4F9EA

Cyclic di-gmp sensing via the innate immune signaling protein sting
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
173
Chain Sequence
NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPDSSFSLSQEVLRHLRQEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Transmembrane protein 173
publication title Cyclic di-GMP Sensing via the Innate Immune Signaling Protein STING.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 173
sequence length 185
ec nomenclature
pdb deposition date 2012-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f9eA02
4F5DA 4JC5A 4F5YA 5BQXA 4LOLA 4LOJA 4LOKA 4F5EA 4EF5A 4F9EA 5CFMA 4YP1A 4F9GA 4QXRA 4QXPA 4EF4A 4F5WA 4KC0A 4KBYA 5CFOA 4QXOA 4LOIA 5CFNA 4KSYA 5CFLA 4EMUA 4LOHA 5CFQA 4QXQA 5CFRA 4EMTA 5CFPA
chains in the Genus database with same CATH superfamily
4DNFA 3FNGA 3QOWA 4W1SA 1V8DA 3ZJ4A 2RARA 1S3IA 1SKYB 1Z6XA 2GKSA 1KH1A 3AUAA 3O26A 4UM9D 3TLEA 5KKAA 4CWAA 1ADBA 2QI9C 1TU0A 1CQIA 1I6LA 3QLJA 3DBHA 4GI3A 1TPZA 4XOUA 4D9CA 2ET6A 3JWPA 4IIJA 4WRRA 4Z0TA 1EUCB 2G04A 2JCVA 4ZKEA 4BN4A 1I2DA 4WGFA 4G4IA 5CYGA 3KTOA 1MF7A 2JEZA 3GVIA 1BXRB 3MJVA 4XEUA 2FUNB 1EGQA 1MH9A 5TPWB 4OP2A 2ZJ2A 2I3GA 4YC7A 2FLWA 3MAJA 1BWQA 3ED1A 3DAHA 4OI4A 1M10A 3HYNA 4I4TB 5AK6A 5F3WB 1H1LA 3E1GA 3NI2A 3C7DB 2YCBA 1HQKA 3EY4A 4H4DA 1IOWA 1J5XA 3CF2A 4ECAA 1YUNA 4GS5A 2WT8A 3QEAZ 3U44B 1CR0A 5IZCC 2ZBRA 4JB3A 4N03A 1XDDA 1S9DA 1SRRA 3Q7TA 4IH1A 4WKPA 5AW9A 1A7AA 3ZWNA 3TIGA 3EQZA 4BJ1A 1DKOA 3PR1A 3GMIA 4KQMA 4U6SA 2QJFA 2QOEA 3GJ0A 3HV2A 4IOLA 4UUQA 3W8EA 3G0HA 2XOEA 4A10A 2Q6IA 1E1YA 1YQXA 1FNCA 1T4CB 1HE2A 1G5FA 1UK7A 2Y27A 3EDCA 3JQQA 4HWGA 2NZYA 1C29B 2RAVA 2YASA 1PTJC 3BGVA 3BVPA 3IMGA 4MVJA 1QHXA 4ARBA 4BUCA 4N54A 2XHZA 5KSYA 2DECA 2ETVA 4KVGA 1B26A 2A4KA 4PLTA 1PYDA 1KZGB 1TIKA 4DM3A 1BHSA 3S1AA 1GXSB 4D02A 3G8CA 1U0HC 1PT7A 2GFQA 3OZAA 5E4YA 2UXCB 1SOMA 2ZUSA 5EAIA 1P7ZA 5IRCD 1TZJA 4M8NE 4MQLA 2FPPB 4FE4A 4RHYA 1L5HA 3AEUA 4CIAA 3DQQA 1QQTA 4DLUA 3TNFA 1C8KA 5I7HA 1SOAA 1RADA 3QHAA 3MCZA 1MIOB 1OWPA 3O92A 4L85A 3KSBC 3VC3A 2AI2A 2R5NA 4G37A 2VEDA 2P0AA 3ZJ5A 4JKOA 3OWXA 1X7WA 2IVFA 3A4IA 1NKTA 3HKEB 1RWNA 2IXGA 2PXHA 2VTBA 5AHKA 1CW2B 3SKXA 3ZE8A 3D1LA 3GP8A 5JIBA 2WYVA 2V54A 3AVWA 5CDFA 4PO1A 1K88A 3KKQA 3UOAB 4B3GA 5ALKA 4IOMA 3K4QA 4AZTA 4RTKA 3NC1C 3PICA 5F64A 1PG0A 4I9UA 1W9HA 4AY6A 4US1R 3FR7A 4RQBA 4ISCA 3IR6A 3B1YA 4I5EA 1PJAA 2CHQA 4FC6A 3I23A 4FXPA 4EELA 4TRJA 5KNBH 3SR4A 1XAHA 2EFHB 1W94A 2FJPA 4HSEA 2WM2A 1IJBA 2JIZD 2OM2A 2GLUA 3CW2A 3OM1A 3GUCA 4QT4A 1RKXA 3E0QA 2Q6LA 1KAHA 4A1OA 1E1RA 2HQRA 4NAUA 5BO5A 1A9QA 4UMEA 2GPSA 3DLBA 1V3VA 2EFYA 2GN9A 4TZTA 4XR9A 2P2ZA 5M04A 1BCSB 2FSUA 3GFVA 4M9SA 3KZVA 2XXBA 3HY3A 1I1NA 4Q4HA 3RVLA 1OKKA 3V8BA 1AJEA 1EBUA 1VECA 5K4GA 4E13A 3MVEA 1D2NA 2E2WA 1T5BA 2OXRA 3FZQA 3IA7A 3LWDA 4CM9D 1RMTA 2JD2A 1L7RA 2FHSA 4WKOA 1NC3A 1W1WA 3KOMA 3LPAA 4HL6A 4WEQA 1G6OA 4OQLA 1NJGA 2ZVJA 4HS4A 3VHRA 1MV5A 4XFKA 4RVUA 2YRXA 4B74A 1T1EA 1X7XA 1YIDA 4IDFA 1T3HA 2VSXA 3NLLA 3V7YA 1VL0A 1ZR4A 3TW0A 1ZUNB 2W6ZA 1ZVJA 5HG0A 5CGZA 5FOXA 5TNXA 1PSZA 2Y9MB 1WNTA 4BGDA 3NIBA 1KDVA 2V5VA 2XWQA 1GCIA 4FEEA 5AYVA 2IS4A 4EA9A 3PWSA 1KVTA 2NU9A 3BH6A 4IUYA 5KHLB 1UL1X 5HK8A 4EM6A 4OYLA 3T61A 3B6MA 4PFJA 4WDRA 3OT1A 1FY2A 1XQXA 4H08A 1DBWA 5EWJA 1N2GA 5CVCA 1PYOA 2AV6A 3WDKA 2AMYA 1G9TA 4K0KB 4Q1VA 5DCLA 3AXTA 1L5FA 5KX5A 3OLZA 4URYR 3HS3A 1Z8DA 1NNLA 3MINA 3ZK7A 2XUAA 3PDIB 5AUOB 3ES9A 4JU8A 1JJIA 1QGUB 5F7OA 2KLBA 3K8ZA 3OIVA 1NNUA 1DV1A 4Q3CA 2HBQA 2W6JA 2F90A 3SHFA 5CX4A 2FPRA 1P61B 2K4MA 3GEMA 4PLPA 3U7IA 1Z7YA 4H7DA 2ZUTA 3S2IA 2H2IA 3PWKA 1Q0PA 3RC7A 3MLEA 4EO7A 3G1UA 2CL7X 5MN5A 4RVGA 3DE7X 4FX5A 5EFZA 4JDUA 1M6EX 2WU1A 3CZ5A 2FQQA 3JVVA 3X1MA 5AVOA 1EDDA 3EEOA 4L72A 4HX2A 1O96B 3LTEA 4JBHA 1JMVA 4MKHA 3GCXA 2E1RA 2CVOA 3DHVA 4JKYA 4AFNA 1ODTC 2GCOA 1KOLA 1BH6A 2F3RA 4PAMA 2IEZA 1G4HA 3FF4A 3I04M 3KOXA 1GNSA 4O63O 3TPFA 1PDWA 4U63A 3SSAA 2WWFA 3G9UA 4BKRA 3O3OB 1DAKA 2VHYA 3E1KA 1EJ0A 1T3ZA 3QG5A 2NMVA 1J9EA 4AKIA 1V5GA 3RI3A 1HSOA 3N2ZB 2UUBB 1CQIB 1N8KA 5B7PA 4YQYA 2C2XA 3DBHB 2CXRA 1WKBA 1W29A 1VG9B 4IIJB 3L1KA 1JKIA 2Y1FA 4TV8A 1OROA 1P29A 4EUKA 2YXEA 2C97A 4KH0A 1E92A 1OHHA 1X1EA 1N7HA 2GN4A 2R11A 3FGNA 1BJKA 4G24A 5JQGF 5CYFA 2FUCA 5B2EA 1EXVA 1I30A 2KS6A 1WZCA 4RMHA 1VRVA 2HCFA 4ACAA 5CLHA 3EMVA 2R6AA 3GT7A 3H2ZA 4CLEA 4OXXA 1E6KA 1HKUA 1H1LB 2AFHB 2XB4A 2YMQA 4L8LA 1G8SA 2H18A 3IHTA 3LA8A 3LZDA 4RELA 5EE9A 3UJNA 2ZRLA 1NFFA 5BRAA 3WYDA 3BREA 5JPIA 4GMGA 3QVMA 4X20A 2GRUA 5D87A 1PG5A 3AVYA 5KTKA 1T4MA 1N25A 2IXTA 5ESWA 1QXSA 1YT5A 4XVRA 2Z4TA 3PHBE 3LQ2A 5JZSA 1H5QA 3AP2A 4NBUA 3JWJA 4LHEA 5ECWA 3HZZA 4D3YA 3PDHA 3NAGA 4FXOA 1ZD1A 4G6ZA 4KMSA 3ZIUA 2XBLA 2O3JA 4ALKA 1OXSC 1UEXC 3DVRX 1X1RA 2VDMB 3LU1A 3KYCA 1HT0A 1BWSA 4DV6B 1RPZA 1JVBA 3DV0B 4Q39A 2HR1A 3W6ZA 2ECFA 2X0KA 2YXLA 4Y9SA 1SVKA 3SC4A 5EMMA 1SKQA 1XPUA 5BUQA 2DHRA 4IPTA 3BWCA 1BKDR 3F9IA 2WRZA 4P3OA 4W7SA 2EFDB 5DF1A 3T94A 1WMFA 3QOXA 4HAOA 1JMKC 2BEJA 2P9QA 4X41A 3HCOA 4NL4H 4ENRA 3O8BA 2D13A 1DTWA 1L5HB 1RABA 