5ECGC

Crystal structure of the brct domains of 53bp1 in complex with p53 and h2ax-pser139 (gammah2ax)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
257
structure length
227
Chain Sequence
ALEEQRGPLPLNKTLFLGYAFLLTMATTIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords Cellular tumor antigen p53
publication title ATM Localization and Heterochromatin Repair Depend on Direct Interaction of the 53BP1-BRCT2 Domain with gamma H2AX.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 227
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF18428 BRCT_3 BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 5ecgC01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 5ecgC02
4BU1A 3SHVA 3U3ZA 1IMOA 2COUA 4Y18A 2EBWA 2D8MA 3EF0A 2K6GA 4IFIA 2R1ZA 1OQAA 4IGKA 3I0MA 3T7KA 3SQDA 4XPZA 3K0KA 1T2UA 4XQ0A 2XNKA 3L41A 3PC8C 1L0BA 2E2WA 4BU0A 3PC6A 2VXBA 3K15A 3K16A 3HUEA 4Y2GA 2K7FA 3JVEA 3UEOA 3QVGB 1T2VA 3OLCX 5ECGC 3FA2A 2L42A 1L7BA 2COEA 1T29A 2LE0A 3I0NA 2EP8A 3PC8A 1Z56C 3AL3A 3K0HA 3PXCX 4OFBA 3L46A 2NTEA 3PXBA 3T1NA 2ADOA 2M2IA 1JNXX 2INGX 3T7JA 3PA6A 3SHTA 3SZMA 2AZMA 4U4AA 3AL2A 1IN1A 2DUNA 2HTFA 3K05A 1T15A 1KZYC 3UENA 4BMCA 2COKA 2WT8A 1N5OX 4BMDA 2VXCA 3PXEA 4N40A 3KTFA 3II6X 3EF1A 1Y98A 1CDZA 4ID3A 3PXDA 2ETXA 1GZHB 3PD7A 3COJA 1WF6A 3HUFA 2XNHA 3PC7A 4JLUA 3QVGA 2EBUA 3T7IA 3L40A 3PXAA 2JW5A
chains in the Genus database with same CATH superfamily
1Y6FA 3H5LA 4R9SA 2VPIA 3CA8A 1K88A 4DILA 5FNVF 1NQVA 2LUOA 1SHJA 3RCBA 4DGSA 4W1RA 1T34A 2AFIB 3DEAA 4KFUA 2A0UA 3VKFA 4EELA 5KNBD 2EBFX 3TG8A 4Z9YA 3T61A 3W2GA 4BFSA 1V3VA 1JLMA 2I6SA 3EXAA 1TIKA 3I0MA 2PXCA 3KHSA 4X24A 3EBPA 1QLJA 4OI0A 3ZY3A 2VUUA 3CCBA 3CT4A 3K09A 1X1AA 2VAPA 3IEPA 3BHNA 4FCVA 3FWHA 4PZEA 1O03A 2B4QA 5C80A 4QM7A 2GCNA 1P5RA 3H1PA 3VJKA 4GXTA 1UKVY 5ECWA 2QGFA 5L51A 2RCYA 2DUJA 3NHSA 4G86A 4LJ4A 4BX2A 2QN1A 3KE8A 1LDMA 2BFDB 4OMUA 1GEGA 4KG7A 1NBME 3GWZA 2NXEA 3PVCA 1F2TB 1GA1A 2D1FA 1U0HC 2O2DA 2D1TA 1WZUA 2Z8YA 1MBZA 3IS3A 4JU9A 1CQXA 4R31A 4A5OA 1IXSB 3PZRA 3L8ZA 4NEGA 2DM6A 1U3TA 2YVAA 3EVAA 3OT1A 4JYCA 4N3AA 5JXIA 2FPIA 4QSHA 1Q1QA 4E6EA 1HDXA 1R4AA 1P8JA 2R7NA 1XTPA 4YN3A 5BMVF 3RV3A 2WNSA 2P6MA 3G0IA 3KVNA 2NUTA 3JCZA 2IKSA 3OJOA 1Z22A 2RD2A 3BGSA 3S99A 2IYPA 2OENG 3IO3A 3IUJA 4MWZA 1YUMA 1XLTC 1OPRA 1XYYA 1LS1A 1C81A 3FWKA 3MB5A 1GSHA 5JCOA 1E8NA 2KJQA 3PXCX 2DULA 2GEVA 4LECA 4RZQA 3VU8A 1NVMB 4RANA 2DQ4A 4GQIA 2NV6A 4N01A 4C3OB 4HXYA 3UHAA 3H0CA 3OM8A 4LJLA 3JQPA 3WZMA 3KB1A 3P5BA 1J21A 1QB7A 4FSHA 4IUBS 5DEOA 3JQDA 1EFLA 4NDZA 2GBGA 3C6QA 4OI4A 4MKRA 3EPJA 2YV2A 1XWIA 4BNDA 3LJKA 4J0IA 4RYLA 2BBWA 2FDRA 3ZW9A 3ZVNA 2HI0A 2FZ4A 4IS3A 2JZCA 5CW1A 2DEUA 1G16A 3RAPR 1QH8B 3EXHB 3IAAA 4HWOA 4KE9A 4XQEA 2QVBA 2GN4A 5IDVA 5AI9A 3O2JA 3QOXA 1TYZA 3CXRA 3DO6A 4H2DA 1THTA 4KXNA 2Y1DA 4UBNA 3V4VB 3P9NA 2M9MA 3WXMA 4BGEA 2ZRQA 1KA9H 1O9GA 1KZ7B 2PGJA 2QRKA 4EUNA 1RAIA 1U99A 4J03A 5H1YA 3CZAA 3VYUB 2YV1A 1VXRA 2C54A 3UWKA 3QEMA 4BECA 1LDYA 2I9PA 3K1AA 1KK2A 3O4GA 3DYBA 1J33A 1QQ5A 3I1IA 3SLKA 5KKCA 4R2KA 3AVOA 3D3KA 1CEYA 1ZUIA 2ZPUA 4W5RA 1Q1EA 2QRPA 1EX6A 1F6BA 1G6HA 3OX3A 4YJ3A 4BP1A 1PLKA 1VB5A 4TUYF 1TOAA 2GZ2A 3CUVA 3FFXA 3L0IB 3NUQA 3D8NA 1C1HA 1SVMA 3ND7A 4LN1A 1SCJA 4MLDA 5F4ZA 4Z4GA 4YRZA 2QR3A 3W6NA 2ACWA 2GPAA 1U6KA 1QIHA 2RHJA 4NS1A 4D8WA 4MI6A 1U3DA 4ERNA 2GEJA 4OOFA 4LBWA 2YZ7A 3M6XA 2JFBA 2AYZA 1XP8A 4LYDA 1QFXA 1ETHA 3FETA 5JYDA 3AF3A 1SQFA 5FULA 4ZGWA 4IYRA 4HBZA 2OP1A 4EEKA 2ZUFA 3K9QO 3ZZTA 2SHKA 4H0CA 1TKCA 4X71A 3LYAA 5LIPA 3FMIA 5ALHA 1ZN8A 5CP8A 4QG3A 5A0VA 2ORED 2OWEA 3LQ2A 3GX1A 1NVBA 2HLPA 2D8MA 3COWA 4PF1A 4QQFA 4PPNA 3TMKA 1QP4A 1H8HA 3V1YA 1IZZA 4X1KB 4LY6A 2AJBA 2XUAA 3T41A 1TF5A 3KS9A 1KDZA 1DJLA 1CUGA 3MWLA 4JDPA 1UAGA 5ALNA 3KZ1E 1XJ5A 4BX9A 4ANFA 3DPUA 4V0LA 1JDVA 1E9CA 3E9YA 3TRIA 1M9NA 1HR0B 2XXBA 4EJSB 2XXAB 5TJ9A 2VJMB 4Q1AA 1T4GA 1NC1A 5LOVB 1MABA 3RRJA 1EZZA 1S5PA 2IYAA 3L1IA 3OECA 4FFNA 3L07A 4QYXA 5DLQC 5IAKA 3V4PB 3O4JA 4G63A 3GLIB 3G8AA 3IE1A 1H3NA 2P35A 1MJNA 2B8NA 3K15A 5HF9A 1N2GA 3ZZ1A 2ZITA 5IM4F 5TIIA 3RH0A 1DRUA 2I1QA 1S4MA 2D74A 2Q5JA 4OB7A 4E33A 3ZHBA 4QBKA 1CZNA 4BEJA 2C7RA 5DTJA 2ABWA 1UC5B 3NPAA 4MR7B 2HAEA 3LC0A 4WXMA 5JAOA 1NJ1A 2ZRIA 1GN9A 3BFKA 4HVLA 3ZJ4A 1A8QA 4DY4A 1E64A 1OLUB 2K2WA 1U4OA 1VLMA 2QSUA 3I9OA 4H1HA 1SHUX 4E88A 1ULHA 1ZH6A 3E1SA 4RDXA 4GIBA 5C81A 1DOHA 4RKFA 4KR9A 4ETWA 5K0EA 1VRCA 3VVMA 3Q3HA 2EJVA 3QLEA 3GP5A 3IE2A 1E5LA 1KMIY 2NV2B 1SCIA 3OLYA 3VR6D 1JLHA 4EH1A 4DLPA 5B3JC 4MDEA 2O8CB 2WHRA 1CS0B 3UB4A 2XTMA 2D2XA 3LGSA 1G21E 4NCBA 3HP1A 1W29A 1EQAA 2QIOA 4RZ2A 1MJFA 2ZWPA 3N59A 1Y9EA 2XNSA 4UUOA 3LPAA 4ACAA 2QMQA 3DEJA 5FQOA 2G4CA 3N9IA 3U4DA 4AC9A 1PR3A 3MRXA 1UBNA 2X9QA 1S8OA 4FZ3A 5BR4A 1CR0A 3B1JA 2Q1TA 3D0KA 2BY4A 1E2IA 5B1SA 1TQHA 3DOIA 5DV9A 1D5CA 5FADA 2IDJA 221PA 2WSLA 1M1NB 2CB9A 2COKA 3AP2A 3A6EA 4B4VA 2J7KA 3ENZA 6YASA 1OIVA 2BGJA 1Y4ZA 4DV7B 1RLOA 5H9VA 4A10A 3CN9A 1G8MA 3BD8A 1WMDA 3N5KA 1NPDA 1J99A 4Q47A 1J00A 2EFCB 3ZLVA 4IW3B 2DQSA 3GUVA 4C89A 5CGQB 4OXXA 1DE0A 2WAXA 3IQZA 