4F9EA

Cyclic di-gmp sensing via the innate immune signaling protein sting
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
173
Chain Sequence
b'NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPDSSFSLSQEVLRHLRQEEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein 173
publication title Cyclic di-GMP Sensing via the Innate Immune Signaling Protein STING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 51
structure length 173
sequence length 185
ec nomenclature
pdb deposition date 2012-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f9eA02
5CFNA 4F5DA 4F9GA 4KSYA 4EF4A 4F9EA 4LOLA 4EMUA 5BQXA 4F5EA 4QXRA 4EF5A 5CFPA 5CFLA 4LOJA 4LOHA 5CFMA 4YP1A 5CFQA 4JC5A 5CFRA 4QXQA 4QXPA 5CFOA 4F5YA 4KC0A 4EMTA 4F5WA 4QXOA 4KBYA 4LOKA 4LOIA
chains in the Genus database with same CATH superfamily
5KQMA 2XMGA 3IE0A 1NJSA 2R2AA 2I6QA 3JQ9A 2JC3A 4F1KA 5HWSA 4J1TC 4HDRB 4O1MA 4OOEA 4IWXA 3HZRA 1R16A 1FVFA 3FPHA 3WNDA 4YAIA 5TIIA 3DHYA 4GQBA 3ORQA 1ADJA 3IJPA 5IBQA 5EKDA 4Z7JA 3T1VA 3REGA 4B3IA 3CG0A 3HBFA 3K7EA 1G8KA 1EZ4A 2XUPA 5TPWA 5BMVA 1O94D 1FQJA 1U1EA 4HHEA 1BCSB 2YJZA 1G41A 1K68A 1N2CA 3LO8A 3DXYA 3GRAA 2HLNA 5BMVF 1IMOA 3R8CA 3HB9A 2ZJ0A 5MFPA 2NYRA 3KKLA 2RGNC 5E4FA 2CVQA 2C9DA 4AJOA 1E6EA 4FBMA 5BSKA 1LLDA 5HZKA 1QHEA 3HUEA 1M2WA 4H6PA 4RH0A 4ZVRA 4ZMSA 4KYIB 4E15A 2J31A 3QMPA 4IHKA 4Q24A 4RMGA 3VH4A 3U31A 4RE5A 4DDHA 4F6CA 3EPRA 1P29A 1RJDA 3TQSA 2XCRB 1N32B 3H75A 4JIGA 1PUIA 4BLOA 2IPXA 3CEAA 1XALA 5T4EA 4JC5A 1L8LA 2A33A 3S2GA 1W7AA 2GBFA 1WDLA 4LJ4A 4MGKR 3UUGA 1MXFA 1DXYA 1OJ7A 3K73O 4GR4A 2CLOB 3NDPA 2ECQA 4DJJA 2OZLB 4EJSC 5IEBA 1KI6A 3Q0IA 1OROA 4PSKA 1HI9A 2Q6KA 5HM8A 5AR1A 1ZICA 4BCCA 4JS0A 4WKOA 3HI6A 1BS2A 3OIDA 3RSCA 4Q3AA 3VOBA 4BP1A 2FSUA 3GHHA 4JLAA 2VH1A 1XWIA 4M6WB 3ETCA 3I6BA 3NALA 5D6NA 4YMIA 4WEOA 2ZI9A 4B2PA 5HBGA 5JSHA 3ET4A 3QOXA 3GLQA 3RVDA 1I5OA 1GCGA 3FPLA 2YS7A 1SVOA 4UHCA 4ZEXA 4AF6A 4ES6A 2OBNA 3PPWA 4HTFB 4OEHA 2J3KA 4FR0A 4XQCA 3UMYA 2JHGA 4PFKA 4G5RA 4L4UA 3HHPA 5LIPA 3JQRA 1A98A 1M73E 5F76A 2VXYA 3BMNB 3FLAA 1GGHA 1VLHA 3Q0TA 4KLNA 3ROFA 5LA6B 2EX0A 5ADHA 2UXDB 3WGZA 2W2NA 4D4HA 5L8VA 2G9ZA 5K0TA 2R1TB 2NXWA 1XC7A 4FTWA 5KKAA 3VMFA 1GNVA 4J3FA 4CUJA 4D0GA 3PE4A 4H7HA 1UDBA 3IUMA 4G1UC 1SKQA 2JW5A 2PSSA 5CK5A 3RC7A 2Q4RA 2K87A 2OBFA 1KNXA 3PNVA 3II6X 1PK9A 2ZRCA 3KSZO 1JECA 1PBNA 1RBQA 2CLCX 1K9VF 4MV1A 1F4PA 1NRWA 2YRWA 2ZUUA 3PUJA 4HAWA 4M8KA 4CMBA 4ZCMA 3A04A 2YXLA 1OXKB 2DBQA 1S8OA 2QTLA 3JQDA 5ULLA 3H5OA 1U9JA 1ZGCA 2Q6OA 4G0QA 1N3BA 5JUWA 4L15A 1DBVO 4HDRA 1EWQA 2VZEA 1R8JA 2R8ZA 1T91A 5EQFA 1VL5A 9GPBA 4WOBA 2IT1A 2IIQA 2VUTA 3PTAA 4BLQA 5J4LA 2XR1A 3BERA 1EFDN 2VRBA 4KQ1A 1RKQA 3HACA 1WV0A 3KSDO 4FQ8A 4G8JA 4AZ0B 3CRRA 2X5OA 1A2QA 5TDHA 4KYUA 2G1UA 4R2KA 5LQMA 4FBLA 5CH5A 1LV8A 1B76A 4CPDA 1HH4A 1T9HA 3ZW8A 1BCSA 4D9HA 1IXKA 1MOQA 3FTCA 5JARA 3KZOA 1IJEA 2GVNA 3EFOB 1PGPA 2N46A 2YUTA 3MYRA 4J2TA 3HJRA 1ZD1A 4J9UE 3HXQA 1EGVB 3V34A 3V7FA 1OXVA 2V98A 3V2HA 1R10A 2O19A 2E18A 2WB2A 3ZGXA 5JS6A 2DUJA 4CQNA 5DLQC 3NMUF 4H1WA 1N7JA 5KNDD 1HSOA 4D8TA 2EVWX 2I4IA 4DLLA 1ID1A 1H2FA 1QIIA 1UQTA 2D54A 2BMFA 3F2VA 4FYXA 4JJKA 121PA 4NSNA 3TJZA 3ZKAA 4NJEB 1G17A 4IWNA 4DWVA 3TTSA 1K6MA 4W5JA 2NTNA 2OHIA 3L0CA 5J40A 4XIGS 5T8KC 5TGTA 3W8FA 1OMOA 4DGQA 3AVXA 4WNCA 2JGKA 3F6SA 4L5YA 3R9KA 2B7LA 4G2NA 4YRDA 4BJ5A 2G8NA 5J2TF 2Y1GA 5KTYA 2OZLA 4UVIA 1LPMA 3M1LA 4KRGA 3FDZB 2HWUA 1EP3B 3QFSA 3DV9A 3I0NA 2RHLA 4CHGA 2MSDB 3HR4A 4RHUA 1ULUA 4RVCA 4OJYA 3AG6A 3UOGA 1NJ1A 4JP8A 2PTGA 2WG1A 3G13A 3ZNOA 4NPAA 2CFTA 1ORWA 2QN9A 3WL4A 2FOIA 4ASUD 4M6WA 3EYWA 5KTPA 3HSSA 2O7VA 4M8NE 2BV3A 4TRRA 3U7IA 2SECE 3R9XB 2JH8A 4HTFA 3WLKX 4DB4A 1U31A 1SUIA 2B69A 2ZSKA 3KVRA 4DILA 2JIBA 3WRXA 1O9BA 3PS9A 1NPYA 2X3YA 4NBKA 3MPOA 3HSKA 2C9ZA 3BMNA 2XYRA 5LFAA 1K97A 1NF8A 2HMYB 2Q5FA 4HRYA 5LA6A 3VZCA 4A5OA 5JROA 1EWTA 3GFGA 3U60B 4G3XA 5LA6F 2PX4A 2R1TA 4P7GA 1M33A 2YKGA 3NFYA 1CLEA 3LUKA 4X8LA 1I36A 1XDUA 1P0IA 1VSBA 3DC7A 1DJQA 1Z6YA 1PL7A 2EJTA 2IZ1A 3FWNA 5LZ8A 3QY0A 1XZPA 1VCOA 4EVQA 4U7DA 2PXHA 3HJCA 4KFCA 3LLMA 2G83A 4BLSA 2P2DA 4QFDA 3QE0A 3TLKA 5IANA 4REQB 3VVLA 5K3SA 3IR5A 2G82A 2W43A 4KMMA 3I52A 4EPXA 3AR2A 3H8VA 4WCFC 3SKVA 1HMPA 3BGDA 3QE2A 4RV4A 4Y2RA 4ZC8A 1J8VA 4JVMA 2CXQA 2O48X 4LJ8A 3BFJA 3HB1A 1OT3A 3LGXA 1WULS 2C1EA 1GTL1 2RI0A 1GD1O 1YR1A 4B3RB 2VAXA 2P9YA 4BE9A 4LWOA 1YHYA 4LN1A 3AWDA 6ABPA 3INYA 4AZ0A 1B1AA 4EHFA 5EHIA 1NM5A 3GT0A 3UGTA 3WOHA 1CY1A 1TEXA 2QX8A 3AEXA 3G5TA 3SM9A 2ODQA 4KPYA 2KM1A 2WVJA 3R6LA 1E9AA 2BEKA 1TVKB 3X1WA 5J5AA 1E59A 1JDPA 2ZIFA 1KJWA 2IPAB 2HO4A 4H3HB 3HDVA 3EFOA 4MINA 1SKBA 4EQZA 3P19A 4HSGA 1JEDA 3I05A 1OYOA 4IG4A 4YDQA 3L4JA 1VB3A 2GBIA 1E2BA 1Z4LA 4FU0A 2XMRA 4K9PA 1AKWA 1IAQA 3WLSA 5IHXA 3IUPA 5I7UA 1SPBS 1Q77A 1X7WB 4GOMD 1MX9A 4ZDWA 1J2UA 5CLGA 2RBEA 3VO8A 4JLWA 1YDGA 1YCFA 4O02B 5KU1A 1C0KA 1W36C 4RLFA 2BT4A 3WK9A 3NUGA 4BTVA 4URFA 4URWR 3VAZA 2Q5CA 2YMMA 1H94A 5FQOA 3EXAA 2JFBA 4XIJA 3D7NA 3C5HA 3OLYA 5EHQA 3M9WA 1AQIA 4AKEA 1X70A 3E84A 5TR9A 5JATA 1Y8CA 2XKKA 