3A26A 3AEUB 3I1YA 3CE9A 3JAWA 4IUBS 4NPHA 4Q02A 1SUCA 2W6QA 4ZVQA 5IM4A 2H8GA 2C4UA 4FP9A 3TEMA 2I3BA 3L1IA 4RQUA 2H57A 1O95A 3C6XA 4A0GA 2C9DA 1KI1A 2PD6A 3K0CA 5BSMA 5LMUB 4M0FA 1NNSA 3T3PB 2ZWOA 3ITEA 3QNUA 1L8AA 3C4VA 4R0NA 3O9VA 1W5EA 3QWBA 1RLIA 3T41A 3TOCA 3NONA 3F8WA 5LFAA 2VTBB 2RH4A 3AWDA 1TEHA 2FVXA 2R9VA 2Z2YA 4M87A 2GEBA 4UM5A 4E88A 1KEUA 3RVQA 2MSDB 4JEIA 1I13A 2QTAA 4LA4A 5F2KA 1TUEA 2A92A 1H1TA 1KAQA 1EQ2A 3H5TA 3O5AA 3NMUF 2H8KA 1RSZA 1XDGA 5EP2A 1R0XA 3OU7A 2EZUA 2W5UA 3UB3A 3KUDA 4CL8A 3WYAA 1U1DA 3GFPA 1T2NA 3HUEA 1G7CA 1P9NA 1F6DA 1SCDA 4BBZA 4DG9A 1QIDA 3L8FA 3HMQA 1NTRA 3EZ7A 3NANA 5ILQA 4DVJA 4RBNA 3ETEA 3K30A 3E7DA 4I66A 2ZBPA 2PANA 3F6PA 4R7ZA 3WQBA 5BWLA 5TMPA 1Z15A 2BSQA 1NULA 1AZLA 2I7VA 5AW1A 3PDCA 4LBYA 1VFNA 5C1PA 5IZCA 2C7RA 1Q1ZA 5JO0A 2XITA 4ITVA 1VI2A 3MBKA 3UCEA 1UCFA 1HYEA 4Q4HB 1WW8A 1U1IA 3MT0A 2Q7OE 5KU7A 1AF4A 1CIPA 3EZGA 3I1FA 3U4HA 3PRYA 3F46A 2XTJA 4MRRA 2IWRA 2P5TB 1KDRA 1FQOA 3FYCA 2MSEB 1MX5A 3FPBA 1S1MA 3OZEA 4B0PA 1UFRA 1V39A 2IZ0A 3FRHA 4HOYA 1P4GA 2WHQA 3UMCA 4MGHA 3H7IA 2BFFA 1OBCA 2TSYB 1PTJA 3CN7A 2OE2A 2CZQA 3L43A 1GKYA 4I50F 4MVJH 3SYNA 3A6EA 3UHJA 4AUKA 2Q0HA 3LT1A 3MB5A 4HLCA 4NYIQ 1W9MA 4NCNA 3PCXA 3PTZA 3TRIA 1J2TA 4ZI7A 2NU9B 1FDRA 2OD9A 1O0CA 5DI3A 2NTJA 1X80B 3KQVA 5IJAA 3TRJA 1FW8A 5EI5A 2C2GA 3FH0A 1ZN7A 2SKCA 3RS9A 1O03A 1SUAA 1P2VA 2VYVA 3H5VA 4TL9A 3ZDEA 3BZUA 2XNJA 2RAFA 4BN5A 1Z68A 5EWJB 4D3SA 4W1RA 1M1NA 4L95C 3RVBA 5U9CA 5MF6A 1CFZA 1VHWA 3GJXC 1WTCA 3A3OA 3K9LA 5DGXA 3IS3A 1C4KA 3UT5B 3WWZA 1XNQB 3MINB 3VKWA 4CDRA 1PK7A 2V7UA 5ARBA 3MJRA 5EPOA 2DT5A 1CDDA 3V1LA 4PNEA 3CSDA 3FCUB 1GSIA 2ZXFA 5IDVA 1SWVA 3S8YA 2A3RA 2VYQA 3TTXA 2PH1A 4H60A 3D64A 3HCRA 3K16A 3LXUX 4BKOA 5BR8B 2ZK7A 1C0LA 4IHJA 1LS1A 3W05A 1W5BA 4UC0A 1TGVA 2VT3A 4C7VA 4IQ8A 4ZHQF 5KNDD 3GBSA 1RRMA 4MA5A 1O54A 3RASA 2ORWA 1UM8A 3HVIA 3MPOA 1OZAA 4ZU1X 1R0BA 1VYVA 2GCOB 2JHPA 4A8HA 3VDQA 1P1HA 2XXJA 3K5PA 1L9XA 3T6KA 1E8NA 1EGAA 5GY7A 4B4UA 1Y3HA 2MTBA 2WJYA 3SSMA 4TTPA 3BXFA 2VN8A 4AY4A 3I8XA 2GD2A 3F73A 2EVWX 1SXGA 1XEFA 2R79A 4EPWA 2ZULA 4R41A 1SHZA 1DZ3A 4V0RA 2YJZA 1K66A 2PL5A 3PA8A 5GMOA 1DEAA 3T1QA 3LOQA 3PR3A 4I1VA 1WCIA 2HJWA 4N7BA 1F5SA 1PEKE 1NI5A 3NIWA 4XSVA 1NFRA 3BGSA 3T3DA 1OCEA 4UTVA 3GLIA 1Y3FE 4H4EA 3L8YA 2JLUA 1BKYA 3PE3A 2PUGA 3L18A 3R7NA 1Q5PA 3RYCA 3IE1A 7YASA 5I7AA 3ESCA 4AKTA 2QRUA 3EB9A 1OR8A 4OL0A 5K09A 1P72A 4R3UC 4FPXA 4MKXA 2GBFA 3RNLA 4ID9A 2AX3A 3CG4A 4OYHA 2WAOA 1OXUA 4YV1A 4UM8B 1R88A 4EY6A 2DFLA 6AT1A 3TW8B 3NTVA 3TRFA 4CUKA 4EYOA 2XKAA 3NUGA 4WECA 2W2LA 4MJLA 2HU5A 3KYIB 5T4FA 3TTUA 1ISMA 3AFGA 3CF6R 1MB0A 5HF8A 1HSZA 3VAYA 2ZYRA 4ZVOA 1TYBE 4OHUA 3KT3A 2CNLA 2JK0A 1XIVA 3SSNA 2EBHX 3GC6A 3WFJA 3C3EA 1LTKA 4O4LF 4UU0A 4UTRA 2FZ4A 1DAMA 1GV0A 1ZW1A 2XUGA 4BX3A 4G1EB 4RTPA 1QK4A 3DGEC 2WKRA 3MJFA 1NLZA 2RGXA 4OUDA 5ES3A 5TGZA 2PA0A 1QAMA 1JEEA 4YRCA 5L4NA 1Q0SA 3KL4A 3H16A 1A8PA 5HZMA 1NV8A 3DDUA 4B34A 1ST3A 4OLAA 1DQZA 1BJRE 2YZMA 3ICCA 4RSHA 5DM4A 3C1OA 3S7ZA 3SHVA 4L2IA 2J9GA 1LLQA 4KAAA 1XQWA 1NATA 1MC4A 2VHUA 3JAWB 1DTWB 1E1QA 1WUJS 1N7IA 2XTNA 5KYNA 1QF6A 1N2CE 1P2TA 1FS4A 5LXTB 2XTAA 3TYXA 4B7ZA 1IUKA 4IG4A 1QIFA 1ZC4A 2OUIA 5A62A 2ATVA 3D2BA 1T0UA 4L4SA 1HEYA 4HNAA 5DW0A 2ZWVA 2IXBA 4HH0A 5KYKA 3DFMA 4KI0A 4HDAA 2L18A 1RMQA 3OFND 1JKXA 1IVSA 1DBIA 5HFJA 5EIBD 2VP0A 1A9XA 4MW0A 2O7NA 3TL6A 4C29A 1AGXA 1Q44A 3IRVA 1BG6A 1GARA 5ITZB 3L6RA 1ZMBA 3OZUA 3EYWA 1QZZA 2WMNB 4RGBA 5BQ5A 1WB9A 1ZGAA 3CX8A 2R7KA 1P17A 4RDHA 4PV7A 3R7AA 4EI2A 3OCXA 4NJEA 3PE4A 2JFQA 4U7WA 4GFDA 1H2EA 3P27A 3TEJA 2FMFA 3QF7A 2Z30A 5KVSA 4QZVA 3CWZA 1NASA 4D25A 2Y66A 3HR4A 2ZBDA 3QIAA 3FTCA 3PNKA 4LY0A 4BU0A 1K4MA 1DFGA 1DBQA 1N6HA 4YJ3B 1C1HA 4LF4B 1NHGA 4P80A 4IJKA 2QTNA 2VZ0A 2WD8A 2C78A 1SBHA 1Z12A 2X13A 1QTNA 3B5EA 3RIYA 4NOLA 1U2DC 1UBOS 4S0ZA 2V6BA 1LRJA 5JANA 5A2QA 3HHEA 4JB0A 3UFXA 2XR1A 2VNIA 3V5NA 4R2LA 1X2EA 3O21A 1DX4A 2YQZA 2E89A 1Z2AA 2WAXA 4BFSA 2IK8A 3H0EA 1O6FA 4Q1FA 1YWGO 4MCAA 2ORED 4HQFA 4W1QA 4IO1A 5ALMA 5C5IA 3VVCA 1H0RA 1Q0RA 1I80A 2BFFB 2J9ZB 4OK5A 3LHFA 1XNRB 1MT3A 5CT8A 3MT7A 4XJXA 5B3AA 4KR9A 4PGAA 3EXEA 1PT8A 5J2TF 5KU1A 1R6TA 3G0IA 5EPUA 3IBTA 2HRCA 4BRZA 1E69A 5KUTA 1CR6A 2CE7A 2FW9A 4I5DA 1HL3A 2R6FA 5FR2A 5KYXA 1NUAA 4C30A 4BKPA 2G36A 3G0BA 4QYMA 1V3UA 2H0AA 4C7XA 3ZN2A 1SBZA 4ZI7B 2PUEA 3RANA 2CVPA 4YDHB 4ZOEA 3TZKA 5JXHA 2VXYA 5DI3B 5E9QA 5IVKA 1SC3A 1TJ3A 3I53A 3M5PA 1EHCA 3IDQA 5FOSA 4NDAA 4U9IS 4AK9A 3F6CA 4ZAVA 5CT4A 5K0FA 4AJPA 1VRCA 3U4DA 1AQNA 4YX9A 1M1NB 3DW3X 3G2LA 1PX0A 5DYGA 1DDOA 4J29A 1JR3A 4LWZA 3RC2A 4IDGA 2C7QA 4NZ9A 2MT9A 4UMFA 3V42A 4B82A 5KS2A 5KQPA 1H0SA 1E3WA 4V3BA 1FQKA 3FCYA 3RFXA 2RK4A 4LYHA 4LHXA 4V38A 2GESA 4Q47A 3P96A 2OQVA 4RANA 4DZRA 4YJ2A 1TIBA 3CA8A 2V0NA 2X5OA 4HWTA 4KMOA 2GAFA 3DJYA 2BHSA 1TQDA 1LH0A 2V9CA 3LA6A 4PAWA 2GBLC 2QUAA 4YJHA 3PWZA 2DZDA 2UXDB 1PV1A 2AG6A 4W1PA 5F4ZA 3NXKA 1NYQA 4P84A 1QH9A 3OAAA 4XGNA 4ZQFA 4D5GA 2EFJA 3ZG6A 4PN7A 2BHRA 1XCJA 1SUBA 4GR5A 4IHJB 1M67A 5TY0A 3KETA 1KOFA 3C3WA 4PX5A 3UJ9A 5TF4A 4FU0A 