4F9EA

Cyclic di-gmp sensing via the innate immune signaling protein sting
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
173
Chain Sequence
NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPDSSFSLSQEVLRHLRQEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cyclic di-GMP Sensing via the Innate Immune Signaling Protein STING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Transmembrane protein 173
total genus 51
structure length 173
sequence length 185
ec nomenclature
pdb deposition date 2012-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f9eA02
4EMUA 4F5DA 5CFOA 4LOLA 5BQXA 4LOHA 4KBYA 4F5WA 4QXQA 4LOIA 4QXPA 4F5YA 5CFRA 4KSYA 4LOKA 5CFPA 4JC5A 4LOJA 5CFMA 4EF5A 4F9GA 4EMTA 5CFQA 4QXRA 4KC0A 4F5EA 5CFNA 4QXOA 4F9EA 4EF4A 4YP1A 5CFLA
chains in the Genus database with same CATH superfamily
4D6YA 1XLTC 4DHEA 3KZNA 3LXUX 3NT5A 2E4YA 4PPFA 1LEHA 4YUXA 3JZIA 4IHAA 3QZUA 3JQAA 4B6PA 2WJ3A 4RA9A 1MO6A 2HMUA 3DVSX 4Q9KA 2ZP1A 2W9XA 4I1SA 4I6JA 4YT2A 1MHTA 1J6UA 5F4BA 1SUIA 2ATVA 2ECFA 3MJCA 5EZ6B 2V7XA 3KOYA 1E1NA 2OB1A 3C97A 1D2EA 1UQUA 2EBWA 3PB3A 1JIIA 1NI5A 2IYVA 2N0SA 3JRNA 3O2JA 5A4MS 5AW8A 3KJEA 1O95A 2VCYA 3BL5A 5DN9A 5KWVA 4OQXA 3QE3A 4P6VF 2FPGA 4L2IA 3THYB 1IY9A 1NPYA 3G2MA 2GK7A 1XXHB 3G79A 1THZA 3W2GA 2OV8A 4QAQA 3T5BA 5HQ3B 1AHPA 1ZAYA 3L93A 3OA0A 4LOAA 3OZIA 2Z9DA 4F6RA 3PE6A 1WB5A 4J49A 5A62A 4F21A 4ZO7A 4EG1A 1XE3A 2X8WA 1FUKA 1YVUA 2IIBA 3DD5A 1YZGA 1CEQA 4WCVA 3E53A 1GLGA 3BFVA 2DOKA 1ULAA 3EVFA 2X6TA 2JAPA 2XQIA 1G21A 3C41J 3LNCA 5IN4A 2BSQA 2IOQA 3IOYA 1GHTA 2X2EA 3N0XA 2D3TA 3NOQA 1QG6A 5AM4A 3U61B 4QO8A 1G7TA 3BWDD 1X92A 4B6FA 4F3CA 1BQEA 3OFKA 3VNSA 3BB3A 3TLMA 4E2FA 4ZYWA 5JJBA 3L0DA 3LV8A 2QU7A 2Q3MA 2C9OA 1T0PA 5GJWC 4HAXA 1ECLA 1Q1ZA 3T54A 4IGEA 3C1OA 2REXB 2V4UA 5FOUA 2EFCB 4L3VA 4N3GA 3U3OA 1C3OB 2J3KA 3MTEA 2PAFA 1JHZA 3I04A 1MDBA 1USUA 1BMTA 4HZGA 1V7QA 2ZQ5A 3EZ9A 3UNXA 1ZJ4A 2CXRA 3S40A 4PYLA 2PGXA 4GDMA 4XYMA 3WHPA 2OENG 3U7EB 3WMEA 2VYCA 3W6UA 4BYMA 1SQFA 1UQRA 3DBHA 3N2NA 4UZEA 3V55A 5CDTA 2H16A 4EG6A 3WGTA 1CUGA 3U3MA 4Z4EA 2C04A 2IXAA 1X7ZA 1PJ4A 1M34E 5JMOA 1Q3HA 1BYUA 1QOPB 4JQCA 3RVJA 3S4YA 4FN5A 1A9OA 1ZVJA 3L8FA 4OI4A 2R1VA 4U5QA 4C89A 4CVNA 1OH8A 1YA8A 2BJWA 2WF6A 4LUCA 4XJVA 3B6EA 2BKVA 3ZD7A 1WHTB 1DDGA 1CRZA 4J29A 4O4LB 5TMDA 4RH1A 5JH7A 4R8VA 1IDN1 1JE0A 1FZQA 4ICIA 4Q00A 1ZK3A 2Y0PA 5C46F 2D1FA 3PWSA 3VAYA 3KALA 4MUBA 4B6EA 3ZDRA 4WLEA 1H9CA 3RSQA 4DKXA 1BE0A 1IHYA 4YXFA 1TNDA 5KOHA 4UFPA 4ZVRA 2WOOA 3ETJA 1T6ZA 3H4TA 2CJPA 4NBKA 3I5UA 4E09A 4KH1A 4LVNA 1B6GA 3O9VA 3QBVA 5FI5A 2EHDA 3ZHSA 3ZGZA 3AFHA 5GTDA 2ATCA 2PD6A 3PFKA 4QUDA 1SU7A 2FPIA 4HX2A 2HREA 2DF8A 2WUFA 3Q2OA 4J9VA 2C88A 4MI1A 4NAVA 1LSOA 3I9NA 4B33A 2ZB7A 5MN5A 4NATA 2VQEB 3VZDA 3T0IA 1NOJA 5A4KA 1Z5GA 2VXYA 3PD0A 3VGPA 3L0OA 3CVUA 1FK8A 3R9WA 1YBMA 3ZKWB 2QZSA 1T3SA 4KE6A 1LBIA 1CW2B 2P90A 1DARA 3E7PA 4R6WA 1P1JA 3TZBA 2Q1XA 3IEPA 4XM2A 1VDMA 4R1PA 2AN5A 5AM1A 4L28A 4HMPA 3T94A 4AO6A 1S7GA 2BFCA 1JDVA 1L4BA 3KIPA 2DLNA 4GR9A 3UN1A 4HXEB 3CRNA 2H3HA 1O5IA 5F7XA 2BM8A 1P19A 1E2KA 3ISVA 4D9KA 3HL4A 4YAIA 1E7SA 2JFWA 5L40A 1OFGA 4ZI3A 3CT4A 4B3DA 2I7VA 2QXTA 5BV1A 1PW7A 4O4LF 5IVDA 1Z22A 4D4IA 1E5DA 1NJ5A 2FX2A 2QU8A 1I8TA 2ENUA 1PIWA 3O93A 2VK4A 1B76A 1KARA 3TTYA 1KQNA 2IYYA 5FTNA 1IZYA 1GAWA 4AZSA 3GCXA 3VYSB 3GRUA 4J0IA 5IVHA 3MRSA 1SIWA 1Q95A 3R6TA 4AKEA 4WZBA 1UFVA 1W35A 2BFFA 3BMNB 2G9QA 2ADMA 4MWSA 4NFLA 2ZRJA 2PO7A 5H9VA 3TQQA 1J5XA 3GLIB 5DT2A 1JQEA 4Q66C 4CTNA 2IOFK 4BB9A 2XI4A 4DV6B 3QXXA 1LPOA 4UTVA 3IC5A 4IFEA 4F11A 1NN1A 4PSUA 4RHCA 4R2XA 5HKLA 2Q2WA 3T9CA 3QKRB 1LTQA 1VE5A 2Z0MA 4QLOA 1A69A 3EBOA 4GLLA 3ZWCA 1F2DA 3DE6X 4FIZA 1XMQB 3S70A 4KVFA 1QPZA 3DFZA 5JOQA 5LQSA 2WY2D 4DIUA 3H1PA 3I1FA 3ZV7A 2HB6A 2H5LA 4H7HA 1BS1A 4KRGA 2CCGA 3HJCA 2RKBA 1XEWX 1SKBA 1WW3A 2DECA 1P4RA 2YR0A 3AHJA 3R5HA 2IYPA 3RU3A 1CF4A 2I8LA 3IJRA 1OTXA 1WQ4A 5J2UA 1G4HA 3AM4A 3VO9A 1GJRA 2XNSA 3QYPA 1UJ6A 4AJLA 4C08A 1G42A 2HK6A 2H2HA 1R8QA 3EFOB 4DMLA 4QL3A 5KMGB 2HNAA 5LD2C 3A3KA 4FB4A 4J0KA 3B5JA 2B36A 5K01A 3GHYA 2FKAA 4IX1A 4IZOA 2J9FB 1JG1A 1NMEA 4U9UA 4FMDB 5C32A 2OHIA 4K9PA 3B36A 3SAJA 3OEHA 4QAJA 3X2SA 3U7HB 3QX8A 3THOA 1LCIA 3BGOS 1HYHA 2HTEA 3A04A 3WO1A 3EVCA 5EJ7A 3U4MA 3LRTA 3Q0TA 3FWNA 3ZZNA 2ZG6A 4DMKA 2OWEA 4EI2A 3IELA 1PSDA 1I9GA 3OVMA 4OI2A 3WQSB 3SJUA 2B7CA 1TD1A 1MUUA 3BBLA 2ALJA 4YS6A 3O7MA 1NQVA 4V24A 1JQBA 1OYWA 2SKEA 4RDHA 2WNIA 2VUUA 2PUVA 3GDWA 4XLZA 1JEQA 1NDUA 2PK3A 4NYJQ 4DJAA 4YRGA 4RS4A 5L3SA 3WLHA 1Z4JA 3PXDA 1XQXA 1D1TA 3C3KA 3DWIA 1ABEA 3LXMA 2Q3BA 3WRXA 1P2VA 4HUQB 4ZGWA 4G0VA 2PX0A 2XYGA 4JYAB 2NNWB 2RJNA 4G5XA 1QPGA 3WK8A 1Z34A 1M5RA 5AKYA 4ZYLA 2NZYA 1R4NB 2NU6B 1V8PA 2H7CA 1IXKA 2AK3A 2ZYGA 3IIIA 4G1UC 3O84A 2HCBA 3JR3A 1QTRA 2QYSA 3HKCB 4ENUA 2C2BA 2OXRA 3QWHA 3N0TA 4QGHA 3L6EA 2WU1A 4MQFB 5FPPA 4YT8A 1AUOA 1VHTA 3SF8B 2FWMX 4CN9A 2FN8A 1CE8B 2HJHA 3OU2A 3BIFA 4LNAA 2I3GA 2ECQA 4FKZA 2NSHA 3NAGA 1RQRA 2Y3IA 4IOMA 3Q5DA 5FBZA 2CBXA 2BHRA 4K46A 4HQ0A 4L0CA 3IRVA 3A6PC 3U7FB 2B37A 5IH3A 