1NBOA 3NPMA 2QXTA 1W88B 1N6PA 2FZGA 3PB3A 2VAVA 3OE1A 1TVKB 4ER0A 1M10A 2WWFA 4WBNB 4Q4HB 3ZV6A 1VZ2A 1E0KA 4RVHA 3CH6A 3VUFA 1ZITA 2PH5A 3JYNA 4U9HS 3ER8A 5CBKA 6PFKA 4L78A 3ZWBA 4Q3AA 5LQNA 5IH7A 4B3SB 4DY6A 1PG5A 4E7OA 2CJFA 4GI7A 2Y05A 5JVDA 4AFNA 4HDAA 3VYSB 1Z4NA 5E2AA 3WBJA 2JKZA 2Y76A 4KAJA 4NTZA 4OXRA 4UHFA 4I4IA 4I3GA 1U98A 3NIFB 1CT9A 1C1YA 2Y99A 3EFOB 3MMPA 5IX8A 4CI9A 3GFQA 5KX5F 2JFYA 5AW0A 5EZ5A 2OSBA 4V1CA 4UVDA 2C95A 2Q21A 3WK6A 3O2SB 5JBNA 3OQNA 1RPZA 4ECAA 4KWCA 2O06A 4Z49A 2AUNA 4IXDA 2NV0A 1Z39A 2XQVA 2BI8A 3C3EA 3U4MA 1WZIA 3KL4A 1DLJA 3PC8C 3FOEC 4N65A 2PUHA 4B09A 3GROA 1Z8HA 2WF7A 4AY3A 2PIAA 2A1IA 4I4TF 3T15A 4GYYA 4RQUA 3UJHA 1VE6A 3TD2A 3SZLA 1MOPA 4TOIA 1EBFA 1ZO8A 4EATA 1DJOA 2PBLA 2ZTLA 2Y0EA 3KKKA 4B40A 1CY4A 1NDHA 3I28A 3HCAA 5FPHA 3K0EA 3OURA 2PZKA 1MB4A 2A9PA 6NULA 2IEYA 2OCXA 4MHSA 1X1QA 5F9MA 3KT8A 1EEHA 1KP9A 4DG5A 1L7AA 2Q5HA 3AU9A 2JG3A 1KJYA 2L42A 1FFEA 1QVAA 1DX6A 2GESA 2X0RA 4G1CA 5GJVC 3R75A 3TIGA 5IF3A 3LUAA 4C1NA 1J56A 4JLOA 1J5EB 4FTWA 5SYAA 1QB8A 1NP7A 2C5HA 2FUNB 1FP6A 3DQPA 4E5PA 3PHJA 1CQJB 1WEKA 2JIRA 3VSEA 1HORA 3NALA 3PT5A 1ZGBA 4CWAA 1RKVA 4PYMA 4QELA 4HQOA 1SEPA 4G23A 4EPTA 1Q3KA 2I3AA 2HJSA 3HCEA 2OO5C 1QRUA 4L51A 1ATIA 3IIMA 3MYYA 1T3GA 3RIMA 5MGNA 3LYLA 4H3SA 4QODA 4YRDA 1Z75A 3I4CA 4ECEA 1ZIOA 4OK3A 1ZNYA 1CY6A 3IIKA 3IT0A 3KQPA 4X97A 5DKFA 3VR5A 2H18A 4C2TA 5DBIA 5JSZA 4KV7A 1U0FA 4KYIB 4F5WA 2PH3A 4G0UA 3HXMA 3AL2A 1ONBA 3IJEB 3OKCA 4B0PA 3NHZA 4MTLA 1UJBA 5EHQA 1JSZA 2CVQA 1PFQA 3U62A 4DDTA 1DEOA 2O8EA 1VMKA 4P58A 5EXTA 3B51X 4L73A 4N3BA 5K2MA 1COWA 4FUTA 2VK8A 1FMFA 1XEWX 5LJIA 2PZFA 3NHPA 4RZUA 2D00A 3NWEA 2FP3A 2AJDA 4DUGA 2WTEA 5JMPA 2ASVA 2UDPA 1NXTA 1GAWA 3QU7A 2Y1KA 1Z45A 4G5XA 4PZ0A 2EBHX 1QR2A 2I2AA 1U1EA 1TJPB 1F5NA 4LJ8A 1WPXA 1QVWA 2D2VA 1TPYA 1F0YA 3N1UA 4EMUA 4AX4A 4HX9A 3ZJUA 1KR5A 1JRLA 2H63A 3DE7X 1Q1AA 3NJRA 3KQOA 4G37A 3GPBA 3SXPA 3AOEC 1Z4OA 1E2BA 5JWRA 1OXUA 1PZEA 3K9BA 2AZTA 3MD0A 1E1QD 1S0UA 3PJDA 5CFOA 3B13B 5EJ7A 3WRXA 4M37A 3OLZA 3EXIA 4MB2A 5FNVB 3IX7A 3ZWMA 2HWYA 4R51A 4V02A 1GNTA 4R3WA 5CT5A 3AHDA 5FUWA 4N3GA 4TM8A 4I9GA 3MUFA 4EK9A 1QANA 2JIQA 2PLRA 3JD2A 2OCKA 2P3QA 2IY8A 4RM2A 3WNQA 3ZBUA 4QVIA 3QFCA 2F9FA 1NSFA 3AB8A 3LQQA 5AKYA 1PZHA 3U4HA 3G6KA 3ZJTA 2F1OA 2PD6A 4FYJA 1G2PA 3BREA 2EHDA 5I8PA 1RXCA 5JXGA 2O3RA 1SY7A 5IJXA 3NYIA 5CGZA 1SD2A 1ULUA 1MW9X 3CO0S 4C4RA 2B20A 2X0KA 2XPCA 3DEKA 4YROA 5EMHA 1I80A 3SS7X 2PG3A 3BK1A 3T0IA 3GG2A 1BD4A 2VXOA 1P74A 1THMA 1XVIA 1PTJA 4F8YA 4UHBA 1KYWA 2W00A 5LWHA 5IKXA 1Z25A 1V9LA 1TKRA 1EFHA 1OE0A 1YQUA 1E3TA 1QZZA 2B34A 2QUKA 3ANTA 3AQIA 3IUSA 4FBMA 3TN7A 3UAVA 3UV6A 1JILA 2JEYA 2F1HA 1V16A 4RLSA 5CH5A 5JRDS 2CEAA 1H05A 2WLSA 3I2IA 2WJZB 2O6HA 4QASA 5P21A 3C6XA 3RO7A 4C21A 1AZLA 2GUGA 4MWEA 5KNDA 3BE5A 1MQAA 1PS8A 3UPDA 3FY4A 4KR3A 2EZ8A 5AW7A 2CYCA 4DREA 3ETHA 3DT9A 4Z9FA 2F7SA 3C98A 3BMNB 3N2ZB 4JI1B 3UWMA 4IV8A 3EX7C 3NYRA 1CQWA 2QVZX 3NIGB 1YMVA 2Q0QA 2Y1FA 2R4QA 4R83A 4UPVA 2LPMA 4BVJA 4RAOA 3HKBA 1CUFA 3I09A 3D8SA 3IV9A 1QHFA 3H2GA 4P2BA 3KYIB 1D4ZA 4GX0A 5BQ3A 3VHRA 5ISMA 2QD1A 4E09A 4M88A 3I3OA 2J6BA 2ZJ6A 1WP4A 3Q5DA 2PMKA 1YVRA 3ETEA 2NU9A 3L7YA 5IUNC 3REFA 4PYLA 1JEDA 3BEOA 5J5CA 2GXSA 2FJUA 3T8YA 2C4WA 4N6NA 1V6AA 2GPYA 3JRXA 4IJMA 4NE2A 3VU9B 5J59A 2HWWA 3AM3A 1W85A 3N53A 4N1AA 4OHUA 1H69A 1Z8NA 4ESVA 1GNRA 3DPIA 1AB6A 4K9DA 4L50A 2H2IA 4I08A 3R5HA 5AMXA 2FMTA 1IN4A 1HEYA 2DZDA 2GERA 4JKYA 4BN4A 3WLIA 1M8KA 2OUIA 2PGOA 4BGIA 2PVSA 2PXXA 2VJKA 4YI3A 3WQBA 4XA8A 1FF9A 3GJ6A 2XCIA 2PWYA 1Z2OX 2G0NA 2A94A 4RD2A 3F71A 4TUYB 3EPHA 1T9HA 4WKOA 1CP2A 1B15A 2WSSA 2WKPA 1KC1A 4MRAA 2IZ1A 3TTSA 3R3UA 3VGJA 4CLRA 4QM6A 1RFGE 2FETA 1NJ6A 5EEHA 2VF7A 1KE2A 4HRXA 4CV3A 3PZBA 4MS1A 5I9BA 3F1LA 3URKA 5E9QA 2AZXA 1CUYA 1B6TA 3QJ5A 2C92A 5E38A 1P3JA 3RYFA 2CMDA 3UJ3X 1K68A 3IQHX 4CM3A 5J3JA 3AHEA 3VTFA 3WBKA 3HWSA 2JARA 6AT1A 4TVOA 1D9ZA 1J8DA 1SN7A 2V7VA 2QXYA 2VSQA 3ACCA 2MINB 4QAQA 2VDWB 4RNDB 3U6BA 3AJEA 4UREA 4ARSA 1U9JA 3NAMA 2YHSA 2VS1A 4U6NA 4XARA 3CZRA 5JRJA 2MT9A 5MFZA 1DX4A 1X7WA 5ALUA 1VSUA 3E22A 2XW6A 1YZYA 3ZD7A 4CMEA 1RRMA 1SC1A 2QG4A 4P82A 4PTLA 2ID4A 4U2KA 1QRAA 4UD6A 4ZEWA 4QREA 1N9GA 3U1VA 3Q8MA 2WVHA 3PFWO 1FQJA 2NZJA 2JGRA 5JDCA 1XE3A 1P5ZB 4KQHA 1NUPA 1LF0A 1AC5A 1RIFA 2OG2A 4EGQA 3TM4A 1MF7A 1CK4A 4GEGA 1IUNA 3MJVA 3E5HA 1JU9A 2ZYRA 3EWNA 3PPVA 4RGBA 2WJYA 4DADA 4H4EA 4IJUA 2YYYA 2B0CA 1M2FA 1JHDA 3EUFA 4WRRA 5DI3A 5JBQA 3FMGA 3LP5A 1YZVA 4D46A 3ORYA 3QKSB 3ZCRA 2HQ1A 1Z15A 3PX3A 3B1FA 4HNGA 3F47A 5CFNA 1QGED 1OGYA 1R0CA 3ET5A 1ZOOA 2XT0A 5K1ZA 5C9ZA 5LKAA 5IN4A 4A8TA 1HLPA 5DYWA 1FDRA 1PGPA 2V3VA 3PEVA 4O3MA 1PU2A 4HAZA 3WQHA 1Z0IA 3UJNA 2GUWA 4L27A 2IUSA 3SAJA 2JLCA 3TI7A 4L6AA 3CIFA 5LCXA 3PPXA 1PZGA 1ZJYA 3B38A 3TLBA 1R5JA 3T3MB 2ILVA 1UMCB 5EHNA 5BN3A 3RLIA 2ZSEA 2IH2A 4HEA6 3EASA 1C8LA 3QM1A 3GHYA 2REOA 4XGRA 3R7BA 4MO2A 4BKRA 2YWRA 2WWHA 2R8EA 3G23A 4LK3A 1E9RA 4M9UA 2CHUA 2ZYHA 2Y71A 3EPKA 2I1WA 4J16A 4FP9A 3PXGA 1YS6A 3SG0A 3V8BA 3T7JA 3UT6A 1XDGA 2R48A 1MNAA 4N39A 1SK8A 3F1KA 2ZCJA 