1JDNA 1FFGA 1U6IA 2V7QA 2VJAA 2D8AA 1M34A 5B6PA 1YTLA 1TTHA 4Z0NA 1I5EA 5C1IA 3OE5A 3WGLA 4C43A 1Q22A 2XB9A 5KVQA 5JWOA 3VNQA 2HH9A 1GZ7A 1VYTA 1I10A 2YFYA 4LNUB 5HJ5A 1Z6YA 2CK3A 1FX1A 3HPQA 5D3QA 3QKWA 1T8UA 5EE5B 2L82A 4GLFA 3RYIA 3HDVA 4RK4A 1U3UA 4TKVA 5LQUA 1Z6TA 4DYHA 4OAPA 2F1OA 2CLEB 1ODLA 2VA8A 1WCIB 3O9ZA 2VT6A 5CFNA 3FRIA 1YCGA 3GEIA 5JV5A 5TQVA 4D3DA 2WAYA 2VA9A 4GLJA 5BSFA 3RJ9A 5BYJA 2F3TA 1DWQA 2C8LA 3K9WA 4BLVA 4H1UA 4TWIA 4YH1A 1U81A 3NCTA 3RYCB 3OOWA 2P78A 4WXYB 1PUXA 2GTHA 3QA3E 4NZPA 3NU1A 2FMUA 2RHHA 2RSLA 3AR8A 3GP3A 3JR7A 4IJ5A 5FNZA 1RXCA 4KN8A 5DNAA 4ZVSA 3J80A 3C16C 2AXEA 1SC6A 1Y6GA 2PY6A 3UBMA 3KQPA 4JVOA 1L5QA 5BURA 3FUCA 2VHZA 1ZGZA 4Y0VA 1ITZA 4LZPA 4X63A 3VDRA 5IBQA 3CX4A 1TYCA 2DR0A 5IYZF 2IX3A 2FSPA 5T8KC 1VIYA 4YRTA 1UWVA 5K8TA 2KW5A 1KMIY 3ENKA 5H3CA 2FF7A 1UZNA 3VRHA 4UAJA 1IEQA 5BPHA 1NMYA 2XDQA 3ZY4A 1WUHS 4BO0A 2EU8A 5FJJA 1OI2A 2CFSA 3H5LA 4H17A 4QPZA 2CLCX 2IP1A 4XWAA 3HC7A 5KYGA 1DFHA 3FOWA 1Z2OX 4V0SA 2OY0A 4JQSA 4OUDB 1JHRA 5EXPA 1YS9A 2WU8A 2QZJA 4ITRC 4KK4A 4P7JA 3QVOA 4WZBA 2ZAYA 3FPCA 4EY3A 2XD4A 3F7OA 4Q1EA 2WICA 3V97A 3RVKA 2B9VA 3IPXA 2IL1A 4B6FA 4L2IB 3GFQA 3FFXA 3KHKA 4X3OA 3EVFA 2QLMA 3DOEA 4D9EA 2W22A 1U7OA 2OXFA 2GF0A 1N5JA 1Z17A 5AVSA 4YI3A 5EIWA 1V7ZA 3UQYS 1H8EA 3KPVA 4MA0A 2QQFA 4NOMA 13PKA 3CZ4A 1KAEA 4HGZA 3EFOB 4HNAB 4JEUA 3NHJA 4CMEC 4FR0A 5IULC 2GZHA 3C5WP 1E4VA 4IL5A 5F7XA 2DWOA 3VVBA 1XFDA 3CN9A 4IQ0A 3BCSA 4IR7A 4MQ4A 2O7SA 2FCRA 2G17A 1MUUA 5BW5A 4BQNA 3IPYA 3LC7O 5C8YF 1EFDN 3H3FA 3KU4A 4MP6A 2BM0A 4M88A 1SHJA 1K7YA 3ZGVA 2EG5A 1C2TA 3OC6A 3EFEA 3NX4A 1FSFA 1T9GS 5BT9A 3CRQA 1AKTA 3REQA 4EYQA 5C2JB 3LGAA 1TO2E 1JPNA 2VDNB 3TOXA 2PT9A 4NJEB 1KRWA 2B2CA 3DCYA 2CD9A 1SEVA 3MTBA 5K7SA 3UKOA 1LVUA 3HEAA 1C9MA 3H6HA 3QYFA 1WM1A 2H4HA 1QV7A 1HL7A 1NBAA 2B30A 2RGAA 3LO5A 3RBZA 4N3GA 2FPWA 2PGJA 2DFKB 5K0CA 3LQYA 4LVCA 2A5LA 3JRWA 2PFSA 1EFCA 2B7CA 3GQVA 3PSAA 2QPOA 3IJEB 2BM9A 1CUIA 4QEKA 4M0LA 1QCDA 2FN9A 2AD1A 4FLEA 2VHCA 2E4VA 4JGGA 3SYMA 4ETIA 3AU9A 2E82A 3UFXB 2BZSA 3LZ6A 3WP0A 2OO7A 5B7QA 5A6VA 4QG7A 1JJVA 3R7WA 1XA3A 4CQMA 3DBVO 3RUEA 5A9SA 1JG4A 4ZI3A 1VE5A 4PG8A 4YRZA 5DOVA 1J5PA 2AGVA 3F74A 2Q1WA 4JSTA 1OT3A 2BGRA 1GTZA 3C0KA 3C3CA 3CR3C 4UJ3A 1FIUA 4MGZR 2IH5A 1V6CA 4WIAA 4DPKA 1XTIA 3N0TA 4R8LA 1KVSA 4B6OA 4E21A 1PJ3A 2C1EA 2KB0A 4RF4A 3GLGB 3CNQS 3PV0A 1FS5A 4ZO8A 3E9MA 3GNSA 1Z3IX 1UKAA 3S2FA 2I3AA 4Z0PA 1KQGA 4CV0A 5DMHA 4PLCA 1XZ8A 3ZWXA 5KYXB 4UDXX 1TW3A 1CJBA 2EDAA 4LBWA 5AOCA 1UPCA 2WSSD 4DTIA 3ICEA 4PZ9A 4DB2A 1N8NA 2WWHA 1NWCA 2NZJA 3E7PA 3HJNA 3TEFA 2G25A 1Z8NA 2PIAA 3M6WA 4CMIA 4MHTA 2GLTA 4OGGA 3SOZA 3A11A 1FTSA 3FYHA 1SO8A 5EZ5A 3IX7A 4LZZA 3LLCA 3V34A 4BVFA 5A5VA 1Q1GA 4HWPA 1F38A 2IHVA 1EE9A 2ZBGA 3C97A 2O48X 4LXIA 4Q3LA 4RD4A 5DM60 1ISPA 1W4BA 1OLUA 2R8ZA 3KR0A 3QG1A 1QCZA 4RWZA 5FQOA 4NFLA 3TOSA 4YT2A 4U8HA 4CR6A 1UQTA 3K6KA 3DR3A 1E63A 3HFRA 5DHUA 4YT8A 4FFLA 4GEKA 5EP4A 4JWTA 4BMDA 4IXMA 5TVKA 4EJFA 5JZVA 3LUJA 1Q12A 4TT3D 3OLQA 2O07A 4QIHA 1C30A 4EKGA 2IYAA 1QUFA 2Q2VA 5JASA 3KOUA 1A2BA 1UPUA 4HB2A 4YJHB 4ETWA 5DN9A 1SJ9A 5HEKA 1BD4A 3DQPA 1SKAA 1JXAA 3ZH9B 5HYVA 5TIIA 2O9JA 4IZOA 3DP7A 1NMQA 4JLVA 3KHUA 3BF7A 1TW2A 3KXIA 1KMNA 4FUTA 1IH8A 1U6KA 2PGAA 2VBCA 6REQA 5BN4A 2OFFA 1GQ2A 2KBEA 1CX9B 1M34B 4Q3AA 5DGHA 3STXA 1KH2A 2R6JA 2W6ID 3ADKA 3FDIA 2ZSAA 3INRA 2C04A 1MQ9A 3LUDA 1KQNA 2JC3A 3JZFA 3LUPA 2B34A 2YQ4A 3LP8A 1S4MA 1U2DA 3AHDA 4EHHA 1DC6A 4LSWA 2IYRA 1P1CA 2BI8A 2R3SA 4TWAA 3ZOZA 3O03A 3K9HA 2XB2A 4RHXA 4DQ0A 4RD3A 4TKVB 4FBLA 1G2PA 2ZRFA 1YNSA 2JCSA 1NE7A 2AC7A 1FVOA 1BJTA 2VF7A 1JFFA 3EQ6A 2XMZA 1CETA 4AP5A 4O2RA 3WL6A 4WXMA 4CV3A 3UTDA 4WY8A 1U3CA 1E32A 5E3JA 1SBQA 1JHXA 3AV0B 4TQUS 3V2GA 1KORA 4OHZA 2OV1A 2CF6A 1PQWA 3KCNA 4IX9A 4IYRA 4O5AA 4MIKA 3W6NA 1XNGA 2ZB7A 2XWBF 1ADCA 1IXYA 3ECSA 2D5AA 5KNCD 5KCMA 3OBIA 4E2WA 3PC3A 5AJZA 4M37A 2I0FA 3O4RA 1VCNA 4WBNF 4ZIRA 2QL9A 1XTRA 1H9BA 1HMPA 3NBUA 2XQJA 3HCDA 2VQSA 2BBWA 2NUAA 5A9RA 3DA8A 4R40A 4BO8A 2UYHA 2OZLA 3AJ9A 4OH7A 1RR6A 4N3NA 3WLAA 4H6PA 5H83A 2J3QA 3VO1A 3S2UA 2QTHA 1S8NA 3SIWA 4O4HF 4UZFA 4H1VA 4MUYA 3ZUGA 2IQIA 2XDQB 3ICWA 4RV9A 3GFGA 3ZCPA 3G2IA 2GI4A 3TQRA 4OI2A 4CR8A 4JXJA 4H1HA 4OF4A 5ER9A 4ZYZA 3WLLA 4I4NA 4DLXA 4BV8A 1UJCA 5LP6A 3ABSB 4BTEA 1MCZA 2AF3C 3CH4B 4K9NA 1FA9A 2VDJA 2GBLA 4WZBB 4DCNA 3TSZA 2W2KA 5U4QA 3O3CA 3OHPA 4BNYA 4FYJA 4B3TB 3A9UA 1DIGA 4AIIA 4BATA 2F8TA 1F0NA 3R0JA 5TF0A 3CPSA 4D8VA 2CGEA 1KKLA 4HLQB 3CNEA 1ZIDA 1I9GA 1FUIA 5K8JB 3HDTA 5LD2C 1FS6A 5LU9A 1C1YA 1P62B 3AV3A 5TC4A 4DCGA 3TFOA 1IAQA 1Z4OA 2O2HA 4JLDA 1NQTA 3WZMA 3ANXA 4ENPA 1DMSA 5ICGA 4FEAA 4N5DA 1ULUA 1SPXA 4RGYA 4LWOA 3R4VA 4ER0A 1B41A 2O23A 5JBNA 4L22A 5CFQA 4UEWA 2B1RA 3CPJB 1DCTA 5LBIA 2CLDX 1Q2XA 2OCAA 2IU4A 3BE4A 3NRJA 4O2BA 4UEOA 4UHHA 4Z2YA 2QR3A 3L6BA 5KOJA 3WWDA 4G1BA 2RCYA 1DC7A 4G25A 1P5FA 5DCYA 2BMVA 1RI3A 3IAS6 1I6WA 2A9KA 1US8A 2C2WA 3KKNA 2C3PA 3OM9A 3RIEA 5K03A 1L1EA 2ZZMA 3I42A 4R8SA 3LT0A 3PPYA 4HBGA 4R51A 3VTAA 5CX1B 4DMMA 1IBCA 4AX8A 2R751 4GXNA 2A8YA 4E2ZA 1GPUA 2IOFA 