4QJ4A 1Z5NA 5EC8A 3RPEA 2CYAA 2QZPA 1CZKA 5HX7A 1GPMA 1N5IA 4WHMA 1ESEA 3WTCA 3G68A 2D5IA 3GLSA 5BUZA 4DLZA 4DCVA 4KO2S 4JVSB 1KJNA 2P30A 1OGIA 2GYVA 2ZTHA 3D3EA 4L3WA 1ISRA 3S1AA 2GNPA 3WVNA 3ADOA 4MA4A 4MINA 5EQJB 2GM5A 1C3VA 4XTRA 1XYVA 2EDCA 4D45A 1C3JA 1TA4A 1II0A 2JLRA 1R10A 1J07A 3QPAA 1Z8NA 2P78A 3HDTA 3M6FA 4DR5B 5K2OA 2KB0A 1SKYB 1ZRMA 2OCIA 3GIWA 3VKUA 3FTFA 3DBLB 1KAGA 4I5IA 4KSYA 5KKCA 2OT3B 5CW2A 1FSSA 5EP3A 3MAAC 4RVNA 1HM5A 4B46A 5DRYA 3AOEC 1JSZA 2PDAA 3LGSA 4HBZA 4LIPD 1ZIOA 2V7WA 4A0SA 4JC8A 3LI2A 4L5CA 3FETA 3GCWA 2FAXA 2BFEB 4BTLA 1NQOA 4PLHA 1PS9A 1EA5A 1TU3A 1XLVA 1YZUA 1WXWA 1IEXA 4XGIA 5IEBA 5T8KA 5AH0A 3K1TA 3G8DA 1DXHA 4X1IB 2OUIA 3BCHA 2G80A 4ZTUB 5IXSA 5AW2A 4FFVA 5DX0A 2L2QA 4O25A 4EPVA 1M10A 2VHZA 3KB8A 2OGWA 1W85B 3R3HA 4UVIA 4INOA 2PNJA 4EEZA 1Y3CE 3MMZA 1Z82A 2IWRA 4DPMA 5JAIA 1FNCA 2PYIA 3P9XA 1RCTE 2CHEA 3FAZA 1LW6E 1UBGA 1PR5A 3W4JA 1L5HB 2C8LA 5EXXA 4BGIA 4CMEA 2XQVA 2FEKA 2D7CA 4OMFG 1E3MA 1PUIA 1ISMA 3BSSA 5ERGB 1RM0A 4YQZA 3B1VA 3HUDA 2NU8A 4NMXB 5IUJC 1J2UA 1E1MA 1X42A 2JLCA 4KITB 1ADGA 3PQ4A 1FBTA 1V16A 3BJIC 3PT5A 2ZWVA 3AR8A 5CA1B 1ND6A 4AXXA 1H42A 1FTYA 4NCXA 3FXAA 5T67A 1GAJA 4JODA 3T3MB 4BVHA 1J0BA 1M34A 3LUDA 4CRWB 3H8SA 4D8VA 2M98A 2O0LA 3CPJB 5AKGA 1W7AA 1YZ3A 3WMXA 1XRLA 5JSQA 1DGQA 4UREA 2AG8A 2W2KA 2XCLA 5FB3A 4MYTA 1XVVA 2XYQA 3DA8A 4LMRA 4M0FA 3ZV4A 5BN5A 2I76A 1U6JA 1CVRA 2JKZA 1U0SY 5CITA 2X0NA 2FETA 1OBOA 1B1AA 1WM1A 2HA7A 3IAS1 5P8WA 1ZH8A 4IV0A 3EMKA 1V7CA 2IYOA 4HYYA 1CUYA 3L40A 1Y3IA 5LQNA 2JGFA 2O8EA 2QAGC 4Y2RA 5BSEA 1OGJA 5J4LA 2IYAA 4GX5A 4YV0A 1L3CA 1PR2A 3ONEA 4WGGA 3X2FA 4PIMA 1PGQA 1NVVR 2A1UA 1EK1A 4J0CA 4RHEA 4BPRA 4CLDA 4JA0A 4PYMA 1G2PA 4HK4A 2NU9B 4BECA 1Z5PA 2QMUA 2OXFA 1G21E 1TA0A 1RWQA 4FD2A 4DDVA 5D3MB 4HMQA 1HE2A 4HWOA 4PIVA 5L7YA 1FNMA 2QPAA 2BMVA 2FG6C 5KYTA 1GD1O 1N2SA 1GGFA 2DXIA 2K5UA 3UXHA 1D1PA 4QDUA 3SX4A 3R8XA 3TZLA 1CSEE 4IJUA 5EMHA 1E1YA 3QELA 3MSXA 3RYIA 1Z8HA 4LSGA 2IYXA 4YNBA 3IMFA 3R6DA 1DZIA 2EKPA 5DYGA 3WTBA 5TPZA 3TUJC 4DQKA 4LCJA 2EVWX 2FE1A 4I1VA 4N5IX 3ADBA 3OWXA 4AZ0B 4CDNA 2FDXA 2QRNA 1U9ZA 4MGHA 1AMOA 3NAQA 3EISA 8ADHA 3GAZA 1V95A 2HHHB 3OX4A 4AB1A 4PN3A 4Z2AA 3MF4A 4LRTB 2IKQA 3OMLA 3S44A 1DS6A 4PZCA 3M6UA 1W581 3HXLA 2WF5A 3R20A 3SKYA 4F71A 1RDFA 4F7WA 3CX3A 3HB0A 1HSZA 5TLSA 3VO2A 2IX9A 1KK3A 4K40A 2RH9B 3S2FA 1SVKA 3L7BA 4KAJA 1C7ZA 4U6NA 3NKLA 4QM7A 1W48A 1QFXA 4ESVA 1F1BA 1XZFA 2BMFA 3HUUA 4FYIA 4LXGA 5BV2P 1YQWA 3L41A 3LT4A 5ERYA 5LIRA 2PFGA 1N7JA 1S9DA 4REQA 1S4QA 3PXUA 1JFTA 1NX9A 3AUYA 3CW2A 3HWSA 4OQPA 3VTAA 4TV9F 2A3NA 3ZJVA 4P7JA 1IRIA 1EFDN 2YBDA 4CF5A 4B4WA 2WNSA 3KXLA 1TEXA 1G59A 4I4TA 3DAFA 1FRFS 3NRBA 2O4CA 2I5PO 4JJKA 5F2KA 3VC1A 4H6VA 5KNCH 2PXXA 3EA5A 1GSAA 3AHHA 5K51A 3D6JA 3VSEA 1Z4KA 1FLDA 1QJCA 1ZLYA 2VKTA 5IYZB 4PG8A 1XA0A 1E8MA 1YGPA 1HE8B 4GX0A 4W1RA 3GT4A 4LF6B 1PE0A 2QG9A 2VWHA 2E48A 1VLHA 3PCTA 3CSDA 3HCOA 2OO7A 2YJ6A 4FINA 1JT2A 2QP4A 3F5QA 5L3VA 3MILA 5HUQA 4D41A 4OFWA 4ND5A 4XIFA 3L05A 5DBEX 1XZHA 2ANCA 3ICCA 4GS5A 6LDHA 1Q22A 4FZ5A 2BFCB 3BULA 1M7GA 2AZXA 5DCWA 4CI0B 1YR9A 5KX5B 4KXNA 4TRJA 3FDJA 3J81A 5FI3A 4J90A 1JQAA 5JECA 3TW0A 1JU9A 3FH0A 4KAXA 4RNDB 1SCNE 3TQFA 1R0SA 1T1IA 3CCBA 1P4AA 2BUBA 4BX3A 4DUPA 2CNOA 4Z4IA 5CFOA 2AG6A 4Z51A 5DTRA 1NKTA 2BTOA 2BTQB 4KK3A 2QPLA 4C29A 4QTYA 1WY7A 2A92A 1FFDA 1R5OA 2UKDA 4GF5A 3U6BA 4WBNF 4FVTA 3ND7A 1JZTA 2H6EA 1UOPA 2YW9A 4HRXA 2ISCA 5ALFA 1YU6A 1GUZA 1YC5A 2VF5X 2WE8A 4XLTA 3ZCTA 4Q39A 2RKOA 5BRJA 1KEPA 1VQ1A 3U9LA 4NK4A 4DNFA 2R87A 4OJYA 3RANA 2VTDA 1KYTA 4S3MA 2WKWA 3P26A 3OQNA 4RF2A 2QUIA 3WQRA 4E11A 3MJTA 2YWRA 1YKGA 3QKRA 3T3NA 2JFNA 1CIJA 3OT5A 2ZJBA 4HG2A 4I1RA 5D87A 1XRMA 4QJ3A 3JYHA 4IIBA 3VZPA 2QN2A 1A9XB 3K5WA 4F2PA 5B2FA 3I34X 4HPXB 5LYJB 3NANA 4A26A 5G0TA 2AI1A 2SHKA 3NXKA 1A98A 2PLRA 3ZGLA 2XVZA 3GB9A 2G67A 5CXXA 5IFLA 2PA0A 1Y37A 2LIVA 2Z6QA 1ZSYA 3IUMA 3QKTA 5I9BA 3HHEA 1SWVA 4JB0A 4HNTA 1RTKA 1BN6A 4DV2B 3BMQA 4N0QA 1GTRA 1JG4A 2HBZA 3TRIA 4D9IA 3AWIA 1DDOA 1LBEA 1UK8A 4G0XA 2D2IA 1Y3DE 3EFHA 1C1YA 3PXAA 2J4FA 3PRYA 3SQWA 3TOVA 4FLEA 4LJ6A 2BR5A 2IVZA 3ASYA 4P5PA 3G5UA 4ZO8A 2ZS8A 1DB3A 2VJKA 9LDTA 3NDBB 3PJDA 4OJTA 1L4LA 2JFYA 4KI0A 2GM9A 1ISHA 4KYVA 4B3BA 4RXTA 1HNNA 3FNIA 4EGQA 2BT4A 2YHUA 1Z8FA 3W9UA 2I6XA 1BEZA 1X80A 2FLVA 1TVKA 2Y05A 2VNIA 3DO6A 1LDMA 2P7HA 4UC0A 1PBNA 2WM3A 1G55A 3G5LA 4TTSA 4G0WA 2Z9BA 5L3QA 1GL9B 2GT1A 4RHFA 3U9TA 2J9GA 2ON6A 1KEVA 1CKEA 1IDOA 3IQZA 4IICA 2W6QA 2YWXA 3LYHA 2DPMA 2XY4A 2LPMA 4EUHA 5KTOA 3STUA 1WABA 1VLLA 3IHLA 3F0TA 4ZT5A 5FORA 3H4VA 1EQ2A 5IDXA 1UBOS 5JXGA 4C4AA 4E21A 4WN3A 5JJIA 7MDHA 4OM8A 3WX0A 3CH4B 1YL7A 1RQGA 2FPPB 1XAIA 1K0FA 4NBNA 1AS2A 2J3QA 2PRIA 2FQ1A 3A9SA 4J16C 4NCNA 4OI1A 3RU7A 5LLTA 1B7GO 4BUJA 2BEJA 4BNFA 2YOFA 3SHTA 3V46A 5I47A 1Z3IX 2O05A 3CUTA 4EJ2A 4LNHA 3BBPA 4RCVA 2P2LA 4AYXA 2BJHA 2X3YA 4KQKA 1JDBC 1IJEA 5EZSA 4CM8A 4EW1A 4B47A 4R0MA 4GKJB 2VDLB 2X4DA 1X7GA 3O0TA 4CI9A 2Y4NA 4NTZA 4C4OA 3R3VA 2IDZA 5LP6C 4KEAA 2WTUA 3DM9B 1WG8A 3LNTA 5JPDA 4UQOA 5DBGA 5GJCA 1E5LA 4LISA 3D6MA 