3H1AA

Crystal structure of este5, was soaked by ethyl alcohol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
296
structure length
296
Chain Sequence
b'AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
molecule tags Hydrolase
source organism Uncultured bacterium
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
total genus 104
structure length 296
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1aA00
3DEAA 4Y2VA 5AKXA 1ZI6A 2QJRA 2XMBA 4FFWA 3H2KA 4G9GA 3WZMA 3EIOA 4FLMA 1B6GA 4F5ZA 3WZLA 1CUVA 5AM0A 3MUOA 5BWBA 2XLBA 3R3UA 4C87A 1T4MA 5D3ZA 4Y2RA 1LBTA 2HA0A 1YAHA 4FNGA 1WB6A 1UWCA 1FJ2A 2BCEA 3ANTA 4PSCA 3PF8A 3IDAA 5HF6A 1XRQA 1YA4A 2XE4A 3DKRA 5K3DA 1ODTC 3DOIA 5AI5A 3AIKA 4P93A 2OCIA 1VZ3A 3N0TA 3N2ZB 2UZ0A 1MX1A 1VOTA 1X2BA 4G8DA 1THTA 1DU4A 2ZYIA 2YYSA 4HRXA 1CUCA 2HFJA 1U8EA 1AC5A 4X7BA 3WIOA 2HA6A 4QZVA 4K6KA 1QFSA 1SCKA 1EHYA 2BKLA 3FSGA 4KE9A 1N1MA 5AI0A 1WHSA 3BE8A 4W1SA 4QE3A 3RM3A 4PO3X 4CIAA 2XUAA 3M83A 2OQIA 1CVLA 1ODSA 3I1YA 3O9MA 3G9TA 2ZJFA 1XZKA 4U2EA 2WJ4A 1XRNA 1E89A 3WI7A 3GFFA 1XZEA 1AUOA 2VQ6A 2H7XA 4P9NA 1QIDA 1H23A 2HA4A 4WDRA 1ZOIA 3AZPA 1QJ4A 4EY6A 1JJBA 5DNWA 4H7FA 1N5RA 4H0CA 3STUA 4EY8A 5CH5A 5CT9A 3DLTA 2WIFA 2GBFA 4DMKA 1BE0A 2ACEA 3LIIA 1XRRA 3ED1A 1ISPA 2OAEA 3F9CA 1XZHA 2QKYA 5LKAA 1RYYA 3WWCA 5C8XA 1MNQA 1BEEA 3S2ZA 3FLEA 4BDTA 3WJ2A 4C01A 2QS9A 4RE5A 1TCBA 3ZV7A 1JT2A 4I19A 2C5FA 1CUWA 1MO2A 2GYWA 2XMGA 1BCSA 1G5FA 1N8SA 5J3JA 3PUIA 2OLEA 4P08A 2XI4A 4J3JA 4Y2PA 2E3JA 4GW3A 3WK6A 1Q83A 1AQLA 4E15A 4PSUA 3PFBA 4MWSA 2VT7A 3H2HA 1ZD4A 2PKYX 3DNMA 4Y2XA 4DNOA 4I4CA 5IVHA 3VXKA 3WKBA 3PUHA 3CN9A 2HRRA 1GXSA 3EQ7A 2Z8ZA 4EY5A 2HM7A 1XLVA 1ACJA 1QO7A 2IIVA 4LXIA 5DYYA 5ALYA 4CI9A 1A88A 1DINA 3OC0A 1ZD2P 3WMRA 5JAUA 2VAXA 1A8UA 2W6CX 1WOMA 2I03A 1QGED 1A7UA 4N5HX 4QLOA 5DTIA 4C88A 3AJAA 1NX9A 2XUKA 2WFLA 1UZAA 4G9EA 4G4IA 1J1IA 2JEYA 1ETHA 4WFJA 3JYHA 4B85A 4U2FA 4BCBA 4Q34A 3GA7A 3O4HA 5ALNA 4E46A 5EIHA 1GZ7A 4ZREA 2VJCA 5H3HA 1EI9A 5AKJA 3M82A 1BRTA 1BN7A 3W9UA 5AM5A 1ZIXA 3H2JA 4QDUA 2DCMA 4V2IA 4OB7A 1GKLA 2CZQA 2H7CA 1FFEA 3C6XA 5EIEA 4EHBA 4N8DA 1KU6A 3O4JA 2ZYRA 2WHRA 1ZI9A 3H1BA 4BATA 3HXKA 5LZ8A 1YR2A 1KU0A 2ECFA 1F0PA 4AXBA 3ANSA 5ISMA 1CUEA 1CRLA 2D5LA 1UK6A 3D4LA 1WHTA 2VJDA 3WL5A 5LZ5A 2H9YA 4MYDA 2OCGA 1VA5A 5AKGA 2AJDA 3DYIA 3IIIA 1ZD5A 2DQZA 2O7VA 3X3HA 3O0DA 5EIAA 4DMCA 4CG3A 5EHXA 1TRHA 4C6HA 3ESBA 1QIJA 3PFCA 1CR6A 4L72A 5HF8A 4GDMA 2XUHA 1E8MA 3F8SA 2DSNA 1PV1A 3HABA 2WU3A 4XWGA 4Q3OA 4KACA 1YS2X 2WIDA 4W1RA 1WB4A 2CUTA 2QOEA 2VJBA 3C6BA 1M33A 5HF9A 3UUEA 2CKMA 2FJPA 3B5EA 2JEZA 5JZSA 3R3YA 2HL6A 5CT8A 1UT6A 2PL5A 3O9VA 3C8DA 4G4GA 5DNUA 1CFJA 3LCRA 4X92A 2DFPA 5CH3A 1GPNA 5DJ5A 1LBSA 5KBYA 2PU7A 4BP8A 4A23A 1VXRA 3CXUA 3HJUA 1SCIA 2OAGA 5HKBA 2JGLA 1R4ZA 3STYA 3IVMA 1ZGBA 2Y1KA 2XQIA 4CCWA 1JJIA 4CG2A 1XFDA 3STVA 1W76A 4BVKA 5KWJA 5ALSA 5AO9A 2HADA 4J0IA 4UBMA 1XRPA 4UBNA 4U2BA 1QE3A 5C7YA 5JALA 1WM1A 4W63A 3WL8A 1XLUA 3B12A 3KOOA 3D7RA 1GT6A 2CEKA 4B84A 4J0GA 2OPHA 2JGMA 4IH9A 1XZFA 1UXOA 2QT9A 2I3DA 4H7EA 1USWA 4AN0A 3PF9A 2ZJ6A 3QMMA 1XKTA 5KWIA 3TJMA 4DMHA 1IUOA 1E66A 4BBZA 3G0IA 4I3FA 3GBSA 1H2YA 3L1JA 2LIPA 2JGFA 5AKEA 4G4JA 2WIGA 3STXA 2XMZA 3R0VA 3KD2A 3U1TA 5HZGA 4H77A 1IZ7A 1EX9A 2XUPA 1L7QA 1MTZA 1YSCA 1SC9A 1W52X 3C5WP 2QMQA 4G5XA 1YASA 4NZZA 5CT6A 2Y2VA 3F97A 2WTNA 1QTRA 4WY8A 1J2EA 4Y2TA 4CCYB 3FBWA 4OYLA 2C4HA 3FVTA 1DWQA 3H0CA 4ZXFA 2AJCA 4Y2QA 2JIDA 1BU8A 4OB6A 2ORYA 1CUHA 1MN6A 3AUKA 2P8SA 1QIKA 4K6GA 2HFKA 5CT4A 4G1FA 5C81A 3G0GA 4U2DA 3I28A 2WTMA 2B9VA 5K3FA 4AMZA 2OGSA 3ZPXA 5JAOA 1J06A 2AJ8A 4H7DA 1FSSA 4OYYA 3I6MA 1P0PA 4BDSA 1JMKC 5LKRA 4FDMA 4FMPA 5ESRA 2AJLI 1Q84A 3OURA 4UBKA 5EHQA 1MJ5A 1MX5A 3YASA 2JGIA 3HRHA 3DQZA 3G9UA 3HACA 3IUQA 4D9JA 5D6OA 5ALMA 1QFMA 1BN6A 2J3QA 2ZJ7A 3F96A 5AKYA 3FNBA 5K3CA 2GYUA 4KEAA 4BAGA 2ZYSA 4ROTA 1QIGA 4K2AA 5AK5A 3T4UA 5E4TA 5JYCA 5ALOA 2QR5A 3UUFA 2G4LA 1CUZA 1UOPA 5JAHA 4OU5A 4OSEA 5FDFA 4DM7A 2YASA 3HSSA 5FRDA 1CLEA 1XZIA 2WUFA 2Y2UA 4JH0A 4Y2UA 3IURA 4H7HA 4OU4A 3DJYA 2ROQA 5JAPA 3MUNA 2QUAA 2WKWA 4F0JA 1CUXA 1LPPA 2GZRA 1F8UA 4FNMA 1MAAA 3C43A 2C7BA 3D0KA 2WSLA 4FWBA 2Q0XA 3WJ1A 1IUPA 1EINA 2BGRA 1XQXA 5CW2A 1CUGA 4X90A 4QLAA 5SYMA 2QVBA 4KE6A 1EXWA 1CEXA 5HQ3B 1R50A 1EB8A 1IUNA 4IO0A 2HRQA 1YB7A 4HTAA 5EGNA 4KYVA 1JJFA 3QMVA 3PE6A 1CQZA 5KREA 4YX9A 1QTIA 2EEPA 4TGLA 5ALRA 4UFOA 4N8SA 3V9AA 2V96A 2X5XA 1CUYA 2B4KA 3IUJA 2OXEA 1Q0ZA 5T4EA 3GELA 2ZSIA 4NMWA 3VDXA 5JADA 4PW0A 3IULA 1F0NA 3GROA 1P0IA 1PFQA 4E11A 5DTJA 5LZ4A 5K5EA 4BCDA 2WJ3A 3D3NA 4MQMA 2HHAA 5IKXA 3WKCA 1LPBB 2RHWA 1TIBA 1CUJA 3QPAA 1AX9A 1FFDA 5AP9A 1EDEA 1FFBA 1C7JA 3FWHA 5K3BA 1Y37A 4AO6A 1X2EA 1XKLA 4PV7A 2WHPB 2H1IA 4M0MA 1CUAA 1TK3A 1YS1X 2VJAA 2CBGA 5IH7A 4DMFA 1WCYA 4DSZA 4J0JA 4HS9A 4X94A 4LYEA 3U0VA 1CV2A 2HA3A 2O7RA 4IHAA 1VE6A 2VA9A 4L9AA 4KAJA 3NWOA 2JGEA 5A7GA 3FOBA 3TEJA 3BJRA 2G5TA 2PX6A 1GPKA 1G66A 3DCNA 1VA4A 3JWEA 2XUJA 4K5QA 3NOXA 4EUSA 2WG2A 2HA2A 1YCDA 3D2BA 4K6HA 3HC7A 3EQ8A 1GKKA 2BAGA 2QXTA 