4IJUA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3-yl]bicyclo[2.2.1]heptan-1-ol
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 266
sequence length 266
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijuA00
3WFIA 2Z1NA 4OMUA 4CLXA 3G1UA 1GZ4A 2VYVA 3JQGA 4CM1A 1JAXA 1FMCA 1ID1A 2JFFA 2RH4A 4D79A 2O3RA 4PVDA 4BQRA 1R16A 3GC6A 4J6FA 3FBTA 1DFGA 4BO3A 3C3XA 5L4SA 2QIOA 4I5EA 4XKJA 4UUNA 4IJWA 4L0QA 4XX0A 3WGIA 3BZUA 2JJYA 4A26A 3CTMA 5IJZA 3JD2A 3I3OA 3COSA 4DXHA 4MO2A 4ZQBA 1CJCA 3FWNA 1LC0A 3BXXA 4KMSA 4RVDA 1E0DA 4XDZA 4BKRA 2DBVO 1HKUA 5EESA 3K73O 4GX1A 3ZW9A 3VKVA 4DLAA 1YQDA 3GVHA 3RI3A 5IDWA 6LDHA 3JQEA 3GQVA 2NTNA 4GLLA 4R01A 3AI2A 1DDOA 1K6JA 2DM6A 3LC2O 1AXGA 5CDSA 1X7DA 4KQXA 1R6DA 2X0NA 3PXXA 3CMMA 4CM4B 4F46A 4AG3A 4GX0A 5JW6A 1GCOA 5G4KB 3UH1A 2GERA 4UEOA 5MGBA 5TIIA 4P4LA 1DIGA 1ZZEA 2RHRA 2WWRA 4J2OA 4ND4A 2PD3A 4O0LA 3GZ4A 3H5AA 3HSKA 5IFLA 1NFRA 2CSUA 4ALLA 1E7SA 3KO8A 4JXKA 4QEDA 5FFFA 1DC4A 1ZKMA 1U5AA 1SB8A 2CUKA 1NVTA 3V2UA 1FXSA 4IDBA 4DIOA 4LCJA 1XG5A 2J6IA 2HCTA 4Q9NA 1Y8QB 3G3EA 5JDCC 5TJ9A 5F5LA 3ZWCA 3M6IA 5IZCC 3WWYA 4KOAA 3RKRA 1AE1A 4CM8A 3WGGA 2ZYAA 5DBGA 1H94A 4BNMA 3R3SA 2X58A 2HMSA 2VN8A 4PLHA 4ROSA 2DC1A 1PJCA 1Q0QA 3O38A 5JC1A 4ZHSA 3H9UA 3WXBA 1EQ2A 1EFKA 1YDEA 3A4VA 1GAEO 3DAGA 4PLTA 4DL9A 4Q3BA 3TSCA 4FB5A 7ADHA 4YT2A 1JKIA 3TF5A 2XPCA 5COBA 1DXYA 5IZ4A 1ZMOA 3ETDA 5EINA 2P5YA 3DBVO 2Q45A 3OF2A 1XDWA 1R4MA 2HU2A 3GK3A 3H9EO 3WMWA 1AXEA 5A04A 1MLDA 4CUZA 3KEQA 1OBFO 3F3SA 4RF5A 1YOVA 4YVFA 1E3IA 2BI7A 3JYOA 2PK3A 3MJSA 4QTZA 4WECA 4ZVVA 4S3MA 2EKLA 5JY1A 3ZH2A 5IXYA 2QYSA 3GPIA 5I7FA 2W2LD 2W2KB 1KIFA 3TQHA 4BKPA 2YHUA 5JBIA 3ROKA 3CPSA 1PR9A 3AY3A 4BO5A 4TQGA 1DLJA 2B36A 2E6UX 2P9EA 2HAEA 3ZHYA 1FJHA 3WG9A 1E1LA 1DFIA 5KKAA 3AY7A 5A3VA 1JQBA 4G81A 4DPMA 1A4UA 2TMDA 4IBOA 2PTGA 4PG5A 3DQPA 2YHIA 3JYPA 3VH2A 4NZ9A 2UAGA 4H7PA 1K6XA 1T2AA 3IUPA 3R1IA 1GTMA 4WCFB 3R6DA 5DBIA 1G0OA 3DMTC 1A71A 2O4UX 2HKIA 3WGQA 4UUMA 1D8AA 3OIDA 3MEQA 3JD1A 4IIUA 2HLPA 2CDAA 1R37A 3OJEA 4B4UA 3E9QA 3W6ZA 4WNIA 2O3SA 1DBVO 5DBFA 4BNGA 4DBZA 3D64A 3MZ0A 4RVGA 3TZQA 4MINA 4KP7A 2OUIA 2FPIA 2VOJA 3JQ7A 5CPBA 3UKOA 3INGA 1OOEA 2PZJA 2OHXA 2VZ0A 1G6KA 3AFMA 3PDUA 5KCZA 3NDRA 4KUEA 1EDZA 4WGGA 2GZ1A 3NT2A 4YBZA 5KJCA 3NTQA 1NR7A 2EKPA 2VUSA 3DZJA 1X7GA 3ONFA 3WBFA 3CMCO 4J49A 2HMWA 4CMIB 2R00A 3ONEA 1GV0A 3TJRA 2O2SA 4R16A 4P4NA 2NU8A 2EW8A 4BO9A 3JQDA 1BWSA 4YJGA 2P68A 3ON5A 1SZJG 5IDQA 4FJ1A 1ADGA 3VH4A 1IPEA 3JQFC 2AG5A 2X9VA 4MDHA 3DZIA 4O5OA 1EK6A 2E4AA 1RYEA 5KJEA 3ROMA 3ST7A 2PV7A 4M1QA 1RJWA 3JQAD 5AXAA 1HDXA 4D7AA 3GDFA 2E37A 5JNLA 1HETA 3E5MA 5A02A 4L74A 4R1SA 1BRMA 1HSZA 2G76A 3OJ0A 4RDHA 3TWOA 3U62A 1VRWA 1FDTA 3F6YA 1RM5A 3GR6A 4W82A 1QKIA 2AE1A 1JVSA 1GADO 2BFAA 1Y1PA 5TRTA 3H5NA 2QRJA 2VUUA 3QQPA 1Z74A 1VKNA 2O2YA 3AWDA 4B3IA 2HMTA 1BSVA 4ND3A 4RPHA 4J90A 4YRDA 3EZYA 3ITDA 2HRBA 3ORFA 2FMUA 1SAYA 1UH5A 1XQ6A 5CEFA 4QFCA 1HDZA 3PHLA 5A05A 2PH5A 2ZJ1A 4CL3A 1EK5A 2ZB8A 3JQGB 1Q0HA 1EVIA 1QYVA 1RM3A 3LT4A 4J91A 4YWJA 4U0JA 4ALJA 3UHAA 1B3RA 3MCVA 1GEGA 1N1GA 2NADA 3BAZA 3MWEB 3WS7A 4TROA 1ONPA 4YR9A 1MFZA 4XGNA 1W0CA 5BNIA 1QP8A 3DONA 2YDXA 2Y99A 1B8PA 4E6PA 4JROA 5JAQA 2ZTMA 4ZQEA 1Y5RA 2JHGA 2GN4A 3IUSA 2X5JO 3PVZA 4BO7A 4FJ0A 2J5KA 3GVIA 2EF1A 5HA5A 4Q3CA 1N1EA 1ULUA 2GZ2A 3D4PA 3C7CB 1VSUA 3GDOA 5L9AA 4NNJA 1ZJZA 4EJ6A 3H65A 2I5PO 3V2HA 2EIHA 1A7AA 1ZXBA 3N58A 4TVOA 2VYND 2PZKA 3S55A 5DCYA 4ZQFA 1XQ1A 3RCBA 2O3JA 4Z3DA 3JTMA 3PYXA 4FN4A 4OKNA 3VKUA 3H7AA 2YW9A 4Z3KA 1G1AA 2IYOA 1R4NA 5A9SA 2W98A 5G2OA 5JYEA 4FFMA 3LC1O 3GUCA 3ZU4A 4O59O 2OXIA 2HRZA 3I9LA 3QWFA 5HBRA 3OJFA 5DOVA 1JA9A 3KEOA 2W90A 4LW8A 3ZHBA 1V0JA 4G65A 4XA8A 4OYRA 2B4QA 3DZBA 1V9LA 1F06A 3PQFA 4J1TA 4PN3A 3VOSA 2Q1UA 4Z9YA 2VHXA 1DIRA 1J49A 3ZWNA 2Y1OA 2DKNA 4CV3A 4FFLA 2RIRA 2WE7A 1I10A 3VVCA 2WEKA 5I7VA 1P3DA 1BMDA 5JS6A 2IRWA 2FOIA 2VNAA 1R4MB 4GMGA 2Q4EA 3CH6A 1WW8A 3RBVA 3DBLA 2J3JA 7MDHA 2NTVA 3KETA 1PGPA 3H3FA 3RC2A 3WQSB 5A9RA 1YOVB 3DOOA 2P9GA 4XYGA 2DBQA 1EE9A 1EMDA 5ILOA 1KY5A 2X7HA 3E9NA 4NFHA 4LSWA 4EUEA 2NVUA 2OOSA 2FY8A 2FRDA 1OZAA 2GN9A 2R2GA 1T4DA 1BXZA 4IQGA 2QW8A 1HDRA 2UYYA 3OIGA 4OOEA 3AOEA 3CUKA 1FDVA 4IGFA 2VQ3A 2FP4A 1B15A 1VL0A 1P74A 3LF2A 2I3AA 3OEYA 3U0BA 4YAIA 1O94A 1B7GO 1NFFA 4RL6A 3NYWA 1R12A 1ADFA 2YJZA 1QV6A 3NT4A 2HMUA 2FN7A 2GUGA 3ANLA 3ASUA 3RC7A 5CFZA 4UEKA 3JD3A 2FWMX 5J23A 1E3LA 2ZTVA 4CQMA 2D4AA 1XIVA 5TNXA 3SC4A 3HZZA 1TXGA 3V1UA 4CMHA 2C5EA 2O7QA 2ZYDA 3I1JA 1LLQA 3DB2A 4DLLA 4RJTA 4NR0A 4XD2A 2PD4A 3PWSA 5I9MA 1GDHA 1XR3A 1NASA 4RCVA 3PQDA 3RJ9A 4KWIA 1YL6A 4BNTA 3WTCA 1DPGA 1U28A 1DO8A 3O03A 1GFSA 1LJ8A 2AXQA 3KUXA 4JIGA 5THQA 1Y5MA 2GSDA 5H83A 3ETEA 1ISIA 3L0DA 3RBXA 4E5YA 4B4WA 3R0IA 4HBGA 3TL2A 1JKJA 3ZWPA 3STHA 4CM5A 4JJGA 2C54A 4MVJH 4NU5A 1QYDA 4YEDA 2EP5A 3GRPA 5CDTA 4JLWA 4BV9A 4URFA 1BDBA 1N5DA 4W7IA 4IXTA 4R5HA 4W9NC 1HDCA 1O5IA 3BMOA 1KETA 2YY7A 5DF1A 3OA2A 4IDGA 5TC4A 3RJ5A 4BHTA 1U1IA 2GLXA 1BXKA 1CWUA 3QVWA 3H2SA 1EE2A 