3BVPA

Crystal structure of the n-terminal catalytic domain of tp901-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
136
structure length
136
Chain Sequence
KKVAIYTRVSTTNQAEEGFSIDEQIDRLTKYAEAMGWQVSDTYTDAGFSGAKLERPAMQRLINDIENKAFDTVLVYKLDRLSRSVRDTLYLVKDVFTKNKIDFISLNESIDTSSAMGSLFLTILSAINEFERELEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TP901-1 Integrase
publication title Tetrameric structure of a serine integrase catalytic domain.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Recombination
total genus 49
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bvpA00
3G13A 3PKZA 5C34B 4BQQA 5C35A 2MHCA 2RSLA 3ILXA 1GDTA 3UJ3X 1GHTA 2R0QC 3BVPA 2GM4A 5C31A 3GUVA 1HX7A 3LHFA 5C32A 1ZR4A 3LHKA 2GM5A 1ZR2A
chains in the Genus database with same CATH superfamily
4WNAB 3ZWVA 4DRZA 1DLJA 4K2AA 5K0ZA 3D6NB 2CJXA 1N92A 1Y3AA 2AN9A 2X3YA 1WW2A 3LT4A 4RZUA 4AS3A 3KKLA 1GRCA 3B7PA 3N0WA 4UOZA 3GRYA 1UMDB 3GLQA 2Q1WA 4Y2PA 2ZT8A 1ST2A 2VZEA 2IIBA 4Z2YA 1RZUA 1T5HX 2EKDA 2ZYTX 1M2EA 4BN5A 4L3WA 1VPWA 2QUBA 4ITVA 1CZNA 4R2WA 1H8EA 3KVNA 5FFMA 5EQDA 4G5RA 4PXAA 1GPWB 2H4JA 5B7QA 5IHXA 5K8CA 4PG4A 5HFAA 3K96A 1ZH4A 1CRZA 2ZI3A 4GC9A 1GNSA 2FW7A 4J4BA 2EGUA 5GV8A 1KI6A 3Q85A 3SLGA 2J5XA 3VQTA 4MV1A 1C0EA 5GY7A 1KAOA 3JD3A 4MVYA 3RVKA 4CGZA 2VWHA 3LC2O 1Y1QA 4XQ0A 3TBKA 3JQGB 1MPXA 1BN7A 1SQ5A 4Q7QA 4MJ7A 3GNTA 3G5TA 4JFAA 1JQAA 1F3OA 2IYPA 1GLGA 1UP6A 1VL5A 3AEYA 4Z1MD 2XXAA 2BJHA 5BOSB 2WSSA 4G37A 5D8DA 4FUQA 1TW2A 5KYVA 4L6CA 5A02A 1HKUA 4MUNA 1H5UA 4HAXA 4PC1A 2XHEA 4Y2JA 3UMFA 3H13A 2IEYA 2V7TA 1MA3A 3IP1A 4AKSA 3BOSA 4KXQA 1KH3A 4R41A 3BORA 3UJ8A 4YWJA 4E2XA 2M6LA 3DMDA 4KUGA 1A5BB 2X15A 5CU7A 2WA2A 2J6CA 3JQFA 8LDHA 3RU2A 4LBYA 4B3RB 4NS1A 4RCYA 4YRJA 4BUZA 4FFMA 4DB2A 1FZTA 5H8WA 1N5OX 1VBFA 4TKUA 3CVVA 4HQKA 3K2BA 5JEDA 2XCIA 1R15A 4PLYA 4WK2B 4BLVA 3A6JA 2BT4A 2V0NA 3FRJA 2IZZA 2R84A 2HHHB 4HQRA 5IP5A 3RANA 2DFDA 1K7FB 3K2EA 2IP4A 3AVTA 5AXBA 1ZMXA 2HA3A 3BCSA 2J08A 1WSWA 1RM5A 1UXIA 1WDLA 1IZZA 4JCCA 4Z3KA 5JNRA 2BFCB 2IE8A 1FRQA 1WZEA 4LDZA 5B4VA 2UUAB 3OCWA 5D85A 1W0KA 3GQVA 1XDGA 3K94A 3PRKE 4XYMA 3RSFA 4QDXA 1K7YA 3RUAA 3FPCA 4DA6A 3K9QO 3I9FA 3QENA 2BMJA 4MYTA 1T8YA 4IXNA 3GAZA 3AHJA 4B3SB 1WD5A 1OH6A 4AROA 2D2FA 1QV6A 4BJHB 3L4BA 4GR9A 4HGZA 2ASVA 1Y98A 1NRWA 5EWJA 2Q1UA 3C87A 4L76A 4YIHA 5LQSA 2FTKE 4P0TA 2C5BA 1XZQA 4RD6A 1Y7LA 3FOCA 3K71B 3CV3A 3SICE 4DC1A 1OWMA 2FDXA 4OBXA 3ZGNA 3BGOS 1R0BA 1S1MA 3I5MA 4X92A 5ALFA 3L4KA 2JLCA 3QYFA 2IPAB 4EMUA 3I92A 3KZVA 3H75A 1ZSNA 3C3YA 2WF7A 1U0NA 2ZIXA 1C30B 1G9XA 2O6HA 3MIIA 1PJ4A 2Q2QA 2Y6VA 3D6AA 1CQZA 3E84A 3GEBA 3C4QA 4RA9B 3RWBA 1CUWA 3KLMX 4BNXA 1DIRA 4F21A 5G0TA 1QG4A 5TT1A 2VTKA 4ZEMA 2FPGB 3HU2A 721PA 3CF0A 3G68A 4WT7A 3NFRA 5DULA 1M34A 1E5DA 2WWHA 1FFSA 3A9CA 3UXHA 2UYGA 5BW8A 4CUZA 2IP1A 2FZKA 3TGPA 4BCDA 1KGDA 2WJPA 1HG1A 3E3OA 4A9AA 5E7IA 2P9GA 1E1CB 4O3FA 1BCSA 2HU8A 5JQGB 1Z2DA 5CXSA 4CM3A 3E6AA 3DHVA 3TQRA 2GN6A 2IYYA 5KNCD 2MYPA 3ZE0B 1IE3A 1SWWA 1V8OA 4DPKA 1P0FA 1U31A 1ZO8A 2A7QA 1HDIA 1AQNA 4W5JA 3HYTA 4J0KA 4CZ2A 1Z08A 1VJGA 1TT5B 3W5BA 2QMQA 4M3NA 2C8KA 4LVOA 5F23A 1PDVA 2WWIA 2RBEA 4I5EA 3T1YB 2ZR8A 2R7LA 2J9FB 3PXCX 4TZKA 2NTVA 1OKKA 2W6MA 4PTZA 4TSFD 5F77A 5LP6A 3N76A 3NOQA 2C4HA 3PKZA 3V7NA 2I2FA 2JH3A 2W2PA 3P9IA 4C7VA 4WOPA 4DSNA 2H4FA 1NPTO 1VMIA 4ZI3A 3R7NA 1JHVA 1YCGA 4LI3X 1YRWA 3QG1A 5ALHA 5FPQA 2BF7A 1RTKA 4ZI5A 3ZIDA 5JY6A 3UA4A 4CMEC 4IV8A 4EF4A 8GPBA 3IULA 3CLRC 4G5QA 2I99A 4LWZA 3Q3GE 3WGYA 3D3EA 4DR1B 1S2NA 4TT3D 3T3IA 1W5TA 2IZ1A 1H6AA 1MDFA 3BMOB 3LHFA 1NBIA 4AP6A 4DE5A 3ECAA 5TJHA 2A5YB 5I7VA 1A7UA 3DV2A 1YJQA 3SZMA 4IX9A 4RKFA 5FQNA 1DWUA 1F6WA 3LQYA 4HZUB 4BCCA 4ETMA 1JGTA 3P2IA 3KLBA 1T9ZA 2ES4A 4W7HA 2C5GA 1JXAA 2XIQA 2ZAIA 3IE2A 2L82A 1CJSA 1HEYA 3I9LA 1UJ4A 4IKEA 1SXHA 5EC8A 2FP4B 5I9MA 1CQIB 3ZUGA 1X39A 5AP9A 3UHAA 3V2UA 4NCHA 2VJYA 4BO2A 2AOWA 3TR6A 4D3ZA 4B3XA 4EVSA 3ZZMA 5HJ7A 5HZHA 4IDHA 1IQ0A 1GSIA 4NARA 2HHLA 3VU9A 4KBFA 4DJAA 3V55A 3B2QA 1VSBA 3I6ZA 1MH1A 2Q46A 2D8MA 4B09A 4A8PA 3KR2A 1XVVA 2Q4OA 4LA4A 1CE8B 4INZA 1QE0A 3PC3A 4K86A 5AVOA 4MKXA 1VJ5A 2WIJA 4F2DA 5CT4A 3UEOA 1H1DA 5IMBA 1JBQA 1DKPA 4JROA 4XIGS 2XECA 1Q5PA 3EGEA 3V00A 2AJBA 4Q9LA 2AZDA 4I9FA 1ZK1A 5CDUA 4A8JC 3MZ0A 4MWOA 1LBIA 3WDMA 2EFEB 1P5RA 4PSVA 1WPRA 2CUNA 1BQEA 4X71A 2KYRA 5KHLB 1T9GS 2RHWA 2FPWA 3LQFA 2ZIWB 3B2EA 1AK1A 1WVIA 3TXYA 2WUEA 4YUVA 3OX1A 1A9XB 4BNLA 2QN3A 4Q9NA 3V4OA 2DAPA 3IL2A 4ZGGA 4BVGA 4D46A 3LIIA 5GIOE 4XPZA 4YROA 3WMXA 5JNUA 1EVLA 1P4JA 1CEYA 3WLAA 3ZE2B 2ZBUA 2WHEA 2OT3B 3EFEA 1WTAA 2I2XB 3QLUA 4UFNA 3V8VA 3X2EA 3UJHA 4KYUA 4DV4B 1KHTA 4W5OA 2NU9B 5IAOA 3GPBA 1NHWA 4JYPA 5JO9A 3VZBA 3FOZA 2QAJA 1TK3A 2BOVA 1EP1B 3FUCA 5HIKA 3CE6A 4W9NC 2IDZA 1ESZA 1VL8A 2C31A 4RLQA 1CR0A 2H7VA 2OGWA 3NPMA 3O21A 1T4MA 1YFZA 2WUVA 4GXNA 4K9MA 1XU7A 1U8ZA 2HMAA 4LYGA 1ZGBA 3LGXA 5H59A 5JYBA 2PMEA 5AI9A 1IIRA 4D81A 4YRZA 1W44A 4XD2A 1JQDA 2V6FA 5HKKA 2CCGA 1JPUA 1L3BA 2JJ1D 2PU7A 2QL9A 2AMLA 1E5TA 1QR2A 3OMWA 4MVCA 4UCWA 4ZC1A 3UUGA 1Z13A 1VL1A 4V0NA 1PG5A 