4F4UA

The bicyclic intermediate structure provides insights into the desuccinylation mechanism of sirt5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
266
Chain Sequence
TARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent lysine demalonylase and desuccinylase sirtuin-
publication title The Bicyclic Intermediate Structure Provides Insights into the Desuccinylation Mechanism of Human Sirtuin 5 (SIRT5)
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 266
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4f4uA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4f4uA01
1UPAA 1UPBA 3EYAA 1NM5C 4BVEA 2JLAA 4G1CA 4TWJA 3OE1A 2C31A 1OVMA 5D7NA 2IHTA 2JIBA 4IG9A 3LQ1A 4D5EA 4D5GA 4JUBA 3CLUD 2Q5LA 4X3OA 4QELA 4MPRA 3EY9A 4IAOA 4MPJA 2WVGA 4JD5A 1PYDA 4K9NA 2AG0A 4RMJA 4GP9A 1BFDA 1HZZC 2PGOA 4JSRA 3CF4G 2Q5QA 5K6RA 4JT8A 4UTZA 2H2FA 2VK1A 1V5GA 4JUCA 5EJ8A 1Z8NA 5K6TA 4BN5A 2JI9A 3GLTA 4X3PA 4K9MA 1N0HA 1V5FA 3ZGVA 1PI3A 1YHZA 4RJJA 4KXQA 1S7GA 2OD9A 1POXA 4BN4A 5EJAA 4MZXA 1PO7A 4JUDX 4J1TC 2OD7A 4MQ5A 4C7BA 2JI6A 4L3OA 1MA3A 2B4YA 1EFVA 4RJKA 4JT9A 4Y6OA 1M2JA 1POWA 2QQFA 1SZCA 5EJ4A 4COKA 5EJ7A 2FSVC 2FR8C 4GM4A 1ZPDA 4QQ8A 2FN3A 2PANA 3CLRD 2Q5JA 2W93A 2Q29A 4UU7A 1M2NA 4UTVA 3PKIA 3HWWA 4GPEA 4RMGA 4GM0A 4BUZA 1Q1AA 3GLUA 5MFPA 1PVDA 1MCZA 4FEGA 4KPUA 4BVBA 4C78A 3FSJX 1YC5A 2VBFA 2AG1A 3F6EX 2EZTA 2OD2A 2H2DA 1XLTC 1YI0A 2WVAA 3PKJA 4QPZA 3ZGOA 2FWNA 5K2OA 2NYRA 4FEEA 2Q5OA 4RJIA 4GM1A 4UUAA 4BV2A 2H2IA 1M2GA 2VK8A 4IF6A 4JU9A 5DGDA 4K9LA 2EZ8A 2VK4A 4TWIA 4MPPA 1M2KA 3FLMA 1Q6ZA 4BVHA 2A1UA 4RMHA 4UU8A 4R8MA 4K9OA 3ZG6A 5MF6A 4FVTA 4V1CI 3HWX1 5EJ5A 1Q17A 1E3TA 3PDHA 1OZHA 3CLSD 2IHVA 1YI1A 2VJYA 4UTNA 1OZFA 1PTJC 3JR3A 1YNOA 5DEIA 3E9YA 2A1TR 4HDAA 2H4FA 2JI8A 1YC2A 2EZ4A 3D4BA 1EFPA 1OZGA 2H4JA 1SZDA 2EZUA 2H2GA 3RIYA 1JSCA 1UPCA 2FRDC 3EA4A 5FEMA 2BRUC 3D7KA 5BWLA 2Q28A 2VBIA 1YTLA 2EZ9A 3IAEA 2UZ1A 4ZP1A 2UZ1B 3U3DA 4Y6QA 4GG1A 3F6BX 3RIGA 2VBGA 4RMIA 2PGNA 3GLRA 4JU8A 3CLTD 2OO5C 2Q27A 5DGTA 4O8ZA 1T9BA 2NXWA 1QPBA 1T9AA 5BWNA 1DJLA 4L2IA 1PNOA 1S5PA 2H2HA 2H4HA 4JUFA 5AHKA 1U2DC 3U31A 2H59A 1U31A 3K35A 1PNQA 5MFZA 1J8FA 4JUAA 2HJHA 1Y9DA 1YHYA 2DJIA 2V3WA 5EJMA 4BV3A 4I5IA 4Q9DA 1U2GC 2WVHA 4UTXA 5K3SA 3IAFA 1O97D 2QQGA 4KGDA 2JLCA 1T9CA 4UUBA 4UTRA 5EJ9A 5BWOA 5EJ6A 1D4OA 2OORC 4FZ3A 4BVGA 4V1CA 2IHUA 4V1CB 2JI7A 4F4UA 3FZNA 4K9PA 1T9DA 1O96B 1ICIA 2X7JA 3D81A 4ZZIA 5MGNA 1Q14A 1YBHA 3JWPA 4K9QA 4J16C 1PT9A 1M2HA 4HD8A 4Y6LA 1V5EA 1U28C 4F56A 4K9KA 5IMSA 4BVFA 5FYQA 3GLSA
chains in the Genus database with same CATH superfamily
2PTHA 3EXIB 4HFMA 4QFCA 1FTGA 3T1QA 3OFVA 2R1VA 1AA9A 2X23A 3MWFA 1WLYA 3WRVA 1YWGO 2DKNA 2R3SA 3LBNA 1L2TA 4FE4A 1I2DA 1Q1ZA 3EGVA 5D7NA 2IHTA 1JSZA 1RRMA 2KS6A 3GVIA 5FNVB 4DLNA 2YMMA 2W6JD 1L5LA 5IBCA 2R66A 3HYNA 3C3KA 3I9NA 3UATA 1B41A 4H0FA 3HCOA 4Q1EA 3N3BC 1KDYA 1JXMA 2WHPA 3PJGA 3OCCA 1E1QD 5IK2A 1KDOA 5JO9A 2H63A 1NGSA 4II3A 1DPFA 4H08A 2ZRNA 3LZCA 1X6VA 2AMVA 2VKQA 1A9ZA 3HHPA 1PL7A 4MPRA 3ZN2A 5LQNA 1UBRS 2GILA 3HVUA 2R00C 1KPIA 5F3WB 3AUSA 2YMQA 4JD5A 4CMHA 1E4EA 4OYHA 1G9TA 4QYMA 2AG0A 3P1JA 1YCHA 4MNTA 5JCOC 1I2MA 2ERYA 2N47A 1U1DA 3OZIA 4TKUA 1N2IA 4JSRA 4FCVA 4YONB 4E5SA 5BNFA 3W5BA 4IDHA 1W0KA 1Y7HA 2FXVA 1XTUA 3A8TA 4MRAA 1FNDA 5K6RA 3SS7X 4EG0A 1U1GA 1VKRA 5CA0B 1AK2A 1FSGA 1SHZA 1ZIOA 3B9PA 1T6ZA 2J30A 2BW0A 2PBRA 4R16A 4RAOA 4EUKA 4YHHB 4J0FA 1ULBA 4TQ9A 3X1YA 5JMTA 2HWXA 1MOSA 5TQ2B 1K66A 4OHFA 2D3TA 5AVXA 2C07A 3B1JA 2ORIA 3PVZA 2O1SA 1JNYA 2QX6A 1TVMA 4LXUA 4RY2A 1EVZA 1QYIA 3H1TA 2HRZA 3I6QA 1P7ZA 1J99A 2OPBA 2VYVD 3FN4A 3ZW8A 5IBQA 3PE3A 5KIAA 4IR7A 4DNQA 1CJSA 4RAQA 3N8KA 1NLUA 3IVRA 4LC9A 5E7JA 3NP9A 1OLSA 2W98A 1S3IA 1RM3A 2A2ZA 1ZCJA 5BSGA 1UAYA 2XQGA 4LJLA 1YL5A 3KDPA 3EA0A 4KXXA 4KC0A 4QYIA 1NR1A 1USWA 1ZH2A 3FDIA 3RF7A 5IHXA 1K3UB 2ANBA 3M6IA 4V0RA 5HX7A 3HJUA 5F52A 2D74A 2B1IA 2HWWA 1ECPA 3WP1B 3K9CA 5EJAA 3ESYA 1A9RA 2RAPA 4LUCA 5F2EA 4AP6A 1OYOA 4LJ9A 2WDZA 1UBCA 2CK3A 2V59A 1KJIA 3QW2A 3TB6A 2Y66A 4I8DA 4E22A 4TYPA 1DG3A 1TYAE 3FF4A 2PCLA 1QE5A 4X6LA 3MJVA 1P5FA 1E7RA 4ACBA 4K6HA 1QNLA 1IAQA 3VNQA 2YASA 3GNSA 4TQGA 4C7VA 2B4YA 3NT4A 1H1LB 1O5OA 2VJOA 3NIDB 1E2EA 4C22A 1VB3A 2HRBA 4P82A 2H11A 1E8MA 1NR5A 1TRHA 2VQ6A 3GRYA 1GLNA 3F5MA 3LT2A 5C52B 3PGLA 3NWEA 2IU4A 4NU5A 5CVDA 4I3HA 1K6IA 3MWEA 2CC2A 3VOBA 2VHVA 3R6GA 1EX6A 4BB0A 1AE1A 2ZBUA 3U19A 5U1PA 1QOPB 2IITA 1NIPA 3FWPA 3HZZA 1VHLA 2JL1A 1ENYA 4G5QA 5H3HA 4LGCA 4OQLA 4DCOA 3BBLA 3DMYA 2UUCB 4FLMA 5HIAA 5JSZB 2ZULA 2BEUB 3ZJYA 2Q6KA 4NWIA 1QAOA 4ZA2A 3RJMA 4PZYA 2WYOA 3UKDA 4M54A 4KQWA 1JEQB 3WLKX 1SCNE 4ZOEA 4CHTA 4BWGA 1NXOA 3P5SA 4LYDA 3TLJA 5LQUA 1DC8A 4DADA 1BMQA 4YUAA 3VNUA 5KNBD 3H18A 3JQPA 3LRPA 3S6JA 3K9LA 1DX4A 4HGNA 3F90A 1TJ4A 1J0BA 1RM5A 2UYOA 3AEKB 3BMCA 4MRMB 4GM4A 5FRDA 4AX8A 2J6HA 2WU0A 4HLNA 1EX1A 5JY1A 4J94A 3J81A 1MFPA 2RHOA 1N0WA 2K4MA 3WX0A 4KQJA 2DLDA 4PR3A 3LLSA 4O1MA 5B1HA 3L0OA 4DLBA 3JYQA 4UDXX 1KH2A 4XVUA 2P8SA 3DL7A 4RGQA 5FULA 4KQ6A 1EE1A 1VLQA 2KMLA 1FXUA 4QGHA 