4AZ3A 2DHDA 2JGKA 1XZCA 2X76A 3WWOA 2BUBA 1DWPA 1HQDA 4HZGA 4UHEA 3CCBA 4UHDA 2ZYHA 3Q0TA 4KRYA 4Y2YA 4FBLA 4B6GA 2WU4A 1NU6A 2CB9A 4Q1VA 1D07A 1UK9A 5ALIA 3EQ9A 5FOQA 1LPAB 4G8CA 1K5PA 2PU5A 1WB5A 4MQLA 2D0DA 5FP0A 4DIUA 1EH5A 3LIPA 4X3CA 4UHCA 5JD4A 4FFVA 4Z49A 1WPRA 2V97A 1R88A 4AN1A 1E8DA 2K2QB 5D3KA 1TKRA 3DS8A 4LKOA 4FLFA 1RWQA 3D59A 3WKDA 1C7IA 2VT6A 3G9ZA 3B3QA 3OG9A 4XJVA 4CFSA 3SWWA 4TVKA 3WA6A 5DLPA 1JMYA 1HL7A 1OXMA 4EBBA 1H2XA 2GBCA 1W6RA 1BEZA 3F67A 1K4YA 3E0XA 5HFNA 4UBOA 1H22A 1QZ3A 3I2IA 2QXUA 1A8SA 1S8OA 4HRYA 4J0CA 3FSGD 5CXUA 1HKHA 4UUQA 5FV4A 4ARAA 3WK8A 3VVLA 1P0QA 4WY5A 2YH2A 3G7NA 3R40A 1L7AA 4HXGA 2PPLA 1MPXA 1EK2A 4X93A 1VE7A 5AK6A 1TQHA 4LIPD 3WLAA 4AMYA 2XQJA 2C0QA 3H04A 1XQWA 5EI5A 3QBJA 3QZUA 5K3FB 3I2FA 5I7UA 4BYMA 5AI4A 4Q3LA 1IZ8A 3P2MA 3D2CA 4AZ0A 4A16A 4F21A 4XIIA 4BTLA 2XUIA 5AI6A 4AB1A 4NS4A 3MVEA 3KXPA 3WWEA 3VVMA 2I78A 1CPYA 3C45A 4DSAA 3VKFA 1H2WA 2XQGA 2HU8A 2FUKA 4GWLA 1CQWA 2XMQA 3HEAA 5AM2A 3AFIA 2WUEA 3G8YA 4ITVA 3V48A 3R3ZA 2C58A 1K6EA 3W05A 4DNQA 3AIOA 2X8BA 3I6YA 2HA7A 1IVYA 3H19A 5EHZA 5IVDA 1UKAA 4H35A 4J0DA 2WILA 3FCYA 2VTVA 2YXPX 3L1HA 2PUHA 3KWJA 3QPDA 1FFCA 3KSRA 3TGLA 4HVTA 2V98A 4A5SA 5JZ9A 5ALGA 4UHFA 1HPLA 2XMSA 5AK4A 1O6GA 1EDDA 1NU8A 5LIPA 1XQYA 4X00A 3R3VA 4YK7A 5BWCA 4QNNA 5E4JA 5AOAA 2PBLA 1OILA 2PSHA 3WK5A 5T4BA 4JYPA 5JASA 2XQFA 2RIPA 3H18A 5JATA 1JU4A 4RE6A 3WK9A 1T2NA 1UK8A 2XMRA 2VATA 1AURA 4INZA 2BFNA 2PM8A 2OCKA 2WIKA 4BP9A 4B9EA 4KAFA 2C0PA 3QH4A 4H7KA 2WHPA 4X6YA 1DTEA 1RP1A 4UFPA 5ALEA 1E8NA 4Q05A 5FXMA 2DR0A 4Q82A 3IUMA 3SK0A 3WKEA 4MWTA 1XZBA 5HFAA 4ZGBA 1R1DA 1ACLA 4TPKA 4WJLA 2JBWA 1BS9A 5ALKA 4ZWNA 4CG1A 4F60A 4GLBA 3HLKA 3O95A 3HYSA 1EDBA 5ALQA 3R41A 3DL4A 3A2NA 3AILA 1HDEA 1DQYA 4M0EA 4KE8A 4LHEA 4B7ZA 2J4FA 5HK8A 4N5IX 1C4XA 2PVSA 4U2CA 5AM1A 3BL8A 5CMLA 1J07A 2WG1A 3R3WA 4UBIA 1TCAA 3L1IA 4DLNA 4B80A 4B81A 1YA8A 2WUDA 1EK1A 1H2ZA 1DX6A 5JD5A 4ZV7A 1DWOA 3ILSA 4MYSA 4GBGA 3BF8A 3G0BA 3WK7A 4OUKX 4M0FA 3NGMA 4BVJA 1AMNA 2H7YA 2J3DA 3OTQA 4L0CA 5CXXA 2OCLA 3BIXA 4X95A 5CURA 3K9BA 4BZWA 3STTA 3FVRA 3EF3A 4EY4A 2XUOA 4UBLA 4J0HA 3M81A 4BB0A 5HKAA 3WWDA 2HDWA 4OD0A 3DKKA 4UPDA 1LPOA 3T52A 4RGYA 4B0PA 3ZLVA 1JKMA 5AKIA 3AZQA 3D5EA 3ZWQA 5ALLA 1E3QA 4QWWA 3WL7A 1LPSA 3MGAA 2Z5GA 3FAKA 3GUUA 5LZ9A 3I6ZA 2JF0A 5A7FA 1XQVA 2XUGA 2ONCA 4Q3KA 5C8ZA 4B0OA 4MXDA 4LXGA 5CRIA 5ALXA 3H1AA 3WK4A 3Q8WA 1UOQA 2WM2A 5A71A 3H2IA 4H18A 1UOOA 3I2GA 3DL7A 3KWFA 3VJMA 3FCXA 2XT0A 5LZ7A 2QZPA 5HQ3A 4MEBA 3V1KA 1K8QA 4MJ3A 1O6FA 3VJKA 3E1GA 1CUDA 2J4CA 1R3DA 3QYJA 4IH1A 1QIEA 3C70A 2PSDA 1JI3A 4HXEB 1Y7HA 2XB6A 2QM0A 2QRUA 1W1IA 4ZI5A 2Y6VA 5K3AA 2B61A 5E4YA 5CH8A 5JD6A 2WHQA 5ALTA 1L7RA 5FKJA 5EFZA 2WQZA 2RHTA 2DHCA 3R3XA 1UKBA 4BC0A 2RONA 4QDOA 1GQRA 1ZJ4A 1MT3A 4WFKA 3FLBA 4QDZA 4N8EA 1ZICA 1UK7A 2NW6A 2OG1A 4X71A 3GZJA 3BDIA 5ALVA 1P0MA 1DX4A 2G5PA 1FFAA 4OCZA 1Z68A 1QIMA 2DHEA 4H7JA 4XVCA 2V9ZA 3H2GA 1R9NA 1XLWA 4EZIA 1XZLA 2VAVA 4S0XA 3C6ZA 1ZGCA 5ALDA 1EB9A 5FPPA 4O08A 4C4ZA 4DTCA 2VF2A 2IX9A 3ESAA 5AOCA 3EBLA 3ICVA 5LLSA 4J0KA 3PDCA 5DYWA 3D2AA 3JW8A 3V1NA 3WL6A 3WYNA 3W9BA 3WQHA 5FLKA 1QLWA 4X85A 4FTWA 1DQZA 4YPVA 1MAHA 5CBKA 1GQSA 1XZJA 3A2LA 1G42A 4U2GA 4X6XA 1HLGA 5AI8A 5AIAA 1ORWA 4BTVA 5BV7A 3FYTA 4GI1A 5ALHA 1WPXA 1Q0RA 3W2TA 4L3WA 5E2IA 2XQKA 4KR0A 3M3DA 4WFIA 1THGA 1MNAA 2XDWA 4AQDA 5JANA 1K63A 2HU7A 3CCCA 2Z3ZA 1XRLA 4RNCA 4FHZA 2WIJA 2RGUA 1QO9A 4ZRDA 4QDXA 5T4FA 4WCVA 4W9RA 5D7BA 1ZI8A 5FPQA 3G9XA 4DNPA 3NUZA 3AINA 3WWPA 1F6WA 2GBGA 5YASA 3VJLA 1G4HA 3SC2A 4CCYA 3KDAA 2O2HA 2BJHA 3FLAA 5CT5A 5AKKA 3BF7A 1W75A 2G63A 4AO8A 3W04A 4BAUA 2XMCA 4EB0A 5A6VA 2R11A 4HXFB 3C6YA 3E3AA 5IVKA 2PUJA 5AOBA 2ACKA 1MU0A 4Y7DA 1LLFA 4X91A 1CUSA 1XZMA 3I2JA 3UMJA 3BWXA 1I6WA 2PSFA 3V1LA 3G02A 1LPNA 2C5GA 4FLEA 5AK3A 2HU5A 1QIIA 4X6UA 3AIMA 2XUQA 3HI4A 1W4LA 1JU3A 3V1MA 3O4GA 5AKZA 2OQVA 1CUUA 4HAIA 4NVRA 5LZ2A 4EY7A 1CUBA 2IITA 3SX4A 3QMWA 4BE4A 4DGQA 3I2KA 5F4ZA 2PSJA 3WKAA 1LPMA 2QTBA 1LZLA 2ZSHA 3OPMA 3C87A 1ZIYA 2I3ZA 4W1PA 4ZV9A 1DT3A 4BZZA 2WLSA 4P92A 1VLQA 3O4IA 3WYDA 4FOLA 3BDVA 3CN7A 2JGJA 1CUFA 5LYYA 5AM3A 1EA5A 1HBJA 5CTAA 2RAUA 4PQEA 1ODCA 4BRZA 2B20A 4FBMA 2AJBA 1R9MA 1PJAA 1ZJ5A 5AH0A 4QWMA 1EVQA 3FYUA 2XUFA 3QPCA 3DOHA 3K2IA 4JNCA 4Y9SA 2BGNA 5ALWA 4X97A 7YASA 2GZSA 3RK4A 4E14A 2BUAA 4RPCA 1GGVA 1SFRA 2VSQA 1QIFA 2WFLB 4EA6A 5ALFA 3RARA 3A2MA 5AICA 4BAZA 3PI6A 5AKLA 5AM4A 1XZGA 3OM8A 4OB8A 5EHNA 4IH4A 5A2GA 4C4YA 2VEOA 4JUIA 5K3EA 1AZWA 3C8HA 4GXNA 2ES4A 3C5VA 4UHHA 2FX5A 3IB3A 2Z3WA 3ESDA 4G8BA 4MEAA 3A6ZA 1DT5A 5SYNA 5BOVA 2HIHA 2QJWA 1JFRA 4J7AA 6YASA 3G0DA 4YASA 1LGYA 1IMJA 3FYUB 2RI6A 1U4NA 4PF1A 5AHXA 4AX4A 5I8PA 5ALUA 3PICA 3A70A 5HK9A 2WG0A 1YB6A 4PSDA 4BCCA 4BE9A 1XZDA 5ALJA 5AKHA 3DDUA 2WFMA 1YAJA 4CIBA 5FUMA 4B82A 1VXOA 4IQ4A 4XX1A 1A8QA 3W06A 4JEIA 3S8YA 4KRXA 3OOSA 4UHBA 2OGZA 2FJ0A 2XMDA 2GYVA 3LS2A 3LLCA 2CJPA 4WDQA 3AZOA 5AJHA 4DNFA 3ZLUA 5JZBA 1TCCA 3TRDA 2O2GA 3BIWA 3I1IA 2WUGA 4H7IA 4GHWA 1SCQA 4B83A 1ORVA 1BROA 1UFOA 3DD5A 3BXPA 