3H1AA

Crystal structure of este5, was soaked by ethyl alcohol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
296
structure length
296
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 104
structure length 296
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1aA00
2JEZA 4WFIA 5ALDA 4N5IX 3FCYA 3L1JA 4JYMA 5D6OA 4ROTA 4L72A 2QUBA 5LYYA 4CCYB 1X2EA 3FOBA 3WIBA 5JD6A 4QWMA 1XZDA 5AOBA 3HXKA 2JGEA 1ZI8A 4CIBA 1XQXA 4DTCA 3WKDA 5YASA 1R3DA 3FVRA 2XT0A 2H7YA 4BTLA 5CXUA 1AUOA 1DWPA 2AJLI 3DCNA 4HAIA 5AKYA 4WFJA 4MWTA 5FKJA 1R9MA 4GWLA 4MEAA 3HLKA 5FV4A 2XUFA 2OCLA 3I6YA 4AB1A 2QXTA 4KRYA 4Y7DA 3L1IA 3ZLUA 3RM3A 1P0IA 1UOQA 1ACJA 5E4YA 2O2GA 2YH2A 3F97A 1WM1A 1ZIXA 1IVYA 3KD2A 5T4EA 1CUVA 4MEBA 5T4FA 4A16A 1YS2X 1VOTA 2X8BA 2IX9A 3R3VA 5ALNA 1K8QA 3HACA 4UHCA 5AH0A 1XZEA 5C8ZA 1YA4A 2VSQA 4H77A 5AHXA 2GBIA 1WHTA 2HA0A 3C43A 1QIDA 2CZQA 4ARBA 3WWDA 3W9UA 5AOAA 3K2IA 4N8DA 5CW2A 1HQDA 1XZMA 1LLFA 4B0OA 5AK5A 2PM8A 4KR0A 4MQLA 5HZGA 1L7RA 4GDMA 4K6KA 1AMNA 1TKRA 4LXHA 3DYIA 2GYWA 1UK6A 1UK8A 3E4DA 2FUKA 4MYDA 1TCBA 1DU4A 2JBWA 1DTEA 3O9MA 2XE4A 2WU4A 2XMBA 3I2IA 1CUJA 1MJ5A 1TQHA 5KWIA 2D0DA 1VA5A 1MNQA 5LP1A 4UHBA 1PJAA 4AZ0A 2HU8A 2VATA 5JZ9A 1MPXA 1ZOIA 1XZJA 4HXEB 2XI4A 3DKKA 5AM0A 1DWQA 2J4CA 4OSEA 5EI5A 4P08A 1DX6A 4UBMA 3WK5A 2XUJA 3M81A 5E2IA 2PSJA 4E15A 5KWJA 1JJBA 4P93A 5ALFA 3SWWA 1ZI9A 5BV7A 3WJ2A 3WWCA 2HU7A 5AI4A 3BJMA 5ALEA 5CH8A 1H2YA 2ZJFA 4G4IA 4ZREA 1EDEA 4GBGA 4BCDA 3QM1A 3O4GA 5EHXA 1X70A 1WB4A 5AK3A 1CUBA 3R3UA 4H18A 4BCCA 3BDIA 2ZSIA 2WJ3A 3OG9A 1W52X 5AO9A 3EQ9A 4IH9A 1C4XA 3OC0A 4B9AA 2RI6A 1IZ8A 2DHCA 5SYNA 5K5EA 4U2GA 4U2BA 1U8EA 3DOHA 4Y2VA 4HZGA 1ODTC 2CEKA 2WG2A 3I2KA 5HF8A 2R8BA 2GYVA 1JU4A 3G8YA 4EB0A 3WK6A 2QS9A 4BE9A 2HRQA 3JYHA 4X6UA 1AC5A 5HF9A 1QE3A 1IUNA 4B9EA 5AKZA 4J3JA 5JATA 3D2BA 4FLEA 1XRRA 2Y1KA 2JGLA 1MNAA 1VA4A 2QKYA 4DNPA 1XFDA 1UKCA 3H0CA 5ALPA 3QPDA 5ALIA 2B9VA 2EDCA 4WJLA 3GA7A 5JALA 3DD5A 3SC2A 1CRLA 4B0PA 3C6XA 1CUAA 4O08A 2XUQA 1C7JA 3N2ZB 4BAUA 5ESRA 3WQHA 3V1KA 3CXUA 4EA6A 4H35A 5D3ZA 4N8EA 6YASA 5FXMA 4DSZA 5HK9A 1DQYA 1EI9A 1E3QA 4BAGA 1R9NA 4FLFA 1L7AA 3G9ZA 5K3BA 2XMDA 5T4BA 4QWWA 4QEKA 1BROA 5DWDA 5K3FA 5EGNA 3STVA 2WFMA 3E0XA 2XUGA 2JF0A 2WFLB 1QZ3A 3IIIA 1CUYA 1R50A 5DNWA 4K5QA 3W05A 3WL6A 1Q84A 5T4HA 3LP5A 1X2BA 4AO8A 3OOSA 1JT2A 2Z3WA 3D2CA 5EIEA 1THGA 2GBGA 3PDCA 3V1MA 2V98A 5FP0A 4EY5A 1DQZA 5JZSA 1IZ7A 4H7HA 4QLAA 1QIIA 1J1IA 3DJYA 4OPMA 4UFPA 2AJ8A 1K63A 2VJCA 1AX9A 2PSEA 2WM2A 3QZUA 3D7RA 5C8XA 1EXWA 3AZQA 3DKRA 1S8OA 2OPHA 3A2LA 3B3QA 3QYJA 1XZGA 2X76A 5CH5A 4H7FA 1K5PA 1EHYA 2WIGA 4JNCA 1F6WA 2V9ZA 4FHZA 3YASA 5JD4A 5ALZA 2WTNA 1U65A 4CCWA 1TRHA 2WUFA 1QOZA 4QDOA 2HA2A 2GBCA 4X85A 2RIPA 5BOVA 3IB3A 2QVBA 3WLAA 4H7KA 4FTWA 1XZAA 5HF6A 3M83A 2WIJA 3M3DA 2PUJA 5JASA 1QFSA 1A8SA 3ED1A 4TGLA 3PFCA 3BXPA 4MXDA 5FUMA 2QOEA 4UFOA 1G66A 4WCVA 1A7UA 3E1GA 2HFJA 4AMZA 2WIFA 1VZ3A 5HF5A 5HCUA 3C8HA 1XQYA 2WHQA 3AILA 4FDMA 5AK6A 3R3YA 4K6GA 1N8SA 2PL5A 3H19A 3G7NA 1BCSA 1Q0ZA 3VJKA 1WHSA 3MVEA 3FWHA 1ZGBA 2I3ZA 5AI6A 5LZ7A 1JFRA 1IUOA 5CURA 4FMPA 2J4FA 2Y6UA 2HADA 1OXMA 1XRPA 2HA6A 1EB8A 4HXGA 2WTMA 2VAVA 5I8PA 4JH0A 2Z8XA 4OCZA 4CI9A 1EB9A 2I03A 3WKAA 3H2GA 1QIKA 5JANA 2PSDA 1J2EA 3VKFA 1SOMA 2C4HA 2OXEA 3D2AA 5EIAA 5LZ4A 4MYSA 1QIHA 3KSRA 5E4JA 4M0MA 1UWCA 4Y2RA 1HDEA 2C5FA 2QM0A 1UXOA 2FX5A 5KBYA 3G0DA 1EDDA 4G5XA 2ZYSA 4B80A 4EY7A 2LIPA 2G4LA 2Q0XA 1CUWA 4PO3X 1P0MA 3V48A 1E5TA 3WWOA 2OCGA 3AZPA 2B61A 2YXPX 1W75A 1LPOA 2VF2A 4OUKX 4RGYA 4BAZA 5AKKA 4NVRA 2OGTA 1LGYA 4EY8A 4QDUA 5CT6A 5AKHA 4EHBA 4BRZA 4U2DA 4Q34A 4CG1A 1I6WA 3G9UA 4N8SA 4FLMA 5JARA 3VISA 3OPMA 1CUSA 1VZ2A 3BDVA 4PF1A 5LKRA 2AJCA 4KACA 3WK7A 3GROA 1MX9A 3STTA 2RHTA 4A23A 1ZD4A 5CXXA 3G9XA 4AQDA 1GQSA 3H04A 3MUNA 1MX5A 1E66A 1QLWA 5LZ8A 4ETWA 5FPPA 1VE7A 4LXGA 1MAAA 4BVJA 3QITA 2VQ6A 3H17A 4PV7A 4DNQA 4X6XA 1EINA 4WFKA 2ACKA 4PQEA 5JD5A 1HPLA 1CUZA 2XLCA 3ZLVA 4UFNA 1THTA 2XB6A 1ACLA 1KEZA 3FSGD 3ICVA 5C81A 5I9IA 1UT6A 1CPYA 2EDAA 5J3JA 4W1SA 5FRDA 1A8QA 4BE4A 3BE8A 4H7DA 3STUA 2ROQA 2WJ6A 4JEIA 1WCYA 4C89A 3A2MA 2WJ4A 3WK9A 1GT6A 4EBBA 2OG1A 3B5EA 4B85A 2ES4A 4B7ZA 3F98A 1JKMA 4C4ZA 1YB7A 2ZYIA 5AOCA 3G02A 1SFRA 2WG1A 3HI4A 4NMWA 1EDBA 2G5TA 1XQVA 4BDTA 1U4NA 5IVDA 5AKIA 3DYVA 5ALVA 3L1HA 2CKMA 5AM2A 5HKAA 5AKEA 4IQ4A 2WUDA 3QPCA 1LPNA 3O9VA 1XZBA 3DDUA 3P2MA 4YK7A 4IH4A 5FDFA 1KU0A 2PKYX 3I6MA 4QDTA 4IH1A 1NU8A 1CQWA 1CUFA 1T2NA 1ZGCA 1LPPA 1QIMA 3IULA 1CQZA 4DGQA 2VEOA 4QA9A 4UHHA 1F8UA 1ODSA 3T4UA 1HKHA 4N5HX 3AUKA 3SX4A 4UBNA 5CT4A 3T52A 4G4JA 5CTAA 3IUNA 2XUKA 1H22A 1Q0RA 4KAFA 3OM8A 2ACEA 4DMHA 3QVMA 2Y6VA 4WDQA 1CEXA 3O4HA 2BGNA 1AZWA 4H7IA 5LZ9A 1TCAA 3I1IA 3NGMA 4FNMA 4DLNA 3IUQA 3KWJA 4W9RA 3I2HA 1SCQA 2ECFA 4UBLA 4Y2XA 1CIJA 1B6GA 2QTBA 1UOOA 1WOMA 4FOLA 3LS2A 3W06A 1USWA 1N5MA 3I2JA 3R0VA 4X91A 3WJ1A 1ZI6A 4BRSA 3H18A 2VT7A 4ZV9A 3FYUA 4GECA 4JUIA 3Q8WA 3QBJA 3ESCA 3OTQA 1YAHA 1W6RA 2XUHA 4Y2SA 4OYLA 4GEGA 3F67A 3AIOA 5AI0A 2BJHA 3IURA 5JAUA 1EX9A 1LZLA 