1ZSYA 2E48A 2BFMA 5CDUA 1C3VA 5HM8A 2X0IA 3RQSA 2YV1A 1ZNQO 1XWFA 1X0XA 2Q2QA 1C1DB 4QO8A 3ZWMA 3ZV5A 1MC4A 2GF2A 4E5MA 4PLFA 4HFNA 3MJEA 2AE2A 2CMDA 2FHSA 3KLMX 1PZFA 3C24A 1OMOA 4UVDA 3EHEA 4R1UA 4AJIA 2VNSA 4BNZA 3U5TA 1GPJA 1WP4A 1NR1A 3GGPA 4GLOA 3OM9A 3U4IA 3KLPX 4S1VA 5TX7A 3LQFA 1LDMA 4CLOB 2O23A 2NQ8A 4NBWA 4CPDA 2WE8A 4LN1A 3B20A 4L8VA 1XU7A 2D1YA 2LDXA 4FR5A 4EJ0A 4RDIA 5K6AA 5KKCA 1MFPA 1QRRA 3CSDA 3MTJA 1VE9A 4GX5A 1ENYA 2ILTA 3IJPA 1T1RA 2PFGA 1FF9A 4CQLA 1EFLA 1LQUA 2OZPA 2YZ7A 4U6SA 4XYMA 1PJTA 1W6UA 4K6CA 2JCXA 1HLDA 2PNFA 3LVFO 1A7KA 1KEUA 3AY6A 3F4LA 3PIIA 1O8CA 3Q2IA 3HFSA 3KHUA 2ZCVA 3ZI0A 2EGHA 2OMEA 1U3VA 3GA0A 4NBVA 3QIVA 4MVJF 2WMDA 3SC6A 1DC3A 2V6MA 2GDZA 3G0OA 1E6UA 3U9LA 4RZHA 1YJ8A 2IZ0A 4D42A 4CMKA 1EBUA 4YTEA 1PL6A 3OIFA 3DDNA 3P2YA 1T1SA 1Y7TA 3GH3A 3RWBA 1P1FA 2DPGA 3ZV3A 5IG2A 3B6ZA 1G0NA 4U8GA 3FNEA 2IZ1A 5AYVA 5TJHA 1DJQA 4PG8A 1QG6A 2AA3A 3IOYA 2BGMA 2QZZA 1L1FA 2GGSA 1A9YA 5JAIA 4D43A 4NIMA 4Z9FA 1KOLA 3MTGA 1T24A 5JLAA 4WPGA 4CM7A 1T25A 4DGSA 3VC7A 4BIIA 2VZ9A 4CM3A 2YV2A 5BSEA 1PGNA 3BMNA 4BNHA 1ULSA 3ZW8A 1JWAB 3PGXA 1I2BA 5A9SB 1BVUA 5AQ1A 1GL3A 1JDJA 1XLTA 4CL8A 2HO5A 3AU8A 2ZB4A 5T6BA 1SBYA 1OC2A 1NPDA 3AI3A 3ZV6A 2AW5A 5T64A 4ILKA 3B70A 4NDNE 4ZD6A 4BO2A 1LLCA 3AI1A 4N18A 4E3ZA 2QRKA 2O4CA 2AQKA 5KOIA 4JCOA 4FS3A 2X86A 4JNKA 1KVQA 3LT2A 4BNYA 4W99A 4E2XA 2B4RO 4R9RA 1E3JA 1JW9B 3DXFA 1N9GA 2CDCA 3ZN2A 5L4LA 1FDUA 4DIFA 1WXDA 5B1YA 5IXSA 2AEJA 1R0SA 5DULA 4CV0A 5FI3A 5L95A 1XEAA 4YAEA 4PLCA 1EBFA 4OOFA 1QR6A 4RPGA 4NPCA 1JAYA 2D5CA 1XU9A 4JJFA 3WIEA 5CDYA 1ISGA 4BNNA 4M55A 4CODB 1F12A 5DDIP 2NVUB 3E03A 4XR9A 1SNYA 1N8KA 3GHHA 4BKOA 4Z0TA 1H6DA 1U3TA 1AGNA 3TRIA 1DLIA 5CDGA 2VWQA 1B0AA 4IJVA 1PQWA 5KJFA 4PGFA 1J6UA 3WR5A 2D2IA 4DQXA 3ZNNA 4BNWA 2ZTUA 4OSPA 4QXMA 4DPKA 4C7JA 2GNAA 1RKXA 2XAAA 1SOWA 4OJNA 3P2OA 3RAJA 1BXGA 3OQ6A 1TLTA 1Z6ZA 2I6TA 1B16A 1NPYA 2Q4BA 3JQBC 1ZK4A 4A5OA 3GAFA 4E4YA 3F46A 4P8RA 2EWMA 4HFMA 3U49A 1P0CA 4PLPA 2F00A 2A35A 2X22A 3SJ7A 3BYZA 2W8ZA 2Q49A 1B2LA 5U4QA 5IDXA 3BHIA 4XCVA 5TSDA 4GGPA 2HDHA 4N7RA 4IZIA 1PJ2A 4II2A 1DJNA 2HJSA 3VAZA 3EVTA 3ZWVA 3DBHA 5TF4A 1YDWA 1DFHA 4HFJA 3KXDA 4AJ2A 3DZFA 3ETGA 1SO8A 4FOOA 4PRKA 2IODA 1U7HA 1Q7GA 4OQZA 3RFXA 3VDRA 1PWZA 2ZB3A 5DOZA 2J8ZA 1HZJA 1UDAA 2D8AA 2B0JA 2PR2A 3DOCA 3K2EA 1SB9A 4EITA 2WYVA 4FBGA 1ZK2A 5CP8A 3QP9A 4TMFA 3GEGA 4BGUA 3PHHA 1NHWA 4FIZA 2YQ4A 4X54A 4DYDA 4BNFA 4LISA 3GMDA 4IDCA 1UXJA 3FNHA 4BB6A 4C4OA 5F21A 1HTBA 3D1LA 3PJGA 4L9RA 3LLSA 1ZO8A 5JE8A 2CY0A 1M76A 1LSUA 3PYMA 3S1LA 3RUFA 4BNKA 2GN8A 5EL0A 1C0LA 4YJFA 3WICA 3ZU5A 2BFOA 2PKRA 2WYWA 2FZEA 1UDBA 4HY3A 4FD3A 4DTIA 1DOHA 3TZHA 5KJ6A 4MIOA 1IYZA 2GYYA 4XJSA 1QLHA 2J3KA 1P0FA 3NTRA 4GKBA 1ENOA 1WMAA 2AMFA 1Q7BA 3S2EA 4K9DA 3IDSA 5G0UA 5FWNA 3WQQA 1SC6A 4RF3A 4DYVA 2NU9A 4NJMB 5T57A 5B37A 4CM9A 4AJOA 4AFNA 4WKGA 1K5HA 5CG1A 4OL9A 3RSHA 1I33A 1VSVA 3RIHA 1EUZA 4Z0HO 1V3TA 1XKQA 2OBYA 1DEHA 2QZ9A 2DQ4A 3R3JA 4CQLB 3IKVA 3DR3A 3H9GA 4YAGA 4XWYA 1WLYA 3JYQA 1BDMA 4DLBA 4BS9A 1A27A 3EVNA 1QV7A 1B8UA 4FQ8A 4IDFA 4I9UA 3SX2A 2O3UA 2FPGA 4GWGA 5ES3A 2DUWA 3QHAA 3RUIA 3A14A 3B1KA 4B3JA 1F8GA 2IZZA 1N92A 1JWBB 2VOEA 4OM8A 3V1YA 4MVJA 4W4TA 4AJLA 3KB6A 9LDBA 5DCWA 3PK0A 4ID9A 3WJ7A 3C1TA 5F1PA 4JN6B 1YE3A 1LUAA 3GT0A 2DTDA 3T7EA 1PL8A 1X1EA 2C20A 1DSSG 4TKLA 1E3EA 1Y9AA 3PFWO 3PLNA 2OORA 4IIVA 4H15A 4IQ8A 3RC9A 4UREA 5A03A 4XEHA 3GVCA 3PTZA 1Z7BA 2VT3A 5I9NA 4J0EA 2Z5LA 3ONDA 4B3HA 1N7GA 4WCFC 1CEQA 1I30A 4RLHA 3QWAA 5AXBA 1PZEA 2NVBA 5DN9A 2FR1A 2ZIZA 1PL7A 5L51A 1S6YA 1X1TA 5IDYA 1I32A 3GVPA 2HQ1A 1FDWA 1C1XA 3FTPA 2NV6A 3M2TA 4R68A 2A4KA 4XJTA 4JP3A 1Z7EA 4DC0A 3MOIA 4HFRA 4B79A 1UDCA 3IJRA 3RC1A 4L76A 2A92A 4O6VA 2EHDA 1Y81A 5T8KA 4TVBA 2GRAA 2AQHA 3JCZA 1EUDA 3CZRA 3AM3A 4PZCA 4W7HA 5T5QA 1B8VA 2XXJA 3GMSA 3QWIA 2G5CA 1UP4A 3WYCA 3ANNA 3H2ZA 4BNUA 1YH3A 1P1RA 1P1IA 1IULA 4XZ3A 4BOYA 1MXFA 2IE0A 4ZGWA 4BMSA 3GVXA 2P5UA 1HE5A 3BHJA 1K0UA 3TDKA 3KYCA 5BSHA 4PG6A 2EW2A 2VRCD 3NAQA 4D46A 3P5SA 4PZEA 1DIAA 1W8DA 1ZVMA 3PHJA 5B12A 4RVFA 5G4LA 4JK3A 5A06A 1LDYA 4HKTA 4NFYA 4F45A 2VYVD 4UEJA 4D0RA 4D45A 1OFGA 5JC8A 2D59A 4ZRMA 4GKVA 1TA4A 3Q1LA 4ESOA 1F17A 1TVEA 4XGKA 1E3WB 2NWQA 3B1JA 1PGOA 2P2SA 2WD7A 2F1KA 3WQRA 3VZPA 1P9LA 1AUPA 2ZB7A 1LDBA 1X7HA 1E92A 4JQCA 5C3MA 3F1KA 4KTTE 4OXNA 1PJ3A 4F6CA 5C37A 3DWFA 4BV8A 4MPDA 3ZU3A 1YQGA 1Y8RB 3NGLA 3FF4A 3AUTA 3NT5A 1E6WA 2EGGA 2QYTA 4I1IA 1XSEA 3BHMA 4MVJM 2UUOA 3BA1A 2DFDA 3AW9A 1HDGO 2CNBA 1VJ1A 3DAFA 4Y8VA 5DCUA 1F14A 2QRLA 3ZNQA 4PRLA 3PI7A 2CVQA 3AK4A 4H3VA 3OA0A 5F5NA 4HP8A 2ZQZA 2UV8A 3PYLA 1H0KA 4GVLA 3FSRA 4MP6A 3WSWA 3CZMA 1HLPA 1I24A 1NQ5A 3DBRA 4DVJA 2Y0DA 3NTOA 3K6JA 4XYBA 3ADOA 4KTVE 4XB2A 4WK6A 3ZHZA 3HDYA 4J4TA 4YB8A 5A4DA 2Q50A 4R4JA 4LGVA 1PJLA 3D5TA 4XIJA 1HDOA 3QW2A 5B4UA 3RFTA 4YDRA 4HNGA 3OECA 4E31A 1P1JA 5GMOA 1K2WA 2CVOA 2XF8A 5A9TA 1DHRA 1KVUA 4I9NA 4XR4A 1MV8A 1PU2A 3NKLA 1PTJA 2GD1O 2V65A 4CM6A 1IPFA 3VVBA 1AN9A 1ISJA 1BG6A 2RAFA 4YJFB 1ML3A 4JX8A 