2ZAIA 3C3BA 3M7IA 1U80A 2VEOA 3C5HA 4HQOA 2NPFA 1NF9A 4Q9DA 2QMEA 4MA4A 4NG4A 2YIVX 5ER6A 3MRSA 2ZYAA 1OZGA 5AKHA 2QE7A 3ONNA 4HGQA 1XLTC 1RJGA 5DIFA 3UJ7A 1NX6A 3EF0A 5ESDA 5T5QA 1ILEA 1JJAA 5DXJA 1NAIA 1EIZA 2J4FA 4HQLA 4DIBA 4AICA 1A96A 4NWIA 3ENWA 1S01A 5T8KA 1YDWA 4DA9A 4YCMA 1Z25A 2H1FA 1SOVA 4NJOA 3NIGB 3R7WB 3T0FA 4CQMB 4J0GA 5AP9A 2YOFA 5JNUA 1L8XA 2X40A 4G0PA 4GF5A 3N6XA 1EXMA 3JZIA 1V37A 1GNVA 2Q1SA 4GKVA 3A10A 4KYIB 5JDCC 1E2IA 1XBTA 3PNBA 3VR6D 1SQFA 2GETA 2I33A 2QPAA 3NOXA 1IBMB 3QIVA 4PICA 1EDEA 1XLWA 3CRVA 3VZBA 3WNZA 2GCPA 3KOYA 1QLWA 1WQ4A 3N2YA 1JU4A 4NYIR 2PRKA 1RXEA 2BMWA 3WRWA 2E87A 3UUWA 1PE0A 3HXMA 3SU8A 2QROA 5BV0A 3HABA 1XTJA 4R3NA 2DVMA 4GYWA 3GLHE 1MEOA 4ZVUA 4DLPA 2ICAA 2QQGA 1N77A 2QYHA 3TNDA 1PR0A 1WXHA 2XPCA 5JWRA 3W04A 3D6VA 4ALNA 2PX6A 2ZT8A 3L0SA 1BOOA 5HBRA 2RKWA 1NVGA 2AJDA 4TTAA 3VTFA 3I2YX 1Y42X 3S27A 2H59A 1O5OA 1DV2A 5A9SB 2VAWA 4JJFA 4KYUA 2CLIB 1AA6A 3Q4GA 1GL9B 5ALWA 4DY6A 4PNZA 4WHMA 4I2NA 4CMEA 1OLUB 2XI4A 2VWHA 3H1EA 3OICA 3GNTA 2DPMA 4D99A 4EDFA 4DMRA 1Z22A 4PSDA 1FUEA 3DDWA 4TQ9A 3PPXA 1JAIA 1C50A 3U0BA 3B8HA 4V0ME 2DUNA 2R4TA 4HRVA 5BYAA 2FKAA 4M54A 1C30B 4DRYA 3THSA 1FTWA 2C7GA 2REBA 3NM4A 4D98A 4D9FA 4EJMA 5FLXA 4UZEA 4Y2JA 1GM5A 2FZKA 2PLFA 2JGJA 1DJLA 5C34B 4I1RA 1BU8A 2PMCA 1GU7A 2GCGA 2OHXA 2QDXA 3AGPA 2IHNA 4LJLA 4O5OA 3OTIA 3HVHA 5ICMA 1Y5RA 4JB2A 1NVVR 2AR0A 3CNBA 1HNNA 3CEAA 3RC3A 4AP6A 2D5BA 3HQ4O 6REQB 4KCGA 3FTEA 4J0FA 5BN4B 2D0DA 3OT4A 4QUKA 2HN9A 1SZDA 4HUQA 1O6CA 2HNAA 4PGMA 4X91A 2XQVA 5ALIA 5M3BA 4M9QA 3C8UA 5JZMA 2I71A 4AU1A 3KALA 3QJYA 3K0HA 4F12A 2PWZA 2BR5A 1HLDA 4LFCB 1TUBA 3OZRA 1M8JA 4PZPA 4WOJA 4B5LA 1Q1NA 1Y7TA 3RRFA 1TAHA 2EFGA 2BJHA 1IVYA 4MLDA 3I2IA 3AW8A 4IGFA 1JFFB 1YA6A 4X8MA 5T57A 1VYHA 4DQVA 3R6DA 2WVHA 1RQRA 3HZHA 2G8LA 3QLEA 4QUIA 2FSVA 1GILA 1U9ZA 1NRWA 3WIDA 4HDRA 2QTTA 3EEBA 1Q3KA 4H77A 4I1YA 3GGPA 5LZ7A 1GZUA 3HUTA 2NZVG 3MWEB 3QXJA 2C9BA 5I9TA 1USGA 1ECCA 4Y7CA 5GJVC 1ZDMA 2A7XA 4UDYX 3TLMA 2HI0A 5KNBD 2J3JA 2Z09A 4FYYA 4PAQA 3LUFA 3TAXA 3OHSX 3RSCA 4H3HB 2CV2A 4Q37A 1ECBA 1FDTA 3AYZB 2RK3A 4P9NA 2CNWA 3LWNA 4KU4A 4MB0A 2OZLB 3H18A 3TCKA 4B32A 5IT4A 2VDQB 1W87A 4FQ5A 3S2EA 3C1UA 1B15A 3KJZA 1LZLA 1M72A 1CNMA 4JLNA 1E7RA 3QI2A 2FX2A 4R2WA 1AZWA 1O6BA 1XVIA 2H52A 3N8KA 1BWRA 2H7CA 3DCNA 1EX7A 1KJJA 1FNSA 1KI2A 3AETA 4CEIA 5DRYA 2OVFA 2B36A 2JLZA 4Z8YA 3AINA 5HIMA 4WUVA 5LP6B 3FWKA 5EJMA 5L51A 3M6AA 1NBMA 4DARA 2EYQA 3C3YA 5KMGA 2J3MA 1CDZA 2ZE8A 5EERA 1B0UA 2XTZA 3RRZA 2WWIA 2QJRA 3WJAA 4BOYA 2AKYA 4R3WA 2ZUBA 2WU3A 5K4HA 3GZJA 3HVJA 5AVRA 5K6AC 2X2FA 3CV3A 4CYMA 4XDGA 1K7SN 3NHRA 3Q7SA 4ZQEA 1J1ZA 2CN1A 3GJQA 4BO3A 3AI2A 1IBSA 3O3NB 4MH0R 4MQFA 2HK9A 1I7SB 3FNQA 1P9WA 3AG5A 1DMRA 3PUVA 2DTDA 2XWJI 3EEYA 3OX3A 5KHOC 2XYQA 3AZOA 2OXIA 4DL9A 1T3TA 5A2GA 2H85A 3BHNA 3OKPA 3U1BA 3FOZA 3QX3A 1VBMA 2C58A 1OLOA 4GZ3A 5D3MA 4X71A 1F2VA 1SXPA 4O2BB 1FUKA 2C5SA 4DV0B 4UMVA 3LBIA 4DREA 1POXA 1AKRA 1X1CA 2GM9A 2TECE 4KLZA 4RGQA 1JG1A 2P6NA 4LRWA 2Q41A 3UHFA 4S1PA 5JCOC 3A1NA 3DL0A 3M2PA 3NAZA 2B3TA 2IYSA 1US8B 4TM8A 3FIUA 3P2YA 1MX1A 5DLQC 3D3WA 3FRJA 4BNJA 3DTTA 1JFLA 1M54A 2BP7A 3OI7A 4IHAA 4CE6A 3COZA 1X70A 1Q50A 4L75A 3Q1LA 2QD4A 2VDWA 2RD2A 1YVPA 2DB3A 3W79A 2EW1A 3K70B 3EOBI 3KKPA 3TKLA 3QUQA 2AJLI 1XPRA 4E3WA 1M33A 5A7FA 3UAYA 2AN9A 3PXAA 1KC1A 1VKNA 1HA3A 4DQKA 5K05A 2RH9B 1PFKA 2I3DA 2ONYA 2CV1A 5AVVA 3ECAA 1B00A 3HLTA 3L92A 4LGVA 2V74B 3QVKA 1PHRA 3B85A 3D3QA 1GY8A 1XDSA 5BSGA 5KQSA 3U16A 5C3MA 3PX7A 5DWDA 2GBCA 1WP9A 2VUTA 4IMJB 2P3OA 4TLEA 5AKZA 4EEKA 3HUDA 3TXYA 5HW0A 4KV9A 1IN7A 1QLHA 2KWIA 4J03A 1W7AA 3OMLA 3JZMA 3U80A 3UGKA 5DBEX 3DD1A 2PZLA 2CEKA 4LQDA 2REOA 4MRAA 8ABPA 1N1MA 2P9GA 4RIIA 4K2AA 1XE3A 4IIEA 4OBXA 3M5WA 3KKLA 4OYRA 3M9XA 4TMKA 3SHQA 1Z06A 3FDXA 3VR4A 2PMFA 3HPRA 4L07A 3AG6A 3JAKA 1NXXA 4AZVA 4A1FA 3PPWA 4BASA 4EGCB 4IRMA 5CDYA 4OPMA 3CIOA 4BAGA 1PUIA 3KLOA 2NTNA 4KQHA 2BFBA 1YE8A 1PBTA 4W5OA 2QAGC 2BRUC 2CJWB 4JLWA 2C4KA 2HSDA 4YMUA 2AUNA 4LYEA 4C6HA 2KQUA 2PTGA 3K0FA 3OFVA 1DUSA 4FEGA 2W83A 4YBRA 1JBEA 1SHLA 3G17A 3PZBA 3ZGLA 4F4CA 2BE9A 3F5FA 3MTGA 4P4SB 1WVIA 1R64A 1NY6A 4MUGA 3KYDA 4AURA 2VUUA 1VJDA 5J5CA 1R4MA 2QRKA 5BMVA 3W8NA 1KJWA 2OLJA 5LQRA 4EVSA 2I29A 1P0IA 4JYBA 3ZWWA 1V1MA 4QLAA 5LCXA 2D62A 2JLSA 4RZ2A 1V8ZA 1P39A 1E5TA 1OFUA 5IXSA 2IEDA 4QLOA 4RKWA 3O82A 3DV9A 3NHLA 2HNBA 3OETA 4LRTB 4MP8A 4X60A 1LX7A 4DIDA 5I9LA 1BROA 2GA8A 3SS9X 2NNLD 4HWSA 2WPDD 1RHJA 4MPPA 2EJCA 1TZCA 2QN2A 4P4TA 2IZ1A 2B8EA 2XMBA 4IP0A 1E5LA 4HH4A 4BWVA 2MSNA 2DCMA 2PEZA 4GO1A 4DWOA 3PUJA 4NU5A 1BX3A 2HCRA 5C51B 2LXNA 4W8HA 1J09A 1I2AA 4G2TA 4C3VA 1ONSA 5JC1A 2C2MA 3GR6A 3KPWA 1Q19A 4LBZA 5TMEA 4D6YA 1BMQA 4PNHA 4G1VA 1OAAA 3OCVA 4G09A 5GM1A 4FE3A 4GL4A 1KVRA 5AUPB 5FADA 1OA0A 3AM3A 4AVYA 1Q57A 1HNZB 4P4GA 3RUAA 1ESMA 1ZMOA 1AO0A 2OUKA 4S0XA 1QHGA 4ZV7A 5I5GA 4KLAA 5BR4A 2Z3VA 1Z5PA 2I5PO 2REQA 2WIKA 3GZNA 2WSLA 4HWRA 3F4KA 4ZJYA 3OO0A 3OBBA 4GE0A 4C7KA 5LUAA 2ZUFA 2TRSB 4ZP1A 3HM2A 3L0CA 5JDCA 3B9BA 2LKDA 2PVSA 3ONDA 4J43A 4G0ZA 3ETDA 5DWQA 