4F4UA

The bicyclic intermediate structure provides insights into the desuccinylation mechanism of sirt5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
266
Chain Sequence
TARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Bicyclic Intermediate Structure Provides Insights into the Desuccinylation Mechanism of Human Sirtuin 5 (SIRT5)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent lysine demalonylase and desuccinylase sirtuin-
total genus 88
structure length 266
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4f4uA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4f4uA01
4K9OA 5MF6A 1M2NA 1PI3A 4Q9DA 4L3OA 5BWNA 1PT9A 2X7JA 2JIBA 2NYRA 3CLTD 4BVFA 4BV3A 4GM1A 4JU9A 2JI7A 2EZUA 4UTNA 1M2HA 4GPEA 3JR3A 2W93A 4HDAA 3U31A 4IG9A 4KXQA 2A1TR 5BWOA 4JUCA 4K9QA 2A1UA 4F56A 4JUBA 2FR8C 4TWIA 2WVGA 1OZGA 2OD2A 4BUZA 5EJ7A 3GLRA 5MGNA 2OO5C 1T9BA 1XLTC 4ZZIA 1YI1A 1Q1AA 3PDHA 2FRDC 1YHZA 2Q5QA 4R8MA 1S7GA 4JD5A 4V1CB 2B4YA 1YBHA 1MCZA 2FN3A 2AG1A 1N0HA 2WVHA 1Y9DA 5K3SA 2VK8A 4RMGA 3RIGA 5BWLA 1JSCA 4RMHA 4JU8A 4JUAA 4K9NA 5EJ4A 2H2DA 4C78A 1S5PA 2IHVA 2PANA 2V3WA 3CLRD 4QELA 4Y6QA 2VJYA 1EFPA 3F6EX 1U28C 2FWNA 5AHKA 1PVDA 2EZTA 4RMIA 4UU7A 4F4UA 5D7NA 2H59A 1D4OA 2PGNA 2Q5JA 4BN5A 3IAFA 4GM4A 4QPZA 1J8FA 1OZFA 1POWA 5FYQA 1SZDA 1Q6ZA 2QQGA 1MA3A 3JWPA 1U2GC 4KPUA 3EA4A 4JT9A 2Q28A 3EYAA 4MPPA 4RMJA 4FEEA 4RJKA 3K35A 4RJJA 2Q29A 1E3TA 3D4BA 4O8ZA 4MPRA 1UPAA 2VK4A 4J1TC 1O96B 4JSRA 5IMSA 3GLTA 2Q5OA 4JT8A 2JI9A 3CLSD 5EJMA 4D5GA 5K6RA 4BVBA 4MPJA 4JUFA 4C7BA 5EJ8A 4MZXA 1YC2A 4D5EA 3ZGOA 1PTJC 4BVHA 3D81A 1T9DA 2H2IA 4BN4A 1BFDA 2BRUC 3PKJA 2WVAA 4K9MA 4KGDA 4QQ8A 1HZZC 2JLAA 3EY9A 2EZ9A 4UU8A 4ZP1A 2VBGA 2H2FA 3RIYA 2H4HA 1NM5C 4X3OA 1YTLA 1PYDA 3ZGVA 4BV2A 5MFZA 2H2GA 3E9YA 2OD7A 4UTRA 4HD8A 4IF6A 1PNQA 1POXA 1YHYA 3CLUD 2H2HA 4BVGA 1Z8NA 4UUBA 2EZ8A 2VBIA 3PKIA 1PO7A 1T9AA 4UTXA 1U31A 5FEMA 2Q27A 2VBFA 3HWX1 3LQ1A 1YC5A 2DJIA 4GM0A 4K9PA 2EZ4A 5EJ9A 4GP9A 4UUAA 3FLMA 3GLUA 2JLCA 3OE1A 4TWJA 4Y6OA 4Y6LA 1T9CA 2C31A 2IHTA 2JI6A 3FZNA 4L2IA 1UPCA 1OZHA 3IAEA 2H4FA 1YI0A 2VK1A 4FZ3A 1V5GA 4JUDX 4RJIA 4BVEA 2OORC 1QPBA 4MQ5A 3HWWA 1M2JA 5K6TA 2NXWA 1ZPDA 2IHUA 5DGDA 3CF4G 1U2DC 2QQFA 2UZ1A 4UTZA 3U3DA 5EJAA 2Q5LA 4IAOA 2UZ1B 4I5IA 5DEIA 4K9KA 1ICIA 3D7KA 2OD9A 5EJ6A 1Q17A 4GG1A 1YNOA 5DGTA 3GLSA 4G1CA 1DJLA 2PGOA 1Q14A 1OVMA 2H4JA 1O97D 4K9LA 2JI8A 1V5EA 1PNOA 1UPBA 2FSVC 5EJ5A 5K2OA 4FVTA 1M2GA 4COKA 5MFPA 1M2KA 3FSJX 2HJHA 2AG0A 4FEGA 4V1CA 4V1CI 3F6BX 4J16C 3ZG6A 4UTVA 1SZCA 1EFVA 1V5FA 4X3PA
chains in the Genus database with same CATH superfamily
3VUFA 2ZVDA 4CKZA 5IBPA 1L4YA 1NW5A 3UJHA 2C9YA 5DTJA 5HDQA 2R7MA 2IEGA 2VDRB 2Y2VA 4YALA 1I4OA 3MWDB 2OSBA 3HB5X 1TIPA 3C1AA 1XXHB 3B36A 1OXKB 2QRVA 3HXOA 4U8GA 3U48A 4DYDA 2YHSA 2H2AA 4DUGD 3C8MA 1H0KA 1N2OA 2BE9A 3OOWA 3OZUA 4Z0PA 1SELA 1PR1A 3EZFA 4KW7A 1HY3A 4GI7A 1BXZA 1SC1A 2X9VA 2WU3A 1L5MA 2ZCUA 3DW1X 4D4IA 4L0DA 4C0KA 2O50A 1XLVA 2PA0A 2XJ4A 3K0FB 4GKVA 2DUJA 3MJVA 5JXIA 1KEKA 1M72A 4XFKA 2D59A 2OXIA 4UHBA 4LV8B 1E7SA 3GELA 1SRQA 2FEXA 4YUAA 1XKTA 2HYDA 2ISCA 3MRTA 1R6DA 2YOGA 2AR0A 2R11A 3FTEA 3L0CA 1VE6A 4P9NA 4S0ZA 4DLWA 3PXGA 2TSYB 1N2JA 2P78A 3SAJA 3GRZA 1NVBA 3M2PA 4UXHA 2IUTA 4FD2A 1H3EA 4I55B 3K6KA 5E3IA 1U7XA 5DI3A 2EP7A 2HRQA 4RTPA 1G2IA 4CKCB 2QAGB 4C6SA 3G0CA 4E88A 1E2EA 2X5JO 2OHGA 2Z5FA 1L5LA 1XAIA 4IVNA 6AT1A 5FTKA 4OATA 1G21A 3RIHA 1AGYA 3VNQA 3FKJA 5K0TA 1G3IA 2OHIA 2ODTX 5J2TF 3NVMB 1TB4A 4MWDA 2VS1A 4N7RA 4CBVA 3AM1A 1EJ6A 1T8SA 4YRKA 2EARA 4MW9A 5K8IA 1G63A 1B0UA 4D4KA 3WGLA 3AH8A 3WK9A 1YJCA 3DQPA 2IDMA 3QLJA 1W47A 2BZ1A 4OQEA 3T7TA 2KBEA 5IG2A 1ISPA 1JZSA 1C7FA 1SB8A 2ZOSA 3ETGA 3GB9A 4J2OA 4LX0A 4ZPXA 1OMOA 2AZDA 3Q7EA 4Q1EA 3EGDB 4ITRC 5GP1A 3VU9B 3ZGVA 1F60A 2NV6A 2HC9A 1D6SA 2P1RA 1GFWA 2HWYA 1EDZA 2OFWA 3VKWA 3WZ2A 1JT2A 1ZHHA 4I4CA 4P3YA 5B1IA 1ECJA 1OGIA 3QE9Y 2C5HA 4MKRA 4I19A 4IYJA 2IS2A 1YFZA 2GT1A 3JTMA 1LWOA 4RF3A 4D8YA 5C7OO 3OLYA 5EGNA 3OE1A 3RUPA 3U3RA 2YY5A 3G85A 5WRFA 2FMUA 5BN5A 1PV4A 2X6TA 3TBKA 3RC9A 4NR0A 5C5IA 3IQGX 3Q87B 3RJ5A 3VR0A 2DPYA 4L8GA 4OSOA 1D9XA 2BV3A 2CL7X 3IPCA 3ZLUA 1GGKA 1V3TA 1T8YA 4L9RA 4RKRA 3F3YA 4WV3A 4MDHA 5HEKA 4D41A 2DTXA 2WF5A 5F12A 5C8YB 3H4TA 2IX9A 5A05A 2J3HA 4CIYA 3A4VA 1IVYA 1LBSA 1ND5A 1R5OA 2J32A 3EF3A 3ORQA 5DEOA 3R3HA 1J1ZA 3ZV3A 3KAQA 1YNOA 4QC2A 1EFCA 1SY7A 2D7JA 1XP8A 1S2MA 4GZ5A 2Q6KA 1T3SA 3ROQA 2CFTA 3KUDA 3MGGA 1A50B 1UBTS 1NQXA 3AVQA 1GTVA 3N3AC 3TLKA 1R74A 1D1PA 1TZJA 4XGQA 4BQPA 2B1RA 2ZT8A 4FQ8A 1JFTA 5AJVB 2IGBA 1SQ0A 1SZCA 3PF9A 2PKRA 1NLZA 3MCTA 4MKIA 4Q02A 3KZCA 4QPDA 4P4LA 2BGIA 2UZIR 5EE0A 4EQZA 1HDYA 3A9VA 4L15A 3KFVA 5C5EA 4FXOA 1U7PA 4TXLA 2JG3A 3CF2A 2VAMA 2O48X 1PG5A 2P40A 3ELYA 1L3IA 2KHZA 3VH3A 4JLNA 1BX0A 4BBZA 1F2VA 4NZ9A 2X42A 4EJ6A 2CXUA 1ZUD1 2C9MA 4OUDB 4YC7A 4F5WA 5GIOE 5EJ7A 1WHSA 5I7OA 3HSSA 2XCOA 5KX5A 1DZ3A 1X86B 4BCBA 4UPVA 3CX7A 3KL4A 4F11A 2QI9C 4GX0A 1UFKA 1RZUA 3AL0C 3IHTA 3P1JA 4FC7A 4WZ6A 3TSOA 3T3DA 4PS0A 2H2DA 2VDWA 2ZULA 4QX6A 4E1VA 3GEEA 4ZFNA 