1E3QA 2NSHA 1QIMA 3PZRA 3SQNA 1TAUA 4BUZA 1LNZA 3EMVA 4EVRA 1E8DA 3RYIA 4HAVA 3GLUA 4UBLA 3SJCA 1OFUA 3RC3A 1OFIA 2WG0A 4AN0A 3RUDA 3KKMA 1UBHS 2DBZA 2DE0X 1X77A 1XAGA 3MQFA 4XD2A 3WBFA 1F2DA 3E03A 3OE4A 5TMPA 3K4PA 3U1TA 3KQHA 4LN1A 1FXSA 3LWDA 4ERNA 3EK2A 3F6EX 4R6WA 4TM8A 1KO7A 2UYCA 1XQ6A 1QCCA 5HDQA 1XD9A 3A28A 1PQPA 4W7HA 5KJ1A 3H17A 3O94A 5DXFA 2H17A 3ED1A 3AFMA 3SE0A 4EUSA 1ZN7A 1P61B 2IS4A 3I4FA 1L3BA 1Q83A 2CCJA 1S2OA 4KHZA 3G85A 5J1TB 4TSRA 1RBQA 1YZVA 5C5DA 5GGXA 3B1FA 3ZDXB 3BXOA 1WQ1R 2WJIA 1PTKA 1XJ0A 3GFTA 3CNLA 1NVGA 3MJSA 4RQAA 1A96A 2VDWB 1WCIA 1ZD9A 1XVIA 1BDHA 3JWHA 4UJ5A 1NVAA 1X19A 1AQYA 2FPLA 1H2WA 2Y68A 3DYBA 1TDJA 4H7JA 3UT6A 2EX4A 4TYNA 4MWEA 3QKTA 2E49A 3RYCA 1TU3A 1ZK4A 1GNPA 2RI6A 3K2IA 4HNRA 4BCDA 4LK2A 1SUEA 2FX3A 4PLVA 4JAVC 1UWVA 3H2HA 1AKRA 1DU4A 1NHWA 3BCRA 3RVSA 4AJKA 4RJLA 4HZGA 3RRFA 4BZXA 4XRRA 2P77A 2BGNA 5K4HA 1GILA 1AKQA 1WJGA 4YO7A 5CG1A 5TC4A 4Z86A 4MPPA 1I3OA 5LP6B 1T8WA 4PINA 3IQWA 1Y8QB 3C7TA 3T5CA 5LU8A 1YCDA 1UQUA 2UZIR 1GQYA 2I33A 5ALHA 2P30A 4B84A 1O1YA 2GK3A 3KZKA 3E48A 5KU7A 3ROGA 5DB4A 5ALOA 4JP2A 4MUXA 3WSTA 5ENZA 1O57A 4JLSA 4XI9A 2WD7A 3ZCXA 5MF6A 1WIWA 2J0QA 3RBAA 2XTMA 5C35A 4CEHA 1U1IA 2GYWA 1WVGA 1QO0A 1XPOA 4CXMA 3IV7A 2PLRA 1OZHA 1EDOA 4HDOB 3GQBA 1C1DA 1YL7A 4TVKA 2QTHA 1TKAA 4RQBA 1BA2A 1GZ7A 2PG3A 5AOBA 1U5BB 2HWYA 5CDFA 1T5OA 4JYPA 3IO5A 2EKBA 4KSCA 3K2BA 2PUDA 1KJZA 3LY9A 3AIOA 4XLTA 1PYOA 5BN4B 2EXXA 2XZTA 4DBLC 1JIIA 4NYJR 2H1FA 4F9EA 1VSBA 3G8AA 1VPLA 3QUCA 3UPTA 2VUIB 1LX6A 1TYCA 2IEZA 3DT9A 2GPBA 1WKCA 3LX5A 4MLZA 3UWOA 4H31A 2HUNA 1ZC3A 4OMFG 3ZI4A 2F3SA 4XCXA 2HAEA 2UYGA 3DMDA 3DDWA 3LPAA 3IESA 1M54A 3AKYA 4KAFA 1H4QA 3HPQA 1CUJA 3W1WA 2PX5A 2QUIA 4LDRA 4PVCA 2HFKA 1MQ9A 1J9EA 1PBTA 5SYAA 4Z54A 4J0CA 2A0XA 4UUMA 4X8LA 4DZZA 1EFPA 1OTHA 1ZOPA 1OZGA 2A0FA 2GD6A 2JFOA 1EFRA 4MV8A 4A27A 3BB1A 5C46F 4UEWA 1U02A 1P77A 2OG1A 3H7IA 1NULA 5HUQA 1RI1A 3OPXA 4YAJA 2EJWA 1F4LA 4M0KA 1O6BA 5E6SB 3FDJA 4DR4B 2AN3A 5I5EA 1R8QA 5HBGA 3W4JA 6AT1A 5GPBA 3G02A 5JS8A 1YS1X 4PGAA 4X6UA 3WGVA 4F5YA 4WKOA 3SIRA 3U26A 4Y18A 4Q4JB 1X1AA 5COBA 2IHYA 2H7XA 4UW9A 1OT5A 3DTVD 5FPSA 5CD9A 3EXEB 2E5WA 4QVKA 3QYJA 2AC7A 1N3YA 5AJVB 3AUAA 5LU9A 1G21A 4L7VA 2FK7A 4FOLA 4D1YA 2NZ2A 1R64A 2WZCA 5JD5A 2O8CB 1NV9A 2W6JA 2XMDA 4QARA 3WKCA 1F20A 1RP7A 1Q0TA 1B6TA 5EGNA 3P4UA 5T4BA 1PS0A 1E2JA 1AUXA 1Q1EA 1W85B 3K1AB 4N5MA 4DANA 5K5EA 1E1QA 2XD4A 2FMUA 4Q1CA 1LNSA 5G0WA 4Y6QA 3ICPA 3CN9A 3GD5A 3HJRA 4BMOB 4IIJA 4ARBA 1U9JA 5F64A 3HN7A 4EZIA 1CPYA 1JAYA 2O59A 1UH5A 1IQ0A 2C83A 3FGOA 3IXLA 5KVAA 4I55B 1Z5UA 1JFVA 9GPBA 1Z39A 4ARVA 3AU8A 2IXDA 5KOJB 1IBSA 1O94A 1M66A 3N8HA 3LHDA 4IBOA 1WE2A 2A0UA 1SGWA 3LDAA 3N0VA 4YV2A 2ZBRA 4NMXB 4MCIA 1MJGA 1QGDA 1Z17A 1S0UA 3H3FA 3R6TA 1WG8A 3SDZA 4EIWA 2AR0A 4IGKA 2FQYA 3BFXA 3D5QA 1UZNA 1FP4B 3G8BA 2BRUA 3A2LA 3G7UA 3L04A 2EVWX 4W8GA 4YI5A 3KB6A 4PC3A 1M10A 2H1WA 3NUQA 1ND6A 4OQQA 3NCHA 2I7VA 1Y34E 4WFIA 2C88A 4DE5A 2VJLA 1YE5A 5M7EA 2P4HX 2XDQA 3IVAA 5CBPA 2Q8PA 3IPRA 2QUHA 4JFRA 2W0MA 4M1YA 2XCOA 1JHYA 3K94A 1BHSA 1T0IA 1A4IA 3AO0B 2GBCA 4LVUA 4QHYA 3S29A 4W9MC 2VYVA 5BWNA 1DKMA 4EHNA 1GTMA 3M33A 3W3AH 4IJ6A 5I9LA 1TKRA 4Q4AA 2VXOA 3KE8A 1OH6A 1FY2A 3E58A 1Y1QA 5LZ7A 3EE6A 3B89A 4GP6A 2I6FA 4ZT3A 3DDHA 1BJTA 3FVVA 3IVCA 3KOXA 3OZUA 3QUSA 3IP3A 4JASB 4NVRA 1L7AA 4ZQEA 3W2IA 3HDHA 3EPJA 4AFNA 2F62A 1X9IA 4YBRA 3MEQA 4RD3A 1RMYA 1B23P 4RPLA 3IDFA 1H1DA 1P8JA 1VCHA 4JVSB 5DM1A 4E7PA 5A0TA 1R1DA 4PV7A 1JSLA 2AFIB 4HYQA 4HWOA 3NHBA 4MQUA 3CEPB 4B75A 5D00A 3WWPA 2CLOB 1A2OA 4BP9A 2ERXA 4NPAA 3T3DA 1D07A 1C5KA 1X2BA 2YVUA 1H2ZA 2FEAA 4U8GA 1BXGB 3MCAA 1DAEA 4X97A 4BNWA 4H3VA 5TR9A 2Q9CA 2BHRA 4GDFA 1X1TA 2DECA 3OU2A 2QSUA 3PX3A 5PGMA 2OZLA 3OKFA 3SM3A 3Q87B 1SQ6A 1SHLA 4CUZA 2Q3JA 4FZRA 4Q7MB 3K9BA 3FOCA 3JVDA 3QE4A 4OHWA 3CX4A 2AC4A 1ONNA 1P9WA 5E95A 1FUYB 1W93A 3PXXA 1OIWA 3GDOA 3EZ7A 4V0ME 4DUYB 2G71A 3B3FA 3QLVC 2BGIA 1XCJA 1MNQA 1ODIA 3VPDA 1EM8B 1KK3A 1YGYA 1PWZA 1QYXA 1XDUA 1WEHA 2LRHA 3U4QA 1KMHB 3TOXA 2WF5A 4HGYA 3E27A 3LVRE 3BFPA 1D9ZA 4XEUA 4ZREA 5LYYA 3UGQA 2XNSA 4DLAA 1V47A 4G5OA 5JJIA 1JXOA 3SIXA 3RBVA 2B9EA 4R1OA 3UG6A 4A8PA 3BYZA 1LDEA 3HB9A 5SZIA 1IONA 4HDKA 1SXJC 4MQFB 4KDEA 5KNBA 2HLPA 4EDFA 1I10A 1N2JA 3ZY2A 1M7GA 4YB8A 5AR1A 3A9UA 1A9YA 3FMOB 4P4TA 2HWKA 3OQPA 3UK2A 4Y2QA 2X8BA 1D2MA 4N3NA 3K16A 1EE9A 2YNMA 4U7WA 4EGFA 5K20A 1PV2A 4S1OA 1ZI6A 3ZKWA 1O95C 1ZU5A 3JX9A 3ETDA 5FKJA 3ABZA 4EAAA 3LCCA 2P3OA 2XMZA 3WJ1A 4QXOA 3DVAA 3GI1A 4S2EA 5ALSA 3USZA 3VKGA 1PJSA 4J2HA 2KSQA 1L7XA 1T5DX 4V1CA 1YK1A 2O8NA 1VKOA 3GX1A 1Q84A 5KJCA 5JJLA 3ZLJA 3D5EA 3TUJC 1ZHOA 2JI7A 3FCUB 3NEAA 4ILEA 1SUIA 4YRIA 1T5LA 1R4MA 4FYHA 3W90A 3GJ8A 3KNZA 4OQXA 5LLDA 2HA0A 1OA1A 2SICE 4QPDA 3R77A 1KK1A 3LT0A 3NNDA 4YUZA 1M1YE 1IOLA 1JAXA 2JFYA 3A6ZA 4PE5B 3Q72A 1M9NA 3PU6A 1OKKD 1G20E 1TCAA 5C31A 5EMNA 3U09A 4X1KA 1X7DA 4MV4A 3OBIA 2AH5A 3WIEA 2WIDA 5A9SA 3OWHA 1I3CA 3WXMA 3UWMA 2Z98A 3ZJ4A 2FFBA 1USUA 2R6CA 1B2LA 5EP2A 2P9TA 4EB0A 2HGSA 4OBWA 3O8OB 3Q11A 1R12A 1BCSA 3JQBC 