4IJUA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3-yl]bicyclo[2.2.1]heptan-1-ol
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 95
structure length 266
sequence length 266
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijuA00
3WJ7A 1A71A 2GZ1A 3IL2A 2O50A 3B1KA 2O7SA 3BXXA 1KEVA 1WPQA 4AJEA 2VHXA 4CMIA 2C54A 3EVTA 3D64A 5A5FA 4KTVE 1XU7A 2A4KA 3PJGA 4U5QA 4P4GA 3V2GA 1U5AA 4PLZA 4TRJA 2DBRA 4BNUA 5TNXA 5ICSA 2O23A 3DDNA 1IPEA 1X7DA 5CPBA 1NX6A 3DAGA 3EGOA 1V8BA 2NVWA 5I7SA 1I01A 1DFGA 4BNWA 2WYVA 3V5NA 1H93A 1XLTA 3M2TA 3JYLA 1D7OA 1E3SA 3BYZA 3PLNA 2B4RO 4IINA 4PG5A 1I0ZA 5CDYA 4Z3DA 4MKXA 1YJ8A 4R41A 4B8WA 5G0SA 3LT0A 4E5PA 4UVDA 3WS7A 2Y1GA 5ITVA 2Y1FA 1YL6A 4EITA 4GSKA 4MVJG 5U4QA 3RASA 3AWDA 2WDZA 2WD7B 3HQ4O 3K2BA 3QW2A 1BXGB 3BMNB 1YL7A 2HU2A 3SC6A 4AJIA 2GN8A 4WJZA 3OSUA 3X2FA 2JD1A 3NAQA 3P5SA 1JKIA 2JJYA 1HF3A 3STHA 4II2A 4W9NC 3E6AA 4XQCA 3WGQA 4CMAA 1PS9A 5A05A 5JAZA 1EDZA 3HB5X 4XYGA 2X58A 2C5EA 1LRLA 4QUKA 5F5NA 2VRCD 1WDKA 4JJIA 2R2GA 1DJNA 5KKCA 4DIFA 1DPGA 4JXKA 4CM8A 1PEDA 5COBA 4EDFA 3OIDA 4NH4A 4L73A 1KC3A 4PZDA 5CDTA 1JWAB 1WMBA 2X4GA 3PK0A 7MDHA 5TF4A 4Q3BA 5CFZA 4O0LA 3H5NA 4XX0A 1YB4A 1ZVMA 2I76A 5IZCA 1NFFA 4RCVA 1P0CA 2FSVA 5FWNA 3BZUA 3DHNA 5EINA 1DRVA 4WPGA 2E49A 2YY7A 3BTUA 4W82A 1E3WA 1MG0A 4XB2A 3A1NA 4YQZA 4BMNA 1N2SA 4ZQGA 3V2UA 1YKFA 1GYQA 1NVGA 4UEJA 1DRWA 3CPSA 5TS3A 3UCFA 3WJAA 3PFFA 1NWHA 4WCFB 1BSVA 1QSGA 1ZSYA 1MB4A 3GK3A 3JQGA 5JSFA 2OGUA 3MTJA 3FF4A 1K6IA 2NU7A 4U6SA 1NVTA 4RDHA 5EIOA 2AQ8A 4NQZA 2YDYA 4UUMA 3KYCA 4D43A 4EW6A 4AJNA 2FRDA 1ISMA 4HBGA 3WDSA 1Q0LA 2CVZA 4WCDA 2EIHA 1WWKA 3JYOA 4E6PA 3JQBC 4D46A 1CIVA 1TT5B 1DC3A 1D1SA 3RI3A 4BNMA 1IPFA 4PG6A 2GDZA 2ZQYA 3CH6A 3I9KA 2PGDA 4F6LA 2AG5A 1T25A 4NBVA 4QTZA 3TJRA 2I5PO 1OC2A 3JQ9A 1LQTA 1ZK0A 3ZWNA 3DBHB 1HETA 4B3IA 2JD2A 3QVSA 1I33A 1G0NA 3ZV6A 4L9RA 3GHHA 2IZZA 1U3WA 2FY8A 4S3MA 1E7QA 3H3JA 5C7IO 4W7HA 4L0QA 4QQRA 1V9LA 4DREA 2C0CA 1I3LA 4J3FA 1UP6A 4FIZA 1KVRA 3ENNA 4AL4A 3JV7A 5ER6A 3TRIA 3I9OA 4QSMA 2Y93A 4BGUA 3ROMA 1CDOA 4P4NA 4BNLA 5TC4A 4A0SA 3TZ6A 3GT0A 2BMAA 1MLDA 3M2PA 3NGXA 1Y8RB 4LMPA 4L4RA 1GYPA 2C82A 2RCYA 2AEMA 1KEWA 1Y8QA 4R1NA 2NM0A 4GLOA 4PVCA 3E5RA 1ZCJA 3FR8A 1QORA 2NV6A 2Y05A 4GLLA 4GX0A 4WKGA 3A14A 4YPOA 1NWCA 1UJMA 4IMRA 3OJLA 2H5LA 2C2XA 4D0RA 3DR3A 4D3FA 2PGJA 1W73A 3L6EA 3GMDA 4FFMA 3WGYA 2JCYA 3LYLA 5IFLA 1CEQA 3M1AA 5F5LA 1MG5A 4FD3A 4DC1A 3KYDA 2C07A 2R6JA 3GZNA 4RVSA 1VJ0A 4FJ2A 1QV6A 3AU9A 1D8AA 4ALKA 2W8ZA 3E9NA 4R1SA 4BMVA 1AXEA 3MJCA 3ANNA 4XD2A 4BO5A 4A2CA 1LSOA 3CZRA 3PQDA 1PZGA 2VWGA 4DA9A 1XHLA 3H2SA 1ZZEA 3UHAA 4L75A 1ADGA 2WTBA 4R4JA 1DAPA 2AQIA 2IRWA 4NJOA 1FDTA 1UH5A 1KEUA 1KY5A 3L6DA 2OO5A 2Y99A 1UXGA 1SOVA 3NT4A 4FCCA 5JCJA 5IDXA 5G2OA 3EK2A 2YQ5A 4ZQEA 2VYNA 1PWZA 1IE3A 5IXYA 2X1HA 4JJGA 4BNXA 5EN4A 3UUWA 3RUEA 2VHZA 5J23A 1EUZA 4CM3A 3NTQA 4WECA 4BV9A 2O3RA 4CM4A 2E4AA 4PG7A 1XQ6A 4YRAA 2TMDA 1UUFA 3IC5A 1BMDA 4OL9A 4WE3A 3X2EA 5L7YA 1ENPA 3KM0A 3QIVA 3I4FA 3C24A 5G0UA 1Y1PA 5ILGA 1GU7A 2YZ7A 1RM3A 1EBFA 3K8ZA 3JYNA 3ZWVA 3AI1A 4YRBA 1X13A 2ZYDA 5ER9A 1UR5A 1HTBA 2B4TO 4IJWA 1P74A 1MFZA 4RVHA 4II3A 4BIIA 9LDBA 5JYEA 2VRBA 2JFHA 3LT2A 2I9PA 1FJHA 2O3QA 2ZJ1A 3QQPA 4EGFA 1L7EA 3FWZA 4YB8A 3CMCO 5T8KA 1JQBA 1ENOA 1N8KA 2P5UA 3NYWA 4OSPA 3S2EA 3WX0A 4NFYA 1IB6A 2ZK7A 4UVEA 4X54A 2B69A 4CODB 1P3DA 4W6ZA 3VVCA 4CMEA 1GUFA 3U4DA 1ISFA 2FHSA 2EKPA 1ZXBA 1HYHA 3COSA 3E18A 4L4SA 3OA2A 2CUKA 1BRMA 4BQPA 3D5QA 2FWMX 3QLJA 1PSDA 2CF6A 3DFZA 3AK4A 1DAOA 3EVNA 1PJCA 2X9NA 4IM7A 5JYDA 5B37A 4CLOB 4RPHA 4H16A 4J91A 3VPHA 4P4LA 1PL8A 3AJRA 4IZIA 3KUXA 3CINA 5JY6A 4XIJA 2FR0A 3VH4A 3BHMA 1ONNA 1NVMB 4YACA 3GVHA 3ZZNA 4IQGA 1HYGA 2AG8A 3WQRA 2Y0CA 1Z7BA 1MA0A 1S6YA 2DC1A 2ZYGA 4RVUA 2Y1OA 3PWZA 1YQGA 3G0OA 5GZ6A 5DCYA 2ZB4A 2VNAA 2DAPA 2P91A 3INTA 4XB1A 1MC4A 3AFMA 5LDGA 2GASA 2O3SA 3PYXA 4EJ0A 5K0ZA 1A9ZA 2HJSA 2G1UA 3IUSA 5TLSA 4OH1A 5CAEA 4YT5A 3OFSA 1Y9EA 4XKJA 5KVCA 1PJLA 1NQ5A 1LDYA 2PH3A 1AHHA 2Y0EA 4NJMB 4ZVVA 3TZCA 3AM4A 4DUPA 1LA2A 3GA0A 4DQUA 1R4NA 3HWRA 4MIEA 3P2YA 1HSZA 5BNIA 4J2HA 3DBRA 3HDQA 3JD2A 1R12A 4YEDA 2C59A 5FYDA 3LC7O 4RF2A 5A5EA 5HWSA 1LSJA 2HK7A 4XGNA 2AA3A 4UEOA 3E5MA 4GI2A 2JFGA 4M8SA 2XXBA 4JQCA 5HBRA 1XA0A 4OQYA 4MVJI 4RORA 4IMPA 1YB1A 3W4JA 5C3MA 4CM9D 1N5DA 1A4IA 1NPDA 2O4CA 3MOGA 2AEFA 4KDFA 2ZTMA 2V6FA 1T4DA 4RPGA 3KVOA 2B37A 3LZ6A 4BNTA 5L3ZA 3GUYA 4GVXA 3Q9NA 3JTMA 3N7UA 5DOVA 4E2YA 3RBZA 1CERA 1KEPA 1DLIA 5A03A 4R1UA 2PZMA 1U4SA 4QO8A 4PLWA 4CL3A 3LT1A 4S1VA 2FPIA 4IY1A 3DL2A 2NTJA 4CMIB 2EG9A 2GO1A 1N9GA 1QXSA 1QLJA 2PTGA 3K9QO 1KETA 5CEEA 5IDWA 1PZEA 1AE1A 3HB4X 4L4XA 1LLUA 3A4VA 2PZKA 1C14A 4O1MA 3PYLA 4J9VA 2EP7A 1FXSA 1FDWA 2ZIZA 3P19A 2FR8A 4BQRA 1ULSA 1EDOA 2DVMA 1ZIDA 4MO2A 4TZTA 1ZUD1 3WTBA 4NDNE 1LLCA 4ALLA 3H7AA 2Y66A 1MUUA 3NRCA 4YJGA 1HZJA 4PZCA 1SO8A 4TSKA 3SVTA 3EZYA 3PQEA 3PGXA 1NHGA 2VWHA 2XXJA 4ONEA 3FNFA 2F1KA 3ORFA 1UXKA 4JK3A 3UGKA 3AM5A 1QMGA 3PHIA 3OH8A 1IYZA 3ZN2A 1LJ8A 3BTVA 4HNGA 