1ZJ4A 3R3XA 1JMYA 4TVKA 4DYHA 2WHPB 2XUOA 3FCXA 4RPCA 4A5SA 3O4IA 5JAPA 1AGYA 1H2ZA 4HS9A 5AKGA 3WA6A 2R11A 4DMCA 1TIBA 1XLVA 1FSSA 4AZ3A 2HIHA 1UKAA 1XRQA 1ZD5A 1GPLA 5CRIA 2VJBA 3H2KA 4RNCA 1QIGA 4X97A 4Y2PA 5AIBA 1LPMA 3LIIA 2DHDA 5HK8A 5LZ5A 4QNNA 3DL4A 5CBKA 4DSAA 4B81A 4H7EA 4DMKA 4W63A 1YCDA 2QXUA 1U2EA 4G8CA 1UOPA 2OGSA 1TAHA 1YR2A 2RGUA 3HZOA 2IITA 4OD0A 2V97A 1TK3A 3UMJA 3K6KA 1YASA 5JAOA 4DMFA 1E8MA 2DQYA 3AIKA 5ALGA 3HABA 1O6GA 1CFJA 1MTZA 2I3DA 5EHQA 4BVLA 4B83A 1XRNA 3D0KA 4QZVA 4PNZA 3PICA 3WL5A 2WFZA 2VA9A 2H7XA 1R88A 3BIWA 3D3NA 5CT8A 4NS4A 3EQ8A 2CJPA 3LIPA 4Y2YA 4F60A 1R1DA 1ORVA 2O2IA 1E8NA 4TPKA 5HQ3A 2PPLA 2VTVA 1BEZA 1BRTA 4K2AA 4OB7A 1UFOA 1XLUA 3JW8A 1SC9A 4BP8A 2ONCA 5AM5A 3IBTA 4E14A 1K4YA 3VXKA 4V2IA 3ZI7A 1GZ7A 3AINA 2HRRA 4Q1VA 1D07A 1FFAA 4B6GA 1PFQA 5A7HA 2OAGA 3C70A 5FLKA 4BC1A 1LBSA 3I6ZA 1KU6A 1EK1A 3DNMA 5JIBA 2YYSA 4PSCA 4L3WA 5FPQA 3PFBA 1QTIA 5JYCA 2HL6A 3FNBA 2OCIA 1TCCA 2ZYRA 4OYYA 1BN7A 4RE5A 1FFDA 2QMQA 2H1IA 2QJWA 4XWGA 4LYEA 4AXBA 1OILA 4GI1A 4YPVA 5A62A 1XZCA 3GFFA 5A7FA 1CUXA 1GGVA 1QGED 3D5EA 4J0GA 2QRUA 2DHEA 4XJVA 4LXIA 5AM3A 1L7QA 1CR6A 5ALSA 5K3EA 2J3QA 1QO7A 4U2CA 2PBLA 4CFSA 3E3AA 3HSSA 2UZ0A 2JEYA 3O95A 3WYNA 2C7BA 1FFCA 1WPRA 2RONA 4EZIA 4RE6A 3WZMA 3GZJA 4BCBA 2XUPA 4KYVA 1XZIA 2C0PA 3UUEA 3CN9A 1N1MA 4KAJA 4CCYA 5JADA 4XIIA 1DX4A 2BUCA 3CN7A 3H1BA 3ESDA 3DLTA 2XMQA 2HA5A 1H2XA 3TEJA 3RKSA 4ZWNA 1W4LA 3DL7A 4J0KA 3HRHA 4FFVA 2WSLA 4ZXFA 1E8DA 2ZVDA 4F21A 3O4JA 4BZZA 4P92A 2HDWA 3FLBA 1GPNA 2XUIA 2DQZA 4Q3OA 1HLGA 4D9JA 2WIKA 4M0FA 4QLOA 3D59A 3DEAA 3FLEA 4G9GA 1QO9A 4H0CA 4X90A 1CLEA 2Y2VA 1W76A 3FYTA 4B84A 1XZLA 4Q82A 2Z8ZA 4Y2UA 3C87A 1BE0A 4GLBA 2OQIA 4B82A 4C6HA 2XQGA 3H1AA 2WLSA 3KDAA 2G5PA 5AKLA 4EY4A 3AFIA 2CUTA 4J0HA 1WB6A 4IHAA 2C58A 2ZSHA 4NZZA 5C7YA 5AI8A 2PU5A 3H2JA 5LKAA 3WL7A 4AX4A 5DYTA 3CCBA 4OB6A 5K3CA 1MU0A 2XQJA 1SCIA 4J0JA 4BC0A 4BP9A 3CCCA 5ALKA 2BKLA 2JGMA 3I28A 1UK7A 5DJ5A 3HYSA 1JJIA 5AK4A 1XKTA 5SYMA 2CB9A 4J7AA 3A6ZA 1BS9A 4G1FA 4KE6A 1GXSA 3STYA 1JMKC 3RK4A 3TGLA 2VT6A 1EH5A 2WG0A 4KRXA 4OB8A 5EFZA 1LNSA 2WHRA 3FBWA 4C88A 4K6HA 4UBKA 5I7UA 4WY5A 3RARA 2QJRA 1J06A 4X93A 3PUIA 1CUUA 2B20A 3I2FA 5CT5A 4JYPA 1E89A 3VVMA 1XZKA 3V1NA 2XQFA 4BVKA 3R3ZA 4MWSA 4XVCA 2OQVA 3AJAA 4LYDA 3AZOA 3QMWA 2YASA 3ESBA 4KAAA 3G0CA 1AQLA 2B4KA 5CT9A 4IO0A 1BEEA 4HVTA 4FFWA 1ZIYA 1FFBA 2W6CX 3G0IA 3FYUC 4S0XA 2PUHA 5ALMA 1O6FA 3G0GA 2XUDA 4W1PA 1QONA 3IVMA 4C87A 3PI6A 3F8SA 3C8DA 4AO7A 4INZA 1QJ4A 2WHPA 3VDXA 4HXFB 3G0BA 4AN1A 2O2HA 3V1LA 2HA7A 4H7JA 5ALTA 3C5WP 3G9TA 3F96A 5LZ2A 2QT9A 1LBTA 4F5ZA 1YAJA 4X3CA 2ZJ7A 1N5RA 3LLCA 4HRYA 2G63A 3F9CA 3TRDA 2XMZA 4Y9SA 2K2QB 1ETHA 3IDAA 3ZLTA 4CG2A 5HKBA 4L0CA 4G8BA 3MGAA 2E3JA 2NW6A 4J0CA 4X95A 5DNVA 1OCEA 3OURA 2OAEA 3WYDA 2XMRA 5DYWA 3VJMA 2QR5A 4BDSA 2W22A 1A8UA 4PSDA 4LIPD 2I78A 3N0TA 3ILSA 1ORWA 4X6YA 5A7GA 3BJRA 4BATA 4QDXA 4J03A 5AM1A 4EUSA 1GKKA 3WIOA 2CBGA 3KXPA 1MX1A 3ANTA 1ZD2P 5AKJA 3M82A 4AMYA 3PE6A 1GPKA 2GYUA 4Y2QA 5JZBA 3Q0TA 3ANSA 1GKLA 3FVTA 5IKXA 1Y37A 2PVSA 5AI5A 3W04A 5A71A 3TJMA 4KEAA 2QUAA 4G8DA 5D7BA 1EA5A 3U1TA 4C01A 1B41A 1P0PA 1H2WA 2H9YA 1DT3A 3WZLA 1ISPA 5ALLA 5A6VA 4UHFA 1QTRA 3BF7A 2XMGA 5FOQA 4ITVA 3ICWA 4U2EA 3D4LA 1QIJA 3SK0A 1MT3A 1RWQA 3C6BA 3JWEA 1YA8A 5JAHA 1EK2A 2XQIA 1AURA 3QMMA 4UHEA 3ZWQA 4M0EA 2WFLA 2EEPA 1H23A 2BUAA 3C6ZA 1JI3A 5ALRA 4AO6A 3NOXA 4PW0A 4BB0A 4OU5A 1J07A 4FWBA 2CMFA 1P0QA 3WI7A 2BCEA 1W1IA 2P8SA 5CH3A 3HC7A 3H2HA 4C4YA 3GELA 3I1YA 2VJAA 4J0DA 3WK8A 3BF8A 2HA4A 4BYMA 3NWOA 1FJ2A 5AI9A 1ZJ5A 4ZV7A 1YSCA 4MQMA 3EIOA 2HHAA 4W1QA 2OCKA 4KE9A 3AIMA 2HM7A 3C6YA 1HBJA 5EHZA 2JGKA 3QH4A 1MN6A 1QIEA 1VJ5A 2GBFA 1M33A 1XQWA 1UK9A 5DYYA 2XMSA 1G5FA 4CIAA 1R4ZA 2FJ0A 5ALJA 4XX1A 1IMJA 4W1RA 2Z5GA 5AP9A 4BBZA 4E11A 2JGFA 1DWOA 3A2NA 4X94A 4Z49A 3X3HA 3EF3A 5D3KA 2GZRA 4I4CA 3WKEA 3W9BA 4PSUA 4Y2TA 1QIFA 2DFPA 5BWBA 5K3AA 4QE3A 5AICA 1A88A 2XUAA 1F0PA 5ALQA 4Q3LA 4J0IA 2HA3A 2PSFA 4KE7A 4YASA 3S8YA 2WILA 5IVKA 3WKCA 1RYYA 1YB6A 4UHDA 4FBLA 4KE8A 3QMVA 2DCMA 1WB5A 4DNOA 3GBSA 5ISMA 4X7BA 4MJ3A 5ALHA 2WU3A 4Y2JA 2FJPA 3WA7A 1JU3A 1XZHA 2JGIA 3C5VA 1QFMA 1SCKA 3R41A 2PSHA 4U2FA 1XZFA 1Y7HA 3KOOA 3BWXA 5ALOA 4YX9A 4X92A 4HTAA 5ALXA 3FYUB 4G9EA 5EIHA 1XKLA 5H3HA 2C0QA 5E4TA 2X5XA 5K3DA 3HEAA 3HJUA 1LZKA 1CUGA 4I19A 5ALWA 2V96A 3PF9A 3WWPA 3U0VA 1CVLA 4HRXA 5A2GA 2XDWA 5HFNA 1C7IA 2WUEA 1CUCA 1CUEA 1NU6A 4CG3A 2AXEA 1BN6A 4FNGA 4FBMA 2Y2UA 3FAKA 3EBLA 5DNUA 1G42A 2ORYA 4BTVA 1ZD3A 2PU7A 1K6EA 3ZV7A 4ZRDA 5DTJA 2H7CA 4Q3KA 4C4XA 1JJFA 3PUHA 1UZAA 1XRLA 4ARAA 5IVHA 2BAGA 3GUUA 3BIXA 3B12A 1XROA 5AKXA 1BU8A 2BFNA 2BUBA 5EHNA 4DNFA 4BZWA 3ZPXA 2WUGA 4DM7A 3WMRA 1CUIA 3R40A 1Z68A 4I3FA 3FSGA 1EVEA 2OLEA 1RP1A 1FFEA 3LCRA 5IH7A 4UBJA 1IUPA 3IA2A 1GQRA 1LPAB 1HL7A 1CUDA 3EQ7A 5C8VA 1T4MA 7YASA 3IUJA 1G4HA 4UPDA 2WIDA 4E46A 4KJXA 2XMCA 1F0NA 3WKBA 4UUQA 1VE6A 3BL8A 4ZGBA 3W2TA 2ZJ6A 2BGRA 4G4GA 1ODCA 1VLQA 1Q83A 5HQ3B 3ESAA 4X00A 4WDRA 1VXRA 2J3DA 3K9BA 3O0DA 1CUHA 1XLWA 2O7VA 3IUMA 5K3FB 3QPAA 2VAXA 3STWA 1YS1X 4Q05A 4GXNA 1UKBA 4AN0A 2OGZA 4WY8A 1VKHA 3S2ZA 3STXA 2AJDA 5AM4A 3H2IA 4F0JA 4GHWA 1BCRA 2RAUA 4L9AA 1DT5A 3FLAA 5AJHA 3KWFA 2HU5A 5HFAA 2JIDA 5IVIA 1ZICA 1MAHA 1EVQA 5KREA 5BWCA 4EY6A 3RLIA 3V9AA 2DR0A 2ZYHA 3WL8A 1DINA 2DSNA 3I2GA 4X71A 5F4ZA 2PX6A 2D5LA 3PF8A 4GW3A 2XLBA 4FKBA 2QZPA 5LLSA 5ALYA 3A70A 4UBIA 3NUZA 1VXOA 4ZI5A 4LKOA 3DOIA 2XQKA 4LHEA 4UBOA 1LPSA 5ALUA 2C5GA 3MUOA 3DQZA 1CV2A 2AJBA 2IIVA 5DTIA 3VVLA 2WKWA 4OU4A 1Y7IA 5DLPA 3WWEA 5AIAA 1LPBB 4DIUA 3C45A 1AKNA 2WQZA 3VJLA 2HFKA 3R3WA 5CMLA 2VJDA 3WK4A 1PV1A 3DS8A 3UUFA 2JGJA 1MO2A 1WPXA 1XRMA 2O7RA 2RHWA 1NX9A 4QDZA 2Z3ZA 5LIPA 4P9NA 2GZSA
