3H1AA

Crystal structure of este5, was soaked by ethyl alcohol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
296
structure length
296
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase/lipase
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
source organism Uncultured bacterium
total genus 104
structure length 296
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1aA00
1K63A 2QJRA 2GBCA 4DTCA 4UBOA 2P8SA 1J06A 3WL5A 5D6OA 5DYTA 2YYSA 3I1IA 3STXA 5AJHA 2PPLA 5JATA 3GELA 5CH3A 1G42A 1MN6A 1VXOA 3G7NA 2D0DA 3WWPA 3STTA 4BCBA 5BOVA 1CR6A 1XQVA 5AICA 3AZQA 3RM3A 4X91A 1H2YA 5AOCA 3IUNA 3PUIA 4L3WA 5AK5A 3I2IA 4XVCA 5SYNA 3QMWA 4HZGA 4LXHA 3LS2A 4I3FA 4OB6A 4P93A 2GYUA 3ESDA 3I2FA 1Q83A 4N8EA 2IX9A 3H0CA 4BB0A 3DD5A 2HFJA 1D07A 2DHEA 2WHRA 1ZD5A 5AKYA 1THGA 2VT6A 1CUXA 1LZKA 4DNPA 2VTVA 3WA6A 3SWWA 2CKMA 3WZMA 4F60A 2GBGA 1QTIA 2H7YA 5CURA 3AFIA 1WB5A 4WFKA 1LPMA 1HDEA 1AUOA 2Z5GA 5C8VA 5DTIA 2GYVA 1CUCA 1ODCA 2VJCA 4QA9A 2QTBA 2XMRA 2WG1A 4BP9A 5C7YA 3S2ZA 4B81A 3IUJA 3N2ZB 3VVMA 3FCYA 4C89A 5EHXA 3F96A 4N5HX 5ALPA 1P0PA 4HTAA 1XZFA 4LYEA 4FNMA 5DYYA 2ONCA 2XQFA 2XUOA 5LZ2A 3K2IA 2BGNA 3LIPA 1CUUA 1QJ4A 3HYSA 2DSNA 4B0OA 1W52X 3C5WP 3X3HA 1BRTA 1VLQA 3OOSA 3DS8A 5E4JA 4H77A 2OCIA 4BAZA 3F67A 2UZ0A 2X8BA 4KJXA 4TPKA 1MPXA 1ZICA 4EUSA 1L7RA 2VA9A 3EBLA 3ILSA 5FUMA 2ZJ6A 3PDCA 1ZIXA 1ZD4A 3G0BA 4MYSA 4UUQA 3FLAA 5AM4A 2VEOA 4U2BA 1EDBA 2D5LA 5H3HA 5A7FA 2WFMA 3A2MA 2OGTA 1USWA 2FJPA 3G0CA 2XUAA 3PF8A 1AC5A 1EVEA 4WDRA 1BE0A 5ALHA 4WFJA 1XQYA 4KE7A 5A71A 1YA8A 4GWLA 1A8QA 3IIIA 4GBGA 4J0HA 4EY7A 2XUHA 4YX9A 3D5EA 4FFVA 1QGED 3HI4A 3FCXA 3ZLTA 1XLWA 2XUKA 5ALZA 3G9XA 2BGRA 4U2FA 4U2DA 2OCKA 7YASA 4H7FA 3DDUA 4DGQA 1WB6A 2WHPA 3DNMA 4KEAA 2FUKA 4MXDA 5KWJA 3PFCA 4K5QA 1CUFA 3QH4A 3WK7A 4BRZA 1XZLA 3S8YA 3WK9A 2ACKA 3H2IA 4K6HA 3P2MA 1XFDA 1MAAA 1LPBB 5T4FA 1MAHA 5F4ZA 1CPYA 4Q05A 5CT8A 4RE6A 1ZI8A 3GA7A 3BF7A 4NS4A 1WOMA 2XQGA 1A7UA 5JD5A 3H18A 1QIHA 4BBZA 1NU8A 4JYPA 3R3ZA 2XMZA 4WY8A 2CZQA 5CW2A 3G0IA 3ICWA 4K6KA 4HAIA 3BDIA 1VOTA 1TK3A 3O0DA 2JGMA 3STVA 5ALRA 3AZOA 4J0IA 2O7VA 3WWDA 2WIFA 1XRPA 1VE7A 2VJDA 1QLWA 3WMRA 3B3QA 4BTLA 1GT6A 2OCGA 3LCRA 5C81A 1XRQA 1Z68A 1M33A 2CBGA 4FBMA 3D4LA 3BJMA 4DIUA 1J1IA 3IB3A 5AI6A 1YB6A 4GDMA 4J0CA 3I6YA 1U8EA 3GUUA 2AJCA 3LP5A 1CIJA 1AZWA 1PFQA 2VQ6A 4KR0A 1XZBA 4UFOA 1IUOA 5ALGA 4B84A 5EFZA 2XQIA 1LGYA 1UFOA 2V97A 2Q0XA 3TEJA 3IULA 2WIDA 3O95A 5ALNA 2DR0A 2QJWA 1TCBA 4Y2UA 4UHBA 4MEAA 3BIWA 5AI4A 5EI5A 5CBKA 4B80A 1WHTA 5ALTA 4G4IA 3R3YA 1F0PA 1XQXA 3AIMA 4FWBA 4J3JA 1WCYA 3NGMA 5BV7A 1QIJA 1Q0RA 1HL7A 1FFBA 2HU5A 2VT7A 4BE4A 5ALOA 3H2KA 5DJ5A 1QIIA 2IIVA 1ORVA 4UHEA 2XE4A 2JF0A 2ZYHA 1GPNA 1QFMA 1JKMA 4DM7A 1C7JA 4X92A 4LHEA 4E11A 1CUWA 5FDFA 1JMYA 2X76A 1GPKA 1W76A 4LXIA 4MWSA 4BVKA 5DYWA 2OAEA 1XZMA 4Y2VA 5D3KA 1CQWA 1SFRA 2WQZA 3QITA 2WIKA 2WIGA 3DQZA 1YS1X 1ZI9A 5SYMA 5HK9A 3ZWQA 3ZLVA 2BUBA 3WWOA 1LZLA 3OG9A 3I2KA 3WYDA 1R50A 1VA4A 3O9VA 1XZEA 2Y6VA 2OQIA 3C6BA 1RYYA 2AJDA 3IVMA 4M0EA 3U0VA 3G0DA 4AB1A 4QWWA 4RPCA 4DSZA 3FNBA 1ACLA 3H2GA 1EB9A 3M81A 3G9UA 4BRSA 1MX1A 2C0PA 5CT9A 3G9ZA 1JU4A 1DQYA 1XZGA 1XZKA 2RHTA 1F8UA 2GBIA 1G4HA 3D0KA 2VJAA 5FLKA 4BCCA 1R88A 2JEZA 4FLEA 2DFPA 4OB8A 3BWXA 4G5XA 5LP1A 2EEPA 5ALSA 2H7XA 1EX9A 3DJYA 1EI9A 1CFJA 1FFAA 4J0GA 4UHHA 2BUAA 2B9VA 4UBJA 3VVLA 2XQKA 4X71A 3DLTA 3ESAA 3TRDA 2XLCA 2DQZA 4QWMA 5AI8A 5FXMA 5JANA 3C6ZA 3PE6A 1UK7A 4F5ZA 2BAGA 4BC0A 3F98A 4E14A 3E1GA 5AI5A 4FTWA 4X6UA 2GYWA 3C43A 3AUKA 4AMYA 5HQ3A 5AKIA 5LZ9A 4FBLA 5ALLA 3D2BA 3IUQA 1L7AA 2JGKA 3HZOA 5K3FA 5AKLA 2RHWA 4BZZA 3DEAA 3KSRA 4X85A 2DQYA 3HEAA 1KU6A 5KREA 1DWOA 4QEKA 4UHCA 4UPDA 2FJ0A 1H2XA 5ALWA 5ALYA 5AO9A 1CRLA 1IZ8A 5ALQA 3ESBA 3WIBA 4DMKA 4CCYA 3DKKA 4BYMA 1DX4A 1C7IA 5AK3A 2C4HA 3R41A 3ESCA 1QFSA 4WCVA 1A8SA 2W22A 1QIFA 4DLNA 5JIBA 3K6KA 1GXSA 1A8UA 2QXUA 2WG2A 2Y2UA 4QDTA 1L7QA 4AMZA 2J3DA 2XUPA 3BL8A 1YAJA 1EVQA 4CI9A 4WFIA 5LKAA 1TKRA 2HU8A 3UUEA 3V9AA 2WIJA 4PO3X 4PNZA 1CUIA 5ESRA 2I03A 3QMVA 5CMLA 2ORYA 4FHZA 2HDWA 4Q3LA 1H23A 2BJHA 2PSHA 3WK8A 4U2CA 2Z3WA 4AN0A 3O4IA 3MUOA 4IHAA 4QZVA 1FFEA 2XMBA 4HRXA 3HLKA 1GPLA 1MX5A 5I7UA 3QBJA 4EZIA 1P0IA 4XWGA 5ALMA 5HFNA 3AIKA 3VJLA 3W9UA 1ORWA 2QMQA 3D2AA 5T4HA 1WPXA 1T2NA 4WJLA 3FYUC 4WY5A 1I6WA 1LPSA 3H04A 2OPHA 4Y2TA 1YASA 1YCDA 3BF8A 3V1LA 3UMJA 3OPMA 5AKGA 5HKBA 5A62A 4FMPA 5LZ8A 5AK4A 1ZD3A 5AP9A 3R3XA 4TGLA 1GGVA 2G63A 2EDAA 2GZSA 2Z8ZA 4PQEA 4X97A 1HBJA 3WKEA 1CEXA 4HVTA 4BDSA 3HJUA 2JGFA 3KOOA 4GEGA 1B6GA 2WFLA 3ZI7A 3UUFA 3V1MA 3I6MA 4IO0A 4ZGBA 5AM0A 4ZWNA 2XUIA 1R1DA 1TCCA 2JBWA 4BCDA 5AI0A 4H0CA 1P0MA 1IUNA 4J03A 2EDCA 4UBMA 1BEZA 4KAJA 1HLGA 3IUMA 2C5FA 5T4BA 4HRYA 1W75A 2I3DA 3H1AA 1XRMA 1PV1A 3VDXA 1IMJA 4DMFA 1X2EA 2WHPB 4KRYA 5K3EA 4X93A 3WK5A 2Y6UA 1TRHA 2BUCA 1LBSA 1E89A 1DX6A 5J3JA 5AI9A 2QM0A 2XB6A 4BTVA 3PUHA 2DHDA 2HRRA 1TCAA 1UKBA 5HFAA 1IVYA 3LIIA 1XZAA 2K2QB 1CLEA 4CG2A 1CUGA 2O7RA 4B9EA 2G4LA 4H7IA 3E0XA 4UHDA 4ZV9A 5JZSA 1XRLA 3NWOA 4OUKX 3QPDA 4F21A 1DINA 5AM1A 