1SNYA 5GMOA 2RBEA 1DIGA 1I3NA 1LU9A 4CM9A 4GH5A 1E1KA 2A35A 4TZKA 2HKIA 4LRSB 1A7KA 5MDHA 4UEKA 1IHXA 4NIMA 1I2CA 4B79A 3QWIA 4F45A 2GERA 4KOAA 4Q3AA 4IDDA 2J3IA 1I36A 4Q9NA 5KNLA 1C0PA 3C1TA 4CM8B 3RCBA 3DZJA 2OHXA 4RVFA 1U8XX 2AHRA 3QVXA 3D4NA 2OXIA 1QYDA 4MVJA 3I4CA 5FFFA 5I9MA 3TFQA 1XYGA 4LCEA 1DBVO 1EK5A 5ES3A 1GCOA 3AUAA 4NU6A 1A7AA 1B3BA 1Y9AA 3G3EA 2UVDA 3ICPA 4Z9XA 4IGEA 3NEPX 1MXFA 5L4LA 4MP8A 3DWFA 3H2ZA 1E3WB 2ILTA 3K31A 1I8TA 1GTMA 3RBVA 5JC1A 5K9ZA 3UVEA 3BAZA 3I9JA 4F6CA 3VTZA 4CMGA 1ZJZA 3PEFA 1B2LA 2GD1O 2CVQA 4FOOA 3U0BA 3IP1A 3JQGB 3WGOA 2AMFA 3B1JA 1C0IA 3DZHA 1BXZA 1NASA 3HADA 4DMLA 3TL3A 2EW2A 4MP6A 3WQQA 3KYCB 3O8QA 3FR7A 2PWZA 5T57A 3Q2KA 4TRNA 3IJPA 1GEEA 1I24A 3ASVA 4K9DA 2Q45A 4WGGA 2WMDA 3BMOA 1YWGO 2O3JA 4EBFA 1VL6A 4ZD6A 4L8VA 3V1TC 1JW9B 1AGNA 1K3TA 2Z1MA 5IXSA 4FW8A 2UUPA 4ND2A 5TX7A 3F1KA 3VPFA 2EEZA 4WNCA 3OETA 1GYRA 2EHDA 1BHSA 4OQZA 1HLPA 4DL9A 4IJUA 4M87A 1K0UA 4HX5A 5KJ1A 3ROKA 4PG8A 5KJFA 5EQFA 3GNSA 3VOSA 2D59A 2VWPA 4IXWA 1PS8A 1KS9A 1P1KA 4EJ6A 3U4CA 2YUTA 2BFMA 3MJ4A 2CNBA 4FGSA 1Y8QB 3S55A 2GN6A 4NK5A 5CEFA 4OYRA 4BUCA 1OZAA 3OF2A 5BT9A 5JDIC 2Q4EA 5TIIA 1NQOA 1BDMA 2VTEA 4R5MA 4GAEA 4R68A 1UZNA 3JYPA 4RF3A 5TT1A 3DZKA 1VKNA 1UDBA 4N5LA 3ZNNA 4RGBA 4EI2A 3P7MA 5CG2A 5F1PA 4HKTA 3RSHA 2EKQA 4F46A 3U3XA 2P4HX 3KYDB 2BGKA 3GZNB 1RYEA 4GVLA 2C7VA 1HL3A 4LGVA 4PLHA 1W6UA 3M6IA 4GMGA 1HSOA 4GQAA 4R9SA 2NWQA 1RKXA 4E21A 4XR9A 3EW7A 2JCXA 3AOGA 4UULA 4W4TA 2W4QA 2QYSA 1ADCA 3NX4A 3GZ4A 3EDMA 3DMTC 3OQ6A 3E9QA 5F1OA 1EQ2A 3LDHA 4LVUA 4I5FA 3OJ0A 3RC9A 5A9TA 5CEJA 5H83A 5JMWA 4O59O 4TROA 3DMYA 1PJTA 1ZMOA 4CV3A 2IDZA 1ULUA 1TEHA 2J6IA 5A9SA 5G0VA 2JD0A 3V1YA 4CR8A 2LDBA 4PLPA 2FMUA 3RFVA 1GL3A 1RM5A 3G1UA 2ZB7A 4I5EA 3ZWXA 1UZLA 2ZTVA 3JCZA 4PLYA 4GPD1 4CM4B 5BSHA 4KWHA 4J9UE 4MP3A 1NFRA 1VC2A 1HWYA 3I1JA 3MWDB 3ZU5A 1PGPA 3A9WA 3CXRA 4IDGA 1A72A 2FPPA 4CUKA 3FTNA 4D7AA 1PJ3A 1ISJA 3H6KA 1F0YA 3ZCXA 5GY7A 3E48A 3I23A 1LRKA 2C2YA 2UAGA 4XZ3A 1BGVA 1ZFNA 4DIBA 4HFRA 2I65A 2QX7A 4D79A 1P1IA 2YHIA 3AUTA 5IN4A 3H5RA 3Q2IA 4KTTE 2HMWA 3IP3A 2BRUA 4AJHA 4DIOA 2X6TA 3WIEA 4D41A 2WSBA 1O89A 8LDHA 3QWAA 3LQFA 2BH9A 4R5HA 4EUFA 5A02A 2NACA 3IOYA 1U3TA 3F46A 4JP3A 4FFNA 2VN8A 3K6JA 4M86A 3AOEC 1OOEA 5CDSA 1E6WA 4BNNA 1I5RA 1LXCA 4IS3A 1VPDA 4IDEA 3IDSA 2VCYA 1CYDA 4NBWA 3GRPA 1NNUA 2ZATA 1WAMA 1QG6A 2X9VA 1HDYA 1ORRA 1RM0A 2XOXA 1VE9A 3H9QA 3KRTA 1GCUA 4B7XA 4GX1A 1ISIA 5ILOA 3AY6A 4Z9FA 3U49A 3WSWA 1ONPA 1C1DA 4FFRA 3VPXA 3JQCA 5FF9A 2D5AA 5K6AC 1GAEO 3VZQA 4LN1A 5AXDA 5GZ3A 5JAMA 1NHWA 3O9ZA 1VJ1A 1YQDA 7ADHA 1GUYA 1SMKA 1GPJA 1NAIA 1Q0QA 2Q2VA 5IN5A 1U3VA 3HG7A 2D0IA 5TGDA 1EBUA 4YWJA 3I9LA 2DBQA 3ZI0A 1DLJA 4ZGWA 1PL7A 1PL6A 2BI7A 1TVEA 3MJSA 4INAA 1YGYA 2DUUA 2Q4BA 2X23A 1EUCA 1YDEA 3PFWO 4GX2A 4Z3KA 1B26A 4D0SA 3GN1A 4UUOA 1HKUA 3OIGA 1HDOA 3Q0EA 3R6DA 2HO5A 1DRUA 1Y81A 3W6UA 3N74A 1HEUA 3Q6IA 3PWKA 3FNHA 1H9BA 3GUCA 3HDHA 4NBTA 2NU9A 1R4NB 1BG6A 1RJWA 2W2LD 3DBRB 3F4LA 3VAZA 3ULKA 3JSAA 4WK6A 3ZWPA 2HJRA 3NT2A 3FWNA 4YYZA 3MOIA 1EMDA 1HDGO 2EW8A 2OBNA 2V65A 3GPDG 4HUJA 1X0XA 5BR7A 1U8FO 4Z0TA 1NQAO 4DLLA 1VSVA 1U28A 2O4UX 4CLXA 2QW8A 1JWBB 1ZXLA 2Z95A 3L6OO 2NSDA 4C4OA 3PRJA 3GEGA 4DRYA 1FMCA 4BO1A 2I67A 3AY3A 3JD1A 4CUZA 4B7UA 4KUEA 1F14A 1R37A 1E1NA 2AXQA 1Z74A 2OORA 1ZEJA 3F3SA 3D4PA 3ON5A 4B4OA 2P2SA 1SEPA 3LLSA 4E2ZA 3Q11A 1I32A 1O0SA 5AYVA 1NPYA 1N9GB 4J4TA 3U4HA 2BGMA 3INRA 3WNVA 4CQMA 4BV8A 4WEOA 1E3IA 2QZZA 1T2FA 1GZ4A 3HN7A 3H9JA 4GX5A 4J2OA 3WGZA 4KP7A 3S2GA 4OGWA 4P22A 2YFHA 4TRRA 3FN4A 4BO9A 2E48A 4BS9A 1H94A 2CD9A 2NU6A 3IKTA 1T4BA 2BHLA 3WSVA 5JCJD 4U0JA 2FR1A 1T2EA 1SPXA 2NNLD 4R9RA 3TZHA 2VYND 4YJGB 4RVDA 5TJ9A 2NVUA 5JY1A 5L4NA 1C0LA 2PLAA 2QQ5A 2W2LA 4YQYA 1TLTA 4ZJUA 4AG3A 4DQVA 4GSLA 3I6QA 2X22A 1VL8A 1JN0A 4UVGA 3Q3CA 4PZEA 2H63A 1YVEI 3BMQA 5BNTA 1T2DA 3I3OA 1ZO8A 2B5WA 4NNJA 1HDRA 2ZTUA 5CG1A 3ETGA 5DP2A 1ADBA 1QRRA 1TXGA 4YBZA 1T1RA 4OOEA 3GPIA 3OIFA 1ARZA 1LSUA 4WLFA 2Q1WA 5C5IA 3HJAA 4HWKA 1CETA 4XYMA 1D1TA 2ZCUA 4CLDA 1ZK3A 4K6CA 1WXDA 2VOEA 3KB6A 1F8FA 4BNKA 4GL4A 5KVSA 4EYEA 4YJFA 4N7RA 3WGIA 4ID9A 1N1GA 2JL1A 3ZV4A 2PA3A 1O6ZA 5I7FA 3NGLA 1MX3A 4M55A 1CF2O 3GNQA 2CVOA 1PGOA 4TVOA 4B7CA 4BNHA 4D3SA 3W6ZA 4J6FA 3WGTA 2NVBA 4NFSA 5EL0A 1KVTA 3WXBA 1V3UA 4D44A 1NAHA 3W8DA 3ST7A 3ANMA 3Q9UA 3K5PA 4JBHA 4E32A 3DTYA 1Z73A 2PV7A 3S2FA 2RH8A 3FNEA 5BSEA 3GFGA 4CLRA 4CV1A 4FPXA 4WLVA 4CV2A 3PIIA 1CJCA 2BLLA 1VI2A 1E5LA 3D0OA 4BO7A 4MVJM 2UV8A 5L7WA 3O8QB 1E7RA 4URFA 1ID1A 1PX0A 3TDKA 1HYEA 3UN1A 4DVJA 5IZCC 4DMMA 2HQ1A 3BMOB 1NYTA 5KKAA 1QYVA 1PTJA 2GN4A 3C1AA 3H9EO 5DF1A 1I30A 4BO3A 1T2AA 1YOVB 4OXYA 4XR4A 3AI3A 1H0KA 3DOJA 1NXQA 3LU1A 1K6JA 1NR1A 1X7HA 5T5QA 1PQPA 4AVYA 1EFKA 5G0TA 4ROSA 4OAQA 3E8XA 3D3WA 3ZH2A 4KMSA 4EZBA 1Q1NA 3RC1A 3F5SA 4B3JA 3U4IA 5COQA 4BGIA 2X5JO 3VDRA 3Q1LA 3ANLA 4MPDA 4WUVA 2OZPA 3ENKA 1TT7A 3NTRA 1S7CA 3S1LA 3RWBA 4E2XA 2OFPA 4TKLA 3RBXA 4C7KA 1HDXA 1P77A 2PKQO 1K89A 1VL0A 4O63O 1IY8A 1G1AA 1TI7A 3CZMA 4J4HA 1XELA 