4GC9A 2QUBA 3THYA 4OYYA 1CEYA 3JU3A 4JJAA 4OQZA 1A8HA 3FDZA 4R40A 1PV1A 1PTJA 2OO5C 4EAQA 5DO9A 3SEFA 4RORA 2FP3A 1T5SA 2VQDA 4CKXA 3HCOA 3AKEA 1GT6A 1UWKA 3HDHA 2EOAA 5A05A 3SIRA 3TBHA 1SR8A 3HBNA 5B64A 4M21A 1R1DA 3GJSA 5ADWA 1ZJWA 5JJIA 3X44A 5FBVB 1IEVA 1AZLA 4OQQA 5EXEA 4TXJA 3H2ZA 3R9XA 2LCFA 2HQRA 1DZIA 3QBJA 5EFOA 2H2AA 5G0TA 2TMKA 1Z0FA 2OCXA 2R751 2FF5A 3A31A 1JEOA 1TM4E 3DFFA 5K8LA 2DXIA 1JA0A 1MB2A 4MWTA 2O05A 1T24A 3VRHA 1H8HD 1L5HB 2VYVD 2PA0A 3SZUA 2WWIA 4AF8A 3P7MA 5FHRA 2IIPA 3ND5A 4L4ZA 4YJ2B 2CE2X 3U4MA 4TRNA 3CW8X 3A6GA 1GL6A 1JV2B 5JDCA 1AN0A 1H5QA 2WJZB 3CJTA 1E1MA 1L7RA 4O4HB 4B4KA 1D1TA 1ISFA 1EJ0A 3E70C 4JI8B 5LD2B 4Y7DA 4JJ6A 1GEEA 1FMLA 4US1R 4UUAA 2PNFA 1CS4C 4TMFA 4C0KA 3CCBA 1Z47A 2KB0A 5FUMA 2ET6A 4P86A 3P9PA 1L5RA 4RTJA 4DRYA 2D1FA 2Y8EA 1U5AA 1P33A 3OQNA 2CFOA 5AVJA 3S8EA 4R3NA 2XUQA 4FS3A 3M6UA 4C29A 2AZMA 2XDQB 3SFTA 1YB5A 4IFTA 3FZGA 2P4SA 5DNAA 1DRWA 5D00A 4BNUA 4KQCA 4EUEA 4JEIA 2O2YA 1USVA 2X8LA 3GDHA 4LOLA 5DE3A 5G1OA 5CLFA 1L7AA 1E3WB 2WYUA 2XEDA 2Q6IA 3WYEA 3ZBPA 3SQWA 5ECWA 2YJ6A 3L6DA 3AU9A 4EATA 1VM6A 3M6IA 3VQTA 3AFNA 3AUKA 4X44A 1IMJA 1RRPA 3ETEA 1XRLA 4TN5A 5FPHA 4QTXA 1V6AA 2NYVA 4PR0A 3AV3A 3JQ9C 4UXHA 4DRZA 1ZW1A 1OKKA 4TWZA 1DDOA 4F12A 1DWPA 1NJ6A 1R8XA 1CQXA 3ZCTA 2GPBA 1XTJA 4B74A 2I7VA 3PQ3A 2GJ9A 1LGYA 2IUEA 2W2LA 2G9RA 5HA5A 1XX6A 4WFIA 1WZNA 4Q37A 2Y1OA 5B1HA 5HKBA 1J7JA 3OEEA 1F8GA 3ZWPA 1TVKA 4ZAWA 1T10A 2QG6A 4IDQA 4G07A 1THMA 1D6JA 1A9XB 3IBYA 4MLDA 4NPHA 4ZQEA 4ZCPA 3SKXA 4YMTA 1DAOA 2Z98A 3IOYA 4EJ2A 4N5NA 3ES9A 6PFKA 1R6XA 3A6JA 5L45A 3W5CA 1R8YA 2WKQA 1XXLA 2C31A 3KZXA 4HEQA 3BL5A 4HSEA 1R7RA 3M9XA 4HKTA 2AFHA 1IXSB 1X7WA 2WUGA 4G5YA 4Q7MB 4QEKA 3MC1A 3WNCA 2PRJA 1ONBA 1WSBA 2VATA 3PFNA 2GTHA 3QFHA 4YIKA 5FKJA 1ATIA 4YMLA 5J3JA 2C7OA 3QPVA 5CYGA 3H8SA 5CG1A 3AXTA 3EPKA 4TMYA 3IT0A 2GYWA 2MINA 2VHCA 1U4SA 2F3PA 2X42A 4FGSA 4C43A 5C5IA 3A1VA 3C8ZA 1AUXA 1JIQA 1T34A 5LOVB 3L8YA 1YOBA 5LPNA 3A6LA 3PNLA 4YJGB 4RHFA 3UC5A 1F3OA 2FI1A 1OWLA 1OHHA 4Q15A 3F4LA 4GLOA 2BGIA 1F4VA 4E6PA 2IHBA 4UTXA 2CCKA 2BUAA 1PZMA 2QTHA 2Y27A 3C3MA 3NBKA 4FD3A 4MUNA 4S0XA 5D3KA 4P4SB 4RXMA 5FOWA 4N6OA 3ZBUA 2BEUB 3PEEA 2IBTA 2JJQA 1NMSA 4PSDA 4XRRA 3IQDB 2XNHA 4TV8B 4Q4HB 1NX9A 1VXRA 2OYSA 2QL6A 4ZOLB 5FT9A 1RYYA 2XVYA 4WSOA 1ULAA 5JXIA 3P94A 4FFLA 2JHFA 2Q41A 4HWRA 1B6TA 1VYTA 2ZJOA 3W2FA 4IIUA 4NWIA 5D5QA 1ZMBA 2O2HA 3NV9A 4KLRA 4YJDA 1YDFA 3IMGA 1L5HA 1MBZA 2CW5A 2GTIA 2D2FA 2Z2IA 4JT9A 4KYTA 5EFZA 1QVAA 4MHTA 2J0SA 3AM5A 2BBWA 3B3FA 1DO2A 2J7KA 2R3SA 4YJ2A 1KORA 4IDOA 3IR6A 4YJ2F 1MNQA 2ATCA 2OQIA 4B9EA 4CF5A 1TAUA 4N1AA 5LDDC 4O4HA 2ATEA 3H8WA 3DVAB 2XT0A 2OCDA 5EXTA 4DLTA 5GJWC 5T3UA 1WLYA 3CIOA 4XOIA 1CDOA 1IM8A 3DMPA 3ONDA 4H27A 1ONNA 1US8B 3TE6A 5M3BA 1BROA 2X8BA 3R5HA 3U4CA 2JI6A 4RK5A 3U7EB 3WHKA 5I7EA 4MI1A 4L51A 1X77A 2OGTA 1ICIA 2XDQA 3AF1A 4Q9AA 2PZMA 1NVXQ 5KJ1A 4UTZA 4EG1A 3IVMA 4D96A 2BKAA 1XJ5A 5KAPA 1E3WA 4H2DA 3TJMA 3UAGA 1T13A 1QM5A 1Q12A 3OZTA 4RMJA 3SXJA 1TZJA 1R8QA 4QUAA 3LQ1A 1PEDA 5BN3B 5K0BA 4FS8A 4ZHQB 3S99A 1X1TA 2CVOA 2FZGA 4XDHA 3H4MA 5K6TA 1KP3A 1M9NA 4F3NA 2CUTA 4NU8X 2J3JA 1E62A 1JZQA 1N6KA 4Q3DA 5H81A 4CLOB 4DRXB 1WSAA 2IYFA 3R3WA 3O9MA 5ES3A 2WF6A 1M75A 1CKEA 5EXSA 5ENDA 2YWBA 3L0IB 3V7UA 1XUOA 1Y3AA 2PANA 3RC8A 3PIDA 2IVZA 3GLUA 3UT5B 1B0PA 3TLYA 1JIVA 1VHQA 3K2QA 2FNAA 1QZTA 3ZWOA 1FJHA 1TA9A 4W82A 2WUVA 4HAZA 2P4QA 4OJNA 1JNYA 3C5VA 4RIEA 3V1TC 1A9XA 1UPXA 5KQSA 4ENVA 4KPFC 4A6EA 3KXDA 1L9KA 2AQKA 2R6HA 5F77A 5B3JC 4I0WB 3LPCA 5LQUA 3HEAA 4LVNA 4XVCA 3KD3A 1WB9A 1KKUA 2MU1A 4S2EA 4X65B 3D81A 2QM7A 3G6KA 1ECCA 3RE1A 3ZPXA 3RAFC 4GG1A 1UPBA 1ZEMA 4O29A 1JSLA 4RK0A 4Q02A 3U9SA 3QPWA 5EWMB 1J0XO 2PV7A 4QOIA 4DC0A 4Z9BA 3WKBA 2BPOA 4GP6A 5H59A 5LLDA 2Z2KA 4ZT5A 4DMGA 1N34B 1XKXA 3U7HB 1I9CA 2OVBA 1VHLA 5LOVA 3KWMA 1UM8A 3EY9A 1DWQA 2IYLD 4YJGA 2GN4A 4PNHA 3KZ1E 5LOVF 3NOXA 1YA6A 4DGSA 1Y1RA 4ABYA 1E99A 3GCWA 2J32A 2HHCA 2EEZA 2FPSA 2JZNA 1QBKC 4CIXA 4DREA 2H06A 2AD1A 3IAS1 5IZCA 1HQKA 1FRNA 2HSGA 5IM5A 2A3RA 1ZRMA 3EH2A 4P4SA 2BEUA 2VK4A 4FN5A 4HQ6A 4GVLA 5ESRA 1EK5A 4TV8A 1UQUA 3L6EA 3IVCA 3N2GB 4Q4HA 4Z99A 4BN5A 1RWKA 4ZOLA 5CDFA 3FCCA 5A5VA 3H1BA 5ABPA 2O8CB 3B6EA 5K3OA 4ZOLF 4UHKA 1IB6A 4KI0A 5KSYA 4PX5A 2O4CA 2TSYB 4AM8A 4CM6A 1MJGM 2V9PA 3ESCA 4UM5A 3O4FA 3ENNA 2P35A 2Y2UA 1K4MA 5I4CA 621PA 5A0VA 4WBSA 4EB8A 7YASA 3DEAA 5K0JA 3MQFA 3JWEA 3F78A 3PPYA 3Q40A 4IIBA 2NPIA 3DVAA 3AM1A 4DEXA 1I4OA 1CR6A 3BRQA 2WAAA 4Z5XA 2D5IA 3SICE 3AGQA 4CL3A 1US8A 5CFPA 4KXWA 4RPIA 4WXPA 4JWTA 2I6UA 2X0KA 3FR8A 4OXNA 4WOKA 4LCEA 3ROXA 4IMPA 3GUYA 5I48A 2XNJA 4XLZA 3DL2A 2EX4A 2CMKA 2CZGA 4IXDA 1K3TA 2VDLB 2VYFA 1G6KA 1L4LA 1N6HA 3VZPA 1Z68A 1YNOA 2RKWA 2YINC 1FSZA 1ISSA 2I9PA 5AKXA 5BN3A 2XDYA 4ZHQA 4XPZA 2MMGA 2Q28A 2NXCA 3A4YA 1SMKA 5JXGA 4DRXA 5GM1A 1O5TA 5JAUA 2VIIA 3GPIA 3JPYA 4CLOA 1MV8A 3BOSA 1QYVA 2GXUA 2GJ4A 3M4YA 3UCEA 1QF7A 1OWPA 3CX4A 2GF0A 2PA3A 5H9WA 3AEKB 5KSZA 2G88A 2XMSA 1Q16A 1RJEA 4MUEA 1BOOA 4MUAA 9LDBA 1PFQA 5CGQB 4OLHA 3UT5A 4HZIA 4J76A 4W6QA 2RAVA 2VNKA 4DC1A 