4IJUA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3-yl]bicyclo[2.2.1]heptan-1-ol
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 95
structure length 266
sequence length 266
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijuA00
1I3KA 2VTDA 3RUCA 3SX2A 1ENOA 1PGQA 4MKXA 1EUZA 3ASUA 2Z5LA 4OAQA 4EYEA 5L4SA 4OKIA 3RUFA 1RPNA 3M1AA 4B4VA 4IDDA 2QHXA 1A4IA 2EW2A 5BR7A 1VSVA 4L0QA 2CF5A 3DONA 1DIGA 1F0YA 3ROQA 1E3EA 3N7UA 1EK5A 4IBOA 1E77A 4B3HA 2OGUA 2IZZA 5JDCC 4BNWA 2DM6A 4INAA 4DA9A 4YWJA 1JWAB 4CMAA 1O94A 4E5KA 4R3WA 4DREA 1PR9A 4OQYA 4XX0A 1R0KA 1XQ6A 3O03A 1DLIA 4OQZA 2O3JA 3T7EA 5BSFA 4CM1A 5KWEA 4GX5A 4BNFA 3PYLA 1FDVA 3ZV4A 1QLJA 5L4NA 1NVGA 3RASA 4IGEA 3NTQA 2O4UX 2QW8A 3I83A 4DUPA 5G2OA 2I3AA 2C7VA 1Y5RA 3BIOA 2WD7B 1QYXA 1EVYA 1ZFNA 4ZJUA 4LISA 4IXWA 3DOJA 3D3WB 2P68A 3PYXA 3EY4A 4PLTA 3ICCA 3NT2A 1ZEJA 4WEOA 3QWIA 4GLLA 5JBIA 1HDZA 1B8VA 4PN3A 3H2SA 4TSKA 2AQ8A 1MUUA 4GGOA 4CMIA 1GY8A 3AFNA 3WMXA 4DMLA 1SO8A 1QXSA 4BKRA 4HFMA 2ZB3A 2Q1UA 2V6MA 4OJNA 1ISMA 3PP8A 1YH3A 4TVBA 1OZAA 1U3TA 4MJLA 4RVUA 4Y6PA 4CMBA 4R16A 4ZICA 2DPGA 4WCFB 2X5JO 1JKJA 3I4FA 1HE3A 3GA0A 2H6EA 1PL7A 4GAEA 1P3DA 4LW8A 3DBLA 1Y8RA 3KUXA 2I65A 3ZNNA 3ZH2A 2B5WA 1XSEA 3LSYA 4K6CA 2AEMA 4K6FA 5FFFA 1IY8A 3PYMA 2UUPA 2GLXA 1LUAA 5MGBA 3KETA 1F12A 1GU7A 3T4EA 2PR2A 1ENYA 2RBEA 3ICPA 3RUIA 4CM7A 5GZ3A 3B1JA 1QKIA 2I5PO 2YUTA 4GVXA 3VH3A 4N54A 4FFMA 3IOYA 1YDWA 2CDBA 3PQFA 2G1UA 4WLEA 4WOKA 4CLDA 1LQUA 1S6YA 4PZCA 1VL8A 5L9AA 2BHLA 5L7TA 4BNGA 4IDEA 5A4DA 5IG2A 4P4GA 3WSVA 5JXWA 2NSDA 3H65A 3AM4A 5A9RA 4JROA 1ULUA 4JNKA 4XCVA 4AJOA 1ZKMA 2J6IA 1HDYA 4IZHA 3DHEA 4AJEA 1I3LA 4EJMA 3MJTA 4J4TA 1XWFA 4XGKA 4CLEA 4IJUA 2E37A 2QQ5A 2VWQA 1X14A 2UUOA 2C0CA 1PZGA 1W0CA 4AJLA 5HBRA 1R16A 1OBFO 4XJTA 4J9UE 2JFHA 3ZNOA 2PY6A 2VWPA 3GRPA 4DWVA 5KJFA 1JQBA 3VKUA 1ZSYA 1FDUA 4H7PA 3WGOA 1SBYA 4BB5A 1WWKA 1B8UA 1WP4A 2C2YA 1D1TA 1EUCA 2H9IA 3X2EA 3C7CB 3FWZA 3PWSA 1OMOA 3ZGYA 4KWIA 1C14A 3OA0A 1B7GO 1E1KA 1P33A 4WLVA 1QRRA 1D3AA 5AXAA 4AJNA 4U6QA 1DRVA 1PJQA 2TMDA 2B37A 1GD1O 1NFRA 1XCBA 3KYCB 1HYEA 3WS7A 3WLFA 4HNGA 1G0NA 3RIHA 1U3UA 3TL3A 4YRBA 3U4DA 1A5ZA 4EUHA 1BMDA 5THQA 3NX4A 4E5MA 1QYCA 5I7FA 4OGWA 4QUKA 4XWYA 3WTCA 3MEQA 3NEPX 4GKVA 5EL0A 4BKQA 4R4JA 3KEQA 3VZQA 4NZ9A 4CR6A 2H63A 4RQUA 1MA0A 4TRMA 2AEJA 2XF8A 1J5PA 3TL2A 1U4SA 3AM3A 5GY7A 5GZ6A 3JQDA 3GPIA 3JD3A 4R68A 4DPLA 2Y1DA 1N1GA 4DBZA 1SC6A 3MJVA 4IIVA 3UW3A 1PGNA 1LSUA 2BGKA 3UH1A 3JQCA 2Z95A 4Q9NA 5LDGA 4PRKA 4E12A 8ADHA 2ET6A 1CRWG 5GMOA 1M67A 2CZCA 4BV8A 1RM5A 2QZZA 3Q6IA 5IF3A 2WJPA 5I8WA 2GASA 3HDYA 1AHIA 3O26A 3KLMX 3G17A 2EEZA 3AFMA 5KJEA 3ZHBA 3EZYA 4CM6A 3PZRA 1MP0A 3QW2A 5G4KA 4J16A 1KC3A 3GMDA 3EC7A 3WTBA 5TS3A 4BNIA 1O8CA 4PG7A 3O8QA 5JDIA 1Y7TA 5JY1A 1LLCA 3MTGA 5EESA 1L1FA 3AWDA 5JCJA 5KOIA 3RC2A 4C7JA 1LI4A 5U4QA 2X22A 1P1HA 1FMCA 4RVHA 2CNBA 2GERA 4ALMA 2EGHA 4TVOA 5B4TA 3G1UA 2GN4A 2X0NA 2HK8A 1ZH8A 3C8MA 3VPFA 4TRJA 3DTTA 1AXEA 2NACA 1VL6A 4I5DA 3PK0A 5ITWA 2GN9A 3LT1A 4HP8A 1TEHA 2J3IA 2DBVO 1GPJA 1R0SA 2UDPA 4WEQA 4K28A 1YRLA 3DBRB 4XR9A 3WJAA 4CV3A 2E82A 2VT2A 4URFA 1P1IA 1LDGA 2VCYA 2DPHA 4CPDA 3NGXA 2DUUA 3K31A 3X2FA 3W1VA 2BFMA 3L4BA 5A3VA 4JK3A 1T2EA 4D79A 4LSWA 1U28A 3VH2A 4E21A 2VZ0A 1G0OA 1FDWA 4XIJA 2HMTA 3DO5A 1DRWA 3CKYA 1T25A 2X7HA 1Z6ZA 1UH5A 1UAGA 3K9QO 4F6LA 4CL8A 5T64A 4NBVA 4HXYA 3PGJA 5EINA 4E5YA 2ZTMA 3PHGA 1PJ2A 5JYDA 3BTSA 1ZZEA 4Q39A 4YJHA 4BGVA 3MWDB 3JQ8A 4CM4A 4M49A 1R6DA 4JJGA 3ZWYA 1C0KA 1YS4A 1YDEA 2VUSA 3O8QB 3BMCB 2OXIA 1KVRA 3VC7A 2AQKA 4FOSA 2B5VA 2Y0CA 2ZATA 2RIRA 3DMYA 4UVEA 4LMRA 1A9YA 5DBIA 3A28A 5CDGA 4D0SA 3I23A 1HTBA 4RORA 3UAGA 3GUCA 5EN4A 4AVYA 1PJ4A 3PQDA 5FYDA 1DC4A 1PIWA 4L74A 3CPSA 4BO5A 2FZWA 3H8VA 4NK4A 5A06A 3ETGA 4JJFA 2HMWA 1HSZA 3L6DA 5LC1A 2WMDA 4IDAA 3KOUA 4EBFA 3R3SA 5JS6A 3GY0A 2EHDA 1H5QA 2JFFA 1X7GA 3GAZA 3DDNA 5HTOA 3UUWA 3GOHA 1JLLA 3GVXA 4IMRA 1E6UA 1YBAA 2P9CA 3VOSA 5AOVA 4XIYA 4OHUA 1ENZA 3DL2A 1PJSA 4HBGA 3KM0A 3PRJA 3ZU4A 4IPTA 1AGNA 3QWBA 3WIDA 1E7WA 1XA0A 5HWSA 1DJNA 3ONFA 4JLWA 5KJ1A 4NHEA 2QRKA 3VDQA 2VT3A 1NPDA 2DTDA 3BTUA 1NQOA 4WCDA 4IY1A 1C0LA 3BZUA 3DOCA 3MJ4A 1RM3A 1YO6A 2VHZA 2D0IA 2AQHA 4DRYA 2E4AA 1PTJA 3KYDB 1CQJA 5A5EA 3PTZA 3AU9A 2VUTA 4O59O 5B4UA 4OM8A 4RLSA 4WASA 1RYEA 2R2GA 3I6IA 3WWZA 1DIRA 4RJTA 1KOLA 5T67A 2R6JA 1H6DA 2C82A 4YAEA 2WSBA 3JYNA 3ZI0A 4RDHA 4KUHA 3S2FA 1Z75A 3RU9A 2G0TA 1PS0A 1C1DB 2B4QA 5HS6A 4JX8A 4XYLA 3KSUA 1VRWA 4II3A 3LT2A 5L7YA 1HYGA 3R0IA 5CDUA 4BNHA 4P4LA 3CIFA 3WBFA 5BSGA 3DHNA 3VZSA 3B6ZA 1ZW1A 2DFVA 4LVUA 1P1KA 4WLNA 4ALIA 2VOEA 2FZEA 2PD4A 2Y67A 4F6CA 5A9SA 5TQVA 3UOGA 2Q4BA 5CDSA 1Z73A 3FHLA 4CMHA 1YBVA 3VH1A 2NNLD 3M2PA 4O63O 4CQMA 4E3ZA 1WNTA 4QO7A 4P4NA 3M6IA 4F45A 5ER6A 1Y1PA 3ETEA 4ND5A 2X5KO 2X9NA 1MXHA 1PWXA 3PHJA 4PG5A 4WCFC 1HDGO 4L9RA 2FR0A 3I1JA 4UVHA 3UCEA 5AXBA 4C7KA 2BF7A 5I7SA 1GTMA 1LRKA 4YAKA 1DC5A 3L07A 1R15A 4TKMA 1LDBA 5A1TA 4GBJA 4MVJE 1FF9A 3H3JA 4UUPA 4IQ8A 1XKQA 4L73A 2BMAA 3FSRA 3CH6A 4W99A 