4F4UA

The bicyclic intermediate structure provides insights into the desuccinylation mechanism of sirt5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
266
Chain Sequence
b'TARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent lysine demalonylase and desuccinylase sirtuin-
publication title The Bicyclic Intermediate Structure Provides Insights into the Desuccinylation Mechanism of Human Sirtuin 5 (SIRT5)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 88
structure length 266
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4f4uA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4f4uA01
1O96B 4FVTA 1JSCA 2JLCA 1ZPDA 1M2KA 1M2GA 2Q29A 4MPPA 1S5PA 3U3DA 4JU9A 2VBFA 3IAFA 1EFPA 1YHZA 1Q14A 2C31A 4G1CA 2JI9A 4JT8A 1V5EA 5K3SA 2DJIA 4K9MA 3HWX1 4FZ3A 4HDAA 5K2OA 4QPZA 4Y6OA 4UTVA 4TWIA 4JUCA 2VBIA 2H2HA 4QELA 2Q27A 4BN4A 4UTRA 2AG1A 1OZHA 3EY9A 5FYQA 4UU7A 4GM4A 3IAEA 1DJLA 2Q5QA 4BVBA 4JUAA 3ZGVA 2Q28A 4UTZA 4O8ZA 4GPEA 4HD8A 2OO5C 5EJMA 4C78A 4JD5A 2A1UA 1YTLA 4BV2A 1NM5C 3D81A 1U2DC 2WVAA 1U2GC 1V5GA 1POWA 2FRDC 1J8FA 1PTJC 1U31A 4IF6A 2EZ8A 1UPCA 5BWLA 5D7NA 1PYDA 1O97D 2Q5LA 4RJIA 4RMGA 2VBGA 2PGNA 2JI7A 5EJ6A 4COKA 4JUDX 4GG1A 5FEMA 2JIBA 4UTXA 1EFVA 2H4FA 1V5FA 4X3OA 3ZG6A 2H4JA 4MPJA 4BV3A 4JUBA 1MCZA 1PT9A 1YC5A 4RJKA 4JSRA 3FZNA 1YI1A 4BVGA 2FN3A 4KGDA 5MFPA 3U31A 2NYRA 3F6EX 1Z8NA 1T9CA 2JI8A 5MFZA 2H2GA 5DGTA 2VK4A 5DGDA 4Y6QA 4FEEA 4JT9A 3RIYA 5BWNA 1PI3A 1U28C 4K9OA 4X3PA 3ZGOA 1D4OA 2PGOA 2PANA 4BVFA 3RIGA 5K6RA 4RJJA 3GLRA 2Q5JA 1M2NA 4L3OA 2HJHA 1M2JA 3D4BA 4FEGA 4IAOA 4TWJA 1S7GA 5EJ5A 3PDHA 3PKJA 1Q1AA 2VJYA 2JLAA 3F6BX 2VK1A 4RMIA 5K6TA 4D5GA 4JU8A 3FLMA 1PNQA 1OVMA 1YI0A 3HWWA 4GP9A 2OORC 1QPBA 1N0HA 2B4YA 3K35A 2IHVA 4JUFA 4UU8A 4R8MA 1SZDA 3LQ1A 4IG9A 2WVGA 1PNOA 1Q6ZA 2H2IA 4F4UA 1E3TA 1YC2A 1MA3A 4V1CB 4MQ5A 3GLTA 1XLTC 3JR3A 1YBHA 1OZGA 2H59A 2W93A 1M2HA 4RMJA 2FSVC 4RMHA 4MPRA 4F56A 1Y9DA 1UPBA 2Q5OA 4ZZIA 1YHYA 4ZP1A 4I5IA 2EZ4A 3CLTD 4J16C 2FR8C 5MGNA 4L2IA 4UUAA 4Q9DA 2V3WA 3CLRD 2JI6A 5IMSA 2EZ9A 3EA4A 2QQFA 1ICIA 4C7BA 4V1CI 2UZ1B 1OZFA 2VK8A 2BRUC 2IHTA 4K9KA 2EZUA 4K9LA 4BN5A 2WVHA 2EZTA 4UTNA 3CLSD 2AG0A 2QQGA 3CLUD 3D7KA 5EJAA 2OD9A 5MF6A 3EYAA 3PKIA 4BVHA 4K9QA 2IHUA 4V1CA 4Y6LA 5EJ7A 1T9AA 1SZCA 5BWOA 4BUZA 2H2FA 1T9DA 4J1TC 4MZXA 1PVDA 5EJ8A 1T9BA 2OD7A 3CF4G 5AHKA 2H4HA 3OE1A 5EJ4A 4GM1A 1PO7A 3FSJX 4UUBA 5DEIA 4D5EA 1POXA 2A1TR 1Q17A 4K9PA 5EJ9A 4QQ8A 4GM0A 1HZZC 2NXWA 4KPUA 1YNOA 3E9YA 3JWPA 4K9NA 4KXQA 4BVEA 2H2DA 2UZ1A 2X7JA 1BFDA 2FWNA 2OD2A 3GLUA 1UPAA 3GLSA
chains in the Genus database with same CATH superfamily
1RXVA 1Z2AA 3BB4A 4WUTA 5DMHA 3KYDA 1CYDA 3D8BA 6GPBA 1QPGA 3L8EA 4O4JF 3AERA 1RLMA 3TLKA 3G6WA 4DKJA 2LWIA 1GGMA 2ZOSA 2X23A 3SFVA 5ILQA 1T3TA 2IYXA 4LY9A 4V0QA 4EG0A 5GP1A 1PR6A 4H7FA 4ZDJA 1M2GA 5AUNB 4W8GA 1UK8A 1P9OA 4U2FA 4WLEA 2M6SA 4BRWA 3E9ZA 4AKHA 3WKDA 2C2MA 3T41A 2GD6A 1AO3A 1RYFA 2XHEA 1L4HA 4G5FA 3TB6A 3GQVA 4F3YA 4W99A 2B82A 4YUZA 5CB0A 2I8LA 3HVJA 2VJLA 2H9IA 2PZKA 3RU3A 4HS9A 4DXDA 3NT4A 1UP4A 2GFHA 1I32A 3ZTWA 1YHZA 1VG9B 4FYPA 3RAFC 1MFZA 4M1EA 3VZDA 1PKXA 1VXOA 3KSMA 4II2A 1IMOA 3A04A 3KQVA 3WSTA 2ZR8A 3EHDA 3TIVA 3H2BA 2I9PA 2I65A 3BXFA 1H2HA 1K7FB 1PX2A 2XVXA 4PCUA 2ZEJA 1AKWA 1M54A 1P7YA 1TA4A 4IIFA 4CGYA 5F7JA 1NOKA 1A27A 3BWCA 2G28A 1UT8A 2ZYWX 1MH1A 2R8OA 3ICWA 1Z62A 4KUHA 5HMLA 5IAGA 3ONDA 3WMRA 3ZTTA 3QPUA 4YJ3B 4CMEA 3AL0C 3ADBA 3KZNA 1KDTA 1YFKA 3WJ2A 4S24A 2YOFA 2C3UA 4MVJE 4UHCA 4WXYB 1WU8A 3T7KA 1T5OA 3TR6A 2XI4A 3KR0A 5D3MA 1XWWA 1XZ8A 2XD4A 3P94A 4RWZA 2WV7A 4Q4JB 4E2FA 2PUJA 4RNDB 4S0XA 2ZQ5A 1NW4A 4EITA 1AF4A 5FUQA 3GRAA 2QN7A 2G9UA 4UZEA 4GX5A 3DL4A 3HR7A 3VPSA 5HP4A 3TX2A 3TZEA 3DXXA 1QCDA 4IJ5A 4V24A 3TTXA 3UXMA 1TK9A 2WV9A 4FCWA 2VJPA 1BC5A 1ZRHA 3WXBA 4R3NA 1ULSA 4K28A 4I08A 3HLYA 4UKDA 5A4IS 2HPVA 3MQFA 3DPSA 2PZEA 1XDZA 5K05A 3NMUF 2XDYA 2PCJA 2VYQA 1FXWA 2B7LA 4LGVA 1A8PA 3ZWNA 1G8MA 4CU2A 3OX3A 3F74A 1T5SA 3WVNA 2GOYA 4FUQA 4NE2A 4RWEA 1MRSA 2BFOA 2RKWA 3HQ4O 3ZD7A 1HEYA 1U65A 1Z88A 2CL7X 1JMVA 2X9QA 2Q28A 3CZCA 3M70A 3HL0A 3JWJA 3RJ9A 2HMVA 3GH3A 4A26A 2O8CB 2YWCA 2ZBPA 5C7OO 1JFFA 3ELDA 3FMVA 4NG5A 3UYLA 5CA1F 1NXQA 2B8EA 4XVUA 3TRFA 4BZQA 5AW5A 2NG1A 2Y2VA 4PHGA 4JD5A 5MN6A 3GRFA 3AWDA 2IP4A 4FCTA 2RGNA 1X7GA 2FQYA 3MWGA 3EGCA 2YXBA 3PF9A 4CTOA 1FTGA 1SVMA 1DINA 1U2GC 2DUUA 2WVAA 3OQPA 4MYDA 2CFSA 1BH6A 4YAEA 1NUPA 3FG9A 4YMSA 5DYNA 5LA6F 4UHEA 2NU8A 2PIAA 3KAQA 4LYJA 2UZ4A 2ZJ1A 3VTAA 1PTJC 2G8LA 3LHDA 3VR6D 4DAEA 1R3DA 5K4HA 2P5TB 2D5AA 4ZEXA 4P5EA 1MOSA 2I55A 3KLNA 3PKZA 4O4HA 1GZDA 5AWFC 1ETHA 3DE0X 5KJ1A 4CRWB 3TO5A 3I2YX 4PC2A 4RU1A 1BCSA 4MUMA 1JVBA 3UWOA 5IAAA 4TZKA 5HIJA 4DNFA 1JX6A 2FWPA 3WC4A 1IXYA 4D4KA 3EULA 1C9EA 1NVUQ 3ZHOA 3O95A 4GQBA 1G2PA 2F43A 3L1KA 4U63A 4ZALA 4CG0A 1G9XA 2O3SA 3JQ7A 4XWGA 1XMXA 4PAQA 3SBOA 1SVUA 2EKQA 2JIRA 2XITA 1IBMB 3QXSA 2J4CA 4QVKA 1W85A 3EDQA 5ITWA 5J4HA 3H7IA 3ZBTA 2JC3A 1Z8DA 3QRWA 3ZCSA 3Q5GA 4TVSA 1J00A 1R0YA 2FU5C 4KR2A 3PJGA 1YZFA 3K2IA 3RKSA 3RM3A 1KQFA 2V0GA 2GH1A 