3HXKA 3D7RA 1LNSA 1BN6A 4WDQA 1EK2A 4Y2XA 4X00A 3IURA 2C7BA 1CUEA 1Q84A 5EIHA 3ANTA 1UOOA 5EIEA 5JD4A 4AXBA 1BEEA 4QNNA 4MYDA 1MNQA 3EQ9A 1R3DA 4I4CA 1XZCA 4UBLA 2J4CA 4OD0A 1ZJ4A 4JH0A 5ALIA 1CUYA 4QDUA 1EB8A 5A7GA 1CUDA 2WILA 1OCEA 3FLEA 3V1KA 4ROTA 2HL6A 2WU3A 4HXEB 2QUBA 1P0QA 4BZWA 3NUZA 4G1FA 2QZPA 5HF8A 1B41A 3CCBA 5JZ9A 1CQZA 1AGYA 2HIHA 1WM1A 3A6ZA 3ICVA 5HF5A 1W6RA 1JI3A 3WJ2A 5LZ5A 1R9NA 3VJMA 2R11A 2WSLA 4YPVA 1X2BA 4QLAA 2PSEA 2JGIA 2OLEA 3KXPA 1E3QA 5A2GA 3AZPA 2IITA 1HPLA 3R3UA 2PU7A 1EDEA 5K5EA 4C4XA 3WWCA 5AIBA 2VAVA 2YASA 3F9CA 1Y37A 2WLSA 3BIXA 5AOBA 3DKRA 5HZGA 5K3BA 3O9MA 2I3ZA 1LPNA 1XZDA 3WKAA 1AKNA 4K2AA 4KE8A 4H7KA 2ZYIA 3CXUA 5LZ7A 3MGAA 1ZGBA 1XRNA 5FPQA 1IZ7A 3B12A 4GECA 1K6EA 1QO7A 1T4MA 4Y2JA 4KAFA 1QO9A 4JYMA 5CH8A 5D3ZA 2PSJA 3SK0A 2AJBA 2ZJ7A 2BCEA 5HF6A 3WLAA 2CEKA 1DU4A 3PI6A 3JYHA 3DL4A 2XT0A 3DOIA 4CIBA 1EH5A 5IVIA 5FKJA 3HACA 1E8DA 1THTA 1DQZA 5AM5A 5CTAA 2H1IA 4XX1A 4AQDA 1AX9A 3YASA 2JIDA 1ZIYA 3HSSA 3W04A 3FVTA 2XUFA 4CG1A 5IH7A 5K3CA 3QM1A 1SCQA 3V1NA 2HA2A 1N1MA 3PF9A 1ETHA 4PV7A 5IVDA 1DWPA 1UXOA 4Y2YA 3TJMA 4YK7A 1NU6A 3C5VA 4E15A 5CXUA 4W63A 5DNUA 5EIAA 4DNQA 4FDMA 4RE5A 4X6YA 4BP8A 3AIOA 4LXGA 1UZAA 2XMDA 4BC1A 1KU0A 4IH9A 2Y1KA 2NW6A 3FOBA 3VJKA 4ETWA 3CN9A 4XJVA 1ODSA 2AJ8A 4G9GA 3GZJA 1YAHA 4B82A 2YXPX 5ALFA 3VISA 2ZVDA 5HQ3B 2C0QA 3K9BA 5HKAA 4E46A 1KEZA 2WJ6A 5LZ4A 4B83A 3WL7A 5K3FB 4AO6A 5KWIA 5LIPA 2PX6A 5AOAA 3M3DA 1UK9A 2HRQA 2ZSIA 1RP1A 2CB9A 4G4JA 1NX9A 2HU7A 2XMQA 2XUGA 2HFKA 4N8SA 3ZV7A 2OXEA 3QZUA 4GW3A 1AQLA 2PM8A 2QRUA 1QIDA 5ALKA 4CCYB 2WTMA 2I78A 1QE3A 4CFSA 3L1JA 2O2IA 1QOZA 5CT4A 2VAXA 4W1SA 3WWEA 3M82A 1K8QA 1QIEA 1U2EA 2JGEA 5AKXA 2ZJFA 4F0JA 1ZI6A 1C4XA 1XROA 3BJRA 5EHZA 3STYA 4Z49A 3G02A 1G66A 4DNFA 4RNCA 1MNAA 4C87A 3A70A 2HHAA 3STWA 5A7HA 3ZPXA 1Q0ZA 2HA6A 2QR5A 4N8DA 4OYYA 1GQSA 5ALXA 3STUA 2QVBA 1EINA 3SX4A 5DNVA 3WL6A 2ECFA 4PSDA 1U4NA 2WFZA 4A23A 5JALA 4W1PA 1EXWA 4B0PA 3WKDA 1VE6A 4EBBA 2RAUA 1EHYA 3ZLUA 4X6XA 4ZI5A 4N5IX 3O4HA 1CUAA 1BS9A 1CVLA 5E4YA 1H2WA 4MQLA 1UT6A 4DNOA 3FWHA 4B9AA 1CUBA 4H35A 3RARA 1LPOA 1R4ZA 1LBTA 1UK8A 1UWCA 5JASA 1HQDA 5HF9A 1JJBA 6YASA 2HA5A 4EHBA 1TAHA 1XZHA 3QVMA 1QONA 5ALJA 2WFLB 1GQRA 1SC9A 3I28A 5AKZA 1WB4A 2H7CA 3WK4A 4BAGA 1R9MA 5DTJA 3FSGA 4BVLA 5AKKA 5EHQA 4UBIA 2V9ZA 1H2ZA 5A6VA 1MU0A 2RI6A 4J0JA 3DYIA 2B4KA 1W1IA 1XKTA 2VSQA 1ZD2P 1JJIA 2CMFA 1N5MA 5CH5A 3FVRA 1WPRA 3F97A 4W1RA 1EDDA 2PL5A 2OAGA 1YB7A 4ARAA 4B85A 1BCSA 3MVEA 5JAHA 3IDAA 4Q3OA 4UFPA 4J7AA 3FYUA 4HXGA 2AJLI 1BCRA 2PSFA 4OYLA 5FRDA 1BU8A 1HKHA 2WUFA 1BN7A 5DNWA 3KWJA 2O2HA 1VKHA 3R3VA 5IVKA 3C6XA 4UBNA 1MX9A 4OCZA 3EQ8A 3ANSA 4NVRA 2Y2VA 2ACEA 1TQHA 2ZSHA 3WZLA 4PSUA 5YASA 5AIAA 1XLVA 1J07A 4CIAA 3I2HA 3DYVA 1FFCA 4MEBA 1UOPA 3C70A 3SC2A 4BVJA 3E3AA 3D59A 3GROA 3E4DA 5LYYA 3H2HA 4QDZA 1X70A 1QIKA 3D2CA 5K3AA 3DL7A 2X5XA 4JEIA 1QIMA 1TIBA 1OILA 4G8CA 2PVSA 3CCCA 1FJ2A 4FKBA 4BAUA 1JU3A 3R3WA 1SCIA 4Q34A 3HABA 2QOEA 4FOLA 2PSDA 3FLBA 4OU5A 5JAOA 1PJAA 3G8YA 3Q8WA 4U2EA 1A88A 4L0CA 5IKXA 5BWCA 2HA7A 2QT9A 3I1YA 1GKKA 3AILA 5T4EA 2PKYX 4I19A 1FSSA 5HK8A 5JAUA 3MUNA 3QMMA 4ITVA 4EY8A 4AO7A 1UK6A 4TVKA 2FX5A 5EGNA 1ODTC 1K5PA 3G0GA 5CXXA 3NOXA 3W06A 1XZIA 2ES4A 2XDWA 3C8HA 4Y2RA 4HXFB 4OPMA 4M0FA 3KWFA 3B5EA 3FAKA 4JUIA 1O6GA 1WHSA 4P08A 5FPPA 3GFFA 3QYJA 4G9EA 2JGJA 2PU5A 1CV2A 3OURA 4DSAA 3R40A 1QTRA 2CUTA 2WG0A 2OGZA 4H18A 4CG3A 5BWBA 3WYNA 3C45A 4C01A 2PUJA 3A2NA 3N0TA 3QPAA 2HADA 1SOMA 4CCWA 3OM8A 2ZYSA 3WK6A 4KYVA 1VZ2A 1E8MA 3I2JA 4Y9SA 3I2GA 1XRRA 5ALUA 4ZXFA 2XUDA 3EIOA 1ZOIA 5ALDA 2OG1A 2Z8XA 1H22A 4G4GA 3AJAA 1XKLA 4P9NA 4KAAA 4J0KA 2WU4A 4GLBA 4QDXA 5AK6A 5ALEA 2XUJA 4ZV7A 3FBWA 4LIPD 1MO2A 2WM2A 4V2IA 5AKHA 2B20A 3G9TA 4INZA 3H1BA 4DMHA 5JAPA 1BROA 1YR2A 3VKFA 2XQJA 1IUPA 1Y7HA 1SCKA 3EF3A 2G5TA 2WJ3A 4S0XA 3GBSA 1JFRA 1MJ5A 4A5SA 4PF1A 1FFDA 2B61A 4J0DA 5CT6A 1UKCA 1JJFA 2BKLA 3R0VA 4LKOA 1UOQA 3BXPA 4X90A 3FYTA 5CT5A 4B6GA 2VJBA 4EY6A 4BATA 2JGLA 1JMKC 2PBLA 4MQMA 5AKJA 2DHCA 3TGLA 3RK4A 3V48A 3ED1A 4H7JA 4GHWA 4K6GA 1VA5A 4NZZA 5AKEA 4BE9A 5LKRA 1S8OA 1F0NA 1XLUA 4EY5A 2R8BA 1LPAB 3EQ7A 4FFWA 1U65A 4Q3KA 3VXKA 3T4UA 5D7BA 3I6ZA 4G8DA 3H19A 3C87A 4FNGA 3O4GA 5DWDA 4EB0A 3F8SA 1LLFA 5KBYA 4AZ3A 1YSCA 4JNCA 4IH1A 2O2GA 4C88A 1DT3A 2HA3A 4OSEA 2DCMA 2PUHA 5JD6A 1CUSA 2ZYRA 4KE9A 5I9IA 1RWQA 1J2EA 2J3QA 2YH2A 4Q1VA 4W1QA 3O4JA 4AX4A 1QIGA 1F6WA 5DLPA 5E4TA 3IA2A 2VATA 2C58A 2JEYA 3WJ1A 5HCUA 4Y2SA 1MTZA 1CUZA 4RGYA 1GKLA 4EA6A 4MJ3A 4W9RA 1N5RA 1EK1A 4PW0A 2GBFA 4AN1A 4X7BA 4M0MA 4X3CA 2HA4A 3HRHA 1CUHA 2H9YA 4H7HA 4OB7A 2WUGA 4YASA 4HS9A 1VJ5A 5FOQA 2G5PA 5FV4A 2WUEA 5JYCA 3RKSA 4QDOA 3CN7A 5EHNA 5K3DA 4IQ4A 2HM7A 2XMGA 3M83A 1GZ7A 3WKBA 1DTEA 5C8XA 4ZRDA 5AH0A 3H17A 4EY4A 2QKYA 2XI4A 2AXEA 4QE3A 5IVHA 4L72A 4UBKA 4GXNA 5ALVA 1ISPA 4UFNA 4Y2PA 4BDTA 3WL8A 1XZJA 3OTQA 2WTNA 1CUJA 4ZREA 4PSCA 5LLSA 1OXMA 3WA7A 1UKAA 3JWEA 4DYHA 4P92A 1XQWA 4MWTA 2GZRA 3JW8A 4G8BA 4X94A 2RIPA 3WKCA 3PFBA 1ZJ5A 2V96A 3WI7A 2OGSA 1QZ3A 4OU4A 3AINA 