4IJUA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3-yl]bicyclo[2.2.1]heptan-1-ol
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 95
structure length 266
sequence length 266
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijuA00
1ENOA 4B3HA 5C7IO 2BHLA 1ML3A 1XA0A 1P33A 3OICA 3ETGA 4EEXA 3LU1A 4OM8A 4J0EA 3VPSA 1PR9A 4J4HA 2QZZA 1H6BA 3QW2A 5KTKA 2NU7A 1EK6A 2DPGA 1ENYA 1GEGA 1ZSVA 5FWNA 3VH3A 1PGPA 3WGIA 3DAGA 1RM5A 4IBOA 5I9NA 3KTDA 5L51A 1TXGA 3AI1A 4BKUA 2PKQO 3D1LA 2VWGA 4K9DA 4L4RA 2VQ3A 1ADBA 4PLFA 1B14A 4J91A 3DOOA 4XR4A 3WX0A 2BMAA 3JQGB 7ADHA 2HKIA 2EERA 1NQTA 3BYZA 3IDSA 3Q3CA 3ZW9A 3VZPA 4MINA 1O89A 1UP7A 1TB4A 4XEHA 3WGQA 2O3UA 2X7HA 3ZU2A 4QXMA 1CETA 4B4OA 3DR3A 3ICCA 4INAA 4WPGA 1YOVA 5JNLA 4BO8A 5I8ZA 2B5VA 5TLSA 4LMRA 3KSDO 1DSSG 3WIEA 2VT3A 4BO1A 4J7XA 2J3IA 4JNKA 3RUIA 5A9SA 2NTJA 1UAGA 1GQ2A 1B8VA 2CF6A 3G49A 2D1YA 4IDEA 3EK2A 1BVRA 2Y0EA 4PG4A 3UW3A 3CPSA 5BNIA 1F8FA 2PV7A 4M89A 3RWBA 2Q50A 3QY9A 4D44A 5T8KC 3PQDA 1WZIA 2OP1A 3FBGA 4QSMA 1YE3A 1L1FA 2X1HA 1I3MA 5KKAA 2V6GA 1PQPA 3RIHA 2HK8A 3D5TA 5HS6A 3ROMA 3TQHA 4EEZA 2EW8A 1D1SA 3B20A 4BO9A 1C1DB 2AMFA 4BMSA 4NBRA 4GX0A 1F14A 1XHLA 3RFXA 5AQ1A 3GA0A 2O7QA 4MVJA 4IMPA 1X1TA 1XIVA 4BNGA 4MVJG 3QVOA 5IZCA 4CLRB 4DXHA 3OJOA 1N7HA 2ZCUA 4HKTA 3B1JA 4E21A 2P91A 2WTBA 4GSLA 1C0LA 5JPIA 3PFWO 2VWPA 1YL5A 2R00A 4TWRA 3DZFA 3DAFA 4J7CA 1LSOA 1DFGA 4JGBA 1AE1A 4LSMA 1Z74A 3NTRA 4ND2A 4CR6A 4M8SA 4BV9A 3PLNA 4DBVO 3B70A 4QFDA 3SC4A 3KYCB 3CKYA 1I2ZA 4Q3NA 5T57A 2FZWA 1HDRA 1GYRA 4IQ0A 2EV9A 4FC7A 4BOYA 2HMUA 3BTUA 1ADFA 1EVIA 1P44A 1WW8A 2VNSA 4NNJA 1NQ5A 4RVGA 4CMBA 4WLVA 4Z6KA 4TRNA 4KTVE 2B36A 4KWHA 3BMNA 3WBFA 4N54A 2OOSA 3K30A 1BSVA 3FRJA 4PZEA 2ZK7A 3QP9A 2DTEA 4OOEA 3HUDA 2EEZA 5L45A 3WS7A 2Y0DA 4AJNA 5ILGA 2Y1GA 1H9BA 4CM4B 4BO2A 2FR8A 1K89A 4RVFA 1PS0A 4ZRMA 3GC6A 4AJLA 1P74A 1Q0LA 2ZQZA 3AOEA 3GEMA 2X5JO 4P38A 4U7WA 1K0UA 2R6JA 1H2BA 3HDHA 2E4AA 4J7UA 4Y98A 4CLHA 1L7DA 1C1XB 1ZXBA 3BMOB 4TZTA 2X0JA 3FN4A 4NU5A 4FFLA 4AVYA 2YDYA 3WQQA 1ONPA 1I24A 1KC1A 1WNTA 5DOVA 1M66A 1LRLA 3AUAA 4W82A 2PKQP 4PVCA 4XRGA 3TOXA 3ADOA 4UVHA 3KEQA 2BFAA 4WLFA 1PJSA 4W6ZA 4RL6A 4HNGA 4YR9A 1RM3A 1YJ8A 1HZJA 2OGUA 5BSHA 1JW9B 1AHHA 1CYDA 5G4KB 3H4VA 4DTIA 4I9UA 4DWVA 3L4SO 1CERA 4LSWA 1Y8RA 3G1UA 2DT5A 1BXGB 1WDMA 2BH9A 2HCTA 3PGXA 1X0VA 4YEDA 1DAOA 2Y0CA 3BMQA 3OJFA 1UAYA 2CVZA 3V8BA 3ANMA 3PWKA 3K2BA 4Q3AA 4PZDA 4ZQFA 4BNXA 3E9NA 4O63O 4E3ZA 4GI2A 1ZK3A 3ON5A 4CV0A 3DB2A 3HJAA 3EZYA 1P1KA 1PX0A 2AA3A 1I10A 2NTVA 3SJUA 4HY3A 1CIVA 1LC3A 2B69A 1GYPA 4HFMA 3OEWA 5AXAA 5ICSA 5AOVA 3L6OO 3LVFO 3PJGA 1PS8A 1TT5A 4HFRA 4M86A 4RORA 4E30A 1X15A 1YQGA 3K96A 1ZZEA 1DIAA 2A92A 2GPTA 3WNQA 1XR3A 3ZGYA 1GCUA 1MC4A 2EKLA 5L7WA 3GAFA 1Q2XA 2ZB8A 3PIIA 4RVHA 5TT0A 3EAGA 4IMRA 1HE4A 4OMUA 1UXIA 2HRBA 4BKQA 4BL5A 4PLYA 4ZD6A 5HS4A 1H94A 1WP4A 3NUGA 4NR0A 5K6AA 3BXXA 2WE7A 4RDIA 4DLLA 3TZ6A 4D45A 1GPJA 5CPBA 2UYYA 1SAYA 3JQAA 2VCYA 1YVEI 4IDAA 1P77A 1J4AA 4TVBA 4WNIA 4P8RA 1DRWA 1U4SA 4UVEA 4FD3A 5DBFA 1VJ1A 1SOWA 5A04A 3FHLA 1DC5A 2ZATA 4WNCA 3MJ4A 3EUWA 8LDHA 4WLUA 3VKVA 4FFOA 3OJLA 5A4DA 4NFHA 4CLOB 5CG1A 1FMCA 4WEOA 4CM9D 4BNLA 5L9AA 2IE0A 3EHEA 1W4ZA 5I8WA 5KVSA 1LU9A 4J9VA 5KJFA 2QYSA 2O50A 5IAAA 3JV7A 1U3TA 3ZN2A 3ZU3A 1EDOA 1PJ3A 2RHRA 2NU9A 3H7AA 3WMXA 3I6IA 4PG5A 5DP1A 4L4XA 1LBEA 4J1QA 5BSFA 3FCOA 1E92A 3PZBA 3GMDA 3LLSA 2FR1A 4R16A 4KQWA 1I01A 5U9CA 4HP8A 4TQGA 3S55A 3B6ZA 2DBVO 3H5NA 1X7DA 3OJ0A 1NYTA 1R6DA 4Z0PA 2JD2A 5FF9A 1NX6A 4E4YA 3N7UA 1P1IA 2Q4BA 1IUKA 4IPTA 3UKOA 4CPDA 4EUEA 1H9AA 3EVNA 1JAYA 3MJEA 2NQ8A 4MVJD 5CDGA 2NV6A 2DKNA 3ZU4A 2Y99A 1QLJA 2NWQA 4BNIA 2AW5A 2R00C 3DBLA 5EQDA 2AE1A 3W4JA 3JQBA 2QQ5A 2I65A 4AJ1A 2Y1FA 4R1TA 4YYZA 1AN9A 1VC2A 4YRAA 4D42A 4K28A 2I3AA 4WJZA 1BDBA 4IZIA 3JD1A 2X6TA 1E6WA 4G65A 4JP2A 3JQAD 3WLEA 1C3VA 3GAZA 3RC7A 4FC6A 2ZB3A 3E03A 1DEHA 4W7IA 3GH3A 4U5QA 4ZGWA 1VRWA 4CMCA 2HK9A 3RC9A 2C7VA 4JXKA 4JN6B 2QIOA 5CEJA 2ZYDA 3WTCA 1YS4A 3KVOA 1PJBA 4MVJH 4CLDA 3C85A 3UCFA 2J6IA 4CV1A 3IJPA 1OC4A 2VWQA 3DMTC 4DA9A 3NRCA 2CDAA 3V2HA 4B4VA 3U3XA 5B4TA 5F3RA 1ISFA 1LDNA 3K2EA 3S2FA 4Y8VA 1QYWA 1T2FA 1UZLA 1HEUA 4W9NC 4BGUA 1YKFA 3ZV6A 2E37A 3OIDA 1ZO8A 1JU9A 4D0SA 1RYEA 3DBRA 3KYDA 1E1NA 5JC1A 3KXDA 4UEKA 3C7AA 4LK3A 5I9LA 3V1TC 1RJWA 3IUSA 3KYCA 4AFNA 1W73A 1A9YA 1UXJA 4OQYA 3C7CB 3T4EA 1VJTA 5IZCC 3Q11A 1P45A 3O4RA 4LGVA 3DBHA 4XKJA 5L4SA 5CEEA 4R1SA 1J0XO 3FPCA 3UGKA 4YQZA 5TJHA 1LQUA 3DZGA 5L95A 1ORRA 3V5NA 2JFHA 1WDKA 2IYPA 2RH4A 2VN8A 3NEPX 5A9TA 3U0BA 1NVGA 1Z7EA 2I5PO 5ER9A 2VTEA 3CTMA 2Q99A 1ISMA 4J0FA 5G4KA 4TRJA 4M49A 4E5MA 4NMHA 5ITVA 4EI2A 3D4NA 1BXGA 1I30A 5TS3A 3KEOA 1GR0A 3UVEA 4NFYA 5G0WA 5JW6A 4BNJA 5L53A 4WGGA 1E7YA 1NFFA 3MWEB 1YB5A 4N5LA 1QV6A 1XGKA 1E5QA 2O3SA 2Q3EA 3DHNA 3NT4A 4QUKA 3ANNA 4YT5A 6LDHA 3JD3A 3QVTA 5EJ2A 1GZ4A 3KO8A 4D79A 1VE9A 4PIVA 3QWBA 3WTBA 3UCXA 3U49A 4A10A 3OSUA 3V2UA 4LCJA 5A9SB 2IZ0A 3ASVA 4DYDA 3HB4X 1P3DA 2QZ9A 4F6CA 2JL1A 1U2DA 7MDHA 1JVSA 3AOEC 