4IJUA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3-yl]bicyclo[2.2.1]heptan-1-ol
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRFIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 95
structure length 266
sequence length 266
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijuA00
1J4AA 5IF3A 2GD1O 3TF5A 3WMWA 3CPSA 3IAHA 1LDEA 4E3ZA 5CPFA 2V6FA 3JQ9C 3CTMA 3E9MA 1GDHA 4IDAA 3ICPA 4YJGB 5JMWA 1Q2XA 3F5QA 1JTVA 1T2FA 4Y6SA 4Z3KA 2DC1A 4Q3EA 5G4LA 1H6AA 2B4QA 3AI3A 3QVWA 4U7WA 3AUAA 4QX6A 1I5RA 4ZQBA 1X1TA 1E7WA 2YQ5A 3OETA 2X9NA 1Y1PA 3MTJA 2LDBA 2J5QA 4UVGA 3SLGA 4MDHA 1DPGA 1J49A 3WX0A 1YQGA 3PI7A 4XZ3A 3WLEA 1WDKA 3K31A 5F1PA 4NNJA 1HYEA 2WD7B 1L1FA 5G4KA 3GEDA 3R3JA 5JCJD 5IDYA 4FPXA 4PLTA 3ZWBA 1XIVA 1PL8A 2R2GA 2Y1DA 3DOOA 1KVTA 3KVOA 3IL2A 1WPQA 3ZHXA 3NV9A 3UUWA 1G6KA 3BAZA 3IDSA 3ZZNA 2DPHA 1VL6A 1E3EA 1DRUA 1B3RA 1OI7A 2EW2A 3GDGA 3GPIA 3LT2A 4WLVA 4WCFB 4YACA 4WE3A 5H82A 2BRUA 3LYLA 2JD1A 1KEUA 1MP0A 3GGGA 4OYRA 3C3XA 2JL1A 1EE9A 1I01A 1M76A 4BNUA 3IS3A 4BO7A 4AJKA 2I6TA 4D3DA 4B3HA 4RF3A 3ZV6A 4RL6A 3E6AA 2QW8A 1A71A 1QYWA 4E5YA 4D42A 1NFQA 3OIDA 4FBGA 4Q39A 5ENVA 3KYCA 3I4CA 1ULSA 1BSVA 4R16A 4IBOA 1B15A 5T64A 1WDLA 3IUSA 1SOVA 3UCFA 3W1VA 4B8WA 2BFMA 3EZLA 2X5OA 2HO5A 4RPJA 1VM6A 1SBYA 4N5MA 3ZWWA 3BHJA 1OC4A 1I3NA 4NI5A 4J7XA 4LSMA 5KOIA 2DFDA 3AM4A 3DZIA 1E7SA 4W4TA 4NJMA 1HSOA 4CMIB 1B16A 4HFMA 5JPIA 4NR0A 3CZRA 1AHIA 4JJFA 3H6KA 2Y68A 2DUUA 5A06A 1FF9A 3ADPA 4RQTA 4BMNA 4YRBA 4HXYA 1LRJA 1WAMA 1GUZA 5DCYA 3ZW8A 1BXKA 1PJTA 1PJ3A 2D5CA 3K2BA 4MPDA 4UEOA 4RVFA 3GGPA 2Q2QA 4YT2A 2FSVA 4GQAA 1DRWA 2P2SA 3E5RA 4XA8A 1E7MA 5T5QA 3V1UA 1UP7A 3BMNA 3DBRA 3EY4A 3O38A 1EBUA 3I52A 4OOFA 2E48A 3RUCA 1ZH8A 1TT5B 3PYLA 4JX8A 4Z0PA 1NR1A 1O5IA 4LVCA 3C7CB 3EVTA 3E8XA 4FOOA 4IXTA 2FPGA 1IL0A 1YB5A 2QIOA 4IDCA 5KTKA 4GGPA 4D45A 3E03A 4IQ0A 4J9UE 4EI2A 1R4NA 2A35A 4DIBA 4PZCA 1GFSA 2C59A 3FNFA 4KTTE 4QECA 1DJQA 3JQGA 1BDMA 4BNWA 1A27A 4D3SA 3PIIA 4IUYA 3ZWNA 3VHRA 3BA1A 2JJYA 4RCVA 3ZNPA 4B4OA 3I5MA 1R66A 2QHXA 1V3UA 4FC6A 3G1UA 1Y5MA 3O4RA 5JE8A 3UVEA 2HMWA 4B3JA 1ML3A 4IS3A 4CR8A 1K6IA 1OMOA 4X54A 2OUIA 1GEEA 2PFGA 2YFQA 4PGFA 4FDAA 2ZB4A 4A2CA 3OHSX 4NMHA 4J4HA 1YVEI 3AFMA 2FMUA 2C29D 3I9KA 3BYZA 3NKLA 4BGUA 4FFPA 1SC6A 3WGQA 1E6UA 4BNTA 5GZ3A 2HQ1A 1KEPA 1IPEA 3NJ4A 2CFCA 4DC1A 5A4DA 1NVMB 1HDGO 2CDAA 3KRTA 3TPCA 1BXGB 2J3KA 1CEQA 5CDTA 3VPFA 3EAGA 3NDRA 3H5RA 4ALNA 3P19A 2VNAA 3GOHA 5G4KB 3PHJA 4J91A 5DN9A 1GV1A 1Q1NA 3WOHA 3ZWPA 4HNHA 3IOYA 5L4LA 1NP3A 2J3JA 5DOVA 4E30A 1KERA 3WNQA 1K5HA 1H93A 2NU8A 4ZQEA 1JWBB 2Q1SA 1YGYA 4CLRA 3U49A 3U5TA 5CP8A 2EIHA 5TT0A 4XQGA 1UP6A 3WJ7A 2IZZA 1QP8A 4R9RA 4XIYA 5COAA 1JVSA 3DC2A 3NT4A 3BTUA 2I67A 3FWNA 2NQTA 2B83A 3H9JA 3SC6A 1D8AA 2CY0A 2I65A 1MB4A 4YT5A 3GUCA 3KYCB 1EVZA 2ZB7A 4LVUA 4BNHA 3UGKA 4EEXA 3WFIA 1G1AA 3PDJA 1BMDA 3MJSA 4NDNE 3OQ6A 3ZU3A 4UULA 2QG4A 2X1HA 3VH1A 1Y8RA 5HA5A 1EK5A 2BH9A 1ZK4A 5AYVA 3ZWXA 4WCDA 5TJHA 2GNAA 4FD3A 2GN6A 1FXSA 2W4QA 1LRLA 3MTGA 1W4ZA 2V7PA 4WNIA 2EXXA 5DBFA 4NJMB 4DLBA 2VUUA 4RPLA 1DB3A 1F0YA 1LSOA 1LDNA 4I5DA 4RGBA 4DRYA 4Y6PA 5JLAA 2IYPA 4ZICA 1MA0A 3FSRA 3ZW9A 1HL3A 3A1NA 1UDBA 2JHGA 4DQVA 1B8UA 3ZNNA 3PP8A 3QY9A 1P1HA 2GPTA 3HHPA 2CMDA 2PD6A 4HWKA 4N5NA 4R68A 4LISA 3TZ6A 1PJSA 1U1IA 3S2FA 3DMTA 4J7UA 1PU2A 3BMNB 3DBRB 1J5PA 2JCYA 1T2EA 4BO8A 3V5NA 1HYGA 4TVOA 1TEHA 1DO8A 1UXGA 3RU9A 2UUOA 4FR5A 4ESOA 3CE6A 2HMVA 2A94A 5AXAA 2EGGA 1EMDA 2Q1WA 1XELA 4P22A 5F21A 1YRLA 2Y67A 4BL5A 1ULUA 4BMSA 1R4NB 1CDOA 4D79A 2C5AA 4H7PA 1PX0A 4I8XA 1I0ZA 4XR9A 3WYBA 4BO5A 1A4UA 4LCEA 4OQZA 2VHWA 4NZ9A 4BVAA 5TS3A 3IP1A 2HK9A 3ROMA 4FJ2A 4R51A 5IN5A 4G81A 4JN6B 3UOGA 4IQ8A 1LJ8A 4R3NA 3FNGA 2RBEA 2E4AA 5KNLA 4JP2A 4RQUA 1P9LA 2DAPA 2IZ1A 4MVJG 4BGEA 3ASUA 4OH1A 3D1LA 2QQ5A 4D41A 3PWSA 3CSDA 4WOKA 3WGYA 4KUGA 2Y1FA 3HB4X 1S6YA 3HQ4O 4CR6A 4HADA 5ITWA 2RAFA 1QMGA 1ZZEA 2PNFA 3L6EA 1WMBA 3AUTA 3U62A 4NIMA 4OHUA 3TL3A 4GVLA 4L75A 4OL9A 5HTOA 4Q3CA 1SPXA 4RVHA 1ZJYA 3GNQA 1LA2A 4QQRA 1XKQA 4B4UA 4DC0A 1IB6A 4CV1A 4IJUA 4ZQGA 1XSEA 2IODA 3Q11A 3OFSA 4JLWA 4YTEA 5ILOA 4RPKA 1LU9A 1NVTA 1P31A 4UUPA 5HBRA 4IMRA 1GAEO 4LRSB 3FF4A 3DMTC 5AXCA 4A0SA 3OH8A 2ZATA 1XWFA 5CDGA 2Q50A 3GNTA 2IYOA 5DP1A 3HDYA 4BGVA 1GZ6A 4PLWA 2BI7A 2AQIA 3GRKA 4G2NA 3AM5A 1B8PA 2AE2A 3WGIA 1DC5A 3PK0A 4KUEA 2Y1EA 3WNVA 4N18A 4UAGA 1F8GA 1ORRA 4BMVA 4CLRB 2B37A 3L07A 1QR6A 4TRJA 4I5EA 1C0PA 5DBGA 2P4QA 2UUPA 2EGHA 2JFGA 1QKIA 3MZ0A 2EWMA 3KSDO 4A03A 4DREA 3FN4A 1XG5A 2EP5A 2Y0EA 3E5MA 5DNAA 5JXWA 4BQPA 4DQXA 5LDHA 4ZQHA 3HN7A 3VZSA 4INAA 4U5QA 3LZ6A 3RD5A 2DTDA 2HAEA 1O94A 1JKIA 1DEHA 3ZNQA 1LQTA 3MWEB 3HADA 4YQZA 1P45A 1Y8RB 4FJ0A 1MXHA 5L40A 3E9NA 1BW9A 1M67A 2AQKA 4J3FA 4CM4A 3KSZO 3RI3A 3PJEA 2ZKLA 2J8ZA 4CL8A 5A04A 1P0FA 3U9LA 1I3KA 8LDHA 1WLYA 1ZSVA 2ZYGA 4YAJA 2OZPA 3RUDA 1GZ4A 4PG5A 4AL4A 1RKXA 3JQ6A 1ENPA 1YH3A 1Z6ZA 4BKOA 4J2HA 4WJZA 5BNTA 5ADHA 3AUSA 4O59O 3DEYX 4WLEA 3R3SA 3CEAA 5A5EA 5KVVA 4ZHSA 3UKOA 3HN2A 1LBEA 1QLHA 2HU2A 2C82A 