2E3JA 5AM2A 3WQHA 4A16A 1AURA 2WJ4A 2W6CX 3C8DA 4KRXA 2C5GA 2WUDA 3C6YA 4FLFA 4B7ZA 3PICA 1E66A 3DOHA 5E2IA 2CJPA 3Q0TA 2J4FA 1G5FA 1N8SA 2OQVA 1MT3A 2WKWA 2QS9A 4XIIA 3L1HA 1EA5A 5AM3A 1E8NA 3BDVA 3H2JA 4U2GA 5I8PA 5JZBA 1ACJA 3FSGD 4LYDA 4C6HA 4AZ0A 2XUQA 4D9JA 2XLBA 2VF2A 4NMWA 5JADA 4DMCA 2V98A 2RONA 4C4ZA 3LLCA 3IBTA 1Y7IA 4FLMA 4L9AA 2BFNA 3FYUB 3L1IA 3RLIA 5AHXA 2QXTA 1DT5A 3KD2A 2QUAA 2XMSA 3HC7A 2HA0A 4Q82A 4Y7DA 4Y2QA 3BE8A 4X95A 3T52A 4O08A 1CUVA 4ARBA 1K4YA 3W9BA 2RGUA 4GI1A 2ROQA 4H7EA 1VZ3A 1YA4A 3OC0A 4C4YA 1VXRA 1YS2X 4UHFA 1AMNA 3QPCA 1DWQA 5C8ZA 3DCNA 1W4LA 2XMCA 3KDAA 3A2LA 5ISMA 3D3NA 4KACA 1E5TA 4H7DA 4AO8A 5CRIA 3U1TA 4QLOA 1ZGCA 5FP0A 1O6FA 2Z3ZA 1JT2A 5JARA 4IH4A 3W05A 2WHQA 3WIOA 2LIPA 3W2TA 1LPPA 2OCLA 4KE6A
chains in the Genus database with same CATH superfamily
1JQ5A 4NF2A 1M7HA 1PG2A 1R64A 3NHAA 3UXYA 4E31A 2WTEA 3SN6A 4XPZA 1JQEA 1A8IA 1BFUA 3SM3A 1BS2A 2YMPA 4DLSA 3QX9A 3I8SA 4S1PA 4DC0A 2FLVA 1SVSA 2J0UB 4LNAA 1U0BB 1YTUA 2HJHA 2JFHA 1CD5A 3Q5DA 4KMSA 4OY3A 4TL7A 4YMWA 3STXA 4TVSA 4BKRA 2PPLA 4P7JA 3A6GA 2GN8A 1SCDA 3E3NA 5KKAA 5DM70 1ENOA 2CT8A 3BK2A 3AOGA 5EWMA 1GGNA 1S01A 1OH5A 1W2HA 5THXA 3LSYA 1ADFA 1M1NA 1CU1A 1NYTA 4ZOBA 1VXOA 2VTDA 1NPTO 4C03A 1LDGA 1D7OA 4G8JA 1RM3A 4JJ4A 2BR4A 4BCBA 4CV1A 1PUXA 1YFKA 2UVDA 1VP9A 3L7AA 4H60A 4WZAE 2V6GA 1CS0A 4X91A 2QSYA 4ALLA 5JXWA 3VX3A 2OAQ1 3JASB 3IUNA 1K75A 4OK3A 4PHCA 3RE1A 3PUZA 5G1OA 4XDYA 5FQNA 1F2TA 2C03A 3BAZA 4MRVA 5FBWB 3HNOA 4XVCA 4QQKA 3CX7A 4F6RB 1PQPA 2FP4B 3N2KB 4EYGA 4YXFA 1VGVA 1VBNA 1N3YA 3QMWA 4X61A 4HZGA 3G2IA 1T9KA 2N75A 1NQUA 2O7NA 2I2BA 1N34B 4LGMA 1PEYA 5J4VA 5HRCA 3L0DA 3U5ZB 4O8CA 5JH7A 3ESDA 3L79A 3VRHA 1ABFA 2RHMA 4M6WA 2XW6A 3V2HA 2FGJA 1XNHA 1QHEA 4DABA 1QNFA 3BORA 4QX6A 1ZOOA 5H16A 1JFFA 1I6KA 3RS2A 2C07A 3RVSA 3HKBB 3SY8A 1B2RA 4TMTA 4ZIRA 4CEJA 1JBEA 1GADO 2A14A 2EL7A 1FTSA 2OBXA 2PXCA 4PHTA 1ZD5A 3QWAA 4WJZA 3INGA 1THGA 3E05A 4YACA 3M3PA 4NFSA 4D74A 2NUAB 5ICGA 1BC5A 5DGIA 2FQXA 3FZYA 2VT6A 1ZUIA 3NXKA 4P0TA 4WFQA 4DLWA 2B8WA 2GYYA 2WLTA 2YWRA 3IQZA 3IPYA 4RZ3A 4AY4A 4KQ9A 1ZN9A 1PYOA 2ATCA 3WGKA 3SWWA 4GPTA 1N25A 3V8MA 1D6MA 4F60A 4NU0A 3JQAA 4XVQA 2IGTA 1QTIA 1Z0SA 4HHEA 1WB5A 2WY2D 2D1FA 1GKYA 2XF8A 3GP5A 4ED9A 3JQ7B 4IHJF 3ULKA 4BQNA 1AQNA 1VMAA 3KPVA 3ORRA 2PS0A 3WNQA 1AK1A 5DTIA 4KB5A 3TAUA 4YRIA 4G41A 2QZZA 1K8YB 4K6MA 4WZBB 4OJTA 4FZJA 4KFCA 4WKGA 1BW9B 1KZ7B 4HLUA 3RYCB 4DIKA 3X1XA 1BVYF 1R0CA 3EZLA 2OV4A 3GA5A 1KY3A 3JWGA 2HPHA 1MABA 1M66A 2AQIA 2AT1A 2E4YA 5ED0A 2OR3A 3LQRA 4IGIA 2MSLA 2OHFA 1IM2A 2VHQA 5CVVA 2ZYDA 2Q29A 4JC8A 3EGWA 3IUJA 2ZZNA 3OQVA 1E7YA 4NCHA 1YHNA 5KU7A 2W6JA 1H94A 3IKMB 4YYZA 3NHFA 4BPRA 1NVDA 4TV8B 1JHAA 1XJWA 1OZFA 3H11A 1RW4A 1SELA 1DO0A 1SVOA 3MLAA 4ZA2A 1VL8A 1EVKA 3DFZA 3NHSA 4QATA 3NDBB 1UC4B 3PK0A 2O5EA 1JIVA 1GPJA 1D9XA 3FNEA 5EQFA 5K8JB 2FEXA 1OLOA 2FPWA 4EQ6B 2QSUA 3SC4A 1SPXA 4RK6A 3RWMB 2BH2A 3EFHA 4F9TA 1RADA 3HYRA 1YI1A 4KRGA 2OVFA 1V4VA 4ZO4A 4DKXA 4I8DA 2PUVA 1M10A 2IYYA 4U3JB 1Y33E 4WIAA 4FUTA 4OFBA 5IC4A 5BR8B 4MUHA 4OK6A 3EVEA 1EWTA 1D1PA 3A9VA 4H77A 2VQSA 2OCIA 3OPVA 5DHPA 2R2GA 3IO5A 3OZBA 5IYZA 4RK1A 1Y4UA 3CH5A 1ZICA 3IL2A 2AMVA 2DFVA 2IP4A 2VDWA 3IJEB 4RFSA 2P5TB 4A15A 1KJNA 4IYRA 4BJHB 3VZRA 2HW8A 5FUMA 3ZVNA 3ZDCA 2MCFA 4C2TA 2O3UA 2EHJA 1F7VA 2VSYA 2MOKA 3GHHA 4EKYA 3A36A 2LD4A 4DLXA 4YV0A 3G0BA 1U0RA 2JS7A 4MYSA 3FLAA 1A4UA 5FCDA 2GXSA 2IPXA 3NKFA 5AM4A 2OXIA 3ZV3A 1LBIA 5KJ6A 1CZRA 4LV8B 3BXOA 4TKVA 5KCMA 4CJXA 1O08A 3EC1A 4A8PA 2YHIB 1W581 2C92A 1VL2A 2WC1A 3OE5A 4OFWA 4YP5A 4TRRA 1J0CA 1T5BA 2WFMA 3A2MA 3IOEA 1WJGA 3LUHA 1WE2A 3DHNA 1USWA 5DWVA 2O8EB 2FJPA 5E6SA 3LYHA 3KYDA 4OP2A 4QU9A 4TSRA 1AVTA 1FYEA 1Q1QA 5AVUA 5FOUA 2AMLA 3I45A 1COZA 1H8EA 1EVEA 1KYYA 4WDRA 5FADA 3IAHA 2VJQA 1LRKA 4Z9XA 5JXJA 3JQGB 1J99A 1Z4QA 4D1YA 5A71A 2GEJA 1XDUA 1PTJC 3MWLA 1D9ZA 2G0AA 4RKYA 4DRYA 1WD5A 2CW5A 2D13A 2ZBDA 2XUHA 2A57A 4TOIA 5IJ9B 1R0KA 2BMJA 2R6R1 3A6DA 2APJA 4DQKA 4EOGA 4YX9A 2ZAYA 1O89A 5H8WA 3D5EA 1Y34E 1FZTA 1Q2XA 2QLTA 2QAIA 3DBIA 3MCTA 5K4GA 1DAEA 3MWYW 1SUSA 1M6NA 3UXEA 4BX8A 1G8GA 2XZOA 4NE9A 4CZ2A 4V0ME 4ZYLA 4BGUA 2AYYA 2VUHB 2XDYA 5CB4B 2BGRA 3V8VA 4U2DA 3ZHRA 2OPBA 3HCCA 2OCKA 3IKLA 7YASA 2PRJA 2OHGA 4H7FA 1BHO1 1JKJB 1Z5ZA 5D3QA 3UJHA 5CEFA 1K0UA 1C7FA 2JZNA 2Z2YA 4UW9A 2HLNA 4Z0HO 4LCJA 5BW6B 5JISA 4PG8A 4BX3A 5JMOA 1ADGA 3DDUA 3ELBA 1SXJA 2Z6VA 1V8BA 4HX5A 1PEKE 4LW8A 3NC4A 5NLLA 3ZYZA 4I3GA 6PFKA 1US8B 2CD9A 2WHPA 1U2PA 3I76A 3K32A 1X19A 4UUAA 2L0XA 2IY8A 3TE7A 3VGPA 2WSBA 3FDZB 2BY4A 4IS3A 2BEVA 4LRUA 4NV3A 3X43A 2IF2A 3ESXA 5KWJA 4ZU1X 1W5FA 3FVWA 3UPDA 4OL9A 4F86A 3RVDA 2EEZA 3S8YA 3ESZA 3NAMA 3WK9A 2J31A 3BXXA 3QPUA 1ESNA 5FBKA 1C8KA 3JX9A 3H2IA 1QX3A 1WS6A 1XFDA 1MAAA 2K6GA 1N1DA 2QMHA 5CLQA 3VKWA 5HKKA 4TYNA 1A7KA 4HGQA 3PEVA 3DWGA 1X0XA 4FCWA 4A36A 4NENB 1WMFA 1ZCFA 4Y1GA 3IR6A 2FQ1A 5JJCA 1XLTA 2OZVA 1JHZA 2O4UX 4HPWA 2XRYA 3K2BA 2NXWA 2W8BB 1WOMA 1PTKA 4LQCA 2PX8A 3VHXA 1NU8A 4EJSC 2PGNA 5B5SA 1VDMA 1ZM4A 4CFYA 3ISVA 2XMZA 