2ODPA 3KQHA 3VR4A 1JW9B 1NM5C 3P20A 2C82A 2JLBA 1ZR2A 1XF1A 1NY5A 5TQ0B 3DVSX 1A95A 2HXSA 3UGQA 4E2FA 1IQPA 2PS1A 1NTRA 3QI2A 3F96A 3KEOA 1V43A 3V6LA 3ECAA 5FUXA 3NONA 1VLJA 5I4KA 1YFJA 2D0DA 3R0IA 5EWMA 2NAFA 4GH5A 3K8YA 3RB8A 3A3NA 4ZYUA 5TPZA 3CPSA 4KWEA 3PUZA 1QHGA 3PTLA 3RARA 3OTIA 3ZWXA 4OGWA 1WS6A 2H0AA 3I3OA 1Z75A 2X9LA 4N9WA 4P35A 5DWQA 4CDNA 5JZVA 1KKMA 2HK6A 4QATA 1IZ8A 3QYJA 4CM5A 2WWRA 4ZRMA 2PJRA 4JYAB 4C7VA 5BSFA 3Q6MA 3G0GA 1NW4A 4QPZA 5H7XA 1HDGO 4J7CA 5HEKA 2VUHB 1M6EX 4LDRA 2VNJA 3HRHA 1U8AA 1L5YA 3O4HA 3WQQA 1IFXA 2FWJA 2X5XA 4QBHA 2L42A 3N2GA 4EY4A 1DPGA 3BULA 2WB4A 2IEGA 3MPUA 1CNFA 3HY4A 3K5WA 4OMDA 1A77A 1LS6A 1CRZA 2O8CA 4LV5B 4LQCA 4GZLA 4FFRA 2BW0A 1MH1A 1P9OA 1J0DA 2WYHA 3B1JA 3TQRA 3V7WA 3ISJA 4BNFA 1P4RA 3WYCA 2JASA 1KBQA 2GKGA 1X8LA 3C24A 3D6TB 3L79A 3QVGB 1ODTC 2BGLA 3K8ZA 3R3XA 3T0FA 1XOIA 2PH7A 1A5BB 5KC9A 2VS1A 3AF3A 3NEAA 1RD4A 4HXGA 4JMPA 5BV2P 1JVBA 2I67A 2PSDA 3X1DA 3CMCO 4ZCLA 3N0XA 2ZJ7A 1C5KA 1E98A 3FNGA 1BSVA 2PUJA 1QYRA 1WB6A 3A70A 3DMYA 2FK8A 5JDCC 2ZBVA 3DB1A 4ZCIA 1F2UB 4F4FA 1YJQA 1TYAE 4WV3A 1LDBA 1W5FA 2Q21A 3ZOZA 5LJIA 3RKSA 3M89A 5H82A 3DDZX 1RP7A 1SWVA 3EQ9A 4GI5A 3UAWA 1HL7A 4ABTA 4Z4IA 1JR3E 2VDQB 4UE3S 4QSMA 3VZRA 2JCYA 3CRVA 3RO7A 4KGZA 5ALHA 2A9OA 3R3SA 5IVIA 1H4TA 2H8KA 2P77A 4FKMA 4MW9A 4I1PA 4H6VA 2VSXA 2JBAA 1M5TA 5FTMA 1VYHA 1LPBB 3FYDA 1TT7A 1G8SA 2BH9A 3GA7A 4RA6B 5KHLB 3UAZA 1N6OA 2VKQA 2WTEA 2ILTA 2NSDA 3GAZA 3D6FA 3DBOB 3LA6A 1JQEA 2BBSA 4B7UA 4WBNB 2JAUA 1VFNA 4YRQA 4H3KB 3IR7A 3AVUA 1ECGA 1R0RE 3AEKA 3PGA1 2QUKA 3L4EA 3SSNA 1GN9A 2ZIEA 2LBPA 5DRYA 5JW6A 3TR0A 3TEFA 3BCSA 4J0IA 4BTEA 4YWJA 3ETGA 2FZVA 4WWHA 2HDOA 3PC3A 3FCSB 1GPLA 2G76A 4KB5A 2B34A 2NVBA 1IEXA 2R66A 2ZT7A 3AKDA 3SS9X 3U9TA 2JAQA 2FY8A 4N5MA 5TQ0A 4M1OA 3N6VA 4CIVA 1W9HA 3DMHA 1M2NA 4AMZA 4EVIA 1VHJA 3B1ZA 1C7QA 5KPDA 1G2OA 3RAPR 4FB5A 1D4AA 4QOHA 5HF5A 5HPYB 1H6CA 3WV4A 3C3WA 2BMEA 4JOSA 1FTYA 3HPRA 3HNOA 5HOEA 4HEJA 3R7BA 2NV2B 5KYNA 2PH3A 4BBAA 2ZIGA 4X6YA 3GDWA 2PYZA 4LWQA 2WKWA 5HKKA 4U7TB 4Q7EA 5JY6A 3RUDA 3IQHX 1LVUA 2OILA 1FOEB 1RACA 4HBGA 3TTWA 1WZ2A 4DZZA 3B3JA 1QCZA 2P0AA 2BKLA 3E5HA 4D4KA 2WTNA 1EBUA 2AG5A 1DVRA 4RHYA 5IWCA 2ZYWX 4G85A 1DU4A 1UPUA 2V54A 1KMCA 3B9PA 2HUNA 3GU3A 4OGGA 1T8UA 1XYGA 3MUOA 4DYDA 5IUNC 3A37A 1ZZGA 2D7CA 2LDBA 3HS3A 3Q2IA 2QNIA 1HWYA 3EC2A 4AP9A 1JH9A 1UT5A 4WRRA 1UXHA 3MWDB 4PPQA 5FLYA 3ZCQA 1UPAA 5JJLA 1G291 3K0CC 1FVOA 3I5YA 2RH5A 3WLOA 1C3EA 4M86A 3ZD6A 4B6SA 1PIWA 4NBSA 4HXEB 1UK6A 3CX6A 3F9IA 1N6NA 2ZRFA 1KYVA 1X7DA 2C7VA 2XWJI 2HLDD 2HU8A 4YJ3B 3QVGA 4KL8S 1ZG3A 3RU9A 2WOJA 1S8NA 5AOBA 2OXIA 3QXGA 2Q5HA 3T9CA 5CW2A 3WIOA 3P4UA 4BGUA 4EIWA 4Z7QB 4BFTA 6NULA 4C9BA 2HIHA 3SE7A 4DCOA 1V7ZA 3C4JA 5HJ7A 4Z53A 1FLDA 3GIWA 1G0OA 4QT0A 1KMIY 4HUJA 4RGVA 3WLHA 4AO7A 3IA2A 4NMMA 1AS0A 2PXXA 1BWPA 2VN8A 2ZU0C 3A4MA 3NNNA 1Y3IA 4B79A 1X1BA 1LDYA 4BBZA 1F2UA 4DSAA 4IVRA 1U0SY 3HU1A 4I4IA 4X1YB 4C0SA 1Y7PA 1T1SA 4JJ4A 3C45A 5FQNA 1S3SA 3UGKA 3ZS9A 5LD2C 4G56A 1CUAA 3KJGA 4DG9A 5A3QA 1LSUA 3EK2A 2WABA 1OVMA 1ISJA 1YI0A 3JZMA 1ZCFA 3H4IA 2AX4A 1GU0A 3JQAB 3O95A 3HKEB 5FFMA 4JBLA 3KFLA 4PCLA 1E8NA 4OKNA 4RF5A 3SDSA 2ZUTA 5T4HA 1IZZA 4R51A 1J7KA 3T7EA 2O1EA 5JFTA 3CZCA 4DE5A 2XUFA 1CHDA 3LH5A 1V96A 3VR5D 2ACVA 5K0CA 4RA6A 4B6EA 2ID7A 3VJKA 2PT7A 2F1OA 1NWHA 1TTQB 3PIIA 2XV1A 5FBKA 3ZDXB 2H4FA 4MVJE 1CW2B 2ORED 4G9BA 3CXRA 3TXXA 4AS1A 3T06B 1B0UA 4WBNA 3HCEA 1VIAA 4RVNA 3R75A 4JBXA 3UCFA 1TC1A 1Z82A 3IURA 1PZEA 4HT3B 4WBNF 2HHHB 1T2CA 3EQ6A 1E9VA 3FIJA 3NHPA 3H11B 4I36A 2QPOA 2ID9A 4QPNA 4CMKA 5ECGC 2W42A 1WUHS 1TF7A 2G9UA 4L08A 2Q50A 2FWRA 1G8GA 2NU8B 4BNVA 5AVTA 3IVAA 2Q3CA 1ILEA 1NOKA 2Y93A 1J97A 2PZJA 2WUWE 2ZTMA 5DNUA 2VHTA 4UE6A 3IUQA 2H2GA 1RLMA 4JROA 2YY5A 1J23A 3H5TA 4XWGA 5HF8A 2DKFA 3CISA 1FNSA 3ILHA 3X1JA 4Z54A 4MZDA 5D87A 3GJTA 1GDTA 4PGFA 1E7SA 3BZUA 3I37X 3ICWA 1HL3A 3D4NA 3PD0A 2ZSIA 2CLEB 3IMKA 4JOQA 5AM4A 1WKBA 4ENRA 4F6RB 5WRFA 1AC5A 3BRSA 5AVWA 3GLHE 4W9RA 1E9BA 1VL1A 3K3PA 1L1RA 1UKZA 2HH9A 5G3ZA 1UK9A 2XI4A 1VYVA 2AZXA 1EGQA 1NP7A 1AY0A 4K1XA 4GLJA 5ALSA 2PIAA 1UODA 1G1MA 4YR7A 4MS1B 4L02A 4BQFA 5AW2A 2IS1A 5C8YB 2GT1A 1KI9A 1E6UA 3IUJA 1J0EA 4Y0AA 5EIOA 1SD2A 4DIMA 1R18A 3DOUA 4ID3A 2R5WA 3GN1A 1NZFA 4Q16A 3EDCA 3ESZA 3W8EA 4J4HA 1W35A 2Z4RA 5KEIA 4GOND 3WGJA 5K6AA 1LJUA 1U6IA 5AXCA 5J4HA 1IDN1 1YONA 3MRXA 3LF1A 1S2NA 3MWDA 3H17A 1T4DA 1UWLA 2AXQA 2FPUA 4N0MA 5KCMA 2JFUA 5I7AA 2VDVE 5JCOA 1A4IA 1Q2UA 3FFXA 5HHTA 1OGJA 3HGMA 2F1RA 1JQDA 2ZSAA 4LIPD 1S2DA 5BRAA 5BV1A 2H1FA 4XUGB 3D8UA 3PZBA 4AKGA 1KIFA 4YJ3A 1A5ZA 2WNIA 3FSGD 3AV0B 5HX7A 1M8KA 1T1EA 4U2CA 5A4AA 4BB9A 3N58A 5D7NA 1GUAA 3ZZMA 2BJHA 2Z83A 1MJNA 2WAYA 1OLSB 2WTMA 1PVOA 1RW4A 4Q3OA 1SELA 1GWNA 3K15A 5AKZA 4LZPA 4BP9A 1T29A 3MJSA 2W6PA 4L6AA 4QAJA 1EFRD 5CYOA 3D6UA 1E9CA 3QX7A 4X1YA 1RM5A 3BB3A 2ZVQX 2OM2A 3AINA 1J2TA 1DKMA 4IS2A 3WO1A 3ZD8A 1I2BA 4E2YA 3MT8A 1MABB 4POOA 2CHEA 4NPCA 5F9HA 3C1OA 1JLSA 3KQLA 4O3FA 3H5LA 4A1FA 1XHEA 3JQAA 1ZONA 4YMUA 3HKEA 2ZYIA 3KXIA 2DRIA 3T9AA 4ER6A 4J0KA 2ZIVB 