3TQSA 3CH5A 4R7ZA 3M6LA 5IHXA 3G2KA 3DZCA 4N49A 4ZRMA 5FP0A 3GJXC 4LBVA 2CBXA 4Y1EA 4ZQCB 5HYVA 2CV1A 1JDZA 1YB1A 2VWPA 5LYJB 4GUAA 4O3FA 4NCNA 2FPSA 3TNYA 5DE3A 2ZXEA 4UVEA 4ZVVA 3ZBPA 1EB9A 5DK6A 4NHEA 3T94A 1M2KA 1FZTA 1QRSA 2AOVA 2R7MA 4YV7A 4CF5A 3BEDA 2Q6OA 4TN5A 4Z0PA 3FLEA 1P1HA 5BW4A 1KYYA 2JEOA 2QN8A 3RSFA 5CB4B 1JLLA 5FTJA 3VOAA 5ALKA 4IDQA 4JYPA 4ZDJA 2IX3A 4P34A 5LOVA 2XQGA 1F7VA 2ZB7A 3NHJA 2ODEA 4AF6A 4RZSA 3ZDZB 1OXMA 3KOXA 4J94A 3THWA 1V9SA 2XI4A 3WQSB 1ZGAA 3NVMB 5IBPA 1K5GA 4I99A 2PZ8A 4DJJA 4IHJF 4WJKB 3UO8B 4D98A 4DMMA 5A5VA 1JFTA 3ESQA 3GLFB 3OJ0A 1PJAA 2HF7A 5GPBA 1WG8A 2R1TA 1WBJB 3M8KA 3N2GA 4IMRA 5A3SA 4B47A 4Q3CA 2WJHA 3CUYA 4LX0A 4KPEC 4Y3UA 3REOA 3I05A 3N2YA 1Z63A 1SVUA 4LG1A 3I6ZA 4S1TA 3WR5A 2B5WA 4B35A 1TUBA 1XZIA 2VHXA 4FT2A 3WDSA 4EARA 3ROPA 2XYPA 1A8IA 4FN4A 4B5KA 1X9IA 2QV0A 3LK7A 4ND5A 1MJGM 4FI3C 1MVLA 3O6VA 1IB0A 5L53A 3U6KA 1MU0A 3MS2A 4CKEA 1L3IA 3FF1A 4I4TB 4H1WA 5IVPA 1FU7A 3LG2A 2EVWX 2OG1A 5DBFA 4U3JA 5JCOC 1SUIA 2BKEA 4L9SA 4EG3A 4LDAA 4KVGA 1YZNA 2EZ9A 3TO5A 4M0UA 2X2PA 4RLFA 1NOKA 1T0BA 3C48A 1YR8A 5CT8A 5DF1A 1AN0A 1U0NA 2I4LA 1DQRA 4MKXA 3LLCA 1U0OC 2OLKA 4O2LA 1L1FA 3RG2A 2PZLA 1HT0A 1V96A 1CRZA 4NXNB 1V0JA 3LLSA 1AV6A 4HLQB 2AX4A 2J9YB 4HUTA 2FLVA 2YJ5A 3V1NA 3ZY4A 4WAUA 1UBFA 2B4AA 2HCFA 1F2UB 1UM9A 1SQ6A 2QW8A 4ZOLF 5G0UA 1Y7HA 3EWSA 1WABA 3OLWA 1U80A 2X3YA 4A4DA 1L1RA 5E9WA 4QTTB 2OZPA 2XOEA 1SB8A 3AEQB 1FOEB 2X0DA 1QHNA 4ND8B 2FP4A 1FJHA 2OV6A 4MVWA 3SEZA 3WYDA 4A1FA 1JE0A 4TMTA 5KWIA 1RKUA 3AP3A 4X7RA 3QSGA 4WGGA 4MVJF 5KTSA 4C4YA 4NOMA 2C3OA 4P31A 2HLDD 2D8AA 2JAQA 2JI4A 2CL5A 3AY6A 3H9GA 3FTCA 4KH1A 3IMFA 2H4WA 4MGHA 1OZ0A 5JXHA 2BEUA 1T0IA 3N58A 5KREA 2X5JO 4MDFA 4KQ2A 4Q1BA 2AN3A 1E92A 3IQWA 4XEHA 3DMHA 1ZUHA 1E9SA 1X38A 3NEJA 2N47A 2VH2A 4GLJA 1ZSVA 4KVAA 2EFDB 4LXIA 4OXIA 1U8YA 3THRA 3X1ZA 4J43A 3ZE2B 4KPUB 1XMQB 1XZAA 1CEQA 3X1DA 1XKQA 4TMFA 3JVUA 4BBJA 3ZJVA 3ZWQA 4CE6A 4ZXFA 1ZJZA 1YVEI 3P0RA 1AKVA 3ZXYA 1GZ7A 3IPXA 2IXTA 2JFUA 1I13A 3WV5A 2O2GA 3DL2A 2YWXA 4QTXA 2DUNA 3HCNA 4UVHA 2ZYWX 1D8TA 2RHWA 4BY9E 4FUQA 5ADHA 3GT4A 1BJRE 1FP1D 4FQ8A 2YNMC 4DJAA 4ZANA 3G89A 1XDUA 2K7ZA 2CV0A 3RQSA 1H6AA 3MUEA 4MR9B 3AHHA 5CM8B 1WE2A 5DCWA 3GLHA 4CM9A 2CVHA 3P0FA 1OR8A 2I7XA 3NEPX 3X1YA 2B5OA 3I2KA 1XX6A 5GJCA 2A14A 3WO0A 1ZINA 3D6FA 4KXMA 2JBAA 2Y1EA 3FDJA 3M6IA 3FCXA 4MQ6A 1GLGA 3NNDA 1BW9A 4MICA 4JJZA 3LF2A 3ONEA 3LNCA 4IILA 4ZYZA 5L7WA 2ZT6A 3FTEA 3ZYZA 2RGEA 2ZBFA 4LYJA 1GZ6A 1OXSC 2ID8A 2PRZA 1GCOA 4KO8A 3O7WA 4R1TA 4JXJA 5K3DA 4B6PA 5KOIA 2G9ZA 4BVLA 3EHDA 3T3HA 5BSGA 3K4QA 3RHFA 4F3CA 5B37A 5JY6A 4D3YA 1A4XA 1FMCA 4BKOA 3DP9A 2OE2A 4FS3A 4KK4A 2O2HA 2FMUA 1RWPA 4BNXA 5JAPA 5I7HA 4ZYTA 2Y6UA 1U28C 4CLDA 3A70A 3B2QA 1NVVQ 2L18A 3MBOA 3VKVA 1M2HA 3TEJA 2X7XA 4FBLA 4QYTA 1Z33A 1L5SA 2ZBGA 2ATEA 2QTMA 5KMGB 5FT9A 2D13A 3E9DA 3FAKA 5IMBA 3BJEA 2PUJA 1NMXA 3EQZA 2G70A 4G67A 3ER6A 4R2LA 4TQ9A 2C9CA 2ECQA 1XTQA 2NO1A 2YY6A 3V1MA 5HCIA 1UXIA 2VP0A 3IBSA 2C1XA 1L4HA 4JV5B 5I7WA 4C7XA 1ZUNB 2Q4OA 2CLEB 1UQTA 3A6ZA 2Y2UA 2E5FA 3TLZA 3A9SA 3PQ5A 3DV0B 4LC1A 4CUZA 2IYOA 3MGGA 1L0BA 2NQTA 4PYOA 4MPDA 2A30A 2P62A 3E1GA 4H1TA 1DWOA 1ADGA 3P96A 2BGGA 4N18A 4UCXA 2ZT5A 2O8DA 1NUUA 2PKWA 3Q5GA 4YMGA 3H5VA 1XC7A 2HDHA 2JGAA 4P32A 4P4GA 2JDID 3ANLA 4NZYA 4ESEA 5AW4A 1R0XA 4UQLA 2VBFA 3GLVA 4G01B 4REQB 2W90A 4GP7A 3H75A 3LECA 1D2HA 1G66A 4I55F 1D8AA 4FFSA 5ELMA 1HF3A 2AHOA 2PKQO 2QZ4A 3FSJX 4OGGA 4Y2TA 5AI4A 5SZHB 3WGNA 5DEIA 3N8IA 1PGNA 4PWZA 1UBHS 3PWTA 3OIFA 4OHVA 3LPLA 1XCLA 4RWZA 4WCFC 2X8JB 5HRCA 1JG1A 1I3KA 4H18A 3IMEA 4OLHA 2JD2A 3E3NA 2GB4A 1NONA 3QV1A 4IDHA 4QX6A 4FGUA 1RT9A 2FFAA 1DWUA 2X8LA 2YXDA 3AERB 5JJCA 3B6EA 1SOUA 4OSPA 2QP9X 1C5KA 2X58A 4MW0A 4FI3F 4U8HA 5DX8A 3PLRA 3R6DA 1SUEA 5AW6A 2RGNC 4U0KA 1N2EA 2XRMA 3LBIA 4BP3A 3U1BA 2XVZA 3PGA1 2WUEA 4ZC1A 1R64A 4TZ6A 2QXUA 1VIVA 5CBPA 3OJFA 1E60A 1PJZA 5DHPA 3A0UA 4RMNA 3HUUA 3T12A 4WOPA 2FN9A 2OL4A 3OT5A 4MUKA 1LLUA 2OB1A 2R8OA 3HABA 4JSRA 3WKEA 5JQGB 1BKDR 4OA5A 3IBGA 1Y82A 3K6RA 5CLLA 1FP2A 4HH4A 3VTZA 3D3JA 1ND6A 2EJBA 3KIPA 5B6IA 2ICAA 4FGLA 3KVRA 4FONA 1G4HA 3HNOA 5H68A 2HRRA 3CU5A 4F2WA 4MYTA 2F6RA 3SFTA 2IOFA 3NZEA 1B0PA 2OHHA 2QSZA 1YVDA 1RBMA 3JXEA 4R1PA 4BO5A 1XJ0A 2V98A 3PXEA 1U7WA 3N3BC 2NWQA 4B3XA 1Y9JA 3LVBA 1J2JA 3RBXA 3JZMA 3TTYA 3HU3A 1VJDA 3CSUA 4LTMA 1QSGA 2JFOA 1A9YA 1A8HA 1ADJA 1MV5A 3BGIA 1A7JA 1RI4A 4EW2A 1NXXA 4U2DA 5J43A 2DPMA 3ESRA 4B3DA 3VISA 2WDPA 1RYMA 3DWIA 3WWEA 3ZHYA 3LHIA 2HPZA 2WW8A 3KOOA 2JRCA 2K87A 1T0JB 1BD3A 4IOLA 2WE7A 2KPOA 2FN7A 5CXXA 1IOWA 3RRZA 2YW2A 3A4VA 2AXEA 3O4HA 1PSZA 3OD5A 4CEIA 1Q57A 1AQJA 5FBLB 1ORHA 1R74A 1RCFA 3MFYA 3Q5EA 3MJFA 3S2SA 5EJAA 2Y0DA 1CU1A 3EEYA 4X1YA 2DERA 4WCVA 4JB3A 5AVZA 1NW4A 2VQEB 3WGLA 3GAZA 4FR5A 1VXOA 3I92A 3ORSA 1CYEA 5GV8A 4LRSB 3VM6A 1E3LA 2NP7A 1NQWA 3MPUA 1G4AE 5SZIA 4IUCS 4BC0A 2RAUA 1GQYA 3FJOA 3H18A 5BRNA 1XRQA 5KCZA 1G3IA 3HV2A 5B3LA 5TPWB 3D6VA 1E2HA 2VF8A 4HYQA 2ID7A 1X1TA 3OF5A 1FYWA 1W4RA 2OXRA 3A4NA 3NDPA 3QIAA 2WPNA 2VH1A 4KN5A 4D0RA 4CF4A 1F17A 1X70A 2QUAA 