3H1AA

Crystal structure of este5, was soaked by ethyl alcohol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
296
structure length
296
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 104
structure length 296
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1aA00
1SCIA 3OTQA 3H1AA 2XQJA 4EY7A 5EGNA 3WA6A 1VA5A 1F6WA 2VJBA 5ALRA 1CIJA 1N1MA 4AX4A 3BL8A 1E8DA 5AOBA 2VA9A 5CURA 5AKKA 3O9VA 4J0KA 2QS9A 1DINA 1EINA 3BF8A 4RE6A 2OCLA 2RAUA 1QOZA 5FXMA 5ALFA 3WMRA 1BN6A 4OB7A 4BP9A 4BVKA 5AM3A 5AICA 5HQ3A 2H9YA 1LPSA 2GBGA 4EY8A 2ZYIA 4OB8A 3HRHA 1TK3A 1XQWA 5JAUA 3HZOA 2D0DA 4OSEA 1AQLA 1GXSA 1LPNA 1CLEA 3HACA 3JYHA 2I78A 3LIPA 1SFRA 4IHAA 4DMHA 2G5TA 3T52A 3DOIA 1CEXA 3I2KA 3H1BA 3N2ZB 3UUFA 3ZLVA 2OXEA 2QRUA 1G5FA 5SYNA 4GECA 5DWDA 3T4UA 1ZD4A 1HBJA 3D5EA 3G0BA 4YPVA 4G8BA 5ALHA 2I3DA 3FYUB 2DR0A 4WCVA 4HRXA 5ISMA 5AM1A 1H2YA 3GUUA 3WYDA 2WUFA 1XZJA 3R40A 1E89A 3F98A 1QTIA 1CQWA 5HFNA 1A8UA 1DT5A 1XZGA 4J0IA 3C6ZA 2Y6VA 2OGTA 5DYTA 4J0DA 1WOMA 1BCRA 1XROA 1YB7A 2EDCA 4FDMA 3OURA 2LIPA 4BE9A 2E3JA 4HS9A 5AK4A 5AP9A 1H2ZA 4W1RA 5JYCA 1R1DA 2HU7A 1JJBA 5AKZA 1TKRA 2GYVA 3PDCA 4N5HX 2Y1KA 3MGAA 5E4YA 5E2IA 1N5RA 2OGZA 1YASA 4MEBA 1KEZA 4LYEA 1QO7A 1J07A 1R50A 4U2EA 5EFZA 3AIKA 3W9BA 1QIGA 4NVRA 4QE3A 4AXBA 3D2CA 3MUOA 5T4EA 4OD0A 4Y7DA 5AI8A 5SYMA 2WFLA 2WIKA 1O6FA 3B3QA 4BTLA 3G0DA 4K6GA 2WFZA 1GT6A 2C58A 4ZREA 4QDXA 5DTIA 2JGEA 2Z8XA 1WM1A 2AXEA 4PSDA 4ZV7A 1ZGBA 2DCMA 1WB5A 1YSCA 4J7AA 4J03A 1UWCA 3UUEA 3WZLA 5D6OA 2PM8A 2HU5A 4C88A 3DJYA 5AM4A 2CZQA 1FFCA 2B61A 3P2MA 2Y2VA 2JGJA 3TGLA 2CJPA 4PSUA 1T4MA 2RHWA 1DX6A 2V9ZA 1VXRA 1JT2A 3FYUA 4BVLA 1GKKA 2BGRA 2NW6A 1ZI6A 3L1IA 4JUIA 5CT8A 2BUCA 4CIAA 5KBYA 1AZWA 2FJPA 1DX4A 1CRLA 4H35A 1W52X 3QH4A 4GBGA 5JAHA 1XZEA 2XLBA 4QDUA 3O4JA 2ZJFA 4AN0A 4BCBA 3I2FA 5AM5A 3GFFA 4PV7A 2HFKA 4Y2YA 3U0VA 3G9TA 4UHBA 3VISA 3DYIA 1UOOA 3BDIA 4IH1A 3RLIA 1AC5A 1XRNA 1VJ5A 4MWTA 2XMRA 1DTEA 1E5TA 2ACKA 2WJ4A 4UHHA 4J0HA 1MN6A 2W22A 3C5VA 4JEIA 3R0VA 5JIBA 1GQRA 4DGQA 4KE7A 1UZAA 5CMLA 4ZXFA 4L0CA 4H7JA 3EQ9A 2WFLB 5DNUA 2XDWA 3WA7A 5EIAA 1CQZA 1BE0A 4CG2A 4W1PA 3EIOA 5CT4A 3WKCA 2BAGA 2EDAA 1JU4A 5K3BA 1BEEA 2QKYA 5DYYA 3BF7A 4M0FA 3ZLTA 1L7QA 2ZYRA 2RIPA 5JZSA 1I6WA 1LPOA 3G0GA 2QZPA 4GEGA 5C81A 5ALUA 2HA7A 4XVCA 3LCRA 1E3QA 3L1JA 3KWJA 4X00A 3ESDA 4C89A 2PL5A 4B81A 3N0TA 1MO2A 4GI1A 4G5XA 5C8ZA 4BAZA 5ALSA 5HF6A 1MX5A 5LLSA 1MT3A 4BAUA 2ES4A 4LIPD 1PV1A 3QPDA 4AO6A 2IX9A 4FHZA 3BXPA 4W1QA 1FFBA 3X3HA 2ONCA 1VZ3A 4X94A 1IUNA 2WJ3A 1CUJA 3F8SA 1CUCA 5AOCA 2YXPX 3FSGD 1MTZA 5LZ7A 5HQ3B 1QIJA 1TCBA 2QMQA 3GZJA 3A2LA 2Z3ZA 5LKAA 2PSJA 1ZGCA 2XQFA 2DQZA 3IA2A 3RARA 3LLCA 3O95A 1GKLA 1YAHA 3W9UA 4ZWNA 5JATA 3W04A 1XQXA 4OPMA 1JMYA 1UKCA 1WPXA 5D3ZA 1A7UA 2CKMA 3HYSA 5A2GA 3G02A 2OCGA 3S8YA 2Y6UA 1N8SA 1UK9A 1WB4A 1D07A 1N5MA 1QIHA 2WJ6A 3KXPA 3L1HA 2C0PA 1XQVA 4FTWA 3WKAA 1CUAA 3G9ZA 5LP1A 4HAIA 5ESRA 2ROQA 4ZRDA 4Q1VA 2I3ZA 1EXWA 3OC0A 2HRRA 4JH0A 3FOBA 5JASA 1Q0ZA 2WG0A 1THTA 3WL7A 3WL6A 1LPBB 4DLNA 4DMFA 5LZ5A 3PICA 2QTBA 4X7BA 1KU6A 1WHTA 2XMQA 3FLBA 3OOSA 2XUJA 2ZVDA 3QM1A 3RKSA 2DHCA 2QXTA 4AO7A 4QZVA 4CI9A 3ANTA 5FDFA 4QA9A 2C5GA 3QPCA 4X3CA 5CBKA 5FV4A 3DYVA 4QWWA 4C4ZA 3ANSA 1UFOA 1NX9A 3STVA 2B4KA 5JD6A 4MEAA 1VOTA 3UMJA 3O4GA 2XUDA 5FUMA 1SCKA 2WILA 2OGSA 4BE4A 3QITA 2XMGA 3D7RA 1W76A 3W06A 3WZMA 4EY4A 2V96A 4X6UA 4GXNA 5ALLA 4HZGA 4MQLA 1WB6A 2RHTA 3F9CA 1WCYA 4EHBA 3G8YA 1XZCA 1EVQA 5JZ9A 1VZ2A 3IURA 3IVMA 1EDBA 2AJBA 1CUDA 3A2MA 2ZYSA 5T4HA 4FBMA 1SCQA 1CV2A 4P9NA 2WHPA 3ZWQA 4L72A 4KJXA 1UOPA 1CPYA 3D4LA 3R41A 3G9UA 4U2CA 5JD4A 4Y9SA 3VXKA 1CUZA 4H7FA 4EA6A 3SWWA 1ZD2P 2BUAA 1XQYA 1J06A 1BCSA 2WUDA 2XQGA 4XJVA 3PE6A 2WUGA 2WFMA 1F0PA 1ZD5A 4B7ZA 4J0GA 5FPQA 1MPXA 3GBSA 2K2QB 2WIJA 3H2KA 4Y2UA 4P08A 2H7XA 5AKIA 2OPHA 5YASA 5K3DA 4OCZA 3E4DA 2RGUA 2J3QA 4OYLA 5DNVA 4JYMA 3IIIA 4MJ3A 4UBIA 1MAAA 4LXGA 3I28A 3DOHA 1XKTA 2C4HA 2CUTA 5I7UA 5AKXA 4TPKA 1YB6A 5IH7A 3VKFA 1ZIYA 4HTAA 2QR5A 5AK5A 3ZV7A 2C5FA 4IO0A 1AX9A 1UKBA 5HCUA 4F60A 1GPKA 4U2GA 4D9JA 1Q0RA 2VF2A 1X2BA 4RPCA 1EHYA 4G9EA 2PSFA 3K9BA 4C87A 4GW3A 3CN7A 4K2AA 4UBNA 4PF1A 2PSDA 3KOOA 1R3DA 1FFDA 2XUPA 3IUQA 4X85A 5DLPA 1UXOA 4B0PA 2WG2A 3AIMA 4CCYA 5HKBA 1W4LA 1XZDA 1FFAA 3WLAA 4DNPA 1CUEA 4AZ3A 4AN1A 3STWA 3NUZA 1C7IA 5AKEA 4MYDA 3STTA 4BATA 2VJAA 2PX6A 2Y2UA 3C8HA 4PQEA 5ALNA 1EH5A 5HF9A 1A8QA 2ZJ6A 4B84A 4P92A 5AI5A 2OAEA 4DMCA 1GQSA 3H18A 4WY8A 1U4NA 1Q84A 2PPLA 3HC7A 1DWQA 4UBMA 1JKMA 5CT6A 1Y37A 5LZ8A 1QE3A 5JAOA 5EI5A 2DQYA 4K6HA 2VAXA 3BJRA 3WKEA 1LBTA 3IDAA 4BC1A 1H22A 3LP5A 4WY5A 5FOQA 5JARA 1FJ2A 4H18A 4OB6A 2HL6A 4Q05A 2HFJA 1DWPA 3TRDA 3WK5A 1XZMA 4H7EA 2BKLA 3DCNA 3FLAA 5EHQA 1MX9A 4UHCA 4TVKA 4F0JA 5AHXA 1YR2A 1U65A 4KE9A 4L3WA 2VT6A 4W1SA 1Z68A 2HRQA 3CXUA 4X6YA 3H17A 2RI6A 5AI0A 3V48A 4PSCA 5KREA 2HU8A 4UBJA 4KAAA 1DQZA 1YA4A 1MNAA 4UBOA 1AURA 3V1MA 3FYUC 3VDXA 4A5SA 1R9NA 4PNZA 4QEKA 2WQZA 3ZLUA 4CCWA 2JGKA 1CUXA 5ALIA 4M0EA 3V1KA 2X8BA 5K5EA 3I2JA 1EK2A 1R9MA 1CFJA 5A71A 