5ECGC

Crystal structure of the brct domains of 53bp1 in complex with p53 and h2ax-pser139 (gammah2ax)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
257
structure length
227
Chain Sequence
ALEEQRGPLPLNKTLFLGYAFLLTMATTIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title ATM Localization and Heterochromatin Repair Depend on Direct Interaction of the 53BP1-BRCT2 Domain with gamma H2AX.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 61
structure length 227
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF18428 BRCT_3 BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 5ecgC01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 5ecgC02
2VXBA 3I0MA 2EBWA 3SZMA 2EP8A 4U4AA 3II6X 2COKA 3HUFA 1T15A 3SHVA 3QVGA 3K0HA 3UENA 1T2UA 2DUNA 3AL3A 4OFBA 4BU1A 1Z56C 2COEA 2ADOA 3K15A 4IFIA 3PD7A 4Y18A 3QVGB 2E2WA 3I0NA 3SHTA 3UEOA 3PA6A 1T29A 1N5OX 2R1ZA 1CDZA 1T2VA 3T1NA 3AL2A 2L42A 3HUEA 3K05A 3PC7A 3SQDA 3PXBA 2INGX 4BU0A 2NTEA 4IGKA 3PXAA 2COUA 2JW5A 2D8MA 4XQ0A 2XNKA 2WT8A 5ECGC 2EBUA 3L46A 3PC6A 2ETXA 1WF6A 3EF1A 1KZYC 3K0KA 2M2IA 3U3ZA 1GZHB 2K6GA 1JNXX 3EF0A 1Y98A 3T7JA 1OQAA 3PXDA 1IMOA 2LE0A 3L41A 3KTFA 4N40A 4XPZA 4JLUA 3JVEA 3T7KA 1L0BA 3K16A 4BMDA 2HTFA 2XNHA 2VXCA 2AZMA 3PXEA 1L7BA 3PXCX 3FA2A 4ID3A 3PC8C 3T7IA 4BMCA 1IN1A 3PC8A 2K7FA 3OLCX 4Y2GA 3L40A 3COJA
chains in the Genus database with same CATH superfamily
3GEEA 5CGZA 2EIXA 5BR4A 1MO6A 4L3WA 2PY6A 4MW5A 6REQA 3NYWA 3Q1LA 3JATA 3TXAA 2PG3A 3UW1A 2G71A 3PFNA 4XQGA 2ZI7A 3UIEA 2XT6A 2WYUA 1NVFA 2XZDA 4PAGA 1AK1A 5I7AA 2W9XA 2B83A 2YY7A 4RZQA 3N7UA 3HDTA 1X15A 4IIVA 1D2HA 3IIKA 1A71A 1Y4SA 3QPDA 4L74A 4R41A 4D9GA 3ZE1B 4DXAA 2G63A 2A35A 1K97A 3R7DA 3VR0A 2O2EA 3R6WA 1D9XA 1A8HA 1QSGA 1XZJA 1LVHA 4MEJA 4S24A 3SJUA 1YK0A 4EHDA 4GKKB 1HFKA 2CW5A 3SJZA 4BRUA 1WUTA 3B5JA 3DKKA 1AE1A 3CURA 2O7NA 3GEIA 1SBZA 2ES4A 5T5QA 5C1PA 1G38A 2OCKA 1CUEA 3IUMA 2HR1A 3VUEA 2QPLA 1VKHA 3EZ2A 2W93A 4R2JA 4LXGA 2M6KA 4E7PA 1G3IA 1SR8A 3ZX5A 2QLNA 4JEUA 3U6KA 2WLSA 2WUGA 3ZXXA 1AURA 1PR4A 1LCIA 1KO5A 1TF7A 1VBKA 4IDBA 4TKLA 5FB3A 1J2RA 1DPFA 1G5HA 3OX2A 3KVYA 3SJAA 4ETIA 2V03A 3QOYA 4K9LA 2H2FA 1B0UA 4EB6A 3DEYX 1F0PA 3HR8A 1A77A 3K2QA 4YFYA 1DIHA 3GIDA 5C8YF 4A8TA 1SUWA 4WX2B 9ATCA 2OORC 2B4RO 2OORA 4CKBA 2C99A 4W5HA 5KS2A 4TLAA 2R7KA 3GNTA 4PYIA 4AZ0B 2IQ5A 1IY2A 3H19A 2RJNA 2PLFA 3KZNA 5BT9A 1V1RA 4CHGA 1Q0TA 1WP4A 4NOKA 3ZE9A 2E5FA 3JASA 1DELA 1UP6A 1HFWA 1XU4A 1E59A 4MUXA 7GPBA 1TYAE 4GKAA 5HCNA 4M2LA 3KL4A 2K2QB 2RDMA 2R65A 4CM5A 1GUZA 1M2OA 1GR1A 1SCAA 2VDQB 4BNLA 4Y6GB 1R6VA 3O0DA 1VB3A 1VCOA 1BWSA 4R8SA 4D9BA 1ADCA 3IEIA 4AKIA 1T5DX 3F4BA 4RJLA 1LH0A 1Y7IA 1EM6A 2GPYA 3BGSA 1VHDA 1CR6A 5HRCA 4U7FA 1W88A 3CX8A 1M5UA 5CYPA 1Z4KA 2E7ZA 3G85A 4U6SA 2ZCJA 1W4RA 2DTXA 3RYTC 2IV2X 2XAUA 3D1LA 3DP7A 3EAFA 4S0ZA 2J6IA 3Q5EA 2JKYA 2DMRA 1VIVA 4TOIA 1JQDA 1N2EA 1UBRS 3E7XA 3L8CA 5FTMA 4F8EA 4UVIA 4G81A 2FMHA 3V4PB 1S7CA 1NBHA 2Z2YA 2ZRAA 4OA5A 1J21A 1PBTA 2ZJ6A 2FSFA 2WJ4A 1XVLA 3WDMA 2GAJA 2UXCB 2WDPA 4ZFNA 5CNKA 2O0MA 4QJBA 4WBNF 4MV9A 4KREA 2VP2A 2XMCA 2X9NA 3IP6A 4IXTA 2FQXA 4MJLA 4X3CA 2VL7A 5L45A 4PX2A 2QB5A 2IU3A 3B3FA 4AJHA 5FWAA 3TFWA 3MGGA 1AUQA 4ZI5A 3NRJA 2KPOA 4ZI7B 2HA4A 4DLWA 4HVAA 1FNSA 4CT5A 1IM5A 1XJQA 3TRFA 3RSFA 3LVRE 5ES3A 3EXHC 3PPWA 5I3ZA 3DVRX 3EXHA 4E5KA 5L3QA 1N32B 4GH5A 1SVKA 3OKFA 4GX0A 3KXIA 1BO6A 1YIDA 1YZKA 1V4VA 3HP7A 3W90A 5BN5A 1BMQA 2IF0A 4B7AA 1O5OA 1ZITA 4V0SA 3WGGA 1N2CA 5TF4A 4D6XA 2ZJYA 3JAMA 1A9TA 3P2MA 3Q15C 4TZ6A 3LECA 2DUJA 2IW3A 1PFWA 3A0UA 3HJTA 5LFAA 1WBBA 3NTXA 1QVWA 3DZCA 4B81A 1DKQA 3OCZA 4JBNA 3PI6A 4OBXA 2WJ3A 2L19A 2VSQA 4KV9A 2QTNA 5F5NA 2BEWB 3UOGA 4ARZA 2P0YA 5JZOA 3AL3A 4QBTA 4WNCA 2RGCA 2OP0A 2NP6A 3A6LA 2PMFA 2WTAA 3VKUA 1BIFA 1N6RA 2RJ3A 3V1UA 3OZVA 2YN0A 2A9KA 3P2IA 1FVHA 4G1CA 3NETA 3AEKB 1E2UA 2Y0EA 4TLBA 4MI6A 2W11A 1T29A 1BC5A 2QUBA 4ETNA 3R0QA 4KRYA 4RTLA 5HG0A 1Z26A 2XDQA 3PR1A 1QVRA 4L9WA 4TSFA 5EMHA 4A9AA 4HH3C 4V1CI 1J42A 2AX4A 3D3JA 1DKMA 2M98A 2AT1A 2V3VA 2NAFA 2VTKA 5ERGB 3TXYA 1D5CA 5K0ZA 3IV9A 1QE5A 3E03A 1OYYA 4D6YA 3VHRA 2PLRA 1CNMA 1DRKA 1WB4A 2XA2A 4JU8A 5J2TA 3A36A 1Q7BA 3UAXA 1LA2A 4PN7A 4B3BA 5FL7D 1JG3A 9ABPA 1V4BA 1Q14A 1A2KC 1YCGA 2BP7B 4DUPA 3NG1A 1O8CA 1URPA 4FDTA 5GAJA 3ESZA 3NASA 2AJ8A 3OUUA 3NJ8A 5B12A 1ZJJA 2F2TA 2NYUA 4LE1A 4KVGA 2BRUC 2HV8A 2BRUA 1JU4A 3UN1A 5FORA 3DFFA 1Z08A 4IXWA 4CV1A 2CFIA 2QGZA 1LGYA 2GNAA 2X9LA 4EJSB 2I6QA 3EGXB 1TM4E 2FMXA 2Z09A 1M1UA 1R0WA 2LWIA 4YJ3B 3LPAA 4GI2A 4YRPA 2VPPA 3DJYA 1K4YA 2NTVA 3QKWA 3W34A 3CW9A 2CXNA 1W36D 1NQXA 2O2DA 4DLPA 2GZMA 2XYQA 1T5TA 3A6JA 1ISHA 1FUYB 5JLJA 4QU9A 5BXYA 2HJSA 3C8HA 1Z73A 1UOOA 4H6XA 3TQSA 4EB0A 5AW3A 5HK9A 2CMFA 3SF8B 1T3TA 1XFDA 2FW7A 5ENDA 3M4JA 3WRXC 4MYRA 3VKHA 3WRXA 2ADMA 5IF3A 4GBJA 2ZLBA 5AVTA 5IDQA 1Y3CE 3LP6A 3GP5A 3UMFA 1CD5A 1JE0A 2DBVO 4W6ZA 3W1WA 1HTBA 4EATA 1Q5PA 4Q1FA 3L92A 4B82A 2XUZA 4P35A 3HWRA 2VCHA 1KDOA 3KT3A 1QKKA 4BQRA 5DI3B 3UCFA 1B3BA 3MSXA 2BC9A 1TO1E 1DG9A 2CF6A 1WQ1R 2IUFA 3F3MA 1NNEA 3QIAA 2X86A 4NBNA 