3H1AA

Crystal structure of este5, was soaked by ethyl alcohol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
296
structure length
296
Chain Sequence
b'AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 104
structure length 296
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1aA00
4G8BA 4Y2XA 1Q83A 3H2GA 5A7FA 1LGYA 1CUXA 5CTAA 1EXWA 2NW6A 2QJWA 2HA5A 4Z49A 5HKBA 3W9BA 4B81A 1LPOA 2ZYHA 1XZJA 4H0CA 1XZEA 1OXMA 2HU5A 1WPRA 1OILA 3CXUA 4Q82A 1CUDA 3ZWQA 3R3WA 4RE6A 3H2JA 3R3ZA 3EF3A 1F6WA 1CUVA 3E0XA 1ZD3A 4LXIA 3IULA 4JEIA 2RONA 4QE3A 2VA9A 4DMFA 3V48A 4CG3A 3FLEA 2QVBA 4YASA 3DL7A 3D4LA 1ODCA 5D6OA 3HLKA 1XLWA 1GXSA 4X97A 4P93A 1ACJA 4UHCA 5IH7A 5D3KA 3OOSA 4MYSA 5HF8A 4B0PA 4M0FA 5LZ5A 3L1JA 1JKMA 2JBWA 4FDMA 2CZQA 2HHAA 2CKMA 3SC2A 2Q0XA 3I28A 2VAXA 3AIKA 4WFIA 1XQVA 5HFAA 1UKCA 1EB9A 4X3CA 2WKWA 1DQYA 3WIOA 2XQFA 1UXOA 1I6WA 1R1DA 2WJ3A 4B80A 1EK2A 4J0CA 5FPQA 1XZAA 4L72A 1W1IA 4MQLA 2EDAA 1R3DA 5DNWA 1K6EA 1XRMA 2XQGA 5HF6A 4M0EA 4Y2RA 1H2WA 1TIBA 5JARA 1CUHA 2CUTA 4P92A 4DNFA 1BCSA 2YXPX 2HM7A 3HZOA 3I6ZA 3V1NA 2ACKA 4C01A 4QLOA 4K6HA 2B20A 2CB9A 3MGAA 2W22A 5AM1A 4B9AA 5IVHA 2WIJA 5FXMA 1ZOIA 3U0VA 4PV7A 4U2CA 4FHZA 4BZWA 3S2ZA 4NMWA 2AJLI 2OGZA 1WHSA 4KACA 5ALFA 2XLBA 3STYA 1HKHA 1VXRA 1BE0A 2WIGA 1MAHA 3KXPA 5ALJA 3STWA 1XRLA 2Z5GA 1H23A 3H18A 4LHEA 3AZQA 1P0QA 2G5TA 4C87A 2J4FA 2WHPB 2K2QB 4W1SA 5KWIA 3GA7A 3K2IA 4HVTA 1NX9A 2ZYIA 4UFPA 3WYDA 5K3FA 4FKBA 4J0GA 3PF9A 4CCWA 5LIPA 1LNSA 1R88A 4CIBA 5FOQA 1THTA 3C6ZA 1ZD2P 5ALUA 1VZ2A 3RARA 5JAPA 3OTQA 2OXEA 4HAIA 1JU4A 2Y6VA 4KJXA 4HS9A 4CIAA 2C4HA 4LKOA 1R9NA 4BVLA 5AKGA 3WK9A 2IIVA 2XQIA 5A7HA 4C88A 1R9MA 3PICA 3ZLTA 2RAUA 1VLQA 1DU4A 3M3DA 4BCBA 2XT0A 1ORWA 3FNBA 3W05A 4X7BA 1M33A 3WI7A 1AURA 4Y2TA 5YASA 1JMYA 4PSCA 2HA2A 1XZFA 3TEJA 3MUOA 5JADA 4MEAA 5K5EA 1K4YA 5CBKA 3LCRA 3EQ7A 3DS8A 4BDSA 3UMJA 1CUGA 4EBBA 4IH4A 3CN9A 1CUWA 4Q05A 3TGLA 4E14A 1BCRA 2OG1A 3ZLVA 3BIXA 2JGLA 2C5FA 1JJIA 2OCKA 1CUEA 1ZGBA 2XI4A 4OB8A 4KAJA 3PDCA 3HABA 1JT2A 3R3YA 3I2JA 2FJ0A 4FMPA 4AZ0A 5EHNA 4HTAA 1TAHA 3KWFA 4OSEA 5JYCA 5F4ZA 1F8UA 1RYYA 1G66A 5HFNA 5E4TA 3WKDA 5AK6A 1HL7A 3GZJA 5LKAA 1XZGA 4X6YA 1THGA 2VQ6A 4H77A 4GWLA 1ACLA 5ALGA 5K3EA 1GGVA 3CCBA 1G42A 5ALLA 1BN7A 4X95A 5CXXA 1CUUA 2WIDA 4Q1VA 4JYMA 3QH4A 5AI5A 4BATA 4IQ4A 4GDMA 1XFDA 2V96A 4YK7A 3STUA 4E15A 4PNZA 3WMRA 3QPDA 5ALDA 3STTA 1J07A 1Y37A 4L3WA 1U4NA 3HRHA 5JD4A 1MTZA 1MX1A 4H7KA 2O2HA 4QLAA 1MN6A 4YX9A 5ALIA 4FFVA 4UUQA 2C58A 1USWA 4PSDA 2DFPA 3D2CA 5JD5A 5ESRA 1GT6A 1VKHA 1C7IA 4FOLA 2XUHA 4GW3A 2RI6A 3B12A 1DTEA 5CT6A 5AKJA 4WDRA 4LXGA 5ALWA 3CCCA 5AI8A 3C8DA 1N1MA 4KAFA 5DYYA 2XUKA 1F0NA 2XMBA 1CUCA 3KOOA 4W9RA 2XUGA 5ALKA 1AUOA 2V9ZA 1DX6A 4P9NA 5HF9A 1DINA 2I78A 1CUJA 3LLCA 5CRIA 1C4XA 3A2MA 2BGRA 4UBNA 4U2GA 4XJVA 2HDWA 1HBJA 1ZJ5A 3UUEA 4ETWA 4G8DA 1YS2X 5C7YA 5DTIA 4ARBA 4U2DA 3WZMA 1O6FA 1VE7A 5JASA 3VJKA 4J0IA 4DSZA 4G9EA 4AXBA 2HA4A 3BJRA 4B85A 2X76A 3WQHA 4EA6A 3WK4A 1WCYA 3IDAA 4EUSA 4KAAA 5A2GA 3M83A 2VJDA 4OYLA 1CUBA 4GEGA 4GECA 1Z68A 1VE6A 2C0QA 1GQSA 4G4JA 1L7QA 3I2HA 1MT3A 2HIHA 5DWDA 2GZRA 4FLEA 4BAZA 1A7UA 1UZAA 3KDAA 2OPHA 1EINA 4X93A 3WKEA 1QE3A 3HYSA 1KU6A 1XLUA 4HXGA 4WY5A 4J0DA 1BEEA 5FPPA 4W1RA 3WK8A 1N5MA 3EBLA 4UHEA 3ANSA 3R3XA 4E11A 1E3QA 4G4GA 2G4LA 2QUBA 4JH0A 3PFBA 3QBJA 3G9TA 2PSHA 2WIKA 4BDTA 3DJYA 1J2EA 3W9UA 5EHXA 3A2LA 4PO3X 3G8YA 4F5ZA 1T4MA 1MPXA 2HL6A 4DGQA 1IUNA 2ZYRA 2WG0A 5FRDA 5E4JA 3STXA 5AM5A 1EVEA 4Y2YA 3FBWA 3IUNA 1G4HA 5LZ7A 1XZDA 3G02A 5HZGA 3ED1A 4FWBA 4GXNA 3T52A 1EA5A 1TCBA 7YASA 5ALSA 4UHFA 1SCQA 3O95A 4H35A 3E1GA 2QMQA 2PM8A 3C87A 1FFDA 3ILSA 4W63A 3OPMA 3QZUA 3OM8A 1QIEA 3PFCA 1ZIXA 5CT9A 1A8QA 1PJAA 1R4ZA 2H9YA 4F0JA 2ZSHA 1XZMA 4BTVA 3I2FA 3FCYA 5LKRA 4P08A 2YYSA 5KBYA 1Q0ZA 2X5XA 5SYNA 5AKZA 4G1FA 5IVDA 5CT8A 3AFIA 3C8HA 2VT7A 1UK9A 3GFFA 3WIBA 1IVYA 2PSDA 1L7RA 1CEXA 3I6MA 2PSEA 1YA8A 2XMZA 3HC7A 4ZXFA 5EIHA 3GROA 3I6YA 5FP0A 5I9IA 1VXOA 2G63A 3ESAA 3G9ZA 3F97A 5ISMA 2PX6A 4BP8A 1O6GA 2DHDA 2JGJA 5JD6A 1ZD4A 4RNCA 1LZLA 4RGYA 1B6GA 4INZA 5BOVA 1CUAA 4PSUA 4ZV9A 1GZ7A 2OAEA 4IH9A 4DNPA 5AM4A 4AN0A 4DMCA 5DYTA 4IHAA 5DNUA 2VATA 2O7VA 1VA4A 5FUMA 3DOHA 4QDOA 4K6GA 2JF0A 1YR2A 1ZIYA 1WOMA 4KYVA 1MU0A 2O7RA 1AKNA 1FFAA 3VISA 5FV4A 4MQMA 1OCEA 3VVLA 3ZV7A 4MXDA 4UBOA 2WUDA 4TGLA 1CQZA 5H3HA 2JEZA 3WWEA 4UPDA 3U1TA 4QNNA 3G0DA 4X6XA 3D59A 4UBIA 5I7UA 4U2BA 4GHWA 3WJ1A 2DSNA 3C5VA 2OCLA 1QFSA 2WHRA 4U2EA 4AO6A 4BBZA 5JAHA 3I2KA 2XMSA 1TCAA 4E46A 1WB4A 2WU4A 1IUPA 4A5SA 1JFRA 5JALA 4AX4A 4ZWNA 2WFLB 3I1IA 2JGMA 4CCYB 2OCIA 1NU6A 1BS9A 1UK8A 3C43A 1MNQA 2DR0A 2XQKA 5SYMA 2DCMA 4TVKA 4Y7DA 4AQDA 5DYWA 1YA4A 1ZI8A 1WB6A 5AK4A 4KE9A 1E8MA 1LBTA 1XZKA 1YCDA 4OU5A 5AP9A 4NZZA 2WUFA 4J0JA 1C7JA 1GKLA 3C6BA 5FDFA 2QR5A 2Z3WA 2Z8XA 1ZD5A 5ALVA 2JGFA 4Y2QA 3C45A 5JIBA 4RPCA 1WM1A 1E8NA 4WY8A 2BKLA 5T4FA 4FNMA 3IURA 4DNQA 3BIWA 4X91A 4Q34A 4G9GA 1XRRA 5LLSA 5ALYA 3RM3A 3FCXA 2CJPA 4JUIA 4QEKA 2JIDA 4MEBA 4AO8A 3KSRA 3PE6A 1ORVA 1FFEA 1KU0A 