3DOFA 2XUGA 1CP2A 1U28C 5B7PA 1UBJS 1PK7A 5BN5B 4HZIA 1DEXA 1G7CA 2ZB7A 4GKJB 2OC4A 3CHYA 5IHXA 5LMCA 5FYQA 1T6YA 3JATA 1BS9A 4OXXA 1WRBA 2G1KA 1HYQA 1FLAA 2GOYA 3EYAA 1WBJB 3PQ4A 3FKSD 4KPUA 3VKFA 5LLTA 2XRYA 2IW1A 1OLXB 3ANSA 3PSHA 4PPGA 4C0XA 1VCOA 4JFAA 3SJCA 1ZD1A 4GX1A 5E9QA 4MPRA 3KOOA 3Q0TA 2ZSUA 2XTMA 3BTVA 3WZMA 4EB3A 3UMFA 4TZ0A 2HBYA 1N9GA 3PHIA 4OHMA 4LEIA 3W2HA 4OP1A 1X7XA 2ZAOA 4AKGA 3ENNA 3H18A 1JT9A 4JBHA 3GFGA 4REQA 4DGSA 5K9ZA 4D45A 1GO2A 4EVIA 1XF9A 4FGZA 4PLFA 3QKSA 3TBFA 2O5CA 1YVRA 3RE1A 2J85A 3G2QA 1HZZC 2OSVA 1U2GA 3SE0A 2FR1A 3ZEAA 3IA2A 1UZAA 2X8LA 3SC2B 3CCBA 2YZ2A 2JFQA 3BXZA 4GBED 4WK6A 1QF6A 1LTKA 2OD7A 8MHTA 4JCCA 2CHQA 3B5JA 3EZ9A 3FMGA 1UBRS 3IUPA 1L7BA 1QQ6A 4M9RA 1L6RA 1DCTA 5DHRA 4M46A 1YDEA 3K5PA 5BSFA 5P21A 1F2TB 2ORWA 3P9KA 1ORDA 1L4FA 3OKPA 1OFHA 2ZJ2A 3B5EA 5ALTA 3RREA 2ZBEA 1ABBA 5HNKA 3H3XA 3HN6A 3UK1A 1G0NA 1U0EA 2AMYA 3BMXA 3LKDA 3QEOA 4H15A 3CYFA 4HUJA 2RH5A 4TTQA 2EKLA 2KBFA 1ZRNA 3F9IA 1GG8A 3FMFA 3PDCA 3HCDA 2XT6A 4C21A 1E4EA 5LBIA 3HBLA 3A28A 5FQNA 3AUYA 4B5LA 4PZAA 1GDTA 3FMOB 1NOIA 1M76A 1OWNA 3KPUA 3JVIA 3X2EA 3CIOA 4WL0A 4EJMA 3S2EA 2Y92A 5F1KA 4BO0A 3CNOA 4R51A 3VR5D 3NBXX 2VJMB 3R41A 5JBQA 1ODCA 1I4TD 4J16C 1IOWA 5B12A 3K1AB 3W06A 1JHDA 3T3PB 5CG1A 1XAHA 1XE3A 2QMYA 5AM3A 1GQYA 3SJBA 1P6QA 5J40A 1LU9A 1D2CA 1FJXA 3FUCA 1KZYC 1XPJA 3BMQA 4P35A 1N8SA 5GJBA 3D6AA 4KACA 2Z8YA 1AQIA 2VAWA 3TLMA 5L3QB 1QQTA 1PWHA 4ZXPA 3KYDB 4KSCA 2BOVA 4QYIA 1W35A 5ADUS 4DDTA 1ISSA 1FCJA 2J3KA 2UAGA 3DDHA 3E8SA 4TVKA 2QQ0A 4FJ0A 3VVBA 2NVBA 3THYA 1ZK2A 3IDZA 1CT9A 2CCJA 2HLDD 3ITEA 5DXFA 3PDIB 3ENWA 4XSGA 2QEQA 4BOYA 1QZUA 4OG2A 1KF0A 2XUDA 4TKUB 1VZ3A 1QH8A 4NTZA 3R9XA 2O8BB 5CDHA 4U02A 2IDZA 1K8XB 1ZIDA 2OZKA 2AX3A 3KZKA 3KZMA 3P9QA 2IIVA 2HSEA 2WWIA 3AQIA 4HSEA 5BRAA 3HDQA 2NXJA 1I3LA 1UC4B 2HHHB 4BB5A 2VNSA 2HI0A 2XNDA 4ZAWA 1KQ3A 1L4BA 2BF4A 1XKQA 1QRDA 2W2XA 2HTEA 1XELA 3GROA 4ND1A 4M1TA 3RTDA 4BEBA 1O58A 2VDLB 3D2LA 1Q0RA 1E3TA 3LUGA 2XUKA 3JQAD 3OSUA 4QLBA 3BSYA 3UQYS 3X2FA 4PGMA 5HXAA 5C53B 4PNZA 4ZKDA 1WA5A 1RQ7A 4PVCA 1H93A 3SJUA 2HIMA 3BJZA 2I2FA 4HRYA 3INNA 1Y8CA 4U1RA 3JZDA 3RC2A 2YCLA 5I6DA 1ZUIA 4Q66C 5HQTA 3H0EA 1MGOA 3LC7O 1IBRA 3PGKA 4E6PA 2FEMA 3P45A 5HMMA 4PQRA 4JL8A 4NJEA 1UL1X 4HYEA 3OPYB 1QB8A 2FOIA 1JLSA 3NBAA 1KERA 2CXTA 1WIWA 4M0UA 3N86A 5ESXA 1RACA 1ZD8A 1FW6A 4JJKA 3CRQA 2FWJA 2HMAA 3B12A 3FFAA 5DLPA 3R2JA 3WK8A 4IBOA 5KTKA 2P0AA 4C4XA 4JJ6A 4HB0A 4TSKA 5D1NA 3WS7A 5JQGB 2OBLA 1RYZA 1ZI8A 4KC0A 2AV6A 3ONVA 2FF5A 4LOKA 3CUUA 1K3TA 2O52A 5CYOA 3TAUA 3UWSA 3ZJUA 1IHDA 3C48A 2VPIA 5I4CA 5JSKA 3FWHA 5BVHA 1EZZA 1U0LA 1LPSA 1RWKA 2IPMA 3KJHA 3ND5A 5CA0F 3SQMA 4CYMA 3B3AA 1X3SA 5JASA 1P33A 2NNLD 3N2LA 3NYIA 2CDRA 4F7WA 1K4MA 1A4XA 2CXNA 4HATA 1U8AA 3WAKA 4OBWA 3OJ0A 2ZQYA 1OC4A 4LWQA 3LO5A 5EN4A 5TEVA 1CEXA 2DHCA 2VT3A 1V1JA 2G83A 2ZRBA 4PLWA 1GDDA 5ICGA 1U6JA 3R0VA 2GZ1A 1R4ZA 4R3WA 5TQ2B 5E3HA 1K5PA 3V1LA 3TLXA 2VEOA 5LA6A 1I3MA 3RQIA 2XADA 1CUIA 3R44A 4V39A 5CAEB 4L5AA 4OVKA 3VKHA 1ZJWA 5DCWA 3F7MA 3GNTA 4EHBA 1EB9A 3BHNA 4UFOA 3SEQA 3Q8LA 1XN1A 2C00A 2A84A 1PNRA 1G4HA 3L6BA 1UPUA 4XLLA 1L4LA 2ZUFA 4B7AA 2X0JA 3GRPA 2D62A 4LY0A 3W6NA 4JXXA 3T3OA 2IV7A 1N3IA 2DR3A 1I6LA 1KDTA 2ST1A 1BE1A 1B73A 1YD7A 3HVKA 2IODA 1AZLA 1C8KA 1GSOA 4GYYA 2ZK7A 1YDFA 2FYTA 5HIAA 3OQJA 2V7VA 2Q1TA 2A5JA 4BNYA 3MWEA 3LHIA 4WN9A 2JVIA 3A4YA 3B7WA 1OZAA 4FLEA 4V3CA 3OAAD 3AOEA 4CIXA 5FAKA 5K51A 3GIDA 1PFQA 4C5CA 3WFJA 3F4KA 1IAVA 3L4BA 3A6ZA 1M74A 4M9SA 3ETCA 4JMLA 3O8QA 4ZVMA 3HFRA 1MG0A 2W6JA 4PO8A 4ROSA 1D8TA 4UAUA 4AJPA 3GT7A 4FIDA 1TXGA 3GJRA 2HA0A 4IXMA 1Y4SA 2BCGY 3PUYA 4H31A 3RUCA 2BISA 1SIWA 1J8FA 3U44A 4ZDKA 1FE8A 2WB4A 5FF9A 4DV6B 1AK1A 4FX5A 3H5LA 5BN3B 3NBKA 1IY2A 5LNK1 4NK5A 1H3FA 3F71A 1SC3A 3VBEA 1Q7CA 4E7OA 3KS9A 1AX9A 1MJGM 5H16A 4F21A 1XNHA 3IMKA 4W5WA 1JG7A 3D8TA 5JECA 2CKDA 4MPJA 1E66A 3LT5A 2H1VA 3UJ7A 5CB4F 4TLLB 5ALXA 2AN5A 5JZOA 5C51B 3USES 2TRSB 3DUFB 5JYCA 5AKGA 1DDOA 1I36A 3NC1C 3MPOA 1B93A 4OOEA 2OB1A 3RK1A 1QCYA 1UBEA 2FQ1A 3PNLA 1IQUA 3UEOA 1F1JA 2JNWA 3H42B 4B3XA 2EDCA 3V3TA 5G1NA 2PEZA 1E9AA 3RFUA 3AJDA 2IYWA 3B1WA 5HZKA 2DWCA 3A25A 5CLHA 3VBCA 4IGIA 4JHLA 4CETA 3DDNA 5KTTA 2I91A 5J5VA 4I1PA 2Z56A 3SWWA 3V1MA 4E5UA 3RG2A 3OQBA 4EW3A 1N5KA 5I8WA 2E3JA 2QIOA 3A31A 8ATCA 4BFVA 1YC5A 3HZHA 5J58A 3IUMA 2EZ4A 4BO5A 3V7FA 2AR7A 2E37A 2ENWA 2JHCA 4DEYA 1ZD5A 3M1LA 1NJ1A 1W5FA 1C30B 3IEUA 4Q4CA 1EEXB 1JUDA 1GAJA 1ZAKA 4O0LA 4OY3A 3HKCB 1YNSA 1WUYA 4Y3UA 1JYSA 3FGZA 4QJ3A 4C05A 3TJRA 2AW3A 2IP4A 2R6DA 1COWA 2CMGA 5K0JA 1PEDA 3UFBA 4ND7A 3AP3A 3EMBA 4LHEA 4ZCMA 3VYWA 1RJFA 1QH8B 5IEBA 4O2BF 5BOSB 4DCGA 3FI0A 4RDIA 2RCNA 4NLLA 3VHXB 4A8HA 1Q14A 1KVSA 3UNXA 4Q12A 2J9FB 2IYYA 4DIFA 3WKCA 3GUHA 5FUWA 4Q4JB 4OK5A 4PYLA 4MQBA 1YFJA 4Q21A 2PRJA 3O4RA 4JBWA 1W581 4B6JA 5IC5A 4RTMA 4NXMB 1RU3A 4P4NA 2NYUA 2GCIA 3P0EA 1W9HA 2PMFA 4QXAA 5GIPE 4E21A 3L6RA 1YZYA 3GCGA 2RDMA 1LLFA 8ADHA 3WQHA 1UXIA 4DV0B 5IJZA 4JBLA 2LIVA 3RJZA 1XU9A 4Q5IA 3WGZA 3WYEA 4DEVA 1P74A 3N75A 3LYLA 1HBJA 4NCIA 