5B6PA 3QPUA 5DM70 3MCTA 2FPOA 4JB8A 4HLUA 3WQBA 4AJ2A 3L4SO 5IVDA 1YR8A 3OJCA 2VXBA 4UDOA 1E4OA 1OI3A 2HXGA 2J3DA 3HKDA 1QOZA 3MFQA 3OD1A 2RHGB 1WBDA 4LJ7A 2GD2A 3DF9A 1T9DA 3WLRA 5E9QA 3BCHA 3J80A 4LJSA 4AY2A 2EBFX 3IDZA 5EXDA 5E38A 2VPYA 3IKLA 1KJIA 1VI6A 3C3YA 3H11A 5C4GB 5T64A 5GV7A 3U3OA 1KU0A 4EO9A 2DP4E 5A0FA 1NMYA 3QPDA 4S1TA 1U0EA 2NU8A 3V8QA 2YW9A 2VPZA 3N8GA 2IYZA 2YWEA 2H2DA 3WP0A 4BCBA 2J5KA 4KITB 4I6JA 1E6LA 1ECJA 3H9EO 1ZMRA 1GU1A 2CLFB 4MV3A 4KXNA 3R3HA 1YJ8A 2GKOA 3RRFA 3GLIA 1MAUA 3QWFA 5IZ4A 3BDIA 1N78A 1NTOA 3EVCA 1CWUA 3ZVLA 3PDCA 4PO9A 4BNGA 3A6KA 2ZJ6A 2XNDD 3UT0A 1Z0ZA 4AECA 1CZKA 4F6RA 2Q5EA 4B6PA 4EHDA 2VTEA 4DSNA 2AMYA 1QQTA 4WE3A 4ND5A 2HRRA 2B8JA 3IT1A 4RHTA 3FOBA 2NPFA 4D57A 2I2XB 1NV8A 1DADA 4MS1A 1ENZA 2FFRA 3G1UA 3SQLA 4EUSA 3IOBA 2OBYA 3K1ZA 3U1BA 1H8HA 1C1HA 2VYVA 3CA8A 3MK31 4XJSA 1YVPA 1TVMA 4BKPA 4Z4QA 5C8YF 3R6DA 4OLBA 1Z37A 3OIFA 4BDTA 1S4QA 2C3UA 1PW5A 2RIRA 4LXUA 4Q4DA 4F56A 2FRDC 1R9NA 2I03A 4D41A 4DCUA 2RAUA 3KUCA 5E2AA 3T9BA 5I8WA 2X9NA 3G2OA 1GUBA 4LTDA 5DHFA 1F38A 3N8KA 4YAGA 5F7OA 2ONKA 4I19A 4LKRA 5ADUS 4DWWA 3A2LA 3PUWA 3RTAA 2PV0A 3OKPA 4XFDA 4R7GA 5K0LA 2F1JA 2GNAA 3WNBA 3ICQB 3W2IA 5CNKA 3B6JA 4PQEA 1GNPA 1IM5A 2C5BA 2BMJA 2J5RA 1KDYA 2E49A 1TFRA 1OLOA 2YX1A 2DPYA 4TS9A 2CFIA 4E03A 2WDZA 3VR4H 4NZOA 4M7PA 4NFYA 1CZNA 4WACA 4DANA 4CETA 1R64A 2GN9A 1ICEA 1RIFA 2P3LA 4AROA 4JLUA 2PPLA 2CYBA 2ZAGA 2G3YA 2Z58A 3CLKA 3RIMA 1NX6A 1MW8X 5F1PA 3HYCA 1GM5A 2X0IA 3OM1A 5IBCA 1OLSA 4C5CA 4B75A 5HCNA 5JYEA 1W85B 3OF2A 2ZB2A 2H31A 1B6SA 4LK2A 4AL4A 2AR7A 5DN6D 4LCBA 5BPHA 2A4MA 3TLBA 5D2CA 4MEBA 1JWLA 1NBHA 2MR6A 4LC9A 1B8VA 4W5QA 4U5QA 1OIVA 4RKQA 1MABA 4RZSA 5PNTA 3UA3A 3C5WP 2LTAA 3KSBC 1TXGA 3G5UA 4B4WA 1N9KA 2X22A 1F48A 4V0NA 3ZH2A 3BB4A 1QZXA 2AMLA 3U3XA 1K0FA 1UBTS 3SHQA 4WK0B 5JCXA 3AYXB 2W9XA 2OQ2A 3RVKA 3RYFA 5F7JA 3KOYA 4NZZA 4J1SA 4L85A 1LLUA 1O94C 5LL6P 4Z9AA 3IX7A 4QSHA 3ROQA 1KIMA 1V6SA 2GEVA 2G4VA 3A1NA 2W11A 3QJ5A 5U1PA 5IN4A 3C6MA 3WMWA 1U0LA 2LGJA 2W37A 3C87A 4HS4A 4L8LA 4D9GA 2BR5A 1JR3D 3DZGA 5EP4A 5G40A 1ZNWA 2ERXA 3D6VA 4EFKA 3PGKA 3M6VA 3LX5A 2JFGA 2AUMA 1PD1A 5JJCA 5CG2A 1SKYE 2RD2A 2DPGA 3RJ9A 5C18A 1UP7A 2V59A 1YRBA 2MCFA 1YZTA 1Z36A 3OPYI 1YT5A 1IY1A 4WKGA 3R8XA 3MTGA 1KMMA 5E7IA 2FG7C 3INTA 4BVFA 4YNBA 4DA6A 4Q48A 1W30A 5KVQA 1CERA 1U2EA 4KQHA 4Y1EA 3EXEB 2RMKA 4MR7B 3V4VB 1GO2A 4E1VA 2O8EB 4WL0A 3RV4A 4ZZIA 1P81A 2PKXA 2R25B 1GLVA 3SOPA 2UZ0A 1Z07A 2WJ3A 3AY6A 2Y4NA 3Q3EA 3EGVA 3CVWA 1WHSB 5AVQA 1FY2A 4GMDA 5H0IA 3PXDA 4HQ0A 5FOTA 1ULSA 3LY5A 5GZ1A 3L06A 3UH1A 4X7PA 2DEUA 5M7EA 1HG0A 2F3QA 4CTKA 2HT1A 4KQIA 2JLZA 4C7OB 1Q20A 2P6NA 1NHGA 4P98A 4YRBA 2AQ8A 5FTNA 2E4YA 1RXEA 1T4MA 3GBSA 4R1SA 3REQB 1ZCZA 1KO8A 5FBQB 3EHEA 1YK0A 4MUIA 4OHBA 4QO7A 4JB0A 4US0R 3SR3A 3CH5A 2XITA 4I66A 3PRHA 1QQBA 4GDFA 1CY8A 4BNTA 5ALPA 5CEJA 4XTRA 3HADA 1WCYA 1C9DB 3FGPA 2R0QC 2VOJA 3M9LA 4IIVA 2VQSA 3UV7A 3ZHBA 1FTGA 1E1CB 2BFFA 1AKNA 2H3HA 1SNYA 5U4QA 1B3RA 2FUEA 4C4RA 1Z17A 1OVGA 1WZUA 2NU7B 4LKOA 4NFLA 4PSCA 1JZSA 4GRAA 3UK0A 4D7AA 1AMUA 1N33B 4KVFA 5JEEA 4G5XA 2XGMA 2ZXFA 1SVUA 1LW7A 2VL7A 4YMSA 4TQAA 4Y6PA 5FORA 3SPXA 3I30X 5ALUA 3D64A 1SB8A 2DUWA 3CBGA 2DTEA 3U7FB 1HETA 5IMSA 3RC2A 1W85A 4EHHA 2PDAA 3SLRA 4AN0A 5AM0A 1RYNA 4DDWA 2UU9B 5B5SA 4CQLB 2XQGA 3D0RA 4LPKA 1NFFA 3O8RA 4TYPA 2PZGA 1DWUA 5T67A 3UA4A 3DBVO 4AZWA 4JGBA 3JYLA 1VJRA 4PLPA 4YP1A 3GLIE 1RNLA 3L2OB 1TU4A 4U9UA 4B4DA 2Z43A 2HJ9A 3V42A 3PFBA 3GFPA 2HEGA 1A88A 1XVIA 2BMDA 5BP7A 4GNRA 4YUAA 3WTCA 2F7SA 4IEFB 4F5WA 5HZMA 2OPBA 2X0NA 1K5DA 3DZCA 3FF4A 4RELA 5A5FA 5BWBA 5CA0F 4KE8A 2ZDGA 4BUCA 1KTVA 1EFUA 2N1MA 3E7FA 1HPLA 4CU2A 3PT9A 5DM1A 4P5DA 4RM2A 1GLGA 1CUCA 1N8TA 1Q84A 2IPLA 1B16A 3NHKA 3V97A 1A9TA 2J6BA 1KL7A 1Y5RA 5A3VA 4L5BA 1Q0ZA 1E9DA 1Z7GA 1KK1A 1F17A 3QUAA 4YAUA 3L0YA 4DMLA 3CVUA 3SS7X 1UINA 3J81A 4MVJD 3K71B 3E3OA 4D5GA 3EXEA 1NRXA 4MR7A 2O8EA 3QLEA 3DHNA 2H57A 1L5WA 2NTVA 2ZVDA 3V4SA 1JTFA 2WWVD 3TIXB 4YGXB 2CUZA 5IJXA 1G20B 3HJBA 1HURA 1TO2E 1WHSA 2CNBA 3USCS 1FQOA 4LGVA 5DHRA 5IF9A 1X1CA 5EVCA 3UEOA 5JSQA 2WZDA 2F9MA 3EQZA 4ANFA 3AL3A 3SBEA 1NW5A 3LUGA 2R96A 2AW5A 4ITRC 4XDGA 1PS8A 5BSUA 3PVSA 4RHXA 1CUEA 3U17A 4AJ1A 3OE7D 4C7OA 3KT3A 3IAS6 2B1QA 2V7VA 1U1CA 3P9NA 3SJ7A 3OC6A 4EHAA 3PE3A 3GPCA 2L82A 2R6AA 4Q6WA 3REQA 1P0MA 4G0MA 1E8DA 5DH9A 1EUZA 4YUWA 2XUOA 4EBFA 4I46A 4EG8A 3NBFA 1TB4A 1E79D 2FPPB 4RO0A 2VHVA 1E2QA 4CIYA 1NSTA 1XAJA 3KSAC 2JHCA 1PEAA 3HSYA 4G65A 3QF4B 3OZVA 5IK2A 4AVYA 5JZOA 1BG6A 1XMJA 4KPUB 3GZ4A 3UVEA 5ALOA 2IGBA 3JAWB 2DHCA 1ZHHA 4HAUA 2FN7A 3BWDD 2Z5FA 3FZEA 3H18A 4M8IA 4XSHA 1E1CA 3ASUA 2R8YA 4B09A 5K8VA 2FWBA 1FZTA 2EIHA 1RC1A 2NU7A 3E4DA 3M4ZA 4REOA 5AK6A 5JCOC 3IODA 1O6CA 3PHCA 3GYBA 1KA9H 1H2WA 4UUMA 4C6SA 1LZKA 3K9GA 4NC9A 3BA1A 4IF6A 1JKFA 4B3JA 1P4SA 1DJOA 1OXMA 1IN8A 4WXMA 5CJJA 2XF8A 3WLLA 1UJMA 3AXSA 2H29A 3IQEA 3OEWA 2YVAA 3GJXC 4UQPA 2A3NA 1XMVA 2WVAA 4ON9A 2HQ1A 2QY9A 3QXXA 2AQHA 3R6GA 8GPBA 1WUKS 3R3VA 3L05A 4RPJA 3O74A 2P5YA 3A14A 1D0SA 4PSVA 3GWZA 5EJFA 3TZKA 4DTCA 5KYYB 