3G7NA 3HEAA 3JW8A 3AIMA 1N5RA 4FBMA 4AMZA 3LIPA 2GYVA 4MWTA 4I3FA 4CG1A 1Q0RA 1CUIA 3DKRA 4QWWA 1UK6A 4X00A 4BAGA 3V1KA 3HJUA 1GPNA 2JGKA 2CBGA 3WL5A 4X92A 5AKLA 1XLVA 2RIPA 4M0MA 5JZBA 1N8SA 2WG1A 1LBSA 3FVRA 4H7HA 1UKBA 5EHQA 1CUSA 1TK3A 3LP5A 3A6ZA 4H7JA 3I2IA 3H1BA 1DWPA 1QIIA 3EIOA 4N8SA 1FFBA 4EB0A 1YB7A 3ICWA 4CG2A 3WA6A 2HRQA 1AZWA 4N8EA 1GKKA 3I2GA 1XROA 2I3ZA 1FFCA 1EX9A 5D7BA 2GBCA 4CI9A 4HZGA 3TJMA 2C5GA 2QM0A 1XKLA 5FLKA 4I19A 5EGNA 3SX4A 3WK6A 1QIFA 1EB8A 4N5IX 4NS4A 3ESCA 1DT3A 1QTRA 1JMKC 2GBGA 5DJ5A 2BAGA 5DLPA 2JGIA 1AQLA 3N2ZB 3NUZA 4N8DA 2HFJA 4EY8A 4B9EA 3L1IA 2PU7A 5AH0A 3H2IA 1CRLA 2HA7A 4FLFA 2QXUA 2EEPA 2WUGA 3O4HA 2B4KA 5BV7A 5AKKA 3JWEA 2Z8ZA 4FBLA 5D3ZA 4EY6A 4BTLA 2ZSIA 5AOAA 5A7GA 3G9XA 1WB5A 3AUKA 5FKJA 1L7AA 5C8VA 1XRQA 1TCCA 3ESBA 3AILA 4J7AA 5ALQA 1J06A 3H17A 3WWDA 3ESDA 3FWHA 2WFZA 3WL8A 3W2TA 4G5XA 1EI9A 1IZ8A 5ALMA 4X94A 4WCVA 4KE7A 3DQZA 2QS9A 3B5EA 4DMHA 2C7BA 2WFLA 2GYWA 4CCYA 3FLAA 4C4ZA 1UT6A 3DYIA 2OCGA 2H7CA 5CURA 2OQVA 5LZ9A 1ZICA 4EHBA 5CH3A 2EDCA 1DWOA 2WSLA 2DQYA 2QT9A 5ALTA 4DSAA 4B7ZA 4A16A 5HKAA 3HSSA 3IBTA 5EI5A 1SFRA 2OGSA 1ZI9A 5AI0A 2I03A 3GBSA 4Y2UA 1R50A 1CV2A 4BCCA 2PSJA 3VKFA 4OU4A 4QA9A 1GQRA 1Q84A 3F98A 4DLNA 5JAOA 4I4CA 2ONCA 4A23A 2XMRA 3BDVA 3QITA 4DIUA 3GELA 2H7XA 2WJ4A 1W6RA 2V98A 3K9BA 2RGUA 2QTBA 3C6XA 4DM7A 4PW0A 2VJCA 3LIIA 3VDXA 2ZJ6A 1QLWA 1Y7HA 3STVA 1Y7IA 4OD0A 4LXHA 2O2IA 2PPLA 1EDDA 5AK3A 2WHQA 4BRSA 1JI3A 5T4HA 5CH5A 2PUHA 4XIIA 5ALZA 3JYHA 5CT5A 4C6HA 2VAVA 3X3HA 2UZ0A 1P0IA 2X8BA 4AB1A 1XZLA 3FVTA 3G0CA 1IZ7A 2VF2A 5LP1A 2ES4A 2BCEA 5EFZA 3A70A 5JANA 4FNGA 2J3DA 4DYHA 1CVLA 3NWOA 2DHEA 5AKIA 4KE6A 1W76A 1UOPA 4BC1A 3R41A 1AX9A 1LPAB 1E8DA 3O4JA 3AIOA 1F0PA 5HQ3B 1K8QA 4XX1A 1H2XA 2I3DA 3E4DA 2XUFA 1BRTA 3G0GA 3WJ2A 2ROQA 4J03A 5JATA 4DNOA 2ZYSA 3G9UA 1X2EA 4F21A 1BU8A 3TRDA 3EQ8A 5CT4A 1HQDA 5AJHA 1EHYA 1QFMA 1HLGA 2OGTA 3G0BA 3IVMA 1DQZA 3BJMA 5ALOA 1EK1A 1GPLA 4ROTA 4LYEA 1MNAA 1VOTA 2XDWA 1EVQA 1LZKA 3RLIA 4BB0A 4EY4A 4PQEA 5KWJA 1CPYA 4MJ3A 4UBLA 5IVIA 4C89A 1A8UA 2IX9A 3A2NA 4H18A 2HADA 4FFWA 2HU8A 2PUJA 4OB7A 3H2HA 2D5LA 3SK0A 1QO9A 4B84A 3RK4A 5ALEA 1ISPA 2V97A 2CMFA 4GBGA 2ZJFA 3YASA 4JNCA 2GYUA 2DHCA 2PVSA 3P2MA 1MX5A 2J3QA 4HRXA 2HA6A 5K3CA 1U65A 4WDQA 2RHTA 3ANTA 4BE4A 2QJRA 4Y2SA 1QIDA 1RP1A 5AM0A 5JZ9A 5AI4A 4MWSA 4AMYA 3K6KA 1AC5A 1P0MA 4H7EA 3DEAA 1CFJA 2QOEA 4J0HA 4AN1A 4F60A 3E3AA 3EQ9A 1A88A 1GPKA 4B83A 3WL7A 4UFOA 3NGMA 5ALHA 5EIAA 1BROA 4ITVA 5LZ8A 3C5WP 3HXKA 3HI4A 6YASA 4OYYA 3L1HA 3H04A 5AKYA 4BAUA 1YAJA 5K3BA 3F9CA 5E4YA 5EIEA 4K2AA 4KE8A 1H2YA 4ZGBA 1B41A 4ZV7A 5C8ZA 2HA0A 1QIKA 2WJ6A 1DWQA 5IVKA 4LYDA 2XMDA 1QOZA 2ECFA 3KD2A 3KWJA 3QYJA 4B0OA 2GBFA 4ZREA 3FLBA 5JZSA 4Q3OA 2Z3ZA 1JJFA 4X90A 4Y2JA 1ODTC 2XLCA 4DMKA 3BL8A 3H19A 1QIHA 4ARAA 2PU5A 2BUAA 3FYUB 1IUOA 3O4IA 2PL5A 3V1MA 1CR6A 4D9JA 3R0VA 4W1QA 4Y2PA 4K6KA 3G0IA 1XRPA 4L9AA 3RKSA 2AXEA 2VT6A 1XQYA 1FJ2A 1VA5A 5CMLA 2BJHA 3WL6A 3ICVA 5T4BA 4B82A 3D3NA 4UBMA 5CXUA 1CLEA 1T2NA 3QMVA 4JYPA 2YH2A 4YPVA 3W06A 4OPMA 5CH8A 5J3JA 1QZ3A 2BFNA 4UBJA 5HQ3A 3UUFA 3IB3A 1HPLA 3O4GA 5LZ4A 2XUDA 4AO7A 2J4CA 3N0TA 3WKBA 2PKYX 5HF5A 1CUFA 2R8BA 3Q0TA 1TKRA 1ZI6A 1KEZA 3WWPA 4RE5A 5JAUA 5E2IA 4NVRA 2LIPA 1LLFA 4AZ3A 1BEZA 1ZJ4A 2HFKA 1LPMA 2R11A 3F96A 5C81A 3O0DA 5KREA 1U2EA 1E66A 1WHTA 1QIGA 1QJ4A 5AI9A 4QZVA 5AIAA 1AMNA 2XMQA 4Y2VA 5CW2A 2ORYA 1JU3A 3BDIA 5AICA 4BRZA 3PUHA 1S8OA 5I8PA 5DTJA 1ETHA 4KRYA 1W75A 5ALXA 2HRRA 2WM2A 4QDZA 1XKTA 4Q3LA 2HU7A 4BP9A 4UBKA 2AJDA 1UKAA 2XUIA 3VJMA 5A71A 1G5FA 2WLSA 3R3UA 3AZPA 4WJLA 1UFOA 4HXEB 5LYYA 2O2GA 3OC0A 4HRYA 3V1LA 2Y6UA 1J1IA 3DOIA 3V9AA 5LZ2A 5A62A 1YAHA 1CIJA 5AIBA 4CFSA 4H7DA 4H7IA 3QMMA 4UHBA 4ZI5A 3ZPXA 2H1IA 3DNMA 4XVCA 1XRNA 4O08A 1YASA 4S0XA 5IKXA 2ACEA 3IUMA 2JGEA 4TPKA 3WKCA 3QVMA 4KRXA 3O9MA 3M81A 4J0KA 5AOBA 3D7RA 1D07A 1XQXA 4OB6A 3BF7A 2XUAA 2BUCA 1CUZA 3VXKA 3PF8A 1CUYA 3AZOA 5AI6A 2VJAA 2ZJ7A 1MO2A 4WFKA 2XUOA 3W04A 2OQIA 1LPBB 1XZIA 3FAKA 3D5EA 2BGNA 2Y1KA 3WZLA 4QDXA 2XQJA 2GZSA 3BE8A 1ZGCA 2XUPA 2WTMA 4ZRDA 3FYUA 1AGYA 1SOMA 3IUQA 2XUJA 4B6GA 3DLTA 2WFMA 2VSQA 5AK5A 3C70A 1MAAA 1K63A 1QGED 4K5QA 5AHXA 4FLMA 2PSFA 5DNVA 4DTCA 1UOQA 2B61A 1NU8A 3F67A 3FSGD 1UOOA 5AOCA 2VEOA 4QWMA 2WUEA 1XZBA 2QKYA 1H22A 1BN6A 3D2BA 4V2IA 2XE4A 2GBIA 2RHWA 1MJ5A 3PUIA 2VJBA 2Y2VA 2C0PA 2QUAA 3H2KA 1P0PA 2WIFA 4PF1A 4H7FA 1HDEA 3FSGA 4BCDA 4BC0A 3FYUC 1EDEA 2E3JA 5HK9A 3DL4A 3B3QA 1TQHA 3WK7A 1W4LA 3QM1A 3LS2A 1SC9A 3D2AA 1EH5A 2WTNA 4L0CA 4MYDA 3OG9A 3WK5A 3ZI7A 2AJ8A 5AKXA 4U2FA 2WHPA 3FYTA 3MUNA 4BYMA 2QZPA 5C8XA 2WU3A 3BXPA 5EHZA 3NOXA 2WG2A 5BWBA 4HXFB 3C6YA 2HA3A 4BVJA 3AJAA 3H0CA 2YASA 2OLEA 2D0DA 3FOBA 4G8CA 1X2BA 5ALRA 4C4XA 2OAGA 4UFNA 3H1AA 4J3JA 2XUQA 1QIMA 1EDBA 1TRHA 4G4IA 3WA7A 2DQZA 3MVEA 3QMWA 3DYVA 2FJPA 3QPAA 3DD5A 1PFQA 4GLBA 4QDTA 1W52X 2IITA 5ALNA 3WWCA 5BWCA 5T4EA 1MX9A 5K3DA 4GI1A 3VJLA 1JJBA 1LPPA 4OCZA 2Y2UA 3QPCA 1YSCA 3PI6A 5AKHA 4X71A 3WLAA 1UK7A 1QTIA 2B9VA 4EZIA 2FX5A 5HCUA 4X85A 1U8EA 4Q3KA 4BZZA 2ZVDA 2QXTA 2XMGA 3IA2A 1QIJA 1RWQA 2H7YA 1A8SA 3SWWA 3T4UA 3CN7A 3D0KA 3I1YA 5AM3A 1XZHA 1X70A 1XQWA 4QDUA 3WKAA 4IO0A 1SCIA 3OURA 3ZLUA 3S8YA 1K5PA 2XB6A 4KR0A 2FUKA 3GUUA 2CEKA 2P8SA 1WPXA 4UHHA 2WILA 4LIPD 4N5HX 4XWGA 3WWOA 1FSSA 1VJ5A 4UHDA 1LPNA 2AJBA 3R40A 4X6UA 4KEAA 3Q8WA 3DDUA 3M82A 4OUKX 4C4YA 3HACA 2W6CX 1QO7A 1CQWA 3O9VA 3WYNA 1ODSA 1IMJA 4BE9A 3R3VA 3BF8A 3DCNA 1YS1X 1SCKA 4EY7A 4EY5A 2XMCA 5HK8A 1DX4A 2G5PA 3BWXA 1LPSA 3DKKA 3VVMA 1YB6A 1E89A 3IUJA 4W1PA 1H2ZA 3F8SA 4FTWA 2WQZA 4BVKA 5AO9A 5K3FB 2QRUA 2PBLA 3IIIA 3AINA 4IH1A 1XZCA 1E5TA 4Y9SA 5K3AA 1UWCA 2BUBA 5AM2A 5ALPA 2JEYA 5AKEA 1VZ3A 1DT5A 1PV1A 1QONA 4WFJA 5A6VA 2AJCA 2VTVA