2GXUA 1LPNA 2A1UA 1HE3A 1SD5A 1AUVA 2YZ7A 3GAZA 4TROA 2ZS7A 1PFVA 4AMZA 3NWEA 4QHSA 3EIFA 4FYYA 3RBZA 4C89A 2V6FA 1RMQA 1VPDA 3IEVA 4BGIA 3EOBI 1R4AA 2ZP1A 1IXKA 2OTCA 3EXIB 1CYEA 2MR6A 2C2YA 4OX9Y 2VK2A 4I9HA 5JRZA 2C5BA 1ETHA 2JAQA 3UV7A 3HJHA 2YVQA 4N76A 4YRFA 1WQ3A 3KEFA 3LOQA 2Z3WA 3CEJA 5CGQB 2ADOA 5E7MA 2IUFA 1J2TA 2DF8A 3QOXA 5EHZA 2CLLB 3U4MA 4QWWA 4MYUA 4M49A 4AJKA 4GM4A 2R6AA 3W8NA 4F5ZA 2DY1A 1X74A 2YMQA 5DOVA 5HUJA 5IN5A 3ZE0B 4AROA 2JFPA 1WD5A 5JY1A 4RK1A 4MV0A 1BHO1 4RJJA 4AUNA 4EJ0A 4L3WA 4L7VA 4DVJA 1XZMA 3KBBA 4N49A 4GXRA 5I9IA 5DASA 4M38A 2A57A 2H85A 1PFKA 4KFUA 3X1XA 5FPKA 3OA0A 3AZQA 5IAEA 3RUDA 1JKMA 1NQUA 3P4XA 4LF4B 5CXSA 2RHJA 1PZNA 4LE0A 5JCPA 1C41A 2CDBA 1JEQA 3L7IA 5B57C 2Q49A 2IZ5A 5C7IO 1XAJA 3I05A 2ZUTA 3VOAA 2EFYA 4RK7A 3FNBA 2G17A 4H7DA 5A5VA 3TUJC 5D3QA 4FWTA 1NF2A 2GJSA 4G25A 5E2AA 3AR9A 3HBAA 4PNHA 3ZI0A 1U2DA 4NMLA 1JFSA 4WOKA 2GSWA 3V2GA 1WDTA 4DSNA 5ELLA 2XUFA 4HVAA 4CLOA 1QS0A 4KZKA 4NNPA 1XQ1A 1SH7A 1NVEA 2AQHA 4LE2A 1N1MA 4OIFA 4R5HA 2QR2A 4KE8A 2YIVX 1E3SA 1GCOA 3YASA 4Z7OB 3CA8A 5FT9A 1R5JA 4XVCA 1KDYA 3TD9A 2VHYA 2OE2A 2Z1DA 2JGJA 4LWPA 1J6UA 4MB6A 4YRTA 2PUFA 5A5GA 1UT6A 3CX3A 4FOPA 4PG4A 5BRJA 2IHJA 4AW9A 3WICA 5DYNA 3GLVA 4JIMA 2FPWA 4INZA 3K53A 1AKMA 1KU6A 4F84A 4NJOA 5CU7A 3TWOA 1BN7A 3V7WA 4Z3KA 3STXA 3P96A 4G56A 2GK6A 2XMCA 4PZLA 1UJBA 3SJ7A 3GX1A 5KU7A 4I5IA 3H8WA 2HDHA 3D02A 1KQNA 3B1YA 2QJTA 2ZUBA 2OFFA 3UAOA 2PGOA 4Q3KA 3SXUB 4CRWB 3WWEA 2H1LA 1YZVA 2ZJ0A 2UZAA 4IXNA 4OQPA 3ZIUA 4B34A 5EZ6B 2DFNA 2JJYA 3BT7A 2AG6A 2WKRA 2F2TA 4W1PA 4HDRB 5MFPA 2FMKA 3O4GA 1EESA 4QDOA 1KDVA 2QUJA 2QJWA 1Y5LA 3PCXA 1YBVA 3PE6A 2YXBA 1OXBB 3BQMB 1YOVB 3C1OA 3EQ7A 1ZL0A 4XYMA 4DPLA 3U5ZB 4DMRA 1T1SA 3MG9A 5BWBA 5F7XA 4S1WA 4H18A 5EWJB 2DWQA 3DE2X 3NHUA 1C3OA 1W46A 2VOEA 2ZZMA 4ZIRB 3ELBA 1KYIA 2FEWB 4YXFA 1UKVY 2R5FA 3KLNA 2FEKA 4TRNA 3OFSA 1Z33A 1QSGA 4TQUS 3REFA 4BB9A 2LTAA 4H9GA 3U3KA 4MQEA 4C4OA 3ICEA 2CBZA 5F51A 3O0TA 1WVIA 3WVNA 5JANA 1XZAA 4YCNA 1PUXA 2ZJFA 1AU9A 1YBMA 3VSEA 1YIAA 1YI1A 1KGDA 1PR9A 3ZWKA 2Z5VA 4F97A 4HVCA 2B30A 3KDAA 1SC4A 3U7RA 4XOIA 1EVYA 5CK5A 1LK5A 2FMTA 4EBFA 2OQVA 5KUTA 4ZZ1A 5A4FS 1OI7A 2H4YA 5FORA 4ZMRA 1MC4A 2IYPA 2QVLA 5G40A 4UTOA 1L4GA 4HAWA 4CEHB 2G0TA 3C16C 1KFJB 4Q1VA 1BH2A 1D4FA 1XCGB 4BEVA 2X76A 1MR3F 2ZE6A 1QXSA 3WLKX 2CUTA 2OXRA 3ELUA 1KTIA 2GRAA 2IDJA 4PRLA 2Q50A 1P2DA 4PX3A 1P5RA 2W8BB 4DS3A 1W25A 3CVXA 1CYDA 3C3EA 5JVDB 1EB8A 1Q3TA 1QRSA 1KQOA 4BASA 1WQ4A 1JIKA 2DXIA 4AWAA 2CJWB 3UC5A 1R66A 1WW2A 3KAPA 3QKIA 2FSPA 4KQFA 1FZTA 2CHFA 3HYSA 3HPQA 3FR8A 1ISRA 4KJZA 5F5NA 5AOVA 5TPZD 1JVBA 2P2DA 4OAQA 3TXYA 3WMRA 5AW6A 5FEUA 3WE7A 2TMGA 3BL8A 4DQLA 4Y18A 4FN5A 1G38A 3D31A 2RHBA 3HNOA 3THWA 3T7DA 4U2FA 3VMFA 4P92A 4WESB 1MO4A 1YTLA 3NUQA 4AZSA 2Y2UA 2GXQA 1ZM3A 3D2AA 2QW1A 3I9OA 4MVXA 4HD8A 3PEVA 2XCLA 1T43A 1ZI9A 3NTXA 2GXAA 3CRW1 3OUUA 4UTXA 1C1DA 2AC2A 4EMSA 3GG2A 5B6JA 1Q7BA 3SVTA 3K16A 2WDZA 2Y99A 3OO0A 1QRTA 1TQ4A 2F48A 4RD2A 2IH5A 1IHXA 1KVTA 3FMVA 5JUWA 2PVPA 1YUBA 2X41A 3GEGA 3PRHA 4X61A 3SHWA 1RWQA 4NBVA 1FYWA 4MYRA 3VR6H 3IAEA 3P26A 3L8ZA 1WKVA 4FQ7A 5TGDA 4ZVSA 4BVEA 1TT5B 3TNLA 3R5XA 4EIWA 3PEWA 3FAZA 1G4UR 3IIMA 3MWGA 4UUMA 3X2SA 3SSNA 4AG3A 1FFYA 1UXHA 1Z0UA 3MT9A 1CUFA 2VHEA 3TR0A 4R9RA 5SYMA 1GL3A 4PZZA 5EQJB 1OWPA 2BGKA 1MZVA 1WV0A 3WB1A 2CXPA 3EBPA 4J0KA 4H17A 1K5GA 2V7QA 2WIAA 5TPWA 4IRMA 1SPBS 3KR0A 1QLHA 3JVEA 2DG2A 3VU1A 3GZJA 3U4QA 1R0ZA 4XCQA 1UQUA 4G0MA 4EAAA 2QDXA 1TQHA 4IMRA 3BERA 1FA9A 3MC1A 3L4KA 4TMVA 2BMVA 3GAFA 1HEUA 4TTSA 2ZATA 1LBQA 2YRFA 3V48A 821PA 1A8SA 4JBNA 4NZYA 5KTSA 3EDOA 2QXTA 3ZDDA 3EIUA 1UIRA 2GD2A 2JGEA 1PGJA 4D80A 3PQ2A 3FWNA 4I8DA 1Q92A 4ZIRA 1L8XA 3IUSA 2QNBA 4AJOA 2XOKA 4F6LA 1SB9A 1JJAA 1XV5A 4ZYWA 2NTNA 2DHQA 4N40A 5C8XA 4N3BA 4HR7A 2KLHA 2ZRAA 4J3FA 4BCCA 2GLXA 4AJJA 1FDSA 2GZ2A 4CZ2A 1KC3A 5DI9A 2GBGA 3G2OA 1ZA2A 1NASA 3CUYA 1XZJA 1ZITA 5KOIA 2AH5A 4UJ3A 1EBFA 3SC2A 2JFGA 3NBZC 5EESA 4D79A 2IU0A 3T4XA 5DGIA 2QM0A 4INOA 1C9KA 1VIYA 1K3FA 1W30A 2ASEA 2INGX 5AMXA 4OH1A 4JL6A 3IDFA 4HS9A 2B6NA 1I3NA 1JZQA 1VCMA 1WMFA 2BEJA 3BE4A 3IUQA 3LF1A 3NDRA 1ZSNA 3OQVA 2PX0A 4BNIA 1BQEA 4F0JA 3WGUA 2P9GA 4ZI3A 4JOBA 1EFHA 1G5PA 3HHEA 3MJTA 4HI0E 4Q7MB 1Z2NX 4WZZA 4RELA 5J1TB 3BEOA 2VTBB 1JLLB 1NLFA 3GJ4A 5LP6A 1L4NA 5JI2E 1T9ZA 1YL7A 3KR2A 2I6XA 1ULUA 4YDHB 2DPLA 2Y9PB 5TR9A 3ZY4A 4RMJA 3NWBA 3BXFA 4JJAA 3SSMA 1BDHA 3FGOA 4FT4A 4N3GA 4MDFA 4ZOBA 4Q1FA 2GPYA 1GGVA 2P4SA 3X1JA 2FR0A 5ALFA 1RBQA 3G7SA 3QFFA 4TMWA 2EKQA 3STWA 1YRLA 1GQOA 1U5AA 2VH1A 3ZU2A 4W82A 2F17A 3JQBC 2VP4A 4TV8A 4DR6B 5CVCA 1GUAA 1YE3A 2IXTA 4AP6A 3ZY6A 1JHPA 2XUQA 1GSIA 1B8PA 2QRGA 1AUOA 2FP4B 4MWCA 4PRYA 2EP5A 4M8SA 3NAZA 3W79A 3UUGA 2D8MA 2ZBPA 3DHYA 2IYAA 3HCBA 4UUQA 1H4QA 1GV0A 1HDXA 2MMGA 5IT5A 4B80A 2G1AA 4K6MA 3F49S 3QW4B 2P3OA 4U3JA 3AJ8A 3HDGA 4S2UA 2AXQA 2O0KA 1KMHA 2R6HA 4BFTA 4CLOB 2CLFB 3H2JA 3SKVA 2IXGA 3WYBA 3GH1A 3NC0C 3HXLA 1OQAA 1I0IA 4RVHA 1N5DA 2XKAA 3Q0EA 4GKBA 1QCZA 2CVFA 2JIDA 3AXTA 2Z2ZA 5H3CA 4B84A 3AKCA 2PR2A 1KYTA 3DKIA 2J7PD 