2NVOA 2WK1A 3OCYA 2VPXA 3DNFA 3RU9A 2PUGA 1QTIA 2WJGA 2A1TS 1PL6A 2WWTA 2YIMA 3L8FA 4LY3A 5NLLA 2Q46A 4X8OA 5DDIP 3I9V6 2WAYA 4UPDA 1KMHB 3M4XA 4BFUA 1YK0A 2EJTA 3PQCA 1SCUA 3HBJA 2HCTA 3OIYA 3ZCQA 2HSWA 1T91A 2R3SA 3A2LA 4Q4DA 5JFTA 1LRKA 3LLUA 1P7ZA 1ZVVA 4C6RA 5JMOA 1AZSC 3SHFA 5IKEA 4TMXA 4DMHA 5E3IA 1PFUA 4ODIA 4CUJA 4KO3S 2CJWA 2IEAA 2IC5A 1R4ZA 3NTQA 1HE4A 3GGSA 4J29A 2XADA 3QHPA 3WWOA 2H8GA 1EB8A 2JA2A 3KUXA 4XCXA 1ULTA 3QVLA 3UVEA 4CIXA 4FFWA 3F4LA 3QVXA 3CUWA 2FR8A 2CMHA 2PA0A 3NDJA 1MHPA 3Q3JB 4MQEA 4TXMA 3ZWYA 5I4BA 3EEQA 2B99A 3JRNA 4IO0A 4DCVA 2JD0A 2POQX 2QK4A 1AKTA 3H9EO 5H4HA 4IMJB 2DT5A 2VJOA 2BDTA 5JECA 3NIBA 5BUCA 4W5TA 1VMEA 1YI8A 3QX7A 4W8OA 1W5AA 3IP8A 3R5KA 2Q99A 1FCJA 3ESZA 4ZK2A 1UBRS 1U0SY 2J9FB 1ZAYA 2ZRBA 3SS8A 4BASA 5THKA 3RLFA 1GR1A 2QZPA 3RUAA 1XU4A 1B8NA 1YS2X 4FYHA 4S1OA 3BHJA 3HU5A 2VJYA 3EMDA 4FZRA 3ZYCA 3UJCA 5D3ZA 2RGRA 3LVQE 1KKUA 1M7GA 2GN8A 1NF3A 1ST2A 1SQ5A 4MV3A 4QUDA 4Y0AA 1FNMA 1Q0UA 2TMKA 4UDXX 4XSHA 2FPPB 1G42A 4LDJA 1U9CA 1VE5A 3BTVA 5AHWA 2LCQA 1EM8A 3WRXC 4XOUA 1T5TA 3E03A 4YRJA 1ECJA 2PTGA 1H9CA 1AQ6A 2CLHB 2YCLA 4OYLA 1CR6A 4LS3A 4I4LA 1QIIA 4IJWA 4YGXB 2JI6A 1JI0A 2PQ0A 5EPUA 3NP9A 2HA5A 4N8EA 4K9NA 3E5RA 4DCOA 5K3EA 1OWNA 2RCNA 4Q39A 4DAEA 3RFUA 2Y66A 5LFAA 2ZM6B 2J3KA 1KPIA 4NBUA 4XWYA 5HGXA 1OKKA 3AVWA 4NATA 1P6QA 3AVVA 4ARCA 1EHIA 2R4UA 4X84A 4I50F 3HCCA 4KLAA 4WE3A 3MN1A 3WG9A 1R27A 3EZ9A 3IP1A 2VFAA 4AJ1A 3A2MA 1QU3A 1A98A 1TM1E 4UASA 4FNOA 1JQBA 2UYGA 1XCMA 3P9IA 2G77B 3WMWA 3M6FA 1GZVA 2JGEA 1DCMA 1MX1A 2PVPA 3OX4A 3EAGA 4WKBA 3WSWA 5ES4B 2DX7A 3IDQA 4GICA 3NI2A 4LBYA 1TC1A 2B4TO 3CG0A 1Z0JA 3DLCA 1K3FA 4RD0A 4U8GA 3TW0A 4YV0A 1A9QA 2GCPA 3FE2A 5JVDF 3BILA 1U2TA 1H8EA 1TQDA 2B6NA 3N86A 3AEKB 1NAHA 4GSLA 2XMZA 3TLMA 3IKLA 3ZN2A 2CVZA 3BXPA 3QXSA 3IGFA 3HA7A 4KRXA 3TS1A 4FWIB 1JW9B 2XUFA 1VG1A 3FWYA 4ITUA 3TRKA 5L3ZA 1ONOA 2EEPA 5DYYA 2IXBA 1GCUA 2ZBVA 4WXHA 4RWEA 4BEWA 2PT7A 3DAPA 3E5MA 5A0TA 3D59A 4DG9A 5CPBA 2ZS7A 2Y1GA 3KOUA 3O1IC 3U3DA 3G1TA 2PKXA 4TTRA 1TCBA 1LDGA 4BLQA 1U1IA 3O1HB 4HN9A 3AVPA 3P2EA 3P26A 1RACA 1XNJA 3ULKA 1ENOA 1KFKB 3NP7A 5DNCA 4M8KA 1QU2A 3UJPA 5KYTA 1DC6A 2XF8A 3PKJA 1T10A 1AGYA 3EVFA 4OIFA 4R2IA 4LGYA 5EYPB 4UEQA 4AUMA 2B21A 1GYQA 1U8TA 2JBWA 2BGLA 4HHEA 1HNNA 4OFBA 5ANRB 3I9FA 4JBHA 4ZVMA 3RK4A 5IF9A 4RMHA 1SG6A 3M2TA 5ITVA 3TNLA 4D82A 1EFCA 2C9BA 3BIJA 1OAKA 3CX7A 4UCQA 1JFSA 5A1TA 1LDBA 1U2ZA 2YRFA 1WR8A 1IEWA 1IZ0A 4OQ4A 1O5TA 1AKUA 1U8AA 1ZA2A 2A57A 4FHCA 4IM7A 5CCEA 2XDAA 3CXUA 1VKOA 1SUSA 4NESA 2WD9A 1HYGA 1GTG1 3KKQA 3SC4A 1AS0A 1IIBA 3TBHA 3D3EA 4GFDA 2ZAMA 4HEJA 4FDUA 1DC8A 3M89A 4QLOA 1IONA 2V9ZA 3TJRA 2UYCA 4O8ZA 3QGMA 1ODCA 3DQZA 3VTKA 2WJ6A 1S3FA 3V8PA 3OFND 3OZWA 1TT5A 4KMMA 5KSWB 1CZRA 1YFJA 3HNRA 1OC4A 2TS1A 2AVDA 4TWRA 4R1SA 2BDUA 1XFDA 1A3CA 1D1PA 1Z73A 4P7JA 1B8VA 1TCUA 4TTAA 3RFXA 1ISHA 2I4IA 4GECA 4X8HA 4XOIA 5IXSA 3I12A 3IUMA 4Z54A 3D1LA 4KODA 3VC7A 1PGJA 3KJNA 2VRWA 3UK2A 2QRHA 4ER6A 2ARKA 5CFLA 1RZRD 2YW9A 1VTKA 3IR6A 4G4SO 1KWKA 3M7IA 4GOND 3TB4A 4ZTUB 3OVMA 4Z4FA 2HHAA 1GUAA 1RM3A 1N6RA 1CF9A 1KR2A 2F3RA 4DIKA 4OTZA 5FI1B 2P2SA 2BR3A 2FW0A 2V5VA 2X1MA 2C3PA 3KALA 5ALZA 4CKCA 3PG5A 4Y2YA 5C7OO 2JHAA 2D1QA 4QU9A 4MARA 5K0LA 3NOOA 4P08A 4RTLA 2UV8A 1ENPA 3P0JA 1Y6QA 5JZMA 1EJBA 5HKOA 2REBA 1LDEA 4IJ6A 1W2GA 1M34B 2B2CA 3VI4B 1ZM3A 3QBDA 5I7OA 5CJPA 2GAJA 3L82B 2GLUA 4KNWA 4N0EA 4BNHA 3P0EA 2ZIAA 2HC9A 4GPD1 3FYCA 4S1NA 5KYNA 1Z16A 1Z5WA 3B7GA 3G2LA 3S1AA 5FBRB 4OJTA 4C4XA 4J0KA 3SQDA 1W46A 1HX7A 1EESA 3Q3IA 3U40A 1UFQA 1DO8A 1OWMA 1XTIA 2VZEA 5E8RA 3LDFA 4DRYA 4GPBA 1J7JA 1LPPA 4WLFA 3KSZO 1AS2A 4F0JA 4IFBA 3D2AA 4AROA 4MWDA 4BLSA 1GLVA 1GG8A 2BKXA 4E14A 3E18A 3GAMA 3H9UA 2OBBA 1FQKA 3H19A 6LDHA 1EWKA 1N57A 4KU4A 3JVDA 4N8SA 1ZXXA 5F23A 3CN7A 2GILA 2H2GA 2ORYA 1IQRA 3H1FA 4HDOB 1EUZA 1J5XA 1E2JA 3O75A 2VJPA 4GSYA 4I55B 4PW0A 4AU1A 4X65B 4K46A 2DFTA 3OEWA 1YULA 3PD0A 4FFDA 5CM9C 3T5MA 4TT3A 4CL8A 4D4IA 4CMAA 1YRAA 4NKRA 3MGBA 1L7BA 2WC1A 4HDMB 4IIJF 4J16C 4NCIA 3OT1B 3HVKA 1RWWA 2C5AA 3BXOA 2J85A 2FZ5A 5EVCA 1UBOS 3FNFA 1KEKA 1UPUA 1Q5PA 1GUFA 1F0PA 1V1MA 2XMPA 1I2ZA 3PQEA 5TT0A 1SH7A 1GXSA 4BAUA 1SUDA 1EP3B 3MWFA 4RKRA 4NICA 2XJ4A 2PO5A 1ZIDA 5AUNB 2EG5A 1DIHA 1E1CB 3R2JA 4D0NA 1RQGA 1YZ3A 4LJ7A 4HUJA 4LGVA 1XD9A 3OOSA 1XN4A 1ORTA 1RJEA 1BCSA 2GYYA 2PRJA 3MVEA 1KTVA 1JFFA 2FR0A 4ZFNA 4KC0A 1QQTA 2BJVA 4H35A 4C3UA 3VRHA 1AM4D 1GFWA 5D1NA 3AF1A 1KE1A 1NASA 3BMCA 3ZZ0A 5G0TA 1KHTA 4H3KB 4LDNA 3T4EA 3AP1A 3OC0A 4F3KA 3QF4B 3VR5H 3U37A 3H2SA 4F2GA 1RMYA 2XCQA 5KJ6A 2UUCB 1V3TA 1OHHA 1Y3DE 2FOIA 5EHZA 3JALA 4XLZA 4D3DA 1OYYA 1ZMRA 3WGTA 5TXGA 2ADFA 4PN3A 1TMYA 3PCRB 3R3ZA 1UEJA 4WECA 5DHSA 2MMCA 1I5OA 1FYVA 1GQOA 4MQFB 4RJKA 5CFQA 1P75A 1TD9A 2B35A 2GZAA 3E23A 3OKPA 3Q7IA 4R8MA 1KKLA 1M72A 2JJ2D 4YDRA 2RKOA 1NBWB 3DXXA 4YX9A 1N2SA 2IEGA 4Z0TA 4BEVA 1C7QA 4RJLA 3IQDB 1UDCA 4Q4JB 5H7XA 4LKRA 1FDSA 4AS3A 2HZBA 4ZGGA 621PA 1X0VA 1VRVA 3WSVA 1CUCA 1JALA 1U7DA 1N6LA 1BMDA 3N3AC 3BXHA 4C0KA 5IANA 2X0EA 4AECA 1WHTA 4QLBA 1VLVA 3ELDA 1ZLXA 3NMUF 2XGJA 