2JFBA 4U9HS 3ZIDA 4F3CA 4REOA 4L72A 4RDXA 1J22A 1WQ1R 3CR8A 1LS1A 3NIDB 1NVAA 2ZRMA 4LI3X 5GGYA 2FHSA 2IUTA 3IMKA 1BS1A 4PZCA 1A50B 1P8JA 2ZB7A 3FMIA 4LY3A 4DRXB 1OASA 1ZD3A 2R8EA 5CDFA 2RHTA 3C6BA 2VP5A 4WCVA 3FGNA 3LBFA 4Y2XA 3UK1A 2ZVDA 3VH3A 2IC5A 1NSTA 2FN3A 4KQ9A 1P2BA 1RM5A 3DR5A 3PS9A 1XNRB 1LV8A 1XD2A 1QV9A 3B2EA 4LWOA 3CIFA 1EM6A 2FX5A 2OBXA 2PJDA 2KQUA 3BWDD 1D3AA 1ISPA 2QL6A 3IQIX 3KPJA 3LPMA 4GPBA 4KIFA 4EMUA 5JD5A 2HXSA 3AFIA 3JQ8B 1SUSA 2J6BA 5BN5B 4BGDA 3OEED 1SVIA 2XUZA 4DT1A 3UMCA 3AX6A 1FJGB 2PUCA 2AA3A 2LGJA 1P3DA 3E9CA 1ECPA 5L51A 5F98A 2WTEA 3Q3CA 1RQGA 1W76A 2A0YA 2DG2A 2I29A 3E9DA 1TVEA 3H17A 3CTMA 3H9EO 4FKMA 5HG0A 3TQOA 2OK7A 4C7KA 5I51A 2VTVA 3M2TA 1SZPA 2WE8A 1TVCA 4J2OA 1RJ9A 1LQ2A 1BDJA 1IY9A 1Y1SA 2RBEA 3R3XA 3UWPA 2OXCA 3NHLA 5ED0A 3SX2A 3KQYA 4CQLB 2PZBA 3HB4X 3NNNA 3DP7A 3F9IA 2XE4A 3A6LA 4G01B 3EE6A 4GMHA 2HMTA 4GLJA 1PBNA 3VBCA 4RY9A 5JAPA 2X6TA 5AOBA 3K8ZA 4NCJA 4BB6A 3OCVA 4DLLA 2FDRA 4F8EA 2R62A 3ZJUA 1XRQA 3NNSA 4IIXA 4MW2A 3M33A 2JFVA 4UM8B 3T4EA 2CEAA 2XUIA 1UPTA 2HQSA 2MOKA 3G1WA 3OI7A 1R50A 2JB9A 1CR6A 4NMHA 3PQ2A 3STVA 3WLOA 1XXHA 1N2JA 4IVPA 2OYSA 2V7EA 4R98A 2XDAA 4C3ZA 5B12A 1EK5A 3I4FA 5BR7A 4QVGA 2BIFA 5CDTA 5JSQA 4IZIA 3QX7A 5CFPA 2D5LA 3PBKA 3NV7A 1Z15A 3R40A 4F3TA 2BCEA 2JI4A 1XMJA 2NT4A 3RF6A 3U1TA 3OJ0A 2A1TS 1APBA 3PGA1 5A4JA 2PD3A 3PB3A 4KITB 1WXIA 3DTYA 3GYBA 1FP7A 2JCXA 3P2JA 4KE6A 4KGZA 4X1YB 5EIOA 4F1JA 5IJ9B 2O5VA 2I54A 3AK4A 1FNNA 4HXEB 3D0RA 5AOVA 3C39A 4JI3B 3KB1A 4N0QA 5F21A 4M88A 1Y4SA 3KEFA 4PO8A 1A3CA 3I6ZA 4R1LA 3PNYA 4EY6A 1CZRA 3URKA 1HFJA 3SZRA 3DD5A 3TFQA 5AKHA 2AX4A 2QJFA 3L8MA 1NU8A 3FWHA 3HP4A 4YECA 3CUVA 3E81A 3SC2B 1TEXA 2UYCA 3AHCA 2IDJA 2EFJA 1J5PA 2XUHA 1WD7A 1V37A 4EM6A 2P0YA 5BURA 3JVVA 3CCCA 2FRXA 1PNTA 5GM2A 2IIBA 5K0JA 3G8AA 2VH2A 1R8QA 2VYND 1P1HA 4UU0A 5B37A 1XNQB 3K0SA 3HU3A 4EPWA 2JGNA 2RGAA 4TTTS 4D5GA 3RJMA 3NH9A 1HT0A 1DG3A 3GUZA 1T5BA 2C3YA 3L02A 2O4CA 2XWSA 3VR3D 4HC4A 4CKEA 1T3SA 4J9UE 1UBFA 1YFZA 3WGNA 1KK0A 1W4BA 4MDEA 5EYPA 5ICGA 1KC1A 2OQRA 1S9HA 1KMCA 2C5GA 2IW3A 3PE4A 3SBDA 1XKTA 3WYGA 2D7JA 5DOVA 5EZSA 1FNSA 3S2IA 2WQ6A 1CY4A 1EXWA 4YWJA 4J3NA 1JMKC 1N5MA 2PX3A 4LF5B 1KO7A 1LRKA 2G3YA 3EIOA 2PT6A 4IG9A 4Y2RA 1H65A 2WHEA 5AK4A 3SN6A 4D7AA 4I9HA 1IB6A 2D1TA 5FTLA 3RIMA 1WSDA 5LOVF 1HMYA 4IICA 5A5DA 3JD3A 3EHEA 4PG5A 4LZPA 1YMUA 3K72B 3PJEA 3WQHA 2OAGA 3TTVA 4IWNA 5BY2A 5C4IA 2NSJA 3UV7A 2D5IA 2BLNA 4GNKA 3VV2A 1G1AA 4CEJB 4GFDA 4I7EA 5LXTA 1KI8A 2EHDA 1SU7A 2C2KA 5IPFA 4PBTA 4W5TA 1NOIA 4EOGA 3H6HA 2BEVB 4OQYA 4P3PA 5KTPA 3GZNA 1I8TA 1A5SB 3NUGA 3LDHA 4ZZ3A 2FW6A 4CM8A 3W2IA 4W6ZA 1DADA 3QE3A 3W9SA 5DGCA 2QRNA 4DUGA 1JVSA 5G3ZA 2PSEA 2L17A 1K7YA 2C2HA 1HPLA 3BD7A 1T4MA 1VFPA 2PEYA 3KJFA 3LY7A 3OOSA 1W48A 3OFVA 4QTUB 4UU1A 3RSSA 3UTCA 3IB6A 5C52B 2VDKB 4DBZA 4WFQA 3GPCA 2FR8C 2WTAA 1S1MA 1ZK4A 1EBBA 2APJA 4UPVA 1JDZA 5K4GA 5IN4A 1OGJA 5KJCA 1J06A 1P9LA 4DZTA 4LF6B 5IJZA 3NU1A 1DBWA 5TC4A 3R9XB 5F2EA 4TV9B 1GA4A 3CLRD 2F1RA 1FQOA 3LG2A 1OH8A 5LB2A 4YAIA 5JALA 1KBZA 1VZ3A 2EIHA 2UKDA 4NNOA 3LUBA 2P78A 3EIWA 4Q1EA 3K6SA 3RAGA 3RBVA 4MW4A 2JCGA 1EUZA 2GR9A 2BGTA 4XB1A 4JITA 5JD3A 4CTJA 5J4LA 3OQVA 1OLSA 1CDEA 3ZK8A 5GY7A 3UJHA 1H2ZA 1SEVA 3OP4A 1YGPA 1PFYA 4GZ3A 4JP5A 4U7GA 4TSRA 3W8NA 3QXCA 1TTQB 2I2AA 2PUTA 3GWZA 4Q02A 3ECSA 1BE6A 3HKDB 3F6SA 2OORA 2R84A 2WDZA 3PUKA 4MWZA 3REGA 1AQJA 2C5BA 4JJ4A 5ES4B 4UTNA 3UJDA 4X7RA 2GVNA 1GPNA 1L8OA 2ID4A 1E2HA 2IDKA 2VA8A 3MSXA 3QLJA 3ILXA 1NQXA 1TUEA 2QMOA 2YJGA 3O8OB 4GYKA 4I5GA 3W8FA 4F06A 1WPXA 4RTKA 2YHIB 4JEUA 4RKYA 3QYFA 1I2CA 2WB2A 5JZOA 2D5CA 3VGJA 4AMVA 2ZBVA 1AXGA 1KY2A 5CEEA 2P9JA 4WJKB 5L7WA 4F72A 3T7IA 1IUKA 2W6PA 1LDBA 3V4PB 1VRCA 3UQYS 4UM9B 4QPDA 4WZAA 2B8JA 2BFFB 1QQAA 1KY5A 4R0MA 5JNTA 1UFQA 4F21A 1EM8B 1AKVA 1DB3A 3KVVA 3P71T 2MU1A 1RWWA 1T9AA 1EX9A 1W1WA 1B2RA 3LUFA 4NU0A 4V39A 4L6AA 4ADSG 4B73A 2H2FA 2RG7A 4M83A 2ERCA 3NUQA 4HFRA 4N5HX 1XRRA 4E0BA 4Q93A 1RYMA 2RE8A 1U9ZA 3C85A 3L1UA 4KWEA 4TUYA 2E55A 4G0XA 2QPLA 4C87A 1HE4A 3BULA 1YJXA 1M76A 1DDOA 1QB8A 1U9IC 5CURA 3RSFA 4KO2S 1PJCA 1TVKB 5D5QA 3O73A 3DUFA 2E4WA 2FSVA 1SXJD 5K8IA 5B3JA 1AX9A 1E9CA 4NMMA 4K8RB 4C1NA 1POXA 4TLCA 3INTA 5JLJA 4G0WA 5JDIA 3KE9A 4Q4LA 4F2WA 5JY6A 1E0DA 2AH5A 3FPFA 5EWMA 2NQ2C 2GAIA 1ZLYA 2PWBA 3ONVA 2QG9A 3FVWA 3HM2A 2KBFA 3LFTA 4XGRA 5KO2A 1G66A 3DMNA 1FNDA 2F1OA 1N4DA 3WWPA 4MV1A 2A67A 4FS3A 1QQ6A 5DI3B 1W2HA 4D8TA 3KJHA 5JXGA 2HCTA 1CIPA 2QTAA 3OT1A 4ZAYA 4KXVA 4KQMA 4OFWA 2GN0A 4NBRA 1NWCA 5KQRA 2XEXA 3K2BA 5K0NA 1C8KA 1U1DA 1TA0A 2VDUE 3R6TA 1DL5A 1H9AA 1QLJA 3D8RA 4H1TA 5J40A 1UUFA 2EERA 4BASA 1EX7A 3LJKA 3BN3A 4A10A 4PLCA 3P8ZA 3IP5A 1QE0A 2LIPA 1SOMA 1PEDA 2QGNA 4R1PA 5F76A 5DSXA 6CHYA 2WKQA 3QY9A 4N54A 5FL3A 2GT1A 3Q7EA 4F5DA 4MKGA 1ZBQA 1PF7E 3GLKA 3HCNA 4CI9A 1NNSA 1UJ6A 5CM8B 5JWRA 3TBHA 1KDOA 3IJPA 3QY0A 1WWKA 4MJLA 4R6WA 2FRVA 1GGHA 2B7CA 3GJZA 2EWVA 1M1UA 2NPIA 2FOXA 3QWHA 3TOVA 1VPWA 1WHTA 2DQ4A 2Z5GA 3PFBA 2I3ZA 3BK7A 4MWSA 3AESB 2Q2WA 4NOLA 3ZE8A 4BNJA 1NNLA 2Z1DA 3C97A 4IILA 