4JROA 4DBZA 3JQ9C 4RV9A 1P0FA 3H9GA 4PVDA 1UAYA 2ZCVA 4ZA2A 3DAFA 3MJTA 2GCGA 2BF7A 4E5MA 3KBOA 3F1LA 3V2HA 3ZW8A 3AY7A 2JAHA 1NBOA 4DXHA 3WYCA 1E7SA 3OP4A 3BMCB 5JC8A 1QLHA 3LC2O 3OQ1A 4RPJA 3GN2A 2E37A 1P1RA 5HM8A 3U09A 5JNLA 1XKQA 4JN6B 5A06A 2WD8A 3GFBA 4RO0A 4WOKA 1DO8A 1VM6A 4FBGA 2J3KA 1HDCA 5ENVA 3CUKA 3VZSA 3TOXA 1ML3A 5A1TA 3D4OA 4WLEA 2HDHA 3ONFA 4ND4A 1E3JA 1DHRA 1LBEA 2WWRA 3WB9A 4B4UA 3D7LA 2B0JA 4I5GA 2BKAA 4KDEA 1XR3A 1NPTO 4D3DA 4XGIA 3ONEA 3VKVA 4BB6A 5A9SB 1CWUA 3B70A 2QRKA 4CM7A 3VKUA 4IDBA 1Z45A 3N58A 1BXGA 1DSSG 4CJXA 5MGBA 4RF5A 1OBFO 3KZVA 1X7GA 4KWIA 3ZWYA 3VC7A 1Z6ZA 5KTKA 1SC6A 3IIEA 3E03A 1ZJYA 1SCUA 5CPFA 5BSFA 1UDAA 5I8WA 3C8MA 3WGGA 4MVJH 1M2WA 1LLQA 2HSDA 2Q50A 1DFIA 1GQ2A 2X0RA 5B1YA 1E1MA 1EK6A 1EVIA 1HDZA 3V1UA 3MCVA 1J4AA 3OJFA 5KWEA 3NDJA 5IAAA 4IPTA 3VDQA 4XWYA 3SJUA 1PZHA 3R3SA 4P8RA 4I9NA 4Y6RA 4E33A 3M1LA 1R66A 2YHIB 1KYQA 4XQ9A 1B14A 3W8EA 1P31A 4HNHA 3T4XA 4EEXA 2YV3A 1SOWA 3LLVA 5KVQA 4YAKA 3VH1A 1M66A 1JDJA 1RPNA 2IEDA 3GAZA 4ITUA 3RIHA 2DUWA 3JQFA 5LCXA 1XCBA 3PZBA 2OOSA 3KSDO 4HFMA 1W8DA 2VUSA 4LMRA 5EMHA 4M89A 4MVJD 2W2KA 3L4BC 4LRTB 5I7VA 2RH4A 1KVUA 1H2BA 4UAGA 2UDPA 3GY0A 2GNAA 4MKRA 5C7LO 4I9HA 3O03A 3QHAA 3I9NA 2C7GA 1H6DA 2IZ0A 3FD8A 1GDHA 4WOJA 5BNFA 3CMMA 3GVXA 4J49A 1HRDA 3VPGA 1V0JA 4AJKA 1LSSA 2GF2A 1FDUA 4CL8A 4FS3A 3O4RA 1M67A 1GQYA 4PLGA 1C1DB 1P44A 1TT5A 3RFXA 2DBZA 1A5ZA 5DCWA 4CMEC 2RAFA 1EQUA 2JKVA 3G1TA 2G17A 5T67A 1VRWA 3HNPA 4EEZA 2Q2WA 1R4MA 4DLAA 2PNFA 5JXWA 1T26A 4HFJA 4MINA 3VPSA 3CEAA 1U4OA 4IXTA 3NDRA 4J1SA 2B83A 4PRKA 1U1IA 3CSDA 4CV0A 4Z0HO 3GLQA 2VTDA 3OEYA 3PVZA 2DU8A 1JLLA 3C3XA 2GLXA 1M6HA 3INGA 4YVFA 1PJSA 1O94A 3VZPA 3KXDA 4KQXA 3RKUA 4M49A 2DPHA 3IMFA 3JD4A 3WR5A 4J4BA 1V35A 2QZ9A 4I5DA 4EUEA 3EZLA 3KLPX 2DT5A 3DHYA 3PLRA 4PCVA 5KIAA 1CQIA 3DMTA 4L76A 1BTOA 4FOSA 1E7YA 1DOHA 1X1TA 3OA0A 3WICA 2DM6A 4HFNA 3BTOA 2Q1TA 4MIYA 4HADA 2PD4A 3H65A 1RWBA 2DTEA 5A3VA 2GGSA 1B0AA 1F17A 4UREA 1H9AA 2GSDA 3LF2A 4ZRMA 1PS0A 3QY9A 2EERA 4BHTA 2VYVD 4XDZA 3JQAD 3QVOA 1K5HA 1H6AA 1QYXA 2EGHA 2HMUA 1GZ3A 2Q49A 3QV1A 3AFNA 1G6KA 1W4ZA 1YRLA 4RL6A 5GZ1A 5JW6A 3F5QA 2VZ8A 1YBVA 1JAYA 4G81A 1OC4A 1H2HA 1WDMA 1IULA 4JBGA 4N5MA 4QECA 2IYOA 3RC7A 1CQJA 4BL5A 3WMWA 1SB9A 4BKUA 3ZU3A 5F3RA 2ZKLA 2YJZA 5JLAA 3ROQA 5THQA 2IXAA 3SLGA 4WLOA 2OP0A 2WE7A 2R00A 3JQ6A 3NUGA 1DDOA 3RC2A 4RDIA 9LDTA 1DJQA 4RQUA 1GV1A 1WZEA 4TMFA 4R54A 2P9EA 4EJMA 4CQMB 3DBLA 4FFPA 3K92A 2D3TA 2OBYA 2B4QA 4MDHA 4DQXA 1DIRA 1PJQA 1HXHA 2JHGA 4WCFC 1HLDA 2PK3A 3AW9A 3WFJA 5L51A 1BDBA 1Q0HA 4BB5A 3ZWBA 3P2OA 1QKIA 3QSGA 1U5CA 2FOIA 1YJQA 1B7GO 4KZPA 1ENYA 1R6DA 2NVUB 4I8XA 1YQXA 3AI2A 4AJ1A 2IXBA 1AXGA 1HE5A 4ESOA 4K26A 1UXHA 4MVJF 1JA9A 1R0KA 1YL5A 3W1VA 1M75A 4CQLA 2VT2A 3BMQB 4GKVA 4IQ0A 2FSSA 1P1JA 2BI8A 2VWQA 2YHUA 2VYVA 3GGPA 4AJ4A 3JQAA 1NR7A 5IDYA 3BHJA 4XQEA 1DFHA 1WLYA 3F6YA 3TSCA 5AXAA 5K6AA 4N18A 5JCXA 1OI7A 1GADO 1PIWA 3A06A 5JE8A 1J6UA 3RJ5A 1QYCA 3HDJA 4AJLA 5KCZA 5L53A 1RYDA 2H9IA 4DC0A 2J5QA 3UAGA 3RJ9A 5HS4A 4NBRA 4XQGA 5DDIP 3GH3A 3ITDA 3UW3A 1DIAA 4YJFB 2FPGA 4DBVO 1YXMA 5JDCC 3EYWA 3DQPA 2EGGA 4DYVA 5IJZA 1B3RA 3C85A 1KOLA 4NMHA 4W9NA 4IZHA 2AE1A 1AN9A 1PU2A 3RUDA 5BQFA 3PJFA 1JAXA 2DLDA 4IDCA 3L4SO 2RIRA 2I6TA 4QFDA 1EZ4A 3GMSA 3KYBA 1TA4A 3LSYA 1C1XA 3JQEA 4GGPA 2HLPA 1WZIA 1LUAA 4HY3A 1HE2A 2C20A 1I2BA 4OO3A 4RVGA 1DXYA 1Q7BA 3T7EA 1CRWG 3ZNOA 2FZEA 5IDQA 3OBBA 3C7CB 4YDRA 4PLFA 3JQDA 3ZHBA 4CLRB 4CR6A 3KSUA 4FN4A 5CP8A 1MFPA 1R0SA 3ICCA 4FJ0A 2NU8A 4AJPA 5F21A 1DC4A 2VHWA 2QIOA 2O2SA 1BWSA 2V6BA 3F47A 5CDGA 1ISGA 1BW9A 5L9AA 4ZN6A 1XQ1A 4XJSA 3ROPA 3FPLA 3HHPA 4YAIA 4R3NA 4QXMA 3FHLA 4WLNA 1GZ6A 2D4AA 2O3TA 1UZMA 2Y0DA 3UF0A 2LDXA 3O38A 5F1KA 3FI9A 2ZB3A 4OXKA 1X15A 2Y1CA 3PDUA 4R69A 3WLFA 3D3WB 4NK4A 4NHEA 4FQ8A 2FP4A 3JQBA 2B36A 2B5VA 4YT8A 2BELA 4CMHA 1YH3A 1Y5MA 3PGJA 1SB8A 4J43A 3TPCA 4E13A 4LSWA 5EESA 3WGHA 4IDFA 3U62A 3C1OA 4XIYA 4A5OA 4BNVA 4O5OA 2QRJA 4MIOA 2A9FA 2O2YA 3E1KA 2QHXA 3K2EA 1U7HA 3FCOA 5TQVA 3U5TA 1GQQA 1GUZA 3FBTA 2UYYA 4YA6A 4CM6A 1NQTA 3QWFA 2XAAA 2P4QA 1WW8A 3GQVA 3IJRA 4ALIA 3MEQA 2J3HA 1LX6A 3GRKA 4GKBA 4YAGA 2PFGA 4ND3A 2YV1A 4JGBA 2C5AA 3DFUA 2DTDA 4TKMA 3D5TA 2H6EA 5L7TA 5HTOA 4OSOA 5JFOA 4KQWA 1E1LA 4HP8A 2HAEA 4OM8A 4E30A 4WASA 1BVRA 4IGFA 3DZBA 4NG5A 3ZHXA 3G49A 1LEHA 3VH2A 3WIDA 1DEHA 2Q1SA 4RF4A 2PR2A 3ZU2A 2JFFA 3PHGA 1XDWA 2CFCA 3K30A 5DBFA 3S2IA 3ZWOA 1Y5RA 4FSHA 2JHFA 4QT0A 1LTHR 3AM3A 1VJTA 3PJEA 2ZB8A 3ASUA 4J0EA 3IAHA 1JVSA 4U8GA 4YJDA 3G79A 4PN3A 2Q99A 4IQ8A 4PFJA 3T7CA 4BNIA 4M1QA 4CMJA 4CQMD 2CSUA 2AEJA 4UVHA 2I99A 3I83A 1ZEMA 3R3JA 3HUDA 4PG4A 2J5RA 4CMCA 1ZKMA 3QWHA 3RAJA 1XIVA 1MXHA 2ZQZA 3D3EA 2AE2A 4W7IA 4GBJA 4LVCA 1ZBQA 3OICA 1E77A 4PGFA 3KO8A 4YXFA 3DTTA 3B1FA 2BFOA 2BD0A 2X8LA 2P9CA 4H7PA 3AUSA 6ADHA 3WLEA 4A26A 4BO4A 4OKNA 4BVAA 2HMSA 1IL0A 3JD3A 4N5NA 1EVYA 3KOUA 2ZJ0A 3PYMA 3HFGA 4J0FA 1T24A 3RFTA 4FC7A 2DBVO 3UCEA 4BO8A 2Q46A 4N54A 4PLVA 3UH1A 4B4VA 3GR6A 3IS3A 3PWSA 1I2ZA 3WYEA 