chains in the Genus database with same CATH superfamily
4DARA 1NR1A 1MRSA 3RTDA 2WVHA 3P0RA 5DKFA 4F4DA 1T4CB 3EUFA 1V6CA 4N5IX 3FCYA 3RIMA 2FZ5A 3ND9A 4YUZA 1UWLA 3UPUA 1NBMA 1Q0TA 3R8CA 4ZC8A 3TQQA 4CIYA 2E85A 1GV0A 3LJKA 4QPPA 3ZXXA 2IWHA 3QVWA 4BZPA 5I7RA 4CEJB 4CCYB 2NU6A 3RADC 5I5GA 1G8MA 4AWBA 1Z4NA 2FUNB 3SQDA 3BDAA 2PT6A 8MHTA 4G1BA 1PQ4A 1XZDA 2OL4A 5DMXA 2MDTA 1KHTA 1MV5A 2KLHA 2P6NA 3OCZA 4CIBA 3ANYB 3I3SR 3WRXC 3QUCA 1PGJA 1OAOA 2PMKA 3KV1A 3EC1A 3PG5A 1U0NA 1VG1A 1ZW6A 2HH9A 2UVQA 4GVLA 4I6GA 1KO5A 3WKDA 2JK1A 1SVNA 1X1SA 3FVRA 2XT0A 2W48A 4QGHA 2YWDA 3QFRA 3I9JA 4RTJA 1G6HA 1MC5A 3WO1A 3KB8A 3WGVA 5LUBA 2RHLA 3GN2A 1UWKA 1E7WA 4G25A 4ZHQB 1G2OA 1F8XA 1UJ4A 3DZHA 1I3NA 1X13A 1T9CA 2NO5A 4HAIA 4HWRA 4OHUA 3HP4A 5GVSA 2BGIA 1ZDMA 4Q4HB 3BHMA 2BN4A 2C31A 1CJSA 1UFVA 4JL6A 5FKJA 1FFXA 4MEAA 5FAKA 1OHHD 2YOHA 3BXZA 1E6UA 3M4YA 4LTMA 3T12A 1XTTA 1I0ZA 5A06A 2ZPUA 1T15A 1XEWX 2C7QA 4WV3A 4WCFB 1U7PA 1YS9A 1T24A 3V7NA 3H2ZA 1OIWA 1YU9A 3KOWA 3GLQA 3LOPA 1SQSA 3PX7A 3GMIA 4ZEXA 1IWPB 4PAOA 1P0IA 1NVGA 1ACJA 3G5MA 4YCMA 5GM1A 3PXGA 1BGWA 5E4YA 3OHPA 2QDXA 2C57A 4P32A 1YR3A 5DM0A 4D9NA 1YZFA 1JQEA 2FWPA 3QEMA 4FYIA 4U8HA 1ZIXA 5BT9A 3NCTA 3TAHA 3KD2A 1ZA2A 2LP4Y 5T4EA 4RQUA 3HCOA 4M99A 2AI3A 2YWEA 3MTJA 4MEBA 5T4FA 3ZY2A 4EDFA 1ZAYA 2B9EA 1UM8A 4QOEA 1TNDA 2G83A 3MZ0A 4MUAA 2RC5A 4GWGA 5FL3A 1TFRA 1YS2X 3A3NA 5DCYA 3OFKA 3UF0A 4HVLA 1GGEA 1XZ8A 1KIMA 1JRLA 1FXUA 1Q74A 1T1GA 1EBBA 2ADOA 3U7FB 3ZTTA 4Q93A 3T5GA 3ZGLA 5AH0A 4MLCA 2J7PA 4OKSA 4RDIA 4BUCA 4E1AA 1XZEA 2Q1YA 1YA4A 2OOSA 2VSQA 5TQ0A 2N9UA 2QHXA 3MXTA 3OFND 3SU8A 5LWHA 2GBIA 4PNEA 4ZTUB 4TT3D 2HA0A 1U2GA 4OI0A 2BF7A 4X20A 2R3SA 4RTKA 2F64A 1CU1A 2ZANA 2V7TA 4WHMA 3GLUA 3L8HA 4PFSA 2HLHA 1Y8QA 1ATZA 4WZBB 1G1MA 2B36A 3LDHA 1VTKA 3W5JA 4ZZ3A 1H93A 3TRKA 1ISJA 5BXQC 2JL1A 3PFNA 4ITUA 5EWJB 2N3ZA 3ZX4A 4L51A 4QPZA 2XIQA 4DA0A 2I8CA 2UYHA 1PNVA 4N8DA 1RZRD 5EMJA 4JVSB 3G7SA 4KQJA 4NPAA 4NPHA 1LQ2A 3QQPA 3H4TA 4DIEA 4FFRA 2J48A 5BNWA 1E1YA 4YRTA 4BFXA 3WS7A 1N36B 1VL6A 5HZGA 1L7RA 2ONZA 1WCV1 4I1IA 1Z6QA 4MAMA 4B5KA 4ZEVA 1QVZA 2O6HA 3P2EA 1Z15A 1NJ1A 1NQVA 1COZA 1HT2E 1VFPA 1ZD9A 2BPOA 1ZRHA 3IMEA 3RAPR 4NZMA 3UBTA 2GYWA 2NT4A 3PXEA 4YUVA 1KWGA 1UK6A 1ZUWA 2PHZA 5KKNB 3IKLA 4QFBA 3LVBA 3GDWA 4C5AA 4KR3A 4AYXA 4MW6A 4AS2A 3RFUA 2F1RA 3EGCA 2AI1A 3EXHA 3LHKA 1FF9A 3TLAA 5IZCA 1A76A 4A8HA 4WLOA 3AVYA 4YCDA 1DU4A 2JC3A 3MMXA 3O9MA 3B1XA 3NBUA 4Y1EA 2BGWA 2PWZA 4GMHA 2CJYA 1VLJA 3LW8A 4NBTA 3MINA 1YC2A 2XMBA 3JQFC 3I2IA 3FWNA 3NHKA 1CUJA 1MJ5A 3IIKA 1VA5A 4QUHA 3RFVA 3IVGA 3KETA 3O8CA 5ENDA 1L5HB 3TKYA 2ODBA 3DH0A 4R1LA 2ZUFA 1TJ5A 1E3WA 4KFTA 4MV0A 1HM5A 4ALIA 821PA 4FK8A 4QIHA 1XTKA 4WOCA 4F8EA 3CV3A 2QDKA 4W7IA 5MFPA 3GGJA 4Z0HO 3C3AA 2HIMA 1LTHR 3NYRA 1ZOIA 5DHUA 4S24A 4BLWA 3QIAA 4Z3OA 2L42A 3VBCA 1G19A 1RKVA 3N3BC 4OLJA 3QF4B 4P3KA 2QTGA 2Q41A 1NR7A 3ETNA 1YVUA 1VCOA 2HEGA 2FA9A 2J4CA 2NN3C 2NO0A 4OSEA 4QFCA 3RU2A 5LOVA 2I71A 4BO5A 2FP4B 1NNEA 3H1GA 1DX6A 5B2EA 4J91A 1UDWA 4F72A 4A0SA 5BV0A 1NJFA 1T25A 5FPKA 2GZ3A 3HB1A 2ZBQA 2XUJA 3WK5A 4K7JA 3EVBA 3GEPA 5FOVA 1VHDA 4E15A 2QRZA 3PC4A 4P93A 5ALFA 4YCNA 1G7CA 5ER6A 1V8FA 4RZ2A 1ZI9A 4LOIA 5D3MB 2OA0A 4TTRA 5AI4A 3WJ2A 4WINA 1IAVA 4W5RA 4M38A 4QFMA 4UUNA 3CLSD 1A9PA 3VRHA 4G4IA 3QI2A 1J25A 4ZAVA 1RRPA 3NFRA 1JX6A 3EXEB 2CD9A 1EDEA 4BCDA 1F06A 1FBNA 3QM1A 4D4MA 2CL6X 4I5EA 5MF6A 4Q16A 3D6MA 3BTVA 4ACBA 5EHXA 2B3TA 4NULA 5AQ1A 2QV7A 2O23A 5HIAA 3NTLA 4A6PA 4FEAA 5E95A 3M1AA 2O8EB 2JKVA 1A9XB 4EUHA 3O8RA 3LMKA 5AHKA 1CUBA 3VQTA 5HUHA 1KKUA 3U9SA 4FW8A 1DJMA 1Q21A 1AF4A 4I08A 1R8XA 4GYYA 1N7JA 3UGKA 3OJXA 2HNAA 4EVQA 5SY4A 5TMPA 1K27A 1Y1TA 2WJ3A 2F4VB 3WY9A 2IBSA 1TVKA 4PHHA 4XWWA 1UBEA 3C85A 1ZNYA 2GM9A 3JQ9A 2QN7A 3NXSA 4NFYA 4N01A 1U8CB 4IOKA 4JD5A 1VKOA 4OQPA 3MW8A 1Y3CE 2NYVA 1YOBA 4PG7A 3K92A 2OD9A 3GJXC 3MWJA 3AL2A 3CRNA 4IH9A 1QZUA 4UHJA 1D8TA 1BHO1 4B33A 4KG7A 4ESEA 1DUIA 1VP9A 3TSOA 2RI6A 5SYNA 1I2MA 1PW7A 2MR5A 1C8KA 3I0NA 4FI3C 3UQYS 3ZJ4A 2CFRA 1RXEA 1IZ0A 2VQ3A 5IAOA 3M4JA 5JTUA 3GZ4A 4KL8S 4PPYA 2YV5A 4JLVA 4N47A 4EJSA 5H4GA 4D92A 3QX7A 4GI2A 2EZ9A 3B3AA 4ENUA 1D6SA 2F9MA 1ODTC 4YUWA 1PBNA 4R40A 2GEKA 1I2BA 1A8HA 3QUBA 4D1YA 1YE3A 2Q0SA 1F2UA 1L5WA 3A4TA 2GYVA 4ZYXA 2J59A 1N5KA 1RXUA 2WJJA 3V55A 5AW8A 5CA0B 4YP5A 5C1BA 4RYLA 3WADA 6NULA 