1OAAA 3I83A 3ZWVA 3QIVA 4ZRMA 2DTXA 3K6JA 1MX3A 1UZNA 4R3WA 1NQ5A 3WXBA 2Y05A 1BXZA 3DQPA 3BHIA 4U0JA 2BGLA 3N74A 1AUPA 1Z82A 1FDTA 3O26A 3JD0A 4YDRA 3H9GA 3QWFA 1E5QA 4XEHA 3PHIA 5DDIP 1N5DA 1TXGA 4CQLA 1Y6JA 4KWIA 1WDMA 3D4OA 4ND4A 3KO8A 4YAEA 1KVRA 2FR8A 3SC4A 4YAKA 1F8FA 5JY6A 1ADBA 4JBIA 1E6WA 1NBOA 4RO0A 2Y0DA 3WB9A 4ZVVA 4EJ6A 4N54A 2D0IA 3B6ZA 1I36A 4E5KA 2F1KA 5KJCA 1X1EA 5U9CA 2ZYAA 3I6QA 4BNIA 5TIIA 2AHRA 1E3WA 3BMCA 4AJ4A 1H2BA 2G82A 4AG3A 2BELA 3AY7A 1PEDA 4XGIA 3OSUA 2JD0A 4ZJUA 4DBZA 3GPDG 4UEKA 3TFOA 2C20A 1QORA 2HMSA 5EMHA 2VT2A 3TNLA 5HS6A 1Z75A 1U9JA 3KYDB 1NAIA 3L4BC 4CQMA 4E5PA 4P4GA 4PG4A 4W7HA 5GZ1A 4YPOA 4QEDA 4CM8A 2VWQA 4GMGA 2DT5A 1SZJG 2NVBA 4RF5A 2IEBA 3QWAA 2PH5A 4CJXA 2Q2WA 1F06A 3JD3A 1I2BA 4NPCA 2GUGA 2YDXA 1GQ2A 3O9ZA 4IJKA 3AWDA 4H16A 3ZWMA 2X0RA 3KV3O 5B1YA 2CF5A 3W6UA 4R1TA 2RHRA 1H2HA 2X0JA 2FPIA 3JQ9A 3ZH2A 2FWMX 1LNQA 3S2IA 5HS4A 3PHHA 2CD9A 1XU9A 4CV2A 1ONNA 1VRWA 3STHA 1Y9AA 2DVMA 3GAFA 2CUKA 3GC6A 4GX5A 2AE1A 4GX1A 1PWZA 1EVJA 2ZTVA 1KYQA 4JBHA 4GBJA 3GN1A 1HZZA 3QQPA 3QVXA 4NBVA 1BVRA 1NPYA 4F3YA 2X5JO 2WJPA 1PWXA 4BS9A 1P1IA 4W6ZA 4WLUA 2H63A 1ID1A 1N7GA 4II3A 1H9AA 1GY8A 1UXJA 3HZZA 4R5MA 1VLLA 3TWOA 5A9SA 3AU8A 3WJAA 1K6XA 4O5OA 4BNLA 1KBZA 1FDUA 1SEPA 1R16A 1PZEA 2P5YA 5MDHA 5JCXA 3AOGA 1EK6A 3IKVA 4XQEA 4CQMD 5EQFA 4BO3A 4GVXA 3OJEA 1YB4A 5ILGA 3BTOA 2B5VA 3D4NA 4GAEA 1BVUA 1BW9B 2FR1A 4XYEA 3RROA 4QSMA 4M87A 4CM4B 1YL5A 4I5GA 1P1KA 4GX2A 4BNZA 3KTDA 5J23A 1Y7TA 1I3LA 5LC1A 1WZEA 5L7YA 4O1MA 1DDOA 1JA9A 2PLAA 3FI9A 3RUAA 4YA6A 2BFOA 3GLQA 4CV3A 4WK6A 2HLPA 1P1RA 4MVJI 4RV9A 1K2WA 3V2UA 3GRPA 4D43A 4OQYA 4E5NA 2ZJ1A 1T1SA 3ONDA 3D5QA 2QZ9A 4E33A 3FWZA 2H6EA 4GWKA 3HJAA 2UVDA 4KTVE 4WEQA 3V1YA 3SX2A 1LSUA 1NXQA 5TNXA 5EESA 1PJLA 3VAZA 1ONOA 2EJWA 4XGNA 2I9PA 1QG6A 2NU9A 4DPMA 2Y1CA 4PLCA 5COQA 2CZCA 3TZCA 3DBLA 5C37A 4PVDA 1JKJA 3JYQA 2VZ8A 2DUWA 1P0CA 4F45A 1DIAA 4CQLB 3CIFA 1ISHA 3JCZA 2D5AA 4L8VA 4XDZA 2VRCA 4S3MA 3ADOA 3OEWA 4IDFA 4OSOA 3EZYA 3QVOA 5IJZA 1EUDA 1R0KA 3D64A 4Y9DA 1X0XA 3ROKA 4DQUA 3JQ8A 1I10A 5EQDA 1JKFA 2DFVA 3DZBA 3GAZA 5BSFA 3GZNA 3PHGA 4S1VA 5T8KA 3W8FA 1Z45A 2X6TA 3GK3A 3DBHB 3ONEA 3GQVA 4NK4A 2OHXA 1XR3A 3CH6A 3EVNA 5I8ZA 1I2CA 1E3WB 3BMCB 4XX0A 5A5FA 1D7OA 3T4EA 4DGSA 4M8SA 1A5ZA 4CM5A 3NTQA 3GVXA 3LF1A 4DWVA 6LDHA 2HJSA 3AI1A 2D3TA 5DCUA 3HE3A 4OIMA 5EERA 1DIGA 4ND2A 4EUEA 1RWBA 3I9NA 3RKUA 1T25A 2PR2A 3DZJA 3ANMA 1EEHA 4JCOA 4CQMB 1ZXLA 2V65A 4CM8B 3VPHA 3NJ8A 1DHRA 1MUUA 2B0JA 2VCYA 1ADCA 4PRKA 3L9WA 3UXYA 5JFOA 3VTFA 3RWBA 5F3RA 4FFNA 1U3TA 1R15A 5KKCA 2OO5A 1I8TA 2FPPA 4OXNA 5HWSA 3ITKA 4XKJA 3AM3A 4TMFA 4YT8A 4G5HA 3WSVA 5CG1A 2BGKA 4PVCA 3DAPA 3DZKA 4IY1A 1XHLA 2WYUA 4ZA2A 4BKRA 1LLDA 2NTVA 5EL0A 1JWAB 2VYVA 4FFOA 3GVIA 3KEQA 3PVZA 4DYDA 3TJRA 3FBTA 2HKIA 4NG5A 3EGOA 2VYNA 3MOGA 1ADFA 2GGSA 4WEOA 2VRCD 4PIVA 3EUWA 4OAQA 5IDXA 2O50A 2HCTA 3E1KA 4KDFA 4CLXA 4JK3A 2O2YA 3PJGA 5TF4A 2VZ9A 4OXKA 3OICA 4XB2A 4D3FA 2W8ZA 2NTJA 2OP1A 3LVFO 4ZRNA 5IFLA 3N7UA 3WGGA 3BXXA 5C7IO 1ZK2A 4CMGA 3AI2A 2R00A 4PRLA 1X14A 3U4CA 4BNMA 4PLHA 3FHLA 1K0UA 1LI4A 1ZFNA 3A28A 3AOEA 5JO9A 2X5KO 2D1YA 5B4TA 5B4UA 2VWHA 2A9FA 2QRLA 4MIOA 4OO3A 5A9SB 4J90A 4R9SA 3QJ5A 4AJEA 3K30A 1RYDA 4B8ZA 5T8KC 4K1LA 3JYNA 5G0TA 4KUHA 4EJMA 1CYDA 2NU6A 2ZIZA 3WTCA 2VTDA 3RBXA 1ZNQO 4GKBA 3I1JA 5CDSA 1KVQA 2X23A 5FEUA 2YV1A 4QT0A 2E49A 1ISJA 1TI7A 3DL2A 4CM7A 1JQBA 3RUFA 3W4IA 4EW6A 2DBRA 3LC1O 4Z6KA 1C0IA 2I66A 4R5HA 3HWRA 2CVQA 3B20A 3PWZA 1DAOA 5LDGA 1Q7GA 4CMCA 1HZJA 2BD0A 2VYVD 5FF9A 1DC3A 4TKLA 2WSBA 4JBGA 2GYYA 2AMFA 2QYSA 2VYND 1CF2O 2EHDA 4QFCA 3EW7A 2VRBA 3IKTA 2EF1A 3F47A 1ZXBA 3T4XA 3HFSA 4ILKA 4BGIA 3ZWOA 3VKVA 1JU9A 1QSGA 4MIEA 3U4DA 3QVTA 5T57A 1TA4A 4ALJA 1UDCA 3AUUA 4JIGA 4HFNA 3TZQA 2X22A 4YJFA 2R6JA 3ZHZA 2GR9A 4O63O 3F1LA 3RJ9A 4M49A 2Q1TA 1SAYA 2Z95A 4WOJA 1ZMTA 3K96A 4BO0A 3DBLB 4L76A 3KM0A 1ZEJA 2X58A 4OGWA 4P4NA 1M75A 1W0CA 2VUTA 4O0LA 4BKQA 5BSGA 4OKNA 3KETA 4UVDA 1PGQA 1QXSA 3D5TA 3GUYA 3TZKA 3RCBA 5IZCA 3ANNA 2R00C 4IJWA 5A1TA 3HUDA 5ICMA 3AOEC 4LSWA 1E7RA 2B35A 3DR3A 1XQ1A 2W90A 5K6AA 3DHEA 5HRUA 2X86A 2Z1NA 3JQ8B 3GZNB 1DIBA 4MVJD 4YJHA 1PSDA 1PGOA 3E18A 4BO2A 1A7AA 5T67A 5A02A 5G0WA 1EUCA 3PHLA 3LC7O 3GN2A 3W8EA 3GDOA 2OGUA 1R0SA 5G2OA 4A10A 5K0ZA 1ARZA 2YFHA 5JAIA 1H6CA 2XOXA 4YR9A 1BG6A 1MFPA 3GFGA 4JP3A 4CM6A 4EDFA 1KVUA 4FS3A 2BF7A 1VC2A 1DAPA 4DIOA 5FWNA 2VHYA 3LT0A 4RLHA 5TLSA 3JQFA 2C5EA 2AEFA 4K6FA 4U0KA 4C7KA 4LN1A 3OBBA 4XQ9A 2PZLA 4R01A 4EZBA 1AXGA 1ISFA 1P77A 2P5UA 4GH5A 4AVYA 1U3UA 1Z74A 4OJNA 1GCUA 1VSUA 3F9IA 1MGOA 1WVGA 3DTYA 3GMSA 3JYLA 3ZWAA 1DXYA 1Q0HA 3I9JA 3VPXA 1Y8QA 4BQRA 3HG7A 4PLZA 4RORA 1Q7BA 3TRIA 3KHUA 3PQFA 3FRJA 7ADHA 4FC7A 5THKA 4PG8A 2ZB8A 4XYGA 2RCYA 3R1IA 3PYMA 3A4VA 1P3DA 3VH4A 2FHSA 3ZCXA 3JQBA 4Z0HO 1T4DA 3ZU2A 2PA3A 5C7LO 1PGPA 1LDYA 4NH4A 1JN0A 3AJRA 3E9QA 3GVCA 4YCAA 3ZNOA 5IZCC 4E12A 1FDVA 1K6JA 5F5NA 1TT7A 1HE5A 4BV8A 2O3RA 1HEUA 1JW9B 3RUHA 3ZHYA 4RF2A 5C3MA 4J1TA 4ZN6A 1XQ6A 3ORFA 2YQ4A 