5JBIA 1F8GA 3GEMA 1OFGA 3FSRA 3IQDB 4AFNA 3ZHZA 3QRWA 1ONOA 4Y67A 4Z9YA 5FI3A 4A03A 1U7TA 3WTCA 5G4KA 1YS4A 2Q2QA 4Q3CA 3PDJA 1Z82A 4FJ1A 3MZ0A 3KV3O 1R15A 3LK7A 2G0TA 3I9MA 5KVVA 2EP5A 4ND5A 3VZRA 2XF8A 4ALJA 4J7XA 5AOVA 3QJ5A 3KEOA 4YT4A 4YJHA 1R0LA 1T1SA 5T6BA 4NFHA 3H9UA 1ZSNA 3PPIA 3PP8A 1P1HA 2W2KB 3LT4A 3TL2A 3U9LA 1RM4A 2TMGA 3UXYA 1KC1A 5KOIA 2F00A 3TZQA 1MGOA 1BXKA 2GR9A 3PIDA 2DFDA 3NT5A 3ONDA 2GZ2A 2VUTA 1N92A 3PXXA 3WWYA 5LC1A 4OJNA 4GWKA 5U9CA 3OQBA 4XYEA 4U7WA 5KJCA 4YR9A 2ET6A 4J7CA 2QRLA 3GAFA 1G0OA 1HE3A 1GV0A 3V8BA 4BGEA 3EAGA 4FFLA 1PQUA 1GR0A 1D4FA 4H3VA 4E2WA 2CF5A 2VHVA 3GVIA 3BIOA 1KBZA 5DBIA 4BMSA 5ENDA 3EHEA 3EUWA 2GZ3A 2Y1EA 1PR9A 3WFIA 1YBAA 3ZGYA 3PTZA 3SC4A 2VRCA 2X9GA 1R4MB 4KUHA 2VT3A 3DZIA 4TRMA 3SEFA 2PGLA 5AQ1A 3TWOA 2HK9A 4JNKA 1UP7A 1WP4A 2DFVA 5EQDA 3PJDA 3SXPA 1B8VA 5TJHA 3VHRA 4LCJA 5THKA 1N1EA 1XU9A 1K6XA 3L77A 4TWRA 4J90A 1X14A 1VSUA 5TRTA 3WWZA 3DOCA 1EUDA 4XRRA 3D1LA 2AW5A 8ADHA 4Q39A 5I9NA 4OOFA 5G0WA 3GVPA 1J49A 3OJOA 2O7QA 3RUFA 2DKNA 2X7HA 1YONA 1D3AA 1LDBA 1VLLA 2Q3EA 4YCAA 1DHTA 1B16A 4KUGA 3ZWCA 4LISA 2G5CA 2W90A 3JYQA 3LF1A 1M6WA 3GHYA 4J1TA 1LQUA 1KY4A 5C37A 4NI5A 3SBOA 1N7GA 2E6UX 4L74A 3RUAA 3ZW9A 4IJKA 3KEQA 1E6UA 5AVOA 1Q7CA 3WMXA 2PH5A 1QP8A 1QR6A 3DEYX 4U0KA 1TB4A 5HRUA 4OHUA 5T64A 3RUIA 3NKLA 3OM9A 6LDHA 4JBIA 4FDAA 4I9UA 3WBBA 5FI5A 4JLWA 3B6ZA 5KJ6A 2JAPA 2GYYA 1E5QA 4XCVA 1ZW1A 1JU9A 4RZIA 1UXIA 2GRAA 4XYBA 5ICMA 1KIFA 3H5AA 4CLEA 2WM3A 4IBOA 3OHSX 4RJTA 2X0NA 4BNFA 4JIGA 4JX8A 3DBLB 1EE2A 2J3JA 1L7DA 1B8PA 4YRDA 2PKRA 4UVIA 3E9MA 2PKQP 2VUUA 2V7PA 4EUHA 1FK8A 2D1YA 2WYUA 1EFLA 3MWEB 3QVWA 4D45A 2NQTA 1JKJA 5A04A 2GPTA 4XJTA 1LDNA 1IOLA 2XPCA 4RLSA 3L4BA 5DULA 2X0IA 2V6MA 4B8ZA 1SZJG 4BNZA 4YT2A 3ZHYA 2HMVA 1AHIA 5TT0A 3W4KA 3FPCA 5G4LA 3FTPA 3RVDA 1Y6JA 1WMAA 1JKFA 1SEVA 4J1NA 1PQWA 2CDAA 3C7DB 2VOJA 3JQ7A 3JQ8A 3ADPA 2IYPA 4ZQBA 4CQLB 4MVJP 1ZSVA 2OMEA 1PJ2A 4ZICA 4DPKA 2J8ZA 4OXNA 1ENZA 3JQAB 1GD1O 4U6QA 1UXJA 2HMTA 3RU9A 2AQHA 5DZSA 5L45A 3CE6A 1DC5A 1PGQA 4YAEA 2B35A 3DHEA 4CMBA 3ETDA 1UAGA 2BFPA 4MVJE 3PI7A 4GMFA 5AXCA 3SLKA 3SX2A 3TN7A 4ALMA 4CUJA 1Z75A 4XDYA 3ZWWA 2NQ8A 5L4SA 3WBFA 2CY0A 1DIBA 4ZQHA 1QYWA 4HV4A 3GVCA 1OAAA 5I7EA 2OP1A 2FN7A 1X0VA 4K28A 3UOGA 2CZCA 4H15A 2E82A 4E31A 3AU8A 3DB2A 4IDAA 5BSGA 1NTOA 3LVFO 4IJVA 5DBGA 3UKOA 5CDUA 2NTNA 1VKOA 2D5CA 2OL4A 2JCVA 4Y6PA 1MP0A 1C1XB 1GFSA 1SBYA 4C7JA 4UUPA 2NLOA 5IG2A 5B4TA 4A73A 1WVGA 2WD7A 2DTXA 3I52A 4IIUA 1IZ9A 4GGOA 4QEDA 4DYDA 3BMNA 4CLHA 2VZ9A 1PWXA 1O9BA 5FEUA 2DQ4A 4Q3NA 3S8MA 4W99A 2EJVA 3VTFA 3TNLA 3DC2A 4XYLA 4BO0A 3HE3A 3DONA 1BVUA 1DC6A 1EVJA 1ZH8A 3HN2A 3UICA 3F9IA 2I66A 3MTGA 5DCUA 1BW9B 4Y8VA 3K96A 4UUNA 1P9LA 3GDFA 1E0DA 1FDSA 1GY8A 3ZWAA 1IHYA 1LLDA 4CM1A 5A4DA 5I8ZA 2G82A 3C7AA 4J7UA 2P5YA 4NU5A 3TF5A 1Z7EA 3BA1A 2YQ4A 4ZU3A 1LDMA 1NP3A 3GG2A 4CM5A 1H5QA 3SJ7A 1XGKA 1OMOA 2Q1UA 3DXFA 4R16A 3ETEA 1E3LA 4G65A 3ZU4A 3GG9A 2A92A 2X0JA 1A9YA 3QWBA 2WJPA 4YTEA 4A7PA 3TFOA 1O8CA 4LK3A 4AJOA 3VH3A 2X5KO 4WNIA 3ZDFA 4BKRA 2A94A 1ISHA 3KETA 4OMUA 4WCFA 4XRGA 4JCOA 4CMKA 1YDWA 3L07A 1F06A 1E7WA 1IUKA 2ZYAA 3GF4A 2EV9A 2HUNA 2RHRA 2YDXA 4TQGA 3FNGA 3DZGA 5T8KC 3HDYA 1DIHA 1B15A 1WDLA 3B20A 4PLCA 4NR0A 1V3TA 4AICA 2O3UA 3GC6A 5ITWA 5U1PA 3GEDA 5A9RA 2NADA 1EVZA 4I08A 1YB5A 2ZTLA 4Q3DA 4R1TA 3VVBA 3DBHA 5JDIA 2J5KA 4PLTA 5LDHA 5CHEA 3IUPA 2WYWA 1ZK2A 4DGSA 3ZWMA 3DBVO 1DB3A 3QE3A 3RUCA 5HS6A 4ZHSA 4ZQFA 3WG9A 3NV9A 5A3JA 2PY6A 1P45A 1Q7GA 1HT0A 2CDBA 3WQSB 5ADHA 1E92A 5AXBA 3RQSA 4E3ZA 1LDEA 3R1IA 4P38A 4QX6A 2D8AA 4G2NA 4A27A 1Y8RA 2WEKA 3HZZA 2CMDA 5DP1A 5JDCA 4ZRNA 1GPDG 3ITKA 3WNQA 5B12A 2UUOA 2YYYA 4OKIA 1N7HA 1XWFA 1PJ4A 4LSMA 5JAIA 3BHIA 4BGVA 1C3VA 4MOWA 4IS2A 3PHLA 1EEHA 2Z1NA 4R3WA 2I3GA 3BTSA 3TZKA 1A4UA 3H4VA 1ZK1A 5JO0A 2YW9A 1PGJA 1X1EA 1HE4A 2D2IA 4BOYA 2C29D 3OJEA 1U9JA 4NBUA 5IF3A 3ZV3A 2GN9A 2PZLA 4G5HA 3K73O 2W98A 2HCTA 4OIMA 2POQX 2Z5LA 1LDGA 1ZK4A 4DLBA 1PGNA 4FR5A 4CPDA 1U3UA 3OMLA 5H82A 3RROA 2GUGA 3OEWA 3PZRA 2PD3A 5G4KB 1PJBA 2IEBA 5DNAA 4LW8A 5L95A 2QYTA 3AUUA 2BFAA 3DZFA 3PHHA 2YV2A 1JVBA 2YFQA 5COAA 2NTVA 4E5YA 3OECA 5TSDA 2VNSA 1ADFA 3MJVA 2IZ1A 4AJ2A 1O95A 1FF9A 3NTOA 4WLUA 1U2GA 4R51A 3A28A 2Y67A 5B4UA 4YJHB 3NJ8A 2HRBA 1PZFA 3TQHA 1R16A 4JJFA 2Y68A 4E4YA 2X86A 4Z6KA 1YO6A 4FC6A 3ZV5A 4Y6SA 3CIFA 3W4IA 3PHJA 3KHUA 4BKQA 3I5MA 3GDOA 1J0XO 4DTIA 4IIVA 2HK8A 1UDCA 3GGGA 1V6AA 4QO7A 3AOEA 4Y9DA 4CR7A 3EMKA 3GGOA 2VHYA 1I3MA 3JQFC 3RD5A 4QFCA 1YOVA 3EY4A 2HRZA 4E5KA 4BNGA 4BO6A 4TVBA 1F12A 2G76A 4F3YA 4J16A 1LNQA 4FFOA 1Y7TA 5JS6A 5C7OO 3EC7A 3MJEA 2RHCA 1ZMTA 1J5PA 1LRJA 3I6IA 1UP4A 3DOOA 3KTDA 2WE8A 2AQKA 1L1FA 4B4WA 4BNYA 3ABIA 3LC1O 4HXYA 3E82A 3O26A 5JO9A 3GDGA 3FRJA 3HFSA 2FZWA 3KSZO 3GOHA 3UCXA 2PZJA 3CTMA 4XGKA 3WOHA 4BO2A 4FGWA 4D42A 2P68A 4MKZA 2EF1A 1H6CA 4FB5A 2SCUA 5JPIA 1HZZA 1W0CA 4DWVA 1T2CA 3QVTA 4NPCA 2VZ0A 2IODA 3DO5A 4CLOA 1ZNQO 1LC0A 1XEAA 1E7MA 3IKVA 1A27A 1V3VA 2IE0A 4B3HA 1Q2XA 2I3AA 3G17A 1QV7A 4RLHA 1MC5A 