1QHXA 3TLGA 3SR4A 3CB4A 3KFXA 2WR8A 5LA6B 3V2IA 3LUKA 4TN5A 4DNFA 4F71A 3RRMA 1S3IA 3RYIA 3SPXA 3PF9A 5ALRA 2IYOA 5FL7A 1VGRA 4B3TB 1KMCA 1XLTC 1XLTA 5CFPA 3DAOA 3KUDA 4AG6A 1PBNA 1P2FA 3ANNA 3K92A 3GZJA 1VG8A 3L6CA 4BNTA 3I8XA 4JI7B 4CMEC 4JP8A 1P0QA 2P5YA 2PD4A 4JROA 4MH0R 4MV5A 4FFWA 4ON9A 3QF4A 1NC1A 1YVPA 1XA0A 4IUCS 4D0GA 1OFHA 2D59A 3KDSE 5IPFA 1RJFA 2P40A 3T5CA 5C5IA 2P1DA 4U2EA 1OYVA 4LBWA 3VC7A 2EJWA 3ZDBA 3U49A 5M2QA 2H0RA 3FBGA 1F7UA 1VGVA 2C2BA 3ONNA 5KI6A 1XMIA 3BDVA 5BRAA 3H0KA 2P67A 2NTNA 4WFKA 2PH7A 4MRSA 2O7SA 1N0VC 3MUEA 1LK7A 3AOGA 4M1WA 4X6XA 3K71B 3LOPA 2H2IA 1FSGA 2OYRA 4RKRA 1FE8A 3ENVA 1B1AA 1LBTA 1QB7A 2PS9A 4QFCA 2G4LA 3ENWA 1JI3A 5HUQA 2RKBA 4HMOA 3DVAA 3FX2A 1SXJB 1XD2B 1Y9ZA 2XGGA 2ZUDA 3AJRA 4DLRA 1N6OA 4ERNA 5LN1A 4RPKA 5H02A 4P6VF 1LTHR 2KB0A 3KG2A 1VIYA 1KMHB 1IDN1 2YV4A 2W6NA 3VI3B 1GG8A 4EYOA 1EFUA 1L3IA 2VXYA 3SC4A 4DPLA 2P2CA 4JNCA 4ZGGA 4Z7OB 3Q2IA 4S05A 4R71A 2PFSA 3FYHA 3VHXB 2BF4A 4LOAA 1DOZA 1H93A 4IGFA 3MD9A 4YHHB 3EFEA 4M9CA 1L7PA 3C3BA 2XTZA 1IBLB 4RTPA 2L17A 1XMSA 4O3FA 4PLPA 1G20A 4JZYA 4AURA 3O1LA 2R0QC 2GMWA 2QTVB 3MN1A 4DA4A 4U00A 4YAKA 4YRZA 4N12A 3IP1A 2O50A 4G5RA 1L1FA 2Q5JA 3TZBA 3KJEA 4D1YA 2W42A 1SXJE 3ICQB 4B6RA 2MSEB 3H11B 3KVNA 3AETA 4MP6A 2Q1YA 4FWIB 1GCGA 2GF9A 3CR7A 2ZE5A 3TVYA 4BN0A 3VAZA 4DBLE 3A6PC 3REOA 2ODTX 4PHGA 4E33A 1SQFA 1J22A 1GZ3A 2AOXA 3L7NA 4H6WA 4YCDA 4YTEA 4GKBA 3TQTA 3KQYA 1R0KA 3KT6A 3G2JA 3OM0A 5H7XA 2ONCA 3LBFA 1QV7A 3B6JA 3BCRA 3JV7A 2H57A 4JIMA 4DCSA 3OQHA 4C7OA 3V00A 2AH5A 2BBTA 1EX1A 2JH9A 5K0CA 1Y1TA 1ZRHA 4RTJA 1VG1A 2I3DA 2QNBA 1FS5A 2DWQA 1UEXC 1RLJA 4C88A 1KFKB 1M34B 4HV4A 4FI3C 1LS6A 1H2RS 2P77A 5HIIA 1XPOA 5BUQA 3UJNA 2HF2A 3WQRA 1E3WB 2OCAA 2R8XA 3LUPA 4IJWA 4REQB 4US0R 2XXJA 4S0XA 4JLKA 1MVNA 4IKPA 5J4VA 5KBYA 5BVHB 4YAIA 2G4VA 2XKBA 1L5HA 2XMZA 3G8CA 3G8BA 3GIWA 3ZI7A 1VL0A 1Z25A 2QRKA 2AFIA 3PRJA 2PYIA 3EZ7A 3RS9A 4BFCA 2FQYA 2RB4A 5IKEA 3TZQA 1ZONA 2CLMB 2GF2A 3K5HA 1AV6A 2HBRA 2V6BA 3GCWA 2Q6OA 4FEEA 1YC5A 5ILGA 2B1JA 1C3OB 4I6GA 3VO1A 3J81k 3I53A 2QX6A 2FF7A 1BXKA 1Z4LA 1Z4JA 5JQWA 2OQRA 3RWOA 1KNXA 2HMTA 2QZJA 3PGJA 4PONA 4YLGA 1M34E 3AEXA 2YICA 1EWYA 2IUUA 1BJKA 1WSAA 3GEDA 3UMSA 4AO8A 4B3JA 3FIUA 3I9NA 3OICA 2AZXA 4KXMA 4ZHQF 4PC1A 5BQFA 5JSZA 4F5ZA 3UMBA 1P19A 4IDOA 3WHKA 5I7SA 3P9CA 2G5GX 5TE9A 5CT9A 1J07A 1XZCA 2ZSBA 3H5IA 4ARBA 1XR3A 4C08A 1QHYA 1O4VA 5H9WA 4YRAA 4P93A 4I3GA 2BFDB 3K9FC 5CH3A 1DEAA 2JH3A 3DUFB 1S2OA 3KHUA 3PEUA 1PZFA 3OLVA 4X93A 4B2LA 9MHTA 1CQXA 2DKNA 5ALXA 2WSLA 1SVUA 2IGBA 3X1YA 3DH0A 3KBOA 3A06A 1D2MA 3BCHA 3DC7A 2PTGA 3FDFA 2PYDA 4H4CA 3NHUA 2OT3B 3UGJA 4NMWA 4FMCF 4U2BA 5BSFA 4XIIA 2V8OA 1DEHA 4R1MA 3CH7A 4QGBA 2A94A 4IZIA 5IBRA 5FWDA 3GJ6A 4DV3B 1J0XO 4HT3B 2NZVG 4OMFG 2XE7A 1UR5A 3RARA 2QZSA 3QYAA 4PHHA 2WM9B 4TYWA 5CLQA 4A92A 5LKAA 1Y8QB 2HJGA 2X9GA 1NQWA 2Q3EA 4ZAZA 3LT2A 4YP7A 1JEEA 1DI0A 2Q5FA 2YUTA 2Q49A 2XTNA 3ZIAD 1EVEA 4B75A 1CULC 1LK5A 1FZTA 4PPFA 2JW5A 5AIAA 4LF8B 3BIXA 3FPJA 2ARKA 1K86A 1OBHA 3AU8A 2I03A 3BYZA 3HJGA 3Q8WA 4XUEA 3ETDA 1P7WA 1T9HA 3TI7A 3P9NA 5TMDA 5BWCA 2KBFA 1CFJA 4FQ5A 5L95A 4WERA 3O4RA 2VJPA 3OLYA 4K9RA 1K6XA 2J5RA 1V16B 2H52A 1YJ5A 3O03A 2EFJA 2C42A 2ZAYA 1GL7A 3GJQA 3X0DA 4KYUA 4K8RB 4UM7A 3MTQA 3N0RA 4ND4A 2ENUA 2IDKA 3HJCA 1XEXA 3EVZA 3WSWA 2JBAB 1BW9B 4MW6A 4Y67A 3ONVA 1JT9A 1BQ3A 1SC4A 1WMAA 2R3SA 3U44B 3THOA 2I6TA 2NPOA 2REQB 4YAFA 3T7JA 3TLMA 2WILA 4E2XA 4CL8A 2AR7A 3DTTA 4Q7MB 2AFHB 1E2HA 3BD7A 3KQOA 1L8OA 1QC5B 1H1DA 2NUBA 2YYAA 2DHEA 4WNAA 1CIPA 1RRCA 1ML3A 1P0IA 1TTQB 2Q9UA 3H9BA 4OFWA 4AMBA 4ZV4A 4J43A 5H3HA 1ZK0A 4J4TA 3AIKA 4RJTA 2X13A 4YEDA 2LR0A 2JAOA 1UODA 2BY4A 2D54A 4PG7A 3EZ6A 2PBZA 3V8VA 1BA3A 5B3AA 5JUWA 3ESYA 2PMCA 2WUFA 4BX9A 3ENZA 1JE1A 1GGMA 2VDRB 2NXJA 3JWPA 3QYJA 4CM1A 4Q1BA 1FX0B 2FFJA 4FFBB 4DPMA 4GLOA 3MFYA 2VJAA 4XOUA 3NC0C 3LT0A 3TIXB 5ENVA 1MMFB 3ZHYA 2AFHE 2NV0A 3S1LA 4NU5A 2BCJQ 1L4MA 4Y2GA 2AI1A 5CUQA 1ZP6A 1KDPA 5ULLA 1D04A 1VSUA 3AJDA 3ZIAA 5BR7A 2P2GA 4J03A 4LV6A 5TQVA 4WA7A 4XM0A 3AG5A 5DLQC 3TQFA 5AVVA 4AY6A 4R0NA 1QP7A 3OJXA 5FFMA 4LOKA 3NCTA 5EQJB 2X41A 1N6KA 3KTDA 4UKDA 5AI9A 5JCOC 5LPNA 4M8NE 5A4KA 4ODIA 4RGBA 3O5AA 2PUAA 1PDVA 4IYRA 4LBZA 1P4RA 5LVAA 3V6MA 1QANA 5CT5A 1YNOA 3KZOA 3B1YA 4PNEA 1CY7A 1KI9A 3M5WA 4PO9A 1V96A 3HADA 4ZT5A 1CZNA 1ZVQA 2AIRA 2C1XA 2F3TA 3NWPA 4PQEA 1G8PA 2NQTA 2ATVA 5CTJA 3WJ1A 1SHTX 3T9FA 1EFKA 2EL7A 3I1IA 1CUVA 2OXEA 2A33A 5B1DA 1EGQA 3CNQS 3ESRA 2AYYA 2BUBA 1R4AA 5GGXA 3JYNA 1XAGA 2QLMA 3ZQ6A 1IATA 3HLYA 5P21A 3ADBA 2VJKA 1XVIA 1NBWB 3GGGA 5FBLB 3A1EA 1ONBA 5ALZA 3UXMA 1WLSA 1ILEA 3B1WA 3MLEA 4EUHA 3PNBA 4AZ0A 3PUVA 1JWBB 3VKFA 1KDTA 4P84A 2LXNA 2WIAA 4QUDA 5ALUA 5ECDA 5AHOA 1NLYA 4EI7A 4OHXA 3ZBPA 4DA6A 4TTPA 1E9RA 2FOLA 5DW3A 2LIVA 1SFRA 3PI7A 4XE5A 3UVEA 2DVMA 4IGAA 4JJ7A 3BDIA 4JT4A 3WICA 4MS4B 2OO3A 3LGXA 3TXXA 3ASVA 5H4GA 4B4KA 3GLRA 3RYCA 1KK0A 1QH8A 4I46A 4L6IA 3NIBA 3KOUA 4O4LB 1CY8A 4P5EA 4J0FA 1U6JA 2I2AA 3MUOA 4RKQA 4AXBA 3V3TA 4B3GA 3RK1A 2F17A 1A82A 1Y8AA 2EKPA 1AGNA 1BN7A 1LDGA 1CUXA 1WUYA 