4W82A 1XU7A 2Y93A 4Z0PA 3SEFA 1MFPA 4JGBA 1BDBA 3HN2A 3VH4A 4J2HA 4IXTA 4FFPA 5DBGA 4E31A 4B3JA 3AUSA 2VWHA 1JU9A 2Y0EA 3TFOA 3SVTA 1IL0A 3VPGA 3TN7A 1QYWA 4I9NA 1TB4A 2J5RA 3HB4X 1CQIA 3QWHA 3DOOA 3L4SO 2EP5A 3ZNQA 3BMQA 5EERA 4WE3A 1J6UA 1P9LA 2E6UX 1E7YA 5IXSA 2FHSA 3QVWA 4OMUA 1IUKA 4TKLA 3KXDA 5A9SB 4U7WA 4YXFA 3FF4A 4RPLA 3NYWA 4PZEA 3U49A 2EJVA 5ILOA 1F8FA 3NT5A 4GSKA 3TOXA 1TT5B 2Y66A 1EFKA 1PL6A 2IZ1A 1A71A 2O7QA 1T2AA 3QA9A 1ZK0A 2C2XA 3EW7A 1QYDA 4D3DA 5FEUA 2B36A 1ARZA 3VZRA 3S2IA 4RPHA 1P1FA 4FFOA 1Q7GA 4PFJA 4PRLA 3TSCA 1HT0A 3DFUA 2UYYA 3BMNA 3HE3A 4ROSA 4BNNA 4YPOA 5JCJD 1A7AA 3D5TA 3ONEA 3U0BA 1U8FO 1HLDA 3DC2A 3NDJA 3TNLA 3LT4A 2EG9A 2HJSA 2PGDA 1X7HA 3R6DA 3ASVA 3WIEA 1PEDA 3AOEA 2HRBA 4NNJA 4YRDA 2O4CA 5F5NA 4XD2A 1NYTA 2ZYGA 4FC6A 5TJ9A 3B70A 1NNUA 1T2DA 2DFDA 5IJZA 4LRSB 1G1AA 3B1KA 1Y81A 1GZ3A 2FR1A 3ZWOA 3FRJA 4P8RA 1W4ZA 2BFAA 1QR6A 3F9IA 3I4CA 3GC6A 3H9EO 2NTNA 4CJXA 3LDHA 1ISIA 4CLOA 2HQ1A 3VZPA 3UXYA 3BMQB 2V6GA 4NIMA 4MIEA 4J4BA 4ZN6A 4R69A 5F1KA 5G0TA 3K5PA 4FW8A 3RJ5A 5KKCA 3GGPA 2JD1A 4MKZA 1GZ4A 3OJEA 3TFQA 3Q9NA 5JLAA 4N5LA 3GEMA 4ZQBA 2BKAA 4Q3DA 1C0IA 3VVCA 4QFCA 1BTOA 2DT5A 4PVCA 1BXKA 3H5AA 4YQYA 3DBHA 4DLLA 3PIIA 1KVSA 1VE9A 2RHRA 5DCUA 3F5QA 4CMKA 4RF4A 4BO0A 4KZPA 4M86A 4D43A 4JIGA 1NR1A 3D5QA 3CZRA 5TT1A 3BXXA 5IN4A 2IDZA 3WLEA 4KOAA 1U3WA 4DXHA 4PLVA 5HA5A 1UXGA 3RBXA 2HCTA 1P77A 1DFHA 4LRTB 2J3KA 3VPSA 1UUFA 4BNZA 1PZHA 2DBZA 1EMDA 3IUSA 4WOJA 2VWGA 2FSSA 1T26A 4GI2A 3LT0A 4DLAA 1SNYA 3NUGA 1BDMA 5TLSA 4KUEA 1EEHA 1NAHA 1TA4A 1H2HA 3DZBA 2NVBA 1NTOA 1NVMB 4MVJD 4MDHA 5KVCA 3GQVA 2C07A 5JAIA 4MVJH 4BB6A 3K96A 3AY6A 1Z82A 1OAAA 5ADHA 3Q1LA 4UVDA 2O23A 3ZV6A 1Q0HA 2HU2A 2JD2A 2WYWA 3IC5A 2EKQA 1HXHA 3AUUA 3QVSA 4YB8A 3CMMA 3KLPX 4GVLA 3INTA 1Q0QA 1YE3A 1V3VA 5EQDA 3LLVA 4XA8A 1N9GB 2E49A 4WLFA 3OEWA 1Z45A 4XEHA 2JD0A 2QX7A 4BO4A 2DUWA 3GPDG 2WE7A 3GNTA 1WVGA 4MP3A 4RGBA 4AJIA 2GYYA 1I5RA 4F3YA 1Z7EA 1N92A 2Q2WA 5L40A 1E3WA 4TZTA 4NJMA 1LLUA 2VYVA 3CUKA 3EUWA 1ZCJA 2V7PA 5IDQA 3CSDA 4OYRA 1P45A 4Z3KA 4OL9A 2BI8A 3RI3A 1LU9A 1U9JA 1ISGA 1UZLA 3GDFA 4M87A 1YQGA 3N58A 4FIZA 3HJAA 4CMEA 1E5LA 3RC7A 4A2CA 3FTPA 1QP8A 4CM5A 3A9WA 3I9NA 8LDHA 5JDIC 2HK9A 1I3NA 1Q1NA 1B15A 1TLTA 2JHFA 3AI3A 1QORA 2YV1A 1PR3A 5IZCA 3F4BA 4BOYA 3OIGA 4U6SA 5FI5A 3EYWA 4YJGA 5F1OA 2Q4EA 2I3GA 1B2LA 1RKXA 4P38A 4XR4A 1XGKA 4EJ0A 1WDKA 1WMAA 4XRRA 4FR5A 1XIVA 1DO8A 3ZV3A 2RAFA 2AE1A 3U4HA 3L77A 2JCYA 4TRRA 1Q0LA 1T2CA 4WKGA 3H5NA 3H4VA 4W7HA 4EUEA 1U5AA 4N5NA 2OZPA 3U9LA 1OOEA 4YVFA 4CQMD 3GMSA 2POQX 3HWRA 1KYQA 4GGPA 3ZWVA 3G3EA 1DOHA 4W9NA 4WECA 3NDRA 2G17A 3NGLA 1YOVA 1ADBA 3CZMA 3L4BC 3MOIA 4A03A 5B12A 1HSOA 2JAPA 1CWUA 2O3QA 1ADGA 5CG2A 3OICA 3WQRA 1DIHA 4XZ3A 2EW8A 3AY7A 2Y68A 2RCYA 3EMKA 4I9UA 4XRGA 3A1NA 3W4KA 3W4IA 3TF5A 3GZNA 1GQYA 3JYOA 4R9SA 3WGYA 2OMEA 2YQ5A 5CEFA 1WW8A 1KETA 1LNQA 1N7GA 3F4LA 4WPGA 4BMSA 4CQLA 3LF1A 1ADFA 4L4RA 1EE9A 4RVSA 5T6BA 1YB1A 4CUJA 2OFPA 2ZJ0A 4HFNA 2HMSA 3V1UA 5FI3A 3D3EA 1LTHR 3ZZNA 4NU5A 4RO0A 4XYMA 5DBFA 2BH9A 1R0LA 4PLHA 1OC4A 4CV0A 1FDTA 2NTJA 2PH3A 4YJGB 4RZIA 3HUDA 1E3IA 3K92A 1DDOA 3D0OA 3F47A 2Y1CA 1NFQA 1NWCA 2W8ZA 1DC3A 1X13A 3QY9A 4GX2A 4IS2A 3C24A 4JBGA 1BHSA 3WQSB 3QE3A 2YY7A 5DP2A 4CMJA 2VHVA 1DAPA 1EE2A 4R1TA 3A06A 5DDIP 1ZK1A 2JCVA 3OBBA 2B83A 3GFBA 3UN1A 2BI7A 1YQDA 1BXGA 2HSDA 4BNXA 1Z74A 4DC0A 3CE6A 4IJKA 2D5AA 1WXDA 3W6UA 1GPDG 2X8LA 4BKOA 3GVIA 3H9QA 3RKRA 4Z9YA 3ZV5A 1F8GA 2B69A 4FS3A 3JV7A 4NU6A 4BNVA 2Y99A 4I5EA 1L7EA 1VKNA 2AMFA 2A35A 3FN4A 3OEYA 4CMIB 1V3UA 4DIFA 4R5HA 3GZNB 3TZQA 2IYOA 3T4XA 1YJQA 1H9BA 3FNGA 2CDAA 3E5MA 4ZHSA 4ID9A 5JO0A 2DBRA 1MC5A 3DFZA 4GMFA 3MTJA 1V35A 2ZKLA 1LQTA 2QRJA 4YACA 4TROA 1H6AA 4B7XA 4CM9D 3DBLB 1Y8RB 1PJLA 4ALLA 1ULSA 2IRWA 3DWFA 1PGJA 5L95A 3B1FA 2OL4A 3PQEA 1HRDA 4LCEA 4LGVA 1OFGA 1PU2A 4KTVE 2HKIA 1EVIA 1IHYA 1IHXA 1R66A 5ENVA 3E9NA 4BO7A 3BHIA 1YKFA 1KVTA 2YHIA 2V6FA 3ZWPA 4J7CA 4E0BA 2RH4A 1LDYA 5AXCA 1DB3A 1ZK3A 3PDUA 1T4BA 2NLOA 3U4CA 4OXNA 4UVGA 3QWFA 3BAZA 3KBOA 4QX6A 4QECA 2CVZA 2QIOA 4XB1A 3QV1A 1NPYA 4AJKA 3VVBA 4UVIA 1BW9A 4J3FA 3LZ6A 1U3VA 2D8AA 3E5RA 1E7QA 3H9GA 3QVOA 3RFTA 2O3SA 3K30A 4DQVA 5K6AA 4Z0HO 4B8WA 4YQZA 3VHRA 4BUCA 4YJFA 3WYEA 3AJRA 1O89A 1CETA 5KCZA 1K2WA 1XDWA 3VPXA 2AE2A 3K2EA 2I66A 4EITA 3BYZA 3GHHA 5DOVA 3RC9A 1KEWA 2X4GA 5EQFA 1RM4A 2IYPA 4FFRA 3GEGA 3IAHA 5DCYA 5I7VA 3WFJA 2XXBA 3IKVA 1KS9A 1U7TA 2D59A 3NT4A 4YR9A 1A4UA 1R4NA 2IXBA 3IQDB 4MP8A 4O0LA 1I3MA 2P4HX 4TZKA 3KSDO 5JAMA 2NM0A 4U0KA 2X6TA 4ZRNA 4NR0A 4CMGA 1WZEA 4FBGA 3RKUA 3SLGA 1ZUD1 1Y9AA 3JD1A 4MVJP 3PJGA 4D7AA 1KY5A 3D7LA 5ILGA 1JTVA 3OQ6A 1WLYA 2IEBA 1GR0A 4IGFA 4EI2A 4ALKA 3V5NA 2HO5A 5T57A 3HQ4O 4OO3A 4WK6A 2ZYAA 3OH8A 3GF4A 3O4RA 5I9NA 3D4OA 3JQ7A 1SOVA 3HADA 2A4KA 3WQQA 4DIOA 2LDBA 5KVVA 2VYVD 4BO1A 4K9DA 2VHXA 3GR6A 5BNIA 1UDCA 2B4RO 4MKRA 4YJFB 3ABIA 3PPIA 1IOLA 3C85A 3JYPA 3K6JA 3HNPA 1B3RA 1GEEA 1LEHA 3EVNA 2W90A 5JMPA 4LVCA 3V1YA 3I9KA 4GKBA 3FPLA 1DIAA 3KRTA 1GAEO 4NG5A 1EDOA 