1KDRA 2QRMA 1GY8A 2WRZA 2Z5LA 2ZSHA 3O8QB 4QQFA 3SFTA 5L3RA 4P54A 1Y33E 3HRKA 1N6NA 5B2EA 3SSAA 2QG4A 2ZSBA 3FPGA 4QRDA 4YMWA 1BVRA 3WXMA 3N0VA 5TNXA 4X1KB 1NVXQ 2HQBA 2WMDA 4KO4S 4BNZA 3C3XA 3PRJA 1KNXA 1T6ZA 2IGTA 1EDEA 4DSAA 5CFLA 4M1MA 4KQEA 2MCFA 3TD6A 5CNKA 2IHJA 3KZCA 3O2QB 4EHKA 3L1HA 3DE0X 4N8DA 1WWKA 3VTKA 3MCUA 2ZRBA 1VLHA 3VVLA 3I62A 1SUAA 2VPWA 2ZI6A 1HQYE 2COUA 3NKVA 4MWBA 4J94A 3RF6A 4DUGD 2JBAA 4NFYA 4JUAA 2RHLA 1XZHA 5ALPA 3FGOA 1LGYA 1KY3A 1ZRNA 1CJMA 1FNSA 3HGQA 3FTPA 2WG2A 3IOBA 4BUCA 1Z7EA 1PR2A 2O05A 3EG9A 1MC5A 2Z8YA 5JVDA 1FSPA 3PSAA 4P98A 1RAEA 2VATA 1I4EB 4P82A 2ZRPA 4W5WA 3NYRA 4QPJC 1CR1A 3HZZA 4I46A 2PXXA 2UYYA 3CVJA 4ZRNA 5EFZA 1NDHA 1G5TA 1AGNA 1GILA 4NFLA 1QNFA 5FPHA 1CQXA 3N2ZB 5K45A 1HTWA 1I2AA 1Q0ZA 1N9GA 1U0OC 1ZD9A 2H1LA 3A3NA 1BW9A 3S68A 4BHTA 1P1IA 1C80A 2NSDA 3DDOA 4M99A 4FI3C 1NVWQ 2ZE5A 4IICA 4R98A 4JCOA 2DFVA 1JLLA 4N39A 4P8RA 4BWYA 3DBIA 1B3BA 3KQPA 1B6SA 4LJAA 3ICPA 3M6IA 4KACA 3S2IA 3L18A 3KSUA 3MQ2A 1NAHA 1OY1A 3Q12A 1RI4A 1ESCA 3G9QA 4E51A 4Q00A 2P2SA 3D8TA 5T5QA 3TRIA 3AXSA 4EQ6B 4X9XA 2RJ3A 4YAGA 2B34A 1IUPA 3N28A 5HE9A 2A0XA 2EAUA 4C4PA 4D9KA 4MGKR 1R64A 2OAQ1 1KK2A 1JJFA 1RYEA 3DTVD 4MWTA 2XYHA 5JYEA 1V8PA 2IHVA 4EY5A 3GVIA 5L45A 2XUIA 4LZLA 1O9GA 1RJ9A 1IYZA 1R16A 2BTQA 2E0IA 4DVGA 3C6KA 5KWVA 4KQJA 3DNPA 4XTRA 2IGBA 5AVQA 2BWJA 1ONPA 3EVFA 3USCS 3HGMA 4DDKA 1FX0A 4OK3A 4Q4JB 5DI9A 4DEXA 2P6UA 1NMEA 2ZT6A 3CF4G 4IR7A 1JAXA 4LXTA 2XMRA 1NVVR 3V7FA 1EDOA 4GMFA 4Q9HA 1M2GA 4CQMB 1MX5A 3TXXA 4AF6A 4OAPA 4PBTA 1B8VA 3A1DA 5G41A 3TW6A 4AJJA 4DT1A 3EXHA 4WNIA 1GDHA 4JP3A 4LJKA 5FBQB 2MSWA 1QZTA 1V8DA 5JRDS 1OX4A 5JW6A 3VAAA 2PIDA 2RC5A 5DNVA 5U1PA 1ZS9A 2PWAA 3A3KA 4GRDA 3TW0A 1YL7A 1EP3B 1G41A 4F8YA 5LXTB 2QZJA 1DBQA 5HK8A 2RGAA 3S8MA 1IWPB 1I30A 1T91A 4URZR 4NU5A 3V7YA 1QO7A 4ER3A 2AR0A 1GPDG 3FSJX 4CV1A 4Q9AA 1VKHA 2PSDA 3IUQA 1L4EA 4KXVA 4P7FA 3WGQA 4KQ1A 1G3MA 3RCBA 3NHYA 2W71A 2FN9A 3G7UA 1PNRA 2ZJBA 2JHCA 3PWSA 1DXYA 4HV4A 4S2EA 5CX1A 2PX6A 4X1YB 3ZVNA 2CYCA 3BSYA 3L1UA 3R41A 4YLEA 2R65A 3EVTA 5JSYA 1KHHA 2PFGA 2JFWA 3RFXA 5FHQA 4CLRB 4JI8B 2GM3A 1AZWA 4H59A 3C6BA 3NT5A 4XD7D 3AM3A 4A10A 3EGDA 4D8VA 2SKCA 4H2DA 4BYMA 4MUFA 4DZRA 2GD1O 4ABYA 4ID9A 2VA8A 1R4NB 3FFXA 2ZUCA 4TLBA 3UJDA 3THOA 4BQQA 4HNTA 2IYXA 3HLTA 3ZJ4A 4QJBA 3GGPA 4N47A 3H5TA 4JJ8A 1FMCA 4ESEA 3I39X 4Q1VA 1VGRA 4Z53A 2QG9A 1P29A 1JG2A 5H68A 1NC3A 1WV0A 2XHZA 3L0YA 4DLWA 1S01A 1GGMA 3UUEA 5FRDA 1SCNE 3ZKWA 1E9EA 2WT9A 1WV1A 4TLLB 5DIZA 3CT6A 5KHAA 2O54A 1BFKA 4TVBA 4NZPA 2MSCB 1G7CA 5DF1A 2XWJI 3TW8B 1J06A 3T6KA 1MX3A 1UM9B 1KQNA 1D6SA 4ETWA 3U4QB 2B92A 3PXGA 2HPZA 3R7AA 3B52X 2A33A 5A3QA 1Y7TA 2PU5A 1GZ4A 4G8DA 1L4YA 1T2UA 3CKYA 4HH4A 3STTA 4ZTBA 3OUUA 3K2IA 3KJHA 4K9PA 1FXUA 2GM5A 4F1WA 4GGMX 4UMVA 4MAMA 4ZYXA 5BSGA 3C6YA 3DWEX 2GZMA 5SY6A 4LHEA 1QVWA 1SCDA 1L4NA 1V37A 3QPWA 4KQKA 4DEYA 5ELXA 3JQQA 3JYQA 1HDXA 3RU7A 1YHNA 4ODIA 4WNAA 3X0DA 2EIHA 2WB2A 4G5SA 1NJ6A 2FR8C 5JS8A 4G1BA 2B61A 4QD3A 2JKZA 5KB3A 2A30A 3LCRA 4C7MA 3IDFA 1ORTA 4PRLA 4Q93A 3K20A 3DW3X 1T1EA 4G5YA 4WZBE 4RDCA 5HKAA 5LB4A 5HX7A 3I37X 1F5SA 4MR9B 2V97A 4EX6A 1W5SA 1P7PA 4HGNA 5FT9A 4O4JB 2E48A 1NBMD 3GCGA 3B1ZA 1MIOB 1U2PA 821PA 3WGMA 2PGAA 1UIMA 4TWZA 4IKPA 4B4WA 1U4SA 1N5LA 5A4FS 1SD5A 1W6RA 1E2JA 1C4XA 3HJHA 4U2CA 4XXHA 5F21A 4BGVA 4DLRA 1PV1A 3ZHRA 3TTUA 3QZUA 1DJLA 4Q19A 1SU4A 1UBCA 1HC7A 3C2QA 1N2BA 5IC6A 2HRZA 3VGJA 4JYCA 4AYXA 4HUTA 5KSOA 2XQGA 2OFOA 3JQGA 2DWCA 1KS2A 4C4OA 5HWSA 1OZHA 5J40A 1XJ0A 4HEA6 3UAXA 3DGEC 2JCYA 2C20A 3JYNA 4BU1A 5IJXA 1WO8A 4HN2A 4LGCA 5A9SA 5BOSA 2Q45A 1E9FA 2VP2A 1H8HA 2OKGA 4LZOA 4EECA 4JJ6A 5FL7A 4RAOA 3TNYA 2NTYC 1MN6A 2O8NA 3P9KA 1GQYA 1XV5A 4KQIA 4N5NA 4W1QA 1O94D 1YS7A 4OHCA 4HHEA 3PGJA 4B45A 3HJFA 3DL0A 3B89A 1ZN7A 2B4KA 4HWPA 1HFKA 4RA6B 3PQ3A 1JL3A 1KP3A 2VF5X 3MXTA 2PKXA 3BWVA 4OA8A 5C34B 1QR6A 4G86A 4E5KA 1XROA 3VOSA 3CBGA 3OZGA 3R7SA 3FGZA 3HZRA 2VUTA 1ZD3A 1TAUA 3L7YA 4WBSA 2O0JA 1J33A 3T1VA 4EO9A 1T4GA 1U11A 4A2QA 4MAAA 4TVOA 2JGLA 5GTDA 2RBGA 1Q0QA 3N7TA 4GI2A 2JIPA 3QVTA 5AESA 1RVV1 3HFRA 2H06A 4FLFA 3OFVA 2WYHA 4W5HA 4BLRA 5B4TA 4QU8A 2CL6X 3PUVA 2BFCA 1M8FA 2HA2A 1K98A 2RH4A 2W6OA 3FMFA 2NG1A 4UFOA 5ALSA 2GZ2A 3WWEA 4CIWA 1X38A 4OUDB 2QYTA 5IVDA 1XD9A 3I2FA 3NIFB 3MHPA 2IL1A 4IJ6A 1IEVA 1K2VN 4LHVA 4ZVNA 4ZCLA 3S5JA 3LHDA 4C4XA 3ZEAA 3M34A 4DDUA 1R0LA 2LIVA 4Q37A 1D2HA 5A5VA 4Q3OA 4GI7A 4J0GA 4LXYA 4ENVA 4ZTUB 1K4KA 4IGAA 4LBWA 4IUYA 3RT9A 2O0HA 4KZPA 1MR3F 2ACEA 4QA9A 3P9YA 3H19A 1EVZA 4UZSA 4Z3DA 3BGSA 2FWMX 1L5ZA 1P5FA 4ARSA 3IVRA 3PGLA 5JRJA 3PEYA 1AGYA 2Q50A 1CVLA 1NYTA 2QSYA 1BE0A 4P08A 2AEJA 5FJJA 4B3HA 5HUQA 1UFOA 1WCWA 2WK1A 1NG9A 3IBFA 3KYIB 4F04A 1XF9A 4ZGWA 2FPRA 3SVLA 1XRRA 1A2QA 2C03A 1X94A 3ECCA 4NZOA 4OL0A 4BO3A 2H2WA 3FCXA 3PZBA 4JXKA 4H7KA 2GWRA 1KPHA 4B4OA 5LQMA 3T3HA 5FYDA 4MA4A 1C30A 1EX7A 5B1IA 5I8PA 2GETA 3GI1A 2D62A 4RA9A 4TQ9A 1LBQA 1KSHA 2F62A 3L06A 1I3KA 1N77A 1EAYA 2FPGA 4IMIB 1Q21A 3LP5A 5HMLA 4B2LA 4C3OB 2XV1A 1TCUA 3VHRA 5B12A 1J5PA 3L0PA 5BQ5A 5FV4A 5KWEA 1CYEA 1U8UA 