5AI9A 1ZD3A 4JYMA 1EVEA 1N5MA 5T4HA 2Y6UA 3IBTA 4QDTA 4J03A 3QITA 5LP1A 5ALPA 3ZLTA 4BRSA 4BC1A 1U65A 3FYUC 2OGTA 3G0CA 5JIBA 3IA2A 3QM1A 5DNVA 4W1QA 1TAHA 4KJXA 3LP5A 1LZKA 1XRMA 4QA9A 5HCUA 2QUBA 3HZOA 4FKBA 3I2HA 2W22A 5ALZA 2O2IA 5A62A 1LNSA 3BJMA 1OCEA 1Y7IA 3ZI7A 2GBIA 5IVIA 3QVMA 4C4XA 4AO7A 2ZVDA 2HA5A 4B9AA 3ICWA 3RLIA 2DQYA 2EDAA 1VKHA 4Y2SA 1VZ2A 5A7HA 1VJ5A 4ETWA 4LXHA 3H17A 1XZAA 4BVLA 1QIHA 4OPMA 5I9IA 4DYHA 4KAAA 1XROA 3ESCA 1CIJA 1UKCA 4PNZA 1BCRA 4C89A 5HF5A 1QOZA 3WIBA 3IUNA 1AGYA 1U2EA 4GEGA 2WFZA 2XLCA 4KE7A 3E4DA 5DWDA 3K6KA 1CUIA 4ARBA 2PSEA 4UFNA 4UBJA 4GECA 1B41A 1AKNA 3VISA 1SOMA 3F98A 1E5TA 1MX9A 2WJ6A 3STWA 1X70A 3WA7A 3DYVA 3RKSA 1GPLA 2R8BA 1QONA 5JARA 1KEZA 4LYDA 5DYTA 2AXEA 2CMFA 2EDCA 2XUDA 4QEKA 4Y2JA 2Z8XA 2BUCA 5AIBA 5C8VA
chains in the Genus database with same CATH superfamily
2HRZA 3EZYA 2ZJ3A 4L5JA 4Y2VA 4CQLB 3Q3VA 4C3ZA 3ETEA 1PR9A 1PFYA 2QJRA 3T9FA 1Q20A 3FZEA 2BF7A 1K1EA 1AGRA 4HAOA 3I05A 3KKMA 1A9ZA 3ROTA 4G9GA 4YJ2F 3DCYA 1ILEA 3OJWA 1XCOA 4NG4A 4LX0A 1YRWA 3NMUF 3IL2A 3IQHX 4HDMB 3RIHA 4WKOA 4YRQA 3UMRA 3EIOA 4KX3A 1XRJA 1YOBA 4FLMA 3EE6A 2V7QA 4F5ZA 3UTCA 1YHZA 1JVNA 1UPAA 5DBFA 4GM4A 2I34A 4YMWA 2AK3A 2O3JA 5C80A 3HY6A 3QU9A 1GLVA 1T4MA 3L0PA 4LRTB 1GSHA 5D3ZA 4AS1A 3PXAA 4KWHA 2QJFA 4ABTA 1R2QA 3X1JA 2XDQA 4ZT2A 2IKSA 5DNYB 3FPGA 5CX1A 5DM60 2FNAA 3GHHA 3Q3JB 3V6LA 1NW8A 1VJGA 3QVXA 5BSWA 1AQIA 1D2GA 3JALA 3OQOA 3CR7A 1BWPA 1HT0A 1TM3E 4Z4IA 3TTYA 2ZGVA 1WZ2A 1G55A 1W1UA 3BZWA 4UTRA 5J4YA 3THYA 5HF6A 1XRQA 1KJ9A 3BXXA 2QUIA 3I9LA 1WV0A 3AIKA 5AI5A 5TMBA 1QF7A 1O95D 4OLBA 1MT0A 1TA4A 3LWNA 3N0TA 4RTKA 3OE7D 1QYIA 2WVJA 3KB8A 2L69A 4Z1MA 1S5PA 3TZCA 1THTA 5IN4A 3M33A 1UFKA 5JFGA 4BMNA 1I2ZA 4A0QA 3ZQUA 1KHHA 2OZLA 5ILGA 2ZSEA 3BMQB 4RA6B 3ZGYA 2RE8A 4E1AA 5JQWA 4MUYA 3B2NA 1NFQA 2X1MA 2NPOA 1ORHA 1OWNA 3QY0A 4X7BA 4L5IA 3WIOA 3CPEA 1TUBB 1BDJA 2RGAA 1SWVA 3EGEA 4EGFA 1NXOA 2OWDA 4M8KA 4K1LA 1QFSA 1WUTA 1NVWQ 1SCKA 3H5TA 4HFNA 4O1HA 5GINE 2YNMC 3PNBA 3RDPA 2Z6UA 2FG5A 2X42A 3FDZB 3FSGA 1JNXX 5AI0A 3NYWA 3VHQA 1WHSA 3BE8A 3RJ9A 1KY4A 1F5NA 4Q15A 3ZX4A 2EYUA 4XFKA 2VYQA 1JG7A 3L8MA 4N54A 5KQRA 2VH5R 1HEYA 4QJIA 3OA0A 3X2FA 3JRNA 5HJEA 4BNTA 3PKZA 4DCSA 1UMKA 2IXBA 4YAFA 4BQRA 5COBA 4CIAA 3MINA 2PBFA 4LGVA 4ASUA 4LDPA 1E79D 4C03A 4CYMA 4BP1A 4D42A 4Q9JA 3BRQA 1QUEA 3RVRA 4F5DA 4DLBA 1ODSA 1IB0A 1EAYA 1FRVA 2JAUA 1GRCA 2LIVA 2VWQA 2BDTA 3FMVA 2M98A 3MN1A 3O9MA 3L6OO 2DQKA 2R0QC 3HWWA 1J7KA 1D5CA 4PNEA 2XGSA 5FFNA 4GL4A 5BV2P 5EIBC 3U1BA 3UM9A 5KWEA 1AUQA 1MABA 3DH0A 5CA0A 2R4TA 1L5FA 2OPBA 2W58A 2YJ6A 4OOFA 1H0SA 3W6OA 1JEOA 3GFPA 2H7XA 1NSTA 1NBAA 2QVXX 3OWOA 3DDCA 1CK4A 4L9RA 4BWFB 3L8CA 4ZEMA 1XCLA 2AYZA 3C39A 1EJ0A 2ZFUA 5CLHA 4QUJA 1FBNA 3NVKI 4WK6A 4XQEA 1QJ4A 2HLPA 1O08A 5AWFC 1HG0A 2ONKA 4AD8A 3STUA 1ZOPA 4L4RA 3IKTA 1KJJA 2PL3A 4RLFA 5EPOA 4Q9DA 2NT4A 3N05A 2GWRA 2A67A 5FTNA 2PUCA 5CT9A 3RSOA 5FYQA 4I9FA 5IHPA 4G0ZA 3SYLA 1Y63A 3HKCA 2IEBA 5FV7A 4OY3A 5LP1A 1F2TA 4L57A 2R4QA 2CVZA 4LJ8A 1XRRA 4LDNA 2HMSA 1GFSA 2P77A 4ND5A 1ONPA 2H0RA 3FTNA 3IHLA 1VCNA 2G82A 4V0MA 1L7NA 3MMSA 3A05A 4KVAA 2YZMA 1GPJA 3F9CA 2C59A 2GPAA 3E84A 2QKYA 3DE2X 1WKCA 5LKAA 3RUCA 1G291 3WWCA 1UDXA 1R6BX 5T41A 4XEHA 4R0MA 4C01A 2H4HA 1ZQ9A 4OKIA 3F71A 5JBNA 1YBHA 3JQ9A 2O1XA 4L51A 3UAVA 3IT0A 3KQWA 2H17A 2NZYA 2RH8A 3OY7A 4MKZA 4PFQA 4R1PA 2ENWA 4RE5A 3SSMA 5KJFA 2ZVPX 2I1WA 3KYBA 3TGPA 1NXPA 1DLIA 1OI4A 1O94A 1YHYA 2O0LA 3PLRA 4S2UA 1ZJJA 3W5BA 2JIOA 4EFNA 4BUZA 1TADA 1M1NA 4J49A 2PWAA 4C0XA 2JCBA 5EGSA 1T6ZA 2W6IA 4EF5A 4LSWA 2O20A 4JMLA 2CE7A 4Y6OA 1N8SA 2YINC 4OVKA 1UKEA 3WSWA 2P1DA 5BY2A 2PFSA 3PUIA 4P08A 3K5WA 4M9ZA 1P2UA 3K5HA 4KVZA 4QUBA 3BWMA 5IM4F 2F43A 1E5VA 3V4SA 3W8EA 4KAXA 2IHKA 1NBHA 1I9CA 1RYMA 1E1QA 4BLTA 4M88A 4QNMA 1XVVA 2JIMA 3TR5A 1A9TA 4HGRA 4IQ0A 5BSFA 4FXOA 1VCIA 5C4IA 1X8JA 3B3JA 1EGVB 4YI5A 2CW5A 1JBKA 1U2TA 4AJPA 3HB1A 4QPJC 3ND8A 5TEVA 1RC8A 3SHVA 1Z06A 4V0ME 1SUWA 4P5EA 5HZKA 4XUCA 2WWHA 4MWSA 3H2HA 5DEIA 3WYBA 3VDNB 3G2QA 4R5MA 1QPGA 1U4SA 1Z0ZA 2PLAA 4PR3A 2FLKA 3C6MA 1F2TB 3H3JA 4IR7A 4Y2XA 5JWOA 2W0SA 1DJLA 1JLHA 2E89A 4KVFA 4OXIA 3J7AC 5AVZA 2O59A 2VL7A 3PUHA 3CN9A 3VYTB 3ZC3A 3I37X 5DSZA 2Z2XA 2HRRA 4QYWA 4TMFA 4TZTA 2A7XA 4QD3A 2WWVD 3TM5A 3W8RA 2QVYX 2OO5C 2W5UA 3B5IA 1XLVA 2XWPA 3UFBA 1ACJA 3ORHA 1QO7A 3AUTA 1RQPA 1TTPB 4LXIA 3SE7A 1JH9A 2O54A 5B7PA 1IM2A 4E1BA 4HFJA 1GFZA 1ADGA 2GCOA 5LBUA 4B3XA 1SXJE 4GR5A 2ZWIA 1IG3A 5TX7A 1M2VB 1T36B 5FPHA 5K0CA 5KYUB 2HDOA 1CY8A 3K8QA 2I03A 3FKJA 2VG8A 4IGAA 1WX1A 1OLUA 3TVDA 2Q3HA 2AMJA 5B53A 1VG8A 2E85A 4QLOA 1XYYA 1AA6A 3HVUA 3QELA 3BDAA 3GPIA 4KQFA 1Y9JA 1L5SA 4GI3A 3UXHA 1F38A 3L7YA 1Z6XA 2CXHA 1Y9EA 1VECA 1UBOS 3L4EA 2ZRMA 3D8RA 5IANA 2QY9A 1U28A 3CLTC 3PDWA 4K05A 1XELA 2VJLA 5BORA 1P6UA 2BR4A 2ORIA 3L82B 3H5AA 2J3LA 3EEYA 3ICCA 3IR5A 4L4ZA 1A2OA 3M1AA 4LV5B 1NL3A 4JI8B 3BREA 4FBGA 4PZ9A 2JEYA 3CGWA 4QPZA 4EY3A 1Q6YA 3P0IA 3Q5EA 5BUSA 4D9EA 3NDRA 4O4JF 3ZD9A 1DC4A 1SUAA 1MMFB 1FP6A 3HTXA 4ZU3A 3WBBA 3GA7A 1MJGA 2V0NA 