3IKTA 5KNLA 1P1RA 1LLCA 3L4BA 4KZPA 2J5KA 1GQQA 2AG5A 3GUCA 3PWZA 5THKA 4BHTA 1A71A 2FR0A 4OIMA 2V6MA 3MJSA 2NVWA 1LSUA 1MC5A 3FR8A 4D3SA 1F12A 1LNQA 1Y6JA 2GYYA 3QWFA 1NASA 1JDJA 3GGGA 4IDCA 5EMHA 2ZIZA 1SBYA 5HA5A 1VKOA 3KBOA 4BQRA 4DMMA 1T2EA 1EMDA 2YFQA 1NPYA 4JBIA 2YV3A 4IJVA 4CUZA 5IZ4A 2XAAA 3HADA 3RC1A 3OA0A 1LI4A 3WFIA 1J5PA 3RJ5A 2GUGA 1MLDA 5COBA 3BTOA 3BMCB 4LCEA 4WCFB 2W4QA 3JQCA 1NWHA 4UREA 4BUCA 4J4TA 4RPHA 4AJIA 2Y05A 4QO8A 3WFJA 2GNAA 4ZN6A 1HXHA 2FPPA 3U9LA 1YBAA 4HFJA 2C07A 1DRUA 1NAIA 1T26A 3LT1A 4L74A 3MZ0A 1NPTO 1UDBA 1G1AA 3ICPA 1MG0A 3JQDA 3JYLA 3SLKA 3WGHA 4QO7A 3MOGA 2QG4A 3PJEA 2BGMA 4HV4A 5BR7A 2CDBA 4O1MA 1NQAO 1YL6A 2Q46A 4BVAA 5JC8A 1U4OA 1J6UA 3JCZA 3MWDB 4M55A 3GNSA 1GU7A 3WWYA 4IUYA 2QW8A 4J1NA 1I3KA 4XCVA 1ZMOA 1L7EA 3VH2A 5BSEA 4GWGA 1IHYA 1N8KA 1GFSA 1Q0QA 1XQ1A 2G76A 3DONA 1HKUA 1V3TA 4XDZA 4I1IA 3QA9A 4CLEA 2GCGA 3JYOA 1NVTA 3P19A 1UDAA 2OMEA 3GVXA 4DQUA 2FP4A 4JBGA 4KUHA 4UVIA 4MVJM 1R37A 1Z6ZA 1HF3A 3EYWA 3ZCXA 4MP8A 1DOHA 4FB5A 3PJFA 2Q2WA 2FMUA 4D7AA 3UN1A 4U6SA 5JAMA 2B4TO 3WBBA 2HO5A 3PHHA 3U4CA 1EQUA 4RGBA 1DHRA 3DEYX 3GNQA 3HN7A 3SX2A 3SC6A 2C7GA 2VRCD 3UUWA 1N5DA 1HYEA 1EE9A 3BTSA 2VUUA 1ISGA 2GO1A 3OQ1A 4AG3A 1YH3A 4L9RA 4R1NA 3ETEA 4A7PA 1LDBA 4L76A 2JD0A 4GKVA 4XZ3A 3WMWA 4DC0A 5I7SA 4QQRA 4RDHA 4ZQEA 2D59A 3ANLA 3INRA 4W7HA 2P9CA 3ZWMA 1V8BA 5MGBA 2GSDA 5C7LO 4R5MA 1P0FA 3A1NA 4BNMA 3F4BA 4YWJA 1JN0A 1VI2A 1DO8A 4FGSA 3KYDB 4GAEA 4B7CA 2XXBA 2AEFA 3AI3A 4OXKA 2Q4EA 3U5TA 3DO5A 1IULA 1V35A 2FHSA 4NBWA 4LISA 3I9JA 4XR9A 1E5LA 3LZ6A 3GEDA 3DZIA 1DXYA 1EK5A 4EZBA 1MX3A 3DBHB 2RBEA 4UEJA 1Y9EA 3V2GA 4IXWA 1LDYA 2EG9A 3H9UA 4C7KA 1M67A 1ZK1A 1E6UA 1R12A 2AEMA 4XIJA 2YZ7A 1KERA 4GPD1 5B37A 3AUUA 3W6ZA 4JROA 1QKIA 2EJWA 1V3VA 3DOJA 4MVJP 2AQIA 1PZFA 1SB8A 1RPNA 5CG2A 2GERA 1KVTA 3I9KA 1F17A 4WCDA 2CD9A 1BMDA 1A9ZA 1HE5A 1NFQA 2EHDA 3GEGA 3ITKA 4MO2A 3GMSA 1BRMA 2YHUA 4E31A 3DZJA 3LF1A 3OECA 1H5QA 2Z1MA 3L77A 3BAZA 2DBRA 3AU8A 3I9LA 1SEVA 2NNLD 4AJOA 2Z1NA 4A73A 2WSBA 1EFLA 2FSSA 3RVDA 2D3TA 4MPDA 4QECA 3AK4A 3QV1A 3HQ4O 1QXSA 1TA4A 4CM4A 2VUSA 4CR8A 1B7GO 5T6BA 2GN8A 4CV3A 4R51A 2CY0A 4RPGA 3H3JA 5JAIA 5IXSA 5JYDA 1IHXA 1R0KA 4P4LA 2QRKA 4JP3A 1E3WA 5BT9A 1U2GA 3I9MA 3HDQA 3TSCA 5EIOA 3Q0EA 3ROPA 3RUEA 2ZTVA 1IZ9A 4BKOA 3KRTA 1DC4A 1M2WA 1DHTA 1V6AA 5BNFA 4PCVA 1HLDA 1H93A 3FNEA 2AQ8A 1R4NB 5JXWA 2CDCA 1N92A 1U28A 2C54A 2FY8A 3ZDFA 4RJTA 3B1KA 1U7HA 3EW7A 3LLVA 4XDYA 3UHAA 4LRTB 2B4RO 3ZWYA 3RROA 5B4UA 2FRDA 4OGWA 1PSDA 5DZSA 2G17A 4W99A 2WE8A 3O26A 5KOIA 1QORA 3RAJA 1U5CA 2JFGA 2P4QA 3DFZA 5KVQA 1FF9A 2EGGA 3PRJA 4WLNA 3Q6IA 2Y1CA 4KQXA 4M87A 1I3LA 4R1UA 3VC7A 2BI8A 5L4LA 3B1FA 3O8QA 1LRJA 2BKAA 2GN6A 1EUZA 2WJPA 5C7OO 1WZEA 2Q1SA 2VRCA 2O7SA 2EIHA 4PLCA 1MGOA 3NJ8A 3UXYA 4XD2A 4YTEA 5JO9A 4E2XA 2WEKA 4MVJE 2GASA 1QP8A 4J49A 2I9PA 2GRAA 3ZNPA 4E12A 3ZHBA 2H5LA 3OP4A 1DLJA 2EW2A 3AFNA 1RWBA 1PJTA 5EN4A 4FGWA 2WMDA 1QRRA 3EC7A 5CDUA 5KCZA 1R16A 3DOCA 4NFSA 3PHIA 3V1UA 1JWAB 4Z0HO 3RUDA 3H2SA 3RKRA 4WCFA 4WK6A 1HYGA 2DLDA 3C1OA 1DC6A 4DIFA 1AUPA 4R01A 3ZWVA 1Z73A 2WYVA 1SB9A 1U8FO 4CR7A 1B3BA 4QT0A 4OSOA 3H9JA 3MTJA 2DVMA 1XU7A 1QYCA 3GLQA 3OF2A 2RAFA 5BSGA 4PFJA 2YQ4A 3NDRA 1LXCA 3QWAA 3DMTA 3L9XA 6ADHA 4E33A 3ONFA 1PL8A 4CLOA 4CM9A 1ISIA 4IDBA 1VLLA 3U09A 4BMNA 4FIZA 3I23A 1RYDA 1B2LA 4JBHA 1DIBA 1UXKA 5ENVA 4KUGA 1OI7A 3WGTA 1JWBB 3FPLA 4IGFA 4QTZA 3PK0A 3WQSB 1KS9A 3GDGA 2D2IA 1S7CA 2PR2A 4ALJA 2GZ3A 4KTTE 3CXRA 4J2OA 4WOJA 2AEJA 2AQKA 1YQXA 2VHWA 3I3OA 4B7XA 4AJEA 1M6HA 3RUFA 3ORFA 4YAJA 4YJGA 4CQLB 3I9OA 2P4HX 3E5RA 4CMAA 4IDFA 4XYBA 4Q3EA 3OH8A 1JQBA 3JSAA 3ZWOA 2HJSA 3GPIA 3UOGA 3VAZA 5A3VA 2Q2VA 5JFOA 5IDXA 4FFNA 2YUTA 2VTDA 3RFVA 1KBZA 3ZNQA 4R3WA 1C0KA 2PFGA 3ZV4A 2YDXA 4ALIA 4AICA 3AWDA 3SLGA 2IRWA 3ZU5A 4BNWA 4GMGA 5JLAA 1UXGA 2FPGA 1IY8A 1U3WA 2E49A 5TX7A 4HXYA 4D0RA 3WYEA 1SOVA 5L4NA 4FFPA 5A03A 1ZW1A 2DU8A 3M1AA 4E5YA 1RM4A 2DUUA 1K2WA 1S6YA 4YJHA 4BNVA 4I5FA 1J49A 4IS3A 3ZHYA 2YY7A 4Y6PA 5DULA 5HM8A 3FWNA 1PJ4A 1DPGA 4ALNA 5DCWA 2VNAA 1TLTA 3C3XA 3KOUA 4E5PA 4WOKA 2JCVA 4KUEA 4NJMA 3HNPA 3QQPA 4DL9A 5GZ6A 1F8GA 4EITA 2EP7A 3TF5A 5T5QA 3W8FA 3M2PA 4Q9NA 4CM5A 1ADCA 1OFGA 1XSEA 4Y6RA 2P68A 3C7DB 3TZKA 4XGIA 1LJ8A 3PHJA 1T2AA 1TI7A 2YJZA 2YV1A 3FTPA 4CLXA 3S2GA 3JQFA 1E1KA 1MP0A 5DT9A 2F1KA 1I33A 1XELA 5JDIC 1HDXA 2Z95A 5B12A 4FOSA 3QE3A 3GUYA 2J3JA 4R3NA 1U7TA 1UR5A 1FDVA 4MDHA 3BHMA 3NDIA 1GAEO 3PTZA 4UVGA 3U62A 2BFOA 4OOFA 3LC7O 1QYDA 3GF4A 4PG8A 4IZHA 1A7KA 1Y8QB 1H6CA 3H9GA 3TRIA 3UF0A 2VYND 3QIVA 3S2IA 3H65A 2GF2A 2LDBA 4S3MA 4DLBA 5JCXA 3F6YA 4YT4A 3E18A 3JQGA 4FSHA 3PLRA 3ZHXA 3VVCA 1DFHA 1E7RA 3PYLA 5JMPA 3LSYA 4LVCA 2Y1EA 4CMIA 3DZKA 4BNYA 5LC1A 3NDJA 1NM5A 4OHUA 4GGOA 3HZZA 4JJGA 1E7MA 4YACA 3WSVA 4ALMA 5CDTA 4EW6A 3E48A 3ZWNA 4B79A 5L7TA 1YO6A 1D1TA 2NM0A 1X13A 5EINA 2W2KB 3RFTA 1BVUA 1MFPA 2WYUA 1EZ4A 1HDYA 1HLPA 1V0JA 1YRLA 2I66A 4PG7A 5U4QA 3TPCA 4B4WA 3NV9A 1ZFNA 3WB9A 2DBZA 1XU9A 1UJMA 4NI5A 3F4LA 5HTOA 3HFGA 2B35A 4ROSA 