1V3UA 2O6LA 2W2TA 4GSYA 2BM1A 4RDCA 4RMIA 3KV3O 4F2HA 5CFMA 3AW9A 1L6RA 3UY4A 1K8QA 1NMYA 1ZEJA 1PG0A 2W4MA 2WWHA 2PUHA 1J24A 4PYNA 5BNFA 3OTOB 1E1RD 1XWWA 4Q18A 1Z0JA 3C6YA 4NBRA 3Q0TA 3IO3A 3QHAA 3TQIA 1M74A 4Z4HA 4MR8B 4YK7A 5HM6A 1SU6A 3AR7A 4IOMA 4FCTA 4LRTB 1RWOA 3EMVA 4CMAA 4ONEA 3TUIC 2DR2A 4QTUB 2CVZA 2JGMA 1Z8NA 1YWGO 2P9QA 2UYOA 4Q15A 2I2BA 2NQ2C 3IH5A 1UJNA 3PDIB 1J09A 3QYFA 5AKGA 1WXDA 3ME5A 3DLBA 4TQAA 4OHVA 4LMAA 4ZI7A 3GFGA 3WJ7A 1JQ5A 4UM5A 1NP7A 1ODSA 3QZUA 1YS6A 2PU7A 3M6AA 4JN6B 5DHQA 3SYMA 3W2IA 2F43B 3O4VA 5IK2D 3EZGA 3Q88A 1NJ5A 1SVIA 2CNNA 4LJYA 2EJUA 1BFDA 5AUQA 4EKNB 3DONA 1O7JA 1ZDMA 1SCIA 2JLBA 4MJ3A 2I2WA 5DHAA 3IEMA 4TV9B 3ZDXB 3ZU6A 2Q5EA 5KNCD 1F1JA 2H16A 3BGOS 4G86A 2RGDA 4N0MA 4OQYA 5I9TA 1KGSA 2G09A 1WNFA 3I2GA 5T8KC 1F48A 1NBME 4O4JF 5AM1A 4RZSA 5T8KA 3F73A 3MCVA 1ORWA 3GCGA 2XZOA 2BZ1A 4L6CA 2BEWA 4NU0A 1NX9A 1OV4A 1TTPB 4LEIA 4DVJA 1WV0A 4D9EA 1KNQA 1Z33A 5FH9A 3B52X 1N5MA 3GA5A 1USIA 1FP1D 2OAP1 4PNZA 2BEUB 2NACA 4D3FA 1RW4A 4L5CA 2AC7A 3A1VA 2CMGA 2IC5A 1NVEA 1ZI9A 1ZH0A 4PRKA 5JFGA 4CMGA 3B85A 1U9ZA 3AEKA 1GDHA 5AMXA 3RUEA 4P4TA 4CTJA 1VKNA 1MPXA 3BE6A 4ER7A 4HAIA 4OFBA 3RU9A 3H2GA 4F4FA 3AY0A 4PLYA 4OOFA 1E1RA 1IBCA 2CFTA 4ZAGA 2EIHA 2CLHB 3KT8A 3GFBA 5BORA 1M6NA 1VI6A 3AF0A 3SZ3A 3C74A 3NTVA 4ZK2A 5ADUS 3FUWA 1ZHHA 3Q9LA 3UW3A 4GPTA 2CXPA 4NF2A 2H1OA 1AK2A 4YV1A 3BICA 3D2CA 4MRNA 1EPUA 2IU4A 3K5IA 4F9GA 1T9DA 4UMDA 4WZBA 1Q7EA 3HKBB 1A4UA 3D59A 2FPSA 2ONYA 4NCNA 4MGYR 1WU8A 2HQOA 3L8FA 1F5SA 1T2CA 3BGIA 2IYUA 5FOSA 4N5MA 1EFRD 5TS2A 4OQPA 5K20A 5IK2A 4NMLA 4EJSC 2OGZA 2Y2UA 4ZJUA 3KSDO 4EJSA 4E94A 4OO3A 4TPKA 1KEWA 4BB9A 1T5LA 4C0WA 1V9LA 1F0KA 5K3CA 2VWHA 3D5TA 1P2DA 1QQ5A 2QAIA 3NM6B 1IQRA 4AX4A 1RKUA 2OG1A 3A4NA 2C2YA 1IPEA 1S9DA 1UDBA 4ZALA 3SLKA 2H6EA 3FW1A 2RG7A 1YU9A 2OPBA 3AF3A 4CUJA 1U0JA 2POQX 1VMAA 1A8UA 2WJPA 5KQLA 1T3ZA 3CUVA 4FEAA 2QD5A 4J0JA 3SEQA 1S6YA 1U7DA 2BLLA 2B82A 1E66A 1UXJA 2VRBA 4IVNA 3SF8A 4CM9D 3MLAA 4CQJA 4CEIA 3PFFA 1O6FA 3UHAA 4PQYA 4K9SA 2QTHA 4HAWA 3MGAA 1KO8A 2OHIA 1QGED 3IEPA 4NONA 1DJOA 4DCMA 2VDKB 3P9SA 1ZOIA 2ZXFA 1I2BA 5DYNA 4EHAA 1IMOA 3UCEA 5JZBA 1Z5ZA 2Z0MA 5ER9A 1CKEA 4N39A 2IIBA 2OECA 1TADA 3A1WA 5DI3A 5EZQA 3OFJA 5FNZA 3PTLA 4CM8B 4QTZA 1PEKE 1YDGA 3QPWA 4JLWA 4DM7A 2A58A 3L7OA 3O74A 4HDAA 5LA6A 3ZZTA 1XTBA 5IH7A 4YJ2A 3C16C 2FVYA 1Q0UA 3GZNA 2IA5A 3FFWA 5CP8A 3DXZA 4HATA 5DXAA 5JXGA 5KYKA 2VZ8A 8GPBA 3QSYA 1Y82A 1TC2A 1YQWA 1BU8A 1IOLA 5A3SA 4JC4A 1Z4OA 3VYRB 1JHOA 2BKLA 4BFYA 1LRLA 3K35A 4BVFA 4EA7A 2TMYA 1C9EA 2JCYA 3N76A 4N0PA 4Q9LA 5EP1A 2ZJ5A 5TS3A 3C8DA 3CISA 2OKCA 3ILHA 3PC3A 1EFRA 1YU6A 2VT2A 1MQ9A 2JPDA 2BPOA 2NG1A 1Q19A 1QO7A 3O9MA 4Q3OA 5AXDA 3GWZA 3E9QA 3WNVA 1KYQA 4EHNA 5CD1A 2R8RA 1IZYA 3N8KA 1I1NA 2BELA 1EHYA 4YROA 3TPFA 4RVGA 4GGOA 4BYGA 3F6YA 1VFPA 3PGLA 4RAOA 5EJ5A 3HY4A 3KTOA 4L8WB 5DWDA 4XGQA 1U0OC 5THKA 4F2DA 5TVKA 2CVQA 1I13A 3HUTA 1LZLA 3K0HA 1YBFA 1P62B 1RR6A 2FGJA 4GOKA 4L9SA 4QVKA 3X2EA 4F06A 3L8MA 2QMUA 2GGSA 1YRLA 3RAGA 1LC3A 1RPTA 3T38A 3EASA 1XD2A 1UMDA 1OCEA 4AF8A 5DMHA 3ZHCA 4TXLA 1FFDA 1OSNA 3DCJA 3PNYA 5JJBA 2JFVA 1DDIA 1KI6A 1KMHA 1NSFA 4HQLA 4HWKA 5IASA 1OWMA 1XZFA 3U37A 4ZXPA 1E7MA 2XWQA 3HCNA 1JEJA 2X0KA 3I0NA 4O4HF 3VJMA 5LD2C 4CEIB 4P80A 3NTUA 3NVDA 1RMTA 2PFKA 3PUHA 4FX2A 3VHXA 2GKGA 4DCVA 1T36B 3D8BA 4URWR 3WRYC 4FJ0A 4RZXA 3WRYA 1PGPA 3TKAA 4C4OA 1EDOA 2BBWA 3FOAA 1KVTA 3VR1A 4QATA 5C46F 5JS1A 1N5IA 2UUAB 3NAQA 2IYPA 1OU4A 4MHSA 2QTVA 4LW8A 2OCBA 2X4LA 3EUWA 3LPCA 3B9QA 4M99A 4OCZA 1RPZA 3LGSA 3IBYA 2F55A 1RD4A 2VF8A 3FLAA 4QQKA 2QW0X 1UKBA 3GYBA 1E8NA 3H11A 4B3RB 1M8KA 3W4IA 6PFKA 4ZTUB 1R7RA 3DR3A 3EXG2 1BVHA 3THYB 4KXLA 4LX8A 2YWCA 1UBUS 4OIFA 5IT5A 2EQBA 3RRJA 1N2BA 2HJ9A 4HN2A 4FFMA 3KHSA 4OYHA 1E7YA 4WKGA 2PL9A 3AF2A 3DP9A 1G5PA 3DE6X 2A1TS 4WLEA 2GJSA 3BT7A 5LQCA 3Q7QA 4UCWA 2H06A 1IC6A 4UNSA 4CN8A 2A5FA 4GGMX 1DRUA 4R1LA 3DYVA 1Y81A 2DM6A 2PX0A 3H05A 2PV0A 3V7UA 3B2NA 4LDRA 4PZPA 4RV4A 4XASA 2WIBA 1VSBA 4V0RA 1E3WA 2NT3A 3G8DA 1VJDA 2OP1A 1MUUA 4QYSA 4BAZA 2A78A 5KNBH 1J1IA 1JAIA 4QBHA 1I8TA 1I24A 1HEYA 1QCZA 1QP4A 3MK31 2Y0PA 3RVNA 3ONEA 4UPVA 4W9NC 2EX1A 4GEGA 5KTNA 1UJBA 4G5GA 4W9NA 1JIIA 4XJXA 1SKYB 1SUBA 4I4LA 3N59A 4MQMA 3RE1A 3IURA 1IHPA 1ZK1A 1LI7A 2QD3A 2YJ5A 3NOVA 4A4DA 4AJ1A 2E1PA 4J9UE 3ZWDA 2ILVA 3I5AA 3O8LA 1W5AA 1GKUB 2CXOA 4GUDA 4MQUA 1ESZA 3V7YA 4DA7A 2QTCA 1BWQA 3AHIA 1IRIA 3L4KA 1E62A 2GUWA 3EVCA 3S8EA 2GAAA 4S04A 4NBWA 1OLSB 4TMKA 4CNBA 3OFND 3GO4A 1AKNA 1WPGA 1ZD8A 2ZUUA 5DDIP 5C3MA 2ZZKA 4JYZA 4KJZA 1WULS 3PX7A 5DYWA 1NPYA 2IYRA 3E2PA 4B8YA 4DM3A 3GT4A 3OLXA 5GIOE 3M6LA 5FF9A 2YQ5A 1ZJ4A 1NOIA 3DEKA 1M1YB 5LJLA 1XC7A 5HX7A 3Q7TA 1GU7A 3RRBA 2C2XA 3WXBA 1ZR2A 3FLBA 1SKYE 1VC2A 3DUFA 2VDVE 4IO0A 3MC1A 5JZVA 5IVKA 1J2UA 4C22A 1EU1A 2BMWA 1XRRA 2BGKA 2DP4E 2V6GA 5JD6A 1ZHOA 3W5JA 2FPWA 1EM8B 1T35A 3WQSB 1WZEA 1J2JA 2ZRIA 4RU1A 3W8NA 4HBGA 1BD4A 4X66B 1KZ9A 3HA3A 3M83A 3MSCA 3RC8A 3DZKA 2XQGA 4XR9A 1JIQA 4UBIA 1B42A 3SP1A 4ZVKA 2CZGA 1Y8RB 3VBCA 1BJTA 3OWHA 2XWSA 4F84A 1DC7A 5ICSA 4QYTA 4H3SA 