chains in the Genus database with same CATH superfamily
1LA2A 3ANMA 1Q83A 4IRMA 4JLKA 5IUKC 4EITA 2VPYA 5DGCA 5CTAA 2P6OA 4D96A 4ZP1A 4H1HA 1OYWA 3IT3A 2KB0A 1TU3A 2FWIA 4Z3OA 2YWCA 3IMEA 2VH5R 1VLLA 3RT7A 3ZWDA 1MVOA 1HA3A 3EOZA 1WTAA 3BORA 3FIJA 5HKBA 3VOBA 1LPOA 2ZYHA 4I08A 2DLCX 2LNDA 1XZEA 3CLRD 2D2IA 4H0CA 1DKOA 3ZWOA 5HYVA 4QYXA 1JIUA 1OXMA 4RC9A 1R0YA 1ZOOA 3CXUA 1V96A 3FZQA 4W7IA 5BQ5A 3W6OA 4NBNA 1GPYA 5C35A 2GD2A 3ITNA 2PJZA 3PSAA 1BZYA 1GZHB 1OF1A 2NO4A 4OAQA 4AF7A 1C9MA 1QORA 4RD2A 4PO1A 4NXMB 5CYPA 4MVJF 5IDWA 4EKEA 2AI2A 2X0KA 4LTDA 3H2JA 1F6WA 4E09A 4FFRA 2WZDA 4IG9A 3VPAA 3QU9A 3D81A 1AKUA 1F2UB 4UEQA 4WZZA 3SD7A 2H29A 1WU7A 2VNIA 4XZ3A 5AVTA 4QE3A 2VA9A 3LNCA 1RW4A 4HHEA 1SA0A 4FYJA 4R8RA 1Y0BA 1OFUX 2NTEA 2VFAA 1Z6PA 2I91A 1L6IA 4NG5A 1I7PA 3VH4A 2ODTX 3DL7A 4EFDA 4OJKA 5JPCA 4RJJA 3U7FB 3UPUA 1SC1A 4H1UA 1GXSA 4LJKA 3IDQA 2V7TA 5EQFA 3PHHA 2HHHB 4GLLA 3BPSA 4TLDA 3HO1A 5K0LA 4P93A 1TQ4A 1ACJA 1PQUA 3A8TA 5HGXA 5D3KA 5LOVB 2CCGA 1XV5A 3OOSA 1BCRB 1MO5A 4MYSA 3G88A 4WOBA 4KN6A 3PEYA 1YZQA 2OUIA 1CB7A 2QQ5A 4EAQA 3ZE6A 3VA7A 4J4TA 1XP5A 2CLKB 2X0IA 1VPTA 3D4IA 1IE3A 4FE4A 4FC7A 4FDMA 3WOHA 1C50A 1V7CA 3H2BA 1KI6A 3E03A 4FOOA 1KFJB 1YS9A 2EIXA 1Y3IA 2H2HA 2NT4A 4QO8A 1GAEO 1B2RA 2A0YA 3UJDA 4RA9A 3CA8A 2PT7A 3HWWA 4LDRA 4NENA 4FMCB 5KWSA 4CIVA 4DKJA 1Y8QA 2NYRA 2Q4BA 3I76A 2JIQA 2Z56A 4KX5A 2PX0A 3HZHA 1D0VA 4Y9RA 2FPWA 4CF6A 3UHPA 1N5JA 2ZWVA 3FIUA 1FNDA 4FC6A 1QG4A 3P2OA 1A9RA 2BMVA 1E20A 3ZGNA 4IFBA 5FUXA 1P4JA 2VNKA 1RT9A 1G17A 4DM3A 5KHOC 1RKXA 1SUEA 1W1IA 1XZAA 4L08A 2W37A 5E4FA 4C7MA 4WBSA 2BEVB 2BSAA 3NCTA 5A4IS 1IOLA 3VKGA 1GSAA 1FMCA 3PC6A 3TPZA 4FT2A 2E18A 3DYBA 2ZT7A 3N3AC 5HF6A 3ONEA 4M0EA 5EJAA 5TB5A 2O5CA 3Q87B 2CB0A 1T13A 2C29D 3AUUA 4YPFA 4BBJA 1YZFA 1PZMA 4N49A 5LC1A 2VAPA 1ZD8A 3OFVA 3GCXA 1KH3A 4GG1A 4HN2A 1U3VA 3QVLA 2G04A 3DW1X 3TO5A 3A9VA 3ASYA 4XB6B 3EJ6A 5CB6A 2HM7A 2V7BA 1SRRA 3HZOA 1XTUA 3I6ZA 1JG2A 1XX6A 2IY8A 1QQ6A 2YMMA 5CDHA 4D25A 1GTJ1 4W5TA 1FNMA 3QOYA 3RI3A 1K7EB 4JOQA 4RHTA 4UE3S 2ACKA 1G21A 3O8DA 1MXFA 3FZYA 2CB9A 2FR1A 1YOVA 1PJZA 2OSBA 3DZCA 1PK8A 5A05A 1A97A 1MGOA 3SNHA 2AV6A 2R48A 3SSAA 1EZ1A 4Z7QB 2JLUA 4ROSA 1RCFA 1P4GA 2P4QA 3NKVA 1TXGA 3ROFA 4B9AA 4LDQA 3D4PA 1HE1C 2WC1A 1ZOIA 2WIJA 1CK4A 5IVHA 3BTSA 1F4LA 1LB1B 4PV7A 3L6RA 3UPTA 1TMOA 1XMPA 3LYUA 4U2CA 5B1IA 4P6VF 1F7VA 3DHYA 1IZ9A 1OXXK 4IEIA 4NAUA 3ZWVA 1E0SA 5B36A 2F6RA 1ZY2A 4ZO6A 5FI5A 1XMIA 2OCYC 2E7ZA 1LCIA 5FEMA 3S2ZA 2QRHA 4P3NA 4X20A 4XJTA 5TGDA 1J1ZA 3JAMA 1TZCA 3EC7A 1M8FA 2AJLI 2HX1A 4GYJA 4ESHA 5B6JA 3DQQA 1WHSA 4MVJI 3STYA 2XLBA 3AF1A 2O20A 1HKHA 1JWBB 1DE0A 1VXRA 3BL5A 1DSSG 3OOWA 3U9LA 2H5LA 4PGAA 4BNUA 2NZ8A 4NZPA 4U9HS 4WADA 3E7FA 3MA0A 1AD2A 2LRHA 1ZSYA 5DXJA 5FUYA 3M6VA 3UUGA 1GRNA 7ADHA 1JEQA 2GAJA 1PYOA 5K0JA 1NY6A 2DUJA 4IFIA 2PUCA 1DELA 1I80A 4YV7A 5LMUB 5BN5A 1ZC3A 2O2YA 2W8BA 1XFAA 1J2JA 3MJHA 4G24A 4TQ9A 3TI9A 1SC4A 3ETEA 3ABQB 3OO1A 1W5FA 1UXIA 2G5TA 4UMEA 1JSZA 1GEGA 5KKNB 2VOJA 1QUFA 1FPQA 2WHPB 1O58A 3V4ZA 3KFVA 2NVBA 4GYKA 3NKLA 3ASUA 4KH0A 5SZIA 2J3HA 3IHKA 4L7VA 1JIKA 4IQGA 2Q0SA 3FTPA 2R25B 1YRQA 5IAAA 1DFGA 4HKTA 4BMXA 3AVOA 2ZGVA 3AF0A 3I45A 4OBEA 1A77A 1W1UA 1N7GA 1A9PA 2ZYIA 4PTLA 3OZGA 2VXBA 4A6PA 1V25A 4PBTA 1FSPA 2JIBA 3SLKA 5K3FA 1ORHA 2GRUA 2NU7B 2XT9A 1INLA 3PF9A 3K6SB 1JHVA 1XN4A 2ZDQA 1FP1D 1ISSA 3L79A 4I5EA 1FS5A 3WLOA 1YQEA 1R88A 2YDYA 2WF6A 3UJAA 5IUJC 4EG4A 2YQZA 3K0FB 2BKUA 1XCGB 2GLXA 2NG1A 3KPWA 2GXSA 1FPMA 2PMWB 1Q17A 2HJWA 4QQNA 2SCUA 4R7TA 4GC5A 4CLDA 4K8OA 1CZHA 3GPDG 2JFNA 2V7UA 3JAWB 1RJDA 2GS9A 1ZNYA 3OTQA 5ILOA 3VU3A 4IRXA 2OXEA 3WBFA 3HA5A 3JALB 1NKVA 5ERXA 1R4AA 1Y9DA 3KLBA 1BS1A 3KT6A 2PD3A 4FEGA 4HS9A 4DABA 4RYLA 4HLDA 3RVBA 1D1SA 2BFCB 2FZEA 4CF5A 5AKGA 2O0LA 3WK9A 5F23A 3UB4A 1XP8A 4N47A 4TKUA 1X74A 1PT5A 5BQ3A 3DTVB 4QBTA 4AN4A 4OFZA 1DAPA 3S1AA 3THOA 5I7RA 3I6IA 3D8BA 4DC0A 1SXJC 3ZLTA 5JOQA 1M1XB 2BR5A 2ZRIA 1WW8A 3HJAA 3PQ3A 4FDAA 2RAUA 3DJFA 2GHRA 1Z25A 3I9MA 3GDFA 1QHGA 1VMDA 2H4YA 2VNAA 2WPDD 3DE7X 3FPSA 1JILA 3FNBA 4RQAA 4EG3A 1N5LA 1W5EA 1EJ0A 4KVAA 1IN5A 1UZLA 4P7GA 3PD7A 4IYRA 5ER9A 1N6RA 1RHJA 1N5OX 4YAWA 2FUCA 4QGAA 1T9CA 3RJTA 1OBHA 4WCFB 2PZFA 5C4GB 4YRZA 5E6SB 1EGQA 3COPA 3V2HA 1V4NA 4UJ3A 4UW9A 3GPBA 2H7VA 3MUOA 1XYYA 3UV7A 1DAMA 2Z08A 1JHAA 3ZE7A 