4F9EA

Cyclic di-gmp sensing via the innate immune signaling protein sting
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
173
Chain Sequence
NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPDSSFSLSQEVLRHLRQEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein 173
publication title Cyclic di-GMP Sensing via the Innate Immune Signaling Protein STING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 51
structure length 173
sequence length 185
ec nomenclature
pdb deposition date 2012-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f9eA02
5CFLA 4F5EA 4EMTA 4QXQA 4EMUA 4F9GA 4F5DA 4LOLA 5CFMA 4LOKA 5CFOA 4EF5A 5CFPA 4KBYA 4F5YA 4F9EA 4YP1A 5CFRA 4F5WA 5CFNA 4EF4A 4KSYA 4LOJA 4LOIA 4QXRA 4JC5A 4QXOA 4KC0A 5BQXA 4QXPA 5CFQA 4LOHA
chains in the Genus database with same CATH superfamily
4LSGA 4B3XA 4LJRA 5K0NA 1TT7A 2WJPA 3FFBA 4JUDX 3TBFA 4BGEA 1XLVA 2XTNA 4ZICA 1KJYA 1KO7A 1VKRA 1XZDA 1GQYA 2J1LA 2Q3BA 3C8MA 3Q3IA 3K8OE 4I55F 4KO4S 4OQEA 4QODA 1UZMA 4XXHA 1KAQA 1YJBA 3OETA 1GKKA 5DTRA 3RIEA 4A23A 4YXFA 1XKQA 2WILA 1SD1A 1XNQB 5J4LA 1DKLA 3UANA 1IUKA 4EY7A 3N70A 1AZTA 1PQPA 3PGMA 3OZDA 3IEMA 2MR6A 5EJGA 2W70A 5I3ZA 1OASA 5MN4A 2LCIA 3U4HA 5FA8A 5EHZA 1UT6A 4LV6A 1CIVA 4I8DA 4F97A 1LJ8A 2OPBA 3OQBA 3GDGA 3ZK7A 2QVZX 2PMKA 5JO9A 2AR7A 1IOZA 3C3KA 5HS6A 2CMKA 5LQAA 1KYQA 3FBWA 3UJ7A 1JSLA 5AJWA 3O4HA 4DNOA 2QD2A 1KMMA 3P4UA 1HSZA 1SXIA 4J49A 1PK7A 2AW5A 3PHJA 4NCIA 1GL9B 2F1IA 2L17A 3Q9SA 4N76A 1AXRA 5DSTA 4BX8A 1QFJA 1T4BA 1KFEB 4C08A 2HRCA 1CPYA 4S1TA 4CM9D 1D04A 3AT1A 5AVWA 1KS2A 4QQFA 4CIVA 1DUSA 1SCIA 5KVAA 2DM6A 3HUDA 1V95A 1UWLA 1RWKA 1AY0A 2XMPA 4L5IA 1W73A 2MHCA 1X3SA 1RM0A 2WPDA 3KTFA 1SUEA 2IDJA 4HGPA 2C4WA 2OWEA 5C7YA 4I9NA 5BW6B 2G1PA 1OREA 1XEAA 4XDGA 1ZVMA 2ODNA 3UJ6A 2HJSA 4J2HA 2P6NA 2XKJE 5J2TB 2VPWA 1OCEA 2VYCA 2VAMA 1EKXA 2HMYB 2XOKD 4U2EA 1T9KA 4CI0B 1FDVA 1HDGO 4PWYA 1KAOA 3LKZA 2X0DA 1P7ZA 5TGDA 1JEQA 2QENA 2XNDD 4HUQB 5KSWB 2ZRLA 3DE0X 4PPFA 5CJPA 2E4VA 2I2DA 3OLWA 4A6EA 2RH8A 3FCYA 4NSNA 5ADHA 4B3FX 1Z0FA 1P18A 2IIQA 1V25A 1KQFA 4ALNA 4IQ4A 5DJ5A 3KL2A 1QRRA 4Q7LA 4BLUA 1ID1A 3Q9UA 5IX8A 1NYQA 4KXQA 4QTYA 2D2EA 3GG9A 3RU7A 3RVSA 3GGSA 3H4TA 3DO6A 4HWTA 1OZ0A 2VXYA 2YX1A 4BFCA 2JGDB 2WSMA 1OX5A 4NCBA 2BMAA 2QNRA 1JWBB 1M1NB 4ZGBA 5KYYB 1TEZA 4GOJA 4D3FA 2TSYB 3EAQA 4IJVA 1SWVA 1XC7A 1SK9A 1LRJA 4AZ3A 1MN6A 2RIPA 3HYTA 4XWOA 1YJQA 1PX0A 1Z82A 2MWMA 3WADA 4AJIA 4JDPA 3AI1A 1BOOA 3UG6A 1TZMA 2MYNA 1ZGZA 1RI3A 2ZRKA 1XHLA 1GFIA 3BJRA 4KQJA 3W5VA 4B79A 3AEUA 2X0JA 3K9QO 4PPQA 3OFND 2WM8A 1N3LA 5CW2A 1KJ9A 4PLCA 1DELA 1LV7A 4Z3OA 4OGWA 4QNNA 1FNSA 2IYFA 1NP6A 1TD9A 2I54A 3D8UA 3G0DA 4V0MA 4MWGA 4K2HA 3DSRA 1LSJA 1HKHA 1ISSA 1NZDA 3C24A 3PEUA 5DO9A 4J0GA 5FTLA 3VU3A 2C3PA 2UYGA 2D0IA 4GP6A 1XN1A 3OZXA 4KN5A 4MAFA 4Z8YA 2PJUA 1GRVA 5E6SA 4CRWB 2JGEA 1ODLA 2Z4SA 3JATB 5JPCA 4KQEA 5TF0A 4JP8A 3U1TA 1WSAA 2QOEA 3UFXA 4IM7A 2PMFA 3MUFA 2O8BA 3R23A 4FSDA 4Z9BA 3IE2A 2H52A 1TIKA 3OE4A 3PDCA 1PSDA 2HREA 1IEXA 2Q5FA 2WJHA 3QOXA 1DLJA 4NJEA 4HEHA 2V74B 4PYMA 4RSGA 1NT2A 3N7TA 1ML3A 2D59A 2CHFA 5JJBA 2FFQA 3IQWA 2V0GA 5F98A 1Y34E 4DE5A 3AUYA 4PYJA 5IJ0A 2QNBA 3VC7A 4IL5A 3FDJA 1MVLA 1D6SA 3CTPA 3IP3A 3AVUA 1R0RE 1QGAA 2HTFA 4EWLA 4WHMA 4QU5A 4UKDA 4KR9A 1J9GA 5G3YA 4PAMA 3C7DB 1RYDA 4P4SB 4AKHA 1BX3A 1S0UA 4G07A 4QJ5A 3ZHBA 5D51S 4UM9D 4AMYA 3DBLB 1QM5A 4O0LA 2MMGA 1N57A 2JJ8A 4XH9B 2R1VB 2C5HA 3QBVA 2B4QA 2F1HA 4PO3X 3GPBA 4Y2HA 3Q8WA 1EK6A 2IZ1A 3B6KA 1BE1A 4MINA 1XOIA 4H4CA 5FOWA 1SR8A 5BPFA 3DAHA 4R5HA 3SM3A 3AF1A 1QHIA 1XZNA 4O5OA 3RQIA 3F46A 1L6RA 4K6CA 4PZYA 4E5MA 2WDZA 3GMTA 1CFZA 3PLNA 4TT3D 4DM4A 5CD1A 4G0WA 2X9QA 4Q4DA 4RO0A 1PDWA 2Q6OA 5KNDH 5I8ZA 2OAQ1 3E5HA 3N6RA 2EU8A 2FZEA 4MSUA 4P34A 4GLBA 4WNYA 4G1MB 4AJPA 3LE8A 3ORSA 1NVBA 4UEKA 4CM1A 2B6NA 1M8JA 1N6RA 5IVPA 2JLRA 4FZVA 2HHJA 1O8BA 4UARA 4ND2A 3I09A 1S1CA 2GCOA 4RCVA 5AOAA 5ERGB 2C1XA 3W1VA 2IDZA 1G21A 1CQXA 3QV1A 4JFRA 4E3WA 1U8XX 5KC9A 4EVSA 5KWSA 2GUGA 1IQPA 3N1UA 3NDPA 2NYRA 3NASA 3NTVA 1J97A 3IUMA 4HH0A 1NRIA 5HCUA 5BOVA 4ZO8A 2C58A 2X6RA 1VRWA 2OHIA 2XTZA 2C4KA 3HJBA 2ECKA 3AGPA 1PFUA 2EXXA 4BMCA 2QM8A 3QG1A 2W6QA 4AKSA 4E4YA 1QHFA 2NU8B 5AW8A 3VC1A 1E9SA 2Q07A 2FF7A 1W0JD 3R6TA 2O05A 5C81A 3RGGA 4DLPA 5IYZB 4PN7A 4QNRA 1U2PA 3MJTA 4JQSA 3Q0TA 3IIJA 3SC2B 2VPZA 1CEEA 1AQ6A 5K6AA 2C9DA 2VT3A 2FEPA 2XDYA 2G40A 2WIJA 4ZAWA 1JR4A 1RQGA 5DBGA 3UWKA 4EELA 1QPZA 1XTVA 4OL0A 2AOXA 3FCSB 1JFFA 1RPJA 4XTRA 2ZUEA 1T8UA 2DUUA 2JIOA 1X80B 4H3SA 2QRNA 4HAOA 1G7SA 1E2KA 4M1TA 3DXYA 1F0PA 1TW3A 1H2BA 4M4SA 4AMZA 4IS3A 1I51A 4RACA 3HXMA 2NP7A 1E2EA 1VRCA 3TR6A 1Y7IA 2DLDA 3KQWA 4TMZA 4MXDA 2EZUA 4J75A 3SOPA 3SS9X 1J99A 3GJZA 1O1YA 2PMBA 1OA0A 4G85A 4HNUA 2O5EA 1VPTA 2VPXA 1V35A 3AZPA 1KQNA 5CNJA 1SKYB 1Y5LA 2MYUA 2WYWA 3LH5A 3II6X 4ZQBA 1FFBA 2P3OA 3M0EA 4RKWA 4HLCA 1UM8A 3ROPA 1K3TA 3AVWA 4UATA 2R1TB 1HSOA 2EZ4A 3QJGA 3DJYA 2MYPA 4QBTA 3SCZA 4OO3A 1GZ7A 5HDBB 5CLFA 1LFDB 1ZUNB 2HX1A 1WCWA 1EVQA 2FW6A 4L02A 2RHMA 1ZGAA 1K8YB 2J87A 3AMVA 5A05A 1MEEA 1RJ9A 3I9OA 