4Q39A 5KYTA 3B82A 3H1PA 3T0IA 4EZBA 1C3XA 2PL3A 3CINA 1T0BA 2I1QA 1IWBB 1JTVA 2FN9A 5H83A 1AN0A 3RSGA 1YJAA 4E6EA 1H0KA 4C14A 2KWIA 3BFKA 3L8EA 5JPIA 1YCGA 2GH1A 3HXMA 4E14A 5T8KC 5CXUA 2JCVA 3T9AA 4A0GA 4B2PA 2OCKA 1QYCA 2E9SA 3AF0A 4GLLA 2VCEA 3BGSA 5FUQA 3F2VA 3ZE8A 4MMYB 1V8FA 1VI2A 2D13A 4LJ5A 4S3MA 4WMLA 5I7WA 4QQFA 1R8JA 1JDJA 2FUCA 4RF3A 2HMAA 4C0JA 1CQWA 2R751 3UYKA 2B61A 3NOVA 1GUYA 1DFGA 4OIMA 3VU3A 5FH9A 2XA1A 1W87A 1DP4A 3LXUX 4D5GA 2I4TA 3JQFA 4RPKA 1JQLB 2B4QA 4QYXA 4C0LA 2CLMB 2DHRA 4LC1A 5EZSA 1QFSA 4F5WA 3CLUD 3WDKA 4Z0NA 2Q5LA 3OO0A 2A7QA 1IBCA 4MRRA 4QO7A 1EBUA 3N75A 3GJ3A 4V3CA 3VTFA 4PC1A 3O7WA 4FFLA 4BO9A 1M6VA 2VPWA 5I47A 1SG0A 1H2EA 1WDLA 1XZBA 4JT2A 4MPJA 2C1EA 3NWPA 2VJKA 1TPZA 1EMDA 4RK6A 1QX4A 1HTTA 5IAEA 3GRAA 3FDFA 1HZZC 2PGOA 2VSYA 3ZV3A 2EYQA 2Q6LA 4FOPA 1L4YA 1Z62A 1L7QA 2OTCA 4XIFA 3WKAA 4US2R 4K0KB 1YIDA 3RYHB 2NZVG 3QITA 4MQBA 4JT8A 3TINA 5J2TB 4WFJA 2HJGA 1LK7A 2DWPA 3BJMA 1HSZA 4O63O 1UBOS 5KOHB 2H2FA 5CPFA 1I13A 1J2EA 2ODEA 4MARA 3PFWO 5IDXA 3GLFE 4BFUA 3LIPA 4GI5A 1K0UA 4X92A 5FNZA 5BVHB 2B4AA 3OI7A 1SEPA 1AKWA 2JPDA 4LQDA 2PZ8A 5AUQA 4OO3A 4I81A 1QUFA 3V42A 1KP9A 3LY8A 2QPAA 2VP5A 3CUSA 1NVKA 5BNZA 1AN9A 3LNTA 3OM0A 1A76A 1U11A 1N0HA 3UXHA 6NULA 3UJHA 3SC2B 4CN9A 3PF8A 3WLSA 4HUTA 2FW7A 3EGIA 5ETJA 3SC6A 3TX2A 3GAAA 4ZTZB 1JVSA 3Q1LA 1JR6A 3OG9A 4RTLA 4A73A 1DAHA 3SIPA 1KEEA 1E66A 4KXQA 5TLSA 1OXBB 2WNIA 5AKLA 5BT8A 5CJ2A 4GKJB 5KNCH 3GCDA 2CDCA 4I1VA 1C8BA 2PMDA 1QF6A 2ZTSA 1EU1A 2HX1A 4TTRA 1J0CA 1NN0A 4HDMB 4U7HA 1G291 4FGKA 4Y7DA 3HA3A 5CCXA 1X1SA 4FFBB 5GV7A 1M1YB 3BCUA 5C3UA 5GWXA 3AM5A 3E05A 1J9GA 3G59A 1XQVA 1G20B 2YQ4A 2RGCA 2XNDA 4LX8A 3IE1A 4AO7A 3IHLA 1P17A 3DTVA 1FTQA 4YWHA 2GNAA 3OECA 2OQIA 3PNYA 1JAHA 3IP7A 3PTZA 3GIWA 4DA9A 1ZQ9A 4ENUA 3SBXA 4ETMA 3QYFA 1TMYA 2R68A 4WNCA 5B7GA 3DAFA 4KXNA 4ETIA 2QJTA 1IHYA 1G8SA 2ODNA 3ID6C 4H3HB 4KE6A 5AO9A 2DFDA 3ZLVA 4TMXA 2PO5A 1IN4A 1XD8A 1ZIDA 1UCFA 4B4OA 1G5PA 1YDGA 4JKOA 4TYWA 2CJWA 3LCJA 1NFFA 2AEFA 3GGCA 1XK7A 5CX4A 3AILA 1ULAA 1LD3A 3N74A 2BCJQ 1L1FA 5B53A 3O75A 3BMXA 3NRBA 4JKYA 1S8AA 4R8SA 2WB2A 4EI8A 4YY3B 1QO7A 2A0KA 2P9JA 3DDNA 3C1UA 4MV5A 2GZ2A 1C30B 1TUIA 3OIDA 4J1TA 3ITKA 1IN5A 4I5DA 2B78A 2VWHA 1TPYA 1E20A 4J9UE 1EXDA 1BMFD 3COPA 1KY3A 1LPBB 4MKIA 1JAIA 1UMDA 1AS0A 1B1CA 2LKCA 3EVTA 1BKSB 3WNVA 1SQ5A 4PGFA 4EYSA 1DKQA 4WD3A 3ELUA 5AOVA 2F64A 2IEYA 4G56A 2DQKA 3G9XA 3GT0A 4EPXA 1WA5A 3BHJA 2AKYA 3BTVA 4KO3S 3KO8A 4U2CA 1OXUA 3RREA 5CAEA 2GRUA 1CQJA 2CBXA 3FNBA 3CGWA 3NG1A 3S2FA 3PG5A 5L9AA 8MHTA 1SPXA 4DBZA 3LXRA 4MRNA 1QQ7A 1NBMD 2VZ8A 4W1RA 5KKNB 2BFFB 2C84A 2FNAA 1CERA 3IUNA 5G0TA 2PXCA 4F1KA 1FK8A 4YAOA 1J39A 2QG6A 2VP3A 3Q8XB 2ZM5A 2IHNA 4W5RA 2X0NA 3O3OB 1EFTA 3OTGA 5HCUA 1EEHA 3ZIDA 1YC5A 5AW6A 5IAGA 2W70A 4YCAA 3T7IA 3GLFB 2JIPA 4R0VA 3JRXA 1ITZA 2VYCA 2HO4A 1RWPA 4WNAB 5FDFA 1F3LA 2WV7A 3L7OA 1UP4A 3A25A 1Z6TA 4L15A 4B2LA 3TZ6A 3RVPA 4OI0A 3D3QA 1XBTA 4FC7A 1VJGA 2OD2A 2COKA 4TKVA 4TX1A 2YJ5A 3VZRA 4CKCA 3RH0A 3C3XA 4C6SA 3PD7A 3FSGA 2Q4OA 2XMPA 4UREA 1CQIB 5E6UB 5AXDA 4N12A 3T3EA 3V8RA 3T3NA 2QXTA 1KFBB 5AW4A 2NVUB 3UMRA 3BPSA 2QRMA 3AJEA 1N2XA 1QU2A 1A2KC 2QX7A 4C2BA 1D09A 4C4SA 4DCTA 4BFZA 4UVGA 5GMOA 2GAFA 3HO8A 1KO8A 4AY4A 2P11A 4H1HA 3O82A 2VQFB 4TROA 4G0VA 3D4OA 2GB4A 5H4HA 2IP1A 3NHZA 4QDJA 3WGYA 4KK4A 3EH1A 3HWSA 1DUSA 3OQOA 3IBSA 3HRIA 1JU4A 3LXXA 3DP9A 3N1UA 5TE9A 1K68A 4BBZA 2ERCA 4WCFC 3LC2O 3OCWA 1JIVA 2JHFA 4RFVA 4KX3A 1D2HA 2E55A 5IFKA 5K45A 3FOAA 1RT9A 4JY7A 3QVJA 4AQ7A 3L7JA 1U5CA 3FETA 1N5JA 1ZD5A 1AGYA 3CZ9A 3THYB 4MJXA 3FNQA 3I45A 3P2JA 2FUKA 2ZM6B 2E4ZA 3KSBC 4N01A 4P2BA 2FP4A 3OE7D 3RHFA 3UQZA 3ZHUA 2HSEA 5HCNA 1XLTA 4ZVRA 2RH9B 3G0GA 1DEHA 4QOEA 3SJUA 4EMTA 1HR0B 3R41A 4JBIA 4ME6A 1I3LA 3N5CA 2JVKA 5IPFA 1Z0SA 4Z9XA 3AVYA 1NQTA 3FE2A 4AWAA 5C8ZA 5ICGA 1E1RD 1NJFA 2HHAA 2BJHA 2NO0A 2QZ4A 4KR3A 1Z18A 3QIAA 1D9XA 1NRJB 4R7ZA 5B3JC 3M89A 1TEHA 3Q8LA 2R5FA 1P91A 3M6UA 1O9HA 3O26A 2J9YB 4J1QA 4LWQA 3VOAA 3AY7A 2HV9A 2NU8A 1PZFA 3UENA 7GPBA 4B31A 1PSZA 4UE3S 2FEMA 3PWZA 1B6SA 4RDCA 1NX6A 1SCBA 2X2PA 3DHYA 3C6KA 3QY9A 2N3ZA 3MTIA 4LNUA 4OUDB 1KKLA 1GPDG 4RETA 1OKKA 4XW2A 2PUWA 3HCFA 4E1AA 2P9HA 2Q3FA 2ZPUA 4QBIA 2DQZA 2ZRGA 1EVEA 1QKJA 1L5HA 3OEWA 3HCRA 3AF5A 4NONA 4IINA 1DWQA 1NYQA 4BE4A 1LI5A 2VTVA 1CDDA 3MYYA 4P35A 3WRWA 3BRWD 5AKZA 3ROMA 3OP1A 2DTEA 4UNPA 3DEIA 3KHUA 1FQKA 3VU0A 5JDIA 4YT8A 5ECDA 5B6IA 1RFLA 1Q1GA 4ZVMA 4C6HA 4LCBA 4OQZA 4YCNA 4ZK6A 1V4BA 2PXAA 3U16A 3ROEA 1MD9A 1PEDA 2FG7C 3F5FA 4DDMA 4UUOA 3OEHA 3NLLA 2QYTA 2X6QA 4XYGA 5GAJA 1LSSA 1X3SA 3RC2A 1H5NA 4RKRA 4BKRA 1HMYA 1ZD8A 5JJBA 3R24A 2ZIAA 1K4YA 1I2AA 1VPTA 1WMBA 5CT8A 1E58A 3FUWA 1RJDA 4FWIB 3TBFA 5KVVA 2OOSA 3KBOA 3OUZA 3Q5EA 3WWEA 1X0VA 2Z2ZA 3PKZA 3NEPX 4YMGA 1JS1X 3BDVA 2W48A 3DZCA 4XDHA 3ZEIA 1OBHA 2ZKLA 5LB4A 4JUIA 3LY7A 3W7BA 5KWEA 2HUPA 4C29A 4AY6A 2PSDA 1QH1B 1ZMTA 1ZLXA 2HK6A 1TB4A 4HX9A 1I9GA 1O4VA 2Z8ZA 1II8A 2UYYA 3FM9A 1EUCB 2CT8A 4KH1A 4PY2A 2CYAA 1KFKB 2AB0A 1IXSB 4NBKA 1MUUA 4Z53A 3L7BA 2R86A 2WKSA 4N82A 