4A26A 1O95A 1S7CA 2I99A 5K6AC 3OEYA 3P2YA 3RASA 3QWBA 1PIWA 3W4KA 5IN4A 5A9RA 2CDCA 4AJ2A 1R37A 1CIVA 1WXDA 3M2TA 4YJDA 1EFLA 2WMDA 3H4VA 3Q3CA 2WE7A 4MO2A 3EMKA 1IZ0A 1NR7A 3UW3A 2HK7A 3EHEA 5DF1A 3OJFA 3QWHA 4ITUA 4JJIA 2IDZA 4CLOA 4XD2A 4DYVA 3HDJA 4RF4A 2P4HX 5BR7A 1V9LA 1R12A 2OL4A 3JQFC 3RUEA 4BIIA 3PGJA 3JQGB 3PZBA 1QYCA 3MJTA 4Y8VA 3AK4A 1CWUA 4XB1A 4D46A 2RIRA 1KETA 3DDNA 3JQAA 3NAQA 1FJHA 4BNNA 3GG2A 1DC4A 1K89A 4BNFA 4CM3A 2Q49A 1PGJA 3BMOA 3ENNA 2B4RO 4GX0A 4MVJE 1U4SA 1YDEA 1YDWA 3K92A 4M89A 4Z9YA 5L53A 3BZUA 5DZSA 3GZ4A 2V6GA 2PK3A 2AEMA 3GHHA 1QRRA 4GGOA 2G76A 4WLNA 1ZK1A 4GL4A 5DCWA 3WTBA 4CPDA 1UP4A 3AU9A 4J1QA 4AJHA 4GMFA 1Z73A 1VJ0A 6ADHA 4RPGA 4YJFB 4BHTA 5CG2A 3RU7A 4PLPA 4KWHA 2AXQA 4RJTA 2QRKA 3L4SO 1VSVA 2HMTA 4IDEA 4KP7A 3R6DA 3DFZA 3PLRA 1QV6A 3PQDA 3JQBC 4J0FA 5KKAA 4RDHA 3DXFA 4NU6A 5I8WA 4L9RA 3FPLA 4KOAA 3RUIA 3WS7A 1CRWG 3NGXA 1HE4A 3DZGA 3FCOA 3ZI0A 1N92A 2J3IA 4DMLA 5B4VA 1LC3A 1AE1A 2X0IA 1SB8A 2PZKA 3IIEA 1H0KA 3Q9NA 5EIOA 4UEJA 4PN3A 2PWZA 4XRGA 2B69A 4B4VA 5U1PA 3N58A 1C3VA 4YT4A 1RM0A 3JSAA 4YJHB 4BNYA 4Z0TA 4L4RA 4AJJA 1O9BA 3NRCA 1PL6A 2RH4A 3FBGA 1X7GA 4I9UA 3RFXA 5EN4A 1E5LA 5JYDA 3I6IA 5BNFA 2DTEA 5ICSA 1D1SA 4MVJH 1ZIDA 3CKYA 4EITA 3JQAD 2ZTMA 3WIEA 3ZV3A 5I7VA 2PH3A 2WDZA 3VH3A 3QA9A 4ND1A 4RVGA 5TSDA 3VVCA 4J43A 5JAMA 1T2AA 1EE2A 3IJRA 3HFGA 2NACA 1Q7CA 1C1DA 2BHLA 4IXWA 5ES3A 1HDZA 3U0BA 5HM8A 4BV9A 3NUGA 3S1LA 4IMPA 5GMOA 5I7SA 1VI2A 3IQDB 4N5LA 4FCCA 1ZK3A 3V1TC 4YQYA 1U2DA 5JYEA 2BLLA 3K9QO 1BGVA 4BO4A 1AHHA 4GKVA 4GLLA 2DBZA 1EVYA 1EUZA 3PZRA 4I08A 3F4BA 2HK8A 2PGLA 1NPTO 3WR5A 1SEVA 1B2LA 2GN9A 4NFSA 3GFBA 1Y8QB 3L6DA 3QHAA 2GN8A 5THQA 3SJUA 1EBFA 4Q3AA 2OXIA 5CEFA 1DRVA 1H6BA 3G3EA 3OA2A 1P1FA 3L4BA 4LMRA 4AJNA 2IXBA 5IDQA 3SVTA 4ND3A 2J5RA 3B70A 1CETA 3DZHA 4IGFA 4OSPA 5U4QA 2EG9A 5JDCC 3GH3A 4ZD6A 5KVSA 3FNEA 3GEGA 4J0EA 1W8DA 3SJ7A 3WDSA 5B12A 2YHIA 4Q3BA 5EJ2A 5A3VA 3TN7A 3QWIA 2GLXA 4TZKA 2PKQP 3I3OA 3JQDA 4YVFA 5TGDA 2VHXA 4EGFA 2EV9A 3VH2A 4BB5A 2PD3A 1UAYA 3NTOA 2O3JA 3GNSA 5KJ1A 1VL8A 2I5PO 2Y93A 3C8MA 3GVHA 4GSKA 2D4AA 3FPCA 2UDPA 3LF2A 4JNKA 5I7EA 1R0LA 1LTHR 1NHGA 2CVZA 2VNSA 2VWPA 1I24A 2O48X 1BRMA 1LLUA 1BHSA 4CLOB 3EK2A 3Q6IA 3WFJA 3DOCA 2OMEA 4NU5A 4CODB 3FR8A 4BNKA 3ASVA 1YONA 2FSSA 2OORA 3ZU4A 1FDSA 2QZZA 3WICA 4EUHA 4BNJA 3MWDB 3JYPA 3JQAB 5KIAA 2WD8A 2DPGA 1LDBA 4G65A 1U5AA 3BMOB 3E82A 3MJVA 5KJ6A 2UYYA 3L9XA 1QLJA 3T7EA 4CUKA 2GSDA 3OP4A 3DOJA 1PJ2A 3D3EA 2O23A 3VZQA 1WNTA 5TJ9A 4AJPA 3MJCA 1UUFA 1KC3A 4W9NA 5FFFA 4YRDA 3OJLA 3JQCA 2IRWA 5L9AA 2OP0A 4OMUA 2GF2A 5DULA 4W82A 4Z9XA 4BNVA 1YBVA 2C7VA 4IQGA 1AXEA 1NYTA 4XR4A 2DM6A 3DAGA 2W2KA 3P5SA 3PLNA 4K26A 4EYEA 1YXMA 2GERA 1LSJA 3ZDFA 5K9ZA 2QYTA 1E3LA 3RBVA 4RZIA 1LEHA 5CEEA 1JDJA 2DLDA 1UZLA 3AY6A 3F4LA 3UFXA 4BKUA 4MP8A 1A7KA 3NT5A 1PJCA 3VPGA 2VHZA 2GRAA 3CZMA 4UUOA 1LUAA 4QTZA 3VC7A 3FNHA 1MXFA 4MKZA 3LLVA 4XRRA 3QSGA 4BO9A 4CR7A 2B5WA 3MCVA 2QRJA 4DLLA 1C1XA 3PGXA 1IUKA 1L7DA 1YBAA 4IIVA 2EKPA 1P33A 1YJ8A 3G49A 5JY1A 1HDYA 4ID9A 2Q46A 2FR0A 3ZHBA 4XYMA 1KC1A 2P9EA 4IDGA 3UH1A 5CPBA 3A14A 5H81A 3OQBA 3PEFA 3D3WA 2Y66A 3GGOA 2HRBA 3V2HA 3KZVA 4XJTA 5IXSA 1X7HA 3ETDA 1E77A 1A72A 1C1DB 3FTNA 3MJ4A 4CMAA 1MC5A 4J16A 1V8BA 5I7FA 3ON5A 3KBOA 1YWGO 1HTBA 4IM7A 4FN4A 4XYLA 1PQUA 1E3SA 3O03A 1JVBA 1NQTA 3PJFA 5A03A 5F5LA 1B8VA 3ETEA 1E6EA 4NBRA 2X8LA 3GF4A 3GMDA 9LDTA 1SCUA 5JMPA 4FJ1A 1ZSNA 1U7TA 4DL9A 4LGVA 1E1LA 2EJVA 3P2OA 1HKUA 4M54A 3UN1A 4OKIA 2NM0A 4U8GA 4R1UA 1ISGA 3VZRA 4E2ZA 4PZEA 1SOWA 4W9NC 4QUKA 4NBWA 5I9NA 5F1OA 3ZV5A 5CDYA 1PL7A 1VKOA 1IYZA 1N2SA 1X15A 2YJZA 3P7MA 4JGBA 1HLDA 4Z3DA 4JXKA 1WMAA 4J4TA 3M6IA 5C5IA 1JAXA 3RC2A 2ZK7A 3F46A 1F17A 4B7CA 1YJQA 3OIGA 3OQ1A 1YBMA 4PCVA 3JD4A 4UREA 3G0OA 4FFRA 2DU8A 4HP8A 5A05A 3MEQA 4CLEA 4EUFA 4MVJM 1JAYA 2CVOA 1N1GA 1U5CA 2YHIB 3DHYA 3VOSA 2WYVA 4AJOA 3PJDA 3A9WA 4I5FA 1M6WA 4MJLA 3PFWO 2H1SA 3KB6A 4E6PA 1PR9A 4MP3A 3ZWYA 1B26A 1GEGA 5C7OO 3H2SA 3C24A 3U4IA 3U3XA 5A3JA 2BMAA 4IZHA 3I9LA 2FZWA 4MP6A 4J1NA 2BFAA 2O3UA 2XXJA 3W6ZA 3WGTA 2O7SA 5LCXA 2G1UA 1E3IA 1GYPA 2EEZA 3C1AA 1E1NA 3WGHA 4HFJA 3C7AA 1JLLA 4CM9A 3OMLA 4W99A 1UXKA 2WE8A 2YY7A 1R4MA 4URFA 4YXFA 4IDDA 1RJWA 5COBA 4R54A 4DPKA 3ENKA 3UCEA 1IY8A 2NNLD 3K5PA 1NPDA 1IHYA 3Q1LA 1I32A 3GDFA 1HDOA 1PS8A 2C54A 1DIHA 4R1NA 3BMQA 2J6IA 1YQDA 2O4UX 5DBIA 1VKNA 4A73A 4E2XA 1E7YA 1K3TA 1L7EA 1BXGA 1TB4A 1GYQA 2DKNA 1I3MA 3DZFA 1UXHA 2Y0CA 1NASA 4BNGA 3KLPX 3H3FA 3NYWA 4C7JA 1E7QA 3LT1A 1N7HA 2I76A 5BSHA 2AA3A 4WNCA 4JROA 4M1QA 4NFYA 1Y5RA 2BFPA 3H8VA 1PS9A 2OBYA 4IS2A 3KLMX 4E32A 2W2KB 1HYHA 3ABIA 4MVJP 3RFTA 2AQ8A 1EDZA 2ZJ0A 4TRNA 2JHFA 4CMHA 2E82A 1A4IA 2X0NA 2TMDA 3C85A 2P68A 3PPIA 1MC4A 7MDHA 3Q2IA 1N1EA 1J6UA 1SB9A 3LQFA 4BO1A 4CMJA 5BSEA 4TROA 2JAHA 4A27A 3HNPA 3HDQA 5CEJA 1D1TA 3HSKA 2NUAA 4HX5A 4TWRA 1C14A 1EVIA 1X7DA 3EYWA 3JV7A 4HUJA 3S55A 4CM9D 1C1XB 2Q99A 3KXDA 3SEFA 3B1KA 2J5KA 1DOHA 1RM4A 3KSUA 1LLCA 2ILTA 2UV8A 3X2EA 3F3SA 4PFJA 3WWYA 5BQFA 3D3WB 3R0IA 4ND5A 