3D6HA 1H2YA 3FNIA 2AI1A 3D2CA 4NARA 5DSZA 4BB6A 3ZY5A 4RVSA 1A88A 2W42A 4HDRB 3OOJA 1L4EA 4IMIB 4DILA 1AD2A 3N6RA 4LCEA 4QVIA 1TAGA 2JKZA 2WTUA 4G8DA 3FZGA 3N9IA 1OBHA 4N4AA 3R8CA 2MMCA 3MJCA 4ZVMA 1LPPA 4J0DA 4BNDB 5ITWA 2B7BA 2ZRPA 3CZCA 3ETLA 1QQAA 4HYTA 721PA 1P2GA 3WLHA 4ZXFA 4YV0A 1U3FA 2ZYUX 1VRWA 2CVQA 3OM8A 3OF3A 2O4CA 4L4UA 4U4AA 1QFXA 1TJYA 2I67A 5CK4A 1SN7A 3M6IA 5K0JA 4R8MA 1OBFO 3C8HA 4BFXA 1W4RA 1RKUA 1PR4A 2GPJA 2H4ZA 1SZJG 9ATCA 2GUWA 4PZLA 5K3DA 1N6IA 4UUPA 1FLVA 1GNPA 3RTDA 1AV7A 5BQFA 2I6FA 1J21A 3WIOA 3AETB 4CEIB 1RP1A 2ISCA 3DULA 1H4SA 3H1GA 5F2EA 1ZGCA 3DAPA 3HNOA 5G1PA 3AIKA 1JEQA 3JQFA 3GPDG 2JBAB 4DR2B 1SXJE 2VAMA 4RD0A 4YWHA 3K9FC 2HT1A 2O3QA 3THWA 1TKRA 4MVJD 5BWNA 4I2VA 5FA8A 1BE0A 4K1XA 5F9HA 2YDYA 1C8LA 5HZHA 4HEQA 4HXYA 3WGUA 2QEQA 2V8OA 4OHVA 1JI3A 3ZWYA 1LW6E 5JBQA 1JZQA 3MJ4A 3Q7EA 3LKDA 1KFJB 4MQFB 1YA8A 5I8PA 2WHPA 2AEEA 3B1FA 2P11A 4PBRA 2D4AA 3KUCA 3ZHYA 2XZOA 1NMSA 2QN9A 1KP3A 1W96A 2EIXA 2HU7A 3RIMA 3IEIA 1FP4B 1XTKA 2RIRA 3PP8A 3DM5A 1OYWA 3NHSA 4IBOA 2GR9A 1V3QE 3I9NA 1W6UA 1GUAA 2YDXA 3LH5A 2O1SA 3L9WA 1V2GA 4COOA 3SKYA 2IVZA 3KEFA 3B60A 1V7QA 10MHA 4DUYB 2QSZA 3MJTA 2NXWA 4I9GA 1QPBA 3D2AA 5KI6A 1D4OA 1DX9A 3CONA 4LOIA 4N0DA 2ZWAA 2Q2QA 4KRFA 1EJBA 2CHGA 1XL1A 2AZMA 2VP4A 3IC5A 2H11A 4JR2A 4A6PA 4MUMA 4BP8A 4N8DA 1QDEA 1A9ZA 1PNTA 1XCOA 2ERXA 3DD5A 3N53A 4RLQA 4M7OA 4WK2B 5LA6F 2BP7B 3B6JA 4QSMA 4IWXA 1AK9A 4B4DA 1G59A 1DDGA 5E1MA 3PGKA 3T4EA 3TI7A 4NULA 1E64A 1MR3F 1T13A 5DKFA 3A7EA 4PYOA 1VHLA 2QRQA 1RWVA 3AEKA 1NJ8A 1P45A 1CZUA 1VL8A 3ZWAA 4F9GA 1E0KA 4NATA 4CLDA 1ZN9A 3V8QA 1E1RD 4KO2S 3AM1A 4HQNA 3T4XA 5EIFA 3L06A 3C98A 2N0SA 4Z9AA 3MD0A 4YFYA 4Z9BA 4ZAZA 1TM1E 1NTOA 4H7FA 2YC2C 2FFJA 3M1AA 4QXQA 9MHTA 1QWSA 3R9WA 4DBLC 2AA3A 3ZJUA 5L7WA 1Q7CA 3R23A 2KX7A 2PAFA 2DH5A 2ODAA 1E4EA 3I5AA 2ZB2A 4RPGA 3ENVA 2QGNA 1J25A 1WUIS 2VP9A 3A2MA 3PUXA 4PXSA 4YREA 2PKQP 4KXNA 5JZ9A 1E9DA 3JAKB 2QX6A 1PFWA 3IULA 3L84A 4N39A 4U0JA 4O25A 2ODEA 3AKCA 1XX6A 3CUYA 3FGZA 4OXNA 1DBRA 1L4YA 2OLKA 4WJKB 1W93A 4AO6A 1SKYE 5I9NA 3IP5A 3KQYA 3PEEA 4I99A 3SY8A 5LD2B 3TLKA 1MMFB 1W1IA 3K0FB 3L6OO 3NOVA 3AP3A 1ESZA 1XRJA 1ZFNA 5CNKA 1E9EA 4PGHA 4RSGA 4X7BA 3KVNA 4I1OA 4QO7A 5EZYA 1KJ8A 3T1HB 1KFEB 4OKSA 2B5WA 1I01A 1QB7A 2B78A 4LTNA 1IXRC 4RFSA 5BMVB 3S2ZA 4U7PB 2PLWA 3OWOA 3V9AA 4UCQA 1YZVA 1RCUA 1T5OA 1UF9A 1V1MB 3IP1A 1GZ5A 3GBVA 3AX6A 1PFGA 2P2SA 3R0XA 1RRVA 4NFYA 4RTLA 2WDPA 4Q1CA 2IV2X 1JEDA 5JCOA 1YL5A 5L3SA 1V45E 4C3UA 3VNVA 5FR1A 4YYZA 4Y3UA 1GR1A 2UZ3A 3DBOB 3QKTA 5CLJA 2JI8A 2F48A 4XWTA 2Q1YA 2QM3A 5ENVA 1ZVVA 1U2QA 4Z4GA 4MZDA 2W6JD 2JLRA 3CCCA 3I2GA 3P9KA 1IIBA 4MI9A 1KVQA 2RBGA 3RU2A 3HA2A 1YHZA 2HRZA 4BZXA 1U1EA 1G5QA 2RHWA 4RY2A 3JX9A 4P4UA 4JI8B 1GUDA 3UOWA 2PGXA 2JGAA 1YS4A 5JSKA 2HWXA 2G5TA 5TT0A 3DT9A 2XLBA 2JIQA 2FWAA 2N1MA 1DKRA 5EE3A 2C07A 5HTKA 3BS4A 3WWOA 1UJNA 4QHSA 4CCSA 1WX1A 2JGLA 2QD1A 4M9UA 5C18A 4B3BA 4R01A 2GEVA 2W6NA 4OIFA 2PE5A 2YV4A 3HB4X 1K75A 4DRXA 4ZCLA 3V46A 3CZPA 3L0BA 2REQB 1XZMA 3GZNB 3SNKA 1NZJA 3ZV6A 5JPDA 2G5CA 3I83A 3S40A 2OCGA 1ZZEA 4AJ4A 2VSQA 1R4AA 2J0UA 3LYUA 2BKAA 5FFNA 3MJSA 3Q3VA 3AJEA 3LQ4A 4U2DA 3L0YA 4X62B 3F97A 5I7WA 3Q40A 2R6CA 1GLGA 2VF8A 4XVHA 3VAAA 1J2JA 3EBLA 4RTSA 5JHHB 2JAOA 3IIIA 1GTMA 1CWUA 1U4SA 3QFFA 2CNDA 5WRFA 1BZYA 2Y1WA 3VR4H 1MHTA 1ZGJA 1ZOSA 4NPAA 2Q50A 4LMBA 4AQYB 4GD3Q 2AXNA 1L9KA 3KFXA 3WRXC 3KQLA 1XJ5A 2O06A 2ZR8A 3TZHA 2QAGA 4OSEA 1XRMA 4KAJA 2V6JA 4B3XA 5GJCA 4QU8A 1WWKA 4E1AA 4GI7A 5JU6A 1YGPA 5HIJA 1T5HX 4Q3DA 1GQYA 3OQMA 3EZXA 5CLLA 3TSYA 3I9OA 3V4LA 2ZPAA 4EB3A 1G4UR 2G08A 2XD9A 4ERNA 3KKEA 1WCV1 3WO0A 2HO4A 1L5GB 1U5BA 3CW9A 4FJ0A 3T5PA 4IZ6A 4KIWA 3L8ZA 3DE1X 1CZLA 1WMDA 2X7JA 3FGPA 5GPBA 1A76A 5A0FA 4XYLA 3ZW7A 4IJWA 4GMDA 4UU8A 1PL6A 1H5NA 1WIWA 1F20A 3BN3A 4LZLA 1XL0A 1JEQB 1JG3A 2O4UX 2WVAA 5EL0A 5TQJA 4ZEVA 2JS7A 5JNRA 2J08A 2WF8A 5CGQB 1AKWA 3F5QA 3THWB 2VRWA 4KQ9A 3L8GA 4AECA 4BEVA 4IEFB 1QLJA 1RI1A 1OX4A 2BJVA 3OKCA 4O4IA 4OMFG 3INTA 2A9JA 4QUGA 5AIBA 2NACA 5DYIA 3S70A 4MKGA 3QYJA 4KLCA 4ZMRA 2HMWA 4R81A 1D0SA 3AUSA 3B38A 3QVGB 1QIEA 2NSHA 3ROPA 3O8QA 4AS1A 3D6UA 2O59A 1GUBA 2BEWA 2WHPB 3GQBA 1ELOA 2NO7A 3TD2A 4F71A 5DIZA 1H5UA 1M1YA 1UP7A 4M0UA 2OXTA 3HN7A 3U62A 4DV7B 2Q3JA 4S1TA 4KSCA 1CUYA 5JD3A 5KNLA 2OXCA 1O95D 3WDLA 4CXMA 2PSJA 4AF7A 1WBBA 4E22A 1Y9ZA 1KEEA 2B1JA 1VMKA 1C4OA 3ZHXA 5TJHA 3PTLA 1I7QB 5EQTA 3HVKA 4NQZA 4WCVA 4QDTA 1V16A 4KVZA 4TWJA 4JI3B 5BSUA 4GOMD 3LK6A 4OB6A 4C0JA 1VKHA 2GMWA 1PG2A 1OPXA 2QA5A 5CXQA 3BWMA 1SHUX 3N86A 1ZESA 2XB8A 1OTXA 1QG0A 2Q5HA 2F3PA 3WAGA 4AJEA 3RSGA 1AMNA 3BQMB 1B6TA 3ZS8A 3FB4A 4LOAA 3ZE6A 1U0BB 2BTOA 3PX2A 5KINB 2EIHA 4HP8A 4TN1A 4CEHB 2BZ0A 3UAXA 1RI2A 4BRSA 2GN0A 4G0XA 1GRNA 1O1YA 1PJTA 1NBWB 3I32A 4GSKA 2WYOA 3AEKB 4R9SA 2UUCB 1KKMA 1N2ZA 1XZCA 4WNCA 5JAPA 3EC2A 1SU6A 5LDDC 1EUZA 4HT3B 4RULA 5T67A 2VNSA 2FE1A 2HX1A 4FMDB 4M0PA 2WSBA 1WG8A 3DWFA 2FYTA 3AL3A 3NTRA 3L0DA 3QEKA 2C2BA 2NUBA 3L1VA 4FHGA 4ID3A 4W9NA 4YRSA 1S2LA 3CZQA 4BIMA 2WWXA 1UDCA 4H7IA 2X0JA 3EBPA 3I6IA 4CRWB 1EFUA 