3AF4A 3FSEA 1JFVA 3DAYA 1EK0A 3PX2A 4HWTA 1W34A 1W0KA 1K7EB 4ZHQF 5CA1B 4RY8A 3SEFA 4ASUA 2UXBB 5ALSA 3NMUF 2H4FA 5C0OE 1X80A 4D4LA 1XCMA 5AUQA 1RMTA 4PQEA 4KR2A 2CN1A 4EFMA 1OCEA 3K0CA 3LG2A 1TAGA 4HP8A 2GUWA 4HS4A 4HYTA 1X39A 5JWRA 4HUQA 4LQCA 2OC9A 3HJUA 4W5NA 1JR3E 1V35A 1HDGO 1PL6A 4MR7A 4H4CA 5ULLA 3MLAA 4TLEA 1JS1X 1OSNA 3ZVRA 2J5RA 3HKCA 3FYUC 1UFOA 2QDKA 3JAKB 3AOGA 2IIBA 3A1FA 1Q3HA 1O6ZA 3BX1A 3K1YA 1PP4A 3OEEA 4M53A 4UBKA 5EE1A 2QT0A 4FMPA 4B43A 4FKBA 3P5SA 2C4NA 1KDRA 1YAHA 1ZWLA 2BFFB 1X1CA 2R1VB 3B13B 2IE0A 3A27A 3WLRA 1PJ8A 1Y8RB 2G04A 1KO4A 4WECA 5BYAA 4IO1A 3EPLA 1H5NA 4DCVA 4L3OA 4M21A 1RRMA 2BKAA 2OB2A 4FUTA 4TKMA 1DINA 4LBWA 4ENPA 3C74A 3E2IA 5AI8A 2BIFA 1M1UA 3LC0A 5IWCA 1J07A 4FFNA 3LH5A 4ZAYA 1AA6A 3IXMA 1RYNA 5F5LA 4C6RA 1Z38A 3HVHA 1VKNA 4LSMA 3ZQ4A 1V2HE 2O14A 3DD5A 2BLNA 3GMSA 4QAJA 5TB5A 5I45A 2XOEA 1WCIA 4DMFA 2JCYA 3D8UA 1P1JA 1AN9A 5FUQA 1J97A 3O3NB 4LYHA 1TEXA 4RFSA 1Q21A 5TMDA 4CJXA 1FP2A 4U7DA 2WTBA 2DHDA 1XL0A 4RMGA 1J33A 4KFRA 4Z2YA 1IUOA 1UFVA 4ZAFA 1CEEA 3H4MA 4EGJA 2AQ8A 1A27A 3G9UA 1RPAA 5C8DA 4LYDA 3WQRA 3R23A 4R0VA 3ZHTA 4IO0A 4TZKA 5HUQA 2H0QA 2F1JA 3ZJ5A 3FETA 4CXMA 4EYGA 3KXPA 5TARA 2H59A 3FPJA 3JQ7B 5BSGA 3DP7A 3ZKWA 1POWA 3GK3A 2FETA 4QOIA 2O2DA 4HQOA 5A0VA 3I58A 4MW6A 5IK2A 5LIPA 4KVGA 4MPPA 2ZITA 5HJ7A 4Z53A 1P7WA 3KTFA 1JIJA 4FNGA 3CB2A 2I6FA 2CFCA 4K0KB 4MUAA 1S3FA 3ZX4A 2W6ID 4EFNA 1YS6A 1Z3IX 4YJHA 4PW0A 1B1CA 2PUWA 2WFLA 2XVYA 3OQIA 5ALWA 4KO4S 4L50A 2DLNA 2P77A 4NZZA 2QORA 2HADA 3A3KA 3E8XA 4PWZA 3ZZ1A 3S40A 4F3YA 4MR7B 1M1XB 3UWDA 5J4KA 1CDEA 1P72A 1UM8A 1QHXA 2AWOA 5D00A 3FPFA 4A91A 4N5MA 5KHLB 1X8XA 1VRCA 1KOGA 721PA 1NVGA 2BRUC 5DYWA 4DYVA 4DCTA 2DT5A 4ZYLA 4B74A 5JAZA 1TUBB 3K1JA 2D00A 1XEXA 4M7WA 1GWNA 2QXUA 3M49A 2BZSA 4G86A 3DMHA 2H5LA 1Y8RA 5L7YA 3ESRA 2QBYB 1I1QB 3MM4A 4PICA 1J5PA 1DJNA 3PWZA 2HGSA 3MTGA 1BW9B 2HU5A 2ZRKA 1XZCA 3QV1A 2ZPUA 4H7PA 5AUNB 4RY0A 1NJ2A 5L3QA 4OHRA 2O54A 3VKUA 1E8MA 1W4BA 5HM6A 2WZQA 2ZT5A 3OA2A 1CJTC 4DARA 3DDCA 3JYNA 4CV1A 1OPXA 4OXRA 2FSVA 3JD0A 4QOEA 1W7AA 3D3EA 1A77A 3CINA 3NLLA 1XZQA 2O0MA 3S29A 1NR7A 1KQFA 1ONOA 3S8YA 4JLBA 3ST7A 4KYUA 3OBIA 2GS9A 3VTFA 1YE8A 4AMVA 2HNBA 1QB7A 3IXLA 1VTKA 2E1PA 5CVDA 1NTOA 2QV0A 2YFYA 4AJLA 2WM2A 5CB0A 2DZDA 5J47A 1KKMA 4TQ9A 2JHFA 3IEMA 5FHQA 1EKXA 3NHWA 4M9UA 4CCYA 4EAQA 3QQPA 3WY9A 4AK9A 2ZJAA 3GJYA 3IVMA 3ZE2B 5HP4A 5FADA 3KQOA 2PZAA 3WL6A 4V0LA 4QUHA 1YQQA 5EWLB 1IQPA 1YR8A 5HDBB 1Y7PA 5A6SA 2C58A 5ALMA 4K05A 3Q7SA 3SYKA 1RYDA 3ETHA 3O2SB 4ZEVA 4M7PA 3RFFA 3HC7A 5A4DA 3QUTA 2GEUA 1XDUA 2JIRA 4RETA 5IJXA 5EEGA 3JYPA 3KSMA 1TUEA 3A10A 1Y5NA 1ZH8A 1HOXA 1PFWA 1Q0SA 1P2GA 4CMCA 3I9NA 4EZEA 2X7JA 4ACAA 2I66A 4BO2A 3AK4A 4OJYA 4AKEA 1X7GA 2Z0MA 3LL7A 3NHKA 2A1TR 2UVQA 3EG9B 3L4JA 1DVRA 4EW1A 4R2XA 4X8LA 3U60B 1A2QA 1LA2A 4K2AA 2GGSA 4OHUA 4L8FA 4MKZA 2CNWA 4X8OA 2F7SA 4RKQA 3X1MA 4DM3A 4BZPA 4XVUA 4Z49A 3PEYA 1QQ7A 3S28A 1SCBA 4WBNA 5U9CA 1T8TA 3QYAA 5A9SA 3EVDA 5M3BA 4ZCIA 1TK9A 2AHRA 4TTIA 2G09A 4DTCA 3N59A 2JKVA 4P2BA 2PQ2A 3JPWA 1GNVA 2BPOA 1E5TA 3AKYA 3GJTA 4BJ1A 1ZJ4A 1U8XX 4MMXB 4AYWA 3EIQA 4FMCB 4AP9A 4XRRA 2GAOA 3HS3A 5FFNA 1WXFA 3SC4A 1T6ZA 4U6QA 5ALUA 3I04A 2GCOA 3EUFA 4HDQB 4HQ6A 3AHIA 2WD7B 3QM1A 3JTEA 4QYTA 3PPVA 3R6GA 2BFBB 4J03A 2QTBA 3H2YA 1NVMB 2JJMA 2V7QD 4Z86A 1R64A 1U63A 3GR6A 3T4PA 3KB1A 1QHFA 2YZKA 1CY0A 4S3MA 2VF4X 4MEAA 1TEHA 1BROA 4V0ME 4YCDA 5ERYA 4I4NA 4D9EA 1NIPA 4N0EA 1U8YA 3AFNA 4KSBA 3KQPA 4ZOCA 3E48A 4H6XA 5ELMA 4EDFA 1I4WA 2CHUA 1G4AE 3Q7QA 4ITUA 4D81A 5KREA 2VP6A 4AJHA 4MR8A 1M2WA 1KK0A 3GFOA 3UICA 1BCSB 1E6UA 3PQDA 3RSFA 3KE8A 2XGJA 5IT0A 3GFPA 3FNRA 1MOQA 4I14A 2BDUA 3M4ZA 4MH0R 4UHKA 1GFZA 1AVTA 5CA0B 4EGFA 4MJ7A 3OZTA 3KYIB 2CK3D 3QTBA 5K8TA 5KYNA 1JAIA 3U7HB 2GWRA 3DVQX 2D7DA 2NO9A 4XGKA 4DSUA 1C1DB 1XZGA 3HP1A 1ESCA 4DG5A 3SGLA 1Y42X 4F2HA 3AGQA 3VPSA 5E8JA 2WPNA 4HFJA 4Z5XA 5LQAA 3SIPA 4X1OA 4DC1A 3CS3A 4XFDA 4XWGA 2QTZA 4ANFA 3GRFA 3LXXA 3N2NA 4OK3A 4P33A 1FLNA 4RJIA 1Y0BA 5BQ5A 3REQB 3D7RA 2AOUB 4PPNA 7ABPA 1IIBA 2HA6A 3C3DA 2H3HA 5AHXA 3PFCA 3HWSA 2KS6A 3LU1A 3RVQA 1WSWA 1JPUA 3MQ4A 4OCZA 4A0FA 1FXSA 2Q5LA 1SBCA 1S8OA 1Z83A 3GXOA 2XTJA 2GNOA 1BAPA 1AS2A 1HWYA 2WF7A 4G1CA 1X7YB 1WDKA 2GEBA 2GYUA 3NTLA 4K6CA 4LKOA 3V32A 1IHYA 1AKTA 3NHMA 4KL8S 3AUFA 4HDCA 1BCRB 3EARA 1F0YA 4CQMB 2WWFA 2HJHA 1Y1LA 5KB3A 2OLJA 3KQHA 3NASA 4DA9A 2PRYA 1Q1NA 3Q7RA 1TAHA 2Q3EA 2FZKA 2UZ3A 3G2LA 4C4RA 4QSHA 4AZWA 3JVVA 1L7RA 1A5AB 1QLWA 1ZXLA 1CF9A 3HEAA 5TIIA 1ZNXA 3CLTD 5D01A 5LD2C 3L06A 5FI3A 3O38A 3PD0A 3OZGA 3VI3B 4GPEA 1N2CE 5ALVA 1C7JA 3OUZA 1NDUA 2JJ2D 1NE7A 3ZHZA 4D9NA 4H1HA 5KYWA 5F7JA 5EUQB 1YJ5A 3TLZA 4BFCA 3T3EA 2HLHA 2I3BA 2I7XA 3LQ2A 4Y2VA 2IUYA 4ZOQI 1ZRSA 5E2IA 1G17A 2XDYA 1XU4A 2QMEA 3DZIA 3E9EA 3GJ8A 5U4QA 4DUPA 4O59O 3TRFA 3F6YA 1BX1A 3KOXA 4DZZA 1PWXA 1YJQA 1NLUA 1GAXA 2ZUUA 3A05A 3JQAB 2B4YA 1MKYA 4LZZA 1I7DA 4HNQA 4BNLA 3MELA 4WLFA 5K0ZA 5KQGA 2IEAA 4Y2XA 4AI6A 2H7XA 2HQBA 4K88A 4TX1A 2NO5A 4NY1A 1NRXA 1RZVA 2CZCA 1T3GA 3GRUA 5KDLA 4G5FA 3AHCA 1C3OB 2ZU6A 