1TAHA 2NU8B 4M1MA 2JLWA 4JR0A 3PKIA 1SUCA 2WAXA 2EDAA 4KBFA 4GPZA 4NG4A 4KXXA 2HK8A 1CY8A 3B1FA 3DHNA 5FJIA 3V1TC 5K6AC 1BMFA 4U6SA 3UMMA 4I36A 4B6JA 2FTKE 4FEAA 1F06A 1UIMA 2W90A 2XWJI 4BVKA 4QWMA 4XWKA 5KOHB 3UAYA 1PGOA 3RQIA 4M6WA 1Y3BE 1J8QA 1Z68A 5J5AA 2J0VA 1R4NA 3VU1A 4TS1A 1ZN9A 2JH9A 4OQQA 4RXMA 1WKBA 5KNCA 3V2IA 5F9HA 3UQZA 1GRNA 1X7WA 5K0SA 2IHNA 3FVVA 4R16A 3IA7A 2PMEA 3O74A 3VRHA 4EUNA 1Y7IA 3IQEA 2X5XA 1Z0SA 2JLAA 1ENPA 1ZZGA 3JWPA 3COJA 1BU8A 3BJMA 3NBZC 1CS0B 5B6JA 2HMYB 4XWTA 1SMKA 1YS1X 3EF3A 7ADHA 4F5YA 2FLWA 2JKVA 5AHOA 3MHTA 2X14A 3HG7A 3VAAA 1HFEL 2ZAMA 1RBZA 3D6FA 7ABPA 4ZYXA 5HQ3A 5KTNA 1TMOA 5FF9A 4EVIA 1PUJA 2FI1A 2CVZA 1HFJA 1SM4A 2ZPAA 3OEHD 5FL3A 3R7WB 4DJEC 1SKMA 5FNVB 5LP1A 2ETXA 5E1MA 4CV1A 3DOFA 4FR2A 5HRUA 3PNMA 5EPEA 4PICA 1MQ8B 3ABQB 3NOVA 5KDOA 3SZRA 3QLEA 1KY4A 1MC1A 5A4DA 1GZDA 2CNDA 2ZTSA 4WNAA 3B6JA 1Z88A 2G08A 1OOEA 4NOLA 1WOYA 4EX6A 1ND5A 3NV9A 2HA6A 1LVUA 1E62A 2DWUA 1CIVA 2WDPA 5IDWA 5JXHA 1FDWA 4RHXA 2VTBB 3TVYA 4I7EA 5LYJA 5A4JA 4LDPA 4RANA 4ENQA 4MV3A 5DTEA 3TG8A 2EGHA 2PR2A 1IPEA 2NWQA 4PM4A 5HEKA 4EHNA 3QNUA 1O9GA 2CWWA 3M70A 1JQ5A 3ZU6A 3DR5A 3E23A 4KPGA 3JVVA 4F1KA 1SOMA 4PXSA 4YONB 3SNKA 3RVPA 4PW0A 3EQ6A 2ZVQX 4IGKA 5AHWA 3AHGA 3EVTA 3E1SA 3CJRA 3WJ2A 2HA3A 2WRZA 2CLKB 3H2YA 5BNIA 5JY6A 1DBQA 5FPTA 5U9CA 3TFWA 1GITA 1OB2A 3CXRA 4NDAA 5JMPA 1CUIA 3UGKA 4A15A 1QP0A 3NJRA 1HXHA 3AKCA 1J00A 2W6ZA 3IUPA 4Q3NA 4AYTA 1PS0A 1RPNA 3HP4A 4JWTA 4MW2A 3WLNA 2V7TA 4AWXA 4HMOA 3LCCA 1KFJB 1M2WA 5HKKA 1GKLA 2VJLA 3H5TA 4HADA 1DX9A 1YB2A 4R2LA 4EA6A 1VSQA 1VE7A 2CJYA 3BRCA 2I1WA 4A23A 5CB6A 1CVLA 5LNK1 1FP4B 1L9XA 2JD0A 3WGJA 1Z73A 3AONB 2IF2A 4YX9A 4RJLA 3UWMA 2H4WA 3SBOA 4XD2A 1NW4A 3ZCPA 4P4LA 1RE1A 1WU7A 1NKSA 3IBCA 1QDEA 3MFYA 4MS1A 1X1SA 3L0SA 3NTOA 4YA6A 3H04A 3AOGA 2F2TA 1Z0KA 2MU1A 3PDIB 4BHTA 3VAZA 2QRGA 5I9NA 1RM5A 3M82A 2LZ0A 5EXDA 3TRFA 2LWIA 1NI3A 1OF1A 4MQEB 3WLTA 3CXUA 3EOAI 3AR9A 1BFUA 3PDJA 3M3HA 1RIIA 1DVRA 3N53A 1F1JA 2XRFA 3WFJA 1QU3A 3A9CA 3BCUA 3ZKWA 2V55B 4UAGA 3F73A 1S2OA 4BO9A 2F3QA 3QHQA 2W71A 4GMXA 1BMFD 2DHDA 2N9UA 3F67A 2NSDA 1Z2OX 4UHKA 1PJTA 3O3NB 2W42A 3KVNA 4NFHA 3UMSA 3H6GA 3K32A 1NVAA 1OLUB 1YQXA 2J0UB 3M4YA 2JBHA 3C4VA 4L9RA 1XZMA 2EWMA 2A94A 3KV1A 4DDUA 2CHFA 5H0IA 4QQRA 1GUFA 1ZIDA 5FL7D 2IBSA 5LYYA 2AL7A 2FWRA 2G9UA 2JFHA 4BJ5A 4BO6A 2H85A 1A4IA 4EHLA 1ZKDA 3NHBA 1NVUQ 3FHTA 1ZOOA 1XXHE 2UYGA 3BIXA 3HE3A 4OL9A 4RZUA 9MHTA 2W4QA 3L02A 2OFPA 1A7JA 5JRZA 3M49A 2R0QC 2C7OA 1VFPA 2YMLA 3BGIA 4GMDA 1GUYA 2GCIA 5EJGA 1WBDA 1DRWA 3DBVO 3WHLA 1NBIA 4Y2XA 5BSGA 1CY2A 4JVLA 4DRXB 2O8NA 3LQ1A 4FC6A 2Q8QA 3HJFA 1ZFNA 3TEJA 2VXBA 1RJ9B 1E5QA 1YI1A 4UMDA 2QXUA 1FSZA 3IUEA 2EZUA 3DOEA 3SPXA 4UFNA 4HVCA 1PFVA 1E0KA 5LZ5A 1LA2A 4U9HS 1GPUA 3HHPA 4H2DA 3RRFA 1V6CA 2ASEA 2CDNA 3ZJTA 3MGKA 4DLRA 1N3IA 2GAOA 4KIJA 1KI9A 1ZWKA 4PAMA 3BD8A 4XCVA 2AKAB 2RHCA 1NJFA 3BK7A 5JSZB 3HBLA 4EMBA 5BUQA 1NF3A 1Y7HA 3NBXX 4UTRA 1WEKA 1QO0A 2H11A 3QPBA 3RW9A 4O29A 1AK9A 4EP1A 2C57A 2VJNA 3HR4A 5EKXA 1N3YA 3AEUB 2WLSA 1ZSNA 3GLVA 4P5EA 3N3AC 1NQWA 3HFJA 3GYGA 3NBAA 3KR9A 3FWZA 4PAGA 3HBMA 4LJAA 2F8LA 5AUQA 5HPYB 1TX4B 1ZVKA 4QPCA 4D3ZA 1FFHA 1TQDA 1OXKB 2G6BA 3NHRA 3IPYA 5ALOA 3VISA 4BDTA 3CHYA 5J3JA 2PL9A 4MUKA 4Q18A 2OXCA 1CZRA 3WLEA 4HT3B 3X3HA 2WWYA 1KJYA 4EB6B 1O94C 5FYQA 4A7PA 1ZVVA 2W4MA 3ZXYA 4LYDA 4A0HA 1YIAA 3F1KA 1N8TA 1FX0B 1UT6A 2VJBA 3RUPA 3ZV5A 2RONA 2PJRA 4IIEA 1L4FA 5DGHA 1YVDA 1E4EB 5DK4A 3VGJA 2BKEA 4J6EA 1Z63A 3AY3A 3CNQS 1DG9A 2IHJA 3PI7A 4X6LA 3R7LA 2X3FA 3PQ5A 1D0VA 3LP6A 4D4JA 1F7VA 3RAJA 4JH0A 2IXEA 2NNLD 5I5EA 1RW4A 5HOQA 3HABA 1E3WB 1VIVA 2C3PA 4IIGA 3ABSB 3WY9A 3IJEB 4M76B 1LU9A 3LE8A 1O9BA 4D0RA 1PJ2A 1SPXA 4PO8A 2RK4A 1VKZA 2GHIA 4I9NA 3RUEA 1Y6ZA 1D5CA 4NQRA 3OFSA 4FYPA 1U8TA 4ITVA 2V7QD 1RADA 4IG4A 4TMXA 4F4IA 4ZTZB 3KPJA 3DMTC 2O7QA 1CZNA 3JXEA 4NU8X 4YUZA 2BM1A 1PT9A 1T36B 1YTLA 3A0UA 4JBNA 3R7NA 1PHRA 2IL1A 3HWWA 1RYNA 2JZNA 2Z4SA 3F46A 2ZRGA 5EGSA 1GQQA 5E1OA 1PRYA 1H3EA 2D1SA 4MVWA 3H05A 4O2BF 5EWMB 4WOBA 2XOKA 4ZOLB 3UXYA 3ZCQA 4D26A 3GLGE 1Y9DA 4DYVA 3G02A 1IIRA 1Q7EA 2NVWA 3OZTA 3PJRA 3OECA 4D81A 1BWSA 3OTHA 2Q1YA 1PFGA 1N9GA 2FXVA 2ZJAA 3N2EA 1YGYA 2PAAA 4V0LA 1X87A 4DC1A 5CLHA 4OSOA 4ILEA 3CLUD 1XHLA 2GKOA 1XKLA 3DDUA 4I1IA 3GD5A 1XTRA 4R5HA 1DIBA 4E5PA 3F78A 1E0DA 4QHTA 4TV8F 4KNYA 1PZNA 1WULS 2HPHA 1YB5A 2B8TA 5E9QA 5EN4A 5KNDH 4G9BA 1M2KA 2DH5A 2CXSA 4ZYTA 5JH7F 2QSJA 2WWGA 3H9BA 1MHPA 3HPQA 1JIQA 3LG2A 5BSMA 3TTWA 1WS6A 3PIDA 3BCSA 4A8JC 1U9CA 4CM9A 1UBLS 2AC7A 3RNOA 4KUEA 2PH3A 4A8JB 1LRLA 1N34B 4CLRB 2WM2A 1ZGGA 2IPAB 3JASB 2R751 5JROA 4UHDA 3S81A 1FJGB 2IY9A 4BB0A 2O5EA 3MIZA 4TXJA 221PA 3RYHB 3FCXA 5KJCA 4MUYA 5CLLA 4BIIA 5CFMA 3C7KA 3R3YA 4BWYA 3PGVA 2QT0A 2IYUA 3T7JA 4GDFA 5DM4A 1RABA 1RPTA 1SCUB 3KJIA 1AKMA 1NGSA 3AFMA 3PSAA 3TOSA 3QI7A 3W90A 4AKSA 2PKQP 4MCAA 2C3OA 4FT4A 2GUGA 1U7ZA 2H7YA 1BW9B 1NSTA 2PGJA 3ILXA 4PZAA 4Q16A 3TI9A 4DY4A 2OKGA 2D2XA 2OL4A 3MCTA 3GFBA 4TZ0A 2XA1A 3R3SA 1SUFA 2X0FA 2NV2B 2QUKA 4XX0A 1CULC 1JR4A 3FI9A 2C4VA 1PV4A 2WWRA 