1R6DA 2JCVA 4E5MA 5JO0A 1OOEA 1NQOA 2IZ0A 5L45A 4I9NA 2UAGA 1DC6A 1EZ4A 2PTGA 1P44A 1GTMA 3B1FA 3H7AA 1ZBQA 4D7AA 1LLQA 1WP4A 4D44A 5GZ6A 5L51A 2AG5A 4NBUA 4KDEA 3RC1A 4JJGA 1ZKMA 1OBFO 3KUXA 4E4YA 4LK3A 2C2YA 1KY5A 3GEMA 3KOUA 3LC2O 4MIYA 2BGMA 1DLIA 2NU7A 2FRDA 1U8XX 4WUVA 3JQ7A 1GYRA 1DFGA 3L77A 3RC7A 1HLPA 5T6BA 1YOVA 1IPFA 4DUPA 2C0CA 4QFDA 1MG5A 4CMBA 4MVJA 2JD2A 1C0LA 2PZJA 1NAHA 1NX6A 1PJ4A 2JKVA 3WQQA 3Q0EA 4DTIA 3C7DB 4AICA 5CAEA 3DAFA 3DONA 1T26A 4NJOA 4XQCA 5AXDA 3JQEA 3H9UA 3PYXA 4FFMA 4KZPA 3DWFA 4E0BA 4IDBA 1HDCA 1NM5A 1DFIA 3EC7A 5GY7A 1G0NA 3INGA 2NVWA 3H9QA 1N8KA 1Q0QA 1B0AA 3WQRA 1LSSA 4E31A 1V35A 1NFFA 3NTRA 3TOXA 4RPHA 3PXXA 1F12A 1LRKA 1X0VA 4PG6A 3KEOA 3WLFA 2P9GA 1U7HA 5JW6A 4HKTA 3V2GA 5CFZA 3V8BA 5JBIA 1AGNA 2JFFA 4L0QA 5JAQA 3D0OA 3E48A 4J4BA 1DJNA 2A92A 3I9MA 4YEDA 4UUMA 2QX7A 3D7LA 4XCVA 2XAAA 2CF6A 1LC0A 4PZDA 1ZO8A 4J7CA 4WECA 4M86A 4BUCA 3RC9A 4CMKA 1FK8A 1BTOA 3DB2A 2JAPA 1PQPA 1XU7A 4BOYA 2WWRA 1CQIA 4H15A 1NWHA 2GASA 2C7GA 4LCJA 5MGBA 2GN4A 2RHCA 3JTMA 4LRTB 1R4MB 1E92A 2NVUA 5B37A 4Y98A 2IXAA 4DA9A 1WWKA 5G0UA 2TMGA 5DP2A 4B4WA 4TKMA 3BMQB 2J3HA 2A4KA 5A9TA 4UUNA 3S2GA 4I1IA 1NTOA 1YS4A 1UDAA 2ZTUA 1D4FA 1ZMOA 2OBNA 3QV1A 3W4JA 2HMUA 1Z7BA 3OJ0A 4MVJF 4KQXA 3ROPA 2IE0A 3CXRA 4GLOA 3RBZA 2E37A 5G0VA 5IDWA 1LDMA 2FZEA 1T2CA 4WKGA 4TRMA 2PY6A 3D4PA 4HBGA 4L74A 1XLTA 4IINA 4WGGA 2Z5LA 4BO6A 1GD1O 4FB5A 4TQGA 1NNUA 2AW5A 4ZU3A 3TFQA 1XCBA 4IZIA 1PQWA 1O6ZA 1U8FO 3FTPA 4B7UA 2RH8A 2NLOA 4TZTA 4DVJA 3ZGYA 4MOWA 2CDBA 1YKFA 3WWZA 4PLGA 3WGOA 4CV0A 1VPDA 3NT2A 4P4LA 4MINA 3WMXA 1I2ZA 1V6AA 4XGKA 3LSYA 1GPJA 1TVEA 3OIFA 3HB5X 4DMMA 4MKXA 1CJCA 1O0SA 4QO7A 4CMEA 3G1TA 2EKLA 3H5AA 3H65A 2CNBA 2EKQA 5EPOA 1BDBA 1DLJA 1SO8A 2HDHA 4RDIA 3X2FA 3C1TA 3UHAA 3WGZA 1ONPA 5BT9A 5L4SA 4GSLA 4J9VA 4PLVA 2H5LA 3TDKA 1RM5A 3ST7A 1NFRA 3UCXA 1PZHA 5TRTA 5JC8A 3Q2KA 1PR3A 3BTSA 4GPD1 1O89A 3K8ZA 5TC4A 1F14A 2OOSA 1HRDA 1PS0A 3TSCA 3WBBA 1GUYA 3ANLA 4Q9NA 2H9IA 1V3TA 3I23A 1QYVA 1XDWA 2VN8A 3IP3A 2G17A 2ZQYA 3PWKA 4WASA 3F6YA 4A5OA 3F5SA 4RZHA 2PD4A 4Q3NA 4FW8A 3WBFA 5AQ1A 1DIRA 3VZPA 2B36A 4CM1A 3M2PA 4NFHA 5FYDA 1M6HA 2NSDA 3JQ7B 1DFHA 1HF3A 1A9YA 1ZVMA 1YOVB 4B3IA 1E1KA 2YW9A 3PQEA 1ADGA 2AG8A 3MOIA 4UVEA 4EJ0A 1GCOA 4XWYA 3WQSB 1ZK0A 4YAGA 5IG2A 3IMFA 2HRZA 4K6CA 5AOVA 3RFVA 4NK5A 1VJ1A 2JFHA 3T7CA 4ALMA 2POQX 1T4BA 3I4FA 3OECA 5H83A 5EINA 5KJFA 1T1RA 1RYEA 1WW8A 4AJLA 4BKPA 3ZN2A 1ZUD1 1RM3A 3BTVA 4CL3A 2YYYA 2ZYDA 4K28A 4M55A 2JCXA 4LW8A 2AQHA 2Q4EA 1EFKA 4P8RA 4PLFA 1LXCA 4FGSA 3B1JA 5AXBA 4CMEC 3GT0A 1DSSG 1WZIA 1FMCA 1U3WA 4A7PA 1Q0LA 3L0DA 2ET6A 4DXHA 3RSHA 4N7RA 2YDYA 2YV2A 2GO1A 1X13A 5JDCA 3G17A 1KVSA 4E2YA 4XIJA 3TQHA 2BKAA 3ITDA 3L6OO 2FY8A 4R4JA 3WYEA 3ROQA 4MKRA 4BB6A 1XA0A 1NWCA 5L7WA 1E0DA 5JNLA 5TX7A 2Q2VA 4F6CA 2Y1OA 4J49A 1SNYA 1HDXA 3KYDA 3UAGA 2ZB3A 2NVUB 4Y67A 3DFUA 3LK7A 1T24A 1C0KA 5G0SA 3H9EO 3S8MA 3K73O 1KS9A 2I3AA 1P1JA 3A06A 1VL0A 1N9GA 4F46A 4FQ8A 1IOLA 3RAJA 1LQUA 3QW2A 3DHNA 5I9MA 4D0RA 3CINA 3VPSA 4Z9FA 4R1SA 1ZSYA 1P74A 1ZCJA 2PV7A 4IIUA 2VHVA 2I3GA 4LMPA 4EEZA 3WIDA 2FN7A 2O4CA 9LDBA 2VOJA 2BI8A 3M1AA 2G0TA 1DHTA 2VOEA 3DBVO 1QV7A 2IEDA 5TT1A 5KVCA 3NEPX 1YL6A 5CHEA 1MLDA 5ER9A 2VZ0A 1YO6A 3VDQA 4R69A 5JS6A 5KWEA 3KYBA 2O3QA 1LDGA 1J0XO 1UZMA 1YB1A 1I33A 4L4SA 1RPNA 2E6UX 2X9GA 4Q3DA 3ZU5A 2O7QA 4ZQFA 2Y99A 4FIZA 2CSUA 5DT9A 1B7GO 4B7XA 5FI5A 3ETGA 3H2ZA 4K9DA 2Q3EA 5L95A 2NQ8A 1HT0A 2PGDA 3CUKA 3TL2A 4FFLA 3OA0A 4NBTA 2GCGA 1ZJZA 1HETA 1VJTA 4DLAA 4E21A 1ENOA 2HSDA 3BHMA 2Q45A 5L3ZA 1A9ZA 2HJRA 3PFFA 3O8QA 1E3JA 4UVHA 2YV3A 3C1OA 1XYGA 2ZCUA 4FGWA 3PDUA 1H9BA 4GI2A 4AJ1A 1M66A 1YL7A 4EBFA 3QVSA 3JD1A 1ISIA 2FP4A 4PLYA 4U6QA 2YHUA 5CDUA 4IGEA 3K2EA 1CERA 1PZFA 3JD2A 1TLTA 3NGLA 3EDMA 3IUPA 4OXYA 5BNIA 1KOLA 2PKRA 2FOIA 2W2LA 2VT3A 3CMCO 3LU1A 4ALIA 3U09A 1PJQA 5AVOA 3BIOA 1PTJA 1YQXA 3NDIA 1U3VA 1UXIA 1XEAA 4OM8A 5FI3A 4E13A 5F1KA 3DMYA 4OOEA 1MV8A 2W98A 3OJOA 1HWYA 5ENDA 4II2A 5JSFA 1OFGA 1PGNA 3LDHA 1GPDG 5I9LA 1QYDA 3RVDA 2Q1UA 1GL3A 3U4HA 5IXYA 1EDOA 1Y9EA 2WEKA 1H6DA 4J6FA 3ULKA 2GZ2A 4IJVA 3TOZA 4DBVO 4YJGA 3GG9A 1UAGA 2LDXA 3QRWA 2HUNA 4HY3A 4QO8A 4ROSA 1D3AA 3COSA 5KCZA 4TVBA 1KEVA 1BWSA 2V6MA 1NHWA 3MJEA 1GR0A 5JDIA 2WTBA 2EERA 1V3VA 2GZ3A 3INTA 5IZ4A 2GZ1A 4ALKA 2Z1MA 5JAZA 1KEWA 1PZGA 1UJMA 2DBQA 2O3SA 4CLHA 4ALLA 1LX6A 1U28A 1V0JA 4RVSA 4W7IA 2WD7A 3VKUA 2Q4BA 4WPGA 3UF0A 4QXMA 3FR7A 2NWQA 4TSKA 2PKQO 1B3BA 2WM3A 4NQZA 3G79A 4YYZA 1YE3A 3GY0A 5L4NA 5ER6A 2AEJA 3AFNA 3DBHA 3OF2A 3DO5A 4WCFA 3S2EA 3AY3A 2XXBA 2P9CA 1OZAA 2W2LD 3PRJA 1GU7A 1UR5A 3CMMA 3LLSA 1UH5A 4R41A 1VE9A 3SBOA 2EP7A 4YAIA 1G0OA 3SLKA 2XPCA 3FD8A 4B79A 4Y6RA 4U6SA 3H5NA 1MG0A 1HXHA 1HE3A 4J1SA 2D8AA 4XYBA 5L7TA 3VDRA 3GVPA 2G5CA 2X9VA 1E1MA 2D59A 4FSHA 4YB8A 3GR6A 1T2DA 4YBZA 5KJEA 4NHEA 4WLFA 3RJ5A 3SXPA 1ZW1A 4E2WA 1IULA 3GA0A 3I9OA 4YRAA 1IE3A 4TRRA 1EQ2A 1H94A 1N9GB 2Y1GA 4HV4A 1OC2A 3Q9UA 2OFPA 8ADHA 3INRA 1W73A 1U4OA 4P38A 1GQQA 3PTZA 3HDHA 3VTZA 1U2GA 4J2OA 2EW8A 