3GROA 3I2GA 1CUFA 2Z8ZA 2XLCA 2IITA 2HM7A 2FX5A 4TGLA 2WUEA 3SC2A 4UFOA 1ODTC 1EI9A 3FCYA 3V1LA 3KSRA 5BWBA 2DFPA 2CMFA 3AFIA 4X6XA 1OXMA 1J1IA 3QVMA 4U2BA 1VA4A 4AQDA 3B5EA 2HHAA 3AJAA 4E15A 2WTMA 3K6KA 2HDWA 3FVRA 1USWA 4ARBA 3QMMA 3STXA 3LIIA 5JAPA 5AJHA 4G8CA 4GHWA 4ARAA 3R3UA 2JF0A 3H19A 3AUKA 4Y2XA 4Y2JA 1DU4A 2Z5GA 5FLKA 1HLGA 2VJDA 1QO9A 5LZ9A 1C7JA 2XQIA 2YASA 3DLTA 4N8DA 2XUQA 3QMWA 2WTNA 1WHSA 1ODCA 2O2HA 1EDDA 4BDSA 2OQIA 5ALEA 2XQKA 4IQ4A 2VT7A 4B9EA 4YX9A 1GZ7A 2FJ0A 3A70A 2AJCA 1MAHA 2OLEA 4WFIA 3WL5A 4BZZA 3IUNA 3C6XA 2G4LA 4A16A 3WWPA 4Y2TA 3JWEA 2DHDA 1LPPA 3O0DA 5K3AA 1ORVA 3WIBA 3KDAA 1EK1A 3PF9A 2WHRA 1CUVA 4DNQA 3WWEA 3DKKA 1F8UA 4LYDA 4UHDA 4QDZA 1TCAA 2VAVA 2PKYX 4WDQA 4CFSA 1A88A 5ALPA 3HXKA 1IZ8A 4H7HA 5FKJA 1ACLA 4K5QA 1AMNA 2XUAA 3FLEA 4J0JA 4X90A 5JD5A 4BCDA 1EB9A 1XRMA 3OPMA 3FAKA 2XI4A 5F4ZA 2AJLI 5KWJA 1B6GA 4OU4A 5AI4A 3G0IA 1W75A 1K4YA 4EY5A 3BIWA 2XUIA 2YH2A 5KWIA 1HKHA 2ACEA 2XUFA 5JALA 3O4IA 1XRLA 1F0NA 1FFEA 4W63A 3C87A 4EBBA 1XLWA 4EZIA 5D3KA 3G0CA 1GPLA 5K3EA 3VJLA 5HF5A 7YASA 2X76A 2JGMA 4G9GA 3PF8A 3R3ZA 2WHPB 3ESBA 5IVKA 3CCBA 1Y7HA 4LKOA 4UFPA 1XZAA 3I6ZA 4S0XA 5EIEA 1DWOA 1YAJA 1ZJ4A 5T4BA 4YASA 3HJUA 3GELA 2DHEA 1CUYA 1X2EA 3U1TA 1XZBA 1NU8A 4UHEA 1FSSA 2G5PA 2XMBA 3O4HA 1HQDA 2BFNA 4PW0A 1MJ5A 2VSQA 4HXFB 3AZQA 3ESAA 2GYWA 5J3JA 1VLQA 5JZBA 2I03A 3MVEA 4MXDA 4GWLA 2XE4A 1DT3A 1HDEA 3DEAA 3VJMA 3C6YA 3KD2A 5IVIA 4P93A 3F97A 2XUHA 4X95A 1BRTA 3IUMA 2G63A 4G8DA 2PSHA 2AJ8A 3R3YA 2X5XA 3EQ7A 1TIBA 3I6MA 4RGYA 5CXUA 2VTVA 5DNWA 3TEJA 3GA7A 2OCIA 4Y2VA 1CUBA 3E1GA 1ZICA 4UPDA 2VEOA 1NU6A 3WIOA 4Q3KA 1LNSA 1W6RA 1H23A 3C6BA 3WWOA 2ZYHA 3WK8A 4BYMA 5BV7A 4C4XA 4FKBA 1G66A 2R11A 4N8SA 1THGA 1LZKA 1EX9A 5JANA 5BOVA 1P0MA 3EF3A 4EY6A 4C6HA 3FSGA 1QGED 4N5IX 2H1IA 4CG3A 3E3AA 5DYWA 3M82A 2QXUA 2OG1A 3IUJA 3VVLA 4LHEA 3ED1A 4Q3OA 1P0PA 1QONA 4MWSA 4DNOA 4H7DA 4E14A 3DNMA 1SOMA 4Q82A 3OM8A 1AKNA 5EIHA 3K2IA 3Q0TA 4L9AA 2CEKA 1CUUA 2BGNA 1CUSA 3H2GA 4NZZA 2QUAA 3RM3A 1CVLA 1LZLA 1VKHA 1U8EA 1L7RA 3WYNA 2J3DA 1HL7A 2WU4A 4XIIA 1PJAA 2BUBA 4WDRA 4DSAA 1XZLA 4I3FA 1A8SA 5C8XA 4QDTA 4BDTA 5AO9A 1TRHA 1CUWA 3RK4A 4QNNA 1IMJA 1UT6A 2OQVA 3V9AA 4B80A 4ZV9A 4WFKA 3A6ZA 5ALKA 1UKAA 1JJIA 2HA6A 3S2ZA 1QTRA 1QIDA 5ALQA 5A6VA 1IZ7A 1OILA 2GZSA 5ALXA 2HA2A 3I2IA 5IVDA 3H0CA 5IVHA 5CH3A 5A7FA 1E66A 4DSZA 5LZ4A 1U2EA 4CCYB 1DQYA 3EBLA 2ZSHA 4MYSA 2XUGA 3FVTA 1RWQA 4J0CA 5HKAA 1ZI8A 2WIFA 2EEPA 1ETHA 5AKJA 2WSLA 3D3NA 4KR0A 1XRRA 2IIVA 4NMWA 1G42A 3CCCA 2P8SA 4FFWA 1CUIA 5CH5A 4G4IA 4V2IA 3ESCA 1AUOA 4DM7A 4QLAA 2JGIA 3PUHA 4ITVA 3M3DA 4I19A 1QFMA 1P0IA 2PUJA 3BIXA 3VJKA 4X93A 4BCCA 4K6KA 3FNBA 1LPAB 1QIIA 5AOAA 1JI3A 3I6YA 2WHQA 4BZWA 2Q0XA 1HPLA 4Q34A 3DKRA 2BJHA 5ALZA 5K3CA 1ORWA 1Y7IA 4C01A 3O9MA 5D7BA 1UOQA 5AKLA 3M83A 3OG9A 5HK8A 1VXOA 3ILSA 4DYHA 4RNCA 3ZI7A 4FWBA 2JBWA 4AMYA 4GDMA 1ISPA 4OUKX 4BBZA 3H2IA 4QLOA 2V97A 1BN7A 3B12A 4X71A 2HIHA 5ALOA 2PUHA 1L7AA 4ROTA 4BVJA 4CG1A 6YASA 2YYSA 2QJWA 3R3VA 2C0QA 4QWMA 4KRYA 3QBJA 1R88A 2QJRA 3STYA 1MX1A 3HSSA 3BWXA 1O6GA 3WL8A 3DL7A 5AKGA 2QOEA 1QIEA 4JNCA 1T2NA 5LZ2A 4I4CA 4G4JA 5AI9A 3CN9A 3R3XA 3WQHA 1ACJA 5AKHA 1BROA 1W1IA 4KE6A 4A23A 4Y2QA 1WPRA 4UBLA 4IH9A 4C4YA 1EVEA 4BRZA 2PVSA 5CT5A 1IVYA 1UK7A 2VQ6A 4FFVA 3A2NA 4UBKA 3I2HA 4IH4A 5BWCA 5EHZA 4OYYA 2GZRA 3WKDA 1CUGA 4M0MA 3DDUA 1RP1A 5ALVA 1MNQA 4O08A 2XUOA 4BB0A 3BJMA 2R8BA 2WLSA 1GGVA 2XB6A 3IB3A 2WIGA 3TJMA 4B85A 3ZPXA 4H7KA 2H7CA 2GBFA 3IULA 4DIUA 1UK8A 4ZGBA 5ALYA 2XUKA 3LS2A 2FUKA 1RYYA 2C7BA 3FWHA 4X92A 1XLVA 4FNMA 4WJLA 3PFBA 1H2XA 3HLKA 2W6CX 2XMCA 3D0KA 1UK6A 3WJ2A 4PO3X 4MQMA 4DMKA 1ZJ5A 4BRSA 1CUHA 5HK9A 1H2WA 3C8DA 2DSNA 2XMSA 4ZI5A 2HA5A 3G7NA 4Y2RA 2PU5A 3C45A 1XFDA 3F67A 5I8PA 4KACA 4ETWA 5AM0A 5CH8A 1QIMA 4FLEA 3F96A 5C7YA 5HFAA 1XZIA 4B0OA 2HA3A 2WIDA 2JIDA 1ODSA 4BAGA 3PI6A 2O7VA 2J4CA 2CB9A 4B82A 3C70A 1LLFA 5CXXA 3W2TA 2H7YA 3HABA 2WKWA 3STUA 2WU3A 3WWDA 2B9VA 4F5ZA 1P0QA 4G4GA 1QIKA 3C5WP 1TCCA 5CT9A 3M81A 1GPNA 2QVBA 5E4JA 1XRPA 3NOXA 4BP8A 3D2AA 4FNGA 3QPAA 5C8VA 4E46A 2XMZA 4HRYA 3Q8WA 4E11A 1MU0A 1XZKA 1TAHA 2QM0A 3WI7A 2QUBA 2VATA 5K3FA 4EB0A 4G1FA 3VVMA 1YS1X 5T4FA 5AH0A 2ZSIA 2OAGA 1XZFA 4YK7A 1BEZA 5CRIA 1E8NA 1ZD3A 3V1NA 5AM2A 1AGYA 5A62A 5IKXA 3H2HA 1QIFA 4AB1A 1TQHA 1JU3A 4KAJA 4Q3LA 4U2FA 1OCEA 3EQ8A 2BCEA 2PU7A 3C43A 5EHNA 3AZOA 3QYJA 1J2EA 5AK6A 2UZ0A 2HA0A 3BE8A 4OU5A 2V98A 2JEYA 3R3WA 4EUSA 1ZOIA 5E4TA 3WK7A 4H7IA 1KU0A 3PFCA 5AIAA 5A7HA 2ORYA 1K8QA 5LKRA 4FMPA 5AK3A 3H04A 4HXEB 2HADA 3WK4A 1QFSA 2PBLA 4GLBA 4QDOA 5H3HA 4UHFA 3H2JA 2AJDA 3JW8A 2RONA 4FLFA 3WJ1A 1JFRA 5ALGA 1IUPA 1R4ZA 3W05A 4CIBA 4LXIA 3D59A 2B20A 2WG1A 2JGLA 4HVTA 4KE8A 2GBIA 4J3JA 4X97A 4XWGA 4JYPA 2JEZA 2ECFA 1K6EA 4KYVA 3D2BA 3DQZA 3YASA 1VE6A 4U2DA 1YA8A 2D5LA 1K63A 4B6GA 1M33A 1XZHA 1QLWA 4BC0A 1ZI9A 4AMZA 4Y2SA 4KRXA 2O2GA 3AILA 4WFJA 1YS2X 3PUIA 1X70A 3AINA 3HEAA 4FOLA 4RE5A 5DTJA 3DL4A 1QZ3A 3ICWA 4AO8A 5K3FB 5JADA 1LPMA 5FRDA 3SX4A 5LIPA 4W9RA 5A7GA 5ALWA 1XRQA 2XT0A 3WWCA 1LBSA 5CTAA 3DD5A 3E0XA 3BDVA 1B41A 4FLMA 3G9XA 4NS4A 5HZGA 1G4HA 1E8MA 4HXGA 3FCXA 3IBTA 3MUNA 3HI4A 2XMDA 1K5PA 1LGYA 1YCDA 1EA5A 2JGFA 5AKYA 5CW2A 4DTCA 3QZUA 5ALDA 1Q83A 1JMKC 3DS8A 5ALJA 2ZJ7A 2O2IA 2HA4A 5I9IA 3WK6A 4B9AA 2WM2A 2GBCA 2PSEA 3WKBA 4KAFA 4Y2PA 1PFQA 4F21A 1EDEA 1C4XA 1XLUA 5ALMA 3FBWA 3AZPA 2VJCA 3NGMA 5AI6A 4XX1A 1XKLA 5FP0A 2OCKA 3KWFA 5HF8A 1IUOA 4FBLA 2CBGA 1JJFA 1CR6A 3FYTA 4B83A 1ZIXA 2J4FA 5LYYA 5FPPA 3WK9A 4N8EA 3I1YA 4AZ0A 1S8OA 3SK0A 3AIOA 2Z3WA 4Z49A 4DNFA 4LXHA 3NWOA 1EB8A 5EHXA 3I1IA 2QT9A 4UFNA 3QMVA 2O7RA 5ALTA 4H77A 5DJ5A 1VE7A 5AIBA 1BU8A 4BTVA 3ICVA 1SC9A 2GYUA 4H0CA 4X91A 1QJ4A 1BS9A 4INZA 4UUQA 4KEAA