3QVKA 2OV2A 2QI9F 4EARA 3TIGA 5I4IA 4KR7A 1JWBB 1N2XA 1M2KA 2ZREA 1I4EB 1I4WA 4ZVKA 4YUVA 1N1DA 2VJOA 3GUHA 4GMFA 4B0PA 2Q07A 2D1RA 1VGRA 3RUCA 3GAMA 4YXWD 1M1YA 3U1VA 4Y2SA 5JYDA 4JU9A 4DNQA 2P9BA 1RQNA 4E46A 1UPFA 4M0PA 1MP0A 4LF9B 5C35A 5HQ3A 2QN9A 3K1AA 4BAUA 1BO6A 5BV2P 1N57A 2IZZA 1Z0UA 2L2QA 4TZTA 5DRTA 3LH5A 3R9KA 1LD3A 3RTCA 1EU1A 4JYZA 2YNMD 4QPNA 3STWA 4CQMA 1KWGA 1KYIA 3ISTA 1RIFA 1CZHA 2CXXA 5JEEA 1TFUA 4IQ0A 5DK6A 4QPZA 2PXCA 5DTQA 1SY7A 5LWHA 4PO9A 1JIQA 4W5QA 2Q9CA 2HREA 1ZI8A 2VKTA 4LUCA 4UBOA 1XVIA 1PE0A 4UBKA 4Z2AA 4YA6A 4OQZA 3G9UA 1F8UA 2ATCA 5GVSA 1SC9A 2BD0A 4BDSA 1US8B 4Y0VA 3TZ6A 4DQXA 10MHA 3WHIA 3HBFA 3SZUA 3LBNA 1DTWB 3KR2A 3BA1A 4ZI7F 2Q27A 1GUAA 4FZRA 4RPGA 3V3KA 1ZM4A 2MJLA 4ZT4A 3WIBA 1PHPA 4HZUA 2IBMA 5DX8A 2V4MA 4EY7A 3K4PA 5LIRA 2FP4B 1LLDA 2CDBA 1T3ZA 4YMTA 3JXEA 2LXNA 1Y9AA 4FB4A 2NO9A 1KI2A 4HDKB 4LZZA 1XVLA 3M4YA 1MNQA 4ZODA 5SYAA 4OI0A 1XCLA 3BRWD 1Z4QA 3CF2A 4I46A 2QY9A 1N9KA 1GLVA 1RBZA 4QIHA 1EFUA 4QNNA 3F2IA 3LF1A 3BMNA 3J7AC 1AUQA 4CLOA 2I33A 1K5GA 4GM4A 5DP1A 5MN4A 5JZ9A 4DQVA 1QBGA 5BYKA 5CFRA 1N3LA 2Q3JA 3F8SA 2J9FB 2LBPA 1ISJA 3CH7A 3PCTA 2SHKA 1NBME 4OHOA 4YO7A 5FTNA 3OJXA 3DO8A 3D6UA 4CL0A 4D0NA 3HU5A 4UM7A 2F8SA 1U7HA 1ORVA 1JI3A 4OB6A 1TB4A 1N36B 4QLBA 4C4PA 3NIGB 3RBAA 3BM5A 4JLAA 1RHQA 4KAAA 5JO0A 3JZMA 4GPEA 4GRIA 4LBYA 4KO8A 1JR3D 2OO5C 3L4BA 3GZJA 3ZD6A 3HFJA 4BE9A 3FRJA 4BMCA 3L7KA 1D7AA 4E5PA 2DECA 2PAFA 3VR4H 3Q8XB 1MHTA 2ERXA 1AGXA 1I7PA 4IH9A 4MIEA 2PX6A 2EW1A 3IMFA 3EQ8A 4Z1MA 1U0TA 2C42A 2WUEA 2QGFA 5J59A 3NM6B 4RTSA 4C01A 4KSBA 3ZS9A 2JH3A 2ZBEA 4MS1A 1BW9A 1UKBA 2WM9B 3CJTA 5L3ZA 2YS6A 4ALLA 2F1HA 1C3OA 4Q3AA 4QTXA 4LQCA 1DEHA 1AOXA 2B6HA 4KXYA 3STUA 3NHAA 4XIFA 3ROZA 4W1PA 3T3EA 1U7WA 3BORA 1FVOA 3UAXA 1R6UA 4EYGA 4F1WA 2QLLA 4P1ZA 2AJCA 1TQ2A 3GIWA 1QTIA 5CJPA 4YHBA 3C6YA 1C1DA 1JFVA 2IOYA 4PRKA 5K0FA 1PW7A 2EV9A 3V55A 1WKCA 4I1IA 3GCWA 2CJYA 4JQSA 4F85A 2A4MA 5EFOA 2VUSA 1QOPB 5ADHA 4OYHA 2DPMA 3E1GA 2O0MA 3IV9A 3NEJA 4C4XA 1PQUA 1FXUA 2RJOA 3DOIA 4HUTA 2BKUA 3FMPB 1O7JA 3GLVA 2PGNA 4X7MA 3U3JA 4E51A 2J4DA 4I5EA 3ZIAA 4Y7CA 5FLEX 1O2DA 3EXAA 3EDYA 1OKKA 4OQDA 1K6IA 5A05A 4DG8A 4RNCA 4EVSA 1IHOA 1IY0A 1UOPA 3I09A 4JB2A 1M2OA 1TEVA 1U0SY 2AUTA 1ZUHA 3C3XA 1QVWA 1ABEA 1DO2A 1OLXA 3CWCA 3NHUA 4G0PA 4HAIA 5EWLA 2GNAA 1OH5A 2PH1A 1TO6A 4X90A 4M8NE 4G5QA 3RVOA 2XCUA 3MNFA 1IYZA 2QM3A 2ZZKA 4BCBA 1NI4A 5DW3A 4WEQA 1DO0A 1WNTA 2M6LA 3A9VA 3B7GA 3BXXA 6REQB 4BC1A 1DMRA 1EWYA 1PT9A 3FNFA 2I6XA 5C8DA 4MW9A 2CE7A 1T0HB 4LV5B 2VJAA 2P2GA 1AXEA 4NY1A 3A9TA 1Z16A 2PHZA 3KUCA 4KI7A 2FDXA 5ALTA 1OYYA 3VYVA 4RF4A 3ON5A 3RU2A 1M7HA 4FHZA 4HHEA 3DA8A 1XKXA 1R5OA 4B71A 5B64A 1L5WA 3FZGA 2VQ6A 3UMJA 2IH2A 1QS0B 4D45A 1DKNA 2W8BB 3ECCA 2BFDB 1N8KA 3D1JA 4Z4IA 3ASZA 1EQ2A 1H8ED 1RWMA 1VYVA 3Q2KA 4RD4A 3UUGA 4WNIA 2FZWA 2GMWA 1FYEA 1SBZA 1YCGA 4HLQB 1RT9A 4IDGA 4JDPA 5BWMA 2RGXA 1VL6A 4IUYA 3GROA 2XF2A 4E30A 3KPUA 4ZOAA 4WOBA 5EY5B 1AA6A 1CUZA 2Z1NA 2HQBA 2VK4A 3PTLA 4DWWA 1ZMTA 4F6LA 4KDRA 1IZZA 2O7NA 2NNLD 4V02A 3FYDA 3HCCA 4V0RA 3K71B 3RS9A 3KQNA 1KSFX 4U2EA 3MGBA 2BMEA 3NATA 4CWAA 1U2GA 1GYPA 1YZGA 2I3AA 4HNAA 3S1LA 1QORA 4XPIA 3DOJA 1Q0QA 2ZBDA 1L8LA 5CLGA 1DBIA 4B6PA 4B75A 4MNTA 1LK5A 3MWDB 4BZWA 2Q1YA 1IUNA 1H23A 3MWFA 4IOLA 2GKSA 4OP3A 3W1VA 3KEQA 1DIAA 3A6ZA 4AK9A 4G5SA 1VDMA 2H5LA 3L0CA 2CT8A 4AUMA 2YOHA 3U49A 3W5UA 2GJ4A 3MJDA 3PHCA 3IALA 3K9HA 5E6UA 2LDBA 4ZVMA 5JARA 3N7AA 5JC1A 1G9SA 1NXOA 2VHJA 3I1FA 4DV4B 2V8OA 1IHDA 2X58A 1Q3KA 1LBIA 3I6QA 4XSGA 4M60A 1ZN2A 4ARAA 4EFLA 2XYVA 4O2LA 1U02A 2VSFA 3QE4A 4LFCB 621PA 3CB4A 4DV3B 4B35A 2VQSA 5L95A 1TI7A 3LWDA 4M2LA 3UA3A 2BFCA 1I24A 4PYQA 4G4IA 4TN1A 1GKKA 3SM3A 2VRNA 4LS3A 3MIIA 4MEJA 2IY8A 2AE2A 1TQHA 2I9KA 2IUUA 4D9NA 3PX7A 3ZBQA 1Y6ZA 2NWQA 2O8EB 3SY8A 3SVZA 5J4YA 5KNBA 1GLNA 3HUDA 1M2JA 3CCBA 4P0QB 3LBIA 1CQZA 3RSQA 3WL5A 1T8SA 2XGMA 3KJEA 5HRCA 3F3YA 3KM0A 3I8SA 5JYCA 1YUMA 3MTBA 4G1FA 3VH4A 4J6FA 3W3ZB 2VTBA 2BOVA 5EZYA 3ZWDA 4UJ5A 5TS3A 4YYEA 2HWYA 3SQNA 1O95D 1P4GA 3B5EA 4LBVA 4HV4A 3FMFA 3DZCA 4IP0A 4QQFA 1KP3A 5FKJA 1TYDE 2VN8A 2JAUA 2AWOA 1UC4B 1THZA 1WUHS 3I05A 4XGQA 5B7GA 3W3AH 1VSUA 2A0FA 2X0JA 1DRKA 2WZBA 3QXGA 4FMCF 3QX3A 1IPEA 7YASA 5E4TA 1P1IA 3AM5A 4B82A 4N0PA 4OP2A 1JAHA 1SUAA 1WP4A 4GYYA 5JS2A 3HNOA 1NX6A 3OZFA 5IH7A 1X86B 4DBLE 3SR3A 2OG2A 2PSDA 3NTRA 2WLTA 3OHPA 4HRAA 1TJYA 1KSJA 4LE0A 3GDGA 4RFVA 3LP6A 1SUEA 1I5RA 3T1QA 1XHLA 1D4FA 1SUIA 4RFSA 3LCJA 1RXSA 1H94A 2OCBA 3C5CA 4Q9KA 1E63A 3THYA 4WGFA 2IPLA 5IVIA 4EJSB 2IYYA 5HOQA 2YZMA 4E2XA 3TXXA 1TCAA 1FY2A 2VF5X 1C1XB 3BD8A 3WHPA 2VCYA 3NHWA 2CV2A 3V8NA 2FUEA 4RIIA 5KNCH 2HPHA 1SCUA 3DVQX 2Q99A 1V8OA 1W4ZA 1PNOA 3I9MA 5JS6A 3FDFA 2B83A 3QF7A 4ZQGA 1W49A 1NVTA 1SIWA 5KINB 2W58A 1U7DA 1Y89A 3SXPA 2JAWA 4GXRA 4P38A 1GL9B 4NMXB 3K09C 2Y92A 5FNVF 1FDVA 2WY2D 3VPCA 3NKFA 5LQKA 2YQ4A 1L4MA 3PG5A 1YQEA 3H4VA 5M04A 4RMJA 1E3WA 1P2SA 1GZ7A 4MX8A 5L3QA 1HDCA 2ISSD 2XR1A 1IRXA 2GHIA 3A0UA 3EIQA 4CMAA 4IO1A 3QG5A 2G77B 1HDGO 1ABFA 2H54A 3DYIA 4MUGA 4XIIA 3S70A 3WLNA 2G08A 