2X4GA 3H3JA 1Z7EA 3QLJA 4L4XA 1M2WA 4KQWA 4UVIA 2VWGA 4HNGA 2YZ7A 4ONEA 1QYXA 4KMSA 4DPLA 2NTNA 3GHYA 2DQ4A 1HDRA 4WLOA 4HFRA 4CMIA 1NQAO 2X7HA 1NVGA 4H3VA 2ZTLA 5DOZA 1GQYA 1GV0A 1Y81A 3OM9A 3IC5A 2C2XA 4RVDA 2ZQZA 4PG7A 1SMKA 4YWJA 5JDIC 3UICA 4CUZA 3ONFA 3JYOA 4RLSA 4JQCA 4XDYA 3WYCA 4I9HA 2XF8A 4IPTA 4CLDA 4CUJA 4GWGA 4RVUA 2NADA 1O8CA 2B4TO 3RQSA 2YUTA 3ZV4A 3PIDA 3WSWA 1HSZA 2VQ3A 5TQVA 2O3TA 1CQJA 3M1LA 4XJSA 3LT4A 1B14A 1ENYA 1TT5A 1KY4A 1GADO 1W6UA 1PJBA 2PZMA 3VVBA 3WG9A 2VTEA 4FOSA 3IJPA 3NDJA 4C4OA 5IAAA 5JC1A 3NX4A 3O8QB 2V6BA 1IZ9A 4WCFC 1I30A 4F6LA 2PGJA 3ICCA 5JCJA 1GZ3A 3ZWCA 4ZGWA 1ENZA 2WYWA 4O6VA 1EQUA 3W8DA 1ISMA 1FDWA 3QP9A 4L73A 4DIFA 1KIFA 2VUSA 1GUFA 3RKRA 4AJIA 1IHXA 1H5QA 3QE3A 2GDZA 2O2SA 2DBVO 1ZEMA 3TZHA 2NV6A 1HE2A 3RIHA 2ZCVA 4AFNA 3F1KA 5KVQA 5ITVA 1XGKA 4BNXA 1AN9A 2F00A 4D0SA 3AW9A 2SCUA 3DTTA 2D2IA 1DBVO 1MFZA 2C07A 2P91A
chains in the Genus database with same CATH superfamily
3SIWA 1CY8A 5IUKC 4BB9A 1OGIA 4TYNA 4X1YA 1I14A 1E2EA 4L6AA 5KOJA 3EF3A 4G89A 3ZHUA 3JQ9C 4EY5A 1DWUA 2GCPA 3GBVA 3UJ7A 4ZGBA 1GDHA 1GVNB 3QMVA 3HM2A 1IN5A 1KJ8A 4OLHA 3ZCVA 1F2VA 4P3YA 3B6IA 4Y6SA 1GL7A 1O8BA 3KLBA 3CF0A 1H6AA 4FUQA 4OQ4A 5G4LA 2IE8A 3P9ZA 4U7WA 3ZS8A 1I5RA 3OY2A 2C7OA 2J7PD 1CF4A 1TKBA 2WU8A 3G2PA 1QHSA 5F64A 2NYAA 5DMXA 1UC9A 3LYHA 2K5UA 2AF3C 3NWBA 1XD9A 1XC7A 3KELA 4K6OA 3DLCA 4XWKA 5BWLA 2CHUA 2HA2A 4XZ3A 3GEPA 3WLEA 3R09A 2JASA 3K31A 2B9EA 4LJKA 4KDRA 1FP4B 4MLZA 4AO7A 1RHUA 3BXEA 2QGZA 1PI3A 4Q01A 3EFEA 4QOHA 4FLFA 2J09A 3VGJA 1F1JA 3K4HA 3ZWBA 4DCMA 3R44A 5C51B 2W22A 1PL8A 2PJUA 2X2EA 3KVOA 4X66B 4XFKA 3NV9A 4EATA 5ALJA 3BAZA 4I46A 5LWHA 3C6MA 1OX4B 1G55A 5CM9C 2DPHA 1VL6A 1DRUA 2IDJA 2EW2A 3EZ7A 4FWBA 5FD8A 5I9IA 3RAGA 1SK9A 5J2UF 3RVNA 4N5HX 4MUKA 1MN6A 2BJVA 3RRYA 1E4YA 1M8JA 2ARKA 2BRUA 2VHJA 4NYIQ 1KEUA 4NV3A 2CW5A 2WTMA 2PFKA 4OYRA 1I01A 1G63A 1UBNA 3UT0A 2YX1A 1Q12A 2QIPA 3CJRA 4RF3A 3ZV6A 1UKBA 3E6AA 1E2UA 1P0QA 1KI3A 2MDTA 4REOA 4CQJA 2BBOA 1M6YA 3MBOA 2IY8A 4RTJA 1DTWA 2ZZKA 2IX3A 1OB2A 1YUMA 3SHFA 4BCBA 5KWJA 2ZIVB 1F8YA 1OWLA 3HYLA 3O6VA 2YMPA 2W4MA 3STWA 5CXUA 5DT2A 3GBPA 4KAFA 1GT91 4G97A 1R8SA 1OHHA 2O8VA 4IBOA 1ANKA 3DUWA 1WDLA 2YUIA 3HKEB 4PRZA 3UCFA 3MQFA 2BFMA 3COPA 3MGCA 4P80A 1XUOA 2J9GA 3MK31 1BDHA 4N5MA 3NBFA 2QLNA 3ZWWA 2UUBB 2HCRA 4GPTA 3PICA 4MKHA 4DJAA 5A5GA 1I3NA 2PBRA 4NI5A 4RKFA 3THWB 4WBSA 3CR3C 1VOTA 1XDGA 4DR1B 5KYXB 4X5OA 3ESYA 1WB4A 1AQJA 5FUXA 3GJQA 1HSOA 2YWFA 1B16A 2PH7A 2ZS8A 2FFRA 3DDUA 3H6KA 3V7YA 1NMZA 3S3TA 1D07A 1UM9B 3IERA 2OMKA 3ADPA 3BJZA 1XAGA 2GF9A 3AEYA 3IQXA 4KWCA 4RQTA 1P81A 3HCEA 1YD7A 3PUWA 4HXYA 1BMQA 3KD2A 3OUTA 4HJRA 4LFBB 1PJTA 4AKGA 1XLWA 4PWZA 5L3SA 3SJCA 1PJ3A 2D5CA 3N2NA 4G37A 1RQ2A 2O1EA 4MPDA 4UEOA 1M34E 2P67A 2QAGA 1K8QA 1T5SA 1VI6A 1DT3A 2ETXA 2WBLC 2QN8A 3E5RA 1E7MA 3EGEA 4PYMA 3U16A 2W6IA 3EXFA 5I9TA 1JIKA 5FBWB 5T5QA 3VC3A 1EBUA 3I52A 1HLFA 2E48A 3NGMA 4WNYA 3RUCA 1ZH8A 1O6CA 4UCXA 3S8EA 4UEWA 3MCUA 3P0FA 4V0NA 1RCUA 2EBUA 3NIDB 3NHFA 3OAAD 4KVFA 5I7HA 1RI1A 4IXTA 4YAWA 3DPUA 1DAGA 5ITZB 4FIDA 3ZLUA 3LA8A 4O2AA 4IDCA 2I7XA 5J2UB 5LZ8A 3SC2B 1UZAA 3PC7A 2CFIA 4E1BA 3HXMA 2NSJA 3IELA 1QIIA 4PPNA 2CL5A 1FBTA 4CFZA 4YP7A 4DIBA 5HQTA 2PYIA 4ZI5A 4DR4B 2ZAIA 2ZRCA 4H3HB 3G9QA 4DHWA 3MERA 1J0BA 3KZOA 2B3DA 3FVRA 2OCBA 1BDMA 5EHNA 2DPLA 1TMYA 2FF7A 4BNWA 3SFVA 4UCWA 4AG6A 3ZCPA 3HP7A 2JGDA 3E3MA 2OQVA 3VHRA 5BRAA 3BA1A 3PSAA 5DX8A 4NJEA 2FE1A 4RCVA 3TI9A 4ARUA 3KQKA 1DWQA 3U3KA 1DNPA 1NW3A 4XGRA 3I5MA 3JSXA 4BBZA 2EU8A 3N2GB 1VGQA 4ROTA 3ABOB 2QHXA 2WWIA 4WVFA 4PYIA 3R9XA 4E5VA 1M8KA 2AN4A 2PTHA 2V74B 4NVRA 4F56A 1PZMA 1U81A 2JIZA 3K0AA 3O4RA 5KEIA 4GOMD 2H7XA 1XDZA 1LFDB 2HMWA 1EYZA 3ABZA 1OYVA 3JVVA 2ZJAA 1M0SA 4HRXA 5M2QA 1ORWA 4RSGA 1CIPA 4AMUA 1S96A 2GN0A 2VA9A 5FOQA 3TR6A 1YVEI 3AFMA 3IKLA 3REOA 2BFBA 2C29D 3I9KA 3ZCTA 4DG9A 4MVXA 1WJGA 3HYNA 1SC6A 1SRRA 3WGQA 2BFEA 2XEDA 4QE3A 2E5WA 3QKSA 3L7YA 1BCSA 2HQ1A 4ZI7A 4J8PA 5L8VA 1HMYA 1DKMA 3ROEA 2AWNA 2CFCA 4YV2A 1NVMB 4YCLA 1HDGO 2CDAA 5I01A 5KYGA 3HHEA 5IM5A 2BFFA 1BE6A 4HWSA 2QAGC 4ZZ2A 4GOXA 1HNZB 5KC9A 4Q18A 2D2FA 2J7KA 3WIVA 2ZAGA 4LJYA 3ZY5A 4Y2PA 3K1TA 2IH5A 1L5HA 5DTIA 2Y6UA 4EKIA 3HCCA 1QQ7A 1SULA 5FX2A 4REQB 4XFJA 1H23A 2ZBFA 3ZWPA 4X92A 4HNHA 3H0EA 3DEKA 1ECCA 1RXUA 4PSKA 4IO0A 2FB9A 2C2WA 4R2XA 1P9NA 3OZWA 4NQRA 4E30A 4QAJA 4G23A 4BZZA 4IVNA 5EKTA 1K5HA 2ZJ7A 5K1ZA 1EJBA 2NU8A 4EHLA 5EHGA 3UAYA 4UUAA 1T1EA 4OA5A 3MXOA 4MTCA 4CLRA 5BYJA 3U49A 1WRBA 2FVXA 2JFVA 1V43A 5TT0A 4NCNA 3ROFA 4PXSA 4XQGA 3IDOA 4C7VA 1QP8A 1BD3A 4XIYA 2O2CA 5COAA 4C7XA 1R0YA 4EKGA 2QX6A 3NT4A 1N1DA 5KNDH 2C4KA 3FWNA 3VNRA 1E4VA 4EMBA 3N59A 1IAVA 1TF2A 3A7DA 1YQWA 4N47A 3SC6A 3TNJA 4JJZA 3GCDA 1JHAA 1JFRA 2XOEA 1JQEA 2JFWA 1Q0TA 1EA5A 4ZVMA 2O6HA 3H8JA 2CXUA 3BORA 5E9AA 1RZRD 3B2EA 3M70A 3ZK9A 3L1KA 2EKDA 2PUHA 8OHMA 1YVUA 4LVUA 4LZJA 5KPJA 3GLHA 3EH2A 2TS1A 3WFIA 1FLVA 3KZ1E 4TMTA 3KC2A 3DE4X 1M6NA 3RSOA 1IZ8A 4YAFA 1G9SA 1XQYA 3SYNA 3NDBB 3O7MA 3VH1A 1BZYA 1Z4KA 