1BS1A 4WY8A 1NDHA 1COWD 2WP8J 1U7PA 4M1EA 4M8NE 2QN2A 3G0IA 1CC1S 3ICWA 3HCWA 4RA9A 1L9KA 4G5RA 1FVXA 1KIFA 1UQRA 1VOTA 3E5HA 4FX2A 2PZFA 4MTCA 3SE7A 3EQ2A 2N1BA 3M7IA 1TK3A 5ERGB 2BFOA 4ZDKA 3GD7A 4QUKA 3BT7A 3QVXA 2HLHA 2Z5LA 1Q1ZA 3FKSD 4IIDA 1PDOA 3EW7A 4NBKA 3W6UA 4IIUA 4TTTS 3TIVA 2WQ6A 1M2KA 3ORHA 2WIFA 1D2RA 1ONOA 2VSXA 3WMRA 1U0HC 5CYFA 5KQLA 2RGDA 3ITKA 3Q41A 3LCRA 2J6CA 4G5OA 1DEKA 4D41A 4OBWA 2VJMB 3RU9A 3JZAA 3EXFB 3OZCA 4O59O 2CBGA 2CC2A 2GJAA 3D5TA 2WBLC 2Y92A 2WPNA 1NJFA 5AI6A 3BOSA 2V5VA 3EXG1 3T7TA 5IUNC 2X13A 3E3MA 3LNTA 4J0CA 2R4UA 3INYA 4YRFA 1P4AA 3GUUA 1UIRA 1EJ2A 2J1LA 2RB4A 4Q19A 2GUGA 3GLGB 5FO1A 1JR2A 3BN3A 4XYMA 4DAEA 1U8FO 4J9VA 1ISIA 3QIVA 4KR0A 3P94A 1O96A 4ZHQF 3ZXYA 3KDSE 1QQ6A 1V3UA 3PU6A 1JV2B 1U2GC 2CCGA 2IUFA 3GOHA 1I7DA 5ALGA 3WGMA 3DBHB 5EE5B 2OXRA 4PZCA 2IODA 1XRJA 3K94A 4QQFA 2AXPA 4UJ5A 2E2WA 5EMKA 2V97A 3ZD8A 5EJ4A 5K45A 3HBAA 4CG0A 2WINI 1XTIA 1RBQA 2WIDA 2XD4A 3O83A 5ALNA 2UXCB 3TXXA 2QJWA 1I4OA 1M1ZA 4I6GA 4F3TA 1WXIA 2VUIB 4EMBA 2HK9A 4B3JA 2PT9A 1HY3A 4JL8A 4LZNA 4L22A 4OJMX 4ZVQA 3PI7A 2EKQA 1LF0A 3W34A 2FWRA 3R2JA 5JQGB 1GAQA 2ABWA 4G36A 2B78A 4PYQA 5CBKA 3E5NA 4GZMA 1WHTA 4ZVRA 3OE1A 5ETJA 4DSUA 4IGKA 2CJWA 1M9NA 3K0HA 3ME5A 3R5JA 3AFHA 4MGKR 4PPQA 5GONB 4UXHA 3JZIA 3PC7A 4JODA 1F0PA 2JD1A 2VJPA 3GFSA 1RRVA 4JP8A 2R7KA 4X1YA 2UYQA 4EEXA 5C4MA 4LI3X 3UUWA 1IVSA 1L5NA 3AY0A 4IILA 1D4AA 1FU7A 3CMCO 2QU8A 3LRTA 4I4IA 3QJYA 1WCYA 2VC2B 4J3JA 3NGMA 3I2YX 3UZUA 4DMRA 3H9UA 3U9SA 4LF7B 2DGDA 3ONFA 1Q0RA 1YE3A 4M86A 1P44A 4DOMA 4WXYB 3K4PA 1FFBA 2VT7A 2P9EA 2Y0CA 1RXWA 4E5PA 2PH1A 4WECA 5DHFA 1GQOA 3H97A 1E96A 1BRMA 4MCAA 3DMHA 5A9TA 5BVGA 2I3BA 1E4EB 1PGNA 1GG9A 3P2JA 1TEZA 2IIVA 1ADCA 4D43A 3U6KA 2FQYA 4D5EA 1IPHA 4DLRA 3QVVA 4C7KA 2FLWA 4L4ZA 4ZAYA 1S2DA 3P9IA 1GPNA 2EYUA 4J2HA 3EPKA 1IWBB 1X1CA 3NM5A 3ZTTA 5B4UA 4AURA 3DG9A 2PZGA 4CN8A 2PX4A 4X92A 2W6MA 4A0GA 2PH7A 1OFHA 1GZ5A 1EWRA 1QUFA 1HQKA 3GG9A 1CUWA 4Y6LA 4E11A 5LMCA 5DEIA 3KZVA 2IDJA 1H6CA 3UMFA 2ODPA 1KP2A 1IHOA 5BW5A 3BX1A 2JAOA 1C3OB 3EEFA 1VFPA 4OO3A 3GC6A 4BVKA 1EU1A 1XEXA 4FC6A 3CUKA 4QPPA 5DXAA 4DV5B 4I36A 4YCMA 1WZNA 4KKXB 4Y2VA 5TSDA 2HWWA 1I33A 1XB2A 4W5HA 1VE3A 4PCLA 2D5AA 3RYFB 1JIJA 4MJLA 3NBXX 5KOJA 4YO7A 3QITA 5HR5A 1F5SA 1I7LA 3LQYA 4FEEA 1PS8A 2WWRA 3M9LA 2ZZKA 1Z6GA 1ZI9A 1ZPDA 4E33A 1NT4A 2DM6A 2GM3A 4CIWA 2CKDA 1T6NA 3CO0S 3CZQA 3CRNA 1PX2A 3GLRA 4GUAA 2Q7OE 3WWOA 4FILA 2IYFA 2ZTLA 2FYTA 3OG9A 3OWXA 4NQRA 3I2KA 3PL5A 1KEVA 5GM1A 3PTAA 5ECYA 1JEEA 2BR5A 5HEKA 4MB0A 2D5BA 5DSTA 3TRIA 2OM2A 3NPMA 3UV6A 1XZEA 2Y6VA 3C1OA 1EFHA 1ZCBA 2CFRA 4IINA 4KV7A 4BNVA 2X22A 2CFTA 5BO5A 2D62A 1FS4A 1OX5A 4DUGD 4AB1A 4TKMA 4I46A 3PUJA 1WL8A 4DSZA 1EWVA 2REXB 3F47A 2GCOA 1ZVKA 3D0RA 3FLMA 3IILA 3DWIA 3ZZ1A 2X9QA 2AUMA 2QUIA 4G5GA 4RAQA 5IDYA 1EP1B 3T6KA 3K0SA 3W2GA 3GLFE 1E0JA 1UOEA 2AN1A 2CHEA 3PUYA 2PXHA 3L7OA 4M9CA 3OKPA 5IF3A 1ZAYA 421PA 2R4TA 3M81A 1DS6A 4BRSA 1DUSA 1JFVA 1PJLA 1Q6YA 3ACBA 4MZDA 4U7WA 5TXGA 1MX1A 5CT9A 5UKDA 3VH4A 1RBMA 3GFGA 2ZW9A 4ZEMA 3OM9A 3THWB 3D7SA 1JU4A 3GFRA 3F3SA 4QQ8A 4H31A 2ZUTA 3HKEB 4YCCA 4HQFA 1XZGA 5FUBA 3FTDA 3H5IA 2PYDA 3HLTA 3CO5A 3QEBZ 3MBOA 5C5IA 4YUVA 1SKYE 5BQPA 3ZVRA 3Q9UA 4OTZA 3WLLA 1KAMA 3BS4A 1UMBB 4Y6PA 2I67A 5A02A 3WS7A 2YVQA 4BLPA 1H0RA 4DEYA 1J0AA 4MR7A 5E0OA 3M49A 1E3JA 3I0ZA 4YJ3B 4C05A 1ILWA 5LP1A 1FUEA 4UEOA 1N92A 1R5OA 4RANA 1LW7A 1VHQA 5ALSA 3NASA 2RGCA 2IEBA 4KTVE 3E9CA 1PYDA 1RYFA 4W82A 1MB9A 4HDNB 1FFAA 4J0GA 4D8YA 4KITB 3C24A 4IL5A 3ZC3A 3OHPA 1ZKDA 3A6JA 1JG1A 2YW9A 4Z99A 3E9RA 5ITZB 1MV8A 2B9VA 3KDPA 3QE0A 4DC9A 2DB3A 4UBJA 2BHSA 1CP3A 2F1JA 1FNSA 4FZRA 4NYIR 4J4BA 3VVLA 2W8ZA 1YDFA 1RWXA 3MCAA 2VHYA 1Q3TA 3R77A 2VYCA 1VCIA 1KVTA 3M2PA 4TV9A 2WWVD 1RJDA 1P17A 2P35A 3E7XA 1ZO8A 3CURA 3TG2A 1NY5A 1O6ZA 1QC5A 3C6ZA 5JANA 1NGSA 4AVYA 2QI9F 4AN4A 2ZBFA 1T0JB 3PE6A 2VSNA 2HH9A 1UK7A 1GEGA 3OY7A 4F5ZA 2O19A 4FD3A 3ZQUA 3IBSA 3OZSA 2JLRA 1A9OA 2CXXA 1B15A 1B6TA 1BZYA 1IBSA 1SCNE 3DTVA 3KWMA 4B6RA 5BSWA 3ZVMA 1I4TD 3ND5A 4WK4B 3KTAB 1IN6A 4KW7A 2HMWA 3RFXA 4AMYA 5HQ3A 4QBKA 1IZ0A 3PQCA 2P6RA 1GTL1 3UJAA 2DR2A 1NW9B 2A35A 1IN5A 1CSEE 4FBLA 2Q2VA 4JROA 5GZ6A 2IRWA 2P9TA 1O8CA 3IUQA 3LDAA 3R3SA 4UVIA 3TRFA 1LDNA 1L7AA 2HOQA 3NTQA 1MORA 5B7GA 4CKCB 2NTJA 3AKDA 4NCAA 5ESDA 2Z9CA 1CY1A 2RHWA 1SHKA 5DTEA 3ZN2A 3K4QA 1X42A 4BZZA 2YXDA 2X1VA 1MENA 3R8FA 4KR6A 3KSRA 1D8AA 4JL5A 2EZ8A 1KMHB 2P11A 3FFTA 3I52A 5DHSA 5E9AA 2FN4A 2R1VA 4A0HA 4LA4A 4RK4A 4EBFA 2KJQA 3UICA 4C9BA 3KTOA 3N2GA 4RKQA 1QWSA 4QEKA 3T94A 4BECA 1N6KA 2ATXA 4OGWA 5G53C 2W6NA 2CMKA 2QM8A 3AF2A 3N5CA 4RY9A 3LTNC 3PV0A 5WRFA 1JEJA 2F67A 5JCOC 1J20A 3OZIA 5HX7A 5JOQA 1DMSA 3SDZA 1U1EA 4JI3B 2O59A 3FE2A 3WTBA 5D5HA 3EEYA 3GT3A 3BCSA 2FR8C 2ZJ2A 1PNVA 2OFWA 2IEIA 4HO1X 5DBEX 4C2UA 3L07A 1OJLA 3P9SA 2DKOA 4L4YA 5EINA 3WIBA 1UM9B 4UQPA 2XV1A 2DUUA 3LU1A 2QZ9A 3DKKA 1RS0A 2XCTB 3WP0A 4L8FA 2XNCA 4LK2A 1AQUA 5AK3A 3EXAA 4FHCA 4DCCA 3ESCA 2W7TA 3X1ZA 1A8SA 4FBGA 2W4QA 1QIFA 1FP7A 2A9OA 2RB5A 2B8TA 5AJZA 