1GYPA 4EI2A 2YFHA 3DFZA 1ZK1A 4R3WA 4R41A 3WGHA 2JD2A 2H6EA 4HNHA 3C85A 3EZLA 3K8ZA 4LMPA 1NVGA 4E5NA 2R6JA 3IIEA 2P4HX 2QG4A 1I2ZA 1U5CA 5GZ6A 4A2CA 5TLSA 3V8BA 3JQ9A 3GRKA 1PJSA 1LX6A 2Y1GA 1ZK3A 1YBAA 3UN1A 4AJPA 3FI9A 2UDPA 4MP8A 5G0SA 4DIBA 4PIVA 4LRSB 3AUSA 1WDLA 2C2XA 3QVOA 3RUAA 4AJHA 4II3A 4XQCA 4B7UA 1PS9A 2CFCA 4XQEA 4D41A 4WASA 4MIEA 4ZRNA 3DZKA 5JXWA 2PY6A 2X1HA 4DWVA 1T2CA 4ZQGA 1B3BA 5ENVA 4CM8B 2P4QA 4GVXA 1XCBA 5I7SA 4NK4A 1AHHA 5KVCA 1X14A 2B5VA 3PRJA 4IJKA 3W6UA 4EBFA 1WDMA 2BKAA 4WEOA 4E13A 5CG2A 1EDOA 1I8TA 1TEHA 4J1NA 3K30A 1LDGA 3IKTA 4XRGA 4XQ9A 1OAAA 1GU7A 3L4BC 4KUGA 5KVVA 2A9FA 4Y98A 1GR0A 2H1SA 2X0JA 3DTTA 1XHLA 5JCJA 1M2WA 1KY4A 3K31A 2EEZA 4CMEA 4MJLA 2FPPA 3H9JA 2C29D 4BO1A 4MVJI 3NDJA 1O89A 2GO1A 2XXBA 2EJVA 1YB4A 2Q3EA 3VTFA 2P91A 3FNGA 3OBBA 4Q3EA 1QYCA 3K9QO 2BRUA 5C7OO 2EKQA 3FCOA 3O4RA 4NQZA 4R1NA 1GQ2A 2C5AA 4FFNA 3GF4A 2BELA 8LDHA 4AJKA 4IMPA 2GN6A 3GEDA 3NJ8A 3EUWA 3DC2A 2X23A 3KTDA 3INRA 1O9BA 1ZXLA 3HB5X 1O6ZA 4KDEA 4E32A 5L40A 1V3UA 4WEQA 3HQ4O 2YHIB 3LU1A 1UP6A 3DEYX 4CMCA 5G0WA 2PGLA 1C1XB 4FPXA 1PSDA 3ENKA 3DTYA 1WAMA 1GUFA 4LVCA 1KEPA 1UZLA 1R15A 2P9CA 3HUDA 2Q2VA 1U7TA 4Y67A 1UP7A 2R00C 1HXHA 3TFQA 4PLGA 3ZNOA 2BH9A 4BO6A 5T67A 2NUAA 1PGQA 2VWPA 2VHWA 1P45A 3D3WA 1ADCA 3PZRA 5MDHA 3JQ7B 4D44A 4RVSA 1ADBA 3QRWA 4QX6A 3OEWA 3EY4A 1NQTA 1R66A 1P1HA 2W4QA 4J4BA 4GSLA 3OMLA 4PG7A 4DREA 4E30A 2E49A 1IHYA 5IF3A 1NFQA 3O8QA 4JBHA 1PIWA 1I3KA 3NGXA 3K96A 4P22A 4E21A 4YPOA 4BGEA 1U3WA 1DIHA 2D0IA 2O3TA 3SEFA 3ZZNA 1YBVA 1MP0A 5TS3A 1I2CA 2WYUA 4TKMA 4YJGB 3HNPA 2HJRA 4ND5A 1L7EA 2VZ8A 2DAPA 4RO0A 4E0BA 3LLVA 2V6BA 1WDKA 3O26A 1ZBQA 4NBTA 4DPLA 2AEFA 3OJLA 4UULA 4CR6A 2ZCUA 3VZSA 5KJ1A 5H81A 2BMAA 4OAQA 1ZEJA 4CMAA 5C7IO 1GQQA 4G2NA 4OH1A 4NBUA 4XB1A 3EW7A 4WLOA 4ZN6A 1ENPA 5F3RA 4UAGA 1JU9A 2BHLA 4E2ZA 2WD7B 3HE3A 3L07A 1L7DA 4CR8A 1SEPA 1LEHA 1IUKA 3VTZA 4PFJA 4M86A 2EERA 3GY0A 4QQRA 1ISMA 1E7WA 1QORA 4N5NA 4WNCA 1T2DA 4BQPA 1M6WA 3DL2A 3OH8A 2Y0EA 3FHLA 4IJUA 4CM4A 1UAYA 3ZWOA 2PWZA 3RU9A 2EJWA 4YXFA 4INAA 5G4KA 3LF1A 3HDJA 5LC1A 5KWEA 3C8MA 3UUWA 2NTJA 1GY8A 5K9ZA 3I4CA 2DU8A 1E7YA 3PGJA 2HSDA 1PJBA 5C7LO 3FPLA 1J5PA 3ICPA 3GOHA 1OI7A 3B1FA 1TI7A 1VJ0A 5ENDA 4BNXA 3FTNA 1BW9A 2J3IA 1ZCJA 3SLGA 3ZWXA 4KDFA 4WLEA 2X5OA 4GAEA 2Y66A 3O9ZA 5AOVA 2VWHA 3UCXA 1VLLA 3RBZA 2Y05A 4EW6A 5HWSA 2Q2WA 4RZIA 4N5LA 3GHYA 5C5IA 2C82A 1DAOA 3HJAA 4CMBA 4ZU3A 4ALKA 5K0ZA 3M1LA 1MG0A 1LSJA 4J9UE 2B83A 4RGBA 4DUPA 1W73A 3UF0A 3CIFA 4YT8A 1DAPA 4XIYA 4K28A 2JCYA 4PZDA 1GPDG 5ADHA 5JDCA 5IZCA 3Q2KA 4BNIA 3DZHA 1ENZA 4BMNA 4R5MA 4BL5A 1Q1NA 3EGOA 1IOLA 1I0ZA 1YGYA 3GG2A 1E7RA 4GX2A 3IAHA 4RVHA 3H5RA 4I5DA 3OJOA 1R4NB 4MKZA 1U8XX 4NFSA 1H5QA 2VWGA 1M75A 2W2KA 4XYLA 4RF4A 4BO0A 3T7CA 4XQGA 3D0OA 4U7WA 4DC1A 1YS4A 1I3LA 1CF2O 5KTKA 2I9PA 1UXGA 2X0RA 3Q9NA 1BGVA 1IZ0A 3L6OO 4K26A 3H4VA 3IC5A 1OC4A 1HSOA 4L73A 4OKIA 4TZKA 5H82A 3T4XA 1ZK0A 3WGOA 4DRYA 5HS4A 3Q11A 4M49A 4U0KA 4WOKA 3VZQA 3WMXA 3GFGA 4IMRA 5L7YA 1ZIDA 4LVUA 4YJHA 1LU9A 2E82A 2Y1DA 3UCFA 1WVGA 5JMWA 3A9WA 3U4HA 4U6QA 5IN5A 1XA0A 2J5QA 4P4GA 2IDZA 2OGUA 4O1MA 3GN1A 1Y6JA 3FBGA 2Q1WA 4A03A 4BKUA 4CLRA 1QSGA 5ICSA 2NM0A 2BLLA 3LT1A 3I9KA 1FK8A 1CERA 3OQ1A 1GV1A 4TRJA 1PS0A 2V7PA 2TMGA 3E48A 4LRTB 3A28A 1BVRA 4BO8A 4FSHA 2W2LA 3P7MA 5IAAA 3QWBA 3DBLB 4E12A 2BFPA 5G0VA 3AOEC 2EXXA 1V35A 4LK3A 5EPOA 3PEFA 4CQMD 1CQIA 1MA0A 1UAGA 1VC2A 3OP4A 2OBNA 4IINA 2C2YA 3KZVA 2C7VA 1BHSA 3DMTA 1CETA 3FWZA 2IEBA 3AM5A 1PS8A 3JD4A 5CHEA 3WB9A 4RVUA 1SEVA 4EUHA 4TZTA 1UUFA 4QECA 5JPIA 3NRCA 1H9BA 4JBIA 1HE3A 3E5RA 2X4GA 4J7UA 1LBEA 1D1SA 2LDBA 1ZMTA 2FR8A 1XELA 1PR3A 4MKXA 4HADA 1WPQA 2NU6A 1R0KA 3VDQA 3PIDA 4E2WA 3QWHA 3KBOA 1XYGA 4EDFA 3PHGA 3UCEA 1H6AA 4PVCA 4Q3AA 2RH8A 1NXQA 4WCDA 4IY1A 1JKFA 1HL3A 5I8WA 4QFDA 4CQMB 3H3JA 3DZGA 1LRJA 4XGIA 2Q1TA 4CV2A 3V5NA 3OETA 3BTUA 1NQAO 1P44A 1CDOA 5A5FA 3GNTA 2DTEA 2X9GA 3D3WB 3W4KA 2IXAA 1IHXA 2ZKLA 2PD6A 4EEZA 3JQFA 1EEHA 1QYXA 2NU7A 1LRKA 3JYLA 1LI4A 3ASVA 2VRBA 9LDTA 3TZKA 5EJ2A 4UVIA 4ALMA 3L4SO 5G0TA 3S2IA 3MOGA 3O8QB 3RVDA 1V8BA 2UUPA 3OQBA 1YB1A 2G1UA 3ULKA 1K89A 2JD1A 4GL4A 3JQAA 4IPTA 5DZSA 5BT9A 4E5KA 5L45A 3PZBA 1D7OA 5HTOA 2OFPA 3L77A 6ADHA 1RWBA 3BMOB 4GH5A 2C59A 5ER9A 3LC7O 1YRLA 3IL2A 4ND2A 2YUTA 1J0XO 2DUUA 1H93A 5JAMA 4R3NA 4FOSA 4BUCA 4O63O 4FFOA 2Y93A 3EC7A 4BGVA 5K6AC 1C14A 4FC6A 4N5MA 1KYQA 3DHYA 4ITUA 1VJTA 4DQVA 3QVSA 3W8EA 1C0PA 5ER6A 3N74A 1NX6A 1T26A 1Z82A 2OP0A 2VUTA 4WLFA 1U2GA 3OSUA 2POQX 4A7PA 3W4IA 5JSFA 3JQCA 2Y1FA 1Y9EA 1IL0A 1YONA 2NNLD 3KYDA 4GPD1 1PQPA 3E6AA 2V6FA 1UXHA 3U4CA 2BGKA 3W4JA 4WOJA 3FD8A 4TRNA 3BTVA 4OXYA 1LSSA 4WUVA 1K3TA 4Q3DA 4R51A 3C7DB 3PJFA 4NMHA 3INTA 5COQA 2Q46A 3DHNA 3D4NA 4B8WA 5EQDA 4CMJA 2BF7A 3LT0A 3PHIA 4I5GA 3GLQA 3KM0A 1IY8A 4BKQA 1LTHR 1MUUA 4EEXA 1PWXA 3V1TC 2YDYA 4NG5A 4YQYA 4LSMA 5LDHA 3KSUA 1ZEMA 3TOXA 1LLDA 4GBJA 4BVAA 2PKQP 4PLZA 3ZWYA 1BW9B 2AG8A 3PFFA 4YACA 2J5RA 3AOGA 1PQUA 1PZHA 3K5PA 1NTOA 1YO6A 3ANMA 2YQ5A 3ZWBA 