3L9WA 2VNSA 1D7OA 4NI5A 5CEEA 1I10A 4A0SA 1QV6A 1RJWA 4CV2A 2JHGA 4GQAA 4PLGA 1IPFA 5G4KB 4GMGA 4O5OA 2NQTA 3BTOA 1LDNA 1R4MA 2BGLA 4DL9A 4XQCA 2HLPA 1LSSA 4PVDA 3FR7A 2GD1O 3IS3A 4XGNA 1K3TA 4Y67A 2IXAA 4BMNA 2B0JA 2VUUA 3P2YA 3PLRA 3I3OA 1P31A 4IDFA 2EF1A 3H6KA 1JKFA 1X0XA 3SC4A 2UAGA 1JAXA 3D4PA 3QIVA 3KVOA 4FD3A 1I33A 4MINA 3TWOA 1DEHA 4Y8VA 3PJFA 1LC0A 3RUAA 1WAMA 3H5RA 4MVJA 1P44A 3JQ7B 3QWAA 4Z9XA 3SBOA 5BQFA 3V2GA 3AUTA 1PL8A 4YTEA 2Q1WA 4G65A 1HDOA 3DAPA 4EEZA 3WGTA 2B35A 3I9MA 1VJ0A 5IDWA 2CMDA 2YDYA 5ENDA 1XELA 2X0JA 1HE4A 4IMPA 3ZU5A 3L6OO 1Z7BA 3ZU2A 1V9LA 4O1MA 1NM5A 4CR7A 3JQBA 3EHEA 3OP4A 5ER9A 3GNSA 1LA2A 4S3MA 3D64A 4RVGA 4B7CA 4Y6SA 1D8AA 1EVJA 1JDJA 2WWRA 5ITVA 3G1TA 5THKA 2HK7A 3ZU3A 5A5FA 2AQIA 4OOFA 4HKTA 1E3SA 4LMPA 1XG5A 4H15A 2G76A 2QZ9A 4YJHB 2CDCA 2E48A 3JQ8B 4CM4B 4MVJI 3C3XA 4PLYA 5F21A 1I30A 2NU6A 3JD2A 5CFZA 2C20A 3ITKA 1HLPA 4ND2A 1B14A 2GCGA 4W4TA 3DAGA 5KVSA 4J4HA 3ZWCA 3TOZA 3I9LA 4GX1A 4J9VA 1V8BA 4KDFA 3RCBA 4AL4A 3K8ZA 3GN2A 1GUYA 4J49A 2UVDA 1ZJYA 2CFCA 2YJZA 3PZBA 5J23A 4IJVA 5KJCA 1F14A 5AQ1A 1UDBA 1UXKA 1GYQA 1ISHA 1Y8QA 1Y6JA 1EDZA 3JQFA 2PGLA 1U4OA 4Q3CA 3T7CA 4BNYA 2R00A 1EK6A 3JD0A 3AOGA 2V65A 4Y9DA 3GVHA 3U4IA 1DJQA 2Q3EA 4R5MA 3ETDA 5DT9A 4ALNA 5B4VA 4DQUA 5DZSA 3PVZA 1Y5MA 5EMHA 4H16A 3TZ6A 5B37A 5CDYA 1MXFA 3DBVO 4XQEA 5BNFA 1U5CA 1Q7BA 1DHTA 1UAYA 3PEFA 3ZCXA 5I9MA 3WB9A 3ZHZA 4CLRA 4R01A 4PLZA 1UP4A 3GN1A 4DLBA 4LSMA 7ADHA 2NU9A 2ZIZA 3GG2A 4B79A 1T4DA 1KIFA 2XXJA 2YDXA 3DZIA 4RVDA 1NASA 2HAEA 4ZRMA 5IZCC 2O50A 1V6AA 4PCVA 4BNTA 4OXYA 1A9ZA 3HDHA 4UEOA 3FR8A 4YRAA 4GL4A 4KWHA 2BGMA 4M55A 3OIFA 4IDBA 4IJWA 4PZDA 3IUPA 3ROMA 3V2HA 1P0FA 2OUIA 1PQPA 4FJ0A 4J7UA 4MVJF 1VI2A 2RHCA 1GADO 3OF2A 4N18A 4YJDA 5KJ6A 1ML3A 3WYBA 1H94A 1SB9A 4M54A 3GT0A 1K6IA 4ALJA 1E7MA 4RCVA 2BRUA 4NQZA 2WE8A 2DC1A 2X9VA 1DFGA 1K6XA 1I8TA 2FRDA 2J8ZA 4RZHA 4U8GA 5H82A 3AI2A 1UR5A 4RVFA 2J3JA 1LX6A 3TJRA 2ZB8A 2PK3A 5K9ZA 3BA1A 2QYTA 3WYCA 1TT7A 1UZMA 3JD4A 2AA3A 1Y9EA 1FXSA 2GNAA 2HDHA 1NVTA 3ADPA 4XYBA 1N7HA 1GV0A 5MDHA 1ZNQO 2W2KA 1HDCA 3KB6A 4U0JA 4CQMB 1B0AA 3UGKA 2DU8A 4PG4A 2FMUA 4UUNA 1YL5A 4M1QA 3H9JA 4HY3A 3UF0A 4CV1A 4RPKA 3RBZA 4L4SA 4B3IA 2GZ2A 3U3XA 1I2ZA 1QMGA 4L76A 1NX6A 2OO5A 2OHXA 1YQXA 2W4QA 3TZCA 3ULKA 1CJCA 3VKVA 4KMSA 5CP8A 1A27A 3ZN2A 4EGFA 1VJTA 2PGJA 4RL6A 3ENKA 4CUZA 3ADOA 2HUNA 1DLJA 3ZWBA 3HZZA 5ES3A 4OIMA 3SLKA 4CODB 1DAOA 4YAGA 5L4LA 1O95A 5A05A 3WGHA 2ZYDA 3W8EA 3UFXA 5AXDA 5JC8A 1ZXLA 3NTRA 4AFNA 4IDCA 4N5MA 5DULA 1D1SA 1HZJA 4IZIA 4CM9A 5JSFA 4R1UA 4TRNA 4E2XA 4Y6RA 2Q49A 4ZQGA 2D1YA 4JP3A 5ICSA 4CR8A 3GEDA 4BO2A 1M2WA 3QRWA 3KYBA 2FWMX 1ZIDA 3ZWXA 2AG5A 3KV3O 1EBUA 3CEAA 1JVBA 4XJSA 4LK3A 3DZJA 2W2LD 1NAIA 1RWBA 1N1EA 4AJPA 4K1LA 6LDHA 5I9LA 1CIVA 1J49A 2X9GA 3DB2A 4D45A 1H0KA 3U5TA 1T1SA 4O6VA 4W7IA 2W2KB 2ZTLA 2Y05A 5C7IO 3W8FA 5KKAA 1SOWA 1FDSA 4XDZA 3E9QA 1XU9A 3L9XA 4R9RA 3G49A 2C7GA 3FBTA 3RFVA 5K0ZA 5TF4A 1BSVA 1BGVA 1HE2A 3JQ6A 5AVOA 3S2EA 1WDMA 3COSA 3JQAD 5A02A 2PD6A 3KTDA 4RPJA 3JYQA 4GLOA 2O2YA 4QFDA 1YWGO 1GZ6A 3BMNB 1BVUA 4FCCA 2ZQZA 3GVCA 3SC6A 1LC3A 1SMKA 1T2FA 3ANNA 4M89A 4DIBA 3BMOA 4KUGA 4YT8A 4Z9FA 4FB5A 1YB5A 2VTEA 3IJRA 3PGXA 1ADCA 3AW9A 1HYHA 4DMMA 1IE3A 1NHGA 1VM6A 4HUJA 3I6QA 3QVXA 5DCWA 5JFOA 4FFNA 3SJ7A 2C59A 2FPPA 2YZ7A 1ZK2A 1DBVO 2AW5A 4R1NA 2P4QA 1SAYA 1IZ9A 3JQGA 1SCUA 3U62A 4FSHA 5G0WA 2W98A 2VRCD 1KVQA 2GGSA 4CLOB 2P5UA 4R41A 4UUOA 1M75A 5K6AC 2AG8A 1ZEMA 1NQTA 4UEJA 4J1TA 4TQGA 3S1LA 2VOJA 3LLSA 7MDHA 1MG5A 4FN4A 3AU8A 5A3JA 3IJPA 4JQCA 2Q99A 2HRZA 1KC1A 3RFXA 3EK2A 4BO9A 5F1PA 3DBHB 2YV3A 3VPHA 4UULA 2EJWA 1S7CA 4D42A 4E6PA 3IKTA 5G0UA 3GFGA 4X54A 2TMGA 4ZQHA 3DZKA 2FY8A 4XB2A 4AJ1A 1U2GA 3RUHA 3F3SA 2A94A 1R12A 1YGYA 3D4NA 4IS3A 3HFGA 1JVSA 2ZCUA 3OQ1A 4ILKA 5KNLA 1XYGA 1JN0A 2GSDA 4PG6A 5FF9A 3F5SA 1PWZA 4G5HA 4CM8A 1HZZA 1NP3A 1PSDA 3BMOB 4BO6A 3AUAA 4RPGA 5TGDA 2P5YA 1M66A 3GVPA 3DTYA 5KVQA 1LDMA 1EQUA 3DMTA 3LYLA 3R3JA 1K6JA 5CPBA 2QG4A 1AN9A 4KTTE 4Q3AA 4WLUA 1MLDA 1WPQA 4WCFA 5JC1A 3Q0EA 2NU8A 1PJTA 2NVWA 2WM3A 3STHA 3FPCA 4ZVVA 4D46A 1EBFA 2OOSA 4HADA 4BQRA 1GFSA 3JQGB 1BG6A 2IEDA 3IMFA 3CXRA 2AEFA 4UEKA 3BHJA 4EZBA 2D3TA 1TXGA 1E1LA 4W6ZA 1XR3A 4RV9A 3QP9A 4IINA 4ITUA 3NV9A 1E6EA 3WWYA 1K89A 3QLJA 3C7DB 3F6YA 3ST7A 4NJOA 1ONNA 4BV9A 5HM8A 2DTXA 1E7RA 1HF3A 3UHAA 2WD8A 3H9UA 3NJ8A 1E3WB 4NJMB 1PZEA 1PX0A 1E0DA 3SXPA 4FDAA 2GR9A 4IDGA 4BO8A 1UZNA 2VHWA 4CM3A 1VL0A 1CYDA 5L45A 1PGOA 3INRA 3ZHYA 4A5OA 3E03A 4DPKA 3ANLA 2PWZA 3GUYA 4E33A 3IIEA 1HDRA 4J6FA 1E1MA 4E13A 1FJHA 4J43A 3F1LA 1XHLA 1V0JA 4XYEA 2CVOA 1D4FA 2H1SA 2PKQP 4CM8B 4Z3DA 2JAHA 1GQQA 4B4UA 3JQEA 1HETA 3MCVA 4BVAA 2EXXA 1GL3A 3KSZO 2Q45A 3NDIA 3JQ9A 4WGGA 1ENPA 1MX3A 2HMVA 3WGGA 2X5OA 4UAGA 3ZHXA 5BT9A 4YDRA 5FWNA 1JKIA 2VYND 4B7UA 1W6UA 1OC2A 4LCJA 4XYGA 4AJJA 5CEJA 1VC2A 2O2SA 1M76A 1HWYA 3Q3CA 1YXMA 1PJ3A 2NUAA 2PNFA 3R1IA 1GV1A 3WGQA 2FSVA 2VZ8A 2WYUA 2WTBA 4MP6A 1G6KA 5JO9A 4BNJA 3ROKA 4BHTA 2ZTUA 4ND4A 5C7LO 3RJ9A 1U1IA 