3QVWA 3TFQA 1SZJG 3CE6A 4ILKA 3N74A 4S1VA 5A1TA 4RF5A 3L4BC 1KY5A 2BFMA 4MJLA 3QLJA 3S1LA 4UEOA 2J8ZA 5MDHA 3GRPA 4FS3A 4E2YA 1T1RA 4OYRA 1GQYA 3A14A 3AW9A 1ZXLA 1GUZA 4OQZA 3RC2A 3NX4A 2D4AA 4J2HA 1VPDA 4EJMA 3MTGA 5K6AC 4NDNE 5IJZA 4ND5A 1YBMA 1LSJA 4IJUA 4M1QA 5JBIA 1XQ6A 1FDTA 3GDFA 2EKPA 1PJLA 2O3TA 4L75A 5KJ6A 2AG8A 3OA2A 1MV8A 3KZVA 4XA8A 4AJJA 2IXAA 4MKZA 3W1VA 2I67A 3L07A 3VDQA 2B5WA 3PZRA 2ZTUA 1HL3A 1ZJYA 1B0AA 1T2DA 3RBVA 1T25A 1LRKA 5I9MA 4CUJA 1EE2A 2ZTMA 1X0XA 3E6AA 1DBVO 3WLFA 4OKIA 3GQVA 1H6AA 1WDLA 3JD4A 3I6QA 4RPJA 4LW8A 1I36A 5HBRA 1PJQA 1OC2A 4YXFA 3VH4A 2OBNA 1WMAA 4B4UA 2J3KA 1HDZA 1CDOA 5H83A 4CMJA 4MOWA 4N5MA 4EYEA 5CAEA 4FN4A 5C5IA 1B26A 1EBUA 1KIFA 1KVRA 4FBGA 3VH1A 4YAKA 4OSPA 1ZNQO 3VPFA 1JA9A 2VYVD 4E2ZA 1R0SA 4W4TA 1TEHA 2YQ5A 1E7QA 1O9BA 4RO0A 1OAAA 1Z45A 2VHXA 4ZQGA 2O48X 5KVCA 4NU6A 5K9ZA 4MIEA 4OKNA 2CSUA 1OOEA 3LC2O 4LRSB 3VPXA 1HZZA 1XYGA 3AM3A 2QYTA 5THQA 4OL9A 1Q0HA 2J5RA 5DNAA 3LT2A 2GGSA 4BMVA 4ALLA 1EVJA 4CM8B 2W90A 3MCVA 4GKBA 3NT5A 3PGJA 4NIMA 3I5MA 3Q9NA 2IDZA 5F5NA 3WSWA 2PD4A 3C1TA 1QYXA 3P2YA 3ZZNA 1B8PA 1I3NA 3NTOA 1PGQA 3INGA 4FDAA 3IIEA 3ZV3A 3HG7A 3MOIA 4II3A 1A72A 1JKIA 3G17A 3RBXA 3A4VA 5GY7A 3ZWCA 3WWZA 4YJFA 4OXNA 3UH1A 3NYWA 3AM5A 1LLUA 5AXBA 3JYNA 4DPMA 3GZ4A 2TMDA 4MKRA 3TJRA 1C1DA 4XX0A 2BELA 1F0YA 3ULKA 3FBTA 4GLOA 1BW9A 3E1KA 3F5SA 1C1XA 3M2TA 1B15A 1CRWG 1KEPA 2EGHA 1DJNA 2HUNA 1E3IA 4R9SA 1VL0A 1WWKA 4ZQBA 4B7UA 2B4QA 1PU2A 3Q9UA 4NQZA 1GZ3A 1M75A 1YJQA 4CQMB 3JQ7A 4ND1A 1O0SA 5A05A 5G4LA 3JYPA 5HRUA 4ZQHA 3T7CA 4TZKA 2HAEA 4UVDA 4CMKA 5LDHA 3AFMA 2G82A 4BGVA 5KJCA 2J3HA 1HRDA 4J6FA 4XGNA 4A03A 5A02A 5GMOA 2CF5A 3GVCA 2BFPA 4XQGA 4I9NA 3ETDA 1I32A 2HMSA 3TZQA 4RVDA 1XLTA 4XYGA 2CVQA 4IM7A 3C24A 3CH6A 4RF2A 1ZK2A 3MJTA 1E3LA 1E7WA 4TMFA 3R1IA 1QR6A 4PRKA 3ZWWA 4CUKA 2QRLA 3C1AA 5IDWA 1KEUA 4XJSA 5TT1A 4YT8A 1HDCA 1EUDA 1NQOA 2OBYA 3CZRA 3PHGA 5DDIP 1YL7A 3PYMA 4UAGA 4WE3A 3PEFA 4NJMB 1TT7A 2POQX 4IS2A 4J9UE 4QX6A 1QSGA 2ZJ1A 4PLZA 2O2YA 4JLWA 5KKCA 4YT2A 2XXJA 2GZ1A 2H9IA 2X9GA 3C8MA 1MFZA 1RM0A 2TMGA 4CMEC 1CQJA 4NK4A 3LT0A 5DCUA 2HRZA 2G5CA 3JQAB 2HDHA 5IDQA 5KJEA 5IG2A 1Z7BA 4XJTA 1PGJA 1KC3A 1GTMA 4GVXA 3IP1A 3JYQA 3GDOA 2C2YA 3V1YA 3GR6A 1O6ZA 4CMIB 1G0OA 1P9LA 1NR7A 2VWHA 2AE2A 3TZHA 1ULUA 2OFPA 4KDEA 3WG9A 1ZCJA 4L4SA 3TWOA 4AJ2A 1XEAA 1NPDA 4IQGA 4XB2A 3GVIA 3PJDA 1HYHA 5C37A 2YYYA 3W8DA 4F45A 4Z9XA 5TGDA 4PZCA 2JKVA 2PH5A 4II2A 2X8LA 5DF1A 5IFLA 1Z82A 4G2NA 3OMLA 2YHIA 3PWSA 2P5YA 1MXFA 1PQWA 5AXCA 4PGFA 1UH5A 3AU9A 1DJQA 2O23A 4H7PA 3OQ6A 5F1KA 4GLLA 2NACA 1V9LA 3AUSA 2VYVA 2C5AA 3WJAA 4QEDA 2IZZA 4JIGA 3H8VA 3TL2A 4ZICA 5TSDA 4A26A 3STHA 4BB6A 4FR5A 1JAXA 2X9VA 4E13A 2Y1DA 4L0QA 1LQTA 1RKXA 3OJEA 4BNZA 1O94A 1YDWA 1LSSA 1LX6A 4C7JA 3CINA 4UUOA 4G5HA 1WLYA 3LT4A 1E77A 4CMGA 3CMCO 3K73O 3TFOA 4WLOA 3KLMX 1P0CA 5I7VA 3VHRA 1PZGA 4TSKA 4DGSA 1PWXA 3TL3A 1GEEA 2VHZA 4XQEA 3M6IA 5JAQA 1CF2O 4BV8A 4K6CA 1U9JA 4GX2A 5T64A 1PR3A 4XQCA 3WGYA 1GCOA 2O3RA 1IE3A 3VOSA 2R2GA 3U4DA 5JMWA 4U8GA 3SBOA 3E9MA 3WXBA 4RPLA 2PZJA 3RD5A 1ZK0A 2Y68A 3LYLA 5ER6A 2PKRA 4Q3BA 3F47A 5KJ1A 1Q7BA 4CL8A 4OXYA 4R41A 3LC1O 1SO8A 2FZEA 4HX5A 1CJCA 3LK7A 4JX8A 4AJHA 4CMHA 1MUUA 4GVLA 3T7EA 4FOOA 5JCJD 1NWCA 2H63A 2VUTA 4PLWA 3L6DA 4XGKA 1Q1NA 4HNHA 2XF8A 1IPFA 2Y93A 4DYVA 1M6WA 2Q2QA 4GQAA 1EVZA 3K8ZA 2A94A 1PJCA 3FWZA 2E6UX 5FYDA 3KM0A 3E9QA 2A9FA 1GV1A 9LDBA 1E7SA 4JK3A 3RU7A 5ENDA 2PTGA 2GDZA 4I9HA 2CZCA 2D5AA 3O03A 3HFSA 3D3WA 1GD1O 3F1LA 2CUKA 1ONNA 4Z0TA 3S2EA 3F46A 4B8WA 2NVUA 3F5QA 1NVMB 2PGLA 4BGEA 3GN1A 2QX7A 4ALKA 2PNFA 4LVUA 3DWFA 1EBFA 4G81A 1YGYA 1ZEMA 3G3EA 4GSKA 4P4NA 2VZ9A 4PLTA 3GGPA 2C0CA 3R0IA 3DFUA 3OIFA 3OM9A 4R5HA 3K6JA 4F3YA 3AY7A 2C2XA 4Y6SA 3RASA 1Y8RB 4YJFB 3F3SA 2BLLA 3ZV5A 2RH8A 2B83A 2Y66A 1MXHA 3PDJA 3F9IA 2NUAA 3BIOA 3K9QO 1LLDA 2BF7A 4D3FA 1JTVA 2PWZA 3NAQA 4L73A 1ONOA 4EGFA 2I99A 5CDSA 4HUJA 1ZBQA 2PLAA 2OL4A 3MEQA 4ONEA 1LUAA 1EDZA 2W2KA 3EDMA 1SPXA 1UZNA 4YAEA 3ZI0A 4B8ZA 1GY8A 3BMCA 3CEAA 2O2SA 5ES3A 4PLVA 1GPDG 3BHJA 1ADGA 2HJRA 4FJ2A 4IDGA 3MJCA 2HQ1A 2CNBA 2Q1UA 5ADHA 2PGDA 3D0OA 2Q45A 2DM6A 1B3RA 4E5KA 1XWFA 5GZ3A 4CL3A 4PLPA 1OMOA 5CPFA 4IXTA 5JAZA 2ZJ0A 3HE3A 3RI3A 3ZHZA 5JDIA 2VOEA 1O95A 4W9NA 1HDGO 3MJVA 4BO5A 2HMTA 3UCEA 3GOHA 3PQEA 1BG6A 2GLXA 4FPXA 2A35A 2Q1TA 3QVXA 4YRDA 1HETA 2SCUA 3GFGA 4RQUA 3ONDA 1XG5A 4YCAA 1B8UA 5L3ZA 3GY0A 3FNGA 3H5RA 3VVBA 1UP4A 3VTZA 5T8KA 3HSKA 1BGVA 3CIFA 3F1KA 1B16A 1EFKA 1KETA 3L6EA 3BZUA 1A4IA 2X0RA 5L7YA 2VYNA 4U0JA 1GZ6A 4CV2A 1U1IA 1XKQA 1CEQA 4N7RA 1PS9A 1N1EA 1WMBA 1T4BA 1K5HA 1IYZA 4R54A 4WLEA 5EL0A 5JY6A 5G2OA 3RQSA 1VM6A 5AYVA 4NZ9A 4D41A 2B0JA 4GWKA 3A9WA 5B4VA 2OO5A 5F1OA 2JHGA 4IGEA 3IQDB 1KVQA 2YHIB 3GZNA 1NFRA 4BB5A 2QRJA 2O3JA 4K1LA 4U0KA 4CM1A 3D4OA 4GGPA 3PIDA 5CHEA 3RSHA 3NT2A 1QYVA 3QJ5A 2WDZA 3IUPA 3JQ8A 1D3AA 1U3UA 4DRYA 4I5EA 4NBTA 2C5EA 3JTMA 4WASA 1ZSYA 2X58A 3K5PA 5EPOA 4CM8A 3I52A 3BHIA 1BTOA 1PGNA 3GGOA 3WOHA 4CMEA 4CQMD 3R3JA 1PQUA 3G1TA 2AHRA 