SS8A 4FYMA 4RK5A 4RMIA 5JISA 3PXBA 4JP1A 2Y99A 3DDNA 2OO5A 1GPLA 4V0QA 2MU1A 4DCNA 4QC2A 3VR1A 3ZWOA 2ON6A 3UUFA 2G5CA 2HIGA 1BA3A 3SZMA 3GZNB 1OFGA 3NWOA 3UAOA 2R6R1 1SD5A 2IPOA 4Q4AA 4XPIB 5LZ7A 3D7KA 4S1WA 1OQAA 1PDVA 1YI1A 3KEQA 2E2WA 2WAMA 5ILQA 3LH5A 4L5JA 4OOEA 4RVDA 4TYPA 3D6HA 4RUKA 1QFZA 3WGOA 5IPFA 4ZOEA 3VAAA 3W2GA 3IT1A 4NU8X 1SXGA 2OB1A 4PG6A 4DM4A 1BU8A 2QZ9A 2IXEA 4ENVA 4MJLA 1Q12A 2BKEA 3HJTA 1PVOA 4UBIA 3G1UA 3HDTA 4Q48A 4ALJA 1NDHA 5DM2A 2OECA 5HX7A 5CA0F 5KU1A 2Q46A 2CHGA 1G42A 3OF2A 5AI6A 3V8QA 2CK3A 3R7AA 1NIPA 4BVBA 2NXEA 4KEAA 1H2EA 3RD5A 1DRVA 2R8ZA 3CH4B 3N9IA 4ODIA 2G77B 4N7JA 3IDQA 4X20A 3HM2A 3IQWA 3PE3A 1E1YA 5M3BA 3TBHA 2XXAA 5HYVA 5E9AA 1NYQA 3ET4A 2BCGY 4GOKA 4I4NA 2P9QA 3EDYA 2PL3A 1P91A 3EGEA 1RQXA 1UIMA 4F5EA 4ZCMA 1QX4A 3HGMA 1AKUA 4MJ3A 2W2LD 4NE2A 5H4GA 4CTKA 1RBZA 1PJ3A 4OLFA 4WBXC 4A6EA 1GKYA 4GU5A 3ZVRA 1XEFA 1ND5A 1L5RA 2FEWB 3R5XA 2WV9A 3DKRA 4GYKA 4N5MA 3TCNA 1N1MA 1Q74A 3OZCA 3V2GA 2NWQA 2RHDA 3JZAA 4ZT4A 3V4OA 3ZW9A 5A2QA 2AVDA 1H2HA 3A1EA 3NTUA 3O2SB 4REOA 4L3WA 1KY2A 1PZXA 3H2SA 5FTKA 3SJAA 2WQ6A 5HIMA 4JQYA 3COYA 3FZGA 3CGGA 3P5SA