4B6FA 5ISMA 2XB8A 2C2KA 2B1RA 3KUKA 4K6MA 4U9HS 1M1YE 4KJXA 3ROEA 4ZCIA 3HKCA 4JOQA 1EWQA 2JVIA 5KHAA 4FKZA 1K8XB 1KVSA 2YZ7A 3O6VA 5E1OA 3TAUA 2ERXA 4QKQA 2CZCA 1COWA 4HVCA 3HXQA 3H5OA 1HC7A 4KXQA 3OQPA 4Q6BA 2PR2A 4Y7CA 2DBQA 3QHPA 1GTVA 1D1QA 2CXHA 3M1IA 3K6KA 4IINA 5LP6B 3V1YA 4LYHA 4IGKA 1ZN8A 2GJ4A 4TTTS 3TVDA 1DC5A 2Q50A 4IICA 5EE5B 5FOVA 1O58A 1QM5A 3L8EA 3N2GB 4AJPA 2W0SA 1PJLA 3GF4A 1RC8A 2JD1A 4J7AA 1V16A 3PRKE 3FNEA 4H1VA 4NOMA 4RQBA 3ZUGA 2JZNA 4Z7QB 2R2GA 3ONFA 3W5BA 1AVTA 2OWDA 2FSSA 2GESA 1IQ0A 1YZLA 2YV5A 3ABZA 4G8DA 4M1YA 1ZK2A 2Q8PA 4QGGA 1UBMS 1TUGA 2DWOA 2V7BA 1BW9A 3COYA 3NBYC 4BHTA 4DRXA 2PMEA 5JEDA 1N25A 4OJYA 1U8EA 4QPDA 2CNKA 3U44A 1RYBA 3EY9A 4LNUB 5AKHA 5F64A 1RXSA 2REQA 1QX3A 2B37A 2BR4A 2VH5R 3SFVA 2AFHA 4MUGA 1S5PA 4URHA 4EYKA 2PNFA 2GBPA 2PBFA 1QC5A 4LYAA 1CJCA 2CHQA 4O2RA 3U3ZA 1WEKA 2BMJA 1GV0A 2W5UA 4JYMA 3IUPA 4M9XA 4RTSA 2UKDA 3STXA 1P8AA 2PJRA 4M88A 4LTNA 3GGOA 1BE6A 1DTWB 1JTVA 4Q02A 1W5FA 5ALPA 4F5YA 4HDMB 2AR0A 1BGVA 2FQQA 1HWYA 5CJJA 1NI3A 3WKAA 1GG5A 1ODCA 2AN5A 2JLQA 2QRZA 2XF2A 3TQCA 2AEEA 3E5MA 2Z04A 4L4RA 4RK0A 5K3BA 3VR3A 5FUMA 4N40A 2GHIA 1GQSA 1L7RA 3COWA 1W5BA 3LXUX 1FX0A 4MLCA 1LLFA 1POWA 4FFBA 2DULA 1R5JA 1A2OA 1PJSA 1WEHA 1ZH6A 2O2HA 2IXFA 2W6PA 4LJ9A 1Y48E 7REQB 5GZ6A 4C20A 5KKCA 2MWMA 3QPAA 4DRXB 4M60A 1E63A 3PBKA 1S2NA 2P6UA 5BR8B 4Q0MA 1N5DA 3HN6A 3EB9A 4ZI2A 1YBVA 2NUTB 3QITA 3MZ0A 1X1DA 3LUDA 1HRKA 5ALQA 5I45A 2G4CA 2J32A 4F45A 4J6FA 4D79A 1XOIA 4KO3S 5DT2A 5AM3A 1HV8A 4EPWA 4GICA 4LZPA 4FWTA 1P91A 4IH4A 4JYBA 4GZ5A 2Q5CA 3QM1A 4IJQA 2EGHA 3UUGA 1U0TA 4BO7A 5CXQA 1TEXA 2G8NA 1C8LA 1JRLA 4IWXA 1C0EA 4JB3A 1M8JA 2JGKA 4PHTA 1C81A 3MILA 2BE9A 5TJ9A 2LKCA 2RAVA 1X6VA 1EP9A 3MWGA 3CRQA 1M2FA 3L1IA 1N7IA 4AQDA 3ISVA 3MJFA 4AW9A 4EGJA 2QT1A 5AXAA 1U7OA 3OQIB 4TSRA 1O0BA 2ABWA 1O57A 1XZEA 2D2XA 4YJGB 1UZLA 3GGCA 3SIWA 4C4RA 4D5EA 4EK9A 4YT8A 4ZAFA 3UYLA 1EFTA 3JAWB 1SHZA 1U5BB 1GV1A 2O0KA 3HEAA 2XKKA 3JPYA 2PX4A 5K0SA 1NU6A 2IEDA 2J0UB 2QYOA 3QH4A 1PT9A 3KQQA 5FA6A 1M9NA 2ZREA 1D6MA 2CEAA 1DQRA 4CLOB 2BFCA 4TTAA 1Z2NX 3EVFA 4Q9HA 2YXLA 4Y2VA 5F4ZA 2DTEA 4ISCA 3RVOA 1K4KA 2BD0A 2HBZA 4B5LA 5B2ZA 1OX6A 3ANLA 3ZHOA 1DJNA 4G1EB 1S8OA 1NMEA 4MDHA 4AICA 4J9VA 4EL0A 1I3KA 2C92A 2ZANA 3VVCA 4O4LA 3JTEA 4ZO9A 3RSGA 1S3FA 1NOJA 1YVEI 3OF2A 2QE7D 5LUAA 1OBOA 3GEGA 4YV7A 4KIFA 2HRBA 4RL6A 2VWQA 3DMRA 2QPAA 3PXAA 1X7YB 3FCEA 2V5VA 3KD3A 2BSXA 1OIVA 3VYSB 2IKSA 4P3NA 3HKEB 4MROA 1LPAB 5E0KB 3ZHZA 3UUWA 4CMHA 2FEOA 3OP1A 1L7EA 2EW1A 4MR8A 3VMFA 1VJ5A 2Y92A 4WXYB 3EX7C 1G6Q1 2MSKA 4GYKA 3GN1A 3C5EA 4DUGD 4IV5A 3GEMA 5D7BA 1U2ZA 4RSMA 5A04A 4DV7B 1RVV1 2YWBA 2ZTMA 3NHPA 2HDHA 4WADA 1ZMBA 1SKAA 2WWWA 3L6OO 4FMDF 5T4FA 3PDIA 4Z3OA 4QO8A 4BMPB 4LVUA 4R98A 5IC6A 2G9QA 3F0TA 1VFNA 4PRZA 4KQGA 3CLRD 1DTEA 3GAFA 2X5XA 3R5JA 1ZVVA 3NT5A 3DVSX 2PWPA 4I4TA 4ZKEA 1DXHA 2D1YA 5ALIA 3VR5H 2C9MA 4FR5A 1M2JA 3E18A 1C9YA 2F43A 5DGDA 1CF4A 3TQQA 3RD5A 1TFRA 2I22A 1TOAA 3H83A 2WP0A 1VL2A 4TV9A 1E3TA 3CUYA 5DMXA 2I6GA 3AINA 4C07A 1R88A 3GUHA 4LY0A 4MPJA 2DCUA 3I01M 1CP2A 4DSZA 4WPGA 2O8EA 1AU9A 2IPMA 2QJTA 2YBEA 2DF8A 5C81A 3LGAA 2PMDA 4A15A 2ZB8A 5HEKA 3WB2A 1R4ZA 3WL3A 3DQZA 4EBFA 3C2QA 2VKTA 4GVLA 2OCDA 1Y6RA 2BW0A 2VUSA 3VTAA 1T43A 3PQ4A 4LC0A 2CNOA 4MLPA 2PGAA 2ZJFA 1QUEA 4I1IA 4LECA 2AC4A 2M6SA 3PHLA 4CQMB 1BHQ1 1YACA 2BEUA 4RPLA 3DLCA 3SZLA 3LK7A 1GOTA 1TZBA 4OOEA 2QE7A 3UHJA 4O08A 4BZPA 1YK1A 2D00A 2ZE8A 1N9GA 2QXYA 5DOZA 4EYQA 4LF6B 1QKIA 1T6ZA 2VLIA 2ZEJA 1VDMA 3B1ZA 5B37A 3RSZA 2PVSA 3UJ9A 5HKAA 1JB9A 1XALA 2C5SA 4KR9A 4ZTZB 3GFPA 3OPNA 1CZLA 3EQZA 1R50A 4DWJA 3OOEA 3D1VA 1V26A 1GNTA 4NESA 1AOXA 5JANA 3C39A 3WMRA 1LV7A 3Q0EA 1HPLA 4RLSA 4BQQA 4I1RA 3RVJA 4NMXB 4F85A 2WKPA 3NALA 4XYLA 5JROA 1YFJA 4HPJB 3CKLA 4DV1B 3IPAA 1VSTA 3E05A 4M87A 3JYOA 3GLFA 1VM6A 4RYLA 4KXYA 4QJ5A 3UK2A 2AWNA 1Q17A 3IT0A 3ORYA 1JJVA 2XBLA 4KGDA 3CLRC 4ALIA 3EEIA 5KYNA 2EFEB 3VR2D 2ZKLA 1G3RA 4TUYB 1ULHA 2RGYA 3B1FA 1O94C 1WDLA 2CNDA 1L3CA 2V3WA 3NWBA 3NX4A 5SY6A 3UKOA 1J56A 3P52A 4ARAA 4BNFA 4BN5A 5E4JA 4CV2A 5HZHA 1UIRA 2CK3D 4H17A 2GERA 4GOXA 2GEFA 4TKVB 2OOSA 1BX1A 3Q7RA 2OXTA 1B2LA 1KIAA 2G28A 4WWHA 4XGIA 3KP1A 5EVCA 2FJPA 4RVNA 1GFIA 1SUCA 1Z2PX 2X9VA 3LYHA 4FP9A 1P1BA 4MRVA 5IABA 1PTJC 4YB8A 1PTJA 2IHUA 5JEEA 3C8MA 4I1UA 3ZHTA 3KJNA 1IB0A 2CNBA 3DOUA 4Q7JB 3NHBA 3M6XA 1VIAA 2J7KA 4I5DA 2NXCA 3GAAA 3F2VA 5DW0A 4DEVA 4ER5A 2VUHB 1Y3AA 4GNKA 4QU8A 4PIMA 4KX3A 3EAQA 4MR7A 1RXEA 1Y3HA 1KI8A 1EEXB 3K4QA 3CBGA 2YMLA 5U1PA 1W46A 4QSMA 3ZEIA 1JLKA 5JBQA 4PZ0A 3GYGA 3HI6A 1NMXA 2PKQP 4G0PA 5AWFC 4E0BA 1IOZA 3RJ5A 1H9AA 3D6UA 1FJGB 2A6PA 1XTZA 1R16A 1E7SA 4O2BB 3C4VA 3KWFA 4Y9TA 3L82B 4UD6A 4CM8A 1GVNB 1LI5A 1Y9EA 3C4JA 4KL8S 4RHEA 3THRA 1MOZA 4WVFA 4Z9FA 2CGEA 2Q1WA 3CV3A 4CDMA 2V9CA 6GPBA 4IQ4A 1QG2A 3IPRA 4WGFA 5DHRA 1EESA 2IPLA 2PJDA 1WA5A 5LZ5A 4Q1VA 4CLRB 5BWNA 4MI3A 1P5RA 3X44A 1SPXA 1Z5WA 1EK1A 1TJYA 3CZQA 1SXGA 4QYIB 3VDMA 4E5MA 3PF8A 1LQTA 2VXOA 3VJKA 3O73A 1EGVB 3V9AA 3AM3A 4H7DA 2Z58A 1YFKA 3T7KA 3W06A 1Q0RA 3C8UA 5EL0A 5HUHA 2GFQA 