4I08A 4DQUA 1LXCA 2PZLA 5EIOA 4IDDA 2VYNA 5FYDA 3IP1A 2PLAA 3FR8A 5ICMA 3WOHA 1E7QA 3QLJA 1YVEI 3DO5A 4ZQHA 4NH4A 4P38A 2OP1A 4DMMA 3Q6IA 1NWCA 2V6GA 4K1LA 1M6HA 3TN7A 3WIDA 3TZCA 1Q0LA 3CKYA 2DTXA 4IXWA 5DNAA 4IUYA 1I3NA 3PDJA 4RQTA 3I9JA 3WYEA 1U3UA 4ZJUA 4HX5A 5GY7A 1O95A 1GUYA 1HDYA 3GNQA 5KIAA 2YYYA 2I67A 3GGOA 4J7CA 3BMNB 1C0KA 3KSDO 3L9XA 1LNQA 3MJ4A 4YT4A 4EZBA 1F0YA 3V2GA 4GWKA 2J3HA 2ZJ0A 3WFJA 2NVWA 3L4BA 3L6DA 1ONOA 5L7TA 3TZ6A 1E6EA 1HF3A 3WTBA 3W1VA 2PKQO 4LMRA 3GPDG 4BNVA 2GZ3A 2JFHA 5A5EA 1U4SA 1YJQA 4EUFA 2VHZA 3CXRA 3JQ6A 4OXKA 4EYEA 1R0LA 5HRUA 3NDIA 4FJ2A 2DBRA 1CQJA 3NX4A 3MWDB 4IS2A 4YJHB 5JYDA 3RFVA 3FRJA 1U8FO 1MG5A 3RUCA 2I76A 1EQUA 1E77A 3DMYA 4HV4A 1CYDA 1N9GB 2X5KO 5F1OA 4CLRB 4YAJA 2CF6A 2HK8A 1AHIA 4RQUA 3WJAA 4B4VA 1V3VA 4AICA 1NWHA 3WGYA 4D3SA 3L6EA 1H6BA 4A27A 1TT5A 1TB4A 1NAHA 3PP8A 3ROQA 4A0SA 1P33A 3WSVA 4YAKA 1HRDA 4E33A 4D3FA 3HADA 1DHTA 2X6TA 3BMCA 3ICCA 4M87A 2B37A 1LDEA 4E5PA 1HYHA 3BIOA 1YWGO 1RPNA 2JAPA 1X15A 3Q9UA 3CINA 1B26A 3G79A 1DRWA 1T2EA 2FZWA 4L4RA 4J0FA 1W4ZA 2BD0A 4J1SA 1HE4A 3VPSA 2PZMA 1LLUA 2B69A 4QO7A 3VH1A 1IE3A 1EUCA 3UGKA 1GQYA 3I83A 5U1PA 4M89A 3RUHA 4PLWA 3SBOA 3JV7A 3SJUA 1YL7A 3ZNPA 4GSKA 4D0SA 3K92A 1I01A 4A73A 3HDQA 2VT2A 4FW8A 1BXGB 2Y1EA 1HE2A 1EVJA 3SVTA 1SCUA 2Z95A 4L4SA 4Z6KA 2RHCA 1E1MA 3JQ8A 1E1NA 2AHRA 2NSDA 1D4FA 2X9NA 1PX0A 2YFQA 3IP3A 1ARZA 1I5RA 3EMKA 3M1AA 1CIVA 4FCCA 5FF9A 1RYDA 1C1DA 1A72A 4XYEA 3LDHA 2CZCA 2A94A 4GI2A 4YJDA 3I5MA 5B4TA 3BTSA 4C7KA 3QVXA 4I8XA 2O48X 3DBHB 2WSBA 3BMQA 1DRUA 4NK5A 4K6FA 4W9NA 1YB5A 3GGGA 3PPIA 4CLOA 1I36A 3D4OA 3OICA 4OQYA 1YQXA 3E82A 1E1KA 1P31A 1UR5A 3DFUA 4Y6RA 1JN0A 4YRAA 4BB5A 4MKRA 3BTOA 4AJEA 1KS9A 1YL5A 3JQAB 4CM9D 5IN4A 3RASA 3WGTA 3T4EA 4WE3A 2DFVA 1CRWG 1GYRA 3QSGA 1FDSA 1A5ZA 1X0VA 3M2PA 4JJIA 1MB4A 1NHGA 1NVMB 3G49A 1KERA 5AVOA 4GQAA 3I9MA 3ZV4A 3RD5A 4EGFA 5ILGA 4WJZA 2QX7A 4RLSA 3LSYA 2VHYA 3TPCA 1WNTA 1U9JA 1Z45A 2DPHA 1GYQA 3EYWA 4FGWA 4KZPA 1NNUA 3HWRA 4EJMA 4YCAA 3H8VA 3JSAA 4J16A 4YA6A 4CUJA 2B5WA 3E18A 2JL1A 3HG7A 1BTOA 4UVHA 4BMVA 4CUKA 3GG9A 2FSSA 1A9ZA 1U2DA 4MVJD 3PWKA 4R54A 4DMLA 4CJXA 1N2SA 2VTDA 3ZHXA 5EERA 1HYGA 3EDMA 5JDIC 5TT1A 2NACA 3KYDB 2Z1MA 1WMBA 4R69A 3AUAA 1VKOA 2BGLA 3QJ5A 3EK2A 3KRTA 4Z0PA 4XRRA 4AJJA 1WWKA 3Q3CA 2DLDA 4WLUA 2OO5A 1ISHA 4J2HA 1KEVA 3FNFA 3RROA 5ITVA 1YBMA 3SLKA 2I66A 5I7EA 3A1NA 4Q3NA 2EG9A 4PLVA 1WZEA 3RKUA 3TL3A 3WWZA 3HB4X 4TWRA 3IQDB 5HS6A 4D3DA 2G82A 2JD0A 2JHFA 4LCEA 4Z9XA 2HK9A 2WM3A 4IDAA 4PLYA 2WD8A 4QSMA 3HDHA 3UXYA 2AEMA 3WLFA 4G5HA 4BO4A 1KC3A 4KQWA 4H16A 1QMGA 4CV1A 1RM0A 4HWKA 3LK7A 3W8DA 1MGOA 5BNTA 2HMVA 2GCGA 1E3SA 4UVEA 3G17A 5CEJA 1LSOA 2O50A 3C1OA 1VL8A 3D5QA 1F8FA 4RORA 2QHXA 1MXHA 4Y6SA 3HN7A 3HN2A 1UJMA 5JO0A 3ZGYA 1J4AA 1LC3A 5BNFA 3TFOA 1IB6A 4E2YA 1H9AA 5T8KC 2G17A 1VM6A 3GZNA 5KVSA 1DRVA 3ZU2A 3VHRA 1QLJA 1X13A 3VPFA 1Z73A 5TT0A 1M66A 1HT0A 1H2HA 1XGKA 3I6QA 1RM4A 1HWYA 1GD1O 3E9MA 5KVQA 5EMHA 3TNLA 4AVYA 2H5LA 1ZJYA 3AUUA 3QE3A 4B8ZA 1HEUA 3JYNA 1KVSA 4J9VA 3EAGA 3WX0A 3GDGA 2FSVA 3Q0EA 5LCXA 3C1AA 4IDEA 2OL4A 4OGWA 3K2BA 3VPHA 4JGBA 1DIBA 3GEMA 4I9HA 1K6IA 1T4BA 1YXMA 1NQOA 3DAPA 2VHVA 1JVBA 2DBZA 1MX3A 1UXIA 5I8ZA 4UVGA 3OFSA 4R9SA 4FFRA 3UOGA 4GMFA 5A1TA 5JY6A 3G1TA 2ZQYA 2ZK7A 3GN2A 3X2FA 1Z75A 2PA3A 4J7XA 4PG4A 5COAA 3MJVA 3F4BA 2WTBA 3I9NA 1TT5B 2C7GA 3KYCB 1SOVA 3P19A 1E5LA 1KVRA 2JAHA 3BMCB 1ZH8A 4HUJA 3JQBA 4IS3A 4RPJA 4KWHA 2CF5A 3PQEA 4RF2A 1QXSA 1PJQA 3LZ6A 5L3ZA 1NM5A 3S2GA 3WYBA 3GFBA 1KC1A 4CR7A 4NI5A 3F47A 4OO3A 4R1TA 3UFXA 4OSOA 2O3QA 1ORRA 1HZZA 3AJRA 3QY9A 3I52A 5GZ3A 2Y67A 1TT7A 1GCUA 1P1KA 4J4HA 2H63A 3E1KA 3NUGA 2JCVA 3WNQA 3A06A 5JMPA 3UAGA 4KUHA 3JQ8B 4RV9A 4I5FA 3UVEA 1LRLA 3JD0A 3KOUA 1PJ4A 1LA2A 5L53A 1NPTO 4W6ZA 4MOWA 4FDAA 1DB3A 2QQ5A 4AJ1A 2I65A 5CAEA 4NBRA 2X8LA 2HUNA 3KSZO 2ZYGA 4ZA2A 3WBBA 4CLHA 5U9CA 1M67A 3OHSX 2B4TO 2D5AA 2Y68A 5THKA 3ZWAA 3BMQB 3D3EA 2D3TA 4WLNA 3WNVA 1EVZA 1JTVA 3IMFA 1JLLA 1PZGA 1PEDA 3ROPA 1EZ4A 4WLVA 1N7HA 4MVJP 4NJMA 4NHEA 3DBRB 5LDGA 4CLEA 4YYZA 2PGJA 4GGOA 3SXPA 2VCYA 5L7WA 3PJEA 3ENNA 1Y8QA 3I6IA 5BSFA 4ZICA 2EP7A 4Q39A 1E7MA 1KVTA 3KYBA 3U4DA 4AL4A 4UUOA 4NU6A 4FFPA 1VPDA 2G0TA 3X2EA 2B35A 5CEEA 3PLRA 2NLOA 3AFNA 1LQTA 5JDIA 2Q99A 3NEPX 5F1KA 1Q2XA 1S7CA 2DVMA 4IGEA 2IYPA 4A10A 3HHPA 1UZNA 5DP2A 5AXCA 3ITKA 1NBOA 5ITWA 2SCUA 3DHEA 3JQ9C 2WDZA 4L4XA 2HK7A 4QUKA 4J43A 5FI5A 3IS3A 3RUDA 4MIYA 3H9QA 4DA9A 1GEEA 2ZTLA 1DC5A 1GUZA 1ZUD1 2BI8A 1KBZA 4CMGA 3FR7A 5AXDA 3FPCA 4DBVO 3I23A 4AJNA 2CVZA 4L75A 4TRRA 2NQTA 2DT5A 4MVJE 4AJ4A 1I3MA 3WLEA 3VH3A 3GAZA 3S8MA 3F5QA 2FR0A 4B7XA 4XDYA 4PCVA 2I3GA 3E8XA 3MJTA 4QT0A 2JFGA 5JCJD 3NV9A 3QV1A 8ADHA 4IM7A 4BGIA 2PGDA 1NYTA 3F1LA 4RPLA 3WGZA 1GZ3A 4MVJG 3TOZA 1QYWA 3F5SA 3L9WA 2PH3A 3UICA 4YT5A 3U09A 2WJPA 5BQFA 5CPFA 5JFOA 1ZFNA 3KV3O 4CMEC 3U3XA 4J1QA 2YV3A 4TRMA 1D1TA 3ABIA 4MP3A 3VZRA 1MC5A 2Y0CA 3C7AA 3PJDA 5DP1A 1U4OA 1WZIA 1ISFA 1ZSNA 1LDNA 3QVTA 4WCFA 5B4VA 3S2FA 4JBGA 1PGJA 2CD9A 3D7LA 