3LUCA 2QUJA 5C5DA 3I23A 4MV7A 1LBIA 3AM5A 1X15A 2WPDA 4AJKA 4ARVA 1UMDA 2VPXA 1NMXA 1VJTA 1FFXA 1GTVA 1UT8A 2ZJ3A 4U6NA 1CUGA 5H70A 3RK1A 1XAGA 3JPYA 4PQGA 1Q50A 4O1HA 4I4NA 3ESZA 4F7DA 4ZO4A 2QMZA 4GOOD 3BSSA 3CN9A 4ZVSA 3WGTA 4YP0A 3ZDQA 2HJVA 4W7HA 3ZCSA 4JOCA 2UZ1A 4KQKA 1UPBA 3OLQA 4E14A 3TGLA 2ZPTX 1FLAA 3CNHA 3OUUA 2X8JB 1QBGA 2CNKA 3E35A 3NDIA 2C57A 2FN8A 1QU2A 5AJYA 3KJIA 2JAHA 2MDTA 3EZFA 1F2DA 5EQTA 1M10A 2D3WA 3AEQB 4JUFA 4RHYA 2HW8A 3G23A 5ILQA 5FOXA 4JC5A 5IAGA 1ZIPA 5L6MB 4MWCA 3B70A 1M8JA 2X5OA 3F49S 4GE0A 2NU8A 4CKXA 3JZMA 4KIWA 5KNLA 1XR3A 3RVRA 4JLUA 3V46A 4X1YB 1L8QA 3O47A 2ECQA 1G66A 4HB2A 5E4TA 3WKDA 2O3TA 3M1AA 3KHSA 2AE1A 3G59A 4M1QA 3PSHA 5ESXA 4WZBE 1LF0A 4LZZA 4BNWA 4MRSA 3F7TA 3GB9A 3HJTA 3M5PA 4MKZA 2CJWA 4NU0A 4H77A 4FDUA 4OP1A 4CKCB 1STOA 2PLAA 4B46A 4JD5A 1N5IA 3WHPA 3RC3A 1L4YA 3LKBA 4FZJA 3KS9A 1O5OA 2AZMA 1QKKA 4O0MA 1E7QA 2FZ4A 3BM5A 4OUDB 2DR2A 1M2JA 1A4XA 3KYJB 2QMEA 7AT1A 4P4UA 4LCBA 1BN7A 4MTCA 3BE6A 2O07A 4KO2S 3USCS 5DK6A 3QGMA 5CXXA 3ZS8A 4Q4DA 2WIDA 3IIMA 4PANA 5CYOA 3C8MA 1K8RA 1QS0A 4CKYA 5AVJA 1V47A 4L4UA 2IWHA 3P52A 3BMNB 4B6PA 4YDSA 4J6EA 3G17A 1D4ZA 1OBVA 3MIZA 1QNLA 5HGJA 1E5VA 2R97A 1XFDA 2AG5A 3HJBA 3KXIA 3WGYA 1EX1A 4G81A 2OGWA 1M67A 3K8ZA 3STTA 1B74A 2N1MA 4HGPA 4DR6B 3CRRA 1GL7A 3FNQA 2PUEA 2ZBEA 1EG7A 1A50B 5AW6A 3KAKA 1VMKA 1MX1A 1WL8A 2VZEA 4GPIB 2AN3A 3HZZA 5BY2A 2NQ8A 2BH9A 1COWD 1R0KA 4ZXPA 1P91A 3RQIA 4CEIA 1D8AA 4QFMA 2OT3B 4QUHA 2WU8A 1RPNA 2WV7A 3EN0A 4QYSA 4B6EA 2XVMA 9LDBA 4RETA 5KINB 4DV4B 4LCEA 2CXXA 1GPUA 4D0SA 1SG6A 2OESA 4JSYA 1Z4LA 1B8PA 2YW2A 4FOTA 1I36A 4PSDA 4KQ2A 1T2CA 3D8UA 3DT9A 4AJLA 3O83A 5JD5A 5JY6A 1GT6A 4ZQCB 4EJ6A 3I73A 2PXXA 4UAVA 1WCV1 4L50A 5AVOA 2R6R1 3T4EA 4YR9A 1YUBA 3H9JA 1FTWA 3TR5A 1CR0A 3FHLA 3IP6A 5CAEB 3W9YA 1KHHA 1YR1A 1COWA 1LX7A 2YWGA 3JD3A 4GW3A 3C4QA 1NPTO 1DIBA 3OH8A 1IEWA 2J4DA 1ES9A 4KDEA 5TMDA 1UJNA 3GWZA 1PAUA 1V2GA 1A8PA 3KR2A 4B17A 5CT6A 3G3EA 2GD6A 2A5JA 1JYEA 4IF6A 4YP5A 4LXGA 2B6NA 3ECAA 3RSCA 2P2DA 2Q5OA 4ENUA 3OF5A 2AJTA 4MUYA 1HI9A 1H5UA 1E9CA 2AI1A 1M9NA 4LMBA 1GM5A 4X24A 1CQJB 5C3MA 4ENSA 1Y6ZA 4MQ4A 1FSZA 1CDOA 1F0NA 3KG2A 1IDN1 4HD8A 4MUFA 4DQUA 3GLGE 3KOOA 4WOKA 4GR4A 5ALKA 1DIHA 5TR9A 5KWJA 2ZBVA 3U09A 1F17A 2G17A 4H31A 1NQUA 3H7IA 3IE2A 4OQEA 5L3ZA 3RR2A 5HF9A 1G4UR 3ZG6A 3KEFA 1G8GA 4EI9A 1QKJA 3IJPA 1P5RA 4LY6A 1N2JA 1ZMXA 2I78A 4US0R 1CUJA 3UT0A 1YJAA 4FIZA 1EK0A 1U6JA 4ZCIA 4WKNA 1FS4A 3DT6A 2YHIB 3NIDB 2QE7D 4QOSA 4R1SA 4WUVA 5B12A 3S44A 2V6BA 3WB0A 1GPBA 5BWLA 2ARKA 2GZ1A 1NASA 2Y71A 3OZTA 3FOCA 1RYEA 1HBJA 1P77A 2IPAB 1OC2A 1NHWA 3K5WA 5CR9A 4B33A 4ETWA 2VJPA 2BC9A 3IPRA 2G1JA 4KKXB 1QYVA 2ZZNA 2B34A 4LRUA 2XYRA 2R5WA 5FB3A 1UBEA 2YN2A 3LXRA 1M6VB 4QREA 5IDVA 1BXKA 2HF2A 1KFEB 2PQMA 1MR3F 2I7XA 2VTVA 4OMUA 4ARBA 2J9YB 1TMKA 4KYTA 5K01A 1NYQA 3HUEA 5LR6A 2EERA 2Y9MB 3D02A 2FZLA 2RJ3A 4G3XA 4JZKA 1IXZA 2CXHA 5TF0A 2ERXA 2GF2A 2I4RA 1A1SA 1FYFA 1H2RS 1PHPA 2BTOA 2QE7A 2FX3A 4YROA 3OLCX 4DDWA 2I4OA 3CG0A 3HDVA 2HA4A 1TF7A 2Y1XA 3CNQS 4FUQA 4B85A 5BSTA 4WKGA 2VLIA 1VIYA 2A7QA 2H08A 2EX4A 4EA6A 1JDPA 3ME5A 1TAGA 2BYTA 1H4QA 3G5AA 1JSLA 3L0BA 3RSLA 3VYRB 4CL8A 1LDBA 1OYYA 2FG7C 3B9BA 1XPUA 1BD3A 2P5SA 1PGOA 3V55A 4C0KA 5H7XA 5EESA 4ZQIA 4LPSA 3U80A 1P45A 4HV4A 3ZNOA 5F98A 3KR1A 5TT1A 3ZIAD 3TVTA 2RGRA 4QOIA 2MSNA 4TTTS 4HH0A 4W9NC 5AHRA 4HADA 4KQCA 4V2UA 1J0BA 3QBEA 1C0PA 1SOVA 2WWWA 3PUJA 5B1SA 6REQB 4K81B 1CUBA 1Z6ZA 5CVDA 2K7ZA 4EQZA 5JISA 1U0EA 5KX5A 1Z68A 3PNPA 1P5FA 3GHHA 4MYUA 3A05A 3IVAA 4QHTA 5AW3A 4W5QA 3T1HB 4MQFA 3SHVA 3TMAA 4F1WA 1R6AA 4DLWA 4FBGA 1GDDA 4AP6A 3ONDA 4QBFA 3OO0A 1MT3A 2HIHA 1M6YA 3ENNA 3H65A 4XQCA 1B8UA 2GZRA 3OF3A 4Y18A 3KFXA 3OCXA 4ZYZA 3WL3A 3ZIAA 1E2JA 5HE9A 2IS1A 4V0QA 1Q15A 4FLEA 5DI3B 3HLYA 4DR5B 1UZAA 1N7HA 2V9PA 4KR6A 4RACA 2QDKA 3CUWA 3KDAA 3K2EA 1GD1O 3GGJA 4X93A 1QFJA 3JYLA 3L7AA 3WMEA 4E6EA 3MLEA 4B44A 3B6JA 1KU6A 5FTNA 5C1OA 4MKRA 4HUTA 3DKVA 4G5HA 1UUFA 3FPGA 3O7WA 5B3JC 4DSOA 4WNCA 1HYEA 4HXGA 4YIHA 4TTAA 3K20A 3BILA 3EF0A 4MHTA 5C51B 2JK1A 3KELA 3SN6A 3FDJA 4BQOA 2AFHE 4GBJA 4ATNA 2P2GA 2O1WA 1H9AA 2E21A 2QW0X 3LP6A 4MPRA 3HB1A 4JCCA 5SZKB 4IHJA 5JS8A 3LL4A 3Q7SA 3WK8A 2NMVA 2C9YA 5KX5F 1U1EA 3DDZX 4Q00A 3NU1A 4U7WA 1WSBA 4I9HA 1TM1E 3MYRA 3OX3A 4M1OA 5BVGB 1Q0TA 2HWXA 5JVDB 4P54A 4NE9A 3DLAA 2JH9A 1J90A 1N5DA 3ELBA 3MELA 4UU8A 2JRLA 1AUVA 1G5PA 2G4LA 5K7SA 2OUKA 1CJVC 4Q9HA 4M2LA 2GN4A 3ZC3A 4RCYA 1WW2A 5CLGA 1FDOA 3PITA 1SXJB 3BFPA 2RGBA 5ERYA 2P9FA 2QYHA 4WTOA 4EJSB 2PIDA 4K6MA 5JJLA 4WNYA 2V45A 2H1WA 3LT5A 1Q7EA 4XUDA 1GA6A 3T41A 3G8YA 5DBEX 2H1VA 2IK8A 2XWSA 3A37A 4F5ZA 1T4MA 1M3SA 3RRBA 2HL6A 4DGQA 4EUFA 4C29A 1O54A 2QZJA 1OWPA 2XE8A 3FSEA 3AEUB 3MWKA 2VPWA 3PJEA 4RH0A 5IFKA 2WG0A 1ZM9A 2OB1A 3HDJA 1SQSA 2WPNA 1NY5A 3IQXA 4J7XA 4OHBA 3RIMA 3WHLA 1KRWA 1T6XA 3QUAA 4LGCA 5E4JA 5CFOA 1SY7A 1UBHS 2WB4A 5EPUA 1QR6A 1S2NA 1G59A 1XVAA 1N0UA 1NI4B 1E4EB 4AZWA 3PNLA 3O73A 1B43A 4JODA 3KOUA 3B82A 1X86B 3JZDA 3Q8XB 1SQ5A 3HKCA 3H2ZA 3CBGA 