4ZCMA 2YXDA 2A30A 2FF5A 4L15A 3IHKA 4PYQA 2K87A 2GK6A 2JJ2D 1Z5UA 5U1PA 4E46A 1WZNA 1Z5NA 5CAEB 4CLOB 4DB2A 3ZEIA 3K1AA 1YB2A 1J5PA 3PZRA 4L0DA 1PFGA 1XMSA 2GN0A 3NM5A 4RV5A 1QX3A 2CWDA 5H3HA 4A2WA 1U7OA 5TDHA 3CIOA 1U0EA 2P11A 1BRTA 1EBBA 3CF6R 4GZ6A 3TAXA 2CHEA 5JQGB 1ZW1A 3O4FA 3VTFA 3KU4A 1ODLA 1F2DA 5KQLA 1JDBB 3W9UA 4HNVA 4LE1A 2REQB 4DCTA 1RCFA 3IP5A 5DM2A 5GONB 5HTOA 1DX9A 4QRDA 3RYCB 3GFQA 5HNKA 1EG2A 2A3RA 3M4NA 1DBPA 1RQRA 1Q95A 3DV0A 4JU8A 2QGZA 2DCMA 3NTVA 4LYFA 1Q0SA 3TQRA 4V2IA 1T5HX 3ZU2A 4EFMA 4V1CI 1BGXT 3L43A 2QRZA 1RJFA 3IQGX 3JQFA 4MW4A 2LNDA 3C6XA 3K0FB 4OQEA 5H83A 2AG0A 2P4QA 4QRHA 5JRJA 4MUJA 5C1PA 4K9MA 3PXEA 3ORSA 4J76A 1MO4A 1Y6ZA 5IM5A 2ZYRA 5SZHB 4YRKA 1RMQA 3JZFA 2P5SA 3LW8A 3GV0A 3K3PA 3IEUA 4XLZA 2CFCA 2WICA 2I6XA 3L04A 3C5HA 4XWYA 2OC4A 3I5UA 4HZIA 3GFOA 4RACA 2PH5A 2ECFA 4M1ZA 4RPGA 2ZWAA 3FVQA 2IYYA 1SIBE 1UXKA 1RYZA 1F0PA 2VZ8A 4QFCA 3H1TA 2YRFA 4BMYA 3ANSA 2BKUA 3ZUPA 1WXXA 2D5LA 5ICCA 4RTPA 1OLSB 5BSMA 1WHTA 2IZ7A 3R74A 2XWSA 1YCGA 2WLTA 1FDRA 4Q1BA 3VNBA 3HCEA 2ATXA 3GPDG 4KXMA 4YUVA 1J9ZA 2Q45A 1F4LA 3UJ7A 3ZU5A 2MR5A 4F46A 4PQRA 3GIWA 2FRXA 3N6VA 4L6CA 2B8WA 4XGRA 2ZQ5A 5DHUA 2NUPB 1AKEA 2HY7A 2OO7A 5ES4B 1WVMA 4LJ4A 2PQMA 3K94A 1ZLXA 3BXFA 3OCVA 1L7DA 1YJAA 2F3UA 3SC6A 2SNIE 3WYEA 4DLSA 3DKVA 2PV0A 1JX6A 2FR8C 3MWLA 3O3OB 1EUDA 4KXXA 1CR6A 3HV2A 4ND8A 1TT7A 4NP6A 3V00A 5B12A 1EFUA 2D00A 1KQGA 4M9UA 1NAIA 4A8PA 1ZGHA 2PA3A 3VZDA 3HBMA 4O29A 3HUEA 1KF0A 2NNLD 2DSNA 1JA9A 3PI7A 4TRNA 2W00A 3F3MA 4A6PA 2J09A 2L19A 1HOXA 3A31A 3NPAA 2WU3A 3BGIA 1PK9A 4C0LA 3GARA 4XWGA 4D6YA 4TWBA 5JAIA 2QQFA 2XVZA 1A8PA 3OKFA 4NR0A 2RHLA 4HWGA 5EZYA 5DVZA 1BRMA 4W1RA 1A9YA 3VYSB 5BRAA 3L06A 2BRUA 1D4ZA 2VZLA 1UMDB 4JDUA 5M2QA 1L5LA 3T3MB 1FVOA 3DFIA 3H8VA 1WB4A 1ZIDA 1USUA 3FZGA 4QYIB 4UTNA 5EJ6A 4CGZA 5TMDA 2YJNA 2VJBA 1M54A 4HRAA 2YZGA 3K8OE 3TJZA 5BNWA 2C77A 2Y92A 3UUEA 2JAQA 4ILEA 2YWJA 1IN8A 1L0BA 1XIVA 2JEZA 3C3CA 3EJ6A 2BLNA 4XCVA 1Z7BA 5JV5A 4A36A 3C8DA 2PWZA 1V4NA 2GNPA 4V3CA 4XSHA 5HS6A 1KDYA 3HR4A 1CD5A 3BAFA 3LCRA 4LDJA 2QB5A 3USES 1G21A 3LPMA 2DFPA 2AFIE 3H83A 5DJ5A 1TFRA 1UWKA 4OQNA 1IOLA 1CY2A 2CL7X 1ES9A 2LR0A 3N7UA 4HEHA 4BP8A 5IDXA 1QAMA 3EEFA 3GDOA 5CW1A 3OIFA 3D5TA 3D1JA 2G0TA 2R25B 4IPTA 4QUGA 4UNIA 2JGLA 4K3VA 4GPEA 2F3RA 4TKMA 1UXGA 2NTVA 3NNNA 4XDHA 3STYA 2G76A 4FZ3A 3KV3O 5L3QA 1DDIA 2Y1KA 3TG8A 2QRHA 1SKBA 2WD9A 4HADA 8GPBA 1NIJA 4KN5A 1XD2B 2AXPA 4MWOA 1XFDA 5HTKA 5LB4A 3T5AA 5BPHA 1X80A 4RM3A 5CM9C 1C14A 1W76A 2HXSA 1NNI1 4FQ5A 1UC4B 5KZMB 2KI5A 3TCKA 2ADFA 5ALSA 3EQZA 5E38A 3UV7A 5HE8A 1TA0A 1U7UA 2P8JA 3VNAA 1H69A 2PRSA 1QG4A 3OFJA 1K6XA 2B1RA 1MC4A 1QZXA 1SZDA 2ZRFA 2F3PA 3C1AA 3PNMA 4MDYA 5K6RA 5MDHA 2YWXA 3OD5A 5GMOA 1JFSA 1LNZA 2A5YB 1FX0B 3O75A 1B1CA 1U8TA 4JOCA 1KVRA 2IF0A 1S8FA 5KVVA 1ID8A 2JJ8A 2HRCA 3VX4A 4KCGA 3SG0A 1IHDA 2NSLA 2VUHB 3OVMA 4O2AF 1KEEA 1GG8A 4E94A 3K6RA 1DS6A 4WASA 4R71A 1PG2A 3LOUA 4MQ4A 4ZVOA 2MSDB 2OPHA 1ZS9A 2VH2A 3SOZA 3MS2A 5F78A 3TFWA 3C4QA 3DE3X 5KEIA 4IH9A 4LMAA 4D3ZA 5TQ2B 5DXAA 1CP2A 1WY7A 3UMSA 1QH1B 2AD5A 2QT9A 2VP2A 3I92A 3IJEB 3ZQ6A 2YDXA 3PJGA 4MVWA 1RRPA 2ZRLA 4H7EA 3LLVA 2XY4A 2M9MA 1IEQA 4RTJA 2F8MA 1T4GA 3MWEB 2B30A 3HBFA 3KZKA 3NYIA 2NNWB 5LA6A 4TT8A 4RADA 3ZBTA 3ND7A 1I0IA 3AG5A 4I3FA 5BN3A 5C5DA 3PCTA 2A33A 5BVGA 4YDQA 4HQKA 1UEJA 1H2YA 1WEKA 1BXGB 3GZNA 2OY0A 5HKKD 1TZMA 3FPLA 5E6SA 3WLFA 2JGFA 4KP7A 5C7OO 1G8HA 5A5GA 1I7LA 2P7IA 4DV2B 1LW7A 1UANA 2CHQA 2ZYUX 4LJYA 2Y4OA 4LVOA 4U2KA 4CM1A 4EG8A 4RVDA 4G5RA 1D0VA 2CDNA 2Z58A 5A2QA 2NO0A 5ELXA 1QR2A 2DHRA 1IZ7A 2B6HA 3E3MA 3DBHB 2XUPA 4OSOA 5JI2E 3R7WB 4AY5A 1QTQA 4UE3S 3URMA 3PFHA 5TS3A 3X1MA 1CCWA 1IEVA 1V5GA 2BZGA 2EFYA 2KBFA 2XNSA 3TO5A 4I6JA 2F9LA 3C5WP 1B16A 2NTNA 3PHIA 5M7EA 1CVRA 4FQ7A 2VTBA 2DH6A 3GJ8A 1YASA 4NJEB 1VKRA 4P82A 4MIEA 5FHRA 4TL9A 3K96A 4R2LA 1BX1A 4C6SA 3B1YA 5C34B 2ZBQA 3R3HA 1NW5A 5CCBA 4U6SA 3OMXA 1G2IA 2WTNA 5DT9A 1QTRA 3UXMA 2MHCA 3WQSB 4DR7B 3SC2B 5EJ8A 4DDHA 1NOIA 5E1OA 4MVJE 4YROA 2Q4TA 3ORRA 1SAYA 2M6RA 3DE4X 2WJAA 4MVJM 1U0OC 4RUKA 1TKAA 1M2FA 3B7GA 4TMXA 3TD6A 5B64A 3KQNA 2HV8A 2JIDA 2Z8YM 4E5DA 4Y2GA 1NWCA 1BU8A 1S7GA 1DXQA 3R75A 3DPIA 4EG1A 5BUCA 1MW8X 1V5FA 1KI8A 3OQVA 1K75A 1OD6A 3P52A 1CUHA 4IMRA 3ESXA 4JEHA 4IIHA 3G2KA 3HJCA 1RCTE 1YACA 2P8SA 2G6TA 4WUVA 4N0PA 4I66A 4NU5A 4OA5A 3ZDEA 1P0CA 1T4BA 1JJAA 5ES3A 2WSSD 5IAOA 3FDZA 3IUBA 2EGHA 4G1FA 2YWHA 3BMXA 1ZFNA 5DHPA 2IKQA 4KVGA 3H86A 5TJHA 4Q47A 1GZHB 2R6GA 2ZS7A 3GJQA 3IS3A 3NBXX 2I1QA 2ZPAA 4KJZA 4PCVA 4TMTA 4UQPA 1W6UA 1Q1QA 4DV3B 2WNIA 4CEIB 4FVTA 4A82A 1Y4SA 1LLQA 4Q4AA 1C9MA 2BGGA 2QSJA 3OZBA 1M10A 3QNWA 1C2YA 3PNKA 1T9KA 1OIXA 4P33A 2QN9A 3HP4A 3IMCA 1T5BA 2PKCA 4KFTA 4Y7CA 5EAIA 3HM9A 1U6KA 1NDHA 2FPOA 1A7KA 1T13A 3IIKA 4WXRA 1C0KA 4B3DA 4KYTA 3VOBA 1MP0A 1Z4NA 4GOXA 2PUVA 3EWSA 3TW8A 1DDGA 3OBBA 3F78A 5ITZB 2RB4A 3R5TA 4D74A 5JO0A 2HSGA 2WVGA 1TVEA 5E1DA 4BBAA 5KHLB 4V0SA 1N9KA 2FI1A 3Q8KA 1Z8HA 1PIWA 1UL1X 4QO7A 4MIOA 4W5QA 3OAAA 4GX5A 3Q11A 2IWHA 2WD7A 4X1YA 1MENA 1QUFA 