1ZBQA 5KTNA 3W05A 2R6CA 4HTFB 5JDIA 3PC8A 2FU5C 2LWIA 2Q4EA 4URZR 5F2OA 4JOQA 1A88A 3L0IB 3HJRA 4RLSA 3FJOA 4AS2A 3OJEA 3FOEC 4N3AA 4FC6A 1MFZA 3B5IA 4TV8F 2FZGA 1B41A 3D3WA 2YKGA 4DR1B 3IPAA 4J1QA 4L57A 3ZHUA 1YCFA 3EZGA 4DQUA 4XYEA 4JT8A 1NL3A 2OV3A 2BR4A 5CLQA 4ZI2A 2Q3DA 4NU6A 4WFKA 5EL0A 3OQ6A 5EJ8A 2NZYA 3V8NA 4BNNA 2JJ1D 2HMUA 3BF8A 3DT9A 4B83A 3JQ6A 4DCMA 5EIBC 1XEWY 3UVEA 5MN4A 3L4SO 2Z8ZA 3Q11A 2VP2A 1QLJA 4BKMA 1GNTA 2G9RA 2DFKB 4DV2B 1ODJA 1QIDA 1H0RA 4JKIA 3UJAA 3EHEA 4KR3A 1VIMA 1DC8A 4RZIA 1HE2A 5BOVA 4PC7A 1YOVA 2JK0A 1DI0A 4DLZA 1R2QA 1NMEA 3IOEA 1GPWB 3BB3A 2PCJA 3PDJA 4YPFA 4D9GA 3LCUA 1DP4A 1FP7A 5A62A 3QYPA 3Q6IA 4JI8B 4Y6OA 3VR3A 4RVGA 3AM3A 3WV4A 1KAEA 1MH9A 4JI0B 4LHZA 4LHSA 4KAFA 2F55A 5JROA 3W9YA 5ITSA 2NXWA 3WGNA 3THWB 1DC5A 5SYAA 3VU9A 2HJVA 4JQZA 2BBTA 3HCPA 2PBRA 4OAPA 1T2VA 4BX8A 1TJNA 1MW8X 1ZLXA 3O6VA 4UBNA 5FPYA 3BAZA 5F2NA 1E79D 1WUIS 4RH1A 5DHFA 5DEIA 3RFVA 1E3EA 2VYQA 3LX8A 4A0QA 2WNHA 4MMZB 3WIVA 2FKAA 3L77A 1DOZA 2WAMA 2PYDA 3L79A 5EA2A 2XAAA 4ZANA 4N6OA 1BN6A 4BKUA 5LJLA 2VO1A 5HF8A 2V96A 2Y1EA 1QYDA 4ZOAA 4ALIA 4HGQA 5J43A 1B16A 2C82A 1U0NA 2CVQA 4F4FA 2VVTA 3QPAA 1E2BA 1O89A 2Z09A 7REQB 1IXRC 4ZRMA 3VO8A 2HWUA 2YHIB 3HA5A 4HNAB 3HCOA 1FFXB 2MINA 5AJZA 1QBGA 2EYQA 4L5YA 4XR4A 4PO9A 4JQYA 5I4BA 3W5BA 4JU9A 2VHZA 2XXAA 2JAHA 1UBUS 1X9IA 5DBHX 4LY3A 1SVIA 2DT8A 3ULKA 5JLAA 1UZUA 1MIHA 4QDXA 2XF2A 2HO5A 3C15C 2OKGA 4HXFB 4Q05A 3ZY3A 1Q84A 1C3VA 4V0NA 3D3NA 4PXYA 5LYYA 3TCXB 2PZGA 4X94A 1ETUA 2BLLA 5FPPA 1UBSB 3QRWA 4UMDA 3EXHA 3LY8A 2JGMA 4L5CA 4NS1A 5JFOA 1F2UA 1RLMA 2ATVA 2RHRA 2XQFA 3HSYA 2FW7A 3P9SA 4RZ2A 4TXJA 4BLUA 3R5FA 4BQOA 1Z7BA 2BHTA 5CW1A 3ROZA 4CM9D 2WJHA 3GJ5A 1A8HA 3O75A 4RENA 1HL3A 5I47A 1EWVA 3VR1A 1T1EA 1K06A 3R6TA 1QYVA 2H1SA 2VDNB 3AF1A 2EKBA 1M6NA 1IB6A 2OO5A 4KFCA 1ZOSA 4JMPA 1VPEA 1DBVO 3KTAB 4DMGA 4C76A 1S4MA 2P2ZA 2EDAA 1WB5A 4CM7A 2QZ9A 3B7GA 3DZKA 1CUXA 4K9SA 4DA8A 1KMMA 2GSDA 1DTWB 1RQPA 2YJZA 1GPAA 2NUPA 4KRYA 5IZ4A 3LX6A 3DUWA 1EHYA 1MAUA 3CLSD 4IXTA 3ETEA 4ZVLA 1GGEA 4RJLA 3OQ1A 4TMTA 2OYCA 3HJBA 1TD1A 3O4VA 1UDWA 4GI3A 2RGDA 5IF3A 1A2BA 3IKMB 4XIIA 5IN4A 1RRKA 4JJ8A 1XXHA 1ATZA 1G5HA 4BZQA 2ZJZA 3EH1A 3SXPA 2C2ZA 3O4HA 5HIIA 6YASA 2Q5EA 3VTKA 1TA4A 3SXJA 2GN6A 2ONKA 4TYYA 3SFZA 4KN5A 7REQA 1Z8FA 1QCDA 2D1FA 2GASA 2X6QA 4Q48A 5IKOA 3KKEA 2HDNB 2WFZA 3DHVA 4PGGA 4DJAA 2GTIA 3NHYA 1GKUB 1QIEA 3IQXA 3AHHA 2O8DA 1HGXA 2O2ZA 2UDPA 1U7UA 3EPRA 4R8SA 4G89A 5TT0A 2FSGA 2NWQA 4RHEA 3SR4A 1CWUA 1W88B 4ENTA 1ZSVA 4FDTA 1U28A 5DOZA 2IRWA 2CL6X 3GJ0A 1EXNA 1EK1A 3R40A 4UMVA 4WKOA 3TRKA 5IKEA 5HTOA 2GN0A 4S1PA 3U3OA 3HZRA 4BNXA 1F20A 1GGNA 3O4IA 1XFAA 4I5EA 1Z4KA 3E3NA 4YGXB 4KE9A 4O2BA 2JAPA 5F4BA 4UNPA 5K0LA 4GYWA 1Y3AA 3UAVA 3WNQA 1W4RA 1MTZA 2OLKA 1W49A 3O94A 5GZ1A 1T4MA 5H02A 1L5KA 2PGDA 2VH2A 3EGEA 1NAHA 1Z5WA 4K9DA 1ZJ6A 3AB3A 3P32A 4GVLA 3JALB 2VHJA 4IM7A 3TIVA 2E49A 1A5SB 2FG6C 3AYZB 2ZE8A 3L84A 1IHOA 5IVHA 4EHIA 1U65A 2OHJA 3OOSA 4MUJA 1HQCA 2H52A 3GJ6A 1Q74A 4PPYA 5F3RA 4H3SA 1NMQA 3AIKA 3ZW8A 2FPGB 1P4HA 2GK4A 2Q3LA 2VPYA 3A6PC 4YAUA 1EWQA 3FYDA 3FLEA 3FI9A 4GI5A 5E7IA 1BYIA 2XUJA 3AG6A 3L8HA 4IG9A 2Q0SA 2WHXA 1KK2A 5I9TA 1F0KA 1IDOA 5FCDA 1Z5OA 3Q85A 5CVVA 2ZYHA 3QXJA 2BKLA 1Z73A 3O3OB 1Z6AA 3DMPA 1M6HA 5CITA 4YHHB 1QU3A 5FA8A 2UUOA 4LCBA 3AR4A 3F8SA 3T3IA 2QN8A 1G5TA 1ZXXA 1L7MA 1ECGA 3BDVA 3CF0A 4TTPA 1I10A 2Y0DA 3KOYA 4D0LB 4Q19A 3THXB 1XWWA 1VJTA 2QJFA 2I71A 3CLRD 4Q34A 5CA0A 1II0A 1IATA 5ALQA 3ZHVA 2A92A 3QU2A 5EOVA 3E0QA 3WIEA 4ZZ3A 4DBLE 4FGJA 2O19A 4LA4A 3C85A 4Q4LA 4EARA 4MK4A 5AM4A 4CL3A 2Y68A 1U2GC 5G1PA 4EG6A 8GPBA 3FLAA 2A0FA 4PNEA 4C07A 2K6GA 1M2EA 1PDWA 3GAAA 1BHSA 1IK4A 4W5HA 3MHTA 1V5IA 2GVNA 2W6JD 4YQZA 5EQFA 4Z9YA 5IEJA 5AVUA 1OB2A 1JWLA 2AHOA 1J9EA 5HQ3B 1S1MA 2ACWA 1WXIA 1IRIA 2XA2A 3F0TA 2MHCA 3NM4A 1H0HA 1DBQA 5FTMA 2WV7A 5LMUB 5A3QA 2JFVA 1E3LA 4LW8A 3TB4A 3O03A 1JFFB 1P0IA 2XMDA 3AEKB 3V33A 4G0YA 4JI5B 1AIPA 3OE5A 1I30A 3ZIAD 4A4DA 4GH5A 5JOQA 5K8UA 2HMSA 3JYQA 2JIMA 2X4IA 5GONB 3D7MA 2GN8A 3EFBA 3SZRA 4EJSA 2R1VA 4YPVA 1F6WA 2OECA 4ODIA 4Q9JA 1ZGZA 2WT9A 1UDRA 3PR1A 3W9SA 3A6FA 4DJDC 1EX6A 3ZXXA 4IF6A 3KCNA 2WPDA 1KO8A 4PEVA 4NECA 5B5SA 2PV7A 2V8BA 4IDGA 5G4KB 1GL9B 1H2FA 2WP8J 2HQ1A 3ONNA 1RYFA 2IHTA 2BZGA 3FB1A 3FCEA 2HF8A 2G4CA 4EG8A 1BU5A 4KQHA 2I2CA 4F4JA 1SCUA 1BVYF 3PGMA 5IYZB 2OHHA 5FNVF 2EJTA 4QL3A 3KSUA 2CVHA 4BJ6A 4CEJB 3RS4A 4QUAA 3D3QA 3B9QA 3H2IA 3M9WA 5IWAB 2PSSA 5LLSA 4HMPA 3B48A 4P7FA 3DAOA 4R40A 2WSSA 4WLEA 1DJLA 3JZFA 2QTCA 1IM2A 3ZC3A 3E9RA 2XGSA 4UQLA 5EE5B 2IW3A 3CRVA 5CXUA 1IBLB 2QTRA 1VRVA 3GLGB 1SXGA 1E79A 1O08A 2O1SA 3OC0A 1P9RA 2PSDA 3TE6A 2EJCA 3I6ZA 3JYLA 1KSJA 4LN1A 1NXTA 1ZDMA 4FIZA 1ZEMA 3UUFA 4C4TA 3DTTA 3OP4A 2FKNA 1MGPA 2QE6A 2VCHA 3JWHA 3A1VA 2OFPA 3H1TA 1LS6A 1C7EA 5B3LA 5JQGA 1J24A 3LJKA 5ES4B 4OHFA 1E1CB 1TF5A 2ID7A 4F3CA 1UPFA 5FLKA 1TKCA 5TQ0B 2QE7D 1R9NA 1X42A 2JGDA 3ADKA 3S27A 1YB7A 3IOCA 2P9QA 4P3KA 1TMKA 3II6X 4IHJF 5DHUA 2FFHA 1CJKC 2JHPA 3WRWA 1K8ZB 3WRYC 4AXXA 4TV9B 1EA5A 1NU8A 2FP4A 3OCXA 