1ZH0A 2JFQA 4IGFA 1JU4A 2EBUA 5DSXA 4LJ4A 1Q95A 4MZXA 1NN0A 4AXXA 3DLPX 1Z34A 3SZ3A 1AY0A 2MYTA 4S1WA 5FYQA 7AT1A 2DSTA 5LLTA 1LH0A 1AC5A 5HF9A 5EWMB 5A04A 2V1UA 3UWDA 2VDNB 3FDIA 3N3AC 4PHCA 1RBMA 3PJGA 1WLYA 5HBRA 3VTKA 3NANA 1GUAA 4JP5A 4OV6B 3CUEF 3H1EA 5E8JA 4FSHA 4YMHA 2GSDA 3BORA 5JATA 4HUTA 2AEEA 1WWKA 1YXMA 1XCOA 3FCOA 5CBPA 1DAIA 1P91A 2V9CA 4G0ZA 2JGLA 4IIJF 4OQDA 2XRYA 2PDAA 4J76A 4DNPA 3UJBA 4OXKA 1FUKA 3ONEA 2IP2A 3GQBB 2JVIA 5H80A 2ZIVB 2E48A 5LJLA 1Q6ZA 2XV1A 1GPWB 1IQPA 2PGIA 5ALIA 4OF4A 1II9A 3UB2A 1QTQA 1NM5A 2CHFA 2H0RA 2KW5A 3TYXA 1JH9A 1GCIA 3N0VA 3UENA 1GADO 2IP4A 3H5VA 4WA7A 3MD9A 4GBED 3NYIA 2O8FB 4WXPA 1GG5A 4AY6A 1Q6YA 5E1BA 2LUOA 3B89A 3ES9A 3BRCA 3MQFA 4MB2A 4MHOA 3DD5A 1J0BA 4YAJA 4BLOA 5GZ1A 3KQHA 3TKLA 1GTRA 5C37A 2B37A 1U0HC 1HWYA 3C6XA 3EARA 3REQB 2F9LA 4FYWA 5EKXA 5DO9A 4OXRA 2JD1A 4JT4A 4N0EA 1QF7A 1VL8A 3P45A 2ZJBA 2HJHA 3JAKB 3AETB 4QXQA 3Q3JB 1C7JA 1YS4A 2JH3A 2X58A 3AUYA 4D9KA 2PYDA 5DNDA 5E9JA 1TX4B 3N2ZB 4UNQA 4UVHA 2CLFB 2OV8A 3D8UA 3B5JA 3SZOA 3WQHA 2JIOA 1DKPA 1GFZA 4UTNA 5AJXA 4WBXC 2O2XA 1M6VB 1J5PA 5KSWB 4OKIA 4L0DA 1DKLA 2IEZA 5LNK6 3N5CA 4LSMA 3UAZA 4BV8A 2A67A 4RABA 5FXMA 4J49A 4XSHA 3SIPA 1EIZA 3ET4A 2J9YB 3I6IA 4HEA1 3MWDB 3HJGA 4LYYA 4QYWA 4BFVA 4XCXA 1G8JA 2CUNA 2PXHA 3P4UA 4UTXA 3S44A 4R6WA 3OD1A 1DVRA 1L5LA 4LXYA 1NMSA 3LY9A 3GJQA 3ZJVA 4H17A 1WSAA 1QFYA 2GQ0A 2WZCA 2X8AA 4AMBA 5HYVA 2GVDC 4TLMB 4RAOA 4C21A 4BGVA 2XNJA 3PR3A 1UQRA 2JHCA 1W2WB 2D0IA 5DWDA 1T3SA 5EGNA 5C3MA 3IJ5A 1FTGA 4TVOA 3N53A 3O26A 5DYNA 4IDPA 1JFTA 3R9XA 4RPIA 4AG6A 1E4OA 1CDDA 2OORC 4JK3A 3RSLA 3SLRA 2GZDA 4CHTA 3IIIA 1G5PA 2GK6A 4II3A 4FQ8A 1CUYA 4Q4JA 1R50A 4TLEA 1U7HA 5A4AA 4G0XA 4R2JA 1JLMA 2XVMA 4WJZA 4AP5A 4DFDA 4ZZ0A 1T3TA 2AQHA 4IG9A 2CFOA 4S1VA 4TWRA 3ZZTA 1Y4AE 3WQBA 3W05A 3HBNA 1SUFA 1XD2A 2IYRA 1Q84A 4G09A 1KJQA 3TLGA 1VPVA 1OKKD 4KN6A 4NKRA 2J3IA 4OM8A 4EMSA 1WCXA 4R2XA 4QGSA 4TT8A 4QOSA 3DJFA 2Y3IA 1DAEA 1L8LA 4PRLA 3QOWA 2AFIA 2FN3A 2JGAA 4MLPA 2ZSBA 1ZNZA 4R1NA 4RIGA 4MSUA 2XHZA 1H8EA 3D2CA 1X42A 1WKCA 3D3WB 4B4WA 4ZGGA 4COKA 5J4KA 1PGPA 1Q0HA 2P9JA 1YBVA 2BR4A 2B7LA 3HBMA 2B2NA 4PCVA 1R0YA 4EYQA 2SCUB 1ZEJA 3C3YA 3WRWA 2PXXA 3GZNA 3QPWA 4G23A 5FP0A 1UANA 3CRZA 5H16A 4CWAA 4DR6B 1X7ZB 1R00A 1AM4D 1T6BY 5F7JA 1YVRA 5LXTF 1CWUA 4P54A 1WP9A 4RCVA 4LRTB 4MPRA 1N5LA 3OIWA 3OETA 5JQGB 2EYUA 4LZNA 4RPKA 4RVNA 3TW6A 4QICA 1XNHA 1J1IA 2BP7A 1CP3A 4L85A 4C5CA 3QIVA 3ZUGA 4DR5B 2AJ8A 3JWIA 3SIWA 4EJ2A 3NATA 1JWAB 1ICIA 4EABA 5C8XA 1L8QA 1OASA 1UMDB 3EEBA 3SM3A 3NHFA 4NS1A 1JDUA 2FGKA 2O2CA 1U7UA 2RK3A 2X22A 4UCWA 5JTTA 3R9WA 4R2KA 4J0QA 1MVOA 3A2LA 1CYDA 3B3QA 2A30A 3QYJA 4CMHA 4TL7A 4D9MA 3OZEA 1K7YA 4UULA 3A8TA 3SGLA 4J6EA 2P40A 3JALB 3D3JA 4JYCA 3ILVA 3RHZA 4J4HA 1WXXA 2POCA 5BVHA 1XYGA 5AT1A 3CX4A 2V74B 4JNCA 3DE7X 1TCVA 2OT3B 2XKAA 5KX5F 1RJEA 4Y1GA 3AQIA 3SE0A 5JXGA 5JCXA 2FFJA 1PWZA 5ALZA 1CVIA 2MINA 3GAFA 4M1KA 3T5AA 2IS4A 4YJHB 1FQJA 1WNFA 4PPNA 3USZA 1LK5A 1QOZA 2WYIA 4PZCA 5JH7A 1UAAA 4RFVA 1LKZA 3TNDA 5EIWA 3UO8B 1ODJA 1OFTA 2A7QA 2W2KB 5DRYA 1EESA 4CMBA 3TDNA 2JJ2A 2HREA 3I52A 3WIDA 2VBCA 4H7KA 3NBFA 1CE8B 3NYWA 4KREA 4K9SA 1O96A 3G2KA 3HYTA 1V71A 2Y77A 3JZMA 1DRUA 3O1IC 4BXOB 4GVXA 2JNWA 2WIJA 2OBLA 4FFBB 5J43A 1NLFA 2IIPA 3CG4A 5FPSA 3W1VA 3QXHA 2BTOA 3IQEA 4JODA 1A8SA 1O9BA 2A33A 5IBQA 3U7RA 1I1OA 4AJ9A 1XV5A 3A1SA 1CRPA 4MXDA 1WXQA 3OF3A 4NC9A 4PO8A 3RREA 3JQAA 2AOUB 5K0CA 4UFOA 3ENKA 5KVQA 2ZLBA 4QAJA 1NJSA 2O3SA 1GG2A 4TUYF 1G21E 3EMDA 4MEJA 4UAGA 3E1GA 3SHWA 3VPBA 7ADHA 3IBCA 4YAOA 3DE5X 4BMXA 1MJHA 3V8QA 3BFPA 1CF9A 1MQ8B 2EWMA 3T7JA 2B1IA 2I7TA 3HDHA 5A9TA 3Q98A 1H2AS 1J49A 3II6X 9GPBA 1H69A 2QG4A 5HCUA 3ZTYA 1O1YA 2LKDA 4JJEA 1JB1A 3PHBE 3ZCVA 3P2KA 3C8HA 4FGJA 4Q9LA 3I6QA 4PZDA 4LDPA 1PFGA 4GOOD 2ZBGA 3BKXA 3RO7A 4BLUA 1X8KA 2W42A 3GP5A 3SZUA 4LHZA 2PL5A 2REQA 5BSGA 1FUUA 1Q0ZA 4CFYA 5HJ5A 3QY9A 5CNKA 3I9KA 3L3BA 4LC0A 2FRVA 1EFKA 5D86A 2HY7A 3TQRA 4PYMA 4LMAA 2X8JB 1T2CA 3AR8A 1OH7A 3F6SA 2FZWA 2P0EA 4YQYA 1NZFA 5CXQA 1TKAA 1HGXA 2E4ZA 5CURA 4F85A 2C2GA 4FMPA 4Y6QA 4WT7A 3F4KA 2CGEA 1BXGA 1NE7A 2HADA 3L1KA 3C1UA 1K8XB 1NBIA 4NJEB 3GPDG 1I4WA 1IG0A 1MT0A 2XR1A 3AB3A 3AR3A 3UOAB 3URKA 2OTCA 3EZLA 3LGSA 4NDAA 4R4JA 4O33A 4XOUA 3ZWNA 3VC2A 5I01A 1NGSA 4U02A 1Z0IA 4WERA 4XIYA 5FFMA 4EWLA 1C0PA 3CLTC 4NRDA 4JQYA 2EFYA 5I8PA 1H8HD 2YIMA 3CUUA 2EYQA 4QPJC 1E32A 1KYVA 221PA 3JVUA 4TMTA 5L4LA 2H0QA 1IVNA 3QUSA 1F2TB 3KCNA 3O9ZA 5P8WA 4REMA 2E4WA 5F5XA 3VHLB 5A9RA 2INGX 3NPAA 3RGGA 3R7NA 3B78A 4G5OA 4C6SA 1QIKA 1FW8A 3ZQ4A 1MB0A 2HMVA 1EUYA 2BM9A 1BW9B 2AR7A 2PSDA 3EB9A 4XYMA 3ZZMA 1D03A 3CUVA 3VKFA 2ISQA 2OXEA 3D2AA 2C2WA 3PGA1 5JE8A 2VAPA 2P2YA 2ENWA 4YP1A 5C7IO 2H2IA 5IW8A 2V7QD 4LDNA 4TTSA 4HKTA 5EOVA 1ZCJA 4P83A 5BRNA 1QIHA 1ZNQO 5E4JA 5JHHB 3VO1A 2VTDA 1IN6A 2BE9A 4FD2A 2B0CA 2HZ7A 2B94A 2C5FA 1NW9B 1A69A 4QG3A 1EEHA 3OFVA 4LMBA 1VHQA 3SLKA 2DPXA 5K0NA 4BO7A 2YYAA 1TMGE 1E2HA 3BBLA 4AT1A 3THXA 3H5IA 4PO3X 4MV3A 4HBGA 4DXDA 2VP9A 4FINA 5IFKA 3HM2A 