3O1JC 1O0SA 5A4MS 1MC1A 2OXTA 1K5PA 1OXBB 3P0RA 1WDMA 1Y34E 2HU5A 1Z28A 4OJQA 4P3KA 1OWNA 1J2RA 5LQCA 1X14A 2OK8A 5A2QA 1EESA 3WYNA 4HN4B 4MVCA 3I2IA 3PKZA 2V74B 3JYNA 5FWXB 4M0EA 4XDYA 4FOSA 1VLMA 1H4VB 4QGSA 5BW4A 4I9GA 2C96A 2OCGA 4GLFA 4N6GA 2NTEA 2G06A 2C4WA 3W79A 1U8XX 5I01A 3I5AA 1IQUA 3KZCA 3UPUA 4NONA 2XQJA 4XVHA 4QHSA 2CJXA 3NBQA 1U7PA 1U8YA 1WMSA 2IZ0A 3MTDA 3G82C 3O73A 1YB1A 2AIRA 5HILA 3M4NA 2OD7A 2NO4A 4UPEA 5LSAA 1ORIA 4KR9A 1C9MA 1TW2A 2PUEA 5FL7A 1X92A 3L0PA 1JHVA 3QE4A 3ZWKA 1ZM3A 1IOLA 1JSRA 4BWFB 8ATCA 3EVEA 3PRJA 4CFZA 4RCZA 1N2BA 4P54A 4M7OA 1LK7A 4UNSA 1XD9A 2COEA 2SNIE 1UCFA 1VPEA 4CV1A 1IY0A 3C43A 3CZPA 5I9IA 4U6QA 1DIBA 1ND5A 1WAMA 1TM3E 3C14C 1K0UA 2OZEA 2QL9A 4CDRA 3MWJA 3WZ2A 5I4IA 1G20A 2P11A 1T3HA 3DB2A 1GTG1 5SY6A 3ZTTA 2VEDA 1BYIA 1N5RA 2VJKA 1TAHA 1VB5A 3UMJA 4CM1A 4RJTA 5DTRA 1QGOA 2JFQA 1E1RD 1JHYA 3B53X 1NW6A 1OT5A 3FCAA 1TF5A 4KO2S 5THXA 3BCUA 2B83A 5GVSA 4O4IB 1UBLS 3H42B 2ZYRA 1OTHA 3H0CA 5BOVA 4HQOA 2R5FA 4ZK6A 3A3YA 3ZGYA 2XLCA 3NORA 5JBIA 1X1SA 2QJFA 4N5IX 2C00A 1NDQA 1RRKA 1MAWA 2OENG 3GFTA 4LOHA 2IXFA 3E4CA 4ND3A 4QTTB 2AQIA 2ZJYA 3K72B 4HRXA 3TLZA 1SCKA 4ITUA 5DSZA 3U5ZB 2SBTA 5K01A 4O33A 4RU1A 1Q44A 2D2VA 2FPPA 3ODPA 5JSYA 5C1DA 4TTSA 4YDRA 3EPLA 2P40A 1D1SA 1JQBA 5AKIA 1ZA1A 4CI0B 3WLEA 4XWWA 4KV7A 2IXGA 3QF4A 1W1IA 5LNK6 4KPUA 4ND6A 1VHWA 2YIJA 3QFTA 4DLAA 3JAWA 3OFJA 1OI7A 2OV1A 5F23A 4NMLA 4LY6A 3EXG2 1H05A 1N3YA 3MWFA 4G63A 4RS4A 1EEHA 2B61A 4N18A 3JS5A 4U6NA 3MIIA 4HNAB 1HT3A 4OM8A 2FLVA 3O5AA 3D7SA 4Z2YA 5TJHA 2C4VA 3I01A 4D43A 4E22A 2RGGA 4J1QA 3PG5A 4P1ZA 3I2HA 1QGAA 4CM8B 5A02A 4LBVA 2DSTA 1BS1A 3K09A 5JI3E 2ZE7A 1KEEA 3KKNA 2F67A 2XUDA 4GD3Q 4X3OA 2Q1WA 1PW7A 1E2IA 5AJUA 2CFSA 5L3RA 4H59A 1FLVA 4D4JA 2ECOA 2GPTA 3IDAA 3TOZA 2J6CA 3BDAA 4LHWA 5KYYA 3JVEA 1U8EA 2VO1A 1ZN7A 2GN2A 3CYFA 4B6JA 4IIEA 1CYDA 4C4OA 1TUGA 2YXNA 3ZXIA 5B6IA 1UKVY 5KU7A 1V2GA 2H92A 4IDFA 4B34A 3JVDA 3GLRA 3NWOA 4QUBA 4WY2A 1UXIA 3W4KA 4AAYA 5A1JA 4PX9A 2XE4A 4RENA 1WU7A 4RVSA 4JC0A 5FWXA 1Z06A 1KQPA 1AQUA 3LFUA 3OUTA 1JRLA 1SU7A 1PFYA 2QN3A 3GNLA 2O7SA 3TVDA 3I64A 1D2CA 3OX3A 3IXQA 1MF7A 3TPZA 1X15A 2ZIUB 1KZYC 3I9OA 2OXCA 1G64A 1M66A 4XIIA 1A7JA 4ME6A 3DLIA 3OIGA 2XYVA 3O1LA 1U63A 3H6KA 4R1OA 5CM8B 3WKAA 1FS5A 1ZK4A 4NIMA 4TQ9A 1VQ1A 2C4TA 1LUAA 3STTA 1RXWA 2EEPA 4UDNA 5EKTA 3PNYA 4ODIA 2BWJA 1FDRA 1N3LA 2QPLA 2PAFA 3FH0A 3O8NA 4FN4A 1Q5PA 2PVPA 3LVQE 1SD5A 4NBRA 2H4HA 2A0KA 3BWXA 1DQYA 2O2SA 4MJ7A 3RLIA 5EJ9A 4RD0A 4YECA 3UHAA 3ICPA 3ROPA 2HA6A 3RGWS 3C41J 3MBKA 1IL0A 4GX1A 4BO7A 1YDWA 1K7FB 3HXTA 5KTOA 1PL0A 5JDIA 1G2PA 4FBGA 1DKUA 5JZSA 1QG6A 1AG9A 4WNAA 2VP5A 3RJZA 3Q7QA 4O4IA 1VMKA 4ROTA 4B0PA 4ZT4A 2RCNA 3FNQA 2AJ8A 1EXNA 2REQB 2WJGA 5FAXA 2BGMA 4CGYA 3QX8A 3QXSA 3LOPA 3AHFA 3OLVA 4G23A 4GXTA 2XT9A 2C9OA 3F98A 2HYDA 4Q0MA 2V7XA 4EYQA 1P18A 1JR4A 1JHOA 2H4XA 3PR2B 1KVQA 4R9SA 2F17A 5ER6A 5BPFA 3QJYA 3B82A 1GUFA 1HOXA 4U4AA 1B42A 4A2WA 1QO0D 5CFRA 1U0BB 4OIMA 1X1DA 1UWVA 4ZVLA 4HWSA 2AJDA 1CJSA 2B8NA 4MITA 4C14A 4J2OA 2D2XA 2C8KA 3ENWA 3FDIA 5K2MA 1TMKA 2Z6QA 5CYFA 1RYFA 3ZLVA 1RWPA 1UT8A 3C7DB 1U2RA 1XJ0A 4P31A 3LV8A 1F5SA 2Y0CA 1P1BA 4AFNA 1BIFA 3RF6A 1LU9A 2QK4A 1YUNA 4HNAA 2DFPA 4IBOA 1W59A 2B8WA 4XUDA 5CA1F 1O2DA 4RH3A 2QD1A 4QNRA 4ZWNA 4GPBA 3SC6A 3CMMA 1X7XB 4JZYA 3SYRA 1H2AS 2QR3A 3C8HA 3U1TA 1PSZA 1U5CA 2R84A 4CM8A 4DARA 1PR5A 4PX3A 1ZIXA 4MWZA 3VR5A 3N2KB 4C21A 1B8NA 1F7UA 1SCJA 2I7DA 1KSHA 3FMVA 3IULA 3SC2B 2KE5A 2ZYUX 2Q5LA 1P7PA 2I1WA 2X5NA 4OQMA 1Z88A 2YZMA 3JWGA 3AB3A 1SHKA 4YI3A 5ELLA 4DQVA 4E5UA 1WDKA 3FA2A 2H85A 4UHDA 4EMBA 3DDSA 3O8DA 1ZNXA 2J3LA 4UUOA 3TL3A 3WL5A 1CS0B 3ZE9A 6ADHA 1L5QA 4DY6A 3L1JA 4HATA 2JARA 1U0JA 4QXOA 1C8VB 1ML4A 2Q8PA 3QENA 2X9GA 4XGIA 1F8UA 3EIEA 1YE8A 2IEDA 3MCAA 3P2JA 4BNJA 4UZEA 2HIMA 2EBUA 1Y9ZA 2HTEA 1XTUA 2ZOSA 3EQ8A 3FYTA 3N6RA 4B8YA 5JAMA 4B6RA 2WZCA 4BO4A 4UHEA 3FTEA 4ZT7A 4FT4A 1Q1AA 2GWRA 1Y4ZA 3N7UA 4NFSA 4ENTA 2W6ID 1FX1A 3IYLW 5GOTA 4GM4A 4MGEA 3IBGA 2R85A 1LLCA 4U8HA 1NJFA 1QORA 3OOHA 4K9QA 1I7NA 2AK3A 2AMFA 3E53A 1KYXA 3HFJA 3OOYA 4PY2A 5FO0A 4RV5A 2AOVA 1FYWA 3GJ6A 1F4LA 2JATA 4OHOA 4BUZA 3OSUA 4K87A 2DERA 4FLEA 3USES 4BFYA 2MMCA 2DQ4A 4H7FA 4GFDA 2GFIA 4HAVA 1QF6A 4RJJA 1OW3B 3QG1A 5B6JA 2OESA 2VCYA 5BQ3A 5BSEA 4NOLA 3TXAA 2OEPA 5BW6B 1HDYA 2V7QA 4R1LA 3DAHA 4OXIA 1OTXA 4YP5A 1OILA 3QG5A 5HCUA 5TMDA 3BPSA 2Q62A 3KJEA 2QZSA 3NFRA 4XD2A 2X1LA 1E1NA 3TF5A 1Y6FA 3Q3GE 1XRSB 4M1EA 3K20A 1WABA 3MUEA 1EVIA 4KDEA 5KNDH 1ULHA 4C04A 1FIUA 2Q1UA 3M1AA 1Z08A 1I4WA 4MGIR 1M5UA 2O8NA 2QI9F 3KPJA 3OWOA 3UK6A 3S5UA 1I3KA 1IG3A 2O3SA 1YCGA 3LYUA 2REQA 1V39A 5I7SA 3R5XA 3PEYA 2B92A 2QE6A 3FSGA 4O08A 2Q07A 5CVJA 4YXFA 1QP0A 4JSTA 2DJ5A 2DFTA 3CE9A 4MWDA 5ALKA 3HXMA 4TLCA 1P1CA 2ZRLA 4K81B 2P2GA 4ZCQA 2O3TA 4RFLA 5ED4A 1HE5A 1PVDA 2ZTUA 3KB8A 3QX9A 2NP7A 5J2TB 1P2GA 4MJLA 3T5PA 2XKAA 3V4OA 4MUFA 1MQSA 4WZBE 4YBRA 5EMNA 4ND2A 1K8XB 1M1YE 3JAMA 3NXSA 2G5CA 4TRJA 1H1TA 3B6MA 4DLNA 4JQYA 4IUDS 1P9WA 1W0KD 2OFXA 5HYVA 4QQNA 5EVJA 1DARA 4G9GA 2QLFA 3LQRA 4ZU1X 4LBZA 