2PGIA 3F97A 1KZ4A 2BLNA 2GWRA 4JLAA 3ANYB 4L9WA 2YRWA 1VYUA 2E4WA 1VP3A 2BFAA 4ARUA 4NE9A 1Z6QA 2F8TA 3W8FA 2IHVA 5K99A 4CMIA 1K6JA 1Y4DE 5CG2A 4YRGA 5KYXA 2EYUA 3BMXA 4LCJA 1FP4A 1NUTA 4PQRA 1SIWA 2K6GA 3KU1A 2A5FA 3BZWA 3TDKA 4YCNA 3PNBA 1TJNA 1EFDN 4Q5IA 4LF4B 4V0NA 2I99A 2FDCA 2LKDA 2XE4A 3INNA 4ZIRA 4U7FA 1H0SA 2HU2A 1ZZEA 3KEOA 1KARA 2IPMA 3I6IA 4INZA 2JLAA 4TSRA 4DEYA 2Q4BA 2GLTA 1TA9A 3NJ8A 1CZUA 1ZESA 1PEAA 4PGHA 4PLVA 4A92A 1Y89A 1NVEA 4EB6B 3ADBA 2VOEA 3IHLA 4A8PA 2W4IA 3PTAA 4RPIA 5BYBA 2YWDA 3O8NA 3SI7A 5G1NA 1VGRA 4GQAA 1V4NA 4QPJC 4L75A 1Y9ZA 1VL6A 1WKCA 1PGQA 1MABB 1YIDA 4B6JA 1Z5VA 4JOSA 5AVUA 3TZQA 2GEBA 2F67A 2O8VA 2H1WA 4K2HA 3PEFA 1WB4A 5A6VA 4K6KA 1CHNA 3EA0A 2QDKA 2Y93A 5AJHA 2R11A 3HRHA 5T64A 3TQHA 4CT0A 4JIGA 3L8YA 4O02B 3OFKA 1L7DA 3HFGA 3RNOA 3VAAA 3ETGA 5GADl 1EGHA 2DR0A 2NZWA 1LX6A 1HUQA 1QHHB 3DT8A 4JL5A 2PL3A 1GZ4A 3B7PA 1NQAO 3VDMA 2D5IA 1GFSA 3WL5A 2PMFA 1B43A 4UXHA 2YJTD 3PHIA 4K0RA 2JLQA 4RVCA 4RZHA 3F96A 2NPIA 5JZOA 3TLCA 3ZWOA 2LNDA 3ZXUB 3W5VA 4H6WA 4IIDA 5DWDA 1N2XA 4KR2A 2X6RA 4EY5A 2PV0A 5IPFA 1J9EA 2Q29A 2W2TA 1EZ1A 3KZXA 4V2UA 4JR0A 3BAZA 2C1EA 5CX1B 4GRDA 3PI6A 5BUZA 1DXQA 3C15C 3DUWA 3E15A 3FXAA 5AJTA 4EKDA 4ZKDA 2V6MA 1C4XA 2W2QA 5AK5A 1IXYA 5DM1A 3CRRA 1A7AA 3O2QB 3PD1A 2NYVA 1K98A 1J1UA 1B0ZA 1GVNB 3OLXA 2JKVA 4ZXPA 4WCFB 2QJRA 4KFTA 5JWOA 2FWRA 3AWDA 3AZOA 3STTA 2O59A 3CEAA 1EX9A 3IHKA 3PDJA 1FUEA 4AKTA 4DDHA 4G0VA 4BUZA 1P18A 2JHGA 1U3WA 1XD2A 1J97A 2EP5A 4UMVA 4BQNA 1IBKB 3CKMA 4MYSA 1K5DA 1ZD9A 5F1PA 3W8DA 2WP0A 5AKLA 1Y4UA 4UEOA 4DYDA 3PXXA 2E3JA 4GDMA 3D3QA 3D1VA 1O94D 2B1IA 4I50B 4URYR 4AY2A 5CD9A 1VA5A 4F2PA 1GKYA 2DSTA 1Y5NA 1IY0A 2P77A 3ZVLA 5H3LA 2ZBEA 4RHXA 3S8MA 2C31A 1E6MA 1IWPB 4LOKA 1XRPA 4KXLA 3RANA 4TLBA 2N46A 2OAEA 1HZZC 1XLVA 3E7XA 4XFDA 3EGDA 2UUBB 4O33A 1BE8A 1TTQB 3LE8A 1PSDA 2GEDA 4ZA2A 3SHVA 4DSUA 1NKTA 1G8YA 2ZRKA 3G68A 3JZFA 4NK5A 1P4JA 4CM1A 2BGUA 2VF4X 1YOBA 1U0LA 2Z8YM 1NVTA 1PNTA 1GNPA 1RJ9B 1RJGA 1WOMA 1XD8A 3QKUA 3UXHA 4B81A 2VH5R 3F73A 1KBOA 2GVDC 4TS9A 2YMQA 4HJRA 7ADHA 5L4NA 3CRW1 1IVSA 2ANCA 2R1ZA 3C43A 4O59O 1T2DA 1JT9A 2QN9A 3EZXA 3N6VA 3Q2KA 3GVXA 1DAKA 1TIBA 1QFMA 2FLWA 2H6EA 3GRCA 4QHSA 5HNKA 2DECA 4G0QA 4NL4H 2ZZMA 1JDJA 1RM5A 4F5EA 3U80A 2NN3C 4RA6A 5DXFA 4R54A 5BRAA 5JCZA 5HX7A 1HT2E 2I3GA 3OOJA 3IKMB 2MIIA 5E3JA 1G7CA 4HH1A 5A4AA 1J8MF 1G21B 2JIPA 2XB9A 2PRKA 1JQKA 1LS6A 3VI3B 1CIJA 1L4NA 1JHOA 1ILEA 2F3UA 1Q3TA 4LOJA 2QTWB 2H2FA 4CLOA 1F1BA 1TRHA 3OEHD 5A9SA 3ZQ6A 4QPCA 5DNAA 5CDFE 3AYXB 2Q62A 5FI5A 5KJCA 1IEQA 3GOQA 4D1YA 2W6MA 4DBZA 1DOAA 3RYHA 1RE1A 4YUAA 2BFFB 4CPDA 3FLAA 4O4JA 4DANA 4JJ4A 5TGDA 2W6QA 3KFLA 5HIIA 5K3FA 3UWOA 2QBYA 2CFIA 1YE3A 4KMSA 2H07A 3H13A 4HZUB 3ABQB 4K9OA 4C0QC 2A4KA 1G8JA 4QXAA 4CODB 3WGKA 1W7AA 1NW6A 1M74A 1VCNA 1KPGA 1UKAA 1ZJ5A 2GRAA 1Z0FA 2I2DA 4LRTB 2OFWA 3K5PA 4P22A 2FPOA 2IF0A 1I4WA 4UHCA 5G1OA 1PNRA 3J7AC 2A1UA 1WZCA 2L82A 4CCAA 1Q7BA 3KJEA 5HUQA 1DINA 1ZK0A 5G1PA 1GAXA 2RGDA 4MYHA 3N8GA 1J70A 4E3WA 5KWEA 5I9TA 1USUA 1KQOA 2CHQA 4YT4A 1RC8A 1VJTA 5FF9A 1GAJA 2KBFA 5FR1A 3C3WA 5MF6A 1AHHA 1H6CA 1GAQA 1PDOA 1SUWA 2P79A 4FYXA 1FW6A 1BG6A 4Y1RA 1N2BA 4HR7A 5DNUA 1HY3A 5AJYA 1KS2A 4Y6OA 2PSJA 4OL0A 3RQIA 3DULA 3T4PA 4W5HA 4A15A 5JSZB 1E6EA 2VJAA 4WY8A 1QOPB 3DOJA 1KYXA 3PHLA 1U0EA 2I9KA 1XN1A 5EIBC 4PLGA 2EQ5A 3AESA 3RIGA 2HJRA 1YBHA 4HK4A 1F1JA 3U81A 4LRUA 1XVVA 2DQYA 3CUKA 1Y1TA 3HVUA 2W8BA 1T6ZA 1BNCA 1O97C 1T9BA 3Q7SA 3QELA 4NOKA 3MAJA 1BXGA 3KWMA 1R12A 3FYSA 3FUTA 2HBQA 4EHAA 5JSHA 3QVVA 4KQWA 3TAXA 2F8SA 1X8LA 5K4AA 2IHNA 1DAEA 4DLZA 4WWHA 1VMDA 1BWSA 1V2GA 1HYHA 2GXUA 1V5FA 2JAWA 3IAUA 3IXMA 3WJ2A 5CDFA 3L4KA 1QTQA 4WT7A 2KE5A 4YGYA 3ZIUA 2VK4A 5ESWA 2Q3JA 1CERA 3B8EA 3GLKA 1QO9A 3EVTA 2REXB 4IOJA 4G4IA 1X3LA 1MB3A 3U7EB 5IUJC 4XGQA 5AM0A 4UM7A 2QE7A 1BEZA 3ADCA 1JZTA 2OYRA 1TEHA 1SM4A 1IMOA 1GAEO 2WOJA 4KQXA 5FPKA 4EKEA 4UAVA 2I6QA 2W83A 1KQFA 3U60B 1WL8A 2FSFA 4GNRA 4ZU6X 1AMUA 2BHLA 1P0MA 4AKGA 3EGEA 1JU3A 4X9XA 1ZRSA 1EKXA 2WIDA 3P9CA 5ELLA 1RHJA 4AG5A 4CKBA 1P61B 2E6UX 1TYBE 3PLAE 1SZDA 3GJ0A 1BJKA 2LV8A 3TOXA 2JI9A 2B9EA 1BGWA 1ZIXA 4FMBB 3C2QA 3FYUA 1F2DA 3E4DA 4JP2A 5K3AA 4B7CA 4PLTA 3VMFA 2PCLA 4BGUA 4BNLA 1OLSA 1NP6A 2P2LA 1TO2E 2ZYTX 3I53A 4FGKA 5A4DA 2JJYA 4UU1A 4Y2GA 3TXYA 4EAQA 2NW6A 3EDMA 4QARA 1NBAA 1HBJA 3BGVA 2WDZA 4YUWA 4RDHA 4IIJB 4YVFA 2VDKB 4R0VA 4XM2A 1XZQA 5T57A 4C43A 5JD3A 1HM5A 3KOMA 1FRQA 1Z12A 5AOBA 3QE4A 3ZHXA 1ICIA 3LA6A 3BL8A 4DR3B 3K8OE 2C8KA 3UV7A 1N77A 1YGPA 1BX0A 2FYTA 2P4SA 3LC2O 5AR1A 1IHPA 1Y8QB 1FFGA 2ZR7A 2ZDHA 5EXPA 4A2PA 4R1UA 2Z1MA 5CLIA 4F12A 3ZG6A 1X2EA 1I6MA 3I9V1 4X61A 1ICEA 3N2KA 5FUMA 4I5GA 1TU0A 1BX3A 3FOCA 3MMSA 3SR3A 2ZYSA 1OV6A 5CVCA 2EWVA 3LX8A 5K0SA 2P5SA 4JSYA 2ETVA 3G9TA 3PDHA 4LV5B 4MJLA 3UAYA 5AVJA 4DTCA 3N07A 4NBVA 4Z7OB 3D5QA 1QO0A 1M2EA 3KZOA 4P3KA 2EQBA 4TL9A 2IOYA 3LBHA 4LZNA 3LW8A 1W0KA 1NQTA 3ICPA 4FYMA 3BGWA 4LMBA 3CMCO 4WZ6A 5IZ4A 1R6AA 2IX9A 1OSNA 3A1WA 3GLRA 3QFHA 1Q0HA 4X92A 2QAGC 2GFIA 2YOGA 1JPVA 2I2BA 3H8WA 4ERXA 1EHCA 2O2YA 2QTZA 4Q05A 