4QREA 2BKEA 5KZMB 2HCBA 4OY3A 1PR0A 3N70A 1Z29A 4C30A 3J7AC 4BTLA 3K6KA 5EC8A 2XNJA 3DFKA 3P9NA 4Z4FA 1HE4A 2PWZA 3ZYCA 3JWEA 3G2QA 1PEKE 4XR4A 1Z4LA 3V8PA 2YZMA 3DPUA 3JZIA 4G2NA 2ZI3A 3RWBA 4CHGA 1MC5A 4FEAA 3RS4A 2GCEA 5DGHA 4EHIA 4MWTA 2QE7A 2PPLA 2GESA 3ESRA 2JGMA 1IJKA 2C5FA 2EJUA 5B1IA 3HV0A 5BOSB 4M83A 3A10A 1XV5A 5KKCA 4PZLA 5ADUS 2YWFA 3D2BA 4MS4A 1EK6A 5CA1F 1CNFA 1MTZA 4TKMA 4M21A 4LEIA 1JXAA 4S1PA 4EW2A 1D2CA 2QZ9A 3V3TA 1QLHA 3PNQA 4DM7A 2YCBA 4GRAA 4DR5B 4WW0A 2RGBA 1QGAA 2GJ8A 5BT9A 1OFHA 1QRAA 2I7TA 3NNNA 3ZOZA 1QOZA 4D9EA 1JHQA 4KTTE 1QG4A 3P0JA 3CRVA 1EP9A 2V7UA 4HQNA 3TIFA 2HOQA 2QTGA 4QECA 3AB7A 3GFSA 2KLBA 3BXHA 1DCMA 3G9TA 4MPTA 1ZMRA 2A0YA 2BEVA 2XHEA 3KG2A 4GGPA 4RVDA 2AQIA 3WZ2A 5C8YF 3OCJA 1SQ0A 2QN6A 2WSSD 4LW8A 5D8DA 1P2FA 2W6NA 3MTDA 3LI2A 2IP4A 2QJFA 2A8YA 2B2XA 3DE5X 3O4IA 2OZPA 2NO7A 5G4LA 3L7KA 1Z0DA 5DF1A 3PDCA 4D46A 1RRKA 4B09A 1IOWA 2LZ0A 4DDTA 1KZ4A 4JT4A 2DSTA 3SOZA 4DA4A 2OAEA 2NN3C 4U3JB 2PT6A 1QV6A 4HNSA 4DV6B 5E1MA 4LKRA 5B37A 4FOOA 3D6FA 1XXHA 2WJHA 3U5TA 4GFDA 3P9IA 2JAWA 4Y2HA 1V9SA 1CP3A 1SFRA 4OL9A 3ZQKA 1PR9A 1UPTA 3KOYA 4BLOA 3L7YA 3VR5H 2B30A 1XTSA 3JPWA 2MYUA 4MS3A 5ECGC 3DLCA 4M49A 4UXIA 1IOVA 3RFUA 1V37A 1J56A 3MAAC 2Q1SA 4BUCA 1HURA 2C4UA 1CIPA 3I2FA 3IX7A 4FT2A 4UAUA 2AGVA 3RWMB 1T9CA 1SCUB 2QF7A 4JCCA 1E5TA 1WO8A 2VXYA 4QNNA 4Y8VA 3ZR4B 2IY8A 4JROA 4ZT2A 4U0KA 4X62B 3ZWBA 4KBYA 2PYDA 2HWUA 3R4VA 1TCUA 1BMFA 2WBLC 4ESHA 1CS0B 3ES9A 5HG0A 3N76A 3FLAA 3V2HA 1T0JB 2H1IA 4PPNA 4LJYA 1C1XB 1XZAA 3IDZA 1HBJA 1NC3A 2OBLA 3HN6A 4O0LA 4HVLA 5H70A 3G68A 3KQUA 5J59A 2DP4E 1DTWA 1M8GA 4XVQA 3FPEA 3MFYA 5C2JB 3OM8A 5HIIA 5JXJA 1A4RA 2YIMA 4LZPA 3ANNA 1LSUA 2Y2VA 4HNAB 4BDSA 4PFKA 5IXYA 2B1RA 4GXRA 2PL5A 5CLFA 5IZCC 2DTDA 3M5DA 1E3WB 3LLVA 1W73A 4FMCF 4EF4A 5A02A 4FSHA 3ONVA 4MWCA 1XU7A 2QP9X 1RCTE 4UBJA 4ZDWA 4D9GA 2ZJYA 2QBYA 1DCKA 1EXMA 3HR4A 4ZZIA 1XR3A 4KO2S 3SVLA 1QIDA 1GTRA 1JG7A 1M0WA 4BIIA 3GLIE 1BMDA 1XTJA 2BTEA 1VMDA 1QAMA 3U44A 4MINA 1ZR4A 1NW6A 3LL7A 1OAOC 3ZDQA 3CMCO 3ZQ6A 2UZ0A 2NV2B 3MC1A 2FZ5A 1F1JA 2HBRA 2CDRA 4D9BA 1XJWA 4F5DA 3PR3A 4UOEA 1XYYA 4DZRA 1XCBA 3IT2A 2I8LA 3FJOA 1KI1A 4BX9A 4A4DA 4TN1A 1JR3A 1JMYA 4BE7B 2MT9A 4FQ7A 3OFND 1WNFA 3WY9A 3IQXA 3GAZA 5DKFA 3DQPA 3ENZA 4Q7KA 4YJGA 1JLLB 5F33A 5HHTA 3EJWA 5JNLA 1G3QA 4MWGA 2G9ZA 2FSSA 4K9KA 1FRQA 3PJFA 3I6ZA 2BDUA 2X0KA 4KFTA 3WO0A 5HGXA 1G18A 2DAPA 4OJQA 4FCTA 2GOYA 3DE4X 4HLQB 4R8RA 3EC7A 1QHSA 3TTTA 3A0UA 5L3VA 2CMFA 1K88A 4JP3A 4ZI7F 2JFVA 1DCTA 1W19A 5KTMA 3VZBA 4F2DA 3A6HA 1JHXA 2SHKA 3J81k 3AHGA 4L8VA 5AUPB 2GZRA 2AOTB 3FPCA 4PWYA 2D2EA 2GNOA 3T61A 3LW7A 4IG9A 2JI4A 1L9XA 1P6UA 2RC5A 3LUPA 2GAAA 3CVOA 4LZZA 3ZCUA 3S1SA 4P7FA 1CF9A 3WLOA 5C4MA 2WFLB 1ZM2A 2GEVA 1JHRA 1JB9A 2G0AA 1SKQA 2ORWA 2PL9A 4UHHA 1VG8A 4MEAA 2IPXA 4I4LA 3K0HA 2O8EA 3THOA 3STYA 1IUKA 4C0AC 2REQA 2HIHA 1QK4A 1X7GA 2WVGA 3ASYA 3F9CA 4FDAA 2ETVA 3UCEA 3OHMA 1W94A 1T2NA 3CR8A 4LZLA 4GP9A 1CK4A 5J4LA 1O6GA 2OB2A 3L8DA 4GVXA 4YJDA 5GONF 2V6GA 2RB5A 2N1BA 3KKNA 4UDNA 4WY2A 3T7KA 1C0IA 2FQWA 1NZDA 3EZ6A 3UTCA 1MRNA 1GPBA 5BSMA 3TUZC 1DRWA 4CMEC 1WXDA 5EWJB 2VP0A 1PV1A 2COEA 3Q0EA 5AVOA 4MIKA 2LPMA 1DV1A 1W29A 4EEKA 1YZKA 1H2FA 1ZP6A 2BBOA 5G2OA 1GG2A 1JTEA 3A31A 2QRLA 3QHAA 2C03A 4HH3C 5A06A 1E6MA 1FEZA 3CLRC 1J00A 1TM2A 3I01A 3AYXB 1TQHA 4MV9A 5BYJA 4L9SA 1HSOA 3IJPA 1U7PA 1U0NA 1JNXX 1E9EA 3NETA 3UUEA 5ICCA 1O0CA 2QTMA 4BMZA 3HKBA 4IV8A 2OGZA 4EGSA 4WCDA 4H1WA 5IF9A 1OROA 3DBVO 3ECAA 3UA3A 2G1KA 1LTQA 2XDAA 1BX1A 5C0OE 3GBVA 4F38A 4KIWA 1PFKA 4ZYXA 5A3RA 3W8EA 3NTOA 2FZ4A 4EMSA 1Z26A 1Z22A 1L5RA 1RHMA 2BT4A 4FE7A 4LZWA 3PYLA 5TQJA 4RTSA 3ELDA 2ZS7A 3S7ZA 2XTNA 5C5IA 1JJIA 4JXKA 4YASA 3P8ZA 5KREA 5JAPA 1GPUA 3H7AA 4W8OA 1CYDA 5DCLA 2FPGB 4TMYA 1ADJA 1BXZA 3HDGA 4X1YA 3Q40A 3GLGA 3UPDA 3U49A 2BI8A 4YDQA 3IXQA 1RMQA 4BL5A 3FPHA 3JZMA 3VPBA 1U0EA 1TECE 3BL5A 3UXMA 1ODJA 4ALKA 4O2AA 3GLIB 1MHTA 1JALA 3FIUA 3OCVA 1CE8A 3LGSA 4LJKA 3DEJA 3PNMA 1IUPA 2Z6VA 1S2NA 2A1IA 2KJQA 2UZAA 1LPOA 2JFNA 3LA8A 1MGPA 3P2EA 3ZS9A 3A4IA 4O4HA 2X7XA 2W8BA 3I5MA 3O7MA 4HPJB 4RHCA 1M67A 3BB3A 1CJUC 2J0SA 3DA8A 3W1VA 5J2UF 2DPXA 2WIBA 3KQNA 4Q4CA 4E31A 3WGGA 1TJ3A 2K87A 3TLYA 4A23A 4D9HA 3PYMA 4D4GA 4G65A 3UJ7A 1SKYB 5D2CA 4NDAA 2D2FA 3BQ9A 4NSNA 3SLRA 1KI8A 4R7GA 3RR2A 1XMSA 2Q1YA 4RKFA 1ZUNA 2L17A 2V3CC 5F78A 1H22A 2F1IA 3MBKA 1ORHA 1Z5NA 3AETB 3MMNA 2VWPA 2H92A 4BQQA 3EXHB 1KVRA 1P45A 4QTYA 1MDFA 3KZ1E 5HJEA 1U0JA 4CL2A 4BX0A 1NAHA 2GVNA 1QS0A 1XOIA 3C8DA 2FW0A 3AI3A 4OGLA 3K0EA 3THRA 1WDKA 4URVR 2NW6A 4DMMA 4GOXA 3VR1A 4WADA 3BMOA 2BGUA 1O6ZA 4PG4A 2C5HA 2ZRPA 1M1UA 1IL0A 2XRZA 2PMWB 4DDUA 4UU7A 3PS9A 4PG8A 1NUHA 2HY7A 4YIHA 3TF5A 2M98A 2QY9A 4EB6B 2XAAA 1I5EA 2CFRA 1RKXA 1ZXLA 2MSWA 3QVMA 4MVJD 4ZAWA 1P19A 4NV3A 3V4RA 3DDCA 3K72B 1A3CA 1DRJA 4MI1A 4MKGA 3FVTA 4WKBA 3N2KA 3QUQA 1V3UA 4BFTA 1YS6A 3VR6D 4EHJA 2OHFA 3FSJX 4ZQHA 5BR4A 1WHSB 2NTYC 2Q7XA 5DHUA 4PSKA 3R9WA 4I5EA 2VZLA 3IL2A 2X4DA 3FLBA 2DQSA 2WABA 4ITVA 1ULZA 5EJ8A 1ZHFA 2E3JA 3MXOA 4I4TF 4XUCA 421PA 1PWYE 2O6HA 