chains in the Genus database with same CATH superfamily
2JJ1A 2QZJA 4LV6A 3ROGA 1DAEA 1OZHA 3WGZA 4CKCA 1FU8A 4TL6A 5CX1B 1BJRE 3UO8B 3U7FB 3HDVA 3NYIA 4EJSB 4IEFB 4EY7A 3DL0A 1J1UA 2ZI9A 1JF8A 1ENPA 1B93A 1B26A 1FXUA 4X3OA 2RH5A 4PTZA 5ECWA 3O8OA 4NCBA 1E5DA 4RXTA 2A0UA 2FY8A 4TYMA 3IOEA 2QTLA 4ZOAA 3RHZA 4LQ4A 1KPHA 3ZH9B 4DIMA 5ITZB 1ZBDA 3D1VA 3BL8A 3NNDA 4R05A 5CJ2A 3ZHRA 5FAKA 5IUKC 2ZIFA 5FTKA 2IPLA 4EUKA 3GDHA 1AGXA 1PFYA 3N87A 4M9XA 4OY3A 3ZXYA 1ZBQA 1WRBA 1L9KA 1LXCA 1XTKA 4FNAA 3O9VA 3ND6A 3CSDA 4J0KA 3W78A 1EINA 4UW9A 2P9BA 1N1GA 2QQ5A 2RHGB 1GZSA 3CG4A 1VGVA 1X7HA 3FHOA 2BHRA 3BF8A 4RE6A 1PWYE 5LA6F 1QOZA 3SYNA 4KVGA 3SLKA 4XM1A 4E88A 3WMRA 4IKEA 2JW5A 3EZ9A 3ROKA 3LVRE 3SIXA 1B00A 2FMIA 1ADYA 1XMOB 3P2JA 4IICA 4WUTA 1XMIA 2MDTA 1G8YA 1VC2A 3LZDA 3RS8A 3DEFA 3ZHCA 1R0LA 4JI0B 2Z4RA 3DAFA 3H9QA 5BNTA 3NBKA 1UBKS 1CEQA 2EX0A 2HIAA 1CJUC 3I52A 5EZ5A 2KLBA 1NONA 4PU0A 4AQYB 1JR3A 3VU1A 2KM1A 2HRCA 4DOMA 1YBAA 3L7IA 4GGMX 3L7YA 3T61A 2UVPB 4D5GA 5HQ3A 3MS2A 2PH1A 3JVVA 2ORED 4EJ2A 5HS4A 1LPSA 2XCSB 3KK0A 3UAXA 2GBGA 2B3TA 4GI7A 5I9SA 2I8AA 2OOKA 2P75A 2WNIA 3I4FA 4XIYA 3AESB 3GMDA 1F51E 2LWIA 3QKWA 4HMQA 3LP6A 5C34B 1GXSA 2VJNA 5P8WA 2FWJA 1H65A 4HDMB 4MUXA 1CRPA 1LPNA 3FKSD 1E9SA 1M8KA 3ZZMA 4JBYA 4JL5A 4KRFA 5EMNA 5I7WA 1P7CA 4FYJA 1QPGA 4JSTA 3RS7A 2C0CA 4FOSA 1GLGA 4JJAA 2W6PA 3W5CA 4FP9A 4J1NA 3JQ8B 4XVHA 3PEWA 4OYYA 3A6PC 4J6EA 4ZA2A 1Z0IA 5JTTA 2IHNA 1NE2A 1TADA 3PL1A 5JLAA 3VR5D 3WL4A 2AJTA 3B9BA 3BA6A 3DOIA 3GG9A 3NKFA 3PPIA 1ZN7A 5DTEA 5FQOA 3SSNA 1MEEA 4C76A 4CEIB 1A98A 1FRZA 3K4QA 3COWA 2GNOA 3N2ZB 2ENWA 3GCZA 2YUTA 5JRZA 2PCJA 2ZANA 1XVIA 1JQKA 1QLJA 3AY6A 3OIVA 1RABA 4YRDA 1PLJA 4RY9A 1U5CA 4EPYA 2Z6QA 1U1GA 4LJRA 4Q9NA 1M7BA 2Q5EA 1I6KA 2R79A 4Z7QB 1J0AA 3K0EA 2DPLA 1MEJA 2ISQA 4MOWA 1FW6A 1MC5A 3HVKA 5CX4A 4XKJA 3QKRB 3CUWA 3VOTA 4JR1A 5EXXA 4BJHB 3G0BA 4QRHA 4MVJI 3UK6A 2FPIB 2OZVA 4G8BA 4B6JA 2V6GA 4D81A 2X9NA 1DAIA 3GRAA 3NBUA 3TMKA 1VB5A 4H6XA 2I3DA 4B6SA 2ORWA 5DGIA 4DRZA 2P1ZA 1FUEA 1O95C 4RZHA 4ZC8A 3LWDA 4K9NA 4PWZA 1FTNA 2PN1A 1H2YA 1UWVA 2G6BA 2R44A 4NJMB 4TL8A 4Y0AA 3BGOS 4AIIA 5C5EA 1NT2A 3VR1A 1PE0A 4NG4A 3ZU2A 1TX4B 4DR3B 2BLLA 3R0QA 4EUEA 4B4UA 1E89A 4B2PA 1K27A 2OP0A 3DP9A 3F98A 4CQJA 1PU2A 4E5DA 1CQWA 3M5DA 2VXBA 3I4CA 1DT5A 1E6CA 2JJ2D 1NM5A 2VAPA 3QBEA 1TFRA 3C6ZA 2OGTA 1RPZA 1V5GA 4ZARA 3ID6C 1W2GA 2EOAA 5F78A 4MQEB 5HIMA 1EFVB 2ATCA 4YJKA 1BCRA 4KR9A 4ZU1X 1PR6A 4EIWA 2IC5A 5TE9A 2CJXA 3SHFA 4OM8A 4LOIA 5IN5A 5DHAA 5CVUA 3AVWA 1YGYA 3FR8A 3D3KA 4HS9A 3ZU5A 4M46A 3G7UA 5AK4A 2JLSA 3ZJ4A 5LDHA 3V7YA 1X15A 4KAXA 2CV0A 1H2ZA 3ZJTA 5E7MA 3QF7A 5EERA 1QC5A 5JCJD 5JYCA 3PQ4A 4IWXA 4IPTA 4K81B 4U7HA 2PMKA 2C07A 1JDJA 3IODA 5JQGA 5IDYA 2AL7A 2FP4B 2WKQA 4LTNA 5AKZA 3U3MA 5L7WA 4JLPA 5DP1A 3KZOA 1KMHA 1OFUX 4EJ0A 1V96A 4EA7A 4P4LA 2A1UA 3GLSA 3OJEA 4C0JA 3L49A 1XPUA 3LPLA 1D7OA 2E1PA 4JUDX 2BMDA 3BIJA 3HCRA 3FOZA 1X0XA 4Q3EA 3LCVB 5JC1A 1FVOA 3BH6A 3N53A 1PJLA 5E2IA 5TDHA 2AD5A 3LKZA 4NQZA 2C20A 5DCLA 1PUIA 3DTYA 3QUCA 2F9LA 1KEZA 4WKPA 2EG9A 3NYQA 1SRQA 1WTAA 1YMUA 1Z2OX 2WAXA 1DAHA 1VIDA 3UMGA 4BMNA 1ZUIA 2JKZA 4FZJA 3O5AA 2C00A 1KVRA 2FEOA 5EFZA 3AIKA 4R7TA 3Q3VA 3OE5A 2ZTVA 4QYXA 4OQLA 2A67A 3KYIB 3E5RA 5HGJA 9LDBA 3IAAA 2W9XA 1NXOA 1Y1LA 4A1OA 3GLIB 1TQDA 5DHRA 4FDTA 2C5AA 1Y5LA 3N2GB 1FS4A 1GN9A 4HATA 1QUFA 4LY0A 4BNDA 5DM70 3BYZA 4X8OA 5T4EA 1AN9A 3BK1A 4OD0A 3Q10A 4NENB 3MCAA 4JLSA 1E2QA 1GD1O 5BSUA 4C4TA 4HAZA 2PMWB 3UFXB 2WIKA 1QPBA 2NTYC 5CB0A 3G0HA 1O94C 1E9EA 2HEGA 4TMYA 5IT0A 4I5IA 3VTKA 3Q8LA 4QDXA 5DTIA 1OXKB 2BHTA 2CYCA 2VSXA 4IOKA 3F74A 3JYOA 9ABPA 4MKZA 1U8UA 1SG0A 2AXEA 4MPPA 5KYNA 4WH0A 3DTVA 4JELA 4C0KA 5J2TA 2A5GA 4C04A 4Y30A 3U9TA 2DCMA 2EXXA 3R6LA 1DI0A 2WOJA 4FYXA 3UUEA 5HQTA 4IIVA 4PLPA 4O2BF 5D6OA 3G85A 4HDAA 4LHXA 1XIVA 5JSYA 1MX3A 1XMSA 4KP7A 4DBVO 2ZIUB 3BXFA 3NHZA 4F5YA 2PX0A 2RAVA 1G9XA 5BRJA 2B21A 4BKUA 1FYXA 3NGXA 4D4IA 3NBQA 4EHNA 5L3VA 4BLOA 1FSFA 1J23A 2VOEA 3K73O 3TGLA 1GU7A 1KI1A 1XZNA 3H3FA 5B1YA 1EFKA 1Z74A 2J48A 4RESA 1DXQA 3RIGA 1ZFNA 3ORRA 1VXRA 2A9RA 3DMDA 4R1QA 1WXFA 2VQ3A 5I8WA 5A06A 3TRJA 4PX2A 5L45A 4JVNA 1GKKA 1UMBB 2BGRA 3HL0A 2UYQA 1DQRA 1HI9A 3WB0A 4ND7A 2A3NA 1N2GA 3UJ6A 3BRWA 1MH1A 5CT8A 4CIAA 3MWEA 3RJZA 1PNTA 1L9XA 3HFSA 3GLKA 2BN4A 2H2DA 4M9QA 5IAKA 4CM4A 1DX4A 