1CJKC 1BDBA 1U3DA 3ZHCA 4AJPA 4ZZIA 3VSAA 3N1UA 4N49A 2JGAA 4X0EA 3TRKA 3VSBA 4S05A 3EWNA 3HA3A 1YVRA 2RGCA 1VI2A 4PBSA 2EZ4A 3CZAA 3Q6MA 3WLTA 3G0CA 5K3EA 1D6SA 1W0JA 1IN7A 1EVZA 1GNQA 2B99A 2DPXA 2HMAA 2JA1A 3AXTA 3V9AA 3ELBA 3OU7A 3RCBA 3W5SA 2MTBA 3AVPA 3IQHX 2B1IA 3BREA 3IAAA 4AI6A 2FW9A 3DMPA 4QEKA 2QL7A 4OSPA 1OHHD 5D3KA 1PEYA 2DFDA 2WJIA 3IQWA 1SVLA 2VSOA 3PEFA 3QKSA 3L4SO 4HTFA 4KVGA 4V2IA 1JTEA 4ZC8A 4ZVOA 3RS5A 3SYKA 1ULAA 1NJ6A 1H3FA 1G6Q1 2VQDA 4J7AA 1JR2A 2DR3A 2PL3A 4KR0A 3H9BA 1PJRA 1WABA 2G9VA 1LQTA 1RHJA 1W581 2GZSA 4EDFA 4GIBA 2AC4A 5FUXA 4EMTA 4YPOA 5HPYB 1RAIA 2OPBA 1MIHA 2ZUWA 3IE1A 4FC7A 4KLNA 4ZAXA 5CDHA 1JEQB 2GSWA 2N3ZA 1WZUA 2LDXA 2F3TA 2YASA 3V1KA 4J0HA 1LDNA 3C6MA 2J8ZA 4O2BF 1Q95A 2XUJA 3GRRA 4GZLA 5AK3A 5FTJA 2FKNA 3HB9A 1KJIA 4FI3C 4LZLA 1NFQA 5E3JA 4XWKA 5JD6A 3IURA 3SJUA 3ZU5A 4A8PA 4I6EA 3WYNA 2X9NA 7AT1A 4OD0A 1SCKA 4MZDA 4LRWA 2OZLB 1V95A 1L1FA 5AESA 4JOBA 3HN7A 2JHAA 3ILYA 3MT9A 1HSZA 5DBFA 5K3FA 3BE5A 4RVUA 3SIXA 2D4HA 3LP8A 4A36A 5FJJA 3KKZA 4DV1B 5HFNA 4ZCPA 3TJRA 5LD2C 4XSHA 1XZNA 4MRSA 3GGDA 2Q2VA 2HF9A 2OCAA 3FWKA 4MKRA 2XQKA 4UQOA 2HU7A 3U4QB 2WC1A 3AI3A 4I99A 4UMDA 5AVJA 4W9MC 4K9QA 1KPIA 1R4AA 1UKEA 3JYPA 1TQ4A 4GI1A 2RG1A 4U9UA 4KQGA 4LNUA 1ZKMA 1JAXA 4MKIA 2R6AA 4O2AA 1CUDA 1JQJC 4FGKA 4ILKA 1L4NA 1CKEA 1XZDA 3HKCB 4PBRA 3IVXA 5CLIA 4REQB 3U44A 4P7JA 4RIGA 4UVDA 1JHAA 3DPUA 4HXGA 4HG2A 5B7QA 1J20A 9ABPA 4HDCA 2IITA 4QTTB 4JKOA 3Q12A 3KOYA 1AD2A 1SIBE 2V54A 1MAUA 2QTGA 3QWBA 2KW5A 2OPHA 5BVGB 3V8EA 5L8VA 3S5JA 1B0UA 1U3FA 2JCVA 4IJKA 4Q7JB 2ATIA 1UBNA 4GGOA 3TQFA 4RHEA 4A8JC 1OXMA 1QK3A 1PWZA 2V6FA 2E5FA 4IFTA 4NYMR 1DKLA 1XJ5A 2AG8A 2I7XA 5TQ0A 1XU9A 2Y1EA 1E3DA 3PSHA 1J0DA 1EHCA 1GKLA 4HAWA 3P2OA 1QZXA 2AS0A 1LPPA 2AQIA 2FEWB 4YS6A 3CVXA 3OPYA 3R41A 3SHOA 1CUEA 2O7VA 5EQFA 2FR8A 4GZ6A 4TMVA 3CN7A 2YXPX 2ZBUA 3MCAA 1S2GA 1G18A 4NESA 2FE4A 4G8JA 2YIDA 4NABA 3SE7A 1USUA 2HADA 1Q2XA 1OROA 4AJOA 3IUMA 1KI9A 2FOIA 3AEKA 1RLJA 5I45A 2BCJQ 4DIUA 4GECA 1JDVA 3D3NA 3LX8A 2YDYA 3M6WA 2H4YA 1S3GA 2C7VA 2PBLA 2VPQA 2IYWA 4NSNA 3TM5A 4B0OA 2IE8A 4ZVNA 1JDNA 2VHQA 3CEMA 4P98A 3NPMA 4DDWA 5CK4A 1PEKE 2VLBA 1LSUA 5AOCA 4YJFA 1ZZEA 1C5KA 2G0AA 3WGYA 4RV5A 3B9BA 4GMGA 5E6SB 3WZ2A 3RS4A 3ZLUA 9GPBA 1P4JA 1KEKA 3RNLA 1U1IA 3ZXXA 1JIXA 1OAOC 4LDQA 1IXSB 4EFKA 4YV2A 3UKDA 2QRQA 4EHFA 5BSTA 1K3FA 4MIOA 3V46A 5KVSA 1Z63A 3CNQS 1DJMA 5CYGA 3W2GA 1HG1A 2EF1A 2AR7A 4B40A 1EUDA 3D59A 5IBQA 4BZPA 4F9EA 1OXVA 1ZCZA 4X8MA 1JQEA 4DM3A 1NXWA 2AUNA 2BKXA 4DCVA 4JXZA 4YUYA 1RRPA 1A0OA 1ADJA 5BNIA 4MUYA 2V97A 3ZDYB 4KACA 3P9QA 1JG4A 3DSRA 3R3UA 5DNUA 1SUFA 1ACLA 1F3OA 3LDFA 1I4TD 3AHGA 4EYEA 3SOZA 1QRSA 2JHGA 4Q9AA 2Z58A 4EYKA 5IDYA 3GPDG 3P5SA 4HDRB 4ZHQA 2QMZA 3MD9A 3CEAA 4FDMA 1NRWA 1P33A 3FCUB 2AZ4A 2XKBA 5CCBA 4FZ3A 1SHLA 3KCNA 1B6SA 1RM4A 4RKEA 3T9CA 3KYJB 4GDMA 1V5IA 3JYOA 1A9PA 1OQAA 1U9IA 3CT4A 3ET5A 2AB0A 3TFOA 3NH6A 2GYVA 4YV7A 2CW5A 5TPWB 1EGQA 2PNJA 4BVKA 1LPSA 1DP4A 4L22A 2ZUUA 2NXNA 2OHFA 1PR2A 4FWBA 1N6RA 1ZISA 3HG7A 4K6FA 2VJQA 1EQAA 2H2HA 2V7XA 2ZB2A 3DV0A 3DC7A 4I4LA 1G2OA 2YWJA 1XF9A 2VFAA 2RFLA 1JZQA 2TMGA 3BH0A 3ZPXA 2J3JA 3UPUA 2XMCA 2V1XA 5DXFA 1M74A 2BR5A 2OFWA 1QPZA 1ZRNA 2V7WA 1NMSA 2G07A 4INAA 1KK1A 4O4JB 3SX0A 1SIOA 5FUWA 2F7SA 5AW7A 5JZMA 1IY1A 1DEKA 3OJEA 3IAM1 2QTNA 3GRYA 4L3WA 2JLVA 2PWAA 3MCWA 2ECKA 1HTTA 5HKLA 4UNRA 3DZIA 1O9GA 1UPXA 1TIPA 4OMFG 1PV2A 3GAZA 3NR2A 4GLOA 1M6YA 1ISSA 1N2HA 3BMXA 2J0UA 3G1TA 3O4JA 3TOSA 2CNKA 3OCZA 1C0PA 1ZVQA 1NXVA 3FRHA 2B4TO 3F98A 4MGIR 1G7RA 3PNLA 3C4VA 1NI5A 3DZKA 3TZQA 1CHDA 3UMMA 4M86A 4IHKA 4EKEA 4OKSA 3S4YA 3GUUA 3KVNA 3I34X 4JK3A 3S0JA 4G5YA 3RFTA 3WWCA 1K4KA 3GJ7A 4BNKA 4WXEA 1UEJA 2V6MA 3X44A 2IBTA 3CKLA 2E4YA 1FXSA 4GXTA 3FOCA 5EJMA 3W3AD 3GQBB 1MB4A 3P9NA 2XUPA 1T25A 2QX9A 4PPNA 3RUAA 3H5WA 4N18A 2YJ6A 1JSXA 3G9QA 1ZCFA 3MT0A 4Q9IA 4WA7A 4H2DA 1HOTA 1M0SA 1QK4A 1EBUA 4H60A 5KDOA 2C98A 1NQTA 3DBHB 2J85A 3OOYA 4JSYA 3MOGA 4Y1RB 1AF7A 1V5GA 2ZUDA 3QYJA 2PGDA 1XZIA 4IUDS 5CYFA 1CBUA 4QDTA 2YUIA 1AHIA 3EGVA 3ZWOA 1QYIA 1BROA 3QBVA 4JL6A 4FOTA 4WKCA 3UOWA 4HT3B 5C32A 2PE5A 2IEYA 3OPVA 4J29A 3ZK9A 2ZSIA 2AMVA 3FDXA 3ZU6A 3TLBA 2AD5A 1QR2A 1O97D 1ZNWA 2NO1A 2HZBA 3ORYA 4MRRA 5E1BA 5KNCD 1Q57A 2YQZA 5ALRA 2C4HA 4E5VA 2Q8QA 5TT0A 3YASA 2VBGA 3P45A 3G7SA 4U0JA 3LHKA 3ETHA 4X97A 1SU4A 3R7NA 1V6SA 3JAWB 1ZIPA 3PV0A 4UMEA 4ZGBA 1I7LA 3LUKA 1UMDA 3OCJA 5CTAA 2XUFA 4RSMA 1YCHA 1PR0A 5ALWA 1JKMA 2BDUA 3L82B 3O8QB 4EGSA 2WMDA 1GV1A 2A0XA 3GFSA 3QLUC 2ZCJA 2GK3A 5BYBA 2R6R1 4RPIA 3FYSA 1SB9A 1K66A 1JDPA 1XHFA 5ELMA 4EHJA 1QV7A 2ECQA 1VA4A 3FSEA 5FOUA 1KAHA 3BIOA 3RRXA 4CTNA 1L4YA 4ZJYA 5J1SB 2E9SA 3ABOB 3AEXA 4TSFA 4S12A 2UVPA 5HZHA 4IHJA 1ODIA 3OEYA 1MABA 4CLRB 1ZC4A 1DNPA 1KYWA 3BFKA 4AYWA 3HKEB 2OB1A 5CLJA 1UBOS 3TLGA 1I0LA 5G41A 4AJNA 4RJKA 5CIYA 4RKFA 1WCWA 3PXAA 4QYWA 4QQKA 4WZ6A 5ERGB 5JVDA 5KYKA 3JQQA 1DUVG 3IT3A 4JVNA 4TTAA 5J9FA 4PS0A 1O03A 2ZUVA 4WHMA 3HN2A 4N5MA 5FIUA 4BLVA 3W6OA 1NVEA 3IDZA 1KO5A 3F6EX 5F33A 1B00A 1UIRA 4M46A 5KX5F 3U3XA 1AGYA 3R6DA 