3FA2A 4ZI7F 5JIBA 4L51A 1GXSA 4TM8A 16PKA 2VHTA 1DARA 4FQ5A 3MS4A 3T4PA 1OB2A 1FF9A 3OZVA 4UREA 5EJIA 3ZWCA 4D46A 5G4LA 4CQLB 2E37A 2QXUA 2QTVB 3P7MA 1ZUWA 4QDTA 2VAPA 2VZEA 3QEMA 2ZJ4A 4NZYA 3IRVA 1H93A 4H9GA 5KOIA 4MVCA 3QKIA 3TOZA 3TLMA 4UM5A 5EA2A 1QYCA 3D1VA 3FXAA 2DVMA 1JDNA 2LCIA 2LVBA 3GEEA 2ZIGA 1O9HA 1RE1A 1S3SA 2JHCA 4XB1A 1UKYA 4ZCPA 2XA9A 1BDHA 1MO3A 1Z2CA 4P2BA 2JFXA 2FUNB 4Z7QB 2BFCB 2RC6A 4PO3X 4PNZA 1Y9JA 1OFGA 4Z1OA 3KQPA 5ESRA 2WWHA 4WLEA 3AF4A 3O8BA 3QMVA 4P3YA 4FYKA 4CVNA 4J94A 3U7HB 2NGRA 3AHHA 2AZDA 3FZEA 4Q3LA 2I4OA 5TVGA 1H23A 2BJHA 4KYIB 3EDOA 2QL7A 3L4KA 3CF4G 1VG1A 4U2CA 3W4KA 2PH5A 1XD8A 1B8VA 4PFJA 5AUQA 3K31A 4MVJH 4V0SA 1BWPA 3VDRA 1J9GA 4AWAA 2XMBA 3FGOA 4HRXA 1GN8A 3HLKA 4L16A 1G63A 1MX5A 1KGSA 3LVRE 5I7UA 3ZZTA 5EJ6A 3EFBA 1TT7A 1XYVA 2JIPA 3QBJA 4ND5A 1FX0A 4EZIA 5KPJA 1X13A 4K9NA 4ZQIA 4Q37A 1J25A 1EEXB 3AIKA 3QLUC 5HFNA 1M2NA 5FBZA 1S3FA 1HFKA 1IXRC 1ZH2A 4ALIA 3TQFA 1PWHA 3W6NA 2F48A 5KPDA 1T2NA 1UBFA 1QS0A 2BFFB 5K0EA 5HKLA 2QVCA 1ZK0A 1T9CA 5JNVA 1M2EA 1LPSA 4MB6A 1YRLA 4EA7A 2YXNA 4DUYB 1GZ4A 4OMFG 4JC4A 5EIXA 4BXOB 1I7QB 4PVCA 5CNKA 4YJ2F 4CMJA 1J5EB 4GP7A 5M29A 4K0KB 2FEOA 5BNZA 1WXGA 1RZRA 2R65A 4A73A 4RSMA 3K0AA 3HO1A 1RVDA 3TZEA 4D79A 5HKBA 3MJFA 4FMPA 4XFKA 2YZGA 1TLLA 3EXHB 2JH9A 4FB5A 4BS9A 1ZGHA 4OHFA 2P27A 5AP9A 5K4HA 1R00A 2H1SA 4WZZA 5KMGA 2G63A 2R85A 4RF3A 3ZX4A 2XGJA 3GLUA 1T36A 1F8XA 4PQEA 4RXTA 1SVIA 2OKGA 3U7GA 1G4UR 2VP6A 3BERA 4HVTA 3FNRA 4ZZ0A 3F5MA 3KBBA 4R81A 1KVUA 4G0WA 4LGVA 3RT7A 1ENPA 1Q7CA 2HQBA 2OLJA 4LMAA 1GSOA 4MH0R 3ITDA 3R76A 1XNRB 5BURA 5JS2A 2WFLA 1X8JA 2WJGA 4LZAA 3S81A 4RV4A 3MS7A 3UUFA 1Z4NA 1Y9AA 5EKTA 1ZUD1 5GINE 3HI6A 5JPCA 4RM2A 1KNQA 1FTQA 3NYIA 3LT2A 3FTQA 1N32B 5E38A 2L19A 4R1OA 5CTJA 3Q6NA 1MW9X 3SEAA 2HZBA 3V1MA 3F7MA 1O58A 3ZE8A 4KH1A 3I6MA 4IO0A 4A4DA 2H6EA 2XB4A 2ONZA 3OQJA 5EXDA 3DL0A 2II6A 1C0EA 4ID3A 5GJCA 3PD1A 1C3XA 3BK7A 4ZWNA 3IIEA 2WWYA 3EG9B 3OX4A 2P77A 2Q6LA 2W2LD 2XUIA 4M7OA 1R1DA 1TCCA 2KWIA 1S3IA 2VF7A 3KNZA 2Z04A 5FBQB 4BCDA 3RVPA 1Z18A 3JZFA 4H0CA 3MG9A 1P0MA 5EZYB 2X6RA 1E3WA 2EDCA 3PNYA 5FTMA 5KO2A 1H8ED 2A9VA 1EK0A 3E70C 2C78A 2PMWB 3NTLA 4RJKA 1NURA 5K0NA 2QBYB 3G1TA 4N7BA 1A9TA 5J1TB 3WX0A 4KNVA 4BNGA 3JPWA 1UFVA 4MUFA 2Y68A 3NVAA 4R4JA 1UDBA 3ENKA 3FSRA 3IUMA 4KZPA 1TT5B 1XCBA 1RPZA 4EHIA 3NNSA 1PV1A 3K0KA 4MICA 2ACVA 1TEHA 4II2A 1BSVA 1ONNA 1RJFA 2AI2A 2R97A 4ZOCA 4B47A 1P4SA 2H1OA 3TIXB 3G2PA 1CDEA 5HGXA 4I08A 3AM5A 1O9BA 4UUBA 4WNYA 1RQRA 4LISA 3ZHXA 4Y6QA 2C59A 1Y3DE 3WK5A 4I50A 3PC6A 4CM4A 4F38A 1G5HA 1GITA 2I6TA 2XHEA 2Q8QA 2J67A 4FZ5A 4K8RB 4E32A 1ZEMA 3BGOS 2A9KA 4M8LA 3E9QA 1H2BA 3OTWA 4KO1S 1OUMA 1K68A 2FQWA 3G5MA 1XTPA 4ETNA 3D3WB 4U7TB 5F7JA 4Z54A 2QM0A 4N48A 2XB6A 3LF1A 3SD7A 5EIBD 5JLAA 3ZW9A 3LRXA 3OJFA 1GIAA 1PQ4A 1W36B 1SXJD 4RK7A 1TCAA 2DWUA 1PV4A 3OTGA 5HFAA 2PAAA 3HZHA 3LIIA 4N01A 4UNIA 5KTPA 2QG9A 1PD0A 3DW3X 5EL0A 2ZXFA 3MS2A 3T8YA 5M34A 4QOGA 2Q5JA 4OV6B 4BB6A 3RAFC 3QKTA 1L0BA 5EXTA 1A9SA 1JLHA 3OU2A 3PUKA 4AQ7A 1U0LA 1X6VA 1ECJA 4H7IA 5F73A 4E5DA 1DKQA 3HWRA 3WLPA 2ZSAA 3A1VA 4GOJA 1XRLA 1NSYA 2I6QA 3AHJA 4O33A 2P3LA 3G89A 4HQKA 2R5WA 2GTHA 3EK2A 3QPDA 5J2UB 1Y1QA 3O4FA 4MVJF 4F21A 1Z4LA 5AM1A 1XPUA 3P71T 4MITA 1QWOA 3OA2A 1LNZA 3GMTA 3ISTA 3GEBA 1LNSA 1X94A 4N9WA 3OQ1A 4Y2XA 3VR3A 3A9CA 4YY3B 1N5LA 1BX0A 1R6XA 4X41A 4D3ZA 3BD7A 4MZXA 1V2HE 1CUEA 2C7BA 2NO0A 3IOYA 3VV3A 1G21A 1VHJA 2A1TS 2O0JA 3DKPA 5KI6A 2UUOA 3OM1A 4M89A 4LXQA 4UJ3A 2PNJA 3KSAC 4R2KA 4I14A 3V7UA 1YBHA 4CI0B 4CMIA 3L84A 3TAHA 4ERNA 1NXVA 5LWQA 3DO8A 4AXBA 4F2HA 5EUCA 1DQSA 5LP6B 1RRMA 5KYNA 4CT5A 2B8NA 4JR2A 3VAZA 2FZKA 2VF4X 4J7CA 4JOCA 4B33A 4QPZA 3E3LA 1T3HA 5J2TA 5C3UA 4JXKA 5LQJA 3C2QA 3LDUA 2D6FA 2G1KA 4L9SA 1MC5A 4UBLA 3KFVA 1JBQA 1NFRA 1NTOA 1ZJ4A 5H3CA 3I5XA 1ULSA 3BMCA 3P9ZA 1Z62A 3KLOA 4GI3A 4EZEA 2IYEA 1HYHA 3DCJA 3AL0C 4M1ZA 2O2DA 3VU9B 1Y3HA 4N3AA 2D2VA 4DM4A 1Z82A 5C18A 1VMEA 2JFGA 2OHOA 3BAFA 2R8XA 2YHAA 2WILA 2PCLA 1X14A 1OCEA 2EZ4A 2ZT8A 3FLEA 1VSQA 2WJZB 4EKGA 2HMVA 4KUGA 4GMDA 1UXKA 1KS9A 1R9JA 2HL6A 2IYZA 4ROTA 1M54A 2BFWA 4CV0A 1FNNA 1JEYB 2G1JA 3SIXA 3HDGA 4BNXA 1O57A 3NFYA 4C4SA 5C0OE 3SQNA 2QUBA 1TO6A 3UK6A 4AS2A 1D1QA 1XDBA 2GZ1A 3RAJA 3ZQ6A 1U63A 2YDYA 3L6DA 3RSZA 3TOCA 3VAYA 4W6ZA 3UKOA 4K26A 2YYYA 8ABPA 3IEKA 3WLTA 1IDOA 2AFHB 3KQMA 2F62A 1K7FB 4D9CA 2Q49A 3A6ZA 4C7BA 1OX4A 4E6PA 4NJMA 1V11B 1YDWA 1FSZA 2XGSA 1OBOA 3E22A 1Q92A 1GFSA 2QW0X 3SXPA 1TMKA 3WB2A 3VR5D 3KZNA 4RZXA 1DHTA 5JWHA 4BU0A 2AFIB 4Q93A 3VJMA 2EFJA 4O4LB 3WRXA 4HVCA 3MFYA 2R11A 4FYXA 4HLDA 3AVPA 1Q15A 1OWOA 2Q3JA 2H16A 1BTOA 1Z12A 1X2BA 1P7WA 3EEIA 1I1HA 1K3UB 2VKQA 3OLVA 2P0EA 1R4NB 4IIJB 1OXUA 4HEA1 4PN3A 3IBFA 3PCRB 2OLEA 3S2GA 3V5NA 3FPGA 4JVMA 1ORHA 1M6EX 1RQ7A 3DC7A 5B3KA 4LRSB 1X1BA 3O7MA 4NBWA 3SQOA 3WWCA 2H9AA 4EK9A 2VBIA 5LOVF 5JJBA 4HH3C 3SHWA 1Y37A 1VPWA 2G25A 4BVBA 3DL2A 1AKWA 2GM9A 1HXHA 3DZKA 4MRMA 4ND3A 4ENRA 3FWYA 3K6JA 1HE2A 3ODPA 5JCJD 3S2UA 1LWNA 4HEHA 1JQLB 1N0VC 2W2MA 1J7JA 2PMDA 2Z30A 4D45A 1JXQA 