3AUJB 1YL6A 5FWDA 5GONA 3PC8A 3KDAA 1U65A 3FIJA 4U7DA 4HUTA 1YI0A 3H9GA 1VI6A 2NVWA 3ITNA 4IXDA 1V9LA 2DBRA 3WHLA 2JFUA 4BFZA 2ZAOA 2HCTA 4RPCA 1ZRMA 2A0XA 1Y5IA 3L41A 3UV6A 3DFZA 4UATA 1RPAA 4WA8A 4QYIA 1JMYA 1SC9A 4DR7B 4J16C 4ZYTA 3T9EA 3AEYA 4F5ZA 3KFVA 3FBTA 1LJUA 4YVFA 4NPCA 2DQKA 2ZJFA 1NE2A 4KQKA 4V1CI 1VLZA 5LNK6 2R8YA 2V7TA 4B83A 4HTAA 4EO9A 1MZPA 3ANYB 2E85A 2G77B 3NATA 4DMHA 2BI7A 2RKBA 1DU4A 1NC1A 1Q15A 3LZCA 5EZYB 4BNKA 1ZNZA 4C4OA 4CBVA 4BE4A 3U6KA 1XPJA 2FPOA 1SZPA 4JXKA 4L6IA 4LJYA 2IP2A 3LYLA 3ILXA 1GPKA 2VYVD 2C94A 2X7XA 3MGAA 4KQ1A 4LMRA 4YNBA 4RFSB 3RT7A 4WBSA 1X9HA 1E2JA 3QVXA 4CV2A 1GGNA 4B6PA 2VJLA 4REOA 4KOAA 2BT4A 1E3IA 1HM5A 1IY2A 1CUHA 1YASA 1DVRA 1JKFA 3DDHA 4UQLA 2O5EA 2WIBA 4X6LA 4BQOA 3K0SA 3R5JA 2AFHE 5L3SB 4DCOA 3DPUA 3PGA1 1SU8A 3HO6A 2NN3C 1Q0HA 3IOEA 1EHYA 2GKOA 3D8BA 1AO3A 5ILOA 4AAYA 3SJBA 3Q0IA 2CXXA 4HPWA 1QX3A 3E70C 4KITB 5DHTA 2OPHA 1PR5A 2RHBA 2WM3A 1XJWA 2QD3A 3I04A 2QGZA 2Z2ZA 2A57A 4IIFA 2C03A 1MTOA 1YR1A 3T9CA 3TK1A 4DWVA 4JJ6A 4HFMA 4E7PA 3PT5A 3OOSA 1L5OA 1K6JA 1RJEA 3D0KA 3D8NA 5GADl 2AHRA 5L4SA 2W2NA 2A86A 2EC5A 3WGTA 4C1NA 1O77A 2QVZX 1CFJA 3BRQA 4MVJE 4KWCA 1S5PA 2YH2A 4F4FA 4WUTA 5HCUA 4EP1A 1XCPA 2F9LA 5EWLA 3WL8A 5CXXA 3DXXA 1Z16A 4E4RA 4Q24A 5DM70 2O8FA 4DRXB 2DBZA 1IZ7A 4BB5A 2AYYA 2PBFA 1VPDA 5DM1A 4CLOA 5LYJF 5H9VA 3H11A 3ZHBA 2J0UB 1EPUA 2ZKIA 2BUCA 2EFCB 1FCJA 1CIVA 2IUSA 2B69A 3IAS1 3VGPA 6NULA 4JI2B 2UU9B 2Z3WA 5GZ1A 3IUQA 1I3OA 2QRVA 3BH7A 2JARA 1Q20A 3M4YA 4QXOA 2WWVD 2OHVA 2CT8A 2W2PA 5E38A 4ZVNA 4XGRA 3JVIA 1XA0A 5I9SA 3I73A 4EYEA 3D6AA 1CY2A 1KAMA 2J6CA 3H1AA 4GZLA 1NT4A 4HPXB 4LHVA 4MRSA 4Q9JA 4K8RB 1HFWA 2ZE6A 2HIAA 4G23A 1T6BY 4JJ4A 8MHTA 4KXUA 3NJRA 2QAGB 1U5AA 2GSDA 4UNPA 1V35A 1A98A 4L8WB 1FRQA 2FPSA 3FFTA 1EGHA 1EXNA 2GCNA 2NV0A 4KN9S 1DUVG 4IV5A 4PINA 4QLBA 3CT4A 1YGYA 1P6UA 2OWDA 1TXGA 4WZ6A 3BWVA 4W5RA 1X74A 5HCNA 2FDRA 1Q21A 3KR1A 5HQ3A 2BKEA 3HJHA 1U5BB 3QVJA 2Q2NA 1N8SA 2ZAMA 1PDOA 3ACDA 3PWTA 4JD5A 4NNOA 5CH3A 4YN3A 2PGNA 2GEKA 2W2LD 2G1KA 2EGHA 3GLFB 4E51A 2J33A 3KHSA 1HZZA 2EJVA 2QVLA 1QFYA 1KFKB 1EVQA 5EIXA 1YZYA 3TJRA 2AOTA 3MQ4A 2CC2A 4RD1A 4YUWA 2PPVA 3TIXB 3OIWA 1OX4B 1RTKA 2R0QC 1NXSA 1QAOA 3BWDD 3V4RA 5HCIA 4UKDA 2CWDA 2B5OA 2CUKA 3GDGA 4V39A 4DQXA 1T91A 3NGMA 3SS8A 7ADHA 1HLPA 2BMJA 1EP9A 3HBJA 1AQJA 2NSLA 1MBZA 4BNIA 4HZUA 2BEWB 2WI8A 3GQBB 1HLFA 3U9TA 1XWWA 1E1QD 1M1YB 4OOEA 1NJ5A 1M6YA 4AC9A 1F3OA 4EYGA 1USUA 1ORIA 1T6YA 2WP8J 4KB5A 4WASA 4DLRA 2H1WA 4X8LA 4KI7A 5CW2A 2C2YA 2FFQA 2HADA 2Y67A 4M9CA 1KEEB 2ZBEA 3VPBA 3JQBA 3VA7A 3FTPA 4JT4A 1MD9A 4OLHA 4EVRA 1NDHA 1CVRA 3QBDA 5HGJA 4CM4A 1V16B 2FP4A 3M4NA 3ME5A 4DBZA 4DMGA 3JQ8A 2PZBA 4U5XA 1MN6A 1N75A 1FFSA 2O8VA 3MWKA 2RHTA 3PA6A 1BE1A 4EW1A 4F6RA 3BJMA 4JOSA 4YQZA 1V8FA 3OPXA 1NLYA 3ADBA 3M33A 2I7CA 2XAAA 2KI5A 1DJPA 4MITA 5AJYA 4TKZA 2N42A 2ST1A 3T38A 5DHAA 3A28A 3TZ6A 1JVSA 1R0LA 1QUEA 1ST2A 1Z33A 1HORA 2BFOA 2D1QA 3FMGA 3NPMA 4N9WA 3WRXA 1VHJA 1P2BA 1H6BA 1ULBA 3DB2A 3F7NA 5CIQA 2GXAA 3HRKA 2QXYA 3BFKA 4OLFA 5ARCA 3WIEA 4JSYA 4IMPA 4E5PA 4DA4A 3OTGA 3EOAI 4YWJA 3CNHA 2V0CA 5DM2A 3GLTA 4JVLA 1FTYA 3PHCA 4HNGA 1YS2X 4OLJA 3UM9A 3LLVA 3OJ0A 4MV5A 1OAOC 5GONB 4EGSA 4NXMB 4DNPA 1HE4A 3CH5A 3PJEA 3LD9A 4H27A 4DQDA 1UDBA 1T1JA 2C84A 2YR0A 1JQ3A 1Y4DE 4D4KA 2FZWA 3SYTA 3P45A 4X8HA 1A95A 3MTIA 5JSUA 1DRJA 1QGED 1T8YA 2O1WA 4QYIB 4WOKA 3VU8A 4CVNA 3PJFA 1EQUA 3CUEF 3JQEA 1HYQA 5DEOA 1JIKA 5EG5A 3JQRA 4WCFC 2GJ9A 2IF2A 1ZH0A 2VG8A 1JDPA 1L4BA 5L7YA 5JRJA 1CTQA 1UOPA 2QTVA 4XR4A 3WQHA 5AW0A 1Z3CA 1E0SA 1SK8A 3A1UA 5FA6A 4R69A 3RS8A 3G49A 2P67A 1W59A 2ZS9A 5AI8A 4KR7A 4EABA 4JI7B 2I4IA 4MRVA 4ERXA 4XVCA 4K5QA 3ZI7A 4OFWA 4PEVA 5I5EA 4C4YA 1NXWA 4AUEA 2NT4A 1IYZA 2OMKA 1GP2A 3GVXA 5IKOA 2OESA 4KXMA 2GTIA 2YWCA 1UPFA 3JQAA 2FSGA 1KK2A 1N5DA 3MJEA 1EH5A 5F7ZA 2UYCA 4EB6A 1TMYA 2B8WA 5H82A 3WHIA 3FLMA 1QYWA 3LSTA 1G3QA 3M81A 3ESAA 3UWDA 1NRJB 4K87A 2I6UA 1H9CA 1XEWX 3T12A 2FPIA 4RAOA 4B2YA 1NU8A 4LXYA 3TBKA 1E3EA 1JSCA 4OQ4A 1JP7A 5EOVA 3QXHA 4JX8A 5FT9A 3EHDA 2JHFA 3NWPA 4HH3C 4FZ3A 4BLWA 3OEHA 3EF3A 1H0HA 2VPZA 2X9VA 3GDFA 3OAAD 4HEA6 4X95A 1KSHA 1LXCA 7ABPA 2JJQA 1D1PA 1XQVA 5IN4A 3AO0B 1H42A 4Y6LA 5DNDA 3C5CA 2GYUA 3UCFA 5KYYA 2V7QD 3O2JA 4UTOA 2HAEA 3SHWA 1L1QA 1NOKA 2IDMA 4Y6PA 5EWLB 5B30A 3P4UA 4IGEA 2PSEA 4KXLA 5E9JA 3GGDA 4XWWA 4G5XA 2DX7A 3A7DA 3RH0A 3OJCA 4KWEA 5E8RA 4CLOB 2B2NA 2CK3D 4EB8A 3EIEA 5REQA 3FOEC 1EIWA 3CVJA 3L0OA 5I7OA 4G5QA 1D2CA 1DZIA 1PWEA 4JQYA 3WKEA 4D2IA 3TM5A 4MR7A 5IZ4A 3IMKA 4EY7A 3SQXA 2QRVB 4QBGB 3CKLA 3I12A 1PBNA 3UQZA 3VXKA 4NH4A 2YTZA 2IE8A 4FDLA 4J16A 1M83A 4MQEB 3T06B 4RF3A 4IDQA 1VJTA 4ND1A 3B7PA 4TL7A 3Q6MA 5IK2A 1C3JA 4S24A 3RUHA 2FG6C 2ZTHA 1Y34E 4RJ2A 1H4TA 1CB7A 1DQPA 2PBLA 1FTQA 4LV5B 3K9CA 2CMKA 2R00C 1EG7A 1EBBA 1XZJA 1TAUA 3GJ6A 3HVRA 2HO5A 1QPGA 5HQ3B 2CL6X 2ODTX 4ZEOA 1PZGA 1HT3A 2WIGA 2OV2A 3IPRA 2OV8A 3SE7A 3BDAA 3CC8A 5TS2A 1Q7EA 3FB1A 3SEFA 1DIRA 5JCXA 3KEQA 4PGGA 1I7LA 4K9MA 1TO6A 1TOAA 1TUIA 3W9UA 3NXSA 5DBGA 1HPLA 3BWBA 3AJAA 2AOTB 1V3TA 1E3MA 