2WHPB 4D4IA 1TM1E 2XWSA 5JY1A 4Z0TA 3RO7A 2HO4A 1SOWA 1IY0A 1LPSA 3IBSA 2I1QA 3NWEA 2NZYA 1PYOA 4PNZA 2BFDA 3BQNB 1T43A 1PT6A 3UM9A 5HILA 1YRYE 2ZVJA 2BLLA 1ZVJA 4NZNA 3RRFA 3KJZA 5KYNA 3LZ6A 5HP4A 4QXQA 2YV5A 3ZWBA 4B74A 4A8JC 1F7VA 3GNQA 5BXQC 5JATA 1OGIA 1SUIA 1BE8A 1JTFA 1U63A 1AKNA 2W6JA 1ODJA 1Z63A 2O7SA 2ZUUA 4WD3A 3SXJA 2LVBA 3H2ZA 1MPTA 4JOBA 3ZG6A 1VLHA 1DBPA 3WLKX 3LDUA 5BT8A 1P2GA 4R68A 1H8EA 1XCPA 1ADCA 1EA7A 4ZT5A 1BIFA 4PPNA 5AKGA 3ANXA 4AMVA 4L4RA 4ZAGA 4W5RA 3F7MA 4WKNA 3RFUA 1KE2A 3C74A 5KTKA 1X14A 3CS3A 3FR7A 4NQZA 4CDMA 2K2QB 2ST1A 5F76A 3ADPA 3C6ZA 1ULAA 2Q0SA 2QE7A 4R1SA 3DDNA 3KXPA 4XGNA 5JVDB 2P5YA 1A7AA 1RW4A 4FFRA 16PKA 4BQOA 4D5EA 2CE7A 1ULBA 5ETJA 3STVA 1IONA 1Q11A 1RAAA 1X7YA 2WWXA 3W77A 4J91A 2NVUB 3E70C 3U7EB 1WCV1 2CYBA 1E3JA 3TTVA 3UB2A 2NT4A 3G17A 4NP6A 4XJXA 1JKJA 2ZSUA 3HRKA 2QAGB 1JHOA 1LFAA 1G8JA 1E2NA 4L6CA 4M0EA 3AR6A 3OURA 3O83A 4ZQFA 4GPAA 3TQFA 3A1TA 3V33A 3I0NA 5AXBA 1IPFA 3LLMA 4JX9A 4YJFB 4E2FA 3GAAA 1QP7A 3UT0A 4BFTA 4KYVA 1RJEA 3QKSB 4B87A 2QN8A 1I6WA 4FD2A 4TYMA 4ARCA 1MEJA 1R0CA 2CUNA 1V7QA 2R96A 3LVBA 4HBZA 4EW6A 2D1FA 2BISA 1JT9A 3JQ8B 2VR1A 4U6QA 4R2LA 2M6LA 1XVVA 4G63A 5K6RA 1H4QA 3RC8A 3EWAA 3VHXA 2E4UA 1N2ZA 1PDVA 4BQPA 3R3JA 3ADBA 1NP3A 3JS5A 1QC5A 1AMOA 4LG1A 5LQCA 4ERNA 2I3AA 2OCXA 2V9CA 1X38A 3P9PA 1OYWA 1Y89A 1QJ4A 3OCYA 5L7TA 1TADA 4NU8X 4ODIA 4KITB 1EP9A 1XHEA 2ORED 3DTVB 5LBIA 5KWJA 3M3HA 3GN1A 3H1FA 3PRHA 4BNWA 3TB6A 1GZ6A 3RTBA 5KCMA 3H11A 4ESHA 5CDGA 1NDHA 1IUPA 4D9FA 4PNPA 1TEXA 2WD8A 3D6FA 1UBKS 1JX6A 4YUVA 1AHHA 2IEGA 4R54A 4UPDA 4YRFA 1OWMA 3ER9A 3ORYA 3OZIA 4GVPA 1CFJA 2BYTA 4F2WA 1RPAA 1KZHA 3TW8A 2X0NA 2DXIA 1CJSA 1PQYA 2OG1A 1M6VB 2KLHA 3A1VA 1G8FA 1T9CA 1TO6A 3PE3A 2G9NA 4MA4A 3OD1A 4IX9A 4LGYA 2H57A 1JAHA 4LQDA 4UTOA 3R5JA 1C1YA 1X2EA 4UCQA 3MT8A 3ZVKA 3UHPA 4MCJA 4UXHA 1X7XA 2J6CA 3G8BA 3HFGA 3MINA 4O4IA 3WLTA 4F4DA 1FU8A 3EEOA 1SGWA 5BPHA 4EGSA 2ZVDA 1H1LB 1WXIA 2B4YA 1Z45A 1G6KA 4RVNA 4HDRB 4TL7A 2XCOA 4UTRA 3OHMA 1S8OA 2H1VA 4FB5A 3GLFB 4ZHQF 4AO7A 3D2CA 4UBMA 2JGNA 1YZNA 4CUZA 3LXXA 3LX4A 1FW8A 1OXMA 1NLFA 4K1XA 3Q1KA 4REOA 2AJBA 1DRKA 3AY3A 3NJRA 2PJZA 1G64A 4CQMD 4J0QA 1WPRA 3QUSA 4O4HB 4RA6A 3HGQA 5ICEA 1KDTA 2ZBFA 2VS1A 2BAGA 3FH0A 2QXYA 4IH1A 2VSNA 4RORA 3JV7A 4N5NA 1ZKDA 1X1TA 1TJPB 3H5TA 4B6JA 2HSZA 1X15A 1RJFA 3HP4A 2QR3A 1RADA 1L4GA 1URPA 4FM9A 2CVOA 1H42A 2FVXA 3OIFA 3C7AA 2GBLA 2JI4A 3CRMA 4MRRA 5ALWA 4MHSA 3Q3JB 3V34A 3K53A 2K87A 1KMIY 4LDZA 4F5EA 3TEMA 5FTNA 5FT9A 2ETXA 4F6LA 1UJBA 3EQ2A 1PQWA 3WGTA 5EJ6A 3FMVA 3UV7A 4F3CA 3VSCA 1WBJB 4R41A 5L53A 5I8PA 2Z2XA 4GKVA 1M10A 3H9UA 1RPNA 2J6HA 3GT0A 3TZHA 2F9FA 1DAIA 3VKWA 4C01A 1GRNA 4D8UA 1ZINA 4MKFA 5JAZA 2P2GA 3ETLA 3GO4A 4PVDA 3VZRA 2XKBA 4V39A 3CVVA 1UKVY 3S55A 3C1UA 3C7KA 1EFAA 2AJTA 5JSHA 1Z7YA 1DT3A 2DUNA 2R8OA 4A82A 1GAXA 1AUOA 4ROSA 2R2GA 3D3KA 1NR5A 3PGJA 1NMQA 4JCCA 4NF2A 4GKJB 3EZNA 5ILGA 4TKVA 1NXVA 4XPIB 4NXNB 1YBHA 2X4GA 3FNHA 1PKEA 4N0MA 2GAOA 3I76A 4CKYA 4YHHB 2A2ZA 4Z6KA 1KKLA 1N5LA 3FDZA 4XWYA 2Q2OA 1RYMA 2PGOA 2AGVA 1DVRA 4F84A 1JA9A 3ZCRA 2EP8A 1GA6A 3ONNA 1TYCA 4AYWA 4S12A 2XT6A 4C7MA 5JMPA 1ISJA 1R6VA 3NORA 4NFLA 5BP7A 2WD7B 5EJ8A 2YR0A 3T7SA 3FCUB 5B57C 1GLNA 3RFXA 1XRLA 1X1SA 2A9FA 2C20A 1WUIS 2H0AA 3OEWA 4PHHA 2H1WA 4PPGA 4TLMB 1G2QA 1NDUA 1V1MB 1TEHA 1XJWA 3VDRA 2HMAA 2UZ1B 2Q6IA 1GZ4A 2HA5A 1W581 4GKAA 5KO2A 3AH8A 1E8DA 1QCCA 3ZWPA 4LOKA 4DHEA 1A9ZA 5EHXA 1LGYA 4OF4A 3CJTA 2WT8A 4WZBE 1KJJA 1DQPA 4GKBA 1U7OA 4OHFA 4JS0A 3HE3A 4AXBA 1BEUB 2ZIZA 5GONB 3AR8A 4EB3A 1Q7GA 3NMUF 3OOWA 4TV8B 2JFUA 4OLAA 2A78A 4IV5A 5EJFA 1FVXA 2EARA 1FMLA 1E7QA 2FQ1A 5TNXA 4DC9A 5K0ZA 3UUEA 2UZ4A 1KMHB 1ZGJA 2RHCA 3KVNA 4OQPA 1T0UA 4P92A 3R5HA 3OSZA 4ZVVA 5LUAA 2AL7A 2XQFA 2EZ8A 2FPPA 2LXNA 2A4MA 4HKTA 4AP9A 1MNQA 1T26A 2VHEA 3DFFA 5G02A 1VI6A 4G0VA 2XITA 3G9ZA 5L51A 2A84A 4PAWA 2HIAA 1YHYA 2JL1A 5F3DA 1QZUA 3H0EA 4WOCA 4LX8A 1IRIA 3BRWD 2VQDA 4DPLA 1J5PA 1GZ3A 1ZRMA 1XZEA 4FC7A 2EIXA 3CY6A 2RG7A 4IILA 4EHKA 2Z4RA 5IK2D 5JD5A 6REQA 4GX0A 4QD3A 1KY2A 4WFKA 3U31A 5JAIA 3GWGA 2B8WA 2D1YA 1R88A 1EWYA 1U9IA 2CJYA 2H5IA 3BDVA 4KE8A 2QUKA 4DY4A 4RQTA 2YZNA 5CFQA 4UU7A 4Y30A 2BFFA 3GA0A 3R7DA 3BMQB 3W7VA 4MUYA 5KTRA 4OTZA 1SK8A 3CB4A 2HSGA 4NHOA 1ICEA 3GGOA 4MKRA 3HCEA 2IS2A 1FFDA 1LPPA 4OJQA 4WQMA 5B37A 4U2CA 3K8ZA 2BVNA 3OMXA 1SBCA 3B1YA 4R1MA 5EUCA 2VF5X 3ESRA 4O1HA 5BUSA 1TJ5A 5ICSA 5EWMB 4PO9A 3EA5A 2XUFA 4RDCA 1TM3E 2C0CA 2X9GA 1Z0AA 2GPJA 3JQ7B 4ZC8A 4CR7A 1FX1A 2ZYUX 1KEWA 1M74A 4IWNA 3WFJA 2HJHA 3I9JA 4Y2UA 1N1MA 2F67A 3OU6A 5FWXA 2N9UA 1M54A 3BXEA 3KVVA 4WN3A 4BZZA 4EJSA 4EO9A 3MMXA 4DLAA 4LVCA 3ZJ5A 4WLUA 4GECA 2J0SA 3FSGD 1FBTA 3DE6X 1ZESA 1A76A 2DYKA 2QN2A 3KHSA 3MFQA 1IZ0A 4FDLA 4RFLA 3UA4A 4OGFA 2FLKA 2XGMA 4D9KA 1NZFA 3E84A 3Q5GA 4MIEA 3WYDA 1EZ1A 4BFYA 2ZIXA 3BH0A 1Z34A 4GMKA 2JATA 4UMDA 3OLXA 4UPVA 1W1WA 3VX4A 4C9BA 2A86A 3AR4A 1OLXA 3ZU6A 1JGTA 2H9AA 1DHRA 1L0BA 1DSSG 1GL7A 7GPBA 1JTVA 3MUEA 1EZ4A 2UYYA 4QOGA 3W6PA 2MSKA 1SXJB 3QELA 3UW1A 4ND6A 2DZDA 4TMVA 5IWAB 1B43A 1R9NA 3G82C 