1CRLA 3TLKA 1OY1A 4UNNA 4HDRB 3MJCA 4G67A 3FJYA 4PN7A 4G5HA 1W52X 3CIOA 4GLFA 3WLRA 5KPJA 3DLHA 2X5KO 2ZYVX 2QGNA 3CKMA 3L5OA 4EWLA 1DRJA 1NNUA 2X4LA 4QDUA 4WZBA 1OTHA 3O4JA 2EBWA 3ONWA 4GPD1 1BHO1 1QBKC 2GH1A 1YZVA 4BCBA 5SICE 1G8GA 3C7KA 4KQFA 4W82A 1KO5A 3I2FA 5JO9A 5AM5A 3TLMA 3GFFA 3H65A 4DG8A 1NPYA 2HFKA 3H84A 4LYJA 4URZR 2YWCA 3B3GA 4F2PA 1G41A 4GQBA 1YZNA 3ZHTA 1JEOA 2OHJA 4FR0A 4FT4A 1GPMA 4Q4AB 4YIKA 1M1NB 3W1VA 5K6RA 4MI6A 4UHBA 3WISA 4ERXA 1R0KA 2IH4A 5AVSA 2ABWA 4YXWA 2XCIA 5BYJA 1CY4A 4CZ2A 1PS0A 2V5UA 3PQ7A 4IH1A 4R2LA 1Z5NA 3ZEIA 1JG3A 3TVTA 1DEKA 3RLIA 1AC5A 1QO0D 3P9SA 3ZZTA 2WZBA 5DOVA 1IN6A 1SCUB 1VJ5A 3BB3A 3G88A 1JA1A 4IIGA 5JCZA 1DWUA 2ODTX 3V2HA 3EXAA 5C8DA 3DEZA 1DIAA 1TYAE 1DXYA 2AK2A 2WJ4A 2IDKA 3CUKA 3OOHA 3HBAA 4NE2A 4ZOBA 4ZOLA 1GPH1 2J0UB 4ZKDA 3OY7A 5B1DA 4DCUA 1MRZA 2AOTB 4N5DA 3HDTA 1NQUA 1KNQA 4HLUA 1MJHA 1K08A 2HIMA 3DM5A 3W6UA 3GDGA 3ZBUA 1NTRA 4DGQA 2C5EA 2Y1CA 1E5LA 2RBGA 3M1LA 3UJAA 5EWLA 4TYQA 3L0IB 3S81A 1UZAA 1F2UA 5EY5B 4C5BA 2BFCB 4FUTA 5EJ8A 3ROEA 2I34A 5CDGA 4GG1A 3HB5X 5FA5A 2PXHA 5B1IA 5KJFA 2YWFA 3AHIA 5DULA 1QBGA 2XBLA 3A4MA 4FYHA 4KOAA 5GJWC 3TL6A 3ZY4A 1ORTA 3ZCUA 1AKWA 3RS3A 5JWRA 1Y4DE 2P9EA 4FEGA 4BBJA 1CQZA 4OH7A 1BE0A 4IGAA 4TMFA 4A8JA 1WF6A 1DG1G 2I2AA 4YI5A 4AWBA 3EGVA 4YRSA 1TM4E 2QYHA 2P69A 3DPIA 3EIOA 3F5QA 1QCCA 1SELA 1ZW6A 2A5DA 2Q8NA 3WKCA 3HM2A 3K8ZA 2X6QA 3O1JC 2X40A 1U4OA 1DNPA 4IIJB 5DBHX 2Q28A 2CLDX 5H0IA 4TWAA 1CZHA 3PP8A 2EDAA 2O07A 4LX8A 3AR3A 4KQKA 4L4UA 4CKBA 2QTNA 2QKYA 1BEEA 4M0FA 1KO7A 4WAUA 4XFJA 1V41E 4HAOA 1DELA 2YHIB 3N8DA 3ZS8A 4G5YA 5H8WA 4MWCA 1IYZA 2VSYA 1KMMA 3QXHA 1ULZA 5JZSA 3CH6A 2I4MA 3FJ1A 3P9CA 1P1HA 4DUGD 3L8FA 1E2MA 4RZ2A 3IEXA 5FUYA 1P5HA 1T5DX 3UC5A 4OJYA 3TQHA 1O89A 5C81A 4JU8A 2HA7A 3FBTA 4XVCA 3HZZA 5GIOE 1ZM9A 3A9WA 1ZR2A 5CDFA 2C82A 3KWJA 4X00A 4RJTA 2ZTHA 5BORA 2XPCA 1AF4A 2HK9A 2ZT7A 5U4XA 3KX2A 4YXWD 5F77A 1N1DA 1M6WA 3F6BX 4K05A 2PGNA 1OZGA 4K86A 3N0TA 4GKBA 1MO2A 2J6IA 2FNAA 4HVAA 5E9QA 5T8KC 3WHIA 5JJ5A 5KQMA 4GNKA 1SIOA 2SNIE 5C8ZA 4YC7A 5TQ0A 4F38A 3UTCA 2P79A 3GAMA 4LZPA 5FI0B 5BOSB 4RNDB 2V6IA 3FCEA 1DQNA 4FFOA 4Z9BA 3UWKA 4OAQA 2P9YA 2GRAA 1A69A 3M3HA 4MAFA 3BGVA 5LLSA 1ODIA 2FW8A 4BAUA 1WY5A 2ES4A 3FD8A 3QPDA 1VHDA 4Z4HA 1JHOA 1SZPA 4FHZA 1AUVA 1YL5A 1TZBA 5ULLA 5KYGA 1JR2A 2IEZA 4RCYA 4W1QA 4NU6A 2BMAA 4ARVA 1W48A 5IT4A 1CS0B 1K5DA 2FWIA 3Q7SA 5BVGB 2MR6A 4EYQA 5AVOA 4WCFA 4QPPA 4K9PA 4EF6A 1OXXK 5AOCA 5A4JA 4HNGA 1UADA 2ZSFA 3HN6A 4HX2A 2EGGA 2YXPX 3FSGD 3RTGA 2C9MA 3TW4A 2YRXA 5LMNB 4Q4HB 4A9AA 2VSFA 3Q6MA 5U9CA 1AZTA 4MLCA 3GUVA 4LGCA 2B9EA 4KDCA 3MMNA 1E1QD 1TCBA 1TU4A 1XOIA 2AMYA 2QMQA 4LJ8A 4OGLA 3VUEA 4ZK6A 5JS1A 2E55A 3NAMA 5JJLA 2EIHA 1S8AA 4ZANA 2JD2A 1E98A 5LYJB 1VP3A 1ZM7A 4QXQA 3IVCA 4DV7B 3UH1A 2C4WA 3M4NA 5LKAA 2CUZA 2B6HA 2XVAA 1SIUA 3M6LA 2JHCA 4GX0A 4C0QC 1HSZA 3K9QO 1A2QA 4JI3B 5KX5F 4ALMA 3EODA 2Q3BA 3F4BA 4D43A 2H4ZA 4NESA 4L5JA 1QH0A 2DQZA 5E38A 1KFBB 2JD1A 1G1AA 5LC1A 4D2IA 4MWOA 1Q1EA 3ISTA 1JHRA 2FEKA 3TRHA 4EX7A 2ZJBA 2NSYA 2QAJA 1V9CA 2HR1A 1A27A 3ZWVA 1KWKA 3ZVKA 4WBXC 1A9QA 2AF3C 4WGGA 3A1EA 2P6MA 1FYFA 2HH9A 2P2CA 3FCUB 1HY3A 1UKCA 1UBRS 2H63A 3IOCA 3T6KA 3DFZA 1VG8A 4EK9A 4B5LA 3Q6NA 3QE0A 5DT9A 3P96A 1R5NA 5CG1A 3OF3A 1SKYB 3G2JA 4NJEB 2D5CA 1I4WA 1PIWA 4WADA 1WXWA 4XLZA 4OXYA 3ZHUA 2YQ4A 5A2GA 2HLHA 1JJ7A 4PZZA 4RF5A 3NGLA 2Z57A 3UOAB 3I58A 2OCGA 3NC1C 3S8YA 3CZQA 1DGQA 1GGJA 3NETA 4YT5A 4JNKA 1WB4A 1QIHA 2WJ6A 3VNRA 1P1BA 3KAQA 3ST7A 2MYUA 2XVZA 3CF4A 1Y9EA 2R6JA 1CUAA 2O20A 2A78A 1IPHA 4AY5A 2EJUA 4I4TB 1N3IA 1Z2NX 4NV3A 1I3OA 1BXRB 1A71A 1JAIA 1E4OA 4Z7NB 5HXAA 1QRTA 5TC4A 1ZGGA 2A5YB 5KJCA 2O8CA 2H7VA 4FU0A 4GBMA 1P6XA 1OFIA 2E5FA 5TB5A 1GQQA 3L7BA 2HRRA 3OE7A 3A6GA 2BBOA 3OIGA 3OC0A 2ZJZA 3AIIA 4UNIA 1H8EA 3W77A 2DEUA 4RZXA 4E5SA 2N42A 3QKSA 3VR2A 1QDEA 2K4MA 4E2WA 2ZZMA 2PZAA 2Q1XA 4RABA 3ZYCA 3MJDA 4ABTA 1BX1A 4AX8A 1SBHA 1OPXA 3ABRB 4FGKA 3WL6A 5EIOA 1ESEA 1HE4A 2E4AA 3CX8A 4BFXA 4PXSA 4NWIA 5GINE 5LZ5A 4XVUA 4WHMA 3NBXX 3FNGA 2PGAA 2QE6A 1KU6A 2OBXA 3KYDA 4LMPA 4NATA 1KSGA 4BYGA 3WBKA 2EW1A 1WHTA 3FLBA 3OOSA 4IHJA 5SZJA 3TZBA 1G0OA 3C85A 5EMLA 3BHJA 2R5FA 5FCDA 2XUJA 3RSLA 5FPKA 1XT6A 2R96A 3AWDA 2QUJA 3I53A 3MRXA 3NM4A 3OPXA 3PKZA 1JXOA 4HAVA 4JVOA 4P4TA 5EOVA 1U3GA 1V3TA 1IHUA 4ND2A 2X0EA 3KALA 1FL9A 1XCLA 2QXTA 3O0TA 1ZONA 3MTBA 4MTCA 5IPFA 4QZVA 2H6EA 5FDFA 1ZN9A 3N58A 2DHQA 4LFAB 2QYTA 5JVDB 3K4PA 1HQKA 3AR4A 1S7CA 2Q7DA 4EABA 2I80A 4ENRA 2DH5A 3UJ3X 5CBKA 3LHSA 5FV4A 3AY3A 3JZDA 4HLUC 2ZU0C 4QWWA 3HJAA 3U7HB 4FEAA 1V4NA 5FTJA 2C2KA 3TQIA 4TS4A 5IM4A 3V4RA 1K66A 3FX2A 4OXNA 3ZVLA 4C4ZA 2EATA 3W8EA 1SIWA 3MM4A 1RC8A 1UFOA 5GMOA 3D6HA 3AF1A 2II6A 4AF7A 3E3MA 2ZREA 4GMHA 2OZLA 3UCEA 4AZWA 2A0FA 2DUWA 2ZW9A 3UMJA 3CW2A 4IDBA 5IH3A 1LK0A 1WG8A 3N3BC 5EE1A 5FUMA 4ZHQA 2GQ0A 1Q5PA 3K0HA 3DFMA 1U0HC 2OGSA 2RI1A 1WW2A 1SH7A 2QY9A 3QITA 1OIWA 4I1SA 3PNLA 2P2YA 3RYHB 1M67A 5JD3A 3D0OA 5EZQA 5FOSA 1MB2A 5HIAA 3U4HA 4MQ6A 1P1IA 1OXUA 5IJ9B 1Q7GA 3LHKA 