1QP7A 3GGCA 3I5MA 4PCVA 2C9ZA 4B2IA 3ZHVA 5GOTA 5M04A 4CZ2A 2XXJA 3U19A 5DN6D 1RJDA 2V5AA 5ESRA 4FOLA 3X1XA 3VGPA 3BG5A 1P31A 3ELYA 4KLRA 5LQRA 4P2GA 1F8YA 1TYDE 4WJLA 2X22A 3ICWA 1ZFNA 1FYDA 3QVSA 1DHTA 3WLLA 1QGUA 1N7IA 1W76A 2H29A 1EFUA 1Q0TA 3K20A 1IAVA 3HV0A 4JBLA 5BYJA 3OU7A 4AYTA 5ENDA 1SB9A 3DZGA 1KI4A 3CX3A 4N0PA 4PLCA 2BWJA 5BQPA 3BRQA 2HWXA 2JJMA 1QZUA 3A7DA 1BKSB 4G0MA 3UOWA 4X64B 3R77A 4I0WB 4IRXA 1JEYB 1K7YA 2WAOA 1CR1A 2JBHA 3WICA 5KB3A 4KEAA 3AJAA 1A9RA 2ZJYA 4QUIA 3SDBA 1WZNA 2IUEA 4DPKA 1H0KA 1HDOA 2XWPA 2ZI6A 4IOMA 1EE2A 3UICA 3H2IA 4MW4A 4B48A 1PVOA 4RMGA 2GO1A 1RC0A 1X1CA 2AX3A 3D7MA 3EF0A 2CDAA 2X8BA 4LE1A 4RJTA 1G8FA 2JIDA 3EJWA 3UG6A 2H7CA 4PSKA 5FX2A 1AF4A 2AI2A 4TKVA 1KDTA 5LZ8A 1HT1E 3BB4A 1WZ2A 3AFGA 1JEJA 2HN9A 5TGZA 4C0WA 2JGKA 4UM9B 5JDIA 5FPYA 1P80A 1XK6A 3E3OA 3WK9A 2CE2X 2GRUA 5JC1A 2VQ3A 2YUIA 3I30X 2CK3D 4OHYA 4HTFB 1T3HA 3C4JA 4Q9HA 2WD7B 1BDIA 1QHSA 4KKXB 3RUIA 3SM9A 3GVHA 1J2RA 3VZRA 2VBIA 4TQUS 4Z51A 5AJVB 3E2PA 3KXKA 2O1XA 4QRHA 3GGGA 4QU8A 1WUTA 2QD3A 3DFUA 8AT1A 3WMEA 2J9GA 5ITWA 5F7ZA 1J4AA 4JVNA 2WUWE 5E1BA 4AWXA 5C3MA 4RXUA 2W2LA 2A3RA 4RF3A 2ZZNA 1T3TA 2GCIA 2A1TR 3NT2A 3PUXA 4LHYA 5ALVA 1T8PA 1FZQA 1K7XB 4UULA 5FO0A 5FUYA 4DBLE 1XT6A 2RHOA 4XX0A 5EKXA 4BMPB 1JH9A 2VHYA 2PX8A 4MVYA 4G36A 3I52A 4B74A 1A5BB 1WB6A 3LTEA 4BVGA 4QZVA 3S2ZA 3AJ9A 3SSNA 5JC8A 4DKJA 2O3JA 2DR2A 2HXSA 3DL0A 1IBSA 4LXUA 1C1DA 2A5LA 4QOSA 1SNYA 1NV8A 5E8JA 3VR4H 5LN1A 3L0DA 4COOA 3BH0A 2ZVJA 4FS8A 4PCLA 1FK8A 1PV2A 3H8JA 3L8GA 4ENTA 4M0FA 2QRQA 4PGMA 1JB1A 3R9WA 4TTVA 1B73A 1N3IA 5DWVA 4RY9A 1YJAA 5HIAA 3PXBA 4N3NA 1FLAA 4NF2A 2VBGA 4KQ1A 2BEVA 3LUCA 1PUXA 3D8UA 3QTTA 3VHXB 4XDYA 5TQ0A 4F5YA 2QA5A 5K0JA 1GNQA 2C20A 2RI0A 4DQ0A 2ZJ5A 1ISPA 3TLAA 821PA 2BMDA 1ENYA 3H6KA 3TZKA 4JN6B 4YEDA 1OXTA 1Q44A 4DS3A 2WJWA 1WXIA 1FFXB 3G2JA 1U9IA 4LJ9A 4EG7A 4FKBA 2V7EA 5F76A 5FWXA 4TMKA 1TPZA 4AMBA 2CL6X 2OHIA 1N2CE 4P33A 4C4SA 1TM3E 2JLSA 2ZEJA 3DD5A 2OWDA 1H4VB 1RI1A 4MWBA 1T8TA 2AK2A 2GZ1A 4MUHA 3G2QA 4DWVA 4ZQIA 3UBTA 1PDVA 1P91A 4RIFA 4UD2A 3U0VA 3CLUC 2R47A 2R7AA 4AB1A 5M7EA 4NH4A 3TR5A 1IC6A 4U02A 5JROA 2BM1A 3I04A 2BE9A 2G5CA 3GLUA 5CYGA 3J80A 1J49A 3W5BA 5BSMA 4ZYVA 5F51A 3IR7A 1XTBA 2O3QA 3M6WA 3HLKA 2B4YA 3PQ2A 1C7RA 1Z18A 2Z3WA 5IBCA 4IVNA 1OH5A 1UMDB 1G41A 4MV6A 4D9BA 5ALDA 2VP5A 1U4SA 2AMJA 2MSWA 1XZFA 2PU7A 3H1EA 3AI3A 1H85A 4EW6A 3SX2A 1G63A 3W5HA 2GAFA 4B2PA 1YJCA 2BHSA 2VYVD 1P2TA 3W6OA 2WAMA 4HXFB 2PKYX 4ZOBA 2R1TB 3GEHA 4IRUB 1GLNA 1PR5A 2E5LB 2NO0A 3RGWS 5CB6A 2NG1A 2BW0A 2BISA 4Q9KA 4IIUA 3ZDAA 1CY8A 3CKLA 3BWYA 4RLHA 1QFYA 3QZUA 3MWYW 1OX4A 3P1JA 3AUFA 1GGEA 4OYRA 5K0FA 1JKMA 5KTYA 3MLAA 1HDEA 2ZLBA 3AR9A 4NZPA 1BWRA 4YNBA 3OZSA 3FHOA 4J49A 5TEVA 4CKWB 1YC2A 2PUBA 2J0QA 4OKSA 3BXZA 3DOHA 4HEQA 1LNQA 1I3MA 5KVCA 4CG3A 4EF5A 4P7KA 3IRUA 1KDYA 1AK2A 3IURA 5DGCA 2OB2A 2EX1A 3V6MA 2HW8A 3AZQA 1G8SA 2FTKE 1FDUA 3ZLUA 4F86A 5JJBA 5AM3A 2H06A 1WETA 2JCYA 1YB5A 2FSVA 1Y1RA 2KYRA 2PN1A 5F33A 3DC2A 3OQIB 1IJEA 1IWBB 1NF9A 1DRVA 1N2CA 1BROA 1XZDA 2ZRPA 1QH1A 2XUZA 4U9UA 1JDTA 4M8IA 1OLXB 4M6WA 4MA5A 1W1WA 2XA2A 3EZGA 1USIA 5J4VA 2VO1A 1PYOA 3IVXA 3T0GA 1A9XA 1W4AA 2CN1A 4P8RA 2ZCUA 3IT1A 3JZDA 2F43B 3LTNC 1Z4MA 1VSQA 1XYVA 1JR3D 2E7ZA 1DLIA 1WVMA 2I66A 4PXAA 3DMFA 4P9NA 4TXJA 3KHKA 4TV9A 4F6RA 2BMFA 3ND9A 4FOTA 4UE3S 4IGFA 5DSZA 1X9HA 1LQTA 2OK7A 5IAEA 3BF8A 4EYGA 3OIVA 1TCVA 2D7JA 1ORRA 1SQSA 3B3JA 1BS2A 3G5UA 4YAFA 3JQ8A 5KC8A 1BRTA 4D97A 2BEUB 3MWJA 2ZJ4A 2HY7A 3R0JA 3ZJYA 1A5ZA 2WWXA 2FB9A 4ZAZA 3UK1A 1K08A 4C29A 2QTNA 2W58A 1ZD1A 3ZX4A 2IXDA 1UZUA 2RAVA 4ALJA 1FFSA 1THZA 3G85A 1ZEMA 1LJLA 1V8BA 3HA2A 4IHAA 1IHYA 4MINA 2PPLA 2Z9DA 2OXTA 1M8JA 4Y67A 4XIGS 2IYWA 3TD9A 4IIXA 5I9NA 3COYA 4P6VF 1ZN2A 3G8DA 1UJMA 2ACEA 1R4MA 3M33A 3W77A 5ICMA 5H5JA 5EWJA 4G26A 4MPJA 2PYIA 2EWMA 1VSBA 4EUHA 5TS2A 1A5TA 1XXLA 2ZB3A 4ZAYA 6REQA 3K1JA 2OFPA 1SOMA 3L7JA 3NVAA 1A2KC 4UUNA 4PGGA 3CF4G 5U9CA 1OIXA 2HHJA 1NZJA 1RRFA 2P0YA 2HIMA 5CCDA 1AOXA 1YC5A 5AKXA 3ZCSA 1S89A 5C5CA 1C3JA 2C5FA 2ZVQX 5DNDA 4BLVA 2IXAA 2DFDA 2VDJA 4HLUC 4YO8A 5LYJF 4DUZB 2C00A 2FI1A 4ZO4A 3WAJA 1IM5A 1AH2A 4XW2A 4TSFA 3GRAA 2FUG6 1Y4AE 1QOZA 5CDYA 1Y1LA 5A62A 3JPWA 1P1IA 5JHGB 4NJEA 1YCHA 4DV2B 4CV1A 5EIEA 2QUHA 2W4MA 2WHEA 2NU6A 4HNAB 4MKGA 4P3YA 5J2TA 2BFPA 2ZAYA 3BQMB 1SXJD 3CVOA 5AXDA 3TSWA 3OTHA 3AUKA 2CFOA 5JAZA 1R6TA 3WGGA 2ZBPA 3FNEA 1HLGA 1GQQA 1WIWA 2AK3A 3EC2A 1FPQA 5CHYA 3R7WB 2JLUA 4RGYA 2HBZA 1ZOPA 3LT5A 3DDNA 4ALLA 3OUZA 4TV8B 2HT6A 3OZUA 2PX0A 1G60A 2B8WA 1JAIA 5DBOA 2YKGA 3PR1A 3AR8A 2I2XB 1CNEA 3UTCA 2VA9A 3WGUA 4E2FA 3P9ZA 2XEDA 3P52A 3F3SA 4QGHA 2EFJA 4X8MA 5IAJA 1NLFA 3V8VA 1Z74A 3FCYA 1CCWA 5CVDA 5KHAA 2ZE7A 4BBPA 4GKBA 5FLXA 3WLHA 3BH6A 4Q01A 4MHOA 1B1AA 2HQOA 2XAAA 1EFVA 4AXXA 2O8DB 4RY2A 3PUZA 5KTRA 2XDQA 2P2NA 1VGVA 3QE2A 4IJVA 1DBRA 5HQ3A 1Y0BA 5EJ5A 3ESBA 3EMVA 4WDQA 5IAGA 4XWGA 1XDSA 1R3UA 3AH8A 1VLLA 2IHYA 2QM7A 1DRWA 1NRXA 3QY0A 4PYRA 3U9LA 2ZIXA 3HKCA 3OY2A 4GMXA 1O77A 4FDMA 1QYRA 4DDVA 5DASA 1PK7A 3AY7A 3K9WA 5CA1A 2B1QA 2Y67A 3L1HA 1XRMA 