3DBLB 4R9RA 3I9NA 4E5NA 4EJ6A 1VL8A 4E6PA 3E82A 2DAPA 1ULSA 2WM3A 4BNNA 4IJWA 5F1PA 2G0TA 3ONEA 2NVBA 4BGIA 1UXHA 5LCXA 3W8EA 3ENKA 3ZH2A 4BKRA 4BIIA 4ND3A 3TNLA 4BO3A 8ADHA 3JD2A 1PEDA 4RF3A 1N1GA 4HWKA 1NTOA 2YFHA 4F6LA 4O6VA 2Q49A 3EY4A 3PPIA 3ENNA 4P4GA 5JO0A 1K3TA 1DDOA 4ITUA 1E3SA 4XWYA 4TKLA 4J16A 1BW9B 2CMDA 1R4MA 5IDYA 3KSZO 2IEDA 1IB6A 5KVVA 2V7PA 4J3FA 2JCYA 3NKLA 1R15A 4TKMA 1KOLA 1ENPA 1ISJA 2Z5LA 3EGOA 2WD7A 2W2LD 1FJHA 3D4PA 4D43A 1O8CA 3DHYA 1Y5MA 4DLAA 2ZB4A 5B1YA 3ABIA 1LDEA 5BQFA 2B37A 2V65A 1SNYA 4BQPA 3DC2A 5GZ1A 5FI5A 1PWZA 3H3FA 1U8XX 2DC1A 3WYBA 4J90A 1R66A 2FSVA 3KV3O 1GDHA 1SMKA 4WKGA 1VKNA 1SEPA 2PZMA 2FPIA 4ZRNA 3ZW8A 3X2EA 1OBFO 1U5AA 2EJVA 3TZCA 1GUFA 2W8ZA 4HFNA 1W6UA 3DDNA 3JQ7B 4X54A 3RKUA 5DCYA 1LTHR 2PH3A 3M1LA 4Y9DA 1VSVA 2DQ4A 2OZPA 2G1UA 4ESOA 3H5AA 1R4NA 3IS3A 4OAQA 4BO7A 3D64A 1YB4A 1Z75A 4F46A 4JQCA 2RCYA 1H6DA 2GD1O 3BTVA 3ITDA 4UULA 2E82A 1HT0A 4ZVVA 5H82A 5FFFA 3DAPA 1GYQA 1I2CA 2VZ8A 1CQIA 3WIDA 1PL6A 1E1MA 3D7LA 2LDXA 4Z3DA 4K26A 5JS6A 1ZSNA 4HBGA 1Y9AA 3DQPA 4ZU3A 4DPKA 1E1LA 3SXPA 3TN7A 3O8QB 4PVDA 5DN9A 4D46A 2NLOA 1X1EA 1G6KA 1R4MB 4RVUA 2O4UX 5JE8A 3WGGA 1HE3A 4PRLA 4YAIA 2C82A 3Q1LA 3UAGA 2EF1A 2ILTA 2X4GA 3LF2A 4LN1A 1IL0A 1PL7A 5TF4A 4AJPA 4BNHA 5L40A 3PHLA 4J4BA 2BGLA 1TVEA 2X22A 4DMLA 3IJRA 1GADO 5FI3A 4EUHA 2NSDA 2IODA 5I7EA 1DIHA 2OORA 5JDCA 3VTFA 4EBFA 2V6BA 4DBZA 2CFCA 4EUFA 4RQTA 1DLIA 1D7OA 3K31A 3D3EA 5DOZA 3WICA 5A3JA 5T67A 4GMFA 2IZ1A 3AY3A 4BO4A 2HU2A 1P1FA 3JQFC 3KYBA 1Y81A 4NPCA 3DBVO 3ZWAA 3QWIA 3WQRA 2Q1WA 3G0OA 1Q7GA 4DIOA 1HWYA 1UP6A 2FWMX 4P22A 1YBVA 3HHPA 4AJ4A 4ID9A 2Y1OA 4KOAA 1NXQA 4RCVA 3ROKA 1Y1PA 1ZKMA 4Q39A 1GUYA 4FJ1A 3DXFA 4RLHA 4YQYA 4DQVA 4GX1A 1QV7A 3S8MA 1I2BA 4IINA 3GFBA 2HMVA 4R69A 2DFDA 2IXBA 3GG9A 1HSOA 3TDKA 2FOIA 3DL2A 4MVJF 1KEWA 1PTJA 1MA0A 1ZVMA 4B3IA 3WGZA 4CQMA 4UUPA 1Q7CA 2HLPA 2NTNA 2DTDA 1PZEA 5JCJA 4DVJA 3Q2IA 2WWRA 2W2LA 5ICMA 1QMGA 2UAGA 5CFZA 1FK8A 3IAHA 3LDHA 3ADPA 2X86A 3PQFA 2JHFA 3ST7A 2NVUB 1T24A 3WDSA 2YV2A 4O59O 4ZJUA 4HADA 5EQFA 3NGLA 1C0IA 2UV8A 3GPDG 3IL2A 4DIBA 5J23A 2PA3A 1DFIA 5COQA 3D5QA 3VPGA 4KMSA 2EP5A 1E0DA 1BXKA 4IIUA 3CZMA 1DAPA 4RZHA 4PN3A 2ZYAA 3P2OA 4BNKA 4TVOA 1OZAA 2JAPA 1YOVB 2PD3A 1E3WB 2ET6A 3EZLA 4I8XA 1DB3A 3TOZA 1ZEJA 4Z3KA 4OJNA 4Q3CA 1NR1A 2VT2A 5TRTA 3RUAA 3SVTA 1UZMA 2PD6A 4XRRA 5F21A 4J43A 3HDJA 2X5KO 4UUNA 1IPEA 2ZB7A 3HB5X 1NHWA 1AXGA 2D5CA 5EESA 3X2FA 3KLPX 4YPOA 1D4FA 2FN7A 4J1SA 5TIIA 4XB1A 4WECA 1DIGA 5JYEA 1KVSA 4CM7A 3NJ4A 1NBOA 5A06A 1NHGA 3KETA 4XYMA 4PLHA 1WXDA 4TRRA 2P5UA 3CSDA 4URFA 4R68A 1NAHA 5A5EA 1WVGA 3SJ7A 5CDYA 4Y67A 4KP7A 4NBUA 5TJ9A 3AOGA 1X7HA 2NU6A 2VRBA 4BNTA 4WUVA 4EDFA 5IF3A 3JQEA 2ZCVA 3FR7A 3FNFA 1W0CA 1W8DA 2VHYA 3H2ZA 4FJ0A 1ZK4A 4MP3A 3FTNA 4DPLA 5KWEA 3PI7A 4XQ9A 5G0VA 9LDTA 3ZWPA 3GT0A 1MB4A 2J5QA 3P5SA 4NK5A 4Z9FA 4CJXA 3E5MA 3VZQA 3D3WB 4YRBA 3U4HA 3O9ZA 4RPKA 2DBQA 3A06A 1AHIA 1C14A 1N7GA 1PZHA 1EVYA 1FDWA 4QFCA 3RUHA 5ILOA 1T1SA 1ISHA 3JQBC 4ZA2A 3FD8A 3LQFA 2C59A 1YB1A 1PGOA 4DUPA 3PVZA 4YDRA 4E2WA 2IEBA 2UDPA 1YDEA 5AXDA 1LEHA 1G0NA 3K92A 3GHHA 1HSZA 3P7MA 1AGNA 3R6DA 3VDRA 2BD0A 1N2SA 3VKUA 4PLGA 3IMFA 4D3DA 2RIRA 3GHYA 3VZRA 2UVDA 1HTBA 3AJRA 3I1JA 3W6UA 3W4IA 1I5RA 1R0LA 3JD0A 5K0ZA 4E32A 5COAA 2UUOA 1QG6A 2EXXA 2XOXA 1FXSA 3GZNB 3OETA 4XIYA 3DHEA 1U3VA 3ROQA 4WCFC 1JKFA 1LA2A 3INTA 3RJ9A 1ZJZA 5AVOA 4MKXA 1KYQA 3UICA 3T4XA 3I83A 3L0DA 2DFVA 2BI7A 1ZMTA 2JFFA 3VZSA 3IP3A 3OIGA 3QWHA 1Y8QA 2C29D 4FCCA 3OFSA 3IKVA 3GK3A 3JQ9A 2DUWA 2RHCA 1A27A 1PIWA 4FFMA 4MIOA 5CEFA 4B3JA 1E3JA 4MP6A 1EQ2A 4NBVA 4PG6A 3WNVA 3FNHA 5IN4A 4NG5A 1ZIDA 2X9NA 2JD1A 2NU8A 4I5GA 2X0NA 1H0KA 2OXIA 1ARZA 5EERA 4TRMA 3COSA 4UUMA 3OBBA 4RLSA 1LDMA 4JCOA 5A9RA 1EEHA 1VL6A 1M76A 5H81A 4YJGB 3RUCA 3AY6A 1V3UA 3N58A 4U6QA 3WR5A 2PGJA 3R3SA 4IJKA 3JQ8B 1ENZA 4A2CA 1TT5B 5KIAA 3NGXA 2GN4A 4A27A 2OHXA 5CP8A 1AXEA 4YBZA 3GNTA 1LLQA 3CUKA 3RCBA 4DREA 2JJYA 3ZNOA 3HN2A 4H15A 5TQVA 1LDGA 1F06A 4GBJA 1A4UA 2Y67A 1ID1A 2H6EA 4Z9YA 3EVTA 2WD7B 3OEYA 5IN5A 3QRWA 2WYWA 1YXMA 2C20A 3KB6A 3W4KA 5U1PA 3KHUA 4RF4A 4GX5A 4LMPA 2DTXA 5A5FA 4A0SA 4Q3DA 2IYOA 3DMYA 5JDCC 1KY4A 2I76A 1BWSA 3JQ6A 3U4IA 4RVSA 5TC4A 1LC0A 4KWIA 3NTQA 5I7FA 2A4KA 4RZIA 1EUCA 1P1JA 4IIVA 1D8AA 1UDCA 1YWGO 3E8XA 4H3VA 4XYEA 4MIYA 5G0UA 3ZWXA 4WEQA 3QSGA 2X0IA 1UUFA 5ITWA 1K6XA 3KSUA 4ZHSA 5DBGA 3H9QA 4YJHB 4A5OA 1YONA 5JY1A 2X5OA 1CWUA 3AUTA 1O5IA 3L9WA 5LDGA 1WAMA 4BKPA 3I4FA 3AI2A 3FF4A 2GR9A 1NNUA 2O4CA 4L8VA 3QHAA 3PP8A 1HDOA 2AXQA 2P9GA 3JQ9C 3RBZA 1A5ZA 4NHEA 1X7GA 3WJ7A 4NJOA 2ZYGA 2F00A 3KUXA 4BS9A 4CLRA 3AM4A 1H2HA 5TNXA 3BA1A 1E6EA 4OO3A 4FFRA 4BNUA 2EWMA 4J1TA 4CM6A 4BO0A 3DZHA 3BMOA 4JJIA 3QVSA 3PDUA 1VJ0A 1KVUA 4BNFA 3I4CA 1N9GA 2P2SA 4I5DA 4CQLA 3DTTA 1GL3A 1I0ZA 4M54A 1NP3A 3BMNB 4YJDA 3WYCA 1Y7TA 3GVHA 2ZTLA 4NH4A 4C4OA 2D8AA 2V6FA 1DIRA 1FDUA 3Q2KA 2W98A 3CMMA 1A7AA 2NADA 5F5LA 2BGKA 1JVBA 1DRVA 1MG5A 2CVOA 3RU9A 1JKJA 3ASUA 2HSDA 3PYXA 2YW9A 4MVJI 1QLHA 3GN2A 3IOYA 