5JMWA 1M6WA 3WOHA 4II2A 1JA9A 1DXYA 2DTEA 1E7SA 3HDJA 3PWKA 3KYCA 4H3VA 2H5LA 1YOVB 1U7HA 4U5QA 4A10A 3Q9UA 3TRIA 4EEXA 1F06A 4WNCA 3V1TC 3I52A 3OJFA 1GCUA 1XQ1A 2FP4A 1OI7A 3JQBC 3OJOA 4HV4A 2DKNA 4OXKA 3UICA 2I67A 4NFHA 4XGIA 3TDKA 3RVDA 1GUFA 2PKQO 3OETA 3B20A 3RUDA 4CQLB 1MFZA 3S2GA 3E1KA 3IP1A 3NTOA 1M6HA 1I0ZA 3MJSA 4I5GA 2ZK7A 3LK7A 3UCXA 1E92A 3N74A 4J90A 2Y1EA 1LLQA 2PV7A 4ZGWA 4BNKA 4EDFA 4WUVA 2G82A 1EQ2A 5COQA 1T1RA 5HRUA 2EWMA 3PFWO 5JYEA 2PZLA 1ISFA 3DZGA 1ZSNA 2A92A 3L6EA 5BSEA 5G0SA 5CG1A 3FI9A 6ADHA 1E1NA 1ZVMA 2J5QA 3PJDA 1YVEI 4KQWA 1I01A 3VAZA 5CPFA 1IB6A 2PTGA 2GO1A 2EV9A 1O5IA 4BKPA 4B8ZA 1E5QA 1MGOA 4Z0TA 3OA2A 3I9JA 3PDJA 1R37A 1YONA 4ND1A 5I8ZA 3PJEA 3V8BA 1WMBA 1BXZA 1UP7A 1YBMA 1GEGA 1I32A 1H6BA 3GH3A 5A9TA 3I9OA 4RF5A 3JQFC 4JN6B 1I2BA 3WNVA 2NU7A 4D3SA 2IZ0A 1E3JA 2R00C 1H6CA 3MJEA 4AG3A 4BNLA 1BXGB 4E4YA 4FQ8A 3DZHA 1ZMOA 4NBUA 3TZHA 1TVEA 3QJ5A 2X0IA 1BRMA 4D41A 2QRLA 3UKOA 4WNIA 4QTZA 2CSUA 3OFSA 3ONDA 2X23A 4YT4A 2GZ1A 3IP3A 1LDEA 2FOIA 5JAZA 2DLDA 1I36A 3GK3A 4J1QA 2X86A 1AE1A 1X1EA 2CD9A 3V2UA 4D44A 3BTVA 4DVJA 1N2SA 4PG8A 4NFSA 3AM5A 3A4VA 4R1SA 4DYDA 4P22A 2PLAA 2LDXA 1O6ZA 4IQ0A 3DBRA 3WJ7A 1H9AA 1QG6A 2DBQA 4RF2A 2PFGA 5JCXA 1AUPA 1HEUA 5T8KA 3TQHA 2BD0A 4R51A 3GDOA 5IZ4A 2Z1MA 3OQBA 1H2BA 5H81A 4GPD1 3NRCA 4DGSA 2C29D 2CUKA 3E8XA 1UXJA 4YAJA 2BLLA 5U1PA 1IULA 2EP7A 3FCOA 4BGEA 5C5IA 1X15A 2WYVA 1GQ2A 3RC1A 4YEDA 2VRBA 3FD8A 5DF1A 2YHIB 4MPDA 3NJ4A 2Q46A 4HX5A 4YBZA 4M8SA 4L75A 1YJ8A 4PLPA 1Q2XA 2RH8A 1LSOA 2P91A 3E6AA 4FFLA 3RD5A 1KVUA 2G5CA 1XLTA 4J91A 5DN9A 3UVEA 2GRAA 3PFFA 1DC6A 3WX0A 4F46A 4FJ1A 2NVUA 4QEDA 3BMCA 3OHSX 5F5LA 1BW9B 1E3LA 2P2SA 4RF3A 4R3NA 4A73A 3H2ZA 3EDMA 4E5PA 1RM0A 3K2BA 4D0RA 5JDCA 1A7KA 1EVZA 2Y1FA 4HWKA 4J1SA 3GLQA 5BNTA 1VLLA 1DRUA 5TJHA 2X0RA 3PHLA 3E18A 2EIHA 4Q3NA 1V3TA 1VKOA 4TMFA 2W2LA 3IDSA 5COBA 4OH1A 1I2CA 1P1RA 3GGOA 3FNHA 3ZWMA 2YFHA 1ZMTA 3INGA 3Q2IA 4HFRA 5DNAA 2F00A 3KEOA 4QSMA 2XOXA 5L51A 2VNAA 4BS9A 4FGSA 2O3RA 4NBRA 5IAAA 3AI1A 3QHAA 3GRKA 2I76A 2BFOA 2GF2A 5TX7A 1LLDA 1KEUA 3WXBA 1R4NB 2PZJA 5KIAA 3AOEC 4K26A 2VN8A 3AY3A 4YA6A 9LDBA 2D5CA 1MV8A 2PKRA 3JQAA 1B8PA 1P0CA 3EZLA 4IUYA 1DIBA 2Q50A 3DAFA 1LRJA 1WDLA 4A26A 1GCOA 1QV7A 4MVJM 2HJRA 5EPOA 5CAEA 4GSLA 4BNUA 4E30A 1KEVA 4KQXA 1C0PA 1UJMA 4WLOA 4BQPA 3PHIA 4Q3EA 2CY0A 4NBTA 2CF6A 2DAPA 1N5DA 4ZA2A 4E2YA 5L53A 1KERA 3S8MA 1DPGA 3KYDA 2JCXA 3FWNA 3H3FA 4NPCA 3HSKA 3W8DA 2OP0A 2Q2QA 1VSUA 3JCZA 1QYVA 3LU1A 3WNQA 3DHYA 2A9FA 3DZFA 2NVUB 3GG9A 3ENNA 1NHWA 3G79A 2Q1TA 4AJ2A 4AJHA 1O9BA 1BWSA 2GN8A 1VJ1A 1C1DA 3AK4A 3JTMA 1LSJA 2VRCA 2DQ4A 4ONEA 3K73O 3W6ZA 5GZ1A 5IXYA 4L8VA 3KHUA 2J5KA 9LDTA 3ZNPA 4A27A 3W4JA 4DTIA 4PLCA 4Z6KA 1ZSVA 3OIDA 3GDGA 1NQAO 4NK5A 5JAQA 1N8KA 4J0EA 3WMWA 5ICMA 3ZW8A 2Y1OA 1W8DA 1HDXA 3RUEA 2X1HA 5TIIA 1B16A 2O3UA 3DXFA 2X58A 3ORFA 4B4WA 3ZWNA 2VQ3A 3DEYX 2VZ9A 1B26A 2UV8A 5LCXA 2PZKA 3GZ4A 5C37A 4J1NA 1K5HA 4ZQFA 3GHYA 3WR5A 1JW9B 5JW6A 1PZFA 4KDEA 2C54A 4R54A 3LC1O 3F1KA 3OM9A 4TWRA 1IZ0A 4Y98A 3M2TA 1NBOA 1NR7A 1R4MB 3FTNA 3JQAB 3OJLA 3LVFO 4ZU3A 5IN5A 2D2IA 5DP1A 5COAA 3ZW9A 3O9ZA 4UUMA 1PS8A 1SZJG 2NTVA 2O3TA 1LJ8A 4ZD6A 4QT0A 3PLNA 3Q2KA 3WICA 4Q3BA 2GUGA 4ESOA 3MOGA 4CMCA 4NMHA 3TPCA 4FJ2A 4YAIA 3BHMA 5IDYA 3HDQA 2I6TA 3LC7O 2Y1GA 4BO3A 5CHEA 1X1TA 2Q1SA 4UREA 1RYDA 3RROA 3PXXA 4RQTA 4JXKA 2FR8A 2FPIA 4BIIA 4DPMA 4J7XA 5TT0A 4JP2A 5L7WA 4BNMA 4N7RA 3VDRA 5C7OO 3DQPA 2JL1A 5F3RA 1DFIA 2NQ8A 4HFJA 4FC7A 4XQ9A 3MZ0A 3NAQA 5KTKA 1HE5A 3C1AA 3HFSA 3PWZA 4XDYA 3QQPA 4AICA 2O7SA 4I1IA 4IM7A 1U2DA 3L0DA 4EJ6A 5LDHA 1SEVA 3RSHA 2GDZA 2BELA 3S55A 4MIYA 3ON5A 3CTMA 4I8XA 3LF2A 3QVTA 3ZDFA 4BGUA 1JAYA 4CMEC 3VTFA 2Z1NA 2JJYA 2VHYA 2ZQYA 1QSGA 3RBVA 2PH5A 2ZTVA 3TZKA 2OORA 2YYYA 5HS4A 3MWEB 4MOWA 1MG0A 3M1LA 3RQSA 4FGWA 5JE8A 3DMTC 1TT5A 3KO8A 2YW9A 2PZMA 4QO8A 1W73A 1ZBQA 2Q2VA 3DR3A 2YQ4A 3E9MA 3CINA 5TRTA 1QLHA 1EZ4A 4XQGA 1ORRA 1KY4A 3ANMA 4WJZA 4XKJA 5CDTA 4CUKA 4EW6A 1SPXA 2GN6A 2PA3A 3EGOA 3NKLA 1MB4A 4NBWA 4NFYA 2ILTA 2P9EA 1PJCA 4C4OA 2YFQA 3OJ0A 3EAGA 1NFFA 1GDHA 3JSAA 4MIOA 1TI7A 1J4AA 2VYNA 3RAJA 5C3MA 4NH4A 5EIOA 2J3HA 3WSWA 2WEKA 4BGIA 3E48A 3HHPA 4OSOA 4I5FA 1IYZA 5AYVA 2JFGA 1LBEA 1ID1A 1NPTO 2DVMA 1Y8QB 5U9CA 4W9NC 3ROPA 5L3ZA 4GH5A 4LN1A 2WDZA 1AXGA 4B4OA 5IDXA 2C5EA 4JBHA 5A04A 4I08A 4PLFA 1C1XA 1CF2O 3C7AA 4A7PA 1YL6A 3RWBA 4HNHA 4E5NA 1KEPA 2OBYA 5JPIA 4FPXA 2O48X 4DQXA 3IL2A 1P1JA 1YL7A 1CERA 1JWBB 1UXIA 5B1YA 1ZJZA 4I9HA 3PHHA 3C1OA 3ZWAA 4CLRB 1ZO8A 1PQWA 1X0VA 1SEPA 4GX0A 1NXQA 5T5QA 2YHUA 3P2OA 3EVTA 4E32A 1ONPA 2IE0A 2EGGA 3QSGA 4DBVO 3JYLA 3C1TA 3ITDA 3A14A 4DC1A 1PQUA 1VPDA 3JQ9C 4G2NA 5TSDA 3ZWWA 2SCUA 1UXHA 1LRLA 1PGPA 3P19A 2I99A 1WZIA 1CEQA 3P7MA 3SJUA 3FBGA 2GZ3A 2V6BA 1ZXBA 2OP1A 1BVRA 1ISJA 4NDNE 4E2ZA 3WFIA 1A72A 5IFLA 3GAFA 3F46A 1EUDA 1ONOA 3U09A 1DHRA 4YT2A 4GWGA 3WGZA 3KZVA 4L4XA 1P74A 1AHHA 5G0VA 1O0SA 1LXCA 1U8XX 4GWKA 1B3BA 4QXMA 4YT5A 4JCOA 1E6WA 2FPGA 4CL3A 2YV2A 2XAAA 4PGFA 2FN7A 3MJCA 4DYVA 