5G41A 2IYSA 1E5TA 2P9ZA 2HNBA 2OCGA 4LJ6A 3WNCA 3NOOA 3C4VA 4LE0A 2YXPX 3EGEA 3WBFA 1BKYA 1Z8FA 3M5WA 5KDOA 2HMTA 1LPOA 2VF2A 1Q0LA 2J87A 3A14A 4RGYA 3T0IA 5AKKA 1W36D 1ZMRA 4IV5A 3HJTA 1KJJA 2G0NA 3BSWA 2ZZNA 2OGTA 3L6DA 1D4OA 4NPCA 3QYAA 3JZDA 4EY8A 2R1VA 3IBYA 1D5CA 1DEKA 4OVKA 5CT6A 3K9NA 1BXKA 3D6FA 5AKHA 1NVXQ 1O95A 3L6OO 4EHBA 2F8LA 4KXXA 1KOLA 4RPGA 1NJGA 3DW3X 1SG0A 3OE4A 1QHHA 3T1OA 2Q5CA 4CG1A 4DDVA 4B3DA 1SKMA 121PA 5E1DA 2GILA 1BX1A 3RWBA 4U6NA 2AC7A 1V1RA 2AB0A 4K40A 1GRQA 2FKNA 1V37A 3R7WB 2J3JA 2QUJA 3DSRA 2IEDA 4G37A 5B3LA 4Y98A 2GH1A 1E9FA 3HXLA 3FTQA 1KYQA 2YJ5A 3BPSA 3PNVA 3DHYA 1D8AA 3MQ2A 2AJCA 4Q3DA 1U4OA 2VOJA 5KJ6A 3RSFA 1ZMOA 3LP8A 2H8KA 4FZVA 1Y9JA 3MMPA 3MHPA 4A23A 2CSXA 4PZZA 3GVHA 4GVPA 2JGNA 4UU7A 2B7BA 1RHQA 2A9QA 2LGJA 3GNSA 2CCKA 3IIJA 1YZYA 1UC9A 3MA0A 1QLWA 4N3GA 5B3JC 2QG6A 4ETWA 4KUEA 3B9BA 3V97A 5BYBA 2H6EA 5G3YA 4V0RA 1CX9B 2F3PA 1D7OA 1OBFO 1JEYB 1JXQA 1Q7CA 1FDUA 1T1JA 2ET6A 2IHTA 4MCAA 3TRJA 4Z4HA 3L01A 4BNJA 3MHTA 2X0KA 1T0PA 3EK2A 3JZIA 4LVOA 4V39A 1JSZA 4LXXA 3UXMA 4DRXA 4L6AA 3TZQA 3USES 3E7PA 2Z1DA 3NUQA 1QX4A 4K26A 3JD2A 1QKKA 5BW8A 3HVHA 2HK7A 1P2UA 4U2KA 1V4NA 3INNA 5FB3A 4TTIA 2OC4A 1SHTX 3MLBA 2XB6A 1OLSA 4GMGA 1Y3HA 4XUGB 2QUKA 4J75A 2RC6A 2YN2A 4ZT4A 3HEMA 1Y6JA 1O94A 3LZ6A 4KXVA 2ZTHA 5I9IA 2R62A 1UT6A 5SZJA 3ETEA 2AOTB 1NQ5A 2QU7A 2WABA 3ELDA 4W1SA 5J3JA 4HP8A 2YVLA 4D0LB 3KB2A 3IBGA 1WBDA 4AG3A 1XMVA 3AESA 3PU6A 3TZBA 2NX2A 3BE8A 4FE3A 4BE4A 4QASA 3P9SA 3GGCA 3I04A 4JEIA 2CEAA 3BMNA 3GJ4A 4C89A 2VSFA 2ZW9A 4XH9B 5I5EA 2RHGB 2WJ4A 3QWBA 3K8YA 1T5HX 2NZWA 3SSMA 5K1ZA 3WK9A 3JAWB 3ETGA 4FB5A 1BS2A 2FRDA 4ZZ2A 4B34A 5CHEA 1JT9A 4LF7B 2GASA 2GD1O 4FNOA 4YAIA 2B1QA 1QCCA 4GT1A 3EG9A 1JG7A 1NR5A 1R4AA 2QIOA 2PMDA 3GLIA 5KNBA 2JLQA 1BYUA 4PR0A 3BG5A 1DKQA 2BFBA 2XA2A 1JKMA 1N6PA 3F98A 2HGSA 4WKOA 2D2IA 4C9BA 2WVGA 4AUMA 2HUPA 3IP5A 1F3LA 2DKOA 4BU1A 3H5RA 4EG1A 1GEGA 4G0MA 1U7WA 4AW9A 1KYWA 3B2NA 1GPYA 1UM9B 1ISGA 1SFRA 3AKCA 1EDBA 1NT4A 1PFKA 1LBQA 3D7LA 3DAGA 4OYHA 3AYXB 5ADUS 5KQSA 2BZ0A 3F8TA 1TF5A 3H4MA 4BDTA 3NQ41 1VFNA 1KK1A 4HAZA 3CZCA 4D9FA 3PVSA 4OX9B 3W5VA 4OQMA 2P1RA 3DYVA 2D59A 2DP4E 3TBKA 5KNDA 1U2TA 1B00A 3M70A 5IJZA 1DWUA 2X2OA 4DYVA 3TB4A 3AVPA 5ESWA 4MYUA 1U8YA 1RXIA 1VG8A 2NXEA 1LDBA 3YASA 1IOVA 1RKXA 3P9ZA 4DMMA 3BS4A 3FMGA 4L02A 5BQPA 5A0TA 1L5NA 1Y89A 1LPNA 4CT4B 1N5IA 2QSZA 2ZB7A 3HHEA 1XZBA 4LPKA 3DDUA 3VYVA 1CY2A 4LY6A 4X1KB 3OJOA 5EEGA 4D97A 3P94A 2Q9CA 2B6HA 4QDJA 1Z5NA 3K1YA 5JR3A 1SULA 3LC0A 3R24A 4MV1A 3WGTA 1XLTA 3G17A 3QK7A 3D8TA 1KI6A 1VB5A 3I6MA 1Y6QA 2VI5A 5E0OA 4B8YA 4QDTA 4WCDA 4ABYA 2B5WA 3BERA 1S2MA 4ND2A 2PWBA 4YLEA 2GJ4A 3ZHBA 4AY5A 5B2FA 4IUYA 5IX8A 1F8YA 3IPYA 3QRWA 4V38A 4EKGA 2FWJA 4C7XA 2XA1A 2Q6KA 3AR6A 2IHYA 1B8VA 5HRUA 4RSMA 2X41A 4F2WA 2CNDA 3FIJA 4F9GA 1OPXA 2PRIA 1ZGCA 2ZBDA 1Z0AA 1O0SA 5I9TA 2WUWE 4DCTA 1N9KA 1QIMA 3IULA 4KWHA 1RD4A 3CWQA 4C1BA 1QZZA 2IU4A 2MSCB 4UNRA 4OXIA 5EP2A 1JVSA 3WLLA 2RHRA 3K4HA 4HFMA 4HUQB 3T4UA 2AWNA 1DV2A 3TD2A 3C1AA 1ECBA 2QYOA 1ICEA 1HKHA 1G38A 3SMQA 1EGVB 4ALKA 5IYZB 3AUKA 3TNJA 4CRWB 4LA4A 5M7EA 4UZFA 5CT4A 3LYAA 2BZ1A 2IVFA 4CTOA 1DO0A 2ESRA 3C15C 1QYIA 3O2JA 3ZV4A 1P45A 1Q0RA 1M2NA 4PZEA 3SJBA 2OECA 3F8WA 3OM8A 2RBKA 4BLTA 5JI3E 5KNCH 3DOOA 2Y6VA 3EZGA 4V3BA 4WPGA 1ORTA 2NAPA 2YW2A 3O4HA 3VOAA 1OH6A 4NOLA 4NBNA 3VC7A 5LZ9A 3LPLA 2G9VA 3CONA 3F0TA 3M6WA 4XD7D 5C4MA 4FNMA 4PX3A 1IEWA 1F14A 2ZJOA 1ES9A 5E7QA 4EEZA 4RQTA 2JFBA 3MMSA 4ZYUA 4MVJI 2XKKA 1B0PA 2D54A 5HG0A 4DY4A 3D0QA 2ECFA 1NXQA 4JU8A 5E2AA 1SNYA 3QELA 3WFZA 2ZAYA 4EBFA 2QWXA 2VL7A 2R6HA 3GGGA 3RYHB 3JQCA 3T15A 4YHHB 1GZSA 3F7TA 1UOOA 3HMKA 3TNYA 3O84A 1E0JA 3ECSA 2OV2A 5IHXA 1Z5WA 1R0LA 4QL3A 5FD8A 2R2AA 2EIHA 3I2JA 1H05A 4ZI3A 5F9MA 4OIFA 1UBJS 2O59A 4RULA 3H18A 4HC4A 2YZ7A 4G84A 1JLLB 4JBWA 3WTCA 4IVNA 2PPVA 4JUIA 3IOMA 1JDVA 3Q8WA 2RGNA 1M0WA 4RDCA 4DWOA 4OJQA 1KIFA 3ESCA 4JB0A 4WLNA 1E7MA 1C9YA 1YAHA 1RWXA 3FTNA 3DAHA 1GITA 1WZEA 3VOTA 3TUZC 5EQTA 1K6JA 2CNKA 4KN5A 2LPMA 5G0WA 4Y2SA 2G4CA 5GV8A 2ZE5A 3O47A 4NK5A 3FNFA 4PXAA 1E1NA 2RHCA 3IHLA 4OYLA 3UOGA 2W37A 2IDKA 3N70A 5IG2A 3RKRA 4TKVA 5E2BA 4M3NA 2W2PA 2UUOA 3LBFA 3C3MA 3TX6A 1Z83A 2ACWA 2V55B 2PWYA 3HNPA 2BJHA 4MI6A 1ZHHA 5AI0A 3ZV3A 2RH9B 3I8OA 3DMPA 1T2FA 1EX9A 1LBIA 1ZJ4A 4IQ0A 3FE2A 3F1LA 2K4MA 4HBZA 2WHPB 2XUOA 1NN3A 1KK2A 3FCXA 3JQ6A 3KEMA 1C8VB 2HWUA 3OZ7A 1N0UA 3W3ZB 3DFFA 4WE3A 2PJRA 2OB2A 2G7MC 3O4IA 4HNAA 4UD6A 1GRRA 1QGYA 2H31A 4WFQA 4EI2A 4U4AA 1GU7A 1U99A 2M6KA 2V0CA 1E2QA 3DYBA 3K2BA 4YV2A 2NU9B 1FYVA 4F5DA 1RQRA 2B34A 1GCOA 5L6LB 1HO3A 3X1KA 1I0LA 3THYB 4D45A 5H8WA 4YRLA 2F3QA 4K9QA 4QPDA 3CVVA 2Q0HA 2YY5A 1X39A 4QBGB 1UXHA 1G6OA 1AUQA 1KR5A 1O54A 2HIHA 2OCPA 4AZ3A 1NHGA 2V1XA 3JPWA 1GPLA 5BR4A 1K7SN 4YPOA 2PQ6A 5BSMA 3TG8A 3PZRA 1QRDA 4ZVNA 1T13A 2WOJA 2C94A 2ZIXA 1MCZA 4XDZA 3OQOA 1PJLA 1DPFA 1OWMA 3KQTA 1D4ZA 4ME6A 5JOQA 2BFEA 5EESA 3JQGA 3N05A 1NLUA 3QBVA 4CE6A 1TT7A 3A4MA 4TMXA 4WLFA 2AK2A 3H05A 5LZ5A 3P19A 1MHPA 2GA9A 2XOEA 