1QIDA 2ZRGA 2J8ZA 3E03A 4OG2A 4BNNA 4DQUA 1H6CA 3MTBA 2FHPA 5JQWA 1E1CA 1W581 2ZSJA 5TF4A 4TYNA 4NSNA 5JQGA 1P9NA 2EG9A 4DJJA 1SCKA 3OP4A 3PGVA 2W9XA 4FQ7A 1XDBA 3U3RA 2Z1NA 1DHRA 1L7OA 3R6DA 4R2KA 1SPBS 4L9SA 4ZRMA 4PQYA 3ELDA 2HMWA 3KYCB 4QOGA 1I9CA 4L2IB 4FEGA 1TT5A 3QVSA 2HQ1A 5JMPA 2E6UX 2QTNA 3R5FA 4M53A 1ZITA 2JHFA 4PGFA 2VHTA 4ZT7A 2J9FA 2Z0MA 5ELMA 1EHIA 2OC4A 3M6FA 1Z7BA 4FR2A 3VHXB 2E4UA 3IAXA 5CDFE 5JEEA 2WJGA 3FIUA 3MAAC 1KJIA 4U2FA 2G4CA 4OHYA 4IDEA 4N3BA 2E21A 1V7QA 2JS7A 4Q3CA 3RC3A 3SZ3A 1ZCJA 3IT1A 3UY4A 5M5BA 4EGSA 4EVQA 4RHUA 3KEQA 3RROA 1HDRA 4OSPA 4CL3A 1EXWA 2AI1A 1OI7A 4FJ1A 2P0EA 2W6IA 5B58T 3ZQ4A 1J25A 3AF5A 4JYMA 1ENZA 5T6MA 2PR7A 1Y9EA 2ZB3A 3I34X 4MEBA 4XRGA 1BH2A 4IF6A 1VBKA 2QXYA 4LYFA 2DHEA 3BMOA 3P7MA 4Q4HA 4PGAA 3WP1B 2JLVA 7ADHA 1G8PA 3P0EA 1VA5A 3T9AA 5KC9A 1RI3A 3G1WA 2HREA 4HDMB 4BFVA 5DRTA 2A9KA 2DR3A 3ORQA 3TDKA 1IPFA 2PY6A 3K0BA 3QVGA 4RHFA 1RLUA 2VN8A 4DUZB 1Q1ZA 5E7QA 5I4IA 4HZUA 4KJXA 4QM7A 1IUKA 3T5AA 2JHGA 3D54D 3NC1C 2RAPA 5BV1A 5K0TA 1I4OA 5CDHA 2A1IA 3EARA 5HBGA 1X9IA 5COBA 1V3QE 3ESZA 4ZVQA 5MFPA 1KSFX 1F2DA 3EZ2A 1YRQA 2EL9A 3O90A 3R6LA 4CT4B 4OGGA 1DEHA 2FP4A 1CQIA 1FLDA 3ZJ5A 2H11A 4JJZA 3K35A 1YQWA 4KGXA 4MV4A 5KTRA 2UUCB 4MDEA 1LEHA 3V7UA 1YVRA 3E7FA 1ADJA 3EGWA 4P4GA 4DAOA 1NURA 2X86A 2VSXA 3TLZA 1X3SA 2QZ4A 1AO0A 4J0CA 1GDDA 4JEIA 2I6SA 4LRUA 1W0JA 3NKFA 3OX2A 4RJJA 4UM5A 1KF0A 1C2YA 2PS0A 3TE6A 3IBYA 1DOAA 3VR3D 1CCWA 2B8JA 3LKDA 3M8KA 4C88A 2B8TA 1Z83A 4M1YA 1RWXA 2IXDA 2XITA 1CE8A 2QD2A 2ZYUX 4S1TA 1JDJA 1DRKA 1U5CA 4YB8A 1FXSA 1S5PA 1SBCA 1ZD1A 2NWQA 4KNWA 3FTFA 1HBJA 4MCAA 5BSHA 1YRHA 1JT2A 2OR3A 3AXTA 3K73O 2JFQA 1JUDA 2GM9A 2KMLA 1HORA 2A58A 4IMPA 3BPSA 2WJ4A 3WB2A 3DZFA 3WKAA 3AESB 1XEXB 3K15A 3KETA 1OD6A 1ZIOA 4DCMA 4F3RA 2HNKA 1G0NA 2DY0A 4MB0A 5E2IA 3V4VB 2HCFA 3QXGA 2JCGA 3VU8A 4LJRA 3GFQA 2P77A 3QUQA 5AOVA 3ZHXA 5JV5A 5IT9A 4GE3A 3V34A 5CLJA 3EIOA 1IK4A 1JSXA 2CHQA 3KT8A 4YRNA 1W46A 5ADUS 2R8ZA 5JROA 2ESRA 4NFHA 2D06A 3AHHA 5DSZA 2QXUA 1U0GA 3U4HA 2G1UA 3IUEA 4KI7A 3VXKA 3F8WA 1Y37A 1PX0A 4BUJA 2BM0A 5HM8A 4GPAA 5IUNC 1YB6A 5JCJD 1V48A 4TRNA 1JHPA 1D07A 5MGBA 1TKCA 3BJEA 3Q2IA 3AEUB 2VTEA 2VT2A 2IF2A 1MJNA 1GQOA 2NU9A 3BHMA 1T0IA 4Y0VA 4XVHA 1ADBA 2Y2VA 4WTOA 3KEOA 1ZR4A 3CUYA 4G5XA 1XN1A 1UMCB 2BI7A 5AMXA 4YRAA 5B3LA 4DLKA 1G4UR 1U8AA 3OKPA 5DVZA 5FH9A 4DPMA 2A9OA 2QM0A 1IN1A 3WBKA 2YWGA 2Z2ZA 4DIUA 1YKGA 3H2KA 1S02A 4FYJA 4GL4A 4IIYA 4DQKA 5HGXA 2L42A 2XD4A 3JY6A 1F60A 2FETA 5C35A 1E79D 3ABQB 3O8QA 4MV5A 4O4IF 2G1KA 2ZBQA 2VUSA 3BULA 1L4BA 1YQEA 2J0UB 2REBA 2YWXA 3B3QA 3GJSA 2EFYA 5AK3A 1XZIA 1WAMA 4QUEA 4ZK2A 2XYQA 2GX6A 2LCQA 4D7AA 5FUXA 1A5SB 3AVQA 4ZPJA 2C9OA 1BA2A 4IJUA 5SZKB 3UNXA 2C78A 4GSYA 2WJ3A 2WZCA 3PTZA 1TAQA 5BSFA 1QHHB 2UUBB 2B94A 3ONDA 4BBAA 3UQZA 3ZZNA 5BSUA 5D86A 4YGYA 4Z4QA 3K9HA 3P8ZA 3NBZC 3I2JA 4C7KA 2UYHA 3QFSA 3FFBA 4UAJA 3PDIB 1KPIA 1CJCA 3HB0A 4MVJE 4RY0A 5DBFA 5HFNA 4UBMA 1TE2A 2OZVA 1Z07A 2WWXA 5AHKA 1THZA 3ASYA 3RFVA 5FR2A 3FVVA 1UANA 2JLZA 4ZVLA 2AFHE 1KYQA 3BFKA 2AFRA 3TL6A 2Q9AA 1IHDA 4MW5A 2OZPA 4G6ZA 1Z8HA 3LYHA 3E4CA 3QPDA 3LP6A 3LF1A 4GOMD 4N6OA 5CLQA 1UJ5A 1X87A 3ZS9A 4POAA 2V1XA 3ILVA 2CV1A 4QAQA 1WXFA 5HRCA 1JSLA 2IHTA 1COZA 1XZNA 5HIAA 4FWBA 3THSA 4HWGA 1I7LA 3EZLA 5BR1A 2Z6QA 1UBLS 4BE7B 1Y1KE 5C5EA 1WXGA 5KNDD 3I4CA 3QUBA 2BISA 3QP9A 2J9GA 1U2EA 1UBMS 2ZYAA 1JHOA 3L6EA 4YJ3F 3DE5X 4BBJA 4ZDJA 2NP6A 2FRDA 2DJ5A 3KAPA 4JZYA 1LDEA 2HHJA 2P5UA 4C7OB 4EQ6A 5EJFA 4BN4A 3U4GA 4HEQA 1T15A 3IR7A 3TIVA 4G41A 5JY1A 5JZBA 6REQB 4KLAA 1JR4A 3NKLA 4BC1A 3HV0A 4ZQFA 4BFXA 4RVUA 4AZVA 2LBPA 3S7ZA 5LKRA 4PVDA 1KI4A 4U2DA 4DV5B 4CI9A 1K97A 4RDXA 2NAPA 1WQ3A 4I4IA 3AI1A 2QY9A 5KWJA 1KJ9A 1I3OA 4Q4JA 2VJKA 1P1BA 5FORA 3EVEA 5DYNA 1V7PC 4RF2A 1FDSA 3ETDA 5DJ5A 3GGGA 4WMLA 1UAYA 2E87A 2WD9A 3BA6A 4IO1A 4LK2A 2GEFA 3JWJA 4JQSA 2C7GA 1U4OA 2XXJA 3D8HA 5TVGA 4WASA 3H2SA 2FOXA 3RVRA 2FMIA 4AXBA 4CQMA 2W2LA 4QXAA 5F3WB 4NZ9A 3HB5X 5EG5A 1BVHA 4JI4B 2FMKA 3QMVA 4NVRA 5FNVA 1MJGM 1Q7BA 1XJCA 2PJZA 1KO1A 4PZCA 3B3FA 3ZZ0A 1MT0A 1EK1A 1M6WA 3C3JA 1VL0A 1NYQA 2N75A 2QYSA 3B6IA 3OFNA 3OQVA 1T4CA 4YP0A 3UMVA 5LXTA 5J1TB 4II3A 3MQFA 1JQKA 1Z06A 1KOFA 2ORED 1TYCA 3G0CA 2QD1A 2CFOA 2LXNA 1UBKS 2C3PA 2WAAA 3EY9A 3FNFA 1NDUA 1CY4A 3OCVA 2EBHX 3TYXA 1DJQA 1XZJA 2P3SA 2AA3A 4DJTA 3UJ6A 3VTAA 3AVOA 1FE8A 4BZZA 4NYIQ 1M0EA 1JXQA 3DJYA 3IEMA 3EMBA 4CLRA 3ZI4A 1GU0A 1QHIA 1VHQA 4K46A 4UUQA 4HB4A 3VDXA 3IKTA 2V4MA 3Q8LA 4RESA 2ZLBA 1NQUA 3IUSA 4K26A 2Q49A 2GTHA 3QE2A 1I6LA 1H9BA 1POXA 5REQB 3S4YA 5JS1A 2YC4C 2QWXA 1R6DA 1R4NA 5CEJA 3KQLA 1QZUA 4MS3B 3M6AA 1WY5A 3HCBA 1E5QA 3A9UA 1KYZA 2YJNA 1CUGA 1R9MA 3FMOB 3OM8A 3EAGA 3P94A 1UFKA 3K9WA 1U2QA 1UP7A 4FYIA 3X1ZA 3NTLA 2C3UA 4V03A 3W0LB 3G0GA 1VTKA 3NYIA 4C05A 4O3MA 2AN3A 3KUDA 2WJAA 2G7MC 3E8SA 3EVBA 1ZH6A 3KDSE 4YJHB 1Y6JA 4AZ3B 4R9RA 1LNSA 3O95A 4AT1A 3NATA 1SHZA 1P0PA 2PX0A 1N8SA 2M6SA 3P20A 2POCA 3EEYA 3PEVA 5IM5A 3FZEA 3KQMA 3TMYA 3G2JA 4C2AA 2P35A 1ZH0A 2FWNA 3TW8A 1MB2A 3OQMA 1U65A 1UM9A 4UXIA 3U4QA 4ZVRA 3UZUA 