3WYEA 5A9TA 3EXIB 1Y42X 1QR2A 4G9EA 3F3KA 1GUFA 2CYAA 3NEAA 5FYDA 2CK3A 5C5DA 2R4UA 2ZRGA 3QA9A 1Q1BA 1PWHA 1W85B 4EEKA 1Q3KA 2Q3CA 4B73A 2QVCA 5HVNA 3ND9A 1XI2A 3C3AA 3I2IA 3T7IA 1XZIA 4BEBA 4BNDB 2OZKA 4ND3A 3UNXA 4JBHA 1MOPA 4Y2SA 5TVGA 4UOZA 4M7RA 1IHXA 2G5TA 2F8MA 2YHSA 1H1LA 4UATA 4DZZA 3DZDA 4KLZA 3UB3A 3U61B 1O1YA 3BL6A 5KJCA 1F8UA 3D81A 1K3FA 5I48A 3Q1KA 2HYDA 2FPGA 4C6RA 3C5CA 1EG7A 1O08A 1RPAA 2JI6A 1TK9A 5LBTA 2ZULA 4KQ6A 1T24A 4DLXA 4YDQA 4F7WA 3SY8A 3GNQA 4IUYA 3OPMA 4TVOA 1FX1A 4YRJA 5EPEA 1FDVA 4OL9A 1RJ9B 2PXCA 4LFBB 3R5XA 3TGLA 1BX3A 2JVKA 2XGSA 2FSVC 2J59A 2JEYA 1PS0A 1RLTA 5DNAA 1K2VN 2YWGA 2W8BB 5AI4A 3VPFA 2XMDA 4NEQA 4YMGA 1JZSA 1FTQA 3DMTC 3L79A 5BV0A 1NZDA 2G9UA 3DMTA 3F1LA 2JDID 3G0BA 5HQTA 4LSWA 5GADl 1QHNA 3OCYA 2B3TA 1A1SA 3WLKX 3FWPA 4RA6B 1KYVA 1YAHA 3PXBA 1J2TA 2NTEA 3B12A 3BWMA 3L04A 4WGGA 3QLJA 4CZ2A 2BGWA 1TO2E 5DX0A 4I2VA 3Q8XB 2CLSA 3EZXA 1E2NA 1PZXA 4GMGA 2IBMA 4R8LA 2XT9A 1YMQA 4W5JA 2WU1A 4WXRA 1AT1A 4QSHA 2HT1A 3B6MA 4D3ZA 4QPJC 3VU3A 4PAOA 1KZGB 3KKPA 4BOYA 4QBGB 2BE7A 5EIEA 3KXDA 4KAFA 4UTPA 2ZBGA 2W37A 4H1TA 5EJFA 4HNUA 4QOSA 3ZWMA 2QD4A 1IHUA 1T0IA 2VAWA 4LXUA 4J0DA 3NTOA 4W7HA 3V55A 5CA1F 5K0NA 4YCNA 4B79A 1T3HA 3Q0IA 5BT8A 4N3NA 4GLJA 1WTCA 2DGDA 4REMA 2HIAA 2IXGA 3OLQA 4IVPA 2EJTA 4OGFA 4M1TA 4X1YB 1PR9A 1W2WB 4N5HX 5COBA 3TZLA 4AF7A 1XKQA 4E3ZA 1SIUA 4M0CA 3DMDA 1GWNA 4KIJA 1JQEA 1K7CA 1I01A 2B4QA 3QVUA 5DCWA 5HIAA 1FNDA 2WU3A 4ZVUA 1ODKA 5KC8A 2VHZA 5ARDA 4YT5A 3E1SA 3G02A 1HTTA 3C6ZA 1OLSA 2FPKA 4L95C 1NGSA 4GR4A 8AT1A 4J29A 5LNK6 1P5FA 1R8JA 3JU3A 1EQAA 2AW5A 1NJ2A 1XCJA 1YRQA 2C0QA 2ZI5A 3FE2A 1G8KA 3KO8A 4OQFA 4ZHQB 4QTTB 5EJEA 4KN5A 5U9CA 1EX6A 1RKVA 2J4CA 2O2GA 3IUQA 3M1LA 1F9AA 3MYRA 2ZUTA 4AUNA 1TZKA 4PXAA 1M1YA 4XX1A 4HUQB 1IU9A 2JDIA 3PVCA 1Z83A 1CDDA 3AYZB 3PEEA 1ZU4A 3UMGA 1OFVA 4RD0A 4FXOA 4KPFC 4G0VA 1FQOA 1OBCA 3ESQA 1WSBA 4W5NA 1E96A 2PBRA 1XF9A 4YCCA 4LJ5A 1W5TA 4G0XA 1H8HA 1QCCA 1BMTA 2IOFK 4CG3A 3ZZMA 1IONA 2VDUE 5B7NA 1E6LA 4DNQA 3DL0A 3P9QA 1RQ7A 3LU1A 1WL8A 2GN4A 4NV3A 1SQ0A 3GARA 1CRQA 3HM2A 3P2OA 5LQMA 1NRWA 1Y8RA 5CM9C 3T99A 3W5VA 1GLNA 3GK3A 1Z2OX 2FAXA 3HDQA 4KTTE 6Q21A 3A37A 3ZU5A 1ZWLA 5KTYA 2XEDA 4BB6A 5GY7A 2OTCA 5KAPA 3RKRA 1EIZA 3DEJA 1OTHA 3FYCA 1QIDA 4AS2A 2OY0A 5A03A 2QS9A 1GKIA 1DAMA 5CNJA 5H0IA 1B26A 4R9UC 3L49A 1U2QA 3FWNA 4JI6B 3PTZA 1T2DA 3O1HB 4BZXA 4BLOA 1SVMA 2COEA 3KM0A 4LJLA 3CA8A 1U81A 5LP6A 3ZLTA 3KU1A 2VSFA 1Z63A 2CC2A 1OBFO 4OXQA 2BN4A 1Z47A 3C3XA 4NY1A 5BSHA 2WIGA 3HV0A 4F4JA 5CDUA 1JHUA 4KN8A 4JX9A 4ZWNA 3RFCA 1M3SA 1XTJA 2BEJA 3EPRA 1CU1A 4HAYA 3NDPA 2Z9DA 1NU8A 4MYCA 5THXA 5ICFA 3TX2A 1W0JD 3RUPA 4RY9A 2PSSA 2EFCB 4LNUA 4M89A 1Z36A 4ZVRA 1M0TA 5I5GA 3SBXA 1DZ3A 1Y6GA 4N7RA 1NJSA 3ZJTA 2IIPA 1QIIA 2W4QA 1BMFD 3KEFA 3D8HA 4YS6A 3KBBA 4DJAA 2MTBA 3V8PA 3NNNA 5CURA 2NSJA 4Z51A 1TU3A 2WWGA 5G2OA 3IUNA 4NENB 4KSCA 5LLTA 4P0TA 1DTWA 1G6KA 4GVXA 1EQUA 4R2HA 2HHHB 3AR3A 3QMVA 4HDMA 1WF6A 4GUAA 2HHCA 4AT1A 2VHXA 3KKZA 3NYRA 1UFRA 3B7WA 1Z62A 4JLBA 3L77A 4I66A 3V46A 2JNWA 4DNXA 1CY2A 4F3RA 1RJDA 3A3KA 1P1IA 1NP6A 4LJSA 2P11A 4YASA 3TM4A 3BTVA 5B4UA 3AVXA 4IGIA 1IHOA 4OI4A 5DPMA 4AU1A 1L9XA 3CF2A 2XW6A 3MCZA 1BXRB 4U9UA 3GU3A 5K05A 3LWZA 4U1RA 5FADA 7REQA 1NL3A 2AJBA 3FJ1A 5JCJD 3USCS 1EYZA 4FD2A 1MEOA 1KSFX 1U99A 1R0BA 3DDWA 5TPZD 3FOWA 3IHKA 3QQPA 3RC2A 3UJ6A 4Y0AA 2PZ8A 3UOAB 1SA0A 4L76A 5CIYA 4F2PA 3HKDB 1DC6A 2NUTA 1NXVA 3BVPA 2IDMA 1Z3IX 1VPDA 4B3XA 4NOLA 3H75A 3T61A 1SUEA 4PAMA 4BBJA 4NYIQ 2GJ9A 3O4GA 2GHRA 3ZU2A 1R2QA 3PB3A 1VL8A 4KUHA 2GO1A 4X63A 1MW8X 4BVBA 1IG0A 4DG9A 1OTYA 1IAVA 1Z29A 4DE5A 2YYYA 1GNQA 4FOLA 1KQNA 3WK8A 1B6RA 3DFMA 5FUXA 1UDCA 2D0OB 2VZ9A 1XZDA 4U9IS 1I4WA 2M6RA 1OFIA 2RH9B 4QRHA 1WB9A 1KBOA 2O3UA 2Q3HA 3RVMA 2ONJA 1ZQ1A 3RWMB 4OREX 4R6XA 1CF2O 3OQIA 2PUEA 4DIBA 1E2PA 3BMOB 1A9ZA 4Q4AB 4YJGA 1BMFA 2R4QA 3KSUA 3R3HA 1VXRA 2QMZA 1YZTA 2BM8A 4R1TA 3MRVA 2FN3A 5HMMA 2J9XB 1VLZA 1N6PA 3JAWA 4C0KA 4XLTA 3RVKA 2NSYA 2WUEA 4BC1A 4OTZA 4JBYA 3L7JA 2Y1CA 4PTLA 1XTUA 4ACBA 5AJUA 3S2YA 3DPUA 4Z3KA 3H16A 4TRJA 4MIYA 2J0UA 1AXGA 4BLRA 5DULA 4RMGA 1N3LA 2R6FA 1TYCA 5B4TA 1V1MA 3PXUA 3R3SA 4QT4A 3ESDA 4CLOA 3DW1X 1S0UA 2HU5A 4Q01A 3H87A 4P33A 5IARA 5I47A 4JOBA 1FFYA 4LIPD 3ICOA 4G97A 1CLEA 1GTL1 3NQ41 1SZPA 2Q2OA 4MGHA 4JI2B 4G84A 2XYGA 3AFGA 2OC4A 4FXPA 3A9WA 3AF5A 4MR9B 5DBIA 4DDMA 5B7PA 5IUJC 3I61A 3ZVNA 4IQFA 3E3NA 3ZGYA 4OQMA 5TPZA 1PR1A 1JXOA 1DAPA 4WE3A 1MT3A 4UU1A 1IY9A 1X7YA 5DN9A 5FI0B 4J3NA 3AHHA 4MW1A 4PGAA 3GRAA 5FFFA 3TIIA 1DBSA 3E7PA 1AUOA 4LHYA 2VK1A 3HKEA 3K0CC 3HCOA 4H4DA 4QDZA 3K0CA 2Y66A 1RC0A 5FPHA 2DH6A 5KNCH 1D2RA 1GTRA 4MRPA 5AJVB 2GI4A 5BMVB 1NW3A 4MYSA 4LG1A 3R0JA 4Y8VA 3KOOA 5EXTA 3BWYA 2AOVA 3BG5A 4H7PA 4HX5A 3DCIA 5CDHA 1QJCA 1DNPA 3ZS9A 1TKCA 4J91A 5DO9A 1C8KA 1RWXA 2I8AA 3F6PA 2FI1A 4NAUA 3RU2A 1X74A 2JAUA 1AIPA 1UC4B 2WYOA 4LF9B 2C4UA 2XUHA 2WHRA 3CRNA 3P7MA 3IQDB 4ZEOA 2WWRA 4XGRA 4XVRA 5EXEA 5K8LA 3K53A 2YS6A 5E6SB 1YAJA 1KU6A 1XCPA 2Y1GA 1QGAA 4EAQA 4BLTA 2J08A 4PTZA 4CI0B 3QVVA 2X5KO 4KK4A 3BIOA 1JWLA 