1VI6A 2XDWA 4HNQA 4GR9A 4PNEA 1YRWA 1LPNA 1Z28A 2O4UX 3BREA 4IM7A 3VJMA 4BASA 4DPLA 5KNDD 3PF9A 2WSSA 3QV1A 4HNGA 3QOXA 1Z0JA 2G40A 3K1YA 1IPFA 2JS7A 4CTMA 3DE0X 3WMXA 1NUQA 2FQQA 2QU8A 3WLIA 4ID9A 5FWXB 5L8VA 4RCYA 3KYDA 2IF0A 1O95D 3IOCA 3QG5A 4H1TA 2P90A 3L0DA 5DHPA 3V4OA 4IFIA 4UOZA 3AL0C 1MABA 4NBSA 4R2IA 4RSMA 2C2XA 1D6NA 3WK7A 1HXHA 2DUMA 2OSVA 1TRKA 2D0DA 3GUVA 1ISHA 3I42A 1YDFA 1QH9A 1T8TA 3Q2OA 4ZO6A 3VC2A 4EYGA 1IYZA 2ZTHA 4PGMA 4YWJA 3TR0A 5KTSA 3GVPA 2C0PA 2XYGA 4NJMB 1SCIA 2BGGA 1F6BA 2FWAA 3TQRA 3EGWA 4IHJB 4BGIA 2HC9A 3I05A 4G4SO 4Q1AA 1SIBE 4ZAFA 2YZNA 2R8YA 3AUJB 3HGQA 4ACAA 1FDRA 4JLVA 2V4UA 2RBKA 4X54A 3GEEA 1TKCA 2WYUA 4LOHA 4B46A 5LMZA 1VSTA 1FP2A 2JGDA 5HYVA 1ESZA 2HU5A 4G97A 2OAGA 3ULKA 5LZ5A 4YCMA 2WSMA 4BO4A 3KR9A 1MGOA 2Z1MA 4ZMBA 3BTUA 1U7OA 1IB0A 2YXLA 3SK0A 2VTBB 1P2GA 3INTA 4MLPA 1WD5A 4X20A 2WM9B 4UVEA 5I7HA 4NYMQ 5EXPA 1D4ZA 1N5MA 4RY0A 3WRXA 3ILVA 4MYUA 3WJ2A 4BX2A 1E3IA 3EBOA 2VRWA 1ZCZA 1QFJA 2JIZD 3DO5A 3QVGB 4C06A 4K8OA 2X14A 2ZYAA 2I3BA 3V1UA 2OL4A 2ZS9A 4U7TB 1MX1A 1YRYE 3PLNA 1JKMA 1JXQA 2AOUA 2F3PA 1I6KA 1Q16A 4NEQA 4U1RA 5EOVA 4ZVLA 4A03A 2GETA 2XVXA 2V98A 3JALB 4EMUA 1AGXA 4TMVA 3CKKA 3LBAA 3BWBA 1YUMA 5EE5B 1RYEA 2VRCD 3C3MA 3WZMA 4G0WA 4JI4B 4KWTA 2B4RO 4YXFA 1L4LA 3EGOA 3QUAA 4CTNA 4B3GA 3BK2A 3BWXA 4IV5A 1YDEA 1FS6A 3OF3A 1I1OA 2YYSA 3JR3A 3N59A 2B5VA 2QN8A 3KSMA 3I6BA 1NZJA 1QDUA 2HMYB 4AF8A 4GOND 5BSUA 3WZLA 1A72A 1ATZA 1HQCA 1TYZA 2XE6A 4KXWA 3SBDA 1JN0A 5T3YA 2XMSA 2OYRA 2F8SA 1YVEI 3C1TA 3PRYA 2QXYA 4JI8B 1MN6A 3B5EA 3BH6A 1CVLA 5E6RB 2IV7A 3TDMA 3KK0A 4YJHB 1TNDA 4QUEA 5IX8A 2AZDA 3MJCA 4F5ZA 4YPVA 5B4UA 3LGXA 3L92A 2GT1A 5ALZA 1JA0A 3HUFA 4YDSA 3OFNA 3CUEF 1N8SA 3Q9UA 5DPMA 1YQGA 2QAGB 5BWBA 1W2HA 1EHCA 1QGUB 2V7GA 2G77B 2VHCA 2PL1A 4NU6A 4YRJA 3RVMA 1HY3A 1H8EA 3QKRA 1OAAA 3STVA 2O07A 1KYVA 4M7OA 1R3DA 5LA6B 3V4LA 3EX7C 1FJGB 1GDDA 7ABPA 3T5MA 1DKNA 1DL5A 1L1RA 1RWVA 3HYCA 4N9QA 5CNKA 5B36A 1ANKA 1F4PA 3HM2A 1COWD 4CLOA 3COZA 1FFAA 1K5GA 3MS4A 4FN5A 4IJ5A 2GF0A 4PO8A 4P4LA 2YR0A 2I66A 1UR5A 1YDWA 4MB0A 2CLHB 4CFSA 1KERA 4HCJA 2BDTA 3NAGA 3RC7A 4UNIA 4B7CA 2V7EA 3H0CA 4QQNA 1CUBA 1WXIA 2QZPA 2W2PA 4RM3A 1J5EB 1HDXA 4GG1A 3ZXXA 4O4IA 4U7FA 2Z3VA 5F7JA 3EUWA 1X7XB 5L4SA 3M6FA 4HLCA 2PX3A 3A70A 2WWHA 4W7SA 3CRMA 2Y76A 1MC4A 2Z43A 2EC5A 4JBXA 1G3RA 1NT4A 1VMEA 2OKGA 3CNNA 4MOWA 4CG2A 1DWOA 1JLSA 5LN1A 1CG6A 3H05A 4L75A 1B16A 4XYEA 4RA9A 2XLBA 2VL7A 2EX0A 5G1OA 2KX7A 1AKUA 4ZOAA 3SAJA 3PUKA 4PX9A 3RFFA 4XRGA 5P8WA 1KEPA 2ZUFA 2FZKA 1RNLA 1K86A 1XL0A 1Z7GA 4EYKA 2KPOA 3QHPA 3UKJA 4N8DA 5EKSA 4WACA 4FPXA 4TLDA 1NUSA 2P65A 3R0XA 1O5TA 3WGUA 5EHNA 1BDMA 2A59A 2ZXFA 3RTEA 4C76A 2UUPA 4GWKA 1CR4A 2G4VA 2YY6A 3HA7A 2H1OA 1W5TA 5JARA 3SGLA 4MEBA 4EATA 3OZCA 3PJDA 4PS0A 1IEXA 2KB0A 1KO1A 2JIRA 3EVAA 3F4KA 2YW2A 2HBZA 3PLRA 1W8DA 4J3JA 3KUDA 4OU5A 5E8JA 3UM9A 1XPRA 4FYWA 2C1XA 1IMJA 2XKJE 4MW5A 2JB9A 4NDNE 1W52X 4B9EA 5K3EA 3KYJB 2IEAA 1SQGA 5TVKA 4YJ3B 3C98A 1O03A 4EVQA 4DV3B 3QOYA 1J0AA 1U31A 1SIWA 1BW9A 1UBNA 1KETA 2HJWA 1XTTA 2J7PD 2PH7A 3CW8X 3O84A 4OB7A 3OEYA 5ELMA 3RUCA 2Z56A 2P3QA 4PPQA 2I8AA 2ZIEA 3MUOA 3P9QA 1M7BA 4YGXB 3SNKA 3TL3A 2LV8A 4PHCA 2JEZA 3UJ9A 3W6UA 1DQNA 3QWAA 1YMQA 1AA6A 5JAMA 2ZU6A 1UDCA 2ZIXA 1R0XA 4QPCA 3MGKA 4JZYA 4CTKA 5KSYA 4DV0B 1QH8A 5LQKA 2W8ZA 8LDHA 1DKRA 1TT5A 3CZPA 2F7SA 4FHFA 1Y1PA 4JLPA 3GMSA 3I39X 3TGWA 5K9ZA 1IHDA 3HMQA 5FFNA 4EY5A 2WVHA 1V2GA 3VR4D 3RABA 1U7HA 1X7ZA 5EIOA 5JAZA 1A97A 4W6QA 1OY1A 5K3SA 5FXMA 1LI4A 4RSRA 3DM9B 3P9ZA 4HDSB 1MT0A 4WPGA 1MG0A 4M6WA 1TEZA 2OV1A 3R23A 3AI2A 4N4AA 1O2DA 5EZ6B 4EY8A 1JR4A 1B26A 3USCS 3LUFA 1R4AA 1R0YA 3WQBA 1J07A 1BDJA 2Z3ZA 3PQEA 1U0LA 2D1TA 4MH0R 1CFJA 1H8HA 1I9CA 1WZIA 4R1LA 2Q6OA 3KB8A 1VJ1A 1H2HA 2ENWA 2MR6A 3IAS1 3KUUA 3ZDBA 3CUVA 2BEWA 1RPAA 2XCUA 3DE1X 1JPUA 5AK5A 5IVIA 1KGDA 1LW7A 1BD4A 3HI6A 4LHWA 2YINC 3CG4A 4LISA 4M37A 4EY6A 2WTMA 1DO0A 1N8TA 1NMQA 4M7RA 4NBNA 2WC1A 2ZFUA 4HI0E 5G0UA 3MAJA 5LQDA 4J0IA 5KDLA 3ZOKA 2IE0A 4XEHA 4Q93A 3SXUA 3UW3A 5BSWA 4P53A 5ALEA 2ONCA 2AEEA 1KAMA 3JQRA 4G5SA 5IWAB 2E6UX 1VLHA 3EH2A 2Q3CA 2XECA 4IX1A 2Y2UA 3IRVA 2YFKA 4GD3Q 1HQKA 3QKUA 4TXMA 3H3JA 3HKDA 5KNCA 3CB4A 2DHQA 1AZLA 3F98A 1PK9A 4XGNA 2IHKA 3S68A 5EJEA 1E2DA 4I1IA 2FQXA 2IHUA 1BVRA 2IBSA 1BG6A 4JWKA 1IN6A 1E7QA 3G0IA 4EABA 3D6JA 5CIQA 5EQFA 1FA9A 3AG6A 3H42B 1WXFA 3VR6A 1ZU4A 1O96B 2ZSBA 4U2BA 1EQUA 4Y9RA 4XB2A 3IPLA 4HB3A 2G1PA 1YQXA 1V7QA 2PYIA 1LTHR 3WLEA 1M34E 1DO2A 2PS9A 3ZDAA 2OR3A 3P2YA 1KOGA 3S28A 2XHZA 4J16C 1JB1A 2C95A 2B1JA 1TIKA 2OMEA 3R5TA 3RD5A 1LC0A 3QVXA 1JR2A 3MERA 4KX5A 3QUBA 3LU1A 5KNDA 1CY6A 1NMZA 4DREA 2H7CA 5E9QA 4YMUA 4H0NA 5TS2A 1R0ZA 2QR3A 1F7VA 3AONB 4HADA 3WYFA 1O95A 1WULS 2Q1UA 3I62A 1NPYA 1ZK2A 4JC8A 1E79A 1P5HA 5ALWA 3VO9A 3O92A 5I8PA 4FK8A 2ZP1A 3CLHA 3CUYA 4TTQA 2A9QA 1JDNA 3NTXA 2FPPA 2EFYA 4Y1GA 3U4CA 4RTQA 1C4XA 1RM4A 3HB7A 3N86A 3SSNA 1SUDA 2ILVA 1CDZA 1PT7A 1ZIXA 2O05A 3AK4A 3GZTB 2AMJA 4C0BA 1O9GA 1JDBC 3BDAA 4MP3A 3B9BA 5TMBA 4O2BB 5HILA 1JLRA 3BWVA 3T9DA 1T4BA 4BS9A 