4Z0PA 4RPLA 1JTVA 3RUHA 2PD6A 3RU7A 3ADOA 3PQFA 3TOZA 3BMCA 1P33A 3L9WA 3KLMX 1MV8A 1YE3A 4Y98A 1XSEA 4YAJA 1LC3A 3ZNQA 4DPMA 2OUIA 5IZ4A 4XA8A 2EKLA 5HA5A 4AJJA 4BKOA 4R01A 4DPLA 1C0KA 1M76A 4PRLA 4RQTA 1U2DA 4I1IA 3L0DA 4Q3EA 4K1LA 1LI4A 5L40A 3NDIA 2H1SA 4BKPA 2DPGA 2VQ3A 1B8UA 1KVSA 3CKYA 1I3KA 1YBMA 4ND1A 1E6EA 1NFQA 1P1FA 3DAPA 4PIVA 4K6FA 4ALNA 4A10A 2EJWA 3L9XA 5EPOA 2BGLA 5B4VA 1NM5A 5JMPA 2CDCA 1XG5A 4NJMA 5I9LA 4RZHA 5KJEA 2O48X 4BNJA 1EE9A 3RKRA 4RPKA 1FDVA 3F4BA 4GWGA 2QG4A 2P9GA 3R0IA 3T4EA 2NUAA 1KERA 4ILKA 2EXXA 5EERA 1IZ0A 2EWMA 1KVQA 3H8VA 3JD0A 3QA9A 4JP2A 4M54A 3UFXA 1WNTA 5DT9A 4E12A 3GNTA 3W8FA 1PR3A 2X5OA 5DN9A 4MJLA 4WEQA 5H81A 1SAYA 3HSKA 4XEHA 2R00C 5JAQA 1H6BA 1O5IA 2V6GA 4E5NA 3FBGA 1K2WA 3NJ4A 1AUPA 1E3EA 1I10A 3H3FA 3JQ8B 3JQ7B 4IUYA 4NZ9A 5DOZA 3ZNPA 1GEGA 4E0BA 3QP9A 5EJ2A 2Y1DA 4O6VA 4J1QA 3WYBA
chains in the Genus database with same CATH superfamily
2PVSA 3LUHA 4RACA 5DNDA 1HFEL 2Z04A 3BEDA 1JR4A 4EW1A 3COWA 3RHFA 3IL2A 2O50A 3VR5A 2O7SA 5CB0A 3HXOA 4Q82A 1T5HX 2REXB 2KQUA 3O4HA 4PGHA 2ZUUA 4YGXB 2H4XA 3HHEA 4UEQA 1SIUA 3AR5A 4X20B 2LIPA 2X0DA 1G4UR 1QH8A 4DUGA 4DIKA 2CB0A 3A6ZA 1N9ZA 1SXJA 1E3TA 3KB8A 1U5AA 2OAP1 2VSQA 4RK5A 4TRJA 3W6OA 3IYLW 3FGNA 4BNUA 2ZXUA 2DJ5A 2UZ3A 2EFDB 4MDYA 5BMVF 1NX6A 3DAGA 2I7TA 2QRGA 4BE9A 4DB2A 1KP3A 3ANSA 1O6FA 1DAIA 1V8BA 3G13A 1K27A 5I7SA 1K1EA 1K5PA 1T8YA 3I2FA 1M1ZA 3M4ZA 4QBKA 4WKBA 3C14C 5KEIA 1T1GA 1CCWA 1ZXXA 2PT6A 5JZOA 1RI3A 2ZYRA 4IP0A 1FMJA 3ZW7A 1H5NA 1I1OA 3BYZA 3VR3A 4AF8A 4WBNF 5CDYA 3D02A 4Z3DA 1HYQA 4Z9AA 4MKXA 1YJ8A 1RBYA 2YIVX 1YZYA 2B1QA 2SBTA 3I4LA 4R41A 4B8WA 3WS7A 5ITVA 5AR1A 1EXMA 1EZZA 4TWBA 1P5RA 4BRUA 2YKGA 1Z2EA 1OSNA 2GEUA 4MVJG 3QUQA 5EGSA 5U4QA 2B4KA 3T9DA 5B7NA 1YZGA 4O4LF 4N6NA 3ILSA 4QQ8A 4IIGA 5GTDA 2QVLA 1BOFA 4LHWA 1A4RA 1YL7A 3I2YX 2UU9B 1YJ5A 1N6KA 2X1VA 2HSEA 4ZXFA 3SSAA 3KKMA 2H06A 2HJ9A 3MCWA 3OSUA 4Y2QA 3TLGB 3EIFA 4GQBA 4GW3A 1GSIA 4KN8A 2JD1A 2JFXA 5KDLA 1JKIA 2JJYA 1Z5NA 1HF3A 4MV4A 3MQ2A 3GQBA 4XQCA 3WGQA 1D5WA 3K4PA 3MCAA 3OSZA 2AR9A 2RB5A 3FDZA 3R5JA 4UU7A 3HR4A 4LXUA 1FRFS 5EXPA 4UPEA 2VRCD 1UKBA 3B9QA 4BKMA 4LFAB 4JXKA 4H0NA 1PEDA 2BPOA 4NE2A 4FDMA 4JY7A 1YS9A 4PZDA 1GAXA 4G5RA 1SG6A 5G41A 4ITRC 3VZCA 2X4GA 4Z49A 2XD9A 1DV2A 3BKXA 1XXLA 2PDAA 1VLQA 2XB4A 4A8JC 4D4JA 3Q5GA 2G88A 2D1TA 7MDHA 1R5BA 2YNMD 3AUXA 1FFBA 3O84A 3NC1C 1Z0FA 3QHQA 5IZCA 3KZMA 2FSVA 5UKDA 5FBQB 2NOAA 3A26A 5FLYA 4F12A 5L6LB 1T29A 1S96A 2Y2UA 3DHNA 5EINA 3SSNA 1WDTA 2E49A 3BTUA 1FUUA 3DMHA 3KKPA 1CJBA 3SZOA 3ZTYA 5FFMA 5EUMA 2VBCA 4F6RB 1MG0A 5FWXB 1YTLA 2G8NA 4LBYA 3PGLA 5AW8A 3DL4A 4UEJA 3CPSA 3JVIA 1KYVA 5TS3A 2OB1A 1XTBA 3Q87B 3UZUA 3PFFA 3U7GA 1O97D 3KZXA 2PCJA 5JVDF 1W52X 1KJNA 2YVLA 3KX2A 3PNYA 4PYKA 3V7NA 5LPNA 1KZYC 2Z6QA 4R0VA 3JQGA 1MB4A 3O8RA 5IUJC 1JFTA 4MGHA 2GVNA 3FF4A 1K6IA 3Q10A 3UMYA 2F64A 5EIOA 3N2IA 2WHQA 4BLWA 2VF8A 1YRHA 4UUMA 3DF7A 3FNIA 1NJ6A 2JLSA 1VMAA 2CVZA 4WCDA 1JT9A 1WWKA 3DTVA 4D46A 1CIVA 1TT5B 4RK4A 3BWXA 5LWHA 5IVKA 3TQFA 5DU2A 2QD2A 1NBMD 2GDZA 1X87A 2PGDA 1DAKA 1T25A 1M2NA 2WIJA 5A4DA 3HXMA 3L0ZA 4BLTA 1HETA 1H5UA 3L1JA 3GEHA 4B3IA 3OZBA 4C7XA 4G4SP 5TMEA 1U3WA 3LP5A 2RDMA 1E7QA 1FOEB 1PEKE 1YZLA 2ZAOA 3GX1A 5P21A 4MTCA 4S2EA 2QMOA 2RAPA 2R1TB 1I3LA 2ZBDA 4KI0A 4LZWA 4CU5A 4X1YA 4AL4A 3ENNA 1KO7A 3BH7A 3JV7A 1FXUA 4CE6A 4DG9A 4R31A 2OR3A 3A36A 1CDOA 3IQEA 3AINA 1JPUA 2LW7A 5TC4A 5EYPB 4LYFA 1Z8DA 4A0SA 5EE3A 3GZTB 1FSFA 3GT0A 3TZ6A 1NN1A 3AFHA 1U5BA 2I6QA 3FDJA 4HDNB 4W5JA 3TSZA 5IABA 1GYPA 1X6VA 3DOFA 3P0RA 1KEWA 4JLMA 1D2AA 3FFAA 4AP5A 1DBRA 1XVAA 3C3YA 3TH5A 3V97A 3FR8A 1LZKA 4GLLA 3IP7A 4HAWA 1ZH4A 3DYBA 2ZRLA 4KKXB 3MUOA 1OXKB 1ZHHA 1JAZA 1ZGBA 3LBNA 1PD0A 3LG2A 4C22A 4D1YA 3PS9A 3A3OA 4F11A 3V9PA 4RIGA 3L6EA 3DE7X 3B9PA 5HE9A 3T0GA 2X8BA 3WGYA 9ABPA 1CHNA 1Z35A 3M1AA 5F5LA 4Q1EA 4DC1A 3KYDA 1IJEA 1SVMA 1T9DA 4DCCA 3KOOA 5AVYA 2J7KA 3ZWKA 2G36A 2X2OA 3VBCA 1V8ZA 1PLKA 3D1JA 3C6ZA 3DHVA 4O4IF 4RV4A 3LZDA 3PX7A 5FOTA 5LLSA 4JUBA 4RD1A 3F71A 1PZGA 1K8XB 1O03A 3VKHA 1Q12A 5CFMA 3QUTA 4L75A 1ADGA 3VJKA 3LTEA 2WTBA 2C5HA 2G80A 1D1PA 1V11B 1DAPA 2FEXA 2G28A 3RAEC 1QONA 1R00A 1SBCA 2AQIA 4URXR 2GA9A 2Z43A 3D6UA 3CLKA 2FU5C 4FR0A 3OJCA 2XRZA 4IRUB 3T5CA 5FNVB 3RRFA 2GESA 3L6DA 3ZX5A 4CIWA 5EJ5A 1JDVA 3OPYA 4KAJA 5JCJA 2Y1KA 2X5XA 4G09A 3DM5A 3LKVA 3EK2A 5CFPA 2YQ5A 1RT9A 3L7IA 5IXYA 2DUMA 4G8DA 4A15A 4O2AB 1CTQA 1EA7A 5C8DA 4JJGA 2BFCB 5EN4A 4CF5A 5F9HA 2C8KA 2REOA 3CT6A 3V1LA 2VHZA 4UAJA 5FLKA 3ZJVA 1L5MA 4NBSA 4BQQA 3B13B 4WECA 4M1YA 4IXNA 3M5CA 4CM4A 2AF4C 3ILXA 2E4AA 4PG7A 1ZCZA 3DG9A 4GSYA 3UK1A 1XQ6A 1WKBA 2XDQB 3AJDA 3LMKA 4M60A 4YRAA 1A88A 2TMDA 4BGDA 1UUFA 1BMDA 4WE3A 2R60A 3TAHA 1YGPA 3N6VA 3LQ2A 4JT8A 4G9GA 1JFLA 5CLFA 4KQ1A 3TG8A 4OBBA 4MV0A 2CYCA 4UU8A 3NVAA 1BA3A 4KXMA 5A1JA 5JJ5A 1U7PA 1ZGCA 2VP2A 1Z6GA 3WGNA 2B4TO 4IJWA 421PA 5H1YA 1P74A 1Q83A 1GN8A 2MINB 4K1XA 4R7GA 1FQJA 1THMA 5EP1A 4ZVKA 9LDBA 2JFHA 3BD8A 4B6OA 1I4TD 2O3QA 5CLLA 3QQPA 3VMMA 1YAHA 1VI5A 