3Q5GA 1MORA 4G41A 5HILA 1T9AA 3RYIB 5F7OA 1U2ZA 2WEKA 3OQIB 4GI5A 2EW2A 3RVNA 1P2FA 4M1YA 4LOKA 5CX1A 4HZGA 1IIRA 4MQLA 5EE0A 3WHKA 9ATCA 5KB3A 2Z56A 4ZZ2A 3TIVA 1PG2A 4R9NA 3F9CA 1XA3A 3VJRA 2HWWA 4H7PA 5CA0A 3QTTA 1TEHA 3H05A 5JZ9A 1EVQA 3IV9A 2WHEA 1XA0A 4GEKA 3LQ4A 3VNQA 1T2EA 5K0EA 2R6CA 2QEQA 2DPXA 2PZEA 1CUDA 5DGTA 5HJ2A 4A0FA 5JNSA 3HP7A 4FQ5A 2QLFA 4F9GA 3U4QB 4ZU6X 4FIZA 1XRSB 1SU6A 2FE4A 4ZCRA 3AYXB 4GOOD 1V16A 3JVEA 3WWYA 4FBMA 4ZO6A 5HDBB 3SQXA 3NFYA 1REQA 1HEUA 1VI2A 2XNKA 1YFKA 3EZ6A 3LBIA 1I80A 1SHZA 1DTSA 1YR1A 3OCUA 4PSAA 1YS9A 2OV6A 2WHPA 1QE0A 3ZWQA 5AVZA 3EVNA 5CBPA 3CEMA 2I2DA 3IBYA 3H2YA 1NIPA 1KETA 3CEHA 3NX4A 3T38A 3THYB 5CR9A 3L6UA 2WR8A 4JK3A 4ILKA 4NFSA 3L8EA 1C3XA 1CPYA 4PYNA 5C2JB 4Z6KA 5IEBA 4L07A 3CUVA 2BH2A 4N3GA 5ECDA 1DZIA 3KJFA 3HTXA 1P29A 4CU5A 2GLTA 5JG7A 3KTAA 4E5NA 2P2DA 3LQYA 4YAOA 1WO8A 5JD4A 1LTHR 3L4JA 3VXKA 4JC4A 1FFXA 1ZCZA 3QVGB 4IUYA 4YLEA 1ZD2P 3GRVA 4MW9A 1XQYA 1J06A 2GLXA 2HQRA 2JIBA 1BCSA 3AEUA 3PR1A 2WUDA 2FPRA 1M7HA 2C2BA 3VAYA 4F96A 1YNOA 3U9SA 1H3EA 1H1DA 3CZ5A 2A0XA 4IS2A 3BBPA 5FWAA 3TRKA 4DSNA 1VGRA 3V4VB 1M5TA 3X1KA 1X7GA 3EG9A 5FULA 3CNHA 3I61A 1WF3A 1Q12A 1Z25A 2BFMA 2Y1DA 2Z4TA 3SI7A 1ZH2A 2WIJA 1Y33E 3Q85A 1ES9A 4JA2A 3M5CA 3GMTA 1QV9A 1T9HA 1Z5PA 5AKIA 9LDTA 3HKBB 3LA6A 2J9GA 3KHTA 1KY2A 5YASA 4B74A 3RUIA 2RGBA 3MJEA 4HG2A 1CJSA 4OYLA 5DNVA 1BDIA 5EN4A 1EXDA 2FWMX 1OA1A 1Q1NA 4WA8A 3T1NA 3LO5A 2C5HA 4HO1X 4OHFA 1FTSA 1N8NA 1UL1X 2J3MA 2ZRIA 1ZJZA 3A1UA 3I28A 1W4ZA 1XEXA 3DOHA 1MV5A 2BEWB 2QLTA 4M0KA 2XY4A 2G1UA 4JLVA 3WMXA 3ZNNA 3QV2A 4EY3A 3TE6A 5I7UA 4L95C 1UEJA 3HO8A 1YI8A 1AVTA 2XDAA 4MWGA 3KHKA 5ESDA 3UJCA 3NRJA 4S04A 3VKFA 3LGSA 4CPDA 1NL3A 3QX7A 3VYRB 1T9CA 2C5FA 3JWIA 1W0KD 5EQFA 1DC4A 3T5GA 3TSZA 1CP3A 3EC7A 4ZYUA 4EJMA 1UKBA 2IYWA 2FMKA 3MJFA 1GPKA 3HGTA 4LF4B 3W4JA 2R1TA 3IBGA 1NX6A 1GOTA 3QTBA 2VF2A 1X2BA 3SF8A 5M34A 1TYEB 4KQHA 3PNKA 3ES9A 2PSFA 3QKRA 1P1CA 5ELMA 3SBDA 3WDMA 2ZBPA 3PZBA 4PZDA 2I3AA 3R74A 4D6XA 1EHCA 1HOTA 4RFLA 1YDFA 5EHGA 1F12A 1SCNE 4CV0A 3CS3A 2NSLA 3RU7A 3R44A 2G8LA 3F5DA 3UGJA 4RLFA 2QQFA 3ANMA 4OP3A 5IS2A 2IU6A 1J39A 5JFGA 2C97A 3KOOA 4QX6A 2JLZA 1R3DA 5IAOA 1TIPA 3HDHA 4H1HA 4TUYF 1WMDA 1XHLA 3L8YA 3NHPA 3OZVA 4AF6A 5T7BA 2WI8A 2B8EA 3ZV4A 1KJZA 4UPEA 4DJJA 3ONDA 1JQDA 3AP3A 2RJ3A 1UBCA 1K98A 3GF4A 2BMFA 4JLDA 3AIMA 4GLJA 4GMDA 4K87A 3ZDQA 4CCYA 5KINB 4N41A 1UXGA 2OHFA 4JQOA 4L0MA 3E2IA 1T2FA 3GEHA 5SYAA 3IKVA 2VH1A 2SKDA 1E69A 2ZRQA 4XWWA 2Z6VA 3FGNA 2ZSDA 1CUEA 1VL8A 1J7KA 1EFDN 2R8ZA 4HDRA 4R98A 1MG5A 2BFPA 4RMGA 5AKEA 1AKEA 2WF7A 5E95A 3K0SA 2PIAA 5EG5A 4MR9A 1BVUA 3D7SA 2ECOA 5L3SB 3ZGNA 1Z6ZA 2EG5A 1QHHA 2VJAA 4N40A 3ONFA 4N9QA 5IBRA 3ZQ4A 5AUPB 5CDHA 1Z7WA 2VOJA 4PQEA 1SGWA 3CISA 1OWOA 4S0ZA 3D6AA 3EA4A 1EH5A 5ALNA 1P9RA 5IWAB 3MA0A 3RBXA 3ISVA 4ZVTA 4MCIA 3UOWA 1RACA 4FW8A 1GFSA 2OAEA 4BLSA 2HT1A 3FYDA 3ZZ1A 1M1YA 4H31A 2X7XA 1Q0QA 3VHXB 1R27A 2R85A 3LVBA 3NR2A 1MRNA 2GFIA 3OH8A 3W2GA 5PGMA 3E7WA 1NLUA 4QC2A 4B6QA 1VMAA 3BSYA 4MVYA 4BMSA 2B99A 1Z29A 2YIVX 3PUZA 4EW3A 5CT6A 2DRIA 2BDTA 1W93A 1JDSA 1YU9A 2VPQA 4TRJA 5TMBA 2BC9A 2I0FA 4HPXB 1WU8A 5B1EA 2AG8A 4AJEA 4GKKB 2QRJA 3RSSA 1QE3A 4NABA 1SAYA 5JAOA 4O4IA 2RH8A 1U6KA 3C6QA 2JLWA 4V38A 1MFZA 2YW9A 2H4XA 1ILWA 3BJRA 1B0PA 3W3AA 1LBTA 3IDAA 1H6AA 1Y6RA 5K8LA 2I8CA 4CIVA 1K1EA 2XCUA 3ZDYB 4WY5A 5FOQA 4R6XA 2JAUA 4O1MA 5JARA 1Z63A 3HDJA 4TMVA 2E89A 2XAAA 4Q05A 1WXEA 1DWPA 4JLBA 4Q7MB 1QWSA 3PNOA 2C78A 2FSVA 4M9UA 3OQPA 1YHYA 4IDAA 1ZWKA 2C7VA 3AC0A 2IZ1A 1V1JA 4NQRA 2VLBA 1S2OA 1XX6A 4FONA 1NXXA 2Y66A 1BJKA 5AQEA 1MX9A 5DE3A 3S40A 3VPFA 4F0JA 1UZLA 5B3JA 1UKEA 3NOOA 5AHXA 3CBQA 3KR9A 4GOLD 3DMYA 1T2CA 3DAGA 5EC8A 3HNRA 3U39A 5JRJA 3W5AA 4LBVA 1TJ3A 3AUXA 2Q6TA 1L4BA 3PTAA 3ZHXA 3AU9A 4S1NA 2EQAA 4INJA 4ZVRA 2GETA 1LFAA 4LSZA 1NF2A 3S1AB 3BMNB 1LWOA 4BLRA 1OASA 4M98A 1EGAA 4NV0A 2P4UA 4ZEOA 5ESWA 3V48A 3OPNA 4PSCA 5DT2A 2B5WA 3TBFA 2AG1A 3EXIB 1XMXA 3A10A 6REQB 2DG2A 1KQNA 4OQYA 5IW8A 3HKEB 3CNNA 3HQ4O 3JARB 1YA4A 3MTAA 4UPVA 2VJQA 1MNAA 1SJ9A 4BMZA 1TK2A 3FUUA 1G18A 1FP1D 3C6KA 3FG9A 1RAIA 2O1EA 3W8DA 3WVNA 4BFTA 5EKSA 1CD5A 4NPCA 2HPAA 4UATA 4G23A 5KVQA 2CJYA 1E1QA 3QTLA 2I33A 5CK4A 2Z09A 1Z39A 4OQFA 1C0KA 4BJ6A 3EW7A 3S1SA 1I4OA 4PNZA 3VHLB 1X1TA 4Q9LA 1JEQA 3SM3A 2DLCX 1ZN2A 4OQDA 4QEKA 4CUJA 4HDCA 4KWHA 2I2FA 1N7JA 4N0MA 3ZWWA 4EH1A 1IXRC 3KDPA 3DNPA 3E3LA 3VRHA 4BZPA 1QE5A 3C48A 1CQXA 3QXXA 4UE6A 2FW6A 1EEXB 4GE3A 1T2VA 3KNZA 4JU9A 1RXUA 3EQ2A 3MERA 4M0EA 1TVMA 3GGJA 4YR7A 5K5EA 1MO3A 2Q5QA 3I2JA 4D7AA 2QTRA 3EC1A 3UXMA 2CK3D 2ZUWA 5J2TF 1RKVA 2JC3A 1ZY2A 5EYPA 2KX7A 3G8BA 1VGQA 3TFQA 3M9LA 1RAGA 1K4KA 3SS9X 4WN9B 3V7NA 5EKXA 3UWOA 1U0FA 1N2JA 3V2GA 3QUQA 1QDLB 1SQ5A 2HBQA 4PX9A 3CNQS 3G68A 1TA4A 3HZRA 1YZYA 4M1OA 3TG2A 1F5SA 4HBGA 4UFOA 4URUR 3RC1A 3TPFA 3TQTA 1ODTC 1KMNA 2BFAA 2C5BA 4JHXA 4JP1A 5BRAA 2YNMD 2Q4TA 1EI9A 4OKSA 4W9MC 3G5LA 1QP8A 1WMAA 2VUUA 4JITA 2G82A 2QYSA 3R6WA 5EQTA 1UDWA 2WJJA 3DOOA 4JFAA 5BWBA 3GDFA 3JZIA 4WXYB 4XOIA 