1E5QA 5ECWA 4ZC1A 3MCWA 3NAMA 1NWHA 1NW5A 1FMFA 1RM4A 1NN0A 3QGMA 4O4JB 4RC9A 5FWYB 4C6TB 3SVTA 4OLFA 4GX5A 1CETA 4IDDA 4ZT2A 5ADHA 5KYYB 2VUIB 4TXHA 4MVWA 4FUTA 1BKYA 4V38A 3ZUPA 1UXHA 3ZW8A 4RQUA 1X94A 3U13A 5E3IA 1Y8ZA 1UKCA 4WTOA 3AHCA 3KKLA 4Q82A 1XZKA 1JFFB 2I87A 3KHKA 4EG7A 1JN0A 4QX6A 3ZD8A 4EKGA 3IALA 3JAKA 1XMXA 4KI7A 3OZBA 5ALSA 4DOMA 4GSKA 3TRIA 1YB6A 1C50A 3EQ2A 3FLMA 4GC9A 3KQTA 5EHNA 1Q16A 2X7HA 5CT6A 5J59A 5LB2A 3RG2A 3HFGA 4B5KA 4RHTA 1XD8A 1NIJA 1E7RA 1QAOA 1Z74A 4KQHA 2H3HA 3IBGA 5INTA 4C7KA 3MJEA 2NO6A 1M6WA 5AW5A 2CNWD 2ZR0A 4G8BA 3AO0B 4I5GA 2JIZD 2MSNA 3IS3A 2MU1A 1IM8A 1ZXBA 3AB3A 2X5JO 4LXXA 4N7MA 4YONB 3WSVA 3LK6A 4A23A 2H1SA 5LR6A 3BRSA 5AOAA 2P4UA 4D74A 4DMRA 2YN2A 1E1QD 4ZQBA 3ORRA 4UU8A 2XQIA 2ZS8A 8ATCA 4I8DA 2ZBVA 4U4AA 4EDFA 4FKMA 4DA0A 4Z54A 4D26A 1PD1A 1LLQA 4BVAA 1EUDB 1VLVA 4TUYA 1YOBA 2FNAA 4PQGA 1YGPA 3PLNA 3PZBA 3WIEA 4A03A 1X87A 4AUEA 3NUZA 1VIDA 3STWA 4EIWA 4OQNA 3TOZA 1VMEA 8MHTA 1CEYA 2WAYA 1GG2A 4R2MA 3CIFA 2C7BA 1KMNA 3OT5A 4P3PA 5E9WA 4A5OA 3LCCA 1P0FA 1RZUA 2KE5A 4I1OA 4UJ3A 2V9PA 4YPFA 1G63A 4E5SA 1R10A 1ZY2A 3KXLA 2OSVA 2PKQO 4XI9A 5AK5A 1ZGGA 5HBGA 2ZUVA 3BCSA 5G0TA 3HCEA 1L6IA 2JFFA 4AULA 1TLLA 3BFKA 1KRHA 1U7WA 1U1DA 2HFKA 2NNWB 3H5LA 1PL7A 2FYTA 3ZCRA 4O63O 5L6MB 3ZI0A 3EEBA 2Y05A 4AP9A 2IZOA 4YGXB 1K5DA 1C7JA 2VHUA 4D96A 3FWYA 1M1NB 4FVTA 3S2IA 4NNPA 4V0NA 2AXPA 3DCYA 3IPXA 1T4DA 4OMDA 4MUFA 2SKDA 4L6AA 1SKUA 1KRWA 3K31A 4ZP1A 1KWKA 2HIHA 1C14A 2JASA 4RPHA 1D2AA 1SH7A 2COUA 3A6KA 3H9EO 4QOEA 1E79A 4QAJA 4O2BA 5E6RB 1MP0A 4ZVPA 4RACA 3AIMA 3RS4A 3EMDA 2QZZA 2WT8A 4DMGA 5T41A 2DUWA 1YNSA 3INTA 4UCXA 3TSCA 1QTIA 3WLMA 2CNWA 2IHYA 2NPIA 2OZVA 1SZDA 2JIZA 4H7HA 1C7QA 2QA5A 3O94A 4M0UA 1Q0LA 4PSDA 1UMCB 1BU5A 3O83A 3FOZA 3DW3X 3UWSA 2PK3A 4CLRA 4E30A 2B8WA 2RH4A 3T54A 3VH1A 4KX5A 2HXSA 1D07A 1E1QA 3F71A 3T0IA 2FXVA 2P0AA 4G0YA 3EA5A 1N2ZA 1T25A 1PNOA 2VYQA 1W4ZA 2Y1OA 4DABA 3S81A 2QZPA 5ALMA 1NRXA 1PFVA 3KAJA 3V7WA 2P4QA 3M5CA 4K9PA 4TKMA 3DV2A 1TXGA 4JB2A 5MGNA 3QHQA 3AR8A 1QCDA 2ZJ8A 1CQZA 2BI4A 3KPUA 3QY0A 3X43A 5AW8A 2C9OA 2FZGA 1P4AA 3EIQA 4F2WA 3QKUA 2VAXA 1W85A 4KXVA 3TLXA 2OHFA 1NUUA 2EX0A 3HNPA 3IDFA 4WY5A 3TFQA 5JRJA 2E5WA 4BNDA 3WGIA 3J7AC 2OBYA 3B48A 2QQ0A 3PZRA 4X3PA 4GLFA 1XFAA 2OHGA 1ULUA 4TMVA 5D85A 4IBOA 3AUAA 3SZRA 2QL6A 2Q4EA 3ACBA 1VLLA 4ID9A 3DT6A 1DIAA 1BOFA 2XUFA 4QVGA 3RIXA 5DM0A 1RRPA 3F5QA 3IDAA 1RVDA 3ZQ4A 1L8XA 5HBRA 1MH1A 2QV7A 4JWTA 1I6KA 1MTZA 5KINB 3R8FA 1VKOA 5DNWA 4QL3A 2XOKD 2Q62A 1PGOA 3AIIA 3G59A 1G4UR 2V54A 4L85A 1JFRA 4KU4A 2Y3IA 5JD3A 1FPQA 3FPGA 2HT6A 4MWSA 4QBFA 1U8UA 5KHOC 2PJZA 1Q2XA 3UJBA 2IX3A 1MNAA 3LKVA 2H29A 1Q11A 3VAYA 1R0ZA 4MA4A 4HDRB 1P1RA 3AP3A 1MIOB 3LO5A 5BN1A 1SK9A 1PL8A 1UPTA 2NNLD 2W8BA 5A5GA 1UQTA 3ZWXA 2I1LA 4JAVC 4I4IA 4E70A 5DNEA 3SS8A 4OLHA 1X1TA 4QQRA 5EVJA 1EE9A 2CYCA 1D0VA 2Z8XA 3P2EA 4TV8F 4CF4A 1CDOA 3ID6C 4O1HA 5HQ3B 4RA6A 4G4SP 3DJFA 3C7KA 3CJRA 1RHQA 1XJCA 4BP9A 2C7GA 4R3UC 2G9RA 4OAOA 3NXSA 2NZJA 3VC1A 1V3QE 5L3ZA 5M7EA 1P81A 2O59A 3H1EA 4PPYA 3GUUA 3STYA 1TVKA 1I5RA 3OCXA 1W6RA 2W71A 3RBZA 2ZSUA 3GMTA 4QGHA 2HMYB 1P6UA 2A1UB 3BMNB 2OOKA 4NH0A 1CXZA 5AQEA 5MFPA 3KNZA 4ZJYA 1V8FA 1P2UA 4Q3BA 3DDOA 3LYLA 4J2HA 1BH6A 3DMFA 4RHYA 3FI9A 3D6AA 2H1HA 3NEYA 1N6NA 2H1RA 1RPJA 2Q5HA 2OV2A 1W73A 2X6QA 2Z43A 3HE3A 4KCGA 4MJ7A 3JYHA 3O2QB 2CEKA 3U4GA 4X1YA 2CBGA 1DAKA 1K4MA 9GPBA 1NP3A 2XOKA 1F8YA 1FDWA 1ZEMA 4RPGA 4FIDA 4FYHA 1NW4A 2RHJA 4R0MA 1JXMA 2XNCA 4XB2A 3WOVA 2OHOA 2WZDA 1PW5A 3ZCVA 3TZCA 4ZI3A 5KOIA 3RFUA 2J3JA 2OGWA 4RZ2A 3SOPA 2A9JA 2JI7A 1U3WA 2C84A 4EFMA 1PWEA 1Z82A 2HJHA 2QLFA 3NO4A 5L3RA 3GJXC 3SR3A 2HB6A 1B8VA 4ZHQA 3O93A 1X13A 5KJFA 5FBZA 2DBYA 4Q4HB 4P7GA 2FPUA 2N46A 3KCQA 2PM8A 3O7MA 4JVNA 1IMJA 5I4IA 4FYMA 3NPMA 1JHRA 1RQ2A 3WGMA 4KKVA 2QQGA 4G56A 4RWZA 3ZW7A 1IY0A 1OLUB 3NP7A 3PHGA 4G37A 4RK1A 2EBHX 3I05A 3LMKA 4QO7A 5KVQA 1F38A 3RH0A 2CJWB 2B5OA 3H2JA 1W96A 4YCAA 4PG4A 2NAPA 4TS1A 2CVPA 2UVQA 4XCXA 1TEHA 1U9IA 3TAXA 5AW2A 2GFIA 2MIIA 1NRJB 2Q7XA 4E5UA 2XNSA 1NV9A 4GP7A 1KAQA 4PHFA 2XRYA 1T2EA 2J87A 1EP1B 2VJOA 2GPTA 3B2QA 3G49A 1R4NB 1Q1QA 3S29A 4PQRA 1V5EA 2NVWA 4DZRA 2IT1A 1K0FA 3ZD9A 2GR9A 2Z1DA 3IAAA 1XAHA 2B7BA 2WTEA 4TLDA 3S68A 1VLQA 3CPHA 4LC1A 1FTGA 3T1VA 3WFJA 3DE1X 3BJRA 3CVOA 4YP6A 3SZUA 1G98A 5AW1A 5JMTA 1JIKA 2PFGA 4NG5A 3UICA 2I1WA 4I1VA 2G70A 3ZWYA 2PRJA 1R6TA 3W04A 1OAKA 1ZM4A 2V7TA 1AKYA 2Q0QA 3JYLA 3W5AA 1D9ZA 3ENQA 4D42A 2WJ6A 3ADKA 2J5BA 3G2LA 3LRXA 1TQ6A 3N2IA 5IYZF 2P9ZA 2VPTA 4IFBA 1JDSA 3SFZA 5ITZB 1ZN2A 1D0SA 3KOZA 2Z8ZA 2RHLA 3D7RA 3PFWO 4TMFA 1JQ3A 2VT3A 2G0AA 4L9RA 1G4HA 3N1UA 4QTYA 2WMDA 1QGZA 3FZNA 3OOHA 4HPXB 1DC3A 2H17A 4JQSA 2WP8J 1A7AA 4NFHA 3L6BA 4RZHA 1DFHA 3AVTA 4DJJA 2YOGA 1GNSA 3DDCA 2UUBB 4IIHA 4KPUB 2VP5A 4X92A 3R8CA 4QHTA 5DGXA 3M5PA 3PQ8A 1E1KA 5KTRA 3WQBA 3CLKA 1Z68A 1GKYA 4ENPA 3C7TA 2Q8QA 1NQUA 1YS7A 2FG7C 4QIHA 1SC3A 1NN3A 3PD7A 3CEAA 2XXBA 5SYMA 3L0OA 1RYFA 2XTJA 5AKKA 1KEEB 2I4RA 4G09A 3RIYA 4M6WB 3WHLA 3DE4X 4FIZA 4LMBA 1HOXA 4H15A 1V6CA 2Z8YA 4OHZA 1RBQA 1CDZA 