1C1XB 2P9GA 5JNLA 4OSPA 3WBBA 3WGIA 1UDAA 4ND3A 5A03A 2D4AA 2EKPA 2PD3A 4G81A 2ZB4A 5I7EA 3P5SA 2ZB7A 4BKUA 4PIVA 4MVJG 1GUZA 3CMCO 3HN7A 1SB8A 1N9GA 3GGGA 4E2WA 4CLXA 4BMVA 1XEAA 2JKVA 3Q11A 2AHRA 4MO2A 3LQFA 5H83A 1I24A 4OKNA 4AJ4A 3OSUA 1YB4A 1NQ5A 2IODA 3PI7A 4S1VA 2GPTA 1J0XO 2EERA 1PS9A 2F1KA 3I5MA 4J2OA 2CVQA 1T24A 4ZQEA 1CDOA 2ZCVA 2XPCA 2QYSA 4CLHA 1GYRA 3WG9A 2C5AA 1L7DA 3HB5X 1HL3A 3H7AA 4RDIA 3VTZA 3D1LA 3OMLA 4QQRA 3FNEA 5JY6A 1X7DA 5TC4A 2BFPA 1IPEA 3G0OA 1Q7CA 3UCFA 1ZK4A 2EKLA 4OOEA 2NADA 5EJ2A 3GNQA 1K0UA 2AXQA 2HMUA 2Y0DA 4JJIA 5G4LA 5BSHA 2ZJ1A 2NWQA 1NWHA 3O38A 5DOZA 1FK8A 1DSSG 1KBZA 2OBNA 3WDSA 1GYPA 3RU7A 3PIDA 4RLHA 4YCAA 3OECA 2WD7A 2B4TO 4IQGA 2NV6A 4IIUA 4JBIA 1C3VA 1MC4A 1EFLA 4PLWA 3D3WA 4J0FA 5T8KC 3HG7A 4YYZA 2I9PA 1F17A 4D3FA 4FOOA 3LC2O 1H93A 3FNFA 3E82A 1UP6A 4BL5A 4KP7A 1HKUA 4EUFA 5TNXA 1PJBA
chains in the Genus database with same CATH superfamily
4FGJA 4P2BA 4DCNA 3EMVA 3MWJA 4PF1A 3RUCA 1ENOA 3D3NA 4MKXA 1EUZA 2WUDA 2Z5LA 3UB3A 3O3MB 4QUAA 4BLSA 5L4SA 4A0QA 3ZOZA 2NYAA 4OKIA 4EW1A 3VJLA 1RPNA 3P20A 1CR0A 2QSUA 5KSWB 1AV6A 2J7PD 2KW5A 2I3DA 3ZXXA 5KOJA 2L17A 1E96A 1XLTC 2WICA 4DBLE 3EXFA 3LD9A 2JFOA 1VSVA 1J2EA 3QPWA 2VHTA 1CB7A 4QXAA 3ZTYA 1W19A 3E35A 3D6JA 4MA4A 1AGYA 3H2BA 1YR2A 3DONA 3OTHA 3B53X 3ROQA 1R8SA 3BD7A 2ZAGA 3N7UA 2CDNA 4QBFA 3CR3C 3BEOA 3WGVA 2OGUA 5FOXA 3AVOA 3MJDA 3I58A 3H11B 3L7KA 1IY0A 1KYIA 3L7BA 1DKNA 3FYCA 1IXRC 3OZCA 4GOKA 4K3VA 3A6JA 5CLLA 5TF0A 4R3WA 4F4UA 4DREA 1OH5A 3RRBA 3PC2A 5IANA 3U6KA 2O0LA 4U5XA 2AX3A 4IW3B 3FPKA 1MH1A 3NTVA 4B6SA 2BMEA 2HJWA 4C6TB 4KIFA 3BGOS 4LJ9A 3B89A 3R3YA 1UKCA 4H0NA 3ZV4A 3PF9A 5CIWA 3UBTA 4L5IA 2PUTA 3EIUA 2ZE8A 2ZSKA 3OCCA 4KVGA 2RGUA 2C7VA 2X4IA 1EDDA 4E4TA 1TD9A 1SC1A 4YMGA 4IXWA 4ZJUA 2IZ7A 3O94A 1CQXA 3QOXA 5K3DA 3ICCA 1TM2A 4KODA 2P1RA 2B3TA 4AKTA 2R2AA 3K70D 4JSRA 1J56A 3QWIA 2J87A 3C45A 1U8TA 2OAQ1 3H2SA 1JHAA 2EQBA 4IKPA 4GGOA 4RK1A 3CVYA 1RLOA 2HHLA 1QXSA 1DBPA 2ZBUA 3I4LA 1JEDA 3MQ2A 3R5SA 4X61A 4BJ5A 3EC1A 2HFKA 3M6WA 5HIAA 4FFBA 3RAFC 4OJNA 1VHTA 1OYYA 2JLXA 1WR8A 4MQFA 2DFPA 1OZAA 4W1SA 3TJZA 3GUUA 1KZYC 3UV7A 4EH1A 2OFWA 2IOHA 4R16A 3U7GA 2HHAA 1KYXA 2INGX 3SX0A 1AIPA 4DCJA 3N75A 1JKJA 3CN9A 3GA0A 3I4FA 3N8GA 1QOPB 1RLTA 3BG5A 4TGLA 4LW8A 3DBLA 5E9WA 5HRUA 4G9BA 4AP6A 1MOPA 4R0VA 1DQZA 4PPGA 3VU9A 5B2FA 3RT9A 1Z4IA 4ISCA 3O1JC 3FOBA 3EOZA 1AA6A 1XDBA 1JB9A 2I6UA 1FEZA 1IY8A 3PYMA 2UUPA 4XFDA 2VHEA 5CR9A 5CVJA 2Q1XA 3HXQA 5GONF 3GGCA 5CIYA 3VJMA 1ENYA 2QSZA 1YBFA 4IG9A 5JSYA 4F3NA 1IFXA 5H1YA 5MN5A 1P2VA 3UPDA 3RUIA 1NM5C 2BOVA 4CM7A 3E3AA 4OXIA 5DTEA 5FNVF 1EEXB 3RHTA 3EQ6A 1G8FA 3FUXA 2BISA 4QTUB 4YCLA 2JANA 4Q0MA 2DETA 4EYQA 1EFVB 2XMQA 3M4NA 3K1ZA 2AG1A 3HUUA 3QVJA 4WLEA 4CLDA 5ESDA 1OJLA 1VL8A 3PNSA 4PZCA 4L0DA 1FP2A 5CM2Z 1Q0UA 4UZFA 3ZUPA 3RVLA 2J5XA 4IDEA 4BNGA 5L7TA 4MUGA 1AQYA 5JH7B 1PLJA 1CY4A 5JXWA 3O3OB 1RZRD 3A9SA 2J4FA 3GYBA 2OV6A 4JNKA 4AJOA 1L4EA 4LHYA 2JF0A 1DT3A 1WS6A 4IZHA 1TAQA 3DHEA 3I92A 5HIJA 5BO5A 1I3LA 3NBZC 4EJMA 4JOBA 3EAQA 3ED1A 1XWFA 4FX5A 4HGNA 4J4TA 4MMXB 4UHBA 2DFTA 1CUVA 4IJ5A 4CLEA 2PUDA 1E89A 3SYMA 3K0SA 2FFRA 2UUOA 5EIXA 1YI1A 2C0CA 2I87A 5EMKA 1FYVA 4EY3A 1SVMA 5HBRA 2C2BA 2G28A 4L5YA 1U0JA 4IIGA 1EM8B 4N3BA 5IW8A 3P0RA 2JFHA 1EFRD 4FYJA 5SY9A 2P8SA 2QAJA 3TEFA 3DTVD 2WWGA 3THSA 4DWVA 1FDUA 2OB1A 2NUAB 4BB5A 2ZJBA 4JLJA 3B78A 2H9IA 3CPEA 2NYUA 2ARKA 3E7FA 5JS8A 2FR8C 2C2HA 3C7CB 3PWSA 4INPA 4XM0A 1C14A 3OQOA 3HM2A 1W0KA 3GFOA 4ZAYA 1WABA 1P33A 1K5GA 1QRRA 5AXAA 4EHDA 1V9CA 1P9OA 3IVAA 4XDHA 3DBIA 1T5SA 2RARA 4XD7A 2G9NA 1U5BA 3I30X 2TS1A 5FJJA 1T3HA 5B6IA 2BMVA 4M7OA 3WLFA 4EKYA 5LMCA 4YMUA 2OD7A 1JIQA 1S3FA 1MHTA 4ZYWA 5IAKA 3TL3A 3G89A 3EIXA 1A5ZA 3ADKA 4MITA 1K7CA 2VS1A 4ZVKA 2CNLA 4Z4CA 2FP4B 1IN8A 5DMXA 3NX4A 4Z9BA 5THQA 3GQBB 2EDCA 3TBHA 4DHEA 1UWLA 4B3BA 4OGWA 4XWYA 4A2PA 4BRUA 5FWYB 3NEPX 2AJBA 4GKVA 4NCIA 4BKQA 5KQGA 4G0WA 1G9XA 3KEQA 4IDOA 3SYRA 3VZQA 1GJRA 2GX6A 1M2NA 1MA0A 3A9VA 4RQUA 2Z09A 5CFLA 2AEJA 2OORC 3EVBA 5IHPA 2C00A 2XF8A 1J5PA 1CBUA 1FX0B 2AD1A 4GVPA 1ORIA 2G9ZA 4KO1S 4W8OA 3TL2A 5GZ6A 3WYGA 3KQHA 1PFYA 3JD3A 1M0SA 4WBNB 2ZWPA 2ZYRA 3NHPA 1ZGBA 3SZUA 2X6QA 3WLOA 1UOEA 4DIDA 1MJNA 1SC6A 3GJ5A 4Y9RA 1QOZA 4QU5A 3WGJA 4BVHA 2HDNB 3CWZA 4PHGA 4ZO4A 3VNBA 3HFRA 1I94B 2WG1A 1M6VA 4PRKA 3LP8A 2D7JA 1IM8A 2DSNA 2VJYA 4Q05A 1PUJA 2H1LA 1EA5A 1AGPA 2CZCA 1T10A 2R7KA 2QZZA 3Q6IA 4FLEA 2WJPA 3TSYA 3TQRA 1V7ZA 4HEQA 5I8WA 1AHIA 3GRZA 2PA0A 2AR7A 4TWZA 5FA8A 3WVNA 3HJTA 3AVXA 1CNEA 2BZGA 3HKBA 3AM1A 5KYUA 3BCUA 2YWBA 4MHSA 5KB3A 3MVEA 3PZRA 4K9KA 2GBPA 2SBTA 2QRZA 3CKLA 2QTGA 3WRYA 1H8EA 1U7ZA 2R7AA 4LDRA 1SXJD 4A0RA 4BNIA 4PG7A 4YQFA 4H2DA 2GRUA 1D4AA 2LKCA 4PU0A 2G9VA 1LI7A 1M1NB 3AWDA 3R0QA 4QHTA 5JCJA 1L1FA 3VYSB 4D9NA 1DE0A 1JHMA 3RC2A 1GDDA 1FMCA 1DAFA 3IT1A 3PUKA 4A03A 1F2UB 4GWLA 3G1UA 5FI1B 3H0KA 4JKOA 1ZN2A 4HH1A 4K9SA 3C8MA 1O8BA 3JALB 1OBVA 3K32A 2VDWA 4L1KA 1AXEA 1VG1A 1B6TA 1ES9A 2CL7X 3DWIA 2OQVA 1ZOOA 4JV5B 2OCPA 4OB7A 