3GBSA 4L28A 5L4SA 1UF9A 5DYTA 1T9DA 6ADHA 5J1SB 2CJWB 3D6MA 3IEIA 1NQWA 4FJ0A 3ITDA 2BEWB 4JQYA 4A92A 4CF4A 5DNWA 5KINB 3DV0B 3PQ3A 3UWMA 3IURA 5DEOA 2PUDA 1QYVA 4A03A 1FFCA 2P9EA 1E6CA 3AHFA 3JZDA 4NV1A 3NH9A 1Z4OA 4YEDA 4BBZA 3PTZA 4OSPA 3IHWA 3M6WA 1WSDA 3GLGB 3I9V6 4YWJA 5IAKA 4PYLA 5EMHA 3AV3A 2PV0A 3CURA 3C3EA 1QTNA 3G7NA 3KVOA 5CGQB 5JCPA 1BDIA 2O0KA 3GJTA 3GLRA 3RIMA 1UH5A 5KQGA 4CKBB 1WMSA 1DZ3A 3I37X 3ZWCA 1IVNA 1HDYA 2P3SA 2W00A 4H3KB 4MVJA 4OLJA 1TF7A 4G65A 1OXXK 2FRDA 1KGDA 3QP9A 2O06A 1YD7A 1UDCA 3F0TA 2DLNA 4NOJA 4RESA 3CPHA 2A7QA 3F6EX 621PA 1QV6A 3T34A 4F46A 5FWYA 4I1YA 3NC0C 1EP2B 2VYNA 3V1LA 8OHMA 1ZX1A 3G2IA 1J0CA 3D6UA 4TKUB 4RV9A 1B93A 1PEAA 2A5GA 4TS9A 2A5LA 2HRBA 4IIXA 2CV2A 2QD5A 2RE8A 4EUKA 3GRKA 4IRMA 4MV1A 4HDMA 3E7WA 3UWOA 1C80A 1DAOA 4YP1A 4CQNA 3JAMA 3PU6A 1I6LA 5CXUA 1HDIA 5DM1A 2FMIA 4K9NA 4D8VA 1CSEE 2QVBA 4LA4A 1P6XA 1G66A 1Z88A 2IY7A 1A9OA 3HLKA 4X6UA 4CUJA 2O7QA 1T5DX 2K2WA 4BQIA 2JAOA 3HCOA 1NXQA 4QSHA 4E31A 1QGUB 1CG6A 3NAMA 5J40A 5HX7A 1O6CA 1G8YA 4YHBA 2IYLD 4E12A 1BROA 1ZM7A 5CT6A 4WJLA 1T4DA 1ZN7A 2OCDA 2DBZA 4OQQA 1WEHA 4GE3A 4X1YB 2HADA 4XM1A 4MUJA 5DISB 4AF7A 4U2GA 1E9RA 4HDOB 2NO4A 2P1ZA 3HCNA 2BWJA 1REQA 1E60A 1SFRA 1VBFA 1KZ4A 1M5UA 4IWYA 4WJKB 5C8YA 3K9FC 4JI4B 2QORA 1JQAA 4DRYA 5G1NA 3AVVA 1M34E 3EBLA 1KYVA 2IHUA 3FYCA 4C0AC 2NLOA 3H2YA 1CLUA 3H18A 2EEZA 3DLTA 4I55A 4HMPA 4ETWA 2J3LA 1KI6A 2KBEA 4D8XA 4ZK2A 5I7WA 3U0BA 3DUFA 2XBLA 3WDSA 1RZRA 3KOOA 1OGYA 2C57A 1OV6A 4QL3A 4BLVA 4ENTA 1NV9A 1Y6FA 1B2LA 4F1JA 2VJOA 1QLWA 1DXQA 3EC7A 4FS8A 2W4QA 5EP1A 4ZT7A 3SX0A 2PBFA 3KALA 3EH2A 5ALIA 2LPMA 2WWVD 3V4ZA 4OFZA 3HN2A 1T3SA 2O4CA 3QF7A 5HFNA 1HG1A 1FY2A 421PA 2JIQA 1KI8A 3VV2A 4CL8A 1BU8A 2Q1YA 3IPCA 4LHSA 4ACAA 2BELA 5FDFA 2XE4A 3N8DA 1A8HA 1Z4JA 1XMJA 3K73O 3Q1LA 1K4YA 2BONA 3RBZA 1WP9A 1VMKA 1W5BA 2HCRA 2J9ZB 3PJFA 2WJ3A 3PUKA 3OWOA 1W0KA 1XJCA 1QGOA 3UJ3X 1NBOA 4NWIA 4BAUA 4C43A 1R74A 2VDNB 2GVNA 2I6GA 2ZI5A 2XDQB 3MWJA 4IIDA 2VTVA 1WSBA 5J5CA 5J47A 1EHYA 3GF4A 2WP0A 1E1MA 3IUEA 3G2QA 1VHTA 5EXXA 1NE7A 3REGA 4PX2A 5JY6A 3IBGA 3O8NA 4P7KA 5E6UB 4YQYA 2CLOB 3M9WA 4QG7A 2WY2D 2FQWA 2RBGA 2B3DA 1CQIB 4CDRA 4DMKA 3EHDA 1KY5A 3JAWB 4G5RA 3UGKA 3G2LA 1JSZA 4Y2QA 3AF4A 4OD0A 4HH4A 4PXYA 1IWPB 4BMDA 3PEWA 4AO6A 2IUYA 3NDIA 5LA6B 1OAOC 2ZE5A 3GLHE 4BN0A 3TUZC 3OZBA 1YUBA 1UC8A 4TTJA 5B5SA 1J2RA 3F6RA 2WAYA 1FU4A 5IVDA 1R10A 3GNSA 3NWPA 4PLTA 4EB6A 1DRWA 2CKDA 2PYIA 1VCOA 4DR7B 1MJGM 3ZXXA 3KK0A 3OT1A 2OP1A 1IK4A 1I32A 4KWIA 4NZYA 4PR3A 3W5UA 4YLEA 1CEYA 2DCMA 1NVFA 1G98A 1ADJA 4KX3A 5F35A 2JLZA 4NYIR 4ZT6A 4CM8A 2A1TS 1E9BA 4O02B 3OKPA 1HY3A 2C2OA 4WMLA 4LHXA 1W4AA 3EXFB 5HYVA 3JTEA 1P73A 3KQOA 1SHLA 3VZCA 1L5SA 1N7GA 3NP7A 5ULLA 5HHTA 1KORA 4XYMA 4KFSA 5A62A 3TKLA 1LBEA 2JHCA 1DEOA 2WU4A 2LE0A 3EXEA 1EE1A 3RKSA 3FTQA 2DHQA 3V8QA 1C7FA 4BZWA 3C4VA 3ZHZA 3U6BA 5DBEX 3PXAA 4K9DA 1Y3DE 4ZHSA 4G0MA 1BYUA 4QJ4A 5C1DA 1SQ0A 2IY9A 1O5TA 2BR5A 4LWQA 2H65A 1M8KA 3L8DA 5JYDA 1AQLA 1NVWQ 2M32A 4MWBA 4XIGS 1PR0A 2QN7A 2X8JA 1KS9A 4HRVA 3OCWA 5A71A 4CQLB 5HIMA 3IB3A 1DBQA 5IYZF 1U3WA 4FYKA 2O8DA 2MSEB 2ADFA 4L15A 3W6OA 2KW5A 3GZNA 4W4TA 1E7MA 3FZYA 4BWYA 1W2HA 4LGCA 1FMFA 3AOEA 4GDMA 4HLUA 4WKGA 5IJWA 3UC9A 4KW7A 4D43A 3GHHA 2NQTA 4N54A 4WZBA 4PTLA 1AVTA 2NG1A 2RAFA 1PJ3A 2HSWA 2JCGA 2W90A 2V1XA 2QTLA 1N33B 1A9SA 1TUBA 2I3GA 3DVRX 3SJAA 4EPYA 2IPNA 3IV9A 4DBLC 4K3VA 1NFRA 4K86A 1BHO1 1N78A 1NNSA 2CD9A 2LCFA 4HADA 4EGFA 2QMHA 3X0DA 2OCKA 4AK9A 1CEXA 2ZIGA 2B8JA 4L3OA 3HMKA 3TOCA 1FFHA 1IATA 1RWMA 3CW9A 1LBIA 2E5FA 5AUQA 4X93A 1TEVA 3MCWA 4R01A 3TG8A 3GP3A 5I7RA 2QRJA 1WUYA 2QN1A 3LUKA 2XNDA 3D0KA 1G291 3RS3A 4V0SA 3VR0A 2DH5A 4HD8A 3EULA 3RVMA 3PNVA 1UDWA 1C0LA 2O4UX 4ZMBA 4OLHA 1UMKA 3PQ4A 1JDVA 2WAOA 2FWBA 3Q88A 2XCTB 2V45A 3A3PA 5AXCA 2Z0MA 2ZWOA 3VH3A 5C37A 2I7TA 3TG2A 1TYDE 5LQNA 4JQZA 5EFZA 4QOHA 2CFIA 3QLVC 3WLIA 1NRJB 1WW2A 2WLTA 3DTVD 1I13A 4U7JA 1FP4A 1NW3A 3CRQA 4JJFA 1VSBA 4N5LA 4OQNA 1E9DA 3IIMA 1IJEA 2IQIA 3NBUA 2ICAA 5BO5A 1Y1TA 2J41A 3SJBA 3NDRA 3RS7A 1BD3A 4HBGA 1ADGA 1E18A 3KR2A 1XA3A 1YA6A 1TMGE 4GX5A 3BWEA 4NYJR 3HBAA 3A0UA 4PCVA 4FYHA 4MRNA 3ZOZA 3G8AA 1QHHB 2POCA 5IU6A 2A0UA 2J5RA 1GADO 3AHIA 3CLUD 4IRUB 2KB0A 4LC0A 4OP1A 3UYKA 1PZEA 5AR1A 5AVYA 3KLNA 2XXBA 4ESOA 2GHQA 1PD1A 3X43A 4ANFA 3IO3A 3FTEA 2DPGA 2ZJFA 1RR6A 2GGSA 3AVPA 3Q7TA 4L5JA 3DCNA 2BFWA 2QTCA 3DKRA 4DT1A 3AY6A 2E4YA 2J09A 5JW6A 1RHKA 2R8YA 1XGKA 2PRSA 3HVKA 3OFNA 4R1UA 3DZJA 4U39A 2ZCVA 3FR8A 5DP1A 2IH4A 1DEKA 1U1FA 2RK4A 2AYZA 4YAEA 5C35A 5LP6B 1S89A 3UWSA 4BB9A 3LKVA 2EG9A 2ZJAA 4YJ2F 1A2KC 3DWEX 3R9KA 1NMXA 2A5YB 4JGGA 4D74A 2JGJA 3AVXA 2WJAA 2ZSHA 1KYWA 3QI7A 4R31A 1QIMA 2IEBA 3HXOA 3DBHA 3HDVA 2BH2A 2PR7A 4JENA 3WJAA 3FHTA 1AN9A 1E7SA 4KV7A 4OSEA 4D9MA 3VNUA 5JNRA 4KTVE 4XRRA 4RQUA 2UVPA 3OTOB 1RAEA 4BU0A 1TQ6A 2I6FA 4JWTA 3WX0A 4WY5A 2JBAB 3VPHA 2PQ6A 3MWKA 5KMGB 4YP9A 2FW0A 3NRCA 2VDRB 2XUIA 2XDAA 2GT1A 2I71A 4GSLA 1UPBA 2OQ2A 2FUNB 3VKHA 3CX6A 3C98A 4BVGA 4V03A 1C8BA 4EY5A 2QEQA 2RAPA 2QI9C 4G0PA 5C32A 1YBAA 2RHJA 4IGAA 