4YB8A 4Q6BA 1JQBA 3S2EA 4PV7A 5EWJA 4Q1FA 1F9AA 3KP1A 2F1IA 2ZK7A 3G9TA 4K9KA 1AXRA 4HMOA 4UVEA 1G98A 5BR4A 2V1UA 3GJ4A 2F43B 3DEIA 4KAAA 3VVCA 2C3YA 3MTIA 4WW0A 2FHSA 1S2LA 2FSUA 3QVGB 4FZVA 2A8YA 1PT9A 3PD1A 1KQOA 5F98A 4M3NA 1G5FA 4BXOA 5FOWA 4F38A 1S8AA 3G89A 2YHBA 5TEWA 3UHOA 4KVGA 1W0JA 4XASA 3D5QA 2OCIA 1TYAE 3SXUA 4AS2A 1ISSA 4NV0A 4GR4A 2CF6A 3HXQA 1JPJA 1EYZA 1MQSA 2JHPA 1V5EA 1DAOA 1UJBA 2C8LA 2MMCA 5GV7A 3VR6A 5BP7A 1XZAA 5E4YA 4J91A 1DARA 1M1XB 1Y9ZA 1HI9A 1PL8A 3QU2A 4N5DA 4Q9AA 1HQKA 2OYCA 3ER9A 1SKBA 3ICVA 5DGCA 2YZKA 2QLLA 1ZI8A 2YOGA 1NMSA 3DL7A 3HKCA 3KR2A 3ETNA 4FWIB 4TM8A 2W70A 4A92A 4FEYA 4GI7A 5JT1A 1IQ0A 1GN9A 4P4TA 4D02A 1QAMA 2XA9A 1D07A 1E61A 3DDCA 1KJJA 4LYYA 3ZZNA 4Y3UA 1WJGA 4YRKA 2Y0CA 4XIFA 1S6YA 2UYQA 4X93A 3NORA 4WY8A 5LQDA 1J07A 4RVUA 3O7MA 3FA2A 2IHYA 2Y1OA 1YNOA 2YV5A 2AUTA 3G7NA 3G9XA 3RHTA 3G0OA 4BZXA 4D97A 5DCYA 1W85B 2ZB4A 2DUNA 2VNAA 1JQLB 4AF7A 4IG4A 5JZMA 3AFIA 4WXHA 5T3YA 3KWMA 3VNUA 1A8SA 2CXNA 2O3SA 5FWDA 2HJSA 4REOA 3B3JA 4UTVA 3FTEA 4LF4B 1T6ZA 3IUSA 2Q29A 3O73A 3VJMA 2CSXA 4JJ4A 5G0SA 3OFSA 5IDVA 3FOZA 4DSZA 2AR0A 3H1PA 4IKEA 3G85A 2XMGA 1B42A 4B4DA 1DAMA 3O4GA 3C1UA 4PN7A 1C9KA 1NURA 1V25A 2YOHA 3TIGA 4DJFC 1XN4A 4LJ5A 2Y0EA 1IVNA 5IMBA 5I7WA 3TZCA 3Q3VA 3AB8A 1XMIA 4GF5A 1J2EA 4B0OA 4PX9A 5BPHA 2LV8A 2O05A 3HWRA 2V9PA 3H5LA 3S1SA 5BNIA 3CONA 3DBRA 4K5QA 3HDQA 2NUAB 1QIIA 3A2LA 3BORA 2K7FA 3EODA 3LFTA 4QYSA 4C0SA 4HUTA 2R8EA 1JSXA 2DMRA 4XGNA 2W6ZA 4UEOA 4P36A 3E5MA 3NB0A 4GI2A 4K3VA 4AO6A 3R41A 4JJZA 2EQAA 1XA0A 3VPAA 2D2FA 1DXOA 4OQYA 3FXAA 4A4DA 1PFKA 2SKDA 2A1UA 2XOEA 4X1IB 5C3MA 1A4IA 2O4CA 1VYVA 4L7VA 4QAJA 2AOUB 5ARBA 4HAYA 1BCRB 2V6FA 4RPGA 4F5ZA 4TYPA 4A6EA 2VC2B 2X1LA 3G8AA 5HFAA 2Z9CA 5IJ9B 2AK2A 3CC8A 4GVXA 4HDOB 4IILA 3RBZA 1XTVA 3JU3A 4ZHQB 4BTVA 2WI8A 2CLIB 5A03A 4R1UA 4P0PB 1SUPA 3HMQA 1KGSA 4BBPA 1H1LA 3BWYA 4LDJA 2JJ1D 5C1OA 1I2DA 2IIPA 4JU8A 4PLWA 4L0CA 1AU9A 4MX8A 5EI5A 5KYWB 2GHIA 4E5DA 4FB4A 4AK9A 4M1OA 3U2QA 1JLHA 4R2KA 3S8EA 3KZ1E 3R7SA 4EARA 1ZHFA 4TQUS 1P6QA 4Y0AA 4EJSC 4EX6A 3K9QO 1AM4D 1KETA 2E55A 1XA3A 3RK1A 5IDWA 3O75A 1DL5A 2ORED 3LBAA 4OCZA 4XAQA 1B43A 1AKMA 2CWDA 3C6MA 4D9FA 3WMGA 4F06A 3PYLA 4OIFA 1AHPA 2NMVA 1Z26A 3OLYA 4MAMA 5KYXB 4YRSA 3P0EA 1MVNA 2YXNA 4ZYVA 4IO0A 3F67A 1OB2A 4IEEA 4RADA 4RGVA 5FHQA 4YQFA 1EFRD 1Y1SA 2IUYA 4TSKA 3SVTA 3EZYA 1AT1A 2R86A 2WPDA 1D4OA 2G04A 5K3FB 1NQVA 2OCDA 3CF2A 4DLPA 2JG3A 5BW6B 1KQPA 2AVNA 2XLBA 3CEMA 4HATA 2F1KA 3ORFA 4WDRA 3AM5A 4BJ5A 4RA6A 4RTMA 3ONWA 4PPNA 4QDOA 3IR7A 4PZYA 5GGXA 1SCJA 1H3FA 1LJ8A 4HNGA 4EYSA 2OQ2A 2ETVA 1DIGA 2RBEA 3SDZA 4G5OA 2QLBA 5LVAA 1U2TA 1F2DA 2A35A 2PJUA 2HKIA 2ECFA 5B30A 1U0JA 2WHEA 4KAXA 4MWOA 1OHHA 2OWDA 2P27A 1G20B 3LXMA 5D3QA 2RHOA 4F2PA 4EY5A 1SVWA 3CPHA 1IHXA 4WKCA 5KYUA 2DF8A 4FFSA 4X95A 3OP1A 4GE0A 5BSUA 1QF6A 3L6UA 4JT9A 2QTHA 4IDDA 1CS0A 1I36A 1V9SA 1C0PA 1XD2B 4CM8B 3RCBA 2IFTA 2OHXA 2WP0A 4KQIA 1SD5A 1MOZA 4GNRA 1M5UA 1AC5A 1O77A 4NMWA 3CH5A 4MVJA 3S6JA 1AV7A 5B6JA 5FFFA 3RJTA 3PCXA 2X76A 4H6XA 4JUFA 4RZUA 5KB3A 4Q12A 4D9IA 2R6CA 4B7ZA 4MUEA 2ZSHA 4ZYXA 1V16B 5ES3A 5KU7A 4O4JA 5HKLA 2QRQA 1F0NA 4XX0B 1B3BA 1Y9AA 3B5JA 3G3EA 2ZRMA 1F2UA 3W3AA 1VKRA 3BX1A 4IGEA 4A6DA 1CQPA 5E6RB 2B82A 1PNQA 1MXFA 3A04A 1PZMA 4KB5A 3ZGNA 4MP8A 1ULZA 2XKAA 3OY2A 3H2ZA 1E3WB 3OCYA 1M8PA 1CVLA 1ZZGA 1I8TA 3IVXA 1C29B 3JZIA 4DBLE 4URVR 3QYJA 2ZAYA 2E3JA 3RBVA 5B1IA 1WDWB 5H80A 5CBPA 3NV7A 1BQ4A 4JH0A 1YVPA 4X7PA 4YIHA 1BWPA 2CVQA 4URUR 5FP0A 1SELA 5MHTA 1YZNA 1P0QA 2GD6A 1BXZA 5J43A 4UHEA 2EW2A 3KYCB 3HWWA 5LIRA 3O8QA 1XZBA 4NL4H 1N57A 3IJPA 1GEEA 1I24A 2Z8ZA 2IYYA 3ASVA 4K9DA 1V7CA 2WM9B 4WGGA 3MTEA 1JIVA 4EBFA 2VJNA 4INZA 4YUYA 5J59A 4PTYA 1T2UA 2ZWIA 3M4YA 1JW9B 2V98A 3NTXA 3FYSA 1AGNA 2H1FA 2C9YA 1N6HA 4HYEA 1K3TA 2FWBA 2OD9A 4NH0A 4FW8A 3DJFA 2HIHA 3BRWD 1RCUA 1W5TA 3UG6A 4NYJQ 3EQ6A 2V5AA 4UZSA 4BPBA 3AZQA 3RVJA 5JROA 1GYRA 3R76A 4QTUB 1BHSA 2QEQA 3WGKA 1PF7E 4MVYA 2W83A 4XSHA 5BNWA 3OEED 4GD3Q 2O1WA 4M87A 2O8DA 3RTDA 2J3MA 3WHIA 1E64A 1R74A 3C3KA 3T38A 4AZTA 4PC3A 4XLZA 2FF7A 5EQFA 3VOSA 1QBKC 1PS8A 3DT6A 1P1KA 3CKMA 3LY7A 3F8SA 1Z34A 3MJ4A 4I3FA 2CNBA 3GEIA 1OI3A 4FGSA 1EGQA 2QD1A 3ENWA 4DYHA 3HU5A 1HQYE 5FT9A 1E1RD 1JJ7A 3GLHE 3B52X 4HOYA 1OT5A 4OXRA 5BT9A 5MN4A 3UJ8A 5GOZA 1RHJA 1NBHA 3INYA 3R3XA 4K2HA 2NW6A 3QTLA 2VHTA 5SV2A 4R68A 1UZNA 4X61A 1QIFA 4RF3A 5FNVF 1AN0A 5ALYA 5LKRA 3ZNNA 4RGBA 4Y2YA 4KC0A 2QUZA 5AW9A 1DTSA 5F1PA 1FYWA 2DPLA 1FUYB 2EWWA 2IVFA 2XCLA 2P4HX 2FEPA 2ZG6A 1RYEA 1GZHB 2C7VA 2IUSA 2QE7A 4O2AF 3ZLVA 2B6NA 5SYMA 4PLHA 2IV3A 3ZE9A 4ND8B 3MGGA 4GMGA 1REQB 4PYNA 1RWQA 1HSOA 4KJZA 4ETIA 4FDUA 2P2ZA 3PFGA 2EJUA 3FHJA 3ELBA 1VRCA 2IYAA 3H84A 3QNWA 1T1EA 4GQAA 4XR9A 2BKEA 4M8LA 3X1JA 4E21A 3EW7A 2GD0A 3NOVA 5CM2Z 5AVXA 5KSOA 2I55A 3PT5A 4QQFA 3BFXA 1ADCA 3AMVA 4AM8A 1JA1A 2QI9F 3EDMA 5EE1A 2FN9A 5F1OA 4GI5A 1C7RA 3FWHA 1HURA 1QTIA 3JQPA 1A77A 1O6BA 3WDKA 1ZJ5A 3PCTA 4D0LB 4DUGD 3TVDA 1RAEA 1I1NA 1SUIA 4DEXA 5CEJA 3MTAA 2YS6A 1FFGA 