1UPAA 5BNZA 1W2GA 4QXMA 1OGIA 1YFKA 3T7AA 2H2HA 4RKFA 3QFCA 4UQOA 3ZCUA 4EX7A 4V24A 3FWZA 1AQUA 2OA0A 4AJHA 1C3EA 4LIPD 2IXDA 4WACA 1G5HA 4JELA 1WB4A 3TQQA 2OHHA 5AOVA 3GMTA 3UMVA 3O4GA 2AZ4A 3SDBA 4G4SO 1P8JA 5FUQA 5DDIP 4BNTA 4F60A 4FZRA 6CHYA 5ALJA 3TQSA 3QLUC 5T3UA 1UAAA 1CC1S 5KEIA 2ZYDA 2I1WA 5FNVA 2VO1A 1ACJA 3P0RA 3IIMA 3K5WA 3U60B 1W49A 2P40A 2LGJA 4LSGA 1Y0BA 4CM4B 1H4QA 2FP4B 5IEBA 1CF9A 4EMTA 3TINA 1NBEA 1FU4A 1EWTA 5FKJA 1JB9A 1T36B 1L3BA 4P32A 4J1TC 5LQDA 1SEPA 2VPPA 4FZVA 4JNCA 3T7JA 1QE0A 1QNFA 3QNMA 1RYFA 5HBGA 1R5BA 3EXHC 4JUDX 3ZXIA 4D9MA 3MQ2A 4GVXA 1GQOA 3C6MA 3MWLA 1VLLA 4BP3A 2IZOA 1TM7E 1X1QA 1F5NA 3P2MA 3GCDA 4J2HA 5AVJA 4F6LA 2C20A 4BCDA 3RYHA 1UR5A 2I2FA 3A3KA 1JPVA 3VVMA 1BW9A 2NGRA 2BGMA 1DQRA 1ES9A 2JZCA 4CPDA 3BCUA 4DXHA 1T1GA 1W2HA 2E1PA 3HO8A 4G0WA 2IIVA 3I5YA 2AZDA 1W47A 3BE8A 5B6IA 3LL4A 3Q8LA 1SG0A 1J2RA 3D5TA 3S29A 3B6ZA 3M9WA 2WQ6A 2TMDA 2NZ2A 4NBKA 2QAJA 2HC9A 1NW8A 2DFTA 4JT8A 4Q7JB 1AUXA 2EGGA 2BFDA 3LV8A 3ZTWA 2H9IA 4FMPA 1A8UA 4CQMD 1GADO 4MV9A 3Q5DA 3TX6A 2RGYA 2PWPA 1EWRA 3VX4A 1WAMA 3AUUA 3L9XA 4UTXA 4ZDWA 1T3SA 2WYUA 1A5SB 3MBIA 3NZEA 4DLAA 3IBFA 1P9LA 2IHKA 4W5WA 4ZGGA 9LDTA 1RRFA 1YQQA 1FU8A 1ZL0A 4KX3A 4LZNA 4H16A 4M0KA 1RVDA 3A4VA 1C7ZA 3NC4A 5FBRB 3EX7C 3OTWA 3IKLA 1DPFA 2AXQA 4I4TF 2PLRA 3ZXXA 1RZVA 4ZGWA 1IQRA 1BA3A 1P1IA 4A23A 1U04A 5MFPA 2QY9A 5D2CA 1IZ8A 1JQLB 3U4IA 3I39X 1N5LA 5F51A 1BQ4A 1PWZA 2GK4A 3BIJA 1KOJA 3HL0A 4HZIA 4PE5B 1VL6A 3ROGA 1YKGA 1QB8A 2OMEA 3ML1A 4E12A 1C8BA 1WXGA 1GAXA 1DLJA 1S2IA 3Q98A 1UIMA 4IVQA 4XQ0A 4ABYA 1QS0A 521PA 3ZDXB 5LN1A 1UBUS 1X1SA 1YQ9A 2VF2A 2RC5A 3JQAB 4QE3A 5ARDA 5L4LA 4RTNA 4EB6B 2C4WA 3CNLA 3M83A 3I9MA 3V8PA 4LBVA 2JI7A 4JBLA 1BDMA 3VH2A 1A9OA 1NVWQ 4TLAA 2Q4EA 2QLBA 5GQSA 2FPIB 4YS6A 2WIDA 3COYA 4UXHA 3CS3A 1KU0A 2LBPA 4KEAA 4QTZA 3VHLB 4CM7A 3SZLA 4ATNA 2J3IA 1K7XB 3Q7QA 4L4RA 3USCS 5DHSA 3H0KA 3HBAA 4YRLA 3DJFA 3EVTA 1RXYA 1N92A 3TGPA 1IEVA 5G40A 3ORQA 1U5CA 1WKVA 3NKVA 5KYYB 2N9UA 4RAQA 2O3SA 5CB0A 2VHWA 1AB5A 1UP4A 2A5JA 3TKYA 5FPSA 2E49A 2AVDA 2PN1A 3CLUC 4MTCA 4D42A 3ESZA 4G8BA 1SKUA 4MV8A 4PHFA 2BH2A 1VGRA 3EPKA 4EY8A 5J3JA 1E2MA 1AOXA 3PHGA 4BEBA 3TBHA 3WNBA 1F1JA 5REQB 3S1AB 3UTCA 5TR9A 1G291 2HPAA 2OZVA 2WG2A 4ZCQA 2WWYA 4MR7B 4MR8B 5ICFA 4D74A 4F5EA 4CQLA 1WU8A 1CU1A 4JI5B 2PSDA 5B2FA 1FMFA 2CD7A 5J59A 4C05A 2BHTA 2J4DA 4HLNA 1D09A 2GNOA 5JJKA 4WCFA 5E7MA 4M1QA 1DO8A 4B7CA 3FNRA 4FOOA 3FJYA 4EF6A 4EG4A 3FFBA 2VWGA 2XX3A 1NUUA 3I28A 3JWIA 1Y8RA 1VSUA 3ZK8A 4Z7QB 1IN1A 1ZEJA 3ZBTA 1W2WB 2AB0A 4OMCA 6ADHA 1GSOA 2Q3LA 1Y6RA 2ZJ7A 2CNKA 1ZONA 3LCMA 3E23A 1M0TA 2BH9A 1F9AA 5D00A 2R2GA 3VX3A 1TZ2A 1USWA 2JD1A 3PUWA 3DDCA 2V1UA 1D2EA 3THOA 2R86A 1SUSA 4LV6A 4R2IA 5H1YA 1T2AA 1VJ5A 2HIHA 2NG1A 3T7SA 4G3XA 3OO1A 4BVHA 1NNEA 3WTCA 2Z95A 3ETHA 3PNLA 5K6TA 1F4PA 2YJ5A 2AOWA 2VSFA 4DA8A 2ZRIA 1A4RA 3MWDA 3R20A 2BELA 4EAQA 2R7MA 1TVKA 2LRHA 1U8YA 2C9OA 4LG1A 4OHPA 5EINA 3UXYA 4P7BA 2BSAA 1APBA 1ZM3A 5J63A 4HNHA 2NQTA 3H5NA 3TXAA 4A8TA 1G7RA 5C7LO 4QGGA 2VHEA 4H31A 4L9SA 4E15A 5K0ZA 3KD3A 3WG9A 1TQ6A 2FPLA 3UWSA 4EVIA 2VLBA 4J0JA 5E1BA 4PQGA 4LJRA 3CM0A 1K4KA 4QNMA 3LYHA 4FFRA 3ZE1B 2DBQA 3QUBA 3T7RA 5FNVB 3PCRB 3GLGE 1T1RA 3IPCA 2OG1A 2NUPB 2VRCA 3GRPA 4ABTA 4J7AA 4QBFA 2AR7A 1RWWA 3AR4A 2D00A 1M2JA 1XXHA 2HEIA 4I0WB 3W4IA 2FN7A 2OKCA 3ND9A 3RODA 2JH8A 1WB6A 1G41A 2F1RA 2I1VB 2P8JA 3BTSA 4I55B 5ECGC 3BJIC 4GI1A 1J4AA 4X9XA 5K3FB 1QZ3A 3V8EA 1M5UA 1BDHA 1VL5A 2V0GA 2QX9A 2B5VA 1ONPA 3IE2A 2LD4A 4FQ8A 4II7A 1G1MA 1CJMA 2WFMA 3SQMA 2NTEA 1KMMA 4CM8A 4J0QA 1LU9A 2YWEA 4MUXA 3O91A 3RYHB 3WQRA 4EJ6A 5LQAA 4OBWA 4RYLA 2JF0A 5TPZA 3M6MD 4JCCA 3GF4A 5IVPA 1BW9B 5IAOA 2V4ZA 3K70D 1RJWA 2V7GA 2AW5A 3O4JA 3OJOA 3O95A 3O8LA 4HVLA 2QE7D 2F6RA 1IOVA 4LS3A 2MU1A 2Q9BA 4U2EA 1ZMXA 3OCCA 1LPOA 3E3NA 3VJRA 3B9RA 3AHJA 1S2MA 2QT0A 4OTZA 1Z5OA 1E5VA 1L6RA 4LQCA 3UEOA 2QR2A 4IUDS 4ZYUA 2BFDB 2VNAA 3NB0A 5I47A 1ZVQA 4L76A 2FRVA 4CL3A 5E3HA 4DCVA 3HWSA 2WIFA 3CX6A 2GF9A 4XGIA 1RC1A 3VHQA 4B73A 5BQ3A 2RI0A 2QUIA 1KIMA 4KYVA 3AUXA 1WBDA 2IBMA 3ZHCA 3G2QA 1DDIA 1F14A 5BQOA 3U40A 3ZW9A 3KWMA 1Y7IA 4D9HA 1AQ6A 1M6WA 2EKDA 2E5FA 3T7DA 3JS5A 4CU2A 1C81A 4GR9A 4GDFA 5CD1A 3L2OB 2FA9A 3RWBA 2NLOA 3A6PC 4K6MA 3LF1A 3RAJA 2QJTA 3FVTA 3RYIB 2W37A 3L49A 5HJEA 2XVAA 4TXMA 5DNEA 5CB6A 3IQFA 4NRDA 3AL2A 3RS3A 2X2PA 5B64A 3TD6A 4NDZA 1I4EB 1YRQA 1L7BA 4JX9A 4F5DA 1MOSA 4FVTA 4M49A 1QGDA 1YSCA 4E5SA 3VH4A 3N05A 1YC5A 3LCCA 1MTZA 1N9GA 3N39C 4YRAA 3K6SA 1ZIPA 4EGAA 1XMQB 3R5FA 3GCWA 1KEVA 4L50A 3JALA 1FEZA 1GPMA 2O0HA 3I72A 1VXRA 3OECA 4J07A 1ND6A 4KGXA 3STUA 3ZLJA 2WWWA 1GKUB 3SJ7A 5LM3A 2RHRA 2AUTA 1P4JA 1ZOIA 2W6CX 4TSFA 4E11A 4KPYA 2C57A 3EXHA 2GNAA 3BJRA 3B2QA 3I8SA 4M9ZA 4OU5A 4KIJA 1JG2A 4QICA 1Y5NA 3UC9A 4NCAA 4RIFA 3L1JA 2A78A 2E4AA 1E1CA 3L7KA 5JALA 1X15A 3TG2A 1MAVA 1N1EA 4CG1A 3K70C 4URFA 1ZH8A 4NK4A 1Q17A 5HKLA 2WDZA 3K0BA 5FWNA 2AOXA 1G2QA 3CJQA 4MCHA 2JAPA 1Z37A 3ZLTA 4CDMA 4XVQA 2QG6A 3HJGA 4O29A 3VO9A 3ZE7A 1Z29A 1PZFA 3I6YA 1NYRA 2HFJA 3I2HA 1KYQA 4NEQA 4F5WA 5JISA 