4RKRA 1V6SA 3WIEA 3WKAA 4DWWA 5L9AA 3U61B 4NBTA 1A4IA 2FPIA 4K2AA 1Y3IA 2J09A 4A8TA 2QLNA 4N0QA 4OXRA 5EJ8A 2BE9A 1MGPA 3QNWA 4KE8A 4H7KA 3T06B 5IRCD 3AR4A 3B8HA 1EQUA 4Z4GA 1SUFA 4DXAA 4FQ7A 3PC8C 4NBVA 5CP8A 3BG5A 3INRA 5FPQA 1IZ7A 1QGZA 1Z36A 5K0BA 3VHRA 1RLOA 1ZM9A 4E7OA 3ETNA 3G8DA 3HKCA 4DIEA 2O9JA 5L3ZA 1A50B 4KGVA 5JJIA 4GLFA 1QLHA 4J2TA 5CH8A 4J2OA 2ZT6A 4BNTA 1LI4A 1P72A 3DFKA 2AJBA 3H8SA 2X5NA 4OQZA 3COVA 4BO0A 1YRBA 4L4XA 4YDRA 5FOTA 2ZIXB 5MN5A 4C3UA 3T0IA 1VE1A 3FOZA 5HF6A 1ZRNA 4Y1RA 2EKDA 4CM3A 1E3EA 3U81A 1II8A 2FZEA 1NN3A 1QKJA 2P91A 2WYOA 4N82A 1RYBA 3D7KA 2C8VA 5CLLA 3U09A 4QUGA 2C1XA 2JLAA 5IVIA 3WYBA 2GWHA 3FMOB 2J59A 4KWTA 1THTA 3R6LA 2BSAA 5B1EA 2BD0A 3BEOA 4YGYA 3H0KA 1TFRA 2H1HA 3QVUA 1P3Y1 3J7AC 1XAIA 4OQYA 1GNLA 4AT1A 3MCUA 4KQMA 1L5QA 4AQDA 3SICE 1AX9A 3AEXA 4CTKA 4CKWA 4XUGB 1N57A 2M98A 3YASA 4RTOA 2B30A 3NDIA 4KO8A 4PPYA 1ZIYA 3QF4A 3A9WA 1CT9A 2ST1A 1Q1GA 2XUFA 1RHJA 3C74A 4CG1A 2VH1A 5AI5A 2CMGA 2HF9A 1Y48E 5DT2A 2CWWA 4MGIR 3PPYA 3GFVA 3ZDRA 1AUPA 3IXQA 1R0RE 2HA2A 4LV5B 3GRCA 3H75A 4AJKA 2BFPA 5E7QA 2B37A 4G3XA 1PVVA 4HD8A 4IMRA 1O97D 3DKIA 4PV7A 2O8CA 3SLGA 2PEZA 3TJMA 1DWPA 1X74A 2FUEA 3K1AA 1XD2A 3Q10A 4Y2YA 3VC7A 5CFQA 3LCMA 1T1GA 2VNAA 4F71A 4RY0A 2BBTA 1CETA 2H08A 2WF5A 3FN4A 4UEQA 1C3LA 5JAIA 4E5MA 2A5DA 1S02A 1XJ0A 3THYA 2BGLA 2PGAA 3JWIA 2ISCA 4NXNB 4NV1A 4ZGWA 4JT8A 3OF5A 7ABPA 2V8BA 3F49S 5HUHA 4ZJUA 4KIFA 1M6VB 1KI3A 1RI3A 3IHTA 2GLTA 5LMZA 4LE2A 5BNWA 1H1DA 1U8AA 4EF5A 4XEUA 4O2AB 3U3KA 1F3LA 2P3SA 4JD5A 5FOXA 2OYSA 2QM3A 4X6YA 4ZV4A 4L0MA 2WWFA 3G2JA 3HJTA 3OP4A 4AJJA 1UZAA 2PYZA 3OEHD 3MWJA 2B1QA 2XMDA 3U4QB 4DHWA 3L8GA 1JFLA 3H5OA 5HYVA 1T5TA 4FOTA 1WP9A 4FIZA 3BK1A 1FBTA 2XNJA 1KSGA 4JBWA 1KSHA 2ZANA 4HTFA 1R0WA 4J8PA 5H5JA 1GM5A 1M72A 2Y76A 1KORA 1NXSA 1NX6A 4QPNA 3TINA 3MYRA 3JD2A 3VJKA 2CNWD 3GJ3A 4ILKA 2QX6A 4ETWA 2PUTA 4Z9YA 4CNQA 3QYPA 1NBIA 1USGA 2VIIA 4RL6A 1DTWA 5SICE 4U7FA 3TB4A 2CK3A 4ND1A 2HKIA 2Q5LA 4Q18A 1ENZA 2H85A 1QHGA 1C4OA 3TQTA 2V65A 1AO0A 4LF5B 3L8CA 4EENA 5C5DA 3REGA 1I3MA 3UAGA 3I8XA 1N0IA 4MKIA 4BWVA 4KREA 1B8PA 2G71A 1G2OA 2FG5A 5ALFA 1TVMA 3W4IA 3IAFA 1DJMA 1EDZA 2ILTA 3DBOB 2C0QA 2DMRA 1PE0A 1GRQA 4BVFA 4Z3KA 5ES4B 2B1RA 3DNFA 3KR0A 5DOVA 5J5CA 1U28A 3CLTD 1KEZA 3S27A 1E5DA 1QVZA 1O94C 4N0DA 1BD3A 2GFIA 2JLBA 4PAOA 3VNRA 3WL7A 5LZ4A 3U7FB 3H1GA 4ZAVA 1SBIA 3MRXA 3FOWA 3KQWA 1RAGA 4AF6A 2X5KO 3LYAA 2PLFA 2XQVA 1RE0A 1SBYA 3GJYA 4BFZA 1UK9A 2AVDA 2HRQA 2ZSIA 1YJBA 3D6NB 5DHUA 2BM0A 2CB9A 3DUFB 3ZHUA 2Q7DA 4MS1A 3D8SA 1QH0A 2QVYX 1FDTA 2YJ6A 3ECAA 1YDHA 4G4JA 2FF5A 2JFVA 2DF8A 3I9MA 4RETA 1OI7A 1ZNZA 1QHNA 1RLIA 3F7TA 2H00A 5JE8A 2X15A 4CQMA 2NXCA 3CB4A 1U02A 3AKEA 1RRGA 1YVEI 3S1SA 2HFKA 1KAHA 4DW8A 1SUCA 1JF8A 4LTDA 1OASA 4NBSA 3USZA 2LUOA 2X8LA 3ZZ0A 4RZ2A 4YB8A 3CA8A 3WGYA 3G49A 3AI7A 5L7YA 3SYKA 3KQUA 4RABA 5KTTA 2IUYA 5ALKA 3K8OE 2WTMA 3FF4A 4QXAA 2AI1A 3NTUA 1AUXA 2AEFA 5EWJB 3MW8A 3QW4B 1PK7A 4MW4A 4I55B 3EXIA 5I3ZA 1TI7A 3L1JA 4KYUA 4EFLA 3N86A 2Q28A 4V1CI 2E82A 2O5RA 3EXG2 1V1RB 3HVIA 4WXRA 4INPA 3SZMA 3TQIA 3WYGA 3P2MA 2BFBB 2QJFA 3OIFA 1K8QA 1PJ2A 1QHHA 3FF1A 4RPJA 721PA 3D81A 4AJIA 3IAUA 1R6DA 3ED5A 2WTBA 5ULLA 4DILA 5F12A 5KSYA 2AC7A 4Y0NA 3GO4A 5CDYA 5F1KA 3R9IA 2ZJFA 4KPGA 1PW5A 3KZXA 4FHGA 5CLFA 4F0JA 1ZI6A 1U3CA 1HFEL 3RKUA 2OV1A 2F7SA 2K87A 4P4UA 1BHQ1 4LS3A 2VOEA 2J7PA 4PLHA 3C39A 3QXSA 5IBPA 4QG3A 4KBFA 2Z09A 3WQSB 2ZWOA 2P9HA 5JFTA 1ZH4A 4AMGA 1FTGA 1V3QE 1CEYA 2A92A 2ZP1A 1KC1A 2WJHA 5FUQA 3NCTA 4ZO6A 3WWZA 1PVOA 1LQ2A 3ROXA 3ICOA 3R6GA 1KZ4A 2WPDA 3EVAA 1OXTA 3DZFA 3GEMA 1CVIA 1ZK3A 3EE6A 5DYNA 2H51A 4YONB 3KKMA 4K6CA 4ZVNA 2QVBA 2ZQYA 2V7WA 5J5VA 1RAFA 3SX4A 3L8YA 2C3OA 1V7CA 2HSDA 3FUCA 2I2AA 3LGAA 4AF8A 1YZQA 4PSDA 2ID8A 3OI7A 4RIHA 3R9WA 2W2NA 2I4RA 4FS3A 4FW8A 4IV5A 1I4DD 3Q11A 4YCNA 1OFUA 1Z0IA 4WRRA 2Y4NA 4CMEC 1V5WA 3U13A 5J23A 3NV9A 2YZNA 1KL7A 2JKZA 5JYBA 1UBMS 4D8VA 1JVNA 3MJCA 3N6RA 3D4PA 3UA4A 5CBPA 1JAHA 1G8PA 2IYLD 2XJ4A 3CT6A 3VDMA 1G20E 3ZLUA 1D4ZA 2HCTA 4QGHA 4JGGA 4TS9A 4Z9FA 1JMVA 3QEOA 2IIQA 2AF3C 3RVNA 5DOZA 3ER9A 1P5FA 1CUAA 3QU4A 1BS9A 1B4DA 4OATA 1P5JA 2RHCA 3UJCA 1QZUA 2P9BA 1UT6A 1WBDA 2HO5A 4JU9A 1C9EA 4LVUA 1TUGA 3CU5A 3HFRA 4N9QA 1VMIA 3DD1A 1JZTA 4GWKA 2GOYA 1TMYA 1NMEA 2IYAA 5T64A 1H4VB 2X2PA 3TIFA 3R4VA 5I7HA 1BKYA 1J22A 1Y1SA 1YS4A 1OZ0A 2PTHA 1W5BA 2HRBA 3C1AA 4TWRA 4XIJA 3F6BX 2MTBA 4XDZA 3UMBA 1K08A 1UK8A 1KSJA 2E49A 3I6BA 4GGMX 2X7HA 1HQDA 1UBRS 2VF5X 3I9KA 2XKKA 2ZYVX 4EGJA 4FJ2A 2RGEA 5JS6A 1TM3E 4HWKA 1R0SA 2HIGA 3W5IA 1JJBA 1AN0A 6YASA 3D0QA 3TL6A 3WIUA 2W2KA 4EHBA 4CMAA 4PG5A 1EUDB 3F6RA 3JARA 3QVSA 1TAHA 4HQLA 4D8UA 1XQ9A 4G65A 4RD6A 3EXEB 1XZHA 3QVMA 2B1IA 1C9YA 2PKXA 2AHRA 1XQ6A 1JDBC 1EJBA 1GQRA 1SC9A 2H7CA 1E7WA 2E4WA 2AYZA 1WY7A 4OUDA 4DRXA 3KQHA 3AWIA 1Q5PA 5FA5A 1ECLA 4ZOLF 4DLVA 1FVOA 2O23A 5AXCA 4D0NA 4GZ5A 4DIDA 3BC1A 4MR9A 2B25A 1Y5LA 2CUKA 2F3PA 3NDJA 3VPBA 1Z8NA 2QU7A 3D8RA 5AUPB 2GN6A 4IV0A 2ZITA 2JH3A 1G9SA 4M22A 2V3WA 3I58A 3V1TC 1YQDA 5CX1A 1KYIA 3JQ8A 