4OXKA 5TVKA 3N2KB 4MUJA 2IU6A 3PQCA 4WY5A 1YZQA 1W36B 3EOZA 1JS1X 2N9UA 1YAHA 1YI0A 1GG9A 2OOSA 2YWEA 3H8VA 4IQ0A 5DYYA 3ZBQA 2F4VB 4C07A 3W2GA 3X3HA 2PWZA 4WV3A 1SC1A 4JU9A 4V0KA 3ZS8A 1GTVA 1K88A 2RK4A 4ZC8A 5JJCA 3PVCA 3FBTA 4QSMA 4PG8A 2GJ9A 3P2OA 1QO0D 3AR4A 3MILA 5CCBA 2ZOSA 2Y4OA 3QVKA 4O2BB 2OLKA 4N18A 5EIFA 3DR3A 4FC7A 2JAOA 2CSXA 3J7AC 4V0LA 2Z6UA 2X2PA 3DD1A 1OWPA 2VAXA 1VIVA 3B2NA 4J7AA 3VSDA 4BQPA 1RS0A 5HP4A 1EA5A 2AEMA 2OG1A 2XB4A 4MR9A 5EIAA 4E6EA 2FNAA 5J4KA 5B36A 5BV7A 2O7RA 1W88B 2X0KA 3PCXA 3OZDA 3NT2A 2VR1A 4MPPA 4O4JA 1L7RA 5HSGA 2KQUA 1ZEMA 1MIOA 2XWBF 4QXMA 1XZ8A 1I3LA 3DWFA 4F3YA 4EHBA 1P77A 2SKEA 1C9MA 4E15A 3PXBA 4FGWA 3KP1A 4QBGB 4V0ME 1ODFA 1QX3A 1YV9A 5J3JA 1GGKA 2R6HA 2R48A 2BF4A 2WDPA 1S2LA 1Z28A 3VSAA 3IP6A 1UPFA 1L4HA 2FEOA 4FDVA 1UBEA 4DV7B 2IELA 1W96A 2I6FA 4OHVA 3LHIA 1UXGA 4LVUA 2DRIA 3V3KA 3I01M 1BJTA 2JH9A 2P0YA 1O03A 1U9CA 2IS1A 3E61A 1MT3A 2ZSEA 1UMBB 2XJ4A 3T7AA 3LW8A 1XKLA 4JWKA 5DO9A 1S89A 2C2KA 3EUWA 1RYNA 3G88A 3WV4A 1QVVA 3L93A 3K3PA 3Q3JB 3JSAA 1AMNA 2IITA 1ISMA 1N8NA 3H6KA 5TMBA 1J24A 2CXSA 4F8EA 3QVLA 5LD2C 4RA6A 1ND5A 4ID3A 4HFJA 1MC4A 1MVLA 2DQKA 3CH7A 5F64A 4M1QA 3TQOA 3ROFA 1P74A 1KARA 4RD1A 3JQPA 3OOWA 4R9NA 2PVPA 4G0PA 5EKUA 3MCTA 2JGKA 4EEXA 3FZQA 3UJPA 4GQIA 3EN0A 3LQ4A 1SBYA 1D0SA 1YZNA 5TPZA 1XHLA 5AYVA 2ZI4A 4B5LA 3IX7A 1JHRA 2ODTX 2VUHB 1NLUA 2PHZA 5B7PA 1NW5A 2X23A 4HBGA 4DA8A 1N6PA 4D3SA 5KYUB 3CH5A 4MGZR 4TUYB 2CLHB 1PW7A 2IUEA 4YA6A 2BGRA 1GYRA 1TJ4A 4OUDA 2XA2A 3RE1A 3RVQA 4DFDA 5DHQA 4TWJA 1Z73A 2Z5GA 2DHDA 3L8GA 2IIPA 2VLIA 4NV0A 1T2EA 5BSTA 1Y8ZA 2OGSA 2REOA 5DTRA 1DKLA 2AX3A 1LH0A 2ETVA 2LZ0A 3F74A 3NUQA 2ZUVA 4ZCQA 2QQFA 4KQ6A 3T35A 3EGCA 5EJEA 5TLSA 4QM6A 1BS2A 4MRPA 4QDZA 1S2IA 1ZNXA 4FHEA 1KRWA 1C3JA 3WNZA 3VO8A 3U7GA 1Q84A 1DI0A 1MJFA 1TYZA 2JFZA 2QRUA 3BYZA 2J4DA 2PL9A 4O5AA 2FPOA 4QULA 4B3JA 4LAFA 2O20A 5C1BA 3S44A 1GFSA 1ZLYA 5MN5A 4M7WA 4DA9A 1Y4SA 1ZXBA 1MU0A 4M1EA 3L01A 1G7SA 4C78A 4BMPB 5K3SA 3IC5A 3FA2A 2XVMA 5ES3A 3ZDAA 1MA0A 3A4MA 2YS7A 1DT3A 1KSJA 4JLOA 4QPNA 4WZ6A 4BTLA 2OMKA 1I0LA 5E3HA 1UDWA 2W6JD 2YZ7A 3Q8XB 2W6ZA 3IUMA 1JT9A 4GBJA 4KNVA 4LDRA 2ONJA 3E8XA 3V32A 5ICMA 1VSUA 3M81A 4KE6A 1TZCA 2O14A 1F9AA 3V1NA 1T4BA 5FJIA 4WADA 2AYXA 3FI0A 2O2EA 2C94A 3NM4A 3ZGXA 1N0VC 3JQ9A 5SZIA 1K1EA 1MQ8B 1Z9BA 5CTAA 2OGUA 3D64A 3RYHB 4BRWA 4D41A 4EUNA 1FXWA 3LNCA 4M9ZA 3RREA 5AUNB 3ID6C 3VFDA 3VNRA 4RTLA 3IDSA 1L0BA 3IMCA 4UBKA 2QT9A 3FHJA 5JS7A 4MO2A 3BL6A 2KWIA 3EEFA 1M8KA 3KYCA 4A15A 4L2IA 1M1XB 3IFSA 5A7FA 4J1TA 5BV2P 4G5FA 4MV8A 5AUOB 2PTGA 5J2UB 4B82A 1P9OA 2PT5A 2KPOA 3I6YA 1G20B 4I5FA 5EHZA 5KQLA 4O0LA 1GG8A 4GBMA 2PRSA 3H5IA 4K40A 4EK9A 3U19A 1SPXA 3F4BA 1KZ4A 2OTCA 5BXQC 3VHXA 1NKSA 1TZJA 3LX6A 4TQUS 3T7EA 1DQYA 4KPFC 2QD4A 3CKKA 4BASA 1YS4A 2JLRA 4QPZA 1YVEI 1FQKA 3RF7A 4B8YA 4D3FA 4B35A 1TJ3A 2DPGA 1E1RA 1N2XA 2NXNA 2POQX 2JBWA 1JTVA 4WKNA 2PNJA 1H2BA 1OGYA 2EKLA 1O4VA 4DZZA 3PQ6A 4NU8X 2COEA 2ZZMA 3F5FA 4H31A 5CBPA 1ZCFA 4X1KA 1N0WA 5CH5A 2CBZA 4D8XA 1B7GO 4B73A 4A0HA 3Q9LA 4CM8B 1OLSA 3LZDA 2FWAA 4HDMA 5F33A 3VVMA 2VPIA 2DM6A 4P33A 2WZBA 4CIYA 4HK4A 1PYOA 4JENA 3U26A 2CNWD 3MIZA 4DR5B 2IH4A 1HM5A 5JNSA 1VIAA 1E58A 2ZRJA 4V02A 5AW5A 3PS9A 2WTXA 2A5LA 1KEEB 1WUIS 2LNDA 2OXEA 5TV2A 4AP5A 1EZ1A 2FKNA 1KI2A 3FNRA 2I2AA 3RKRA 2AFHB 2QT0A 3ZDYB 4EL5A 1RIIA 5L3VA 3AVWA 1S0UA 4EYQA 1OBOA 3MTQA 4ND8B 4RLSA 4ZT2A 4JOBA 5LZ8A 1EFDN 1BYIA 1V8FA 1XDDA 5DM1A 4DSTA 1T3HA 3NXKA 1T8PA 5EIBC 1REQB 5IBRA 2QUHA 3C1UA 5JCXA 2IQ5A 4K81B 5AM4A 4NRDA 5L7TA 2ON6A 2AOXA 3I45A 4AL4A 5DHUA 1BU5A 1K6IA 4BLQA 2JCSA 3HBLA 2OD9A 4LEIA 1GL7A 5AWFC 1Q3KA 4AMVA 1W76A 2QG6A 4V0QA 4X6UA 1EI9A 1EWVA 1YA8A 2V03A 3F2IA 3WL7A 1LWOA 1SELA 2QU7A 5AUPB 2FE1A 3NT4A 2L18A 1UT6A 4EHNA 3O1HB 4S3MA 3OZIA 1TDJA 3SZRA 2NSYA 1GNLA 3CNOA 5JTUA 4LJSA 5CVDA 4ED9A 5LQKA 3NWEA 1VA4A 4RKWA 5I8WA 1GGFA 2YUIA 2P2ZA 2AHRA 1K3FA 1OF1A 2ZS9A 3HWSA 4GZ6A 2H7CA 4Y9UA 3REGA 3AESA 3U9TA 1XEXA 4MA0A 3D4NA 1KYWA 1T3GA 2GAOA 3JZMA 3NIGB 4HMQA 3AOEC 1O8CA 1SBQA 3KOMA 2OK7A 2YYAA 4DMCA 4X3CA 1NF2A 1HDGO 2H1SA 5C8DA 3ZWCA 2I6XA 2V7QD 2DX7A 1QHYA 4RFSB 5CIQA 4WKCA 2WUGA 1Y4UA 3EIQA 3NEPX 2ZI7A 4DYVA 2Z3WA 3QVMA 5DGDA 4FBLA 4XWGA 3ADOA 2BFNA 4LBZA 3OZEA 5BQXA 4YCCA 2PMDA 3G2KA 1OGIA 3A2NA 4MR7B 5E8JA 3NO4A 1KIAA 2R6R1 2FDRA 3EZFA 1P81A 3WJ7A 4ABTA 3AEUA 5HA5A 3VZQA 5D00A 1WW3A 3BFVA 5HIIA 5KHOC 1ZOOA 3GP3A 1NBAA 2Z1MA 2QA5A 4RTJA 2P62A 1F7VA 2FAXA 3C8DA 3RGGA 3GN1A 4GLLA 3QPAA 2PEZA 4DIFA 1KZYC 1UMCA 1W85A 2FKAA 2NSLA 4YP9A 3PR2B 3DUFB 3PUZA 4NFSA 2QX8A 4EFKA 3GMIA 5JSQA 4A8JB 4KQHA 1DDOA 3OMLA 1LFAA 4UMDA 4KWEA 1S2MA 1E96A 5AFSA 1UK8A 2NGRA 1Z6GA 1N5DA 1PR6A 1H2EA 2F9LA 1E7RA 2PZGA 3LZCA 1T10A 2YV3A 5ARDA 3TJMA 3STXA 2ZRKA 1PL7A 2YJZA 4MUYA 2H1WA 3IPAA 2DQ4A 3JWEA 3A4LA 5GV7A 1VLMA 4TSFA 5ICSA 2VPTA 3N05A 1JTEA 2J0UA 1NC1A 4ALKA 1RBQA 4LXGA 4P35A 4DR3B 4HATA 4JI7B 3AHIA 5FWYB 3P96A 2G88A 1XRQA 2Q2VA 5TDHA 3CLVA 4I4TF 3WSVA 1YR1A 2NVOA 4IIJB 4YP6A 2DPHA 3ZYCA 4A36A 3PNQA 4P4NA 2WJHA 5IFKA 1QHHA 1KTIA 4XLLA 3MS2A 1LLQA 3L0OA 