5ITWA 2JH3A 3M9XA 5DGCA 2OTCA 1X1AA 2ZWOA 2DBVO 4UBLA 1HTTA 3A10A 1R0SA 2UDPA 3SQDA 5LVAA 4FE3A 4YMHA 4HXGA 3WJAA 3O82A 4CV3A 1PZMA 2XNCA 3BZWA 5ERXA 4NC9A 3LUAA 2X42A 1WKVA 2Q5CA 2VCYA 4EFDA 1GRVA 3NGXA 2H57A 3X2FA 1E2QA 2BFMA 2FVXA 3L4BA 5D5PA 1N4AA 2VLBA 1T2EA 5JU6A 5EXEA 1R00A 1OT5A 3VH2A 4DUGD 1RXVA 2A9VA 1FFBA 3NVKI 3ASZA 3PPWA 2HMTA 3CKYA 3VO2A 4QASA 4X8OA 3KLOA 3STTA 4OI0A 2YRXA 3EQZA 1Z6ZA 2XGOA 4CL8A 5T64A 3UHPA 4NBVA 2OO3A 4FI3F 2OLJA 5CT4A 2ZI6A 4HXYA 3PGJA 2JJQA 4IH1A 5EINA 4EMBA 3IV7A 1Q20A 5ED0A 1N0VC 3NTXA 1NUHA 3A3OA 2PZFA 3PHGA 1DAHA 2MSLA 5FX2A 4P36A 4Q39A 1N2BA 1T15A 3DH0A 4K9OA 4YJHA 4BGVA 1XVUA 4CM4A 3OX4A 3KT0A 1VQ1A 2QYHA 1ESZA 1CD5A 1YS4A 3T9BA 2O19A 4GI3A 1QHYA 2IV3A 2OXIA 1FFXB 4Y2XA 4D9HA 1XP8A 1V2GA 3OE4A 4FOSA 5FLEX 2XWQA 2ZATA 4UVEA 1DNPA 1ZUHA 4IFTA 1QQ6A 4LMRA 2R1VB 5CJPA 3FZNA 2YN0A 5DYNA 3I23A 1HTBA 1NF9A 5EN4A 1F20A 5JZVA 2X9LA 3PQDA 3IAEA 1PIWA 2W8BA 3O47A 4L74A 3TIIA 3CNEA 2GTHA 2FV8A 4NK4A 4JJFA 3NDPA 4F8JA 5A06A 1J42A 4JI1B 1W2HA 2GKOA 1E6MA 1GNRA 2JGJA 1GRQA 1X7GA 1HQKA 3TK1A 4OQPA 3HZOA 1Y6GA 3FUWA 3TIFA 1DXQA 5ALWA 1TNDA 4LTDA 4PFKA 1YRBA 3LX5A 4EFNA 1QQ5A 2ZSJA 3EZGA 4R6XA 3ELBA 3R77A 4N65A 4KR6A 3O8LA 1JU4A 1JL3A 1MIOA 1Z8HA 2HI0A 3IYLW 5E38A 2BT4A 1AG9A 1T2UA 1LD3A 1XZ8A 3KM0A 3FMOB 1NSTA 4I14A 2YOHA 4B2LA 1AGNA 3QWBA 2GAFA 2FF5A 3ZR4B 3ONFA 4MR9A 4JLWA 4I3GA 3TRHA 3SJAA 2CHQA 1RXEA 3VDQA 2VT3A 4HSGA 4JC4A 4RKRA 1PBTA 1KTIA 1XMQB 1E9AA 1CP3A 2Q6VA 3G1WA 4I6GA 4DR3B 4O2BB 4EVSA 2JIOA 2QUJA 4LE0A 5AK0A 3N07A 1YZ3A 3MJHA 5EIAA 3VR2D 3WA7A 2AQHA 2JGAA 3P0EA 1BRTA 4FKMA 5A5EA 5B57C 4M9SA 1DG1G 2VUTA 3AU9A 4O59O 4P5DA 5JQGA 1U0RA 4O4HB 2H1FA 1RYEA 1SVUA 3WWZA 4RJTA 1KOLA 5T67A 1A76A 4DWWA 2B2NA 4DDTA 3T1TA 4YAEA 1NYLA 3JYNA 1NF3A 5TR9A 3SDSA 3HCRA 1XMJA 1YQ9A 3FM9A 3LX6A 5K0GA 3FG9A 4XM1A 1TUGA 3AHFA 1SKYB 2C96A 3RU9A 1VECA 2QY6A 2G0TA 3EVZA 1G5HA 1C1DB 1PR5A 1L9XA 2QIPA 2W4IA 1ILWA 4RYDA 1IRXA 2V7TA 4IIEA 4MI3A 2G77B 3HFJA 1JEAA 1UODA 3LKDA 4YRSA 1JZSA 2DEUA 3OY7A 4P4LA 3CW2A 5ALUA 2RAVA 3WBFA 3THYA 3B6ZA 4YUVA 1A97A 3L7YA 2HA7A 1Z2OX 3OQJA 1G59A 5IARA 1P1KA 3A1VA 3ILSA 1HFJA 5F2NA 3FLEA 1NW7A 2QF7A 2ZRJA 3N3AC 4IIXA 3OT1A 2NV2B 3WK7A 1J09A 2HTFA 3SE7A 1D9XA 5TQVA 4F6CA 5A9SA 3GLIB 1Z73A 5DWVA 3HS3A 5EEHA 1BNCA 2VDLB 3GO4A 4ARVA 2BL4A 4YHBA 4JQSA 2C99A 3Q5EA 4Q6BA 4FFWA 5ALSA 5HR5A 4E3ZA 1WNTA 3W6OA 1JILA 4QO7A 4IKOA 5TARA 5MFPA 2RGCA 2F8SA 4BB9A 2V7XA 1Y1PA 1Q12A 5ER6A 4YPVA 2AZXA 3EUFA 2X9NA 1JMKC 1MXHA 2O7VA 3JPWA 3PHJA 4M0MA 4PG5A 3SMVA 3KFLA 1RRCA 1E69A 4WCFC 4UM9D 3SAJA 1I3OA 3CE9A 4GXQA 4P6VF 4C29A 1DIOB 2O5RA 1GTMA 4IV0A 4GM4A 1TAGA 5DLQC 3UYLA 1DC5A 2G83A 1C7ZA 1I6LA 2D3WA 2VXYA 3OQHA 2ISQA 5ES4B 1A96A 1NW3A 1WETA 4IQ8A 1BROA 3AONB 1TFRA 4AO6A 2ZT5A 2IHVA 4Q3LA 3FYSA 1TMKA 2EATA 1G19A 4DEYA 2QTTA 1FQKA 3CH6A 3CLRC 3OJXA 4XSHA 2YN2A 3THXA 1JHDA 2DWUA 3C3EA 3FLAA 1P0PA 1FSFA 1YZYA 1G98A 4J8PA 4MUJA 2ADMA 4MUNA 3DHWC 4CQJA 4G0UA 1BDBA 3CF0A 3VH4A 2XVAA 1RWNA 2HBRA 2C8JA 4FFPA 5DBGA 3A1WA 4E31A 4IDNA 1U0GA 5TMEA 1RKVA 3HY6A 3QNUA 4ETWA 1SH7A 4L15A 1XRSB 3RFCA 3SVTA 1QHGA 2G8NA 4OFZA 1TB4A 2J5RA 4L7QA 5HJ5A 2IL1A 1V11B 2OMKA 2V7UA 3RU2A 3SZ3A 3WMRA 2FFHA 3O8BA 4LS3A 4BWYA 4UMEA 3PQCA 4KLCA 1QC5A 3BMQA 5KDOA 1P9LA 3HNRA 1E7YA 2BGIA 3D7NA 3UAXA 1HR0B 1VLZA 1IUKA 4MUKA 2YWEA 3OQVA 5ALPA 2QPLA 4U7WA 2XT0A 3FF4A 1CR4A 4TKUB 3NYWA 1YR1A 2E4ZA 4DAEA 3TMYA 1E5VA 3H04A 3OC0A 4JBNA 4OB8A 2FPWA 3S8EA 1H9CA 2R5FA 1F8FA 3JATA 4MGKR 1ZM3A 3WZLA 3T4UA 2IS1A 3O4JA 2A57A 3FGZA 3A9CA 3QA9A 4U3JB 2GLUA 2BP7B 4LSZA 4D3DA 4NATA 2ZBVA 2B36A 3ID6C 4GE0A 1IN6A 2DMRA 2JRLA 2Q4RA 2W2MA 3TX2A 4YLGA 4X45A 1GKKA 3SJCA 1RZRA 1IXZA 4P3YA 3PDHA 4PFJA 2BMFA 3HB0A 3MAAC 2NVOA 3TSCA 1U7PA 4LNAA 4UQLA 1L8QA 2BMDA 2UYYA 2PS0A 3BMNA 1KEEA 1SWWA 3IP6A 3N2GB 4ZAZA 4Y9UA 4AJ9A 2JGDA 2XKAA 3H6GA 3PIRA 1U80A 4EHHA 3UC5A 2OCBA 2AFVA 2CUTA 2HJSA 2ODBA 3KJXA 2IV2X 5JD6A 2X5XA 1PEDA 3TTVA 4BQIA 1TCCA 4Q9HA 1BXRA 2HRBA 4NNJA 2KSQA 3SR4A 4HQKA 1EFRA 2AOTA 4UEQA 4YRDA 1PDWA 2IX3A 3ZDCA 3DTVA 4EIWA 3DVSX 4XD2A 3C97A 5EJ5A 2QRQA 3B70A 4LYGA 1NNUA 3N53A 4OPMA 2FMHA 3S27A 4HYYA 2EX1A 4E07A 3QXHA 3KOWA 1FB5A 1Y81A 3EPJA 2FR1A 3ZGVA 2B98A 3FRJA 1B42A 1GCIA 4P8RA 2IHUA 1KGSA 4JI4B 3I8OA 4EPRA 3LDHA 1ISIA 4IUBS 4OK5A 2HQ1A 5ALQA 4NIMA 1UBUS 2PVSA 3DE5X 1QE0A 1KJZA 3DSRA 2FW1A 4RWEA 4DNXA 5F1KA 5G0TA 3TFWA 3UENA 3H0EA 5KYKA 5KKCA 3GGPA 2JD1A 5H59A 3UMFA 3ZEIA 2VP6A 2H2FA 1GZ4A 3F98A 3OJEA 5DRYA 5E6UA 4QG3A 2FSGA 2XUGA 4CDGA 2ZDHA 3OLQA 3Q9NA 3QBDA 4N5LA 4ZQBA 5JLAA 3G0BA 3VBEA 4C0AC 1C0IA 2F1IA 3TUZC 5FRDA 4QFCA 4Q4AA 4U39A 5IASA 1BTOA 4PM4A 4MUBA 3RK0A 1V1RA 5EHNA 1GFWA 4BC1A 4W5RA 1WCYA 3C39A 2J6HA 3FB1A 1CUWA 3OPMA 2GB4A 2OCAA 4KXMA 4TLDA 1TK9A 4NYIR 4YQYA 4BX8A 5DCUA 1KVSA 1KXZA 2C9BA 4W5QA 1L7QA 5J63A 3L6UA 2BEWA 4JIGA 4AMUA 3CZRA 4RFSA 5B30A 3RJMA 5IN4A 1R8XA 5LLTA 3WYDA 4EHJA 3HCEA 4KOAA 4L6CA 2DWCA 4Z2YA 3T7JA 5KTMA 1NNI1 2Q6TA 1G4UR 3HLYA 3PNPA 3RBXA 4C21A 4QL3A 1W36D 2Q3CA 3HKEA 5GGYA 1NQXA 5AVJA 