3QVUA 4D25A 4HDQB 2AZTA 4DN6A 4AIRA 4GZ3A 4J4HA 1C9MA 2FX5A 1CLUA 4KEAA 1ONPA 2O8BA 3MAGA 1EAMA 3F3YA 3ONFA 4MWDA 1Z2PX 3REOA 2Q41A 1Z07A 3H5RA 4R1SA 1AT1A 1R5JA 2BJVA 2V7QA 1P3Y1 5CXSA 1N5DA 1J49A 4BYGA 3HJNA 4IQGA 5J3JA 2JLWA 5L3QB 4A6EA 3D0OA 4HL6A 1WY5A 4XYLA 1UDAA 2WPNA 4DYDA 1EGQA 1II9A 3JQBA 4EG8A 4WCVA 1GZ4A 4Z51A 1QVZA 4UTOA 5I01A 4DQXA 1JBKA 1RPTA 3FA2A 5JBIA 2FMFA 1BFDA 2V7BA 5TRTA 3UHOA 4DGQA 2JIZA 2AC2A 2GJ9A 3EAGA 3JWJA 1AMOA 4QJIA 2ECPA 1VMKA 4OQEA 2PGAA 3GRVA 1Z4MA 2O8VA 2ZQYA 1WB5A 4KOAA 4TL7A 4B44A 5ICEA 2QUAA 3DCJA 1YO6A 1Z7YA 1KY5A 2QMUA 1P3DA 3AB8A 3EEBA 3JY6A 1ODCA 2UXBB 2NYVA 2QR5A 3WADA 2YV5A 4YP9A 2WJZB 2HIGA 3D6NB 1M1ZA 4BN5A 1TA4A 4PYKA 5EVCA 4BQEA 4YP0A 2QM0A 3WLTA 1JYEA 4C01A 4O4JB 3DDOA 3BKXA 3PFCA 1JIKA 2XMQA 3ZWDA 2RKWA 4RE5A 2QT1A 5FFFA 2C4HA 5BSKA 2EAUA 3VVCA 4KH0A 4MWOA 1A8PA 3WQHA 1JP7A 4PAMA 3OIFA 4P7JA 4ZAYA 1H6DA 3ZNQA 4F45A 1ULHA 4HYEA 1NVWQ 4CCYA 3R0QA 1WB9A 3CEAA 4Z2AA 2J7KA 3DMTA 4V02A 2XF8A 4E32A 2FQ1A 3IUSA 3OWXA 4TSFA 4QHSA 4B3HA 3EPKA 4CM9D 2WTAA 2GK7A 1NN5A 3VYWA 5A9RA 4BMDA 4E2FA 1J24A 4CEHB 1UMKA 4HXGA 4LGMA 1Y5NA 1XE3A 2R84A 1GGMA 1EUZA 3K96A 1E2PA 2C0QA 1Y6JA 1V6SA 1M34B 4D3XA 4JBLA 3E2IA 2FI1A 3SEFA 3FZQA 3TQFA 2JI6A 2AWNA 4NE2A 3RVRA 1FX0A 5CVTA 1CVRA 1JJBA 1LSOA 2PKQO 1I2BA 5TQ0A 5BW8A 2GJKA 1KVUA 3OQNA 1H42A 2ROQA 1D0IA 4D79A 1W36D 4D3ZA 2GHIA 1KYXA 1HE2A 4ERXA 1RAFA 3K6RA 5E38A 3VUFA 4DMUB 4HSGA 3STUA 1BXRA 1G5QA 1L7DA 2RH5A 3VPXA 2HCFA 2IZ6A 1XC7A 4V2IA 1QCYA 3JQ8A 2OHOA 1FMFA 4CKBB 5K8LA 5IXJA 3DBLA 3KQLA 4X84A 1L4NA 4RXTA 5LL6P 1GGNA 2WJPA 3SIWA 1M2JA 1GL7A 3FPGA 2FSGA 3ND5A 2WWIA 1X13A 1QKIA 3HKEB 3KFLA 1ZBDA 1LPMA 2H08A 5JR3A 2PD3A 3EXG2 4TMFA 1IQRA 3EGXA 1ZW1A 3IQIX 1NKTA 4NICA 3ETHA 2ZROA 1T1IA 1Y9AA 3HUUA 4AZSA 3U2QA 3C4VA 5AVZA 1WZUA 2HQSA 3CE6A 2BUCA 4J75A 3W8NA 3ZWAA 5A1JA 5C1BA 3AJ9A 2E85A 3SEAA 3DVLA 3DPIA 3E2PA 5IEJA 4N0MA 4GPZA 2NACA 1EVQA 2FDCA 3LM8A 1JW9B 4NZMA 4HAWA 4NH4A 2R2GA 4P92A 2VNHA 2Y27A 3AESA 4PTLA 2ZTUA 2I91A 3K2QA 1SXGA 2RKBA 3RUEA 1CIJA 4U2GA 4ZCLA 4LMPA 3V4FA 4E07A 1G21B 5HJ5A 5JG7A 5A04A 1O6FA 4UTVA 1VHJA 4P6VF 3TSZA 1OLUA 5AKHA 2IVFA 4BMXA 2IXGA 3MG9A 1T4DA 2BMDA 1TKBA 3FMIA 4FGJA 1SU8A 2G1AA 3G79A 1TK3A 2QL5A 3A4LA 4H7PA 5AOAA 1ORWA 3UFXA 5F5NA 4O4HF 1K4MA 1SWWA 2G25A 1BWSA 3HWRA 2PSJA 3QY0A 4LSGA 4BVBA 3SLKA 4AX4A 3KOUA 1NF9A 2RHTA 1OBFO 2J9FB 3KL2A 2YVLA 4I1SA 4XUDA 4AYXA 4C6TA 5EJ2A 4KVAA 1PW5A 4FGSA 1E0DA 2CNDA 2W2KA 2BH9A 3FJYA 3L1UA 3Q9SA 4HFRA 4PW0A 1O0BA 3SWWA 2J7PA 2F90A 3BGWA 4L3VA 3NOOA 2GWRA 1ZITA 2QU7A 2XB4A 5IYZA 1VG0B 2BMJA 1PX2A 1TM5E 1ADCA 2DTXA 2J46A 3BCSA 5FADA 4H16A 3VV2A 4DCVA 5I9MA 3AHIA 1FDVA 3DZBA 2WVAA 3AHFA 4UC0A 3AVPA 3KHSA 4A2PA 4R9RA 1YQEA 4CMAA 4EITA 4Q3OA 1I24A 5CBPB 3OZBA 4XD7D 1V8ZA 5DHAA 1EDDA 1ZD2P 2ZDHA 3FCAA 3JQ9A 5BN1A 1R4NA 4MIEA 5A3QA 5I7FA 1U9YA 4RM2A 2MSEB 2JANA 1VPDA 3VR4A 1GRRA 2DR0A 1DEOA 2GNPA 3ZBTA 2VK8A 5DDIP 4L57A 5H1YA 4XJVA 1P60A 2QM7A 4NYMR 3IUEA 1LNQA 2O3RA 1K7EB 1U3TA 2EZ8A 4EFMA 3OCXA 3TG8A 4KPGA 3DBRB 1UMBA 1E1DA 4WI1A 3CPEA 2BZGA 4IIDA 1KIMA 2LP4Y 4LECA 3I28A 2AXEA 4YCCA 5DXJA 5DVZA 3OM1A 4OP2A 3P9PA 2XJ4A 5A9TA 3KWMA 1LDMA 4YRMA 3DEYX 1QHHB 3AZPA 3E84A 2GEFA 4Q7LA 4DTIA 4ZIRB 2F8TA 3AEZA 1KRHA 4KMSA 2QD4A 2A1UB 2YXEA 4UU8A 3W9UA 3MGBA 2AN4A 1Y3CE 4TGLA 2EF0A 2VJAA 5CYPA 4QUDA 4C4YA 4V1CI 3VYUB 4TYMA 1Q17A 5MHTA 3K6SB 2PJRA 2Q2NA 3OLZA 5E9AA 2F1RA 4XWKA 3FBWA 1TQDA 1VGRA 1Q20A 5DHQA 3TQQA 5FHQA 4XDGA 4EGJA 1VMAA 4B35A 1LEHA 4FDVA 3GB9A 3B2NA 2JC3A 2ZUVA 3JYPA 1ZRSA 2BMEA 3N2GA 2HSDA 1YJBA 1DLJA 3HDVA 4GE0A 3RQIA 4MHTA 1GN9A 2OK8A 2ZETA 2ZSIA 3QENA 1LF5A 1NSTA 2BELA 3UJ8A 4IHAA 1IVSA 3CEHA 3JVVA 3PDIB 3MILA 4BWFB 2AFHA 3VU1A 2BFDA 3B38A 4EOGA 1MH9A 1GZ5A 3K0CC 3O1JC 1SC9A 5L3SA 3GCWA 2TMYA 4WVFA 3ORRA 1R88A 1I2CA 2J9ZB 5B6JA 2JCBA 3ZIAD 1OYVA 3GPBA 1DT3A 2J41A 3PX2A 4PF1A 3A11A 2J3EA 1MXFA 1GG8A 5KOIA 3TVTA 1Z0UA 3GWZA 3TCKA 3UTDA 1NJ2A 4ARAA 1W6UA 1LTKA 1UJ4A 1J06A 2IKSA 5E0KB 4LYEA 1QFYA 3U39A 3VR5A 1SZDA 1IULA 1YB6A 5FUBA 4EEXA 3MOSA 4RU1A 4AMZA 4F84A 4OLHA 2WVJA 1C1HA 2ANCA 3SS8A 1E0KA 1GEGA 2HF2A 4INPA 4D0GA 4L72A 5BNTA 1AGPA 4G9EA 2CXHA 4ZODA 3ZXYA 4WDQA 3AHCA 4PFQA 5ENVA 5KVCA 4WZAE 5KYUA 4OJMX 2IUYA 3L9XA 3TQSA 3W5IA 2R1ZA 2VSXA 5BORA 2OM2A 2C7RA 5SYMA 2CVHA 1DWPA 4PZAA 4C20A 5J4HA 5F4BA 2E6KA 1XLVA 3HVKA 1W88A 1RQGA 1UL1X 3FCXA 4DLVA 2CCKA 2ZJZA 4Y2VA 3V1LA 5DYYA 4L5IA 2OESA 3VHXA 4BHTA 2O5RA 3HY4A 4O2RA 1Y8CA 1X2EA 2EV9A 3LCVB 3RHZA 1VYUA 2RK3A 4FONA 1I32A 4LNHA 3A9TA 3ETGA 2O2CA 3S3TA 4W5OA 4F46A 1FXWA 4HGRA 3KLOA 4PVDA 1ID8A 1U8YA 3R7BA 2HM7A 1DXOA 2JLYA 5IJ9B 2YXPX 4LSWA 3AU9A 4M0UA 1G6OA 2O2DA 1CRWG 3HZOA 1GRNA 1PNVA 221PA 2R4UA 4GL2A 1GPYA 2OLEA 3DHNA 2V7VA 4PO9A 2NWQA 4RMIA 4FR2A 2CV2A 1IBRA 3N6RA 3NHSA 2ZJ8A 2H16A 2HCJB 3MS2A 3EF1A 4M0LA 3QLUC 5EN4A 3VDMA 1K27A 2GA8A 4FBGA 5DIZA 4BLVA 2ADFA 3FRJA 2C3OA 3KDAA 1EWQA 3U9SA 1WMEA 1FL9A 1K7YA 1I94B 1JI0A 2GAOA 3R74A 3WV4A 3GCGA 2QTNA 2DM6A 4P0PB 2L2QA 4RGBA 1UC4B 4A1FA 2Z6QA 1OV4A 2BSAA 1D1PA 2ZJFA 5AH0A 5LBIA 1JMVA 1DKOA 