2CMFA 2IYNA 2VDRB 2NUAB 2I7XA 1I3NA 2QN3A 4Z0PA 2FI1A 4LS3A 4OBXA 3GPLA 2FE1A 2Y76A 3NALA 2QLLA 2G83A 3QU9A 1NUQA 2XDQA 4K9SA 2BGLA 4AQDA 3B5EA 2AV6A 1FF9A 2G76A 2V6MA 4E15A 2HF9A 4MLDA 1E2GA 2YN0A 4ND1A 1R0YA 3K6KA 4DQLA 3ETLA 3EVCA 4NXMB 3MT8A 4J1QA 1FLVA 1USWA 5H7XA 3GFBA 4F8YA 1L2TA 3ZE6A 4FD2A 3R6TA 1XXLA 2PZFA 4HDKA 1DTWB 1II9A 2D1FA 2PYDA 4RZSA 4U0JA 1J8YF 2QR2A 3OBBA 3WLIA 3BQNB 4GHWA 5TF4A 4EHLA 2QZ9A 1DFGA 1RIIA 2W6ZA 4NR0A 4WE3A 3Q8MA 1SEPA 3KEOA 3EIUA 1WSDA 4P7KA 4V0QA 4D98A 5BR4A 1EGVB 1WL8A 1PTJC 2PUGA 3HDGA 4CV3A 3KB1A 1G6Q1 4P33A 2QA5A 3ZWKA 4RY8A 4UOZA 4WERA 2JFVA 3ZXXA 3RC2A 2VJDA 1KR5A 3OOJA 1Z73A 2GEVA 1EWRA 1YIAA 5DBEX 2HYDA 4Y6SA 1V9LA 4HNVA 3EGWA 3WLOA 2ZBUA 2IIPA 3MWJA 4MQUA 2I91A 4Q19A 3G17A 1IDOA 2P2GA 4S2UA 5J5AA 4RTLA 1VE5A 1Y48E 2R1ZA 2C7OA 1ZLXA 2H54A 1QHYA 1PDOA 2EP7A 3AEQB 1SHLA 3RI3A 3UBTA 2FQWA 2WTNA 3HYCA 1PT9A 2Q2WA 5DI3B 4YAIA 1G3MA 4D8XA 1KK3A 2JK1A 4AN4A 4Z5XA 4BLTA 4HB0A 2G0NA 2XTAA 4P84A 2NZJA 1EDDA 4X24A 1DAOA 3VAAA 3EPJA 1H05A 5ALEA 3VR4D 4A0SA 1IM5A 4IQ4A 2NO9A 4B9EA 1U2DA 2JFZA 3QWHA 2FR8C 3TZLA 3SOZA 4US1R 4PGAA 2DKNA 1WV0A 2CJWB 4R1MA 3MOIA 1YDMA 2AJCA 2ZAMA 1JLHA 2FRDA 3LDFA 3VA7A 5DLYA 2PS3A 3WL5A 1RI1A 5ES4B 4CLHA 2BI8A 4NCKA 2JFYA 3OZUA 1RHMA 521PA 2O1XA 8MHTA 4X61A 1HDGO 5GVSA 3MCZA 4YJ3B 2OTCA 2DF8A 1ZYUA 1IK4A 2CXXA 2YJ3A 3LAWA 3T1VA 1YC5A 1XDGA 3IHLA 2Y4OA 3JWEA 1KP3A 3Q6IA 4GD3Q 5M5BA 2DHDA 3DFIA 4KO4S 2GSWA 3T12A 2FPXA 2AR9A 1NY6A 1R4AA 2JDID 3AR2A 1F1JA 1U7ZA 3EUEA 3PITA 4MB0A 4HDSA 4GL4A 4PNPA 4JR0A 2B4YA 4QUAA 5AHRA 3KDAA 3L46A 1Q1QA 2QPTA 2J7PD 4XQGA 3WIBA 3D64A 2VP2A 1CUVA 1PNRA 3ACCA 3PR3A 4TLEA 4BQQA 5KYTA 4D0RA 3WWEA 3L7LA 1G7CA 2GAJA 2QTWB 3AKYA 3DKKA 2QRHA 1F8UA 3L1UA 2ZIVB 4HQFA 4LRYA 4LYDA 4UHDA 3PL5A 4V1CB 2YCLA 2FOLA 2VPXA 1A9YA 4GPIB 3FGOA 3ZY5A 5K6AA 3D6VA 4MV4A 1K06A 3GJ6A 1NF9A 3E22B 1RWBA 4AJ1A 4CFSA 1E2FA 2IW3A 3DE5X 2WTXA 1KJ9A 4HTFA 3RT7A 1MXHA 1A88A 1UZNA 2AXQA 2AXNA 2QTCA 4XIJA 5BSEA 5ALPA 3V8PA 3LKDA 1CZKA 4QREA 1VHJA 4H7HA 1ACLA 4Q01A 4OJKA 4JC0A 3SHQA 1ETUA 1QU2A 4BN5A 2KQUA 2OBLA 2XUAA 3CNLA 5B3JC 3FETA 3GZNA 4C29A 1ZDMA 5LXTB 3QUAA 5TQJA 3NTUA 4PZLA 2LKDA 1PSZA 2HNKA 1E32A 3OPMA 5KTYA 2JVIA 4I8DA 1B6GA 1CR0A 1P62B 4AP9A 4PZ0A 1QKKA 4ZQFA 1QV6A 4E2XA 4HPJB 5EESA 3FCOA 2XUIA 4Z8XA 3QLVA 4PG7A 3PEEA 1T8PA 4BQPA 3GL9A 4H1WA 2JPDA 3O4IA 1QRDA 1VCIA 5BNFA 1W36C 1XRLA 2H4JA 5HX7A 3EVTA 3M6VA 1A1VA 4Z0NA 3PB3A 4W63A 2ID8A 1RC1A 5MFZA 4EBBA 2SKEA 3QWBA 4DSTA 2CXUA 4OLBA 5K3EA 2BEJA 1WLSA 2HMVA 2QMYA 3MJHA 2DP4E 4OOEA 1O9BA 1SHTX 1W1UA 1Y0BA 4NG5A 3WOVA 4B4VA 5D3QA 4R51A 3IE1A 3ZGYA 4ZZ0A 4OSPA 3MHTA 2P35A 4AJ9A 3Q9UA 2ASVA 3EIFA 3U2QA 3PF8A 2G80A 6PFKA 5A9SB 2WMNB 2WHPB 2X5JO 4KLCA 2C98A 3UWDA 3M6FA 2FMTA 1D1SA 4FDVA 1N3BA 2PCLA 3N7AA 4LKOA 1OLUA 1YRAA 4YP1A 4F11A 4G4SO 3I6ZA 5EIEA 3GARA 1DWOA 4X44A 3ZHYA 4PG6A 2WE8A 1UBFA 3INTA 1LF0A 4ESOA 3RSFA 1JNXX 5E1DA 4GM1A 3SXJA 1C0LA 4OK5A 5A6SB 2HCTA 1N6PA 4LJKA 2Y05A 3GELA 3OOEA 1MB0A 3TTUA 1RBMA 4P7JA 3CJQA 1TM7E 3GBPA 5H02A 2RGAA 3A1FA 1ODFA 3A27A 3KPYA 3ND8A 1SC3A 3SXUA 1G7TA 2YCBA 1UXJA 1T6XA 1YU6A 3KJZA 4P5DA 3UN1A 3K6SB 4AI6A 2JLVA 2I2BA 4PO1A 5HJ7A 3U1TA 1SHUX 4N9WA 2GDZA 4EJSC 1H69A 2X4GA 1FSSA 1Q3KA 3NJ8A 4UHEA 4WACA 1N6HA 1Y4UA 4HFJA 4QNMA 2BFNA 3ICPA 4MUKA 4E33A 1RZUA 2D5BA 2IV3A 1Y42X 4DYVA 2BEUA 3R6GA 4BEWA 3H99A 3BFJA 4QPJC 3B38A 3UUWA 4UEKA 2QMZA 2W2XA 3FSEA 4WQMA 5EPOA 1RLJA 5HS6A 4FI3C 3FFBA 5IARA 1D6MA 1P33A 3HKCA 4OM7A 3JATA 3O03A 4MXDA 4QNRA 4GWLA 2RHOA 1OZFA 1NFRA 1AHIA 3VDRA 3FF4A 3WLKX 3RKUA 4J1SA 3HB1A 1VIMA 3VH1A 4MR8B 4NNPA 4HNUA 4O63O 5JWOA 3SQWA 3HKDB 1XTUA 4Z9AA 1FEZA 2EAUA 4X95A 2O8FA 4Y0VA 4N54A 4URWR 3HJHA 4JVLA 1FLDA 5JCXA 4GRIA 2IYFA 5GJCA 5ENZA 2G63A 1E63A 2C77A 2AJ8A 3AONB 2FPLA 3JQFA 4O1HA 5KQRA 2J0SA 3MB5A 3PE4A 1P4RA 2EKQA 2X5XA 2CVHA 3CTPA 2FSUA 2NQ8A 4QXRA 1PR1A 3AI1A 4RGVA 1JFVA 2ZUDA 2AS0A 4IFEA 3JQBA 4DEYA 1RTKA 3K4HA 1VCNA 3T5BA 5CXUA 2VTVA 2HSGA 3D4BA 4M1SA 5DNWA 4YWHA 3TEJA 5LU8A 2XZOA 2G0TA 2REQB 3GA7A 1XU4A 2YQZA 3UHPA 2IJGX 1TW3A 4PLTA 3E1GA 4DRXA 5BN3B 1ZICA 1D2HA 1NLZA 3OJ0A 2GCOB 3K70D 1L8XA 3VOBA 4P2BA 3UATA 1PVVA 1JDZA 2JK0A 5CYPA 3MN1A 2ACVA 2V65A 4L5BA 2NQ2C 1EBFA 4OHZA 1ZIPA 2LV8A 3WWOA 4CHTA 8LDHA 5I45A 1R64A 1G6OA 4QGSA 3G2MA 1O96B 4BYMA 1GHTA 1Q1GA 3F47A 4C4XA 1DADA 5JV5A 5LUAA 1ADFA 3DONA 2PR2A 1G66A 1NFQA 2VJOA 4FYMA 1E4VA 2C2YA 1LZKA 4C0BA 1VPWA 4KXFB 1YQ9A 4UHKA 1IZ0A 3ZBPA 4LTDA 3ZW8A 2ACWA 3TZHA 2TMYA 3ZNOA 3EF1A 2IV2X 5BOVA 2QM8A 4MQFB 2ZIXA 5I4KA 1HNXB 4C6HA 3FSGA 1QGED 3D3QA 4CG3A 1Q0SA 1NIJA 5D6NA 4ZJPA 3K72B 4DQDA 4NE9A 1WEHA 4HQNA 4UAVA 1A4UA 1SUIA 1VHLA 3BJIC 3FPHA 1PX2A 1V37A 5J1TB 2SKCA 3IUJA 4MVWA 1K2WA 3MZ0A 3ED1A 5KX5B 4CDGA 2X3UA 5JJKA 4Q3OA 3AFNA 5K4HA 5KOYA 3CVYA 4TX1A 2Y27A 3K9CA 5EJ9A 2Z5VA 3DDWA 2IUUA 3DEKA 3JWGA 2H2GA 3L77A 1AKNA 5KVVA 3QVUA 4QOFA 5M3BA 3LU1A 3I62A 3CH4B 4MRMA 3BFPA 1ZOOA 4BNMA 5K6AC 2IA5A 4XI9A 3D7NA 1CUUA 1Y89A 3EXEB 1NG1A 3TVDA 3AKDA 3R8XA 3O91A 1ZKDA 1VM6A 2W2PA 1EZ1A 4G26A 