2J0QA 1KY3A 3SIWA 1Q0LA 3HZRA 1LDMA 1NN5A 3ND7A 4OXKA 4WKBA 1PQYA 4Z2AA 2AR7A 4ZI7B 3C5HA 4ZCSA 4DT1A 1LJ8A 3IO5A 5A5DA 2DUNA 2ZJ5A 1GARA 3CRMA 3LUGA 3K0CA 4CMHA 5KYXA 3CVVA 4WW0A 1X92A 1R6DA 1JQ3A 4FFLA 1QYIA 1AA9A 3LWDA 2WMYA 2RHBA 3HA3A 4S1OA 1NFFA 2CCKA 2KJQA 3OM0A 4X44A 3NMUF 4J9VA 4J4HA 3AI2A 3U4QA 4GXNA 3OHMA 2IUYA 2ACWA 4W4TA 3TM5A 1JMVA 5JYBA 4DMLA 5ALSA 5K0EA 2X0NA 2NSDA 2WV9A 3KXKA 4KIGA 4WKOA 5A9SA 1NXOA 4L16A 4RORA 1QU3A 2Y66A 4BO7A 3E1GA 5HSGA 3C87A 3GJYA 3NHPA 1NNEA 2XNSA 3W5VA 1U2GC 1ZEJA 1TF2A 3GEDA 1FFDA 3DG9A 1JSCA 3JQAB 4D4IA 4OGFA 1EFVA 1NVEA 1F8YA 3BGDA 4ECAA 2IH5A 5F1YA 4FN4A 1NF2A 1C7FA 2VUIB 1QIEA 3JD1A 1T91A 1BKYA 2FSIA 1GQOA 1XUOA 1QP7A 4HGZA 2BZSA 2R6CA 2XD4A 1R4ZA 1WVGA 2NWQA 2H9YA 5CVTA 4BP3A 1P1RA 1C3OA 2H4WA 2IYZA 5ICCA 3BE4A 4P5PA 5DT2A 5JBNA 2HJHA 1E7SA 3FZGA 2L2QA 5IAJA 4IICA 3FCYA 2YWRA 1L5HA 3RAJA 4YV0A 1N2ZA 1YR3A 1Q7TA 3SAJA 1A4RA 1Z7EA 3Q7TA 1ST2A 1KJ9A 4U9UA 5KBYA 3E81A 3DV0A 4D9MA 1Q0ZA 2X5XA 5EJ5A 4BN4A 4WE3A 3EYWA 1T5HX 2EZ4A 3DULA 3WLFA 4ALNA 4X45A 3C8HA 3D5TA 4ADSG 2VHYA 4M76B 1ENPA 1PJ8A 3R7BA 4PNEA 2HBQA 1SJ9A 1NMQA 2J0EA 2NOAA 3JSXA 4JYCA 4XFJA 2PSDA 2V0GA 2F3QA 1NI3A 1NVVR 4L15A 1H9BA 4RAOA 3CU5A 2GA8A 4JP3A 3ZDZB 5FPHA 1U2QA 3CB4A 2MMCA 1GNLA 1KSGA 3NAMA 1N9ZA 5KYWB 1P62B 1WJGA 1JQJC 2O3QA 4PG5A 3AF6A 4JI8B 3KDSE 3S1LA 4KPEC 2VJYA 2BW0A 4F3KA 2BCGY 2B1JA 3DWGA 4WRRA 5FP0A 4PO9A 5I9IA 2VF4X 3DFMA 1VXOA 1MOSA 3N1UA 1LSJA 5A6SB 4WV3A 4ZOEA 3VSBA 3GQBA 5EQDA 4J0EA 2YXEA 4UXHA 1K2WA 2BI4A 3LG2A 4XGKA 3ESAA 1NPYA 2CT8A 1A2KC 2QW1A 1E2FA 5G0UA 3RLFA 4U7TB 5F9HA 3U7JA 5CIQA 5K09A 4X1OA 4NV1A 4KWCA 3KZKA 1O6GA 2ZWMA 3SVLA 1PLLA 4Q9NA 5JD6A 2E55A 1EUZA 1TIKA 1AB5A 1ZD4A 2AFVA 2EATA 3QNWA 3ZY6A 4RNCA 4A0QA 4KB5A 3OPNA 3O8BA 5DZSA 2NYVA 2YFQA 4YHHB 3W5IA 3MBIA 1PJBA 2GB4A 3AJRA 5BOVA 2A7XA 4X8OA 4TXJA 1ZCZA 2HC9A 2DZDA 2DECA 3HFRA 3N9IA 4PWZA 4PZPA 4OXXA 4RDIA 4XYGA 2C9MA 2J0SA 4NYJR 3MT7A 2I6SA 4DMCA 4MVCA 1ZJZA 3RUPA 2P6MA 4DBLC 4MLZA 4NU8X 1Z36A 2VHVA 2EYQA 2D3TA 3IQWA 2J5QA 4KMRA 2VATA 3AEYA 4PBRA 5E38A 5DM0A 4TTPA 3CC8A 3BWYA 1ECGA 1VA4A 4NCHA 5G0SA 3NUGA 2HHLA 3ICEA 2VCYA 2P62A 4QYMA 4WNAA 2C7RA 2HK8A 1KVQA 3G2MA 3JWJA 3N5KA 3OI7A 1JAHA 3I58A 4G1UC 4DJAA 1KGDA 4YDQA 3EAQA 1PF7E 1UJ2A 2V8OA 3CXRA 5IN5A 2B8JA 3SJBA 1YL5A 3QIAA 2V58A 1OROA 1T0JB 1VYUA 4MS3B 4YONB 3PD0A 2Q2VA 4RV9A 3DZGA 1WOMA 4G2TA 1MU0A 3DNPA 3RHSA 1YZHA 5H1YA 2J0UA 4B32A 3B1JA 2AMLA 2RSLA 1OLSA 4FQ8A 3TOZA 1A96A 2Z4TA 4MVXA 1FFAA 5EZYB 4MX8A 2AG8A 3KLPX 2BF7A 1X8LA 3T3IA 3MCUA 1I3KA 5J5CA 3QUQA 1OCEA 5LDGA 2F48A 3UYKA 1RFLA 3OZRA 4P3YA 2G09A 1ETUA 4MXDA 5KPDA 2B7CA 3VZDA 3JZFA 1MH9A 4PSKA 3SJAA 3CZQA 2OFXA 1P8AA 1C1DA 2QI9C 1GZSA 4UQOA 2QZ9A 3WWEA 1RP7A 1N78A 3C5CA 5JCXA 5B55A 1D6JA 2FQYA 4HPWA 3G0DA 4X6XA 2AF4C 2E4WA 2QM8A 2ZI4A 2FW6A 3J7TA 2ONJA 4EPWA 1I1HA 5JS6A 1S3FA 5THQA 1PBNA 2NZ2A 1NSYA 4GHWA 1U0BB 3AR5A 2A1TS 2DQ4A 2R84A 4LJYA 1W30A 3TCKA 3AVUA 4FCTA 4TKVB 4ZVQA 1JV2B 1RWOA 2C7QA 1RXCA 4M0CA 4BBZA 2AQHA 3IIEA 4HDRA 1FYWA 1TJ5A 3ROPA 3ZDAA 2XMSA 3BMOA 5IANA 1TCAA 5CVVA 1O5IA 3AUTA 2P9CA 2J9RA 4CZ2A 3PFKA 4UCQA 1F4PA 3PGJA 4A5SA 1JFRA 3IVGA 2FEPA 2A9JA 4AX4A 3Q85A 1XL0A 4TT8A 1VHTA 1AHIA 2XB9A 2HXSA 4M0PA 2OCIA 1J0EA 4C14A 4Q9AA 1NU6A 1UK8A 2A59A 3T06B 4QUEA 4R1QA 1E59A 1M2HA 2Q1SA 4J7UA 4Y7DA 3U7IA 5IXSA 3D7KA 5TE9A 2F17A 2YJGA 1WB6A 2ORWA 2YY6A 5GV8A 1SR8A 3B1XA 5AK4A 2AKEA 1JG4A 1UIRA 2IX3A 3SKXA 5AMXA 3TMYA 5AHKA 3SPXA 4YMLA 5M7EA 1I24A 2W58A 1B0UA 4DRZA 4C6SA 1B00A 3R5SA 2WUFA 2H18A 4PRKA 3ZGLA 4M3NA 1EVIA 5GVSA 5GOTA 3C6BA 4YWJA 4DDUA 3GVCA 5B53A 2KM1A 4Z4CA 4MRNA 3TQQA 1YGPA 1CZKA 2Z3WA 1QUEA 3OZSA 3WLKX 1KEUA 2V7QD 3HL4A 3K8YA 5JXHA 1UBMS 3DH0A 3L0SA 2A14A 2AK2A 4JBYA 4P2GA 2ISCA 3WFJA 1H2HA 2PO7A 3CSDA 4JUAA 4BFWA 3JQ9C 1JEOA 4G86A 2I6XA 2JGRA 2ZE6A 3NX4A 1FP2A 2LR0A 3NNDA 4PU0A 2UZAA 1OAOC 1WM1A 2QR2A 3GV0A 1OJLA 2Q1TA 3SYTA 3L02A 4MNTA 4UMVA 3N7TA 1FMLA 3CEAA 1CJTC 3EG9A 3FMVA 4B47A 5J4KA 2GEFA 4PLTA 1Y3HA 1T9KA 4R2MA 3P9XA 4QUGA 2ODQA 1KO4A 1TW2A 1JXQA 1TT7A 1R9GA 2M6SA 2OAQ1 3RB8A 3ZGYA 3JV7A 3BIWA 3C15C 4U9IS 2V7QA 4X91A 4G9GA 3REGA 4O5OA 3ZY5A 2VJQA 4F4IA 1CVRA 1M2FA 1GYRA 5ALYA 2RHGB 4QASA 1TB4A 5D3MB 1QFZA 4HSGA 1JQBA 3B60A 4LMPA 3IRUA 3D6AA 4XQ9A 2JIDA 5JU6A 4GPZA 5IT9A 4LN1A 5CJ2A 3PE6A 1OX6A 1W4BA 1J8QA 1OGJA 2JJ8A 3PTZA 1LY1A 1FFEA 2EKLA 1KU0A 4F3TA 2P6NA 3WIEA 3A58B 2ZVQX 3JW8A 2K87A 2KW5A 1UM9A 2YCBA 2ZSUA 4XQGA 2IODA 5C4IA 3ES9A 1DDOA 4IAOA 3FSJX 1YRYE 3G8CA 4Z9FA 4XWOA 2RK6A 4Z6KA 2YVKA 4PYLA 5KOHB 3AIMA 3AVYA 1N5RA 2FB9A 4FEEA 3L4BC 1AK2A 3MHPA 5HJ5A 4CL2A 2FMHA 3VR3D 2ZIVB 3UOGA 3GFOA 1Z2NX 2D2FA 2C0CA 3ZXUB 5FTKA 3ZX4A 5BPFA 2AT1A 2CLEB 1T8PA 3ADKA 3LGSA 4YT4A 1K2VN 2HMUA 4DYDA 2X0RA 5JDCC 3CPSA 2Q45A 1KDZA 4CGZA 1NONA 5DHUA 1N2CA 3RASA 1MVNA 2NSHA 2VHTA 3UIEA 1NXWA 5C37A 3EDMA 3K05A 3LWNA 1WABA 1NW5A 5IJAA 1GGHA 4JT9A 3VR3A 2EXXA 2CBGA 4YAUA 4NC9A 3TZHA 6GPBA 3CTPA 1ZJJA 2FU5C 1UF9A 1IZZA 2L82A 2RGWA 3NAZA 4O4LB 1AH2A 2NUAB 5KNDH 3D7NA 1T5TA 1N8SA 2WG1A 3KPVA 