4IDDA 1Y5RA 2E48A 2ZQYA 4OH1A 2I3GA 2UUPA 4H16A 2XPCA 1KEVA 2OUIA 2PZKA 3H6KA 3GRKA 5HWSA 3G79A 1T2CA 4DC1A 4CM3A 4CODB 1GV0A 3H9EO 4N18A 5G0SA 1PJ2A 2DPHA 2EKQA 2PK3A 4O0LA 3SEFA 2I6TA 4AL4A 4E0BA 2HK7A 4IY1A 1DC3A 5BNTA 4RV9A 3DTYA 2VZ0A 1I8TA 3UFXA 1YQDA 5IXYA 2ZKLA 3GG2A 2GZ2A 2WD8A 3IC5A 1SCUA 1K6JA 1T4DA 1WPQA 5JSFA 3BMQB 3OHSX 3DZBA 1JLLA 3PXXA 2VOJA 4ND4A 4JJFA 1HE2A 4YB8A 2JAHA 4GH5A 4YVFA 4EJ0A 4XYLA 2BRUA 2HMWA 5DBIA 4FQ8A 2O3QA 3OQBA 3ZNNA 3FSRA 4YA6A 1SC6A 5DP2A 3ZWBA 4N5NA 3VPHA 3PFFA 1X14A 1P1HA 1XCBA 3FI9A 4FW8A 1IOLA 2H1SA 1BXZA 4BO6A 1XDWA 4YAGA 1ZH8A 3EMKA 5FEUA 4IQ8A 2X23A 2PZLA 1P31A 1K6IA 4DQXA 1VSUA 2P9EA 1C0PA 3GVPA 3HDYA 2AQHA 2PY6A 2NQTA 2OP0A 2VHVA 3DBRB 4R4JA 3WGOA 2GN9A 1N9GB 4I08A 4O5OA 5G0TA 4KDFA 1E3EA 2JCXA 1BHSA 3O38A 3HWRA 1FDSA 4TROA 1IZ0A 3A28A 1ZUD1 1BDMA 2D0IA 4K6FA 4AJKA 2QHXA 4GL4A 5C3MA
chains in the Genus database with same CATH superfamily
3LQRA 2DETA 4G9BA 5IP5A 1ZGZA 2BFWA 2W2VA 3M5PA 1TO6A 4LTDA 1NURA 2GNPA 1JXQA 1GA1A 1ML3A 2W2PA 1VHTA 4OM8A 3IA2A 2QZZA 4WZ6A 1H6BA 3QE2A 1UM8A 2C5GA 1BFDA 2X4DA 3FHJA 4H3HB 4OQNA 1Z8DA 4V0RA 1ENYA 3HCBA 1GEGA 3VC1A 3WNZA 3FFWA 5EQTA 1ZSVA 1PGPA 1ZUWA 4V39A 3PICA 1DBIA 3KTDA 3SIPA 3AI1A 5L51A 3UT6A 2Q2NA 3OQMA 3D1LA 4K9DA 2DFPA 3BD6A 1A8HA 4L4RA 2IGBA 3C41J 2QNRA 3PD7A 5FR2A 2OZKA 4FMDB 5B7PA 1Z6AA 1B14A 1TX4B 3DOOA 4XR4A 2BMAA 3M3DA 2OESA 3SBXA 2XCIA 4FNOA 4BRSA 2VTVA 3Q3CA 3DWIA 5FUVA 1JPNA 3LO5A 4PNEA 3OF3A 1GG5A 5JJKA 1TB4A 3WGQA 2ATVA 3V7WA 3K8OE 1L4MA 1Z08A 1ATZA 1PKXA 2X7HA 1UT8A 3BGWA 3QBDA 2FZGA 1CETA 3RV3A 3ZU2A 3ICCA 5J5CA 1E2BA 3I2KA 1YOVA 3LFHA 1TK2A 2NZ8A 4WPGA 3VSEA 1KK1A 2A2ZA 2VDLB 1R4ZA 2VL7A 3EC2A 5TLSA 4BO1A 3M6WA 4WOBA 4JNKA 4OF4A 2F3QA 5FLKA 3MF4A 3DBIA 2I1WA 5AKJA 2NTJA 2J3MA 3FZGA 3V7FA 3MUEA 1Z0UA 1V4VA 3G49A 2D1YA 2OV3A 4C5BA 3LOPA 1BVRA 2DBYA 2EWVA 4S35A 3L84A 3U0VA 2C94A 1F8FA 1S3GA 1EWRA 1X9IA 5B36A 5SV2A 3FTEA 3AL0C 4M89A 4G37A 1P80A 2UVPB 3PFIA 4N1AA 4KFCA 4Y0VA 2EP8A 2FWIA 2QOEA 2X1LA 1MORA 5E8RA 5F5XA 5KNCD 1Y34E 2YH2A 5HIJA 2O8BA 1PQPA 5ALPA 3D5TA 5F2EA 5CCEA 4Z49A 1D1SA 3Q5GA 4MDYA 4RESA 2XCOA 2BMJA 5ALLA 5B7GA 3FYCA 3QI7A 4E4RA 1QHXA 1FTGA 1Z5NA 1Z6GA 5KNDA 3AR6A 2DHCA 3TR5A 1FFAA 4IMPA 4MVJA 1EYZA 1KJZA 1X1TA 3HABA 3TDMA 1IM8A 1WXQA 2H1CA 5IZCA 1JA0A 1N7HA 3OJOA 3B1JA 2QWXA 2WTBA 1UEIA 2IL1A 2GAAA 2XLBA 2JI7A 1USGA 5HSGA 3T15A 1KYVA 4MITA 3VI3B 2IX9A 4FD2A 5AVVA 3DZFA 4MEAA 4PGGA 5TVGA 1JF8A 1H8EA 3NFRA 4LF7B 4Q7EA 2HBYA 3LUFA 3SFZA 1L0BA 1Z74A 1Z36A 5FJJA 3HEMA 4WGFA 2PCLA 5BNWA 1QP7A 2OG1A 4YO7A 5K3BA 5CFLA 3RT9A 4B82A 1NONA 4LJ9A 3UOWA 1EZ1A 4QFDA 2QUIA 3P4UA 4KFTA 3CKYA 1I2ZA 2PIAA 2PUJA 3ELUA 5T57A 1MKYA 3OZSA 3T7AA 4MAMA 4IMIB 3AKDA 4IQ0A 2OKGA 3KL2A 4FC7A 3C3YA 3M6AA 1ADFA 5BQOA 1P0IA 2Q5QA 4TYPA 3PKIA 2NW6A 3NHBA 5LNK1 4RVGA 4CMBA 2HJ9A 3T3DA 2X77A 1SULA 2IC5A 1HORA 2Q3JA 2W2TA 3D6MA 4FT4A 2B36A 2R3SA 4KWHA 4Y6OA 3WLNA 3MCWA 1BSVA 3FRJA 2QV0A 1JQDA 2HCFA 2JIPA 1IBCA 2JGLA 2J33A 2R96A 2Y2UA 5DYYA 3U48A 4BMOB 5L45A 3E1SA 4AJNA 2UVQA 3OI7A 3EF0A 4MUHA 3VU0A 3QX8A 2NSYA 4KBGA 4NAHA 5DEOA 1SXIA 1SA0B 4J75A 3WADA 3GC6A 4O8CA 2OXCA 3F6PA 2IXDA 1P74A 1TFUA 2PWAA 3Q3EA 2K6GA 1WV0A 2QTVB 1O96A 2O6HA 4MWCA 1LKZA 3PEUA 2IU6A 4J7UA 5F3DA 4CLHA 3MWEA 4JLUA 4F3CA 1EZZA 1W36C 1C1XB 1NJ8A 4M9XA 3BMOB 2H4FA 4PPNA 2WW8A 4NU5A 4FFLA 3UBMA 3M6VA 3BCUA 4AMGA 4C21A 2O7NA 1WNTA 1XVLA 2P2NA 3G0BA 5DOVA 4KBYA 3FZEA 1LRLA 5EWJA 5HFAA 5JEDA 2PKQP 3FFAA 3AV3A 3U7IA 4XRGA 3TOXA 4UVHA 1B1CA 2IU4A 3N75A 2I1LA 1XV5A 3D4BA 2ZU6A 1WQ1R 2R6ZA 1E3QA 3AKCA 3N2YA 4U7PB 4W6ZA 1ZC4A 2FP4B 5EAIA 1X3SA 1IN6A 5CM2Z 4UPVA 4YR9A 1PLKA 2AOTB 1HZJA 2ONCA 3IVAA 4IIBA 4FMCF 1K5GA 2DPMA 4X7RA 4DTIA 3UGQA 4ERNA 4V1CI 1N4DA 5E6RA 4IEEA 4D56A 3D2CA 2EZ4A 4RHXA 1XMOB 4LSWA 1EAYA 4WY2A 4HMQA 4RIIA 3G1UA 2NUPB 3M5DA 3OCWA 3R3ZA 4FLEA 3HH8A 4S0ZA 2JFXA 2KJQA 1YZNA 2VH2A 3L6CA 4TZ0A 1G3RA 4YEDA 1DAOA 1X7WB 2E4VA 2HI0A 3BMQA 5DYTA 4KR2A 3ANMA 4ZQFA 3UZUA 1EFRA 2QVYX 1KYIA 3DB2A 4HDMA 5AKZA 1P1KA 4GM1A 1OIWA 1T1JA 1TJYA 2X41A 1ODCA 1WZNA 5ALNA 2RJ3A 3HGMA 1S2GA 1ZUIA 1TKAA 1LC3A 1Q6YA 1PWYE 2B69A 1QIDA 2OENG 1ZAYA 2W6JA 3LPMA 2IPMA 3O6VA 3ES9A 3OEWA 2P2YA 1PS8A 4HFRA 4MQ5A 1EXNA 1X15A 2WYOA 1N5KA 2C61A 2DSNA 1Y4UA 1DIAA 2MYTA 2H4ZA 2Q1XA 2TRSB 3O7MA 3LL4A 1XR3A 4HNRA 4KX3A 4N3NA 4MHOA 4D1YA 5MHTA 2HRDA 3AHFA 3VHQA 3U4GA 5TT0A 3SZLA 1NMXA 1NVAA 4G1FA 2EKBA 2X7JA 4M8KA 1E1CA 4MYCA 3O8CA 4BL5A 5CMLA 4PLYA 4D25A 5KHLB 2HLHA 2P6OA 4JKYA 3D7KA 3PFKA 2G1PA 2FQ1A 4ZARA 4H3SA 2JANA 1GZ5A 2QGZA 4M8LA 1YI1A 4PBSA 3TZBA 5F2NA 4DIKA 3LRXA 5DNDA 3STWA 5EP4A 4YQFA 1ODSA 4ZDWA 7ABPA 3VKHA 1ORDA 1P77A 4YFYA 4DQKA 5LLSA 5B3LA 4ARIA 3OJXA 5BYAA 1TVKA 1EFDN 2VA9A 2VK4A 3DW3X 4FD3A 1ECGA 5A04A 2DH6A 2Y6UA 3HMKA 1DC5A 2O2GA 2WKQA 4B5KA 4WNCA 1Y8CA 3EUWA 3MJ4A 3UWPA 2K2WA 3D7MA 2SKCA 2UZ0A 1CUYA 4HXFB 1P6QA 3WV5A 3CEMA 1JLSA 3PSAA 2Q27A 4BUCA 3TX6A 2E1PA 4GLBA 4F84A 4NFHA 3HVIA 1FMCA 2BCJQ 2E21A 1JS1X 4RNCA 1RI3A 4OGLA 4U8HA 2YV4A 4WEOA 4EO7A 2IE0A 3LX5A 