1OXSC 3E5RA 1U2EA 2B36A 2PGJA 1WBDA 1SCIA 1A9TA 2JVJA 5LQRA 1EJ0A 2YMPA 2P67A 2MINB 3D6JA 2X4DA 1P4SA 3FOZA 2GLUA 1WW3A 2PPVA 3LXRA 4YJGB 2QNRA 2FI1A 2OO5A 2EX1A 3CPEA 4EZIA 3X43A 5FI1B 3HB7A 3VJKA 2QE7D 1ORTA 1KJNA 2YY7A 4JYCA 5L9AA 2BMJA 3I6YA 3Q0EA 1CULC 1TLTA 1IUOA 4IIBA 4MUJA 3IT0A 2RGUA 4MIKA 3ZD9A 5H9WA 1PYOA 2OXTA 4KXXA 3LZCA 2HA6A 2I2FA 4QU9A 5GMOA 3AKYA 4XWWA 4IZ6A 1L5ZA 4NU8X 3HZHA 2AJTA 2RKBA 3EXHB 1OXXK 4IQGA 3WV5A 1KRHA 4I9FA 1Z6AA 2BBOA 3LIPA 1BN6A 3BE4A 1HDRA 5FO1A 2PSJA 3MA0A 3U9TA 1F2VA 3VO9A 4EY3A 3TKAA 3OE4A 3WKAA 5FPQA 2PQ6A 2AEMA 4PICA 5KSYA 4UAVA 1H22A 4DIEA 5BP7A 4DYDA 1KWKA 1W2GA 2J9YB 2X1LA 4WNAB 5LQCA 1EPUA 3G2JA 3UNXA 4KHPB 1Z08A 2QAJA 4YGYA 2EJVA 2JD0A 2ZANA 2XMRA 3FOBA 2F48A 4L8YA 5F78A 3UYKA 1JPJA 1NLUA 3IDQA 3V6LA 1NJ1A 3FFBA 3ZUGA 4RSRA 2R1TB 1D1TA 2O57A 3DDOA 3IYLW 3UJCA 2BJVA 1OV4A 4CR8A 3FN4A 4AO6A 1LJLA 1XKQA 1OBCA 5AJHA 1AH2A 4YRIA 2BT4A 2I7DA 2GM3A 1OU4A 1VRWA 1GN8A 2QT1A 3OM8A 3SEQA 4D79A 3RRJA 3GFQA 4HZIA 5FTMA 1RXUA 5GV8A 1WVMA 2NO5A 1FW8A 2A4KA 1LS6A 4PYNA 2B4QA 1CETA 2G17A 2QJTA 4LV6A 1M75A 4LWZA 4ENRA 2J7KA 2GXSA 4WE3A 1J25A 1KMQA 5FPHA 2Q5HA 4FNAA 3R7SA 3E2PA 3FCEA 2IY9A 2X5NA 4EUEA 2IXGA 1V11A 3DQZA 3NASA 2X42A 2VK1A 1FYXA 4ZT6A 2POCA 1ZN9A 3KQPA 1OIXA 1JXOA 3IAXA 4C0SA 3E8XA 2OVFA 3WGTA 4CL8A 4QJ4A 2B8TA 1TYEB 1JIUA 2QWXA 3D6MA 3DTVA 3DDNA 2Q3FA 3FLMA 2ACVA 4P8RA 5LL6P 4B3RB 2ZXUA 1JHRA 2ZYRA 4ZYXA 2XUGA 5JPIA 1GFSA 2WWFA 3AM4A 3NM4A 1RWNA 3BSSA 5B3AA 2HLDD 1CPYA 4EHAA 3JYQA 2BM1A 2C03A 5ENZA 3SF8A 1TLFA 3IULA 1V4BA 3BVPA 3K35A 4OFXA 1VB3A 1XTJA 4QOJA 1SMKA 1K63A 4K6KA 1NBMD 1PDOA 4OL9A 4LCEA 1OFUX 5KYXB 1JA9A 2WYUA 3NTVA 3ABQB 4RGVA 4OXXA 2VJCA 1SVKA 1HORA 4G07A 1E2MA 4AM8A 2Y9PB 4ZT5A 3UKOA 3O90A 4ESVA 1XZHA 1RWQA 3CYFA 1PWEA 4YMGA 4OCZA 3F46A 1BWRA 1NRXA 1TZBA 3IRUA 4IEEA 2DUMA 3RRMA 4BDTA 1Z36A 1DG9A 3HZZA 5BRAA 5CB4A 3TIXB 4PXYA 2VH5R 2QVZX 1WETA 1JDTA 1TPZA 3KXLA 3TJZA 3VXKA 1OX4A 2SCUA 4NHEA 3PXDA 1CNFA 4BFZA 5HHTA 5KB3A 3CZQA 3REFA 3ZE7A 2CVZA 4RPJA 2CBZA 3HCWA 4KQ6A 5AHXA 5GQSA 2DHEA 3PNOA 4H59A 3OLZA 3SDSA 3TEJA 1D2RA 1UK9A 1G21E 3L8HA 4NV1A 4C0HA 1CIJA 1P5HA 1UBRS 1G7SA 3VH1A 4Y0AA 2P3OA 3UG7A 4ZQBA 1SUPA 3C6ZA 4C20A 1KI4A 3PT9A 4QGFA 1U0BB 1T4DA 2ATEA 2HRRA 4BMZA 4A15A 2GERA 1KJWA 4TWZA 4I5IA 4WBNA 2JFNA 1FFWA 2HV8A 2D54A 1LW6E 1XD9A 4HNGA 3OX2A 4ME6A 1Z5ZA 3DW1X 4J16C 3ROTA 2GASA 3W4KA 4AUNA 4ZCRA 3H87A 2GAAA 4FE4A 1F2TB 4G67A 3GL9A 4L2IA 4MRMA 1R0BA 4QATA 4IPTA 4POOA 5CFMA 1U6IA 2BHSA 4AG3A 2BBSA 1XMVA 3CH5A 3ONFA 4GPTA 4YRTA 2ESRA 4TQGA 2QX6A 1VJRA 5HCUA 4WX2B 3SS8A 1XRPA 4F6CA 5KTNA 5GONB 5A2GA 4WT7A 5ITZB 1NZJA 1QDUA 4JMPA 2C3PA 4ZCMA 2R7NA 3G5AA 4YRSA 2OFOA 3ZLVA 1THGA 5LMUB 3G8CA 2ONZA 5JCOC 5ITVA 2JFFA 5I5GA 2FA9A 5J5AA 4LFBB 5BN4B 1CJCA 3LKZA 1FL9A 2EBWA 1F06A 1FRZA 4BTLA 2Z6AA 3QEMB 1DXQA 3WYDA 2KLBA 3GVXA 1QDLB 5AJWA 5L7TA 1RD4A 1WZ2A 1USWA 1AQUA 1UCFA 5HJ2A 2A6PA 4KQIA 2VF8A 1Z17A 3SYRA 4R9UC 5DLQC 5HKKA 2HJRA 5JT1A 4E6EA 2GRJA 2I4NA 2IHYA 4QHYA 1YD7A 2Q6LA 1YQ9A 1T2DA 1DAFA 3H1AA 3T99A 3W7VA 5F51A 3ZI7A 4ENSA 3EBPA 5B6PA 2NZWA 2EJCA 1TT7A 3HYCA 2GHQA 5IAKA 5J2TF 4JENA 4RA6A 3LV8A 3OQ6A 5TY0A 1KHHA 2PUBA 3ILHA 2WPNA 5AVXA 3GV0A 3COWA 3ROXA 3LQKA 2Y71A 3AR9A 3V2IA 2O5CA 1PJTA 4DLWA 5JD4A 1CHNA 3N2KA 1E9RA 1HMPA 1Z5NA 2Z0MA 3NUZA 4BKQA 2LW7A 1OT3A 4RVOA 5FOWA 4V1CA 1CY1A 1W88B 2FN9A 1D8AA 1YV9A 2RB5A 1O3YA 5THXA 1WKVA 2ZJBA 1MOZA 1N1GA 1SKYE 3HJBA 3PPYA 3RK4A 3I8OA 2BFBB 1QMGA 1B3RA 1KI6B 2C1EA 2J3MA 2P0EA 4L27A 5AHKA 4DPKA 1X7ZA 3R74A 3PJFA 3W06A 1EFAA 4HN4B 5G02A 3KQHA 1PO7A 2ACKA 2X8WA 3KTDA 1M83A 4HWPA 1KE2A 1XA4A 5NULA 1IDOA 3UUWA 1CWUA 1E9EA 2E7ZA 4FLFA 1LWOA 2RC5A 4M8LA 2HEIA 3ZDQA 2QAGC 1VGVA 1B42A 2QRVB 2W8ZA 3NI2A 4OG2A 3LT0A 1NVVR 3KLPX 2JZCA 4CV3A 5WRFA 1TCUA 3DKPA 1U0NA 4JZYA 2JDIA 3EPRA 2AVDA 5HJ7A 4RDHA 3EQ6A 4I19A 4C88A 5KQPA 1BXZA 2L69A 3AR7A 4ITVA 3C43A 5JADA 5ARBA 2YRWA 4N65A 4O4LF 4C4SA 5K0GA 5JRJA 5JQGF 3S55A 4UEOA 3GDFA 2ZUEA 1NKTA 3LIIA 1RRVA 1A72A 2BH2A 1CUIA 5H1YA 1O6BA 4BEBA 2P6PA 1SUWA 3B3FA 5JDCC 1QG2A 1G5QA 3HFSA 4ZDIA 1WZCA 4KPUA 1LNZA 4JBYA 3HCEA 4E3ZA 4TMXA 1AN9A 2E4VA 2FUG1 2J9ZB 4I50A 2EJWA 5CMLA 1DX9A 2WWIA 4PIPA 3TD9A 1B74A 4JMLA 1DJQA 2BKLA 2AC2A 3FRIA 1TJPB 4RQUA 4KOAA 2QROA 3M6IA 3U39A 5A9SA 1MOPA 1TRKA 4AULA 4BYMA 4BVEA 1VHTA 5C80A 4KGVA 3RHSA 1SHJA 1AKNA 2ZAGA 1CDZA 1HDZA 2GDZA 2NYUA 3AR2A 1XI2A 3KDAA 3OWXA 2AXNA 3M4NA 3QVGB 4MQLA 4R2LA 5K09A 3AINA 1CZOA 2YR0A 1VMKA 1BS2A 1NYQA 2P5SA 2LP4Y 2NNWB 3ESBA 5ALXA 4QM7A 3PDCA 2GARA 4WW0A 2RD2A 2QPAA 4LJKA 2HA3A 5L53A 2ICAA 5HMMA 1FQKA 4IRMA 4CCWA 2P3SA 5FL7A 2C5HA 2AR9A 1V3VA 4MAAA 2WMNB 4F96A 1JSCA 2C2BA 5FA5A 3DZHA 1NBHA 3DV9A 5D5HA 5I5EA 4OQMA 2O1EA 2VDRB 3RC9A 1P0PA 5JMWA 1D04A 4AZWA 4BWVA 2BTEA 3B3GA 4QDJA 5DGIA 3UPTA 1I6MA 1P75A 1Z6GA 1KAEA 2KB0A 2R6GA 3QVSA 4KHZA 3RT1A 3T4PA 4RH1A 2W2KB 1Z12A 4LMPA 1O5IA 4KRYA 2R65A 2WSIA 1N6LA 3BTOA 2IIVA 3P9CA 2JFXA 2ALJA 4BNDB 2BFNA 3IBTA 2IYEA 4L50A 5D3ZA 5GJWC 1IRIA 3EASA 4LQLA 2NTNA 3LW8A 3TOCA 3VYRB 2JBWA 4MHTA 1E2BA 2D59A 2ZRQA 1PG2A 