3KPYA 4Y1GA 5FNVA 4RGQA 2X0FA 3OTIA 2IL1A 3JAKA 4LTMA 2WK1A 1QRUA 2JASA 4HS9A 4L85A 3PP8A 5FL3A 3LDHA 2XF8A 3M34A 3DKPA 3QHAA 1WXDA 4LZLA 3V8EA 3LY5A 1SN7A 3FPKA 2CMDA 2PH5A 1F8UA 2Q5OA 1M75A 5CAEA 1RU3A 3WQHA 2RK3A 4N39A 1CDEA 2ZG6A 3BB4A 3MAJA 4NBLA 4X8OA 1DTWA 4DV2B 1J5XA 2Y76A 1GPJA 1SHJA 1VDZA 2AQKA 4IFBA 1CT9A 1YR1A 2Y4NA 4AVYA 2JGFA 3RS4A 2IUTA 2Z1DA 4TV9B 4HRYA 4XE5A 4N49A 1C1HA 1YCFA 2Q5HA 1K5PA 4DV5B 3PENA 4RK0A 1IN1A 2HNAA 4P3NA 5I9LA 3A11A 1GR0A 1IBSA 3E9QA 5HG0A 1DIAA 3C3WA 1XMXA 3H6GA 5CDFE 2HW8A 4P1ZA 5C9ZA 4YRBA 1MIHA 2RGNC 1V3TA 2X4DA 3PNQA 1W4ZA 3O92A 4D1YA 2LNDA 4V0OA 3AJEA 1IY1A 2JI7A 2WQZA 3K2QA 4X85A 3M4ZA 5T4EA 4DVGA 3RW9A 4EHAA 2FUKA 3CPJB 4CF3A 1P60A 2E4XA 3JSXA 1XYGA 2QLBA 3SF0A 1RABA 1E1RD 2IYAA 3K1AA 3PDJA 2ZT8A 4MQFB 3VNRA 5JFOA 1NPDA 2J08A 1ESCA 1Y8AA 2XZPA 2JB9A 3MK31 5TS3A 5B7PA 3K70B 4FYXA 4D0NA 4Q7MB 2CBZA 4HQNA 4QTUB 1YOVB 3ZWQA 5E4TA 1KGSA 3DBRA 5JWHA 1SD2A 1UOOA 3U26A 3ZH9B 4HUTA 1TYAE 4KPEC 3N5CA 4D9EA 2KJQA 5HUJA 4AG3A 1FOEB 2K7FA 2YN0A 3ZTYA 3AEKB 5K3BA 1KYTA 3KUDA 1NKVA 3EVAA 2XHZA 4C7JA 2PKCA 1ND6A 5ITZA 5GOZA 2O2ZA 5DI3A 4Q03A 2IEDA 3OOSA 3CWQA 3ELYA 4L07A 1G20E 3IPYA 5T3YA 5JAPA 5LYJF 1Q3KA 2GHTA 4HQKA 5FBVB 2Z04A 4A7PA 4K2AA 2IX3A 1XTQA 4C89A 4EI2A 1HQCA 5KB3A 3D4OA 1Q7RA 1TDJA 3FIJA 3GDOA 2VK4A 3P2YA 4NMHA 2I4IA 1XALA 2R7KA 3EUFA 4HQFA 4MGZR 1RTTA 4OCZA 4U0KA 4E22A 2CV1A 1M34A 3A05A 4L74A 3KKPA 1O57A 3QXXA 2JI9A 1AKYA 1W2GA 4RLHA 1DJNA 2J0UA 2XQIA 1E66A 1Q15A 4KP7A 1Z4KA 4Q1BA 4QC2A 1FNNA 3HWWA 4FFBB 2R8BA 4GPD1 3AVYA 2LIPA 2I2AA 3SYMA 1FDTA 2QTVA 5G1PA 4NDZA 2FOLA 4QHTA 5AYVA 4DDTA 1ADFA 2GZ1A 1TE2A 3ILHA 4EYEA 3FMPB 2Y1EA 1LF5A 1T4CB 3VPGA 4FZRA 4W7IA 2G0NA 3NHKA 1R4ZA 3T1QA 4LDRA 3FOFC 3ZHCA 1IEWA 2Y0DA 4LI0A 1KI4A 4JJIA 2ZS9A 1KK1A 3G5UA 3LOUA 3SU8A 3KZ1E 1QX3A 2XIJA 3AHCA 3MMPA 4GH5A 1DX6A 1ZKMA 2XGSA 4ALKA 4Z9XA 4LXYA 4G1CA 3SM9A 2OTCA 4GPZA 3PZBA 3QVJA 4B6FA 4B3JA 4BLWA 1WHTA 2PZAA 3TMKA 3TLKA 221PA 2GEJA 2O0LA 3IMKA 1MJNA 1BS2A 1WP4A 3L40A 1HTWA 1N8SA 3K0KA 4IDCA 3WLEA 4F72A 2I03A 3R9XA 1FQKA 1JV2B 2BGMA 3BJMA 1Z5WA 1DQZA 1HFWA 1WU7A 5E7QA 1Y8QA 3G8YA 3FZNA 5D3MB 4EFNA 1S2DA 4KIUA 2PKRA 4MS4A 3EZLA 1PWYE 4YTEA 3ICVA 2AFIB 2E18A 3A0RB 1INLA 4Z3DA 1O94D 3LXMA 1I4EB 2ZRCA 3IAS1 3UUWA 4NG4A 2GM4A 1J5EB 5IFLA 4WZZA 4EM6A 4QPDA 2ZJ4A 3SC4A 4GO1A 1NJ1A 3I5MA 4BO7A 5A0TA 3SEQA 1Z8NA 2OAGA 5EC8A 2R8XA 4ZCQA 2DBVO 3SSMA 3UMJA 4YDHB 4A0RA 3U7HB 3BJIC 3GLHB 3LQKA 1YOBA 3E9EA 3GLHA 4D46A 1YTUA 3BFXA 5DCYA 5K3DA 3N05A 2OQVA 1YR9A 1GQOA 3ANLA 3SIWA 5E9QA 1N9ZA 1PJ2A 2WC1A 1U7WA 3B53X 1MA3A 4RD0A 1LLCA 1GKUB 3DBOB 3T15A 4MI9A 3WB1A 2COUA 3P4XA 5JH7B 1RYBA 1O03A 1LK7A 2DHDA 4FUQA 1O58A 3CNLA 2AV6A 1UWKA 1NSYA 5SZHB 2J3IA 1OXUA 4ZHQA 2H2HA 4UREA 1XD9A 2FQQA 3MWYW 1FP7A 2MYTA 2R4QA 4QQ8A 2FSSA 2B5VA 3F97A 2K4MA 4B8WA 4NYMQ 4B8ZA 3LU1A 5FWDA 1U2GC 3L05A 4WINA 5BT9A 2I7XA 3CSUA 2DF8A 1AGRA 1FNCA 2V0CA 2PUVA 2ECPA 2ZK7A 4GMFA 4DDVA 4IF4A 3JD3A 1J4AA 1SXJD 4L9SA 1E99A 4QULA 1J8QA 1XMPA 3LOQA 4I36A 4FBMA 3OQ6A 4IDHA 3SLKA 3U49A 3K94A 4Q4LA 3RFTA 1E89A 4MKZA 4OHOA 3QPAA 3GFTA 2DWOA 3WK8A 3P32A 4EAQA 3EISA 4KREA 1NPTO 3VTZA 1GZUA 2V6FA 2YXNA 3PITA 4P53A 4QUAA 1V16B 4BRZA 3QVTA 4JJ4A 2M6KA 4NOMA 5CGZA 5AMXA 4UTNA 1CE8B 3P9CA 4XEHA 2PL5A 3REQA 1GILA 1NQTA 4IHJB 4Q9LA 2W2MA 1OJLA 1Y0BA 2ZVPX 4UCWA 3HKBA 3NKLA 3DOFA 3ZDZB 4ZJYA 1D4FA 3N58A 4XR9A 3NV9A 1OU0A 4JB8A 3GZJA 1UUFA 3QUTA 4MQBA 1PLKA 1KOFA 1TZKA 4ALJA 4MMZB 2VF4X 2VPQA 1WQ4A 1FZQA 3DO5A 3KJEA 1I6MA 4K0RA 5FAKA 2GZAA 3I9NA 4RZUA 5L4NA 1EM6A 4HEA6 4ZWNA 1Q1GA 5AUPB 1XZGA 1F0YA 1H0RA 3O90A 2Z30A 4QJ3A 1ZM9A 4HDNA 1HE2A 4QLAA 1Z26A 5G4LA 3D3EA 3VPDA 2WF8A 2R68A 1IBLB 1JW9B 3K8YA 3AWIA 1TIBA 3DWIA 5IH7A 2GSWA 4ESVA 4ZALA 3IA2A 3OMWA 1GHTA 4QGFA 3CR8A 3EW9A 4PE5B 4EVIA 3UJNA 2RHDA 3FMOB 3T4UA 5K9ZA 2HCFA 3NTRA 2J33A 1D0IA 5I5GA 4MO9A 1HZZA 3WFZA 2JFNA 3KT0A 4UFPA 1E3IA 2CXNA 1WD5A 3PWTA 2NM0A 1RLUA 3MT7A 3TQHA 3DPIA 1N25A 2VHUA 3A4VA 4KGZA 1T9GS 1KVUA 1JDPA 1NJSA 5K20A 3KJIA 2GASA 1G5QA 5K0TA 4X24A 2H29A 3MRTA 5ALVA 5B4UA 3ZWDA 2AF3C 1EGMB 1DEXA 1G6HA 3H7AA 2Q50A 3CUTA 4MI6A 3T1NA 1Y3IA 3WR5A 2C4NA 1XQ6A 4DCTA 1QHXA 1CWUA 1ZLXA 1P1KA 1A82A 1Q0LA 1RS0A 3BL8A 3G8CA 3RJ9A 3VR6A 1IN7A 2Y0EA 4UUAA 5HK9A 4MR8B 5JNUA 4CLRA 1KO1A 2R1UA 1V1RA 3EZ2A 2R4UA 1Q1QA 4LYGA 4JLPA 1RYEA 3JPYA 2Q2WA 3RJTA 4YRSA 4IJ5A 4MYHA 2GKSA 5L95A 4WKCA 3HKCB 2ZT5A 1Q91A 3URMA 1GNVA 4JGBA 3GLTA 2ZBRA 3JQ6A 1TTQB 1B6SA 3KD2A 5CBPB 4IJQA 1E5TA 4FW9A 1DT5A 5HK8A 5KSZA 4M3NA 4FC6A 3ZBPA 5IKPA 1ZK1A 2XB8A 3SE7A 4DCUA 1R0ZA 3BRSA 3O8DA 3ZYCA 3F7NA 3D7NA 2OGWA 1IY9A 5ER6A 2QIOA 1XU7A 5ALNA 2I29A 4GOMD 2BCJQ 4N6GA 1OV4A 2MINB 4PSUA 4Y2XA 821PA 3FB4A 4CTKA 2IF0A 2FW1A 4C04A 2EHJA 3MUNA 1Y9EA 4LXHA 1XEWX 4MGEA 5DHSA 3WJ1A 1P77A 1U7PA 3NP9A 3RJ5A 5E38A 3KQLA 1T1SA 5I4KA 1IBMB 5HJ5A 2NZ8A 2VP0A 1XU9A 2PMDA 1X9IA 3JVDA 4EZEA 4BQEA 3BMOA 2W2XA 3RRBA 4BEBA 1OI3A 1V4BA 3GEGA 5I7HA 3B3JA 3M89A 3RYCB 5KOHA 1YMQA 2PL3A 5JCJA 3BHMA 3R7BA 4MV6A 2PG3A 1KQPA 3CRVA 2E85A 4U9UA 4ZU6X 1F9EA 3PDUA 5JZSA 1KPHA 1YBFA 