2QLBA 2A9JA 4XD7A 4ER7A 3FBTA 2DR2A 2X7JA 3VO8A 1TYZA 2R60A 1BCSB 3IVXA 2E89A 3R3UA 3BWEA 4MWBA 5CH8A 4C76A 1E2PA 4N5MA 3WYAA 1RR6A 2OPHA 1CG6A 1Z74A 4EY4A 1GCIA 3LVQE 4MPDA 4WXEA 3FPKA 3EXIB 2CYCA 3AR7A 2MYNA 1EHYA 2O2IA 2OVFA 1U3TA 5JCPA 2P67A 3ZQ6A 1EJ2A 1Z0JA 2FWIA 3CEPB 3QEMA 1YB7A 3ZXIA 5CDUA 1WMDA 3U4QB 4FMCB 5CT6A 1KR5A 4HFJA 1I10A 1IK6A 5H3CA 2Q50A 5GGYA 4WN9A 2EL7A 5ITZB 4Q21A 4PG5A 4GSLA 1RWNA 3AUFA 3FMFA 1EXWA 4O8CA 3WKAA 4HH3C 4P4GA 3ZR4B 3RASA 4MQEA 3DZCA 2KE5A 3C98A 4IHJB 4D3YA 2YZKA 2BMJA 2ZBUA 4N6NA 4F8YA 3EHEA 4F0JA 1A9TA 2DAPA 3NMUF 3MWDA 1U1DA 5TS3A 1E5XA 1E1QA 4WK6A 1YAJA 5AWFC 3ECAA 4LYGA 3CZRA 4KB5A 3RVBA 3ZG6A 1UPAA 4R2IA 2BP7A 4HZUA 5TGTA 1L5MA 3VSAA 4EK9A 4UQLA 4YP1A 3UKJA 1QCDA 2H92A 2I2WA 4CM5A 1T3LA 4B40A 1W1UA 3TXXA 4MV1A 3WGKA 2Q8NA 5K9ZA 2W0SA 1RXEA 3CSSA 2HA5A 5HGJA 3ANSA 3UC5A 3G2IA 2BFMA 1ECJA 1JJVA 2XEXA 3WBKA 2Q29A 4TL9A 1WEHA 3AQ4A 3HI4A 1FE8A 3DS8A 1UXGA 1JHPA 3U7QB 2X0RA 4J9UE 4FGSA 3VI3B 5I4BA 3F6PA 1GA4A 3FDFA 3CKLA 3FWYA 5ESWA 3MLAA 1GQSA 2B9VA 1MRZA 1VLZA 3AUKA 3DC2A 2WUDA 4M0KA 4EYKA 4Q7QA 2VK2A 5IM4A 3EFBA 1SVSA 5F9MA 1Q7BA 2ZUDA 4QUHA 2X86A 1WB9A 2GD2A 2QVYX 1P72A 2HJSA 3ENNA 2Z2XA 4PGFA 2YWBA 4WXHA 3QXHA 2W2KB 2VN8A 2O19A 1XZKA 4K0RA 1UC9A 3O0DA 1FQKA 4JL5A 1VHWA 4LEIA 4OTZA 4RPJA 2P65A 3FROA 1JFFB 1NUSA 2ZK7A 5JSYA 1M75A 2HMAA 3DYIA 5LU9A 4RPKA 2XDQB 2AR9A 3PPYA 3T4EA 1PI3A 2I91A 1PUXA 2EZ8A 5I4IA 3QWBA 1KMIY 4S1TA 3QUBA 1Z2PX 3IVRA 3C1UA 5HIAA 1MW8X 4WJZA 1KXJA 3E82A 3TNFA 1NY6A 2M9MA 1N1EA 4EJFA 2ZATA 3WIOA 5A5FA 5JZVA 2IGBA 2RBGA 2C9YA 2MINB 1HYQA 4N6GA 3KO8A 2SCUB 4RD3A 3BE4A 5J2TB 2BRUC 3SFZA 3KSZO 4FGUA 4MXDA 4X91A 2O8DB 4QDZA 4UUOA 3W8DA 4WOKA 8OHMA 4G01B 2ODEA 4K2HA 1QGED 1V8OA 1Z07A 3OUUA 2WIGA 2JC3A 3EIQA 4E5MA 5FO0A 3OX3A 3A9RA 3CEAA 1LH0A 3KSAC 4HDKB 1FB5A 2VJOA 3FFWA 4NX2A 5TARA 4TQ9A 5JEEA 1N6HA 5LD2B 3DLTA 3VPSA 4JEIA 4CMIB 1LLUA 2AZ4A 2WVJA 2FSHA 4R1MA 1JUDA 3C3EA 1XNQB 3L6RA 5JD4A 1X6VA 3GNQA 3IAM6 3WYGA 1XYGA 1AUXA 3PVCA 4PHFA 1W36C 5JSHA 1UBTS 1MNQA 4QYXA 2VJMB 2QRPA 1E1LA 1EVZA 2FCRA 3QJGA 3REOA 1I7SB 1EZZA 3FX2A 2ZRQA 4GYWA 5T3YA 1JPUA 5CB4A 5ELXA 3AI1A 3EC7A 1T9GR 3BXXA 4L8FA 2F8SA 3E81A 4NZZA 2N46A 1W75A 3OMWA 5E4TA 2FQYA 3H9JA 3E9DA 5C8YF 1N6PA 3GOHA 4WECA 4YO8A 2QBYB 4RJJA 3WWZA 1N8SA 1H5UA 4U02A 1FTNA 2R8OA 4LN1A 2F1KA 3GXOA 4EKIA 4XUDA 1DRJA 1FA9A 4DCNA 5EJ4A 2ZR9A 2Y92A 3LQFA 1LV8A 2XCTB 4YMSA 2Q2QA 4JBIA 2QTLA 2VDVE 1EX7A 2RHBA 2ZBRA 3EIUA 4RWZA 1BG6A 4Y1RA 1T3TA 5CDFA 4L76A 5AI5A 2J8ZA 4ZP1A 4UCXA 2Z08A 1DJNA 2G0NA 3GBSA 1EFVB 2WTNA 1UKBA 1USGA 2X9NA 2QS9A 2DKOA 1WMSA 4JYZA 4I99A 2IZ7A 2K2WA 2A6PA 5KYKA 3EHDA 1ARZA 1Y4ZA 4LVOA 4MRAA 3PDUA 1NXPA 2XT6A 3BILA 3VMMA 2XRMA 4YJHA 5ICSA 1SELA 3DE3X 1FPQA 3VR5A 3ER6A 4PN7A 5JNVA 2J3HA 4WV3A 2VSOA 3IPXA 4XXHA 1LDBA 4DMGA 3FNBA 3E1GA 1A9XA 1F2TB 3ZVKA 1EWVA 1J09A 3LPNA 4QGAA 4M88A 1VCHA 4ZODA 4YXWD 4I1PA 3ANLA 3O4RA 4NPHA 4BL5A 2W93A 4FS8A 1QQ6A 3HCPA 2LW7A 3QFTA 4WK2B 5H16A 4KFCA 5JADA 2BLLA 2RGNA 4PPNA 4XSGA 1RJEA 1MC4A 1XTVA 1XZQA 3ZHRA 1WSDA 2YYSA 2ZSAA 3PTAA 5THQA 1UMBA 4OOEA 5K45A 2X76A 3SDSA 4BO4A 1MORA 4M2LA 4MV8A 1CUZA 1OY1A 2B4KA 3H2HA 3A6LA 2IS6A 3GARA 1DFIA 4UNPA 1UBCA 2VF8A 3F7MA 4H1VA 2W2QA 3GAAA 5SICE 4BNGA 4L5YA 1G0OA 1ZBQA 3GX1A 3ORHA 3M4XA 3RIEA 4AC9A 4DNQA 4X1KA 4PC7A 2SNIE 3MCZA 3ZHUA 3NWEA 2XOKD 1CUEA 4AKGA 3HCBA 1M1NB 1PX0A 1KL7A 3A3OA 4O2LA 3IDFA 2QMEA 1GG8A 3HM2A 1A4XA 1YZTA 1Z2AA 3STVA 1SU8A 1PDVA 5F12A 3QVXA 2PZKA 5AKLA 4QARA 2WIFA 4IP0A 4MS1B 3DYBA 4HNRA 5CFNA 1P7WA 5AHXA 3PX3A 1GU7A 3EDCA 3DHYA 4RVSA 4D8TA 3ZZTA 2GZ2A 5EUMA 1X14A 5FPQA 3GEBA 1TYDE 3IBYA 3U4HA 2O48X 3CLRC 3ZIUA 5IX8A 2RGXA 1O8CA 1UMKA 4BVLA 2HC9A 5FUXA 1Z06A 3SEFA 2OHHA 4M1ZA 2OD2A 2XNCA 5AQ1A 1RXVA 4OYHA 4XSVA 2DFLA 4O4JA 3FSJX 3EXAA 1L4UA 1FEZA 3I9V6 3JSAA 1JSCA 3UG6A 3WLSA 3NEAA 3EFOA 3BGSA 1I0IA 5ILGA 3G0BA 1WDTA 3LWNA 4J94A 2J45A 4L5JA 4RA9B 5CB4F 5LQMA 2VSQA 2W22A 5I7AA 3TCXB 2F6RA 4H7JA 4LYAA 3TRKA 4JL8A 3D3WA 3QQPA 2P4EA 1E4YA 4P7KA 2BZ1A 2BUAA 5JNSA 2FQWA 4ACBA 4HNGA 3HN6A 1JIUA 5BUSA 1WXGA 1GZUA 5IF3A 5IKXA 5B1YA 2WT8A 1HE4A 4ZAYA 1JLLB 3DGEC 1C4WA 4GZ3A 5SZKB 2UYOA 2Y8EA 1ESCA 3ADKA 4MWGA 4F3TA 3HVKA 3H9GA 1AHHA 4YEDA 4ACAA 4X93A 2H59A 1UAGA 3FOBA 3NORA 1KVTA 1I32A 4HB3A 4O5OA 2OHFA 2QN3A 4BNKA 1ZN8A 4ZPJA 1P4SA 2A3RA 4BGDA 1GV0A 1SC6A 2X58A 3CNBA 4LJLA 2AZDA 1DJQA 2I2BA 2CV1A 4CQLA 2BMEA 3CKMA 2FHSA 1TM1E 1TM4E 5M2QA 2XCIA 1WSWA 4LY9A 4H3HB 1SOWA 4PHCA 4AS2A 4EPRA 2XE6A 2R6CA 2IP1A 2RC5A 2ZYVX 4MHOA 1Y8CA 1G2IA 3C39A 4FGZA 4WQMA 4X00A 4MYDA 2BUCA 2POQX 4ISBA 1EUCB 4K81B 3LKVA 1P1HA 4QDOA 4YP7A 3SS7X 4BX2A 3S8EA 2UZ1A 1AZTA 1GXSA 1W47A 3ONDA 4GMHA 4K88A 1EH5A 2IGTA 4ZKEA 1NQAO 2HBQA 1SXJC 2IA5A 2VLIA 5JFOA 3EQ2A 5HBRA 4YK7A 1ZD1A 1MPTA 1Z0FA 2R97A 1D7AA 3PPIA 3Q7TA 5TQ2B 3I76A 5JSZA 4ESOA 1I0LA 4HRVA 3RRXA 4XJTA 3VH4A 3WK6A 2C99A 4ZEWA 1UFOA 3RAGA 1IPFA 1J56A 3M3DA 3INNA 4R8MA 2HBRA 3UYLA 3JASA 1U28C 3WGQA 1HKUA 3WDSA 4JK3A 3K1YA 4YJ2F 1SXJA 5KJEA 4HV4A 1WZ2A 3OOYA 4FHGA 3HCFA 3S2IA 2XA9A 4X5OA 3FFBA 2X5JO 1RZ3A 3I01M 