2WZQA 5F98A 5DT2A 1AG9A 1HL7A 5IARA 1ZQ9A 3EG9A 4YRAA 2IUFA 1PUIA 2YVQA 3OOWA 3PQ6A 1TMKA 4QNRA 4X8LA 5E6SA 3SICE 1Q91A 3IAFA 1KVQA 4BNYA 2PL1A 1P0PA 1CRPA 4FZ5A 1N36B 3PC3A 3ZHRA 1Z7EA 4GRIA 3CWZA 3FWNA 4WINA 1JHAA 2NX2A 5F7OA 3QX8A 2X1LA 3HHEA 4QOGA 4B85A 1P1BA 2H5LA 3KR0A 1P7CA 1QF9A 2O2EA 2QD4A 2N0SA 2PLFA 4KW7A 1KEWA 3TVYA 1D1SA 2G72A 4C88A 3GYGA 3OTWA 4N5MA 2MSCB 1LK5A 4AJKA 1JR2A 2GSDA 4DA8A 2O7RA 2O2XA 3PF9A 1DX9A 4UE6A 7YASA 3WMGA 1ECGA 3K92A 2P9CA 2HMSA 3MXTA 2NU7B 4TGLA 1Q83A 4RIHA 1S01A 1OVGA 1YB4A 1LTKA 3EWAA 3V7FA 4DSTA 4EMSA 2H9YA 4WLUA 3TPZA 1PF7E 4BQEA 4REOA 2FWPA 3GEPA 3T9EA 3U7IA 4MPTA 4Q16A 3IYLW 3V3TA 2JFGA 2X8WA 3KZVA 3NFRA 4NBKA 2H9AA 3A6FA 2QVCA 2CXXA 3TQQA 3VR0A 2B78A 3ZE8A 1MIOB 2DBVO 3V46A 2LP4Y 3K8ZA 4QRDA 2X4DA 3VDRA 4CG1A 1N5JA 2IDKA 2PWZA 3HS3A 2C7BA 2PMWB 1KI2A 1K4MA 3VDQA 3WHLA 4AW9A 4IGEA 3UYKA 2G9RA 2QL7A 4RD1A 3SHWA 3KT6A 4UTZA 4BLTA 4R01A 1LB1B 2VRBA 1KEVA 3B5IA 4B3BA 4DUPA 5I7UA 2RHRA 2ZRNA 3GFGA 3WLQA 2G09A 2HRCA 2MDTA 1F4LA 3HGMA 4Y18A 2P9FA 3A3PA 2IELA 2FSIA 3NX4A 1CDDA 4TVBA 5LLDA 3R41A 2CL0X 5HVNA 4YIHA 3OWOA 4HH3C 5DM4A 1C8BA 4L76A 3SQOA 3ZCUA 5B4TA 1XZJA 2ZI9A 3SHOA 6ABPA 2HOQA 2PT5A 3Q6IA 1VSTA 4ASUA 4BO2A 1OIWA 2ZBDA 1S2GA 5IVDA 3CE6A 3BL5A 4RADA 3U3OA 4C4PA 2GPJA 4Q4CA 4GC9A 4BXOA 5BN5A 4FN5A 4GWKA 3WLSA 2M6SA 4MV5A 2HU7A 4GX1A 3DLIA 4C0JA 3SE7A 3KD2A 2YZKA 3L2OB 3TR0A 4HDKA 3T1HB 1NURA 4LYEA 2GRJA 4BRSA 4JI5B 5F73A 3OOHA 3RVQA 2DQZA 2VDRB 3M6VA 1PI3A 5CYOA 3R8XA 4BTLA 3TVDA 2E4UA 4JP1A 1AUQA 4FFVA 3C8UA 3HQ4O 3FI9A 5DXAA 3ZKWA 1JZQA 1WPGA 3BTUA 3OMLA 1U8XX 3FZGA 3QHAA 3UW1A 5JUWA 3L1KA 4RCYA 4DT1A 5J63A 1CQIB 2GAOA 4N54A 2JAXA 2FVXA 2QS9A 3K2EA 1RIIA 2OXCA 2Z95A 1S2LA 1SZJG 3BAFA 1NSTA 5H16A 3WYCA 3CRMA 4MYUA 4L7QA 3OQHA 5CIYA 1I4TD 4Y2PA 3WTBA 2C3YA 3QWBA 4DQKA 4KQ9A 3R6LA 1FNDA 4ALKA 2VBCA 2W43A 1ZA1A 4MQEB 3KETA 4ZOCA 2N1MA 5TF4A 1UDXA 3OH8A 5ICSA 1EX7A 1GPH1 1TMGE 5LBUA 4DPLA 1LC0A 1MX3A 4DNFA 2HGZA 4FMPA 3F46A 3F9RA 3PRHA 4YHHB 1KFBB 2XKAA 1RS0A 1XG5A 7REQA 1MO4A 1IN6A 1GP2A 4O2BB 3F5MA 4RUKA 4OV6B 3WWPA 1BXRA 2V7TA 4IFEA 1KQ3A 3NUZA 3NM6B 4KTTE 4BLOA 4JWTA 1P39A 2X23A 3K5IA 1W47A 5TMEA 2VZ8A 4XYMA 1E79D 5C1IA 1IBLB 1JSLA 2VP4A 3L0CA 4M36A 3LDAA 3T0FA 2YASA 2J09A 1XQYA 3O2NA 5FLYA 1Z7GA 1ZD5A 3HCFA 4H7IA 5GVSA 2CNOA 2A9VA 2CB0A 4DCSA 3P4XA 1HK7A 5ER9A 5TEWA 3H7AA 4IF6A 2Q4EA 4EI7A 1SXGA 1C7FA 1GRQA 4UUPA 4OX9Y 2GAIA 5ARBA 5C52B 2OCPA 2VC2B 3L7KA 1VPTA 3G5AA 1C2YA 3N8DA 2W2MA 4E1BA 4HBGA 4KB5A 2ZT7A 4HDNA 3F4KA 1Z2DA 3DDUA 3DF7A 3GEMA 5CFPA 2Z2XA 5FUXA 1GPMA 5C7YA 1I36A 1SBCA 4QPDA 2WJIA 3R0IA 2FJPA 2QY9A 4GKAA 3NDRA 3PL5A 2QPOA 1R2QA 2W0SA 3V2GA 2DTEA 1YBMA 2GR9A 2IPXA 4KIGA 1COZA 2XT9A 1U0GA 5JAHA 4F45A 3QFFA 4MUFA 3M3HA 4YQYA 4RZIA 2WU4A 3O8RA 2BTOA 3T3PB 4EX6A 3SHQA 3AHFA 4N41A 3CVVA 1HZJA 3FYUC 5CDUA 3VKHA 2QAGB 4F2HA 3JVVA 5FL3A 3KOWA 4MUYA 4ZT7A 2PX2A 3DC7A 5ECDA 1YFZA 2FAXA 2JW5A 5EMKA 1NN0A 2IP2A 5AW5A 4X6UA 3SLRA 1WY5A 3PP8A 3OTGA 2YFQA 5JCJA 1CW2B 1KYTA 3G0HA 1TA0A 2OAQ1 4MW5A 4PO8A 3EIUA 7AT1A 4D57A 4L8VA 2ZE8A 2MMGA 3DR5A 1MA3A 1QCDA 2A35A 3E8SA 3ZQJA 2XTAA 1K7SN 1E9FA 3DJYA 4B4KA 3U7GA 2BHRA 5DISB 4GLLA 4XCVA 4RTJA 3FUCA 3FDZA 2I6GA 3JTMA 4OHBA 3Q88A 3TCKA 3VHQA 3O4FA 2OT3B 3OZTA 4EY3A 2GCOB 2IBTA 1LPMA 3EDRA 4R2XA 1YRQA 4MS4A 1J2YA 2C88A 1Z36A 1MT0A 2AGVA 3K72B 2JS7A 3SYLA 3V2UA 3DBHA 4L0DA 4QJ4A 4J0EA 4WOBA 3R0QA 4FCTA 1Q0SA 3B3FA 5EE5B 1WRBA 1I4EB 3LGAA 3MK31 3R3SA 4NCHA 1X7XB 4C4OA 4E21A 2VNSA 2C2BA 3H2JA 4AJNA 4KI0A 4D4MA 1W36D 1GZDA 2NTJA 3H2KA 3KJQA 3OF2A 4R9NA 4CQLB 4LWZA 2EJWA 2BN4A 4EFKA 1NX6A 3I9NA 2Z43A 3V42A 4W5OA 4DQVA 1JHRA 1GTVA 3AXTA 4HGPA 3MTGA 3X1JA 3JSAA 3WYBA 3CEJA 3N70A 4BS9A 1RRCA 1LF5A 1NUAA 2BEJA 1ORVA 3MF4A 5TMBA 3SYMA 2OY0A 2FW7A 1G59A 1OI2A 3A0RB 1GQ2A 2VN8A 4MEAA 4FFBA 1RJFA 2NVBA 5KBYA 1GPKA 4AS1A 2FRDA 2DPLA 3ENQA 5CA0A 5C51B 4QNMA 3EPRA 3U16A 3GP8A 4LI3X 4I6GA 4B3MB 5TQJA 3K0CC 2IEDA 4LSWA 2BM8A 3VO1A 4O4JF 4MJ3A 4EOGA 4JYBA 1R88A 1GYRA 3D6TB 2WUVA 3D6AA 4EY4A 3WB9A 3H8VA 3JD4A 2OD2A 1VG0B 3RR2A 2FUCA 1UINA 2E21A 2RJOA 3AUXA 3V97A 2E4AA 3KR9A 4G4GA 5SZJA 3U3XA 2GTPA 4X6XA 1DRKA 1WTCA 4DQDA 4Z1MD 2Q9CA 1EE9A 2P6NA 2EG9A 3SZMA 3UMJA 3WNVA 1KQGA 5T6BA 3HWWA 5JNWA 3HXTA 4MMXB 1XU7A 3CZPA 4PC2A 2BGWA 1SQ0A 4IWXA 1PBNA 3FKSD 2IU0A 3RBAA 2VYNA 1R37A 2AFIA 4GNKA 5J4YA 2C7GA 2X5KO 2XQIA 4MKFA 3D2LA 3NATA 1VFNA 1ZY2A 2IBMA 4N0MA 4CM7A 1CQZA 4LWQA 3T7CA 4GW3A 2VTDA 1NVDA 1Z06A 5KTNA 1GR0A 3EQ2A 2FZVA 3FKJA 2UYYA 3PNMA 5TQ2B 1U4NA 3HCOA 3ETJA 3DDSA 2BONA 3T7TA 3GNLA 4ZEMA 2BFDA 2VAXA 3AV3A 2R9VA 2GD2A 1F2TA 4IDPA 3DG9A 4X54A 2QROA 4YFVA 4CU5A 3PQ4A 3WISA 4JB0A 4UATA 2HADA 4C2BA 1HE2A 3KJIA 2OCYC 3Q40A 3FPFA 3DBOB 4IDGA 4PEVA 2Y1OA 2YUTA 1ZHFA 1H1LB 2EDAA 2P2YA 3QEOA 3WMXA 2OUKA 1F3OA 4UFPA 5AVXA 1WUJS 3SOZA 2Q1YA 2FFRA 3QUSA 4HP8A 1S4QA 2ZTMA 2Q3DA 2QNRA 5TY0A 4YMVA 1LC3A 1ISRA 4L28A 5L40A 2V6BA 2I87A 3GBVA 1LI4A 1TXGA 5DTRA 2OBFA 3LKBA 4FHZA 2MR5A 4GX2A 4IJ5A 4F5DA 3MOSA 2YJ3A 4QPPA 3THYA 2BM9A 2JVJA 4WASA 3KD3A 5EIOA 3MJRA 4ADSG 3U3JA 4XYLA 4ZP1A 3DH0A 