4UPVA 3AVVA 1EXNA 2V9ZA 1B00A 3AFGA 1H6BA 1YGPA 3GRZA 4ZICA 5KSWB 2HHLA 2Q9CA 3ITNA 1SKQA 2E1PA 1TKBA 4LRXA 4AMBA 3D7LA 3GJXC 4Y9DA 1K97A 4GC9A 8LDHA 4ESHA 4DA6A 4B6PA 4LOKA 3ZQKA 1JJIA 1DQRA 2YX1A 3DOOA 1EVYA 2YY5A 4R8MA 1YT5A 5EMMA 3MYYA 2WF6A 4WUTA 4XIYA 4PR3A 1XKQA 1ESZA 3UMRA 1KH2A 1U6KA 3T7CA 4NTZA 1A9YA 1U11A 1TYAE 1XO1A 3C6QA 4LJ5A 5BN5B 2CJXA 4E13A 2QTTA 4Q3BA 4IDNA 1BHSA 2QAGB 4F3CA 2OAGA 3KB2A 5JAHA 1F6DA 3MVEA 2Q0SA 2W2VA 2GPJA 4Q9HA 1XTVA 4YRMA 3BXFA 3GJ5A 1TJ3A 1H2EA 1V95A 3KUUA 4TYQA 3A6EA 1DV2A 1YB1A 1XT6A 3VR5H 4UFPA 2A3NA 2O20A 4P1ZA 1MRNA 4D42A 1OBVA 4GBJA 4UM7A 3AJDA 3TRKA 5LM3A 3TUZC 3ABRB 5BNFA 1CQJB 2QI9C 3A1EA 3DEZA 2J8ZA 2ZJZA 1BCRA 3GFQA 3V80A 5JHGB 2J48A 1WY5A 3JD4A 3HVKA 4OYLA 1U8XX 3WGTA 3ADPA 3BGVA 3LT5A 2ZWVA 4GVPA 3TLCA 1BH6A 3FMVA 1YA6A 4RHTA 3TNFA 4EGFA 2H2HA 2ZYTX 3AM1A 3V42A 1REQA 4DR5B 3QTTA 1Y8RA 4ZCMA 1KOJA 4PLWA 5DMXA 3KWJA 3AUJB 4U1RA 2AQHA 2B69A 3FDIA 1C7ZA 2A1TR 1MX9A 4OCZA 1X7GA 3E27A 1SBQA 2GPAA 4RQAA 2NVUB 1WKCA 4YCBA 3W78A 1R8SA 2A94A 4OI2A 1E94E 2ZCVA 2WD8A 2R87A 2XA2A 2JAQA 3J7TA 3OPYB 4G81A 2AFVA 3FRIA 3RO7A 5K6AA 3EOBI 1A9QA 1SAYA 1D09A 4OSOA 4JJIA 4MDFA 2FEWB 1Q0HA 4AUEA 2RJ3A 4F12A 3GGJA 2J41A 2IBTA 5FEUA 4DR2B 2P8JA 4CIAA 3C3KA 4B6JA 4WGGA 2YHUA 3RWOA 2G82A 3TW6A 1VKRA 1FFCA 1VGRA 2WWWA 3LDHA 3NC1C 1YQXA 4P7BA 4PZAA 4FVTA 1SD2A 2ZT7A 1EXMA 4B8WA 4JHXA 3TH5A 3SC2A 1M8KA 3GUHA 5LA6F 4E4YA 1UIMA 1X0VA 3DDSA 1YONA 4LJ9A 1HR0B 3NI2A 1AZSC 4PG6A 1ISGA 2JBHA 3GROA 3A4IA 1J97A 1LK7A 4XX0B 1W4BA 3RC8A 4RJJA 3L9WA 3ND8A 5KNBH 1KDOA 1NXWA 3GFTA 4UOQA 5EXEA 4JJ6A 3IE2A 3T12A 4N47A 2PWAA 1QIKA 2R48A 3D2CA 4ZAGA 3H2BA 5TR9A 1DJQA 1P1KA 5CDFA 1DCTA 4K0RA 3K9LA 2V74B 1QH9A 2AX3A 3EVDA 3KOMA 2X5XA 3Q3JB 4J16C 5LUBA 1EMDA 3LG2A 4U5XA 4K9DA 1NVAA 1QIMA 4EHFA 3ZDEA 1X77A 1N9KA 3GUVA 3HUFA 2D2IA 3HB0A 1FJ2A 4JFRA 3AB7A 1FXUA 1JU3A 1E3MA 1U81A 2UUPA 4G89A 1QAQA 1KP3A 3F1LA 3RROA 2Z2ZA 1N4DA 2COEA 4LNUB 3RJ5A 4DN6A 3HJAA 5ICSA 1T8PA 1UINA 4DT1B 1PQWA 3Q3CA 4Y18A 4G24A 3L8HA 4HX2A 3Q7IA 4FUQA 1GVHA 3FFWA 4H17A 5DGCA 2PWBA 4O1MA 3LUCA 4D6XA 1NN1A 3H5LA 4FCVA 2VQFB 3UWSA 1H1LB 4XEHA 3LTEA 4V3BA 3S29A 1PGPA 3E03A 4I1OA 3G8YA 4FT4A 3RRZA 2C84A 3RRMA 1A88A 1TAGA 4PC6A 4HEA6 4ER6A 5BWCA 2B8JA 2HA7A 2QT9A 3DAYA 2ZI6A 4GR9A 3OBIA 4F7WA 4YHBA 4NNPA 4TZ0A 3I92A 2PKYX 1FSSA 5DIFA 2EARA 2QRMA 2Y9MB 3C0KA 5ERYA 1E2PA 1JGTA 4JLPA 4EYSA 2KPOA 3ZXIA 4OYHA 3IX7A 5DB4A 2X0JA 4R71A 3FPAA 1FU8A 2FXVA 1RWMA 3JASA 3DF9A 5BYJA 3SX0A 1MMFB 3U3MA 1SKUA 3TR5A 4F93B 3S7TA 5K8UA 1N7GA 3EC7A 5KQSA 1E60A 2P68A 3L7MA 4R2HA 1TJ5A 4MWEA 5JG7A 2FP4A 3A9UA 4EJSB 4F6RA 4EY8A 2H1WA 1I30A 3FPJA 3O6VA 1NONA 1VHDA 3WGIA 1UK6A 3QQ5A 4IXTA 1L5YA 1KK0A 2XBLA 1RKXA 4GQBA 3QFCA 4FHEA 1U1DA 2BRUA 3G8AA 2O3SA 4KHPB 1DAPA 3PEUA 2XDWA 1T10A 3O8DA 3I4CA 2A3RA 2VJLA 4RORA 5CM8B 2YV3A 5A05A 3ZX5A 4B43A 1WW3A 2NZXA 1F14A 4HXFB 3MT9A 4M49A 4OPMA 4ONEA 3ZWKA 1HG1A 1NVVR 4Q3NA 1P2DA 4Z1MA 5LB2A 3HKBA 3B5EA 4JUIA 4B34A 4P08A 3ZBQA 2QTLA 3QYJA 3WZ2A 3OY2A 1VHWA 3OIYA 3W7BA 4LQDA 4Z7OB 3SF8A 1E99A 1E9BA 1S2IA 4ZP1A 5I5GA 2NUAA 4IJUA 4LOJA 5HJ2A 3RK0A 4P6VF 1PSDA 1QTRA 4MVJE 4DV3B 1QAOA 4MDHA 3MK31 4XQCA 4BNJA 4M0CA 3RBZA 3CRVA 5BWBA 3WYNA 3C45A 5LQDA 3HJGA 2EOAA 1I32A 2G76A 2QTFA 1J0DA 1F9EA 2BHLA 3HCPA 5CVTA 4A8JC 4RA6B 2XH8A 4UOZA 2P2CA 3T5AA 3JQ7A 1R5BA 4NAVA 4YDSA 2WU0A 3WNCA 1FTYA 1SOMA 4NL4H 2HNBA 1IMOA 4M37A 4WZBA 5E3IA 5FTJA 2GPWA 3RTEA 1BW9A 5L6MB 2ZYSA 3SQDA 3EVTA 4Y30A 1EFAA 1QBKC 2BF7A 1IFXA 5BSRA 3I2JA 1MJGA 1QDEA 4K2HA 1RMYA 1EP9A 1E1YA 2GVNA 4D92A 2ZSJA 1TADA 1C9NA 2I55A 3CLRC 3ESRA 4WZ6A 3TSWA 2EYQA 2IKSA 2EF1A 4AYTA 2OSVA 3TLYA 3CR3C 1M34B 2AF4C 4KN6A 1LRJA 1VE9A 4TV8A 2FGKA 2JLXA 4B1FA 4CF6A 2PJRA 1U3FA 2I7TA 2RH4A 2Y0EA 4J3NA 4KQ6A 4E5YA 1DZIA 5IKOA 1EFKA 5DEOA 4LK3A 1B42A 3V6MA 3ANNA 1SXPA 3BD8A 4P9NA 3SIPA 3HNRA 5K01A 2AW3A 1IM5A 4WKBA 3CKLA 4EQ6A 2ZM6B 1WF6A 5DM4A 2IOFA 1FSGA 3K70C 5TARA 2GJKA 5ALEA 2XUJA 3ANYB 1D0IA 4YN3A 3DONA 3CISA 3JQ6A 4U3JA 3RU7A 4M76B 1MO2A 3VNSA 2B20A 2EQAA 5IJ0B 4CGZA 1IB6A 2I5PO 5A2QA 1G9TA 1Z45A 4BO3A 4BJ6A 5EPEA 3H1BA 2JASA 5DIZA 4EHKA 3EDYA 3GRYA 3P0FA 2VI5A 5JAPA 3T7JA 4L5YA 2W6PA 3S2SA 3EF3A 4MV6A 4RY8A 2G5TA 2EF0A 4IGFA 2C7OA 1N78A 2G7MC 2QRNA 3AESB 1HZZC 4PWYA 3ZDYB 5BUSA 2BH9A 1S0UA 3JTEA 4HDOB 3F0TA 3GBSA 3IKJA 3TLGB 1DP4A 5CDGA 4D3YA 1JFRA 4H4DA 3HFGA 5CB8A 2PCJA 3LQ1A 4YRTA 4BNUA 1OXXK 2GJ8A 4JU8A 4IUDS 2CNOA 4KYTA 4RTQA 5KYVA 1JYFA 2YHIA 1AQIA 5L3VA 1PDVA 1Y5NA 4D9HA 2PT6A 2VDQB 4M9XA 5F5XA 3PENA 2X8AA 2J30A 3ZE2B 2O8EA 2WU1A 3BXPA 1G3RA 1Z0JA 4LSGA 4E88A 1DO2A 3L7KA 3VU1A 4F2PA 1XJCA 3BBPA 4QSMA 4Z7NB 4W9NC 1N3BA 2J6HA 5DW3A 5JW6A 3JQGA 3QEJA 3FPSA 5CG1A 5HCNA 4JIMA 4MINA 3L7BA 3AR6A 1ABBA 2C54A 2X86A 3NHJA 1M5TA 2ASEA 1JMKC 2COKA 2E55A 2PBLA 5K0CA 4FEYA 3CEPB 1RPJA 4OQPA 4RYLA 4V24A 5AKJA 4EHJA 5IJ9A 5E3JA 2AN3A 1LC0A 1N5KA 2DHCA 2JFBA 4MMYB 5CA0B 2YJNA 3A3PA 3ED1A 3K9WA 4H7JA 4YRKA 5K8TA 5EE9A 2QUHA 1KYWA 3B8EA 3AFNA 3O1JC 3FROA 1P0CA 2F1RA 2WNSA 3FG9A 4K6GA 4L74A 5C37A 2EWMA 