2ZI9A 3PX2A 2EKZA 4MAMA 3NDJA 4YRRA 5CDGA 3I9FA 2ZIVB 3QUAA 3AJ9A 3T7CA 3H11B 4AY5A 4E7OA 3D5TA 1BVYF 1WNFA 2CZGA 5FCDA 4ZYTA 4R7GA 1TUBB 4GKAA 4KQCA 2QTCA 4JROA 3QENA 4OJKA 2E6KA 4GGMX 3F78A 5DX0A 3HFRA 3ZBPA 2F8LA 5D86A 4K2AA 4I1PA 1I4LD 2YZ2A 3GFOA 4D8UA 1QIIA 4MCIA 1XSEA 5KMGA 3FCCA 2M9MA 3Q7TA 1GZSA 1LRLA 3L7BA 4FZJA 2H1VA 5A0TA 1EG2A 2ZCUA 1NW7A 3NRCA 1T34A 1DC6A 3IR6A 4BUJA 4ALJA 1Y3AA 4A8JA 3V8BA 2Y27A 3RWMB 3U3OA 2ZTSA 3TI9A 3N0WA 1XMOB 2OV8A 3BICA 4ZWNA 4TV8A 1PN3A 4Z9BA 3WNQA 1GGVA 2AW5A 3PL5A 3C98A 2PD4A 4YCAA 1N3YA 3GBSA 3ND8A 1REQA 3DDWA 3RKUA 4BGVA 1X2EA 3RBZA 2KPOA 3RLFA 3RRNA 5IFLA 4B34A 2IODA 1Z4KA 4HDOB 3L49A 3L8ZA 1DS6A 4P86A 2PT9A 4P0PB 2L42A 2AOTA 1CQJB 1G8SA 1QRAA 2GJSA 2OFPA 2YCBA 2I6FA 2P2DA 3D4LA 4LXIA 4X5OA 5T4FA 3T3MB 3HGMA 3TSAA 4BKMA 1SVNA 1NT2A 2QRHA 1KZ9A 1FFCA 2D1QA 2D2XA 3MGAA 1E2PA 4P4LA 3LXMA 2GD1O 3OTGA 5DTEA 2ODAA 1C3JA 2W98A 4JB0A 2CXQA 1R27A 4F86A 2IK8A 3TAUA 4DC0A 3P2IA 4PTZA 1YDHA 3NXSA 3REOA 5CIWA 4KSYA 3I9V1 5GJCA 3UG6A 3ZVRA 3MN1A 1ZK3A 4P4NA 4M3NA 2XVMA 3H5VA 4BMVA 3BEOA 1L5HA 2BY4A 4NK5A 3LHFA 3RJZA 3C24A 4MRVA 4WXMA 2P9EA 5U1PA 3L40A 2Z83A 1FX0A 3KD3A 3L6BA 3S28A 4FR0A 5J2UF 4XX0B 2C1XA 2FRDC 4KWTA 2Q1WA 3T7AA 1AMNA 4KQ1A 2IH4A 1NQUA 4NS4A 5EIHA 2D8MA 3C7KA 4HB2A 4JJFA 3B9RA 4PX3A 2DPHA 4DC9A 2NU7A 5BWCA 1W36C 1A82A 2ZT8A 3E5HA 4YMHA 3AEQA 3FSGA 4NBKA 4DLTA 3SVLA 5D7NA 1LH0A 1RM0A 3OFNA 3B2QA 3OLVA 4LZOA 4Q3BA 3U7HB 2RHBA 1KVSA 1VKOA 2PRSA 4G63A 1DFGA 1MO3A 4JLSA 5CVVA 5JNUA 5LFAA 2HHHB 3ZV4A 2ZGVA 4DV2B 1DV1A 1Q7RA 3UAYA 3D8NA 4QC2A 4M8KA 3RANA 1YDMA 1DBSA 2BMFA 3A4TA 1D0IA 1FMCA 2NU9B 1F2UB 3OAAA 5I7SA 1CJSA 4URZR 1JB9A 1N7HA 3GFFA 2V4ZA 3TBFA 4X71A 5AJYA 1QGOA 2AFIE 4M0KA 5GINE 5AI0A 3LQ2A 3M9LA 2GBLC 2WHPA 2SKEA 5EMMA 3CH4B 3ITDA 5IYZB 2W2TA 3RF7A 3PJRA 1AK1A 1BVRA 2GZ3A 4KZKA 4OMCA 4XFKA 4HWKA 1E9VA 5TQ2A 3M7IA 1DXHA 1R5BA 3BJZA 1JU9A 1Y6QA 2CF6A 4AKIA 4JBLA 1UBUS 1LXCA 2NVWA 4MULA 5C0OE 1HL7A 4KRGA 5U4XA 1QGUB 5CPFA 1QYXA 4Y9SA 3VAZA 3WGMA 3OU6A 1C30A 1K4YA 5E4YA 3IVMA 3ZI4A 3CGGA 1Z6YA 4HYYA 4RVCA 2OAEA 4F8YA 2HA0A 4IIEA 2X2OA 5JUWA 1XDDA 2EFGA 2X5KO 1Y0BA 4JSRA 5DMXA 1JT9A 5E38A 1ZW1A 3ZK7A 4G2NA 3U3ZA 3FVQA 3LTNC 3W04A 3NBMA 5CW2A 4DSUA 1Q16A 1GSHA 3HLTA 1XEWY 4PQYA 5AKYA 2INGX 1JI0A 3KS9A 1N2EA 1I51A 3RTGA 3CM0A 3U3KA 1A8IA 2OWEA 2XCSB 4C2UA 3RUPA 3ENZA 2OHXA 3BHIA 4XJVA 5FOVA 4L8FA 1I3CA 1DAGA 2NXEA 3MCTA 3NJRA 3SDBA 1Y7LA 3WNCA 1BS9A 1SXJC 4TL9A 1YB6A 2GZ2A 2J0VA 1C7IA 3ZGXA 2ET6A 4B81A 1PT5A 3RR2A 3UW1A 5JBNA 1P6QA 1N7JA 1BD4A 2RAUA 2EGUA 2IXBA 3HCAA 5EKTA 4PYRA 1T6BY 5DBEX 3VSCA 4EEZA 1PJBA 2RSLA 1J23A 3I04M 2FZEA 3JQGA 4HR7A 4RV9A 3TQQA 4BJ6A 3HRIA 1HDXA 1NYTA 4IW3B 1A1SA 5JH7B 2D1YA 3EGXB 2JGDB 2RHJA 3KJZA 4ER0A 4AIRA 2P9FA 5E9QA 1NDHA 3JVEA 4Y6QA 2B1RA 1NQOA 2YWRA 3SXJA 2FQXA 3K0FB 1DARA 3NP7A 3IH5A 4HDNA 3GGCA 3UHPA 1ZH2A 1H2AS 1QSGA 3AB7A 1H66A 3MUEA 2A78A 4GEGA 1MJFA 4PZ0A 4DDKA 3RAEC 5BN1A 3C3AA 4QBIA 1KH1A 4CM4A 1D8TA 3GC6A 4J6EA 2X7XA 4I3FA 2V7QA 1KPHA 4E5SA 2FK7A 5EXEA 5BMVF 4F7DA 4D8VA 2TSYB 3CNEA 5F5XA 2X0EA 4Q4AB 2NAFA 4X3PA 1XZKA 2GEKA 1NURA 2VTKA 3EGDA 5D7BA 3WFZA 4EKNB 1OF1A 5JXIA 4C7OA 1KMHB 3PNQA 4DMHA 5DNYB 3QSYA 1XMPA 2IZ7A 3G0IA 3J7TA 1QGDA 3HGTA 1VJDA 1XZMA 1HOXA 2R8RA 3NWEA 1FU8A 4Y3UA 2ORED 2FPKA 3ZE2B 4WA8A 1E2QA 3OFKA 3P32A 5BW8A 1IEQA 2A7XA 2O6LA 4BBPA 1AC5A 3BOSA 4YY3B 2AIRA 4AY4A 2GEDA 4E13A 5FB3A 1RZRA 3PGJA 4BGUA 4QT0A 2PMCA 4JHXA 3SDZA 4A03A 1Z0AA 1SKYB 5AVYA 5IC4A 3CZPA 3WYBA 1R6TA 5E95A 5EUMA 1USIA 2PS1A 1EWKA 3RQSA 1R00A 3DDHA 1MC4A 1QHXA 2JVIA 3QLUA 4IQFA 5K9ZA 2HSGA 3FCSB 3ZZ1A 4DNXA 4JS0A 4LCJA 1VMEA 4G5XA 3ISVA 2EFYA 4KEAA 1WA5A 2EDAA 3RHTA 4IAOA 3EEOA 2BEUB 1MUUA 4N7RA 4G0YA 2B2CA 2DJ5A 4EPVA 5LQDA 2CXOA 3PDHA 3K94A 3AG5A 3FFAA 1MO5A 3FUWA 1EGHA 5J4KA 1RXEA 1KO1A 3HR4A 1E9SA 1M1NB 3BERA 2HRZA 1H6DA 2JRLA 3GNLA 3MGKA 4MV5A 1TC2A 4DG9A 1DRJA 4PX2A 5LP6C 4WBXC 3TWOA 5A3QA 1EDDA 1BEZA 5ALSA 4OOFA 2WUVA 1W87A 3R23A 4W6QA 1SC6A 2PQMA 4TZ6A 3UM9A 1YOVA 4TYMA 4WOCA 3AYZB 4FSHA 1U0HC 3VVLA 1T8PA 3WIVA 4MCAA 4AL4A 1ZQ1A 1VLVA 4QULA 3PQDA 3S7ZA 3IEMA 4WLNA 2YWBA 1NFFA 3LT1A 4HSGA 2HBZA 1PQPA 3LY9A 3KFLA 1W73A 4M6WA 4IEIA 4LMAA 3GY0A 1P5FA 3LA6A 4JI1B 3KL4A 1JSLA 2AJLI 5KYWB 3EF1A 3FX2A 4QBGB 4QYIB 3WAGA 4IBOA 1YB5A 2YIJA 3AETB 1AY0A 3GJSA 1Z0ZA 4JQZA 4WZBA 1L4GA 1O5OA 1WXDA 2PEZA 2V74B 2VAMA 3IQXA 2V65A 2IZOA 4RQAA 4AZ3A 3IHTA 2C7RA 2YDXA 2GSDA 2HRBA 4X6UA 2NSYA 4BO9A 3GLTA 4DRZA 2GILA 3G79A 4CNBA 3UO8B 1OZGA 1QTNA 3AZOA 3OZUA 1SD1A 1TT5B 2PL9A 3O4RA 4DUGD 4ZO4A 3UAGA 1UF9A 1UDXA 3G7NA 4DCCA 2P79A 1JHUA 1RJWA 4KREA 4DQDA 4EQ6B 1PFWA 2O9JA 5DB4A 3T15A 4JWKA 1ST3A 3R8CA 3K32A 4REMA 3FJ1A 2AFHA 2QGZA 1R2QA 2H1WA 1N0VC 1XLWA 1U3VA 4FX5A 3PWSA 2BGJA 5EJGA 5A3JA 1MT0A 2HDNB 5GM1A 4TYNA 5ENDA 1E98A 3RWOA 3Q87B 2C7QA 4O3FA 4PNEA 2GO7A 2C5SA 3GX1A 4IV8A 1BJRE 4BL5A 2PJRA 3ZHXA 4H1WA 6AT1A 4BO6A 4DV5B 1XDWA 2Q3LA 4YBZA 1WX1A 1R1DA 1D7OA 3KSAC 2PRJA 1L7EA 5FWAA 1GL6A 2HDOA 2Z2IA 4D81A 1FSSA 5CJJA 3H1BA 5E6RB 4ZEVA 1J9GA 3NORA 1BMQA 4L6IA 4R1QA 1TO2E 