3MWEA 5K03A 3GC6A 2EQ5A 2RHBA 1VE7A 3JY6A 2IV3A 3T3MB 3OQMA 4HDQB 2X86A 3AQ4A 2MR5A 4P38A 1SPXA 2UZ3A 3F4LA 3DMTC 1YDEA 3KV3O 4LZPA 5LQJA 4S24A 1VDMA 4E08A 2CLCX 3HB5X 3MRVA 2Y6VA 4DUPA 2VSXA 4HYQA 2R86A 2XRMA 4LFCB 2EJTA 4DA4A 3I9FA 5AFSA 3LT1A 1H0SA 3GRUA 5TJHA 4UUBA 3ZE8A 1A4RA 2R66A 4NE9A 1USUA 2B78A 3HVJA 5G0TA 3RUPA 1YQQA 2QYSA 2NV6A 4M0KA 4QWMA 2P2YA 1OLSB 4MCHA 2C9ZA 5AQ1A 4IH9A 1PI3A 2QVXX 1XD8A 2GO1A 4JUBA 4RF2A 3TR5A 4U7GA 1FVFA 3NHUA 1G8SA 2PGXA 2BZ1A 4QAJA 2Q0HA 3VSEA 3CVXA 2QP9X 2YYAA 1U2QA 5E2IA 2CY0A 4BO9A 3IUBA 2YHAA 1VBNA 3KM0A 3DDSA 4FGKA 2JLYA 1JBKA 1NF9A 1ESZA 2AHRA 1XAIA 3DHYA 3S2GA 2ZSKA 3ZWAA 4EFDA 5CCXA 5T6MA 4P58A 4C05A 3SYRA 5JEDA 1V3VA 3AF2A 1RXIA 2ZIVB 1DMRA 3LW7A 5A5GA 3V9AA 4WADA 1CYEA 2JGLA 4HTFA 2IXAA 4YBRA 2VDMB 3H13A 3PDHA 2VHYA 3K1YA 5K8TA 5KQSA 4CM3A 4B1FA 1M6WA 4A8JB 3BTOA 1MGOA 3BCSA 3RSSA 1PW5A 2ODAA 2NO7A 3A3NA 1Q1BA 3GRCA 3KYDA 4NS1A 4WGFA 5F2EA 3G9XA 2UUBB 3C87A 1G20A 4W5WA 2W93A 4HV4A 1J9ZA 2XNJA 4X3OA 1MMFB 5EZYB 4F3NA 3RT1A 1W75A 1MPXA 1Z6TA 3KP1A 5CB4A 3LJKA 2AYXA 2DHEA 5CFPA 2Z2YA 4MYRA 1ZJJA 2BP7A 2YV4A 5F1OA 3S68A 2BF4A 2AXQA 1RRKA 4OL9A 3ND6A 1L5GB 4YRIA 1DTSA 4JT9A 3QE9Y 1OGJA 4BNJA 3ZV3A 2GHRA 1EDDA 4C6TA 1AMUA 3NHLA 1V1JA 2VSFA 3BE4A 4HN9A 2OYCA 1CJVC 1CZNA 3LSYA 2GBPA 1L4KA 2VF7A 3NUGA 3PR1A 3PQ2A 1KQ3A 2CFSA 3EXHB 4Q66C 3SXUA 4FMCB 4P4LA 2PZJA 1X1DA 5LKAA 3PCTA 1VFPA 5BNTA 5KKCA 5CTAA 3ZU3A 3BORA 1V47A 4KAFA 3KQNA 1N2CE 3RH0A 3LCCA 5LA6F 2WMDA 4WLVA 2HUNA 5DT9A 2CEAA 3GJ0A 1TZJA 3R6DA 2PX2A 1G4AE 3A1FA 1CC1S 1PJLA 5ELLA 3RSCA 1ID8A 5DW0A 3E1KA 1FS5A 3F6BX 3PGA1 2QTBA 4XUGB 5KWEA 2R0QC 1ZXLA 4BE4A 3FSGA 1THTA 4M0DA 3ZGOA 3DZIA 1QE5A 3AP1A 4Q9KA 2SHKA 4CYMA 1A9PA 3VYTB 2PDAA 2CFTA 2ID8A 3BMXA 4PONA 4R8VA 3WB2A 3RU2A 2DPHA 3A1CA 3ES9A 4EKEA 3A9CA 4EGJA 3EVEA 1UPAA 1ORVA 4TTPA 2AE2A 1IOWA 4MP8A 3MJSA 1ZY2A 1JPVA 3KOUA 1LPNA 3MGCA 4OBBA 5FUXA 1AX9A 4PBRA 1TKAA 2B25A 3CE6A 3NWBA 3F5FA 1ZD9A 5JJCA 2DHCA 3OG9A 2ZQZA 5GJWC 3EXIB 1PBNA 3D6TB 1X9HA 4BQQA 5GAJA 4D56A 4JQOA 4ITRC 4I6EA 4ZOBA 1CR6A 5AKKA 1KETA 1FFGA 2VG8A 2I4OA 2H08A 2HM7A 3UAVA 1BS1A 1YZVA 1L3IA 3QKRA 2GI4A 4E70A 4LMAA 2QUJA 4JP2A 3DZ8A 4YJ3F 3F9RA 5ALLA 2YJTD 1RFGE 2BTQB 1PL0A 2W48A 3GDFA 4G84A 1GM5A 3M6UA 3IMGA 4JA2A 3IILA 2VPPA 5EIOA 4DV0B 5GJBA 3DF9A 2Q4TA 1HLPA 3HQ4O 1EAYA 2NZ2A 2UXCB 4JC0A 2DEUA 1GO2A 1OTHA 2YZ7A 4MW9A 5LWHA 2JVJA 1JHUA 3FDIA 1JDBC 5EIBD 5DXAA 4BO8A 1CCWA 4DEYA 4AS2A 4D5GA 2EJWA 2OVFA 3BQMB 3MHPA 4RMHA 2W6ID 4JIMA 5JSFA 3CZPA 4HX5A 1W44A 3DMHA 2Q29A 2PO5A 3FNEA 3QU4A 5TQ0B 3GJ5A 4Y3UA 1YRBA 3C2QA 2CDRA 4TZTA 2NTJA 4PSVA 5LCXA 4X6YA 4CE6A 4C78A 1A8QA 5DIZA 5JCOC 5TPZD 1HE1C 4TT8A 5IUKC 1PSZA 3MVEA 2BSXA 4DLNA 4BNYA 2YVAA 1E9VA 5EJ4A 5IDWA 4J2TA 1FYDA 2QL9A 2IW1A 3D5TA 3FHOA 3LQ1A 2IYQA 4FMDB 2OAP1 1MZPA 3THWB 1DXHA 4K28A 2R62A 4TWIA 2ET6A 4UBKA 3RFFA 2NW6A 3AF0A 4QXMA 4D96A 2OCPA 2DVMA 3OZRA 4BJHB 5FNZA 3LTNC 2R79A 3MEQA 4BV3A 2HK9A 1VSVA 4G0OA 2PJDA 3EARA 2D06A 1XZCA 3CXUA 4NENB 4I1UA 1J8VA 2P75A 4ARZA 1FRVA 2YWGA 4BAGA 1XSEA 4W5NA 1NLYA 4XFKA 1G2IA 4R3WA 2PQMA 3FKSD 2RB5A 3TJZA 3INGA 5L3QB 5EE3A 4KNVA 5C5CA 2TS1A 2YDXA 4WACA 2PE5A 3PKIA 2VA9A 2HA0A 4X71A 3C4JA 3RJMA 1KPIA 3V4PB 3ZY4A 5BR1A 1WBBA 1S9DA 3ECCA 2G7MC 1PO7A 1G4UR 1DC7A 1Y3AA 2CHEA 4IJWA 2R2AA 3EQ7A 4IDDA 5AHKA 1Y3HA 2WKRA 3IKJA 3WWZA 1U11A 2ZTVA 4C0SA 1V9LA 5CM2Z 4KR3A 1RPZA 3BERA 4TQUS 4UMEA 1HFJA 1UOQA 5EYPA 1QWOA 2C5BA 4WLFA 5FOVA 3QVMA 2AWOA 2VJYA 3WK4A 4YRAA 1W36C 4OHUA 1W59A 4WRRA 4Y9TA 1FUKA 2J9RA 3L7JA 4H27A 5EUQB 3KVRA 2VDWB 1J2UA 3FNRA 3KE9A 3PNSA 2JIZA 2OORC 2G88A 3HYSA 1FXWF 3R3UA 4I81A 4ZDIA 5KTMA 1L7MA 5LP6F 2N0SA 3OTGA 5TVKA 4RJKA 5CJJA 1C30A 1SURA 2FRXA 2P2SA 1Z5GA 2VAPA 1Z16A 1MABB 2F43A 2O0JA 1K7SN 1MABA 3EOZA 3LW8A 2X14A 2BMDA 4GRAA 1CK4A 1RWBA 3VR5A 3H2HA 3NIBA 3WLNA 4AECA 5U4XA 4H3HB 1IHXA 2Y8EA 1QVVA 1LLUA 2WJWA 1AB5A 3IAFA 2VK8A 2NXEA 1W47A 2W37A 3HSYA 1KI7A 4AMBA 4E0BA 4II3A 5E7JA 2WTXA 4KGDA 2FKNA 3STWA 1E94E 3B7WA 3VC3A 1B8UA 1XCBA 2FUCA 3W5HA 1CZLA 1DX9A 5MGNA 5KHAA 3IP7A 1Z0SA 1M7BA 1L4FA 2ZI6A 3SZUA 2YN2A 2JD1A 2B20A 3LNTA 2FWMX 2XCQA 3AF3A 2QTHA 2HLHA 5HCNA 2A57A 2ONCA 2NZWA 3JQBC 3AVQA 3F90A 5KYKA 1CY1A 4JEMA 1UBHS 4LOAA 4U1RA 2NSJA 1NA5A 3ANMA 4IY1A 3VKUA 3H86A 5GZ6A 5E1MA 2UUCB 3CSSA 1SVLA 4ZEWA 4Q3KA 4V0LA 5BSMA 4TRJA 3E7XA 4V2IA 2XPCA 3K3PA 3RUIA 4KGVA 5HMMA 4ATNA 3HY3A 4DBLE 1WZUA 3V7FA 1KDOA 3B6JA 1MOSA 1QG0A 2EJVA 1CEQA 3D6NB 1QCZA 4MDHA 1T5TA 4B45A 3C6XA 3PB3A 3A2MA 3AHHA 2VRWA 3QTLA 1P1HA 4TV9F 4ZP1A 4BY9E 1TCCA 2OGTA 2QN3A 4OX9B 2QV0A 3A1WA 3AP3A 1I24A 1FNBA 3HU5A 4GZ5A 4PZ9A 4DA9A 1J09A 3KYJB 2G36A 5KYXB 2N1MA 1MAVA 1XBTA 4NE2A 3IT3A 3A9RA 2J67A 1LC0A 1NVAA 3GVIA 2BTOA 2VJAA 3CQ9A 4ZOLF 1HE8B 4JH0A 3RK1A 1QV7A 3A4MA 1EG7A 1ZC4A 3QFHA 4GF5A 4LRSB 1ZL0A 3K20A 2NO5A 3BXFA 1F2UA 5THQA 1ZVVA 1XKXA 3PHLA 4Q4JA 3UJ9A 2VTBA 3WGQA 5CRIA 4HGZA 2EC5A 3AUSA 3S2EA 3B1FA 4EUHA 4RJ2A 3KJNA 2W22A 1U81A 4FYPA 4UOZA 5BVHB 4IVPA 4LZWA 5AK4A 5H7XA 1NBME 4Z9AA 2EKBA 1IIBA 3TNYA 3CXRA 3G0IA 2AI2A 4R84A 1QFMA 2MSWA 2Q3LA 1X13A 