4ZQIA 1MO5A 2QZ4A 3CWQA 1U2TA 3B2EA 3EHEA 2PU5A 3I6ZA 4HDOB 4YPFA 2JI8A 1MH1A 2QYSA 4GZMA 2O50A 3PTLA 3JV7A 4NYJQ 1SU4A 1Z4OA 4KEAA 3TFWA 4AY2A 3AEXA 1XZIA 3WMXA 4KB5A 3HKEA 2SKDA 2P2CA 5DP1A 4GIBA 2QVBA 2YIJA 1VRCA 4J1TC 2GPJA 1R6TA 4M9RA 5KSZA 3MGAA 3N8DA 4WQMA 4FMPA 2FR1A 5U9CA 3O3OB 1QQ6A 1RP1A 3VAYA 4B6PA 4TQGA 2Z5FA 1C8VB 2E1RA 3B6ZA 3SIRA 2QE6A 3T35A 1G291 5KYGA 3H5NA 4RFLA 1NYTA 1OGYA 5FF9A 3LBAA 5F9FA 2BFNA 3R5KA 2H7CA 4AJ9A 4I19A 4D5EA 1XA3A 5AM2A 2ZRQA 1XRJA 2GF9A 2IIBA 1H9AA 2PQ0A 2OECA 1GTVA 3EVNA 1WHSA 3QXCA 3QZUA 1NQUA 2NQ8A 1B6RA 3EYAA 1JJ7A 4A6PA 5CDGA 3AUJB 1E2MA 4P92A 1UKAA 4EG3A 1H4SA 2AW5A 2BEJA 2WMNB 4MCIA 5DISB 4EAQA 2XWPA 3HU1A 4NESA 3F73A 2OY0A 3H8SA 2E5FA 4JQOA 5F9HA 4AKEA 4YYZA 2FE4A 1VC2A 1JJVA 1H2AS 2H1FA 2I3AA 2XVXA 3IP5A 1BDBA 4WJZA 3JD1A 1VFNA 3GRVA 3KR1A 4JP2A 2B4KA 3KKKA 1ZJJA 4ZC1A 2IXTA 4I1PA 4JC0A 1USUA 1T3TA 3T3EA 1IC6A 1XI2A 1VP3A 4ZI7B 2QP4A 5ALHA 1AT1A 1VRWA 1ODIA 2WR8A 1Q12A 4GR5A 3RC9A 1JG6A 1VMIA 3I6MA 1Z29A 1SXJD 4JN6B 4LQDA 4EA7A 5CEJA 3ZQKA 2LIPA 1Y1LA 4K6GA 4QRIA 4MVJH 3I2IA 3QKWA 3ZR4B 1O9HA 2J3LA 5AVRA 5LU9A 5BUCA 1VHQA 4J16C 2VWQA 2V0NA 1XZQA 4MR8A 4DCMA 2JBAA 4UNSA 3V32A 2QR2A 3U3XA 4EMUA 1R6UA 2GJ8A 2OVFA 5F3RA 5B4TA 2FMTA 5AJYA 1M1YA 2C42A 3WGMA 2ZJ6A 1GLGA 5K0NA 5EP1A 4W9NC 3IAEA 4BGUA 5JHHB 3OZ7A 1NLYA 2I4IA 4D0SA 1WQ3A 2WFLB 3RS4A 2XOEA 1PYGA 1UQUA 1E2GA 3R09A 3QNUA 5JC1A 1LW6E 4MUAA 2PEYA 4LK3A 5I9LA 3MSXA 1EVQA 2QAJA 4AFNA 3R3UA 4H0FA 4UAUA 1UXJA 3S2ZA 4MK4A 5AW5A 3T4EA 5KTMA 1FBNA 2CLSA 4ECAA 4KFSA 2W2OA 1H9CA 1V3QE 2IITA 1H1LA 5L4SA 1AGYA 2HXYA 1E9EA 2NUTB 5F35A 3ZVRA 4R1SA 1AJEA 1YULA 1ZCAA 3QXSA 4AY4A 3FPCA 1TIBA 4WKNA 3TKYA 1LQUA 1NT4A 1TO1E 3V5NA 1L5FA 1HO3A 3CX3A 4ZCMA 4OTZA 1MO4A 1NOKA 3B9PA 3HTXA 1WDKA 2VN8A 3EA5A 4QTUB 1L5LA 2J5BA 5AW4A 1O54A 2VTEA 4LY6A 3U56A 2PH1A 5BSWA 3VR4H 5TQ2B 4LECA 3OKAA 2B9EA 1MVLA 4II7A 4LNUA 4M60A 4E5MA 3RVBA 3AVPA 2QW0X 4ZVOA 1D5CA 2BFFB 2BFDA 3QI2A 3KZXA 4LRXA 4OHWA 4TWBA 1I30A 1I2DA 3QLTA 2NV0A 4PBRA 3SSNA 1JQJC 3NHAA 1IAVA 1OU0A 2P79A 4NFYA 5KAPA 4JGIA 4F6RA 1A8UA 3BJIC 4GPZA 4LG1A 1WXFA 1YB5A 4H27A 1FFXA 1XGKA 2VZLA 3AEZA 4N5LA 4JT8A 4PRZA 5EHIA 4BMPB 3CGWA 3CV3A 1RYZA 4L4ZA 1F20A 1PW7A 2PT9A 3IMGA 5KYYB 4RSRA 2J32A 3ANNA 4HUQA 4RIGA 2O5EA 6LDHA 2O8FB 1T4GA 3QVTA 3PPVA 4YX9A 4D79A 3EPKA 4YGYA 3WTBA 3N8HA 3DKVA 2I6SA 3HB9A 3W3AA 3U49A 1O5TA 1FNNA 1F2DA 3FDJA 4PC1A 3V2UA 3FM9A 3OMXA 3VO8A 2IZ0A 2JFOA 3HB4X 1UBGA 1QVWA 4H2DA 3CUTA 3UANA 4ZHQF 2TECE 3AOEC 4HB2A 3D81A 3P9IA 3VDNB 1INLA 3NP9A 4YK7A 1JQLB 1T8PA 2XRYA 1E94E 2G9RA 4KNVA 4LK2A 4EHHA 4EUKA 1MVOA 3KD2A 4LHYA 2AG5A 3GUCA 3PWZA 1ZGJA 1PVDA 1GUDA 5HBGA 3ZC3A 2VK8A 1VCNA 3O73A 2V6MA 2EJBA 1BXRB 2AOUB 4P7BA 5JMTA 4P9NA 3QWFA 4Q01A 4BVKA 1R3UA 1RRMA 1DAEA 3GGGA 3LCUA 4OU5A 5KYNA 4DUYB 2AZTA 1GAQA 3IAUA 5HA5A 4BQRA 2HV8A 3KBOA 2LW7A 5LOVB 4B3BA 3HBFA 2YFQA 3IHKA 4FDLA 2VEOA 2YV3A 3VO1A 2ODEA 2WWVD 1TQ2A 3HADA 4UM8B 2HSEA 3DE7X 4MQMA 3RT7A 3HUUA 3WQBA 4DMCA 5CA0F 3AB7A 1J5PA 1SZPA 5CYGA 3RJ5A 3U9SA 4M9ZA 3QVGA 4EHIA 4HEHA 1CSEE 4KR0A 3SPXA 3BTOA 4A0QA 1XUOA 2VDNB 3A27A 1VLJA 3JQCA 5BUZA 4JI3B 5ICEA 2DHEA 1NWHA 1EH5A 1YIOA 3N2GA 4RPHA 4WINA 4AJIA 1FUKA 1OJ7A 2Y05A 3MWLA 4FI3C 1Y1KE 4OIFA 2GFIA 3WFJA 2HN9A 1CY6A 4H35A 4B6GA 2ZRDA 4RPIA 4W9RA 5JYCA 1JDSA 4YAFA 1T35A 3JYHA 3PNKA 3HUEA 3QX9A 4IF4A 4F2GA 3GLIE 1H23A 1D2HA 1JLMA 4FB4A 5JNRA 4FVTA 1G1AA 4DM3A 3OQJA 4RVOA 2AW3A 4FLMA 4PSKA 3RIXA 1QGAA 3MOGA 3WLMA 2QG4A 2XTMA 3TRFA 1PZNA 1QBKC 3G9TA 4L9WA 1Z83A 1YRWA 5BR7A 3EVEA 3DTVB 1YL6A 4BVAA 1A4XA 4KPUB 2YUIA 1GU0A 3LHSA 3MWDB 3FF1A 4OXRA 3CISA 1KF0A 2DX7A 3GLHB 1GU7A 1IRXA 4IUYA 5AM5A 3WBJA 1VJDA 2QW8A 4KI7A 4ER3A 1XCLA 4S1PA 4UEQA 1IVYA 1L7EA 4D57A 4GWGA 4K2HA 4N5DA 4ZT2A 3DE1X 3RVOA 3DONA 2G76A 3W90A 3AX6A 5K8TA 4KGZA 5LA6F 4XUDA 5FX2A 4ZYVA 4FMDF 2GCGA 4EFLA 1UDAA 3E7WA 3KLBA 3SBEA 2CFSA 4KUHA 2NP7A 4MVJM 1DINA 2W9XA 5CLHA 5TQ0B 4LOKA 3AVOA 4LV5B 1A9OA 3JATA 5K3AA 3WFZA 2YINC 2F7SA 2Q2WA 4B32A 2EWWA 1RXCA 2B4TO 3BIXA 4TXJA 3FB4A 5D00A 3TECE 3WBBA 1IHUA 3PHHA 1WABA 3B3JA 3O0DA 4CG1A 4DJDC 3C8UA 1QHIA 2OAEA 2RB4A 2C7GA 1GFWA 3AUYA 1N5DA 2WUVA 3ZY5A 1QQTA 2FN3A 3KWLA 4RQAA 3MAJA 5SZHB 4UHCA 1BYIA 3SQNA 1BKDR 3ETEA 1LDBA 2QB5A 3BGIA 3L8MA 2GXQA 3OCUA 2QUBA 4BJ5A 3KFVA 2I2XB 2QMOA 2F3TA 3PITA 2YFKA 1I7PA 4OK5A 1YTLA 3R5FA 3SS7X 5CD9A 1Y8AA 3X1MA 4FM9A 4GQBA 1RCTE 2A5YB 5EWLB 1COZA 3R0JA 4QDUA 2AI1A 1FTWA 2GSDA 3K70C 1XVTA 2IY8A 2ZI9A 3HP7A 4Z7JA 5KWSA 2HA7A 1KZ6A 2Q29A 3A2LA 3LZCA 4URYR 2VAMA 3I61A 1KAGA 2GN2A 3WIUA 3ODPA 4CETA 1JN0A 1PLLA 4YCDA 2V7TA 4F3TA 3CM0A 3L04A 3KYDB 1L4YA 3P2IA 3A3OA 3N2KB 3DVSX 2AEFA 3AI3A 3ZY4A 5EIWA 1IULA 2XB9A 2KHZA 4HZUB 4NCNA 4QUIA 2Q5LA 4HN2A 5SZKB 1SCNE 2NXEA 1G5IA 1WA5A 5EHXA 4RL4A 3DZIA 4GM0A 2QJFA 4EZBA 1FFWA 1MX3A 4DCJA 3LDFA 5IT0A 1TZKA 1LDYA 3K2QA 2EG9A 2O2HA 3D2LA 3UGJA 2LWIA 4FHGA 2HF8A 1YK0A 3A9CA 1R12A 4GRDA 4O4HB 5HF8A 4BQNA 4XCXA 1AZWA 3W6ZA 4GPD1 2GO7A 3LQYA 2R1UA 3AUUA 2I2AA 4JROA 1Q92A 3DOJA 3C4JA 