5GP1A 3BG5A 4WKCA 3T0FA 1OD6A 1Q16A 3QVMA 2WKRA 3U40A 3ZWXA 4B40A 2SICE 3AKZA 3E53A 2PRSA 2W4QA 3UK6A 2V7PA 1X2BA 5H59A 4CWAA 5CM8B 3Q85A 5FWDA 2B6NA 5HXAA 1EJ0A 1DB3A 1H2XA 1LSOA 2AT1A 4Z7NB 3NMUF 5CFOA 4IR7A 4JELA 4FE4A 5KX5F 1WXEA 2CNNA 4IUDS 2IYPA 1WPXA 2PO7A 3R6GA 1O96B 1PK7A 1QTQA 2H51A 3ZBTA 2XMDA 1WXHA 4I6JA 4C5AA 1UDBA 5CFRA 3BXOA 3GA5A 3QU9A 3BGOS 1B8UA 1KZYC 3ZNNA 4C4YA 3QY9A 3B2QA 3BEOA 4P2GA 4U2EA 3U44A 1SHJA 3U4GA 1RQLA 5CT8A 3OSZA 4JLAA 5DBHX 3C8UA 3OLZA 1TU0A 2GN1A 4A82A 3EARA 5JHHB 3L0OA 4UMFA 1PU2A 2D4HA 2WB4A 3DBRB 3E9DA 2JG3A 2OBLA 3PXDA 1YFLA 4PO8A 2AYYA 4WTOA 1JEEA 3KUDA 2WJ3A 2VCHA 1N36B 1YKGA 3P4XA 4K87A 3LFTA 4LF6B 1RSZA 4MDEA 2XCTB 1SZPA 1TEHA 1UXGA 4M60A 4OYYA 3RU9A 2UUOA 1G8YA 4FR5A 4QYTA 1HFKA 2EFEB 1P0IA 1RU3A 1SXIA 2FPGB 3TTTA 1BFDA 4O4LF 3F73A 1IDN1 4G84A 5ESWA 5CB8A 2BY4A 3HYRA 4ZCSA 1PW5A 1ULUA 2IHUA 4G5OA 3FWYA 2JIBA 1L5GB 1AKQA 3H6HA 3UANA 4DDMA 3JW8A 3LGSA 5CUQA 1X74A 3S28A 4DNFA 2R8YA 2PT9A 2JBHA 4KLNA 1A4UA 1IBCA 3HPQA 4NZ9A 4GL2A 5DI9A 2BHSA 3NWOA 1E63A 3KQPA 4FJ2A 1Z12A 5FA6A 5BWBA 4KE9A 4TZ6A 1KAGA 5JZMA 4WKPA 3CNQS 3UOGA 4C89A 4DCPA 5K0EA 3G9ZA 2WUVA 3CF6R 3IIMA 3GNLA 5I9SA 3HRIA 4HRAA 2PKCA 4IJMA 4URHA 4UDXX 5AO9A 2KW5A 2QLBA 3FNGA 1NLZA 2RBEA 1MW9X 4N0QA 3DDSA 4GP6A 5KNLA 1M5RA 2GILA 3HO8A 3RE1A 3T9DA 2PUJA 1QTRA 1YDMA 2QQFA 2O07A 2DLCX 3ASUA 1GNLA 1FUEA 3MMNA 3D1LA 3NUZA 2AFHE 4XARA 5MF6A 3MMXA 5C1BA 3CSDA 3GJYA 3PQ2A 3KQLA 3EA5A 3OX4A 4DJJA 2ZSFA 3FMPB 3HB4X 1R3UA 4CR6A 4EB0A 4PONA 5G40A 3UV6A 1GGNA 2D00A 2RAFA 1QMGA 3S68A 3L6EA 3AUTA 1KKLA 3IT0A 4NIMA 1X7WB 5EMNA 4DUGA 3DW3X 2CFOA 5IC4A 5DRYA 4L75A 4OL9A 3ACCA 4X00A 1RMYA 3T9CA 5KX5B 2I78A 1EXDA 4DSZA 2C5GA 2LUOA 4HGPA 4MO9A 5HTOA 1S1CA 2YHSA 3B6MA 3ED5A 4AO8A 1SPXA 2Q5OA 1QOPB 1OA0A 1TM7E 1MABA 1ZJYA 3GNQA 3I6YA 1JIJA 4QQRA 5C9ZA 3R7FA 4MWGA 1C5KA 1DCKA 1KRWA 1JYEA 3EHDA 1LNSA 4HPXB 2PL9A 3OCUA 4IJUA 4EGQA 5K8LA 3I04A 3STVA 4TMVA 3I8OA 1LU9A 1P31A 5AVKA 3ZEIA 3G89A 2OCPA 5HBRA 3HJFA 4KK4A 2BE7A 1PJZA 3FF4A 3QJYA 4M7OA 1U3FA 1I4LD 4KPUB 2PYDA 4JEIA 1M10A 4PGAA 3OH8A 4A0SA 1O0CA 3U6KA 1XWFA 2BR5A 2PBLA 2Q50A 3GNTA 5HNKA 1PKXA 5I4CA 5TGZA 5BNWA 3NAZA 4ARAA 3HDYA 4MRSA 1GZ6A 4A1FA 1PUJA 1UKCA 4JIMA 4G2NA 5LZ9A 4I1PA 1YFKA 3C3EA 2I03A 1RLJA 3FOCA 3PK0A 4P7KA 4N18A 1XFAA 1F8GA 2OOKA 2QSZA 3T7SA 1YK1A 3LKBA 3NJRA 3LGXA 3WIBA 3KL4A 1OV6A 4P98A 3TZEA 1GPYA 2VSXA 3DFKA 2B37A 2VS1A 1NDHA 3L07A 4QHYA 4KIJA 2O8CA 4LBYA 1M2OB 3AXTA 3AJEA 1AKNA 1C0PA 3G0IA 3K9BA 4ZCMA 2EGHA 2JFGA 4YUWA 5HZHA 4A03A 3KSDO 4C2TA 3S99A 1TD1A 1FLDA 1XG5A 5JT1A 3KTFA 1B00A 1GA4A 2IIPA 1PYGA 5TF0A 2D2EA 2HA3A 4D4JA 4MGZR 1LVHA 3ICQB 3CNLA 1EFRD 1UADA 3MAAC 1GGJA 1VCNA 3B3QA 2VH5R 4I2VA 4CVNA 3VUFA 2VH2A 3GFVA 1FQJA 1Z6YA 1TO1E 2BKXA 2DTDA 2HAEA 2NAFA 3RD5A 3WZLA 4AN0A 2JJQA 1DEHA 5KAMA 3WFZA 2WTNA 1KARA 1LZKA 3PGVA 1C8BA 3RTAA 4P3NA 1D6JA 1DIOB 1I4TD 2FWNA 1I51A 2ZI7A 3LBYA 2WQ7A 1CP3A 1Y8RB 1GP2A 3THYB 3OTOB 5L40A 2AUTA 5LZ7A 1M67A 3EVEA 4TTJA 4Y18A 5D85A 2A0KA 4CM4A 3KSZO 2I6QA 3RI3A 2W42A 3LPNA 2N42A 1OIWA 5KMGA 5A04A 4WK2B 2BYTA 1LPMA 1I3KA 1KO7A 2M9MA 5EY5B 5FLYA 3KAPA 2P77A 5EMMA 3RGGA 1FFWA 1ZSVA 5AVWA 1VKRA 2OZPA 5C4GB 3GI1A 4PE5B 3RUDA 5K3CA 1RR6A 2IA5A 2FOXA 4MB2A 4AL4A 4HGRA 3V6LA 1ENPA 6ABPA 3E23A 3CR8A 4G1MB 3BD7A 4OBBA 4EABA 1QHXA 3OURA 4YO8A 5ADHA 5KYKA 1OKKD 1YZHA 1YASA 4BZPA 5T3YA 1GCGA 4BAGA 3LOQA 2QNRA 5IS2A 3OG9A 3DSRA 3TYXA 4HC4A 5A5EA 1SK8A 2VCEA 1RQXA 2PRIA 4QNNA 3BC1A 4C5BA 2QR3A 1F7VA 3QOFA 1GN8A 2QRPA 3I53A 3FMGA 3HCRA 4QODA 2ZRBA 1OTXA 1OZ0A 3ZWVA 2DTXA 1Z37A 3K6JA 3ONVA 1GPNA 4A2PA 1GPLA 3BE8A 1J22A 1H85A 4B35A 1TKCA 1C81A 2BGLA 3PNVA 3G0HA 2QRMA 1TEXA 1VIVA 1AUPA 5FBZA 1IMJA 2GB4A 2IVZA 2Z43A 4UBLA 2VQ6A 1XTSA 2X4IA 3RC3A 2IKQA 3O26A 4GMHA 3JD0A 5BN4B 1MA3A 2WG0A 4YDRA 3H9GA 1OZHA 5DDIP 3RAEC 3PBKA 2HHLA 1LK0A 2CWWA 1Y6JA 2OV1A 4KWIA 4ND4A 3TZBA 3QFHA 4YECA 3VZCA 4FEAA 1QCZA 5DIFA 2GJ8A 4YAKA 3CZCA 4HQ6A 4HWPA 3OZAA 4UBKA 4CIWA 1ADBA 4CKBB 4WJLA 3LFUA 2CJWB 2X8BA 4K9MA 3KU4A 3NW9A 1KRHA 2VAMA 4RO0A 4X7MA 4ZVVA 4EJ6A 4ERNA 4H4CA 2YL2A 4N6OA 4TSFD 2XCQA 2D0IA 3O82A 1V11B 2XOKD 1A69A 2XYHA 5FA5A 3LKDA 4YLGA 2AI1A 2Z56A 2BT4A 2ZYWX 2MYPA 2AD1A 2ZYHA 2N0SA 1VE5A 2ZULA 1E3WA 4RWEA 5BW6B 5TPZD 1H2BA 2ODBA 1A5TA 2B4AA 2C84A 3TOCA 4AG3A 3AY7A 2HSEA 5I4KA 3HBNA 4B46A 1ZOOA 2Y1KA 3AXSA 5HHTA 1E89A 3TCKA 1FP6A 3WDKA 3WV4A 3TNLA 1SKYB 2BBWA 2DCUA 2WUEA 3OPXA 5FWYB 2C5BA 1YI8A 4DQKA 4DN6A 5AJTA 2XUGA 2R7NA 1JFFA 3DKRA 3EIQA 4JEUA 3D8SA 2QN3A 3CNOA 4IJQA 5C8YB 4PG4A 4DY4A 4E88A 1RZUA 1XRRA 4PAOA 4YPOA 4X7PA 1DXHA 2OCAA 2IITA 4I4TF 1F0PA 1ODSA 1B42A 3S2UA 1AG9A 4R81A 2JKZA 4HQLA 4CJXA 4A6DA 2QW1A 1F06A 3TQTA 3RNLA 4IXMA 1XNJA 3ZWMA 1RIFA 1JDTA 2C2BA 4RH1A 4BQOA 5JS7A 1B76A 2RHHA 4FHEA 4L1KA 3CT6A 3U3RA 4CIDA 2HF7A 2HRRA 2FWMX 1N3BA 4I4LA 3FDZA 4CV2A 3RS9A 1RWOA 1ONNA 1U2QA 4JOSA 1SUCA 1QGAA 3SQOA 1GAJA 2JBAB 2A30A 1Y9AA 5M34A 2QUJA 1KIAA 3CURA 3NPAA 4IG4A 4NPAA 4Y0AA 1J07A 2R1TB 3A3PA 3NASA 3C43A 1PWZA 5JOQA 5CMLA 2Y0PA 3BGDA 