1H2AS 3T34A 2ICAA 2XUZA 1W5BA 3DGEC 4S1OA 5DXFA 5JW6A 2X77A 5K3SA 2XR1A 2NXNA 2J3DA 2RK4A 3D8HA 3K09C 4IXTA 4GM4A 4WMLA 1PJAA 2BUBA 2GFQA 4E13A 3EIQA 4G63A 1WCIB 3W4KA 4TMKA 4DIBA 4WDRA 1DAMA 3CH5A 4GXTA 4D97A 3ROTA 1G5QA 2PZ8A 2VF4X 1XZLA 4Z54A 1DMSA 4RV9A 3KXLA 4O4JA 1USUA 1XCBA 3OPYB 3K92A 1NRWA 2O3SA 2HZBA 4QDTA 3OT1A 1GLNA 5IT5A 4N4AA 2COEA 1IM2A 5J59A 2OQVA 3RSHA 3OP1A 3V9AA 1ZC4A 4B80A 4ZV9A 1CS4C 1UJMA 1VSUA 2GRJA 2A84A 2VUTA 1LBIA 4FILA 4PPFA 1QHXA 1WY7A 1Z8NA 2I71A 1CQIB 5C5DA 1KOFA 1UKAA 2CHFA 3AF3A 2ASEA 3GG2A 4H2DA 3S2ZA 1QIDA 2GDJA 4GMGA 4DAEA 3VR3D 1HNWB 5ALQA 1FC0A 2RGCA 2XVYA 3OQHA 3RUCA 1IZ7A 2G9UA 4KQGA 4YREA 1RP7A 1RHUA 1NW5A 4QG7A 3DG9A 1E61A 1DBIA 5JSKA 4UQOA 4EG0A 1GPDG 2VH5R 4L1KA 1IEWA 2CDCA 3I2IA 3NHUA 3OLZA 3RBVA 4GZ5A 4DMUB 8ATCA 2YHSA 4NECA 2R00C 3ZYZA 1E18A 1KYYA 2GZ2A 2XMPA 3H0CA 1NW7A 3N07A 3HO6A 4GZ3A 4TXJA 3UK0A 2VRNA 1FW8A 1FJXA 4LZZA 2NUPB 5A9TA 1ZCAA 2WWHA 5A4FS 2WU8A 3KHUA 3ENKA 2O5EA 3USCS 1U2EA 4L5AA 1GZDA 1RHRA 2I62A 2PFGA 3AL2A 4URHA 4IIJF 3LM8A 2QX8A 1ECCA 2AFHB 4DZRA 1NXQA 3H5RA 4KL8S 2WWRA 2WB2A 2WU0A 5ENVA 5EXTA 2PL3A 4AUEA 2YJTD 3D7MA 4Z2AA 5CDUA 1FYDA 4L75A 2IYEA 4MDYA 1V8OA 4PPYA 4DCGA 4PS0A 5HKAA 5ADWA 3PFFA 4EPRA 1YIDA 1ETHA 1QHHB 5AKJA 1EE9A 1F8YA 1W581 1ZK1A 1GYQA 1I2AA 3CFYA 3DT6A 2WICA 2HPVA 2O5VA 1L5VA 4CQMB 2NZUG 2IHBA 2JA1A 1G42A 1JLRA 3CCCA 2RGDA 2NT3A 3DM9B 4CIYA 4MQFA 1BWQA 3L8ZA 3RB8A 3N74A 3A3OA 4G5OA 3JRXA 2JIMA 5BY2A 4KPYA 3P9KA 1AUOA 1VSVA 4N01A 3RVSA 2H1SA 3AFGA 4QLAA 2JGIA 3LWNA 4L5IA 3KPUA 2HF8A 4I19A 1T2DA 5E3HA 1C7RA 1KC3A 4S1VA 4IVPA 3QU4A 5KSYA 5L95A 2JJ8A 3QVXA 3OVMA 1VL2A 1KHHA 2FGKA 2I2CA 2QX4A 4JLUA 4OL0A 2OA0A 3TW6A 3CTMA 5HUHA 2G40A 3CZ4A 5CVVA 4BCCA 3MLAA 3WRWA 1QSGA 1V43A 3H4IA 4MGEA 1KZ7B 2DTXA 1FU7A 2VDOB 3KT0A 4KH1A 1JI3A 1PO7A 3E2MA 2WZCA 1EX1A 3QF4B 2JD0A 4MICA 3I9NA 3HYNA 3P27A 5JVDA 3BS4A 2QXYA 2AC7A 1N0VC 4CEHA 2Y93A 4Q34A 3W3AH 4E09A 4AZVA 5JYDA 5HQJA 2BJHA 4L3VA 4I55F 1KKMA 1YE3A 4YACA 5K3CA 3HCEA 5EZYB 4QT4A 2VT2A 3IQFA 1CBUA 1IB6A 3LF2A 4JJ6A 1SCAA 2ZRPA 1GCAA 1Y7IA 4DC1A 1OB5A 5CLLA 1OX4B 4KMOA 1UOQA 1SU4A 2A9PA 2UZAA 2ZSBA 4IYRA 3KTOA 2DY1A 4PPQA 1KYVA 4DADA 4EUNA 3M83A 1RD4A 2W6QA 2VG8A 3OG9A 1QOPB 3ETEA 4CODB 4G36A 3JD4A 4QBTA 4DYHA 821PA 3LQRA 4AMYA 1ZMTA 1FDSA 4EGCB 5JU6A 4YTEA 4GZLA 4BBZA 4DVJA 4QLOA 5BUCA 3A1NA 4BX9A 1BN7A 2WMDA 3RTEA 5CAEA 1EM8A 3QOWA 1JSZA 4WTOA 4BUCA 2R6R1 2IPXA 1H66A 2XH8A 1I4TD 1W46A 1Z4QA 2OK8A 3DTVD 3I72A 5DWQA 5SV2A 1H3FA 4QBHA 2FEMA 3KYBA 3TLAA 4I1RA 4MLPA 2GB4A 5DXJA 4JLAA 5GGYA 1IHOA 1M2VB 4Q7QA 3W7VA 2PGJA 2YYSA 3PQEA 2QJWA 3CF6R 4J49A 1U8ZA 1W29A 3DDOA 1KE2A 3HG7A 2C0QA 2JFXA 1FB5A 2I4TA 1KEVA 2GD1O 3BL5A 1KNXA 4JBWA 4DA0A 2C8KA 2Y92A 1QHGA 3STYA 4BQSA 5FWYA 2NMVA 1PL7A 1L4HA 3IKLA 2GTIA 1D0SA 1KJYA 3HSSA 5DX1A 2NXEA 5EVJA 1NE7A 4L15A 3BWXA 3BWMA 3WL8A 2QTZA 3H11B 2WUWE 16PKA 3QFCA 4D4GA 1CJCA 2OMKA 4RQUA 4TROA 1BKYA 1JT9A 1QIEA 2H4WA 5J4VA 4X62B 4WNIA 1ORRA 1KDZA 5DISB 1YBVA 1W47A 3TVYA 5JNTA 4RTOA 4I4CA 4P35A 2B35A 2ZKIA 4G4JA 4TKUA 3TJZA 1HYHA 3I45A 5BVHA 2F6RA 4WRRA 2UXBB 4LXXA 1S1MA 3R7NA 3P97A 4EJ6A 5G4KB 3QW4B 4W5OA 4KFUA 1R5OA 4ZJUA 2VDJA 3CGGA 1V95A 1BROA 1C3EA 2QI9C 4J0EA 3TSOA 3CMCO 2NWQA 1OWMA 3WYGA 5ITWA 5KTKA 3RFCA 4A23A 1WPRA 1I7LA 1JEEA 4P81A 1GAWA 4IH9A 2F43A 1EVEA 3C8ZA 4BRZA 1TJ5A 3AETA 4QPNA 1IVYA 2ORVA 4FYVA 4DLAA 1L8OA 1C1XB 4GYYA 1AO3A 5I8ZA 3E2PA 3MAGA 2E82A 5JXIA 1KI7A 1Z82A 3F3MA 3ZDEA 2JANA 2RGYA 1FP4B 1NN0A 1NUAA 5J4LA 2HWUA 1W4AA 1CRWG 3E05A 1SQ0A 4CMGA 1QF7A 1WCIA 4LMRA 4WLOA 4BASA 1L8LA 1JEYB 3MSXA 1RZVA 3MTIA 3L79A 4RQTA 1J00A 4XPIB 1KXZA 4C2TA 4UOEA 4URYR 4CKYA 3GVIA 1SUPA 3FIUA 4M0MA 5KQLA 1JKFA 3RLFA 4CCSA 3T3GA 4RXMA 1OPRA 3G6WA 1MNQA 2DTEA 4DLPA 4YV7A 1DSSG 4F4CA 2JLYA 1C9YA 2HSZA 2BE9A 1EFPA 1E99A 2BFEB 2XUOA 4CL2A 2R8BA 1SK9A 2VP9A 2PANA 1Y4AE 2R4TA 2WLSA 3D6TB 4FOPA 4Q16A 2GASA 3WGGA 1MC1A 1JG7A 2BYTA 1JFLA 3UAVA 5JXWA 3IB3A 2XJ9A 2WIGA 4JJZA 3SN6A 2VCHA 3C3WA 3LRPA 3ZGZA 1VYHA 1PFKA 5HM6A 2H4HA 3PXCX 3IVGA 3PNPA 3GEGA 4H7KA 2H7CA 2XZLA 2O6HA 4O4LF 4O02B 4TS3A 3IULA 5DCWA 1UK8A 4ZVLA 3WDSA 4EGQA 1DRWA 1A0OA 2HHCA 4F6LA 1IDN1 5DGCA 4ZCQA 1EFHA 3H3XA 4UAGA 4KVFA 1V2HE 2XUKA 3PYLA 4G8JA 1I2DA 3NAQA 1DX9A 4IRMA 2FUKA 4FMDF 5EZ6B 2C7BA 3KXDA 3SVTA 3UC9A 2J9YB 2BP7B 4HJXA 3IVAA 4X92A 4AYXA 1Z2EA 3TMYA 5CA1B 3Q1KA 2IYVA 3ROQA 4WJLA 2I3GA 1SKYE 3OKPA 3PFBA 4KXNA 4M21A 4MRSA 5BRNA 4CKWA 1F3OA 1QGUA 4UUMA 3FTEA 4QPCA 2X4DA 1XXHB 3B3FA 1CJKC 2FMXA 3HWX1 2I6UA 1FUKA 4CNBA 3AY0A 3PUWA 1Y34E 1IPFA 1JIQA 4IRUB 4L51A 2RHLA 3D0KA 4XX0B 3ZWYA 4FFDA 2XZTA 4IZOA 2BELA 2M1XA 4B7CA 3BREA 3WJ2A 5F23A 2EX1A 3I1FA 4PO3X 2EKPA 1P72A 1RLIA 2ZJAA 3M2PA 5T6BA 4LF8B 4FCWA 4ZRNA 4BRSA 2RAFA 4X63A 1RAEA 1IRXA 1ULBA 1U2DC 3G79A 3LYLA 1AXEA 2R48A 4JODA 5EP2A 4BNIA 1KAHA 1JLSA 1ENYA 2Z2IA 4TWJA 2IHUA 3S70A 4DV4B 2H5EA 3TSWA 4ND8B 2PK3A 1JHPA 3C8DA 4RKWA 2DSNA 3OMXA 2V58A 2XMSA 4UVEA 4ZJZA 1K5HA 2HA5A 1UR5A 2G88A 1PN3A 2PKRA 3G7NA 3UJPA 4CMHA 5I9MA 1Z0SA 3B3AA 2O2EA 