1K7XB 1BWRA 1LBEA 1PS0A 1SXJD 1EG2A 2OO3A 2PG3A 2JGRA 3CX4A 2GBLC 3G89A 3M4ZA 4HNQA 4LSWA 4PAGA 4BMVA 1NA5A 3UHFA 3OJOA 4LYAA 3STYA 4ZHQF 3PDIA 3ZWPA 1GZDA 1GPAA 1MB0A 4XEUA 1VGVA 5D1HA 1G5HA 1XI2A 2R8PA 3ZTTA 4DCOA 2X4IA 3UMYA 4H0NA 4L5YA 1M7BA 1TLTA 4F84A 2NYAA 2Q0SA 3TSAA 2OLJA 2G6BA 1FTWA 2X0JA 3K9NA 2IZ7A 1H3EA 2BW0A 3IE1A 3UYKA 4Z4GA 1EH5A 1FJHA 3KKOA 1V95A 2HBQA 4HNVA 1DUSA 2VSNA 1YZ3A 3N53A 3UOWA 3EIXA 1XA0A 4S0XA 1CG6A 1ZGCA 4O02B 4V3CA 3SKXA 3AW8A 1XCMA 1M1YA 2P2DA 3GG2A 4D97A 4NX2A 5JZMA 2QAIA 4A73A 4MSUA 4PINA 4MGIR 1S2GA 1RLOA 3KKQA 3I5AA 4X3OA 1N78A 5EIOA 1ZK4A 4OHKA 5G02A 1I36A 2OQVA 3V6MA 1Y5NA 3NHUA 3Q5EA 5GZ3A 3ORRA 1ILEA 3TTVA 1QKJA 4BNHA 4F45A 1T5OA 4BNIA 2NZYA 4AQYB 1OI4A 1SUCA 4CR6A 2EZ9A 4C7OA 3NI2A 1L8AA 3DOCA 4FNGA 4GZ5A 2EG5A 4O59O 4RK4A 3W4KA 4MUIA 3QUCA 5T4BA 1P39A 4KHZA 2QRVB 3W9UA 5AKXA 4ADSG 3QE4A 4CIDA 3WGNA 1QB8A 1XTUA 2YWHA 2WWYA 1ZA2A 2X8BA 5EIHA 3RADC 1XQWA 1YR2A 3OIUA 4YDSA 2CXXA 5INTA 1V9CA 3I53A 1E5VA 3DTTA 3R3ZA 4LY3A 2FWIA 3ZGOA 4RYLA 1R6TA 3Q3VA 2HA6A 3T1TA 1L5NA 1GTG1 1OT5A 1K89A 4X60A 1G7TA 2GKOA 2QZZA 4RENA 4OKSA 2P2CA 1L5GB 4Z6KA 5KDDA 1PHRA 1ZOSA 5AJYA 1EX9A 1OWOA 2P4HX 2ZSFA 1RP7A 4R7GA 4AJPA 3L1IA 4AMBA 3MNFA 1WVMA 4CM6A 4XB6B 4NNOA 1Y9JA 3M33A 4Q9JA 1H69A 3H4MA 2YHUA 3LGSA 2XWPA 4ML3A 3WOHA 2DUJA 5IPFA 1N5MA 1M2WA 3A1CA 5AQEA 1ZJJA 5EE0A 2WQ6A 1KBOA 2OCLA 1L7QA 1EVIA 1V9LA 2ZVDA 4JBIA 3VR1A 4MWCA 4DIMA 2YHIB 4JIMA 1E8MA 2MSKA 3VPSA 1G2OA 1G1MA 3AHGA 1HO3A 1SUBA 1AY0A 1PO7A 2BLNA 3M7IA 2JASA 3QE0A 2NV6A 5BRAA 1V5IA 4GEKA 1UWVA 1M6HA 4I4CA 4E88A 1XQ9A 2JJ1A 1O7JA 3WRYC 1TVCA 3NM5A 2WY2D 4BVBA 1U94A 4N8SA 1XXHB 3KB1A 3NHFA 5DGTA 2D7JA 1I14A 2FJPA 2DUUA 3RS4A 2C9BA 4YH1A 3NCHA 2P2LA 3W5VA 5K2MA 3FIJA 3NTVA 1NRXA 5REQA 3MT0A 4XM1A 1KO4A 6AT1A 1E9AA 3QNMA 4HX2A 5T64A 4MS3A 5KVSA 1TYEB 1V7ZA 3WGUA 2M32A 4B6RA 3RR2A 3WDKA 1KC1A 3TR0A 1SKYB 2CVOA 2NO1A 5AM0A 3U62A 1TO6A 1X1BA 3ESQA 2DTXA 4IHJF 4GICA 2K7ZA 1N57A 3M3PA 5LZ9A 4QVIA 1SC6A 4YJHA 3SS8A 3E23A 4DUGA 2H51A 3I6BA 4NCKA 3DXZA 3M4JA 1IHUA 2MJLA 1NZDA 4YMIA 2CFIA 3DOEA 4DWVA 5DN6D 1R88A 3UAYA 2OORA 3IXLA 2JLYA 3CZQA 2Y9PB 4BGDA 2YWDA 4QREA 2CDCA 3BB3A 1CV2A 4Y6GB 4DSZA 3ILHA 2FMUA 2ZWPA 1TEZA 2GPBA 3FWKA 1SAYA 3N2KA 2J4FA 5AI5A 5EGSA 2HJVA 4H0FA 5JD6A 3P9RA 3T9EA 4R0VA 2ERYA 1MAHA 5FTMA 3C3BA 4TWBA 5KC8A 3CO5A 3LMKA 4EUSA 2JIZD 2TMDA 2MSDB 5JG7A 2AK2A 2FHSA 1Y9DA 3QUAA 3VPFA 1VE1A 1GCIA 1Q7RA 1MHPA 7REQB 2HJGA 4O2BA 5IABA 1O2DA 2AG6A 3FXAA 4J29A 3FCCA 3UJ7A 1U3VA 2UYQA 3F7OA 4KGZA 4OY3A 4B6SA 3I5XA 4DIBA 4CIBA 3W77A 3OJXA 1G16A 1NVUQ 1ZUIA 1KMNA 1ONNA 1RBMA 3EXG2 3JALB 4ZP1A 3R7BA 1P3JA 2R97A 3B13B 1FFYA 3I2GA 1S7GA 1W88A 4YYEA 1JB1A 2IPNA 2G71A 2ZRDA 5J5VA 1MGPA 3EBPA 4Z99A 2HXYA 3N8KA 4MW6A 4NEHB 4RK6A 1RXWA 1DHTA 4H3VA 2PS9A 3GBVA 2JJ8A 4MPTA 1A88A 4GBGA 3U9LA 2BN4A 1P62B 4OP3A 4YDQA 5LKAA 3W3AD 5FPPA 6ADHA 5EVCA 3KSZO 1D4OA 2IYFA 5JC1A 5IN5A 4BRUA 3UB2A 1JYSA 4EF5A 2QD5A 3G13A 1AKRA 4MI3A 1KQFA 2D1SA 4OGKA 1CS4C 3K9CA 4U5QA 1GLVA 2HMTA 2VQSA 5K3FB 2Y93A 4F86A 1E1YA 2AF3C 3OT1B 4OTZA 2ZUEA 1UMBA 1UAAA 3Q1LA 3R44A 3JTMA 1DXOA 4GSKA 5DTMA 5G53C 3OWXA 4HI0E 5H4HA 5CPFA 3KUKA 4N8EA 1JRLA 5B3AA 2NO5A 2H2GA 8ABPA 1WBBA 2BM8A 4U7TB 2OFPA 5DX1A 1PZNA 3IJRA 5BQFA 7GPBA 3B60A 1W6UA 3F47A 3IQWA 5GWXA 4NYMR 3VR0A 4DW8A 1OYOA 5LP1A 1I3NA 3T3EA 1PP4A 5AD1A 1FVHA 4NH0A 4CWAA 2W6PA 1EJ2A 3NBMA 4Q3KA 3G9ZA 3CCCA 5CB4B 1FTSA 4AJLA 1QGED 3AGPA 1FDIA 4Y9RA 2GK4A 4E1AA 4EABA 4GLJA 1DB3A 5JLAA 1RFLA 2A67A 1RHJA 3T9BA 1Z4PX 3EDQA 3TKAA 2AIRA 2IFTA 2F1HA 2PANA 1Z7GA 2AD1A 2AWOA 3CLTC 3PK0A 2XVYA 2UAGA 3TNLA 4AJOA 3OTOB 3V4LA 4PFQA 3IQHX 4TUYA 1YBHA 4UJ3A 2ZR9A 1QNLA 1SXJE 2ECOA 2OOKA 3E3MA 4ZU6X 3TCKA 3UTDA 3Q2KA 3AWDA 4JUDX 3LUGA 3P19A 2OQ2A 1G291 2QJWA 2YOGA 3FJOA 4U63A 4EI9A 3LUFA 3M70A 2BHTA 3U6BA 1ZGGA 3X1DA 1TJPB 4GZMA 1AXRA 2B8NA 1YGYA 3ZHVA 2Y0DA 4ARUA 1WDWB 4NYJQ 3V8BA 1N6RA 5B5SA 3O7MA 5EL0A 4AN0A 1GPBA 4G0YA 1RWMA 2ZWAA 4KMSA 3WMRA 5FXMA 1DTSA 1SD2A 5JD4A 2X0EA 3BWXA 1QQBA 3LCMA 4XQ9A 2GBPA 2VJBA 4OXQA 4B48A 2O07A 2GDZA 1WRBA 3QPUA 2HPVA 2F9MA 3LW7A 2EWVA 1WKBA 4MH0R 4RH0A 3QELB 2XRZA 1M10A 3TJRA 2BHRA 2FWBA 3IAHA 1DAIA 4Z0PA 2RHTA 1NV9A 3VC3A 4Y6LA 4ANFA 2E5WA 3A05A 3U4IA 3ZWMA 4F91B 4EMBA 1WD7A 2PZEA 2A0KA 1WW8A 5CYGA 3F97A 4UTNA 3GJ5A 3PYMA 2AB0A 1QCCA 1E2QA 2F3RA 2WYUA 3AV3A 2CF6A 3B7WA 5IAGA 4QU5A 2W5UA 3W7BA 3S55A 2A3NA 4M21A 3PGXA 1JPVA 1ODCA 3H9BA 4MQUA 4WJZA 5GIPE 1AG9A 2WOOA 2FUNB 2EATA 2I0FA 2NPFA 1XHEA 1ARZA 3PI7A 4IH9A 2JFYA 3MWFA 4Q3DA 3URMA 5I47A 2P9CA 5LZ7A 5TS3A 1KXZA 2R0QC 4HP8A 1NBMA 2QNRA 3DYVA 5J2UA 5I9TA 4F85A 3DLCA 3D3QA 1B43A 1G20A 1SVKA 1C7ZA 1ECCA 1R9JA 3EGVA 3OFJA 4K9DA 3WMFA 3R6WA 4JASB 4DAEA 1VOTA 2OFXA 3HXTA 4JIGA 1U2SA 5KI6A 4O63O 1KI9A 4PZZA 4QPDA 5HJEA 4PSCA 2I6UA 2CEAA 1ISIA 1DQZA 1VG9B 3P9ZA 2VP9A 2WLSA 5EQTA 1Y8CA 5F7XA 3HVKA 1PR9A 1WUKS 1P80A 3QOWA 3SYNA 4QTXA 3IQZA 3MYRA 3VJMA 1U9JA 5JNTA 1E7QA 4E14A 2F1RA 3VMFA 3N7UA 2QP3A 3GMDA 2G8NA 2YVQA 1XDWA 2H8GA 2Z56A 1Z15A 3ORHA 2P78A 3SHTA 1KAEA 3GARA 3F96A 1M6NA 4ACBA 1Y7PA 