1ISFA 2BUBA 1RXCA 5DX1A 3A6KA 3I2IA 3N6VA 4L8FA 5J4VA 3P9YA 3T34A 5DISB 3P94A 1DJLA 2O8FB 4GRIA 4FCCA 4WBNA 2I6TA 4LOIA 3PQ6A 1CZHA 4Q3DA 1T6XA 4IHQA 4IVPA 1GXSA 1M75A 1P9LA 4LJ8A 4M99A 1CTQA 4Q1VA 2R47A 1M6VB 5DLQC 3FYTA 2GAJA 1KZYC 4JUFA 5T6MA 1L4BA 3P9CA 2VPTA 1OCEA 3OTQA 4P7KA 4GPAA 5AHKA 4CM9A 3G13A 1JTFA 1IZ9A 3VAZA 3F2IA 1C9JA 4F6RB 4DLSA 1Z4IA 5DYWA 4I50F 2IW3A 1VP9A 1B42A 1JWAB 1TZBA 3RYFA 1YVRA 4D9NA 1HLGA 5KC8A 5JZ9A 3AHHA 5CT4A 3GJ0A 3HJGA 2FGJA 4PNZA 4FFWA 4YCDA 1RFGE 1U4SA 5TEWA 5EA2A 1L4UA 4LHEA 4HUQA 4XAQA 1HDIA 1T4MA 2FUG1 3OJFA 4QDTA 4NS1A 1OFGA 4RGVA 4PC7A 1YUNA 2JCSA 3STWA 1Z5OA 1LVHA 1ZK1A 2H6EA 4PPGA 2WY2D 4B45A 2QVBA 2QL6A 3ZHQA 4NQRA 4NCXA 4H4CA 3EVZA 5B4VA 1AHHA 4P81A 2GQ0A 3F3MA 4RSHA 3ZK9A 3NATA 5EP3A 4GECA 1T3LA 5IKPA 2VUHB 3QVOA 2Y1WA 1SG9A 3NDPA 4MUJA 1YB1A 1V7CA 3AUKA 3QU9A 4LQLA 2I6UA 3PB3A 4B6EA 4AKHA 2XTZA 3VNBA 1O97D 4Y1FA 1B2RA 1P0FA 1GJRA 4RCZA 3R7WB 3OQHA 5A9SB 1LFAA 1GL3A 2IGTA 3TM5A 2VHQA 3KTAB 1RWQA 5E4YA 5FBWB 2EHDA 2VYND 1GPKA 3DONA 2JLCA 3HM9A 4IP0A 2JARA 2OWDA 1DADA 1E8NA 3GP3A 5JZBA 4UTRA 2H07A 2G82A 4P34A 5KQRA 1RBYA 4PYMA 2F3UA 2VUTA 2YXNA 3GAFA 3GA0A 2BC9A 3IBCA 5E3HA 4F97A 3KAJA 4Z7OB 3H97A 3M6WA 5IAJA 2Z4SA 4RVGA 4U9HS 5KNLA 4ZOLB 2WM8A 2P67A 3ADOA 3IP6A 3ZLBA 3KXLA 1KE2A 4RHEA 3BE5A 3NGMA 1KI4A 2VIIA 1FP6A 5ALQA 1VCOA 4QUJA 1GD1O 4GMHA 1ZJWA 2IBTA 3CZQA 3IA7A 2XI4A 4C3ZA 4IZOA 5BPFA 1XZEA 2VOEA 3U1BA 2D5AA 2DOKA 2FUEA 3LWBA 1DX9A 4NYIQ 5U4XA 2XUZA 2IPOA 1OV6A 1P9OA 4AJLA 1U0HC 2XQIA 3AEUA 3V4PB 1CUZA 3CFYA 2QRZA 5DTRA 4AJ2A 3QE0A 1R10A 4GLBA 1V35A 5JH7F 4CVNA 4NF2A 3LRXA 3B53X 4F5EA 4FX2A 1XRSB 2ZYTX 2XAUA 4UM9B 5IAOA 3EDRA 2WQZA 3MLEA 4IRXA 5IM4F 4QUHA 2Q4TA 1Y0BA 2P1DA 3TW4A 1S96A 4MIYA 1T43A 2HLNA 3OU7A 5LYJB 2VJQA 4Y6LA 1XNGA 4E2XA 1AV6A 3Q0IA 3NBXX 5KX5A 1KPHA 1ZDMA 4M9SA 1CUDA 2BFCB 4UMEA 2OILA 5ED0A 2BHNA 1EBFA 1UKBA 2JBAB 4I1YA 5AVJA 3UHFA 1Q44A 1E7WA 3DVQX 1Z4PX 5TV2A 5F1KA 3PDWA 5GVSA 1SUPA 4BRSA 3EXIA 3T7RA 2GI4A 1A2QA 2ZIGA 4IWYA 1D4FA 4D0NA 3AM1A 1C7JA 1Y3DE 3ITNA 1R3UA 4TWJA 3W2FA 1AKVA 1U7DA 1A9TA 2J3DA 3DOCA 2J5QA 4JGIA 1DC5A 1RYHA 3D6HA 2JIBA 3KIPA 4DLUA 4FNOA 4MVJF 4Q66C 3K8YA 4UEOA 5FNVA 2NU7B 2GPWA 2RGYA 4LYFA 4MI6A 4QDZA 4NZNA 3C1OA 3INYA 2VR1A 4KSBA 3AINA 1CBUA 3I72A 3RW9A 3ST7A 5LOVB 3B7WA 3QMWA 4MYCA 3GRUA 4B6JA 2OC9A 4P5DA 1AVTA 3ORSA 5EUCA 3RJ9A 1BS9A 1VJRA 3MM4A 4CKCB 2ZCUA 1FVXA 3CEMA 3GGOA 1TJ5A 3SZUA 4E1VA 3LHIA 4K9NA 1XZIA 2P2GA 4NHEA 4Q0MA 2XPCA 2H85A 3L5OA 3B8HA 4MYHA 2BGTA 4PLCA 1LK0A 4TVBA 1GT91 4Q3BA 3SM9A 2YUIA 4C5CA 2F43B 2VCHA 2X2OA 4L85A 5CA0A 3NWBA 4ZYLA 1U8UA 1D2GA 4QBTA 2QD5A 3S99A 3SR3A 2FOIA 3VTAA 2VK1A 1V5GA 2D2IA 4GZMA 4NFYA 5BMOA 1CYEA 3DKPA 1IJEA 1I30A 1G8MA 5G40A 4MO2A 2ZSFA 4QASA 4COOA 5JSFA 2P9ZA 4RIGA 5DRTA 2OO7A 1TCCA 3JU3A 4YYEA 3SLGA 3VH3A 5DNCA 5JFTA 3BH0A 4R4JA 4LRUA 3JQDA 2OXFA 3ROFA 4AL4A 4B80A 1NU6A 1FFCA 1STOA 2C9BA 3ND8A 3T9CA 3R7LA 4RC9A 1RYNA 3D6TB 3GEPA 5CXXA 3NYQA 4OBBA 1A5AB 3ZIAA 5LQAA 4HAYA 4L73A 1Q92A 2WIGA 2Z2JA 4C43A 5KYXB 3FPSA 3OZEA 3TMYA 4YTEA 2WSYB 2XE7A 3OP4A 3P4YA 1CDOA 2VAPA 3BN3A 4G0QA 3CONA 3TLCA 4BNUA 4F4JA 2K2WA 4BNNA 3IA2A 4CJXA 4KK3A 4IZ6A 4P3NA 1GY8A 1JQ3A 3EXHC 5IH7A 1WMAA 3Q88A 4NG4A 2IKQA 4KUEA 3TRDA 2OQ2A 5ITZB 2D7JA 1ZIPA 2WMOB 2HJSA 4CMEA 3RJZA 1AQNA 3GRCA 4AZWA 1RXWA 1WPXA 1RRFA 2X0EA 3M6XA 1E2NA 4AJ1A 3NKVA 3WNBA 1KP3A 4XQ0A 5DSZA 3OUUA 1C29B 3IJ5A 5HBRA 2IUUA 3V9AA 4E94A 3G0HA 2H54A 4BNIA 1DBSA 1GAWA 1HL7A 2AOWA 4HATA 1H1LA 2IZZA 5DM0A 4NATA 3MUFA 3ZXIA 2I54A 1Y80A 2ZWVA 3DCNA 2GUWA 3ESDA 1JLHA 3NBQA 1QG6A 2JJ1D 4JODA 4L9AA 1MDBA 2GJSA 3HA5A 4OL0A 3OZWA 5JATA 3ND7A 3A3KA 4LV8B 2O2XA 4V24A 3FYDA 2TYSB 4DEYA 1OXXK 3HSKA 3KJEA 4CG1A 3EVFA 4DKXA 4RD1A 4FYPA 2LKDA 5JSZA 2BEUA 2ZSEA 3ONWA 2DH6A 1YTUA 1HV8A 1Y4AE 2JHGA 2BYTA 4DIOA 1N2SA 4EHLA 1JEQA 5EHGA 4B0PA 4BNDB 5I51A 1R0WA 3KLPX 3QKSB 3TJMA 2CVPA 1YE8A 1GZVA 5JXHA 2PGDA 2DC1A 4GDMA 3AEKA 1QH0A 4MRMA 3A3NA 5KTKA 4Q9IA 1Z68A 4LXTA 5H02A 3IAM6 1RPZA 4B48A 1IM2A 3A4NA 3RSOA 4RF5A 4UEJA 3AFOA 4ZVVA 3H5VA 1ZVJA 4AQYB 4BQFA 1LC3A 5IT0A 2CXTA 4ZO4A 2EYUA 5EHQA 3HVJA 3GJZA 1FNNA 3ESAA 2O7QA 4HN2A 5GIPE 1IQPA 1G63A 2W6ZA 4LZAA 4GM0A 4CR6A 2G4CA 1DC3A 1Q95A 1RVDA 1E3JA 4DIMA 1IY8A 3NR2A 4YX9A 2B9VA 1FNSA 1UOOA 4OV6B 1CKEA 1RQ7A 2QTFA 4C78A 5LR6A 1BVYF 1W4BA 2VDLB 3HBFA 3EDOA 2ZBEA 4YLEA 2P6PA 1LQTA 4BZQA 1GNVA 1F14A 2FU5C 2X5XA 3SKYA 5LM3A 2PGIA 3DFUA 1DHTA 4QVGA 3KOWA 4P4NA 1Y98A 4PEVA 1SUWA 4EI9A 2HDWA 3B1ZA 2JATA 4FZ5A 3OQMA 4DV4B 1Q1BA 2IYPA 3DZDA 4ZANA 4RELA 2X1VA 3PGMA 2W11A 3IPXA 1C0LA 2QM8A 2XY4A 3KJNA 1PK7A 1PR5A 3OX4A 3C5HA 1KS9A 2FMTA 2FG5A 5J58A 2DETA 4K6CA 4ZOCA 2XUHA 1NP7A 1J8QA 1IEVA 3W05A 1HWYA 5JQGA 1LLFA 1IH8A 1G8AA 4ZN6A 2I4NA 3RCBA 3PTAA 1FMCA 2CFSA 2AF3C 5TMDA 2P69A 4O5OA 1T8RA 4V0QA 3NIBA 3VMFA 4BEVA 1GM5A 2REXB 1E2UA 2GZAA 4OK6A 1IU9A 2A4KA 2CEAA 2I76A 1C2YA 2I6XA 1XU9A 2VA8A 3DV0B 3P9SA 1GWNA 3DJYA 5LP6A 5SY4A 4ECAA 3FOFC 4NQZA 3LTEA 1Y8QA 4YCJA 3NYWA 1QF9A 1G9XA 3C4QA 5CB4F 3VR3A 3ZY6A 2QNBA 3BD6A 1Q6ZA 1L8LA 2HMVA 2WUVA 2IUSA 