3LWNA 1OILA 1CBUA 4XX0B 1U80A 2ATEA 4US0R 4YIHA 3Q1LA 1E2IA 4DHEA 5CAEA 2LW7A 3T5GA 2CHEA 3RVOA 5HZHA 4ID9A 2VI5A 3FLBA 13PKA 2BP7B 2HSZA 3LD9A 3WA7A 1YZQA 2OT3B 2XDQB 1BFKA 1T24A 2R2GA 5EWJA 3LYHA 4CMBA 2WVHA 1UFRA 5KEIA 3R76A 3GGCA 3UHJA 1KH1A 3U7EB 4A8JC 2OGTA 4KKXB 3BSFA 2E82A 4A6DA 2W9XA 3QEBZ 1QHNA 5FWYB 4PM4A 2VBCA 3HM2A 1XFDA 2IA5A 5B37A 2H5IA 5JADA 1E1DA 4K8OA 2VZ0A 2J0VA 1YOBA 3SG0A 2AG8A 4G81A 2VKQA 1CB7A 1X1QA 2B5VA 2XY4A 3DPIA 4P8RA 5EPOA 1VI5A 5LC1A 3RDPA 3FJYA 2VZEA 4HYYA 4YMUA 1VLQA 4Q37A 1MHPA 4MS3A 1H4TA 2QGFA 3RK0A 4E32A 3B51X 4IJUA 3CEHA 4IIVA 3O82A 2QUKA 2AF3C 4G1EB 1KR2A 3QPDA 5AJWA 5BMVA 1KDPA 3V4PB 4RZSA 4D9CA 1T2NA 3GVHA 1J4AA 3Q7TA 4JH0A 4X0EA 3H2BA 2D5AA 1JE1A 3MWYW 1YL6A 3VKVA 3CLVA 3L1UA 3KB6A 5B53A 4DWVA 1UPTA 1XXLA 1XC7A 1PLLA 2VUUA 4KAAA 3LM8A 2WM9B 3QPCA 5FAXA 5G0VA 2JAXA 3OETA 5FV4A 1DG3A 1P4SA 4E07A 1O94D 2VAPA 2I8CA 3TX6A 1B00A 5KS2A 1XJQA 4Z0HO 3WJ1A 3T5PA 1VC2A 1FS4A 2HTFA 1U0TA 2RGYA 3LW7A 3E7WA 4QEZA 2GESA 4L85A 4NCNA 3ZW9A 3FPHA 1QYCA 1C80A 3ZHSA 2FE4A 1JILA 1XX6A 5REQA 1DQNA 2IZZA 1MEEA 5E6UB 1ICEA 4CF5A 1ADJA 2BGGA 4XW2A 1MB2A 1TF7A 3RRBA 5EHXA 4BMOB 1SZPA 3L8GA 1YRQA 4CKYA 4BVLA 5FL7A 5MN5A 1EXWA 1UMBA 1RRFA 2XVXA 4XJSA 3TLJA 3U6KA 3G59A 1M8JA 3ZE7A 1NVDA 2B98A 1JIXA 3U13A 5HOQA 3M1YA 3K0KA 1Q17A 5F1YA 2V55B 1ZONA 2OFXA 2Y1CA 1PD1A 4ATNA 2CJPA 4V0KA 1KK3A 3JALA 3AEZA 2OOSA 4L76A 5TY0A 3FDFA 5B3JA 3TQIA 4ENRA 5IFKA 1UMKA 3QOWA 5LN1A 4L4UA 4JKOA 2I4LA 2JCXA 1QAQA 5FWAA 1GARA 1SN7A 1JMVA 3FTPA 4TTVA 1JAXA 1DKOA 2CMHA 3NUZA 4IVRA 1R8XA 3RTBA 1S2DA 5ECWA 1YUMA 3EC2A 3K0FA 4HHEA 3VMMA 4KFTA 4II7A 2EBUA 3ZQUA 5CX4A 4EI7A 1CR6A 2AJTA 2QX8A 2BMDA 2C8KA 3G8CA 3L0OA 4OJNA 1T0PA 5BSHA 4FDAA 2NYAA 1QOQB 2X7HA 4MARA 4UUPA 1IBMB 2I9KA 1QHIA 3HJGA 3VZBA 1V3UA 3SPXA 4P84A 4F4IA 5L6MB 3HM9A 3MJEA 2R8PA 2D5LA 2WWWA 3TO5A 1F5SA 2H8GA 2RH8A 3ZDFA 1Y9DA 2VHQA 4XSVA 4RSMA 5K0EA 2MMCA 4KLCA 4LDAA 4M60A 1QJ4A 4LZJA 3G9ZA 1AMUA 4K6GA 3IERA 3P2YA 1EH5A 2JPDA 2BCJQ 4LZPA 2QRHA 5ERGB 1B4DA 2M6LA 4B3IA 4UU7A 2YC4C 5CIYA 5K8JB 3I6MA 3R7AA 3SYLA 3N87A 1BOFA 3INYA 3E22A 1DAKA 1MT0A 1RAAA 2ZZKA 3I5AA 4QRDA 4YI3A 4A8TA 2QQGA 5U1PA 1EXMA 1JQLB 2QT9A 2Z4RA 2IS1A 1JYFA 1OU4A 3HB0A 1EUCB 2AJBA 4A2PA 2OR3A 5A06A 4AFNA 4DSTA 1PFUA 1DTWA 2WIFA 3KPVA 1YS9A 1V71A 3FGNA 4ISCA 1CNMA 4KFSA 5L51A 3DYIA 1KJQA 4B2IA 2GNPA 1OH8A 2IPNA 1WXXA 4C2UA 1IY1A 1UZMA 2HU2A 1X92A 3H5RA 4BJ5A 1N8NA 3QHQA 5C4IA 1SVSA 5CFLA 2NU8B 3WLOA 4WN9B 1LK7A 1UOOA 3NW9A 4RZHA 1CPYA 4RV9A 1E0JA 3WKDA 5B7NA 4OHKA 4M1WA 5DBIA 2QRPA 4B3TB 2L69A 3M6LA 5BXQC 2RAVA 4HQ0A 5IBCA 3M6MD 3CF6R 4Z0TA 5B2FA 4XLTA 1Z36A 3OPQA 3IO3A 3VTZA 1T34A 3AVPA 4NULA 1ES9A 3MZ0A 4YMWA 4LX8A 2X40A 1K0FA 4B6EA 4B2LA 3TFQA 1VMEA 2IELA 1MQ8B 3ZHYA 3IKLA 4MW1A 5C5DA 5JZ9A 2FWPA 2ZWAA 4H4DA 5JHGB 2CXSA 2QZ4A 3DEIA 4W5OA 1UPCA 5KWVA 4TWBA 3UBTA 4ZQIA 2O8EB 3WDSA 2XMBA 4Y7DA 2JEYA 2VRCD 4QJ5A 3B3FA 1G1MA 2QG4A 3MGAA 2R9VA 1GZ7A 4ON9A 4CIWA 1FFAA 3OLVA 4BKOA 3ER6A 2RGNA 1GZ6A 4DYHA 5KSWB 1MOSA 1P7VA 3D43A 1DEKA 1FP1D 1PJAA 2VNJA 2X13A 2R1TB 2E4YA 4PSCA 3F3SA 1IZYA 3LWZA 3I3SR 2FQWA 3BKXA 2AOXA 3H8SA 3PFWO 4EJ2A 4JWTA 4MCHA 1B15A 4DREA 1QHSA 4LHWA 1RPTA 2AA3A 3JD2A 3NKFA 1TPYA 1U8CB 4G0WA 4HSGA 4MCJA 2WMYA 4JGGA 3VKGA 4HBZA 4V1CI 4K6KA 1INLA 3EAFA 3PJFA 1Z0AA 1ZJ5A 2R7LA 4J76A 1EBUA 1NHGA 1FXWA 1E2QA 1G3MA 1KY4A 1ZJJA 2XX3A 1UAGA 1I24A 3N2KB 3O8QB 4I8XA 4NMWA 3VDXA 4HH1A 1VE1A 3IUBA 1A82A 3BWYA 3ZV5A 4C0QC 3E7DA 4BRZA 2CE7A 2NAFA 4ZO7A 3E9NA 2P9BA 1XRNA 2I2DA 2O7RA 4QYWA 5AKLA 5AWFC 1QQBA 1XQYA 2GX6A 2W5UA 1GR0A 4YAJA 1DPGA 3V8BA 2DKFA 1WL8A 1Z3CA 4ZHQB 2B9EA 2OCLA 3DOEA 1L3CA 2CZGA 2FWRA 3B9RA 3QA3E 4HX9A 4M0EA 5CLGA 5DP2A 2ZUSA 4Q01A 5DTMA 4BP9A 3L41A 1RXVA 2A9QA 2H06A 3EIWA 4B7UA 3WJ2A 1CQZA 4I1SA 4CN8A 1RQRA 4M98A 2WV9A 4IIEA 1TVKA 3WLPA 4EVSA 2H17A 3DC7A 1J9ZA 1C7ZA 1VL2A 2YFQA 1Z88A 3ZDQA 4DCPA 3HKDA 3EWAA 1A0OA 3G8YA 4FYJA 4JA2A 4LDQA 3IUJA 4M54A 2J9GA 3UT6A 3FRJA 1HYEA 3ZWNA 2I22A 5IKMA 4M0PA 4BRSA 4OQQA 4D57A 1REQA 4A2CA 4D44A 3REOA 3T1NA 1LY1A 4WMLA 3UK2A 2PWAA 4DC0A 2W00A 2NTJA 4QQNA 4F6RA 4DV3B 5AICA 3GEIA 4RLHA 1BDJA 1X7DA 4JLDA 3PRYA 5IH3A 4MW4A 4RADA 2R1UA 5KYUA 5IMSA 1HLDA 4LFAB 3IT1A 3MUFA 3H2ZA 4RE6A 1FQOA 4QTZA 4L8WB 4YJ2F 2GEDA 1S9HA 2ODBA 1BJRE 2XWQA 3IMFA 5EP4A 3L1HA 5FTWA 2ABWA 3S2ZA 2P11A 4D96A 4F9EA 3RH0A 2GZHA 4BVHA 1WUJS 3PFKA 4K46A 2WBLC 3B6JA 3MWDA 4TM8A 4AN0A 1P5HA 2ZT6A 4FE7A 4L6IA 1WKBA 1ZGGA 3LHFA 4G65A 4EX6A 2C7QA 4NZMA 4QQRA 5DLYA 1T4CA 4DQ0A 3ADDA 3E2MA 4TYQA 1ZVKA 2FPLA 1MORA 2GAIA 2O2IA 2O23A 4R8RA 3JAWA 1QF9A 1YI8A 1G66A 5LUBA 1L5ZA 4CEHA 3UOAB 2Y8EA 3REGA 2PJUA 1L6IA 3UAWA 4BMSA 5B1SA 2WMNB 1P1IA 1A9SA 1U31A 3HO6A 2VBFA 3HWX1 3MLBA 3JARB 3ENQA 2BGNA 1Z4LA 4NBTA 1FW8A 4DLNA 3MERA 1LDGA 4ND4A 3H75A 3QWAA 5C4MA 4Y2GA 2CB9A 1XF1A 3DOCA 1T91A 3KEMA 1GAQA 4UHDA 3H9BA 4FHZA 3ZW7A 2ZUEA 5CVTA 2VLBA 1JEYB 4KDEA 4B6SA 4OJKA 2XAUA 3EN0A 4C22A 1Y6ZA 2W2OA 4KMSA 4AZ3A 3I0ZA 1A4RA 1OROA 2G9ZA 3GZ4A 3PNKA 2WMDA 4IJKA 2CF5A 1JBEA 2DSTA 4UOEA 1UMBB 3RIEA 3U4QB 2A4MA 2YASA 5KAMA 