4UAGA 1UC4B 4CM8A 1EGAA 4W82A 2HV9A 4EOGA 3KYDA 4C4RA 2HLHA 2DH6A 4HYEA 5ALKA 5J4LA 3E05A 2OHXA 4ZHQB 2XADA 3VNSA 5M04A 4EFDA 3KCNA 4Q16A 2WKSA 2Y1WA 5BSRA 2WIBA 4OLFA 3VKUA 1VKNA 4TGLA 3U3KA 2FSHA 5AVYA 1GL6A 1QYIA 3AZOA 5LOVF 3K5HA 4MZDA 1FYDA 2AFHA 4UEJA 2BMWA 1XHFA 1Z4LA 4MWZA 4ND8A 1BKYA 4AKIA 3CISA 2F1IA 4BVKA 1NKTA 4HN9A 4RDIA 5AHWA 3RRYA 3GRCA 2VP6A 1J7JA 4FLEA 1ZOPA 1VRCA 1L8QA 1REQA 1TGYA 1YJXA 4IDQA 4KIUA 4OM7A 3D3WB 4F5WA 2Y77A 3RK1A 4P3XA 1JR3A 3U9SA 2ADMA 4G0NA 3RRJA 3WGHA 1UFQA 1LPOA 5ES4B 4L3OA 1Z8NA 4BX2A 3L1JA 2CXQA 4E2ZA 5T41A 1Z5VA 1DIAA 4MW7A 1TQ8A 3R7LA 2FPUA 4B80A 2H7XA 2ZANA 3AI3A 3DMNA 4IL5A 2ZBGA 5AK6A 5HOEA 3W5AA 2FW6A 4PLZA 5J23A 5HCNA 2X5JO 2IJGX 4FM9A 1NPDA 3IAM1 1HE4A 3OIGA 1H6DA 4CM9D 5SY4A 1AA9A 2Y67A 4DLLA 1UMKA 3CUWA 3RC8A 1N2SA 5ELLA 1J4AA 1XAIA 2WR8A 1LDMA 1LI4A 4NATA 3EE6A 4DLSA 1JSZA 1ZVVA 3G6WA 2GNPA 5KNCH 5MFZA 1SVMA 3GRPA 5JFGA 5CYOA 3AIMA 3O9MA 4DV6B 1D1PA 1KVUA 4RFSA 4WPGA 2IXFA 4BQSA 1DJMA 3EQ2A 3FTNA 3IBCA 3IVMA 1NY6A 4J2HA 3HVIA 4YTEA 1HY3A 4KN8A 1UC9A 2WP8J 3E9RA 2M6KA 4MR7A 1XCBA 1HYHA 5EJGA 4H7EA 5FB3A 2W7TA 4GMXA 1PEYA 4LX0A 3OKCA 2I66A 1EINA 1EIWA 3P1JA 3GD7A 1YBAA 4DTCA 3QYJA 3JW8A 3NUGA 5CR9A 3CSDA 2VP3A 4G07A 3DUFA 3Q7EA 4WNYA 3ZHZA 1GPYA 5ADVA 2VO1A 1PL0A 1KYTA 1Y9ZA 2PLNA 3B8HA 1N2CE 3G02A 4MB2A 1S8AA 4MWDA 5L6LB 3RC7A 2I1WA 1I94B 1MENA 2D8AA 3ONEA 4P5DA 1G6KA 1U99A 1ULBA 4NE2A 2AC2A 1BFDA 1P0CA 3BIJA 2AOVA 2O2HA 4Z51A 4JUCA 4EZBA 4RF4A 3BFJA 2V58A 2EL7A 2XRYA 4YLGA 2XA1A 4Q3BA 5B7NA 4X95A 3UXMA 5FWYA 2VTVA 4TTSA 4HTFB 4HPWA 4ZQIA 1Q1QA 4ES6A 4TRRA 5I7HA 3BWCA 2Y05A 4IIJA 1Z62A 1ZVMA 2FG5A 2Q8QA 3FB4A 3HEAA 5KCMA 4NI5A 4W9NA 3EG5A 3BTSA 3WLTA 1LLCA 4CL8A 3HCCA 3A6ZA 1SIOA 1MQSA 4I1IA 3GWZA 3KXDA 3C3CA 3FMVA 2ZIVB 3OT5A 2KLHA 2Z2JA 4KRYA 4V0SA 4C7BA 1II9A 3MMPA 4FN4A 4CQLB 4LOIA 1VB3A 3FDIA 3RBVA 3IRVA 4R1NA 3P32A 1U80A 2IYZA 2H7YA 3A0RB 6PFKA 4Q47A 1XZLA 4REMA 2IP2A 2QQEA 2XCLA 3H1AA 4BNUA 4B3CA 3EQ9A 4L5BA 4PRYA 1IOVA 2X9NA 3MGKA 3JWGA 4NDAA 5DHAA 4ZYUA 1ODJA 4MA5A 1XJWA 1OPRA 3SC6A 2UVQA 1XDZA 2Q4EA 3TZ6A 4LSZA 4JLNA 5IKOA 3T8YA 4KAFA 1P44A 4ASUD 1BROA 3NAGA 2IOFA 5CT6A 2BGGA 4EY6A 5BVHB 5E4TA 1SZDA 3BN3A 3H5RA 3CF4A 3QEAZ 1WHSB 4B3TB 1PGPA 4AO8A 2NUTB 1LF0A 3OWHA 1T3LA 4IP0A 4ROTA 4WXRA 3VR3A 4ARZB 1E69A 4QXRA 2B1IA 4CT0A 5KQSA 1WCYA 5KJCA 4C22A 4JP8A 3TWOA 1OFUA 4PXSA 5GVSA 4MPDA 1KZ7B 2B2CA 1BDBA 1C3EA 2FXVA 2HWXA 2X7XA 1PJSA 3C74A 2VAWA 4M1TA 5E7JA 1OAKA 2O5CA 5KPDA 2ZRNA 2FP3A 1XRMA 2C77A 3OCYA 1JLMA 3R20A 4RANA 5D7BA 5ITWA 2OVFA 1RLMA 2JFHA 2QJOA 5AW4A 2RAUA 4W6ZA 3FPEA 3UV3A 1KY2A 1U0HC 2QRVA 1EGHA 3GVXA 3HB7A 4QEDA 1J2YA 4JLDA 2RK3A 1RKBA 2BHSA 2LP4Y 4UHKA 1PR5A 3KD2A 2FLWA 3TEMA 1QC5A 5AVUA 3VH2A 4M22A 4QRHA 2LWIA 4PO9A 4A0SA 3FPJA 4C2TA 4BNJA 2Q0QA 3KQTA 4BMXA 4MKRA 3GXBA 3ANSA 1N6HA 3JYLA 4Q9DA 3O1IC 2HK8A 2VYVA 4G5GA 4LSGA 1NNUA 5DSXA 3AL3A 2R11A 3ZCTA 4V2UA 4F3NA 1X7XB 3HYLA 3KBBA 1Y48E 3AR2A 4OFBA 5JCJA 3T5TA 3ROEA 3VZSA 1E9BA 1ETHA 3ZU2A 1ILWA 5ALTA 2JLSA 3CRRA 4KXUA 3U17A 2VZLA 3KPVA 1P5JA 3Q6MA 4OEHA 1EA7A 3P2EA 1F8UA 4DLPA 5L4LA 2IS4A 1GEEA 2DR2A 4J1NA 1H5QA 1GFZA 1NXWA 3MERA 2JK0A 2AJCA 3NQ41 1QFZA 4LKRA 4WLNA 4WW0A 1QO9A 2BEVB 1XZKA 2DQYA 2NXCA 3TZBA 2VDVE 2A4KA 2YHIA 1TVEA 2FX3A 2RI0A 3DMHA 2A5JA 3B36A 3F8TA 3QQ5A 2FFHA 2VBIA 4B75A 2WUWE 5C4MA 2WF9A 3O94A 1BOOA 3S2ZA 1R10A 5JWHA 2GO1A 3U3DA 5JAHA 1EJ6A 2B83A 5AW6A 5JS6A 3UH0A 5B3KA 3OE7D 3RTAA 3B1KA 1TGVA 2PRJA 2IRWA 4TV9B 4C4YA 2AMYA 2G40A 1PFQA 2Z9CA 4DR7B 1E79A 1F48A 1U8FO 4IFBA 1XXHA 1E3DA 1PK7A 1HV8A 4R81A 1P61B 2QLJA 3C5WP 1CUXA 2HI0A 3OZAA 4LW8A 4OOEA 3Q6IA 1EDBA 5FWAA 4CTNA 4Z49A 1E0JA 4AUNA 5CFMA 4MS4B 2R60A 3B9PA 1JFRA 4MVJM 4OP1A 2BR3A 2ZJ2A 1F38A 1O95D 3S27A 3FPKA 5EA2A 3NBQA 3H17A 3L6OO 4EARA 2JZOA 4K0RA 4A5OA 1SXJB 3LUAA 4RK0A 2VZ8A 2GRJA 4F2WA 2JA1A 3SIRA 2E18A 4P3OA 1VGQA 4DV3B 3NG1A 1BE6A 5D1NA 5IDVA 3VISA 4A82A 1T26A 3IXMA 1GUYA 1BVUA 4MV7A 4N0EA 4A26A 4CQNA 4Y1FA 3WGJA 4CCSA 1Z38A 3F9CA 2WUFA 3DLPX 3DV0B 1IZ9A 4L8GA 1WDKA 5B2FA 5B1YA 5JADA 3C70A 3NGXA 1R27A 1M1ZA 3AKYA 3VU0A 3ZQUA 4KREA 1KVRA 3KZOA 4QDOA 1VKJA 3P9CA 4B0PA 1UKAA 3LNTA 3SS9X 3ANNA 3FDZB 4M0KA 3VH3A 4DUPA 4W9RA 5HG0A 1WF3A 1YFJA 4IY1A 1T9DA 5LYYA 4AN4A 5JCOA 2JI4A 4LYHA 4QC2A 4U8GA 4YQFA 1KOGA 4DXAA 2B5OA 4I50F 2CE7A 3FPFA 3H5OA 4HNHA 4L15A 5FA8A 2D0DA 4IVPA 4I9NA 1FUIA 4LRSB 2Q1SA 4RBNA 1UJMA 1N25A 2XKBA 3PYXA 4DIDA 5KNDA 3DT6A 5CIYA 1JDNA 2OZKA 5L8VA 4P7JA 1JDSA 4NBRA 3WC4A 3F7MA 4OBEA 4BMYA 1Y1LA 5K3BA 7REQA 1MW9X 4NCXA 4WK6A 5IHPA 3UMMA 1YA6A 1BFUA 1ZWLA 2ZJFA 1IB0A 4Q03A 4URYR 1KYVA 5KTNA 2PA3A 1Z0UA 3E9ZA 4ZVOA 3AJAA 2GI4A 1UJBA 5CVUA 2DFTA 4IZOA 1P6XA 3K92A 3O26A 3EYAA 1CW2B 2D5LA 2CDNA 3JALA 4MLDA 5DLPA 3FAZA 1KK0A 3M0EA 3SHWA 5H80A 3W2HA 4I66A 4NXNB 1WSBA 3JWPA 1DOZA 4X61A 2FMXA 1HX7A 4J3JA 2V59A 3F3YA 3JQFC 4E94A 2YJ5A 3CS3A 4RMIA 2J45A 4HAOA 2JH8A 5FLKA 3TVTA 2XT0A 4JHLA 4A6XA 3HFGA 3CB4A 5EKXA 2C2OA 4E2YA 1X1EA 3OLZA 4F46A 5ESWA 1P1HA 4QELA 2FQYA 4GIBA 3VV2A 2GXUA 1HK7A 5K3FA 3WTCA 3KJQA 1WB6A 3OT1A 4FFBB 4HWKA 