5I9LA 3PWZA 5JAZA 4JP2A 4U5QA 4BNJA 2H9IA 4B7CA 3UW3A 2IEDA 1GZ6A 3N7UA 1B14A 4RPKA 4TSKA 2ZATA 2EV9A 2GPTA 5GZ1A 3NJ4A 3ZWWA 4YRBA 4IZHA 5JCXA 3ADPA 5TGDA 2JKVA 4M8SA 2GASA 2O7SA 4B4OA 2C07A 3F9IA 2C0CA 3AU9A 3CEAA 1Q7CA 4F3YA 2UVDA 5A3JA 1YKFA 1SPXA 4M54A 3MJCA 4UUPA 1ZSVA 2IXBA 4CMIA 1IZ9A 2VTEA 3GNSA 3RUEA 5JO9A 3FN4A 3DOJA 3QA9A 2I99A 1O0SA 3VPXA 4Y6PA 2ET6A 1H6CA 1EVYA 3KVOA 3VPGA 5BR7A 2CDBA 4J3FA 1UZMA 4ALNA 5BSGA 5L4NA 3GZNB 3ZCXA 5KNLA 1NP3A 3W8FA 4F6LA 2RCYA 1ZW1A 1T2FA 2AQ8A 4ONEA 1H2BA 5TQVA 1V6AA 1E5QA 1KEWA 2XOXA 3RU7A 2Y1CA 4YQZA 1A4IA 3WDSA 1DC6A 1E3WA 1D3AA 3AM4A 4ND1A 3I9OA 1C0IA 1VI2A 4FGSA 4FC7A 3GUYA 4OHUA 4OIMA 3ZDFA 2RBEA 4Y9DA 1HYEA 1NAIA 1P77A 4CLDA 2Q1SA 4ALIA 5DT9A 3I4FA 3HFGA 5EN4A 4N54A 3CE6A 2VRCA 4HXYA 3H6KA 1Y8RA 3LYLA 2AQIA 1ONNA 4BNLA 1VL6A 2GR9A 4NJOA 1SMKA 4IQ0A 5FEUA 5EQFA 1UXKA
chains in the Genus database with same CATH superfamily
1BD3A 1Z83A 2EEPA 2Z1NA 4QGHA 2HZ7A 1G7TA 3S99A 2REQA 3ANTA 3JQGA 2O9JA 2WUWE 2G0NA 3R0VA 5LNK1 1NQVA 2ZRKA 3WO1A 1VB3A 1ID1A 4FX2A 4D79A 3CEMA 1RZVA 2PSJA 4PVDA 1DBRA 5IVIA 1OX4B 3FBTA 2E89A 4Q5IA 2JFZA 5CM9C 2B2XA 3NEJA 5DGTA 4I5EA 5CBPB 2DSNA 4QNMA 3WHIA 2WKPA 4NZOA 1R1DA 1N7JA 1YQTA 3IDAA 4L0QA 4HI0E 3IVGA 3L49A 5EKDA 3BZUA 1V5WA 3D6TB 3EGCA 4US1R 3UT5B 2XUDA 3IPCA 1OUMA 5KNBH 5IJAA 3TW8A 4F9EA 2NYRA 2FH5B 2BHSA 1GZVA 2F90A 5JTTA 1XTTA 5HGXA 1LC0A 2R62A 5FR1A 3KWFA 3RT9A 5LD2C 1VZ3A 1U2ZA 4BKRA 2ADFA 1P7CA 4WWHA 1GL9B 1Z2PX 4F3KA 1OWOA 4MWZA 4MKFA 3BCUA 1F38A 4V0RA 3VKVA 1YQDA 1N3IA 3GVHA 4HDKA 4K9PA 4MRMB 5IDWA 6LDHA 2A9OA 1WZ2A 4JT2A 2NTNA 3AI2A 1DDOA 4U6NA 5HQTA 4CM4B 5CAEB 2ZR7A 3QUSA 4CF5A 1QIIA 3A2LA 4GI5A 3W2FA 2FMFA 4BLTA 1YMQA 4PGAA 1VLQA 4HNAA 2WFLB 4QNRA 2EGUA 5KX5A 2C4KA 2GXQA 1MPXA 1ZZEA 2RHRA 2WWRA 4ND4A 2YFKA 4OHZA 3ZGOA 1TQ2A 4O2BA 4O3FA 3ZZTA 5IFLA 4B6RA 1DOAA 4H4EA 3T4UA 1JLLB 4W1RA 4EM6A 3KOXA 5JISA 1BXRA 1OXUA 1U5AA 2CUKA 3V80A 3VBCA 1NVTA 1EJ2A 4PSKA 4E1VA 2CYCA 1DV1A 2JZCA 3V48A 1DL5A 4IDBA 2VP6A 4RNCA 2QUJA 2HHCA 2QXUA 4LCJA 1T1GA 4JC0A 2J6IA 3WLPA 1JXOA 2HCTA 1U63A 4R7TA 1TL7C 3C2QA 1NBIA 4KKVA 2MSCB 4HLUA 1I0IA 1IFXA 1PVOA 5F5LA 5JSZA 5DPMA 3WWYA 4O2RA 3KEGA 3BQMB 3ZQ4A 3RKRA 5C7YA 1AE1A 3TR5A 4EX6A 4E08A 2ZYAA 3JSXA 1AMNA 3HL0A 4BNMA 2XT0A 3QEOA 2PCLA 1L7BA 4Y6QA 5IABA 3DZDA 1FXWF 1PJCA 3O38A 2OAQ1 5EE0A 3UQZA 3WXBA 1Q17A 5CNIA 3DAGA 2WWVD 3HXTA 5LQAA 3RKSA 2SCUB 4JVNA 2OFWA 4JYMA 4Q3BA 2LNDA 2XPCA 3FKQA 3N1UA 1PJAA 1CR0A 1YQEA 1ZQ9A 3ROZA 1GZSA 3HCCA 2PXCA 1FSFA 4DKXA 3DM9B 3GK3A 3H9EO 1IAQA 3O2SB 3TQRA 4AK9A 5JOQA 3BSYA 1TEVA 3Q8LA 1YFLA 3E22B 3U3ZA 3U60B 4RF5A 2JFPA 1YOVA 2G7MC 3H6HA 3JYOA 2RHJA 3N2KA 1UOPA 4QDJA 4WECA 3T12A 3KJEA 4ZVVA 4EQ6B 2D62A 3ZH2A 4ZVUA 3DEHA 2ZVPX 2W2LD 4IHJA 3DLTA 1KIFA 3I32A 3V8VA 3TQHA 2O8DB 1N0VC 2YHUA 1QF6A 1JHMA 1PR9A 4EDHA 1Z34A 2P9EA 1LNSA 3PD7A 2HAEA 3AR9A 2YWHA 5TMBA 3R75A 3WG9A 2LCQA 4DDKA 1BROA 3CNHA 1WULS 5KKAA 1N6RA 1XDSA 4EZIA 5A3VA 1PR2A 1A4UA 2TMDA 2IHKA 5JVDF 3MTDA 4DGQA 2RAPA 1SCKA 2JKZA 1Z68A 3C7KA 3CV3A 4PG5A 2Q5LA 3DQPA 3G5UA 4L4YA 5LLSA 3R7WA 3VBEA 5JI2E 5HM6A 2J9XB 4H7PA 2FMTA 1XEXA 2NUTB 2XT6A 2VHJA 2G6TA 2WG0A 3RIEA 2OD2A 1GAQA 2HLDA 2QDXA 3IUPA 4WCFB 3M33A 5DBIA 1J8QA 5LXTF 4M37A 5BUZA 4F93B 3V4RA 3DMTC 1UMDB 3WGQA 4C2UA 1N33B 1TAHA 3KR2A 4JH0A 4UUMA 3OIDA 4BQOA 3JD1A 1EFDN 3IT2A 1VBNA 1YQQA 5CCEA 1UEIA 4CGYA 3JRNA 2IOHA 3E9QA 3BB4A 1P19A 2O3SA 2Q0HA 3QFCA 4WXMA 1L5NA 4PE5B 4AN0A 4X1YB 4DBZA 4JI2B 3D64A 4FHDA 4UNNA 1C7FA 3TZQA 1AZLA 4MUNA 1G2OA 2WD9A 2WILA 1L8XA 3JQ7A 1SWVA 4LNUB 2FR8C 3INGA 4OBBA 1W0KA 3RSOA 2VTBB 2PZJA 1MQ8B 4HLQB 5GTDA 5EIAA 2O07A 4KUEA 1EDZA 2EHJA 3ELDA 5EHXA 3NT2A 4F1KA 4U4AA 3UAOA 3ONFA 1DTWA 3WK7A 2HLHA 2GEFA 4EMUA 2HMWA 4YJ2F 3T3IA 4C4RA 2R00A 2WABA 3ONEA 4GPTA 2FOLA 4MX8A 2O2SA 1JR3D 1WVMA 4FSXA 2H31A 3DH0A 1REQA 1NVVQ 3BBLA 1RRPA 2DLNA 1OHHD 3F6RA 5D87A 4ZV9A 4F56A 1SKMA 2NU6B 3F90A 5A4JA 4LXIA 2H85A 2FCAA 3WJ2A 2C78A 1DG3A 2W00A 5LJIA 4MDHA 4O5OA 1KZGB 1RYEA 1UBTS 1W25A 5KJEA 4IG4A 4MQEB 3IOMA 5FQNA 3ROMA 2PFSA 3M82A 1HLFA 4LBVA 1JJFA 3HYTA 3JQAD 3VPAA 1AZSC 5KPJA 1IHPA 3H1PA 2E37A 2IOQA 2LGJA 3KJIA 1SQGA 4KW7A 1J1IA 2GPAA 5FBQB 3E5MA 4F4IA 3DUFA 2B4KA 3P2MA 5A02A 4L74A 4HZIA 3D2AA 1BRMA 4NFLA 1CS0B 2I3DA 3KCNA 3Q8MA 1MX1A 3OJ0A 4J7AA 1C5KA 1R8YA 5B2ZA 1RM5A 1QKIA 4EQZA 2QY9A 1GADO 1TU4A 4HJRA 1G8SA 3B3QA 3H5NA 4BFVA 4DMGA 2KS6A 2NU7B 3AVPA 4LDRA 1S3SA 2D2EA 5E6RA 2C57A 7REQB 2FSIA 2ZROA 4TMYA 1JEYB 5AWFC 1AVTA 1BSVA 1OROA 1XD8A 4NEGA 4J90A 2C95A 3Q12A 2FNAA 4YRDA 3EG9A 4P82A 3IP7A 2JPDA 5C80A 1IZZA 3ITDA 3KT6A 4XDGA 3W5DA 2OC9A 1V5EA 1SAYA 3MIIA 4ZTBA 1WSAA 1XQ6A 1N8NA 2YWEA 2JIDA 2PMCA 4NBKA 4NULA 2PH5A 2ZJ1A 4QFCA 2YMLA 3DVAB 2OT3B 4WDQA 1EK5A 4DNFA 1PZNA 2NXEA 3ABQB 4H1HA 4JU8A 1OWLA 1RM3A 4Y6GB 2XZTA 2WVHA 4U0JA 4ALJA 2RGRA 4ZCRA 2DPLA 1T0JB 2W4MA 2BE7A 3STTA 1KQFA 1LLFA 2LIPA 1GEGA 5FCDA 3CE9A 5AW3A 3MWEB 2RBGA 1ZD5A 5AESA 3M81A 1TMKA 2ACKA 1LNZA 1W1WA 2FQWA 3HA5A 4P33A 1HURA 5I01A 2A6PA 1R74A 2NQ2C 