2NO7A 3L04A 4M98A 4N9QA 4UTOA 1KYQA 1PO7A 3HBLA 3GN1A 1HZZA 4JBHA 4WINA 2C95A 3SZMA 3QVXA 4NBVA 1QJ4A 1Y1SA 1NPYA 3KEMA 2WU3A 3PUYA 4BS9A 5FBVB 3IOMA 4ER7A 2AOWA 2H63A 4B3CA 3QF4B 4R8SA 2R8BA 3HJBA 3MCWA 4BMCA 3WK9A 3UPTA 2J7PA 1KAQA 3UG6A 1G8JA 3TWOA 3EVFA 3KJNA 3N0TA 4AMBA 3EA4A 5IXJA 1P4AA 1B0PA 1N7JA 3WJAA 3LCCA 1K6XA 1EK1A 3HWSA 2VJMB 2W11A 4JYPA 4BNLA 3DJYA 4FYXA 3QUSA 5FUMA 3BGWA 4RLFA 3O4FA 3IQGX 4ARZA 1L8XA 3W5IA 1BEZA 3U6BA 4CQMD 1JI0A 2XVZA 5EQFA 1QYIA 1Q57A 2J5BA 3I5UA 1TUIA 1CQWA 3OZGA 1IN1A 3BTOA 4OMDA 3MAGA 4HAXA 4AZVA 3NVKI 1IMOA 4L5JA 1EBBA 1ABFA 2NTEA 2FR1A 1FFEA 5DKFA 1BS2A 1HH4A 3FTDA 3OPYA 3R3ZA 1DKNA 1D0IA 2BCGY 1FOEB 4HATA 2M6KA 1N32B 2RBKA 1UBRS 2FK7A 3MGGA 4R3UC 4CDGA 3MIIA 1YHZA 1ZN9A 1JBEA 4MGHA 5J23A 1NNEA 1I3LA 5EGNA 4E2FA 4TUYF 1FC0A 2X8WA 2EX4A 1P2TA 2X13A 5KSPA 3HB7A 4DWWA 4O1MA 2J3QA 1L4GA 1DU4A 1ZAKA 3RUAA 3EFBA 2AFIE 4I4TB 1OH6A 1Y33E 5DYNA 1GNRA 2ID7A 2QTCA 2IXTA 4MITA 4QVIA 1P1RA 2KM1A 2BEVB 2HF2A 3M9LA 1IC6A 2PLWA 3DWGA 4JOBA 1NVDA 4X20B 4UD2A 1DCTA 3SVLA 4N40A 4OQYA 5AK4A 3N2KA 1Y8ZA 3PXEA 1VYVA 1J1IA 1ZR2A 3DCJA 3GA7A 4OB6A 3I09A 2Q62A 2ZYSA 3UGJA 3HJAA 1UBOS 4WEQA 3CGWA 5GM1A 2LXNA 1LSUA 2Z3VA 3OF3A 4XM2A 5TNXA 1U63A 2QM7A 2QMZA 3AJ9A 1ONOA 4AXBA 5F76A 4EOGA 5LL6P 1QG6A 2Y1CA 2P65A 2V8BA 5COQA 2RHTA 3IIIA 4US2R 1M2GA 3QE4A 4ZT7A 2XCIA 2YR0A 5FHRA 3T1HB 1C3EA 1HZZC 1ORIA 3HXKA 1S2OA 2O0JA 3P9PA 2QRVA 3FW1A 1ISHA 1P39A 2D5AA 3JCZA 4C4ZA 2VRCA 5EYPA 1W87A 2GD6A 3ADOA 1FS5A 4ZAYA 5LXTA 1EP9A 4FB5A 1XCPA 3C5HA 1R0KA 1U2ZA 5B7GA 5F7JA 4DQUA 2BUBA 1L7MA 4QUIA 1HT2E 4LC0A 3JQ8A 3IXMA 1JIIA 1GUDA 1E2MA 5H4GA 5BSFA 3PHGA 5T8KA 4U00A 3G2JA 3W8FA 3W2TA 1Z45A 4BFSA 3VJRA 3D59A 3AMVA 1RFLA 4JYCA 3V46A 1NN5A 4E4RA 1RYMA 1QFJA 2HWWA 3LCRA 1XR3A 4R2JA 3EVNA 4HYEA 2PA0A 2AJ8A 1RC1A 3HLTA 4XX0A 4UTPA 5A4AA 3QTBA 5KNDD 2WKPA 1BA2A 1ZRNA 6LDHA 1GFZA 1YBFA 4CKWA 3H1EA 2D3TA 1DIGA 4YRSA 3S2SA 4EUEA 1RWBA 4L9SA 2WG2A 3AESA 3RKUA 5JMOA 2QSJA 3Q0TA 2PR2A 5DASA 3P26A 1EEHA 2YOGA 4HO1X 5E8RA 1OASA 1A7UA 1ZXLA 3NHPA 4LQDA 3F3KA 3C6BA 3O8DA 4OJYA 3CCBA 3EEFA 4TUYB 4PYJA 3VA7A 3GLGA 2VHUA 3HS3A 1DHRA 2H0AA 3NJ8A 3L8ZA 3LBNA 2UXDB 1UC5B 3DV9A 3LWBA 1U3TA 2OO5A 5ARCA 4NENA 1BJTA 2XT0A 2M98A 3SIRA 1XNGA 3FMOB 5HWSA 4Q9IA 2EVWX 4GXNA 4TMFA 3QI7A 3UK0A 4QUDA 1R9GA 1XK7A 5CG1A 5KOHB 3RAFC 1HG0A 3DZKA 4ZA2A 4IY1A 1R0CA 1KQFA 3W06A 1CS4C 2FPIB 1PBTA 1JWAB 2NTVA 2HY7A 3L7OA 5EE1A 3GVIA 2J33A 4C4AA 5ALGA 1LX7A 1T9KA 4DYDA 1M34B 3D3JA 5KYNA 3I01M 4ZOLA 2CFRA 3TO5A 5IASA 3ZC3A 4YK7A 5M3BA 4PIVA 2UUAB 1ODIA 4OAQA 1IN6A 1MAUA 5IDXA 1Q7EA 4YFVA 3NH6A 4KDFA 4MUNA 4KSBA 4JK3A 3WDLA 1JH9A 3PJGA 4AC9A 3KAKA 1DDIA 2RC6A 4XB2A 3CLRC 2BVNA 5KQLA 2QPLA 2W8ZA 4IICA 1PZXA 1LZLA 3BXXA 5C7IO 1ZK2A 2BOVA 4UKDA 3RF7A 2C1ZA 4EA9A 3AI2A 3LQQA 3KKLA 1TADA 4HLUA 4LZZA 5JO9A 3AOEA 1ZFNA 3DDZX 4XWGA 1EXNA 3L8YA 1RHRA 3L5KA 2R4UA 2J4CA 2BEUA 5A9SB 1XEWY 2UXBB 1OPRA 1PE0A 4R9SA 1FTWA 3QJ5A 5BQ5A 2CHQA 2QU8A 4G5GA 1VA5A 5JS8A 3RR2A 3QKWA 4LYJA 5T8KC 3RYFA 3TPFA 4G07A 4C76A 4EY3A 1GLNA 4KUHA 4EJMA 2V3VA 2ZIZA 3HDTA 2PUDA 5CDSA 2BLNA 2ZU0C 3ICOA 1FL9A 1KVQA 1NLFA 2YV1A 2VZEA 3FJ1A 1AV7A 4CTJA 1ISJA 4P92A 1XBTA 3RUFA 4EW6A 4TKVB 3GDHA 2JJMA 4HAWA 5EFZA 4KPFC 3ZY2A 3SCZA 2I66A 1A8IA 1Y98A 1J21A 2V5AA 1P2BA 2EFJA 2A5DA 2WKSA 3IP8A 4WXYB 4MQ4A 2BZGA 4ZOAA 4CMCA 3E3LA 1Y3DE 1XZEA 4QBFA 1W6RA 2VYVD 4JFAA 1E99A 2B92A 2HMYB 4BMXA 4JBGA 4OUDB 2WHEA 2A9JA 2CGEA 2HA6A 4WIAA 3LQ1A 4CF6A 2SCUB 5MN6A 2OO5C 2XRMA 4N0DA 3DEZA 3EW7A 1FVFA 1JEYA 4PC2A 3MMPA 3FPSA 1A95A 3F47A 2OB1A 2AX3A 1DP4A 4ILKA 4CIXA 1YZFA 3SSNA 1T5IA 5J4HA 3KEFA 1H0SA 1QSGA 3HVKA 4AAYA 1D2AA 3QVTA 2HW8A 1YOBA 2X2PA 5D3QA 5JJCA 1TX4B 1K4KA 3PU6A 4ZQCB 3K6SB 3LHIA 2HIGA 2JKYA 2P7HA 1AB5A 3QNUA 2X22A 3DGEC 4K46A 2XWSA 4ZC1A 3TZQA 4QZVA 2BSXA 3SOPA 1IN8A 1TQ6A 4BLQA 4YIHA 5JADA 4DV6B 4M49A 2Z95A 1KK1A 4WAUA 1V8PA 5ALDA 1UINA 1L5MA 3DKPA 1IQRA 3HB0A 3FZQA 1ZEJA 2V7XA 3K9CA 2V54A 3PI6A 3H2BA 1W0CA 1WXGA 3PEWA 3KDSE 4OKNA 3KETA 4UVDA 1RLOA 1ZY2A 1QXSA 4LVOA 3GUYA 5IZCA 3DKIA 1RQGA 4KQCA 4OQXA 3HVJA 5CA1F 3AOEC 5J3JA 4IZ6A 4M1WA 1EUDB 1SA0A 3KOYA 3O92A 4ZMRA 5ICGA 3EZGA 3MMZA 5F4ZA 4RY2A 2YINC 5K6AA 2X86A 1E9CA 3B6KA 4X95A 4C5CA 2RGUA 2XYQA 1N2OA 3DG9A 4MVJD 1DUIA 1K9VF 4ZT2A 3G23A 3ECCA 3E18A 4NCKA 1HEYA 3EMBA 4F6RA 4MWTA 1EUCA 1NUHA 4JT2A 4OBXA 5DH9A 3PHLA 5G0WA 1K9SA 4BWGA 3NG1A 4QYIA 3SYKA 2OGUA 1R0SA 5GPBA 1ZD8A 1QCYA 2CT8A 5F3WB 5BOVA 5K3OA 4IW3B 5I9BA 1H6CA 4YWHA 5JAIA 4K81B 3SYRA 3GFGA 1X87A 2ISSD 3H4TA 4QUBA 4GDFA 4Z0NA 3VSCA 1DAPA 4UZSA 3LT0A 1MJFA 1ZIXA 3B89A 1VYUA 3JQFA 3L8GA 4MA4A 3SU8A 3WB1A 1T5BA 4XX1A 4BQNA 3M5CA 3OKCA 3CUWA 4GF5A 1Z5WA 4TWZA 4XQ9A 1PG0A 1G8MA 4L9AA 2MR6A 1XE3A 4LKOA 2IX9A 2PZLA 2OEPA 3I4LA 3NHKA 3RPEA 3S1AA 5CB4F 3R0VA 1J56A 4EZBA 1WBBA 1HMPA 1TZ2A 2QGFA 2ZUWA 5H7XA 3PXCX 1OXMA 4IV5A 4LJ5A 2GK4A 5E8JA 3FCUB 2IS4A 3D2LA 4LMBA 3RYHA 3BBLA 1W7AA 5CFMA 1NZFA 1Y5NA 5LN1A 2XB8A 2IZ6A 4ZYWA 4PZLA 5FWXA 1QGUB 1TAHA 3KSAC 3DTYA 1Z5GA 3ND6A 2Q5CA 3ZWAA 