2WTNA 3CZRA 3G17A 4ZCRA 1BE0A 1B15A 3D7RA 1KOJA 3TLGB 2XGJA 4PZPA 1JQ5A 3D4IA 1CRQA 2AHRA 3HC7A 4K9OA 1LV8A 3HDJA 4OOFA 4QXAA 1U3DA 3SY8A 4AS1A 1JG1A 4L6AA 1TVCA 2A86A 1QB8A 3IC5A 3DWFA 4IIXA 3V6LA 4F72A 2C78A 2QAGC 1K5PA 4DLXA 2NVWA 3O93A 3ZHOA 3W1EA 3NT5A 4WZBE 1U5BA 1XD2B 4NBUA 4DCPA 2W00A 4BKMA 2A67A 2CXSA 2Q45A 2AQHA 3ZEAA 1ZIYA 1BCRB 2PBLA 3V3KA 1PUIA 4FYIA 5BN4A 3DD5A 1W8IA 3UAOA 2IPLA 5JPDA 4ZGGA 1R7RA 2NUTB 1NQ5A 1QHGA 3AVQA 4MKZA 2GM4A 2ZJ0A 3NEJA 1M2EA 3NPMA 1VIAA 4JFAA 4LYAA 1XZKA 1ZNWA 3AF6A 4Q34A 4N5NA 3JD4A 2EDCA 4DJTA 3D54D 3V00A 2VHWA 1E0AA 4A0FA 3D4BA 1RWBA 3KU4A 2BZ1A 3KTFA 3T1HB 4P7BA 4M8SA 3H3XA 1XMOB 5T5QA 4NABA 4CWAA 4RPGA 4TRNA 1OW3B 3QU5A 1Y5RA 4PSVA 3VFDA 3LC7O 3LUJA 3IEUA 3FPBA 4QTXA 1WDTA 3EGCA 3IMFA 2HDOA 4PXAA 5E6SA 3R3UA 3OX2A 1RZUA 3QVLA 4F3KA 3NDBB 1HUQA 3QPWA 1L4KA 4HS4A 2ZRBA 4YGYA 1E62A 3O03A 3I9V6 4XSGA 4Y6RA 2GM9A 3OT1A 5ERYA 5FEMA 4B81A 1TUEA 1JILA 3EA5A 2XOKD 3ZH2A 5H4GA 3NI2A 3E6AA 2ZKIA 5LJIA 2LWIA 3HCCA 1SU4A 3I73A 3IOBA 3PHIA 4LTMA 1E6WA 1CUYA 3ABIA 3DZ8A 4WOCA 5FUWA 4OLBA 4JIMA 4FN4A 2O8CA 5C32A 2QTBA 2YWRA 1QV9A 2J5RA 2WM2A 2EQAA 5DNYB 4XIJA 2JGFA 3QEBZ 3K1AA 4TT8A 3WWYA 2X0JA 1GU0A 4CLHA 3MBOA 1QIHA 1Z0AA 4D96A 1IY9A 4RK7A 1TQ8A 1KARA 4K9DA 1I7PA 1JDUA 1MORA 1XCGB 2ZT5A 3ZNNA 3RAEC 5BV2P 3PC8C 2V1UA 1P2TA 1Z25A 2HLHA 1JHVA 2OECA 4I55A 2ZATA 1NVEA 1Q12A 2PS1A 2XWPA 1AB5A 1VGVA 4TXLA 5KOJA 5B58T 1NG9A 4H6VA 3SMQA 2CLFB 4LVOA 5JSKA 3VDRA 3WFIA 4DL9A 3FFBA 1SG6A 2JFXA 3OHSX 2GRJA 3LJKA 1A71A 3RRMA 3ZJ5A 1FP4A 1YA6A 1P2UA 5AW2A 4Y2TA 1TD9A 4NH0A 2F6RA 3DUFB 3AZOA 3WYBA 1PR1A 4LF5B 3W9YA 4RIHA 1V43A 2C3UA 3QWHA 4J91A 3G5UA 1ZN9A 2ONZA 2HU7A 3SSMA 2PGJA 2Z6AA 3TXYA 2IS2A 4LHXA 4V03A 2Y0DA 3WTCA 2QL9A 2XBMA 2GBLC 2YH2A 4FUTA 4N65A 3T4UA 4YBZA 3O4VA 1T9AA 1SXQA 1KFCB 4RS4A 4HNTA 1T5TA 5BVGB 3HZHA 1JJ7A 3RB8A 2F9FA 4PAGA 2RHDA 1F9AA 4UHCA 1Q50A 4YEDA 2WUDA 3L1KA 4Y3UA 3UY4A 3K53A 4BNKA 2EERA 2WILA 4I9HA 2H4HA 5AK0A 4YJKA 3U6BA 5AM5A 2M6SA 3O8NA 4Q15A 1CQPA 4N5IX 5AM4A 3QE2A 3TPZA 4IFTA 4C4OA 3K35A 3ZU3A 2EBFX 2AFIA 4DIDA 3DS8A 3W78A 1EVIA 4E88A 4OXRA 1FLVA 3HRKA 2RKOA 4B74A 4CMJA 3O0DA 1IZ7A 3FHJA 3NRCA 1T2CA 5C34B 4WXMA 4AG5A 3PJEA 3IUQA 4I9FA 1BXGA 1M0EA 5FV7A 1DIHA 4X3CA 2DJIA 2YOFA 1CEEA 1U0TA 3KYIB 4KE7A 3RSSA 1M6HA 3WI7A 1P1KA 2WJ6A 4F2WA 3KLBA 5ADVA 1B8NA 3KPYA 2IYAA 3GJQA 1P39A 1FOEB 4O4LB 1FZTA 4NCNA 2QZZA 4XTCS 4C05A 1S2DA 1XG5A 2KYRA 4DA6A 3M34A 5GZ3A 3LX8A 1PWHA 4MQLA 1A7AA 1C3LA 3KE9A 4CGYA 3ICEA 3U7JA 1JSRA 3F7OA 1EM8A 3RV3A 3QG1A 4TYQA 1GL9B 1ZJ6A 1KMHA 1G2PA 1UBLS 2POQX 1B1AA 1TAQA 4Q7EA 5H16A 3SZOA 1R8XA 1SH7A 5BOVA 2JFBA 1T8SA 2G5CA 2ZJ2A 4CIAA 1W48A 1YU9A 3IRUA 2YMLA 1TZCA 2M32A 3CG0A 5JNRA 5FTWA 2RGXA 4GO1A 2YBDA 4JI3B 3SSOA 4N0PA 3AP2A 1HZJA 4TV9F 1OFUX 3ENVA 4DBVO 2EG5A 4DLYA 5BWOA 3QVVA 5TF0A 5L4NA 3H9CA 4DS3A 3HO6A 3EEYA 2AJTA 1SK8A 2Z2KA 2HA7A 3WSVA 4HN9A 1J0XO 2J3HA 2Z2YA 2EG9A 4JS0A 4N7BA 1JV2B 1RXYA 5JECA 4FZVA 1D7OA 4XWTA 1AXGA 5K0BA 1ZX1A 5C5EA 1DKUA 2FMXA 2A14A 3QQPA 2PA0A 3R7SA 2A5FA 4I3GA 5AXBA 1P31A 1YK0A 4C4AA 8AT1A 5LP1A 3FLEA 4WAUA 4ZEOA 2C00A 1G42A 2D7DA 4I1OA 1ZJJA 2NQ2C 1YL6A 2BBSA 4LRXA 3URMA 4Q6WA 3UB3A 3WJAA 5A05A 1TD1A 2IQIA 2YOGA 4PHTA 4K9PA 1SA0B 3FSRA 3FMGA 4IH1A 2I6QA 1C9KA 1THMA 1USVA 3BSWA 1EB9A 3JARB 5BSTA 4EELA 5CBKA 3L1IA 4IPTA 2O4CA 1ESMA 1HM5A 2X7JA 3CWQA 3W5JA 4HAIA 5AHOA 1XVLA 3COYA 3DW1X 1FRZA 3S7TA 3JW8A 2AW3A 4RX1A 3BOSA 4P31A 4I2NA 3QPVA 3THSA 5TX7A 4X5OA 3HJTA 3D31A 3O8OA 2XXJA 4BPRA 4HC4A 1KJYA 1RI5A 4I6EA 4PZCA 5JYDA 3T7CA 3UO8B 1HT0A 1T1SA 5DCUA 3RC1A 5HJ2A 1GLVA 1ULSA 2P7IA 2VQSA 4R1PA 4AJNA 2A84A 2QTLA 1GGVA 2JH8A 2V54A 4WEQA 1CRZA 1A7JA 3SQDA 1JA9A 1YKSA 1VECA 2IW1A 1SMKA 4UM7A 4KPFC 4DCGA 1CZUA 4L8LA 4KR2A 5IMSA 1K6XA 4AO6A 4RTOA 3GJRA 1Z0KA 3HP7A 2FR0A 3ROZA 1T29A 1SUBA 3FOWA 1MAWA 3AR7A 1E2KA 3TECE 4OHYA 3F5SA 3ZHCA 5BW5A 3GLSA 5K7SA 3UOGA 4H3KB 1IUNA 3B3QA 1IVYA 1SOWA 3CV3A 3M4JA 3VKHA 1MEOA 1W75A 3LK6A 1B43A 1GUFA 2DF8A 3DZKA 2V1XA 3V33A 1OVMA 1RE0A 2GHQA 1G8JA 1XN4A 2O6LA 4Y0NA 1Y5LA 3BXXA 5HKLA 5KJFA 4HQRA 1ZO8A 2NPIA 2ZTMA 2AN9A 3G1UA 4IG4A 4OBEA 3G0DA 4HWGA 4R54A 9ATCA 5I4IA 3D7SA 1A9XB 2WDPA 4L95C 1HDOA 1XDBA 1YONA 1UBEA 1DBQA 4IAOA 4V38A 3SX2A 1UC5B 3U7HB 4V0SA 4JELA 4L4SA 3D1JA 1JFRA 2FFAA 1GPAA 3ET5A 2VCYA 4V0MA 4XDYA 2NV0A 3PTLA 3LUBA 2I34A 1PYDA 4QBGB 4B76A 1QRRA 3KYDB 4GBJA 3OPNA 5AKKA 1WP4A 2XTAA 2FW1A 2ZRFA 1P1RA 3ITDA 4IX9A 3T95A 1YFLA 3VHRA 5I7SA 3FNFA 3RYHA 4Q6BA 4AYWA 4YCBA 1KFEB 5J2TA 5KOHA 4M1OA 5TPZD 1E6UA 2HXSA 2OCLA 4OF4A 3FYUC 1KQFA 4RTPA 1D6JA 3VKWA 3DBHB 1MVLA 2TMGA 1QFZA 1ZXXA 2CMKA 4GVLA 4RYLA 5BVHA 2A4MA 4P58A 2N9UA 4ZICA 4GT1A 1RWNA 1D1SA 4NCHA 4XFKA 5CVVA 3QP9A 1C4OA 5JISA 1VCMA 4JJFA 2BEJA 4AECA 1PT5A 2GM3A 4Z9AA 1FPMA 4KQ2A 4KQGA 4C0KA 3SC2A 3DKRA 3QRWA 5GTDA 1L7PA 4NAVA 2PVCA 1PG5A 2X4LA 2D2VA 2BMVA 4QTUB 4MR7B 5IJWA 2GS9A 3KUKA 5DLEA 4AMUA 1D3AA 2VWGA 3ED5A 1YHZA 4JQOA 5A6VA 4RJJA 2QLTA 1CF4A 3MN1A 2VP9A 2ZPTX 3M6VA 1Y7LA 2XADA 1HE3A 2OD9A 3HKCB 5A71A 3JYOA 4ETNA 4ZV4A 3IEVA 4IIBA 3B70A