5FL7A 2I4TA 2FX3A 4GMGA 2LDXA 1G8GA 3P8ZA 4MNTA 2AEJA 4MROA 3ZS8A 4ZZIA 4UW9A 2QEQA 1DP4A 3KYCB 3GL9A 5BW8A 4PYQA 4DA0A 5CJ2A 4YMSA 2K4MA 1SOVA 4B82A 1V71A 4EBFA 2PGDA 2BM0A 3GLIE 3FD8A 3WOVA 1QH8A 2FFBA 3EXHA 4KUHA 1NRIA 3X44A 4M8SA 4A1OA 4X94A 3WL7A 3A28A 4PCUA 3R8CA 1EK6A 5B6JA 3AETB 5CG1A 2B61A 3FZEA 4JDUA 2KSQA 5EMLA 5J4KA 2RHHA 4IWYA 2MYPA 4HF7A 1Q7GA 1SG9A 1S3SA 1KP3A 3EMBA 4ZCIA 3I9KA 3DOEA 4BQOA 2FW8A 5ALQA 2NZ2A 3O8OB 3AIOA 4Z7JA 2Z4RA 4UTNA 2GHRA 2PSEA 4D4JA 1VGQA 2ACVA 3H4MA 1IM8A 1M8GA 1RABA 1V47A 3QU2A 3RJ9A 3GVCA 4BP8A 1O8BA 3A9TA 1PYGA 1K7CA 2XB4A 2QNIA 3UFBA 1YL6A 3NCHA 5F7JA 3OJLA 1KOGA 1LVUA 1V1MB 1Q21A 5DN6A 1X77A 3MW8A 3RSLA 2P3OA 2JIOA 5F78A 3E53A 5ED0A 3VNQA 4DIDA 1EFRA 1LPAB 4MEBA 5IJ0B 3L4JA 2RGAA 2EGGA 3GF4A 2ODTX 3RS0A 4BJ6A 4QBGB 3VAYA 3KKMA 2HRBA 3MIZA 3KLNA 5B1EA 2GZHA 2JJ8A 4O4HA 3UUWA 2QUBA 3F98A 1UBMS 4LJ5A 1IIRA 4R9UC 3PA6A 2ZE6A 4OXNA 1BCSB 4YRSA 1ANKA 1ZYUA 4BQIA 4UXJA 4DMKA 5GZ6A 2Y1CA 4HXEB 4FCWA 1MPTA 2VT7A 1TQ8A 3GRVA 1R6DA 3JS5A 1ETUA 3IVCA 2H52A 3HB9A 3UYLA 2QJWA 3W1EA 1N5OX 4BATA 2J5KA 4CM4B 4DBLC 5KTKA 4XWTA 4YAWA 1PG2A 3WWDA 4D9CA 5AVTA 4M9ZA 4QFBA 3N74A 4HLNA 5I4IA 3ZUPA 4JI7B 2P2CA 2UKDA 3B6ZA 4ZOEA 2W11A 4RPCA 2IU6A 5DZSA 1P77A 5HKLA 3VPFA 3I58A 1V8OA 2IFTA 2A78A 1ML4A 4UJ5A 3AW8A 1VIYA 4DJFC 4EJSA 4XRRA 4TKMA 2XXAA 5JS1A 4Z7NB 3P2IA 2F3SA 3VPXA 3HR7A 2VYCA 3IESA 3DCIA 4R2MA 4M1TA 4DLYA 2WWIA 3W5JA 2LIPA 3TSYA 3GLIA 2PZBA 4PHCA 1A50B 1XMSA 1XBTA 3HSKA 3TTUA 2PMCA 5CEJA 4MB0A 4M4SA 1AKQA 1KVTA 5A6SB 1OWPA 2ENUA 2Q2VA 3CLRD 4LDQA 3G7UA 1QGAA 1T0HB 2Z2IA 3HA5A 1Q20A 1ODLA 1E2QA 1LCIA 4KGDA 1I14A 1AGNA 4WXEA 4MR7A 3KR1A 4G9GA 4D3XA 5EIXA 2BC9A 2PZGA 3DMTA 1OLUA 2ORIA 3HJUA 3IHWA 4X3OA 3T5CA 2AE2A 2BV3A 1DQPA 5DCUA 5DLEA 3V9AA 2WLTA 3NOQA 4R1MA 3JZAA 4BB9A 4DB4A 2HDWA 3LK6A 5K6AC 3CNLA 2W8ZA 4DMUB 4AYXA 2FSVC 1G5PA 3VC2A 4FOPA 4XE5A 1RYZA 2OSVA 1YSCA 4I5FA 2V96A 2A5GA 3C6BA 3FUVA 3ZWAA 3UCEA 1UK7A 2BTQB 1T2UA 1UC8A 2FPUA 2DPGA 3CSSA 4I5IA 3T9DA 2QP3A 4D8XA 4CM8A 2X77A 3SBDA 5B30A 3ZW8A 1T9GR 1VQ1A 3NBAA 5HK8A 3SQNA 4E5DA 4D99A 3C8DA 4O4IB 1JAHA 2AKYA 1RBYA 3VQTA 3K16A 3C8MA 2J0SA 3PFIA 3BXGA 4YMTA 1TM7E 4HCJA 4EJ6A 4UBIA 1XDDA 2UZIR 2OORC 4MRNA 4N7JA 5T8KA 3RV4A 4F8JA 1YDHA 1EXVA 4P1ZA 4IVQA 1GSIA 2H4FA 4W7HA 2Y4OA 5B57C 1NC3A 5KIAA 4JI8B 1RYYA 3FA2A 3K2BA 4B4WA 5HR5A 1YF3A 1M1NA 2DWOA 2BGTA 5AVWA 3GRZA 3EEOA 1E77A 4MVJG 1Z5GA 2A5JA 5ER6A 1KZ9A 1XZBA 4AQYB 1YNOA 2VZ9A 2AJ8A 3V5NA 3HYSA 4AYWA 3IDFA 3C8ZA 1OUMA 4JVSB 2XVYA 3GMDA 3LHKA 4FYWA 4ONEA 1QTRA 3BICA 5FPQA 5EP4A 3ZW7A 4BVBA 1XTKA 1W88A 2J4CA 5AKHA 2VIIA 2F90A 3G0CA 1TVKA 3C6MA 3FHJA 3ZR4B 1JQLB 1AUOA 4WBNA 4Q4HA 5IT4A 3M0EA 4Q3EA 4JI4B 3DL7A 4FYYA 4URZR 1EJ2A 1OT5A 2XUIA 1A88A 3QXXA 4XR9A 3SX4A 1XNQB 2DHCA 4MJ7A 5A1JA 3JYOA 1LSJA 1RPJA 4M1OA 5KNCD 1D2AA 1Z4QA 3Q0TA 1B26A 2D0DA 4UAJA 4BB0A 4ZVQA 1JR3E 5F52A 3SKYA 5KPDA 3ODPA 1YA6A 3BGOS 1XVAA 2G1AA 3WLMA 1T15A 2GF0A 1UDRA 2AW5A 2XD4A 1X1EA 2J7PD 2ZPTX 2ZR0A 4R05A 4MQLA 4TLCA 4Y6LA 3IOEA 3EFOA 4P7BA 4DN6A 1J42A 4DMLA 4PRYA 4FJ2A 1LPBB 4WIAA 3IFSA 4G5QA 5FUBA 2W98A 4YBZA 3DMPA 4RVNA 3R3HA 3QV2A 3TK1A 5IDWA 3KK0A 2HRZA 2XB6A 1PJSA 1XVUA 3BMOB 4D8UA 4NSNA 3OCCA 2PL5A 1U7UA 5KTPA 3L6UA 4GC5A 3S55A 3V7YA 3TPCA 3GJSA 2P40A 2AHRA 3NORA 4CEJB 2GJ4A 1E4OA 1XD2B 2PX4A 3TB6A 3QKRB 1F48A 2EARA 1NR5A 2ZTUA 1Y33E 3X3HA 2X42A 4HY3A 4PSCA 4BGDA 1S9HA 1XQWA 4ON9A 1CR4A 4UEKA 4E22A 5B7GA 4L3OA 3S29A 4AS2A 4PZPA 4P5EA 4QQ8A 4Q7EA 4TSKA 1L5NA 1SXIA 1J24A 3MPOA 3QEKA 1IFXA 1P1FA 2R79A 3W5AA 4CW7A 2J9ZB 1AURA 1YRLA 4QGSA 3FPAA 3GJ4A 4PAWA 3ADPA 4OLFA 3SJ7A 2QTCA 4QJBA 4PRKA 1ECFA 2QLLA 1CBUA 3CTMA 3ND6A 4PV7A 1CQJA 4WXPA 4MQMA 3ISTA 1QCCA 4XIYA 3OU2A 2WYOA 2RC5A 4F84A 1QRTA 1K27A 4MI1A 3JYPA 3OD1A 5FA8A 2W4QA 1P73A 4UZFA 5AK4A 1LX7A 4E2YA 3OZRA 2DFNA 2A84A 1RLMA 4FCCA 5DTMA 5KQMA 3MSCA 1SCAA 4H7HA 5AHOA 3I73A 4RO0A 4I8DA 1QRRA 3EXFA 5A4IS 4XJVA 4HAWA 5DIZA 5IK2D 3Q9NA 3K5HA 1I0LA 1QDEA 3MCWA 3WHKA 5K9ZA 2QTLA 2X2EA 4JQYA 2IV7A 3RRNA 3VBCA 3WL3A 1SXJE 1NNSA 4BB5A 4Q1FA 3O0DA 2O7SA 3AF2A 4Q3OA 4Q3KA 1ZMXA 3O21A 2XRFA 2PQMA 4NU0A 1SMKA 1DKMA 2H0RA 1JMKC 4EG8A 3KQLA 1YKFA 2H4YA 1U3UA 4NAHA 9GPBA 3PGJA 3K6SA 1KIFA 3DGFC 3GJYA 3NLLA 3O03A 5C18A 3I5AA 4PSAA 4ZYXA 4L8LA 3WAGA 4V0QA 4PFKA 2D5BA 1OH7A 4EA8A 3RJZA 3FYHA 2Q3HA 5U4XA 3QIVA 1XPRA 1KAGA 2EP8A 1RMTA 2H8KA 2GFQA 1OBCA 3QWAA 3LDUA 4LYYA 3IAS6 5C31A 2XGSA 3S40A 1N3LA 4CCWA 3EBOA 2GN9A 4UZEA 3I6QA 4OB8A 1O8CA 3CVJA 2PKCA 3ENNA 2JPDA 5TJHA 2V03A 3ZY5A 4P53A 5F35A 4J0GA 4D45A 4L02A 3A9VA 4ZEXA 2H5JA 4HWTA 1S8AA 4Y2QA 4KRYA 1TAGA 4JUFA 2G71A 1KK0A 4PO3X 5DGTA 3TM5A 1OTHA 4C0AC 4ER3A 2B1JA 2UZ0A 3QF7A 4PY2A 3WXBA 1E4VA 2RGYA 1YIAA 2P6PA 1HRDA 3KJGA 4KXWA 4YAGA 3Q3CA 2A1UB 2O3SA 3MNFA 2G9UA 4NBWA 5FNVA 3RU2A 3UUEA 2F3PA 1YB7A 3O3CA 1YTLA 5ERXA 3ZHOA 4O5OA 3ZZMA 1XEXA 3PX7A 5BV7A 1Y7IA 4OGLA 3TQCA 4D4LA 5L3QB 4LFCB 1QKJA 3W3AA 2PXHA 1V9CA 1M1ZA 1RU3A 2VK2A 4CBVA 3PDIB 4ESOA 4L6CA 2Q1SA 1M7BA 3M5PA 3EZ6A 5D2CA 1B42A 2BE7A 5JG7A 4YMUA 3BH7A 3A2KA 1TYEB 2WU1A 3JQBA 1V4VA 2C4NA 2ZVDA