2NYRA 2X40A 1G41A 2R79A 2OWEA 1EFPA 1G8KA 3LPDA 4MDYA 3IP8A 5LKRA 5CB4A 2BP7A 2X14A 3I9V1 2HRCA 4RTMA 1AV7A 1G7RA 1XLUA 5F51A 3AP3A 4BU1A 3P0IA 3QENA 2FFHA 2VOJA 1JKJA 4URWR 2UZ4A 2CK3D 2XB9A 4KO3S 1P5ZB 4TTVA 2I6UA 2R8BA 2CL5A 1PAUA 4FFWA 5GONF 4ZKEA 3VXKA 4FFSA 4JOQA 2E21A 2HI0A 5KC8A 5D7BA 4ZCRA 3QYAA 3I6ZA 1US8A 3CCFA 1XR3A 4UAUA 1MJGM 4X66B 3E3OA 3MD9A 3F6PA 5IDWA 1VLJA 3AQIA 1KEEB 3FDZA 4XKJA 2NOAA 3RSSA 3TNJA 2UZIR 2P6NA 1WSDA 3WVNA 1TF7A 2CEAA 3GXBA 5CLGA 1BMTA 1ST2A 1VG9B 4NYMR 2JIMA 3INNA 5ITWA 2GEBA 5JXHA 4MW6A 4Y2GA 2I4TA 4KO4S 2NSHA 3N59A 2PZKA 4IH1A 4FR0A 1L7OA 4DV2B 1B0AA 3ROTA 2QT0A 3QJ5A 1RQLA 3BIOA 1T8TA 4ZT5A 1XMQB 3TQHA 1O95A 3VZSA 1E5VA 1SCJA 1TK2A 2RARA 2Z2XA 2ZYRA 1M5RA 4NENA 2ZRPA 3R5SA 4EKNB 3HXTA 4K9KA 4WLVA 1FDUA 1KBOA 1RFLA 2HDOA 2J3QA 2PBRA 4RF5A 1V16B 4Q1VA 3O4JA 4H15A 1NA5A 5AVKA 4BQRA 2OUKA 4EVIA 5BUCA 2X1LA 2W8BA 3CEMA 5E4TA 1MZPA 3QVLA 2H2FA 3U3ZA 3K5PA 3T5GA 2AUNA 3GPIA 3T9DA 8ATCA 3UJ3X 2WD9A 5KNBA 1WCXA 2WRZA 3GDFA 5JSQA 4XVUA 2H1LA 1NOJA 4CQMD 2A0UA 2C58A 1P74A 3TL2A 1YRAA 2ZJOA 3T7DA 4WBSA 1T3ZA 1F0YA 4JL6A 3GH1A 3LNCA 1CUZA 4Y1EA 5H4HA 3AVYA 1Z37A 3RFFA 4EA6A 1VE5A 3AERA 1SBHA 3TPFA 4EO7A 4W9MC 2FDXA 4JVLA 4MJ3A 1FY2A 5F64A 3W2IA 5FWXB 4HP8A 4Q4CA 2CXQA 2INGX 5F2NA 1G7SA 2C2ZA 1Q0TA 3ZE9A 4KDFA 2IYPA 2Q0HA 4J1TC 4M8KA 4PLZA 1JZSA 1LC3A 1YGYA 4OBXA 1BDBA 3LKDA 4X7BA 3QTLA 1IEXA 2JHGA 2JZOA 3SJUA 4X3CA 1QPZA 5I7SA 2HA4A 1PDWA 3GJ8A 4JENA 5JDIC 3JPYA 3T7RA 3U4CA 2PX2A 1MV5A 2QTCA 3OSZA 4H7HA 2A9FA 2VJMA 4OB7A 2WUGA 4P2GA 3GNSA 4DJ5X 2C83A 1QGAA 1B8NA 2P67A 3EXFA 2OY0A 2B1JA 4A3SA 4D8XA 2G5PA 4PGAA 1L7MA 5FV4A 1Z6PA 1E61A 1P60A 1WXHA 5IBCA 3A14A 3K6RA 1PBNA 1QE0A 4IGEA 5B3AA 3RRFA 3W90A 4QDOA 3NVKI 3PX7A 5EHNA 3UJDA 3PC2A 4M0DA 3ZCXA 4IQ4A 1PO7A 1TB4A 1WSWA 3GT0A 3GLGA 1CIPA 1Y42X 1TOAA 2XMGA 3AUTA 3M83A 1NW6A 2G7ZA 2WF7A 3NM6B 3IOBA 4LAFA 5DSZA 3KJHA 4RVHA 1R2QA 3HFSA 1K6MA 3DBHA 2WDPA 3RLFA 1ZJ6A 4GIBA 3Q7EA 3H17A 3VKVA 1ODLA 2P2DA 3HBMA 3M33A 2P75A 4OQQA 2UDPA 1D3AA 4Q66C 3VPFA 2W0MA 3PWSA 4HEJA 1YIAA 4RADA 4EY4A 2UYCA 1JG3A 4BMXA 1O5TA 2AX4A 3B60A 1DEHA 4IRMA 3LW7A 2ADOA 1VM6A 1MH1A 4JI5B 2ONYA 2PQ6A 1KK1A 2P90A 3LFUA 3PXUA 1X9IA 4XCXA 5CNIA 5JNSA 3FBTA 1ZXXA 4O4JB 5IUJC 1DXYA 5JQGA 4KP7A 1NI3A 3CLUD 2R1UA 1P9LA 4DCJA 2QR3A 3FIJA 3WGLA 4YALA 3DT6A 1OV6A 2Q4DA 4GX1A 1K66A 2C4WA 2QB5A 3BH6A 4CQNA 4R0VA 1KOFA 4TXNA 2YQ4A 3PNBA 1BE8A 4FGUA 4US2R 2GZ3A 1EUZA 1CUJA 1SG0A 3K5HA 4ZREA 3W2FA 2WTXA 1V48A 2ZI3A 4LDJA 3WA7A 4FU0A 4JBIA 1UZUA 1UBNA 3KYCB 5ADVA 5C9ZA 1A1SA 1SIBE 2R25B 3TLBA 2PGXA 3UJ6A 1OYYA 4X6LA 3ZCQA 1U0EA 5J59A 2DH6A 2JCVA 3DFUA 3FW1A 1GTVA 1YBFA 1TVCA 4RULA 4MSUA 3A1UA 1C29B 1GAXA 5LLTA 4DIMA 4IF6A 2W83A 3P45A 2JATA 3JW8A 1NC3A 4KVZA 1E4EA 4G09A 3NHBA 4BL5A 1ZJ5A 2V96A 4DBZA 3WI7A 5A5GA 3UJNA 3BGWA 3BRCA 4JK3A 1SQSA 1YF3A 2G9NA 2O1SA 4YP1A 4BB5A 1GL9B 1QZ3A 4ICIA 4N3CA 4LGYA 1RLTA 4L15A 5IAOA 1ZGJA 4GRDA 3B3JA 4MR8A 1G9XA 3AINA 3A2KA 1NFQA 2JJ8A 4BNZA 3L0CA 1Y7PA 5AQ1A 2UZ1B 1L5KA 2DFNA 3FPLA 2ORIA 2F3TA 3SCZA 5AW4A 4XUEA 3G59A 1QHXA 3TX6A 4BFWA 5K0SA 4B2PA 4ZO7A 1ORRA 1VIAA 2JBAB 2WUDA 2ZDGA 4KRXA 5AFSA 1H66A 1P7YA 2PV0A 2H4JA 1OD6A 1TGVA 1C3OA 3QY9A 4KGZA 4RFLA 3V7FA 3ZUPA 2NVWA 4X7MA 5BWNA 4JI8B 5B1DA 2XODA 2EP8A 3NVDA 4L27A 2OQVA 4DV4B 3N2IA 1H2HA 1E6CA 1NMQA 1Z0UA 2Z0MA 4ES6A 2VLBA 1X7YA 3BWBA 1GCGA 4LHSA 2HPVA 4RCZA 4PAWA 5IXYA 2E4XA 3RYFA 2QLFA 4GOLD 4G97A 5GAJA 1IN7A 1YZNA 2XNSA 4DCUA 4B3HA 2BTQB 2O05A 1P61B 4RHFA 4GX5A 1Q57A 1ACJA 3CEJA 2BZ0A 1ISJA 4KK3A 1UH5A 4EMSA 4KN9S 5HA5A 2MMCA 4CIYA 2J0QA 1PSWA 4EGAA 1W4RA 4MQ5A 1Q1EA 5ES3A 3SOZA 4TTSA 2I9KA 1XZNA 2IYVA 2SCUA 4QXPA 4UE2A 2GZHA 3TVYA 1ESDA 3SNHA 3FSJX 5HHTA 4QEZA 1NBHA 5JPIA 1E1RA 1H3EA 3HCBA 1XSEA 2POCA 3BE5A 1HOTA 4Q0MA 1NQVA 4ITUA 5I9NA 1QHSA 3K5WA 3OT4A 4MP3A 4Q3DA 3LLCA 3Q7RA 2J3LA 3GRKA 5KWEA 3IBTA 1CE8B 4LJAA 4FLMA 2GUWA 2OP1A 1SZJG 1XN4A 2QWXA 3L1IA 4FYPA 5CYOA 2CLOB 5E7JA 3UMGA 3Q8LA 2IPMA 2PQMA 3FUXA 3X2FA 4ZAFA 1A7AA 2GAFA 3U7QB 5DXFA 1I7NA 3KD2A 4CEIB 3TYXA 3PGLA 4QJBA 2FPSA 5DM2A 2Q1YA 3IJPA 3H2ZA 1EFLA 1KRHA 3GLIB 4J0QA 4L1KA 4R8LA 4LBYA 1K8XB 1V8PA 221PA 3S40A 5C52B 5JSKA 5DBIA 1J49A 5IM4F 2FSGA 1FLVA 4X95A 4O08A 1CUVA 4E51A 1TYZA 4OQNA 1TC1A 1XU7A 1OXSC 4GI1A 2IHTA 4NMXB 3THWA 1YJAA 1M1XB 4ZVVA 3V3KA 1XNQB 2G6TA 3HKEA 1IM8A 1YZKA 2C8KA 4YUWA 5LXTB 4J3FA 4QODA 4S04A 1U3UA 1J2RA 2QAJA 1N2HA 3AWDA 4H7EA 4HMPA 4TMFA 1E1CB 1VZ3A 5EIFA 3RADC 2HK7A 1LSSA 4BNNA 3QUAA 3UT0A 4M54A 1G55A 1Z4JA 3I32A 3V3TA 1UMBA 4LFCB 2C57A 3HRKA 2GCEA 2QIOA 3QEKA 1JPJA 2B83A 3GVHA 1ZIDA 4OH7A 3IDOA 3ZDZB 3VU3A 4YJ3A 2I8LA 2FN8A 3KDAA 5DI3B 5ISMA 1JLLB 3MWGA 1FTWA 3N2EA 3O74A 5BQXA 4UULA 4HDNA 3JYOA 5KX5F 2FPGB 4QHYA 5F2OA 4AO8A 2CV1A 4DDHA 4RZIA 3L1KA 5ITZA 1BQEA 4EUKA 3QE2A 3P26A 4GOXA 4ON9A 4UAVA 2EP5A 3SX2A 3RYHB 5F3DA 3K92A 4OKSA 1RPTA 5EGSA 3MHPA 1KAEA 2C97A 4LJLA 3WIOA 3DV0B 1L9XA 3K1ZA 2GZMA 2GLUA 4YMLA 5J43A 3RIHA 4EJ2A 3GPBA 1CQXA 1EK6A 3QFTA 4F9FA 4AY3A 3Q85A 2FN7A 1GPBA 3S7ZA 2XMPA 3DF7A 4WI1A 1GTZA 3N0W