3QNWA 3IPLA 1LPNA 1XP5A 4ZU1X 2GF2A 1UBMS 3QPWA 4YQFA 2HEGA 2QMYA 3V1TC 1IHYA 3FWYA 1E3SA 1EP3B 2Z04A 4GO1A 1A8QA 1OOEA 4ZT2A 3TKLA 3DVAB 4LHEA 2GPYA 3LVFO 4OXYA 1WB9A 3F3KA 3GVCA 3PQ7A 2XQFA 4OHCA 1L7PA 5G0WA 4PRZA 1UXHA 1KYTA 2RK4A 4KO3S 4E5UA 5A06A 1AMUA 3OG9A 1II8B 3DO6A 3N8KA 1T26A 3HDYA 2ODPA 3B38A 3KWLA 1AK2A 4QOEA 3DT6A 1K2VN 5KDLA 3W6ZA 5B55A 5FNVB 5B2ZA 4BP8A 2EKBA 4HAUA 3ZDZB 1TM3E 5IRCD 2PLNA 3F97A 2GPBA 4PC7A 3S2GA 1IJEA 1AGRA 3KSRA 2OSVA 3LPNA 3ZU2A 3ETLA 1G8JA 5C8VA 1EG7A 2NU6B 3C6QA 3DMFA 1NRJB 2WU3A 4NXNB 3HY3A 1Z26A 1Q3HA 4G26A 2IYLD 1F8FA 4PYMA 1BX3A 3NHPA 5DCWA 2HAEA 5ADUS 3KQQA 4LWQA 1QQ5A 1M6VB 2XMDA 1VIMA 4LKOA 1OI3A 4OUDA 2CVOA 3UJ9A 5JAZA 1VG1A 3NIWA 5JXJA 3RW9A 4U7JA 3WZMA 3LWNA 1W34A 4CF7A 1A98A 4IXDA 1TM2A 4FD2A 1JEYA 3U09A 2JFUA 2WJVA 3IKLA 1TU4A 2J5QA 2IHUA 4FBMA 1WY7A 4KN9S 2QX4A 1KJJA 3IEKA 2GZ1A 3PPIA 1CFJA 2E49A 5LYYA 5CH5A 2JFQA 5K2MA 1H2XA 4L4ZA 1WHSB 3X2EA 2O23A 4BUZA 3BRCA 4BBZA 1YZUA 5KNBH 4JV5B 3NTLA 4MUKA 2SBTA 4DJJA 4JI7B 2WA2A 1I94B 3AG6A 1UKZA 3VNSA 4BLOA 4EUNA 3CG0A 4GKBA 4AU1A 3NEYA 1NZFA 2OD7A 3CF4G 2RHLA 4INOA 1WXFA 5DULA 3PX3A 2VBCA 1TRHA 2F3RA 2ZTHA 4GM1A 4ZMRA 3NZEA 5DEIA 4ABTA 2ZI7A 2GUGA 5KKNB 4LDPA 1XTZA 4ERNA 4ZK6A 4OXIA 3T1HB 2UUOA 3K9CA 4MCHA 4DSZA 2HIHA 2YOGA 3OMLA 4BCCA 1BNCA 3PUHA 1Q1NA 3G2NA 1BN7A 2GCPA 4N7JA 1E58A 1L2TA 4BFCA 2OG1A 1PFVA 1VTKA 1E5QA 1P7WA 3DUWA 1O0BA 2AOVA 2P4HX 3WLEA 3C3EA 1ST2A 3DDUA 4MGHA 5JMPA 3R7AA 3T5BA 2X0FA 4W63A 3X0DA 4IV0A 4IYJA 2AN1A 4IEFB 2O6HA 1HTWA 3COPA 3OUZA 1SQSA 3AXSA 3R24A 4Q4CA 2H5JA 3CSSA 1N2CB 1PAUA 3EY4A 5JO9A 4J16A 3WA6A 4MS3B 1EX6A 1XGKA 4CM7A 4D99A 5ALYA 1N92A 3AM1A 1L1RA 4OHBA 3K9QO 4EHNA 3ORSA 4I4TF 1U7OA 4ZMBA 5BOSA 1OI2A 1G0NA 2VATA 3E4CA 4LHXA 4DLNA 6ADHA 2W6CX 3TCNA 2BGRA 2X0NA 4W4TA 5I9IA 3UIEA 4IL5A 4TYQA 1CUVA 4IO0A 3KTAB 3GLFE 5JCOA 2X7JA 2R6HA 3B20A 5LNK6 3G2HA 1LNSA 1SHUX 4ZFNA 4RH0A 3S44A 4NJMB 1N6OA 4NR0A 3PPWA 1T2FA 4V2UA 2BGIA 3K4HA 3R20A 2RAFA 2JH8A 3GLUA 4JC4A 4LRYA 1ZGJA 2HLHA 4N5IX 1W1IA 3Q8KA 3WLLA 1M9NA 5B58T 3Q41A 2G67A 1DT3A 3MRSA 1L5GB 1X8LA 1V1RA 3SE0A 2PGAA 3QKRB 3OC0A 3FCYA 3VZSA 4YMUA 4OLAA 1JVNA 5JS7A 1SEPA 4PLPA 5HR5A 4B3TB 4PNPA 5ALQA 1I6LA 4FVTA 1Q44A 4GBMA 1SXPA 4YRMA 2F1KA 3RS8A 1KS2A 1I9CA 4NCIA 4YJ2F 5EQJB 4AJLA 5KYUB 4CMJA 4X44A 4MEAA 3QI2A 2WJGA 3OD5A 4HFNA 2FEPA 2Q1TA 3G2OA 3LKBA 4UVIA 4EPTA 3R3YA 4B7ZA 3CXRA 1BKYA 3I5UA 4OJMX 1T29A 4W1RA 4PLVA 3U3DA 4CQMD 5ALVA 1J5EB 3CE6A 4U3JA 4K88A 2GKGA 1KIAA 1SHTX 1TW3A 4LVUA 1Q14A 1N7GA 1DOZA 2HBYA 2C31A 1O95C 4RVDA 5LM3A 1ZP6A 1VHDA 4G9EA 2C4MA 1FFEA 1ACJA 1D2GA 5K3SA 3OFJA 3QU7A 3ZDBA 3D8TA 1FU4A 4B3IA 1B1CA 1KXZA 4MR8B 4QM6A 4K9MA 1NV8A 4OUKX 3UAWA 3A1FA 4JAVC 2HD4A 5GJBA 4RF5A 5H83A 3CG4A 4C2AA 3RKRA 1EGVB 2GFQA 1A9XA 1UXIA 1ORHA 3WMFA 4LTDA 5A5VA 3BF7A 3LLSA 3LNCA 4YT8A 3JVIA 3RS0A 2RKOA 1KQNA 3STYA 3PQ6A 4B2IA 3S1AB 3OEEA 3TK1A 4CTMA 4OKIA 2QAGA 1X80A 2C4VA 1Y7HA 1H5NA 1X7DA 2DBYA 3LZDA 4LISA 4OM7A 1YFJA 2IYRA 1E5DA 1Z56C 2VNJA 2XWQA 3ELUA 3UHFA 1S3FA 3USES 3JPWA 2D1SA 3ZCXA 1MGOA 2DFVA 1Z73A 3JRNA 2R7AA 1Q1ZA 4FDVA 4CQNA 3VR0A 2F62A 3AHIA 1MA0A 1GTJ1 4POAA 5EUQB 2AXEA 3WBKA 3ZXIA 4EKYA 1QAQA 3E7XA 2BFEB 1RXCA 5JSZB 1Y5LA 2RGWA 4UTRA 4MUAA 1FP1D 3KQKA 1B76A 3AEUB 3EY9A 3WAJA 5FYQA 1GL7A 5JDCA 3MOSA 4LOHA 4MUNA 2JGEA 1LC3A 5T64A 1HBJA 1LBHA 1QKKA 1ZUIA 4I9NA 1E6LA 1UDWA 5G40A 2PUAA 2XOKD 4KIUA 2IGBA 9LDTA 5FI5A 2XKAA 3CSDA 5H4GA 1H5UA 3KV1A 4WKGA 3EMBA 1T13A 3FSRA 3GNSA 2GS9A 3ND5A 1TX4B 3BTVA 2GFIA 4QUDA 4Z6KA 3W5IA 1PQ4A 1EB9A 4P7GA 5EE9A 1S2NA 1ZD9A 1OJLA 1XNGA 3GJ6A 3HJAA 3A1WA 1N8NA 4GWGA 4JBIA 4YAFA 2BWJA 2P9ZA 5HSGA 5G3YA 2XGJA 5C1IA 4Z1MD 5HFJA 4EGQA 4OI2A 1DAHA 1YBAA 4EO7A 3MRTA 4X45A 4OX9Y 2H06A 1B16A 3RI3A 1RHKA 4WCFB 3DZGA 1E1NA 1W46A 4E1BA 2PWYA 3FAKA 1BGWA 2IGTA 1KS9A 3RYHA 1C81A 3L1JA 3WOHA 4IKOA 3GLHA 1KNQA 1W8IA 3OX1A 4J0EA 3WK8A 1CF2O 5AIAA 1RLTA 1X3LA 2AR0A 4M37A 2O8BA 3SZLA 3AVQA 5L3VA 1CUJA 3FKSA 4UZSA 5KQSA 5GJVC 2R47A 1UPCA 1NJFA 4IVQA 1ZRMA 3FGPA 4FS8A 4QGAA 1NLMA 2ZIAA 5DKFA 2ZZNA 3G5TA 1SA0A 1W7AA 1KKUA 2Q1SA 2P5YA 2QJWA 1E2EA 2BZGA 1UZLA 3NYRA 1E4EA 3A6DA 2DKNA 4MHSA 3R6WA 4QEZA 3ZIAD 5DHTA 1WDTA 1UC8A 2ASVA 2V7TA 3CX4A 1OKKD 2Q5LA 4UMVA 1VKNA 3F6RA 2LKCA 4PGHA 5IW8A 3UXEA 1FLVA 2TMYA 4AAYA 1RRMA 1QFZA 1SXHA 4U2BA 3ERCA 1MIOA 2Z2KA 3M1IA 3RTDA 2GZHA 3CRQA 3S8YA 4DLYA 3OZ7A 1K7CA 4MYCA 2HWWA 1VMAA 1L1QA 5KI6A 3LCVB 3F5FA 4JP2A 4LJ7A 4TVOA 1QWOA 1PBTA 3D3WB 2Z08A 3M2PA 3SKVA 3NLLA 3CZMA 2JIBA 1JH8A 2AGVA 4LJ6A 3KELA 3L3BA 3FYHA 4WLOA 1CJTC 4P4TA 4EG7A 2Y1WA 1V8ZA 5CVUA 4Q3OA 3GZTB 4QYXA 2OXRA 2QLJA 2FG6C 2X1MA 2ZVPX 4FOPA 3S2FA 4BV3A 1NUSA 3H0KA 1JBQA 1L4LA 2V55B 5AO9A 1JBKA 3WTCA 3WFJA 4TPKA 3O1IC 4JP8A 3N6VA 4QBTA 3TRIA 1MXFA 2G70A 1YC5A 1FA9A 4M0DA 2DTDA 4C4TA 1L7MA 3T35A 4WN9A 3P9ZA 3WGOA 4EVIA 5GTDA 1JA1A 4HO1X 4JASB 3MPOA 4G5GA 4FMDF 1XE3A 2Q0SA 5C53B 1Q19A 3QPBA 3S2EA 1Y3HA 1ZM7A 1Q20A 1ZJZA 1W9MA 3N9IA 4K87A 2XBMA 1LPAB 3HYRA 4QASA 1A2BA 2P4UA 3F9CA 4R2KA 1RS0A 1WKBA 1XZGA 4BFTA 5KVQA 4B33A 1QFMA 2Q0XA 3NAMA 4R8SA 