4W5WA 2X2EA 4BMVA 4L73A 4BNKA 4DCCA 3OWOA 1RQNA 3BF8A 3GZTB 3I2KA 4G5QA 1Y1KE 1YV9A 2F48A 3SE7A 2F4VB 1YIAA 3GT3A 5DM4A 3PVZA 2IHNA 4QUKA 5FBRB 5BV1A 2IUEA 4LZLA 3F96A 3VNRA 2AMVA 1HYEA 1LFDB 3LQFA 3I2JA 2JFUA 2PSHA 2G1AA 3I3SR 4UQPA 4XFKA 3SBEA 3VR6D 1Z6GA 4OQ4A 1L5GB 5EMLA 4LXHA 3TLZA 4ALNA 4IO1A 3QK7A 1BXRA 3QJYA 5JDCA 3KQWA 4XM2A 4EF4A 2ZATA 2WFLB 4EJMA 3DGFC 4QC2A 4ZVTA 5JCZA 1PGNA 4CLEA 3NI2A 1ZSVA 2SCUA 1L5FA 2HRZA 2WOOA 3LA8A 4AY5A 3GLIB 1SZJG 3FOCA 2HJWA 4D8YA 1U7ZA 2GA9A 3LX4A 3UJ3X 2LNDA 3NHKA 4X64B 5ALKA 5HCUA 1QRTA 3F9CA 3HKDA 4M22A 2HEIA 2FE1A 1V5FA 4JYPA 4XEHA 3ZJYA 1MBZA 4TLLB 5CVTA 3GD7A 1X86B 3EVBA 2QTTA 1JDBB 1J0DA 1HDZA 3OY7A 4BVJA 1OR8A 3MHPA 2RGUA 3ZK7A 4E1BA 621PA 3GEHA 1HE1C 1BD3A 2AN1A 1T9CA 1OA0A 2CSUA 2Z6AA 1G7RA 3VNAA 3C41J 3IAM6 4LDNA 4WRRA 1ZAKA 1I10A 1BROA 5B3JC 3RF7A 4GT1A 5B3JA 4Q4CA 3ZHVA 3CXRA 2ZRPA 2A92A 4P4SB 4B6GA 1IXYA 4R81A 2WA2A 4G63A 1IULA 2FMKA 4M1SA 3GLIE 4L28A 5IKPA 3OJFA 5F76A 1K7YA 2GM3A 2X3UA 5BQXA 2BF7A 4PU0A 3BMOA 3ICWA 4Q4AA 5IX8A 3U4CA 3RIEA 4DGSA 4UDXX 5EERA 4CTOA 1ZLYA 1E2FA 1JG1A 1B14A 1O89A 1QYCA 1ZMOA 4G41A 1YQGA 3A7EA 2G1KA 5KYVA 3LW7A 3G82C 4MUBA 5TGDA 3RODA 5T6MA 4DCPA 1H4TA 5IM4A 1YZ3A 1QFMA 1Z0KA 4GPEA 3BD8A 4RPIA 1USKA 3UJ8A 1XPUA 3KXPA 1E2LA 1N0IA 2AB0A 4HBZA 1OWOA 3NTRA 4DMHA 3IULA 3VZBA 4QEZA 1JPNA 5AO9A 1Z4NA 2GEJA 1UOQA 4LHWA 1M6HA 1U04A 3IOBA 5GONB 4MR9A 1GPWB 1XTTA 2J07A 3PGVA 4FX5A 2WABA 3NJRA 4Y9DA 4C01A 2PUFA 1BAPA 3K9NA 1XRPA 1X1RA 2G17A 4HL6A 4W6QA 2X6RA 3CVXA 4G0WA 3UOWA 3FHJA 2WSSD 3L84A 1NBAA 3RIHA 4KE6A 2BAGA 5F33A 3BE8A 2XCLA 4J75A 4KK3A 2J85A 3UC9A 4B6QA 3NBZC 3GNLA 1XIVA 1TB4A 3H1AA 4H7FA 3FKSD 4PANA 3ITEA 2QRUA 2D1RA 2GJ8A 2IEAA 3ZOKA 2RHBA 2PIAA 2WHXA 1WBJB 2I2CA 2YHBA 4L27A 1PUIA 1UFOA 2R1ZA 2R96A 2GEDA 3AZQA 3WLJA 4QWMA 2ZK7A 4Q7KA 1NKSA 2A5JA 1XDWA 1P1FA 3HRKA 1GPKA 3PQ5A 3EHEA 2ACWA 3OIUA 3X2SA 4M1KA 1NRIA 4ZVNA 4DIUA 4EHIA 1VPTA 4YRKA 5LMCA 5EOVA 1AJEA 1ZD9A 5TX7A 1ESCA 2AW3A 3LWBA 4MI1A 1H0SA 4MW2A 4CEHB 1FYXA 2AN3A 3RC7A 3G0GA 1CERA 3E2MA 4FHGA 4MJXA 3H2KA 4LXIA 4MZDA 1XTKA 4LQCA 5DLEA 1RC1A 3R7WB 4B8ZA 4JITA 4ENVA 1AO3A 1EZZA 1ZOLA 2PH3A 3I6BA 3TSAA 5JS7A 2FR1A 4Q7QA 4COOA 3HZRA 3ZJ4A 3AF6A 1NYLA 4FONA 3CZPA 4DT1B 2P2NA 1C3XA 1X1EA 3FFAA 2K87A 5ECGC 1NVVR 3EG9B 3W6OA 4GI5A 5T64A 5EKSA 4EPTA 3LUCA 4BMZA 5IFLA 5J2TF 1ZU5A 1B6TA 4GD3Q 2JBWA 1MFPA 3D7MA 1OC2A 3DXXA 4RA9B 2C5EA 1LLDA 1R9MA 3NUGA 4RKWA 4O4JA 4XWYA 2WJWA 3UAGA 4C6TA 3D8SA 2ZYSA 3E9MA 4DV6B 3BEDA 4NZPA 3VO8A 1T5BA 2H5EA 2VYND 1Q1NA 5TMPA 2DFLA 4KXUA 4Y2QA 3RTBA 3QFHA 4R8VA 5D3KA 3T7TA 4XRGA 5KYYA 3ZDEA 4X65B 2XVZA 3DAFA 1OXUA 2FE4A 2JLRA 3O84A 1JFFA 1Q83A 1Q0PA 2IE8A 3NIFB 4XPIB 2DJIA 1ZGJA 3ZHBA 1YZYA 2VYVA 4NR0A 3QXGA 4QLAA 3ZQKA 1SPBS 2QPTA 3QOXA 4ZMRA 4M8IA 2FP3A 3SCZA 4M98A 2Y4NA 1IIBA 3UMRA 1WX1A 2JIPA 2WKWA 2H8GA 4I4NA 1SBCA 3P0FA 1SOWA 4B45A 1FBTA 1RYEA 3LLUA 2ORIA 1Z5VA 2PEZA 3MBIA 3QLEA 3ROFA 1GPNA 3UAVA 2D1SA 5E1BA 1B74A 4DDUA 3EZFA 1YONA 4J0CA 1Y8CA 3FKSA 3A1NA 5K0EA 2I8LA 3BFJA 1MB3A 2AEMA 4M7WA 5AUOB 3MPUA 3T7DA 1IH8A 4JVMA 3QUBA 3E2IA 4V2UA 1KQ3A 1PZMA 1WXEA 4LRSB 4J7XA 3G5TA 4XD7D 4Y9SA 1TT5B 4ZVLA 4JYCA 4ZMBA 4DKJA 3VZRA 2FZEA 3NDIA 4E4RA 4A0GA 2ECKA 1Y89A 3L0PA 3LDHA 1SB9A 5LYJB 1BVYF 4G1FA 4GBGA 3VC3A 5F2EA 3EGDA 3O7WA 2BEVA 1EUDA 4CLDA 1WE2A 2EJCA 2FWMX 3OTQA 1GRVA 4FE7A 1V7QA 1XU7A 3L6RA 7AT1A 3DBIA 4E7OA 1QRSA 1TZJA 4M86A 2Q3JA 3RVRA 1K8YB 2BFBA 1A95A 4B4VA 5GPBA 2PEYA 3DWGA 5JC8A 2EBWA 1XGKA 1PX0A 3OZUA 3PYLA 3WSTA 1XWIA 2ZUBA 4Q24A 1CUGA 1KQGA 3VV3A 4S1TA 2I8CA 3TG8A 1YJBA 1TQ2A 2VHYA 3KQPA 2B6NA 2A9PA 3UMCA 3AI3A 2GZHA 3AQ4A 3WLOA 2C5FA 5LQAA 2CDBA 4D41A 2LDBA 1JXQA 3VR4D 2FPMA 4G07A 5TSDA 3HWX1 2QXUA 4X61A 5C3UA 1DWOA 1UMKA 2C2ZA 2VYNA 3AY6A 3G2HA 4N1AA 2PDAA 5EESA 5CYFA 3T5BA 3VSEA 4HR7A 2QE6A 5D51S 5CRIA 2D13A 3ND7A 4QEDA 4W8OA 3ZV5A 1SVLA 4KO4S 1FOEB 1HE5A 5FUWA 1P0PA 1M1NA 2HX1A 3C6QA 4QG3A 1ZXLA 1YJCA 3VKWA 3RCBA 1ZO8A 4MB0A 5EYPB 3T4UA 3BHJA 3PC2A 3AERB 4PN3A 2AXNA 3NDBB 2WJHA 1XE3A 1HYHA 1S2IA 5E6RA 4INZA 4KRXA 1UF9A 2FY8A 1MX9A 4NULA 5EG5A 5C1IA 3QUSA 3TINA 3A3OA 4POOA 3SQXA 3TUJC 3E3OA 2I4TA 5FPTA 1KO7A 1MFZA 2JCBA 4QOFA 3G9TA 5TC4A 4WI1A 3TLCA 5IBPA 4US1R 4LTDA 2P2ZA 1T0UA 1UMCA 1MJGA 1Q1EA 4XD7A 4K6CA 2H7YA 4QFBA 2I67A 1JXAA 4LY3A 2B69A 1YUBA 3CUUA 1RYMA 1C7EA 1EXWA 3HB9A 3IODA 4TZTA 3SEFA 1VLMA 1I6WA 1R0SA 3NIDB 4RABA 3QBDA 4B84A 1U2RA 3LYAA 4L7VA 9LDTA 4CF7A 1HGXA 3A6GA 4I55F 1ARZA 4R9SA 4Z0TA 3PFBA 2QAGC 3AZPA 1TD9A 3RSQA 5H5JA 1JECA 3EIWA 2AYZA 3HHPA 5AUNB 4F0JA 2CHFA 2Q99A 2ZITA 1W75A 3FFXA 4JVOA 1JFTA 3PJGA 1L8AA 4D99A 4EG6A 5JJLA 2A7QA 1VA4A 2XT0A 3S2EA 2IYAA 2XGMA 2YC4C 3NHSA 3HL0A 3JYQA 2B9VA 4FGLA 2ZJ3A 4HRXA 4B35A 2BYTA 1RMQA 1EAMA 4C2TA 3KSAC 1KJQA 2ZFUA 1I0ZA 2GVDC 4D0LB 3VR4A 1EGMB 3OTGA 4M7OA 3IL2A 3I6YA 3BXHA 4O3MA 1KO1A 3LCUA 4N5LA 2F1IA 1TYEB 4I9NA 4GWGA 5ADVA 2OPHA 1FFAA 1EWRA 1MW9X 3WMWA 2Y6UA 1KY3A 4BZZA 2OYSA 4NP6A 3UG7A 1Y6QA 4HB4A 5SY4A 3LZDA 3TE7A 1T5IA 2P2YA 4NYMR 5EIHA 4Z2AA 13PKA 3R0XA 3FPLA 4WJKB 5A4MS 2HMVA 2JLUA 2H2HA 4G4SO 