3B52X 5DYGA 1BS1A 5CAEA 4NFLA 1RC8A 5CBKA 1A4RA 1FMCA 2Z30A 3KEFA 5TJHA 4B81A 5IJ0B 4DBLE 1TM4E 4W63A 3M8KA 2IKSA 2DX7A 1UOPA 1ABEA 1G8GA 1GTMA 1D1QA 1NULA 3G8AA 3RVDA 4NCKA 1ZRNA 3PUWA 4LRUA 1U0LA 5CM2Z 5E6UB 5K6AA 5L8VA 2V97A 1YIAA 3Q7RA 3X1WA 1IJEA 1P77A 3Q88A 2CNWA 1C7ZA 4B75A 1H1LB 1EJ2A 3Q3IA 1E79D 4I9FA 1PKEA 1YFZA 3UMJA 4QJ4A 3ZOZA 5JAOA 5FI0B 3O83A 4E4RA 1HFJA 3U3XA 1SKBA 5K0EA 1SG6A 4IQGA 2QAGB 2DQYA 3NT5A 4QXRA 5ALGA 3WGHA 3DT6A 4CKEB 4FE4A 2QLBA 2GN8A 3KHSA 2BEUB 3ME5A 4WLUA 1CFJA 5EHQA 4E5MA 1WDKA 5B6PA 2GNPA 3LA6A 2BTQB 4L74A 1T5TA 3GEBA 5G4KA 1RM5A 1YDMA 1Z5GA 1EVIA 3UICA 3ZV5A 3KZKA 2JFUA 1TC2A 2HN9A 1Z28A 2VHCA 1DRWA 1FDIA 3QE4A 4M0PA 4DDKA 1W0KD 4ZI7B 1Z6YA 5AUNB 1V0JA 3S7ZA 1A9SA 1J6UA 1E3LA 3C3JA 3VM6A 4AZ0B 3BIWA 4ZO4A 4MW2A 1H6BA 3E9NA 3BK2A 4JEMA 1DIHA 5H81A 4F91B 4LMRA 3WTBA 3B2QA 3EQ8A 1RM3A 1BDMA 1DI0A 1TD9A 2IZ5A 2IPXA 1K92A 4O5OA 2JRCA 4Y2YA 4KIWA 1ZM3A 2UUCB 2CFIA 4XGKA 4ND5A 1AHNA 1LDYA 1XIVA 3F78A 2CJWB 3K09A 4BX2A 1ORVA 3SSNA 1EVLA 1URPA 3LUDA 5BSWA 5I48A 5HQ3A 2GJAA 4QYXA 1GQOA 1NVTA 1YJAA 2BI8A 3NALA 4KBFA 4R01A 4M9ZA 4BKUA 1WL8A 1TYAE 4BFWA 4NFHA 1AQIA 2Z83A 2BFCA 2OV6A 4OB7A 4U7PB 3AI2A 3FDXA 4WEQA 1PDWA 4P31A 5H02A 1KPGA 1SC9A 1MJGM 1RAFA 2FPPA 2RB4A 4D9IA 3RAGA 4KB5A 2I2WA 1IMOA 2ZBEA 4YRDA 1ZITA 4NNPA 3X2FA 4DQUA 4PVCA 1V4BA 1JTVA 3NHLA 5H83A 4RF2A 1KFCB 5B1HA 4W5NA 4LCJA 4F4JA 3OD5A 3ZI7A 4TYPA 1OTXA 3RSQA 2PX2A 4PLWA 1WBJB 3RBVA 1XTQA 4HFNA 2B4RO 1TM5E 5FWNA 4PIPA 3QLVC 4R3WA 4YONB 4Q1VA 2Y4NA 5A4MS 2F1HA 4ZRMA 3CH4B 3ZH2A 3GAMA 2BEVA 1SIBE 4CKXA 1GU0A 3LPAA 2QRGA 2YFYA 1P4JA 4B6GA 1UBUS 1D5WA 2FG5A 1P7VA 4QHSA 2BSQA 1KO8A 1U0OC 4E2XA 1Z6ZA 4BC1A 2NU7A 3I6ZA 4C7OA 1KU6A 4X7RA 5EE5B 3DNMA 1GPH1 5JIBA 3GUCA 3AM4A 3OQIA 1NSTA 1SUBA 3HCAA 1Q50A 1T8WA 5A6SB 4L3WA 1IG3A 3WGLA 2FPIB 2QTTA 3ZE6A 1N78A 1PFUA 4PLFA 3TLXA 1GY8A 2O2ZA 3INRA 2HL6A 3FNBA 3O8QB 5JYCA 2ZSEA 4BNUA 1QPBA 1CERA 1C3VA 1MB3A 5IXSA 2IYWA 4FYMA 2WJGA 1HOTA 3FYCA 4JDUA 2ZYRA 1WUHS 3PUZA 4RTNA 4HUJA 4RE5A 3WWYA 3TCXB 5G2OA 4JBNA 3UT0A 5CA1A 1VJGA 2H1IA 2WT8A 3B53X 1JHQA 4XWGA 3IP6A 3VSAA 1BRMA 1KERA 3GLHA 2BGUA 2KYRA 1P5HA 3QEOA 1YBAA 5A62A 1XCLA 4LGVA 5TS3A 3R7SA 2A57A 1ZIDA 5IS2A 1R15A 2GAAA 1I1NA 5JVDF 2A58A 3WLQA 2H1CA 1EWYA 4H4EA 4D57A 2KI5A 1TTHA 4UU0A 3WDLA 5AM3A 4WJKB 2BDTA 4D02A 1M9NA 3CRQA 4WLEA 4EX7A 4BJ1A 2WU1A 3AUXA 2A5YB 5E9WA 1N7IA 3FHLA 3GJTA 5G0VA 4H1HA 1T91A 4MZDA 5D5PA 5B1SA 4DA7A 1S1CA 2JIMA 2VZLA 2W6NA 3CX6A 1HDOA 1PZFA 3U5TA 4CFSA 3R20A 4X1IB 4YJ3B 1B23P 1Z3CA 5H70A 2HF9A 4L0MA 2P27A 3KV3O 3CNBA 4HQRA 2VXCA 5ED4A 2QTFA 3WE7A 2PD3A 4WY2A 4DWJA 1Y1PA 2O8DA 4BLVA 2XTNA 3U56A 1P6XA 3HV2A 3UV7A 1YIDA 1JIIA 4IV0A 1RJ9B 1Z56C 4I3GA 3W2HA 2Z2ZA 3GRYA 4LWOA 2MIIA 4MDYA 4EZIA 4RK5A 3IO3A 4W5OA 3E3OA 2VSXA 1Z5UA 2NTNA 2PT7A 4HGQA 3IODA 4MV5A 2JGDB 3NEYA 3SS7X 1C8BA 1PAUA 3BXXA 4IIYA 2G7ZA 4UDOA 1KRWA 5DISB 1DNPA 4G26A 1T4CA 2NVWA 2XUPA 3KJFA 1XVIA 4DVJA 4L5YA 3REGA 2NZXA 2X40A 1WVGA 2YWFA 1PL0A 3LY5A 3WYCA 4LWQA 4BE7B 1N1MA 5FR2A 4C6RA 4CCYA 2PH3A 4CEJA 1TMOA 2GLUA 2Y1CA 4PQGA 5IUKC 2G04A 1ECFA 1JR3E 3KKKA 1LC0A 2A86A 1NTRA 1DX4A 5K05A 2P1DA 4R41A 5FOUA 3GGPA 3UBMA 3DLTA 1SK8A 1BHSA 2JKZA 2XMQA 3UWOA 4AZWA 4CW7A 1II0A 2IZZA 2FUCA 3E05A 2ILVA 3BA1A 5CK4A 4D3DA 3PC3A 4HJRA 3TEJA 5CVJA 2X9GA 3I42A 1OAOC 3ILXA 1IDN1 2JJQA 4GE3A 3KJNA 2XCIA 1NRWA 1W4LA 2AYYA 4HQLA 4WNYA 5LDGA 2HCFA 1A7JA 4R9UC 5F1OA 4GM1A 4ZHQA 1ADGA 3OJFA 3Q2OA 1U1DA 1Z47A 4ZVUA 5GADl 3UTDA 1P3Y1 1YHYA 4D4GA 3T5CA 1E8DA 3HU5A 4JL5A 4F21A 4ZTZB 2ZDHA 4FHCA 2WE8A 1R0BA 1P1JA 5IN4A 3NDIA 3MS7A 3Q8MA 4C2UA 3D8HA 3ZGVA 4ZOLF 4Q0MA 1M6HA 5EPOA 5EQJB 4WCFA 4XKJA 1SCUB 1S01A 4O4HB 4X54A 2W7TA 2YYZA 4MUXA 2EW2A 3TZCA 4AMVA 2Q4DA 4MVJG 4IRUB 3ZI4A 1U5BB 3L06A 2BWJA 1IRXA 3DW1X 3OI7A 3DEAA 3F3SA 1WF3A 2X7JA 3OLWA 4H0CA 4XRRA 2WAXA 1VECA 4GNKA 4KWIA 3NFYA 2Y2VA 4DSNA 3K1ZA 4P98A 3FYTA 4TMVA 2GERA 1I3KA 1SHJA 2AK3A 2JBHA 1CQJB 3ADOA 4PG8A 1JIVA 1JHXA 1NV9A 3KKPA 4Q00A 1JWLA 4ZVSA 1W36B 1ZR4A 4XA8A 1JE1A 4QXAA 2R7KA 1JAHA 3C87A 4FMBB 1PLLA 3QLEA 4ITRC 1BE0A 3DMTC 4IXTA 3I83A 1P4AA 3WLFA 4DPMA 5ITSA 5EL0A 4HPXB 2OQIA 3SXPA 3WGNA 4JAVC 1W1WA 2WLSA 2C4VA 1W35A 2IHJA 2H9IA 4O59O 5DXFA 4C4AA 1AGNA 3GRZA 1NOIA 4C7KA 4P53A 1ZMBA 1U31A 4NABA 1WB6A 1PEAA 1E1QA 2BFAA 3OVMA 4WZBA 2G1JA 4CR7A 1PJ2A 3KC2A 3ROGA 2FLVA 2N46A 5EWJA 3OEHA 3TX2A 4NZZA 2OBMA 3UC9A 1W48A 4JSRA 1X7XB 4ZKEA 3H2JA 1YMUA 3GRPA 1OT5A 2HDNB 1SCDA 3CKLA 4AX4A 4EENA 5JBIA 2OG2A 3ZK9A 4EGSA 2GARA 5JD4A 1C1DB 3F4BA 2C2MA 2SBTA 4WAUA 2PR7A 4Y2GA 3ICQB 4II7A 1R5BA 2Q27A 1MU0A 1JWBB 2I67A 4B7UA 5C80A 3DO5A 1SCIA 2V6GA 2OV4A 4WACA 3S99A 1DLIA 4BC0A 1JS1X 1A5ZA 2OPBA 1L1FA 4BRUA 3D7NA 2R7MA 3EIQA 3ZNOA 2BKLA 3GH1A 2DPLA 3QQ5A 3W3AH 1OY1A 1UK7A 4HDOB 3ZQKA 3HXPA 3PQDA 2OHFA 1JJIA 5KAMA 3OY2A 3LPDA 4LBVA 3N2GB 3RS8A 5SYMA 5DP1A 1TGVA 2P78A 4RY8A 4MAFA 4BLPA 2CB9A 3D8SA 3GLFA 1BS9A 1E64A 2LXNA 3COWA 2P5TB 1Y4DE 1HZJA 1YMVA 3EXHC 5TY0A 4E5UA 4YGXB 5IZCC 4XFKA 3STYA 1RMTA 2D5AA 3AF0A 3F3KA 4QATA 