3W7VA 3ZX5A 2IHYA 4HYEA 4LJ9A 5JNTA 2NVBA 1E0SA 3DTYA 3TOCA 3DA8A 2TECE 1H2BA 5BYKA 4GYJA 1SB9A 3UJCA 1EWRA 1JVSA 1E2UA 1Z6ZA 3SSNA 3ZD8A 3ZTTA 3GWZA 2F55A 2VXYA 1RM5A 1VFPA 4NH4A 2R00C 2XADA 3YASA 4JQZA 4KNYA 3PFWO 2GBLC 4HAZA 2GI4A 3TJRA 1QKKA 1WKBA 1X1BA 1UJMA 1Z82A 4Y0VA 3T7KA 3V9PA 4RLSA 5KYXA 3Q87B 1J70A 4CKCA 1PWEA 1MEOA 3IUQA 1I14A 1DWUA 1HORA 3K09C 3QELB 4FYJA 2PT6A 4M9CA 1LDGA 3MAJA 4D4HA 4KTTE 1V41E 4LRYA 5CCXA 5ALMA 1QFMA 3F96A 3B1ZA 4PG5A 4M0PA 4U7JA 3CU5A 4MKHA 3N7TA 1KDPA 4LCJA 4HF7A 4IM7A 5ICGA 2P40A 3CMCO 1N6LA 4KQCA 3BB3A 1X39A 1TM1E 3T9CA 2Q1TA 2ZYSA 3C3WA 4LC9A 1Z0DA 3P0FA 5AK5A 3ZY2A 1D9ZA 5C5IA 4IRMA 5HZHA 4Y9RA 2ZUUA 5F9HA 2PBZA 4MROA 4RF5A 1R0WA 5E4TA 3BFKA 1KIAA 5ALOA 3O8RA 1KOLA 1JEEA 3IAS6 3QVLA 1SUFA 1VG1A 1US8B 2AWOA 4PC7A 1VJRA 3N59A 3UW1A 1JIJA 2EWVA 3UUFA 4CKZA 5I8WA 5FDFA 4ZT6A 3OTWA 2GPSA 1SVIA 2Q99A 1Q0PA 3SQDA 4PGAA 1XZ8A 1GGNA 3LKDA 2O8BA 2FPPA 9GPBA 5EP4A 4OH7A 1CLEA 2WUFA 2G06A 2DPGA 3E7DA 3WNZA 3ZQJA 1U8YA 2O2SA 4B3SB 1TAQA 2QZSA 1NXWA 1XNJA 3L46A 2PNFA 4HGYA 2J1LA 3T7IA 3GEIA 1X3LA 2XJ4A 4KQ9A 2D74A 3EARA 3MUNA 2QUAA 2FMXA 1SK8A 3BWEA 1QBKC 5EQJB 2WKWA 2J0VA 3FCCA 3RJ5A 3T9BA 1F7UA 3DFZA 4NZPA 4DC0A 3ZI0A 5I9BA 1RHJA 3ETJA 3P9SA 1C3OB 3HCOA 1NVMB 1A72A 3SMVA 4FD2A 2C2WA 5E6UA 3R4CA 1KDRA 3CB2A 4N6NA 2UU9B 2P9ZA 3UW3A 1QHGA 1NZJA 2R1TA 4JODA 4PCLA 4OQQA 4D7AA 3M5CA 4PQYA 1U0BB 2VXOA 5FCDA 3UUGA 2WINI 2WSLA 4UEOA 4PG7A 4RF4A 5AW7A 5JJIA 4OYRA 1FDWA 2QY6A 2CXSA 4RX1A 1EINA 2BJWA 1XQXA 1IN5A 4A6EA 3ZWYA 5CW2A 1CUGA 2VXBA 4X90A 1NN0A 5DCWA 4PLGA 3U31A 4JBYA 4C6RA 4QLAA 4D9CA 4C7VA 2ZRHA 4IXNA 2Z6VA 5DXFA 1EXWA 1CEXA 3K8ZA 4B3BA 5GZ3A 1JXAA 2QE6A 3DKPA 4MKFA 2CEAA 2B82A 3TUIC 5JYDA 1I1QB 2DGDA 1BXKA 1E2LA 3FUTA 2B36A 1MO5A 3ZWVA 2VF4X 4EW6A 1WHTB 2UVPA 4H1HA 5B4VA 1X1DA 2ZDGA 3P2IA 4JXKA 4MV1A 2JGNA 2WJZB 4XUEA 1W46A 5EGNA 4POAA 3RJTA 3W8DA 3K70C 3ZDAA 1O57A 3PE6A 1EEXB 1OZFA 1GNSA 5KREA 2BHRA 3KKQA 4Q4HA 2HDHA 3IAM1 4YRDA 3UPTA 2DKFA 1H0KA 3Q3GE 1PJ3A 4UFOA 2GCPA 3V9AA 4YDRA 5B58C 3RC3A 3U7IA 3H9CA 1DRJA 1HT2E 1GLNA 3LH5A 1FYXA 1M2KA 2CF6A 1GU0A 2ZP1A 2HNKA 3IUJA 1JAZA 1LVHA 2MJLA 4LECA 1G21B 4JP5A 5DKFA 4F1KA 4A6XA 4I55B 3EW9A 2VJQA 3AUJB 1E9RA 2Q7XA 4A0GA 1MG0A 4LG1A 3QVJA 4HQ0A 4KV9A 4NFYA 3S2YA 1KEPA 1J9EA 3LY9A 3BE4A 1MJNA 1J99A 1P0IA 3DMFA 1PFQA 1VQ1A 1TAGA 5EJAA 5LZ4A 1JDNA 3SP1A 1NA5A 2FFJA 4EHLA 2IPOA 2ZBUA 1NNUA 3IERA 5CNIA 2AQ8A 2GB4A 5EMHA 4YIKA 4EQZA 1A7JA 4HUQA 1XI2A 2XCIA 3S28A 1LSOA 4MQFA 2VTDA 4XQ0A 3BK7A 3ZV5A 5IKXA 1ZU4A 3PVCA 1T34A 1AKTA 3JYLA 5AESA 3NXKA 3MT7A 1CR2A 3B82A 2PS3A 2I8AA 3CH7A 1XVIA 3GJ0A 2VUTA 4ZODA 1AX9A 1ZDMA 3HNOA 1S2OA 3OT1B 1M1UA 3KT6A 3PNSA 3UJ9A 2XF2A 3IOCA 2ILTA 3JARB 4OQFA 1W5AA 4TMYA 4PC6A 4YI3A 3H87A 3TLAA 5IDYA 2OHOA 3GYGA 1OX6A 3D7LA 3VKHA 2FSSA 2PZKA 4B73A 2G08A 3HVKA 2DUJA 1TVMA 1X3SA 1DL5A 3AM3A 4MQUA 1PZHA 2EQ5A 1JLRA 2O8VA 1Q0QA 3H5LA 4N3BA 4PG8A 1C7JA 8AT1A 7MHTA 4YJGB 1XKLA 4PV7A 2WHPB 1DPFA 1Y3BE 3M49A 4FOTA 1EUZA 2VJAA 4ZMRA 2QWXA 2VYND 3QVUA 4LGCA 5IH7A 4KXNA 4CM8B 4DSZA 4O4JB 1WBDA 5TMEA 3V32A 2FPXA 3B36A 3ELUA 4ISBA 2ZDQA 3HZRA 2FSVC 2YXBA 2HHHB 1G8KA 3DE7X 4LY3A 2Y71A 3X0DA 4JJ4A 3KUUA 4CTJA 3VZPA 2QX8A 1VE6A 4O2BB 2VA9A 2Z6QA 4L9AA 4C3VA 3KYCA 4KAJA 4ID9A 5LU9A 1L5YA 1Q7CA 2JGEA 4YUYA 3PCRB 3QXHA 1NURA 3UTDA 1RHUA 1WUYA 5FBKA 3VGPA 5A3JA 2PPVA 1LDBA 2J7KA 2W2LA 1VA4A 2HI0A 3L7BA 4MWZA 3VPBA 2IY8A 5L6LB 4FU0A 1XNRB 4K5QA 1YF3A 1UAGA 4BWVA 5GJWC 1LDYA 4XQGA 4C1NA 1W96A 2IK8A 2PTHA 5FQOA 4WERA 1R6UA 1M6NA 2YHBA 3GXOA 1L5ZA 2EZUA 3PGA1 1DKUA 4K6HA 4WBSA 1U2GA 5K0SA 1XAGA 3NBAA 2BAGA 4RSGA 3O8CA 2QXTA 1FJGB 3ZJYA 4AZ3A 3SQXA 2BFDA 1TKBA 5GOTA 5BT8A 5IYZB 2BFPA 3ZHTA 5BMVB 1XZCA 5CBPB 4B71A 1E3IA 4IOLA 1V25A 3ND9A 4HUTA 3IP3A 3ZGLA 1PJTA 4UHEA 4JK3A 1SUDA 3Q0TA 1ZKMA 1B0UA 4QOEA 2BBTA 1S01A 1EUCB 4NENA 3DMYA 5LYJA 4N47A 1FFSA 4Y2YA 4FBLA 2QN1A 4OHWA 1KGDA 2WU4A 1F1JA 4B79A 4KR7A 1PEDA 4DC1A 2ZUDA 2CB9A 2OO5A 2R6CA 4EAAA 4YP5A 1G8YA 2FY8A 3G7UA 3OWHA 2B7BA 4RH1A 3DWGA 5BUZA 1D07A 1AKYA 1D1TA 1Z2CA 3EQ9A 3FLMA 3JD0A 4P4LA 3JQAB 2HQ1A 4UM9B 1V7ZA 1RVV1 1TLLA 3KFVA 2MSWA 3VRHA 4F4UA 4IXWA 2XAAA 2G1UA 1OBFO 3LPNA 2HPZA 1M6VB 1DAFA 1LBIA 2LXNA 3TD9A 4BQOA 3KPUA 4DIUA 1EH5A 2YHUA 2VDMB 3B8EA 3LIPA 3U09A 4X3CA 4Z5XA 2V7BA 5JD4A 1G0OA 1PJ2A 4MS1A 2C78A 1FMTA 1V4BA 2B2CA 1R88A 3D6MA 3GWGA 3MCVA 1FS5A 3M4XA 4UMEA 5CX1B 4LKOA 1Z0UA 2Q28A 3KZXA 4UVEA 4BGVA 4IS2A 1XDUA 3FUUA 2WZBA 4MA4A 2QE7D 4TSKA 4K86A 1JR4A 1NLYA 3GW8A 4XQCA 1C7IA 3DBLA 3EHEA 1ETUA 2EKDA 4YV1A 5HILA 2PKWA 1FUKA 3RIXA 3CNLA 1YUBA 3QXSA 5F3RA 3QUCA 3S2EA 3VU3A 4W6QA 1NYTA 3D6VA 1U81A 1JDBC 1F0YA 4A1FA 4I2VA 2Q9CA 4R83A 5AVUA 1PG5A 5DLPA 1YJXA 1YIOA 1OXMA 2BI8A 2P7HA 4GI2A 4AZ0B 2XB8A 5JYEA 2X0JA 9LDTA 2ZBEA 3GDHA 3ABQB 3TAHA 3UK7A 4DS3A 1FLVA 3MW8A 3TNJA 3HXMA 1DXHA 1UFVA 1Z5OA 1N5OX 1RXCA 4TYQA 3LZCA 4KIUA 3EVEA 1ISFA 2AZTA 4BV8A 1A1SA 3RU3A 1CKEA 1NF8A 4IQFA 1A0OA 3F67A 4O25A 2GASA 1A4IA 5JAQA 3NHSA 4MPTA 1MGOA 4KPUB 4HVAA 1YS7A 2YIVX 4UBOA 1ZSVA 4KSCA 4XI9A 1SVOA 5KNDD 