5TT0A 2DX7A 2ECFA 3L06A 3K9LA 4GR4A 2ZS7A 3UMCA 3AXSA 2FGJA 4YJ2A 2ZWPA 2VH5R 1BDBA 7REQA 3KAJA 4N01A 5ER9A 5F7JA 4D0SA 1GTMA 1YZUA 4PFQA 3V55A 5IBCA 3TLYA 1MX9A 2EX0A 2GTHA 3EIFA 2DJ5A 4C4SA 3BGVA 3PPWA 3FTFA 1L7QA 2YUTA 3LT5A 5SYNA 5EL0A 1XCLA 4Y1RA 3W5JA 1MJ5A 2FSGA 2GWHA 2O8NA 4K9RA 4M1ZA 1FSSA 1JA0A 1K27A 1UANA 4QHSA 4TLBA 2VSQA 3HZOA 1RQPA 1GLGA 3JARB 1GQ2A 4YCBA 1U04A 5EWLA 4ACBA 1Z0IA 3WLLA 4BBJA 3WNDA 3AHEA 4JI7B 4PLFA 4DADA 1G9TA 3ECAA 4QVGA 5L9AA 1MVOA 3V1UA 1XMIA 1U2TA 3NGMA 2YMMA 5KPJA 5CEJA 1BO6A 1Z4NA 3EUAA 3NHMA 1ZPDA 1QFZA 4N7RA 5AW6A 1P19A 1RQNA 3CHYA 4F1WA 5IEBA 4YP7A 2XA2A 3HXKA 2D2VA 4MQ5A 3L1KA 4V0KA 3SZGA 3PGLA 3RAGA 4B4UA 4K6OA 1PJCA 4DKJA 4D4HA 1O96A 2CN1A 4HLDA 1PFQA 2YC4C 1MOPA 2C7QA 2Q6LA 3OT4A 5CDTA 1O6GA 5ALFA 1UP7A 1WKCA 2DBQA 1LDGA 3B52X 1CJMA 2LTAA 3FTPA 3GQBB 2AMYA 4NFYA 3FPLA 4MUAA 2HJWA 5FUMA 1UJ2A 1DO2A 2WFLB 4LN1A 4HRAA 1PJBA 2OC9A 5FP0A 1Z73A 5JT1A 3N6XA 1U0HC 1GGNA 1PL7A 3QU5A 5M7EA 3T7DA 3VH4A 4DABA 1NVXQ 2WHRA 3HUTA 4O4JB 4W9MC 1AQYA 5FTJA 4QOSA 4GU5A 2JIMA 2JHFA 4TWZA 2ZUSA 2H4YA 2D3TA 2GRJA 4BO4A 4N3NA 3BGDA 4OU5A 5CVDA 1II8B 2BMVA 5AJVB 1ZIOA 4CMIA 5KX5F 1BOFA 1XYVA 4U9HS 3AL0C 2AOUA 1A9RA 1N2CA 1HFEL 2NPOA 2OAEA 2Q2NA 3OPYB 4RJLA 4FHDA 4JLKA 1O6FA 5JRZA 4JC5A 3HB0A 1BH6A 4WNAA 1A1VA 5HSGA 4HB4A 4MGYR 1JR6A 1RXWA 1E5VA 3OTWA 5HPYB 4GFDA 5EESA 3P5BA 5FFMA 3RKUA 5JJKA 1VI2A 2FP4A 4TYQA 1SC4A 3GX1A 1MQ9A 3PLAE 3N2ZB 3DDUA 4FGLA 4RIIA 3GOQA 3KFXA 4DUGD 4YRTA 3SS8A 2VO1A 4WXHA 5CURA 2O1EA 1RBYA 1S8NA 2C88A 2F1JA 2GF9A 3FPFA 1ODIA 1N7JA 3DEKA 3IAEA 5FTMA 4WN9A 1ZSYA 2B1JA 3NTOA 4I14A 3GROA 3M2PA 5ARDA 4CCYA 4RANA 3D54D 2BUAA 1U5BB 1Y1KE 1U5BA 3K2BA 3NVDA 5BNZA 1NMEA 1CZRA 4E5NA 2I3DA 4RX1A 3TNFA 2OZKA 5A03A 2ZJYA 2Z43A 1U1GA 1CVRA 1HV8A 2A92A 2W2VA 1SY7A 2XCUA 3BB1A 2D5IA 5FRDA 1KAHA 1RRCA 1TVEA 3U56A 4IIHA 1EDZA 2FE4A 4RLQA 1TQ8A 5IUNC 1Z5OA 5CR9A 1CUSA 1X19A 4MVJD 3LBYA 5AOCA 2GR9A 1Q0ZA 2PZEA 4QUIA 2D1SA 2JEYA 3PWKA 5LQRA 4YN3A 4B6QA 1KIMA 3DE3X 1RHQA 2F7SA 1V3QE 1XA0A 2O7VA 2N47A 1BQ4A 1ZA2A 2P5TB 2GMWA 3ZW8A 4G37A 4CIXA 3KNZA 3O8OB 3E9MA 2GK7A 1LBQA 4DR1B 3Q0IA 2VNIA 2BHTA 1I4DD 2XAAA 1L8XA 1EM8B 2CMGA 4G8JA 1AS2A 2I99A 3K5WA 4IXDA 1N5IA 2JZCA 2MMCA 4IRXA 2QJFA 5EP2A 3OI7A 1U0SY 4UNIA 3RWBA 4M7WA 4Q3DA 1L4YA 1PR4A 1OI2A 5J43A 2PUAA 3OQNA 3DOHA 3EXAA 1ES9A 4J3FA 5AXAA 3G1TA 2G08A 2Q46A 1T2AA 4LOLA 3AWDA 4BEWA 4YAFA 2BEVB 1QIFA 1RI2A 2XB9A 1LF0A 4GX1A 1EFPB 4OXIA 3H83A 3T94A 3TE6A 1R2QA 1OZAA 2O1SA 2VWPA 3N59A 3AY7A 4EATA 3LS2A 2P2LA 6CHYA 4RTNA 4YXWD 5CW1A 4WY2A 3H2JA 3OLZA 1MO6A 1SU8A 4YP5A 4QOEA 3N7UA 1SOVA 4GI2A 3GMIA 4R8SA 3KKZA 4HDKB 5ICCA 2R6ZA 4XFDA 3LBHA 3DCYA 4YJHB 3UMBA 5CNMA 2FYTA 2W2LD 3DE1X 3VYUB 3WL7A 1T6ZA 1U99A 3O7MA 4QBIA 4NCXA 3B1WA 3TO5A 1SKUA 2JGRA 2IK8A 3ZTTA 5EZ6B 2Z5FA 1SNYA 2NVBA 3INNA 5A9TA 3I2GA 2IPLA 1DAFA 2QL6A 1J2JA 2C42A 1J2TA 1RWPA 3ECSA 2PV7A 1ETUA 5REQB 4XWGA 3DL0A 2D0PB 2R4TA 4G09A 5LDDC 1D1QA 3OZVA 1OX4A 1HYGA 1OAOA 3L7YA 1F5NA 2HRZA 4WAUA 1EYZA 2XUGA 3UT5A 3PDWA 7ADHA 4F38A 1AU9A 3GJXC 5KYWB 2QQFA 4G5SA 2C3YA 1U3UA 1TVKA 1AA6A 1DKPA 3IR5A 2PRYA 4C7XA 3STXA 1Z6YA 4CHTA 2C7BA 1YGYA 4IQ0A 4Z4HA 2CDNA 5KYTA 3PQ8A 3LBIA 1BD4A 2FN3A 4IG9A 4LIPD 1W88A 1Y1LA 1YZYA 3CF4A 3QXCA 4MVJF 1GYRA 3UMYA 4FMBB 3UBMA 2SBTA 5AH0A 1C8VB 1WB5A 3EMVA 4FR5A 4R9NA 3WIDA 4BNVA 2YFKA 3UK1A 2O07A 2EAUA 4RK1A 4DCCA 5KTOA 2G6BA 1KDYA 3VNQA 2QVLA 5EMLA 5KS2A 5LD2C 3OAAD 3IALA 3BHIA 3QMVA 4CN9A 5HGXA 4BJ3A 2J0QA 1JDUA 2GUWA 3CH6A 2WYIA 2OFWA 4EFKA 4X66B 3MHTA 3ZE7A 4OK5A 2ZBEA 4TL9A 1Q1EA 4KSCA 3L9XA 3EC1A 1PWXA 1U0LA 3DAPA 2NU6B 4E2XA 3DEHA 1M7GA 1NVVQ 2NU6A 2XUJA 4BATA 4BV9A 4D0RA 3WNQA 2DWCA 4FYJA 4YCAA 2VK1A 2YC2C 3B9PA 1UC5B 1NBAA 1G5RA 3AZQA 3VZDA 3PNLA 3JPWA 3KUUA 4JEIA 1DOAA 2HHCA 4YS6A 2O2IA 4UHHA 3QVKA 4NECA 3M1IA 2QG4A 2YDYA 3QMPA 3IL2A 1N77A 5M29A 4U7DA 2YYYA 4AJOA 1YKGA 2FN4A 2FPLA 3V9PA 2FX5A 4OB8A 3CZQA 4O2AB 4RPIA 4XQ0A 4WA7A 3VZBA 4AY5A 2V6JA 4W5JA 1NI4A 3N6VA 2PSJA 5BN1A 5IULC 3NS7A 1FTSA 2AKAB 3RVBA 2UUAB 4JKOA 4Y0NA 3JR3A 2EBHX 2ZDQA 2CXUA 4KXLA 2VP2A 3ZLJA 3R5TA 4RNDB 5J4KA 3A58B 5KYGA 3P27A 1ZH2A 1GG5A 3RYHB 1KK0A 2HHAA 3DE5X 3OZTA 5C1PA 1VIDA 1LBHA 1P81A 4KB5A 1R5NA 2F3QA 4YMTA 1EQUA 1AV7A 1R6DA 3MD9A 1GZSA 1TC2A 3HY6A 1JLHA 3BAZA 4JA0A 3KSBC 1TVCA 2X23A 3BC1A 3OZSA 2H31A 3F6YA 4KX5A 1SXGA 1E9CA 5DEIA 4MUEA 3WOHA 3GFPA 4BVHA 1GUBA 3SR4A 4F8EA 2XYQA 5AVTA 2EEPA 3TR0A 3QNWA 1N0HA 1TNDA 1JAYA 3KV1A 4KODA 4LGVA 5DZSA 1J6UA 5C5EA 2QDXA 1JVSA 1OWLA 5CX1A 3R3SA 5AKXA 2KBFA 4N8DA 1ILEA 3S5JA 2ZRIA 3FXAA 2HWKA 2DQYA 5YASA 4CBVA 4AWAA 1R0XA 5FUQA 3OF5A 5BR4A 5HKBA 3I9MA 3ANTA 1N1EA 3D4IA 2XTJA 2ZAMA 3FYUA 3RRZA 4C7OA 3LYUA 4Q9AA 4WEOA 2F90A 5JSKA 4ZQGA 1CB7A 5IBPA 5KJEA 3TX2A 3JW8A 1UJ5A 3KJXA 3MS7A 3M81A 3WTBA 3QLVA 3D6HA 1VLVA 1HOTA 1CP3A 3QJYA 2GPBA 3HYRA 4IHAA 5KJCA 1NBMA 2ERYA 2B5WA 3ANSA 3BE8A 2ZXEA 4XKJA 4GSKA 3TRKA 1CNMA 2F17A 1XZHA 3BE5A 2VZ8A 3FJ1A 3EIEA 1G4HA 4ND8B 4BBPA 3U39A 1K2WA 3R0IA 3LHFA 5B2EA 4MLPA 2ZYTX 1MVNA 3HKDB 5BMVB 1OAAA 3E4DA 5BMVA 4M99A 1NMSA 4OEHA 