4NZMA 3WLQA 4AXXA 3KQWA 5JJBA 1VLQA 2JJ2D 1LA2A 1WX1A 2E1PA 2J30A 3KCQA 3NTOA 2LR0A 1PT6A 4G0UA 2A0WA 5DXJA 1RJ9B 1X7XA 1OU4A 2Y0BA 1ESMA 2I3DA 4BTLA 1CRLA 4M53A 4A3SA 3E48A 2HI0A 1JUDA 3N2KA 2NUAB 1XEFA 3AR6A 3CX7A 3SC2A 3TZEA 4QA9A 2DWUA 1JAXA 3IE2A 3AC0A 3GJQA 3R7NA 3DE5X 1CEEA 3SLKA 5FOUA 2C7RA 3G9XA 1FRQA 1TRKA 2FRVA 2POQX 2SKDA 1PR2A 4WHMA 4XR9A 1QP8A 5ERXA 1BN6A 3ZDCA 4V0LA 1DT3A 3C1TA 1CS0A 1PR6A 4NYIR 1P3JA 4PSUA 4QXPA 1ZRSA 3TSAA 4BE7B 3IKJA 2Q0SA 2YYSA 5EIEA 3BSWA 4TMKA 3FLMA 2ZDQA 4B6QA 5KNBD 4L72A 2XMBA 3HO8A 1LC0A 1VJGA 1OV4A 2WM8A 4EG4A 2MTBA 1WXXA 4BFZA 5AXDA 3JQQA 3KCNA 4FDAA 1REQB 1U3TA 2Z56A 3TIIA 1VIMA 2GPSA 7REQB 1FTQA 4LZAA 3K2BA 1Z0AA 1Z56C 3UKDA 1H6AA 3GJ0A 3HA5A 3ZU3A 3IEPA 3O82A 1SY7A 3WRWA 3TYXA 5L4LA 3T1NA 4FZVA 2PLAA 4I3HA 5A03A 3KLPX 4X90A 3WWPA 1F0PA 2YFHA 4HLCA 2GF2A 4JGGA 4NEHB 3E7DA 1TZCA 2JANA 4GR5A 4RA9A 1Z6XA 1QK5A 3OOJA 5A2GA 4WASA 3D1VA 2WWWA 4ETIA 1IOWA 1NXWA 3PXUA 1ZVJA 3DZ8A 1PRYA 1XKLA 3KR2A 3L8CA 4L16A 5B7GA 2G04A 1JL3A 2IS2A 821PA 5DI9A 1EWKA 4QC2A 3LLVA 2J1LA 3VR6D 4TTAA 1ZCBA 2OHHA 2QB5A 4LI0A 4OU4A 4OF4A 3PDIB 4XQ0A 4DHWA 4RY2A 3ZV4A 4ADSG 1JHXA 2FRXA 4CIDA 2O0KA 3HKCB 5EJAA 1EK1A 1H1LB 3PRYA 2P1DA 2G08A 3KQUA 4YRIA 4KREA 2KMLA 3OM8A 4CR7A 1GRNA 1II0A 1SOAA 3PUVA 4MV5A 1PFWA 4A5SA 4PZ9A 1CXZA 5J2TA 1NR1A 1RVV1 1PR4A 2I22A 3BIXA 5CVEA 1ZX1A 4NCBA 2A0XA 1ZMXA 4M1MA 1HK7A 4TMVA 3AUUA 1L4HA 1XWFA 1D3AA 1KOJA 2PY6A 1X87A 2XSZD 1UOEA 3L0DA 1L7VC 4R1UA 5DN6A 5BSMA 5IJ9B 1DC6A 3RTEA 4Q4LA 2XB2A 3JWJA 3I6MA 4JYZA 1V7PC 4HQRA 2ZQZA 2Y1DA 2D8AA 2WU3A 3PFWO 3UMVA 4C5AA 5DBIA 1AIPA 2AZ4A 1JGTA 3JVVA 4G25A 1M0SA 3ER9A 5NLLA 1K88A 2IYUA 1IBRA 2P78A 1GGFA 3BMQB 2N1BA 3HLTA 3N7TA 3N8HA 3O1HB 4JDPA 1RJ9A 4FQ5A 4PPYA 3E8MA 1OBVA 2NN3C 4F97A 3PXGA 2NUAA 2E4AA 2K5UA 3MRVA 5I7WA 1SC4A 2IOQA 3DWEX 1QH9A 3AIIA 3E5MA 4M55A 5ALFA 4COOA 3P96A 1P6XA 1J00A 3IL2A 4B3GA 4EKEA 3K09C 1QKJA 5LYJB 4XD7A 1XCPA 2I5PO 1MO2A 1Q1QA 2J5BA 4JI3B 2DBRA 3CLRD 4EHNA 3TS1A 5DSTA 1A50B 1PL6A 2FKAA 2JA2A 2ZGVA 3PD1A 5AJTA 3S8YA 1WW8A 2CJPA 1YBAA 2GYVA 4OAOA 5JH7B 1L8XA 1TOAA 3O2JA 3PLAE 4MV7A 3OOSA 3PQCA 2B78A 4GQAA 1ZI8A 3MTQA 2C5FA 3ZW9A 1UBGA 2O3UA 3OJ0A 4IOLA 1XPRA 4QJIA 1D07A 4BV2A 2KS6A 1V5EA 3KEGA 1NI3A 4BMDA 1REQA 4RTRA 1MT0A 3W06A 3FYUB 4CDGA 1EQUA 1OJLA 2BGNA 1OZAA 3TOSA 4P3NA 1M1UA 2BDUA 1U3DA 5TQ2B 2Y0DA 2IBMA 3QPAA 4CXMA 1R6BX 1G3MA 3AB8A 4OQLA 4E07A 5LMNB 4NABA 4YH1A 1G5RA 4ZZ1A 3GRVA 1CP2A 1SOUA 1HT1E 1RAFA 3BJRA 3A6DA 2KLHA 2WSBA 4ERXA 1JXMA 1UPCA 3NEJA 4AO6A 3FCXA 2CXPA 4IDGA 3AEZA 2UAGA 1LF5A 2Q3EA 4OXKA 1T9GS 1WQ3A 4UNNA 2DWQA 4MDEA 1PWEA 4Z1MD 4CMAA 1EHCA 3HBMA 3HJAA 4UU1A 2GTPA 5BQ5A 5BSVA 3UPTA 1XQWA 4HX5A 3LT1A 4JB2A 5HG0A 1IM2A 1VLZA 3HP4A 4RETA 1I3MA 1QR2A 1F51E 2C4UA 1JG6A 2IEZA 2ZYDA 3JZIA 3KT8A 2EQAA 4HUTA 3DMNA 1TF2A 4V24A 4JLJA 4RVOA 1P2FA 4DSZA 1U02A 2RSLA 1A0OA 1Y1LA 1Z4NA 2VHUA 4QGBA 5FPQA 4F4HA 1I8TA 1RXIA 3R4VA 4OQNA 3O3NB 2CN1A 3ELYA 2VAPA 3H2IA 2Y4OA 1RKXA 1A96A 3FMFA 4UTOA 4BZWA 1D9ZA 3O7WA 5CDSA 2RAFA 5ITSA 2AFIB 5JDIC 3PDIA 1ZA2A 2QENA 1YQ9A 2Z8YM 3D6MA 2KYRA 1VIVA 3GVCA 3EMKA 3HKCA 4GWLA 4RD4A 1H1LA 2B2CA 4U9IS 1T8PA 3N0TA 2AX3A 4M0CA 3BFPA 3JV7A 4UE2A 5LZ9A 2KJQA 4DIFA 3WFJA 1ACMA 1TPYA 3RTCA 5CK4A 5L6LB 4Y9SA 1THTA 3K70D 4X8MA 4EGFA 4IV5A 5DF1A 2KBEA 3FJOA 1YC5A 3HP1A 5DBOA 3SXPA 1EVKA 2WHPB 4N8EA 3W8NA 1NI5A 2XMPA 4B76A 5IJ9A 1X8JA 1Z4MA 3OZSA 3GF4A 2LNDA 5CX4A 1Z12A 2XLBA 3QHAA 4GAEA 4HC4A 2JI7A 2FSIA 2Z09A 3RRXA 1N0UA 4F8EA 5CIYA 1ODCA 4M87A 1ZRHA 4DZTA 2P9BA 1AGRA 4MZXA 4LVUA 2PQ6A 2ZRKA 2UVQA 5DK4A 4MP6A 3WGHA 2V1UA 3BMQA 4B31A 2DMRA 4ENPA 2Z3VA 1LV7A 4FYMA 3BH6A 1RXVA 2J85A 1MOSA 1QMGA 3O75A 2ZE8A 2JEYA 1W4LA 3E9CA 2D06A 3KR9A 3WICA 4H3VA 1XB2A 2FPRA 4C0AC 2PUFA 4W7IA 4KX3A 4UHHA 5MFZA 2XMQA 4LHXA 4KRFA 4KVGA 1RHKA 1VJCA 2BELA 2VBGA 3DMRA 4YWHA 1B2LA 4D3SA 1P1HA 3OPNA 4GOJA 3CPHA 2DYKA 3CRW1 3PWKA 3CZ9A 4OAQA 5LYJA 3TK1A 5GGXA 1DXQA 5CT4A 4D9CA 1DG3A 4N03A 1TTHA 3U44A 3OZRA 3DKRA 2EJWA 1HZZA 1QZZA 5HKKD 4XIYA 5JD5A 1A1VA 3CC8A 1MP0A 5HRUA 3RUHA 4P38A 5JH7A 1Q0PA 3RIXA 1EBFA 3RU3A 3CUKA 1HE2A 3Q7RA 1U9IA 2E5FA 4KJZA 5P21A 3LGSA 3K6RA 4MVJF 2QTBA 3T4XA 4MVXA 2WIAA 3H4TA 1OC4A 3FYUA 4I1IA 1RRFA 3HFSA 3DBLB 1SBNE 2ORIA 3AY0A 4Y9RA 5TQ2A 4UCQA 2CB9A 4TS4A 2A58A 3LPDA 2P8SA 4XVRA 6CHYA 3HGQA 5K8IA 3OZDA 4W5OA 1EVJA 1NV9A 2VSNA 4ZVPA 3LLCA 4BEVA 1MAHA 3TKLA 1C9YA 4MQEB 4BV8A 3K31A 4TTVA 3ON5A 1WKCA 4HJXA 4XUCA 3T5AA 3TOVA 4H18A 1F8YA 1GRRA 3EUAA 1Y1TA 1WPQA 4N6NA 3V8RA 2WJVA 1MIHA 2C2GA 2Q0HA 2BM8A 1ACJA 2XKBA 2JJ8A 2WWHA 3GNSA 5AT1A 3RRJA 3F8TA 3UAVA 3V32A 3AOEC 3WSVA 2OFOA 5EPUA 5FPYA 1Y4UA 1XDSA 3VR5H 1BHJA 2GDJA 2JNWA 2YJ5A 4N5LA 2FEWB 3BIOA 4OSEA 3TINA 4WGFA 1G4AE 4ZVNA 1KRHA 2GWHA 3OZUA 5TMBA 4MOWA 3CT6A 3HXKA 1MIOB 1UC8A 3VOSA 4JWKA 2GM3A 4YPOA 2IPOA 4MJXA 3EPPA 3KS9A 4LYYA 5IARA 2EF1A 4Y9UA 2DBZA 2AFIA 5E95A 3ODGA 1ZNYA 4HGOA 4J4TA 4YC7A 4BJHB 4C7JA 5EJEA 3DMDA 2QI9C 4D8WA 5J1SB 4RTNA 2PR7A 4DB2A 5MGNA 5KNLA 4CCAA 2OPHA 3RTDA 5U4XA 4Z4EA 1R66A 4Q21A 5IVHA 2W2PA 2REBA 3RDPA 1H65A 4B32A 2GHQA 