4OQZA 3DZ8A 3B3AA 2G9ZA 4YDHB 3T9FA 2XEDA 3Q4GA 4BKRA 5DM1A 2DFDA 2Z83A 2HSWA 2HSJA 4JLAA 3HPRA 1IK4A 2HA0A 1X15A 4FI3F 4LE2A 3ANXA 1ECBA 4J1SA 4YFYA 2GRUA 16PKA 3FZQA 2GLXA 2IH2A 3IIEA 1RZUA 4QGGA 4GPBA 3LH5A 5FOWA 3IQWA 5FPSA 1YBAA 3VHXB 3SM9A 5IKPA 4JXZA 2YFYA 2QM3A 5H9WA 2B0JA 2OZKA 3GLUA 3P9YA 5T3UA 3TXYA 4JZKA 4BBPA 4CEJB 1UH5A 5BT8A 1RM4A 1AZWA 4L08A 3B13B 3HR8A 4RTNA 2ZFUA 1GZVA 4TWJA 3MJDA 1IXZA 1G3MA 1CUJA 2GTHA 5I9IA 2GVZC 3GF4A 3HI6A 1M83A 1DUVG 1EE9A 4LVCA 3BS4A 1UZMA 4KLCA 3O26A 1HKHA 2CXQA 2NXJA 2V5AA 4GOXA 4MH0R 4PYNA 4BXOA 2FUNB 3DOCA 1R3UA 3A4MA 3VPXA 1T8UA 1TJYA 2ZE5A 3KYDA 4NAHA 4N39A 1EUQA 2MSLA 2VTBA 3DM5A 1TQ4A 4R7GA 4XRGA 1QH8B 4XEUA 2HRBA 2OBNA 4YR7A 3GGJA 2X8AA 1FYWA 2R11A 1JU4A 3V7YA 3N6XA 3TPFA 2C58A 2HPVA 3UV3A 3V1MA 1G3RA 4M36A 2VNHA 1FS5A 4JYMA 3K92A 1IEQA 3CEHA 5FNVF 4PPQA 1LDYA 1Y1RA 1ITZA 3PQ6A 1BWPA 2WE7A 1GZ4A 1RRPA 3EDRA 3IUJA 1VGVA 1BGXT 2H4JA 2AQKA 2YHAA 5EMJA 5JSKA 3HVIA 3S99A 4J0FA 5BVGB 1RKUA 4LAFA 1R5NA 2QSZA 3BB1A 2DWPA 4JOBA 5LXTB 2V7UA 4DOMA 3DAYA 3H8VA 2DLDA 4RQTA 3QVGB 2G09A 2P9QA 1VSTA 3H9UA 3QW4B 1FMCA 2P9BA 2XUKA 4HPJB 3KHKA 4XQEA 3I28A 4HLQB 1E20A 4V3BA 4BFTA 3EJ6A 1EXNA 3LTNC 1UXKA 1EAYA 3WK9A 4ZIRA 1K5HA 4J8PA 4G6ZA 3O6VA 5KWJA 5EPOA 2PIDA 4HDQB 5ENDA 1NBMA 3TZKA 5JXJA 2WSYB 3RFVA 1XJWA 1YFLA 4YMVA 4G5GA 1NV8A 2JCXA 3LUPA 4KTVE 4CHGA 4K6HA 2I2DA 1VJ0A 5KNDD 4ND8B 1S2LA 1XDGA 1QFMA 3GJZA 1OXXK 1ULTA 2G40A 2Z04A 3NDIA 4PR0A 3B9BA 1BS9A 2GNAA 4FR0A 4PLGA 4YRLA 5KO2A 4C7KA 2G06A 4B44A 1UFKA 2AUNA 3IBTA 2H52A 3KC2A 5CXQA 3A7DA 4GNKA 3IKJA 2ZGVA 1X7YB 2UZAA 2VDKB 3P8ZA 4WXRA 3RK4A 4ARZA 4AKHA 3DP7A 3NP9A 5IAAA 2A5JA 4XM1A 4YI5A 2WQZA 3DZBA 4DV4B 1E79A 4DA9A 4KQ6A 3B3FA 3ITEA 1NMZA 5TMEA 1S8OA 2CUZA 2Q1TA 4IIJA 2CE2X 3B6IA 2CFSA 4Q3BA 2BISA 4PAOA 1U31A 5TF4A 1RZRA 5KTKA 4J7CA 2ZSEA 5DWQA 5CA0A 1RXSA 4I9UA 4OXRA 3ZN2A 1NF9A 2YC2C 4FGJA 5FPHA 1VL1A 3ELYA 2VPQA 2XQFA 4QLBA 2KJQA 1VKRA 2IUTA 1YZKA 4BFCA 2AE1A 2FUG6 5M34A 1SCUA 2BH9A 5HBGA 1UOEA 1NNLA 1YS7A 2XDWA 4II2A 4CN8A 3AL2A 4JY7A 5DFAA 1P2TA 2RGGA 5JEDA 5J1SB 4G0UA 1TM5E 3B8HA 1LQUA 3V32A 2BFAA 2AOUA 3U7IA 4D57A 1C81A 4JSYA 2WSIA 2W6OA 3IJPA 2R4UA 2CVFA 4HN4B 4MS3A 4NH0A 3QGMA 3T7AA 4YMWA 2NTYC 3KD2A 2DUJA 3HA2A 3Q3VA 4IV8A 4EAQA 1FW8A 3GBPA 4G3XA 3RO7A 4KLAA 3IE2A 1DXOA 1JJBA 1LPSA 4M89A 3HJHA 3MS7A 1C5KA 1QU2A 4IQGA 4MW7A 3F6EX 1QP4A 2D2EA 3KELA 1UMCB 1NXQA 1H0HA 1SXQA 4NXNB 2GNOA 3GJTA 3MUNA 3RHSA 3VU9A 1CY6A 4FMPA 5DGTA 4F4UA 1OGYA 4G4IA 3F4BA 5K20A 1F4VA 1H9AA 1MT0A 1R8SA 1TO2E 1E2GA 2YUIA 1EM6A 3KP1A 4IMPA 4JT8A 4Y6RA 2PX4A 3VTKA 1LX7A 3B9PA 3TS1A 2XUPA 1U2DA 3IR7A 4DM7A 4Z4HA 2QGZA 1U63A 1UPCA 2JKYA 2ZXFA 3ZNPA 2O2XA 1B26A 3VR1A 2GERA 2O3UA 2R4TA 1NXWA 3KCQA 5JQGF 3S8YA 3K4HA 2B4RO 3P2YA 3CEMA 4U0JA 4B17A 1TA9A 4LKRA 1BROA 2GGSA 1VBMA 3MA0A 2B0CA 4O2AB 1FLNA 3UEOA 4K2AA 4E03A 2IYRA 2ZIUB 1CQJA 2W6IA 2O7SA 2Y1WA 2CL0X 1W6RA 3JATA 5IUNC 5F3WB 1ZR4A 1CF9A 1WXHA 2HPZA 5F1KA 2Z6UA 1W25A 4B4UA 5AW0A 1B15A 4B83A 1KJIA 1M74A 1DTWA 2P9YA 2XD4A 4OL0A 2UUPA 2X8LA 3OE5A 4RD4A 4TS3A 5HW0A 5L4LA 1X8JA 3LSTA 3FZNA 5EMMA 3OH8A 5EWLB 3JD1A 4B87A 3N87A 2H7VA 3K71B 1E69A 2QN7A 3T1TA 1QVAA 3R76A 1X1CA 4MRMA 1XP8A 1YQEA 4G2TA 3EZ7A 4GICA 4GPAA 3EXFA 4JI7B 3R9XA 3BJRA 1LY1A 1JGTA 3FYCA 2C4UA 4MULA 2OC9A 1U2ZA 1YACA 5KNBD 1U02A 3PEFA 1XP5A 4FQ7A 1KYZA 4C2TA 1U0NA 3AM1A 2QENA 3M5CA 3Q10A 1MO2A 1VHJA 2DUMA 5IAJA 1KVQA 3ROGA 1E58A 1H4VB 3ZQUA 1P18A 3B5IA 4XUCA 4D4KA 5KAMA 2PUWA 1B6TA 2RDMA 4ND8A 3WBBA 1P5FA 3MTAA 4ZVMA 1LBSA 4FFWA 3UUGA 1V0JA 5HJ2A 5AW5A 4W8OA 1MBZA 1OE0A 3MUFA 3P94A 4G65A 1K1EA 2CLCX 2OV1A 1CY7A 3A1TA 4MAFA 3H0EA 4TRRA 2IP2A 4MV5A 4B6RA 3W5HA 4QXQA 1NT2A 1G8JA 2FSPA 2XXJA 1YCHA 3QMMA 4WKGA 1MZVA 5CYOA 4NFSA 2OCDA 4YRKA 1T8TA 4C7BA 1HDOA 4AECA 4ZT6A 1QCYA 1L7BA 4MZXA 4Y6QA 4QFMA 3UHFA 4YASA 2H07A 2P6PA 1I2CA 4UEJA 4TPKA 1UZUA 3KUDA 5D1HA 1OHHA 2ZKIA 1U7UA 2PL3A 4Q4HA 1NDQA 4JQSA 1GVNB 5JS8A 5KSYA 1NVBA 4OG2A 4YRCA 3W3AH 1CETA 5BQPA 2PWZA 3WRYC 3FCCA 5LIPA 3V33A 4Q3AA 2CZQA 3R7WA 3VR2D 2XYRA 1XCGB 3DWFA 3DZIA 1QV7A 2C2MA 3SFVA 5JLAA 5BVHB 2DTXA 5LM3A 1AJEA 1GG5A 1RI2A 3DL4A 4TN5A 1AQYA 2VTKA 1YUMA 2G4CA 4ID9A 5CH5A 5HCNA 4RORA 1WZUA 4X0EA 5EJIA 2EL9A 1YNOA 4CEHB 3MBIA 3MRXA 2O59A 4OQFA 2XNKA 4QQNA 1UP6A 3OJOA 1NNSA 3NP7A 1J1ZA 1MOZA 5FBLB 4BZZA 1J2JA 1JJFA 3ETLA 5K3DA 3DLBA 3W8RA 4YV1A 5ADUS 2CL6X 5JS2A 2GF9A 4MR8A 4F91B 4FDLA 2PQMA 3AX6A 1S7CA 3DW3X 3LYLA 5ERXA 2CJFA 3K0CA 5I3ZA 5KQLA 4F4HA 1UODA 1G9XA 4MUEA 3QVOA 4RACA 2RHWA 3VPGA 4Z0TA 5SZJA 4YMTA 1GR0A 2OK8A 4Z1MA 3OZ7A 1TCBA 4WZZA 3T3DA 2J5KA 1FFAA 3LS2A 4KHZA 3D5EA 4B74A 2BI7A 1UEIA 3UMGA 2AMLA 4RM3A 1KSFX 3NDRA 1OLUA 2J0UA 3HNRA 1RHRA 2DSTA 5C0OE 1DJPA 3VZSA 2V9PA 2SKDA 3KR0A 1C9YA 3LQ4A 4DLAA 3GJ7A 1K88A 1K7CA 4GQAA 5E6SA 1M1ZA 4HBGA 4PX5A 5I4CA 2HAEA 4QELA 2QW1A 4YJGA 1Y6QA 3D59A 4FR5A 1JTFA 3IULA 4NENB 5DISB 4YN3A 1E3IA 3W5BA 2XGJA 4TWRA 4M0LA 3C6MA 2C2YA 4G0PA 3WYNA 1JXAA 1I5EA 4HVAA 2ZRNA 4IW3B 4JBYA 4S1OA 3EEOA 3CPSA 1NRWA 2YQ5A 2IX3A 1L5WA 5DE3A 4O33A 4YJ3F 1G8MA 2FPUA 2VL7A 