3U44A 2X0FA 2EF0A 3EIHA 1U7OA 4CV3A 3EVFA 2IDZA 2QUAA 2HW8A 1OUMA 3X1YA 2OY0A 1RRCA 4R1QA 4CR8A 3RFVA 1V9CA 2XWBF 1YFZA 1RM5A 3G1UA 3B36A 4KV7A 2RSLA 1QGAA 3EZFA 3LLMA 4UUQA 2IWRA 4OGLA 1EWTA 2PQ6A 3E35A 3LX5A 1VPEA 4G0VA 1WS6A 4PGAA 5T4FA 3ILYA 3FUTA 1G7SA 4YCNA 2CBZA 2ZRKA 3GCGA 4KWHA 5AO9A 5BSHA 3VR3D 4PZLA 1O6GA 2IEIA 1DKPA 4MHTA 4MRAA 3IH5A 5JEDA 2I4IA 1BHQ1 1VC2A 4MYTA 3AO0B 1MIHA 4PSVA 1PGPA 1SK9A 4IDGA 2OEPA 6CHYA 1A72A 2BKUA 4FD2A 4CUKA 1Z5GA 1FX0B 5ALQA 4D9KA 4EA7A 5J3JA 4N41A 3B82A 2VBGA 4ID3A 1JMVA 1U9ZA 4MXDA 5AMXA 1GNLA 1QWSA 1MAWA 1YCDA 5ECWA 4BVEA 1FA9A 1LRKA 4BLRA 1AGRA 2R8OA 2QX7A 3EGWA 4E3ZA 1P1IA 4ASUA 1GOTA 3EGDB 2QVXX 3H5RA 3N3AC 3Q2IA 2QTGA 1J09A 4IRXA 2HMWA 2GARA 3I5YA 1NRIA 2YC4C 3OTWA 1KJ9A 3Q9LA 2ZE5A 2VPZA 1ZGHA 3RH0A 3SYLA 2X6TA 3A6FA 3TBFA 3W1WA 4UCXA 2K2WA 1BS1A 1O89A 3SY8A 4B3DA 2JF0A 4OP2A 3QWAA 2EFYA 1BJKA 2REQA 3HJTA 1GL6A 1ZD1A 5DI9A 4X65B 1JNYA 4YRCA 3SICE 4MUHA 3ZHOA 1G6OA 1KYXA 2C5FA 2QI9C 4G89A 2AT1A 1G64A 4YYEA 4KYIB 4NU8X 1P62B 3I5UA 4JCCA 2VN8A 3K6JA 3LY8A 4M86A 1OOEA 4QOIA 4OATA 3GIDA 3IX7A 4TS3A 5CHYA 1SVUA 2QMZA 4LJ8A 4BNNA 4F72A 1KORA 4D9MA 1LXCA 4IS3A 1VPDA 3EZ9A 4OFBA 1XZFA 2CFOA 2VCYA 3IDSA 3A2KA 4NBWA 5SZKB 1SHZA 1NNUA 2VDPB 5H68A 5BV7A 3I1IA 5ALWA 5JSKA 1HDYA 2QR2A 3H0EA 2XBLA 3C41J 3H9QA 3KRTA 1GCUA 4C5BA 2F55A 2ZRHA 2DB3A 4GX1A 3ZQ6A 5IW8A 1D09A 1ONPA 1C1DA 4FFRA 3VPXA 5K0CA 2VJYA 1RNLA 1C9YA 3JQCA 2FOLA 5I9IA 4PY2A 5KCMA 1U8EA 2RB4A 4AX8A 2JZNA 2APJA 2D5AA 3VZQA 1UBRS 2G7MC 3ZQUA 1YA8A 4H6VA 4LN1A 5AXDA 2PEYA 2ES4A 2W6MA 4Y2VA 5A3RA 3NIBA 3QF4B 1U65A 3K9BA 1GPJA 2PFKA 2Q2VA 5IN5A 3LUKA 3UJHA 2ZSJA 2CUNA 1UFVA 2IF0A 3JATB 4MEBA 1HZZC 5DTEA 1EBUA 2FN3A 4BUJA 4YWJA 2Y4OA 3DTVD 2C96A 3LUCA 3UJAA 1TVEA 4Z99A 3OTHA 4YFVA 3ESRA 1D4ZA 1V37A 3K9GA 1EUCA 3KEFA 1G5QA 3TRJA 3USCS 3PFWO 1F0PA 2HZBA 1SC4A 3FH0A 1I5EA 2OB2A 4HAVA 4E4RA 4RIIA 5HQ3B 4KODA 4BVKA 3SFZA 1ZVQA 4RIFA 3OIGA 1QZZA 3T0FA 1E2JA 5AHXA 1VMIA 3L7MA 3W6UA 3JVVA 1OLUB 1UFRA 1XC7A 4J0JA 5EXSA 1H9BA 3PRYA 3GLGA 1MW9X 4ZHQF 4QUEA 2NU9A 4DY4A 1R4NB 1Z4NA 3KKQA 4M46A 1OZ0A 5HZMA 3ELWA 4M9ZA 1BG6A 3H9CA 4UBLA 1NW6A 3W2EA 1PR0A 5IKEA 1CV2A 1NW4A 4LDPA 2EYUA 4BQOA 4F84A 3JSAA 4WK6A 2W0SA 1ZVJA 1WEKA 2B6HA 2I33A 2YINC 4Q3LA 3SMVA 4DGSA 2Z6UA 2NP6A 1U28A 2CV0A 4OLHA 3BWBA 3FPKA 4GPZA 4GPEA 4KDRA 1JWBB 3EQ2A 4QU0A 1L5HA 5J2TA 1J1UA 1OPRA 3OPMA 2XUDA 2RGRA 4EGSA 2SNIE 3FOCA 4AY5A 3VDMA 1A9XA 1A7JA 4BZPA 3PTAA 1JDSA 3IVAA 3IELA 4I1YA 3DCIA 4TKUA 2BEUB 4OK5A 4RNDB 4B6QA 3JALB 3AZPA 4Q1VA 1E1NA 4G97A 3RVMA 4HI0E 1ZEJA 2B8JA 3G2JA 3UGTA 1A5TA 1SEPA 4MUGA 1RQ2A 1I1QB 2TRSB 3QU5A 4MB6A 3Q11A 4U39A 2GAAA 5JH7A 2D7DA 2A58A 3OU7A 1NPYA 4J4TA 2A6PA 2W2QA 3TTUA 3U4HA 2KSQA 2OC9A 2JK0A 3KQQA 4HH4A 2X4DA 3FPBA 1A8UA 1A7UA 2PV0A 3HP4A 1RXEA 1E3IA 2QN7A 2VH1A 1GGHA 3CZCA 3HN7A 4V38A 4ETNA 2MU1A 3O83A 1TMOA 3WGZA 4KP7A 1T8RA 3WP1B 4BB9A 4OGWA 4D8WA 4JLPA 2LZ0A 4NECA 4QBGB 1QZTA 4DBLC 1RLJA 1T6NA 2YFHA 4MQEA 3EEOA 4BO9A 4BS9A 2CD9A 4C2TA 4CL0A 1S2DA 5JCJD 1DGQA 4QXAA 3S27A 4U0JA 2VDWB 1T2EA 3OQHA 3C39A 4RSRA 1KAOA 3TZHA 4DABA 3SHFA 4R71A 2Q7OE 4HB3A 5DT2A 3ROFA 3SS8A 5H4GA 1Z5PA 2C2OA 2W2LA 3N8IA 1TLTA 3P2IA 4MRMA 2AZDA 4RL4A 1Y80A 3LHKA 4AU1A 1UMCB 3U37A 3VR4A 4DQVA 1YKSA 4EEKA 1AGYA 4UVGA 5ESXA 3Q3CA 2F8SA 1V8DA 1MC8A 4RA9B 3ZUGA 1EJ0A 2ZYHA 3G5LA 3MCTA 1EQAA 4PWYA 1JFVA 2E1PA 2H63A 3BMQA 1M2VA 1T2DA 3IDQA 5B53A 3AGQA 4HVLA 1FTWA 1KOFA 4GVPA 1NRJB 4U2FA 1ZO8A 4PYMA 4U3JB 3S1AB 1HDRA 4IIEA 3L18A 1GG9A 1UINA 2OQRA 3Q1KA 1ADBA 1EIZA 3QPVA 5DP2A 1TXGA 3LCMA 4KMOA 5C34B 4YX9A 3VNVA 3U56A 3GFQA 1BE6A 5HILA 2Y71A 1G60A 4AS1A 3FCUB 1JEDA 1LSUA 3BCRA 3MT0A 3RTBA 3MN1A 4F3CA 3D9QX 2QD4A 3HJAA 4QE3A 1L7BA 5MFZA 1PKXA 1MX9A 4XYMA 4CG3A 4FYPA 4LBWA 1D1TA 2ZCUA 3EXG1 3IERA 4BFZA 4K6CA 4WOBA 1QGUB 2I22A 5C81A 4MEAA 3IURA 2B2XA 1BFKA 3O91A 3PFIA 4N0EA 2C4MA 4AZ0A 4HPXB 2H5IA 4N7RA 4LTNA 4GRIA 2P77A 4YPFA 2J9GA 3L8GA 3QKIA 2VT6A 3SC2A 3ZV4A 4EP1A 5CXQA 4M55A 3UUFA 2WQZA 5FCDA 5DXJA 3WGJA 4I3HA 2H59A 1M8GA 1PGOA 3ADBA 3IEPA 4Y1RB 5EJMA 2BZ0A 3VPBA 1TM3E 1HNXB 3QFRA 3P4XA 1UCFA 3VGJA 3RTGA 2ZUEA 1W0JD 1HNZB 1XEXB 1RRKA 1J0BA 2AR7A 3HDTA 2C3MA 4NX2A 4X0EA 4BYMA 1KVTA 1MNAA 2EL9A 1V3UA 4EJFA 1W5AA 2C9OA 3CLSC 3DD5A 3NNNA 1H22A 3VR6D 2H11A 3W8DA 1MIOA 4V1CA 2P2YA 3ANMA 4D2IA 3KXLA 5LMUB 4TV9B 3KU1A 1JBQA 4UQPA 2NYAA 3DDOA 2IXFA 3QMVA 4CV1A 1OA0A 3DVSX 4WLVA 2QAGB 4CV2A 3GDWA 3HGMA 3PIIA 1XMXA 4RPIA 3SZUA 3F6RA 2AI3A 3NFRA 1VI2A 1E5LA 3D0OA 3LBIA 3KXPA 5DNEA 4MVJM 5CTJA 1ACJA 4LDZA 4BO7A 3WA6A 2VCEA 4JLOA 1ZUWA 5TGZA 3ZIAA 3R9KA 4UE6A 4DVJA 3TDKA 5LM3A 2XCTB 3UN1A 2F1JA 1AIPA 3HYNA 2WR8A 4DMMA 2LRHA 4ABTA 2HQ1A 1NYTA 4HSEA 1XMJA 5D00A 1OJ7A 4I5IA 1T2AA 2XQFA 1N2HA 5FOSA 2QGFA 4BO3A 1L2TA 2MOKA 5AKYA 4CI0B 1RJFA 1NXQA 3DAOA 3LU1A 3Q5DA 1W2GA 2HN9A 4PCAA 2YXEA 4MDFA 3CHYA 1JDNA 4ENSA 1Y8ZA 5T5QA 1PQPA 1TIPA 2JHAA 1EFKA 2VDJA 5EJ4A 4OAQA 3N0XA 5ALLA 4KMSA 3IESA 1Q1NA 3VYTB 4FGLA 4B3JA 3U4IA 3EGCA 1U2EA 1YK0A 4JL5A 3DPSA 1I4EB 3UATA 