2AQIA 4ZI7A 4Q4CA 2GERA 2OD9A 3I9KA 3AY0A 4WCDA 4QT4A 2C4HA 5A5DA 3K09C 3CZPA 1F48A 1OT3A 3N59A 4GDMA 3IQWA 4MWGA 3IPYA 3Q6NA 4IJQA 1NFQA 3GEGA 4OLAA 4Y2SA 4D97A 3KWJA 2YHUA 3G2NA 1RXUA 3DZJA 3G7UA 3LF1A 4HGQA 3VSCA 1W5AA 2FMIA 3E23A 3L77A 5BQXA 2DBRA 3AR2A 3K3PA 3SM3A 3B1XA 1A2BA 4DNOA 1KY2A 3FGNA 3IQEA 3WZLA 4PW0A 4A73A 3KSBC 2IS4A 4K88A 1EFLA 3GBPA 3KC2A 5LMNB 2PPLA 1HOXA 4MUIA 4BQOA 5DB4A 2NSLA 4X5OA 1QXSA 4JUAA 4Q7KA 1P62B 1RYHA 2WWHA 5CT9A 2YZNA 4R51A 1P91A 3TMKA 1XXLA 3I05A 2X7XA 1DQZA 3H3JA 3LXXA 3G6WA 5DHAA 3TAUA 2H07A 3I9MA 1NBMA 4BQFA 1N8SA 4AQYB 1TL7C 1Z3IX 2BFCB 2IS6A 3CY6A 5ALUA 3ZK9A 1O1YA 3KTAB 4CG3A 4NZNA 4K9KA 3KRTA 1U63A 1DC4A 2CNKA 4ARBA 1V6AA 2ZZNA 4PCVA 2W83A 4O4JB 1HLDA 3FNEA 4D98A 2AQ8A 1N25A 1O6BA 3D4IA 4J94A 2AOWA 3EGXB 4Y2HA 3MFYA 2XQJA 4U2CA 5CLIA 1JNYA 1U28A 4BWGA 3IAS1 3ZDFA 1NX9A 3GDWA 4EQZA 3CEJA 1DELA 4AIIA 4LYYA 3UHAA 4BX2A 2H48A 1UKCA 1HNNA 4YV2A 3UJHA 5K05A 2XV1A 1CUVA 3KKZA 1QORA 4F1JA 2P4QA 4JLAA 4OBEA 2BGTA 2XE4A 5THXA 2PL3A 4RM3A 4TYNA 3C0KA 1FF9A 2QROA 4M9SA 4WLNA 1RC0A 5EXPA 1N34B 3FWYA 3QBTA 4OFXA 4N3BA 3R8XA 3WWCA 3Q40A 4ZVUA 5L4LA 4MJXA 2HBQA 3B1FA 3LQ4A 4KYUA 4F6RB 5JBNA 2HQRA 3KQHA 5F3WB 3IALA 3T61A 1UWCA 2DF8A 2F67A 2VIIA 3QTBA 5JWHA 4B2IA 4CU5A 3FDZA 2XNKA 1WZEA 5F12A 3ZWDA 2CLKB 2VRCA 4O2BB 3LP6A 1MGOA 2QGNA 5BWCA 4ZEWA 3W0LB 2QPLA 1XJCA 5EI5A 4E2XA 4V1CB 4I6GA 2A7QA 3EGIA 3DAOA 4EVIA 4R71A 2WIFA 5K3SA 3GRYA 1BEEA 2PH7A 2C31A 3IXMA 2KBFA 3FYTA 3SY8A 1SBIA 2XYQA 4KO2S 3OCCA 4UBKA 2RGXA 1MX5A 3R7AA 5KOHA 4RIHA 1MTZA 5D3MB 1UBKS 4V2UA 3DOCA 4NFSA 3N1UA 2IHUA 1SRQA 3HVJA 2QRVA 1GQRA 1YNOA 4WCFA 1G64A 3DFIA 3UH0A 3UK2A 3C1OA 3A6DA 1DC6A 4I6JA 3ESAA 3LV8A 1AUPA 1HDEA 4LJ8A 4PM4A 5HPYB 1VPWA 3NOXA 3I09A 2IYVA 4EPYA 1AF7A 4ZAWA 1HK7A 2F8LA 2H51A 1GKUB 1I3CA 3Q10A 4JR1A 3ROGA 3EQ8A 3OF2A 2RAFA 2ZRMA 4P80A 2D7DA 4P84A 4PFJA 4OYLA 1LXCA 2WTEA 3ZUGA 1QK5A 4AWXA 1C30A 2QEQA 4CM9A 1VOTA 4D5GA 1GXSB 4F4UA 4GWLA 4IDBA 5FPTA 1VLLA 2XQFA 4BAZA 4FIZA 3I23A 1JFTA 3PLAE 2C4TA 3HB1A 3QKIA 1B2LA 3FYUC 5CLJA 4JBHA 1DIBA 5CVDA 1E89A 1VE1A 1IRIA 1JWBB 1MNQA 3CNOA 4IGFA 4PC7A 4EA8A 1DKPA 5DXFA 4QTZA 1YR2A 4XFKA 4PZLA 1KS9A 1NZFA 1H0RA 3BJMA 1V11B 3BXEA 3GJXC 3L1KA 4MQEA 2OXFA 4RK7A 5DHTA 5K2MA 1NT2A 4W1SA 2GZ3A 3K9NA 4J2OA 2GKOA 3JS5A 1PT9A 4AJEA 4D74A 1GGVA 1Q21A 3EQZA 4YAJA 3DTVD 3HRKA 1WMFA 1RJFA 1D6JA 1W94A 5T7BA 3AR4A 1WETA 4CI0B 2P4HX 3WDKA 4P31A 1U2RA 4A82A 4LWPA 4EJ2A 4IDFA 4DT1A 4Q3EA 1JQBA 2B8EA 4EJFA 1PR0A 3BGDA 3B6EA 2VAPA 3SKXA 1WKVA 3BSWA 2Q2VA 2YUTA 4IAOA 1NVEA 4MRAA 5CRIA 1ND6A 3SJCA 3RFVA 3G2QA 3ZNQA 1O3YA 1C0KA 2YDXA 1IN7A 1XZLA 3B60A 4ALIA 1SZCA 5CHYA 3NORA 2W4MA 3THWA 1BJKA 5D6NA 3EIEA 1T5SA 2X8AA 5AKGA 5DJ5A 3NB0A 2QDKA 2QMUA 3A6HA 4NH0A 5JLAA 3SF8A 4B84A 2FPGA 1U3WA 1CZHA 3OUTA 2XEXA 1AM4D 1KSFX 3DV2A 1N0HA 3UA3A 5MF6A 2PUBA 5EUCA 2QBYA 3NC0C 3M1AA 1RM4A 4KO8A 4DAOA 2FQXA 1T9DA 4FINA 2QAGC 1DPGA 4ALNA 1G5TA 1E6LA 3HWWA 3LRTA 2GVZC 4Q9IA 1S96A 5IUKC 3QV2A 4EZEA 4YMGA 4C1NA 3ZE7A 3CPEA 5K0CA 4KUEA 4TL6A 2OORC 3KNZA 3QQPA 5T5QA 3W8FA 1QAOA 1ADCA 3H4TA 3HB0A 4GOMD 4K46A 3C7DB 3BX1A 4I14A 3HRHA 4Y6RA 4XGIA 4Y6LA 1LJ8A 5AM1A 1T2AA 2NXNA 3I8OA 4LV6A 3WRXC 3FTPA 3TLCA 4DCGA 3IQIX 1ULAA 2OFFA 2HSJA 1OB5A 2AXEA 1E1KA 4RX1A 3SR3A 1LBSA 3A3NA 2P9ZA 3FVRA 1T5DX 2R68A 4K9MA 3WXMA 1XELA 1BGWA 2CHVA 1OFTA 1OWLA 1HDXA 1TD1A 2VCEA 3KPVA 3MTQA 3HKCB 2J45A 3QE3A 4AKIA 1LPOA 1CZNA 3LUBA 4R3NA 4NV0A 3CRZA 3A6JA 4JYCA 5EJ8A 1C0EA 1FBTA 3MTDA 4BCDA 1GAEO 2A5GA 2O2CA 4DR7B 1B6TA 4UVGA 2FZ5A 1QH1A 2RFLA 2BFOA 5CVCA 2FWPA 2DR2A 3ZZMA 4UUBA 4ER5A 3DCNA 2Z2ZA 5BWLA 3G2PA 1CR4A 3N9IA 3FB1A 1A7KA 3TRIA 5JZVA 4HZUA 2V5VA 1FMTA 1GOTA 2VYND 2F4NA 2GF2A 2QJRA 4S3MA 5M3BA 3S2IA 4V02A 3F6YA 3X1DA 1CY1A 2Y27A 4DW8A 3PPWA 3IV7A 4FSHA 3TG8A 1LI7A 2PX2A 2F9FA 4YCSA 3LQQA 4UM9B 1E7RA 1ZOOA 2Q6VA 1FVOA 1QK3A 4LI3X 4P5DA 5FBRB 5JMPA 3RYIA 4CMIA 4BNYA 3QYFA 1XMVA 3HO6A 3IDQA 2WYIA 1ZUHA 4RA9B 4EY6A 2RD2A 1DCMA 4ERXA 2VQSA 3B8EA 3O82A 1DEOA 7MHTA 2W70A 1E3TA 3N2NA 4L2IB 2QTTA 4B79A 5L7TA 2NM0A 2ZT8A 4NCIA 4ETIA 1BVUA 4UNNA 1GRRA 2ZYIA 4RTRA 3HDTA 4MLCA 2QVCA 3AKEA 2H17A 1EZ4A 1HDYA 2K87A 4GR4A 1JQKA 4M38A 2QM0A 5ESWA 1PNQA 5M04A 1P4GA 3C5EA 4AZSA 4ETNA 4LYHA 4TWZA 4D9NA 3H4IA 4DJ5X 1XU9A 3HU5A 1UJMA 1BFUA 3F4LA 3IUNA 2HRRA 3H42B 2F3PA 4PQGA 1L8XA 2WICA 4AO6A 2J4CA 1NV8A 2DKFA 3DW1X 4IQFA 5DI3B 3CE6A 5JS1A 3UXHA 1RQLA 3AR8A 1QHSA 5B53A 5HK9A 4XDHA 1KY5A 4MJLA 5KNBD 5IUJC 5H1YA 2A0FA 5AJVB 4B74A 2J8ZA 4WMLA 3EEOA 2IDJA 4FS3A 4E2YA 1II8B 3IPXA 2OAP1 3DLBA 3A4LA 1N5IA 4AYTA 1KGDA 4FLFA 4QGBA 5E4FA 3H84A 5FHQA 4NCHA 1C4WA 4IO1A 3GAMA 5GJWC 2W43A 1EEXB 1QFJA 1GUZA 1W93A 2DZDA 3KOMA 3RC2A 3V00A 2D4AA 4J2HA 1WUHS 3LCJA 3ZVKA 1E1RA 4B45A 4B3DA 4LF6B 4LSZA 1GARA 4NDNE 3WIOA 4BVHA 1XCGB 3C1UA 4RFSB 2CB0A 4C88A 3OWXA 5LQRA 3LKBA 1XRSB 1OZGA 4KQIA 2V45A 4FHZA 4UQLA 3K70D 1Y48E 2HSWA 3N28A 2JLBA 1EFHA 3AXTA 1F60A 3AF5A 1MV8A 3IR6A 1C81A 1FP2A 3A3PA 5D5QA 5DM1A 3EDCA 3MGKA 3V8NA 3W1VA 4C78A 1VSTA 1DC7A 