2FKNA 3N0XA 4UNIA 1FPQA 3B9PA 4WZBE 1Z4IA 4LUCA 2DE0X 4FYHA 4QAQA 2X0NA 1TGYA 3KAQA 3P7MA 2ZRQA 1KO5A 1Y98A 4FFSA 1KXJA 2G9QA 3D8SA 4WOBA 5HMMA 3RABA 4AUMA 3ZCVA 1HZJA 2JEYA 3T7KA 1VPWA 1GYQA 2WLTA 3I9FA 4CQLB 1UJ4A 2FWRA 1T9CA 2JAQA 3WGZA 5I7VA 1Y1PA 3CLVA 2I22A 5CA0A 3ZNPA 2NM0A 1T9BA 4A4DA 1SUPA 2VOEA 3FSJX 3SXJA 4WCFB 5IDQA 2A9QA 3G3EA 1JQAA 1MB3A 2CFCA 4NMWA 3OOYA 4O02B 2VOJA 4PW0A 1KK1A 5JVDF 2WD7A 2P9YA 2YWGA 2W2QA 2X15A 3F6BX 3ZGXA 3BBPA 3STHA 1WXWA 3GNLA 1YJXA 2ZM5A 3B3QA 3LPDA 3FPHA 4RXMA 3R4CA 5HILA 1RYNA 1ZJ4A 2QZZA 3A70A 3ENQA 1YQGA 4WXRA 3N8NA 5BOVA 4RCYA 2ZP1A 4HZGA 2CNWD 4PZUA 4YXWA 4E33A 3QOYA 4Q3OA 2VF4X 5JAHA 4WX2B 3WGVA 1PK9A 4P4LA 4TKMA 3NNDA 4PHTA 5C4IA 1UFKA 5C32A 3DVLA 3ODGA 2WZBA 4ZJPA 1I7NA 3GRUA 3CMCO 1OUMA 1AVTA 4MHOA 2X5XA 3FPSA 2ZI3A 5K99A 3ET4A 1AF7A 1L3IA 3QUAA 4PG4A 3OCZA 1CZKA 4QOIA 1Z83A 5E1DA 5EEHA 5KJEA 2IYXA 3MMSA 3MWDB 4GOJA 4XDYA 3ORSA 1TVKB 2LUOA 4MIYA 5ALTA 1NBMD 5LZ5A 3HVUA 4LTDA 3SP1A 4FCTA 1O9GA 2GARA 1V6SA 2M6SA 4BIIA 4L7QA 4S3MA 2XCOA 5LNK1 1IEWA 1EM6A 4MDEA 3F3SA 3KTFA 2ZANA 5E3IA 5FO0A 2C54A 3AHFA 2JD0A 2QD2A 3RT9A 3SPXA 4C0KA 3VQTA 2XYRA 4BWFB 4MEJA 2BFWA 5G4LA 2QRPA 3GA7A 4Q6BA 1ZHOA 1KYWA 1X77A 4MUJA 4QOEA 4JVMA 4AMGA 2HK6A 3D4PA 1B74A 4NEGA 4C01A 2VDPB 3T5MA 3VPDA 4M3NA 5CG2A 4LY6A 5ED4A 4JLBA 4FINA 2A5FA 3V7WA 1R3UA 2R48A 2OBYA 2OAP1 3CW8X 1R4NB 3EH2A 1NP6A 4QJIA 3SQNA 4D41A 3W1EA 3OQVA 4XQCA 5F1PA 3TKAA 2RAUA 3IUMA 4NMLA 1JL3A 1Y6FA 2ZWMA 3DYIA 1Y6JA 2O2SA 3N0WA 4PSAA 5ICCA 3N8DA 1U0EA 2B99A 5BSWA 4NCHA 3MCAA 4II3A 4CM8B 2XF2A 3A05A 3Q85A 5FTJA 1XMOB 4OGLA 2YZGA 1XF1A 3G85A 3JD3A 2ZRBA 4DUGD 5EEGA 2EZ4A 4P35A 3W9BA 2RG1A 5J40A 2NZUG 1FK8A 3HYLA 3PHJA 3LX4A 3BG5A 4NBLA 3OM0A 3U3XA 2EJTA 4S04A 4RHTA 1BVUA 3UVEA 3E1SA 4IG9A 1T25A 1LV7A 1N6NA 1NJSA 2BI4A 3W8RA 4BPBA 2H4FA 1FFXA 3G5MA 1A71A 4AG3A 4CG2A 3R5HA 4R05A 1KDOA 3IJPA 4OBBA 5HTOA 4E5NA 3TQTA 3BK2A 3HV0A 4IILA 3T5GA 4QELA 4C0XA 2G1PA 2QLFA 3GRZA 1NPDA 2PKEA 1VE1A 1E60A 4RK6A 3SZUA 3E48A 1OXXK 4XRGA 1ZD4A 3HB0A 1XOIA 4N6OA 2OV6A 2ID7A 2RIPA 3A37A 4NNPA 1PL7A 3A1WA 4O4IF 4ZEXA 3SK0A 2PKCA 5B4VA 3DFFA 3A3NA 3H9JA 5IWAB 4GT1A 4PSCA 3U7RA 1VC2A 2ID9A 3GH3A 2QPTA 4NENA 4Q21A 3GG9A 4J6EA 4M8SA 1I4LD 3IAFA 3F67A 3TSOA 1YOVA 1T35A 2CKDA 8AT1A 4CODB 1KETA 1E6EA 2I6GA 4G97A 4JUAA 4NH0A 3VR4D 2ZTUA 1WDKA 4PAGA 4DF3A 5AHWA 4F3TA 4OKIA 2GCIA 4D9IA 1IULA 1EWKA 1TF7A 2DHEA 4NZOA 3RFVA 2IT1A 3WK5A 4CJXA 2O0JA 4A8JC 1TFUA 3IT2A 3LT5A 1GPNA 4A0SA 1EX9A 3W6OA 5CDFE 1E3SA 3NIDB 4GC9A 4AWBA 5DYNA 3PCTA 4FKZA 3GMSA 4QUJA 3OEEA 1KZ4A 4M8KA 3K6SB 1ZGHA 5BW6B 3TTTA 2Y77A 4TMWA 3R41A 3JALB 2JZNA 1F4LA 2MJLA 3G8BA 3HB5X 5BWBA 4DR5B 2H1OA 1ISFA 1T8SA 2PZJA 3I61A 3C6QA 2YCLA 4UPDA 4Y6QA 4FSHA 3EXHB 4TN5A 3QVLA 3P71T 1VG0B 1K5DA 3AKDA 4JUFA 3IP8A 3QELA 3AK4A 2JJ8A 1CNEA 2I2AA 2ZBQA 3UG7A 1Z9BA 5J4KA 4EVQA 1E1CB 2A14A 4MICA 4LOHA 2CHUA 3RVNA 1USKA 4JGBA 3TOZA 4U7GA 2E0IA 3TSAA 4BVGA 3ZJTA 3GRYA 1NP7A 3WYEA 2NO9A 3PD0A 3HWRA 2HRRA 4D8UA 2HA4A 5DULA 3GJRA 3CJTA 4HDNA 2IZ7A 5BUSA 4JJGA 1GRVA 4LE2A 4OEHA 5BSKA 1GGKA 2Q5FA 1N2BA 1Y1RA 1P7YA 5LDHA 1YVRA 4LYAA 2AJBA 5K3BA 3H5IA 3KJQA 4MK4A 5JNTA 3U48A 5LC1A 1RRGA 1VCOA 2QI9F 5T3YA 4W5QA 4I1UA 4GVLA 3TTVA 2PUJA 3VYTB 2GKGA 1KY2A 5GJWC 2RAPA 4NHEA 3IO3A 4QT0A 4PVCA 2QLJA 4C07A 4YJFA 1UKEA 1M5RA 3LOUA 1KAOA 5CA0B 1ZUWA 1U4NA 1TQ4A 2JLAA 2O1EA 4QHTA 4RVDA 1AZSC 3ZY2A 5A4MS 3LUBA 2G3YA 1C7EA 2OO5A 2ZIZA 5AJVB 3MJDA 3GXOA 3RYFA 1G20A 2PHZA 5EJIA 4EA6A 4U2CA 2WE8A 3UK0A 2WD7B 1G38A 3ITDA 4KX5A 4HRXA 3UMFA 4YJ3F 2QBYA 3QKRA 5E6SA 2FZGA 3S7TA 5BN5B 3CHYA 2XMCA 3S1LA 4BNNA 1OLXA 3QU5A 1BHQ1 1NVEA 1K6EA 1II0A 2ZCUA 3T7EA 3B36A 1ECFA 4NICA 5A4JA 4BBJA 2PX3A 5I3ZA 3B6EA 4GECA 1UXKA 4EZEA 4FDMA 4MMZB 3HJRA 1H05A 3PNPA 2D8MA 2PZAA 2C61A 1GEEA 2WLSA 2YFKA 3NGXA 4NBWA 4Z9FA 2DY0A 4FONA 4AMBA 4YAIA 5CCBA 5AJTA 2GEDA 3FHCB 3PLRA 2BGGA 3HACA 1YE5A 2VXCA 3RADC 1U90A 4P81A 1TMGE 3K1AA 4CETA 1Z6ZA 1EFAA 5KSPA 3A36A 2IY9A 3FBGA 1MW8X 3KV3O 4KJXA 1WW2A 4UHCA 1KYVA 2YUIA 1DBPA 1WXDA 4N5LA 2A3NA 2CYBA 4MPJA 5CD9A 3HTXA 3NTXA 2WG1A 3P2IA 4JT9A 1NRXA 3REOA 3VYUB 5LWHA 3HA3A 5D51S 5DU2A 2Y05A 2JBWA 3DHEA 1NLMA 1UOOA 3NH9A 4WXEA 3OZWA 1ARZA 1OTHA 3CBGA 5JCJA 1J90A 5L3QA 3QXSA 3N58A 2H08A 3P9PA 4MTLA 5SICE 421PA 1ZMTA 1PNQA 5FPYA 2C0CA 4KQFA 3MMZA 1WF3A 3NT4A 2AT1A 2CXTA 3G2NA 1KJNA 1OF1A 3X43A 3ZZ1A 4DUZB 5DBHX 2ASVA 1NQAO 1YE3A 2FX3A 3Q8XB 1M8FA 4HTFB 3EUEA 5EN4A 3FNEA 2W6OA 3FSGA 3FA2A 5EMJA 1AGYA 1E94E 4GI5A 1HOXA 3HWWA 2VDLB 3B20A 2C2OA 4ND2A 4UHJA 1C1DA 1P3DA 2O1XA 1W85A 3HR8A 2PD3A 4MJ3A 4URHA 2VJQA 1JGTA 3AY3A 4DCJA 4NQRA 1UBCA 5JQGA 2AF4C 5FUXA 4YAKA 3CSSA 1X2BA 1YRBA 2Q29A 1N7GA 3FNBA 1PT9A 2IW1A 4V1CA 2Z1MA 5FCDA 2F64A 4HEA1 5L45A 3DHYA 3LHDA 1ZEMA 4FOSA 4A73A 4F8EA 4J3FA 4FUQA 4N1AA 2L0XA 1POWA 1EFVA 3NT2A 1XTQA 3G68A 4KQWA 4RZUA 4UUAA 1W36C 3UUEA 1Z4NA 3DF7A 2JFHA 2B3DA 1ZCZA 3NWBA 2ZT7A 4WK0B 1B73A 2JIMA 1BEUB 2OILA 3UHOA 1FJGB 1WDWB 2Y1EA 1II8B 5LQCA 1FFXB 3C70A 3WMEA 5JE8A 3ZC3A 1BH2A 3PRKE 4YCSA 2I4RA 3O3MB 2XE4A 1F8FA 2HF2A 3FUWA 4KAFA