4F9FA 2NAPA 1DKUA 3QBDA 4HLCA 1JLSA 2CXOA 3VR5D 1NI4B 3TB4A 1R0RE 1IEVA 2JBWA 4QREA 1AURA 3KWMA 1MAWA 3EEIA 2ZPUA 1IBCA 3TAXA 3L9XA 2KSQA 3OLCX 4EATA 2L82A 2NU7B 1IU9A 2G72A 2PRJA 4AJIA 4U6QA 1J8VA 4G5FA 1AU9A 4W82A 1JMYA 4MYRA 1JT9A 5HG0A 1RRGA 5ECWA 1DV2A 4GHWA 4KXMA 3EVGA 2Z43A 3MTBA 4X1IA 3AB7A 1NVKA 2AFIA 2POCA 4JENA 5DW3A 2F3SA 5E1BA 3RBVA 3RVLA 3VSDA 1GFZA 1PZFA 5KU1A 5CT8A 4S24A 3EARA 4BZPA 1D9ZA 4N65A 3LJKA 1JFLA 1SR8A 3CONA 2X4GA 4CL8A 1DBIA 5E6UA 3QUQA 1LSUA 1GSHA 3I6MA 1JG3A 2RIPA 1J25A 1R2QA 3ESRA 5FQOA 3F47A 1K63A 4L6CA 4DVGA 2GN0A 5TDHA 4NFYA 4D3FA 3G7NA 2I3AA 3MWFA 1D2CA 3WLFA 1VG0B 1K06A 1MH9A 3M6AA 3KVVA 4FHZA 2UZ0A 3RHZA 4LDQA 1Y6RA 3BGWA 4KQWA 1U9YA 3BFJA 4DUGA 1T0IA 3K6SB 1GEGA 4N82A 2AC2A 1O7JA 5THKA 5A4FS 1FDOA 5HZHA 2OO5C 1H6BA 3ANNA 3DBRA 3GWZA 3G0GA 5KPDA 2PKRA 3C5VA 4KI7A 4TUYB 1ZJ5A 2AJ8A 1AUPA 4IV5A 5LZ4A 3RWBA 2R25B 4V0QA 1QKJA 1SRQA 4PVDA 3IUBA 4HQNA 4BCCA 4F92B 4LXHA 2G7ZA 2QYHA 3TE6A 4ZAGA 4GBED 2GCGA 3GP3A 4HY3A 3JQ9A 4QDTA 1MXFA 2EZ9A 4FMBB 1XF9A 5LZ2A 2YXEA 1U2GA 5AW6A 1F0NA 2OCLA 2YHIB 4U8GA 1C7QA 2J6CA 3HDVA 3D6AA 3LX6A 1B0PA 4HJXA 3SF8A 4UUPA 2XHEA 3W4IA 4ARBA 4KMSA 5FLYA 4KC0A 4HS9A 3DVRX 2NXCA 4PO1A 4XIIA 2X5KO 1ODKA 3WC4A 3ZYCA 3LECA 3O8RA 2BEUB 1AK2A 4RJ2A 1NJGA 1RLUA 5TB5A 3ZVMA 3VPFA 3DMYA 1UZNA 2XMGA 5C80A 3PQCA 3RYFB 3BF8A 1O6ZA 4GI1A 2XUOA 4GOMD 1X7DA 1K0UA 1ZSVA 3GJ5A 3KEGA 2IYZA 4HH0A 4NJEA 3SZGA 1H2HA 3PIRA 3VU8A 4ZYZA 2V4MA 2FEMA 2NU9A 1QWSA 4M55A 1WE2A 3BL8A 5IMBA 2JFFA 1KY5A 5E2AA 3GD7A 4B3SB 4BN0A 3PNVA 2JI9A 3D0RA 4BFLA 3HB4X 4C07A 1PJQA 1Z08A 2V6MA 3P9CA 4ZIRB 1DE0A 1E4OA 1PF7E 2A9RA 3HSSA 4DDHA 1WF3A 1XMSA 1U3CA 1A8HA 1MKYA 2VG8A 3AP3A 4A91A 3OCXA 5KCZA 1ZMOA 3L7YA 4KQEA 4BBJA 2WIAA 4G84A 3BQMB 5LOVA 3QEKA 2GILA 3GVHA 3WAJA 1NVVQ 2JIBA 2P0YA 1HLFA 2Q2VA 2R8XA 2PRZA 1Q7CA 4MVJI 4MQ5A 3GR6A 4YBRA 3WRVA 4OLJA 1AK1A 2D4AA 2P5TB 5DYYA 3B12A 5FA5A 4ERXA 2AMVA 2BONA 2AQ8A 2WT4A 3VR4H 4JJAA 4BNHA 3HJTA 4RVDA 2Q9AA 3IVCA 3HBFA 1SB8A 5D6OA 1ZGCA 1UM8A 2P75A 2VTVA 2YHIA 2BCJQ 1G19A 1I1NA 1V2HE 1LB1B 3EEYA 4G56A 3BH7A 3A3NA 5B53A 5TJHA 5COAA 1E89A 1EDOA 3A6HA 3TPCA 3UAGA 5DLEA 4E0BA 5L53A 2Q5JA 2I71A 3JQ7A 4YGYA 3A9TA 4RIIA 5GM1A 3ZV3A 1P4HA 4DNOA 4ZHQA 1F8GA 2JHAA 2DKNA 4QU8A 4G0YA 4QXAA 5B1SA 3H11A 5IUKC 3PA8A 3CO5A 1DBWA 5E3JA 4K0KB 4W7SA 4N12A 1FX1A 2YIVX 1VZ2A 4AKTA 5DNUA 1YJ8A 1HWYA 4D4HA 2QMOA 2H00A 4HAZA 2V6GA 2ZANA 3MC1A 2CVQA 1ZGJA 2WINI 1RRMA 3TGLA 3MN1A 2IHTA 2QMZA 3PYXA 3GQBB 5FCDA 1XNRB 3A2LA 1XTUA 2NYVA 3MWKA 3DTVD 4RMIA 5DHPA 2IUFA 1TRKA 1EHIA 2CJXA 2HSGA 2ZWMA 1Q7TA 4MCIA 4DBZA 5FI1B 3VR4A 5CU7A 2OQIA 4FDTA 1JL3A 1BX1A 1G18A 4ZCSA 4KPFC 3TKAA 5BW6B 2Z8ZA 2C0PA 2XNHA 3BN3A 1O08A 1FDSA 1TJNA 2HO4A 4HUQA 4X44A 1M0SA 2G25A 5EIWA 3CRW1 4R8LA 2FMKA 3WP1B 1THMA 1UMCA 2CC2A 4ONEA 5DNYB 4H3VA 2F64A 3K35A 1ZNQO 3LIPA 2BEVA 4G41A 3ENWA 1IWPB 5EZYF 5DULA 1A2OA 1VJRA 1J0EA 2Y2VA 2DE0X 2Y77A 3ZXXA 4CEHA 3VR6H 2F3TA 2DBQA 1E6UA 2CD7A 3SZUA 4EDFA 2P0AA 5C1IA 4EKEA 2XOXA 5C31A 3EVBA 4F85A 1YD7A 5DPMA 3IBGA 3PR3A 1F8FA 1AGYA 1P6XA 3NH6A 4E6PA 1KH2A 3LT2A 1Z62A 2GBCA 3TTVA 4FMDF 3NHAA 4J75A 4JBLA 4LZNA 3ZWDA 1LLQA 2Q5EA 5CJ2A 1LK0A 3BEOA 4W9RA 1KGDA 2IOFA 4KV9A 1U0OC 1SHTX 5C1BA 4RQBA 3T3EA 1VL5A 1ZKMA 2BBWA 2J9FA 1F3OA 1RP1A 1TDJA 2ZDHA 3PDHA 3U3JA 5JQGB 2YCBA 3JQ6A 1C3XA 2P8JA 1YQ9A 5U4XA 2FRDA 4OUKX 2YZ2A 3DCNA 3MQFA 2XGOA 1K3FA 3JYLA 3LUBA 1MEEA 4BVBA 5BMVA 3TDKA 5BSVA 3B51X 4OHPA 2COEA 4ALIA 4AY3A 1TQHA 5AVVA 1M0EA 2CDRA 3ESQA 4MV9A 4QHYA 2V7PA 1SCIA 3AV3A 4ITRC 3QU2A 4QYTA 4DB2A 1R9JA 2YY5A 3HKDB 3LW8A 4ZCIA 3LY7A 3WIBA 1JPNA 3K4PA 4F72A 1L7PA 3CWZA 4JJ7A 4ZVQA 3EF1A 4XJXA 4R8KA 2Z6AA 2XMBA 4JYBA 4UEOA 1LFAA 3SC4A 1L7VC 4D9BA 3UBMA 1ULUA 3KVYA 3LLUA 4UUBA 5FYDA 3OQMA 1D2MA 1HPLA 3TJRA 4LYYA 3FR7A 1C0EA 1DT5A 2XLCA 1VSVA 4ZMRA 2RH4A 3GPLA 3LF1A 4GBJA 3C6YA 3EXEA 3NHUA 3OCZA 5A2GA 4GGMX 4XOIA 5JBNA 1GPH1 5B55A 4F97A 2Q0QA 4Z7QB 2FG7C 4BKPA 3G0IA 4K1LA 1KSGA 1MB0A 4C3UA 1OR8A 4DQVA 2PKYX 5G4LA 3NHYA 1Q50A 4ZN6A 4NE7A 2W7TA 2H2AA 4C4SA 4E5NA 4ZEMA 3LPLA 4W1QA 4EFDA 1UJ4A 2ENWA 2CYBA 1M6WA 2PS1A 4TXLA 2J3JA 1FUIA 2QG4A 1MNAA 3UT0A 2OBXA 3N39C 4TL6A 1GCUA 1JKMA 1PG2A 4MRNA 1N36B 5ALIA 1M1NA 3B6KA 4M9RA 3TDNA 4D3DA 3VA7A 1GAXA 1LKZA 1H1DA 4OQNA 3MOGA 5I7VA 2A9VA 1QVZA 2FN4A 3CZCA 3LUJA 3JVUA 5G1PA 5KVSA 1DQRA 3JWHA 1Y98A 2IEDA 5IRCD 3MXOA 1SUEA 3WIUA 1T1RA 4KR7A 4WXYB 3AZQA 2QE7A 4WCFC 4QLAA 4MEAA 4B8ZA 2QX9A 3KYDB 3I04M 4UUMA 4M0DA 3V8MA 2OCGA 4MZDA 2IITA 2VRNA 2Z4RA 3JYPA 2BZGA 3LDGA 3OUZA 1TZ2A 2HSEA 2QQGA 3QPVA 3Q7RA 3B3QA 1YDMA 1C0LA 3E5RA 3CH7A 3NT2A 1AXGA 2YJ3A 4N5DA 4WA7A 2Q3HA 5DN6D 4ZANA 3SIWA 1QO7A 4X7BA 4K3UA 2C7RA 4RDXA 4NXMB 4LBYA 1VXRA 1RFLA 3TEFA 4FFDA 4XUGB 1R0ZA 4RQAA 4AN0A 1A5ZA 1SQSA 3IOMA 2HSZA 3CNLA 3I4LA 4UVHA 4WFQA 1JG2A 5CGZA 2Z5GA 4KR2A 2CHUA 3NOOA 1IXYA 2CXTA 1JHVA 2UYQA 3ZWWA 1SXPA 4FCVA 3AF6A 2AUMA 2WVAA 1BW9A 2HF2A 1Z36A 1JDJA 1MV5A 5D2CA 2H8KA 2YJGA 2VT2A 3UTCA 2KBEA 3Q9LA 2JVIA 4LWPA 2BHLA 1Q83A 1QLWA 3BTSA 2IZZA 4MUNA 2QRLA 2QV7A 1U6IA 4Y30A 3D7KA 5BSTA 3E8SA 4FHCA 