1U3GA 3L07A 3PEYA 5C53B 1A9XB 2ZTUA 3UQZA 2O05A 5ALVA 4OFZA 5HQTA 3ZDDA 3CSSA 1T25A 5I9MA 4ZMRA 1EE2A 2WJGA 2ZTMA 4MQ4A 5DXJA 4CEJA 1E0KA 5FL7A 1SU7A 1NZDA 2ZJ3A 5B1SA 2B6NA 3E2MA 3QKRB 1SD2A 4OQMA 1XLVA 1OXUA 3ICWA 1Z6XA 3PNMA 3UA4A 1WP9A 4QLAA 4YXFA 4YAUA 1C29B 4JI7B 1WMAA 1OFUX 3HCAA 4S2EA 1STOA 4B4UA 2Y6VA 4QTTB 2J3KA 4XIFA 4DV3B 3S8YA 4FP9A 1WCV1 4CMJA 2B7BA 4FN4A 4HQKA 5C5IA 1EBUA 3VH1A 4C0SA 3OM8A 1ZU5A 3OT1B 5JXGA 3LC0A 1ZNQO 1C3XA 4JIMA 5FOQA 4EFKA 4RXMA 1JA9A 1X3LA 2G67A 5KCMA 1WBJB 4W4TA 4AF7A 4NE7A 2DY1A 4I4LA 3R20A 3QLUC 2C9CA 5J1TB 4UARA 3UJDA 1VCIA 4CFYA 4CNQA 1Y33E 3T3MB 5REQB 1UWLA 2O06A 2XECA 3B6IA 4MIEA 1T10A 4OKNA 1M2OB 3L06A 1ULBA 3Q0TA 3LC2O 4QOJA 5BSTA 1SXGA 4IF6A 1QLWA 2JJ2D 2NZWA 2ZWPA 3AM3A 4GL2A 3DEKA 5DNAA 1U02A 3LT2A 4RENA 2GGSA 1U8EA 3OOSA 4K3UA 2X3UA 3OX3A 4W63A 4XFDA 1RYYA 4QYIB 4CM8B 3R3VA 1HNWB 2QG6A 3PGJA 4EHLA 1TECE 5AM0A 3V9AA 1DS6A 1L7AA 1CDZA 2V3WA 4DN6A 1NIPA 3RG2A 2FQYA 3S70A 5E3IA 1X2EA 2G09A 3P2YA 1IJEA 1GPUA 4PFSA 1RZUA 1TF7A 4R1QA 2PLRA 3MUOA 4WNYA 1AS2A 2QX8A 1DAIA 1IPHA 2V7GA 2WU3A 2ZTHA 1EWYA 1E1RD 1ZJ5A 1PHPA 2AFRA 1NBAA 1C8KA 2SKEA 4BFWA 1Z47A 5AUPB 2C8VA 1BH2A 3F97A 4RLQA 1NXXA 4L0CA 2XWBF 4IYRA 5GY7A 4WADA 1FQJA 1E2UA 4Y7CA 4ZOBA 3WWZA 3AERA 4YJFA 3ZV7A 4OLBA 1VLHA 1ZG3A 1YR7A 2BSXA 2ZRBA 4MB0A 5ISMA 4OX9B 4M1OA 4X93A 1LLUA 1PQYA 2TMDA 4E07A 2CV1A 1C1DA 3G89A 4CVNA 4EQ6A 1W5TA 3FUCA 3ZCTA 3T1OA 3UJ6A 3H5VA 5JH7F 5J9FA 1TZMA 1V11A 1WBDA 2C7OA 4KN5A 3RS8A 3LTNC 2GPBA 3M2TA 1OAOA 5IVDA 3NC4A 5JCOA 5TY0A 3W5CA 3UMFA 1KEPA 3P94A 2VSXA 4Z1OA 1Y6QA 1TW3A 1X86B 5IULC 2RG7A 3TRDA 3KQWA 4TTQA 3I0NA 2B4QA 1RPTA 3ET4A 3I9FA 3KL4A 4H17A 1QQ7A 1SQGA 3WL4A 3CKMA 5CVEA 1M75A 1KOJA 1UC4B 1JI0A 2P9FA 2Q5JA 2QLMA 5GAJA 1VSQA 4CQMB 2N3ZA 5ICFA 2HV9A 5A05A 5TGTA 1UM9A 1DKUA 3D3NA 1W5EA 2P3SA 2XNJA 3ORRA 1FLDA 2WP0A 4J76A 4J0HA 4YP5A 5HRUA 2C4UA 1UIRA 2UYGA 3HBLA 5LDHA 4UVDA 3PS9A 1BCRB 2KS6A 1HRDA 1USKA 2CMFA 4J6FA 4XGNA 5EWMB 4A03A 2HIAA 2P2GA 2R6CA 3GVCA 5GIPE 1RKVA 3WB2A 5DSTA 3TD2A 5GADl 2QN3A 2NPFA 3THWB 4LWQA 3IXLA 1B2RA 3WIBA 4RVDA 1XLTA 4U5XA 4XYGA 2ZXEA 4HGYA 3DVAB 1Z0SA 3C24A 4DMGA 2B3TA 4TMFA 1G8AA 3R1IA 4PRKA 3VSBA 2O8BB 3UAXA 1JP7A 3ETHA 4LJYA 3ADCA 1AUOA 4CUKA 3GEHA 4UCFA 5GM2A 3ANTA 1THZA 3QEMB 1C9DB 1RS0A 3D6UA 1V8PA 4XJSA 5C1DA 2G4CA 4H3KB 1QKJA 2R4QA 3C3WA 5IC6A 1B93A 1ATIA 2AFIA 1AUXA 3OWOA 5ECWA 1POWA 3B82A 4HPJB 2PA0A 1RTKA 3FSGD 3ZGNA 1NQOA 2HWYA 2Y0PA 4HRXA 4KX5A 1RWXA 3CZRA 4F92B 4DM4A 3Q3GE 1RABA 1V2HE 1A04A 2G36A 3A1EA 4Y1RB 2OAGA 2POQX 4J9UE 3T41A 4YHBA 1I4WA 3VI4B 4YV0A 1GP2A 1VMAA 1H4TA 4OP2A 4YT2A 4C4XA 1CZKA 2H9IA 3IELA 1P8AA 3HM2A 4NKRA 1CIJA 2COEA 3OEED 1NE7A 1UEJA 3GP3A 4B09A 1XZEA 1SBHA 1T3LA 4FKZA 4CF4A 4C7VA 1CQJA 2OK7A 1B76A 1L4BA 3A10A 3FYUB 4NK4A 2FA9A 4QD3A 3X1KA 2HDHA 1Z7BA 4QLOA 2P9BA 1YCGA 4GRIA 3UUGA 4GVXA 1AV7A 2RGAA 1XDDA 5EZ6B 1BQ4A 2PX5A 3JYQA 3CLVA 1PAUA 2C2YA 2ZVDA 5JJ5A 1O6ZA 1L5OA 4G5GA 1G0OA 4YI3A 4ZAXA 1OVGA 3IRUA 2QP9X 2VWHA 3KPJA 4MWEA 2XOKA 2AE2A 4JYPA 4ZO6A 4ZOQI 5DM2A 1EP2B 4KDEA 1OUMA 4L4SA 3TWOA 2HDOA 4RTNA 1LBHA 1OTHA 4NS1A 4TGLA 4PPYA 1CXZA 1NPDA 1CRLA 1PD0A 1XTJA 2YZKA 3BORA 3D3JA 3IIJA 3TMAA 4O4IB 3TTUA 4IGIA 4EH1A 3W8DA 3IVMA 3ITEA 5GONB 1Z63A 4PZCA 1UDWA 5DF1A 4FFVA 3EY9A 4KQ2A 1VDZA 3OMLA 1RJEA 1L8QA 4Z4CA 4KZKA 4PGFA 5JQGA 2VLBA 4FYPA 4H7PA 1R9GA 2O23A 4NPAA 5D6OA 3X44A 2J59A 3CCCA 3R5HA 4GLLA 2ZBFA 1NRIA 3D43A 3VSDA 4Y7DA 1RRVA 2UYQA 2VYVA 4YRJA 4BQEA 5IVIA 4X60A 1NI4B 2CHEA 1PFYA 2AZMA 2IZZA 3TL2A 4IZ6A 5I7AA 4MS3B 2BM9A 3STHA 3L7LA 4JYBA 1YZFA 4Q4JA 3QVKA 2ASVA 3H16A 4MWBA 5AW0A 3GCGA 4YCNA 1H65A 4MAAA 2Y0BA 3OE4A 1TCVA 5JFTA 3P9CA 4UUOA 1K66A 2JH3A 5LQSA 3E0QA 3IIMA 4DQDA 4DLTA 3EXHC 2A88A 1OX4B 1D2CA 3OPMA 4I81A 1E77A 4E6EA 4QXQA 3VOBA 4NS4A 4NEHB 3K73O 3NU1A 1A50B 4OVKA 5I7VA 3R9WA 5KEIA 4HXGA 4HDCA 4DG5A 5TXGA 4UE2A 4Q24A 1BQEA 4DGSA 1PWXA 4GT1A 3LA8A 3ROXA 4FR2A 3M6IA 4BV8A 2B8TA 1U9JA 3QNWA 5C5DA 2G5TA 4R40A 5T64A 4QAQA 1UBEA 4XQCA 1TM3E 2R79A 1V6CA 2BSQA 2ARKA 2O3RA 4K6MA 4YRQA 3QXJA 4A5SA 2R2GA 2QVGA 2RKBA 3EARA 3UAZA 3U4DA 3ZKAA 2ORYA 4U8GA 5BVHB 2MHCA 1QOZA 4LDRA 4OSEA 1N4AA 5I5EA 5A4MS 1C41A 1DWPA 2D0DA 5ER6A 2NQ2C 2PKRA 4G24A 1XF1A 2W2XA 2W6QA 2D62A 2ZSIA 4GBGA 2NUTA 3S68A 5KJ1A 1Q7BA 2ZETA 3LGXA 2I2BA 2LR0A 4R41A 3K9HA 3UJ3X 1F38A 2FZEA 4FE7A 1TEXA 2W93A 2Y1KA 5EG5A 4YYEA 3BZWA 1G66A 4C22A 3UPDA 5K4GA 1QE5A 5JCJD 3NG1A 3PFHA 5C1IA 4D6YA 4YN3A 3DWGA 1V41E 2HBRA 1N6HA 3VO9A 3FX2A 1S3FA 2W71A 1WM1A 4WXEA 1IPFA 2B30A 4DYVA 1E1CB 1M6WA 3U39A 2H4WA 2ZUDA 1XPUA 1DAGA 4GQAA 1VBKA 3M70A 3K8ZA 1AA9A 3LIPA 3Q7IA 3TSZA 1HGXA 1CFZA 1UZUA 3FWZA 3NRJA 2C1XA 4FYMA 5D85A 1XJ0A 3GCDA 4PYRA 1QTQA 4G26A 1WU8A 2A9FA 4J8PA 1ZWLA 1GV1A 9LDBA 1F8UA 4M0MA 4EO4A 5DYWA 3L0BA 4NY1A 1W19A 1E9SA 1AQUA 1S4QA 5ELMA 5TDHA 3KUUA 5KWIA 4YRMA 1NN3A 3O03A 3TJMA 5LP6B 1C2TA 4X97A 4J3JA 3RT1A 1GD1O 3DEJA 1U7WA 3P2JA 4KAFA 5BVGB 1E2IA 1ZHFA 2PGLA 3GN1A 2QX7A 1T8TA 4ALKA 2I3BA 4GF5A 3I34X 4PYNA 1ZD8A 1ZEMA 4GSKA 2QTAA