5LOVF 2O4CA 1TD1A 2QXUA 2X0KA 1UFQA 2Q2VA 1A8SA 3MGGA 1HSOA 1V26A 3D4BA 1S8OA 1USVA 4J0CA 1ISMA 1HZZA 3CJRA 3ZDRA 4EITA 4ND3A 1DKOA 1PR1A 2REBA 4ENTA 2GHIA 1C9YA 4CKWB 4TTVA 5I4BA 1UT8A 1YB1A 4MV6A 5I4KA 5L6MB 2GCGA 2ATCA 3DE6X 4IHKA 2OHXA 3RC9A 2P9FA 1DE0A 1BMQA 1ESNA 1HKHA 5U4XA 2NVOA 1M83A 2JHGA 1HMYA 4BQFA 3LXUX 4DVJA 1YA6A 2ATEA 2QF7A 2W2KA 1XNGA 4F86A 5K4HA 1B2LA 3HLTA 4ARAA 3OLCX 4E31A 4CR6A 1XD2A 3NB0A 4PWZA 3TKLA 2GHRA 2EGGA 2OQRA 3N0VA 5FPSA 4UPVA 3UIEA 3WK8A 5H7XA 1BHJA 1I30A 2ISCA 1P2BA 2RHGB 3II6X 1GL7A 3MJHA 1TUIA 3OX1A 5JJKA 2QMUA 2NGRA 3D4IA 3G7NA 1N2GA 3LUKA 3Q0IA 2IP4A 4J75A 5IJ0B 4YFVA 5FUQA 1YOVB 3B51X 4TRRA 5KCZA 1FTSA 3ER9A 2BVNA 2ZSFA 4ON9A 1XU9A 1I4TD 1AZTA 4ZTBA 2G17A 2VJKA 4KGXA 5FA8A 4U0JA 1VE7A 2VQSA 3CPSA 1VMIA 2W6JA 3MD9A 4LIPD 2PAFA 4M76B 4O4IA 3WLAA 3LHSA 1WUKS 2AWNA 2XQJA 3ITKA 2PD4A 3BJIC 4YGYA 3TSAA 3ZIDA 1L7VC 1MJFA 3K9FC 4XVQA 3H04A 4R81A 2PQ0A 3O73A 3RSQA 3I01A 5C37A 1FSPA 2RJ3A 3AWIA 1SZCA 5IFLA 4BYMA 1XX6A 1ZEMA 3ZD7A 4C1BA 1I36A 3R5FA 1DDOA 3FTEA 5JO9A 4ZKDA 1QP7A 1GQFA 5F33A 3KR9A 3UG7A 4QVKA 1NDUA 2D1FA 3D2CA 5EE9A 1Q3HA 4HUJA 3VYRB 2OHHA 4BTLA 1CJKC 1FDIA 3H1PA 1K8ZB 2HTFA 2O1WA 3N76A 1XBTA 3MVEA 4EB6B 3KXPA 3OEWA 3GJYA 3MRSA 2D2EA 3IMEA 3C45A 3S3TA 421PA 1PU2A 1HYEA 3UCEA 2OA0A 3WXMA 4MO9A 4RCZA 3ONDA 1N9ZA 1NV9A 1NXVA 1P3JA 3A3PA 1PEAA 1ZH4A 2JVIA 2B0CA 5CFMA 4WESB 5JHGB 3F8WA 1NMQA 1SIUA 3FNEA 3AK4A 4C4AA 3T7RA 2W6PA 2UZIR 2FUKA 1GTL1 2NADA 5IXYA 2WT4A 3IIMA 1UBGA 4Y9DA 2H6EA 1N6OA 3R7FA 4B8WA 2R47A 1N2SA 3MAAC 3KB6A 2PXCA 4GLFA 2EARA 3G8YA 1JYEA 3KPVA 1DBQA 3HU3A 4HLUC 4KQEA 3RU2A 4DV5B 4PPFA 2XHZA 4DJEC 2QTFA 4W7IA 2HO5A 1R8QA 2GWHA 1ISJA 2HA7A 2RBEA 3I6YA 4G5FA 4OHBA 1P17A 1C0EA 1HUQA 3H19A 1EZZA 5EHZA 4P98A 1JG4A 1UKAA 2RSLA 3DBIA 4MLPA 3GGJA 1D03A 1SUSA 3CUWA 4J0DA 4EJSA 2AKEA 1T26A 1K98A 1ZM3A 1FUUA 2WILA 3FCYA 3NFRA 4KFSA 3QKRB 4R2JA 3T7SA 4YRFA 2PUHA 1ZJWA 1PT9A 1I2MA 2P6OA 3BD7A 3EK2A 2YUIA 4R05A 3CR8A 2O8CB 3PFKA 1V47A 3C48A 1XHFA 3FFTA 5ALGA 1E1RD 3I01M 2HW8A 3PCXA 1QHYA 2Z2YA 2C7GA 5H0IA 5MN5A 3PXBA 2R8RA 5DNAA 3HB0A 2QW0X 2BE7A 1XV5A 1EDDA 2H5EA 2NSHA 3FYHA 4PRZA 3LU1A 1L7MA 3TOZA 4BNJA 5LIPA 3T9EA 4HSGA 1ANKA 2OKCA 4A2CA 1M34A 2FCRA 5F5XA 2FHSA 1E2JA 4YT5A 3WLQA 4D92A 1B15A 3HCAA 3LUGA 3DFKA 4LVCA 2J7PA 4HAWA 4Q02A 1IM5A 2LWIA 4QNNA 4IQGA 3D1LA 4AJKA 5JH7A 3AKYA 1CE8A 5TMPA 1LTQA 1JXMA 1HDRA 2G9QA 2ZBPA 2J67A 5EUBA 1U9JA 3OM1A 1QGDA 5LVAA 1LX7A 5AOAA 1NTRA 1OX4B 3K0KA 3C16C 3EWNA 2DKOA 1IN1A 1ZH8A 1NUAA 4JYPA 3QU7A 3MWFA 4TSFD 4BLSA 1TA9A 3C15C 3CX3A 2GJ4A 1E79A 1ZGGA 2CNLA 2XVXA 1PHPA 1AB6A 4KQ1A 1N5LA 4D02A 2HMAA 2V7VA 4YBZA 1DBVO 3GVIA 4ZEOA 1KDTA 2A3NA 3TTWA 3UOGA 4BN5A 4IVRA 1N3IA 1JWAB 2FEPA 4HDNB 3ZGOA 4QT0A 1IWBB 2WV9A 3VJRA 5JWRA 3FG9A 3ILYA 1HLDA 1CB7A 1WWKA 4PC2A 3TH5A 2PMFA 2R79A 5IKEA 2Y0DA 2F3QA 3FM9A 4L2IB 4RMHA 4YO8A 3WLIA 2QPOA 2XMRA 4DLWA 4Q1EA 2VATA 3QFHA 4JSRA 4YS6A 4PM4A 2ODNA 2BFNA 2ODPA 4DIKA 5G40A 1U2PA 2WIKA 3FKSD 1PFKA 1ZUNA 2PH3A 4KAFA 4ZYVA 1JP7A 1K3TA 3CVYA 2JPDA 2WHPA 5KTKA 1DTEA 1PS9A 3HYRA 3PNYA 1V3TA 5K0EA 4DA7A 5TARA 4R98A 1O5IA 5I7HA 2OXTA 4RBNA 3K9CA 1N2XA 3ZHSA 1KOFA 1WL8A 2OD9A 4N9QA 4LSGA 4Q9NA 4M83A 3U3DA 5F12A 1TZCA 1DKLA 3IUMA 3T5TA 4IEIA 1Y3FE 3RTAA 4MWTA 3SJAA 3E2PA 3H0KA 4ZGBA 4GPBA 2GD6A 4Y18A 4IUYA 3AVTA 4AZSA 4ERNA 3AHFA 1XMIA 2TYSB 4P81A 1WMEA 5KSZA 1BS9A 1HY3A 2CMGA 3EVGA 3JZMA 4CG1A 4F60A 1E58A 3O95A 5BOSA 3DLBA 5ED4A 1VRVA 1EDBA 4JP8A 4AUNA 2C2OA 4JL5A 2YJ4A 1FYVA 1E9SA 2ZITA 3DL4A 3V55A 3AILA 3V5NA 3WLSA 4H1WA 1HDEA 1K7SN 1WMSA 2F17A 4LZJA 4B7ZA 3IUSA 1PL0A 1A8HA 3FMGA 2Y1OA 3KRTA 4JOSA 3KU1A 4N5IX 5FNVB 5HK8A 2HWKA 1YC5A 5LIRA 4F4HA 1DHTA 6Q21A 4ESHA 2I55A 2DQ4A 4XB2A 3WB9A 3FXAA 4P4NA 2A5LA 3O3MB 2D5BA 1SOWA 2WG1A 4A8TA 3ZNPA 4R3UC 5FT9A 4J4TA 5K45A 4I1YA 1TCAA 2OK7A 2YOFA 4LSZA 5DOZA 4K03A 3ZEAA 4HLCA 1XU7A 2JBAA 4DLNA 4I4TA 1U1FA 4NYMR 4RFSB 3NC4A 4EPTA 4B80A 2HCJB 3QKSB 3QW2A 3RRXA 5ABPA 2QNBA 2GEKA 3HJHA 2I2CA 4FHCA 1TU3A 2D7CA 1FXUA 1P2GA 2DFVA 1IUKA 3EXAA 3PFIA 3FF1A 4X8OA 5AVYA 1JQAA 3C7DB 3E9EA 3B1FA 3UAOA 3QVTA 1DWOA 1CRQA 3ILSA 2IEAA 3OX2A 5L7WA 3BF8A 1O7JA 3DZDA 1BIFA 1S3SA 1L6IA 1M5UA 3KR1A 3JTMA 2GMWA 4B32A 1V8BA 4DRXB 4YT2A 2IH2A 2BI7A 3PFNA 1OFVA 4M0FA 3SY8A 1L1QA 1K7FB 1E6LA 2ZI6A 2YVLA 3A4TA 4MB0A 1VMDA 3O6VA 2Z08A 2H7YA 1EX1A 3CH5A 1K7YA 2QTNA 1NVKA 3ET4A 2FMFA 5JS1A 3EYAA 1RXWA 5GY7A 5B3AA 2VSOA 1BQEA 4V0KA 1R0ZA 3BIXA 3ELYA 1CS4C 3DUWA 2IYRA 4CVNA 5LBTA 4BZWA 1LK5A 3MCZA 3L49A 3R7SA 1C7EA 3EF3A 2GUWA 1Z4KA 1L5GB 2Z3VA 5HXAA 4NHOA 1H3EA 3DM9B 4RF2A 3QLEA 1V9CA 4KLZA 5F73A 3QEBZ 1CRPA 4J0HA 4YRJA 2ZJOA 3NC1C 2IEIA 4P4TA 2V1UA 1TVKA 1IY1A 2BR3A 2WE7A 3PKJA 1ICIA 3CLVA 5THKA 4CLRB 4I5DA 3CEAA 4BVGA 5KYYB 1ZQ1A 3SYKA 2NX2A 3OQIA 3EG9B 3ETCA 1A04A 1V5IA 4INOA 1KYQA 4M89A 1LPOA 1PJ4A 4EMTA 2DT5A 4WKGA 5F7JA 2AT1A 2OHFA 2ZJZA 2DR2A 2DY1A 1Y1SA 5I3CA 1R6AA 3O26A 2WWWA 4JLAA 4I08A 4I4NA 3WL7A 1I7NA 1MC8A 2UUOA 5EZYF 2PUDA 3OCXA 1LPSA 1TPYA 3D3WA 2Q3MA 1CYDA 2I2XB 3LC1O 1MIOA 4B6FA 1GL3A 3DMTC 