1J0CA 3AHJA 1U9IA 1S1CA 4F1WA 4F2WA 3QX3A 2UXDB 1YU6A 4PHHA 4DLUA 3HR7A 3IQFA 1H1TA 1LWNA 1O95C 2A1UB 3UA3A 4YCLA 5FUBA 3KKMA 4FTWA 1H4VB 1QDLB 1KZGB 4UAVA 3LSYA 3T7JA 3UJ8A 4BNGA 4A0RA 3LZDA 5JV5A 1K8RA 2DR0A 2PJDA 2PGXA 1C1XA 4N6GA 4XSHA 1YS4A 1J7KA 1TM5E 3FSJX 4EY7A 2I62A 1BMDA 4FFMA 2DQ4A 3EAQA 1G3UA 2RHMA 1YZKA 4I2NA 4YUVA 3T4EA 4C0JA 4CNQA 1KKUA 2AL7A 3DV9A 3EXEA 4ABYA 1PDOA 2J7KA 2V3VA 1BMQA 4MV7A 2FX2A 5FB3A 1N6KA 3PVZA 1D2HA 3ETNA 4MW0A 3FVVA 2GN4A 2AEEA 4JLJA 4R1TA 4LC9A 4YAIA 3TRIA 3IVCA 2P3QA 4GC9A 1SOUA 2C92A 2J6CA 3B70A 3KELA 1NA5A 1XKXA 2RB4A 1J09A 1IH8A 1KEWA 3IYLW 2IEDA 4DABA 1AS0A 3IBTA 3GUZA 4PV7A 1XT6A 1Y34E 1FTNA 1JG4A 4OKSA 3QPUA 3ZGLA 4F04A 4K03A 4V1CB 5ECGC 5IAJA 4C6HA 4G23A 2XKKA 3AHGA 3ID6C 1PBNA 5IVPA 4UNNA 4PZEA 5C8ZA 3QPWA 1JLMA 2LKDA 2R3SA 4DR2B 1J2RA 2Q4RA 5K3AA 5JXHA 1SULA 1Y7IA 5A9RA 3QUQA 4KI7A 3ENKA 1IN1A 2NTEA 4FDMA 3E27A 4HWGA 3VOBA 4LXGA 1GPJA 3NIFB 5HBRA 5FUYA 3RT1A 3BORA 1Y33E 1W5AA 2D1TA 4BYMA 1VSVA 3RYIB 1ZM7A 2GN1A 1Y63A 1Y80A 3BM5A 5B55A 4BN0A 2XYRA 3GI1A 4YQFA 5JCZA 3U61B 3RUHA 2Q8PA 2ZJOA 1R6VA 2HL6A 4FHEA 1JJVA 5A1TA 3CWCA 3S7ZA 2ZTMA 1HSZA 3ZCTA 5CH8A 2GM3A 3WLQA 2BT4A 2I1LA 1PUJA 2QIPA 3CRRA 3FWZA 2R44A 3IULA 1VJ1A 2CJYA 4PFKA 5DTRA 4W4TA 3EEBA 5KSPA 3K8OE 1QGED 3SP1A 3TZKA 2LIPA 2WF9A 2XWSA 3I37X 4BX9A 4UBLA 2QLNA 1BNCA 3HDVA 1EAYA 3IODA 3KUXA 4EGSA 1EWTA 3H5NA 3L46A 3R4VA 4CI0B 1T5DX 4KHZA 1NQVA 3VO9A 3M6WA 4LBZA 4GR4A 2I4MA 2WLTA 3PXBA 4CTKA 1Q57A 1V9SA 1QOPB 1Y3HA 1NZDA 1QIFA 2E4ZA 1JMYA 1FFEA 2ZTHA 3QWIA 4IDCA 1Y1SA 4MP8A 5I4IA 1AHNA 1S3SA 3RTCA 1Y8AA 1TIKA 1PNQA 4XJVA 5CURA 4WCVA 3IOBA 1KPHA 3UAZA 3TI9A 1O97C 1XYGA 3ESZA 3GBPA 2AG5A 2PUAA 2VP0A 4HBGA 1EVEA 1SBHA 2DTEA 1D9ZA 2Z2IA 4YP5A 3VDRA 2WHRA 1EIWA 5DHAA 1P0CA 2VNKA 3RU7A 1U0BB 5EZQA 4HH3C 4PWYA 4EY8A 2CUNA 2XBUA 2ZYGA 4EHHA 4XM1A 3CTPA 4ZQEA 1AUQA 4TL6A 6ADHA 2XEDA 2FJ0A 3MINA 4HEA6 4DDMA 2IPLA 2C94A 2GZDA 3IJ5A 4B7ZA 2C0CA 5GV7A 3E81A 1HT2E 5DK4A 1TZBA 2ES4A 5EIHA 3RGWS 2QHXA 3AI2A 5TNXA 3FPSA 3FCCA 5CBPB 1PWYE 3I4FA 4FYKA 3GLSA 3MS2A 5T6BA 2ONYA 1GL7A 4ZD6A 5LQDA 4C04A 1G1AA 1NY5A 4ZK6A 2O06A 3ROMA 3O9VA 2XYGA 1YMQA 2A94A 3LRPA 3ECSA 3I2GA 3NATA 4GOMD 3OAAA 1L3BA 3U7QB 3B6MA 1TE2A 4FNOA 4I4LA 4GICA 3ZTYA 5HHTA 2ODPA 2O2XA 2H65A 1L7VC 3D8SA 1NVKA 2WU4A 2ZFUA 4MW7A 4ZDJA 2WWHA 2ISQA 2JIZA 2X4DA 5AI9A 1E9RA 3SBOA 5GJWC 2X2OA 1PD0A 2PU7A 4TS9A 4CMEA 3KKPA 1QIMA 2GD1O 2JHAA 4Q9NA 2JEZA 3F2VA 3ABQB 4FFBB 3H16A 1RWBA 1I1NA 4GZLA 3ZK8A 2BEVB 2BM1A 5I51A 1JXAA 4WCFB 4ZC8A 1ZR4A 2W6QA 4LJ6A 4WNAA 1ZOOA 1J39A 1CY6A 1QIHA 1QVZA 2R4TA 3BTUA 4L0CA 3GLFB 3C8HA 2C4TA 2X9GA 3OFKA 4FX2A 1SC9A 2I2AA 1FU7A 2PN1A 4I1UA 3D3JA 4PAMA 4YB8A 3DDSA 1CG6A 1T15A 1J5EB 4NARA 3NOXA 4XA8A 1Q12A 1Z4JA 1Q7TA 1S89A 5DM60 4OAOA 1C4XA 2B4KA 5COQA 1VRWA 4LJLA 3A3YA 1RQ2A 5BW5A 2C7RA 1J8VA 5DSZA 4CT4B 3UMGA 1OGJA 2FPKA 2WA2A 2PKQO 3L7LA 2YY6A 1Y4UA 1IHPA 2EJWA 3TS1A 2ATCA 4P08A 2GTPA 2VJCA 3OY7A 1WAMA 1QF7A 2YV1A 4WGFA 4C2BA 2Q0QA 2B8EA 5I7HA 4PYKA 1JG3A 2AI1A 1WCIB 1W75A 4ZQGA 3HYTA 1DEOA 3I9JA 4N39A 3PXCX 1W48A 5JYBA 1B43A 2VPTA 5EMJA 3RHSA 4ADSG 1BFUA 1LZKA 4DMKA 2Z4TA 3DAHA 4C14A 2HN9A 2BAGA 1APBA 2ZKLA 3DR5A 4Q4AA 5CEFA 2A1IA 2DTDA 3WIBA 2Y3IA 5E1BA 5T8KA 3B52X 2EQAA 1BMFA 2LV8A 3EVAA 4OB6A 3WWDA 2E85A 4DUZB 3LDAA 3OBBA 4CI9A 1O87A 1R8SA 2X22A 2J9YB 2VDOB 3NCHA 1AUXA 2OYSA 1FDTA 2D1QA 4QEKA 4G0VA 3C2QA 1J20A 3DDOA 3GBSA 1AUPA 1ONPA 2OZVA 3M1IA 3O84A 4A27A 1E2PA 2XD4A 5SV2A 4BJHB 6ABPA 4DHWA 1A9XA 3H8JA 1N1EA 1F38A 3V4LA 1BIFA 2EU8A 3DB1A 2BHNA 3O3CA 4MUYA 4WACA 3CH6A 3T06B 4CQMD 1FQKA 2J0SA 4AUMA 1YVUA 1ECLA 4FFBA 4Y6LA 3QU9A 1W76A 3WRXA 3AFIA 4ENQA 4G67A 5DT9A 3FXAA 4MDYA 2FLVA 2DEUA 4M7RA 3B1JA 2F6RA 3LCRA 1PLKA 3LAWA 1LTQA 1K86A 5CBKA 1HLFA 4DRXB 2QVZX 3IB3A 3TB6A 1ECPA 1KHHA 2CVZA 4FLFA 1H66A 3AERA 3IEKA 1B26A 1L7NA 2GPNA 4GOKA 1L8AA 2AXPA 4H2DA 4R2JA 3RWOA 4WY2A 5ED0A 4JZKA 2EGGA 5LM3A 1WJGA 2LP4Y 1IZ0A 1RWPA 2CKMA 1YQEA 2LXNA 3FIUA 3LWDA 1V3QE 3UG6A 2CLHB 2WNSA 3ZWOA 4G01B 1TCBA 1BKDR 2G8LA 3BZWA 4JEMA 4UUNA 3TTYA 1J5XA 1GNRA 2PVCA 3B1FA 4Z54A 4DLVA 2I34A 4W1SA 5C1OA 5M34A 4YS6A 4FI3F 3CIFA 4IEFB 2X9NA 4LK2A 4LMAA 1AQJA 3PFNA 4FSHA 1OYWA 1D6NA 3HFGA 1PL0A 3N5CA 3UOGA 4CEIA 1KJWA 2XEXA 3L07A 2H9IA 1ZK3A 2JVKA 1JDBB 1L4KA 2KJQA 4U3JB 2QZZA 3TQOA 4TS1A 3KR1A 4A26A 5LWQA 1L5NA 3WGKA 1JKXA 1FSFA 4FZ5A 2F64A 1A8PA 2AOTA 1VE7A 2RB5A 4AB1A 1TO1E 4S0XA 3GARA 1DARA 2YV2A 5EMLA 1VCHA 4I4TB 4KXNA 4XPIA 1WXWA 4QYSA 2Q2VA 4RA9A 4B81A 2B36A 1L7EA 3FTFA 2QRVB 3W5HA 1UM9B 2EP8A 3B2NA 3H19A 3DYVA 1XK7A 4BUZA 4Z9XA 3T0IA 1J22A 3KJIA 1YKSA 5D87A 2JJ1A 1XA4A 4A73A 1SUPA 2I99A 2WIDA 2HIAA 3EMKA 2ZPAA 2ZSIA 4OSEA 4MVJM 2M1ZA 4NCKA 3VV3A 4KV7A 1FOEB 1SXJD 2BTQA 4PAGA 3SJZA 3CSUA 3SU8A 5I48A 4Y6QA 1G6OA 1U2RA 2FQYA 3A9TA 3QU4A 3RVMA 2G67A 1P62B 2IUEA 4HDKA 3UMYA 2G36A 2Z98A 3HO8A 3MYYA 1L4UA 3LI2A 4IGAA 4BGDA 3KB8A 3FTQA 5CLLA 2MCFA 3ADOA 2C97A 1PZGA 2X8JA 4CCAA 4KPEC 1PHPA 2WUGA 1S3GA 4L8LA 3KSDO 1LJ8A 3TZHA 2WW8A 2RARA 1H94A 4FKMA 2BP7A 5JPIA 4BEWA 3K9QO 4G5OA 3A14A 