2H1OA 4TRRA 1IN8A 1F06A 1E64A 1ECLA 2G09A 2ALJA 3OX3A 5L45A 4DYHA 3EEIA 3CM0A 1YR3A 1NOKA 4ICIA 4UDNA 3AU8A 4ZIRB 2ZJ8A 3M4NA 2IEIA 3VR6H 1EFRA 1NN3A 1XI2A 5H3CA 2WTNA 2PH1A 4OBWA 3VYWA 5EZYF 3HZZA 1NMYA 4ZT4A 2GDZA 1SCJA 2BI7A 1L5RA 2ZJ5A 3DH0A 4ROTA 3A14A 1UJNA 2HRQA 3GG2A 3IO5A 4KYTA 3NATA 4URYR 4E13A 1DJPA 1OH8A 4JYZA 1Y98A 3YASA 1ZONA 1QO0D 4D0LB 2L42A 1RAFA 5FR2A 2HQ1A 4N0DA 4BTEA 2P9JA 3K0FA 4CGZA 3KR0A 2OMEA 3CE9A 3J81A 3QE0A 5CVJA 3W05A 5CVTA 4MS1B 1P7VA 3E61A 4ISBA 4KVGA 3BWCA 3T54A 2AMLA 2IEZA 1LKZA 4BRSA 1QVAA 2VDJA 2I67A 1PBTA 3VKGA 5C1OA 3FROA 1L5MA 3COVA 5AHRA 2ZAOA 4OXXA 4GI7A 4ZI7F 2RJ3A 1CDDA 2VRNA 4UUOA 2ZYWX 3L79A 3CLTC 3HBNA 1DDGA 2YWFA 3TE7A 4HTAA 3WE7A 5L4LA 1QH8A 4FI3C 4NJMA 5CH5A 2Q4OA 4UPEA 4C3UA 3GUHA 1EGAA 3ZHQA 5CA0F 5KYUA 3KKKA 4B3DA 4PQYA 4OHMA 3B13B 3IODA 4MLZA 4WK4B 4QTXA 4DLZA 1K0FA 5L7WA 4RFVA 1SVUA 1JFVA 3S81A 3ITEA 1K1EA 2OHHA 5KWIA 2HD4A 2G1JA 5H8WA 5LWQA 5KTNA 1NC1A 4I5DA 3RYFB 3DWGA 1JDTA 3JZAA 3NI2A 1FDRA 4UJ3A 1EFVB 3CZAA 1ZK0A 2JJQA 5C46F 4R40A 3Q7SA 2F55A 3BL5A 2CVZA 3CNOA 4O25A 4QRDA 5AJTA 4ZAVA 5DN6D 3EZXA 2FPIB 1OYOA 2DU8A 5HBGA 1GN9A 4ZMRA 2HQSA 2QZZA 1U0OC 2CLKB 4IOKA 1VECA 3SKVA 1SU4A 3S44A 4LY3A 4RVCA 2RB4A 4UBJA 3UHJA 4C0HA 2Q8QA 1JBQA 1GGEA 1YNSA 3AUXA 1QKIA 3IOMA 4G5OA 3RK4A 4DLXA 4KG7A 1AS3A 1S01A 2CDAA 5B7NA 1TA4A 1IULA 2RGNA 3WIEA 3IAAA 4DMCA 1HQDA 4LAFA 1QVWA 3MCVA 1KVSA 1SKQA 2OYSA 5BVGA 1IJBA 3C3AA 3U7IA 5B6PA 1AK1A 1XDWA 1JE1A 1XLTC 2R7AA 2FPGB 2Y2VA 3GRFA 5DXJA 4E1VA 5DU2A 3AF6A 2AMFA 3GUZA 4HZIA 2H00A 4LYFA 2F8MA 3VNAA 1E2QA 3UW3A 3VDMA 4DLLA 3PZRA 5IT9A 4DNQA 1R4AA 1Z75A 2WZQA 3NTQA 2JGIA 3VAAA 4JD5A 1YB6A 3QW4B 1MQAA 3F6CA 4ZVMA 2ACKA 4XJSA 2XUDA 4FN4A 3QM1A 5ECDA 3RTAA 2PUJA 4WK0B 5B1SA 5BYBA 4XZ3A 4EJ2A 3H0CA 4LXGA 3C45A 4TXNA 5ALQA 1RYNA 3KC2A 3WYFA 1Q7TA 4GBMA 1E8MA 1F51E 3OX4A 4KI0A 4N65A 1FUIA 1PNRA 2A0KA 2VT7A 3L5KA 3GJ4A 3KWJA 2GPNA 2P40A 2Z58A 2BJVA 3GFRA 2CXQA 3LFTA 3X1KA 1C9DB 1DKMA 4B3BA 1RTKA 1FSGA 1C3OB 1F4LA 2VYVD 3L04A 1Z62A 4IPTA 5FD8A 4GZ3A 2O52A 2GFIA 4IOMA 1O2DA 4CEHA 1L7VC 3FCXA 2OFOA 2W71A 4NEHB 3ABIA 4PZEA 5CLQA 1TMOA 4IKEA 1SCQA 3OEHD 4YUAA 3LPAA 2JH3A 2NTVA 4ID3A 4LHWA 1RT9A 4Q00A 5EQTA 1NFFA 1VMEA 4MYDA 3LG2A 4G2TA 2H06A 1K5GA 3C43A 4ZZ2A 3HK2A 4MMYB 3U1VA 1OTYA 3ZDQA 3R7WB 2AWNA 1J9EA 1H4SA 5LP1A 3QIVA 3DVQX 5CHYA 3GJ6A 4B76A 3URKA 1EJ6A 5KYVA 2V7XA 4K26A 3ANYB 5HJ7A 2FK8A 4QAQA 1FDIA 2RHRA 3E3LA 1PW7A 1HL3A 5D1HA 4J1NA 4CTOA 5ENDA 4EECA 5K0LA 3PQ7A 1FJXA 4LJAA 4LF7B 3KUKA 5D01A 4F2HA 2BGWA 3ZE1B 2R97A 3K92A 4K6GA 4F91B 1UFVA 3FTDA 3KPUA 5AK0A 1IBRA 3T38A 1O5OA 3O4VA 4WIAA 3WQQA 3ZGXA 4YRNA 3DEFA 3TZLA 3LGSA 5L3ZA 4RENA 4EO7A 4QGSA 2QRQA 2QIPA 5AM5A 1WL8A 2NUPA 1HFKA 3EDOA 4ETIA 3P1JA 1LPMA 1GGVA 4IIGA 4OYLA 3ZCTA 4KQFA 5DNCA 1FBNA 3RSOA 5AHXA 2VPYA 4RVFA 3GIWA 2JH9A 1SRRA 3PQCA 4QT0A 4YJ3A 4Y7CA 2WQ7A 1WWKA 3J80A 1B4DA 1ZRNA 3ZQJA 4AKGA 3NEJA 3NIGB 2PWBA 1IN6A 3QWBA 2C9BA 1Z6ZA 4I5GA 5FPQA 5HIAA 5LZ9A 3EXG2 3NONA 1E1YA 4U02A 3ROKA 4YAIA 3N3BC 4HLNA 4RLFA 1U0BB 1UK6A 3FRHA 1V0JA 4U6NA 5ALSA 3GEEA 1XEXB 3PRKE 3F3MA 4QEZA 4FKBA 1JIKA 1UXIA 3W06A 1Y4AE 2X0RA 4DLBA 2ID7A 3DHEA 2E4AA 4Z2AA 1GUYA 3BX1A 4QOJA 1MX1A 5CFOA 4PO1A 4ZN6A 1WDLA 4LCBA 3GEIA 1NSTA 2CUKA 4YRMA 2B4KA 5E4FA 5A4JA 1YQGA 4H0CA 5L7YA 1UM9B 3KB1A 1Q57A 1U2GA 2PWZA 2UVQA 2VZ9A 1L5LA 3W3ZB 1JEJA 2WIAA 3KB2A 3ZE0B 1N3IA 3W5DA 4TXMA 3GBVA 2CCGA 3WYEA 2EGUA 4BJ6A 4GBJA 1SQFA 1NYTA 3TBKA 3I5XA 2HQRA 3WMXA 4X1OA 1DG3A 3LUJA 2BDTA 3RS0A 1UBSB 2O2XA 3IP6A 1HGXA 3IUSA 3L7DA 3EGXB 1TRHA 4QUGA 4PSCA 2LW7A 5FQOA 4CM4B 5JSZB 3QXSA 3C8ZA 5A4FS 3TTYA 5TPWB 1QH1A 2GEDA 4K03A 4AXXA 2H7VA 1Q7EA 3A1SA 1FMCA 3I8OA 4P8RA 3VJKA 3OFJA 3PA6A 3ROZA 2Z6VA 3H8VA 1A2BA 2O7RA 2ZI7A 1N36B 1BWRA 3BICA 4D99A 3PNYA 2PZFA 4YACA 5BQ5A 1C4OA 1EE2A 3EIHA 3KQMA 2VI5A 2IHBA 1GAQA 2CGEA 5EQFA 3KSZO 3PWZA 2AUNA 7YASA 3EEBA 4OGKA 3QYAA 4FD3A 3DTNA 3N2KB 3IE0A 1Q1NA 4MYSA 3VTAA 1EDEA 1BEZA 1FXWA 2IOFA 2Z9BA 4TQGA 4YDQA 2JPDA 3EIWA 1Y5MA 2QRVB 2Y1CA 1SU7A 1G63A 3E9NA 1QGYA 4GZMA 4M0UA 3CNQS 5D5QA 3IS3A 4YP0A 2PSDA 5F7OA 1MQ8B 1XVTA 1RIFA 1TO2E 2YY5A 4FCCA 2CL7X 3TSYA 3BMCA 4YWHA 3C6QA 2C4VA 1ZMOA 3M7IA 3PYMA 4KC0A 5E9JA 1ZW6A 3HJTA 1RJWA 1KMCA 1UP6A 2W6IA 3H2IA 1WXXA 3ISJA 4FIZA 3ZWYA 1P1BA 4WDQA 4E46A 5B3JC 1LPAB 4UVGA 4N3BA 4UAJA 3N0RA 2GBFA 4UQLA 4XARA 1J00A 3GPLA 4G4GA 1OW3B 1FSZA 1XTIA 3ABZA 3FB1A 2Q3CA 1GL3A 1F2VA 5DYNA 4JOQA 2NXJA 4FHFA 5JTTA 5E0OA 1XCMA 2PA3A 4UMFA 1RI5A 1SELA 1NG1A 3NBAA 5I01A 5F5XA 2VK2A 2ZB8A 4P98A 4PICA 1G19A 2E2WA 2OHOA 2X3YA 5HUQA 1BDHA 3UMRA 3ZJTA 4YJKA 4ZI2A 1P9NA 4BE7B 1YCDA 2VEDA 3VR5H 3I5UA 4LC9A 3DZHA 2WAXA 3M4YA 1ODCA 4NK4A 3P9QA 4JR0A 2P9QA 3PXDA 4X0EA 1ORHA 4G0ZA 4EZBA 5FV4A 3HDGA 4HGYA 4J90A 3HO8A 3AETA 1E59A 2H4WA 2XEDA 3GMDA 4C2AA 4WBNB 1NQXA 4PZCA 3AW8A 4BNNA 3ZXIA 3OFKA 4OP2A 4LGMA 5LSAA 4YMIA 4COOA 4HPXB 2BL4A 1ODTC 4P3XA 5FR1A 2IHKA 4EGCB 3PPIA 1T13A 3R8CA 4JOSA 3SQMA 2VQSA 5A2QA 4CLHA 5F12A 4EHBA 3IAHA 1MZVA 3J81k 2YVKA 1QHYA 2RI0A 1WY7A 2GN1A 1JLMA 2IT1A 4KXXA 2R8RA 4OH7A 4ZOLA 