1E9EA 3D0KA 1K98A 3NIBA 4H17A 1TQ4A 4KQMA 1O58A 1EHIA 1R8QA 1U0EA 3O8LA 4ZQEA 1C3JA 2XNKA 1G8JA 1QX4A 2OEPA 3FPAA 2HPAA 2D2XA 4N40A 3VRHA 5BPHA 3Q98A 1BMTA 3HV2A 2WTMA 4BO7A 1E8NA 2EF1A 4HGPA 2QRNA 1EGVB 2PBFA 3GRZA 5KYKA 3NB0A 3GDOA 5KYWB 3VMFA 2NYUA 3CH7A 3ICEA 4H1WA 4ZZIA 1O97C 3QOWA 2QTGA 3KOOA 4JKOA 4C88A 4Q03A 1ZM2A 4MW2A 5CX1A 3VQTA 3H7IA 2OE2A 3ID6C 4EFKA 3V2HA 1I3OA 1E32A 3ISVA 3JQRA 4LF5B 2FUKA 4GZ5A 4LV5B 1TAGA 2PZKA 2Z3WA 2I2BA 5E9QA 4JLMA 1DXQA 4UMVA 5FNVB 4AWAA 2OXFA 3DOUA 2Q4RA 1JAHA 4ZQFA 3RCBA 4DCJA 6Q21A 2OD9A 1YOBA 3AR8A 5IJ9B 3AVUA 4OUDA 3WE7A 3HEMA 5C8ZA 2HSJA 1QZ3A 1ANKA 1Z6QA 4GYKA 4OKNA 1M6NA 2GF0A 4Z3KA 1N5RA 4LA4A 3LAWA 1ZISA 2W98A 2VXCA 3NNNA 2RC6A 3PNSA 4AJ9A 1TEXA 3LDFA 3QH4A 1Z36A 2LW7A 3MYRA 4FP9A 4E5VA 1O95D 2QAGA 4Q4CA 4FBLA 1E3QA 3OE5A 1MOZA 1ZUWA 1DPFA 3D7SA 1BS1A 4FI3C 3OJFA 2OFFA 1JA9A 5JNVA 4KR6A 4F71A 5AKJA 4LW8A 4BX9A 2B4QA 2C7BA 4ZXFA 3HM9A 2YOGA 1OTXA 5L3QB 1V9LA 2ZRIA 2F8SA 1FFXA 5TPWA 4DMCA 1O6FA 1FXWA 5EHIA 1JMYA 2PBLA 3H2HA 2J59A 2QUIA 1EPUA 1V11B 4OATA 4R05A 4XLZA 5DTRA 1B93A 3T99A 1XTZA 3RPEA 1YI8A 2DCUA 3RNOA 3THSA 3U7FB 4CV3A 3HJNA 4GKJB 2IS2A 5IBQA 2ZSHA 1QC5B 1VLVA 5TQ0A 1I10A 4BB9A 2P30A 1KI9A 3JRXA 5DHRA 2FN3A 1WCXA 1UM9B 1W5FA 3WK5A 1BMDA 1IBCA 4Z2AA 3C7TA 4QGGA 3L0IB 5K5EA 5JARA 3OPNA 5JSUA 3DBLA 3T6KA 3TKYA 4IRMA 5JS8A 3A6HA 2ECOA 5K0TA 2DBQA 1EE9A 3DF7A 5HDBB 4DVGA 1P2DA 5ILOA 3E9NA 4C0QC 3UV7A 4LJAA 4NFHA 4CG1A 3URMA 1NJSA 4AYXA 3T38A 3SEZA 1VFNA 1XK6A 1WBBA 4MR9A 2CK3D 1VGQA 5IDVA 4QOHA 3TXYA 2YXLA 1JSLA 2JBAB 3PL1A 4ZDIA 1NVWQ 4OQLA 1BXZA 2CXXA 2RSLA 4X20A 4DWJA 1OGJA 3NHLA 4HGQA 2WIAA 1ZI9A 3AOEA 4HDCA 5FTMA 3U2QA 4TMTA 1FDVA 2VZLA 2XNHA 4K6MA 3RARA 5JVDA 1JQ3A 5KMGA 2DBYA 4ENRA 3FXAA 3LF2A 4M1ZA 3K1TA 1CQJB 3U0BA 2ZR0A 1L7RA 4D9FA 1RMYA 3H4MA 3F9CA 4RL6A 1VCIA 4H6PA 3UJPA 1H1LB 2A0KA 2FN7A 1CG6A 2NO4A 1WBJB 4OMDA 4WQMA 4BLQA 5LXTA 3ASUA 3WKCA 2ZXUA 4ZARA 3RYIA 1P7WA 3OZBA 5B3LA 1B73A 2H0AA 4ZI3A 2AKAB 4B4KA 1G8MA 2ZTVA 3FIJA 4LOIA 4LYJA 5JPDA 2L18A 2D4AA 1XIVA 3S27A 2QJRA 1KKUA 3V1UA 2O7QA 5ILQA 1J22A 1LLQA 2CMFA 2ZIUB 4DLLA 3WADA 3PWSA 3NNSA 2E4WA 5K01A 1GDHA 1VJ5A 3NC1C 5HK9A 3PGMA 5FOUA 4P4SA 4ZJZA 2FPIB 4NF2A 3ZE9A 1GR1A 1A1SA 3UB2A 5BORA 1J2RA 3OCZA 1CY1A 1W88B 1YL6A 1F8UA 4EJSC 4PSVA 1MJNA 1U28A 3H0CA 4PQRA 1PRYA 3KUXA 5THQA 1NXVA 1Y5MA 2GSDA 4LYAA 4WRRA 4DSOA 2XKKA 3ETEA 4YJ2A 1C8BA 4DV6B 2ZJFA 1GG5A 3KKPA 4B4WA 3LYUA 3BULA 5EXTA 4D81A 2VT7A 4HBGA 3TL2A 1JKJA 4UQLA 2QZJA 2C4NA 4DA7A 4CM5A 3K71B 4C3ZA 1ZN8A 3IBFA 2ZZNA 1D1PA 4PNPA 2VS1A 4RTSA 3TNYA 3CSUA 2JBHA 2H00A 2QA5A 4BV9A 4URFA 2G04A 5IKMA 2R751 4BIMA 3MCWA 2YW2A 4IXTA 4NYIR 3CPEA 4W9NC 4X1IB 4OQFA 5FJIA 2AR9A 4TTRA 2EZ8A 2GAJA 3IP5A 4PBSA 5DF1A 1WCYA 1DKOA 2O7NA 4XWAA 2DETA 3U3DA 1ZSYA 3PCRB 1PWHA 1C3VA 5FAXA 3SBDA 5HM8A 3THXA 1J99A 2OCPA 3EARA 1XWFA 1BDIA 2GOYA 1EDBA 4ZDKA 3ZV5A 5HP4A 1NVUQ 3K3PA 4JZYA 4FZ5A 2GD2A 3QLTA 3MJEA 3NI2A 3OUUA 4V0NA 1SOUA 1ZA2A 2C5HA 3V8RA 2B82A 3H1GA 3KLMX 1H23A 1PZFA 4UAUA 2GEDA 4P2BA 4JUBA 4Q4LA 1GZ7A 1T0IA 3AIOA 3LLMA 4R1UA 5DBOA 2GZAA 5DFAA 3U5TA 1Y1TA 1WP4A 1NR1A 3DG9A 4HEJA 4S1VA 4R2XA 1J1ZA 3K0AB 4CLOB 1LI5A 2IC5A 2PUHA 2O23A 3FYUC 1XZCA 3LI2A 4I1RA 4ZAVA 4EHLA 3JWHA 2NV2B 1ZVKA 3HYRA 1AQNA 2XUZA 4B09A 2LDXA 1T5OA 4EJ0A 3WKDA 4WN9B 1H9CA 1L4UA 2PLNA 1E1RD 2I2XB 1NC1A 2AN9A 2W22A 2ZITA 4JIMA 4PO9A 5C1DA 4MUXA 3CSDA 2AYXA 2ILTA 1H3EA 2FW7A 1U02A 1T1RA 2B30A 1YVPA 4TX1A 1PWEA 2XTNA 3D4BA 1UPFA 3KFVA 4LIPD 1OF1A 1RWNA 3CUSA 1VYHA 4MKIA 5D3QA 3WBJA 1JA0A 4IOKA 4ZV4A 5FQOA 1OFHA 3CLUC 2PSFA 4K6CA 1U2DC 4D02A 2GFHA 2YZNA 1A7KA 4HNRA 1KEUA 1A5BB 4WCVA 4ECEA 2B98A 1RXCA 4DY4A 3I5AA 3HFSA 4FR0A 4QYWA 3NOXA 4S0XA 5AM4A 5LMNB 5FD8A 4G8BA 3GA0A 3KYJB 3GUVA 2ZSEA 3KQWA 3ESBA 4MVJF 1PYGA 1UBMS 4NBVA 5AJWA 1HG0A 4QREA 1D6SA 1WB5A 2EOAA 2V6MA 3EWSA 1T9BA 1A95A 3IUQA 1DEOA 4RD3A 4RZHA 4D42A 3PS9A 4KIUA 4OA5A 3P2YA 1MB2A 1T1SA 3V7WA 3RWBA 5FJJA 3S4YA 2Z83A 5AVZA 1I6MA 2OO5C 3B6ZA 4JA2A 2P6UA 5ES4B 3LUAA 2VXOA 2BR3A 1E8MA 2LV8A 4S05A 5F98A 1DJQA 1FSPA 2RGNA 2QTVA 2C2GA 2VPWA 4RKEA 5BQ5A 4ZEWA 1OLXA 1OPXA 1VYUA 2QZZA 2KB0A 4CKXA 3AEUA 3M3HA 1JNYA 1YIOA 1DT5A 3FFWA 3MXOA 3QK7A 4UBOA 5D5PA 4Z9FA 4ZDWA 2G9VA 5JLAA 4WPGA 2ZU0C 3W9SA 2RHLA 4CM7A 1OR8A 5TS2A 4DGSA 2FFJA 5GP1A 5KWIA 4BIIA 4ZO9A 1BU5A 2JVIA 3HU5A 4CM3A 1PGNA 1JJAA 1QIEA 2GAOA 2J09A 1KQNA 3RT1A 2G1KA 4DSNA 4P54A 5EJFA 3NWJA 1WY5A 1XLTA 2JAXA 2HO5A 4JOBA 1U9YA 3K6RA 2X1LA 2IXFA 3CFYA 1NJFA 1JBEA 3M6VA 3OCCA 1I7NA 1C8VB 3BE5A 3R3YA 4Y30A 4KQFA 2QN7A 4J3NA 2E87A 5T64A 3SMVA 5BV8A 1JG1A 2CDNA 4YUZA 3B70A 3G8YA 4JLKA 4NDNE 2ZT7A 3AI1A 1T0PA 2ETXA 2XMZA 4GFDA 5IM4F 2CHFA 4BX8A 2FW1A 3DJFA 5AJTA 4G9GA 2AQKA 4Z5XA 4C0XA 1OXBB 2RJOA 5KOIA 3T0GA 4JCOA 1BN7A 4FS3A 4EHAA 3IPYA 1DNPA 1KVQA 3FNQA 4C76A 9ATCA 2QGZA 3MINB 2B4RO 4V24A 5B3JA 1CUJA 5K09A 3QKTA 3I2HA 5KYUA 4BX0A 3DJYA 5L4LA 1XQ9A 4DNXA 1WXDA 4U2DA 4XLTA 1EWQA 1OB5A 5B1YA 2H11A 3R41A 1V8FA 2IPMA 3E9CA 1NNEA 3A1VA 1U7XA 1VMKA 2DMRA 4MGHA 3ZG6A 