3OU7A 1PJLA 4G0WA 3FVRA 2GRAA 1K9VF 2IPMA 1NG9A 5EMMA 1GNRA 1PWXA 4RHCA 5FJIA 1H8ED 1QYRA 2XOXA 3LP5A 3NDJA 2DVMA 3A6ZA 3ORQA 2H4FA 4H7JA 1LDNA 4UARA 2Z1DA 3W6ZA 4EK9A 1CSEE 2VHXA 4N54A 5KQRA 3EFOA 3ZCQA 1PKEA 3UAZA 4CMGA 3H1BA 2O3RA 4PHHA 3WXBA 1C7ZA 1V8FA 4BMYA 4DWVA 3PGXA 1EWQA 3IC5A 1MAVA 5EINA 3T3EA 4HQ6A 3AJ8A 1BMDA 2X3UA 3AESB 1FFBA 2BD0A 4NMLA 4NDAA 2X3YA 1QAMA 1VCNA 3NB0A 4YRBA 2C88A 4IF4A 3AETA 3EXHC 2XGSA 4K3VA 4YP7A 2DE0X 1DG3A 2ZYWX 1GCAA 4LFCB 5B4UA 4D5GA 1P7VA 1H8EA 2GRJA 3DAYA 4OI0A 2HHJA 3H4MA 2V0NA 4WA7A 1NZFA 1PDOA 1GKKA 4ESVA 1SKUA 4W6ZA 3I4LA 1EFPA 2UVPB 4O2LA 2B37A 1D9ZA 4HZGA 1NXSA 4EENA 4TWZA 1I5OA 3SX4A 2I54A 3BWVA 3II6X 1F48A 5EQJB 4ZDIA 2ZYTX 4DCVA 4WOJA 1R6VA 4NS4A 1DRJA 1QPBA 2G8LA 4BX0A 2NXJA 2MSEB 1PI3A 1U81A 4NJMB 1KZ7B 5DJ5A 4GUAA 2ZRLA 2LCQA 3GLFE 2JGIA 2GEVA 1NSTA 3NUZA 2PN1A 3F3SA 3LHKA 4O4HA 4AUEA 2HK6A 2ZJAA 1KDTA 4IUDS 2Z3VA 1PV2A 2PU7A 5CCBA 2XF2A 3G7UA 1CRLA 1A9QA 5KS2A 2HA7A 1C1YA 2NU6A 4G0ZA 4UCFA 2I1WA 5HRUA 2X58A 3K9LA 3ZDDA 3HBNA 2VTBB 2LKCA 2WUGA 1AN9A 5BV7A 3DMFA 5AKKA 3UG6A 5KYYB 2FGKA 4Q39A 3OE4A 1SBIA 1D0SA 1TYEB 4BJ1A 3RAFC 3LQ2A 4WK2B 4N5LA 1Y5RA 3M6FA 1KJJA 1WE2A 1WB5A 3SIPA 3MFYA 1U8TA 3AUKA 3GJRA 5FKJA 3W4KA 4R2KA 2J5BA 1QC5A 1NQ5A 4S2EA 5C8VA 2W2TA 3RE1A 4XGRA 5AVKA 4A3SA 1ESZA 4ZU6X 1D03A 2G83A 2BELA 2ONYA 4QPJC 1T4DA 1J06A 2DM6A 4PYMA 4ZOLB 5ALQA 1FSGA 3FNHA 2FUG6 2A35A 1PFUA 2CVOA 4X61A 2VUTA 4EB6B 3WWDA 3ESDA 4J1TA 3WFZA 3FWHA 2WFZA 3WL8A 4DRXA 1D2RA 3MTAA 1X7WA 2R2GA 4IUCS 2XBLA 3KYCA 2EW8A 4MPPA 4HAZA 2J30A 4RHUA 4BIMA 4EEXA 1W44A 1IZ8A 1R4NB 2AFIA 2BKVA 1WX1A 2ZS9A 1KETA 1DOHA 3R6WA 4NYMQ 3AKDA 1ZL2A 4O4HF 1A72A 3IJEB 4MITA 5EIBD 3ZDEA 1CFZA 1WWKA 3DQZA 1SXHA 1E3EA 2QTAA 1ESNA 2QS9A 2ORIA 4ND5A 1RZ3A 1SCBA 3MTIA 2IOFA 2F67A 5E95A 2GYWA 2IV7A 1IZ0A 2WSIA 3VX4A 5KTRA 3K96A 3FLAA 3GC6A 1VG1A 2L18A 1PTJA 3U4HA 3HK2A 3N2GB 1Z33A 1MXHA 3L7CA 2FRVA 2W11A 3IODA 1K08A 2QTCA 3GARA 3JYQA 3L40A 2XB4A 4JBGA 4IXDA 1BJKA 1Y9EA 2DQYA 2WYHA 4WASA 4JI6B 4EUKA 5K8TA 3NV9A 3M2TA 3HP7A 4IKEA 1CDZA 3AFOA 3QP9A 1ZZEA 2I8AA 2QTFA 3LJKA 4AQYB 4ENRA 2H4XA 1GKIA 1YULA 1DRUA 4C6RA 4Q9KA 2NZVG 5LD2C 2II6A 1V39A 1M34A 1C3EA 3NHBA 4PQYA 4NULA 1ZI9A 1UJ6A 5PNTA 3UHFA 5C52B 1TUBB 3OQPA 1Y82A 2DOKA 2YIMA 2NQTA 1V3TA 5HKOA 1GNSA 4Y2UA 3LQFA 4JQOA 2ZTSA 3TG2A 1XB2A 1RC0A 1Y3DE 2QN1A 4F3YA 4YMGA 3BCHA 4X63A 5DT9A 3O2QB 4BQSA 4DBLE 1A5TA 1RWBA 1VCMA 1J5PA 1NOIA 2PZMA 3VKFA 1GAWA 2NNWB 5ITZB 1FIUA 4R1MA 3K4HA 1T1JA 2P35A 4R83A 5BSKA 4ZODA 3PZBA 1CEQA 2RGDA 2RGAA 2WVJA 5JAOA 2IPNA 2ONCA 4I4CA 1HDIA 5TC4A 1FVXA 1JZQA 3BDVA 4A9AA 4GLJA 3DVSX 3OIFA 2FMFA 4G41A 2PT6A 4YXFA 3EFHA 1L4EA 3GELA 3MGKA 1SBHA 4YQZA 1J56A 1W6RA 2WJ4A 4YJGB 1MVLA 3KZNA 3P4UA 2Z4RA 4YH1A 7GPBA 3EHEA 1WD5A 2ECKA 2IV2X 2HXYA 2KMLA 2QTBA 3MWEA 4OQDA 1E3DA 4MARA 1RIIA 3A9UA 3M6AA 5BT8A 2VJCA 4IZ6A 1TECE 3VDXA 4C20A 1AK9A 3LECA 1LKZA 4FHEA 2RKBA 1AUXA 5KYGA 3IAS6 3F6CA 4JJIA 3BGSA 1LXCA 1YBHA 3STVA 4AG5A 1N2SA 1ZNZA 5ELXA 2JZNA 2BGUA 2YYAA 1V5FA 2XYVA 3DMYA 3HCNA 3GHYA 4G0QA 3AEKB 4KBFA 2HDOA 3ACBA 1R5BA 1Z2PX 4LXHA 4M88A 3VO1A 1Q1EA 2C8JA 2CVZA 2O2IA 5DTMA 5TRTA 1KBQA 4A6XA 1RYHA 4ZAYA 3TK1A 5AK3A 3ACCA 3LY7A 4RCZA 2W5UA 1SBTA 1T8SA 4HGOA 4JQZA 3AR3A 4JHLA 3TECE 1PSDA 4OREX 3UA3A 1JI3A 5LMNB 4BQRA 3U3MA 3ANLA 3Q72A 2XHZA 1H1TA 1E9EA 1VHLA 3I30X 3H75A 2WHYA 1E92A 1P0IA 2X4GA 4LZWA 3IBCA 2BRUA 1ULUA 2VK1A 2OOKA 3U7HB 3UHAA 4GQBA 3COJA 2IS2A 3ML1A 4RTLA 3FVTA 4CV3A 2GESA 1IZ7A 3JQ6A 5EFZA 2BCEA 3V42A 1U9IA 4LQ4A 5LP1A 4DYVA 4BPRA 1POXA 4K9SA 3EXFA 5CX1B 2GPNA 1HQKA 4MYHA 1E6KA 1P9LA 4LV5B 1YA6A 3NWOA 1E4VA 2QPTA 2Y3IA 3MRXA 4IIJA 4KMOA 1BO6A 2OM6A 4LSZA 4REQB 2QTVB 5AKIA 3RD5A 1ODKA 3E5NA 4ZFNA 2ID8A 3DHNA 4RTPA 2A8YA 2QD3A 3MFQA 5D51S 1F2TA 4QGGA 3FYCA 1E8DA 1GUAA 2XYGA 4M36A 1LVHA 1PYGA 1F0PA 2EHJA 3AIOA 3IR7A 3QLUC 5DULA 3EW9A 3NQ41 4XX1A 1QRUA 1BXGA 3O8QB 4YRPA 4KK4A 1O57A 1BMFD 1Q0SA 3VKUA 2CVQA 1EUCB 5FQOA 3WJ2A 4AJEA 5I7SA 1TNDA 3P9IA 4F21A 1W47A 1X2EA 3LRPA 1BU8A 1AS0A 1FUIA 1HT3A 2Q29A 1HQDA 1VIAA 3NBFA 2M6LA 3TDKA 3ZVNA 2GBLA 3SZOA 2R8RA 1G20E 2B92A 3FMOB 3PDJA 4R2HA 2ZUBA 2GLTA 2OGTA 2P5TB 3ZZUA 3AMVA 2HDHA 2VP5A 4L5IA 1DAGA 2WJIA 1DQZA 3A9CA 5EIXA 4AF6A 3QKSB 3I01M 1Z5UA 2Q9CA 1EK1A 3D54D 4GBED 4WZAE 4ZOBA 1GPLA 2XPCA 3OZWA 4ROTA 5FYQA 1KOGA 2I87A 2WMDA 1BQ4A 1R8YA 1SU4A 2RAPA 1GLGA 1LZKA 1AS2A 3BMQA 1Z7WA 1BMFA 1G98A 1R8SA 1IJFA 1XXHB 3C3BA 5FV7A 3HGQA 3L41A 4N0DA 1L3BA 3ZWCA 3HXMA 2XGJA 1FW8A 3GLTA 3HYNA 1V8PA 2EQBA 1YD7A 3EMVA 1PT8A 1Z5PA 3IUYA 5EWMB 2H2AA 4IIJF 1AXRA 3H86A 3TOXA 1TK9A 4FW9A 4L5JA 5E7QA 1BWPA 3N28A 1RDFA 2GA9A 2AG6A 1IN6A 4C89A 5KJFA 4YJHB 1A8UA 5IXYA 4A1OA 2QK4A 3NEYA 2PKWA 2B2XA 3C1UA 2HADA 3K8QA 4H18A 4IYJA 4MB0A 4FQ5A 4MEJA 2HU8A 2Q41A 4BFYA 4IIYA 5B1YA 4JLJA 3DC7A 2JPDA 2F1JA 5CK4A 3SK0A 2DKFA 1Y4UA 4P0PB 2GILA 2VDQB 3F4KA 1UFRA 3GEIA 3E05A 4Q4HB 4LHZA 1KVSA 3P96A 3S7ZA 2J9GA 5C7LO 5DNYB 1BMQA 3Q7EA 4XX0B 1FVFA 2V97A 3FW1A 1QNFA 3IL2A 5TEVA 3UHOA 4PONA 2DHCA 4AJOA 3MAAC 5DLEA 