4Q05A 1Z5WA 4R05A 5DMHA 3ZE8A 2BIFA 2BL4A 1ADYA 3S5JA 4PQFA 1E32A 3ETLA 1Q91A 1CF9A 2VT3A 3WZLA 3HM9A 2WHPA 3DUWA 4WINA 1F60A 5FB3A 2V7EA 3C6QA 5I8PA 1JALA 3EZ7A 2X2EA 3FZNA 3Q1LA 5KSPA 5KWSA 4M9ZA 1QKKA 2V7GA 3DHVA 1E2GA 3MWGA 4XVQA 4F6LA 1HRDA 1UBMS 3PEFA 4EDHA 1P7VA 2VHYA 3TLJA 1ISGA 2GD0A 1M34E 1ZOLA 3A25A 3IVXA 3OU6A 3SSMA 3TTXA 3NUZA 2WEKA 5GY7A 2Q4TA 1UKBA 2PKCA 3RUCA 4Z9XA 2RG1A 1J07A 4YCCA 5KWVA 2BI7A 2C2KA 4I55F 4I9NA 3ONWA 1BO6A 2J67A 3PK0A 3ZQJA 1EX6A 3A1SA 1NZJA 4LF7B 1YL7A 2Q1TA 4P58A 1C41A 1WD7A 2WK1A 3Q3HA 3UW1A 3RKUA 2VLIA 3PFCA 3OQIB 4IPTA 4KWCA 2Z3WA 3BK1A 3RHSA 4FDLA 3CRNA 3OMXA 4GRDA 4NHOA 4RXTA 1KZ1A 5EE5B 1JDBB 4L3WA 4ERNA 3R5SA 1AKRA 2G1KA 5LC1A 5KSOA 2DLNA 1RFLA 4DLYA 1RPAA 1JP7A 3GDOA 3L0BA 4X3CA 1KMHA 4ARBA 1N2EA 4BYGA 2JAOA 1ML3A 2BC9A 3ET5A 3TQFA 5G4LA 1AQNA 1A82A 1QONA 4LWZA 4P36A 3FCYA 4PFJA 3TVYA 3FB4A 5JSZB 3DBLA 1YZLA 1ZXLA 1WOYA 4IP0A 3U62A 4ZQHA 4DV0B 1R15A 2A9JA 3K32A 6YASA 2YZ2A 1NATA 5L40A 3OF3A 4LJ6A 1ADFA 1CZUA 2FW8A 3H2HA 2BTQB 5H9VA 5BUZA 5HTOA 2B4AA 4LQ4A 1VE3A 1IN1A 4P2GA 3HHEA 1E1RA 4ZVUA 1JG1A 4MQEA 5ECYA 4HWPA 3KJNA 1ISMA 3OEHD 1XNRB 1DX9A 4PBRA 3S2ZA 3DTTA 1DRKA 1L1EA 3S4YA 1DP4A 3B9RA 5L7WA 3HI4A 3ZBQA 1N0VC 2QVBA 3EA4A 2ODNA 1YKFA 2WZBA 2P5SA 1PCXA 4KQKA 2CVZA 3T1QA 2FUG1 3ED5A 2XWPA 3HYSA 4M9XA 1XYVA 2W6NA 3ZU2A 4V39A 1ZK3A 2FN3A 1RHMA 3QU5A 1XQ6A 5CDYA 1BRTA 3W5SA 1USKA 3D5TA 1W19A 3F3MA 2HBZA 1C8LA 2ZS8A 3IP1A 5K1ZA 3ZZ0A 4EPWA 2WPDD 1RQ7A 1Z0SA 4MAMA 1MIOA 1U99A 2WM9B 2R00A 4N9QA 1MH9A 1Z7BA 2FSGA 2JJMA 2POCA 2R79A 1X3LA 3QVLA 1Q0RA 1W2WB 4M9RA 5AKHA 3SSAA 3NHAA 5EINA 2WU4A 2YY7A 4OA5A 3LQFA 1N92A 1CZOA 1EXWA 5AI5A 5DP2A 3OETA 2G67A 3CVOA 4HDOB 1KY4A 5TRTA 5C5EA 1V9LA 3ICCA 1KK0A 1E1YA 4A4DA 5HSGA 1XAGA 2W2TA 1GCUA 2YCBA 1GTZA 2FVYA 4TKZA 3RT9A 2X1VA 5AJHA 5F1YA 3G89A 4YAEA 4GLBA 3G02A 2P79A 2O5CA 5GIPE 1VRWA 4IGFA 4RM3A 3DPSA 5IYZB 1BE6A 1UXOA 1BTOA 1XLVA 2BCJQ 4XLTA 2XWQA 4WKPA 3TX6A 4MTCA 1AKVA 1GZ7A 3MXOA 3MN1A 3O9VA 4GVXA 4AZTA 1C3OB 2EG5A 2FEAA 4C30A 8ABPA 1ZUIA 3GO4A 2N42A 3CEJA 3PUHA 3PICA 5HMMA 5AW3A 3AVTA 4WXEA 4C5BA 4F3TA 1M6HA 1G5QA 1SUAA 3CSUA 2A9QA 2TMGA 2W4IA 1PJQA 2WD7B 3Q6NA 4GPD1 4JJ7A 1FFAA 1POXA 3G9ZA 3ZXUB 1SC3A 1ELOA 1M83A 3QLTA 3SIXA 2ZM5A 3PQ6A 1SOMA 3OQIA 3GLIB 3H1EA 3I2YX 1SZJG 4NENB 5HBRA 6AT1A 3MCUA 4YV7A 1TGVA 4JVSB 1O54A 3ETDA 4IAOA 4Y7CA 5KVVA 4PYNA 4M89A 4YXWA 3GG9A 3OCUA 1JHZA 1FUKA 3PXAA 2ZP1A 1IEQA 4FIDA 4BC1A 2IV7A 1ZS9A 2D2EA 2IHTA 4FUQA 1IUKA 1FX0B 2MYNA 3WBJA 2VJCA 5KQPA 1XMSA 2JLRA 2CEAA 3TDMA 1SU4A 2CXHA 2D1QA 3NV7A 4CM3A 4K6CA 2X7HA 5GZ6A 5JMOA 1ORHA 3ZGLA 1AH2A 1MCZA 5HRCA 1TKBA 2ON6A 1FCJA 3Q3JB 3PL1A 4UBNA 5ALVA 5JSZA 1QQAA 2EZ4A 2OMKA 3PFFA 1TRHA 4QQKA 4Y8VA 3ZDYB 4CLDA 2IHNA 2BZSA 2FPMA 2IE0A 3F5MA 4Q7JB 4MUXA 2RGAA 5AKYA 4JA2A 2BTQA 3T3HA 2OGZA 2PZBA 3ZE7A 4ZEOA 4QT4A 3DAOA 4UU8A 4IH4A 2X5JO 4D8UA 2R6DA 5LQKA 2ZS9A 3FUXA 2V5AA 3ZWAA 3KYDB 4RKWA 1VMAA 4JXXA 1Y98A 3U4DA 2IP1A 4AIRA 1Z4PX 3GVIA 2E3JA 3HN6A 4S04A 2JKVA 1WIWA 4JENA 3R77A 1E3JA 1CEQA 2PUAA 2HIGA 3AF5A 2EZTA 3CR8A 4IMRA 2RH4A 5HDQA 2IPNA 3RU2A 3TW6A 3ZWBA 5IJWA 4HVAA 3LC0A 3K0KA 4ICIA 1V4BA 1JQ5A 1HYQA 1PD0A 3PSAA 1ZBQA 3R3JA 3VU8A 1EFAA 2I1LA 4HAIA 1GRVA 4CTNA 4MGHA 1T0UA 4G41A 1HC7A 3A9SA 5AM3A 1ZK1A 1V8FA 1KQNA 1U0HC 4RBNA 2VDWB 1D04A 4LECA 1FFGA 3D8SA 4XZ3A 2C2HA 4X1IB 4P3OA 2K7FA 1SM4A 3SI7A 2ODAA 3DG9A 4WK6A 3I53A 5DJ5A 4BVBA 2B3DA 2UDPA 5EXPA 2GM4A 1EBBA 4MUJA 3E9NA 3VGPA 5A4IS 4UOQA 4EENA 2QXUA 2YR0A 1E61A 1NWCA 2PL3A 3QUBA 3L1VA 2GMWA 5UKDA 4OK6A 1V16B 4AZSA 5A06A 3BAZA 3VHLB 3ZLTA 3OQOA 3UJDA 1IBMB 3SVLA 3AI7A 1NNI1 1TYEB 1UBEA 4NV0A 2B4YA 2YJGA 3LCJA 5TF0A 3V7YA 1YJCA 1T9ZA 2FWNA 3KO8A 2QLLA 5IYZA 4QQRA 1RQPA 4LF4B 1JBEA 4B3CA 1E0SA 1XZ8A 4XYLA 4C0XA 1C3OA 3EFBA 4DV3B 3D0OA 3GYGA 1AN9A 4CODB 1G8JA 3VJMA 2B25A 2C3OA 4PN3A 1FYXA 1VA4A 4IXTA 3Q9UA 5CW1A 3FHOA 2XVMA 4D97A 2YW2A 2H2FA 2IA5A 1SUSA 7GPBA 2YXBA 1B00A 2WD7A 4DBLE 4RQTA 1KKLA 6Q21A 2P2NA 4L9SA 1IWBB 4YCJA 2VPTA 1I13A 1MU0A 2AW3A 4LTNA 1WM1A 1WVMA 2ZIXB 2ZWVA 3F74A 2W8ZA 4HN9A 1B0ZA 1TFUA 4GZMA 2DUUA 4S2UA 4KQXA 3EG5A 4NENA 4TL9A 4QZVA 1V8BA 1W52X 2GEFA 2JAPA 1XBTA 4G26A 4EG3A 1PQYA 3COVA 4EY8A 1XEXB 4BP3A 2VUSA 3ZHUA 4OHYA 4Z0TA 3BD9A 3AVQA 4IHAA 4HNSA 4JBNA 1GZ5A 4JZKA 5B3LA 5CB4B 2RB5A 4PSAA 1DQSA 1FX0A 1HZZC 1LPOA 1NW8A 3GT4A 2R7MA 3OZBA 4ZT6A 1IHUA 3GUVA 2IUYA 2I8CA 5EESA 3K4HA 3T5DA 2W4QA 3AX6A 4R3WA 2GO7A 3K94A 5BRNA 3ZE6A 3AR3A 2FF7A 2B82A 4BJ1A 5JC1A 3LXXA 3CIFA 1XD8A 2YOHA 4M1YA 4ZYWA 1VKNA 1EE9A 4H4EA 1EWVA 4N3CA 5EL0A 3ROGA 3L7LA 4C03A 3AZQA 3FYUC 1SBQA 3COYA 3MNFA 4KTVE 3KKPA 3DH0A 4UXJA 3G0CA 1Y6JA 1GLNA 1PZFA 4GICA 3KYDA 2FPLA 5C5CA 2ZIAA 4TL7A 1EM8A 4MUYA 4I1RA 4Q1BA 1SVNA 4E4TA 1MA0A 2IBSA 4NI5A 3TZBA 2JZOA 2MSKA 3D2BA 2I99A 3E1GA 4BLRA 4D45A 3NB0A 1P0CA 3OJEA 4X5OA 4E33A 3EULA 4BKUA 4EI2A 4IICA 2CBZA 3IA7A 2GCGA 1GG2A 1XXHE 3IO3A 4NG4A 3KBBA 4E88A 1I7DA 3ZGZA 2CDAA 1JI0A 2XTAA 1R3DA 1XTQA 1XI2A 2QUAA 1PUXA 3IDFA 3OT5A 4INJA 4R1TA 4YB8A 2A9RA 3KJZA 4EGAA 1FSSA 1PT7A 1Q3TA 1YE3A 2JL1A 1PG0A 