4LEIA 3TECE 4EVQA 1DDGA 3U5ZB 1OLUA 3MBOA 1UBOS 1Z2CA 2DBZA 4BNZA 3DLBA 1EUDB 1NP7A 2VJCA 3DDHA 3GD5A 1XTSA 4WH0A 4YUZA 3LBIA 4XUGB 1W8IA 4LYAA 4URVR 4F92B 3U16A 1PV2A 3LKZA 4MUXA 3GUVA 1UKVY 3BWDD 4JLSA 4P80A 1SNYA 5GWXA 1NRIA 4UDYX 3WAKA 3IUNA 4R98A 5ELLA 3WLTA 2FG7C 3A27A 3SLRA 5F9HA 3DZBA 2NVBA 1WMDA 2NPOA 2FPGB 4M9CA 1NTOA 3ZYZA 1NKVA 4QKQA 3I8XA 4ENTA 5KVCA 2C07A 3UC9A 3K96A 1AUQA 3QBTA 3O1LA 3L3BA 1ZD3A 4W5JA 1AKYA 2HU2A 3H5OA 2WYWA 3T7DA 1XZGA 3HJCA 3OTIA 4QU9A 2ZITA 1HXHA 5DCLA 1PR1A 4P3OA 4N0QA 3KELA 4UTRA 2XUAA 5M04A 4BB0A 3GV0A 3KXIA 3NYIA 3HGMA 4CF3A 2ZPAA 1MOSA 3A4NA 4PC7A 1K8RA 1N9GB 3F2IA 4XA8A 4WLFA 3O84A 3P1JA 4RK5A 1YQTA 9GPBA 2IQIA 4G07A 2JD0A 5J2UB 5EPUA 4Y1RB 2PUHA 3GPDG 1UJ2A 2WE7A 3PGA1 1FP1D 1WVGA 4MP3A 3BXEA 2GYYA 3PKZA 2G04A 4HTFB 5AI5A 4HNAA 5DJ5A 2ZZKA 3SJZA 5TLSA 2Z57A 2JVKA 3JWJA 4F3YA 1Z7EA 1FRNA 1LFDB 3KUUA 2BFFB 3Q3VA 4I99A 2C03A 5L40A 4NJMA 2FETA 1U3CA 1LLUA 2JDID 3CUKA 3H2YA 2BFWA 5TDHA 5IDQA 4ICIA 4NG4A 2PSHA 1KI2A 3EGDB 4OL9A 2BI8A 4K7JA 1O54A 2OPBA 3WTBA 4M98A 1KORA 3L7CA 3WWCA 2G07A 4M87A 1MW9X 3EB9A 4D25A 4FYYA 4FIZA 4TT3D 4DUGA 4IXDA 1AF7A 4JR2A 1TUBA 5ADUS 3E3NA 1PD1A 3WRYC 5JHHB 1ZM9A 2D1RA 2IU6A 2V7GA 4G1BA 6Q21A 5CDHA 3GCZA 2PBFA 1QP8A 2WDPA 3FTPA 3R0VA 4CM5A 1ZD1A 2HK9A 3UXMA 1I3NA 1TC1A 1B15A 3LYHA 4U2FA 1I7DA 2UZ1B 3AI3A 3G5AA 1QORA 4I81A 1IUPA 4NBNA 1NZDA 4RH3A 4Y18A 3NAZA 1ZI6A 3M6UA 4HQ6A 2JB9A 3ZQKA 1A4RA 1FDOA 1OXMA 3K1JA 2YV5A 1X7XB 2I3GA 1B2LA 4UFOA 4XR4A 1XGKA 1V16A 5D2CA 1OKKD 1WMAA 4XRRA 4AY5A 1LPSA 5FADA 3F7MA 4RADA 1DO8A 5J4HA 3ZV3A 4R8SA 2MDTA 2RAFA 1QKJA 1YOBA 1RQXA 1NF2A 3ZE8A 1PSWA 2RHJA 2I8AA 3MAJA 4AP9A 4RY8A 4YMLA 1WBBA 4FE4A 2OGTA 4GM0A 4P7FA 4YREA 3P2EA 2AJ8A 4FHDA 4RA6A 4N5NA 4BEJA 5JVDF 2OZPA 1SKUA 4FEAA 4IF4A 4V0NA 3U9LA 3T3IA 3KZXA 3EXIB 4FYKA 3HWRA 2C4TA 1CLEA 2QDXA 2FMTA 3MS7A 4GGPA 4QFMA 3ZBUA 2QENA 1QIHA 2CKMA 3BICA 3G3EA 4WECA 1GTG1 5DTMA 4HDCA 1ADBA 3CZMA 3L4BC 3VPBA 5A5VA 4RY0A 1LBTA 1U2PA 1U90A 3PITA 4O8CA 2FI1A 2EJCA 5JYCA 4LJ4A 2J45A 2ID4A 4AMVA 2Y68A 4L8YA 4ZZIA 4I9UA 3RAGA 4XRGA 5KYYB 2DBYA 3ABRB 4JB2A 1GQYA 3JYOA 3BQ9A 4R2IA 1JA1A 3WGYA 2YVLA 2FPRA 3WLJA 4FW9A 5GJCA 2L69A 5A3QA 3KSBC 3IR5A 1KNXA 1KETA 1N7GA 3N2EA 2YIDA 5E95A 3QVKA 3VKWA 4YRIA 4TM8A 3LF1A 2WF9A 2CFTA 4C06A 1KY3A 2XUFA 4WVLA 2ZJ0A 4V1CA 3LV8A 3V1UA 3D3EA 1XMSA 4YP5A 4FNAA 3LXXA 5TGTA 2JFPA 2Y2VA 5JJKA 2C8VA 2ASEA 1U65A 2JFXA 3G0DA 2RAPA 4J3JA 4PLHA 3VR2A 5LMUB 2AS0A 3KE9A 1T6XA 1HT1E 1RAEA 3EEIA 4YJGB 1PJAA 4RZIA 4DUYB 1DDOA 1H0SA 2ZWIA 4YJ2B 4KR0A 5CVUA 3F47A 2W8ZA 1DAKA 5JAHA 4GYWA 4RMHA 4TUYB 3CRRA 1IH8A 1BQ3A 4QXQA 4GZLA 3QE3A 4UDOA 4XPZA 2H0AA 3MINA 2WPNA 1X7YA 1ZMRA 4YFVA 4ZOCA 1QP4A 1CW2B 2VHVA 1IZYA 3QEMB 3WE7A 1J1UA 4R1TA 1U8UA 1ZJ6A 2ZI5A 3A06A 3KUDA 5IVDA 3DDCA 3F7NA 3JZIA 2JCGA 2HNAA 4HS9A 3OBIA 2R1TA 2HPHA 1Z74A 4DC0A 3CE6A 1ZRSA 2D5AA 1NUSA 2IOFK 2OBLA 2PTHA 3W6UA 1XEWY 2WIBA 1VPWA 2OZLA 2RHTA 3H9QA 4X94A 3DYVA 1NXWA 3U3KA 2YWGA 4M21A 4S1NA 1JTEA 1F8GA 4REQA 3ZV5A 1OH7A 4NU6A 1G64A 2WAAA 2CJWB 1DTEA 4BNVA 5CDFA 1O9GA 2AMFA 5KAPA 4DKXA 1P7PA 2BBOA 3K0AA 4LZJA 3GZNB 4Z54A 3ZVRA 1AZSC 1T3ZA 2PIDA 3T4XA 5FUWA 3RNLA 3FNGA 3MHTA 3E5MA 3FYTA 4ID9A 3FTEA 2R86A 2J3QA 3N2NA 3DFZA 5UKDA 4GMFA 3BWXA 1O95D 4A8PA 2ZKLA 3CVJA 2AN4A 2BIFA 5LP6F 5K6RA 1IZZA 4IGAA 1FLNA 5HOQA 4KR7A 4B7XA 1ULZA 1ORWA 3R5TA 3U4HA 3BBPA 4UZSA 1ZXXA 4RCZA 1ULSA 2GPWA 2IRWA 2VAWA 2RGNC 2OKCA 3DWFA 2QS9A 4I8IA 5L95A 3IEVA 3B1FA 4Q9JA 3PQEA 5DX8A 2JH9A 2IT1A 1OFGA 3CNQS 5BW8A 3GH1A 1GA6A 2V58A 1ZG3A 3ESDA 1KVTA 1ULAA 1RDFA 3TQOA 4OX9Y 1RQ7A 1R1DA 4M9XA 4BE9A 4QTTB 5DU2A 5TXGA 2PNJA 1Z2AA 1LPBB 1OI4A 3LYUA 3UIEA 3F3KA 4RTQA 1V43A 1YZUA 1OD6A 3RWMB 2ZUVA 1FTSA 3FZGA 3KBOA 4QX6A 2R0QC 1I5EA 1JXQA 2CVZA 2QIOA 4QECA 3UJPA 3V4LA 1NPYA 2OCDA 3GRFA 5D51S 2ZRGA 2AFRA 4ZYUA 5DSZA 2D8AA 3QVOA 3E5RA 1KE1A 2JZOA 2XZTA 2J46A 2ZROA 2DWPA 4QBHA 1T0PA 2OYSA 1YVUA 4BX9A 1ETUA 1PT6A 1P9NA 2ZBQA 3FCYA 1P17A 4YJFA 3ZTWA 4WZBA 4C43A 1NNSA 1REQA 2XCQA 1CETA 4MS3B 5KCZA 5K6TA 1XTVA 3K2EA 2XCTB 3AV3A 3GHHA 4E1AA 5K4AA 4XWOA 5B7GA 1KO5A 1GTZA 2AOWA 3FGPA 2RIPA 2X2PA 5LYYA 2CL0X 4WBSA 5BN1A 1ODJA 2ZS7A 2QBYA 4TKVA 3GEGA 3WFJA 4URYR 3DVAB 4FR2A 1KS9A 2WAMA 2D59A 1HH4A 4YR9A 1ZH2A 2PX6A 4AS2A 3GLRA 1HURA 2YRWA 3IQDB 4CTJA 4CFZA 4JYAB 1I3MA 2PWYA 3OPQA 4Y2JA 4N0DA 1KMCA 4FB4A 4MWOA 3R0ZA 1D1QA 1HNXB 1JIIA 1PT5A 2QRVA 2X6TA 4ZRNA 2CJFA 2ZUSA 3L8HA 4K9PA 4YJ3A 5JBQA 1NJ6A 3AVTA 1M7GA 2ZVDA 3FWHA 4B84A 5AHOA 1KDTA 4MVJP 1Y5LA 3PJGA 4D7AA 1KY5A 3RC3A 4RQAA 4PGAA 5F51A 4EHBA 3MTBA 1MQAA 2BGWA 3C6YA 3UK7A 3HBMA 2R62A 5BT8A 3NVMB 2ODAA 2ODNA 3FWYA 2VI5A 4Q7MB 4ER6A 1QF7A 3PL1A 3DDWA 3KKMA 4N8EA 2LBPA 5BN4A 4OO3A 2Q1YA 3K0EA 4RIGA 3OMWA 1XZAA 2AUNA 3TAXA 3E9EA 3F67A 2GAJA 4XLTA 1XQXA 5BVGA 4H59A 4US2R 4JGGA 4OHFA 3WQQA 3ER9A 1MX5A 2LIPA 2XTMA 4F9EA 5BQXA 4Z4IA 4DR4B 4G0YA 1UC4B 1FSGA 4ARBA 4V0LA 2CLDX 2WHYA 3IMCA 4K9DA 4WESA 2YCBA 4G67A 1AQIA 2BF4A 3LPMA 4IVNA 1T3GA 1TEVA 2ZVJA 2G8LA 3PPIA 4QPCA 3WWEA 