1JKXA 2XDAA 3GA0A 3ADPA 3RK0A 1QPZA 1FL9A 1IHDA 2FZCA 4BX0A 1J9ZA 2WUWE 4O1MA 4OSEA 4RQTA 3RVPA 2NGRA 3N53A 4HDRA 5EIFA 3NAGA 1MIOA 1ZJZA 3KE8A 2C2OA 5D5QA 4X6LA 3RPEA 2KBEA 4H6VA 3RF6A 3JR7A 4YJFA 4PTYA 1FP4B 1QTNA 1WQ3A 1IEXA 3K0SA 4WCFC 5EPOA 1OYOA 1AZSC 5HQ3A 1WDKA 5KNDD 2R6CA 4RH1A 3G3EA 5C34B 2P69A 5I7FA 4ER3A 4YO8A 3A04A 2NPFA 4TYNA 3T34A 3EDYA 2FRVA 5B7GA 4W9MC 1UKYA 3JQCA 4JT9A 4KMMA 1RI3A 4S1NA 4KHZA 3WFIA 5LQJA 3I5UA 1TGVA 5EEGA 1OC4A 2D5IA 3GRCA 4IH9A 3CINA 3R5FA 3ZV6A 3MQ4A 3QTBA 4BNXA 2FHPA 3ZY6A 1Z56C 5B55A 1Z38A 4DSAA 2BMEA 2PTHA 2NWQA 2QI9F 4EI8A 3LVBA 3AC0A 3WO1A 2CDCA 5FKJA 1OWPA 2X1VA 2ZBFA 1WY7A 4PC2A 4O33A 1SUAA 3M6WA 4FZJA 4K0RA 3C3KA 5CA1B 4N76A 1ID8A 4FT2A 2AEFA 4TS3A 3SQNA 3EYWA 2CUTA 3DEAA 4HXGA 2ERCA 1XMVA 4OG2A 2D3TA 5DFAA 2O3TA 5BSEA 3BERA 3UWKA 5JNRA 5CDGA 1JT2A 2MJLA 3FCSB 3L9XA 4PF1A 5MN4A 3HVJA 3AFOA 5A5DA 2EWMA 1SB8A 2HWKA 4QVIA 2OFXA 1BMDA 4MWZA 3COJA 2HDOA 1Z2AA 2RHHA 2WZCA 5B1YA 1TVCA 4Z9XA 4DYDA 2B4YA 2HF9A 1T6YA 3O0TA 1Z37A 2DE0X 2MINB 4FSDA 2RAFA 3REQB 5EJMA 1OIWA 4Q4HA 2IV7A 3TN7A 4XDGA 2JFQA 2GCOB 3X1KA 1C7FA 3EISA 4NXMB 1OLUA 1FUKA 4K03A 1J00A 2NVOA 3P97A 3ROTA 1GR0A 4YWJA 2CJWA 3RM3A 5HJ2A 2WMNB 5CFQA 1XVAA 4DG8A 2ZBUA 4XJVA 2PCLA 3OO1A 4C3VA 3C1UA 2WIJA 4TMWA 5ELLA 2MYNA 3HJRA 2JZOA 4KHPB 1VRCA 4NE2A 3MJRA 3P2KA 5J4HA 1R4NA 1B2RA 3QFFA 2WU0A 2HZ7A 1EFAA 4Q3AA 3PHBE 1PLKA 2IP2A 4FZ3A 1U2EA 3UUEA 4UAVA 5CM8B 3G5MA 1TO6A 2YXNA 4WD3A 4HWGA 1JDJA 3PGA1 3TJRA 5KYUB 4MV7A 2VWGA 3RS3A 4HAUA 2J45A 4FYJA 1W4LA 1YB4A 3ETHA 4HLNA 4MWOA 2CUZA 1T0HB 2P68A 2EF1A 4JASB 4NVRA 3IR7A 1Z28A 2FZLA 3BC1A 3BSYA 5ITZA 1Y4DE 2UYGA 3FYTA 1MKYA 4PQFA 4ZCRA 4FN5A 4RDXA 4DR7B 4UXHA 4CKWA 1N77A 2E37A 2JIBA 3KQMA 4BO2A 4C05A 1WBDA 2O20A 5G4KB 4P2BA 4QJ3A 1NM5C 1JHVA 1LPOA 4U2CA 4KPUA 3KQSA 3ZGLA 3ZVKA 4DV0B 1J33A 3MT8A 4V1CB 3AEQB 1LDMA 2XHEA 3BIWA 3DAPA 2EP8A 4IV8A 4HMPA 3WYGA 1YOVA 3FUXA 3HFJA 3KSRA 4JA2A 2Y93A 1UZUA 4BO6A 4RXUA 2J5XA 3ZY4A 3IELA 5PGMA 4C7XA 4Y30A 3GR6A 1KEEA 1JI0A 6AT1A 4HD8A 4IILA 2QRVB 4HNAB 3WGLA 5FAKA 2PRZA 2HA3A 2C77A 1TT7A 1CE8B 2PGJA 2D4HA 1NA5A 1XELA 2H1IA 2Y68A 3QW4B 2HD4A 2JS7A 3R3ZA 2NO1A 4FINA 4XLZA 3FMIA 5LZ8A 3ROXA 3WGYA 2FX2A 5AQ1A 1PEYA 4HH0A 1W59A 3T9BA 1UUFA 1TIPA 4FUQA 3PL1A 4ANFA 2ZWPA 3KEGA 1X38A 5F3RA 4EARA 1UBKS 5F1KA 2IJGX 1SN7A 3IO5A 1YO6A 2P6OA 4WN9B 5KJ1A 2HLHA 5ALDA 3ENNA 3S5JA 3T1NA 4O5OA 1T1JA 1KOFA 4AJ4A 2XXAA 4JGBA 4MA5A 5IAOA 2WV9A 4I1PA 4DSTA 5CBKA 3W9UA 4QM7A 1HMPA 3Q87B 2J3LA 3FH0A 4M3NA 1XLVA 3KZCA 3ADDA 2FUEA 3OO0A 1QTQA 1EUZA 1DMRA 1KFEB 3VSBA 4M9QA 2QMQA 2A4MA 3P0RA 2AG8A 3AKYA 4LKOA 3TLJA 2XYRA 4L0QA 3CEMA 4JI1B 1E1DA 4HB0A 3KC2A 4JDUA 5BWOA 2H4JA 2LIPA 3F6RA 1NI5A 1PWXA 3B53X 1HA3A 2HDWA 5DU2A 5F9MA 3WDLA 1Z9BA 3UG6A 4XQCA 2ISQA 3WX0A 3EXEB 3LBHA 3BFVA 2JF0A 1ZJWA 1MC5A 1TW2A 3K72B 3BULA 3IUSA 2ZSHA 2JCSA 1AH2A 3G68A 4DDVA 1UEJA 2FMIA 3M2TA 3U3MA 3SMVA 2JAPA 3OUZA 2NADA 2RHWA 3FPEA 4D80A 4MTLA 1MXHA 1FYEA 1WY5A 3TTTA 1F2DA 1G2IA 1I51A 3H9QA 4UE3S 4X1IB 4D9FA 2B2XA 3ABRB 3BB3A 3N2ZB 1EGHA 5ALYA 5KTSA 1LPBB 2FWRA 4BP3A 4HDKB 3TEFA 4JBWA 1H0HA 4KQCA 4IPTA 5AK4A 5FYQA 4E1AA 2ZI9A 4LX0A 3ROGA 3AJEA 5CK5A 3WGNA 3YASA 1KK3A 4YGYA 5LDHA 4Z53A 2LD4A 5HZGA 3N3BC 3R44A 3HBNA 4KRFA 1WV1A 4IHQA 1IWOA 3R4VA 5AVKA 3IJ5A 3K0AB 5LLDA 3G9QA 4Y2PA 2VH2A 1L5ZA 4ZI7F 4DUZB 2H0QA 4KQMA 2PXHA 1STOA 3HY6A 4ZEVA 5HJ5A 1FYDA 4JIGA 5A1TA 1A2BA 1DARA 2CCGA 1QIGA 2QVYX 3GRZA 1JZTA 3SXUB 1K06A 5J2UB 4M0EA 1K8ZB 2YFHA 4G0NA 3LDGA 2ZZNA 3RKUA 2QLJA 3OA0A 2GOYA 3GG9A 2XMRA 3I9JA 4PLTA 3OI7A 4EQZA 4YUAA 1A76A 2VNHA 3DBLA 3KPWA 2PQ6A 4EUEA 4WK2B 4M0FA 5JH7B 3EPPA 1PSWA 4BGUA 4K5QA 1KY2A 3R5KA 3HYSA 1JW9B 2QRNA 4DEXA 1HLDA 1N57A 1ZCBA 2CL7X 3FNHA 1JPVA 5KSOA 1UOPA 1UWVA 2OCIA 3A9VA 2QTZA 4DSNA 2YIDA 7MDHA 4L51A 1G42A 2Q3FA 4EHHA 4EY6A 2A0FA 4KIGA 1XDUA 4GPBA 1D1SA 3H13A 2JGIA 1SU7A 4CEHA 2W0MA 1H2EA 2IVFA 5B1IA 4EX6A 3COZA 4G89A 4A0QA 1CUYA 4GYJA 1A9QA 3HU1A 3GH1A 3QX9A 2XUAA 3R7WA 2VJMA 4YV2A 1OY1A 1P9WA 5EWMB 3HYCA 3PFCA 5B6JA 1XQ9A 2IGTA 1SWVA 5DYGA 3TD9A 3Q7IA 1KH1A 4LOHA 3WBKA 2R8OA 4DT1A 2R87A 2XUQA 4U2DA 5D1NA 1P74A 5A3VA 1ZFNA 4MB6A 1KMQA 2QRHA 1MJHA 4F72A 3JALB 4IIXA 3RSHA 4UCQA 1S2GA 2C3OA 2I7CA 1WLYA 1ZGHA 1Z0UA 2WU8A 3I9LA 4RA9A 4YP0A 3ZD7A 1NHWA 4A2PA 5BUCA 5B1HA 4UHFA 3VPHA 1G59A 4L5YA 2RGNC 4RFSB 1A8SA 3LUFA 1AQUA 5AI6A 2RGNA 2NV6A 2POCA 3CSUA 2V4UA 3AP2A 4IX9A 3W8EA 2JH8A 4C9BA 4CDGA 3RAEC 2AF3C 4GMDA 4C3OB 3H8VA 2ZGVA 4NX2A 4XPIA 3G1WA 2ZVDA 3EIUA 4NBKA 1TA9A 5KJ6A 4K6HA 2ZRJA 3RLFA 4FGUA 1YXMA 1S9HA 2A14A 1GVHA 3QFTA 5G3YA 4YJ3F 5KOJA 4Q7EA 2RAUA 2BGTA 2AV6A 4QNNA 4BNZA 1K89A 3UJHA 4O5AA 3ZQJA 3G2PA 2V74B 2Y6VA 3ACCA 2VG8A 3IVGA 5JG7A 2KM1A 4FM9A 2GM9A 5E9AA 1G4AE 1CJMA 4D3YA 5SZKB 1T1SA 4HQKA 1H2FA 1RWVA 2I6SA 3LCMA 4ENUA 5BUSA 1OH6A 2FPPA 4AM8A 2CJYA 2OV3A 1GD1O 1YH3A 4FEGA 4PINA 1BRTA 1F06A 1E6EA 2CV1A 1CZUA 1PJ4A 4LFCB 3LP8A 2ZJ2A 3L6EA 3O95A 2I3ZA 4H27A 1FU4A 2PUJA 4NPHA 1XZHA 1A9XB 1XK7A 4MS1B 4EG4A 3DZFA 2B1IA 1KH3A 3HO8A 2YWHA 3WGTA 4AG3A 2R8PA 1TM7E 3N2NA 2DXIA 5BR1A 4Q9JA