5FJJA 5CFPA 3P9IA 1Q50A 4RJLA 4ZQIA 5LZ9A 1NT2A 1E2EA 1COWA 1LUAA 1NQXA 1OWMA 2J5KA 1C0IA 2ONCA 4GVPA 4HD8A 4LJ6A 1CQPA 1UBKS 2CCGA 3MYRA 4J1TC 4YO7A 4CMCA 2ZI7A 1UEXC 4HTFA 5KTNA 2QG9A 3AV0B 4L8WB 4CT4B 1UBLS 1UZMA 3DBRB 2VZ9A 4LXQA 1W19A 3O2SB 1FVFA 1RQLA 1W49A 2W37A 4Y6GB 2ACWA 5ALXA 3H1AA 3ZCRA 4U3JB 2CLHB 2XIJA 3Q8WA 2W48A 4RKYA 2WTBA 4FMCB 1UOOA 2B2NA 3M5DA 1RI5A 3IAM6 4JENA 4MOWA 2DRIA 1R66A 2D1SA 3O1IC 4EGAA 1MAVA 3NGLA 1PT7A 4B09A 2VDWB 3FGNA 5JR3A 1OWPA 3X2SA 3K9GA 2XT0A 4MV8A 2YIDA 1MQ9A 2AR0A 2QZPA 5ARDA 5IN5A 3SZMA 2XOKA 2ZIWB 3EEBA 3UJDA 1Y6QA 1E2IA 1Z3IX 3AH8A 3PC3A 1J33A 2I4NA 1F8XA 1ECCA 2XHEA 1YBAA 1MOZA 4BRUA 4M1WA 4ALLA 2OORC 1XMPA 1KMIY 4RQUA 3V46A 2N46A 5FBLB 3T06B 1UBCA 1NJGA 3AF4A 4M7RA 3U1VA 1SOUA 3C70A 1UQUA 3Q7PA 1JI3A 2R60A 2UUBB 4FZRA 2X2EA 3M5WA 3UJ8A 1AXRA 4JQOA 4C4SA 3AI2A 3TRFA 2HCTA 4AWBA 5LFAA 1F2UA 1Y9AA 2QM0A 3S2SA 4XWAA 3BAZA 5F1YA 1YMVA 5J9FA 2GEDA 3NM6B 3TNLA 3WOVA 5D5QA 2OZVA 5I7EA 4X6LA 2X19A 4HCJA 4A0SA 4S24A 4YACA 5C5CA 3FH0A 1L1EA 2VDNB 4OM8A 1MQAA 4BFWA 1KQFA 5EMMA 2GGSA 4PFKA 2ANBA 4CKWA 3GLFE 1CS0A 2AG1A 3ZH9B 3T95A 5DHTA 3EEIA 1R6DA 1I3LA 3UFXA 1JTVA 1U2DC 2PGLA 2WHQA 2X4GA 2NZJA 5ALTA 2GXQA 3FNHA 1Q14A 4TLCA 4QXQA 4ER6A 5L7YA 2G71A 2UUAB 2C2XA 4KLRA 1B0ZA 5JNLA 2YVKA 4NBSA 1N5JA 5IARA 4U7TB 2XBUA 2HWUA 4BPBA 3FN4A 3CTMA 3UAWA 4LI0A 1KMQA 2DHCA 3H65A 5IUNC 4CE6A 4AF7A 4JJAA 1K6MA 2IOFA 1G21E 1NI3A 3GMDA 5HCNA 2CLSA 2GKGA 3WO0A 3VKUA 4CHTA 1PAUA 1EUYA 4YP6A 1Y6JA 3R3SA 4TSFA 5E7MA 1A9OA 3T5DA 2RHBA 2FEMA 4QG3A 2H08A 1BH2A 1PR3A 4RZXA 3BBLA 2WSYB 4ZN6A 4EMSA 5ALVA 2ZI9A 4PO9A 1RMYA 2VP9A 3OLQA 3QWHA 4P2GA 2J31A 4UM9D 3K9QO 1GNVA 4MPDA 4IDEA 1ULHA 4FKZA 3GGCA 1TF5A 1MAWA 2GT1A 1NV8A 3EG9A 1ZNXA 1FFAA 4BE4A 2GA9A 2NVWA 3NOOA 5AVJA 5K3OA 2R6FA 2GEBA 4Y0NA 3B78A 3T4XA 3D43A 3EIEA 4GX1A 4K88A 4WOPA 3H2GA 2LD4A 3EFOA 5DYNA 2P2SA 3W34A 3QKRA 3HKBA 2Q3JA 3GCWA 4PHFA 2RK6A 3RI3A 1JKJB 1P31A 5KNDH 4AKHA 1P2FA 3UQYS 3DMGA 1CQIA 4GQAA 3I0MA 4EPRA 2QTGA 3ZWDA 1KQNA 4BQIA 1LBHA 3AP3A 4AY2A 1TX4B 1ZC4A 3ZQKA 5ALDA 2NM0A 4YCMA 3FPCA 5L8VA 4BNMA 4C4ZA 4F7WA 4R2MA 1HDXA 1Z25A 3U6KA 2A9FA 4LY6A 1R4NB 3BGWA 3ESAA 3LYAA 5AOCA 2CVPA 3KTAB 5A6SB 5LLSA 2G67A 3IQXA 3PPVA 4XJSA 5A0VA 2Q3LA 3CJQA 1E6WA 4HYTA 5FPYA 3WTCA 5DXJA 2RI0A 5KIAA 4BMSA 3AOEA 5DYWA 1PBTA 4LDZA 4C76A 1QOQB 1KZ6A 2R5NA 3V1NA 1LK0A 3IV7A 3MJSA 1IL0A 4JB8A 1T2FA 1QFZA 5G1OA 3WYNA 4NMLA 1QYWA 1ESZA 4FUQA 4BUCA 5FLKA 3EHDA 4B4VA 1Q3TA 3OAAD 4Y98A 2GR9A 4ZCLA 4AP9A 4BYGA 5BMOA 3EZ7A 3GRRA 4WN3A 3TW0A 2WAOA 4FTWA 5CFOA 1DQZA 2NZ2A 4MAMA 1YZVA 3G13A 4Q21A 2VR1A 3RYTC 2AGVA 1JTEA 3FJOA 1GQSA 4BU1A 4BS9A 1XZJA 2AB0A 3MWEA 5FBWB 3WFZA 2EATA 5G41A 3QEJA 4OFXA 3CM0A 3GCDA 3D4PA 4IDBA 4MYHA 2BZ1A 2D2IA 3EN0A 2Q3BA 4OV6B 2GPYA 4K9DA 4Q48A 1TO1E 1GQOA 1BE1A 1V9LA 3CX7A 4GI1A 3FOZA 2QEQA 2YWEA 3IJPA 3LWZA 3UV6A 4D80A 1GKIA 1D7AA 4OXQA 1S3GA 5JS7A 3PX7A 4QATA 2YXEA 4KR0A 3M3DA 4C14A 2Q5QA 4FEAA 4MCHA 4ZVKA 1VHWA 2PR7A 1L5NA 1Z5WA 3ZS8A 3G0OA 3CCCA 3HYCA 2Z3ZA 5KWVA 2QPAA 1EGMB 1QAQA 4D9BA 1CT9A 1YZNA 3L7IA 4RNCA 1DLJA 4F45A 1QM5A 1KZ9A 5K7SA 4RSMA 2HNAA 3PHJA 5J2TA 3GAMA 2HIGA 2M1XA 2PVPA 3ZK8A 1TPZA 4AJIA 4BNGA 5T4FA 4EG6A 4WCVA 2WP0A 4W9RA 5K51A 2QTHA 5FPQA 4JI1B 2HT6A 4NYMQ 2G5GX 4HBGA 4GKVA 2DXIA 4CNQA 2QYHA 3NUZA 3AINA 2HR1A 4TTIA 2EFCB 4YV0A 2NZ8A 3HKCB 5BSEA 3A4VA 5TPWB 1BDBA 3MB8A 6REQA 4PO1A 1M76A 3RFFA 4LF6B 1DIBA 4YLGA 1R5JA 3MSXA 2C7RA 3Q41A 2A9PA 5KDLA 4F71A 1Z4IA 3N6XA 4RKRA 2WM3A 1FRZA 4ZVVA 4GI7A 1I4EB 3IPAA 3NTQA 3P96A 3VJLA 4GP7A 5BSVA 1NF9A 1NLFA 3DOEA 4P6VF 1SQFA 1TJ3A 2BJVA 3LDGA 2NXEA 3RTCA 2BJHA 2DWCA 2Q21A 4UAVA 3W1EA 2PZEA 4BTEA 1SBZA 5AW8A 3ZXYA 1KOGA 4IDGA 3H42B 2VTBB 1VP3A 3UG6A 5KNCD 4CXMA 2NUAA 4FCCA 2YW2A 3L93A 3MT0A 4P3OA 1WABA 4G1UC 1TJ5A 4G67A 1U3TA 5A6VA 4LRSB 4D96A 2FETA 1H8HA 4HXFB 4JVNA 5EHGA 2QUZA 3N8NA 5B3KA 2ZUEA 4QNRA 1JHOA 5MFZA 1P1CA 4AJ9A 3OO0A 5G53C 3K6SA 4B5KA 2A1UB 1TL7C 2X2FA 2X7HA 4IY1A 2BEUB 4COKA 1YK1A 3JRWA 5DIZA 2G5CA 4PX3A 1MU0A 2CK3D 4I50A 4R0NA 4L6IA 1DJMA 4ZHQF 4MDFA 2M1ZA 3K0SA 3FOEC 4EEZA 2X1HA 3H5NA 3WXBA 1BFDA 1Z5ZA 4N0EA 3IDFA 2DTXA 3GDGA 3QIAA 1GSOA 1LLFA 2XUZA 1XZMA 2W2QA 3I2JA 2H0AA 2YRXA 3OT1A 3UMJA 1VJCA 3BWXA 3KPWA 5IKOA 3RRFA 4LFAB 3EH1A 1I6WA 1CBUA 3LRXA 2XDAA 2FE4A 5CVDA 1AKVA 1X86B 2XMPA 2A58A 4QXPA 3ABZA 1LPNA 1P4AA 2QRJA 2C5GA 2W6QA 2GCIA 1UXJA 2H4FA 1VBFA 4PYJA 1CY6A 1T0JB 3CRW1 1OH8A 4P0QB 7ADHA 3RFCA 5F7ZA 4CV1A 2BTQB 4CEHB 5LDHA 3BFJA 2XUQA 5G4KA 4YJ3B 4GE0A 4ZO6A 1W5FA 1W4LA 1T2UA 4ZVSA 3WYGA 1ZGJA 3V2HA 1JU3A 4G4SO 3V1MA 5I7SA 5B6IA 2PMDA 3ZE7A 1K68A 1Z6QA 3REFA 4C4TA 4J4HA 5F7XA 5LZ2A 1P73A 1P81A 5CBPA 1PUIA 2QORA 4JVLA 4OBEA 4CL0A 1YJ8A 1WCIA 3JQ8A 4QXMA 5K8IA 1SCJA 2XE8A 3KZ1E 1F2UB 1ENPA 4CPDA 4L28A 4E1VA 3PNVA 4XJTA 1JDUA 3FNRA 1SH7A 2MWMA 3AHIA 1XTZA 3GRCA 4FX5A 3EZ9A 4G81A 4MWEA 4PRYA 4XTCS 4F38A 1O0CA 2PJDA 2F3TA 2IXTA 3I1JA 3NAQA 3AI3A 1MQSA 3RADC 2PSJA 1DCTA 3HMQA 5CIQA 3QUQA 3RKUA 1SKYB 3WKAA 3A1VA 1GY8A 3SF0A 1DAEA 1M2EA 2QTBA 1G38A 1ZH2A 3TM4A 1WXGA 