1LQTA 3TX2A 4D96A 5IDYA 2UVPB 3ETGA 2QLMA 3VBEA 1JR2A 2R44A 1KBQA 2VPIA 3GFRA 1G4AE 5K2MA 2ZTVA 4PGGA 3ZVRA 4D9NA 5I7FA 3LUKA 3BORA 3I05A 3A1FA 3O8OA 7GPBA 3DE5X 2ZJOA 4XAQA 2WG1A 4OO3A 3EQ9A 1RYYA 1TGYA 2VNSA 1ZGZA 4HGPA 1RMQA 2FMHA 3HU2A 3OQIA 4K5QA 2NU6A 1ZVMA 2FZ4A 4HNQA 1ZNZA 5LBTA 3OFNA 421PA 1OC4A 1B00A 1MVLA 2H1LA 3RIYA 2PMBA 5CDFE 3HMKA 4XGQA 2O8VA 1E9EA 3RRBA 1KVUA 2YW2A 3NTVA 3L8YA 4B32A 4NDZA 3N1UA 1JHUA 2PU5A 3FOCA 4FEEA 2W70A 1QONA 2DWQA 4MP6A 4CQMA 4QDXA 4C7XA 4YRNA 2RE8A 3TOXA 1Z5VA 1R37A 3F74A 3G7UA 3IAEA 3KZ1E 3M6IA 3MMPA 4YRFA 2YY7A 3K20A 3P7MA 4RXUA 2OV4A 3O8LA 1G5HA 2VPWA 4XFDA 1WZNA 1BFKA 2QK4A 4GU5A 4NJEB 2BHSA 4OCZA 4ZQIA 1PJLA 3TD9A 5LMNB 2FX3A 3GUVA 2OQRA 3MAGA 1MOSA 1EVQA 1XLTA 1XL1A 2GFIA 3KXPA 1OA1A 4II7A 2BP7B 2NM0A 4OPMA 2PUEA 1M7BA 5AVRA 1C4XA 4K6KA 4RYDA 3I0MA 4AZ3B 1HQDA 1HNWB 3SU8A 3IYLW 4E4TA 3I2IA 5A9SB 1P2FA 3F6BX 2GZAA 2XBUA 10MHA 4RYLA 3WB2A 3QKUA 1KZHA 3OC0A 2NPFA 2EZTA 2ZI3A 1K7YA 2WZBA 3BH0A 3TF5A 1L5SA 1VCMA 1JILA 1JLKA 4FSXA 4BV2A 3STWA 3SJBA 1SUAA 4WK0B 5EHIA 2OYCA 1JHXA 3LDAA 3FOAA 2I4TA 1U1CA 3TLGB 1UT5A 4GWLA 3U0BA 3TQHA 1P7ZA 4A6PA 1CLUA 1N2BA 1WX1A 3EW9A 3Q2IA 4C6RA 1S3FA 2BFPA 2YS7A 3LOQA 3A7EA 4HH1A 4RZ3A 4BFSA 3AEKB 4HAYA 2HT1A 4CM3A 1QG2A 3KKZA 1Q77A 2IPNA 3NXSA 3SKXA 5A3JA 2Q6LA 4KU4A 5EA2A 3L1JA 3ERCA 5HZMA 5A5VA 1DDIA 1L7EA 1XG5A 3K96A 4IILA 4LI0A 5E9WA 5G4KA 1ML3A 5D5PA 5FWXA 5SY6A 2JAWA 3RABA 2P62A 1IZZA 4JUFA 3RODA 1QH9A 5ADHA 3REGA 3P9IA 2OCPA 2X0JA 5AJWA 3VR4D 5BSKA 4YCNA 4LFAB 3P52A 3D7SA 4L9WA 5LLDA 1SHZA 3HO1A 3T1QA 3VX3A 2XUGA 5FADA 3IIKA 3DBIA 3PDWA 3U37A 2P27A 1BCRB 1K8ZB 2VYNA 2R6FA 4BTVA 1ID8A 1GA1A 3SYKA 1Z75A 1Q1GA 3ZWQA 2AJTA 4LTNA 4Z4CA 3CVXA 3E48A 1WL8A 4OHKA 2H08A 2VNKA 5JV5A 2I78A 4Q9HA 5DCYA 5FI0B 2F4VB 1C7FA 1PBTA 3QITA 4CDGA 2WHRA 4XWWA 1P17A 4KN6A 3F4KA 1Y4SA 2BC9A 3MJVA 2FWPA 1PQ4A 1SKUA 1ZGHA 2HLDD 3DTTA 3L84A 1W87A 4FZ3A 1RHKA 3OWHA 3NIWA 3T7CA 5K6RA 1BVRA 2CGEA 3L0BA 3MRTA 4L85A 1O03A 4QEKA 2PHZA 1U0RA 4X41A 4ENTA 4JNKA 1KZ1A 4YJ2B 2ZUEA 3COVA 3UK0A 4K9QA 4RTSA 4G9EA 5K0BA 3TZEA 4AROA 2GAFA 1Z4LA 3DUWA 1G8PA 3RK0A 2RGWA 3UK1A 5FRDA 3RT9A 4GRDA 4V0OA 3IP7A 3KQHA 3JAMA 1YBHA 3LF2A 4RABA 4ITUA 4RENA 3BX1A 2NUAA 3R0JA 1VMAA 2ZB2A 2CF5A 2O1SA 3GRPA 1FXSA 4HEHA 1KQGA 2EKQA 3L07A 1HLDA 1BEUB 2F43B 4ECEA 1QYVA 2OM6A 1LF5A 2JJ1D 4FHFA 4MTLA 4NWIA 4IKPA 3G2PA 3HYLA 3UAWA 4BEJA 4WE3A 1DV1A 5KSPA 1NZFA 1DPGA 2PN1A 3ZW9A 1XDSA 3PLAE 5EJAA 1D6SA 1HRDA 3C1TA 4NL4H 1ZD9A 2O2GA 3WIDA 2F8TA 5LJIA 3GG9A 3QWIA 1DXYA 3U3RA 4DQDA 5KYUB 3Q7SA 5HS6A 1Y8QA 3EBLA 3ODGA 1MAUA 3HLKA 4LGMA 4PLTA 1B74A 2B3TA 2ZRCA 2FSFA 5TXGA 5JUWA 4D25A 4R8SA 2VYQA 4BVFA 1D03A 2GSDA 2FLKA 1XVUA 3C3CA 3O4GA 4GOOD 5LKRA 2NN3C 4IJQA 4IWXA 1H85A 5MGBA 1SVNA 5M29A 2G6TA 1J20A 5JASA 1JAZA 2LV8A 2B7LA 2X23A 5C3MA 3W06A 3G85A 4F4JA 3ZDDA 1POXA 1N2EA 2QTAA 1QYDA 4AMGA 4DM4A 3K9LA 1GR1A 1JYSA 4JOQA 3OIUA 1W5FA 3PRKE 4R1UA 5GVRA 3E7DA 3L92A 3WGYA 1N32B 3ZX4A 1QVWA 4AO7A 4UBNA 1HDYA 3KR1A 4X8OA 1FP7A 3D4BA 3T41A 4MQ6A 1YZFA 4DV0B 2FOIA 1SQ0A 2W00A 5K0FA 2F1RA 4MKXA 2QD5A 4I1OA 2KS6A 4EECA 2FE4A 4BNIA 2Z5LA 4RE5A 4JVMA 1BKSB 2D0IA 5C7IO 1CRWG 2ISSD 2PYZA 5CEEA 1AQJA 1ADCA 1SBTA 4H31A 2Y1KA 4GECA 1RCFA 3JAWB 2MR6A 4BAUA 4R7TA 2PKCA 3E9MA 1RAFA 4IHJA 1TI7A 2D06A 5AI9A 1U8AA 2XOEA 1GYQA 1O6BA 2WMYA 2GTIA 4Q9NA 4X1KB 3SLKA 1KRXA 2I6GA 1HMPA 2AXEA 3GHHA 3RC2A 1SUDA 1IN7A 1BHO1 3ZEAA 4FFLA 2X2PA 3CF2A 3U4GA 3USCS 2IH5A 1WCXA 3PS9A 1AB5A 1BGVA 2AQHA 2HMTA 1XK6A 2YYYA 5A6VA 2HQSA 1RPAA 3VSCA 1E6WA 5AJXA 1V45E 3OCUA 2OC4A 2BRUA 3L7OA 4I4NA 4OHMA 2P6MA 4ASUD 1I30A 3PJEA 2I4RA 1O96B 3RSCA 1JDBB 3O47A 5LYJF 3WLRA 2YOHA 4PZZA 1YAHA 3FNRA 1QFZA 5EJFA 1M0WA 1TAUA 5MDHA 5ALJA 2OA0A 5AUOB 1GKIA 1IN4A 3GV0A 5HF6A 1P1IA 5ARDA 1QYRA 5ABPA 4IUYA 1KO7A 4XYBA 2CNWA 1MF7A 4AG3A 3TM5A 4BLSA 1KHHA 5A5GA 1T26A 2WJGA 1MW9X 3NHZA 1WBBA 1A8SA 1XQ6A 1RJ9A 2JCBA 2C3UA 2NADA 3CUWA 2CNKA 3DTVA 1QGAA 3SSNA 4I2NA 1UFRA 2R7AA 3C3BA 3BG5A 4PBRA 2BGJA 5BN3B 4LF9B 3QE9Y 1T4CA 4RFLA 1OH5A 4DMUB 4Y6LA 4Z0NA 1DWOA 4GKAA 4KN9S 2GM3A 2P2GA 3FWPA 3TO5A 2IW3A 3DZFA 3KD3A 1P1RA 3VKVA 1A8UA 1NYTA 1IZ7A 1DIAA 1RKQA 1GTG1 2V0GA 3E5HA 2PVSA 2O2EA 2GJ9A 4OM7A 1UKZA 5JI3E 1JF8A 1B42A 4FYXA 4CLXA 3QA9A 4X71A 4ASUA 4EH1A 2GCOA 3WKCA 4OATA 1TVMA 2QR3A 5JDCC 1QRRA 4LMAA 4TL8A 1M33A 4UM8B 2C4TA 2NO6A 3ETHA 4B1FA 4WZAB 5FLKA 4DCOA 3HB1A 3BK1A 1I5OA 2AN3A 3KTOA 1MVNA 3WJ1A 3ZY5A 1QQ7A 4GVXA 4PZEA 2RBKA 3HL0A 2H2GA 2LCFA 2IYWA 1EUZA 2RD2A 3MUOA 5CD1A 3I53A 3W8FA 4BLWA 2BOVA 3PZRA 5C34B 4R3UC 4UAVA 3FWHA 3NIBA 4PNHA 3ZIAA 2O8CA 4FNOA 2RH8A 3T5TA 5AM3A 1T6XA 4WTOA 2NP7A 1UJCA 3T7DA 1EFRD 3AY7A 3VM6A 2JARA 5K3BA 4Z7OB 1PLKA 2XIQA 4ND7A 2OCYC 1AF7A 4ZCQA 4G2NA 5K7SA 3BQ9A 1KDYA 3ZQKA 4WLVA 1OT3A 2NXEA 4TYYA 3PWKA 5HILA 1ZR2A 3ROMA 1N9ZA 1R66A 3DNPA 1PCXA 3GFOA 3SR0A 2PO5A 5F98A 1NE2A 1ZNXA 3DXFA 4IXMA 1XZ8A 3CR8A 3G2NA 4LHZA 4F4FA 5D3ZA 1Q0RA 2QLTA 4LRSB 4RETA 3K2IA 5AYVA 3VBCA 1WUIS 1C9JA 2Q46A 1IY1A 4LJ9A 1JR6A 1XPUA 1IM2A 2ZSDA 4FFSA 1YI0A 4RV4A 2C9CA 3H2SA 4Y6SA 4AX8A 4OIFA 