3TDKA 2HQBA 2LDXA 1V9CA 4UUMA 3RK4A 2F3UA 3LBIA 4BMSA 4KPUB 1G0NA 5DNEA 3EGXB 2HPHA 1EH5A 1FS6A 1CJUC 4TROA 3M6FA 1R6VA 1XCJA 4S0ZA 3VX3A 1G1AA 1PDOA 3DP9A 4JI6B 2WNIA 1BA2A 4EELA 2KBFA 4A8PA 2CLHB 1LQUA 1CY8A 1TUGA 5FWXB 1C4WA 1LNSA 2I2DA 3ESRA 3FBWA 3WDSA 2VCHA 4BO0A 4C88A 1YB1A 3TE7A 4DILA 4MW7A 4QQRA 3UHOA 4REOA 4DL9A 5I7UA 5TQVA 3HCWA 1AVTA 2EIXA 2CXRA 1FS4A 4U6SA 4ZQEA 1Z0FA 4X93A 3GXOA 4IXWA 3OT1A 3MF4A 3HJRA 1A9OA 1CHNA 1WEHA 2FP4A 4KMMA 5FO1A 4G85A 1KFJB 2A0KA 4ER6A 4NU6A 3VAZA 4A8JC 1E6EA 1TJ3A 3VVMA 1HDYA 4FJ1A 4G5HA 2R60A 4GKKB 3V1NA 1P1HA 1K7EB 1T9DA 1W1UA 1A8IA 2O0LA 4BVKA 5JZVA 4R5MA 4WGFA 3OY7A 4DR4B 3MT8A 5D3MA 1XHEA 1QAOA 3LYUA 3A6EA 3UJCA 2NPOA 3FNGA 5CCBA 4RY2A 1LDEA 4RELA 1U7ZA 4QOFA 3WIVA 5IKOA 2DC1A 4LYDA 2X4DA 1IHYA 3B70A 1Y9ZA 3EXEA 4UU1A 4RH1A 4KQ1A 3ZX5A 3E8SA 2GCOB 3I23A 2B4KA 1Y5MA 4MMXB 1VLZA 5UKDA 1X8JA 1XC7A 2P5SA 3JQDA 4FFWA 5B1YA 1KSGA 3MS4A 3OE7D 2XY4A 1WEKA 2O8EA 3LQFA 1EZ1A 5DX8A 4CV2A 2YXEA 4YH1A 1A9XA 4TYQA 4IKPA 4F1JA 5IKEA 2V7WA 1C3JA 3RV3A 5EZSA 1EKXA 1ORDA 2W6CX 4FDTA 2PLRA 1H0RA 1Q57A 4PIVA 5ALMA 3G0GA 4LDQA 5DM70 5KSOA 1O0BA 4MHTA 1DQRA 3VR5D 4W1PA 2CDAA 4FHGA 1US8B 4URXR 2RI0A 1ZOPA 2Q6OA 4Y2HA 3GCZA 1PR4A 1A2OA 1WKBA 3BRSA 1FP7A 1MG0A 2ZDQA 3D81A 3JQ9C 3PS9A 3PYMA 1Q3KA 4PXSA 4AO7A 1JDPA 2XCSB 2QNRA 4PZPA 1HTBA 1KNQA 4DR2B 4HXFB 3G0BA 3NHPA 4JBHA 3C8UA 4RD4A 2PLWA 4FHFA 1VBMA 3TBFA 4LRWA 3BREA 1Y1RA 3MEQA 4TSFD 1RYBA 1TIPA 3G9TA 3JYLA 3NIWA 1KEEB 5LZ2A 2HDHA 4CQMB 4DWWA 2DHQA 2C3OA 1LF5A 3HLYA 1WXIA 3BGVA 1YAJA 4OOFA 5K4AA 2QNBA 1E9DA 3PDIB 1U3TA 4X3CA 4EJSC 4ZYWA 1IY8A 1CQPA 3F5MA 3CU5A 4HYEA 5CA0A 3T9CA 1GAWA 1PR2A 2I6XA 5CW1A 4E5PA 2DR2A 1FXWA 3FJ1A 4I4NA 3F9CA 4Z0NA 1T8TA 4BX3A 2W6PA 4MW9A 1ZG3A 2XMZA 4Y9SA 2OXCA 4MRRA 3KOUA 3WV5A 2K2QB 1PJZA 1OMOA 4LHSA 4QUAA 5EWMA 2Q4TA 4FHEA 2XSZD 4JYBA 1RHUA 4MUNA 5DNAA 4CG2A 2R6R1 5HKBA 1M7BA 1K98A 4CMAA 3JQ7B 2J31A 5JHGB 5DNVA 3MWLA 1FYDA 2Q99A 2YS7A 3MYYA 2CV2A 2IHUA 3CINA 3O6VA 4BO9A 4HB4A 1R4MB 1E9BA 4G81A 4MQFB 4U5XA 3T35A 2WWWA 2XMRA 2IW1A 4KXWA 2PBFA 5IK2A 4MRVA 2W22A 1U94A 3QEKA 3HFGA 2I78A 1Q1QA 3OTGA 2J0UB 3PFIA 3ILSA 3KG2A 4LIPD 3TE6A 1IEQA 1J0CA 3GQBA 3H5WA 2VHTA 2XVYA 4X6YA 4WVFA 4Z0PA 5G53C 5LM3A 4LRQA 3M0EA 4NCHA 4CIXA 4QDXA 1ULAA 1BO6A 4BFZA 1MC8A 4R81A 5K2MA 5L53A 2GXSA 1Y5NA 2WTXA 3TWOA 1FUIA 5I8ZA 3KYDA 3QGMA 4FILA 2O8FA 4RLFA 3KU4A 3M82A 2PKRA 1JVBA 1NM5C 2EC5A 2OBXA 1E92A 3KVYA 5FLYA 1CIVA 2FPGB 3IUSA 3LTEA 5BWMA 2WKPA 4HMPA 2ZOSA 4JOCA 2ZRKA 1TEHA 3BAZA 4MWEA 5ES3A 1N2EA 1GPKA 5JZBA 4Y2QA 2CFCA 4B3JA 3B6JA 3ANSA 1GKLA 3F5SA 3VV2A 2AX4A 5FFFA 2P4UA 3GHYA 2QPAA 4L5CA 3JAKA 3H9UA 3AETA 5G0TA 1RWKA 4E5VA 5IKXA 1CDEA 4N5MA 5AI5A 3W04A 3LRPA 5A71A 5A5EA 3IEMA 1TDJA 3H2YA 5A5FA 2MT9A 5KJCA 4YRQA 5D7BA 1EA5A 3W5DA 3CRVA 2V8BA 4B43A 3ND5A 1DOHA 1QTNA 4GOMD 4JMPA 1M6VA 3LX8A 4GRIA 4B3SB 2IP1A 4X45A 3VPAA 3LBYA 1MLDA 3G8CA 4FB4A 2H9YA 1DT3A 4CMIA 5I9MA 3VPDA 3CZQA 3DL2A 4IYJA 3GYGA 4A0HA 1PD1A 3N9IA 4ZAYA 3T1NA 1FFGA 1BMDA 5FV7A 1ADBA 3LHDA 3V7FA 5HVNA 2XWQA 1Z7YA 3BIOA 1P2DA 2YFQA 1C7FA 3QYPA 3RVMA 3ACBA 4RANA 2A14A 2A0UA 1T0IA 2WIBA 4MR8B 3DEHA 5KEIA 1ZN9A 1Q1GA 3EUEA 4LBWA 4NV1A 2VJKA 4NEGA 1MRNA 2Y1LA 4TQ9A 2F1OA 1USIA 5JSFA 1QIJA 1FW6A 1PP4A 1Z4OA 1RWQA 1FX1A 1M1YA 5JAHA 1EK2A 2OBFA 4WI1A 2OM2A 3UY4A 1ZU5A 3QMMA 2XGJA 3O8DA 4KXFB 2BMAA 2J30A 3K9CA 2DE0X 2GOYA 2R4UA 3D2LA 2PO5A 2D1YA 5CLQA 3CLUD 3JQBA 3ZWQA 4A3SA 2BMVA 2O8DB 1B7GO 1T1RA 4EVIA 2IXEA 2QN3A 3HA5A 4ZVTA 3A3KA 2HYDA 1QRSA 2G9RA 2AN1A 4IJMA 3RC9A 1G59A 3KDSE 1TQ2A 2Y9PB 3JTEA 1A77A 4M87A 3SSOA 1WSBA 2FPLA 3R5JA 1MUUA 3I92A 4FXOA 2JFFA 2B7CA 2V7GA 4L0QA 1G8SA 1VKJA 4BB0A 1OYVA 1EJ0A 1YOVB 3ABQB 1E7SA 3KXKA 4HNQA 4ID3A 4MUEA 4W6QA 5LQJA 2QZSA 2J5KA 2PYIA 4WIAA 1THMA 2X0NA 5IDWA 1O5IA 4NZ9A 1GZVA 3TLEA 1P0QA 3U3MA 1BWRA 4MR7B 4EJ0A 2DPHA 1DARA 3D3WA 3VHXB 2JI8A 4H6VA 4P4TA 1WABA 4AIIA 3V2IA 3VNRA 1JHRA 4KQFA 2HQ1A 2WI8A 4WNCA 1ORIA 2P8JA 5FJIA 4UC0A 5CB4B 1PG0A 3HC7A 3ZG6A 3H2HA 3CVWA 4A15A 1Y1LA 1IWBB 4MYCA 3U7IA 2SCUA 1UQUA 5E7MA 1O6ZA 2FMXA 3PFHA 4BMCA 5CEJA 1VPEA 2VNHA 3RT9A 1CZLA 4KU4A 1X7ZA 4CHGA 5HW0A 4LWZA 4URHA 3BF8A 4AYTA 2W83A 2A9OA 1TU3A 3NWOA 1UBOS 2LR0A 1ZJ5A 4JOBA 4ZV7A 1YSCA 3R4VA 3EIOA 3OPVA 2HHAA 3JD4A 4HEJA 5KSYA 4R1SA 5JQGA 3FZQA 4RTOA 2OCKA 1JH8A 4KE9A 2R86A 4P7BA 3QU4A 5ICEA 1W94A 4DW8A 2G88A 2X9QA 1E3EA 4N0MA 1E9EA 3IUEA 4EVRA 4GPIB 1RQ7A 4YO7A 2VN8A 3CISA 3B6ZA 4QTTB 4YP0A 3GRUA 4Z2AA 5K3OA 1L4YA 4N3CA 4UEKA 2JARA 3V2UA 2PRJA 1ZRMA 1VJ5A 1UMDA 5FI1B 1SVUA 1Z74A 3G5TA 1A7AA 4QBKA 2HJSA 5CVDA 1IB6A 3RTEA 3CVUA 2DUWA 2H0AA 3E81A 3H13A 1H65A 1PT9A 2IODA 1R4ZA 1XXHA 3NUGA 4N6GA 1GZHB 3SD7A 5J4VA 3K9HA 3PC6A 3N76A 3JALA 3OLCX 1FTWA 4RORA 4XX1A 5L3QB 3B3FA 3MNFA 4W1RA 2WD7B 1ORHA 3IUYA 4L8WB 3H65A 5EKTA 2G1AA 1DWOA 4CGYA 1ABBA 1NRIA 3OA2A 1JPNA 1TADA 1DAPA 2CL7X 2C3UA 3R0QA 4XARA 3UATA 2J3LA 1JQKA 4X94A 4Z49A 4YJHA 3NORA 3OEEA 1KI3A 2ZWVA 1Z0KA 2AE2A 3A6PC 1G8KA 2WM8A 1QHYA 2BHRA 3EMKA 4PSKA 2AXQA 2AXPA 4RF4A 5D3KA 4B48A 