3NAMA 1U99A 5L95A 4U7DA 4ESEA 5DX8A 3CRVA 5EMKA 4OOFA 3FMGA 1F5NA 1DKPA 1QR6A 1CF9A 3PXGA 4RPGA 4RIEA 1WE2A 4LK2A 3BN3A 3F7MA 2O2IA 1ZIOA 2D5CA 4JJFA 2MWMA 3HCAA 3LOPA 3OFND 1CPYA 3BJZA 5BY2A 1SNYA 3ZJ4A 4BKOA 3C3AA 3JATB 2XJ4A 2G36A 3VR0A 3NHZA 1FTNA 2CLLB 1NN1A 4FDVA 1QF7A 3A25A 3G2MA 3INYA 4IJVA 2J3LA 4V0OA 2B1QA 2Z2XA 5DXAA 3WLJA 3CR8A 2FP4B 4PYKA 3TRHA 2HPHA 4TN5A 3THWB 1THTA 3UNXA 5B1IA 1EVLA 1YBHA 2PS3A 3QBJA 3AJEA 3E0QA 1NDUA 4BFLA 4JI8B 4IQ4A 2I1QA 3HKCB 1Z6ZA 2Q4BA 3RS8A 4MR8A 1ZK4A 2FEMA 1XDDA 2OCKA 3T94A 1OTYA 1WKCA 2IHZA 2ODEA 3LBFA 4HFMA 1P0CA 1QK4A 4KPUB 4P8RA 5GVRA 4AZ3A 4PYIA 2FWJA 3TI9A 3ZHCA 4FU0A 2BOVA 1QRUA 3BYZA 4JX9A 3AQIA 1W2WB 3H4TA 2AMYA 4WK0B 1DMRA 3E9DA 5TSDA 3IVAA 3L05A 4QRHA 2HDHA 5AW4A 4V2UA 1TCCA 1PJ2A 1TRHA 2QVLA 2HJSA 3NHUA 3OZEA 4WK2B 1ECLA 1UODA 2J0UA 1VBMA 2C04A 3DBHA 3EVTA 5TF4A 3SC2A 1DFHA 1U8YA 3KXDA 3DZFA 3ETGA 4R8VA 4FZ3A 4JY7A 3KZNA 5ABPA 1YZKA 1U7HA 1Q7GA 1Z0AA 3O2NA 4W1SA 4OQZA 1TAUA 3VDRA 2VBGA 3LGAA 1XCPA 3REQB 3TW0A 4UM5A 1LY1A 4BJ3A 1NJ8A 4ID3A 5KTSA 3FGNA 2PNJA 1SB9A 1R6VA 2PANA 3D6HA 4CIVA 3U5ZB 1N9KA 1RXYA 3M83A 2HUPA 3P2JA 4FBGA 5CTJA 3TR6A 2P9BA 4BGUA 1UOQA 2W43A 4BMDA 4FIZA 4HWRA 1H85A 3JVDA 3WV4A 1IIRA 2OZEA 3K9NA 3SM3A 4BNFA 1MVNA 1B76A 2CCJA 3EZFA 3GMDA 4IDCA 1M2VA 2WF7A 2OSVA 1WKBA 3M34A 4K03A 5HPYB 4HRVA 2YKGA 1T5HX 2R60A 3B53X 3PHBE 4MPPA 1GA4A 1HTBA 4QEZA 1ODFA 5IKOA 3B1WA 1QAQA 2A0YA 3U7JA 3HA3A 5DNDA 5BQ3A 4J76A 3LLSA 4YUAA 3U7GA 3T3EA 2A58A 2IEYA 1Z6GA 5HKAA 2J08A 5REQB 2F3QA 3Q1KA 3R5TA 5BVHA 3TDNA 3P0FA 3ONVA 3OUTA 2E18A 2GN8A 4JEUA 4KJZA 1UDRA 1T8YA 3WICA 3ZU5A 1R0YA 2PKRA 5CK5A 2P9HA 4ZOAA 2X2FA 4HY3A 3AFIA 1OB2A 2NUBA 3FF1A 1ABBA 1IYZA 1QLHA 2AX3A 4HH4A 2PR7A 3NTRA 1C9KA 1IY2A 1WMAA 3SZMA 1Q7BA 3NPMA 1JX6A 1KZ4A 3CJTA 3COJA 3DEFA 4EHJA 5K2OA 5EPUA 1G20B 3WQQA 4RF3A 2P11A 2WWWA 5FOQA 2KMLA 4NJMB 4MVYA 3WNZA 3V8QA 4IIDA 4JSRA 1DAHA 3MAAC 4HAUA 5FBHA 5T57A 5B37A 3FOAA 4BQIA 4AJOA 1ORVA 1RXVA 3VJRA 3BS4A 4A91A 4FONA 3OZAA 1KJIA 4ZI7F 3WAGA 3HV0A 2KSQA 4OL9A 4EOGA 1I33A 1UM8A 1VSVA 2Q7OE 1EUZA 3RRJA 1AF4A 3F97A 2Q1YA 3B48A 4LDNA 4AS3A 1GJRA 2YWCA 1Y6ZA 4K2HA 2QZ9A 1VG1A 3NUZA 3RRBA 4IOJA 4CFZA 1CV2A 3U7RA 2CJPA 4CQLB 4ENUA 3ITNA 5JS7A 1WLYA 3BD9A 5AM0A 4DLBA 5TPZD 5BRAA 1U8AA 4IDFA 5ES3A 1P9WA 3FKSD 1TUEA 1QRSA 1RU3A 1TM1E 1YKSA 3GLRA 4S1TA 4B3JA 3B5IA 1ESMA 2YYSA 4H7IA 1F8GA 1K9VF 1Z39A 3DBOB 3P52A 2NZVG 4D26A 1RI1A 4MVJA 2C4VA 2X8WA 4O2AB 4YUYA 3SQXA 4KMRA 4G5OA 2ZBUA 3SQMA 3KB6A 1AO3A 2W2VA 2GRUA 2XQIA 5F1PA 4KOEC 1AQUA 1LPOA 1T4GA 2H54A 1VL1A 1X9IA 4A8JC 1YE3A 1L4LA 1YNOA 2VC2B 3GT0A 3I1IA 4B1FA 2J1LA 4ZOCA 1C9YA 2AOUB 4QWWA 4WFQA 2R9VA 1TVCA 1QVRA 2OORA 2ZYHA 3P4UA 2A9KA 4AIRA 4F84A 4F91B 3CO5A 5A03A 2O5RA 2OV2A 2FOXA 2ZUEA 1VSQA 3N7TA 1L4HA 5I9NA 2CNDA 2QM3A 1SD1A 4BMXA 5E0OA 2CMHA 4DMUB 1QGUB 2J45A 3AUFA 1TUIA 3LNCA 1WXIA 3EPRA 4FNGA 5EIWA 5IJXA 1LBHA 3X1DA 2ZXFA 2F9FA 2UVQA 2J3EA 5KUTA 2YZGA 2QJOA 3HZHA 2QDKA 3THRA 3PPXA 3T1TA 2NVBA 5D1NA 3ZKAA 3JZMA 2IH5A 3BVPA 2ZIZA 4C6SA 4D3ZA 3AUYA 2PQMA 1IN5A 3C6QA 5IDYA 1I32A 4ENVA 3GGJA 3F5FA 2ZULA 1D07A 1FDWA 3CN7A 3VGPA 3ZD9A 1C1XA 5K8UA 3DKRA 2EYQA 5C8YB 1Y7LA 5H4GA 2QJTA 3FTPA 2Z4TA 3R6LA 3LP8A 2A4KA 4N5HX 1Q50A 1CJKC 1P9OA 3AUJB 3K1AA 1C4XA 4V39A 1RQ7A 4G1UC 4DJDC 4YK7A 1Z63A 5IM4A 2X5NA 4MXDA 1K7XB 4RYLA 4AMZA 4DG9A 3TLYA 3KQUA 4XE5A 4H7KA 4JOCA 4LS3A 5GONB 4LE0A 2X0DA 4KHZA 3RTBA 1EUDA 2QR5A 2VH1A 3AM3A 4TXJA 5ED4A 2XXJA 4P3YA 5KWSA 2E2WA 2QM8A 1EYZA 4UXIA 4L8FA 1N36B 2G77B 1EUQA 1Q83A 3KPWA 4C29A 3SJCA 1S9DA 1GL6A 2HV8A 4XZ3A 3CZ5A 1LQ2A 4G01B 4BOYA 3H2JA 2AJLI 3EISA 1HKHA 3FYHA 3P2EA 3RJZA 1C80A 3L6CA 3BHJA 3HPQA 5DTQA 4OF4A 1AUQA 4IIFA 3VAAA 4HNUA 5AP9A 1J06A 2K2QB 2Z5VA 2NG1A 1XRSB 1ESNA 2PPVA 2V98A 4IHQA 4D46A 4DSZA 4PZEA 4OHYA 5EEHA 3VZBA 2Y92A 3JZDA 5K45A 4INOA 1UT6A 4RVFA 5G4LA 1Q0UA 3DR5A 5A06A 2BMDA 3AJDA 4IX1A 4RLFA 3VU3A 1CRPA 1P0PA 3HXLA 3G68A 4NFYA 3L0ZA 2VYVD 4Q1AA 3E3OA 2D0OB 4D45A 1OFGA 1FUEA 1SGWA 1USGA 3NHJA 3OU7A 2D59A 4LZZA 5AVRA 3GRYA 3D8RA 2OYRA 3W3AD 5EC8A 4DW8A 1NE2A 3C5EA 2PMKA 1RTTA 1YC2A 5EJIA 2CL6X 3MPOA 4GR4A 4LYYA 3VSCA 2FWRA 2PAAA 2IP4A 3I9FA 4AZ0B 4L9AA 1Z5NA 4ITRC 3AVQA 1P9LA 1ND5A 3EAFA 1LDBA 1ZJ6A 1X7HA 4JQCA 4OHMA 2CXOA 4WXEA 5C3MA 1AA6A 2O54A 5LMUB 4X6UA 4NBSA 2ZSFA 3DWFA 5EKUA 1NW5A 3WYFA 4CI9A 2QOEA 4AKEA 4EX7A 1R4AA 2Y9PB 4K46A 1RHUA 3GJ5A 3NGLA 1V25A 3GJ3A 3QYAA 4MPJA 1IM2A 3EXAA 1XTJA 4MVJM 3TZEA 1YS2X 1OWPA 1Q74A 4EENA 3VSEA 1HDGO 3UA3A 4F9TA 3ESXA 4X7PA 2Q5IA 5K3EA 1XZBA 4HH1A 4ML3A 2CYBA 1VGVA 2QRLA 2A0FA 2ZI6A 4TLDA 3VR6D 1ZAKA 1HGXA 4LEIA 4M9ZA 1APBA 3AK4A 3C4VA 1PO7A 2ZQZA 3C97A 1SKQA 3DMPA 1C9NA 2FUG1 2ZDHA 4K9OA 2JEYA 5ELLA 4QTYA 3WDLA 3KG2A 3BG5A 1SVIA 4ZZ3A 4DVJA 3NM5A 1CD5A 2O7VA 2Y0DA 3K6JA 5LQJA 2NZUG 4RK7A 4RTLA 1G5RA 4CF6A 1XDZA 2PXXA 4TYQA 3WSTA 1WDWB 1G20E 2C2BA 4M4SA 4BZWA 3DCNA 4J4TA 3FSEA 4B3SB 3KUUA 4C7OA 5K8TA 1XCLA 2HA3A 2Q50A 4R4JA 3L7IA 4AROA 4RKYA 3ZVLA 4DLXA 3P0RA 2BKUA 4F4UA 4NYJR 4NCXA 5E7MA 1FYFA 