1B41A 1SQGA 2UVPA 3C85A 3G8CA 2VNHA 3R6LA 5KO2A 3LNTA 4PCAA 1C3JA 2QTWB 1U0OC 3EVNA 2W90A 4PS0A 4YBRA 4LVCA 5CMLA 4O2AB 1ZIOA 5EWMB 5C0OE 3VOAA 3I9KA 5C8YF 1H4TA 1EXVA 3FPLA 1DIAA 1TU0A 3KRTA 3B1VA 3GT4A 3MQ4A 2YOGA 1EDOA 3D2CA 3L9WA 1BU8A 3QX3A 3FJOA 1Z7YA 3OMXA 3LUGA 4NZMA 1N6IA 5JWHA 1E6KA 1QV6A 2IHBA 1OX5A 5FTMA 4D9JA 1WLSA 4P7JA 3LI2A 2ZJ3A 1IPFA 5JNTA 5AW5A 5JQWA 4O5OA 3TSAA 3V4RA 1NMYA 1LDNA 1R4MA 4FT2A 3K6SB 2VHUA 3FR7A 3IS3A 3O92A 3LQYA 4XGNA 3LM8A 3C48A 3LLMA 2B0JA 1KR5A 2DLNA 3MMXA 3P2YA 4CKBA 3L5KA 3H17A 4K9QA 1JQ5A 3M5PA 3I42A 1BEUB 2YQZA 1VI5A 5A7GA 1X7WB 3HA7A 2OBFA 5HJ2A 3EASA 3AZPA 3D4PA 5E7QA 4LZZA 3TWOA 3KVOA 4MINA 5F1YA 1KSHA 2WC1A 4Y8VA 3BPSA 3EHDA 2OZVA 2VDVE 3H1AA 2Q6IA 4PYKA 2RI6A 4QXRA 4Z9XA 1X77A 1UK9A 2BN4A 1A98A 2C83A 4D0NA 4G65A 4EEZA 3IUEA 5BXQC 1W1IA 4F3RA 2H06A 3Q3JB 4FZRA 1VJ0A 1VLHA 4IO0A 4A0HA 5IDWA 2VNJA 4CNQA 1MT0A 1WPRA 1HE4A 4IMPA 3EFEA 2A1TS 4KFRA 4MPJA 3VR3A 3ZZTA 1USWA 2P79A 4DDVA 1YRAA 4NL4H 2FZ4A 1ESDA 1R9JA 1MB3A 4NS4A 3LZCA 2Q5EA 5JYBA 1CF9A 2P69A 3OP4A 2ZUTA 3D64A 3PEVA 2ZTHA 2WWRA 4C30A 4HAIA 1J25A 4KRYA 2JDIA 4JUIA 3VAAA 3QPBA 4L5CA 3TYXA 3EIHA 5EZSA 3O90A 1E3SA 1XZKA 1OWOA 1XG5A 4WA7A 4H15A 1ZRNA 2G76A 2QLJA 1OXSC 3HCBA 5EFOA 2GZSA 2IIVA 3KD3A 4WFJA 3JQ8B 3K71B 4MVJI 4AKIA 3I9V1 4PLYA 1QQBA 4JLBA 3L8FA 2C8LA 4QODA 1HLPA 3FYHA 4JJ8A 2R4UA 4ND2A 3GPCA 2AZMA 3TD6A 4DLSA 4JI8B 4W4TA 4EKIA 4JCCA 1W7AA 4LJ7A 1WO8A 3VU3A 1V8BA 1T6YA 1UFOA 3DLTA 4LKRA 3QU9A 4Z7NB 3KPJA 5LJIA 1N0WA 3GLFA 1ZJYA 2PL9A 4S0XA 1NL3A 1QG0A 2KJQA 3Q0IA 4DS3A 1QFXA 5E0OA 1UPBA 3AERB 1RBZA 2PX5A 5DXJA 4ZT5A 3VJRA 3GPLA 3I45A 5LUAA 4P32A 4BX2A 1ISHA 4B6EA 3E3MA 3PVSA 1Y6JA 1RTTA 4KX5A 4RSGA 3T15A 2BKXA 4F4JA 3T7CA 3V80A 3WKBA 4YXWA 5HZHA 2M98A 4EL0A 1LPNA 3GCGA 4RM2A 4EAQA 1FP4B 3PQ8A 4CDRA 1DJQA 3FKSD 5DT9A 5B4VA 1Q1BA 4OHKA 4H4EA 1Z6YA 3PVZA 2BTEA 1IPHA 3W2EA 2VDQB 1Y5MA 1DCTA 3LAWA 4H16A 2D1TA 3F7TA 2JLZA 1Q7BA 2XCLA 3S4YA 3WB9A 5SYMA 1XA4A 4A36A 2ZRAA 4PLZA 4RV5A 5J5AA 3SZMA 2QGNA 4ZK6A 1PSZA 3GN1A 3O9VA 2ZKIA 3KAQA 3QU4A 4BGDA 5A0TA 2ZIZA 3GG2A 2XXJA 4DDHA 3PUHA 2YDXA 1DI0A 2CHFA 1DP4A 2NO6A 3GWZA 4RVDA 3FA2A 2HGSA 3SQOA 4PCVA 4P98A 1MO6A 1U6IA 2EBHX 3P27A 4D8UA 3KXKA 1NR5A 4HWTA 1PYOA 3QYJA 1BHJA 5C5CA 3IXQA 2Q28A 2HK6A 1H2YA 5DO9A 3OIFA 2PFKA 4PZDA 3ROMA 4CWAA 4EMUA 1P0FA 3RV3A 1JIVA 1PQPA 2NU6B 2YVKA 3JW8A 4LK2A 4MVJF 4RNDB 4D0GA 1V47A 3KZCA 1Q1GA 2PVPA 2IIPA 2XAUA 3PNQA 4OMFG 1NBIA 3AVQA 4R7TA 3DHVA 3GT0A 4Q24A 1L5HA 3ZQJA 2XNJA 3D1JA 4CIYA 1W59A 3F78A 1YQQA 2QY9A 3NKVA 3C8UA 3R8XA 2R6FA 4FDMA 2EGUA 1IBKB 1E1CA 3AI2A 1UR5A 3PPYA 2J3JA 1R6UA 3TJRA 4RETA 2ZB8A 1M6NA 2IDMA 2PK3A 5LQMA 2H08A 4UCQA 2RB4A 4F8YA 5IJ9A 4D8VA 4Z3OA 1NLFA 1ZINA 2QYTA 1UZMA 3KWLA 4JXJA 4ILEA 1IBLB 1U7UA 1CNMA 2AA3A 2I2DA 2NGRA 3CONA 3EN0A 5DLDA 4XPIA 5EXPA 4ZV9A 1UDXA 3ZBQA 5HYVA 1C3OB 3LUBA 2F1JA 5F4ZA 1D6NA 1QUFA 4N7BA 5FOWA 1D2CA 4Q4HB 5EVCA 1CHNA 4U0JA 3SZOA 4CQMB 4HYTA 3CF6R 1EZ1A 2DU8A 5KOYA 2FMUA 2HN9A 2WG2A 4O5AA 4UUNA 5P8WA 4L9AA 3UF0A 4HRAA 3UWKA 3KYIB 3REQB 3BD6A 3KQUA 2GZ2A 2H7YA 1C8KA 3U3XA 1T0IA 4AG6A 3I6ZA 4RD2A 3IAAA 5FFNA 3MW8A 4PBTA 4IMIB 3VKVA 5KTOA 3GAMA 4KMSA 1K7FB 3DR5A 1DV1A 4L27A 3ZN2A 4EGFA 2JIZA 3NBQA 1MO3A 2G7MC 2PGJA 3PR3A 4WW0A 3OFJA 3KHTA 1AN0A 3ADOA 3EZ2A 2HUNA 4GP6A 1QF6A 5ES3A 3N70A 4JEMA 4ND8B 4A6EA 3EDYA 2YC4C 4GKJB 1KH3A 2NO5A 2R68A 3NBYC 1O95A 1FLVA 5L4LA 1EHCA 2ZYUX 4OP1A 1AS2A 4QJ5A 5BW4A 3EEYA 3OZEA 4ZYYA 5JC8A 3A0RB 1EA7A 3NTRA 2XMZA 5MN4A 2BEVB 1KGDA 2FZVA 2QR5A 4UZEA 5JSFA 1KJWA 1TVCA 4R1UA 5KYWB 2O5VA 3T3GA 3ILHA 4Y6RA 3X1ZA 5D3QA 2BKEA 2FAXA 4A16A 5AT1A 4OQQA 2PJZA 4PNZA 3SSMA 4EB6A 1ISRA 4ZOLB 3GDWA 4CR8A 5C80A 1N3LA 4LJLA 3DT8A 3QRWA 1GUDA 3IDAA 3ACCA 3CM0A 2ZE7A 3SG0A 4B44A 4RNCA 1AA9A 1BQ4A 1EI9A 1KPGA 2W2LD 3EE6A 2M6KA 5ARBA 3BGVA 3A9UA 3KEGA 1CIVA 3ASYA 1J49A 3C6ZA 4PICA 3ZGOA 2MMGA 1H0KA 4D45A 5KNBH 2JASA 2CXTA 4FMPA 4IR7A 3U09A 3ZGNA 1YZNA 2NIPA 4JYPA 3ZDEA 2W2KB 4M4SA 2Y05A 4HRYA 4AMGA 2JLUA 1NJSA 4JVNA 5KKAA 4WHMA 3W8FA 3H1EA 4O4LF 3BIFA 4YCMA 1II0A 5AJXA 4DXAA 3EG9B 2PBZA 4G0ZA 4XIGS 5LZ9A 2VK4A 1X74A 3G49A 1ZISA 5C53B 5IMSA 4JU8A 5K0ZA 2VK8A 3IAXA 2J33A 3FCEA 1KK0A 2FOLA 1C4WA 3AESB 1J2UA 3IAFA 2XYQA 4KVAA 5AVOA 4YCBA 3BXFA 1ZNZA 5F7JA 2RHLA 4G0NA 5AOCA 3RS3A 3S2EA 2GEFA 1F4PA 4UTVA 4RPJA 4RTOA 3JYQA 1KFEB 5TE9A 2WT8A 4MQ6A 4MQUA 5WRFA 3RS5A 3TZEA 1YWGO 8OHMA 1PTKA 2E5WA 5BN3A 1VL5A 2J9RA 1Y6ZA 3L6BA 4KMMA 1LC3A 3D8BA 2MYUA 5IKOA 3EWNA 4KUGA 2NYVA 4FB5A 5HZGA 1YB5A 4IRXA 2GEUA 2OXCA 4AZWA 2RGXA 3LCVB 2PEYA 2OSBA 2V8BA 2YYSA 3T06B 1W94A 2N0SA 5KNCH 4LFCB 2FKNA 4N39A 3HY4A 4P4TA 3OM1A 5JFOA 5LIPA 2OM2A 1Z5WA 4FFNA 4HDSA 1O9HA 5FNZA 3JARB 1E32A 3L0IB 2C59A 1L7OA 3F5DA 4H9GA 1BE6A 1TU3A 1P19A 4CTOA 4Y9SA 2CXSA 5DM60 1DBVO 3FSEA 2YRFA 5JWOA 1SHJA 4O4IA 4MJXA 2FXVA 1IXSB 4KPGA 3U62A 3KQNA 2VF7A 4LXYA 2VRCD 2QM7A 4EHFA 2XGSA 2DT8A 2P5UA 3CUUA 1QYRA 3IMGA 4TS4A 3T35A 2P65A 5HKKD 2PQ6A 2PZAA 2AC7A 1YHNA 2ZUUA 5K45A 1NQTA 4QBGB 4MW7A 4GZ6A 4NKRA 4TQG