3P9RA 3CNQS 3QA9A 3FCUB 4G4SP 3KAPA 4FBGA 2QRJA 4I4CA 2X4LA 3WKEA 2A9VA 4R98A 3P0EA 3SEZA 5KYYB 1CE8A 2OM6A 1HLFA 3WC4A 2QUZA 3VPCA 2WJYA 3AF4A 1DJOA 1K68A 1YDFA 2PGNA 2QRMA 3O31A 4B4VA 2OWEA 4BXOA 4FFBA 2MCFA 3KTFA 4UDXX 2VQFB 2Y1GA 3F2IA 5GOTA 3EA4A 3P27A 2CYCA 2VUIB 3F9RA 2YV3A 1VMIA 5ICMA 3CEMA 4Q3LA 4S35A 5BWLA 1WO8A 2AOUA 4OQLA 3VR4D 3NVMB 1YTUA 4KLZA 4C76A 2HA3A 3SSAA 4D82A 4LV6A 2WE7A 4Q9AA 1NBME 2NO6A 4DXAA 4PINA 4KE7A 5ICCA 3ZQUA 2ZRBA 3IR5A 1QGUB 4NBRA 4C7JA 3TTXA 3DLAA 2Y67A 4RVGA 3FPFA 3IV9A 5J2TB 1CS0B 2I2XB 3GMTA 4H59A 5AYVA 4BKOA 3FKSD 5TT0A 3UAXA 4TYMA 2PK3A 1WU7A 4DZRA 5DB4A 1RABA 1VG0B 3JQEA 3N0WA 3QMVA 4PRKA 1JB9A 3I4LA 4HEA6 3UH1A 1ZEMA 2CJXA 1P3JA 3AY7A 3OWOA 5CG2A 1QH1B 2ORWA 3G2NA 4IZOA 5FF9A 4AMGA 2V65A 1VL1A 5BSEA 1PK8A 2B6NA 4OKNA 4Q5IA 2X8JA 3DHEA 2ZXFA 3HJNA 3O3CA 1PQPA 3TMYA 2AE1A 3N07A 3TPFA 4KITB 5C5EA 5ALHA 2X0EA 2WU3A 3MTEA 4Y2JA 4CM8B 3WLIA 2QA5A 5BQOA 5JS2A 4DIFA 5K0SA 1FDTA 2P4QA 5COAA 3PQ2A 4F5WA 8GPBA 1RLUA 3WA7A 3P2IA 4B44A 4NJEA 1XXLA 2JGIA 3RRNA 1QFMA 1FMFA 2AMYA 3PFGA 3R77A 1P7ZA 5IN5A 3WMGA 3FZYA 1P18A 1UT8A 3R41A 3V4LA 2P7IA 2IX3A 1XZFA 1H0SA 1WMBA 4G5SA 1DEXA 1M2OB 3BWXA 3B20A 3SN6A 3AIIA 3ZTWA 2A59A 4DUGA 4HNTA 4HTAA 3BMQB 3KFVA 1SJ9A 1HQCA 2WAOA 4RLQA 4EG0A 3FYUB 5KYXB 1O3YA 5EVCA 1CJKC 3KKEA 4RK1A 4I5GA 1MO4A 1F2TA 2H2AA 5FBWB 4DIKA 4ROSA 2C0QA 3DTTA 5K3DA 3UWPA 2ZYGA 3HEAA 3GDFA 3IALA 1W19A 4IMJB 3EVGA 2FUG1 1RI2A 3OM9A 3DBOB 3B60A 3UK7A 1A0OA 1BW9A 1OYYA 4I19A 1ZUNB 5F9FA 3WSTA 3TCNA 1ZINA 1OFVA 2ID4A 3CZMA 4IXMA 3TSCA 3ZU6A 2OMEA 4WMLA 5AW6A 1CVLA 1G2PA 2LTAA 2ZCUA 1XFAA 1TU0A 1L4GA 3OWXA 2EJCA 3LX6A 5HFNA 2WJAA 1ZMXA 5TGZA 3IOCA 3OJCA 2IZ0A 5BUZA 3WXBA 1EXVA 2HYIC 5DGTA 2WUEA 5CPFA 1UEIA 4PLYA 4KPEC 3FOCA 1Z5OA 3NOVA 2HRCA 1CLUA 2X7HA 4FNGA 4LOKA 3ZVLA 4DE5A 3E53A 3ZE2B 2OBYA 5I7WA 4X62B 2IRWA 3HJAA 4Q3CA 3EBLA 4RZQA 4A0QA 2EHDA 4MMYB 2ZUBA 3I53A 5AUPB 3KT3A 2JJ1D 5K0FA 1XA0A 5F2EA 1N8KA 3D9QX 4HWSA 2CK3D 3ZCQA 4BTVA 1EFPB 1BQ3A 3C3DA 5IM5A 1CKEA 3QEAZ 4OQNA 2H65A 3ERCA 3ZYCA 3UMMA 2ZTUA 1FSZA 2B5OA 4UVGA 1FYEA 4F4HA 2OBNA 2XTJA 4IDCA 4EYOA 1NW8A 2RJOA 1QZTA 2QT0A 5CDSA 3HVIA 4QRIA 2IUSA 2R8PA 2W2OA 3RJTA 1EGHA 3TLYA 4ARAA 3EX7C 2Q1XA 1CZNA 6ADHA 3KBBA 2X19A 3RRMA 5CB4F 4GYKA 3CWZA 1Y63A 2DQ4A 3NOQA 1GL6A 3B12A 3OX4A 4D80A 4BQFA 1E5XA 4ARZB 1YQXA 3S2SA 4YXWA 2X23A 2ORIA 4AZVA 5LU8A 1O95C 3MSCA 5LMUB 3L4BA 3TIXB 3R7WA 2VWGA 3MAAC 1CF4A 4D8TA 1P4RA 3RBZA 5REQB 1NNLA 1HT1E 1U0JA 4K28A 4BZWA 4DUZB 3T4EA 2I8AA 1LC3A 4GL4A 2B99A 4XUCA 2VH2A 5G3ZA 3SHOA 2WT4A 3WMRA 3FIUA 3ZW7A 4DM7A 2BCGY 5IXYA 1MENA 1P72A 2CLIB 2YN0A 3TL3A 1RCTE 2IEBA 3IMKA 4X0EA 3TO5A 2R5FA 2W0SA 3FSGA 2PSSA 3PHGA 1KY3A 2O0HA 5K0GA 5EZYF 1DBWA 2OLEA 2HRBA 3GF4A 2V7BA 2YZ2A 2QX8A 4WBNB 4N9WA 1JR6A 2YHBA 3DPSA 3CTMA 4MOWA 2GPBA 3VDNB 5E9QA 3OKPA 4F2GA 4MDHA 3DTVA 1X80A 1IUPA 1Q44A 4PX5A 4R2IA 1YDHA 1NWHA 1LPAB 3IA2A 3F2VA 4F3CA 3V34A 3ZGYA 5DGCA 1JEYA 2JCBA 3VR6A 1ZGGA 2WWFA 3CNEA 1NBWB 1T4MA 1MFZA 2FQYA 1XTBA 3D1LA 1C81A 3RF6A 3ORRA 2PKQO 4A6EA 4QNMA 4EJ6A 3K8QA 1JU9A 3KFLA 1M0SA 4UPDA 2WIDA 2HNKA 1NY5A 4MUYA 4KJXA 1J0XO 3MJVA 5TVGA 2FSVA 3PNKA 4KWCA 4WRRA 3TINA 2FW1A 3WKBA 2DWUA 3FM9A 1W73A 3HPQA 1ZHOA 1VSTA 1GWNA 1ZLYA 3BH7A 3L7KA 1FYFA 4QGGA 1IEXA 4G4GA 3FTCA 4IGIA 4XQ0A 5EG5A 1N32B 1T10A 3OKCA 3TXYA 2GN6A 3BJIC 4GC9A 1VLQA 4KIFA 4LNUA 5K3SA 4D3YA 2OYRA 6ABPA 3HO6A 3P52A 3RH0A 3IILA 4F86A 3OZFA 3ESAA 1MC4A 4G1EB 1L3BA 1ZMTA 4PRZA 4X00A 4NMMA 3U1BA 1VXRA 3CW2A 3E9EA 4M86A 4MPJA 1NQWA 2J3DA 1O94C 3PNSA 3O8OB 1YQEA 2NWQA 3QWFA 2C2ZA 4OAOA 5K3FB 2FPMA 3E7WA 3E23A 3H9JA 1FTNA 3IPXA 3QPAA 4MVJD 4EQZA 1T9GR 3GGOA 1FMTA 4H3VA 1J39A 1IDOA 3JAWA 3TSZA 5F7OA 1J23A 1XVUA 3N1UA 3VKHA 3KS9A 4FFSA 2P11A 3LUAA 1RPNA 1UKBA 5T6BA 2OE2A 2XNKA 5KOHB 4L9WA 1LV8A 3L7MA 3ROFA 3SZLA 4HCJA 4EMTA 3HUTA 1J99A 2AJDA 2EW8A 2FRDC 3FHJA 4FUQA 4F0JA 1N2OA 1VSUA 3DHWC 4GHWA 4IVRA 4ZI2A 1XPUA 4L9AA 1WY7A 3GRKA 4H0NA 4DXHA 3LGAA 2JIDA 1EZ4A 4XB6B 4GPBA 3AEXA 2WBLC 3TZ6A 3WGQA 4P5EA 3WBKA 5BYAA 4UUAA 4INPA 1IONA 4OHMA 4RXMA 1IN5A 4BKRA 4EIWA 1U98A 1UM9A 4MWGA 1HTTA 3RLIA 5D1NA 4LW8A 1E3IA 3LE8A 2C2HA 1BE1A 3T7SA 3EPKA 2X5KO 4Q39A 2V6IA 3JV7A 3N2KB 4KMRA 2A0WA 3IT3A 2RGEA 2Y8EA 3K1AB 3BQNB 4LQCA 1EE2A 4Q21A 3ZDZB 2C54A 3IUBA 5IWCA 2ADFA 1L3IA 1W93A 1X15A 2IBMA 4X71A 1T6NA 2D8AA 5ECYA 2WWVD 2PX6A 3E2PA 2DBQA 3UKJA 2H1HA 2DQSA 2V3WA 2CMGA 5FAXA 1HDGO 1RDFA 3JWHA 4IOLA 3IV6A 4HH1A 3T9BA 3EJWA 5CEFA 3CSSA 4ZAWA 2QZPA 1QVAA 2PGLA 4Q03A 5GIPE 4O4JB 3HWSA 4YAFA 2PX8A 4BTEA 4XR4A 2J3HA 5K8CA 5KUTA 3KLMX 4UBIA 3ZY6A 4Y7CA 5KVVA 1VMEA 3NUZA 3QEJA 1OV4A 1P81A 1QGAA 1CJTC 4N7MA 2MYNA 3D8BA 3JVVA 1UADA 1GOTA 2VJPA 4RZIA 4X1KA 4EARA 1NXWA 1OLUB 1XBTA 8AT1A 1CEYA 3WAJA 2ZJAA 3MWFA 3FPCA 1EJ6A 1YRWA 4UQLA 3VI3B 1S3GA 5ALUA 5CYFA 5EAIA 2OVFA 1DPGA 4JVLA 1Z45A 3RC3A 3DQZA 5CU7A 1J8YF 3ZHVA 3Q8LA 1V26A 2QIPA 5DTIA 1XLTC 4D8YA 2P2LA 1EP1B 2ERCA 2H3EA 2WKWA 2XOXA 4I50B 1ZESA 4MINA 3ZZ0A 3HGTA 4IDFA 2CL5A 5AIAA 3HBAA 5JCJA 4DIUA 2WF7A 1WCIB