5JZVA 3AVTA 4WUVA 4HDSA 5HXAA 4D5EA 1FC0A 1NUAA 4LVNA 3QF7A 2F2TA 1S7CA 4I50A 3TXXA 3KZOA 4HGNA 3TUJC 5REQA 2OFPA 1O96A 1O3YA 2KB0A 3MJDA 3OJWA 4D99A 1CZHA 1P77A 1I6WA 2H1CA 2IDKA 3ROGA 3ZC3A 4ER6A 3O4VA 1RAAA 2A78A 2HF8A 2V96A 4R1PA 2IV7A 1IY8A 3CZMA 1K3UB 1DBIA 2WZQA 2WTAA 4Q9JA 3R7WA 1ADYA 4BX2A 4B3BA 3H9GA 1UAYA 3GAMA 4FYWA 4ZA2A 3KWJA 2XIJA 3R3ZA 1T0PA 1YK1A 3AHEA 4RK0A 4TXNA 2GCGA 4EHNA 1F6WA 4E5MA 1KZ6A 2OYSA 1WBBA 1ZBDA 1P0IA 1NJGA 3V2HA 2VCHA 3ZW8A 3FGPA 2O8CB 2D4HA 1RLIA 1P0PA 1Q92A 2X19A 4DXHA 3WYCA 5K0TA 1MO6A 2BE7A 4QXRA 5JC8A 1QLHA 4G1CA 3LC2O 4RPJA 4AUEA 3GN2A 2E37A 4WGFA 1EESA 3WHPA 1P1RA 4RAQA 3PBKA 2CUZA 2NN3C 4P58A 4J6EA 2E89A 2BDUA 4RO0A 2VF4X 3O3MB 3RGWS 3O8BA 4K9OA 4C7OB 4NF2A 4FFWA 5HF8A 3INNA 3NH6A 4KVZA 1YJXA 5ENVA 1AO0A 3VZSA 1WY5A 3K5HA 1M9NA 4EY3A 1PVDA 2YWCA 1ML3A 3TOXA 4S35A 4Z1MD 3UWSA 2ZRFA 4Q03A 4ND4A 3WB9A 2OCGA 3QX7A 2P1RA 3CPEA 3PUXA 4PO1A 3RADC 3LZCA 4C6SA 5E2BA 2PZFA 1TF7A 1YHNA 1P5HA 1RZ3A 1YZHA 1V41E 2CJWA 3UJ9A 3CLUC 1RCTE 3MCUA 1D8TA 2CLHB 5AIBA 1NKVA 5E0OA 1TM7E 5EQTA 3M49A 5H7XA 1OBFO 1XWIA 1G4AE 2FFQA 1Q14A 3GWGA 1TTPB 1Z6ZA 4H35A 2Q4TA 1HRKA 2X13A 4O1IA 4RHXA 3MILA 1C9MA 4YMIA 3X1ZA 2BGUA 3E03A 2XB2A 2D8MA 3X1KA 4EMTA 2QUHA 5DLDA 3ZZ0A 1UDAA 1VG0B 2WAYA 4M98A 3HBNA 2QP3A 1D9XA 3FIUA 4PEVA 5G1NA 1GQ2A 1POXA 1JDUA 2X0RA 2YVQA 4QVKA 2AOWA 5E4TA 5HDBB 4C14A 1Z38A 2N1MA 5JZ9A 3T9CA 4QTYA 2GMWA 5KWEA 3G2IA 4PZAA 2FW9A 2QZPA 1PZHA 3AL0C 1UBMS 4I9NA 3VUEA 5CYGA 2UXCB 3K6SA 1FRVA 4R7TA 3CRW1 3F2VA 4KNWA 4GLBA 4PICA 3TCNA 1QVWA 2YHIB 1KYQA 5IAKA 2H1HA 3W8EA 4QBHA 5EA2A 3VHQA 2NYVA 3ZG6A 4EEXA 3CVXA 1OLOA 4B3CA 4QLOA 4YAKA 4YRFA 4DSNA 1JDJA 1CY6A 1VECA 3GAZA 4ITUA 5J5VA 3C3AA 3ESBA 2RKBA 2H4YA 2IHNA 3RK4A 1JEEA 5K0NA 3PZBA 2OOSA 3KSDO 3VYUB 4RKFA 1W8DA 1DMSA 1XMSA 2VUSA 1CEYA 3BB3A 2R3SA 1IZ8A 3IR6A 4MVJD 3EBLA 3L4BC 4J3NA 2IPMA 2IS2A 4LRTB 4F1KA 5JTTA 1U04A 1OBVA 2I3ZA 3MJFA 1KVUA 5FUWA 5AW7A 1ZYUA 3P96A 3O90A 1EB9A 4MZDA 2WJ3A 3K3PA 1P2SA 4I9HA 2BEWA 3QHAA 4FHEA 3I9NA 3AHGA 4WOJA 5JI3E 4Q37A 1GDHA 1H0SA 2J3DA 3W3AD 5G1PA 2X8JA 3KBBA 1XF1A 3GVXA 3HLTA 4J49A 3TD2A 3VPGA 1EGMB 1AGPA 1ZMXA 2B1JA 5CT4A 4CQJA 4EHJA 3LT5A 1DEAA 4DE5A 4B6RA 2EBWA 3TQQA 4GXTA 4MRSA 1J9GA 1P44A 3MPOA 4X6LA 1T4GA 4Y6LA 3WWOA 1WETA 5A0TA 5CJJA 2FF5A 1BMFD 1JKXA 4KQCA 3FX2A 3W5VA 1RI1A 4WKOA 3WA7A 3OD5A 4NOMA 4FFBA 4HK4A 4NCKA 1I6LA 1EQUA 2RAFA 3CUEF 2G17A 4RE6A 4X9XA 5B1HA 1DAHA 1LS1A 1RMYA 2HMAA 1PV1A 1R4MA 4PSUA 3VO2A 2PNFA 4E07A 4NFLA 3DFFA 3KELA 4XWGA 3OO1A 2WRZA 3H0KA 3B8HA 3CEAA 2XYRA 2AKYA 3PR1A 4EG1A 4Q9HA 3P45A 4OAOA 1WPXA 4WY5A 1DPFA 1Q1QA 3CSDA 4PRZA 4PZUA 1XV5A 2HHCA 2VTDA 3PFBA 3H2BA 1ODTC 4PC7A 3HR7A 1XWWA 3INGA 4YVFA 2QTRA 4GOND 2WJIA 3GGCA 2XYVA 1WULS 4B9EA 3FPAA 3G8YA 4Q18A 3B60A 4M49A 2ATXA 1G2IA 2OVBA 3MMZA 2IITA 4IX1A 3DQZA 1V35A 2E4ZA 4I5DA 3SIRA 3WJ1A 2AZMA 5ADUS 5KMGA 5K8JB 3MRSA 4K88A 1R9NA 3KLPX 4JX9A 2R1VA 4LYJA 4ZV7A 4C87A 1P5ZB 3DHYA 3PLRA 4YJ3A 2JDIA 4E09A 3LBYA 1GA4A 1P2FA 2VBFA 3LX8A 4BVBA 4FOSA 2VR1A 1IM8A 2B98A 1CJKC 4JYAB 4GQIA 4PHTA 4B6EA 2AB0A 2PT5A 5F7JA 3NHUA 1J0DA 4C4RA 4F5EA 4MIYA 4ZDIA 1FDOA 2E4XA 2QMYA 1YS2X 3K1ZA 1KDZA 2CDNA 3W79A 4OAPA 1U31A 2H54A 1H9AA 3PXGA 3HZOA 3SIPA 1NC1A 1TJ3A 2Q3BA 5AVSA 1MF7A 1RWMA 1XRQA 3BXFA 3T7KA 1SHTX 2NPFA 5C5EA 1THTA 3ZEIA 1H8EA 1UBSB 4FWBA 2IY7A 5ALKA 4ZYYA 2RONA 1CUVA 4RKRA 5JW6A 1E2QA 5GZ1A 2P0YA 2VZ8A 3NWOA 3UMJA 4G81A 1OC4A 1H2HA 1WUTA 2VNIA 2X2FA 1WDMA 3BREA 4JBGA 4LZPA 5C5CA 2I3BA 4G85A 4OSEA 1SU4A 1W4BA 4N5MA 3DVRX 4QECA 3ZQJA 3U17A 2GJAA 1SB9A 5D01A 1A2BA 3ZBTA 3ZDYB 1X86B 5C53B 1NVAA 5EMMA 3ZTWA 4BRWA 3SLGA 2P65A 5LU8A 5E1BA 2YHSA 2P9JA 4AROA 1TIBA 5JISA 1ZH6A 2ATVA 4HQOA 3A6EA 4BFLA 3FHTA 4RQUA 2OENG 2QV0A 3WL4A 5E2AA 4RSMA 2VJMB 1CZKA 1QE3A 2P9EA 2PKEA 4ZU6X 3F3KA 4OB8A 3LRPA 2O8NA 3MW8A 2FLWA 3DZ8A 1UKVY 3KAPA 4HO1X 4DN6A 3QU4A 2EVWX 3FJ1A 5DVZA 4FFPA 2D3TA 4LAFA 2OBYA 2QW0X 1DIRA 5EIXA 1PJQA 1HXHA 4LFCB 2NGRA 2EJCA 5AVKA 1H4TA 3WFJA 1BDIA 5F2EA 1SJ9A 3D8RA 4XFKA 4NYJR 5J5CA 3S8YA 5TV2A 1ZNZA 1IHOA 5LYJA 1YJQA 1B7GO 2VF2A 4KYTA 1XRRA 5AI0A 5KZMB 1B41A 2HFKA 3PC6A 4YRJA 3P9PA 3ZHUA 3O0DA 4YMHA 3AI2A 3W06A 2IXBA 4Y6QA 5C8XA 1HE5A 4ESOA 3LXXA 5CNMA 2P90A 1UXHA 1N2IA 1JA9A 2GJSA 3NU1A 1E60A 4L7QA 3SGLA 3Q7PA 2WYIA 4GKVA 5K3OA 5I8PA 1P1JA 1GSAA 1Y3IA 1Z0SA 1M0TA 2VYVA 3KL4A 4P7KA 5JSYA 2JZOA 4UQOA 1DFHA 1QHSA 3AEKB 3I72A 3TSCA 4BFWA 2FYTA 4B83A 4ENQA 2WTMA 3TKYA 1Q1BA 4N18A 1OI7A 5JE8A 1PIWA 3A06A 1QRTA 1J6UA 2WU4A 3QEMB 2QJOA 4KXXA 1V7QA 5L53A 4KXUA 1IZZA 4YUAA 2XUIA 1WQ4A 3CU5A 4TV9F 3BQ9A 3UAGA 4ASUD 1UK9A 5AVJA 4B34A 1YS1X 1SBQA 5BO5A 3UW3A 4QJ5A 2FPGA 1CUHA 2NPOA 3HACA 4NYMR 3HKBA 5AKZA 3PFKA 1WSAA 3EYWA 3NASA 1CJSA 1B3RA 3C85A 1C7EA 1JR2A 1N3BA 4ISBA 1KIAA 1L7AA 3BSYA 5D87A 1UK8A 2VJDA 3PDCA 4P32A 3P0HA 3PJFA 3PL5A 1SXGA 4RMGA 2R44A 1WEHA 2HNKA 4JVSB 2RIRA 2I6TA 2CVPA 1EZ4A 1P3JA 3GMSA 4M0CA 1SULA 5EUCA 1TA4A 3DS8A 4ZK6A 1QH1A 3MRVA 4CTKA 2YR0A 4OI0A 1C1XA 1D6MA 3JQEA 4TT3A 1WZIA 1DEXA 1EVEA 1IAV