1KMQA 4RSHA 2ZRHA 3OECA 3RW9A 4Z2YA 1DHRA 1Y3DE 4XUCA 1MV8A 3WLNA 4HDKB 2PKCA 4NMLA 3HRIA 4TV8F 1WPRA 3PC8A 5B3AA 4ER5A 3WP1B 2EZTA 2YCBA 1AN9A 4G09A 4F04A 5EXSA 1PLLA 3N87A 1DEXA 4P86A 2IPAB 2H8GA 4S04A 3ME5A 4UM7A 1GYPA 3LDGA 4JZKA 4EI2A 5ALFA 3NIGB 5IANA 3DFZA 2V0NA 5MN5A 2AOVA 1NW4A 2JD2A 1JVNA 4HLUC 4HNHA 4KO8A 4MV3A 2TMYA 2VSYA 1VSBA 3GEPA 4LMPA 1RI5A 2R6CA 4TSFA 4RTRA 1WXEA 4L0DA 1G4HA 4BJ1A 2JGDB 2R6JA 1Q5PA 2Z9BA 3GRKA 4INPA 1PJSA 4RH1A 3HCNA 4NZMA 1YBAA 4M1MA 4OB7A 3CNNA 2UDPA 5G0SA 4BQQA 1UJBA 4ZI7A 1ZR2A 4BKMA 3AUSA 5AW7A 3LUPA 4AT1A 4QPPA 4AJHA 4ENQA 4MI1A 5F2KA 1MABA 1QTIA 4H0FA 4XQCA 4XQEA 4MIEA 2Y4NA 4MB2A 3PVSA 3D6MA 5I7AA 1CZOA 3EQ9A 5I51A 2OAGA 5JXWA 1T9KA 1J8FA 3USES 4N3CA 2P1DA 5KVCA 3AF6A 4DDWA 2ZIGA 4URXR 1AXRA 1NW6A 2I6SA 3EZ9A 3LMKA 1EB9A 1BJRE 2BKAA 3EFOB 4WEOA 5CG2A 1I8TA 3G9XA 4JS0A 4HH3C 1N1DA 5KB3A 5LDDC 4DCOA 2NPFA 4D8TA 2VK1A 1ZG3A 1NRIA 1Y98A 3EF0A 3JWJA 2WJAA 3FVRA 3NCHA 4XQ9A 3UWKA 5HRAA 3QPUA 4W9MC 1SBTA 1GR0A 2X0JA 5ESWA 1P5FA 3DTTA 1UWVA 2MSEB 1M2WA 1KY4A 3BB3A 3DMGA 3EW9A 2FU5C 3GMTA 3H9JA 1HX7A 4B6GA 4XPIB 4NARA 3N2KB 1CJUC 1XFDA 1V8OA 4LJYA 4AY3A 1YB4A 2Q3EA 1Y48E 5L6MB 1UWCA 3ADDA 2J6CA 4OU5A 2CE2X 1YJCA 4UATA 3K9QO 2IVZA 4UOQA 2QP9X 5DNEA 1KI1A 3MWGA 1ZAYA 3FCOA 3E84A 2RAUA 2JFQA 3RJ5A 1TM7E 1EINA 5B2EA 2OWEA 2CLCX 4MYUA 3HHEA 4M0LA 4CIDA 2R1TA 3D6VA 4FD2A 3LX5A 1E18A 4OK6A 4AJKA 4IMPA 1JDPA 1Z06A 2AUNA 2A5JA 3EMVA 2X23A 2AHOA 3ZDBA 2XGJA 5L40A 1O9BA 1ZXLA 4KDEA 3U16A 3KSRA 2X2PA 4EHKA 1XTVA 1ZH0A 1X9GA 1TPYA 3HQ4O 3PUWA 3R7WB 4EW2A 4KPYA 1QHSA 1MBZA 1QIMA 4FPXA 3RADC 3OPXA 3DTYA 1BS9A 2BGNA 2EFJA 3VMMA 3KZKA 3VR5H 4WZBB 4LVCA 1LWNA 1KEPA 1EJ6A 1CUUA 2JH9A 3NHYA 2P9CA 2A5LA 2V9PA 1TW3A 1SURA 3D3QA 4JB0A 4GE0A 1NBMA 2R00C 3TFQA 1UIRA 1Z5PA 1HY3A 1JTEA 3OC0A 3ZVRA 4BV2A 2VHWA 1P45A 4DEVA 1WTCA 1SBQA 3CGWA 1TYAE 2IWRA 4UASA 5T3YA 3FOFC 4X8LA 3JQ7B 2JAQA 3A1CA 5JWHA 3V6MA 4DBLE 1ADBA 3QRWA 4QIHA 4QX6A 2CV0A 3E7DA 1YK1A 3E9YA 5C46F 5H9VA 2W4QA 5KOYA 4JGGA 3IQHX 2QSZA 1WD5A 2GK3A 3R3ZA 5HIKA 3ZEAA 3AHJA 3O8QA 1QHFA 2ZRCA 3ROTA 1DTWB 5KU7A 4YPOA 2BKEA 1SHJA 5J2TF 4BGEA 3LNTA 2D0IA 1VYVA 2HFJA 1EK2A 2O3TA 2WUEA 3O4VA 4RJJA 3WK8A 1YBVA 3ZCVA 1DRJA 5L8VA 2Z2YA 1VMIA 1RYHA 2WYUA 2QX6A 1K3UB 4L5JA 3ZE2B 2VA9A 1HDEA 4YCSA 1X38A 2HJRA 4ND5A 4DR7B 2UVPA 2V6BA 1ZBQA 2VNKA 2AEFA 2R4TA 4ODIA 3W6NA 2BSAA 1N2ZA 1TJYA 3R5JA 5A3RA 2ZCUA 2HSGA 2AC4A 1WR8A 4QFBA 2IUUA 3UPDA 3AF5A 3Q3JB 1G3MA 2XCQA 4G2NA 4OH1A 1GA6A 1ZUNB 4PV7A 3DUFB 4LYHA 4BAZA 1S3IA 2H51A 4WLOA 3N5CA 3GLSA 2CW5A 3IKMB 2EF0A 3KDAA 4WZAB 4NG4A 3PIRA 5DTIA 2WAYA 4CR8A 1IUKA 3VTZA 3E9ZA 5GADl 5AVUA 2PXAA 3EAQA 1N2JA 4QQRA 4G8JA 5E6RB 1II0A 4NTZA 1JQJC 3EUFA 4M0PA 1ATIA 2I22A 4N5NA 1T2DA 2IHVA 1CZHA 1M6WA 2H18A 3DL2A 3QEMB 2Y0EA 3EG9B 2R47A 3FHLA 3RLIA 1KIMA 2Z2JA 5EJAA 5KTYA 1T6ZA 1QOPB 2PWZA 1E3MA 5BRNA 5G4KA 3B2NA 4EHHA 2ZJAA 2I87A 3H17A 5KWEA 3TOCA 3C8MA 2V9CA 5AKHA 2G8LA 5DM4A 4CF3A 1OAOA 1DI0A 2BM9A 1PP4A 4TS4A 2Q9CA 3W6ZA 1KPGA 3K09A 1ZGCA 1E7YA 1Y3BE 2DU8A 2YJNA 4H7DA 4UFPA 5A6SA 5JS1A 3TIXB 2ZU6A 3AJ8A 4NHOA 2NT3A 4QUAA 1J5PA 1VE7A 2ZRNA 1JJVA 3CX4A 3GOHA 1SVSA 1GPMA 2ISCA 5DIZA 2IXGA 1T0HB 4HDMA 1GARA 4B3DA 4BNXA 2WB4A 1IOVA 1BW9A 2J3IA 1RFGE 1S4MA 1MX9A 4ZYXA 1A2OA 2BLNA 4A92A 3VDNB 3QX3A 5DGXA 5ENZA 2OZVA 1A2BA 3C4JA 2C9OA 3G23A 5LP1A 1ODIA 4H6WA 4R84A 1PFUA 3UCXA 1JE1A 2D00A 1SBCA 1FRNA 2XCLA 3MD0A 2Y05A 3OJCA 1K92A 4CCWA 4EW6A 5SY4A 5HWSA 5K99A 2FWAA 2VPIA 1L4MA 1C7ZA 1YI0A 5A0TA 1CZUA 4AG6A 2C2WA 1V9CA 2C82A 3UTCA 3LFUA 4GBED 5ALIA 4MV8A 5CX1B 3WLAA 1M0TA 4ALKA 2FPXA 1BEZA 4J9UE 1H65A 1MW9X 2QGFA 4HZUA 4JQZA 5F4BA 2B83A 1P4AA 3SHWA 1Y63A 4L1KA 2OB2A 3Q7SA 1W73A 1TO2E 2QAGC 3CIFA 5IJWA 4B48A 3F5DA 3DPSA 3J80A 2JCYA 3DE5X 4KBYA 5JDCA 4AO6A 1PR0A 4LQ4A 4ME6A 1ZICA 2ZBQA 1QV9A 3F9RA 5AK3A 1I7DA 3PT5A 4R5MA 1M8PA 2YN0A 1RLOA 1VKHA 4PX9A 1DRKA 1IBMB 4GX2A 4MWOA 3EYAA 621PA 2V7EA 3MT9A 2PKEA 2J0SA 1ILWA 3ZZ0A 4RJKA 1M75A 4JEIA 2VP2A 4RF4A 3WMEA 3SN6A 4L78A 4XQGA 5DNVA 3D0OA 1QONA 5DBHX 2OSBA 1YS4A 2IHTA 2XB8A 5CB4F 4IHKA 4UNPA 5C3UA 1R4ZA 1XVLA 3BQ9A 3WB2A 1H0SA 2RI0A 2YBEA 3STVA 4OYLA 1NP6A 3DNFA 1XYVA 3IC5A 5H82A 1HSOA 4YP7A 4W5RA 4CDMA 2NZYA 4ARSA 2DR3A 2BMEA 3AIMA 2FGKA 2P2YA 2QNBA 4FGJA 1AG9A 2QVBA 3OD5A 5TPWB 1WLSA 2QVCA 3R9KA 3WI7A 4DLNA 3AVYA 4YJHA 1LU9A 4YCBA 2E82A 2VJYA 3KT0A 4N0EA 4DN6A 2RFLA 3P32A 4P98A 3A9WA 1Z15A 4QFMA 4US0R 2AKEA 1XA0A 1Y6RA 5JHGB 4P4GA 2IDZA 2OGUA 2WF5A 2ZWMA 2XTJA 3GN1A 2OZKA 1Y6JA 4O1MA 3DW3X 1JF8A 5DLDA 5DT2A 1QSGA 4FNMA 4KQEA 4R9UC 3PQ2A 2BLLA 5LMCA 1O94D 2V7PA 2TMGA 1IN7A 1JFRA 2W2LA 3BMXA 3DE7X 2A5FA 3DBLB 1KNXA 4B3BA 3DQZA 1V7CA 2JFVA 3AOEC 3NHBA 4JD5A 3OWOA 2YJ4A 5D7BA 1QFJA 1CP2A 3KOMA 4IYRA 1V35A 3S28A 4CN9A 5JXGA 4CFYA 1MA0A 3DA8A 3GFOA 4CEIB 2OBNA 1YNSA 4DUGD 1QU2A 1B74A 3VOBA 1KO7A 3KZVA 1NW8A 2C7VA 4QYMA 1ISPA 1NF2A 5HE8A 4AZWA 1RQGA 4Q3KA 1ZX1A 3FWZA 2IEBA 3LVQE 3U48A 4ETIA 5F3WB 5F2NA 5DTMA 1PS8A 3JD4A 1DX4A 4URHA 5E2AA 1E4EA 5G02A 5HCNA 1K63A 4JP5A