2D3TA 2ZSHA 4L7VA 3LLMA 3OPMA 1NUTA 3RUHA 1ZH0A 1PDVA 4JP3A 3R9XB 1CEYA 1IXRC 1KO7A 1ZIYA 2I3ZA 1NVBA 2OBLA 3BRWD 3U4IA 4U00A 4W1PA 5SV2A 1XDDA 1YD7A 1DT3A 4BZZA 1P5ZB 2VRNA 4P92A 1AOXA 4M1SA 1K08A 2OFFA 3BDVA 2P6PA 3LQFA 4MCIA 2C84A 2GAFA 1X7XB 2Q4BA 1BKYA 1Y34E 3CKKA 1PGOA 3GMTA 2XOXA 3VR1A 1FQKA 3OC6A 4OJKA 4UCFA 5TY0A 2FZKA 5DGTA 1XFAA 2I5PO 3C3XA 2VDJA 3T7EA 5JY6A 2G1JA 5BSHA 1SG9A 2IE0A 1XRSB 4HTFB 3FMFA 5K8LA 3T1OA 4DJ5X 1W0KA 1C5KA 2R6ZA 3UCFA 5CDFE 2B20A 3D3JA 4PLPA 2AJBA 3JPYA 4E08A 4I1UA 1JT9A 5DW3A 1R9MA 2OT3B 4UPEA 3TL2A 2PKQP 3JZAA 1AS3A 1TYCA 3RSGA 3TX6A 4AY6A 3AEKB 5AH0A 3U61B 1SVLA 1ZO8A 3TQFA 3UN1A 1YZTA 3MJEA 3GC6A 1K66A 1PJ8A 1VG9B 1ADYA 1VM6A 2AHOA 3FYUA 1XTVA 2XUFA 3QPCA 4MV4A 5JISA 3GLHB 5JPIA 2CUZA 1ZHFA 3IQDB 5KYWB 2ZAOA 3GFRA 3BEOA 1FDTA 2BUAA 3OOWA 3D54D 4L22A 3DBVO 3E3NA 1KZGB 2I7TA 3KPJA 1Q77A 3Q88A 3ZBQA 1TMKA 1GGVA 1R5BA 5AHWA 1ZRSA 2VSQA 4KDCA 3X43A 1EE9A 1N32B 4DM3A 1NUPA 3ZV6A 1FNSA 3FVVA 2QTVB 5INTA 2ECQA 5JSUA 4AQYB 4MDEA 2IYUA 2IPMA 1H6AA 1DIOB 4EA6A 2NACA 5ALFA 4H9GA 1EDOA 1SHZA 1VE9A 3A2MA 5DK6A 4B8YA 2F62A 3HKDA 3PI6A 4FFSA 4FN4A 5AKLA 2R87A 2HN9A 3UICA 3AVXA 1G3UA 4MV5A 5L4SA 3MTIA 1GGEA 2V7XA 3WL3A 4OB8A 4F6RB 1D9XA 2VRBA 5D3MB 1A96A 1CNFA 2CNWA 4I1PA 1PTJC 3NASA 2G04A 2JAWA 1X1EA 2VBIA 4HGZA 4RU1A 3ZWBA 4C4YA 3MCUA 4ZRNA 3FWPA 5B30A 5K3EA 3KB1A 3C8HA 1RZRD 2G0AA 2AG5A 3UXYA 3C5VA 1W5BA 1TJ4A 1EVJA 4BECA 2CLLB 2MDTA 1XVTA 4GYKA 3WNCA 4LFCB 2ZIGA 1JGTA 3LGXA 3IB3A 4MJLA 3AJEA 4O4LA 1TYAE 2C5EA 4URYR 3CINA 2H1VA 4X7PA 4G8BA 4CLHA 1QRAA 4RORA 6AT1A 3WL4A 1JIIA 2P2LA 5SYNA 4FIDA 3SC4A 3CVXA 1FNDA 1L5VA 1SBQA 3EXG2 3E9ZA 3KFXA 1C3VA 3NXSA 2HIHA 1M0EA 4YVFA 4LZPA 4O4LB 4CIVA 5JXIA 5H59A 4B6QA 1KVUA 1OR8A 2HPVA 4J7AA 1TI7A 2QTWB 3D8NA 3G0DA 2VNJA 4FZ5A 4ND4A 1YUMA 1N1GA 2VJYA 2Y4NA 2UKDA 2FW8A 3B6EA 4NCNA 2X3UA 4BMCA 4MGYR 4HNSA 5GJVC 3BFVA 3RUEA 3GGOA 4PF1A 4FMDF 4QIHA 5HEKA 4FWIB 1VKOA 2H00A 5ALUA 2PLFA 3TQHA 3HN6A 3P9XA 3JWIA 3QX8A 4DV0B 1YB6A 5I48A 2JFUA 1IY2A 4ZHQB 2YYYA 4H6XA 3RVMA 1XZDA 5K0GA 1I5OA 3JQQA 4AMVA 4BMDA 4RHUA 1BE6A 1AQJA 4NC9A 1E20A 3TS1A 2WR8A 4N9WA 1JU9A 1T29A 4WNIA 3MOGA 2G4CA 2WFMA 4JX9A 4KLAA 4C06A 3I6IA 1SD5A 2IXAA 4RMNA 1Y4AE 4C29A 1ZNYA 3A8TA 1ZR4A 3WRXC 1Q1GA 4CIBA 5FUMA 1XE3A 2QN3A 1I3OA 2IHVA 3BMCA 4IDCA 4B82A 1OX4A 4J43A 4UUAA 4CT5A 4LF5B 1Z0SA 3LT5A 4YUAA 2C9MA 4KQMA 4YECA 1DOHA 4BBPA 1R5NA 5KYYA 3S8YA 3L79A 3PGKA 5K6AA 3VVCA 1MO3A 4OBXA 3I04M 1O94D 5FWDA 4BNDA 3H9BA 2XMDA 4WXYB 2PRKA 5J63A 1WLSA 1GU1A 4FPXA 3MMXA 1K0FA 4XUGB 4U8HA 1WDMA 2CJPA 1DO8A 1VFNA 5CTJA 4EI7A 5FBHA 3V7WA 3VSCA 4AX8A 4KR3A 1RQNA 1Y5LA 2Z83A 2ZTVA 3K92A 1QYVA 1KARA 3CR3C 2I99A 3C97A 4H4CA 1LY1A 1O4VA 1KIFA 2O2GA 4HPJB 5FIUA 2X0DA 2J0QA 4HV4A 5BQFA 1ZISA 3AEQB 2O8CA 5B2ZA 3W0LB 1OSNA 4TS9A 2ZG6A 4EKIA 2CLKB 3A6JA 8ATCA 3DWIA 3MPOA 4TYNA 3I5XA 3LCUA 2H5LA 4H6VA 5KU1A 3I1IA 3IPLA 3PD1A 4LFBB 4GHWA 4CFSA 4QGBA 2CJWA 1A2KC 2ZUTA 3KG2A 2ZE7A 4EUKA 1ORVA 1Q2UA 4GP9A 4RCVA 3CMMA 5CXQA 3BXPA 5JZMA 3QXJA 3W77A 1TT5A 4DQVA 1HE4A 1A27A 2OCPA 4JYMA 3MIZA 4LYHA 4P84A 3VR2A 5L51A 2OHIA 1N5MA 4MDHA 4EYSA 2WEKA 1CY1A 4XOIA 4I99A 4P3PA 5COQA 4RTSA 1PDWA 4PAGA 1L4BA 4E88A 3CEHA 5K8CA 3UPUA 4G1CA 4PAMA 5B1SA 4JA0A 4NXNB 1Z7GA 1H0RA 4PVDA 3ETLA 3FDJA 5KNCH 3DBHA 4XYBA 1OA0A 2XKKA 3T7JA 3A27A 2YN4A 4BRSA 1S4MA 5LC1A 4DZTA 1EESA 5EINA 3A1CA 3C7CB 3FYUC 3R9WA 2OGTA 1TUEA 3G0CA 4JGIA 3V1YA 1Z2DA 1XMOB 1J1UA 3I5MA 5DNVA 2GO7A 3L4BA 2B5VA 1O97C 2FZWA 3H8WA 4BY9E 4RDXA 4G5YA 1OBCA 1VRCA 4MMXB 3L6UA 1LZKA 3LP5A 2B8TA 5HCUA 4KPFC 2WY2D 2AFHE 5KYGA 4TTQA 1TECE 4FJ1A 4LOIA 4PHGA 1H9AA 3P9NA 3G59A 3I2HA 4BFSA 5E6RB 1YL5A 1T4CA 3GLGB 4S04A 3ODGA 5D87A 2ZJ1A 1Z5VA 5ALZA 3QX7A 5NLLA 3ZN2A 1IYZA 3RFTA 4BLRA 4AURA 4X62B 1IOWA 1II0A 3NHWA 3O1JC 3ROXA 1M5RA 1A5ZA 4I7EA 1TZBA 2WF8A 4K8OA 3ILVA 5FL3A 1M75A 4DIBA 3GLGA 1HL3A 3LVRE 3PXGA 3AFMA 4P1ZA 1SR8A 2ZATA 4ZOLB 1A2QA 2OYRA 1CIPA 3W6UA 3KJEA 4BX9A 3PE4A 1JXOA 5IVIA 4U9UA 2JFPA 4OHZA 5IMBA 1CR4A 4WKNA 3VMMA 3CG4A 5DN6D 3BM5A 4KWCA 3BXHA 3ZDXB 2RBGA 4QARA 4AO7A 4FIZA 4B9AA 5JY1A 1SBIA 1X1TA 3ICWA 5DM70 3RLIA 1M1YA 1PNRA 2ID4A 3JQRA 3WHLA 3BXEA 3CRRA 5E9AA 2C29D 1QTNA 4LPSA 3I9V1 4MPRA 2GD1O 4DLZA 3IAFA 3H17A 1SQ5A 3A3OA 4PZZA 2WMDA 3P27A 3WDSA 3ERCA 4BVLA 4A0FA 1D2RA 1QIHA 2JFHA 2L18A 2W6ZA 4QOGA 4RETA 1AGPA 2L17A 2QL6A 3JALB 1M74A 4GEKA 1OFGA 4D3FA 3ESCA 3UJBA 3GRUA 4G5HA 4F06A 1R5OA 2HQSA 1ZAKA 2QRPA 3HUDA 2KLHA 1ST2A 5HMMA 4YFYA 2Q9BA 1BCRA 4E7OA 4BWGA 3S2IA 4C89A 3OQBA 2ARKA 2ZT6A 3AT1A 4KU4A 4TTTS 4ZQCB 4A6DA 3WIBA 3WIEA 2PGJA 2GPNA 3DL2A 4OKNA 2Y93A 4LSMA 1AGYA 2NXNA 4IGFA 2P6RA 1D5WA 5B3LA 1WZEA 4YCBA 2RGNC 3E4DA 2V1XA 4KXLA 4M9SA 3B1JA 3SBDA 4UTPA 3O84A 3RK0A 5HRUA 3GRYA 2HF2A 4UFNA 3T9AA 5FWXB 5C32A 1T6XA 1XXLA 3T5BA 2JAPA 1DRKA 3DLAA 2RG7A 3U39A 3H9JA 2OBMA 1LFDB 5DTEA 4F9GA 5JJBA 5ECYA 3GAFA 2IHTA 3GLTA 4Z0HO 4ZT7A 4IIXA 2F1HA 4KUGA 1PJCA 1AKNA 5DT2A 4F2WA 3EFEA 5KDOA 3ROGA 1KMCA 4DRXA 3BIFA 4LQDA 5LQKA 4TYYA 1FPQA 4ABYA 1O54A 1KYIA 4TKUB 4BKMA 2N9UA 3VDQA