3L0CA 1B8VA 1AS3A 4XQGA 3TTUA 2RGUA 3SQXA 2AFHE 2C8KA 2WTAA 4ZPXA 4EGJA 1JFVA 4B0PA 4RY9A 2I4NA 2ROQA 3TMAA 3I5AA 1AZSC 3C3PA 4U7PB 2ZI9A 2PMDA 5H02A 3M6WA 5BWCA 4UDOA 6GPBA 5FA6A 1W1WA 4XASA 2PRYA 4NF2A 1S2NA 3QMPA 4YJDA 1P6QA 4LY6A 1JEJA 3H6HA 2C1XA 3MLBA 3N74A 4YMHA 3HNPA 3KBBA 1RRVA 3H1BA 4GXQA 2H8GA 4RELA 5DJ5A 2QRVB 1YASA 1OQAA 3UT6A 5TVGA 3BXPA 3MJEA 3ELUA 3K9FC 4CMGA 1QS0B 1RLMA 3N07A 3NWBA 2VJMA 4HNAB 3EUWA 4FX5A 2CKMA 2YQZA 3R5TA 1YJCA 3H9QA 1EFAA 2OB2A 4FI3C 3V2GA 2QWXA 3LUHA 4DIEA 3NM6B 3P0FA 3A1CA 1A9YA 3D6UA 2G77B 2F8MA 2Q5HA 1N9GB 2I3BA 4JSRA 3UJ9A 1NFFA 4OLHA 1IRXA 3D7MA 3CLSD 1C9KA 1SK9A 3VC7A 2WJWA 1O77A 1FLAA 2H2FA 3AVTA 1TC1A 4KUHA 3WSVA 3QFRA 2X77A 1VB3A 3OSUA 2FPGB 3GZNA 3D6TB 3MMSA 1E3SA 4HJRA 1W4RA 2BBSA 4L72A 1JIXA 4G97A 2XTJA 2QUJA 5LN1A 4TM8A 5ES4B 5MGNA 3RAPR 4MUGA 3EX7C 1E59A 3G8YA 1ADYA 4H27A 1P4JA 5CB0A 3DE4X 1M9NA 4JIGA 4NK5A 5CURA 1QIDA 3R5XA 4HTFB 1Q84A 3E2PA 1TMYA 5DP2A 3ZI7A 1WPGA 4E5VA 4C7VA 3PTLA 4I5EA 4O4JB 3UWDA 1F2UA 1ORDA 1U1FA 1VL2A 2QMYA 3WL5A 4W5WA 5F9FA 1DEXA 2I6QA 3D8SA 2BSAA 5DK6A 3FPCA 1MO5A 3KZMA 2WJAA 4M54A 3G59A 5EGNA 1P7PA 3D31A 1U7XA 2PJUA 3EH2A 4BZXA 2WUVA 1EXVA 5BO5A 2H1FA 1SBCA 3PQ3A 3JZDA 4CL2A 2RK3A 3AVYA 1R0CA 3V8EA 2ZIAA 5KWEA 3ZH9B 3E7XA 1KJJA 4OKIA 4PCLA 1XZNA 1C0PA 1T29A 2JCYA 1S2GA 2RJ3A 4Z4FA 1CX9B 3DNMA 5F1PA 4AWBA 4CTOA 1G291 2ONKA 1SZPA 3PICA 4JI8B 3LL4A 4HDCA 3VJRA 3ELBA 4D9HA 4P53A 5H4GA 1NBAA 3V34A 3BFPA 1W4AA 4YCAA 2JCVA 1DUSA 2RCNA 4LOJA 2CK3D 5A7GA 4B31A 1MAAA 4P0PB 1KEZA 1VE9A 2Q0XA 3KSRA 4MI3A 1QO9A 2YRFA 2EFHB 4CTJA 5C52B 4UUQA 3B2NA 3A6JA 4HCJA 4JJIA 4JGBA 2EX4A 4ZQBA 3LY9A 3M5WA 3I12A 3ELDA 4I9GA 1KWGA 2R7KA 3MINA 5G53C 2CLDX 1R9GA 2QRKA 3QVUA 3ONWA 4ZQGA 2W6JA 5I9SA 3OESA 1A76A 1YR7A 3RB8A 4LZJA 3IILA 2ATEA 2QAIA 5A3SA 1T1SA 3MMXA 3CZ9A 3Q7PA 1CFJA 2B5VA 4YMIA 3LTEA 4WUVA 2GYUA 4MYSA 4ZQCB 5KOYA 2BFDB 3MGBA 3FLMA 3QVVA 4BN5A 1KJWA 3UOAB 4CG3A 1UAYA 1X0VA 1YZVA 2QL7A 3DFFA 3ZTTA 4E22A 1S8AA 4FYVA 1M2VB 1RLIA 2HWXA 4U9IS 3P0RA 3PL5A 5LDGA 4GZ5A 3WL4A 2G9RA 1FP6A 2JGNA 4BB5A 1QQTA 1P5RA 3PT9A 3MT7A 1EGVB 3QUAA 4ND6A 5CP8A 3EAFA 3ZEIA 2FPXA 2IP4A 3FNGA 2R5WA 2P2YA 4G81A 4YROA 2L18A 1NSFA 4WCFB 2FSSA 3B9RA 3UUFA 2H9IA 1KY3A 2Y99A 3WZ2A 4P36A 3IAUA 1P81A 2J5RA 3ZLVA 4GKKB 1GPNA 5TPWB 2CN1A 4YPOA 2XMQA 3MHPA 2HRDA 4LZAA 2ZW9A 3VJKA 2GH1A 1MTOA 1T6BY 4RO0A 4ZAFA 2GRAA 4EG5A 1C7IA 1L4MA 4MIKA 3KPWA 4A0FA 4D79A 4M8LA 1DEAA 3D1VA 1PZXA 4O6VA 4Y2UA 5LBUA 5F76A 4B6GA 4PAWA 2ZJYA 4DIBA 2B8EA 5T4HA 4DMHA 4D56A 4A6XA 1EEHA 5JAOA 1VGRA 3MWJA 3WLJA 5IEJA 2EBFX 4KYIB 2ZUVA 3DO5A 2EQAA 2CDCA 5B7QA 2KM1A 2XUIA 2P9FA 3E3LA 4FNGA 1BIFA 1GNTA 1UZLA 2QY6A 3IVMA 5A9TA 3SOPA 3UMBA 1U11A 4DLSA 1KZ4A 3IQFA 3N75A 5AK6A 4DWOA 5CGQB 4O2AF 2FQQA 4BMZA 4CV0A 3K70C 2MHCA 1OJ7A 2UU9B 5F1YA 3AZPA 3I39X 4W1SA 4ZMBA 1KEEB 1XAGA 3SVLA 5ITVA 4MV4A 2JL1A 2YKGA 3G9UA 3LRXA 4GE0A 1VE3A 1XQWA 2FFBA 4H1HA 3QW2A 4XD7D 5JO9A 3QP9A 4BX0A 1UM9A 3ZW7A 2HQOA 1ZCZA 2DBRA 4D4MA 5LUAA 3OBBA 4V0MA 3MGAA 2FN7A 4JOSA 3MCWA 4DIDA 1QQAA 1ESZA 5HWSA 2REQB 1TUBB 1YFJA 2H51A 3FI0A 1P61B 2EP7A 1Q74A 3UWPA 1M2GA 3PRJA 3V42A 4P4SA 5CB8A 3PKZA 2FRVA 3SC6A 2DY0A 2PMKA 4DSTA 1LJ8A 3CRQA 4OBXA 1WW8A 3A1NA 3OE4A 4R71A 3SHWA 4M9QA 3CRZA 1IONA 4C30A 1RI1A 1MPXA 4AVYA 4IDGA 4E31A 4CGZA 3D3NA 3CM0A 2WT9A 5L45A 1ZM4A 3NC0C 5C5CA 1E9DA 1JSRA 2GI4A 2Q6IA 2X41A 4GFDA 1YJQA 5H83A 3ROPA 1IOZA 1W6UA 1FTSA 3QXCA 2DTEA 3MT0A 4IXNA 1C80A 2CZCA 2RMKA 2Y6UA 3I52A 4M9XA 5L51A 2R86A 1ZOSA 3FBWA 4UCQA 3EVNA 1O0SA 4MVJE 4YDRA 1IOVA 1V48A 3QVLA 4PF1A 2YICA 4JEHA 3KE9A 1EK6A 4Y0NA 4DGQA 4EYGA 3P0JA 2I6FA 2WNHA 1JI0A 3KX2A 5B6IA 2ZAIA 3H18A 3OJCA 3WL8A 2OLJA 1YZNA 5L6LB 2EP5A 3LW7A 5CCDA 1DTSA 3JW8A 1FRQA 4UVGA 1BA2A 4BVGA 2GAAA 1DRKA 3C6XA 3TW4A 3C5CA 2C59A 5EHQA 3TKLA 4EMSA 5LQKA 1G5TA 2BR4A 1HDGO 2ZXEA 3VPAA 3EGOA 2GUWA 3CJTA 2VQ3A 2EC5A 4RF4A 5DOZA 1QHYA 4KNVA 4X1YB 2GHQA 4KWEA 3O3MB 2D2FA 4RLQA 2I62A 3U7RA 3IT2A 1DAHA 1IH8A 5I9TA 3UFBA 3ZZ0A 5AW4A 3DQPA 2R1TA 4G37A 1J99A 5B4VA 2DQKA 2VDWA 5CAEB 5IBRA 2ADOA 3BGDA 4TSRA 4ECAA 1XD2A 2RCYA 3AEYA 2CY0A 5CFQA 5HJ7A 4FHDA 3H4IA 1GARA 1E1CB 1VMIA 1Z15A 4L74A 3AJEA 4YFVA 2E2WA 4BQSA 1YL6A 4WY5A 1B2LA 1QP7A 4XEHA 5GOZA 1GDHA 2A35A 2GZ1A 4HZUB 1EJ0A 1XMVA 1CHNA 2VJYA 4UARA 5IWAB 5HKKD 4YP6A 4HD8A 3RYHA 1ODCA 1BN7A 4YUAA 3F8TA 3ZWOA 4DBLC 1M2OB 5D8DA 1YDHA 2IY7A 2PUAA 1B8NA 2NO1A 3OTWA 4C14A 1TJ5A 1R0YA 3MT8A 1XDBA 3BUSA 4DT1A 2B1JA 4EHFA 4JN6B 4RK7A 1ZU5A 2EJVA 3TW8A 5IHXA 1ZK4A 1EYZA 3DKIA 2ZYIA 4F6CA 1E1RD 1KI6B 2WPDA 2ZJ6A 2JGDA 5E6RB 2VP5A 1IZ9A 4IF4A 3PK0A 3ZDQA 1Q19A 4BNYA 3LLMA 4ZI7A 1VLVA 4AY4A 4BO0A 5JZBA 2D2VA 3D8TA 2HW8A 5LB4A 2IPOA 1I2BA 2HGZA 3L6CA 4N6OA 4CLHA 2EJWA 3PKJA 5JI2E 3ETEA 5ALDA 1QR6A 4HAIA 3NPMA 3UJ7A 5KNDA 1J9EA 4TSFD 5CW1A 4ZZ0A 3DHWC 2AR7A 2JGAA 3GEPA 3DAOA 3DWGA 1QFJA 4B7XA 2VHEA 3MSCA 5SZHB 1CD5A 1KTVA 2VRCD 3I64A 2EFEB 2W2LD 1T8PA 2FG5A 2OV2A 4AT1A 5ARBA 1OFUA 3F7TA 3KKNA 3LBFA 1NFQA 3L4EA 1VG8A 1EDBA 1XCMA 5IJAA 1T5OA 3H16A 1WKVA 4TKUB 1NHGA 3ONNA 4Q3OA 1VLJA 4R1NA 3ZTWA 2J0Q