5E0OA 3REOA 1J97A 3MWEB 3W8EA 2WU8A 4PZEA 5EJ7A 2Z04A 3GWGA 4LMAA 3WYNA 2QX9A 2YY7A 1NI3A 1PSDA 4ZEOA 1AH2A 3IQIX 1H1LB 3K8OE 1H42A 3AH8A 3HJRA 5AOBA 1SXQA 1ABBA 5E6UB 3HJAA 4JLWA 1OCEA 3DNMA 2MINB 1IM5A 4FDMA 3AIIA 3U7HB 3L4BC 2G09A 2YIDA 2FPKA 3ET5A 1RYZA 5TJ9A 1WMDA 3PR3A 5IVIA 2PH5A 1FBTA 3TZQA 4OHWA 2H52A 3QVXA 4KJZA 1ZJWA 2ZSUA 3O6VA 3DAHA 4FE3A 4BQOA 1JH9A 2IOQA 4AIIA 3MFQA 1C9NA 4CJXA 2P4SA 3PDHA 4BP8A 3MJ4A 2VJCA 1MAUA 4R1PA 4I8DA 1F4VA 1DG1G 1C4OA 3C1AA 5LCXA 2B4RO 3DSRA 1J8YF 3SYKA 4GMHA 4MQMA 3KWJA 4AYWA 2BDEA 3PB3A 5JJKA 4LZAA 2ZRIA 2OD7A 2IW3A 3K72B 4OU5A 2F3PA 2EOAA 3EYWA 4C7XA 1A50B 3W6ZA 1GO2A 2VHCA 1WXHA 2FUKA 3UCXA 2C4UA 1XDSA 4MRNA 5BMOA 4ZYWA 3KLOA 3BGVA 3LGAA 5AKEA 3DPIA 3SI7A 5F52A 3UF0A 3KHTA 3HU5A 4OA5A 4DMGA 1CZOA 2AYZA 2R96A 4FR5A 5BOVA 3WLOA 4DR6B 4MMYB 4TS3A 2FK7A 2VBCA 2G9UA 3KZ1E 2QDKA 2YIVX 4D82A 3O92A 5M34A 2A8YA 1LI5A 5L3QB 2YXNA 3BHJA 3OD1A 4QASA 5AKYA 1SUIA 2VK2A 4KQFA 3UGTA 5IC4A 4P0QB 4TZ0A 4M0MA 1XRLA 2QL6A 4KRGA 3VNQA 4KQMA 3MELA 2RJOA 4RE6A 5LP6C 5KTYA 4IX1A 2VOEA 3QELA 4PYQA 3ZXYA 5DYTA 4TMFA 2DOKA 4KL8S 2LCIA 2YNMD 3KYJB 3ZN2A 2MWMA 2XVAA 1KK3A 1IY8A 5KNLA 4KH0A 2PXCA 3C15C 1QO0A 5BPFA 1E0AA 1LPAB 3M5WA 3VAZA 2ABWA 1X7ZB 4QNRA 3RYCA 5HF8A 2FPXA 3NM6B 4IUDS 2HK9A 1LNQA 4OHRA 5LLTA 2R86A 3MTGA 1U3DA 4DUYB 4BJ6A 2HK6A 4DLYA 2DLCX 4RE5A 1VMAA 4CIVA 1XVAA 4OLJA 3A4IA 1VP3A 3WK9A 3ZCRA 1J5EB 1N2CB 1SVNA 4HYTA 4MLZA 4KX3A 2M1XA 2H1FA 3AG5A 3LBAA 1H4QA 1NSYA 4MITA 4W5NA 4BOYA 4MI9A 1KEPA 3UK7A 5AVXA 1RNLA 2O3TA 3UMCA 2P7HA 4IGFA 3PLRA 2PMCA 5F4ZA 3SKVA 1VJ0A 2YXBA 4OQXA 1VPLA 2I1LA 4Q1AA 4WWHA 1G38A 3EIHA 4CLHA 1ZFNA 4XGNA 4C06A 4GQBA 1JAHA 3WY9A 4ENUA 3U6KA 3N2NA 4P2BA 3O8CA 4X7RA 2XMSA 1NVVQ 1XJ5A 4P7GA 4QOEA 3E58A 3ETJA 3WB9A 4BPRA 4Q9IA 3OQ6A 1OT3A 1PBNA 2O2XA 4EM6A 4JT4A 1QK4A 3DDSA 3HLYA 3K09A 3D4OA 4GYYA 4YASA 3U4CA 4CN8A 3BRCA 1B8OA 3DHWC 3OP1A 3T3NA 1W93A 1ZGAA 3DOJA 1XNRB 3DLTA 4HEJA 4CMIB 3K9LA 4ZHQA 1U63A 2Y0EA 4YV1A 1E8NA 1Q1BA 5FHRA 3KG2A 4O33A 4GOOD 1B26A 2WP0A 4Z54A 3AUXA 3GL9A 2K4MA 4MQ6A 2VIIA 2WMOB 3T4UA 4D96A 1RMTA 4E5UA 3WNVA 4F4FA 1U0JA 1IN7A 1QIMA 3LKVA 1A27A 3UUFA 2BGNA 2Q41A 2EF0A 1EZ4A 5H7XA 2GHIA 3ENWA 4LOKA 4EJ2A 2PKEA 3N2YA 2JGAA 5J58A 3HNRA 3P9NA 2X1MA 3X1JA 1NJGA 3D3WA 4HGPA 4WECA 1L4KA 4N48A 2Q9CA 3IIEA 1K66A 2BBTA 5K4GA 1C4KA 4H27A 5AXCA 4PPGA 1ZZGA 2ZBVA 3M6UA 4YP5A 4AKHA 2QMHA 1XZAA 3LK6A 3PYLA 1ESEA 5HM6A 3O4JA 3A11A 5AW3A 1MB4A 2CDAA 3QLUC 1VHDA 1KVSA 2BV3A 3QJYA 2OBXA 3D5EA 1L7BA 2AEFA 2XWSA 4QDJA 1WMEA 5DEOA 4ZCTA 5JATA 2BELA 1ACJA 4FMCF 1E2PA 4B3DA 1J09A 1I4LD 1LPNA 2R6DA 3TOSA 1YU6A 2BMVA 1GCGA 2ECKA 1U3FA 3O75A 4LUCA 4ECAA 1WG8A 4KQ9A 2CUZA 3QU9A 4AECA 2IS6A 2ZXUA 1WQ4A 2CXTA 2QTVB 2FLVA 4JC8A 2EJBA 5JECA 2KJQA 3TAUA 5A03A 3SYLA 2JFVA 3K5PA 2RONA 1K8ZB 3AKCA 2WJ6A 4JSRA 3GLTA 2IHNA 1CVIA 3ZE1B 4OI0A 2JW5A 1LX7A 3AC0A 3LQKA 3PQ7A 3QITA 3RK0A 4EG4A 4IJVA 2I3AA 4WXPA 4ZZIA 1WULS 3CEPB 4CNQA 5HUJA 1RYHA 4A8TA 1YS1X 2QN6A 4IH1A 3W9YA 1M5UA 3H84A 3EFOB 4PYRA 1D9ZA 1K2WA 1B2LA 1NSFA 2ZPAA 1L8XA 1KI7A 4Q3EA 4Z7QB 4FXPA 3DHNA 1XP5A 2JGFA 3NNSA 1Z56C 5IT0A 3U40A 1G8GA 1KA9H 2XOKA 2G9RA 3D6UA 4L02A 4TZ6A 4V3BA 2R6JA 2YW2A 5DI3B 4RPLA 2FU5C 2ODPA 4GP9A 2ZB8A 1WCV1 4OU4A 2OK8A 3F3KA 3ROZA 3WL3A 5KOJB 3SC4A 5LQDA 3B20A 4CMCA 2FMTA 5U4XA 4C3ZA 1ADGA 2LIPA 3LCUA 1WP9A 4HKTA 1FP6A 1RXYA 3TINA 2D6FA 2HM7A 3WJ2A 3LRTA 4ON9A 5A4AA 4J3NA 2G70A 3LVFO 1VI5A 4G1UC 5EP4A 3GAMA 1H6BA 4M9SA 1CDZA 3DFFA 5TR9A 3UO8B 3P4UA 3JYOA 1MRZA 2I3ZA 4G2TA 4R2IA 4DMUB 1L3CA 2GEUA 2AXPA 4JA2A 1JQEA 5CM2Z 3B6MA 3TB4A 2CLSA 3PNMA 4D3YA 2O59A 3TQQA 3LY7A 1PVVA 4JQCA 1DPFA 4BFTA 4D45A 2ICAA 2HC9A 4HTFA 4MYRA 4QX6A 2XOXA 1NX9A 1TMYA 4Z9AA 4UPEA 4TLAA 3RU9A 4HOYA 3ZY4A 1E3TA 1HDEA 3T5CA 3W78A 1EUZA 3ACBA 5LZ5A 1NU8A 1F9EA 3GUYA 3KK0A 3LT1A 4ZOLF 5U4QA 2XE6A 4RNDB 2J41A 3MGCA 3ZWWA 1JFFA 4B6OA 5CYFA 4I3GA 3HCAA 2NO0A 4CQLA 2OHFA 2NP7A 1YS2X 2GHQA 3FLEA 3RIGA 4G36A 2CNWA 2OAGA 1UBGA 3FKJA 1TU0A 3MMSA 4R8LA 5DLYA 1U7WA 3W5SA 4E5NA 3AY7A 5JWRA 2IVZA 1F5NA 4OOFA 1LF5A 1QX4A 1V2HE 1E98A 1U6JA 2GO7A 3KDAA 1U7TA 4DXHA 1OZAA 2RKBA 4ZI2A 1FDWA 1LRKA 1S3FA 3HXQA 5KTOA 3X1MA 3PRHA 2Z4TA 4COOA 4XWKA 3ADBA 1ZKDA 4UFPA 3DP9A 3QYAA 1TKAA 1E64A 4LECA 3AUTA 2Q1YA 5BMVA 3I1JA 3H1GA 3SGLA 5BVHA 3HABA 4JFRA 1CLUA 2VVTA 3F98A 1WHSA 3GYBA 4BRSA 4CG1A 3RS0A 1T1JA 2NUTA 2ZIUB 2CJPA 4ARZA 4IOMA 5I7FA 5JAZA 3OJEA 3R0QA 5I45A 2GJ4A 3FBGA 2Z4SA 2NUAB 2P4QA 1M2KA 4MAFA 1Y6ZA 4K9LA 4N3CA 2LUOA 5KJEA 5BUSA 1U1GA 3D3NA 2VT3A 4HAZA 5IKEA 1EUYA 2OY0A 2ZEJA 1RPAA 2C4NA 1BJKA 3IR6A 4UDOA 4BVJA 5JBNA 1S1CA 1YZGA 2W8BB 5KKCA 5DM0A 1DQNA 2EGGA 3R0VA 3OO0A 4PE5B 4C0BA 5JH7F 4TXJA 3C8MA 4U4AA 1FYXA 1PFYA 2Z9DA 4KXMA 3WB1A 1D3AA 1QQTA 5IK2D 2Y1XA 1YH3A 3CPEA 4RKYA 4ENQA 1Q7EA 3HUTA 1UEJA 2VPZA 1L7XA 4Q01A 4Q7MB 4PSKA 1U0TA 4XAQA 4DG5A 4KWTA 3EPPA 3HJNA 5EESA 4KN6A 2EX1A 1H2WA 4RSMA 4DILA 2Q27A 1WR8A 3G7SA 3E3LA 3UXEA 1CY6A 3BA1A 3LWDA 1G5PA 1IBSA 1ODTC 1X7XA 5AHOA 1XPOA 2DVMA 3GFFA 3T06B 3FFWA 3I12A 3RM3A 1T9AA 3AEXA 3EX7C 1N8TA 4TYYA 1N8KA 5HYVA 4O2AF 