1H2AS 1J23A 1RTKA 3CH7A 1SUPA 3HN2A 4MS4B 4KFSA 3DO6A 3FMFA 3MEQA 4V3BA 1Q5PA 2B8NA 4F91B 4XVQA 1H65A 5A5FA 2TS1A 3BHMA 3S99A 1RPAA 4GR9A 1EMDA 5FOWA 1RKBA 3JD4A 1SOAA 2Q07A 4P31A 1L5SA 1KJYA 4WT7A 5J5VA 4AMBA 3GNSA 1RP1A 5H82A 3X2EA 1CZRA 3VU9A 5AW1A 1CVIA 3CLTC 1PWZA 5L51A 3H3JA 4YAOA 1DTWA 1XVIA 2C2OA 1DHTA 1M83A 1YDEA 1E6MA 1NNUA 5FWXB 1OB5A 1UT5A 2CLCX 3IXMA 3LBAA 4FHDA 4KWIA 1OWMA 5IW8A 4LOKA 4BEVA 4QGFA 4F5YA 2GF0A 3PYXA 4OK5A 3GFGA 1F9AA 5LXTB 3LE8A 3E3AA 1IXRC 4IOJA 1PWEA 4HDMB 1GUYA 4JGIA 3KKOA 1SZCA 2J5KA 1YB4A 1MB4A 3DUWA 4Z4IA 4QXPA 3Q9LA 4HEJA 4B83A 2CF5A 3EODA 4KV7A 3ILYA 2I22A 1Z0UA 2B1IA 3SF8A 3REOA 5G4KA 2YWDA 1XDWA 2CJFA 4EVIA 5LZ8A 3BKXA 3R9XB 3OIGA 4B35A 4S1VA 3SIRA 2JGDB 2YNMC 5DHAA 4RTNA 5GZ6A 1EX7A 2ZJ1A 1UBSB 1XALA 5DCLA 3H04A 3ZVRA 1FDSA 1KARA 1ORDA 4V0MA 4OHPA 2R1VA 4XB2A 4Z9AA 3CURA 5HMLA 4BAUA 4KK3A 2BMJA 2W43A 4MW4A 3O74A 4CKWA 2VWPA 4D8UA 4GZ6A 2FEWB 2H3EA 3P0JA 3E8SA 3JVUA 4GRIA 1GEEA 4WXPA 1KEPA 2R7KA 2ZK7A 3EGIA 5TQ2A 3CR3C 3QVWA 4Q3EA 3RSQA 3A1TA 1PBTA 5C8ZA 3NW9A 4TXHA 4B74A 5LM3A 1CDDA 2ZJ4A 3QU7A 4ETMA 1ZQ1A 4RIEA 1AE1A 1E2IA 3DAOA 1PHRA 1I6KA 1XEXB 2XVAA 1ZW6A 3GJ8A 3KOYA 2N3ZA 1IG3A 1ADYA 2JDID 2ZRFA 3I01A 4LYDA 4QGSA 5IVKA 1ZQ9A 1CQIB 2A86A 2A9PA 2XMDA 1NDHA 3GH1A 3T35A 1E69A 1QYXA 4PAWA 2ZUUA 1ZGAA 3O26A 3D3WA 2X41A 3L7BA 4B0OA 3WGVA 5JCOC 4C2TA 1FTQA 2GBFA 4K9NA 5CLQA 1H66A 1RHUA 1RZVA 1VL8A 3KSUA 3FLBA 1ZRNA 3R0ZA 4K3UA 4P3PA 4UNIA 3H5AA 3TGWA 5BNWA 2H59A 1DJMA 3JYPA 3JQ8A 5J58A 4N7RA 2ZWAA 4R71A 2CXTA 1ECBA 4ABYA 1JJFA 3PNSA 4HFNA 4X90A 4JLBA 4TQAA 5FNVA 3GJ5A 5H80A 3T12A 4US2R 2O8BB 5BP7A 4GI5A 4B3JA 1G55A 1ITZA 5ED0A 1QOQB 1SM4A 3H19A 3FYHA 4PLYA 1T4CB 2JDIA 2QP9X 1T5LA 3BZBA 1NTRA 1PLJA 4P81A 4B7CA 7MDHA 5KTMA 5L4LA 1FNBA 1PJ4A 1XTVA 2DTEA 1U0TA 3KR0A 3NVKI 3O2JA 1IUOA 1PJQA 3O4IA 1IN1A 3C3PA 2P40A 2V5AA 2VL7A 1CR6A 8AT1A 3M2PA 1IYZA 4ISCA 4ENWA 5ICGA 4W1QA 4DDVA 1C7RA 4Y2PA 3RJ9A 4MUXA 3AVQA 4R05A 1A95A 4X1KB 4RMGA 1XRPA 4L9AA 5H83A 4CXMA 2YVAA 4PYQA 1G41A 2AXEA 2VT6A 3EWNA 2OCDA 3OE1A 2UYHA 3EDYA 2ANCA 3R7SA 5GONA 1W36D 3OCUA 2QZSA 2NPIA 3PC8C 1Z75A 1XQYA 2O5RA 1UFQA 4CM6A 2R79A 3V9PA 4FWTA 2MCFA 2C03A 2PG3A 3J80A 1Z38A 3TMKA 3WL6A 2YFHA 2XSZD 3ICVA 1P39A 3NDPA 4MW6A 3T1QA 3X0DA 4AVYA 3F78A 5B5SA 1NWCA 4TL9A 5LD2B 1JF8A 1KJQA 1RABA 3AKEA 2DB3A 2VK4A 3BB1A 3K5IA 5FD8A 4YUXA 5CXUA 3W3AH 1CLEA 1DEXA 1XL1A 3QMVA 4O8ZA 5FNVF 2ZP1A 2FF5A 3VR6H 4NBLA 4EMUA 2HF7A 5BVHA 5KNDA 4YPVA 2I7DA 2NXCA 2PDAA 3GJQA 2YMPA 3NAQA 4GI2A 2APJA 3L82B 5CH8A 4NHOA 5J3JA 1ZEMA 4LXTA 1T3HA 1RWVA 1ZHFA 5HQ3A 4A5OA 4WXHA 5FUVA 4PZCA 2Y68A 4IDHA 2EARA 4LV8B 3RFXA 4IY1A 3AB8A 2Y92A 3KZMA 4DCNA 4ZYVA 2DXIA 2XSZA 1ZCAA 3DEZA 1SC3A 2JHCA 4JP1A 2QX9A 1XCPA 3FMGA 4I4LA 2QPOA 4TKMA 2O2DA 2GOYA 5BV1A 4YT8A 3O38A 3U5ZB 1CUFA 4RXTA 3U40A 3B3JA 2H5IA 4RS4A 3RC2A 3TQCA 3KBBA 5GONF 4MHOA 3M1LA 2C8LA 2B69A 3K35A 5E0KB 2R62A 1CKEA 1K86A 3KO8A 3LC2O 2IH2A 3KKMA 3E9EA 1ZI6A 1Q44A 1HETA 1PX0A 5IBRA 3ZQUA 3C3CA 2YMQA 1NQTA 2JLYA 2XWJI 4US1R 1VE5A 2I8CA 3UMFA 4KXLA 3UGTA 3ZCTA 5JECA 5JAUA 5JJIA 2OXRA 5IMBA 4C6TB 3I3SR 3BQNB 3ZV3A 4DJTA 1V9LA 5EMLA 4W9MC 3JQ7A 2PV0A 2LIPA 4E1BA 5L3SA 3R7FA 1O77A 3U3JA 4AZ3A 4L2IB 1KIAA 4TVOA 4RTJA 4QPNA 1GCUA 2FE1A 3EOAI 1L2TA 3L6EA 3WJ7A 4CIXA 5JMWA 3THXA 1RLMA 4JIGA 1H0SA 3NATA 2JCVA 1A76A 1P3Y1 2N0SA 3O0DA 4N7MA 4RVDA 5ECDA 2ZIXA 3K1TA 4QOEA 4EW2A 2ZAYA 3H7AA 3RUIA 2REQA 5IS2A 2EFHB 2GMWA 3B13B 1L5RA 2XMQA 4A2WA 4H6WA 1K4MA 1QHFA 1U2DC 1NIPA 2I1VB 2NSYA 4CL3A 4LJAA 3K92A 1G8HA 1OV4A 4FSXA 3KL4A 5JG7A 3U2QA 4BFLA 3FOEC 2IP4A 2HREA 3IQGX 1DXQA 3CUYA 2C3YA 2ZPAA 4P5DA 3ZKAA 2OBNA 4FR5A 2C20A 2R7MA 1RKVA 5I8ZA 2NIPA 3L1VA 2PRYA 2PNFA 4URXR 4BRZA 3K32A 2MSWA 3DM5A 3PUHA 3DLIA 2PHZA 2QY6A 1QRRA 3QENA 4JLDA 2Q5QA 5DTJA 3SBOA 3WNZA 4KRYA 2ZRDA 1V95A 2AOVA 1Z35A 1W75A 4R0VA 4P5EA 5ALXA 4KQHA 1I4TD 1JEJA 2HRRA 5KJ6A 4HYTA 3Q7PA 2GJ8A 2Q8NA 2IZ7A 1PUJA 1RQRA 4UC0A 5CITA 3A3OA 1C1XA 1YR9A 1YU9A 3GMDA 1V1RB 4K28A 4ND8B 3MJ4A 3RTCA 2HU7A 2NTVA 4E51A 2VDPB 4YCNA 4BFCA 1BW9A 3JQPA 4GI7A 1YCHA 2AJDA 4R9VA 4LFAB 1U1GA 3TSWA 2QN2A 2YV5A 3LBYA 5CJJA 1HDGO 3VTZA 4WJLA 1Y6FA 3BK7A 5HRCA 3F1KA 3RHTA 2SNIE 2QAGA 3EK2A 4D46A 5AFSA 1P7CA 1ZNQO 3C3KA 3WWYA 2WFAA 4IS2A 2K7FA 2GASA 3ZH2A 5JMOA 3PNVA 1QPGA 3LQKA 5LYYA 5EHIA 4LRTB 5E1DA 2YL2A 4MQBA 2ZUCA 4MW0A 3RU2A 4TSFD 1YQWA 3V1LA 4QXOA 3RIHA 3DEKA 4RZQA 2Z2IA 1KQGA 1J1IA 2QRJA 3NCHA 1KYIA 2OV2A 1MIOB 1NVXQ 2QGNA 1K7YA 4G01B 4TRNA 4Q9IA 4UOZA 1CIJA 3DE3X 5K05A 1C29B 1LSOA 1GG5A 3B20A 3WLMA 1MRZA 3D6NB 3QMMA 3ZVKA 4Q02A 1AS3A 2EP5A 3DCYA 4NSNA 5KMGA 4XVCA 1WMEA 3N8DA 3LYHA 1WY7A 4YAGA 5NULA 2V03A 1JNYA 3LUJA 4PICA 2WT4A 3NWEA 4S0XA 4TSFA 3ESQA 3GT0A 4NZ9A 3M8KA 3IKTA 3CLSD 2Q9BA 1NN1A 4OJNA 1A82A 3V2IA 4N76A 3ADPA 1KQ3A 2Z2JA 3WKCA 2IXBA 1GL3A 4KRXA 1MKYA 3O9MA 3F47A 2C2WA 5C1DA 1NM5A 1ODIA 1LRKA 2QX6A 3M81A 1ESEA 1OD6A 1M2VA 4WH0A 4EHIA 1OLUB 3GLIA 3AB3A 4ZDKA 4YALA 3RHFA 4O2AB 3MK31 2YTZA 5LVAA 3F6YA 1O96A 3UAOA 5DGTA 4PZEA 3NDBB 2FEMA 3R6LA 