1LSOA 3M1LA 1S8FA 4PYJA 1EVKA 5BQOA 1SOAA 3DOHA 4ZYVA 2WUWE 3M6MD 2BP7A 5E7MA 1XTVA 3PCXA 1KOJA 4E11A 3DOEA 2H9AA 5JG7A 4XB2A 3VHQA 3LPAA 3EQZA 3PFWO 2VDWA 4DSOA 3R5JA 2DE0X 4UW9A 2CDRA 2QDXA 1YFLA 4EF5A 1Z83A 3Q5EA 2XEDA 1JG3A 1N3BA 4M0MA 3FVVA 2BL4A 3V2GA 4DLAA 2Y0BA 5LKRA 4MR7A 3AF6A 2CEKA 3PXCX 1II0A 2FW7A 3GU3A 2JGIA 1WMFA 3DO5A 4EHKA 4WOPA 2BM8A 2R1ZA 5HK9A 1D2HA 2DHRA 2VDPB 3H2HA 1W52X 1YJ5A 1NMYA 2W11A 2A58A 1Q1QA 2FRDA 3LX5A 1O6CA 2WU1A 4HAOA 4CPDA 1R4MA 3TW4A 4ZT7A 1OYWA 3Q3HA 3BMQA 1GQFA 2RDMA 2ABWA 3F90A 1J42A 2PY6A 1B8NA 1H5QA 2CDNA 3EODA 1JHQA 5YASA 4LRXA 1ZA1A 3CJRA 4NJEA 2VLIA 2FQQA 2BISA 2DVMA 3KTFA 3RODA 2EJTA 2JIZD 3WRYC 3N2GA 4GMKA 5KNBD 3PJDA 1C7EA 3D2BA 4JJAA 3FZQA 3WLHA 4TVBA 6ABPA 4A8TA 2R97A 2O2YA 1C0LA 4D9HA 1F0NA 3DZBA 3R0ZA 1FZQA 3T5MA 2ZQZA 1FJXA 5KX5B 5E3IA 1ND5A 4GI2A 3CX3A 3LUHA 5AJXA 1F17A 4GKJB 4HATA 2C9ZA 1U8CB 3ZC3A 2Q5CA 4EK9A 5A4FS 1R8JA 2VCEA 2H6EA 3KOMA 4LYDA 3MFQA 1WTCA 3RJ5A 4HVLA 2DHDA 2X0KA 3I4CA 3PFFA 4O63O 4U39A 2Z57A 5K1ZA 3PNMA 5B36A 1GARA 4HBGA 4PAWA 2BGGA 1SOVA 2FTKE 2IL1A 1FJ2A 2PLFA 3T7SA 4B9EA 4CKWB 5IVHA 5CP8A 5CUQA 4XARA 1YK0A 1JKJB 2KBEA 3T38A 1QU2A 6LDHA 3SEAA 4ID3A 4JQCA 3CY6A 1RQ2A 4TVKA 3AZPA 3U7RA 1WEHA 4CEIA 2WF8A 5BSHA 1J0BA 3BSYA 4XM1A 1YNSA 2XIJA 4OAOA 3ED1A 3N28A 3O26A 4FNMA 2DBRA 1M34E 2NO0A 4KDEA 4X1IB 3HWWA 4B8ZA 2ACEA 1Q1BA 3N6XA 3IIEA 1U7ZA 3AKDA 3ORFA 3QE9Y 1VPVA 1W59A 2REQB 2Y1DA 3D43A 4I4CA 2QG6A 1GGJA 2PGIA 1JG2A 3V48A 2C4WA 4FSDA 5H3CA 1PUXA 2Q3EA 3ZJYA 1QHNA 1CX9B 1HEIA 2MDTA 1PR9A 2O3TA 3NHKA 4HNUA 1L1EA 3ZE1B 1SXJA 3KIPA 3GRPA 4D3YA 5A2QA 3SHTA 4KW7A 1IZ9A 2GZRA 3OKPA 4PTLA 3C3DA 3T4XA 3GLFB 1L5OA 4N40A 5KQGA 1V5WA 4MQ6A 1KVTA 2P35A 2Z43A 3ANNA 3G0HA 4A6PA 2J41A 3KAPA 3GLQA 3LU1A 4MB6A 1YAJA 1GQYA 3QELB 4FMPA 3PC4A 4LOLA 4Q4JA 5HEKA 3C8DA 1M5UA 3OZRA 1K6EA 2M2IA 1RJFA 3LL7A 3Q3EA 4RUKA 4F4UA 4YJ3F 5J63A 3NAGA 1HY3A 1ZM9A 4GBJA 1MA3A 3M6XA 1KAQA 2C9MA 3IP7A 4NH4A 2HSDA 3KPWA 5DH9A 1J4AA 2XJ4A 3OF5A 4RFLA 4TT3A 4D82A 3EZNA 4IKEA 4EA7A 4ALNA 4NCXA 4DLBA 2K5UA 5A3SA 3O7MA 3UPDA 2O7QA 4X84A 5DI9A 4ZICA 1DE0A 2OHVA 3LKDA 4BWYA 1L7DA 4KOEC 5LJIA 5EERA 3TLMA 3NDBB 2YKGA 4FN5A 1KH2A 3LGAA 3DBIA 2V5AA 1DSSG 4BNXA 3JD4A 3DLHA 1B8OA 1ZGGA 1MX3A 4XR9A 1BXGB 1W0JD 2XV1A 3ZWKA 5L6LB 2H4XA 5E0OA 3I2GA 1J39A 2D7CA 1TF7A 1Z7YA 1S3IA 5CLHA 4KLCA 4GXNA 3EF0A 3EH2A 5LWQA 3GIDA 2FETA 2MMGA 5AQEA 2BR4A 2R25B 5TMBA 3HJFA 3U6BA 5BV7A 3OQBA 1L3BA 1NR5A 3UJ8A 4PG8A 2XX3A 2ONJA 1G3QA 1Z3IX 3JX9A 2CVHA 4GYJA 2JJQA 3SSNA 3ZLJA 3H65A 2A92A 1EXMA 1CU1A 3HJRA 2F8TA 2HA4A 4UUAA 2G4CA 4IFBA 4DWJA 5K0CA 1QAMA 8ATCA 2NSHA 3DGFC 3H8VA 5EHIA 4DLUA 3UUEA 4AF8A 4B6GA 5BR8B 1YO6A 1QHHB 1YSCA 5DM4A 4NMLA 1G38A 1XDGA 2GKOA 4DTCA 4TXJA 3ER8A 4I1RA 3VDMA 4B74A 4KXUA 1PG0A 2IPOA 4PFKA 4MGEA 5JISA 1NW9B 4W5NA 2PGLA 3CNNA 1SXIA 4Z5XA 2I2DA 4KLAA 4EAAA 1YZHA 3OCUA 4MUHA 4G6ZA 3Q4GA 3R4CA 1PUJA 3CX6A 1K86A 2XW6A 5E9AA 4HYTA 1YCDA 4FOOA 5LP6A 1EUCB 3PI6A 2E85A 2ZB4A 2A5FA 4GVPA 1CR0A 3G0BA 4K9KA 2EZUA 1PSDA 5JV5A 2R8BA 1WOMA 3GJQA 2XZLA 1CUAA 1MZVA 4X7PA 5HCNA 3GRZA 4LYGA 5TMDA 4WL0A 5DCYA 1LK0A 5D8DA 4XYEA 5FQNA 2JLZA 3FBWA 4C76A 4LOAA 3Q72A 5EEHA 3KYDB 3K0KA 5HF5A 5C7LO 1E3MA 4C1BA 4QGBA 1ZVMA 3KEGA 4LN1A 1P9RA 2V0CA 2B0JA 2NUPA 3BDAA 3W6PA 1PLLA 2PT5A 3IODA 4BLRA 3HCRA 1A2KC 5JC8A 4Y2JA 1Z07A 1RQ7A 4NYJR 2HF7A 1ZOOA 2FZGA 2PBFA 2VDLB 2WAYA 2O2DA 2Q6KA 3KU4A 8LDHA 3ABIA 4LNHA 3GD7A 3UXHA 1WPGA 1BE0A 2RHHA 1E1KA 2CLDX 4I4NA 4NOJA 3UGTA 2C00A 2QRUA 2YZKA 3FBTA 4OSOA 4JWTA 4ZJUA 4IXNA 1ZSYA 1OD6A 2XSZA 3ZKWA 4LOIA 5K4AA 4P6VF 2H65A 2JBAB 2YV4A 3CKMA 4RTRA 2NZYA 1ZK0A 1MTZA 3OE1A 4GW3A 2VI5A 2PYDA 1D5WA 1H8HA 4YLYA 1OAKA 4OLJA 4TL8A 3OHMA 4PPFA 4Q34A 2ZK7A 1DUIA 1NXXA 1TM4E 3E8MA 3FGZA 3K1TA 2V5UA 1EFHA 5BN5A 3MAJA 1ISHA 5CYOA 1HH4A 3ZWCA 5CVTA 1WBJB 1SU8A 2OGUA 1ONSA 4M0CA 4WD3A 3OH8A 2WAAA 1GRCA 5JIBA 5GADl 1YZKA 2B35A 2GYYA 3O4FA 2VDVE 2Q62A 6PFKA 1YL7A 1NBAA 4Z8YA 1JR3A 4NZYA 4PZYA 3N6RA 4V3CA 5BUCA 1ZVJA 4HGQA 1HDEA 1OZAA 1VSVA 4KXFB 3TIIA 4B7AA 1KYXA 2WA1A 2BFWA 2UAGA 3BB1A 1VCOA 2HK8A 2Z5FA 4JX9A 4ZQFA 5CNMA 1S6YA 4J1SA 4ETMA 5I6DA 2C5AA 5JNRA 1IMJA 1ZJJA 2CUZA 3IO3A 3A2NA 4QU8A 1LLUA 5IBCA 4Y2GA 1YR1A 4EMSA 4XYBA 4Q24A 4YONB 4DJFC 5EHGA 4GX2A 1U0GA 5DZSA 4TMKA 4WMLA 1RR6A 4C21A 3MTIA 2VWHA 1RCFA 3SQDA 4KDFA 3FWZA 2ENUA 2QK4A 1MLDA 1WM1A 4A1OA 3WK4A 2CCJA 1QIMA 3QKUA 5FQOA 4B3SB 3DMGA 3T9BA 1F12A 4D9MA 1NUUA 5DBGA 4WSOA 2VHXA 3RYFA 1AKTA 4QUEA 2YV2A 2VR1A 2VPIA 1UBKS 3ANSA 4M9SA 1U5CA 2XTAA 3D3EA 4WKPA 1FFXB 4XQCA 5H7XA 1ORRA 1F0KA 3ZXYA 5FPKA 4LXUA 3DLBA 2NVBA 4G97A 1IN4A 5DYIA 1XU4A 1H69A 5EKXA 3RK0A 3KKLA 1E7WA 2VNSA 3AIMA 5LU9A 1I10A 5AVQA 1YXMA 3I2HA 3LS2A 4QPCA 1UDCA 4R1SA 4X1YA 4JLWA 3ZWYA 4RORA 3MJCA 2FVXA 3A70A 1Q0LA 3EBLA 2Y1KA 1QAOA 2FJ0A 3P4YA 3L9WA 1KKMA 4JI6B 3FPKA 2HXYA 2OMKA 5EE3A 2NU8B 2OA0A 3G02A 2PZGA 1Y4AE 2XNHA 4D9FA 2PUGA 3KNZA 3R0QA 5BN3B 4C7VA 3MSCA 4UOEA 4GLBA 1EFPA 1J2UA 2QMEA 4RK6A 3SC2A 5JQGB 5C51B 2JFWA 4KX3A 3SYLA 3ICCA 4A0SA 1ZH0A 4JLDA 1N0IA 4O2RA 3D7MA 3IQFA 1V5EA 2M32A