2ETVA 3TTTA 3OIVA 3G1WA 3H04A 3U4HA 1WVGA 3JQ9C 3T9FA 3KOZA 3EMDA 1ST2A 1EGMB 9GPBA 4LG1A 4J0QA 3VC1A 1CUUA 3ZWCA 4DIUA 3BICA 4LZAA 1KXZA 3P20A 4FYVA 2ZDHA 4QTTB 2J3DA 2H9AA 2NT3A 3IKJA 3LBHA 5D2CA 1UXJA 1GPNA 3E9MA 2O8VA 2XUPA 1VHQA 2Q5IA 5FJJA 1E9FA 3P7MA 3G5TA 3QPVA 2EYUA 2V5UA 3B3GA 2NSDA 2ZSHA 1I14A 1RJ9B 2I5PO 3FW1A 3NHPA 1A76A 3FBTA 3O92A 3C3KA 3PJGA 4A7PA 4LDRA 4J7XA 2ZAIA 2GK7A 3HL0A 3RS9A 3VSDA 3WSTA 3IQHX 2JGKA 1NULA 4GOOD 5EQTA 1CUYA 1QO0A 1L7QA 4WA8A 5AXBA 2V54A 3WGYA 1OTYA 5CCEA 4N7JA 1GEEA 4C87A 1Z0JA 3F8WA 1NVAA 4M22A 5AM1A 5GZ3A 2PWYA 5AW8A 4D4MA 4EGQA 2XOXA 1XWIA 5IKPA 4MVJD 1RWXA 2VATA 4CQJA 4WY5A 2X3YA 1V5GA 1I0LA 1E9CA 2RHLA 2D2EA 4ZEXA 3PUHA 1KHTA 1TF2A 3RANA 2FFAA 3P5BA 4H3KB 5TPZA 3WBJA 3H0CA 3C3PA 3LBIA 3R9IA 1P3DA 5HOEA 4FN4A 2COUA 2GO7A 3B2QA 4I50A 1WZUA 2QPOA 1HKHA 5HKOA 4OQXA 5BR4A 3AM5A 5L7WA 3A9CA 2O9JA 1ZM9A 1DIBA 3NZEA 3PC4A 4IUBS 4RC9A 1WXHA 5G3YA 5HF5A 5IMBA 3WIOA 4CU5A 5KTOA 2F3TA 1D6MA 4DAEA 3DO8A 4O4HF 2A3NA 4QRHA 4RDXA 3U9TA 3C8ZA 1LX6A 4B31A 1S8AA 3L0DA 1SO8A 3DG9A 4NABA 4BTLA 4CQLB 4YR7A 4GSLA 3T5CA 3B6IA 3ZXSA 1X7WA 4X7RA 1YACA 3AVYA 4BNWA 3DEAA 1ULBA 1B8UA 3EASA 3BD8A 2VHXA 3PXXA 1BW9A 4YAEA 3TNDA 3MJDA 1P2TA 5HQ3A 1TM4E 4CT0A 4LNUB 2XRZA 2ZBUA 1SVLA 1UWVA 1FRNA 2X1MA 4A0GA 3ZTTA 2IIPA 2B3TA 1R4NB 3QBEA 4HQNA 4LFBB 1P8JA 4GP6A 4GNRA 5B1DA 3RQSA 1B2LA 1YKGA 1BS1A 2PY6A 3MMNA 3DOUA 2UYHA 3WP1B 3AX6A 1EUZA 3QF7A 2K2QB 3QJGA 5GONF 2J41A 1KPGA 4JIGA 4BE7B 2B6HA 2R62A 4YMLA 1A69A 3HV0A 1Y9EA 3HLKA 3K92A 4DIOA 1DX6A 4F5YA 3QEMB 2HIHA 2WJGA 1KR5A 2UUPA 3LC2O 2G07A 2W2VA 3QJYA 4KQGA 4N5NA 2PG3A 4Q3AA 1D2GA 2PGNA 3T5AA 4XQGA 1BKSB 3FDJA 4BV9A 4BN5A 1D8AA 4Q16A 3RAFC 3VISA 2CV1A 1XZKA 2C9OA 3SOZA 3OP1A 2YMPA 4GGMX 3LPLA 3LRXA 1DO2A 1LLUA 4JP5A 5IDYA 3RUAA 3G02A 3KVNA 2I3DA 4YYEA 3DT6A 4MWSA 1PN3A 2AKYA 4EMBA 3QUCA 5LYJB 1ZD2P 3QKTA 2A67A 4Y6GB 3Q5EA 4YCAA 2J5KA 3RC1A 5BSUA 3D1LA 4NFLA 2R1ZA 3T7KA 1KOJA 1XRJA 3U81A 1VMAA 3QLUA 5TEWA 1ABEA 3L05A 4HRVA 3DFUA 4J6FA 1G55A 4Z6KA 2EG9A 4NFYA 2ORYA 1TADA 1Y4ZA 1XRMA 1DQPA 2XUHA 1R0YA 5AOAA 2B35A 3GVXA 2W11A 1Z2PX 2C2KA 1K63A 4UCXA 2OEPA 4IW3B 2LDXA 2YOFA 3AM4A 4PG7A 4QLOA 4ZQCB 3QPBA 4IZHA 1QU2A 2V7PA 1MQ9A 1RMYA 4KAJA 4EUFA 1I6WA 1P7CA 1RHUA 3QXSA 3LW8A 5A6VA 1Z28A 3NOVA 5LXTA 4B45A 4OGFA 3W04A 3UGKA 3H9EO 2HBQA 4D92A 3TLAA 3R3YA 4I81A 3M6AA 4BLRA 9LDBA 4G97A 3TD2A 1QPZA 1QPGA 4M9QA 2VDUE 5AK6A 2JC3A 1QTNA 3H05A 4MVJA 5L95A 1V4NA 2PBZA 2QX4A 4NBLA 3E9DA 5C8YA 4MHTA 2P6PA 2PS9A 2FPGA 5C3UA 2FW1A 2UZ1A 3O8CA 2ZTUA 4CTMA 3NRBA 1MN6A 2ARKA 3HGTA 3IVRA 1WF6A 4Q3CA 3P0IA 2JLQA 3OZSA 3C8UA 1E9VA 1OKKD 1ZN7A 2G76A 4RTOA 3T3HA 1U9IC 2JD0A 2RC5A 3EQ2A 2QENA 3I28A 3PA6A 1VXOA 1JEAA 1T5BA 1TGVA 2FSVC 3NC4A 2XODA 4GYKA 2XVZA 4RGYA 1IJBA 5BPFA 4XQ0A 1YSCA 2HWXA 3MCWA 2PMCA 2VXCA 4QBHA 1XDWA 3FZGA 2QB5A 3FDZA 1GU0A 2QP4A 3E4DA 1VG9B 2HK6A 5JZSA 1DO0A 4H16A 5HE9A 1ZH4A 3PUWA 1SCDA 1JR2A 4IQ0A 4AZ3B 3ASUA 1MAAA 2R8EA 4IXWA 5EFOA 5BWNA 2C88A 1EPUA 3CX6A 4O4IF 4X8MA 2CVPA 2Q3CA 4UM7A 4LJRA 5EG5A 1P8AA 1R10A 3ZWMA 2EGUA 5CB8A 3L8CA 4ZO4A 1CQXA 3GVIA 2Q1WA 3DPSA 3UJ3X 3OCUA 5KX5F 2VWQA 4H7EA 4AZ0A 2Q9UA 1CEYA 1GZDA 3BMCB 1CSEE 2BD0A 2OCBA 4Q3DA 1HYGA 4QJIA 3GP8A 2C5SA 5FPTA 2PL9A 2CDAA 2I4OA 2HLDA 4EEXA 4MQEB 2CBGA 3LUFA 2YJ4A 2FSUA 2EW2A 2PX5A 3NHZA 4G4GA 4UPDA 5DN6A 3HU5A 4W8GA 4LZWA 3S5UA 3VYVA 3WYCA 1T4BA 3D8RA 2E4WA 4DJTA 4E30A 5L40A 2XZDA 2P9TA 4LE1A 1OC2A 2B7CA 1OLUA 2CW5A 1ML4A 1VKJA 1JLLA 3IV6A 2LNDA 3CNBA 2JK1A 1PR5A 1SKBA 1JPNA 2VSQA 3MSXA 2BSXA 2IPXA 1KRXA 3A4IA 4I36A 3CN9A 4OQDA 1U7WA 3CT4A 2WDPA 4BUCA 1Z6QA 3S1SA 3MMZA 4NYJQ 5DM70 2E1RA 1YMUA 3TM4A 5EKSA 3T52A 3CR3C 2EG5A 3NTOA 1K98A 5DBFA 1ZVVA 4ER6A 4RY9A 3B6KA 3NJ4A 5AI5A 2FPPB 4LMRA 1SXPA 3GJSA 4QIHA 1RYBA 2IZ1A 2XCSB 4UVIA 3UUEA 2QRUA 4DFDA 2NTYC 2WA1A 1LLQA 4O4HB 2G9QA 5E1MA 5F5XA 3RU3A 3V8QA 4JCOA 4O4JF 3VV2A 4EUNA 5BQXA 1BH6A 2VJBA 3EE6A 3RRFA 4DPMA 4BN4A 2WJ4A 5TLSA 4AICA 3DCIA 2ZPTX 3PJDA 4UE3S 3J80A 5K0NA 4ZV4A 2F1HA 3RLFA 4ND5A 1V1RA 1L2TA 1NZFA 1XZLA 3C6KA 3UAYA 1Z15A 4DZTA 1M6VA 4L72A 2MSWA 1ZZEA 2EIXA 3BMQB 1Y8ZA 1E2UA 4RPHA 3ZDXB 2YRXA 4CU2A 4QGSA 3NXKA 2QTAA 4A36A 3PQ6A 1U2TA 3LQ1A 5HF6A 1R8JA 1NV8A 1YDMA 3TAHA 2H1RA 4F45A 1HE1C 2O2EA 1JEJA 1TU0A 2AOTB 3MOIA 4PZ9A 2BONA 2EJBA 2O1EA 2JI6A 4NBWA 3ZU6A 1N3LA 1A7JA 2XT0A 4QUDA 2NU9A 1OFUA 3EGIA 4GMXA 1HT0A 3MTIA 4C4ZA 3T15A 5ABPA 4LS3A 2BJWA 2WIGA 5CJ2A 1YDGA 1NBMA 2D3TA 3TW0A 4ZCSA 3GCDA 5K0CA 1OAOC 3T95A 2QPLA 5BVGA 3LXUX 4U9HS 2HPVA 4YMHA 4N5DA 4JK3A 1MD9A 5C1BA 3I6QA 2ODEA 1M2VA 1FX0B 4B8YA 4RX1A 5LD2B 1BYUA 3ZH2A 1ITZA 3BGOS 3VYTB 2OAEA 2N1BA 1MJGA 5FTJA 3VAAA 1KZ6A 4R68A 1GNPA 1QFXA 4DCCA 4WXRA 3LV8A 4KE7A 4YJ2B 3BHJA 3VFDA 2SECE 3BXXA 1GUDA 4X1IB 5KC9A 2C9ZA 1M5UA 4YT2A 3TIXB 2H54A 3HVJA 1UF9A 4UTVA 3F73A 1Q1ZA 4D43A 3FVRA 3ASZA 3UXMA 3H5TA 4E0BA 3L82B 3NONA 5JAMA 2NZXA 4LYAA 4OLAA 2VYFA 3QXCA 2JGLA 1VQ1A 1C8LA 3D9QX 4V0RA 1NYLA 1L9KA 4FEYA 4HLQB 2QD4A 2W93A 2ZYTX 4JBIA 3T7AA 1DBWA 3NTRA 4NBKA 5IT4A 3JAMA 4GFDA 2O2HA 1IQRA 4QYIB 2JIQA 3K9GA 1GCAA