2YZGA 1DXYA 2WT9A 1DZIA 4X7RA 3BS4A 1GZHB 1Y8QA 3LBAA 5AJZA 4DC9A 5F7OA 1NF2A 3HG7A 2Y0BA 4RORA 4Y2YA 2H2GA 1Y4ZA 2VI5A 3FRJA 3PQFA 1YNOA 2R1ZA 2ZBVA 4G26A 4ABTA 4FC7A 2IW3A 5B6IA 4GI1A 4B17A 4HVAA 4MXDA 5K2MA 4DSTA 1BC5A 2OZLA 1BA3A 2ZB8A 2RCYA 1P3DA 1JIXA 1D4ZA 1TYZA 3EEQA 3JQBA 5IK2D 4ZT3A 3MQ2A 4LYDA 1L0BA 4PYRA 3UA3A 4NH4A 3E9QA 5LQNA 2MHCA 3IIJA 3A4MA 2P5SA 3L7KA 4WXMA 2QRNA 3AHEA 2JW5A 4QPNA 1J5XA 2I22A 4MW1A 5IZCC 1SHTX 3F7TA 5GVSA 4BV8A 2O3RA 3UWSA 3RUHA 4DJFC 5L3QB 1SXJA 2Q9UA 3L82B 5CA1B 3DYVA 3E35A 5LP6F 1XQ6A 5D5QA 2I80A 2I99A 3U80A 1GQRA 5K6AC 3RDPA 1YDGA 1GG9A 3GB9A 3QWBA 4DMFA 4R1MA 5IN4A 5JVDF 1WEKA 2HQSA 1YJ5A 1X1RA 1EWQA 2CDCA 2C4MA 4MR9B 1CIVA 4EKYA 1V16A 2D62A 4AXXA 3LUAA 5CYPA 1J2RA 3SFZA 2E0IA 2NU6B 1TECE 4MO2A 4D99A 3ZHSA 3EMKA 1FQOA 1J42A 3EHEA 2C4NA 3AB8A 3PE3A 4IIYA 1SIUA 1YBHA 1NSFA 3H75A 3L8FA 4JVSB 4NYJR 1R6UA 4JDUA 4GM4A 1XMPA 4YP5A 2OHIA 5IDVA 3TB4A 1LBHA 1KK2A 5DXFA 4DR3B 4RF4A 4TYPA 3ZG6A 3JQFC 4NH0A 3RUEA 3LBFA 3I2HA 4B33A 1XZAA 3WLMA 2AFHB 3AK4A 1U1FA 3MWDA 5ALPA 1KETA 3JQAA 2F6RA 1K89A 3GG2A 3ZE2B 4BNFA 4E07A 5CB4B 4H60A 2PQ0A 3E05A 1A2OA 3MIZA 1AK9A 3KLOA 2ERYA 1I3OA 2B4RO 4QXOA 3DV0A 2H8GA 3D3QA 1HTTA 3ADKA 4YBRA 2X0DA 3VAYA 1DQNA 4N41A 3BZUA 4RJLA 5IUNC 4IV8A 3AF6A 3GHHA 4FMCB 6AT1A 2ZI4A 3A1SA 4V1CI 3FVVA 2ZIUB 3D7SA 2Q3MA 3KQMA 1QCCA 4BEVA 1ZK1A 2VAVA 5DCWA 3T7TA 3FYHA 3EJWA 4FHGA 3G1WA 2JRCA 4KQ9A 1KZ4A 3U2QA 3AU9A 3MLBA 5GOZA 1DTSA 2V4ZA 4AJHA 4GMFA 4ZZ1A 1Z73A 3G85A 1VJ0A 3BJRA 5H70A 2R25B 3C3KA 3MHTA 5A4FS 1TE2A 4PLPA 2BKLA 3C16C 2R2AA 4RNDB 5DK6A 5BUZA 1G3RA 4DXAA 3HA5A 1QPBA 3DFZA 3KJGA 1AB6A 2DY1A 3KKZA 1O95D 3JQBC 4RA9A 3DXFA 2PIDA 1N33B 3QVGB 3SS8A 4OJKA 5IFKA 2C2OA 3AUJB 5EP4A 2EX0A 2C7QA 4C6TA 2O2JA 1WUTA 2MCFA 5BWNA 5DEOA 5IH7A 3FCOA 3ZI0A 4UM9B 3SR4A 4IQ4A 4ER3A 1SHUX 2BM9A 4C88A 4DMLA 5B4VA 1LC3A 4FI3C 5I7OA 4IRMA 3CCFA 4M9ZA 1AE1A 2PZKA 4LF4B 4RK4A 1SXJC 4UEJA 2G09A 2P79A 2V6IA 1OKKA 1TU4A 1MRNA 2B69A 3C3DA 3JU3A 4HEA1 4KXYA 3QXCA 3QE0A 1RM0A 5U1PA 2JA2A 4R9VA 3WK6A 4BMYA 1KSGA 4YT4A 4DZRA 1XLUA 2RH4A 3JAKA 3FBGA 5JVDB 4CXMA 2GVZC 1E5LA 3KJIA 2ZPUA 3T15A 4CEHA 2DTEA 4MR8A 4B5LA 5J2TF 1D5WA 5YASA 2HH9A 2ZTMA 5I7VA 3SXUA 1Z6PA 2PH3A 2WDZA 2VPIA 3VH3A 3FZYA 4RVGA 4W6QA 5JAMA 1T2AA 2AFRA 4K9LA 1EIZA 3II6X 4KLAA 4F4IA 4R0VA 3KR1A 4YMTA 2UZ3A 3DEIA 4G1BA 1Q7CA 1NULA 4IXWA 5ES3A 3ZHCA 1HDZA 2H1FA 5HM8A 4RFSB 2WWGA 5TEWA 4Y2RA 3N87A 1SG6A 4KHZA 5E2IA 2ERXA 3FNIA 4OF4A 1E9BA 2ZJ5A 4FCCA 4D8UA 4NABA 3V1TC 3CUEF 4BLPA 3LWNA 4UHFA 1JHYA 4QFMA 1FFBA 1CUJA 1HDIA 2FWJA 2YJGA 4GR9A 1Z15A 4J0DA 4GBED 5F2OA 3HXQA 1FUIA 1Y4AE 3DTVA 4XIIA 5H3LA 2OA0A 4AUKA 1ICEA 2DJIA 3MVEA 4H31A 1V96A 4KQMA 3F4BA 4Q9LA 1EM8A 3MT8A 4PTZA 3ZE7A 2HA4A 2XGGA 2R5FA 1U5BA 1SEVA 1AK1A 1VZ2A 3RWMB 3UT5B 3AR4A 4D25A 1P5HA 1VJCA 4GIBA 3SJUA 2PL3A 1QH9A 3HEAA 3T6KA 3TGWA 4ZTUB 4A8TA 1RYZA 4ZO8A 2CEAA 1G21B 2PXAA 3NYRA 2GM9A 3F2VA 1P1FA 3U1VA 4DZZA 4H59A 1E4EA 3DZHA 4PBRA 4CHTA 4OSPA 5U4QA 4P93A 3FHOA 1N2EA 5E1BA 3A4IA 1MO4A 3SZ3A 3SJ7A 1D2GA 1KH2A 5K8TA 3WDSA 1UDRA 2ZLBA 3AVQA 1KMHB 5EXPA 1J09A 3P45A 2J9ZB 5LA6F 2RK3A 3P27A 1I2AA 4DLWA 2VDJA 2YHIA 4F8JA 1CJBA 3IXLA 4L28A 3U3OA 2GLXA 3BFVA 4TZKA 1ZRHA 4Q02A 3RU2A 2B2XA 3BXZA 4EYKA 3IT2A 5DNVA 1L3CA 5KYUB 2EP8A 5GGYA 3O2NA 3LW7A 2VHXA 4D81A 4FOLA 4C3ZA 4U7JA 5ALSA 3A1VA 2DQZA 2JB9A 4C4XA 2CDNA 1BWRA 2WILA 3PRHA 3GNSA 4XVCA 1Q20A 1VL8A 5BN5B 4Q15A 4GSKA 1A8UA 2FPOA 5ERGB 4BVFA 3DAYA 4C0WA 2XUKA 4AS2A 4D4IA 5C52B 3WMEA 2D4AA 1EU1A 2BBTA 1ZD5A 1FXUA 3AKEA 1XRPA 2XECA 4OI0A 2GRUA 5J2TB 1LTHR 1NHGA 4H7JA 4G09A 5CIYA 3UM9A 1BRMA 1LLUA 4LYGA 2RHOA 1NIJA 1ZL2A 5CX4A 3WLLA 2FE4A 3EK2A 1F3LA 1QX3A 2ZIAA 3Q6IA 3WFJA 1VKHA 3KKKA 4XD7A 3E70C 1YONA 2OORA 2M6RA 3ZU4A 1IZYA 2J67A 1R10A 1J00A 1NIPA 1HNNA 2CJPA 2RGBA 4BFXA 5AKLA 1TM2A 2P9TA 3CW9A 5F35A 4F8EA 2WHPA 2X6QA 1R6TA 1ORTA 3IR6A 4ZP1A 1GVHA 4G65A 3FOEC 4MW5A 2JA1A 1U5AA 3PSHA 3E82A 3WL5A 5KJ6A 2UYYA 1QLJA 2IPAB 3FCAA 2FLWA 4RY8A 4WDQA 4L74A 4NAUA 3DOJA 5E9QA 3UV7A 3D3EA 2O23A 2QTLA 1WNTA 5DXAA 3C4JA 3MJCA 2Q4RA 5DLPA 3DVAB 2Z3ZA 4DLPA 1JTEA 1WUYA 3FUWA 1CY0A 3VZDA 5GIPE 2C5FA 1ZNXA 2CXQA 3BH7A 3FWKA 2GF2A 3QX7A 5DULA 3WL3A 3K71B 4O4HA 4DILA 4X8LA 4KACA 1QBKC 2G80A 4QSHA 4TL8A 3LIIA 3WADA 3PG5A 2ZVPX 2B1GA 1AXEA 4IQGA 1NYTA 2O2HA 1N2GA 4PINA 4RFLA 5EZYA 4P3XA 2ODPA 3BWCA 3A1CA 2UYCA 3P5SA 3A26A 4F2WA 2FLVA 3QNWA 1K6EA 1TFUA 1NL3A 3Q3HA 2Y1WA 1GNVA 3RBVA 1P2UA 2R60A 3L4EA 1LEHA 1LPAB 2UVPA 5CEEA 1CR0A 2DLDA 3AY6A 2JGNA 5FT9A 4ZPXA 1A5BB 1E8MA 5GONF 1BHQ1 3RANA 1G4AE 5LA6B 3UUGA 1ZJ6A 1A7KA 2ZIGA 1MQ9A 3DEHA 2GRAA 3GQBB 3M5PA 1LUAA 1XZCA 3ICEA 1PYDA 2E2WA 4QTZA 4YV1A 3V7UA 1MXFA 1Z62A 1KZ9A 2CNWA 3LLVA 5KUTA 4G0VA 2JDID 1GPMA 3K0SA 2QRJA 4I50F 4DLLA 3PGXA 4BB0A 1L7DA 3G2LA 4RPCA 4BVEA 1NF8A 2EKPA 3G49A 5E6UB 5JY1A 2C2KA 1S9DA 2IGBA 5BW8A 1QWOA 1FSGA 2VF5X 3AT1A 3ZHBA 3WISA 4O4IF 5CT4A 1OFTA 3DMNA 4EYQA 2XKJE 5CPBA 1TQ4A 5EIBC 2XHZA 3OZRA 2PFSA 1Z2CA 3IESA 3DOUA 3V2HA 2QL7A 5IXSA 2I2XB 4YV7A 3ETDA 1UFRA