3RNLA 4MIYA 3DXYA 4CFSA 4E07A 3HA2A 4NKRA 3I76A 5J5CA 2BEVA 1PS9A 3QW2A 4RL6A 3QIAA 1ETUA 3WWPA 2Q4DA 1PAUA 4KG7A 1Q6YA 3FCSB 1YQUA 3PNKA 3EPJA 4X93A 3UFXB 2TECE 3KALA 1G5IA 5CLFA 1D4AA 1PN3A 3ZQJA 4NMWA 1NFFA 2YHSA 2BTEA 2QN8A 3Q72A 5IULC 4YLYA 4J3FA 4TV9A 5AI6A 4BJ5A 3E2PA 5JBIA 2ZIZA 1E0DA 3INYA 3DOHA 3K05A 4NBWA 3T0GA 4BNYA 3AILA 4JD5A 2IY8A 1YZVA 1ATZA 1E5LA 3ABSB 3GJ4A 3L0IB 5K0LA 4A1OA 1GSHA 1KKUA 2QVXX 1A8HA 2ZE8A 3F6SA 4MS4A 5FA6A 5FUYA 2NUBA 3BS4A 4DNQA 5MGNA 3V4RA 2B37A 4BCBA 3AR9A 1ECGA 2X13A 3QK7A 1WLYA 5I7UA 3FYSA 2LTAA 3CWZA 3OIWA 1T6XA 1XPJA 1SXJA 2HRDA 1Q6ZA 1EG7A 4JMPA 1BEZA 1DKRA 1V5FA 1KJYA 4XQCA 3UOGA 1ZHFA 5IZCC 2P41A 1WKVA 2VYND 1JWBB 3K0CC 3T1OA 2O23A 3E81A 1Z22A 3GFGA 4C20A 5KNDH 3IHKA 3P2KA 2C00A 3DV0A 4MUBA 1QF9A 2O7SA 2C58A 5ALUA 5CA0F 5IJ0B 2PWPA 1F8GA 1M3SA 2WHPB 1YQGA 2VUUA 3BVPA 3FHLA 1LNZA 1TUBB 3N87A 4BVLA 4EKEA 6CHYA 2VQ6A 4BFUA 4J4TA 3P97A 4B2YA 2XMQA 2R25B 2FSIA 1CLEA 2ZFUA 3FDZA 4Q34A 1GTL1 3CLHA 2WM8A 3OE1A 1PJQA 1X14A 3NHJA 1FRZA 1MVNA 4FU0A 1F12A 1XFDA 3DVAB 4E12A 1ZOLA 2QR5A 3U31A 4D0SA 1YQQA 3NJ8A 3AW9A 1P18A 5DOVA 2OV8A 1OFIA 3HS3A 1G8FA 1DKNA 5EINA 5I8ZA 2NVBA 4H7JA 1YIDA 3BMNB 4UHJA 3KVYA 2VHXA 4HFRA 2I80A 2VS1A 4F1KA 1TM3E 5H5JA 3UC5A 2QUZA 1UP4A 1FPQA 1SBZA 1P7ZA 4U3JB 2AFVA 3EXG1 4GPTA 2PSHA 3WSTA 3IJEB 3PL1A 1JU3A 5GJBA 1RDFA 1Z4KA 3TTYA 1JFVA 4HNAB 4EP1A 1SKUA 1U1CA 4PGGA 1WSDA 1SBIA 4F6RB 1HKHA 2VNAA 3SZGA 2XMCA 2FQWA 2BFWA 2VRWA 4J4HA 1M5TA 4J7UA 1FA9A 2I4OA 2V4UA 3L7JA 4Y2XA 3TI9A 4ESHA 1K6EA 2CFTA 1O5TA 2QUIA 2FSVC 4BLSA 2GF2A 2FN4A 3OPQA 3FGPA 4X1OA 1XRPA 3WMGA 3E9QA 5ECWA 3FCYA 3RIXA 3GJ3A 3OFKA 4G9GA 5DTIA 2W6CX 3IR5A 1MAWA 4IF4A 3KKEA 4V39A 1HZZA 3TIFA 2QYOA 1BAPA 1FX1A 3O73A 4GI5A 5ALMA 2ERCA 4C2UA 4FFBA 1NONA 3OAAD 2HB6A 3R3XA 1NBOA 3MWEA 3QKWA 1QCYA 4DLAA 4RV5A 2Q5EA 1AQUA 3OBBA 3U16A 1DO2A 3GA0A 2NX2A 2Z5FA 3OLWA 4ZO9A 1APBA 2DU8A 3D1VA 1G2PA 1X1QA 2CFRA 4H6WA 4ZZ2A 3HGTA 3IQDB 4AX4A 5E6UA 2DBRA 3MVEA 3KFXA 2MINA 1XWIA 3DZKA 1YHZA 2EZUA 2GUWA 2WIFA 1Z4IA 4JLBA 4TM7A 2AKAB 4QOHA 4ERXA 5EJIA 4NU0A 4D43A 2YWJA 4UUMA 3SX0A 3KNZA 5GINE 4Z7JA 5ITSA 2PKCA 2DP4E 2X2FA 4FX2A 1E2NA 4AY3A 4OHFA 5G3ZA 1EM8B 4YREA 1T3SA 3UAVA 1E3LA 5LYJF 4Q3NA 3PEWA 1DC7A 5HILA 2H1IA 1QS0B 2XB8A 5DXFA 4DZTA 3PE6A 2CHGA 1M8JA 1F06A 3WLPA 5IT5A 1KO7A 4BLPA 4MVJF 4Q12A 3IIKA 2X0NA 3DEJA 3EISA 3W79A 1P1FA 1PVOA 4M38A 1B0AA 2ZSDA 2C5EA 3D5QA 3ICOA 3K1JA 4JBNA 3DDZX 3RJTA 1E6LA 1SBTA 2OWEA 1RVDA 1F2UB 1U90A 1XZEA 2Z57A 3TM4A 4I6EA 3ZNOA 2NYVA 1A77A 3FPBA 1EUQA 3C6MA 1DIGA 3M4NA 3MJRA 3VBEA 1UAGA 3R5JA 2ZBDA 4QYWA 1W5EA 3HA7A 2VCYA 4GVXA 2H54A 5C8YF 5DN6A 2OSBA 3HDJA 5I7RA 2I55A 3OQIB 4UVIA 1W1UA 3AI2A 2I76A 3L0ZA 3EIFA 1VHWA 3QJGA 5KPJA 4TTPA 1NR5A 3MYYA 2GN9A 2INGX 2D00A 1Z0SA 2WJJA 3HR8A 5DGCA 5L3QA 1N2HA 1UPXA 4KDCA 5G2OA 3R8FA 1GUFA 3RB8A 5CVVA 4DMLA 4YAUA 1SA0B 3T0IA 1HG0A 3TZCA 3ADKA 2WJVA 1T6NA 4HXEB 1OFTA 2H6EA 4G81A 3SHOA 3W1WA 3NX4A 2JI8A 3TRHA 2JIZA 4MYDA 2QI9F 3B1YA 3HUUA 3U4AA 2RBKA 2Z08A 3QY9A 4FHDA 2VH1A 3ANXA 3HO6A 2XEDA 4IGIA 2C5SA 5DNWA 2BSXA 5DNAA 3K6SB 1X7ZA 2X2EA 2OPBA 4UBNA 4FDTA 3U60B 2PKYX 2R6AA 1F6BA 2RIPA 2Q5FA 1JSCA 3TEJA 5FBVB 4OJKA 1WZ2A 2Q3BA 3V42A 4A3SA 2ATVA 3IMKA 2ZXFA 3Q7QA 4DCJA 3B9QA 1GL3A 1N2CA 2B0JA 3NBYC 4FFOA 1OLUB 2AFIE 2PL3A 2PXHA 3CKLA 1KQ3A 1PZGA 3DE2X 4JWTA 5BUZA 2IH2A 4U2BA 2JD0A 2YR0A 2QPTA 3WJAA 4IS2A 4BFSA 5FPTA 1DINA 4UU1A 2O3JA 4BVFA 1WMFA 5HZGA 3GMSA 4K88A 2C5FA 5DIFA 3EDRA 3GPIA 3W3AA 1E77A 4G9EA 1PJ3A 3PVSA 3CR3C 1DBSA 1Y3HA 3GN2A 1I6WA 5KSWB 3AUUA 2E55A 3EDCA 2GNAA 1SCBA 3VSEA 2J5KA 4D4JA 2GCPA 2PZLA 1B2RA 3AIKA 1VECA 3KJZA 3QF4B 4IUBS 2YV1A 1OH5A 4F6LA 4B0OA 1AKWA 4EI8A 3D6HA 5I48A 5CW2A 2Q6IA 1LU9A 3IERA 1JLRA 2XQIA 2CY0A 3C8ZA 1D2RA 4ETIA 3F1KA 4UD6A 5CVTA 3KKZA 2AT1A 3LXUX 4CMIA 2XUHA 1B4DA 1N1GA 4DNPA 4H4DA 3CX6A 3UICA 2HUPA 3G5MA 3GVHA 4PVCA 4DCGA 4EUHA 3B48A 4DF3A 5EZQA 3OEHD 3L7BA 4M54A 1TZMA 4XFJA 1CY2A 2E9SA 1X1AA 2VJNA 3EEIA 3QEBZ 2UZ0A 4ATNA 2WQ7A 2BEWA 2IU4A 2QQ0A 2OHJA 3DLHA 1G42A 3SSNA 1SIBE 5EJ5A 3IBTA 1OBVA 2JKYA 2PKQO 4HB3A 5LBUA 4D98A 1KO8A 3LVBA 3DEHA 2GTIA 2CD9A 5TEVA 5HXAA 4RJTA 3RVBA 2O8EA 4A0RA 3EASA 4PN3A 2HF2A 1ESDA 1KFKB 1OHHD 3G0HA 4AO6A 2YMPA 4P2GA 1PKEA 5KTTA 3NVKI 3ED1A 3HM2A 1Q1GA 4JVLA 4RWEA 1FFGA 2WPDD 5IBQA 2ASEA 1YIOA 2A92A 4N0DA 3SCZA 3SX2A 3UKJA 4C3UA 4EPRA 3RSLA 4PG6A 1C9YA 1W87A 2AUNA 4J16A 5LBTA 4IZ6A 5AJZA 4AJIA 2J85A 3H5WA 4XX0B 1UKYA 2H08A 3A2MA 1CTQA 1KI8A 2FSUA 2EYUA 5AKLA 1XLWA 1H9AA 2C9ZA 3C7TA 4M98A 5IAJA 3NJ4A 1FFXB 2F00A 5EIXA 2QTVA 1PVDA 5JNVA 2WSMA 1NT4A 1BRTA 2HPAA 3IVAA 4QTTB 3T52A 5FUVA 5IMSA 4W5RA 1PWEA 1SG0A 1QZZA 3BMCB 4IPTA 1DJPA 5CD9A 3FUUA 2N1MA 3OKAA 1PQYA 5C53B 2FR0A 1LW7A 3D4BA 4HGRA 2IEDA 2FSFA 2JCVA 3OLCX 1M73E 2QD3A 3JWIA 1NVMB 2G72A 2QRJA 1EB9A 1A3CA 1SJ9A 1AKMA 2DR0A 1YMVA 1RT9A 4I55F 2GD0A 1ZKMA 3AFIA 3EFOA 2QLMA 1E60A 3HYCA 4O29A 3SBEA 4DNXA 1X74A 4WBNF 4QYIB 3ZTWA 1Q20A 5BV0A 3QU7A 4JP1A 4P0PB 3IURA 4NCIA 2EFGA 2NO9A 1A69A 1C5KA 4JBGA 4ZVSA 3VUEA 2VNIA 2RHRA 6NULA 4KR7A 3HK2A 3GLFB 3QY0A