2GZHA 2V7VA 3P19A 1RYFA 3TNJA 4DS3A 2MMGA 1FXWA 4WLFA 5AK0A 5CFRA 5T3UA 1CZNA 4TV8B 3VXKA 4P3KA 1NURA 1CUYA 2VT3A 3D6VA 3KKQA 3E1SA 1E1QA 2FQWA 2WVGA 2BFPA 2VJAA 5K45A 4WXYB 1ONOA 4H7PA 1MO2A 3T7JA 2FHPA 4HWGA 4I55A 2HBRA 2P41A 4TMWA 1ZXXA 4HLNA 1R66A 1GRCA 3MW8A 3SQDA 4ER3A 1YL6A 1Q6ZA 3D5EA 4RVSA 1KS9A 5A0VA 3LUPA 5FTJA 4B2LA 2FN3A 5BURA 2JCYA 1T0IA 2OHXA 4QDXA 2ATXA 4N0EA 1QXSA 4UDOA 2OFFA 1MA3A 2HMSA 3RJMA 5SY4A 3GP8A 2ZBQA 2XUPA 2ZSAA 1FB5A 4M22A 2P30A 3FZNA 1GAXA 4DA4A 1BYIA 1XHEA 2FUG1 3VSAA 1SOMA 2CXSA 4HMQA 2FUNB 5KO2A 5HTKA 1WU8A 1LJUA 3A31A 2OHOA 2YVQA 3KT8A 1CJMA 3OTWA 2C83A 3AI7A 1EE2A 4L8LA 5EWJB 1XPOA 2GI4A 5HILA 3Q9UA 2AN5A 4O3FA 2H4JA 3EIHA 4B6GA 5EXPA 3IOBA 2RHRA 2WFMA 1QMPA 1A2QA 2VSQA 3UK6A 3ZJ4A 1G8FA 4LTNA 5AK5A 2R8EA 3C70A 4F84A 2AEFA 2QY9A 5HIIA 1MAAA 3BHIA 4ON9A 3HVRA 4DQKA 1K63A 2ATEA 2JH3A 2P91A 2WZQA 2XF8A 3BFVA 4KU4A 2VJLA 4OGGA 5IKMA 1IN8A 3RCBA 4TXNA 3E3OA 3JTMA 4PQFA 2FN4A 2IH4A 1OSNA 4AX8A 4HO1X 1S89A 3WNDA 3BCUA 4I55F 4BKOA 2FW8A 3ZWYA 4DQLA 1P29A 2V6JA 4DTCA 4D1YA 4CN9A 1EU1A 4HN4B 5G1NA 3S1SA 1RYNA 1W73A 2YOFA 4ZVRA 1E6WA 4Z86A 4ZJZA 1KIFA 4RK4A 3D31A 1CDEA 3F67A 5L4SA 1UOOA 5DW0A 4B6OA 2RBEA 2HDNB 3PXXA 4M9UA 5AOCA 3T3DA 4B3TB 4BPBA 1Z6YA 4DZZA 3H9GA 4R0NA 1E6EA 3C48A 4QWMA 1J7KA 2DTDA 4DEVA 2O1EA 2OC9A 4PINA 4TM8A 3OTIA 2ZSFA 4MUMA 4DSUA 4FSDA 2QLTA 3W5DA 1QVZA 5EMNA 2XE4A 2A67A 4ZOAA 3FKQA 3L7JA 1ISHA 2VJBA 2CFSA 3R76A 2YVLA 1MJHA 3H2KA 3V7WA 1OI3A 1TZBA 4WEQA 2BKXA 5KKAA 2WIFA 1HDEA 1L4BA 2QN8A 2YRFA 1WDMA 4IJMA 3DZKA 1BX0A 1XCBA 2GR9A 4XGNA 4WMLA 3X1KA 5CB0A 3UMMA 1NF9A 4MQ5A 2O0JA 1JVBA 2JLQA 3IT1A 1VE1A 3KB8A 4P4TA 5IULC 5T57A 1MGPA 3FHOA 1JR3E 3WK7A 1UMBA 4G5GA 1MX3A 1LS6A 3IR5A 5JNTA 5KOJA 2JVIA 4GP6A 2YIDA 2ZS7A 4D3ZA 3QM1A 1RWKA 1GGJA 1XCMA 5KAMA 3QNMA 4F2HA 2JARA 1W59A 2WTNA 4MYDA 4HCJA 3AP1A 1AXEA 3C3XA 1HDXA 3EMBA 4NCKA 2NACA 4NMHA 4KW7A 1UJ4A 3ZI7A 4F04A 5AKXA 3CSSA 2DFTA 2WHPA 1DOZA 3WGZA 1SA0B 2C54A 4PZ0A 3ONVA 1AXGA 4BYMA 1W36C 2QZPA 2YWEA 1MC1A 3I9LA 3IAS1 2PS0A 3IQDB 1HTWA 4J6FA 1T9GS 1O97C 3BXPA 3NOXA 4U7HA 1XNQB 3KT0A 2IUUA 1BFKA 3QOFA 1ORRA 4R8LA 2WG2A 2BI7A 4HS4A 5ECYA 4PG4A 1XXLA 2P0YA 2MR5A 4IMRA 1GXSB 2PZBA 4HXFB 2D0PB 4NS1A 5CLIA 4KHPB 2B4YA 3QVJA 1X0XA 1F14A 2OXCA 5IAKA 4CQLA 4HVLA 2YASA 3KSBC 4G8CA 3PDUA 3C8ZA 4S1WA 5I45A 2QUKA 1KBOA 4UMFA 5ALRA 3BCSA 2YBEA 4C4XA 1ML4A 1P9WA 5KNBH 2OBYA 2G3YA 4XOUA 3A9WA 3QHQA 4RQTA 1EK6A 3UY4A 4ETNA 1KI6B 4J3JA 1NW3A 1U28A 1KJIA 3ZHVA 1ZGZA 2I7CA 2OECA 2ZQYA 1JALA 2RH8A 3ENWA 4KWEA 1B4DA 3PHCA 3UF0A 4RA9B 3CONA 3MWYW 4RELA 4NENB 3QMWA 4KYIB 1WIWA 4WQMA 5JV5A 1QRTA 1Y8QB 2AG1A 1BX3A 3DD5A 4GLBA 1EPUA 3TLAA 4F5EA 3M4ZA 3WLRA 2W2OA 4OV6B 3OF2A 3OZDA 5BORA 5BWCA 4DDMA 2QZZA 2HWKA 1CNEA 4LJLA 5ECGC 3SZLA 1JJBA 1LPPA 4MP6A 4RPJA 3S2YA 3VJLA 3QPCA 4TTIA 1YSCA 5B4TA 1PFKA 2XJ4A 2P75A 2PMEA 3E7XA 4MCJA 3UANA 1HKUA 1TZ2A 3HR7A 4XSVA 5ADVA 4DNXA 3KQKA 1UPFA 1BE1A 4DN6A 2GFHA 1FYDA 1RAGA 2C9CA 2JJ2D 2XECA 4D9IA 3PK0A 4Y6LA 2NPFA 2A4MA 3EXAA 3GVXA 4XIFA 1KVRA 2Z2KA 3R74A 3U16A 3PBKA 4DJFC 4DLSA 3N2EA 5E3IA 5HBRA 1KZGB 1SGWA 4L8VA 5JS1A 3I1JA 4M8LA 4XASA 3SQLA 3UMBA 4RANA 2VDVE 3MJEA 2XMGA 1MAWA 1QIJA 1V0JA 1ND6A 2R7AA 3QUBA 4QOJA 1VCHA 3ICOA 5ITWA 2K6GA 1GG9A 3H5IA 1BRMA 3BXOA 2WUVA 4BKMA 5G1OA 4JC8A 2BFBA 1D0IA 4YMVA 4QDUA 4X9XA 4FWIB 2EKZA 4IO0A 1HLFA 4KVFA 2JJ2A 3JRWA 4OK3A 1DV1A 3RC7A 3W1VA 1S0UA 1G21B 3IYLW 3KJEA 1N6IA 2HQ1A 2MYNA 2PMFA 3RSHA 1YE8A 2XB6A 1YOVB 2FYTA 1PZNA 3NVAA 1WMBA 4GLFA 4A4DA 1ZRHA 2JZCA 2P8SA 2Q3BA 3HY6A 4BO3A 3RC8A 3OC6A 2QZ4A 2Z43A 4JJAA 4R2XA 2CVFA 2VF8A 3D1JA 1X77A 1JP7A 4QAJA 2E49A 2HIGA 1YC2A 1RWMA 5F2EA 4YP9A 3V8BA 2V1UA 2EKQA 3RO7A 1CY0A 4QU5A 2XRZA 2VOEA 5E7IA 1FSSA 2D59A 1K8YB 3OJ0A 121PA 4JP5A 5DSZA 3RKUA 3HFJA 4UNSA 4X20B 4WZBA 4X6UA 3CKKA 1ZMRA 1IY1A 4KEAA 1WHSB 2F4NA 4OUKX 4DG5A 2GEUA 5F7JA 3KEQA 4LJ7A 3NV7A 4FEAA 4RVGA 3HACA 2OFPA 4DIFA 3OLXA 3FUTA 2W6CX 4LYGA 3QK7A 3RU9A 3V2UA 4D4GA 5CBPA 4H1WA 1P7WA 3KJNA 2GQ0A 2YIJA 3LLUA 1NVMB 2NV2B 1DC5A 4TSRA 1N4DA 1PVDA 1PX2A 3H8JA 3WYNA 3IOYA 3EVEA 4FDLA 4ILKA 4QNRA 3W2GA 1HORA 1KMQA 2A2ZA 2ZWPA 3EZNA 3BF8A 5BN5B 2W8BB 2A5DA 3QFFA 3D64A 1V7ZA 4TWJA 5KKCA 4D97A 4F85A 4C3OB 1N8KA 4BB5A 1WV1A 1DKMA 2C5EA 2DPHA 1FUYB 2HHCA 3EGCA 1DUVG 5FOUA 3UTDA 2JVKA 5AVWA 3DKKA 3PUWA 3SR3A 2KS6A 3SEAA 1GL9B 1ZMBA 1V9SA 5B3AA 2IOFK 1LI4A 1L4NA 4I1SA 2UUOA 3WJAA 1VL1A 1JEEA 2JD2A 1HE2A 2FP4A 4IEFB 3TD2A 1PQ4A 1Q7BA 1E1MA 2QMOA 2XCLA 3E4CA 1VGQA 3L0IB 3ND6A 4YMTA 3AR4A 2JA2A 4Q4JA 1C0KA 4BVKA 1HYQA 1RXYA 1VRCA 2AX4A 3DMNA 3Q10A 3LF2A 4MWBA 3KD3A 5K3FB 1P7YA 1XSEA 3V8VA 2EFEB 2DU8A 2PBLA 3C97A 5AW9A 4P22A 1Z2CA 1JLHA 3GYGA 4HGQA 4KMSA 4CMEC 1W4AA 2OA0A 1V8OA 1LSSA 2BN4A 2OLJA 5I7OA 3VZRA 1RACA 4RAQA 2ONKA 2Q6OA 2G1KA 1U4SA 4ZK2A 2J5XA 3ZLBA 4IJQA 4Z4GA 3SDSA 4G09A 1ZJ6A 1L5VA 1GRRA 4RVNA 3FMIA 1Z28A 3ER6A 1NT4A 4B31A 2O1XA 1ONBA 2PZJA 1YQTA 6NULA 5A6VA 2AJCA 4EVQA 5A7FA 3K9WA 2C7VA 5JNWA 1CUXA 1FQOA 2JLXA 2ZYGA 1L7MA 1EUQA 5C2JB 3HWSA 3OT4A 5EKUA 4GL4A 5EN4A