1XK7A 3N0WA 1A2KC 3SZUA 2FETA 5DF1A 4MW2A 4ON9A 3ZZ0A 3RVRA 1SCBA 3UAZA 3VHQA 2OGUA 1VL1A 1O94D 4PAQA 4CLOB 2ZQZA 5I8PA 3FFAA 4KACA 4UU8A 5CXSA 1I7QB 1TUIA 3T5TA 1U63A 3SEQA 1LX6A 3HB9A 1NW6A 3Q8KA 1X7DA 2Z4SA 4FLEA 4A91A 3S2FA 5KMGA 1Z38A 2A1TS 2D1SA 2X2OA 1PFWA 1QHNA 2Q49A 3E18A 2WAAA 3FDJA 2OO5C 3OESA 4MA4A 4ONEA 1URPA 2IYTA 3RHTA 4B0OA 4CUZA 4EG6A 3SXPA 3LZCA 4RYDA 1L5KA 1UMBA 4C78A 1E2PA 5FJJA 5FBKA 2JIDA 1SWWA 4EI2A 2J4CA 3UWSA 2CB9A 2YHBA 3JQPA 2YY7A 3ZOKA 1T2AA 3EF0A 1NOKA 4ZVKA 1XTZA 3VNVA 1KK2A 2ZAOA 3GJ4A 2CSUA 1MB9A 2ODBA 3ZDRA 5LOVA 5IF3A 4YMTA 2O9JA 5MHTA 1KMQA 5JSQA 2CHGA 5JS8A 1ZOLA 1RJ9A 5TY0A 4V3CA 5CD9A 4RTNA 1WEKA 1XA4A 2B9VA 3PVCA 4DLXA 1I13A 5G3YA 1TI7A 1P0QA 4YWJA 1GNTA 3P9YA 2OESA 3FNQA 1G5IA 5B57C 1RE0A 5EINA 4QJBA 1TZCA 1V2GA 1EKXA 2QWXA 3OF5A 4IGKA 5CT9A 3QNMA 1GPNA 3JTMA 2F4VB 1Q0PA 4QXOA 1ECPA 2EV9A 1ZOSA 4MKIA 2X0JA 4MUNA 5EMHA 5IHPA 2D0OB 1AS0A 2I29A 1F48A 3SJBA 3ZWNA 4DCNA 4WV3A 1JKXA 4ZGGA 5JPCA 4MUMA 5IYZF 3ZVMA 4IJKA 1GPBA 2OQ2A 3D2AA 4IEEA 2HLNA 2X1LA 4MDEA 1I01A 4FNGA 1HYEA 4PX3A 3REOA 4RDCA 3FVVA 1FBNA 2KI5A 4H9GA 3MEQA 1E77A 4D42A 4ESVA 2HJ9A 5C8VA 2FPMA 5KHAA 3GGSA 3UG7A 4W99A 4RACA 3KLBA 1E1NA 4UUBA 1MU0A 2A7QA 3FMGA 4II2A 4PVDA 1TAHA 4Q6BA 2D74A 3FZNA 3M34A 4KZPA 3SJZA 4IDGA 5IJAA 3I0ZA 3BHNA 3WTBA 2Q1SA 4B48A 5MN6A 4IDHA 3G23A 1G55A 1LI4A 1YR9A 5AH0A 5T4FA 3PCXA 3ADDA 4CMEA 1M5RA 4BLPA 3GLIA 1XZFA 3RRYA 1ESDA 4YK7A 3EMVA 3G8CA 3U80A 3DKVA 4P54A 4YN3A 1IK6A 1N9KA 3RSGA 2FPIA 3T7JA 4LI0A 1P2VA 2F9MA 4LK2A 3ETCA 1ZD3A 3CW8X 4RA9A 4IQ8A 5CXQA 1T6BY 4EYKA 2IY8A 2DOKA 2PRSA 2BJWA 1QIFA 3MBOA 4ZN6A 3TAXA 1TQHA 2JAQA 1AU9A 4PCVA 2Q9BA 3DW1X 1L4GA 4Q3LA 5E7JA 1NATA 3JQRA 4Z0TA 3DHNA 3ZCQA 5LFAA 1QRUA 5F5XA 3EQ8A 4HUQA 1HZZC 2GM3A 4PFKA 3CVUA 4R1SA 1T9GR 1M34A 1YDGA 2JRLA 2ZULA 2P2NA 3DMGA 3I01A 4NBUA 4J4BA 3VDNB 1FQWA 3OOYA 4JVSB 1SXJA 3TRFA 5A5FA 2FUCA 2JGRA 1M6NA 5DBIA 4YJ2A 2JEYA 5FL7A 3PC8C 4KXQA 5EIBC 2YRWA 1WS6A 3SDSA 2DT5A 3G2HA 2O1SA 6ADHA 1YDHA 3R3WA 2K6GA 2C7QA 2AI3A 2GAIA 2BLNA 3COSA 3HFJA 4AJ2A 3NWEA 4A0RA 4H7IA 2QD5A 2YMQA 3I12A 3PYMA 4LZNA 3RC9A 1MZPA 2HJRA 2ORYA 4KDEA 5I3ZA 2H18A 2PUFA 1YZUA 2HTFA 1A9XB 4MYRA 5JJCA 5AK3A 2C84A 2WT9A 3ANYB 1N2CB 1NW4A 3GJZA 1FDOA 3WK4A 3GD7A 4J16C 4CM3A 1RC0A 2DC1A 4JC5A 5F51A 4Q18A 3HEBA 1WQ3A 2OLJA 4W8HA 1UODA 2PBLA 4DN6A 4LC0A 2QM7A 2HJGA 4GLBA 2OHGA 3EFBA 4GVLA 1QAQA 1DKUA 5EZSA 4POOA 2E0IA 1JYSA 4YPOA 1RQLA 3PTLA 2YZ2A 3LUHA 5AW9A 5CDTA 2E4VA 3OFVA 1P8AA 3FRJA 4J2TA 3T94A 3U6KA 3CZCA 4NYMR 3WJ1A 3N8IA 1IUPA 1R4ZA 1TVKA 3O82A 4U7TB 1SR8A 1QOQB 1UM8A 1WSWA 2ONYA 3IBFA 3LUBA 1SIBE 1UQUA 2VKTA 3L02A 3MCVA 3N8NA 2B20A 2IXEA 3G5TA 4HI0E 3T4EA 4IINA 2EKLA 2HRBA 4R5HA 4F04A 4YUYA 2WG1A 2GCPA 4TV9F 1YRYE 4AG3A 4R6WA 2RDMA 3MD9A 4E22A 1DC5A 1Q11A 1DBSA 5MGBA 4G9BA 3OKFA 5EUQB 4XWGA 2ECFA 4DFDA 1DCFA 3PKJA 3GZTB 1VBFA 2MSCB 4H3HB 1J8MF 4KB5A 4ZQHA 5DRYA 4CL8A 4DXDA 2ALJA 1VE6A 3QPBA 4UULA 2YXNA 1CY8A 4M99A 4OSOA 3EQZA 2E6UX 3FNEA 3JAWA 5KHOC 1JXQA 3OPYA 4TN5A 4B6GA 4BQNA 2GM9A 1ZS9A 4WKOA 4R8SA 4OGKA 2ZP1A 4ARSA 3TSYA 1B14A 4MINA 4O2BA 3OCXA 2PD4A 5DCYA 4ASUA 4KRXA 3T0IA 1HK7A 4OBEA 1JHMA 1E3SA 2YHUA 4ZVVA 3TX6A 4A26A 3DP7A 1ODKA 2J3KA 4RZIA 1KAEA 2NT4A 4BGEA 4HVLA 3NHBA 3R7WA 3TN7A 3MAJA 1SOWA 5JI2E 5ERGB 5AJYA 2M2IA 4F3KA 4JJIA 3IEPA 4JB2A 3GA5A 4BOYA 3S99A 1TE2A 3RD5A 4JXJA 3ZJYA 2EHDA 5K3FB 4MV6A 3UB3A 1KARA 5TVGA 1HZJA 4K6MA 2ZYGA 3I05A 2C61A 2I55A 3IE0A 1QMGA 2IYUA 5TRTA 5EQJB 1FE8A 3AYZB 3I76A 5ALWA 5FA6A 5GOZA 3T7SA 4U2KA 2AR7A 3WK7A 3QHAA 1Q6YA 6GPBA 1D2AA 4BXOA 4Z51A 3UK1A 2H16A 4CN8A 1I3CA 2B92A 1P44A 4RD4A 2I99A 3PFGA 4AUNA 1UC8A 4DSUA 1W87A 2VYCA 1B41A 2ZSKA 1E3DA 3DR3A 3KUKA 4XB2A 4MGHA 2CT8A 2A1TR 4R84A 1PT5A 2ZJ0A 2PUWA 3BK7A 4NNOA 2DBQA 4ZOCA 3TBHA 1RRKA 4ITRC 1ZZGA 1G4HA 2YC4C 1GARA 3VZRA 2F55A 4HXGA 1YC2A 4S1WA 3FCXA 7MDHA 3IILA 4LZLA 1NDQA 1EXMA 1KJJA 4L5YA 2PBZA 4GDFA 2WPDA 4KHPB 1K5PA 1ITZA 2HSWA 2A0YA 2XA1A 3EAFA 1THZA 5JQWA 2PWBA 4UXHA 3ZJ5A 4QGBA 1EUQA 1JAYA 5BQ3A 1F6DA 2CFTA 1Y4ZA 1V8PA 1JMKC 4QEDA 3DS8A 4X20A 4X1KA 3JR7A 3K0FA 2J41A 1W19A 3BKXA 4HWRA 4I9GA 4M7OA 4KODA 5KYVA 1LLDA 5CW1A 3RTAA 4BMVA 1CDZA 1HYBA 2HA4A 4LTMA 1ZCJA 1IN7A 1UAYA 4KYUA 3ZN2A 4PHCA 1K8YB 1Z34A 2RC6A 4DR2B 1T36A 2PRKA 3NHKA 2WM2A 4XDGA 5FYDA 2GBCA 5E8JA 4R9UC 1X8LA 4R0VA 4EMBA 3LOPA 1Y9ZA 4TYWA 2I65A 3GCWA 1I6MA 1IBRA 1YQEA 2C4MA 1Y8QB 1PFQA 3IPLA 2K7FA 1K89A 2EZTA 3O1LA 2O2SA 4Q15A 5BWLA 3KG2A 4BKMA 1N5LA 1W0KA 4MVJM 1C4XA 3RIHA 3A1TA 1JZTA 3ZV6A 3TLEA 2BFFA 2G77B 1GRRA 4TMWA 1CDOA 2EP8A 1S89A 2AHRA 2JL1A 3AKCA 4Q0MA 2J0UA 4ZCLA 2JAWA 4YUVA 3LC7O 4ZT5A 3FBWA 5IFLA 4OP2A 2M6LA 2VJCA 2MINB 3NGMA 3I0MA 3PQ5A 2C3PA 3HEMA 5DHPA 3UAOA 1R8JA 4E7OA 1X92A 3SVZA 3W5SA 1NDUA 5LP6F 3ADPA 4U7PB 3L8GA 2OCKA 4PCAA 5CFQA 1Z36A 1CHDA 2GNAA 4GFDA 4G5GA 2ZZNA 2CD7A 3BHIA 4I4LA 5I9BA 1MOZA 3FYTA 3D6NB 3HH8A 1I10A 2LDBA 2R25B 1HKUA 4URFA 2R8EA 4QU5A 5LYYA 2AB0A 5FPPA 1BE1A 3NIDB 1B0ZA 2E4XA 3L5KA 4MHOA 1VRWA 3FPFA 5E6SB 5HE8A 4QT0A 5LR6A 4Z49A