2OCBA 2VP4A 2BE9A 2G8LA 3OTHA 4TT8A 2HA3A 1XDDA 2O20A 3QWHA 2E37A 2VDWA 3D4OA 3VR1A 3G23A 2BFAA 3HBJA 4P6VF 4EZIA 4US2R 2JJ2A 4X1IA 1C81A 1TGYA 2C8LA 3EGCA 4NZPA 4RIFA 1KQGA 1BD4A 2ACKA 3DUFB 4IZHA 1VP3A 1NT4A 2ZYAA 2VPPA 2ZS7A 1H1DA 4CEHB 1EFHA 3ZJUA 3N9IA 3WK8A 4C08A 3KTOA 1AX9A 2ATIA 3PUIA 1GAQA 4YROA 3ZC3A 4F1WA 3THXB 1H3NA 5HQJA 1HX7A 1XMQB 1V16A 4NV1A 2G6TA 4BP8A 2YWGA 3AFGA 3CONA 1ENOA 3IQWA 2L19A 3Q87B 4M2LA 4RVDA 1R37A 1ZXXA 1A04A 2CL0X 2IFTA 3DEJA 4MRNA 4N54A 4Q7KA 3MS2A 1MJ5A 2ORWA 3G2IA 1GEGA 3ADPA 3K30A 4IVPA 1O95D 1KZHA 2C29D 4UXIA 4JLMA 1Q7BA 1KI1A 2QU7A 2JGDB 3MCVA 2ZWAA 3NGLA 1ZMOA 3GEGA 1JX6A 3FYCA 3P5BA 4JOBA 5KNBA 1YZUA 2M2IA 2YMPA 4OGKA 2XCOA 3ICOA 4LQDA 5HMLA 4JFRA 3I9NA 1RJGA 4MW7A 1H6BA 4BOYA 3GLFE 3UJ3X 2PRKA 3Q12A 1P5ZB 3HNPA 1K6IA 1U2QA 4TYWA 4RSHA 1H8EA 1RCUA 2ZIXA 2XMZA 3O9ZA 3CUUA 3T4UA 1TQHA 2AG6A 3WMGA 3ZJ5A 4Y1FA 5J59A 1T2NA 2HT6A 2BI4A 4PZDA 1EK6A 3IPLA 4HL6A 1I2ZA 3H1FA 3I2GA 1XEXA 4OHUA 1VDZA 5GM2A 3CR3C 1Y37A 2LDXA 1CVLA 4MPTA 2W83A 1I4EB 1P2VA 4J4BA 5CB4A 1XNQB 1JDTA 3VC3A 3NATA 1FLNA 3QITA 4IJVA 1GGNA 1QTRA 5CB4F 4JU8A 1MFPA 2PLRA 5G4KB 1EFTA 3DBIA 5GJCA 3H65A 4NBUA 4D9KA 4X91A 4CV3A 2LKDA 3AETB 3O8LA 3A11A 4DJEC 2E87A 1G60A 2XGJA 3TZQA 4D9MA 1QTNA 3SYMA 4EX7A 3OA0A 7ADHA 2B5VA 2GCIA 1CF2O 4GL4A 5EKSA 4NICA 1CQWA 4BMXA 2ZATA 1FP6A 2QTNA 1J42A 1L4FA 2LP4Y 3AR5A 2GNOA 3BD6A 2VHXA 3NHSA 3QA3E 2QP9X 5T6BA 3MGKA 4RXUA 1Y4SA 2PKQO 1H3EA 3BJZA 4MLPA 3VPSA 5JO0A 4GX2A 3SDZA 2GHIA 5D1HA 3N1UA 1FYVA 1FU7A 4K3UA 1VJ0A 3L7AA 4DJTA 4DWJA 4EGQA 4L7QA 3NHRA 3IDOA 1UP6A 3OA2A 2MDTA 3FX2A 1DO0A 3MMPA 4RNDB 2X7JA 1ORRA 2EJCA 2Z2ZA 3UNXA 3M3DA 1XCMA 2GM5A 3BH0A 1DHTA 5F1OA 1ZR4A 2FGJA 5IASA 4RVHA 2QRHA 1XTVA 4LJLA 2QSYA 4FK8A 1EA7A 2XA2A 1X1EA 2BKXA 1LDEA 3KFXA 3M6MD 5JHHB 1PT8A 1CIVA 5GAJA 1ACLA 3V46A 2I91A 4XW2A 2R62A 4I81A 1PK8A 4TKVB 1I80A 2HL6A 5DM0A 3SJCA 2R86A 3FMIA 5IC5A 3AR7A 1LVGA 3FGZA 4IY1A 2JGFA 1N7IA 3SDBA 1NVVQ 1PJCA 1XP5A 5DCYA 3PENA 3DUFA 1GG8A 2NPOA 1RIIA 1W48A 2QX6A 2R00C 3CWQA 4ND1A 2EFDB 4DV4B 2PJZA 2XRMA 3PCTA 1U5BB 3HCPA 1B2RA 4KODA 4Y3UA 4L28A 5C0OE 3VNAA 4EZEA 1ID8A 2QRUA 2HLHA 2NXNA 2QDKA 3THXA 1Z0JA 3PQFA 3IO5A 1SC1A 2V4MA 3COSA 4OX9B 3TXYA 4AKIA 1L2TA 1FVHA 1D2GA 2R97A 4K46A 5C31A 3T5GA 1NUHA 3NTQA 4K03A 4S3MA 4ZQFA 4P0PB 1G1AA 5DTIA 1UAGA 2PO7A 3A9WA 4RZ2A 1C7JA 4I3GA 2F9LA 3T9DA 1KZ4A 2F6RA 4S1VA 2OV2A 2QDXA 2QGFA 2ZB4A 3DXZA 3MJTA 2JGDA 1F2VA 3AEQB 4V02A 4F5EA 1FFSA 3ANMA 3E81A 3KQQA 5FX2A 3VU9B 4QEDA 1QP4A 1TZBA 1KI2A 3EOZA 4LOJA 521PA 4PHTA 3FYSA 4N82A 5LP6F 3AW8A 4JUIA 3WY9A 3MINB 1DOHA 1PJAA 3E22B 4J0EA 2JD0A 1NF3A 4QLAA 3U26A 2JPDA 3V3TA 4B3BA 2QRGA 4ZCTA 1U1FA 5D7BA 3M8KA 1PWZA 1B23P 2YN4A 4BLPA 1PFGA 4A92A 4C1BA 3H16A 5FRDA 1MTZA 4U2GA 4G0NA 1XPJA 4WMLA 1TJPB 3VDXA 1T5HX 4LFCB 3OQ1A 3DC2A 1ZUWA 4XM0A 4J29A 2BMVA 1JIKA 4ZVSA 2DR0A 4B80A 1UDCA 2QQEA 1IOZA 5F2EA 4CKWB 4KR2A 3K8QA 5YASA 3GUCA 3DDHA 4BJ6A 1DFHA 3QH4A 4RJLA 2ECKA 5ARCA 4ID9A 3R5TA 4EFLA 4J7XA 3K0AB 1JDBC 2IEBA 3QELB 2J45A 2G07A 3DZBA 3GLTA 4QYWA 3C2QA 4KE7A 1HKHA 3AETA 3RSLA 3VSAA 2JVJA 2Q1SA 3A3KA 1PLLA 3HU3A 5EKXA 1RSZA 2ZJ5A 4CMIA 1XEWX 2FDRA 3KZVA 5BYBA 3RODA 2ID4A 4KX5A 1N5DA 4D4LA 5FDFA 1G0NA 1LKZA 4B46A 3U37A 1W46A 4Q9HA 4A8PA 5HKAA 5BUSA 3ONEA 3ZHVA 1BE8A 3ENZA 1AO0A 1TD1A 4G4JA 3OCWA 4QFCA 5FWYB 3ONFA 2AEEA 4OO3A 2DZDA 3TRDA 2Y1CA 2CVHA 1PKEA 4DIKA 3LCMA 1U7UA 5G0UA 4LSWA 3ST7A 4A0FA 3B5JA 3GPLA 2A94A 1DTEA 3QVSA 3MWLA 4BASA 1CB7A 4S05A 1HQYE 4L22A 4DNXA 1SU8A 2G77B 4QYSA 1HDOA 1KMQA 4TKLA 4YACA 4ZKDA 3LA8A 2A2ZA 4OHZA 1OLUB 1U90A 3LDHA 2YVUA 1ZDMA 3FOFC 3PC6A 4JAVC 3VH1A 5F9MA 4EGJA 4TKVA 4JT2A 2G70A 2ZKIA 4ZZ0A 2DC1A 4I5GA 2AD5A 1XP8A 3KLNA 2PS3A 3H84A 4YUYA 4YHBA 3D2AA 4UHJA 2MYTA 5JCJD 1E3QA 3B48A 2W00A 3P52A 3P9XA 1TYBE 3PKJA 2EFHB 2C3MA 2AB0A 2R8EA 4FNMA 5AJVB 2O59A 5GONB 1CJMA 2OECA 2YY6A 5FR2A 4CFYA 1U5BA 4RL6A 4TMTA 1ECBA 1TC2A 3HFRA 3QFCA 4WZBB 5A71A 3H0KA 4BO5A 1WB5A 1MVOA 1EEXB 4EY5A 4RCVA 2UUAB 2REOA 4TYYA 3F8SA 4XJTA 4G36A 4Q34A 3P2EA 4QKQA 5H4GA 4AMBA 4DCTA 4MARA 3BE5A 2PRYA 1AZTA 1XA0A 3IT3A 3V00A 4L4SA 1NP6A 1OI2A 4CYMA 1EVQA 5HZHA 2NIPA 2OCYC 2NOAA 4GBMA 4UTRA 1C3VA 4O63O 1JIJA 5EE9A 2FW0A 1T0JB 3PJRA 1MJGA 3AEQA 4JL8A 4O4JB 1FU4A 1P5HA 1YQWA 4EW3A 3VU9A 1QKIA 3VPFA 1TCBA 2BTOA 2QZ9A 2WUFA 1G3UA 4S1OA 3RSZA 4AYTA 4DBZA 1W8DA 4HZGA 3KXKA 1JJFA 3MINA 3E22A 1H0HA 1JDVA 1XDGA 2JK1A 2VDMB 3IPRA 3L46A 4MV8A 4GT1A 4ZOQI 2L69A 4QELA 4QU8A 3I12A 4C88A 1P2UA 3HP7A 3OQ6A 3D8NA 4RW0A 3M5PA 1ND6A 3B6IA 2O2GA 1WR8A 2A1UB 4C4PA 1Y6RA 1KSGA 3EQ2A 4WZAE 4FVTA 3W9BA 1SZCA 5B7NA 1E4YA 3CZQA 4KO1S 4CR6A 4KE9A 5AK4A 4QE3A 3LC1O 1JEQB 4BKOA 2GERA 4AJ9A 4CM9D 3DMTA 1XA3A 4RVUA 3IAHA 5E8RA 5LDGA 3W5DA 1QQ5A 1U0GA 4J1NA 3K0AA 4G5OA 2DPHA 3ZUGA 1XQYA 2FX3A 3QELA 4HQFA 5AVVA 4F3CA 2BHTA 2QOEA 3K0FB 5DGCA 1Z34A 2PL1A 1T2DA 3IAAA 4GXNA 4PG4A 5KDLA 3RYHB 1MENA 4FNGA 1RHRA 4P0QB 4C0QC 4C3OB 4OP1A 1QIMA 3PFKA 5FBZA 3ICEA 2ZTHA 1BEZA 5JNLA 3LAWA 3SXUB 3VKFA 3WS7A 1AGYA 3BA6A 3FUTA 5D51S 1A4RA 2DOKA 2Q0QA 1RRGA 4B7AA 1AO3A 3OX1A