5D5PA 2G80A 4LJ4A 1IUNA 2CL5A 2OXIA 1SKMA 2GXAA 1ST3A 4PBSA 5DH9A 1SCUA 1KMNA 1PD0A 1TZCA 1NBHA 1CUJA 3OPNA 1KBQA 2CHQA 4I50A 4LCJA 4XUEA 4MPJA 3SI7A 4MGHA 1L1QA 3G79A 4Z9YA 4FIDA 5ARCA 1GNRA 4RWZA 2P77A 3RF6A 2CMHA 5DWDA 1J90A 2JLSA 3PUXA 3SIPA 3SSNA 1DPGA 1MJHA 1YJCA 4RTMA 3TOZA 4Q37A 2I7DA 3ND8A 1R3DA 3QNUA 5AKEA 3GGCA 3Q6NA 4MA0A 1NX9A 4G5QA 3UV3A 1G55A 3ZXYA 4B2LA 3O4GA 4AKIA 1GA4A 1NATA 5JZBA 1MRSA 4MR7B 5EKDA 1WB9A 2XRYA 2Z1MA 3EG9B 1C1XB 3RHZA 3H9JA 5HRUA 2V6MA 1GT91 1XZIA 1RNLA 3HB1A 2AZXA 3PT9A 2LV8A 1RKVA 1JU4A 3BFKA 3DMTA 1WY5A 1F1JA 4TMFA 5BNWA 2HT6A 2QZ4A 1H3EA 5IDXA 3EQZA 2IYXA 2Z6AA 1AZWA 1KY4A 2Q5LA 4PX9A 1T0JB 3OLYA 4KDCA 2GLXA 4I5EA 4BHTA 5F51A 2DETA 3LLVA 3P96A 2I3ZA 1MC5A 3OJFA 3ZTWA 1M2FA 3MQ4A 1X77A 4ZU3A 3ZCPA 5JAMA 3FOEC 4LPSA 2CKMA 1QDLB 2HV8A 2ZTLA 4GZLA 1U0GA 3MLBA 4L4SA 2PJRA 2X1VA 1CQJA 4FDMA 5EG5A 4R9RA 1D9XA 1IUOA 1R5OA 4JI8B 1CUYA 2YIVX 3ENKA 3Q7QA 4HGNA 1PFGA 2YXDA 1NLMA 3R7LA 3RYIA 1LTHR 3MTJA 3INRA 1RRVA 3L4KA 5D7NA 3HBLA 3RTCA 2IEAA 1Y3FE 3U62A 3OICA 1W85A 1B3BA 5BQXA 5DTMA 4MW6A 1D4AA 1M2OA 5PNTA 3LDFA 3TL2A 1YJAA 1I5OA 1RKUA 2FXVA 1N5RA 4G2NA 4M8SA 4WBXC 5BN5A 5L3VA 5LMUB 1ZFNA 3E5NA 4GM0A 2WDPA 5KSOA 3BRCA 3K16A 1A5BB 2CNWD 3VR3D 3UK6A 4KXMA 2C00A 1FYWA 1QHNA 2PT9A 1W9HA 1ZI9A 1E1CA 1GPLA 4WA8A 5TSDA 2ZCJA 3KYCB 4U5QA 1G8HA 3DZGA 3DPUA 3KDAA 1KZ9A 4QXRA 3WB9A 4XX0B 3ILXA 2V7GA 1T2EA 2XE6A 1Y81A 1T1RA 1CRWG 4FFNA 4BUJA 4QDTA 1KSJA 1GT6A 4MB0A 1B74A 1M0EA 4AS1A 3PRYA 3J7TA 3K0HA 3DC7A 2PU7A 4KE6A 4X8HA 4D2IA 4YUWA 2MSLA 3PGVA 3WMRA 5IN4A 3BEDA 3QU7A 1JHDA 5KX5A 1QYCA 4EAAA 3FTNA 3GA7A 1BE6A 1ZD3A 2FB9A 1C3LA 3VVLA 2WINI 3TZQA 4TXLA 2IS1A 4H60A 3T9CA 2ZRMA 2P5UA 4BP9A 1YBVA 4FGJA 4BP1A 2DP4E 2OR3A 2YQ4A 3C1TA 5IS2A 4MWCA 4MULA 1ST2A 3L0SA 2QMZA 3ED5A 3CCFA 4FWTA 3S28A 4EIWA 2V54A 4AJ2A 4KIWA 2Z5VA 4HNSA 1KTIA 3C3MA 4RULA 1FK8A 4KPUB 5FADA 5F1YA 1X87A 1JZTA 2GK6A 1TYEB 3IHTA 4UCXA 5IJ9B 5BWLA 5DMXA 1H1DA 5E3IA 3R76A 1RHJA 3H2GA 1IWBB 1OBOA 1EUZA 1W4CA 3B2NA 4Q4AA 2NO9A 4RFSB 3X1MA 5EJ9A 2H1HA 2G1UA 4BNDB 3OJLA 2Q5QA 4DNPA 1DAPA 3QEMB 3DMRA 1LTKA 1EHIA 4TL8A 4M0CA 3CKLA 3ZU4A 2YJZA 2D62A 4MV7A 4IVNA 5ED4A 1YL7A 2V7EA 4BAZA 4CJXA 3F5SA 1TLTA 4PYIA 3DLHA 5IAGA 1LS1A 4KWEA 1HE5A 1WU8A 2OQRA 4NAUA 3ZKWA 4RKFA 4MWEA 2FUG6 3D6JA 1XROA 1G5FA 4BMSA 3D0OA 2L18A 4PTYA 1GZ5A 4QXOA 4F56A 4RD4A 4RF3A 2IUFA 5A4AA 3U81A 3H1GA 2Y1OA 1CR1A 2DFTA 3K4QA 3JU3A 1F4PA 1GCIA 1K6XA 1O6BA 3AUUA 4EDHA 1O0CA 4ZVSA 1MJGA 3WLRA 1OI7A 3G8DA 5TEVA 3TM5A 1QIDA 3USZA 4CMAA 3RGWS 4RIHA 4BXOA 2C7RA 1XNHA 4HSGA 1F8GA 3UOWA 3KPVA 2R6AA 3BD6A 3R6WA 3WLHA 4LNUA 3OHSX 1G18A 1TXGA 4DCMA 3K1JA 2BFNA 1IXSB 3VISA 5BQPA 2JHGA 3DW3X 3MFYA 4OQLA 5DHAA 1ANKA 4M8IA 4XEUA 4H35A 2M1XA 4QHYA 3PD7A 1S2LA 1J0XO 3I72A 4DBVO 1O89A 4U6SA 3DAOA 2XZDA 5AVUA 1M2VA 1JP7A 1PWZA 4N0EA 1GNSA 1WHSB 4JBWA 4WFIA 4ZCSA 3FDXA 1MKYA 2EVWX 2GKGA 2OXRA 2ZKIA 4MUKA 3NCTA 3PR2B 3QLTA 1T6YA 3NHPA 4CV1A 3WKEA 3ZGYA 2FPKA 4H59A 1YDGA 4KUEA 4GBGA 2XR1A 4PNHA 4RXTA 3CLKA 3BK2A 2PD6A 5DGTA 2XCLA 3M6FA 4DG9A 2JRCA 4OKIA 2A30A 1E3DA 4ZOCA 1QS0B 1BXGB 3IC5A 1FPMA 1NDQA 4YLYA 3ISVA 2P79A 4KQHA 5HXAA 5JRDS 3E82A 2WA2A 5LIRA 4ZYZA 4C20A 2DWPA 3DMPA 1MRNA 4MB6A 4CKCB 3ZHRA 1C4WA 1LDYA 2AUMA 4UNRA 3ZIDA 1NUQA 4I5IA 1I7QB 1Z3CA 4D6PA 2DR0A 4IICA 2W6PA 1RYYA 1KZ7B 2YNMA 4FT2A 4TL6A 3RTEA 4ZVQA 4JJZA 4EUEA 3IJRA 3DYIA 4ARVA 1QZTA 2HQBA 4RPKA 1QG2A 3BWDD 4BFXA 4ECEA 5HVNA 1HDCA 1JQLB 3RBAA 4L2IA 2OHFA 2IOHA 4R4JA 2X4IA 3VAZA 1SQGA 4AN4A 3AM5A 1YRQA 2HGSA 4JSRA 4X1KA 3T0GA 1SQ6A 1A77A 1WNFA 2XD9A 3UAWA 2XXAB 4QDKA 2J8ZA 1E92A 1ESNA 4CKWA 5LQDA 1H6DA 4Y6OA 5FF9A 3ICPA 1IXRC 2ZSJA 1XCGB 4IZ6A 1XDZA 4Z0NA 4BFUA 5B1HA 2VNAA 5H3LA 1P7CA 1FDSA 2J6IA 5KKAA 3V8RA 4B4WA 4DV3B 2OSVA 2C8LA 5TDHA 3HSSA 4A2WA 5HNKA 2GN2A 1RACA 1OYYA 2IE0A 1D4ZA 2BUCA 1NHWA 3UY4A 4Q7JB 1DINA 1AJEA 3WY9A 4M37A 4HNQA 1VMAA 5ESXA 3UB4A 8LDHA 2HR1A 1JBEA 1QAOA 2IBSA 4NAHA 3ZDEA 3EZGA 3EQ6A 1MD9A 1PL6A 4ZYVA 1OTXA 3MMNA 2W2KA 3O4JA 3TD2A 4Q4HA 4EMBA 1GGFA 5D00A 1Z8HA 2VP4A 3ZHXA 4KRYA 1H65A 3JQGB 2G83A 3W7BA 4EKGA 1XJ0A 5CLHA 3UWPA 2YJ6A 2EFEB 4L9RA 2CNOA 1J2YA 2GFHA 4OYHA 4YECA 4QQNA 2WJ4A 2PD4A 3QGMA 4MMXB 5JMTA 3BTSA 1X2BA 5D8DA 3GEBA 2UYQA 1KU6A 1XE3A 3KOXA 3PWSA 5A3RA 5JLAA 5K1ZA 3UUFA 5EE0A 3GLIB 2CNNA 2DFDA 1H9CA 2WAMA 4GBED 2AH5A 1K5HA 1WQ3A 2VRCD 3I39X 5BR7A 4YUYA 1J70A 2FJPA 4RC9A 3WMGA 4HCJA 3FOCA 4F4HA 3V4SA 4F5DA 3SNKA 5H4GA 1VYHA 4NG5A 3JQAB 4NCAA 3PUIA 1LNSA 2PZLA 2OENG 4LFBB 1P0MA 1ONOA 1RCTE 2ABWA 3FUCA 3EGWA 3R4CA 4PC3A 2CK3D 3WDLA 4CIDA 2EGGA 4HMQA 1I3OA 3E9ZA 3IBCA 5DHQA 5JD6A 1OJ7A 5DWQA 3VU8A 3WL3A 4KQ2A 1W6UA 3GCWA 2EZ9A 3T4XA 2PPLA 2IH2A 1JG4A 3VH2A 2OG2A 3CF6R 1A5SB 1QONA 1GEGA 1AHIA 3WWEA 4L50A 5CFZA 1E96A 1R4NA 1S5PA 1E5DA 4MUBA 1PGOA 1RXEA 2BZGA 4U4AA 4B4KA 1UZAA 1UKCA 3WS7A 5FHQA 4E7PA 3C5HA 4HQOA 3PPVA 4BUZA 1V5EA 2WV9A 2YZKA 3OPVA 1AKMA 3HUFA 4BLSA 3C1OA 4QYIA 1E6UA 4F9FA 2H92A 3ACBA 3VMFA 1VBMA 3O2NA 2OB1A 1CJUC 2ZATA 5GM2A 1L7OA 3VOSA 4QU0A 3KJGA 1GL6A 3JQRA 4R6WA 5B2ZA 3AESB 3A6FA 3RSFA 3O73A 4EKIA